data_3HMX
# 
_entry.id   3HMX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3HMX         
RCSB  RCSB053330   
WWPDB D_1000053330 
# 
_pdbx_database_status.entry_id                        3HMX 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-29 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Luo, J.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for the dual recognition of IL-12 and IL-23 by ustekinumab.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            402 
_citation.page_first                797 
_citation.page_last                 812 
_citation.year                      2010 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20691190 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2010.07.046 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Luo, J.'       1  ? 
primary 'Wu, S.J.'      2  ? 
primary 'Lacy, E.R.'    3  ? 
primary 'Orlovsky, Y.'  4  ? 
primary 'Baker, A.'     5  ? 
primary 'Teplyakov, A.' 6  ? 
primary 'Obmolova, G.'  7  ? 
primary 'Heavner, G.A.' 8  ? 
primary 'Richter, H.T.' 9  ? 
primary 'Benson, J.'    10 ? 
# 
_cell.entry_id           3HMX 
_cell.length_a           55.092 
_cell.length_b           116.435 
_cell.length_c           182.781 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3HMX 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer  man 'Interleukin-12 subunit beta' 34739.945 1  ? ? ? ? 
2 polymer  man 'Interleukin-12 subunit alpha' 22568.154 1  ? ? ? ? 
3 polymer  man 'USTEKINUMAB FAB LIGHT CHAIN' 23474.996 1  ? ? ? ? 
4 polymer  man 'USTEKINUMAB FAB HEAVY CHAIN' 24361.453 1  ? ? ? ? 
5 branched man 
;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
910.823   1  ? ? ? ? 
6 water    nat water 18.015    44 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;IL-12B, IL-12 subunit p40, Cytotoxic lymphocyte maturation factor 40 kDa subunit, CLMF p40, NK cell stimulatory factor chain 2, NKSF2
;
2 
;IL-12A, IL-12 subunit p35, Cytotoxic lymphocyte maturation factor 35 kDa subunit, CLMF p35, NK cell stimulatory factor chain 1, NKSF1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL
LLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRG
DNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTW
STPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
;
;IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL
LLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRG
DNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTW
STPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
;
A ? 
2 'polypeptide(L)' no no 
;RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRET
SFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSS
LEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
;
;RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRET
SFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSS
LEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
;
B ? 
3 'polypeptide(L)' no no 
;DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQYNIYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
;DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQYNIYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
L ? 
4 'polypeptide(L)' no no 
;EVQLVQSGAEVKKPGESLKISCKGSGYSFTTYWLGWVRQMPGKGLDWIGIMSPVDSDIRYSPSFQGQVTMSVDKSITTAY
LQWNSLKASDTAMYYCARRRPGQGYFDFWGQGTLVTVSSSSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
;
;EVQLVQSGAEVKKPGESLKISCKGSGYSFTTYWLGWVRQMPGKGLDWIGIMSPVDSDIRYSPSFQGQVTMSVDKSITTAY
LQWNSLKASDTAMYYCARRRPGQGYFDFWGQGTLVTVSSSSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
;
H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   TRP n 
1 3   GLU n 
1 4   LEU n 
1 5   LYS n 
1 6   LYS n 
1 7   ASP n 
1 8   VAL n 
1 9   TYR n 
1 10  VAL n 
1 11  VAL n 
1 12  GLU n 
1 13  LEU n 
1 14  ASP n 
1 15  TRP n 
1 16  TYR n 
1 17  PRO n 
1 18  ASP n 
1 19  ALA n 
1 20  PRO n 
1 21  GLY n 
1 22  GLU n 
1 23  MET n 
1 24  VAL n 
1 25  VAL n 
1 26  LEU n 
1 27  THR n 
1 28  CYS n 
1 29  ASP n 
1 30  THR n 
1 31  PRO n 
1 32  GLU n 
1 33  GLU n 
1 34  ASP n 
1 35  GLY n 
1 36  ILE n 
1 37  THR n 
1 38  TRP n 
1 39  THR n 
1 40  LEU n 
1 41  ASP n 
1 42  GLN n 
1 43  SER n 
1 44  SER n 
1 45  GLU n 
1 46  VAL n 
1 47  LEU n 
1 48  GLY n 
1 49  SER n 
1 50  GLY n 
1 51  LYS n 
1 52  THR n 
1 53  LEU n 
1 54  THR n 
1 55  ILE n 
1 56  GLN n 
1 57  VAL n 
1 58  LYS n 
1 59  GLU n 
1 60  PHE n 
1 61  GLY n 
1 62  ASP n 
1 63  ALA n 
1 64  GLY n 
1 65  GLN n 
1 66  TYR n 
1 67  THR n 
1 68  CYS n 
1 69  HIS n 
1 70  LYS n 
1 71  GLY n 
1 72  GLY n 
1 73  GLU n 
1 74  VAL n 
1 75  LEU n 
1 76  SER n 
1 77  HIS n 
1 78  SER n 
1 79  LEU n 
1 80  LEU n 
1 81  LEU n 
1 82  LEU n 
1 83  HIS n 
1 84  LYS n 
1 85  LYS n 
1 86  GLU n 
1 87  ASP n 
1 88  GLY n 
1 89  ILE n 
1 90  TRP n 
1 91  SER n 
1 92  THR n 
1 93  ASP n 
1 94  ILE n 
1 95  LEU n 
1 96  LYS n 
1 97  ASP n 
1 98  GLN n 
1 99  LYS n 
1 100 GLU n 
1 101 PRO n 
1 102 LYS n 
1 103 ASN n 
1 104 LYS n 
1 105 THR n 
1 106 PHE n 
1 107 LEU n 
1 108 ARG n 
1 109 CYS n 
1 110 GLU n 
1 111 ALA n 
1 112 LYS n 
1 113 ASN n 
1 114 TYR n 
1 115 SER n 
1 116 GLY n 
1 117 ARG n 
1 118 PHE n 
1 119 THR n 
1 120 CYS n 
1 121 TRP n 
1 122 TRP n 
1 123 LEU n 
1 124 THR n 
1 125 THR n 
1 126 ILE n 
1 127 SER n 
1 128 THR n 
1 129 ASP n 
1 130 LEU n 
1 131 THR n 
1 132 PHE n 
1 133 SER n 
1 134 VAL n 
1 135 LYS n 
1 136 SER n 
1 137 SER n 
1 138 ARG n 
1 139 GLY n 
1 140 SER n 
1 141 SER n 
1 142 ASP n 
1 143 PRO n 
1 144 GLN n 
1 145 GLY n 
1 146 VAL n 
1 147 THR n 
1 148 CYS n 
1 149 GLY n 
1 150 ALA n 
1 151 ALA n 
1 152 THR n 
1 153 LEU n 
1 154 SER n 
1 155 ALA n 
1 156 GLU n 
1 157 ARG n 
1 158 VAL n 
1 159 ARG n 
1 160 GLY n 
1 161 ASP n 
1 162 ASN n 
1 163 LYS n 
1 164 GLU n 
1 165 TYR n 
1 166 GLU n 
1 167 TYR n 
1 168 SER n 
1 169 VAL n 
1 170 GLU n 
1 171 CYS n 
1 172 GLN n 
1 173 GLU n 
1 174 ASP n 
1 175 SER n 
1 176 ALA n 
1 177 CYS n 
1 178 PRO n 
1 179 ALA n 
1 180 ALA n 
1 181 GLU n 
1 182 GLU n 
1 183 SER n 
1 184 LEU n 
1 185 PRO n 
1 186 ILE n 
1 187 GLU n 
1 188 VAL n 
1 189 MET n 
1 190 VAL n 
1 191 ASP n 
1 192 ALA n 
1 193 VAL n 
1 194 HIS n 
1 195 LYS n 
1 196 LEU n 
1 197 LYS n 
1 198 TYR n 
1 199 GLU n 
1 200 ASN n 
1 201 TYR n 
1 202 THR n 
1 203 SER n 
1 204 SER n 
1 205 PHE n 
1 206 PHE n 
1 207 ILE n 
1 208 ARG n 
1 209 ASP n 
1 210 ILE n 
1 211 ILE n 
1 212 LYS n 
1 213 PRO n 
1 214 ASP n 
1 215 PRO n 
1 216 PRO n 
1 217 LYS n 
1 218 ASN n 
1 219 LEU n 
1 220 GLN n 
1 221 LEU n 
1 222 LYS n 
1 223 PRO n 
1 224 LEU n 
1 225 LYS n 
1 226 ASN n 
1 227 SER n 
1 228 ARG n 
1 229 GLN n 
1 230 VAL n 
1 231 GLU n 
1 232 VAL n 
1 233 SER n 
1 234 TRP n 
1 235 GLU n 
1 236 TYR n 
1 237 PRO n 
1 238 ASP n 
1 239 THR n 
1 240 TRP n 
1 241 SER n 
1 242 THR n 
1 243 PRO n 
1 244 HIS n 
1 245 SER n 
1 246 TYR n 
1 247 PHE n 
1 248 SER n 
1 249 LEU n 
1 250 THR n 
1 251 PHE n 
1 252 CYS n 
1 253 VAL n 
1 254 GLN n 
1 255 VAL n 
1 256 GLN n 
1 257 GLY n 
1 258 LYS n 
1 259 SER n 
1 260 LYS n 
1 261 ARG n 
1 262 GLU n 
1 263 LYS n 
1 264 LYS n 
1 265 ASP n 
1 266 ARG n 
1 267 VAL n 
1 268 PHE n 
1 269 THR n 
1 270 ASP n 
1 271 LYS n 
1 272 THR n 
1 273 SER n 
1 274 ALA n 
1 275 THR n 
1 276 VAL n 
1 277 ILE n 
1 278 CYS n 
1 279 ARG n 
1 280 LYS n 
1 281 ASN n 
1 282 ALA n 
1 283 SER n 
1 284 ILE n 
1 285 SER n 
1 286 VAL n 
1 287 ARG n 
1 288 ALA n 
1 289 GLN n 
1 290 ASP n 
1 291 ARG n 
1 292 TYR n 
1 293 TYR n 
1 294 SER n 
1 295 SER n 
1 296 SER n 
1 297 TRP n 
1 298 SER n 
1 299 GLU n 
1 300 TRP n 
1 301 ALA n 
1 302 SER n 
1 303 VAL n 
1 304 PRO n 
1 305 CYS n 
1 306 SER n 
2 1   ARG n 
2 2   ASN n 
2 3   LEU n 
2 4   PRO n 
2 5   VAL n 
2 6   ALA n 
2 7   THR n 
2 8   PRO n 
2 9   ASP n 
2 10  PRO n 
2 11  GLY n 
2 12  MET n 
2 13  PHE n 
2 14  PRO n 
2 15  CYS n 
2 16  LEU n 
2 17  HIS n 
2 18  HIS n 
2 19  SER n 
2 20  GLN n 
2 21  ASN n 
2 22  LEU n 
2 23  LEU n 
2 24  ARG n 
2 25  ALA n 
2 26  VAL n 
2 27  SER n 
2 28  ASN n 
2 29  MET n 
2 30  LEU n 
2 31  GLN n 
2 32  LYS n 
2 33  ALA n 
2 34  ARG n 
2 35  GLN n 
2 36  THR n 
2 37  LEU n 
2 38  GLU n 
2 39  PHE n 
2 40  TYR n 
2 41  PRO n 
2 42  CYS n 
2 43  THR n 
2 44  SER n 
2 45  GLU n 
2 46  GLU n 
2 47  ILE n 
2 48  ASP n 
2 49  HIS n 
2 50  GLU n 
2 51  ASP n 
2 52  ILE n 
2 53  THR n 
2 54  LYS n 
2 55  ASP n 
2 56  LYS n 
2 57  THR n 
2 58  SER n 
2 59  THR n 
2 60  VAL n 
2 61  GLU n 
2 62  ALA n 
2 63  CYS n 
2 64  LEU n 
2 65  PRO n 
2 66  LEU n 
2 67  GLU n 
2 68  LEU n 
2 69  THR n 
2 70  LYS n 
2 71  ASN n 
2 72  GLU n 
2 73  SER n 
2 74  CYS n 
2 75  LEU n 
2 76  ASN n 
2 77  SER n 
2 78  ARG n 
2 79  GLU n 
2 80  THR n 
2 81  SER n 
2 82  PHE n 
2 83  ILE n 
2 84  THR n 
2 85  ASN n 
2 86  GLY n 
2 87  SER n 
2 88  CYS n 
2 89  LEU n 
2 90  ALA n 
2 91  SER n 
2 92  ARG n 
2 93  LYS n 
2 94  THR n 
2 95  SER n 
2 96  PHE n 
2 97  MET n 
2 98  MET n 
2 99  ALA n 
2 100 LEU n 
2 101 CYS n 
2 102 LEU n 
2 103 SER n 
2 104 SER n 
2 105 ILE n 
2 106 TYR n 
2 107 GLU n 
2 108 ASP n 
2 109 LEU n 
2 110 LYS n 
2 111 MET n 
2 112 TYR n 
2 113 GLN n 
2 114 VAL n 
2 115 GLU n 
2 116 PHE n 
2 117 LYS n 
2 118 THR n 
2 119 MET n 
2 120 ASN n 
2 121 ALA n 
2 122 LYS n 
2 123 LEU n 
2 124 LEU n 
2 125 MET n 
2 126 ASP n 
2 127 PRO n 
2 128 LYS n 
2 129 ARG n 
2 130 GLN n 
2 131 ILE n 
2 132 PHE n 
2 133 LEU n 
2 134 ASP n 
2 135 GLN n 
2 136 ASN n 
2 137 MET n 
2 138 LEU n 
2 139 ALA n 
2 140 VAL n 
2 141 ILE n 
2 142 ASP n 
2 143 GLU n 
2 144 LEU n 
2 145 MET n 
2 146 GLN n 
2 147 ALA n 
2 148 LEU n 
2 149 ASN n 
2 150 PHE n 
2 151 ASN n 
2 152 SER n 
2 153 GLU n 
2 154 THR n 
2 155 VAL n 
2 156 PRO n 
2 157 GLN n 
2 158 LYS n 
2 159 SER n 
2 160 SER n 
2 161 LEU n 
2 162 GLU n 
2 163 GLU n 
2 164 PRO n 
2 165 ASP n 
2 166 PHE n 
2 167 TYR n 
2 168 LYS n 
2 169 THR n 
2 170 LYS n 
2 171 ILE n 
2 172 LYS n 
2 173 LEU n 
2 174 CYS n 
2 175 ILE n 
2 176 LEU n 
2 177 LEU n 
2 178 HIS n 
2 179 ALA n 
2 180 PHE n 
2 181 ARG n 
2 182 ILE n 
2 183 ARG n 
2 184 ALA n 
2 185 VAL n 
2 186 THR n 
2 187 ILE n 
2 188 ASP n 
2 189 ARG n 
2 190 VAL n 
2 191 MET n 
2 192 SER n 
2 193 TYR n 
2 194 LEU n 
2 195 ASN n 
2 196 ALA n 
2 197 SER n 
3 1   ASP n 
3 2   ILE n 
3 3   GLN n 
3 4   MET n 
3 5   THR n 
3 6   GLN n 
3 7   SER n 
3 8   PRO n 
3 9   SER n 
3 10  SER n 
3 11  LEU n 
3 12  SER n 
3 13  ALA n 
3 14  SER n 
3 15  VAL n 
3 16  GLY n 
3 17  ASP n 
3 18  ARG n 
3 19  VAL n 
3 20  THR n 
3 21  ILE n 
3 22  THR n 
3 23  CYS n 
3 24  ARG n 
3 25  ALA n 
3 26  SER n 
3 27  GLN n 
3 28  GLY n 
3 29  ILE n 
3 30  SER n 
3 31  SER n 
3 32  TRP n 
3 33  LEU n 
3 34  ALA n 
3 35  TRP n 
3 36  TYR n 
3 37  GLN n 
3 38  GLN n 
3 39  LYS n 
3 40  PRO n 
3 41  GLU n 
3 42  LYS n 
3 43  ALA n 
3 44  PRO n 
3 45  LYS n 
3 46  SER n 
3 47  LEU n 
3 48  ILE n 
3 49  TYR n 
3 50  ALA n 
3 51  ALA n 
3 52  SER n 
3 53  SER n 
3 54  LEU n 
3 55  GLN n 
3 56  SER n 
3 57  GLY n 
3 58  VAL n 
3 59  PRO n 
3 60  SER n 
3 61  ARG n 
3 62  PHE n 
3 63  SER n 
3 64  GLY n 
3 65  SER n 
3 66  GLY n 
3 67  SER n 
3 68  GLY n 
3 69  THR n 
3 70  ASP n 
3 71  PHE n 
3 72  THR n 
3 73  LEU n 
3 74  THR n 
3 75  ILE n 
3 76  SER n 
3 77  SER n 
3 78  LEU n 
3 79  GLN n 
3 80  PRO n 
3 81  GLU n 
3 82  ASP n 
3 83  PHE n 
3 84  ALA n 
3 85  THR n 
3 86  TYR n 
3 87  TYR n 
3 88  CYS n 
3 89  GLN n 
3 90  GLN n 
3 91  TYR n 
3 92  ASN n 
3 93  ILE n 
3 94  TYR n 
3 95  PRO n 
3 96  TYR n 
3 97  THR n 
3 98  PHE n 
3 99  GLY n 
3 100 GLN n 
3 101 GLY n 
3 102 THR n 
3 103 LYS n 
3 104 LEU n 
3 105 GLU n 
3 106 ILE n 
3 107 LYS n 
3 108 ARG n 
3 109 THR n 
3 110 VAL n 
3 111 ALA n 
3 112 ALA n 
3 113 PRO n 
3 114 SER n 
3 115 VAL n 
3 116 PHE n 
3 117 ILE n 
3 118 PHE n 
3 119 PRO n 
3 120 PRO n 
3 121 SER n 
3 122 ASP n 
3 123 GLU n 
3 124 GLN n 
3 125 LEU n 
3 126 LYS n 
3 127 SER n 
3 128 GLY n 
3 129 THR n 
3 130 ALA n 
3 131 SER n 
3 132 VAL n 
3 133 VAL n 
3 134 CYS n 
3 135 LEU n 
3 136 LEU n 
3 137 ASN n 
3 138 ASN n 
3 139 PHE n 
3 140 TYR n 
3 141 PRO n 
3 142 ARG n 
3 143 GLU n 
3 144 ALA n 
3 145 LYS n 
3 146 VAL n 
3 147 GLN n 
3 148 TRP n 
3 149 LYS n 
3 150 VAL n 
3 151 ASP n 
3 152 ASN n 
3 153 ALA n 
3 154 LEU n 
3 155 GLN n 
3 156 SER n 
3 157 GLY n 
3 158 ASN n 
3 159 SER n 
3 160 GLN n 
3 161 GLU n 
3 162 SER n 
3 163 VAL n 
3 164 THR n 
3 165 GLU n 
3 166 GLN n 
3 167 ASP n 
3 168 SER n 
3 169 LYS n 
3 170 ASP n 
3 171 SER n 
3 172 THR n 
3 173 TYR n 
3 174 SER n 
3 175 LEU n 
3 176 SER n 
3 177 SER n 
3 178 THR n 
3 179 LEU n 
3 180 THR n 
3 181 LEU n 
3 182 SER n 
3 183 LYS n 
3 184 ALA n 
3 185 ASP n 
3 186 TYR n 
3 187 GLU n 
3 188 LYS n 
3 189 HIS n 
3 190 LYS n 
3 191 VAL n 
3 192 TYR n 
3 193 ALA n 
3 194 CYS n 
3 195 GLU n 
3 196 VAL n 
3 197 THR n 
3 198 HIS n 
3 199 GLN n 
3 200 GLY n 
3 201 LEU n 
3 202 SER n 
3 203 SER n 
3 204 PRO n 
3 205 VAL n 
3 206 THR n 
3 207 LYS n 
3 208 SER n 
3 209 PHE n 
3 210 ASN n 
3 211 ARG n 
3 212 GLY n 
3 213 GLU n 
3 214 CYS n 
4 1   GLU n 
4 2   VAL n 
4 3   GLN n 
4 4   LEU n 
4 5   VAL n 
4 6   GLN n 
4 7   SER n 
4 8   GLY n 
4 9   ALA n 
4 10  GLU n 
4 11  VAL n 
4 12  LYS n 
4 13  LYS n 
4 14  PRO n 
4 15  GLY n 
4 16  GLU n 
4 17  SER n 
4 18  LEU n 
4 19  LYS n 
4 20  ILE n 
4 21  SER n 
4 22  CYS n 
4 23  LYS n 
4 24  GLY n 
4 25  SER n 
4 26  GLY n 
4 27  TYR n 
4 28  SER n 
4 29  PHE n 
4 30  THR n 
4 31  THR n 
4 32  TYR n 
4 33  TRP n 
4 34  LEU n 
4 35  GLY n 
4 36  TRP n 
4 37  VAL n 
4 38  ARG n 
4 39  GLN n 
4 40  MET n 
4 41  PRO n 
4 42  GLY n 
4 43  LYS n 
4 44  GLY n 
4 45  LEU n 
4 46  ASP n 
4 47  TRP n 
4 48  ILE n 
4 49  GLY n 
4 50  ILE n 
4 51  MET n 
4 52  SER n 
4 53  PRO n 
4 54  VAL n 
4 55  ASP n 
4 56  SER n 
4 57  ASP n 
4 58  ILE n 
4 59  ARG n 
4 60  TYR n 
4 61  SER n 
4 62  PRO n 
4 63  SER n 
4 64  PHE n 
4 65  GLN n 
4 66  GLY n 
4 67  GLN n 
4 68  VAL n 
4 69  THR n 
4 70  MET n 
4 71  SER n 
4 72  VAL n 
4 73  ASP n 
4 74  LYS n 
4 75  SER n 
4 76  ILE n 
4 77  THR n 
4 78  THR n 
4 79  ALA n 
4 80  TYR n 
4 81  LEU n 
4 82  GLN n 
4 83  TRP n 
4 84  ASN n 
4 85  SER n 
4 86  LEU n 
4 87  LYS n 
4 88  ALA n 
4 89  SER n 
4 90  ASP n 
4 91  THR n 
4 92  ALA n 
4 93  MET n 
4 94  TYR n 
4 95  TYR n 
4 96  CYS n 
4 97  ALA n 
4 98  ARG n 
4 99  ARG n 
4 100 ARG n 
4 101 PRO n 
4 102 GLY n 
4 103 GLN n 
4 104 GLY n 
4 105 TYR n 
4 106 PHE n 
4 107 ASP n 
4 108 PHE n 
4 109 TRP n 
4 110 GLY n 
4 111 GLN n 
4 112 GLY n 
4 113 THR n 
4 114 LEU n 
4 115 VAL n 
4 116 THR n 
4 117 VAL n 
4 118 SER n 
4 119 SER n 
4 120 SER n 
4 121 SER n 
4 122 THR n 
4 123 LYS n 
4 124 GLY n 
4 125 PRO n 
4 126 SER n 
4 127 VAL n 
4 128 PHE n 
4 129 PRO n 
4 130 LEU n 
4 131 ALA n 
4 132 PRO n 
4 133 SER n 
4 134 SER n 
4 135 LYS n 
4 136 SER n 
4 137 THR n 
4 138 SER n 
4 139 GLY n 
4 140 GLY n 
4 141 THR n 
4 142 ALA n 
4 143 ALA n 
4 144 LEU n 
4 145 GLY n 
4 146 CYS n 
4 147 LEU n 
4 148 VAL n 
4 149 LYS n 
4 150 ASP n 
4 151 TYR n 
4 152 PHE n 
4 153 PRO n 
4 154 GLU n 
4 155 PRO n 
4 156 VAL n 
4 157 THR n 
4 158 VAL n 
4 159 SER n 
4 160 TRP n 
4 161 ASN n 
4 162 SER n 
4 163 GLY n 
4 164 ALA n 
4 165 LEU n 
4 166 THR n 
4 167 SER n 
4 168 GLY n 
4 169 VAL n 
4 170 HIS n 
4 171 THR n 
4 172 PHE n 
4 173 PRO n 
4 174 ALA n 
4 175 VAL n 
4 176 LEU n 
4 177 GLN n 
4 178 SER n 
4 179 SER n 
4 180 GLY n 
4 181 LEU n 
4 182 TYR n 
4 183 SER n 
4 184 LEU n 
4 185 SER n 
4 186 SER n 
4 187 VAL n 
4 188 VAL n 
4 189 THR n 
4 190 VAL n 
4 191 PRO n 
4 192 SER n 
4 193 SER n 
4 194 SER n 
4 195 LEU n 
4 196 GLY n 
4 197 THR n 
4 198 GLN n 
4 199 THR n 
4 200 TYR n 
4 201 ILE n 
4 202 CYS n 
4 203 ASN n 
4 204 VAL n 
4 205 ASN n 
4 206 HIS n 
4 207 LYS n 
4 208 PRO n 
4 209 SER n 
4 210 ASN n 
4 211 THR n 
4 212 LYS n 
4 213 VAL n 
4 214 ASP n 
4 215 LYS n 
4 216 ARG n 
4 217 VAL n 
4 218 GLU n 
4 219 PRO n 
4 220 LYS n 
4 221 SER n 
4 222 CYS n 
4 223 ASP n 
4 224 LYS n 
4 225 THR n 
4 226 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'IL12B, NKSF2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? human 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 
'HEK 293' ? ? ? ? ? ? ? ? ? ? ? ?                          
2 1 sample ? ? ? human ? 'IL12A, NKSF1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? human 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 
'HEK 293' ? ? ? ? ? ? ? ? ? ? ? ?                          
3 1 sample ? ? ? human ? ?              ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? human 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 
'HEK 293' ? ? ? ? ? ? ? ? ? ? ? 'PAPAIN DIGESTED FROM mAb' 
4 1 sample ? ? ? human ? ?              ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? human 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 
'HEK 293' ? ? ? ? ? ? ? ? ? ? ? 'PAPAIN DIGESTED FROM mAb' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP IL12B_HUMAN P29460 1 
;IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL
LLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRG
DNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTW
STPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
;
23 ? 
2 UNP IL12A_HUMAN P29459 2 
;RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRET
SFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSS
LEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
;
23 ? 
3 PDB 3HMX        3HMX   3 
;DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQYNIYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
?  ? 
4 PDB 3HMX        3HMX   4 
;EVQLVQSGAEVKKPGESLKISCKGSGYSFTTYWLGWVRQMPGKGLDWIGIMSPVDSDIRYSPSFQGQVTMSVDKSITTAY
LQWNSLKASDTAMYYCARRRPGQGYFDFWGQGTLVTVSSSSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
;
?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3HMX A 1 ? 306 ? P29460 23 ? 328 ? 1 306 
2 2 3HMX B 1 ? 197 ? P29459 23 ? 219 ? 1 197 
3 3 3HMX L 1 ? 214 ? 3HMX   1  ? 214 ? 1 214 
4 4 3HMX H 1 ? 226 ? 3HMX   1  ? 226 ? 1 226 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3HMX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_percent_sol   55.88 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2002-06-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     3HMX 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             45.700 
_reflns.d_resolution_high            3.000 
_reflns.number_obs                   24337 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.900 
_reflns.pdbx_Rmerge_I_obs            0.128 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              13.220 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
3.00 3.11  100.00 0.494 ? 4.0  14.07 ? ? ? ? ? ? 1  1 
3.11 3.23  100.00 0.411 ? 4.5  14.01 ? ? ? ? ? ? 2  1 
3.23 3.38  100.00 0.316 ? 5.5  13.90 ? ? ? ? ? ? 3  1 
3.38 3.56  100.00 0.240 ? 7.5  13.48 ? ? ? ? ? ? 4  1 
3.56 3.78  99.80  0.200 ? 8.9  13.10 ? ? ? ? ? ? 5  1 
3.78 4.07  99.50  0.164 ? 10.5 12.78 ? ? ? ? ? ? 6  1 
4.07 4.48  98.80  0.150 ? 12.1 12.54 ? ? ? ? ? ? 7  1 
4.48 5.13  99.90  0.137 ? 14.5 12.59 ? ? ? ? ? ? 8  1 
5.13 6.46  100.00 0.121 ? 15.4 13.21 ? ? ? ? ? ? 9  1 
6.46 45.70 100.00 0.073 ? 24.5 12.57 ? ? ? ? ? ? 10 1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3HMX 
_refine.ls_number_reflns_obs                     24198 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.66 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    99.5 
_refine.ls_R_factor_obs                          0.215 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.211 
_refine.ls_R_factor_R_free                       0.303 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.830 
_refine.ls_number_reflns_R_free                  1168 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            1.00 
_refine.occupancy_max                            1.00 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               100.86 
_refine.aniso_B[1][1]                            15.62800 
_refine.aniso_B[2][2]                            0.36400 
_refine.aniso_B[3][3]                            -15.99200 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.00000 
_refine.aniso_B[2][3]                            -0.00000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.29 
_refine.solvent_model_param_bsol                 59.39 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            1.230 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6973 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         61 
_refine_hist.number_atoms_solvent             44 
_refine_hist.number_atoms_total               7078 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        26.66 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 7205 'X-RAY DIFFRACTION' ? 
f_angle_d          0.883  ? ? 9777 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 19.168 ? ? 2583 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.059  ? ? 1118 'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 1229 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.0000 3.1360  2840 0.3020 100.00 0.4100 . . 151 . . . . 
'X-RAY DIFFRACTION' . 3.1360 3.3010  2812 0.2890 100.00 0.3880 . . 152 . . . . 
'X-RAY DIFFRACTION' . 3.3010 3.5080  2848 0.2600 100.00 0.3530 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.5080 3.7780  2844 0.2240 100.00 0.3340 . . 146 . . . . 
'X-RAY DIFFRACTION' . 3.7780 4.1570  2860 0.1980 99.00  0.2870 . . 148 . . . . 
'X-RAY DIFFRACTION' . 4.1570 4.7550  2856 0.1640 99.00  0.2480 . . 152 . . . . 
'X-RAY DIFFRACTION' . 4.7550 5.9800  2902 0.1670 100.00 0.2560 . . 160 . . . . 
'X-RAY DIFFRACTION' . 5.9800 26.6600 3068 0.2100 99.00  0.2950 . . 119 . . . . 
# 
_struct.entry_id                  3HMX 
_struct.title                     'Crystal structure of ustekinumab FAB/IL-12 complex' 
_struct.pdbx_descriptor           
'Interleukin-12 subunit beta, Interleukin-12 subunit alpha, USTEKINUMAB FAB LIGHT CHAIN, USTEKINUMAB FAB HEAVY CHAIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3HMX 
_struct_keywords.text            
;USTEKINUMAB, CNTO1275, IL-12, IL-23, ANTIBODY, FAB, MONOCLONAL ANTIBODY, IMMUNE SYSTEM, Cytokine, Disulfide bond, Glycoprotein, Immunoglobulin domain, Secreted, Growth factor, Cytokine-MMUNE SYSTEM COMPLEX, Cytokine-IMMUNE SYSTEM complex
;
_struct_keywords.pdbx_keywords   'Cytokine/IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 59  ? ALA A 63  ? GLU A 59  ALA A 63  5 ? 5  
HELX_P HELX_P2  2  PHE A 206 ? ILE A 210 ? PHE A 206 ILE A 210 5 ? 5  
HELX_P HELX_P3  3  PHE B 13  ? LEU B 37  ? PHE B 13  LEU B 37  1 ? 25 
HELX_P HELX_P4  4  MET B 98  ? ASP B 126 ? MET B 98  ASP B 126 1 ? 29 
HELX_P HELX_P5  5  ASP B 134 ? ASN B 149 ? ASP B 134 ASN B 149 1 ? 16 
HELX_P HELX_P6  6  ASP B 165 ? SER B 197 ? ASP B 165 SER B 197 1 ? 33 
HELX_P HELX_P7  7  GLN C 79  ? PHE C 83  ? GLN L 79  PHE L 83  5 ? 5  
HELX_P HELX_P8  8  SER C 121 ? LYS C 126 ? SER L 121 LYS L 126 1 ? 6  
HELX_P HELX_P9  9  LYS C 183 ? LYS C 188 ? LYS L 183 LYS L 188 1 ? 6  
HELX_P HELX_P10 10 LYS D 87  ? THR D 91  ? LYS H 87  THR H 91  5 ? 5  
HELX_P HELX_P11 11 SER D 162 ? ALA D 164 ? SER H 162 ALA H 164 5 ? 3  
HELX_P HELX_P12 12 SER D 193 ? LEU D 195 ? SER H 193 LEU H 195 5 ? 3  
HELX_P HELX_P13 13 LYS D 207 ? ASN D 210 ? LYS H 207 ASN H 210 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 28  SG  ? ? ? 1_555 A CYS 68  SG ? ? A CYS 28  A CYS 68  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf2  disulf ?    ? A CYS 109 SG  ? ? ? 1_555 A CYS 120 SG ? ? A CYS 109 A CYS 120 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf3  disulf ?    ? A CYS 148 SG  ? ? ? 1_555 A CYS 171 SG ? ? A CYS 148 A CYS 171 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf4  disulf ?    ? A CYS 177 SG  ? ? ? 1_555 B CYS 74  SG ? ? A CYS 177 B CYS 74  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf5  disulf ?    ? B CYS 15  SG  ? ? ? 1_555 B CYS 88  SG ? ? B CYS 15  B CYS 88  1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf6  disulf ?    ? B CYS 42  SG  ? ? ? 1_555 B CYS 174 SG ? ? B CYS 42  B CYS 174 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf7  disulf ?    ? B CYS 63  SG  ? ? ? 1_555 B CYS 101 SG ? ? B CYS 63  B CYS 101 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf8  disulf ?    ? C CYS 23  SG  ? ? ? 1_555 C CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf9  disulf ?    ? C CYS 134 SG  ? ? ? 1_555 C CYS 194 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf10 disulf ?    ? D CYS 22  SG  ? ? ? 1_555 D CYS 96  SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf11 disulf ?    ? D CYS 146 SG  ? ? ? 1_555 D CYS 202 SG ? ? H CYS 146 H CYS 202 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
covale1  covale one  ? A ASN 200 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 200 C NAG 1   1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
covale2  covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.445 ? ?               
covale3  covale both ? E NAG .   O4  ? ? ? 1_555 E BMA .   C1 ? ? C NAG 2   C BMA 3   1_555 ? ? ? ? ? ? ? 1.344 ? ?               
covale4  covale both ? E BMA .   O3  ? ? ? 1_555 E MAN .   C1 ? ? C BMA 3   C MAN 4   1_555 ? ? ? ? ? ? ? 1.415 ? ?               
covale5  covale both ? E BMA .   O6  ? ? ? 1_555 E MAN .   C1 ? ? C BMA 3   C MAN 5   1_555 ? ? ? ? ? ? ? 1.471 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 242 A . ? THR 242 A PRO 243 A ? PRO 243 A 1 2.63  
2 SER 7   C . ? SER 7   L PRO 8   C ? PRO 8   L 1 4.03  
3 TYR 94  C . ? TYR 94  L PRO 95  C ? PRO 95  L 1 0.27  
4 TYR 140 C . ? TYR 140 L PRO 141 C ? PRO 141 L 1 3.83  
5 PHE 152 D . ? PHE 152 H PRO 153 D ? PRO 153 H 1 -3.13 
6 GLU 154 D . ? GLU 154 H PRO 155 D ? PRO 155 H 1 4.69  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 4 ? 
D ? 4 ? 
E ? 3 ? 
F ? 2 ? 
G ? 3 ? 
H ? 4 ? 
I ? 6 ? 
J ? 4 ? 
K ? 4 ? 
L ? 4 ? 
M ? 4 ? 
N ? 6 ? 
O ? 4 ? 
P ? 4 ? 
Q ? 4 ? 
R ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
I 5 6 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
N 5 6 ? anti-parallel 
O 1 2 ? parallel      
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 2   ? GLU A 3   ? TRP A 2   GLU A 3   
A 2 VAL A 8   ? ASP A 14  ? VAL A 8   ASP A 14  
A 3 VAL A 74  ? LYS A 85  ? VAL A 74  LYS A 85  
A 4 GLY A 64  ? HIS A 69  ? GLY A 64  HIS A 69  
A 5 THR A 37  ? LEU A 40  ? THR A 37  LEU A 40  
B 1 GLU A 22  ? THR A 27  ? GLU A 22  THR A 27  
B 2 THR A 52  ? VAL A 57  ? THR A 52  VAL A 57  
C 1 LEU A 107 ? GLU A 110 ? LEU A 107 GLU A 110 
C 2 ARG A 117 ? THR A 124 ? ARG A 117 THR A 124 
C 3 TYR A 165 ? GLN A 172 ? TYR A 165 GLN A 172 
C 4 THR A 147 ? CYS A 148 ? THR A 147 CYS A 148 
D 1 LEU A 107 ? GLU A 110 ? LEU A 107 GLU A 110 
D 2 ARG A 117 ? THR A 124 ? ARG A 117 THR A 124 
D 3 TYR A 165 ? GLN A 172 ? TYR A 165 GLN A 172 
D 4 THR A 152 ? ALA A 155 ? THR A 152 ALA A 155 
E 1 LEU A 130 ? ARG A 138 ? LEU A 130 ARG A 138 
E 2 ILE A 186 ? HIS A 194 ? ILE A 186 HIS A 194 
E 3 LYS A 197 ? PHE A 205 ? LYS A 197 PHE A 205 
F 1 GLU A 231 ? SER A 233 ? GLU A 231 SER A 233 
F 2 SER A 273 ? THR A 275 ? SER A 273 THR A 275 
G 1 VAL A 267 ? THR A 269 ? VAL A 267 THR A 269 
G 2 LEU A 249 ? VAL A 253 ? LEU A 249 VAL A 253 
G 3 VAL A 286 ? ASP A 290 ? VAL A 286 ASP A 290 
H 1 MET C 4   ? SER C 7   ? MET L 4   SER L 7   
H 2 VAL C 19  ? ALA C 25  ? VAL L 19  ALA L 25  
H 3 ASP C 70  ? ILE C 75  ? ASP L 70  ILE L 75  
H 4 PHE C 62  ? SER C 65  ? PHE L 62  SER L 65  
I 1 SER C 10  ? ALA C 13  ? SER L 10  ALA L 13  
I 2 THR C 102 ? ILE C 106 ? THR L 102 ILE L 106 
I 3 THR C 85  ? GLN C 90  ? THR L 85  GLN L 90  
I 4 LEU C 33  ? GLN C 38  ? LEU L 33  GLN L 38  
I 5 LYS C 45  ? TYR C 49  ? LYS L 45  TYR L 49  
I 6 SER C 53  ? LEU C 54  ? SER L 53  LEU L 54  
J 1 SER C 10  ? ALA C 13  ? SER L 10  ALA L 13  
J 2 THR C 102 ? ILE C 106 ? THR L 102 ILE L 106 
J 3 THR C 85  ? GLN C 90  ? THR L 85  GLN L 90  
J 4 THR C 97  ? PHE C 98  ? THR L 97  PHE L 98  
K 1 SER C 114 ? PHE C 118 ? SER L 114 PHE L 118 
K 2 THR C 129 ? PHE C 139 ? THR L 129 PHE L 139 
K 3 TYR C 173 ? SER C 182 ? TYR L 173 SER L 182 
K 4 SER C 159 ? GLN C 160 ? SER L 159 GLN L 160 
L 1 ALA C 153 ? LEU C 154 ? ALA L 153 LEU L 154 
L 2 ALA C 144 ? VAL C 150 ? ALA L 144 VAL L 150 
L 3 TYR C 192 ? HIS C 198 ? TYR L 192 HIS L 198 
L 4 VAL C 205 ? PHE C 209 ? VAL L 205 PHE L 209 
M 1 GLN D 3   ? GLN D 6   ? GLN H 3   GLN H 6   
M 2 LEU D 18  ? SER D 25  ? LEU H 18  SER H 25  
M 3 THR D 78  ? TRP D 83  ? THR H 78  TRP H 83  
M 4 THR D 69  ? ASP D 73  ? THR H 69  ASP H 73  
N 1 GLU D 10  ? LYS D 12  ? GLU H 10  LYS H 12  
N 2 THR D 113 ? VAL D 117 ? THR H 113 VAL H 117 
N 3 ALA D 92  ? ARG D 99  ? ALA H 92  ARG H 99  
N 4 TRP D 33  ? GLN D 39  ? TRP H 33  GLN H 39  
N 5 LEU D 45  ? MET D 51  ? LEU H 45  MET H 51  
N 6 ILE D 58  ? TYR D 60  ? ILE H 58  TYR H 60  
O 1 GLU D 10  ? LYS D 12  ? GLU H 10  LYS H 12  
O 2 THR D 113 ? VAL D 117 ? THR H 113 VAL H 117 
O 3 ALA D 92  ? ARG D 99  ? ALA H 92  ARG H 99  
O 4 PHE D 106 ? TRP D 109 ? PHE H 106 TRP H 109 
P 1 SER D 126 ? LEU D 130 ? SER H 126 LEU H 130 
P 2 THR D 141 ? TYR D 151 ? THR H 141 TYR H 151 
P 3 TYR D 182 ? PRO D 191 ? TYR H 182 PRO H 191 
P 4 VAL D 169 ? THR D 171 ? VAL H 169 THR H 171 
Q 1 SER D 126 ? LEU D 130 ? SER H 126 LEU H 130 
Q 2 THR D 141 ? TYR D 151 ? THR H 141 TYR H 151 
Q 3 TYR D 182 ? PRO D 191 ? TYR H 182 PRO H 191 
Q 4 VAL D 175 ? LEU D 176 ? VAL H 175 LEU H 176 
R 1 THR D 157 ? TRP D 160 ? THR H 157 TRP H 160 
R 2 TYR D 200 ? HIS D 206 ? TYR H 200 HIS H 206 
R 3 THR D 211 ? VAL D 217 ? THR H 211 VAL H 217 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TRP A 2   ? N TRP A 2   O VAL A 10  ? O VAL A 10  
A 2 3 N TYR A 9   ? N TYR A 9   O LEU A 81  ? O LEU A 81  
A 3 4 O SER A 78  ? O SER A 78  N TYR A 66  ? N TYR A 66  
A 4 5 O HIS A 69  ? O HIS A 69  N THR A 37  ? N THR A 37  
B 1 2 N LEU A 26  ? N LEU A 26  O LEU A 53  ? O LEU A 53  
C 1 2 N GLU A 110 ? N GLU A 110 O THR A 119 ? O THR A 119 
C 2 3 N PHE A 118 ? N PHE A 118 O CYS A 171 ? O CYS A 171 
C 3 4 O GLN A 172 ? O GLN A 172 N THR A 147 ? N THR A 147 
D 1 2 N GLU A 110 ? N GLU A 110 O THR A 119 ? O THR A 119 
D 2 3 N PHE A 118 ? N PHE A 118 O CYS A 171 ? O CYS A 171 
D 3 4 O SER A 168 ? O SER A 168 N THR A 152 ? N THR A 152 
E 1 2 N LYS A 135 ? N LYS A 135 O MET A 189 ? O MET A 189 
E 2 3 N ALA A 192 ? N ALA A 192 O GLU A 199 ? O GLU A 199 
F 1 2 N VAL A 232 ? N VAL A 232 O ALA A 274 ? O ALA A 274 
G 1 2 O VAL A 267 ? O VAL A 267 N VAL A 253 ? N VAL A 253 
G 2 3 N THR A 250 ? N THR A 250 O GLN A 289 ? O GLN A 289 
H 1 2 N THR C 5   ? N THR L 5   O ARG C 24  ? O ARG L 24  
H 2 3 N CYS C 23  ? N CYS L 23  O PHE C 71  ? O PHE L 71  
H 3 4 O THR C 74  ? O THR L 74  N SER C 63  ? N SER L 63  
I 1 2 N LEU C 11  ? N LEU L 11  O GLU C 105 ? O GLU L 105 
I 2 3 O THR C 102 ? O THR L 102 N TYR C 86  ? N TYR L 86  
I 3 4 O TYR C 87  ? O TYR L 87  N TYR C 36  ? N TYR L 36  
I 4 5 N GLN C 37  ? N GLN L 37  O LYS C 45  ? O LYS L 45  
I 5 6 N TYR C 49  ? N TYR L 49  O SER C 53  ? O SER L 53  
J 1 2 N LEU C 11  ? N LEU L 11  O GLU C 105 ? O GLU L 105 
J 2 3 O THR C 102 ? O THR L 102 N TYR C 86  ? N TYR L 86  
J 3 4 N GLN C 90  ? N GLN L 90  O THR C 97  ? O THR L 97  
K 1 2 N PHE C 116 ? N PHE L 116 O LEU C 135 ? O LEU L 135 
K 2 3 N ALA C 130 ? N ALA L 130 O LEU C 181 ? O LEU L 181 
K 3 4 O THR C 178 ? O THR L 178 N GLN C 160 ? N GLN L 160 
L 1 2 O ALA C 153 ? O ALA L 153 N VAL C 150 ? N VAL L 150 
L 2 3 N LYS C 149 ? N LYS L 149 O ALA C 193 ? O ALA L 193 
L 3 4 N VAL C 196 ? N VAL L 196 O VAL C 205 ? O VAL L 205 
M 1 2 N VAL D 5   ? N VAL H 5   O LYS D 23  ? O LYS H 23  
M 2 3 N ILE D 20  ? N ILE H 20  O LEU D 81  ? O LEU H 81  
M 3 4 O THR D 78  ? O THR H 78  N ASP D 73  ? N ASP H 73  
N 1 2 N LYS D 12  ? N LYS H 12  O THR D 116 ? O THR H 116 
N 2 3 O VAL D 115 ? O VAL H 115 N ALA D 92  ? N ALA H 92  
N 3 4 O ALA D 97  ? O ALA H 97  N GLY D 35  ? N GLY H 35  
N 4 5 N ARG D 38  ? N ARG H 38  O ASP D 46  ? O ASP H 46  
N 5 6 N ILE D 50  ? N ILE H 50  O ARG D 59  ? O ARG H 59  
O 1 2 N LYS D 12  ? N LYS H 12  O THR D 116 ? O THR H 116 
O 2 3 O VAL D 115 ? O VAL H 115 N ALA D 92  ? N ALA H 92  
O 3 4 N ARG D 98  ? N ARG H 98  O ASP D 107 ? O ASP H 107 
P 1 2 N PHE D 128 ? N PHE H 128 O LEU D 147 ? O LEU H 147 
P 2 3 N TYR D 151 ? N TYR H 151 O TYR D 182 ? O TYR H 182 
P 3 4 O VAL D 187 ? O VAL H 187 N HIS D 170 ? N HIS H 170 
Q 1 2 N PHE D 128 ? N PHE H 128 O LEU D 147 ? O LEU H 147 
Q 2 3 N TYR D 151 ? N TYR H 151 O TYR D 182 ? O TYR H 182 
Q 3 4 O SER D 183 ? O SER H 183 N VAL D 175 ? N VAL H 175 
R 1 2 N SER D 159 ? N SER H 159 O ASN D 203 ? O ASN H 203 
R 2 3 N VAL D 204 ? N VAL H 204 O VAL D 213 ? O VAL H 213 
# 
_atom_sites.entry_id                    3HMX 
_atom_sites.fract_transf_matrix[1][1]   0.018151 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008588 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005471 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 1   ? 40.762  21.448  25.905  1.00 69.79  ? 1   ILE A N   1 
ATOM   2    C CA  . ILE A 1 1   ? 40.742  20.085  26.429  1.00 69.70  ? 1   ILE A CA  1 
ATOM   3    C C   . ILE A 1 1   ? 41.463  20.000  27.766  1.00 68.03  ? 1   ILE A C   1 
ATOM   4    O O   . ILE A 1 1   ? 42.636  20.347  27.872  1.00 75.34  ? 1   ILE A O   1 
ATOM   5    C CB  . ILE A 1 1   ? 41.370  19.066  25.440  1.00 83.90  ? 1   ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 1   ? 41.071  17.628  25.875  1.00 75.24  ? 1   ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 1   ? 42.871  19.274  25.311  1.00 86.45  ? 1   ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 1   ? 42.031  16.612  25.314  1.00 64.09  ? 1   ILE A CD1 1 
ATOM   9    N N   . TRP A 1 2   ? 40.752  19.546  28.792  1.00 78.15  ? 2   TRP A N   1 
ATOM   10   C CA  . TRP A 1 2   ? 41.354  19.363  30.114  1.00 81.87  ? 2   TRP A CA  1 
ATOM   11   C C   . TRP A 1 2   ? 41.117  17.971  30.669  1.00 78.49  ? 2   TRP A C   1 
ATOM   12   O O   . TRP A 1 2   ? 40.350  17.196  30.106  1.00 82.00  ? 2   TRP A O   1 
ATOM   13   C CB  . TRP A 1 2   ? 40.878  20.421  31.115  1.00 82.10  ? 2   TRP A CB  1 
ATOM   14   C CG  . TRP A 1 2   ? 39.392  20.654  31.183  1.00 77.71  ? 2   TRP A CG  1 
ATOM   15   C CD1 . TRP A 1 2   ? 38.652  21.435  30.354  1.00 77.41  ? 2   TRP A CD1 1 
ATOM   16   C CD2 . TRP A 1 2   ? 38.483  20.139  32.166  1.00 76.48  ? 2   TRP A CD2 1 
ATOM   17   N NE1 . TRP A 1 2   ? 37.336  21.429  30.743  1.00 83.06  ? 2   TRP A NE1 1 
ATOM   18   C CE2 . TRP A 1 2   ? 37.206  20.642  31.854  1.00 73.65  ? 2   TRP A CE2 1 
ATOM   19   C CE3 . TRP A 1 2   ? 38.625  19.300  33.272  1.00 79.25  ? 2   TRP A CE3 1 
ATOM   20   C CZ2 . TRP A 1 2   ? 36.077  20.333  32.609  1.00 69.23  ? 2   TRP A CZ2 1 
ATOM   21   C CZ3 . TRP A 1 2   ? 37.499  18.990  34.020  1.00 72.29  ? 2   TRP A CZ3 1 
ATOM   22   C CH2 . TRP A 1 2   ? 36.244  19.505  33.683  1.00 70.99  ? 2   TRP A CH2 1 
ATOM   23   N N   . GLU A 1 3   ? 41.784  17.660  31.774  1.00 77.54  ? 3   GLU A N   1 
ATOM   24   C CA  . GLU A 1 3   ? 41.720  16.325  32.346  1.00 74.90  ? 3   GLU A CA  1 
ATOM   25   C C   . GLU A 1 3   ? 40.752  16.249  33.518  1.00 73.86  ? 3   GLU A C   1 
ATOM   26   O O   . GLU A 1 3   ? 40.808  17.062  34.429  1.00 80.42  ? 3   GLU A O   1 
ATOM   27   C CB  . GLU A 1 3   ? 43.112  15.869  32.781  1.00 78.33  ? 3   GLU A CB  1 
ATOM   28   C CG  . GLU A 1 3   ? 43.129  14.473  33.374  1.00 91.03  ? 3   GLU A CG  1 
ATOM   29   C CD  . GLU A 1 3   ? 44.522  13.991  33.696  1.00 98.10  ? 3   GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 3   ? 45.453  14.317  32.932  1.00 104.66 ? 3   GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 3   ? 44.686  13.286  34.713  1.00 97.59  ? 3   GLU A OE2 1 
ATOM   32   N N   . LEU A 1 4   ? 39.864  15.266  33.487  1.00 64.33  ? 4   LEU A N   1 
ATOM   33   C CA  . LEU A 1 4   ? 38.957  15.006  34.596  1.00 77.99  ? 4   LEU A CA  1 
ATOM   34   C C   . LEU A 1 4   ? 39.626  14.027  35.557  1.00 87.82  ? 4   LEU A C   1 
ATOM   35   O O   . LEU A 1 4   ? 40.291  14.440  36.504  1.00 99.95  ? 4   LEU A O   1 
ATOM   36   C CB  . LEU A 1 4   ? 37.654  14.423  34.066  1.00 86.49  ? 4   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 4   ? 36.396  14.595  34.911  1.00 67.17  ? 4   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 4   ? 36.229  16.040  35.312  1.00 84.49  ? 4   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 4   ? 35.185  14.111  34.138  1.00 66.28  ? 4   LEU A CD2 1 
ATOM   40   N N   . LYS A 1 5   ? 39.445  12.731  35.315  1.00 92.78  ? 5   LYS A N   1 
ATOM   41   C CA  . LYS A 1 5   ? 40.245  11.703  35.977  1.00 85.51  ? 5   LYS A CA  1 
ATOM   42   C C   . LYS A 1 5   ? 41.507  11.500  35.154  1.00 88.04  ? 5   LYS A C   1 
ATOM   43   O O   . LYS A 1 5   ? 41.696  12.143  34.125  1.00 74.72  ? 5   LYS A O   1 
ATOM   44   C CB  . LYS A 1 5   ? 39.498  10.364  36.053  1.00 78.85  ? 5   LYS A CB  1 
ATOM   45   C CG  . LYS A 1 5   ? 38.442  10.242  37.130  1.00 78.55  ? 5   LYS A CG  1 
ATOM   46   C CD  . LYS A 1 5   ? 37.077  10.645  36.622  1.00 84.10  ? 5   LYS A CD  1 
ATOM   47   C CE  . LYS A 1 5   ? 35.975  10.169  37.545  1.00 89.80  ? 5   LYS A CE  1 
ATOM   48   N NZ  . LYS A 1 5   ? 34.774  11.035  37.438  1.00 86.15  ? 5   LYS A NZ  1 
ATOM   49   N N   . LYS A 1 6   ? 42.366  10.593  35.600  1.00 100.55 ? 6   LYS A N   1 
ATOM   50   C CA  . LYS A 1 6   ? 43.506  10.188  34.794  1.00 107.68 ? 6   LYS A CA  1 
ATOM   51   C C   . LYS A 1 6   ? 42.962  9.416   33.609  1.00 102.47 ? 6   LYS A C   1 
ATOM   52   O O   . LYS A 1 6   ? 42.168  8.493   33.783  1.00 100.92 ? 6   LYS A O   1 
ATOM   53   C CB  . LYS A 1 6   ? 44.460  9.298   35.599  1.00 120.99 ? 6   LYS A CB  1 
ATOM   54   C CG  . LYS A 1 6   ? 45.806  9.037   34.922  1.00 131.49 ? 6   LYS A CG  1 
ATOM   55   C CD  . LYS A 1 6   ? 46.751  10.233  35.065  1.00 141.29 ? 6   LYS A CD  1 
ATOM   56   C CE  . LYS A 1 6   ? 48.113  9.974   34.421  1.00 139.42 ? 6   LYS A CE  1 
ATOM   57   N NZ  . LYS A 1 6   ? 48.037  9.879   32.934  1.00 132.17 ? 6   LYS A NZ  1 
ATOM   58   N N   . ASP A 1 7   ? 43.374  9.811   32.409  1.00 107.41 ? 7   ASP A N   1 
ATOM   59   C CA  . ASP A 1 7   ? 42.950  9.134   31.190  1.00 105.13 ? 7   ASP A CA  1 
ATOM   60   C C   . ASP A 1 7   ? 41.488  9.413   30.833  1.00 97.71  ? 7   ASP A C   1 
ATOM   61   O O   . ASP A 1 7   ? 40.876  8.671   30.065  1.00 97.97  ? 7   ASP A O   1 
ATOM   62   C CB  . ASP A 1 7   ? 43.223  7.630   31.286  1.00 100.67 ? 7   ASP A CB  1 
ATOM   63   C CG  . ASP A 1 7   ? 44.672  7.292   31.016  1.00 102.33 ? 7   ASP A CG  1 
ATOM   64   O OD1 . ASP A 1 7   ? 45.252  6.468   31.753  1.00 88.60  ? 7   ASP A OD1 1 
ATOM   65   O OD2 . ASP A 1 7   ? 45.234  7.867   30.059  1.00 114.03 ? 7   ASP A OD2 1 
ATOM   66   N N   . VAL A 1 8   ? 40.941  10.487  31.394  1.00 91.11  ? 8   VAL A N   1 
ATOM   67   C CA  . VAL A 1 8   ? 39.600  10.941  31.056  1.00 78.39  ? 8   VAL A CA  1 
ATOM   68   C C   . VAL A 1 8   ? 39.618  12.447  30.836  1.00 75.34  ? 8   VAL A C   1 
ATOM   69   O O   . VAL A 1 8   ? 39.867  13.204  31.770  1.00 77.76  ? 8   VAL A O   1 
ATOM   70   C CB  . VAL A 1 8   ? 38.608  10.626  32.171  1.00 61.28  ? 8   VAL A CB  1 
ATOM   71   C CG1 . VAL A 1 8   ? 37.214  11.029  31.741  1.00 75.74  ? 8   VAL A CG1 1 
ATOM   72   C CG2 . VAL A 1 8   ? 38.661  9.148   32.526  1.00 69.50  ? 8   VAL A CG2 1 
ATOM   73   N N   . TYR A 1 9   ? 39.358  12.878  29.602  1.00 65.31  ? 9   TYR A N   1 
ATOM   74   C CA  . TYR A 1 9   ? 39.453  14.290  29.241  1.00 61.09  ? 9   TYR A CA  1 
ATOM   75   C C   . TYR A 1 9   ? 38.129  14.862  28.772  1.00 59.84  ? 9   TYR A C   1 
ATOM   76   O O   . TYR A 1 9   ? 37.330  14.183  28.139  1.00 56.85  ? 9   TYR A O   1 
ATOM   77   C CB  . TYR A 1 9   ? 40.503  14.499  28.153  1.00 57.30  ? 9   TYR A CB  1 
ATOM   78   C CG  . TYR A 1 9   ? 41.768  13.710  28.369  1.00 71.04  ? 9   TYR A CG  1 
ATOM   79   C CD1 . TYR A 1 9   ? 41.866  12.398  27.941  1.00 74.38  ? 9   TYR A CD1 1 
ATOM   80   C CD2 . TYR A 1 9   ? 42.866  14.274  29.002  1.00 73.41  ? 9   TYR A CD2 1 
ATOM   81   C CE1 . TYR A 1 9   ? 43.019  11.668  28.135  1.00 83.81  ? 9   TYR A CE1 1 
ATOM   82   C CE2 . TYR A 1 9   ? 44.026  13.552  29.200  1.00 76.85  ? 9   TYR A CE2 1 
ATOM   83   C CZ  . TYR A 1 9   ? 44.097  12.245  28.762  1.00 84.29  ? 9   TYR A CZ  1 
ATOM   84   O OH  . TYR A 1 9   ? 45.250  11.508  28.952  1.00 87.62  ? 9   TYR A OH  1 
ATOM   85   N N   . VAL A 1 10  ? 37.903  16.126  29.090  1.00 58.97  ? 10  VAL A N   1 
ATOM   86   C CA  . VAL A 1 10  ? 36.708  16.822  28.652  1.00 60.82  ? 10  VAL A CA  1 
ATOM   87   C C   . VAL A 1 10  ? 37.068  17.898  27.644  1.00 75.91  ? 10  VAL A C   1 
ATOM   88   O O   . VAL A 1 10  ? 38.027  18.641  27.841  1.00 80.69  ? 10  VAL A O   1 
ATOM   89   C CB  . VAL A 1 10  ? 35.993  17.492  29.828  1.00 61.28  ? 10  VAL A CB  1 
ATOM   90   C CG1 . VAL A 1 10  ? 35.041  18.566  29.322  1.00 62.03  ? 10  VAL A CG1 1 
ATOM   91   C CG2 . VAL A 1 10  ? 35.256  16.454  30.645  1.00 73.66  ? 10  VAL A CG2 1 
ATOM   92   N N   . VAL A 1 11  ? 36.318  17.972  26.553  1.00 58.22  ? 11  VAL A N   1 
ATOM   93   C CA  . VAL A 1 11  ? 36.478  19.087  25.634  1.00 70.67  ? 11  VAL A CA  1 
ATOM   94   C C   . VAL A 1 11  ? 35.164  19.859  25.534  1.00 73.25  ? 11  VAL A C   1 
ATOM   95   O O   . VAL A 1 11  ? 34.085  19.277  25.436  1.00 74.03  ? 11  VAL A O   1 
ATOM   96   C CB  . VAL A 1 11  ? 36.963  18.645  24.241  1.00 66.68  ? 11  VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 11  ? 37.991  17.529  24.366  1.00 56.07  ? 11  VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 11  ? 35.802  18.215  23.388  1.00 56.41  ? 11  VAL A CG2 1 
ATOM   99   N N   . GLU A 1 12  ? 35.261  21.177  25.586  1.00 61.43  ? 12  GLU A N   1 
ATOM   100  C CA  . GLU A 1 12  ? 34.086  22.025  25.570  1.00 71.94  ? 12  GLU A CA  1 
ATOM   101  C C   . GLU A 1 12  ? 33.856  22.606  24.179  1.00 72.16  ? 12  GLU A C   1 
ATOM   102  O O   . GLU A 1 12  ? 34.805  23.014  23.508  1.00 71.23  ? 12  GLU A O   1 
ATOM   103  C CB  . GLU A 1 12  ? 34.269  23.134  26.603  1.00 65.36  ? 12  GLU A CB  1 
ATOM   104  C CG  . GLU A 1 12  ? 35.726  23.313  27.046  1.00 77.77  ? 12  GLU A CG  1 
ATOM   105  C CD  . GLU A 1 12  ? 35.862  24.118  28.335  1.00 84.15  ? 12  GLU A CD  1 
ATOM   106  O OE1 . GLU A 1 12  ? 35.735  25.360  28.281  1.00 86.59  ? 12  GLU A OE1 1 
ATOM   107  O OE2 . GLU A 1 12  ? 36.105  23.514  29.403  1.00 80.25  ? 12  GLU A OE2 1 
ATOM   108  N N   . LEU A 1 13  ? 32.601  22.634  23.736  1.00 63.83  ? 13  LEU A N   1 
ATOM   109  C CA  . LEU A 1 13  ? 32.281  23.266  22.459  1.00 78.90  ? 13  LEU A CA  1 
ATOM   110  C C   . LEU A 1 13  ? 30.876  23.888  22.379  1.00 81.21  ? 13  LEU A C   1 
ATOM   111  O O   . LEU A 1 13  ? 29.904  23.326  22.887  1.00 87.38  ? 13  LEU A O   1 
ATOM   112  C CB  . LEU A 1 13  ? 32.550  22.302  21.299  1.00 62.36  ? 13  LEU A CB  1 
ATOM   113  C CG  . LEU A 1 13  ? 32.142  20.844  21.453  1.00 71.01  ? 13  LEU A CG  1 
ATOM   114  C CD1 . LEU A 1 13  ? 30.638  20.684  21.269  1.00 85.49  ? 13  LEU A CD1 1 
ATOM   115  C CD2 . LEU A 1 13  ? 32.902  19.994  20.452  1.00 62.98  ? 13  LEU A CD2 1 
ATOM   116  N N   . ASP A 1 14  ? 30.799  25.055  21.734  1.00 81.69  ? 14  ASP A N   1 
ATOM   117  C CA  . ASP A 1 14  ? 29.570  25.846  21.631  1.00 84.81  ? 14  ASP A CA  1 
ATOM   118  C C   . ASP A 1 14  ? 28.696  25.371  20.468  1.00 80.99  ? 14  ASP A C   1 
ATOM   119  O O   . ASP A 1 14  ? 29.211  24.917  19.446  1.00 80.47  ? 14  ASP A O   1 
ATOM   120  C CB  . ASP A 1 14  ? 29.923  27.334  21.461  1.00 94.44  ? 14  ASP A CB  1 
ATOM   121  C CG  . ASP A 1 14  ? 28.785  28.269  21.870  1.00 105.45 ? 14  ASP A CG  1 
ATOM   122  O OD1 . ASP A 1 14  ? 28.944  28.994  22.877  1.00 102.13 ? 14  ASP A OD1 1 
ATOM   123  O OD2 . ASP A 1 14  ? 27.735  28.284  21.188  1.00 112.50 ? 14  ASP A OD2 1 
ATOM   124  N N   . TRP A 1 15  ? 27.378  25.477  20.619  1.00 86.89  ? 15  TRP A N   1 
ATOM   125  C CA  . TRP A 1 15  ? 26.468  24.961  19.598  1.00 100.99 ? 15  TRP A CA  1 
ATOM   126  C C   . TRP A 1 15  ? 25.945  25.957  18.567  1.00 116.19 ? 15  TRP A C   1 
ATOM   127  O O   . TRP A 1 15  ? 24.854  25.766  18.028  1.00 120.92 ? 15  TRP A O   1 
ATOM   128  C CB  . TRP A 1 15  ? 25.297  24.197  20.224  1.00 109.85 ? 15  TRP A CB  1 
ATOM   129  C CG  . TRP A 1 15  ? 25.424  22.704  20.099  1.00 127.97 ? 15  TRP A CG  1 
ATOM   130  C CD1 . TRP A 1 15  ? 24.624  21.765  20.681  1.00 132.77 ? 15  TRP A CD1 1 
ATOM   131  C CD2 . TRP A 1 15  ? 26.418  21.977  19.353  1.00 138.24 ? 15  TRP A CD2 1 
ATOM   132  N NE1 . TRP A 1 15  ? 25.048  20.503  20.336  1.00 134.46 ? 15  TRP A NE1 1 
ATOM   133  C CE2 . TRP A 1 15  ? 26.150  20.606  19.529  1.00 136.57 ? 15  TRP A CE2 1 
ATOM   134  C CE3 . TRP A 1 15  ? 27.506  22.354  18.555  1.00 139.49 ? 15  TRP A CE3 1 
ATOM   135  C CZ2 . TRP A 1 15  ? 26.929  19.613  18.936  1.00 134.39 ? 15  TRP A CZ2 1 
ATOM   136  C CZ3 . TRP A 1 15  ? 28.276  21.366  17.969  1.00 130.56 ? 15  TRP A CZ3 1 
ATOM   137  C CH2 . TRP A 1 15  ? 27.984  20.014  18.162  1.00 130.06 ? 15  TRP A CH2 1 
ATOM   138  N N   . TYR A 1 16  ? 26.712  27.005  18.275  1.00 122.62 ? 16  TYR A N   1 
ATOM   139  C CA  . TYR A 1 16  ? 26.360  27.856  17.142  1.00 129.28 ? 16  TYR A CA  1 
ATOM   140  C C   . TYR A 1 16  ? 26.856  27.234  15.839  1.00 130.12 ? 16  TYR A C   1 
ATOM   141  O O   . TYR A 1 16  ? 28.028  26.876  15.723  1.00 125.24 ? 16  TYR A O   1 
ATOM   142  C CB  . TYR A 1 16  ? 26.820  29.312  17.318  1.00 136.34 ? 16  TYR A CB  1 
ATOM   143  C CG  . TYR A 1 16  ? 28.313  29.557  17.414  1.00 139.15 ? 16  TYR A CG  1 
ATOM   144  C CD1 . TYR A 1 16  ? 29.026  29.209  18.555  1.00 138.50 ? 16  TYR A CD1 1 
ATOM   145  C CD2 . TYR A 1 16  ? 28.999  30.195  16.384  1.00 137.77 ? 16  TYR A CD2 1 
ATOM   146  C CE1 . TYR A 1 16  ? 30.390  29.459  18.656  1.00 132.45 ? 16  TYR A CE1 1 
ATOM   147  C CE2 . TYR A 1 16  ? 30.362  30.450  16.475  1.00 131.41 ? 16  TYR A CE2 1 
ATOM   148  C CZ  . TYR A 1 16  ? 31.051  30.079  17.613  1.00 124.31 ? 16  TYR A CZ  1 
ATOM   149  O OH  . TYR A 1 16  ? 32.402  30.325  17.705  1.00 109.16 ? 16  TYR A OH  1 
ATOM   150  N N   . PRO A 1 17  ? 25.947  27.101  14.857  1.00 134.18 ? 17  PRO A N   1 
ATOM   151  C CA  . PRO A 1 17  ? 26.131  26.301  13.638  1.00 128.51 ? 17  PRO A CA  1 
ATOM   152  C C   . PRO A 1 17  ? 27.487  26.520  12.972  1.00 121.72 ? 17  PRO A C   1 
ATOM   153  O O   . PRO A 1 17  ? 28.215  25.556  12.718  1.00 114.31 ? 17  PRO A O   1 
ATOM   154  C CB  . PRO A 1 17  ? 25.007  26.797  12.726  1.00 128.61 ? 17  PRO A CB  1 
ATOM   155  C CG  . PRO A 1 17  ? 23.960  27.299  13.655  1.00 128.14 ? 17  PRO A CG  1 
ATOM   156  C CD  . PRO A 1 17  ? 24.700  27.886  14.818  1.00 131.50 ? 17  PRO A CD  1 
ATOM   157  N N   . ASP A 1 18  ? 27.810  27.781  12.699  1.00 118.32 ? 18  ASP A N   1 
ATOM   158  C CA  . ASP A 1 18  ? 29.061  28.149  12.043  1.00 109.72 ? 18  ASP A CA  1 
ATOM   159  C C   . ASP A 1 18  ? 30.212  28.292  13.039  1.00 100.66 ? 18  ASP A C   1 
ATOM   160  O O   . ASP A 1 18  ? 30.961  29.271  13.008  1.00 101.48 ? 18  ASP A O   1 
ATOM   161  C CB  . ASP A 1 18  ? 28.875  29.446  11.257  1.00 113.19 ? 18  ASP A CB  1 
ATOM   162  C CG  . ASP A 1 18  ? 27.965  30.428  11.967  1.00 123.08 ? 18  ASP A CG  1 
ATOM   163  O OD1 . ASP A 1 18  ? 28.178  30.672  13.176  1.00 131.68 ? 18  ASP A OD1 1 
ATOM   164  O OD2 . ASP A 1 18  ? 27.035  30.953  11.319  1.00 120.43 ? 18  ASP A OD2 1 
ATOM   165  N N   . ALA A 1 19  ? 30.341  27.307  13.919  1.00 85.97  ? 19  ALA A N   1 
ATOM   166  C CA  . ALA A 1 19  ? 31.432  27.261  14.877  1.00 76.93  ? 19  ALA A CA  1 
ATOM   167  C C   . ALA A 1 19  ? 32.261  26.014  14.616  1.00 88.73  ? 19  ALA A C   1 
ATOM   168  O O   . ALA A 1 19  ? 31.726  24.987  14.181  1.00 93.50  ? 19  ALA A O   1 
ATOM   169  C CB  . ALA A 1 19  ? 30.884  27.237  16.276  1.00 80.60  ? 19  ALA A CB  1 
ATOM   170  N N   . PRO A 1 20  ? 33.572  26.089  14.897  1.00 87.37  ? 20  PRO A N   1 
ATOM   171  C CA  . PRO A 1 20  ? 34.521  25.011  14.595  1.00 79.66  ? 20  PRO A CA  1 
ATOM   172  C C   . PRO A 1 20  ? 34.481  23.865  15.592  1.00 80.96  ? 20  PRO A C   1 
ATOM   173  O O   . PRO A 1 20  ? 33.696  23.870  16.543  1.00 84.61  ? 20  PRO A O   1 
ATOM   174  C CB  . PRO A 1 20  ? 35.890  25.698  14.706  1.00 74.82  ? 20  PRO A CB  1 
ATOM   175  C CG  . PRO A 1 20  ? 35.616  27.147  14.937  1.00 81.57  ? 20  PRO A CG  1 
ATOM   176  C CD  . PRO A 1 20  ? 34.242  27.248  15.498  1.00 83.56  ? 20  PRO A CD  1 
ATOM   177  N N   . GLY A 1 21  ? 35.339  22.881  15.350  1.00 81.32  ? 21  GLY A N   1 
ATOM   178  C CA  . GLY A 1 21  ? 35.611  21.835  16.314  1.00 75.92  ? 21  GLY A CA  1 
ATOM   179  C C   . GLY A 1 21  ? 36.992  22.099  16.875  1.00 75.26  ? 21  GLY A C   1 
ATOM   180  O O   . GLY A 1 21  ? 37.626  23.092  16.524  1.00 86.99  ? 21  GLY A O   1 
ATOM   181  N N   . GLU A 1 22  ? 37.465  21.215  17.740  1.00 64.35  ? 22  GLU A N   1 
ATOM   182  C CA  . GLU A 1 22  ? 38.768  21.402  18.367  1.00 68.48  ? 22  GLU A CA  1 
ATOM   183  C C   . GLU A 1 22  ? 39.766  20.382  17.840  1.00 72.26  ? 22  GLU A C   1 
ATOM   184  O O   . GLU A 1 22  ? 39.456  19.203  17.731  1.00 78.51  ? 22  GLU A O   1 
ATOM   185  C CB  . GLU A 1 22  ? 38.644  21.300  19.888  1.00 66.00  ? 22  GLU A CB  1 
ATOM   186  C CG  . GLU A 1 22  ? 39.958  21.315  20.632  1.00 73.97  ? 22  GLU A CG  1 
ATOM   187  C CD  . GLU A 1 22  ? 39.791  21.678  22.098  1.00 83.07  ? 22  GLU A CD  1 
ATOM   188  O OE1 . GLU A 1 22  ? 38.765  22.307  22.444  1.00 86.26  ? 22  GLU A OE1 1 
ATOM   189  O OE2 . GLU A 1 22  ? 40.689  21.340  22.901  1.00 76.96  ? 22  GLU A OE2 1 
ATOM   190  N N   . MET A 1 23  ? 40.962  20.842  17.502  1.00 69.38  ? 23  MET A N   1 
ATOM   191  C CA  . MET A 1 23  ? 42.001  19.950  17.014  1.00 67.67  ? 23  MET A CA  1 
ATOM   192  C C   . MET A 1 23  ? 42.820  19.419  18.168  1.00 59.55  ? 23  MET A C   1 
ATOM   193  O O   . MET A 1 23  ? 43.753  20.070  18.633  1.00 92.74  ? 23  MET A O   1 
ATOM   194  C CB  . MET A 1 23  ? 42.916  20.653  16.008  1.00 73.27  ? 23  MET A CB  1 
ATOM   195  C CG  . MET A 1 23  ? 44.279  19.976  15.851  1.00 62.79  ? 23  MET A CG  1 
ATOM   196  S SD  . MET A 1 23  ? 45.451  20.910  14.875  1.00 104.48 ? 23  MET A SD  1 
ATOM   197  C CE  . MET A 1 23  ? 44.717  20.762  13.250  1.00 172.51 ? 23  MET A CE  1 
ATOM   198  N N   . VAL A 1 24  ? 42.474  18.225  18.625  1.00 57.64  ? 24  VAL A N   1 
ATOM   199  C CA  . VAL A 1 24  ? 43.151  17.641  19.773  1.00 57.46  ? 24  VAL A CA  1 
ATOM   200  C C   . VAL A 1 24  ? 44.141  16.557  19.386  1.00 63.33  ? 24  VAL A C   1 
ATOM   201  O O   . VAL A 1 24  ? 43.924  15.809  18.441  1.00 63.21  ? 24  VAL A O   1 
ATOM   202  C CB  . VAL A 1 24  ? 42.147  17.085  20.795  1.00 56.07  ? 24  VAL A CB  1 
ATOM   203  C CG1 . VAL A 1 24  ? 40.767  17.028  20.199  1.00 70.17  ? 24  VAL A CG1 1 
ATOM   204  C CG2 . VAL A 1 24  ? 42.590  15.720  21.272  1.00 55.22  ? 24  VAL A CG2 1 
ATOM   205  N N   . VAL A 1 25  ? 45.233  16.485  20.135  1.00 70.35  ? 25  VAL A N   1 
ATOM   206  C CA  . VAL A 1 25  ? 46.289  15.529  19.869  1.00 74.12  ? 25  VAL A CA  1 
ATOM   207  C C   . VAL A 1 25  ? 46.415  14.510  20.998  1.00 73.85  ? 25  VAL A C   1 
ATOM   208  O O   . VAL A 1 25  ? 46.816  14.844  22.113  1.00 80.78  ? 25  VAL A O   1 
ATOM   209  C CB  . VAL A 1 25  ? 47.629  16.249  19.680  1.00 77.17  ? 25  VAL A CB  1 
ATOM   210  C CG1 . VAL A 1 25  ? 48.744  15.250  19.475  1.00 79.03  ? 25  VAL A CG1 1 
ATOM   211  C CG2 . VAL A 1 25  ? 47.538  17.216  18.512  1.00 81.23  ? 25  VAL A CG2 1 
ATOM   212  N N   . LEU A 1 26  ? 46.065  13.264  20.700  1.00 62.70  ? 26  LEU A N   1 
ATOM   213  C CA  . LEU A 1 26  ? 46.112  12.196  21.685  1.00 59.25  ? 26  LEU A CA  1 
ATOM   214  C C   . LEU A 1 26  ? 47.469  11.525  21.702  1.00 74.37  ? 26  LEU A C   1 
ATOM   215  O O   . LEU A 1 26  ? 47.922  10.994  20.694  1.00 79.47  ? 26  LEU A O   1 
ATOM   216  C CB  . LEU A 1 26  ? 45.039  11.159  21.385  1.00 58.37  ? 26  LEU A CB  1 
ATOM   217  C CG  . LEU A 1 26  ? 43.617  11.707  21.264  1.00 65.76  ? 26  LEU A CG  1 
ATOM   218  C CD1 . LEU A 1 26  ? 42.644  10.579  20.937  1.00 64.47  ? 26  LEU A CD1 1 
ATOM   219  C CD2 . LEU A 1 26  ? 43.222  12.431  22.544  1.00 61.39  ? 26  LEU A CD2 1 
ATOM   220  N N   . THR A 1 27  ? 48.119  11.557  22.859  1.00 87.32  ? 27  THR A N   1 
ATOM   221  C CA  . THR A 1 27  ? 49.400  10.888  23.021  1.00 90.34  ? 27  THR A CA  1 
ATOM   222  C C   . THR A 1 27  ? 49.173  9.561   23.719  1.00 92.10  ? 27  THR A C   1 
ATOM   223  O O   . THR A 1 27  ? 48.244  9.424   24.512  1.00 98.55  ? 27  THR A O   1 
ATOM   224  C CB  . THR A 1 27  ? 50.400  11.739  23.824  1.00 91.14  ? 27  THR A CB  1 
ATOM   225  O OG1 . THR A 1 27  ? 50.258  13.113  23.453  1.00 64.08  ? 27  THR A OG1 1 
ATOM   226  C CG2 . THR A 1 27  ? 51.820  11.283  23.542  1.00 66.45  ? 27  THR A CG2 1 
ATOM   227  N N   . CYS A 1 28  ? 50.007  8.578   23.405  1.00 92.05  ? 28  CYS A N   1 
ATOM   228  C CA  . CYS A 1 28  ? 49.867  7.253   23.994  1.00 94.95  ? 28  CYS A CA  1 
ATOM   229  C C   . CYS A 1 28  ? 50.754  7.086   25.222  1.00 105.05 ? 28  CYS A C   1 
ATOM   230  O O   . CYS A 1 28  ? 51.931  7.449   25.214  1.00 107.44 ? 28  CYS A O   1 
ATOM   231  C CB  . CYS A 1 28  ? 50.174  6.165   22.966  1.00 88.91  ? 28  CYS A CB  1 
ATOM   232  S SG  . CYS A 1 28  ? 49.696  4.506   23.494  1.00 104.38 ? 28  CYS A SG  1 
ATOM   233  N N   . ASP A 1 29  ? 50.172  6.531   26.278  1.00 110.40 ? 29  ASP A N   1 
ATOM   234  C CA  . ASP A 1 29  ? 50.876  6.319   27.535  1.00 112.66 ? 29  ASP A CA  1 
ATOM   235  C C   . ASP A 1 29  ? 51.862  5.163   27.400  1.00 107.50 ? 29  ASP A C   1 
ATOM   236  O O   . ASP A 1 29  ? 51.702  4.126   28.040  1.00 107.08 ? 29  ASP A O   1 
ATOM   237  C CB  . ASP A 1 29  ? 49.863  6.024   28.644  1.00 114.20 ? 29  ASP A CB  1 
ATOM   238  C CG  . ASP A 1 29  ? 50.438  6.214   30.026  1.00 119.59 ? 29  ASP A CG  1 
ATOM   239  O OD1 . ASP A 1 29  ? 51.633  6.564   30.122  1.00 126.24 ? 29  ASP A OD1 1 
ATOM   240  O OD2 . ASP A 1 29  ? 49.694  6.015   31.012  1.00 117.47 ? 29  ASP A OD2 1 
ATOM   241  N N   . THR A 1 30  ? 52.876  5.342   26.559  1.00 102.95 ? 30  THR A N   1 
ATOM   242  C CA  . THR A 1 30  ? 53.841  4.280   26.294  1.00 100.66 ? 30  THR A CA  1 
ATOM   243  C C   . THR A 1 30  ? 55.254  4.810   26.086  1.00 106.17 ? 30  THR A C   1 
ATOM   244  O O   . THR A 1 30  ? 55.441  5.950   25.663  1.00 98.12  ? 30  THR A O   1 
ATOM   245  C CB  . THR A 1 30  ? 53.445  3.456   25.059  1.00 99.25  ? 30  THR A CB  1 
ATOM   246  O OG1 . THR A 1 30  ? 54.540  2.614   24.678  1.00 103.25 ? 30  THR A OG1 1 
ATOM   247  C CG2 . THR A 1 30  ? 53.096  4.372   23.898  1.00 95.51  ? 30  THR A CG2 1 
ATOM   248  N N   . PRO A 1 31  ? 56.257  3.975   26.398  1.00 128.38 ? 31  PRO A N   1 
ATOM   249  C CA  . PRO A 1 31  ? 57.674  4.290   26.197  1.00 136.27 ? 31  PRO A CA  1 
ATOM   250  C C   . PRO A 1 31  ? 58.076  4.179   24.731  1.00 139.24 ? 31  PRO A C   1 
ATOM   251  O O   . PRO A 1 31  ? 58.659  5.111   24.181  1.00 138.70 ? 31  PRO A O   1 
ATOM   252  C CB  . PRO A 1 31  ? 58.397  3.206   27.011  1.00 141.74 ? 31  PRO A CB  1 
ATOM   253  C CG  . PRO A 1 31  ? 57.355  2.605   27.901  1.00 141.06 ? 31  PRO A CG  1 
ATOM   254  C CD  . PRO A 1 31  ? 56.079  2.716   27.138  1.00 137.37 ? 31  PRO A CD  1 
ATOM   255  N N   . GLU A 1 32  ? 57.768  3.043   24.112  1.00 143.80 ? 32  GLU A N   1 
ATOM   256  C CA  . GLU A 1 32  ? 58.149  2.806   22.724  1.00 149.80 ? 32  GLU A CA  1 
ATOM   257  C C   . GLU A 1 32  ? 57.194  3.484   21.756  1.00 138.77 ? 32  GLU A C   1 
ATOM   258  O O   . GLU A 1 32  ? 55.993  3.569   22.007  1.00 133.03 ? 32  GLU A O   1 
ATOM   259  C CB  . GLU A 1 32  ? 58.256  1.309   22.424  1.00 160.16 ? 32  GLU A CB  1 
ATOM   260  C CG  . GLU A 1 32  ? 57.052  0.490   22.838  1.00 164.17 ? 32  GLU A CG  1 
ATOM   261  C CD  . GLU A 1 32  ? 57.309  -0.997  22.709  1.00 172.68 ? 32  GLU A CD  1 
ATOM   262  O OE1 . GLU A 1 32  ? 58.300  -1.369  22.046  1.00 176.20 ? 32  GLU A OE1 1 
ATOM   263  O OE2 . GLU A 1 32  ? 56.529  -1.795  23.270  1.00 174.97 ? 32  GLU A OE2 1 
ATOM   264  N N   . GLU A 1 33  ? 57.741  3.961   20.645  1.00 138.80 ? 33  GLU A N   1 
ATOM   265  C CA  . GLU A 1 33  ? 56.992  4.804   19.726  1.00 142.88 ? 33  GLU A CA  1 
ATOM   266  C C   . GLU A 1 33  ? 56.915  4.184   18.336  1.00 141.92 ? 33  GLU A C   1 
ATOM   267  O O   . GLU A 1 33  ? 56.674  4.876   17.346  1.00 142.07 ? 33  GLU A O   1 
ATOM   268  C CB  . GLU A 1 33  ? 57.637  6.190   19.668  1.00 148.21 ? 33  GLU A CB  1 
ATOM   269  C CG  . GLU A 1 33  ? 57.896  6.788   21.049  1.00 149.50 ? 33  GLU A CG  1 
ATOM   270  C CD  . GLU A 1 33  ? 58.742  8.044   21.007  1.00 150.14 ? 33  GLU A CD  1 
ATOM   271  O OE1 . GLU A 1 33  ? 59.453  8.250   20.000  1.00 153.66 ? 33  GLU A OE1 1 
ATOM   272  O OE2 . GLU A 1 33  ? 58.701  8.821   21.986  1.00 148.12 ? 33  GLU A OE2 1 
ATOM   273  N N   . ASP A 1 34  ? 57.105  2.870   18.275  1.00 136.75 ? 34  ASP A N   1 
ATOM   274  C CA  . ASP A 1 34  ? 57.132  2.152   17.007  1.00 127.53 ? 34  ASP A CA  1 
ATOM   275  C C   . ASP A 1 34  ? 55.731  1.875   16.465  1.00 113.44 ? 34  ASP A C   1 
ATOM   276  O O   . ASP A 1 34  ? 54.868  2.749   16.491  1.00 111.74 ? 34  ASP A O   1 
ATOM   277  C CB  . ASP A 1 34  ? 57.923  0.849   17.149  1.00 141.03 ? 34  ASP A CB  1 
ATOM   278  C CG  . ASP A 1 34  ? 59.305  1.063   17.752  1.00 153.68 ? 34  ASP A CG  1 
ATOM   279  O OD1 . ASP A 1 34  ? 60.306  0.784   17.058  1.00 155.74 ? 34  ASP A OD1 1 
ATOM   280  O OD2 . ASP A 1 34  ? 59.393  1.513   18.916  1.00 154.50 ? 34  ASP A OD2 1 
ATOM   281  N N   . GLY A 1 35  ? 55.513  0.652   15.988  1.00 109.44 ? 35  GLY A N   1 
ATOM   282  C CA  . GLY A 1 35  ? 54.303  0.302   15.260  1.00 106.26 ? 35  GLY A CA  1 
ATOM   283  C C   . GLY A 1 35  ? 53.006  0.188   16.044  1.00 100.77 ? 35  GLY A C   1 
ATOM   284  O O   . GLY A 1 35  ? 52.469  -0.907  16.223  1.00 93.21  ? 35  GLY A O   1 
ATOM   285  N N   . ILE A 1 36  ? 52.486  1.322   16.497  1.00 101.23 ? 36  ILE A N   1 
ATOM   286  C CA  . ILE A 1 36  ? 51.212  1.343   17.203  1.00 100.22 ? 36  ILE A CA  1 
ATOM   287  C C   . ILE A 1 36  ? 50.102  1.861   16.294  1.00 95.97  ? 36  ILE A C   1 
ATOM   288  O O   . ILE A 1 36  ? 50.366  2.513   15.285  1.00 95.81  ? 36  ILE A O   1 
ATOM   289  C CB  . ILE A 1 36  ? 51.276  2.227   18.454  1.00 104.66 ? 36  ILE A CB  1 
ATOM   290  C CG1 . ILE A 1 36  ? 51.195  3.695   18.057  1.00 111.36 ? 36  ILE A CG1 1 
ATOM   291  C CG2 . ILE A 1 36  ? 52.555  1.958   19.232  1.00 108.21 ? 36  ILE A CG2 1 
ATOM   292  C CD1 . ILE A 1 36  ? 52.323  4.115   17.158  1.00 120.36 ? 36  ILE A CD1 1 
ATOM   293  N N   . THR A 1 37  ? 48.860  1.565   16.663  1.00 85.53  ? 37  THR A N   1 
ATOM   294  C CA  . THR A 1 37  ? 47.699  1.952   15.876  1.00 70.57  ? 37  THR A CA  1 
ATOM   295  C C   . THR A 1 37  ? 46.550  2.336   16.803  1.00 75.12  ? 37  THR A C   1 
ATOM   296  O O   . THR A 1 37  ? 46.512  1.918   17.957  1.00 79.64  ? 37  THR A O   1 
ATOM   297  C CB  . THR A 1 37  ? 47.249  0.804   14.959  1.00 75.27  ? 37  THR A CB  1 
ATOM   298  O OG1 . THR A 1 37  ? 46.934  -0.349  15.747  1.00 72.13  ? 37  THR A OG1 1 
ATOM   299  C CG2 . THR A 1 37  ? 48.354  0.441   13.982  1.00 90.81  ? 37  THR A CG2 1 
ATOM   300  N N   . TRP A 1 38  ? 45.611  3.127   16.298  1.00 73.19  ? 38  TRP A N   1 
ATOM   301  C CA  . TRP A 1 38  ? 44.523  3.633   17.130  1.00 70.86  ? 38  TRP A CA  1 
ATOM   302  C C   . TRP A 1 38  ? 43.155  3.087   16.731  1.00 68.52  ? 38  TRP A C   1 
ATOM   303  O O   . TRP A 1 38  ? 42.966  2.615   15.613  1.00 70.23  ? 38  TRP A O   1 
ATOM   304  C CB  . TRP A 1 38  ? 44.513  5.165   17.119  1.00 74.97  ? 38  TRP A CB  1 
ATOM   305  C CG  . TRP A 1 38  ? 45.710  5.765   17.784  1.00 71.97  ? 38  TRP A CG  1 
ATOM   306  C CD1 . TRP A 1 38  ? 46.985  5.815   17.292  1.00 74.45  ? 38  TRP A CD1 1 
ATOM   307  C CD2 . TRP A 1 38  ? 45.753  6.393   19.073  1.00 80.02  ? 38  TRP A CD2 1 
ATOM   308  N NE1 . TRP A 1 38  ? 47.816  6.438   18.192  1.00 84.85  ? 38  TRP A NE1 1 
ATOM   309  C CE2 . TRP A 1 38  ? 47.086  6.801   19.294  1.00 85.78  ? 38  TRP A CE2 1 
ATOM   310  C CE3 . TRP A 1 38  ? 44.798  6.648   20.061  1.00 77.64  ? 38  TRP A CE3 1 
ATOM   311  C CZ2 . TRP A 1 38  ? 47.484  7.452   20.463  1.00 81.92  ? 38  TRP A CZ2 1 
ATOM   312  C CZ3 . TRP A 1 38  ? 45.196  7.294   21.218  1.00 76.78  ? 38  TRP A CZ3 1 
ATOM   313  C CH2 . TRP A 1 38  ? 46.526  7.689   21.409  1.00 75.96  ? 38  TRP A CH2 1 
ATOM   314  N N   . THR A 1 39  ? 42.208  3.161   17.659  1.00 63.32  ? 39  THR A N   1 
ATOM   315  C CA  . THR A 1 39  ? 40.877  2.613   17.461  1.00 61.49  ? 39  THR A CA  1 
ATOM   316  C C   . THR A 1 39  ? 39.918  3.467   18.282  1.00 58.81  ? 39  THR A C   1 
ATOM   317  O O   . THR A 1 39  ? 40.360  4.317   19.044  1.00 68.59  ? 39  THR A O   1 
ATOM   318  C CB  . THR A 1 39  ? 40.834  1.140   17.924  1.00 70.99  ? 39  THR A CB  1 
ATOM   319  O OG1 . THR A 1 39  ? 39.906  0.401   17.121  1.00 70.80  ? 39  THR A OG1 1 
ATOM   320  C CG2 . THR A 1 39  ? 40.454  1.042   19.400  1.00 64.39  ? 39  THR A CG2 1 
ATOM   321  N N   . LEU A 1 40  ? 38.615  3.265   18.126  1.00 57.32  ? 40  LEU A N   1 
ATOM   322  C CA  . LEU A 1 40  ? 37.632  4.032   18.898  1.00 61.09  ? 40  LEU A CA  1 
ATOM   323  C C   . LEU A 1 40  ? 36.489  3.150   19.373  1.00 59.91  ? 40  LEU A C   1 
ATOM   324  O O   . LEU A 1 40  ? 35.931  2.396   18.588  1.00 59.41  ? 40  LEU A O   1 
ATOM   325  C CB  . LEU A 1 40  ? 37.053  5.175   18.061  1.00 65.38  ? 40  LEU A CB  1 
ATOM   326  C CG  . LEU A 1 40  ? 35.981  5.999   18.786  1.00 63.70  ? 40  LEU A CG  1 
ATOM   327  C CD1 . LEU A 1 40  ? 36.639  7.024   19.696  1.00 66.30  ? 40  LEU A CD1 1 
ATOM   328  C CD2 . LEU A 1 40  ? 35.034  6.679   17.810  1.00 47.76  ? 40  LEU A CD2 1 
ATOM   329  N N   . ASP A 1 41  ? 36.127  3.261   20.646  1.00 57.22  ? 41  ASP A N   1 
ATOM   330  C CA  . ASP A 1 41  ? 35.101  2.398   21.208  1.00 62.74  ? 41  ASP A CA  1 
ATOM   331  C C   . ASP A 1 41  ? 35.402  0.941   20.886  1.00 66.68  ? 41  ASP A C   1 
ATOM   332  O O   . ASP A 1 41  ? 36.520  0.472   21.098  1.00 69.72  ? 41  ASP A O   1 
ATOM   333  C CB  . ASP A 1 41  ? 33.716  2.765   20.682  1.00 66.15  ? 41  ASP A CB  1 
ATOM   334  C CG  . ASP A 1 41  ? 33.219  4.089   21.225  1.00 88.95  ? 41  ASP A CG  1 
ATOM   335  O OD1 . ASP A 1 41  ? 33.631  4.470   22.346  1.00 92.92  ? 41  ASP A OD1 1 
ATOM   336  O OD2 . ASP A 1 41  ? 32.408  4.753   20.537  1.00 98.79  ? 41  ASP A OD2 1 
ATOM   337  N N   . GLN A 1 42  ? 34.408  0.234   20.354  1.00 57.92  ? 42  GLN A N   1 
ATOM   338  C CA  . GLN A 1 42  ? 34.530  -1.205  20.136  1.00 70.42  ? 42  GLN A CA  1 
ATOM   339  C C   . GLN A 1 42  ? 34.878  -1.590  18.703  1.00 79.30  ? 42  GLN A C   1 
ATOM   340  O O   . GLN A 1 42  ? 35.021  -2.774  18.385  1.00 87.37  ? 42  GLN A O   1 
ATOM   341  C CB  . GLN A 1 42  ? 33.261  -1.924  20.597  1.00 88.89  ? 42  GLN A CB  1 
ATOM   342  C CG  . GLN A 1 42  ? 32.002  -1.083  20.515  1.00 98.53  ? 42  GLN A CG  1 
ATOM   343  C CD  . GLN A 1 42  ? 31.362  -1.129  19.150  1.00 106.39 ? 42  GLN A CD  1 
ATOM   344  O OE1 . GLN A 1 42  ? 30.522  -0.294  18.817  1.00 113.09 ? 42  GLN A OE1 1 
ATOM   345  N NE2 . GLN A 1 42  ? 31.753  -2.111  18.347  1.00 108.51 ? 42  GLN A NE2 1 
ATOM   346  N N   . SER A 1 43  ? 35.014  -0.586  17.844  1.00 78.83  ? 43  SER A N   1 
ATOM   347  C CA  . SER A 1 43  ? 35.384  -0.803  16.449  1.00 71.11  ? 43  SER A CA  1 
ATOM   348  C C   . SER A 1 43  ? 36.836  -1.263  16.350  1.00 69.85  ? 43  SER A C   1 
ATOM   349  O O   . SER A 1 43  ? 37.664  -0.874  17.169  1.00 67.33  ? 43  SER A O   1 
ATOM   350  C CB  . SER A 1 43  ? 35.179  0.486   15.653  1.00 68.41  ? 43  SER A CB  1 
ATOM   351  O OG  . SER A 1 43  ? 35.565  0.333   14.302  1.00 78.11  ? 43  SER A OG  1 
ATOM   352  N N   . SER A 1 44  ? 37.142  -2.089  15.349  1.00 71.40  ? 44  SER A N   1 
ATOM   353  C CA  . SER A 1 44  ? 38.495  -2.622  15.179  1.00 67.47  ? 44  SER A CA  1 
ATOM   354  C C   . SER A 1 44  ? 39.277  -1.809  14.167  1.00 70.81  ? 44  SER A C   1 
ATOM   355  O O   . SER A 1 44  ? 40.462  -2.053  13.947  1.00 66.30  ? 44  SER A O   1 
ATOM   356  C CB  . SER A 1 44  ? 38.449  -4.067  14.686  1.00 71.87  ? 44  SER A CB  1 
ATOM   357  O OG  . SER A 1 44  ? 37.211  -4.674  14.996  1.00 83.56  ? 44  SER A OG  1 
ATOM   358  N N   . GLU A 1 45  ? 38.606  -0.845  13.548  1.00 70.28  ? 45  GLU A N   1 
ATOM   359  C CA  . GLU A 1 45  ? 39.180  -0.114  12.429  1.00 66.10  ? 45  GLU A CA  1 
ATOM   360  C C   . GLU A 1 45  ? 40.211  0.921   12.850  1.00 71.05  ? 45  GLU A C   1 
ATOM   361  O O   . GLU A 1 45  ? 39.931  1.806   13.655  1.00 87.17  ? 45  GLU A O   1 
ATOM   362  C CB  . GLU A 1 45  ? 38.076  0.550   11.608  1.00 69.94  ? 45  GLU A CB  1 
ATOM   363  C CG  . GLU A 1 45  ? 36.976  -0.402  11.179  1.00 75.12  ? 45  GLU A CG  1 
ATOM   364  C CD  . GLU A 1 45  ? 36.082  0.188   10.110  1.00 77.13  ? 45  GLU A CD  1 
ATOM   365  O OE1 . GLU A 1 45  ? 36.575  1.023   9.318   1.00 74.24  ? 45  GLU A OE1 1 
ATOM   366  O OE2 . GLU A 1 45  ? 34.892  -0.192  10.060  1.00 83.07  ? 45  GLU A OE2 1 
ATOM   367  N N   . VAL A 1 46  ? 41.406  0.797   12.285  1.00 63.60  ? 46  VAL A N   1 
ATOM   368  C CA  . VAL A 1 46  ? 42.481  1.758   12.495  1.00 68.21  ? 46  VAL A CA  1 
ATOM   369  C C   . VAL A 1 46  ? 42.075  3.179   12.114  1.00 69.99  ? 46  VAL A C   1 
ATOM   370  O O   . VAL A 1 46  ? 41.538  3.417   11.025  1.00 67.25  ? 46  VAL A O   1 
ATOM   371  C CB  . VAL A 1 46  ? 43.739  1.373   11.682  1.00 69.72  ? 46  VAL A CB  1 
ATOM   372  C CG1 . VAL A 1 46  ? 44.541  2.614   11.309  1.00 64.90  ? 46  VAL A CG1 1 
ATOM   373  C CG2 . VAL A 1 46  ? 44.600  0.397   12.463  1.00 67.04  ? 46  VAL A CG2 1 
ATOM   374  N N   . LEU A 1 47  ? 42.351  4.119   13.013  1.00 65.44  ? 47  LEU A N   1 
ATOM   375  C CA  . LEU A 1 47  ? 42.095  5.522   12.747  1.00 61.97  ? 47  LEU A CA  1 
ATOM   376  C C   . LEU A 1 47  ? 43.363  6.204   12.272  1.00 66.54  ? 47  LEU A C   1 
ATOM   377  O O   . LEU A 1 47  ? 43.321  7.212   11.569  1.00 70.07  ? 47  LEU A O   1 
ATOM   378  C CB  . LEU A 1 47  ? 41.588  6.208   14.008  1.00 62.11  ? 47  LEU A CB  1 
ATOM   379  C CG  . LEU A 1 47  ? 40.334  5.593   14.614  1.00 62.52  ? 47  LEU A CG  1 
ATOM   380  C CD1 . LEU A 1 47  ? 39.695  6.577   15.558  1.00 48.53  ? 47  LEU A CD1 1 
ATOM   381  C CD2 . LEU A 1 47  ? 39.370  5.204   13.513  1.00 67.83  ? 47  LEU A CD2 1 
ATOM   382  N N   . GLY A 1 48  ? 44.497  5.648   12.669  1.00 69.22  ? 48  GLY A N   1 
ATOM   383  C CA  . GLY A 1 48  ? 45.778  6.242   12.345  1.00 82.43  ? 48  GLY A CA  1 
ATOM   384  C C   . GLY A 1 48  ? 46.915  5.583   13.101  1.00 81.47  ? 48  GLY A C   1 
ATOM   385  O O   . GLY A 1 48  ? 46.706  4.640   13.863  1.00 76.13  ? 48  GLY A O   1 
ATOM   386  N N   . SER A 1 49  ? 48.127  6.080   12.889  1.00 80.89  ? 49  SER A N   1 
ATOM   387  C CA  . SER A 1 49  ? 49.291  5.467   13.497  1.00 85.62  ? 49  SER A CA  1 
ATOM   388  C C   . SER A 1 49  ? 50.222  6.513   14.082  1.00 98.75  ? 49  SER A C   1 
ATOM   389  O O   . SER A 1 49  ? 50.111  7.699   13.775  1.00 101.80 ? 49  SER A O   1 
ATOM   390  C CB  . SER A 1 49  ? 50.028  4.605   12.477  1.00 89.65  ? 49  SER A CB  1 
ATOM   391  O OG  . SER A 1 49  ? 49.161  3.624   11.924  1.00 88.60  ? 49  SER A OG  1 
ATOM   392  N N   . GLY A 1 50  ? 51.139  6.064   14.932  1.00 105.02 ? 50  GLY A N   1 
ATOM   393  C CA  . GLY A 1 50  ? 52.034  6.963   15.636  1.00 105.64 ? 50  GLY A CA  1 
ATOM   394  C C   . GLY A 1 50  ? 51.696  7.023   17.113  1.00 100.89 ? 50  GLY A C   1 
ATOM   395  O O   . GLY A 1 50  ? 50.544  6.829   17.508  1.00 97.96  ? 50  GLY A O   1 
ATOM   396  N N   . LYS A 1 51  ? 52.706  7.270   17.937  1.00 100.13 ? 51  LYS A N   1 
ATOM   397  C CA  . LYS A 1 51  ? 52.489  7.415   19.366  1.00 97.25  ? 51  LYS A CA  1 
ATOM   398  C C   . LYS A 1 51  ? 51.485  8.535   19.590  1.00 97.92  ? 51  LYS A C   1 
ATOM   399  O O   . LYS A 1 51  ? 50.862  8.625   20.645  1.00 104.98 ? 51  LYS A O   1 
ATOM   400  C CB  . LYS A 1 51  ? 53.809  7.731   20.070  1.00 91.34  ? 51  LYS A CB  1 
ATOM   401  C CG  . LYS A 1 51  ? 53.754  7.669   21.583  1.00 81.65  ? 51  LYS A CG  1 
ATOM   402  C CD  . LYS A 1 51  ? 55.073  8.120   22.183  1.00 81.30  ? 51  LYS A CD  1 
ATOM   403  C CE  . LYS A 1 51  ? 54.979  8.286   23.690  1.00 86.55  ? 51  LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 51  ? 56.305  8.599   24.291  1.00 92.43  ? 51  LYS A NZ  1 
ATOM   405  N N   . THR A 1 52  ? 51.328  9.384   18.580  1.00 93.27  ? 52  THR A N   1 
ATOM   406  C CA  . THR A 1 52  ? 50.415  10.510  18.674  1.00 96.07  ? 52  THR A CA  1 
ATOM   407  C C   . THR A 1 52  ? 49.329  10.446  17.603  1.00 91.62  ? 52  THR A C   1 
ATOM   408  O O   . THR A 1 52  ? 49.599  10.105  16.454  1.00 97.14  ? 52  THR A O   1 
ATOM   409  C CB  . THR A 1 52  ? 51.173  11.852  18.571  1.00 102.90 ? 52  THR A CB  1 
ATOM   410  O OG1 . THR A 1 52  ? 50.432  12.873  19.250  1.00 103.32 ? 52  THR A OG1 1 
ATOM   411  C CG2 . THR A 1 52  ? 51.392  12.250  17.108  1.00 103.29 ? 52  THR A CG2 1 
ATOM   412  N N   . LEU A 1 53  ? 48.098  10.765  17.993  1.00 88.32  ? 53  LEU A N   1 
ATOM   413  C CA  . LEU A 1 53  ? 46.980  10.817  17.056  1.00 87.85  ? 53  LEU A CA  1 
ATOM   414  C C   . LEU A 1 53  ? 46.263  12.162  17.099  1.00 87.81  ? 53  LEU A C   1 
ATOM   415  O O   . LEU A 1 53  ? 45.598  12.493  18.080  1.00 84.66  ? 53  LEU A O   1 
ATOM   416  C CB  . LEU A 1 53  ? 45.980  9.692   17.330  1.00 71.03  ? 53  LEU A CB  1 
ATOM   417  C CG  . LEU A 1 53  ? 44.816  9.657   16.346  1.00 62.47  ? 53  LEU A CG  1 
ATOM   418  C CD1 . LEU A 1 53  ? 45.330  9.299   14.968  1.00 69.91  ? 53  LEU A CD1 1 
ATOM   419  C CD2 . LEU A 1 53  ? 43.755  8.677   16.779  1.00 59.21  ? 53  LEU A CD2 1 
ATOM   420  N N   . THR A 1 54  ? 46.397  12.932  16.025  1.00 86.83  ? 54  THR A N   1 
ATOM   421  C CA  . THR A 1 54  ? 45.710  14.210  15.919  1.00 79.89  ? 54  THR A CA  1 
ATOM   422  C C   . THR A 1 54  ? 44.330  13.997  15.315  1.00 75.80  ? 54  THR A C   1 
ATOM   423  O O   . THR A 1 54  ? 44.200  13.327  14.291  1.00 85.11  ? 54  THR A O   1 
ATOM   424  C CB  . THR A 1 54  ? 46.490  15.191  15.025  1.00 74.90  ? 54  THR A CB  1 
ATOM   425  O OG1 . THR A 1 54  ? 47.877  15.181  15.389  1.00 74.53  ? 54  THR A OG1 1 
ATOM   426  C CG2 . THR A 1 54  ? 45.933  16.593  15.172  1.00 71.52  ? 54  THR A CG2 1 
ATOM   427  N N   . ILE A 1 55  ? 43.303  14.551  15.953  1.00 66.82  ? 55  ILE A N   1 
ATOM   428  C CA  . ILE A 1 55  ? 41.929  14.409  15.475  1.00 61.32  ? 55  ILE A CA  1 
ATOM   429  C C   . ILE A 1 55  ? 41.187  15.730  15.610  1.00 65.44  ? 55  ILE A C   1 
ATOM   430  O O   . ILE A 1 55  ? 41.715  16.689  16.162  1.00 70.26  ? 55  ILE A O   1 
ATOM   431  C CB  . ILE A 1 55  ? 41.150  13.353  16.276  1.00 52.26  ? 55  ILE A CB  1 
ATOM   432  C CG1 . ILE A 1 55  ? 40.856  13.876  17.680  1.00 59.36  ? 55  ILE A CG1 1 
ATOM   433  C CG2 . ILE A 1 55  ? 41.918  12.054  16.340  1.00 51.98  ? 55  ILE A CG2 1 
ATOM   434  C CD1 . ILE A 1 55  ? 40.026  12.959  18.520  1.00 60.19  ? 55  ILE A CD1 1 
ATOM   435  N N   . GLN A 1 56  ? 39.964  15.776  15.094  1.00 55.95  ? 56  GLN A N   1 
ATOM   436  C CA  . GLN A 1 56  ? 39.076  16.906  15.323  1.00 61.21  ? 56  GLN A CA  1 
ATOM   437  C C   . GLN A 1 56  ? 37.872  16.445  16.116  1.00 65.12  ? 56  GLN A C   1 
ATOM   438  O O   . GLN A 1 56  ? 37.340  15.368  15.880  1.00 63.71  ? 56  GLN A O   1 
ATOM   439  C CB  . GLN A 1 56  ? 38.601  17.536  14.016  1.00 55.80  ? 56  GLN A CB  1 
ATOM   440  C CG  . GLN A 1 56  ? 37.185  18.092  14.115  1.00 70.39  ? 56  GLN A CG  1 
ATOM   441  C CD  . GLN A 1 56  ? 36.842  19.078  13.019  1.00 78.32  ? 56  GLN A CD  1 
ATOM   442  O OE1 . GLN A 1 56  ? 35.697  19.522  12.901  1.00 78.92  ? 56  GLN A OE1 1 
ATOM   443  N NE2 . GLN A 1 56  ? 37.832  19.433  12.213  1.00 89.32  ? 56  GLN A NE2 1 
ATOM   444  N N   . VAL A 1 57  ? 37.437  17.274  17.056  1.00 68.45  ? 57  VAL A N   1 
ATOM   445  C CA  . VAL A 1 57  ? 36.271  16.947  17.864  1.00 63.06  ? 57  VAL A CA  1 
ATOM   446  C C   . VAL A 1 57  ? 35.156  17.960  17.667  1.00 61.97  ? 57  VAL A C   1 
ATOM   447  O O   . VAL A 1 57  ? 35.258  19.093  18.126  1.00 69.32  ? 57  VAL A O   1 
ATOM   448  C CB  . VAL A 1 57  ? 36.631  16.862  19.345  1.00 58.33  ? 57  VAL A CB  1 
ATOM   449  C CG1 . VAL A 1 57  ? 35.443  16.359  20.141  1.00 60.90  ? 57  VAL A CG1 1 
ATOM   450  C CG2 . VAL A 1 57  ? 37.814  15.945  19.523  1.00 57.38  ? 57  VAL A CG2 1 
ATOM   451  N N   . LYS A 1 58  ? 34.094  17.539  16.983  1.00 59.68  ? 58  LYS A N   1 
ATOM   452  C CA  . LYS A 1 58  ? 32.976  18.420  16.662  1.00 68.48  ? 58  LYS A CA  1 
ATOM   453  C C   . LYS A 1 58  ? 31.643  17.842  17.150  1.00 66.77  ? 58  LYS A C   1 
ATOM   454  O O   . LYS A 1 58  ? 30.733  18.590  17.507  1.00 67.49  ? 58  LYS A O   1 
ATOM   455  C CB  . LYS A 1 58  ? 32.929  18.683  15.152  1.00 56.73  ? 58  LYS A CB  1 
ATOM   456  C CG  . LYS A 1 58  ? 31.763  19.553  14.680  1.00 86.41  ? 58  LYS A CG  1 
ATOM   457  C CD  . LYS A 1 58  ? 32.151  21.022  14.534  1.00 84.79  ? 58  LYS A CD  1 
ATOM   458  C CE  . LYS A 1 58  ? 31.626  21.872  15.685  1.00 89.94  ? 58  LYS A CE  1 
ATOM   459  N NZ  . LYS A 1 58  ? 30.193  22.242  15.499  1.00 91.45  ? 58  LYS A NZ  1 
ATOM   460  N N   . GLU A 1 59  ? 31.533  16.515  17.172  1.00 60.67  ? 59  GLU A N   1 
ATOM   461  C CA  . GLU A 1 59  ? 30.283  15.864  17.553  1.00 63.64  ? 59  GLU A CA  1 
ATOM   462  C C   . GLU A 1 59  ? 30.489  14.703  18.531  1.00 62.18  ? 59  GLU A C   1 
ATOM   463  O O   . GLU A 1 59  ? 31.604  14.222  18.701  1.00 55.09  ? 59  GLU A O   1 
ATOM   464  C CB  . GLU A 1 59  ? 29.551  15.374  16.301  1.00 68.78  ? 59  GLU A CB  1 
ATOM   465  C CG  . GLU A 1 59  ? 29.202  16.477  15.329  1.00 64.75  ? 59  GLU A CG  1 
ATOM   466  C CD  . GLU A 1 59  ? 28.241  17.460  15.926  1.00 67.88  ? 59  GLU A CD  1 
ATOM   467  O OE1 . GLU A 1 59  ? 27.670  17.143  16.991  1.00 74.73  ? 59  GLU A OE1 1 
ATOM   468  O OE2 . GLU A 1 59  ? 28.056  18.543  15.338  1.00 71.15  ? 59  GLU A OE2 1 
ATOM   469  N N   . PHE A 1 60  ? 29.410  14.252  19.171  1.00 67.05  ? 60  PHE A N   1 
ATOM   470  C CA  . PHE A 1 60  ? 29.476  13.077  20.053  1.00 64.31  ? 60  PHE A CA  1 
ATOM   471  C C   . PHE A 1 60  ? 29.981  11.841  19.311  1.00 57.87  ? 60  PHE A C   1 
ATOM   472  O O   . PHE A 1 60  ? 30.343  10.848  19.925  1.00 61.49  ? 60  PHE A O   1 
ATOM   473  C CB  . PHE A 1 60  ? 28.118  12.774  20.693  1.00 63.23  ? 60  PHE A CB  1 
ATOM   474  C CG  . PHE A 1 60  ? 27.806  13.627  21.891  1.00 68.76  ? 60  PHE A CG  1 
ATOM   475  C CD1 . PHE A 1 60  ? 26.629  14.360  21.949  1.00 76.86  ? 60  PHE A CD1 1 
ATOM   476  C CD2 . PHE A 1 60  ? 28.690  13.699  22.963  1.00 75.14  ? 60  PHE A CD2 1 
ATOM   477  C CE1 . PHE A 1 60  ? 26.335  15.151  23.055  1.00 80.74  ? 60  PHE A CE1 1 
ATOM   478  C CE2 . PHE A 1 60  ? 28.401  14.490  24.072  1.00 79.38  ? 60  PHE A CE2 1 
ATOM   479  C CZ  . PHE A 1 60  ? 27.226  15.215  24.116  1.00 81.48  ? 60  PHE A CZ  1 
ATOM   480  N N   . GLY A 1 61  ? 29.990  11.903  17.986  1.00 60.37  ? 61  GLY A N   1 
ATOM   481  C CA  . GLY A 1 61  ? 30.534  10.827  17.180  1.00 60.57  ? 61  GLY A CA  1 
ATOM   482  C C   . GLY A 1 61  ? 32.047  10.766  17.269  1.00 65.86  ? 61  GLY A C   1 
ATOM   483  O O   . GLY A 1 61  ? 32.658  9.772   16.878  1.00 72.06  ? 61  GLY A O   1 
ATOM   484  N N   . ASP A 1 62  ? 32.650  11.835  17.782  1.00 59.96  ? 62  ASP A N   1 
ATOM   485  C CA  . ASP A 1 62  ? 34.102  11.919  17.933  1.00 63.32  ? 62  ASP A CA  1 
ATOM   486  C C   . ASP A 1 62  ? 34.529  11.592  19.351  1.00 70.11  ? 62  ASP A C   1 
ATOM   487  O O   . ASP A 1 62  ? 35.724  11.538  19.651  1.00 68.55  ? 62  ASP A O   1 
ATOM   488  C CB  . ASP A 1 62  ? 34.593  13.330  17.607  1.00 68.82  ? 62  ASP A CB  1 
ATOM   489  C CG  . ASP A 1 62  ? 34.229  13.764  16.210  1.00 77.96  ? 62  ASP A CG  1 
ATOM   490  O OD1 . ASP A 1 62  ? 34.339  12.928  15.287  1.00 76.73  ? 62  ASP A OD1 1 
ATOM   491  O OD2 . ASP A 1 62  ? 33.842  14.941  16.045  1.00 75.28  ? 62  ASP A OD2 1 
ATOM   492  N N   . ALA A 1 63  ? 33.551  11.399  20.229  1.00 68.54  ? 63  ALA A N   1 
ATOM   493  C CA  . ALA A 1 63  ? 33.838  11.152  21.633  1.00 71.23  ? 63  ALA A CA  1 
ATOM   494  C C   . ALA A 1 63  ? 33.929  9.658   21.886  1.00 79.96  ? 63  ALA A C   1 
ATOM   495  O O   . ALA A 1 63  ? 33.794  8.851   20.956  1.00 78.81  ? 63  ALA A O   1 
ATOM   496  C CB  . ALA A 1 63  ? 32.772  11.773  22.502  1.00 72.11  ? 63  ALA A CB  1 
ATOM   497  N N   . GLY A 1 64  ? 34.150  9.286   23.142  1.00 75.78  ? 64  GLY A N   1 
ATOM   498  C CA  . GLY A 1 64  ? 34.291  7.886   23.475  1.00 72.56  ? 64  GLY A CA  1 
ATOM   499  C C   . GLY A 1 64  ? 35.741  7.552   23.708  1.00 66.62  ? 64  GLY A C   1 
ATOM   500  O O   . GLY A 1 64  ? 36.581  8.441   23.834  1.00 53.78  ? 64  GLY A O   1 
ATOM   501  N N   . GLN A 1 65  ? 36.050  6.264   23.762  1.00 51.41  ? 65  GLN A N   1 
ATOM   502  C CA  . GLN A 1 65  ? 37.384  5.881   24.182  1.00 66.70  ? 65  GLN A CA  1 
ATOM   503  C C   . GLN A 1 65  ? 38.282  5.498   23.035  1.00 63.83  ? 65  GLN A C   1 
ATOM   504  O O   . GLN A 1 65  ? 38.064  4.497   22.361  1.00 68.29  ? 65  GLN A O   1 
ATOM   505  C CB  . GLN A 1 65  ? 37.352  4.768   25.233  1.00 71.22  ? 65  GLN A CB  1 
ATOM   506  C CG  . GLN A 1 65  ? 36.684  3.482   24.810  1.00 65.60  ? 65  GLN A CG  1 
ATOM   507  C CD  . GLN A 1 65  ? 37.254  2.290   25.549  1.00 65.47  ? 65  GLN A CD  1 
ATOM   508  O OE1 . GLN A 1 65  ? 38.466  2.064   25.546  1.00 62.15  ? 65  GLN A OE1 1 
ATOM   509  N NE2 . GLN A 1 65  ? 36.385  1.525   26.193  1.00 66.72  ? 65  GLN A NE2 1 
ATOM   510  N N   . TYR A 1 66  ? 39.295  6.322   22.818  1.00 63.77  ? 66  TYR A N   1 
ATOM   511  C CA  . TYR A 1 66  ? 40.333  6.010   21.863  1.00 64.00  ? 66  TYR A CA  1 
ATOM   512  C C   . TYR A 1 66  ? 41.341  5.085   22.537  1.00 69.68  ? 66  TYR A C   1 
ATOM   513  O O   . TYR A 1 66  ? 41.784  5.351   23.650  1.00 71.04  ? 66  TYR A O   1 
ATOM   514  C CB  . TYR A 1 66  ? 41.004  7.296   21.385  1.00 61.89  ? 66  TYR A CB  1 
ATOM   515  C CG  . TYR A 1 66  ? 40.093  8.176   20.560  1.00 65.24  ? 66  TYR A CG  1 
ATOM   516  C CD1 . TYR A 1 66  ? 39.199  9.044   21.165  1.00 64.16  ? 66  TYR A CD1 1 
ATOM   517  C CD2 . TYR A 1 66  ? 40.123  8.131   19.169  1.00 79.70  ? 66  TYR A CD2 1 
ATOM   518  C CE1 . TYR A 1 66  ? 38.358  9.849   20.404  1.00 81.19  ? 66  TYR A CE1 1 
ATOM   519  C CE2 . TYR A 1 66  ? 39.289  8.931   18.400  1.00 75.48  ? 66  TYR A CE2 1 
ATOM   520  C CZ  . TYR A 1 66  ? 38.410  9.786   19.019  1.00 79.06  ? 66  TYR A CZ  1 
ATOM   521  O OH  . TYR A 1 66  ? 37.585  10.579  18.255  1.00 73.90  ? 66  TYR A OH  1 
ATOM   522  N N   . THR A 1 67  ? 41.689  3.991   21.867  1.00 67.91  ? 67  THR A N   1 
ATOM   523  C CA  . THR A 1 67  ? 42.628  3.020   22.413  1.00 66.58  ? 67  THR A CA  1 
ATOM   524  C C   . THR A 1 67  ? 43.776  2.793   21.439  1.00 75.59  ? 67  THR A C   1 
ATOM   525  O O   . THR A 1 67  ? 43.545  2.504   20.262  1.00 81.98  ? 67  THR A O   1 
ATOM   526  C CB  . THR A 1 67  ? 41.937  1.668   22.672  1.00 64.24  ? 67  THR A CB  1 
ATOM   527  O OG1 . THR A 1 67  ? 40.782  1.864   23.492  1.00 61.77  ? 67  THR A OG1 1 
ATOM   528  C CG2 . THR A 1 67  ? 42.883  0.711   23.356  1.00 56.10  ? 67  THR A CG2 1 
ATOM   529  N N   . CYS A 1 68  ? 45.008  2.930   21.921  1.00 71.21  ? 68  CYS A N   1 
ATOM   530  C CA  . CYS A 1 68  ? 46.183  2.633   21.106  1.00 73.89  ? 68  CYS A CA  1 
ATOM   531  C C   . CYS A 1 68  ? 46.653  1.196   21.338  1.00 76.95  ? 68  CYS A C   1 
ATOM   532  O O   . CYS A 1 68  ? 46.610  0.702   22.457  1.00 71.79  ? 68  CYS A O   1 
ATOM   533  C CB  . CYS A 1 68  ? 47.308  3.637   21.378  1.00 65.44  ? 68  CYS A CB  1 
ATOM   534  S SG  . CYS A 1 68  ? 47.825  3.795   23.100  1.00 98.80  ? 68  CYS A SG  1 
ATOM   535  N N   . HIS A 1 69  ? 47.090  0.529   20.273  1.00 81.57  ? 69  HIS A N   1 
ATOM   536  C CA  . HIS A 1 69  ? 47.463  -0.883  20.345  1.00 83.40  ? 69  HIS A CA  1 
ATOM   537  C C   . HIS A 1 69  ? 48.902  -1.118  19.907  1.00 88.56  ? 69  HIS A C   1 
ATOM   538  O O   . HIS A 1 69  ? 49.568  -0.214  19.411  1.00 92.34  ? 69  HIS A O   1 
ATOM   539  C CB  . HIS A 1 69  ? 46.553  -1.721  19.447  1.00 75.87  ? 69  HIS A CB  1 
ATOM   540  C CG  . HIS A 1 69  ? 45.095  -1.569  19.742  1.00 79.10  ? 69  HIS A CG  1 
ATOM   541  N ND1 . HIS A 1 69  ? 44.379  -0.444  19.394  1.00 79.16  ? 69  HIS A ND1 1 
ATOM   542  C CD2 . HIS A 1 69  ? 44.211  -2.412  20.323  1.00 85.81  ? 69  HIS A CD2 1 
ATOM   543  C CE1 . HIS A 1 69  ? 43.120  -0.594  19.763  1.00 79.25  ? 69  HIS A CE1 1 
ATOM   544  N NE2 . HIS A 1 69  ? 42.992  -1.781  20.331  1.00 84.07  ? 69  HIS A NE2 1 
ATOM   545  N N   . LYS A 1 70  ? 49.370  -2.348  20.084  1.00 85.84  ? 70  LYS A N   1 
ATOM   546  C CA  . LYS A 1 70  ? 50.649  -2.769  19.527  1.00 87.93  ? 70  LYS A CA  1 
ATOM   547  C C   . LYS A 1 70  ? 50.853  -4.269  19.687  1.00 95.40  ? 70  LYS A C   1 
ATOM   548  O O   . LYS A 1 70  ? 51.019  -4.767  20.799  1.00 88.30  ? 70  LYS A O   1 
ATOM   549  C CB  . LYS A 1 70  ? 51.809  -2.009  20.164  1.00 78.09  ? 70  LYS A CB  1 
ATOM   550  C CG  . LYS A 1 70  ? 53.159  -2.316  19.533  1.00 81.86  ? 70  LYS A CG  1 
ATOM   551  C CD  . LYS A 1 70  ? 54.289  -1.638  20.293  1.00 90.79  ? 70  LYS A CD  1 
ATOM   552  C CE  . LYS A 1 70  ? 55.644  -1.916  19.661  1.00 92.43  ? 70  LYS A CE  1 
ATOM   553  N NZ  . LYS A 1 70  ? 55.816  -1.179  18.385  1.00 93.44  ? 70  LYS A NZ  1 
ATOM   554  N N   . GLY A 1 71  ? 50.833  -4.985  18.567  1.00 101.88 ? 71  GLY A N   1 
ATOM   555  C CA  . GLY A 1 71  ? 50.991  -6.426  18.582  1.00 106.78 ? 71  GLY A CA  1 
ATOM   556  C C   . GLY A 1 71  ? 49.706  -7.148  18.936  1.00 112.56 ? 71  GLY A C   1 
ATOM   557  O O   . GLY A 1 71  ? 49.735  -8.298  19.373  1.00 117.34 ? 71  GLY A O   1 
ATOM   558  N N   . GLY A 1 72  ? 48.575  -6.472  18.752  1.00 110.73 ? 72  GLY A N   1 
ATOM   559  C CA  . GLY A 1 72  ? 47.275  -7.068  19.009  1.00 115.57 ? 72  GLY A CA  1 
ATOM   560  C C   . GLY A 1 72  ? 46.709  -6.709  20.368  1.00 118.57 ? 72  GLY A C   1 
ATOM   561  O O   . GLY A 1 72  ? 45.530  -6.375  20.493  1.00 122.07 ? 72  GLY A O   1 
ATOM   562  N N   . GLU A 1 73  ? 47.559  -6.777  21.388  1.00 114.59 ? 73  GLU A N   1 
ATOM   563  C CA  . GLU A 1 73  ? 47.161  -6.447  22.751  1.00 107.74 ? 73  GLU A CA  1 
ATOM   564  C C   . GLU A 1 73  ? 47.091  -4.937  22.965  1.00 92.90  ? 73  GLU A C   1 
ATOM   565  O O   . GLU A 1 73  ? 47.877  -4.184  22.394  1.00 84.86  ? 73  GLU A O   1 
ATOM   566  C CB  . GLU A 1 73  ? 48.121  -7.086  23.758  1.00 117.65 ? 73  GLU A CB  1 
ATOM   567  C CG  . GLU A 1 73  ? 48.263  -8.594  23.600  1.00 130.64 ? 73  GLU A CG  1 
ATOM   568  C CD  . GLU A 1 73  ? 48.992  -9.243  24.762  1.00 142.16 ? 73  GLU A CD  1 
ATOM   569  O OE1 . GLU A 1 73  ? 49.105  -8.600  25.829  1.00 143.52 ? 73  GLU A OE1 1 
ATOM   570  O OE2 . GLU A 1 73  ? 49.448  -10.398 24.609  1.00 145.66 ? 73  GLU A OE2 1 
ATOM   571  N N   . VAL A 1 74  ? 46.139  -4.513  23.791  1.00 87.58  ? 74  VAL A N   1 
ATOM   572  C CA  . VAL A 1 74  ? 45.904  -3.099  24.088  1.00 76.86  ? 74  VAL A CA  1 
ATOM   573  C C   . VAL A 1 74  ? 47.056  -2.435  24.845  1.00 82.34  ? 74  VAL A C   1 
ATOM   574  O O   . VAL A 1 74  ? 47.722  -3.068  25.661  1.00 94.40  ? 74  VAL A O   1 
ATOM   575  C CB  . VAL A 1 74  ? 44.598  -2.920  24.896  1.00 76.77  ? 74  VAL A CB  1 
ATOM   576  C CG1 . VAL A 1 74  ? 44.592  -1.594  25.635  1.00 84.98  ? 74  VAL A CG1 1 
ATOM   577  C CG2 . VAL A 1 74  ? 43.388  -3.027  23.985  1.00 75.19  ? 74  VAL A CG2 1 
ATOM   578  N N   . LEU A 1 75  ? 47.277  -1.152  24.581  1.00 74.64  ? 75  LEU A N   1 
ATOM   579  C CA  . LEU A 1 75  ? 48.380  -0.415  25.192  1.00 80.25  ? 75  LEU A CA  1 
ATOM   580  C C   . LEU A 1 75  ? 47.908  0.554   26.285  1.00 81.66  ? 75  LEU A C   1 
ATOM   581  O O   . LEU A 1 75  ? 48.319  0.448   27.437  1.00 81.43  ? 75  LEU A O   1 
ATOM   582  C CB  . LEU A 1 75  ? 49.139  0.353   24.116  1.00 83.24  ? 75  LEU A CB  1 
ATOM   583  C CG  . LEU A 1 75  ? 50.660  0.355   24.233  1.00 84.92  ? 75  LEU A CG  1 
ATOM   584  C CD1 . LEU A 1 75  ? 51.197  -1.038  23.960  1.00 81.77  ? 75  LEU A CD1 1 
ATOM   585  C CD2 . LEU A 1 75  ? 51.252  1.360   23.265  1.00 91.14  ? 75  LEU A CD2 1 
ATOM   586  N N   . SER A 1 76  ? 47.061  1.508   25.908  1.00 77.62  ? 76  SER A N   1 
ATOM   587  C CA  . SER A 1 76  ? 46.417  2.405   26.863  1.00 77.68  ? 76  SER A CA  1 
ATOM   588  C C   . SER A 1 76  ? 45.157  2.977   26.232  1.00 73.02  ? 76  SER A C   1 
ATOM   589  O O   . SER A 1 76  ? 44.753  2.538   25.165  1.00 77.86  ? 76  SER A O   1 
ATOM   590  C CB  . SER A 1 76  ? 47.359  3.526   27.311  1.00 79.96  ? 76  SER A CB  1 
ATOM   591  O OG  . SER A 1 76  ? 47.250  4.663   26.473  1.00 89.92  ? 76  SER A OG  1 
ATOM   592  N N   . HIS A 1 77  ? 44.531  3.948   26.885  1.00 74.78  ? 77  HIS A N   1 
ATOM   593  C CA  . HIS A 1 77  ? 43.313  4.541   26.342  1.00 72.12  ? 77  HIS A CA  1 
ATOM   594  C C   . HIS A 1 77  ? 43.109  5.993   26.764  1.00 78.86  ? 77  HIS A C   1 
ATOM   595  O O   . HIS A 1 77  ? 43.732  6.481   27.709  1.00 76.56  ? 77  HIS A O   1 
ATOM   596  C CB  . HIS A 1 77  ? 42.086  3.714   26.735  1.00 69.99  ? 77  HIS A CB  1 
ATOM   597  C CG  . HIS A 1 77  ? 41.703  3.857   28.173  1.00 83.68  ? 77  HIS A CG  1 
ATOM   598  N ND1 . HIS A 1 77  ? 42.077  2.948   29.138  1.00 85.44  ? 77  HIS A ND1 1 
ATOM   599  C CD2 . HIS A 1 77  ? 40.995  4.817   28.815  1.00 88.42  ? 77  HIS A CD2 1 
ATOM   600  C CE1 . HIS A 1 77  ? 41.610  3.337   30.310  1.00 88.62  ? 77  HIS A CE1 1 
ATOM   601  N NE2 . HIS A 1 77  ? 40.951  4.468   30.143  1.00 89.03  ? 77  HIS A NE2 1 
ATOM   602  N N   . SER A 1 78  ? 42.237  6.677   26.034  1.00 81.30  ? 78  SER A N   1 
ATOM   603  C CA  . SER A 1 78  ? 41.840  8.035   26.356  1.00 72.15  ? 78  SER A CA  1 
ATOM   604  C C   . SER A 1 78  ? 40.348  8.150   26.114  1.00 71.54  ? 78  SER A C   1 
ATOM   605  O O   . SER A 1 78  ? 39.890  8.084   24.984  1.00 80.10  ? 78  SER A O   1 
ATOM   606  C CB  . SER A 1 78  ? 42.580  9.044   25.476  1.00 63.03  ? 78  SER A CB  1 
ATOM   607  O OG  . SER A 1 78  ? 43.986  8.903   25.584  1.00 59.67  ? 78  SER A OG  1 
ATOM   608  N N   . LEU A 1 79  ? 39.580  8.294   27.179  1.00 67.16  ? 79  LEU A N   1 
ATOM   609  C CA  . LEU A 1 79  ? 38.165  8.560   27.029  1.00 65.72  ? 79  LEU A CA  1 
ATOM   610  C C   . LEU A 1 79  ? 37.993  10.066  26.841  1.00 67.83  ? 79  LEU A C   1 
ATOM   611  O O   . LEU A 1 79  ? 38.780  10.850  27.355  1.00 73.40  ? 79  LEU A O   1 
ATOM   612  C CB  . LEU A 1 79  ? 37.415  8.063   28.262  1.00 55.93  ? 79  LEU A CB  1 
ATOM   613  C CG  . LEU A 1 79  ? 35.903  8.284   28.331  1.00 77.14  ? 79  LEU A CG  1 
ATOM   614  C CD1 . LEU A 1 79  ? 35.193  7.619   27.179  1.00 68.23  ? 79  LEU A CD1 1 
ATOM   615  C CD2 . LEU A 1 79  ? 35.365  7.758   29.648  1.00 86.78  ? 79  LEU A CD2 1 
ATOM   616  N N   . LEU A 1 80  ? 36.983  10.468  26.081  1.00 53.49  ? 80  LEU A N   1 
ATOM   617  C CA  . LEU A 1 80  ? 36.690  11.884  25.896  1.00 59.24  ? 80  LEU A CA  1 
ATOM   618  C C   . LEU A 1 80  ? 35.220  12.150  26.156  1.00 63.71  ? 80  LEU A C   1 
ATOM   619  O O   . LEU A 1 80  ? 34.356  11.444  25.648  1.00 67.48  ? 80  LEU A O   1 
ATOM   620  C CB  . LEU A 1 80  ? 36.994  12.335  24.467  1.00 59.81  ? 80  LEU A CB  1 
ATOM   621  C CG  . LEU A 1 80  ? 38.375  12.222  23.825  1.00 62.42  ? 80  LEU A CG  1 
ATOM   622  C CD1 . LEU A 1 80  ? 38.543  13.396  22.892  1.00 57.56  ? 80  LEU A CD1 1 
ATOM   623  C CD2 . LEU A 1 80  ? 39.481  12.207  24.852  1.00 68.03  ? 80  LEU A CD2 1 
ATOM   624  N N   . LEU A 1 81  ? 34.930  13.181  26.931  1.00 55.76  ? 81  LEU A N   1 
ATOM   625  C CA  . LEU A 1 81  ? 33.554  13.571  27.153  1.00 56.91  ? 81  LEU A CA  1 
ATOM   626  C C   . LEU A 1 81  ? 33.375  14.979  26.624  1.00 76.33  ? 81  LEU A C   1 
ATOM   627  O O   . LEU A 1 81  ? 34.341  15.735  26.522  1.00 77.86  ? 81  LEU A O   1 
ATOM   628  C CB  . LEU A 1 81  ? 33.221  13.507  28.639  1.00 69.20  ? 81  LEU A CB  1 
ATOM   629  C CG  . LEU A 1 81  ? 33.702  12.226  29.323  1.00 59.05  ? 81  LEU A CG  1 
ATOM   630  C CD1 . LEU A 1 81  ? 33.608  12.358  30.820  1.00 76.84  ? 81  LEU A CD1 1 
ATOM   631  C CD2 . LEU A 1 81  ? 32.909  11.032  28.837  1.00 76.96  ? 81  LEU A CD2 1 
ATOM   632  N N   . LEU A 1 82  ? 32.148  15.333  26.270  1.00 70.53  ? 82  LEU A N   1 
ATOM   633  C CA  . LEU A 1 82  ? 31.884  16.660  25.736  1.00 67.71  ? 82  LEU A CA  1 
ATOM   634  C C   . LEU A 1 82  ? 31.129  17.502  26.757  1.00 67.74  ? 82  LEU A C   1 
ATOM   635  O O   . LEU A 1 82  ? 30.140  17.054  27.331  1.00 66.88  ? 82  LEU A O   1 
ATOM   636  C CB  . LEU A 1 82  ? 31.072  16.574  24.435  1.00 68.75  ? 82  LEU A CB  1 
ATOM   637  C CG  . LEU A 1 82  ? 31.624  15.778  23.248  1.00 67.94  ? 82  LEU A CG  1 
ATOM   638  C CD1 . LEU A 1 82  ? 30.953  16.225  21.962  1.00 63.76  ? 82  LEU A CD1 1 
ATOM   639  C CD2 . LEU A 1 82  ? 33.117  15.952  23.138  1.00 55.18  ? 82  LEU A CD2 1 
ATOM   640  N N   . HIS A 1 83  ? 31.608  18.717  26.993  1.00 67.36  ? 83  HIS A N   1 
ATOM   641  C CA  . HIS A 1 83  ? 30.861  19.683  27.780  1.00 69.93  ? 83  HIS A CA  1 
ATOM   642  C C   . HIS A 1 83  ? 30.276  20.695  26.798  1.00 80.73  ? 83  HIS A C   1 
ATOM   643  O O   . HIS A 1 83  ? 31.004  21.392  26.089  1.00 65.02  ? 83  HIS A O   1 
ATOM   644  C CB  . HIS A 1 83  ? 31.758  20.345  28.837  1.00 65.73  ? 83  HIS A CB  1 
ATOM   645  C CG  . HIS A 1 83  ? 31.017  20.953  29.984  1.00 68.59  ? 83  HIS A CG  1 
ATOM   646  N ND1 . HIS A 1 83  ? 29.679  20.697  30.229  1.00 87.51  ? 83  HIS A ND1 1 
ATOM   647  C CD2 . HIS A 1 83  ? 31.421  21.780  30.974  1.00 70.42  ? 83  HIS A CD2 1 
ATOM   648  C CE1 . HIS A 1 83  ? 29.298  21.359  31.307  1.00 85.20  ? 83  HIS A CE1 1 
ATOM   649  N NE2 . HIS A 1 83  ? 30.338  22.022  31.778  1.00 73.10  ? 83  HIS A NE2 1 
ATOM   650  N N   . LYS A 1 84  ? 28.949  20.739  26.751  1.00 89.82  ? 84  LYS A N   1 
ATOM   651  C CA  . LYS A 1 84  ? 28.210  21.473  25.730  1.00 89.48  ? 84  LYS A CA  1 
ATOM   652  C C   . LYS A 1 84  ? 27.758  22.848  26.204  1.00 93.69  ? 84  LYS A C   1 
ATOM   653  O O   . LYS A 1 84  ? 27.036  22.974  27.188  1.00 100.30 ? 84  LYS A O   1 
ATOM   654  C CB  . LYS A 1 84  ? 27.000  20.651  25.291  1.00 96.21  ? 84  LYS A CB  1 
ATOM   655  C CG  . LYS A 1 84  ? 26.152  21.290  24.218  1.00 110.41 ? 84  LYS A CG  1 
ATOM   656  C CD  . LYS A 1 84  ? 25.680  20.224  23.253  1.00 120.31 ? 84  LYS A CD  1 
ATOM   657  C CE  . LYS A 1 84  ? 26.875  19.524  22.604  1.00 120.72 ? 84  LYS A CE  1 
ATOM   658  N NZ  . LYS A 1 84  ? 26.470  18.416  21.690  1.00 123.29 ? 84  LYS A NZ  1 
ATOM   659  N N   . LYS A 1 85  ? 28.183  23.876  25.480  1.00 93.35  ? 85  LYS A N   1 
ATOM   660  C CA  . LYS A 1 85  ? 27.883  25.263  25.817  1.00 96.71  ? 85  LYS A CA  1 
ATOM   661  C C   . LYS A 1 85  ? 26.894  25.804  24.790  1.00 117.42 ? 85  LYS A C   1 
ATOM   662  O O   . LYS A 1 85  ? 27.288  26.199  23.699  1.00 129.39 ? 85  LYS A O   1 
ATOM   663  C CB  . LYS A 1 85  ? 29.184  26.060  25.780  1.00 85.00  ? 85  LYS A CB  1 
ATOM   664  C CG  . LYS A 1 85  ? 29.106  27.501  26.209  1.00 91.86  ? 85  LYS A CG  1 
ATOM   665  C CD  . LYS A 1 85  ? 30.459  28.167  25.971  1.00 100.09 ? 85  LYS A CD  1 
ATOM   666  C CE  . LYS A 1 85  ? 30.496  29.595  26.498  1.00 114.35 ? 85  LYS A CE  1 
ATOM   667  N NZ  . LYS A 1 85  ? 30.446  29.643  27.988  1.00 114.19 ? 85  LYS A NZ  1 
ATOM   668  N N   . GLU A 1 86  ? 25.610  25.816  25.136  1.00 128.80 ? 86  GLU A N   1 
ATOM   669  C CA  . GLU A 1 86  ? 24.556  26.096  24.156  1.00 134.50 ? 86  GLU A CA  1 
ATOM   670  C C   . GLU A 1 86  ? 24.643  27.508  23.567  1.00 129.83 ? 86  GLU A C   1 
ATOM   671  O O   . GLU A 1 86  ? 24.544  27.690  22.353  1.00 132.01 ? 86  GLU A O   1 
ATOM   672  C CB  . GLU A 1 86  ? 23.173  25.851  24.768  1.00 146.81 ? 86  GLU A CB  1 
ATOM   673  C CG  . GLU A 1 86  ? 22.291  24.897  23.962  1.00 153.33 ? 86  GLU A CG  1 
ATOM   674  C CD  . GLU A 1 86  ? 21.918  25.438  22.591  1.00 158.46 ? 86  GLU A CD  1 
ATOM   675  O OE1 . GLU A 1 86  ? 21.943  24.655  21.614  1.00 155.02 ? 86  GLU A OE1 1 
ATOM   676  O OE2 . GLU A 1 86  ? 21.597  26.644  22.491  1.00 161.36 ? 86  GLU A OE2 1 
ATOM   677  N N   . ASP A 1 87  ? 24.827  28.500  24.430  1.00 125.03 ? 87  ASP A N   1 
ATOM   678  C CA  . ASP A 1 87  ? 24.953  29.888  23.997  1.00 127.62 ? 87  ASP A CA  1 
ATOM   679  C C   . ASP A 1 87  ? 25.259  30.764  25.200  1.00 126.96 ? 87  ASP A C   1 
ATOM   680  O O   . ASP A 1 87  ? 24.398  31.489  25.696  1.00 126.76 ? 87  ASP A O   1 
ATOM   681  C CB  . ASP A 1 87  ? 23.676  30.368  23.305  1.00 137.49 ? 87  ASP A CB  1 
ATOM   682  C CG  . ASP A 1 87  ? 22.464  30.322  24.216  1.00 142.05 ? 87  ASP A CG  1 
ATOM   683  O OD1 . ASP A 1 87  ? 21.522  31.111  23.988  1.00 144.75 ? 87  ASP A OD1 1 
ATOM   684  O OD2 . ASP A 1 87  ? 22.455  29.503  25.161  1.00 138.97 ? 87  ASP A OD2 1 
ATOM   685  N N   . GLY A 1 88  ? 26.497  30.691  25.670  1.00 121.19 ? 88  GLY A N   1 
ATOM   686  C CA  . GLY A 1 88  ? 26.865  31.342  26.909  1.00 113.46 ? 88  GLY A CA  1 
ATOM   687  C C   . GLY A 1 88  ? 26.697  30.375  28.062  1.00 102.06 ? 88  GLY A C   1 
ATOM   688  O O   . GLY A 1 88  ? 27.621  30.169  28.841  1.00 104.85 ? 88  GLY A O   1 
ATOM   689  N N   . ILE A 1 89  ? 25.517  29.766  28.160  1.00 102.78 ? 89  ILE A N   1 
ATOM   690  C CA  . ILE A 1 89  ? 25.231  28.827  29.243  1.00 105.03 ? 89  ILE A CA  1 
ATOM   691  C C   . ILE A 1 89  ? 25.646  27.394  28.898  1.00 102.54 ? 89  ILE A C   1 
ATOM   692  O O   . ILE A 1 89  ? 25.626  26.989  27.733  1.00 93.26  ? 89  ILE A O   1 
ATOM   693  C CB  . ILE A 1 89  ? 23.733  28.844  29.651  1.00 109.59 ? 89  ILE A CB  1 
ATOM   694  C CG1 . ILE A 1 89  ? 22.973  27.685  29.000  1.00 115.40 ? 89  ILE A CG1 1 
ATOM   695  C CG2 . ILE A 1 89  ? 23.099  30.186  29.324  1.00 105.81 ? 89  ILE A CG2 1 
ATOM   696  C CD1 . ILE A 1 89  ? 21.552  27.519  29.510  1.00 114.67 ? 89  ILE A CD1 1 
ATOM   697  N N   . TRP A 1 90  ? 26.024  26.640  29.928  1.00 99.92  ? 90  TRP A N   1 
ATOM   698  C CA  . TRP A 1 90  ? 26.388  25.239  29.784  1.00 85.95  ? 90  TRP A CA  1 
ATOM   699  C C   . TRP A 1 90  ? 25.147  24.366  29.883  1.00 83.46  ? 90  TRP A C   1 
ATOM   700  O O   . TRP A 1 90  ? 24.114  24.794  30.385  1.00 88.42  ? 90  TRP A O   1 
ATOM   701  C CB  . TRP A 1 90  ? 27.380  24.832  30.871  1.00 77.81  ? 90  TRP A CB  1 
ATOM   702  C CG  . TRP A 1 90  ? 28.694  25.551  30.829  1.00 67.72  ? 90  TRP A CG  1 
ATOM   703  C CD1 . TRP A 1 90  ? 29.085  26.584  31.620  1.00 68.87  ? 90  TRP A CD1 1 
ATOM   704  C CD2 . TRP A 1 90  ? 29.798  25.273  29.957  1.00 96.26  ? 90  TRP A CD2 1 
ATOM   705  N NE1 . TRP A 1 90  ? 30.362  26.974  31.296  1.00 81.69  ? 90  TRP A NE1 1 
ATOM   706  C CE2 . TRP A 1 90  ? 30.822  26.185  30.276  1.00 88.66  ? 90  TRP A CE2 1 
ATOM   707  C CE3 . TRP A 1 90  ? 30.017  24.343  28.931  1.00 101.70 ? 90  TRP A CE3 1 
ATOM   708  C CZ2 . TRP A 1 90  ? 32.050  26.194  29.608  1.00 94.99  ? 90  TRP A CZ2 1 
ATOM   709  C CZ3 . TRP A 1 90  ? 31.238  24.353  28.269  1.00 100.35 ? 90  TRP A CZ3 1 
ATOM   710  C CH2 . TRP A 1 90  ? 32.237  25.272  28.610  1.00 68.58  ? 90  TRP A CH2 1 
ATOM   711  N N   . SER A 1 91  ? 25.256  23.132  29.413  1.00 69.31  ? 91  SER A N   1 
ATOM   712  C CA  . SER A 1 91  ? 24.117  22.226  29.410  1.00 70.42  ? 91  SER A CA  1 
ATOM   713  C C   . SER A 1 91  ? 23.780  21.707  30.807  1.00 82.24  ? 91  SER A C   1 
ATOM   714  O O   . SER A 1 91  ? 24.668  21.462  31.630  1.00 73.21  ? 91  SER A O   1 
ATOM   715  C CB  . SER A 1 91  ? 24.368  21.055  28.463  1.00 70.56  ? 91  SER A CB  1 
ATOM   716  O OG  . SER A 1 91  ? 25.546  20.361  28.823  1.00 70.58  ? 91  SER A OG  1 
ATOM   717  N N   . THR A 1 92  ? 22.483  21.549  31.057  1.00 88.80  ? 92  THR A N   1 
ATOM   718  C CA  . THR A 1 92  ? 21.975  21.007  32.308  1.00 86.42  ? 92  THR A CA  1 
ATOM   719  C C   . THR A 1 92  ? 20.840  20.043  31.999  1.00 90.46  ? 92  THR A C   1 
ATOM   720  O O   . THR A 1 92  ? 19.699  20.253  32.423  1.00 94.38  ? 92  THR A O   1 
ATOM   721  C CB  . THR A 1 92  ? 21.417  22.114  33.208  1.00 86.56  ? 92  THR A CB  1 
ATOM   722  O OG1 . THR A 1 92  ? 20.324  22.759  32.541  1.00 91.59  ? 92  THR A OG1 1 
ATOM   723  C CG2 . THR A 1 92  ? 22.497  23.136  33.535  1.00 79.96  ? 92  THR A CG2 1 
ATOM   724  N N   . ASP A 1 93  ? 21.156  18.986  31.260  1.00 84.59  ? 93  ASP A N   1 
ATOM   725  C CA  . ASP A 1 93  ? 20.130  18.084  30.754  1.00 85.65  ? 93  ASP A CA  1 
ATOM   726  C C   . ASP A 1 93  ? 19.774  16.976  31.734  1.00 84.98  ? 93  ASP A C   1 
ATOM   727  O O   . ASP A 1 93  ? 18.607  16.609  31.864  1.00 88.81  ? 93  ASP A O   1 
ATOM   728  C CB  . ASP A 1 93  ? 20.561  17.479  29.415  1.00 88.15  ? 93  ASP A CB  1 
ATOM   729  C CG  . ASP A 1 93  ? 20.616  18.507  28.299  1.00 85.49  ? 93  ASP A CG  1 
ATOM   730  O OD1 . ASP A 1 93  ? 20.027  19.600  28.455  1.00 77.17  ? 93  ASP A OD1 1 
ATOM   731  O OD2 . ASP A 1 93  ? 21.247  18.214  27.263  1.00 84.61  ? 93  ASP A OD2 1 
ATOM   732  N N   . ILE A 1 94  ? 20.778  16.451  32.426  1.00 83.22  ? 94  ILE A N   1 
ATOM   733  C CA  . ILE A 1 94  ? 20.590  15.254  33.242  1.00 85.59  ? 94  ILE A CA  1 
ATOM   734  C C   . ILE A 1 94  ? 19.863  15.484  34.560  1.00 88.02  ? 94  ILE A C   1 
ATOM   735  O O   . ILE A 1 94  ? 18.974  14.711  34.918  1.00 91.48  ? 94  ILE A O   1 
ATOM   736  C CB  . ILE A 1 94  ? 21.918  14.528  33.500  1.00 84.51  ? 94  ILE A CB  1 
ATOM   737  C CG1 . ILE A 1 94  ? 23.062  15.531  33.588  1.00 78.20  ? 94  ILE A CG1 1 
ATOM   738  C CG2 . ILE A 1 94  ? 22.195  13.526  32.388  1.00 87.02  ? 94  ILE A CG2 1 
ATOM   739  C CD1 . ILE A 1 94  ? 24.419  14.890  33.474  1.00 77.69  ? 94  ILE A CD1 1 
ATOM   740  N N   . LEU A 1 95  ? 20.239  16.533  35.284  1.00 90.25  ? 95  LEU A N   1 
ATOM   741  C CA  . LEU A 1 95  ? 19.580  16.850  36.550  1.00 86.50  ? 95  LEU A CA  1 
ATOM   742  C C   . LEU A 1 95  ? 18.373  17.739  36.318  1.00 91.29  ? 95  LEU A C   1 
ATOM   743  O O   . LEU A 1 95  ? 18.443  18.693  35.539  1.00 97.76  ? 95  LEU A O   1 
ATOM   744  C CB  . LEU A 1 95  ? 20.548  17.536  37.511  1.00 77.25  ? 95  LEU A CB  1 
ATOM   745  C CG  . LEU A 1 95  ? 21.716  16.665  37.968  1.00 74.61  ? 95  LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 95  ? 22.586  17.409  38.962  1.00 74.48  ? 95  LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 95  ? 21.193  15.376  38.567  1.00 75.24  ? 95  LEU A CD2 1 
ATOM   748  N N   . LYS A 1 96  ? 17.265  17.424  36.985  1.00 89.18  ? 96  LYS A N   1 
ATOM   749  C CA  . LYS A 1 96  ? 16.054  18.212  36.815  1.00 98.30  ? 96  LYS A CA  1 
ATOM   750  C C   . LYS A 1 96  ? 16.114  19.491  37.640  1.00 105.53 ? 96  LYS A C   1 
ATOM   751  O O   . LYS A 1 96  ? 16.647  19.500  38.749  1.00 105.17 ? 96  LYS A O   1 
ATOM   752  C CB  . LYS A 1 96  ? 14.804  17.410  37.180  1.00 101.29 ? 96  LYS A CB  1 
ATOM   753  C CG  . LYS A 1 96  ? 13.529  18.031  36.622  1.00 113.71 ? 96  LYS A CG  1 
ATOM   754  C CD  . LYS A 1 96  ? 12.294  17.697  37.442  1.00 119.63 ? 96  LYS A CD  1 
ATOM   755  C CE  . LYS A 1 96  ? 11.055  18.377  36.863  1.00 123.07 ? 96  LYS A CE  1 
ATOM   756  N NZ  . LYS A 1 96  ? 11.268  19.832  36.593  1.00 120.47 ? 96  LYS A NZ  1 
ATOM   757  N N   . ASP A 1 97  ? 15.572  20.572  37.090  1.00 113.17 ? 97  ASP A N   1 
ATOM   758  C CA  . ASP A 1 97  ? 15.509  21.834  37.811  1.00 118.33 ? 97  ASP A CA  1 
ATOM   759  C C   . ASP A 1 97  ? 14.295  21.859  38.717  1.00 124.88 ? 97  ASP A C   1 
ATOM   760  O O   . ASP A 1 97  ? 13.208  22.255  38.300  1.00 130.74 ? 97  ASP A O   1 
ATOM   761  C CB  . ASP A 1 97  ? 15.447  23.018  36.844  1.00 125.11 ? 97  ASP A CB  1 
ATOM   762  C CG  . ASP A 1 97  ? 15.145  24.332  37.550  1.00 126.01 ? 97  ASP A CG  1 
ATOM   763  O OD1 . ASP A 1 97  ? 15.552  24.485  38.723  1.00 113.94 ? 97  ASP A OD1 1 
ATOM   764  O OD2 . ASP A 1 97  ? 14.501  25.208  36.932  1.00 131.95 ? 97  ASP A OD2 1 
ATOM   765  N N   . GLN A 1 98  ? 14.478  21.420  39.955  1.00 130.18 ? 98  GLN A N   1 
ATOM   766  C CA  . GLN A 1 98  ? 13.427  21.537  40.953  1.00 140.71 ? 98  GLN A CA  1 
ATOM   767  C C   . GLN A 1 98  ? 13.331  22.992  41.401  1.00 154.90 ? 98  GLN A C   1 
ATOM   768  O O   . GLN A 1 98  ? 13.883  23.374  42.435  1.00 158.49 ? 98  GLN A O   1 
ATOM   769  C CB  . GLN A 1 98  ? 13.704  20.611  42.140  1.00 133.01 ? 98  GLN A CB  1 
ATOM   770  C CG  . GLN A 1 98  ? 15.181  20.446  42.467  1.00 125.12 ? 98  GLN A CG  1 
ATOM   771  C CD  . GLN A 1 98  ? 15.446  19.282  43.404  1.00 120.00 ? 98  GLN A CD  1 
ATOM   772  O OE1 . GLN A 1 98  ? 16.551  18.743  43.446  1.00 115.79 ? 98  GLN A OE1 1 
ATOM   773  N NE2 . GLN A 1 98  ? 14.428  18.887  44.159  1.00 120.32 ? 98  GLN A NE2 1 
ATOM   774  N N   . LYS A 1 99  ? 12.636  23.800  40.603  1.00 159.76 ? 99  LYS A N   1 
ATOM   775  C CA  . LYS A 1 99  ? 12.520  25.232  40.856  1.00 159.42 ? 99  LYS A CA  1 
ATOM   776  C C   . LYS A 1 99  ? 11.685  25.518  42.096  1.00 156.76 ? 99  LYS A C   1 
ATOM   777  O O   . LYS A 1 99  ? 10.629  26.144  42.011  1.00 156.15 ? 99  LYS A O   1 
ATOM   778  C CB  . LYS A 1 99  ? 11.914  25.945  39.644  1.00 161.52 ? 99  LYS A CB  1 
ATOM   779  N N   . GLU A 1 100 ? 12.167  25.061  43.246  1.00 154.31 ? 100 GLU A N   1 
ATOM   780  C CA  . GLU A 1 100 ? 11.458  25.263  44.502  1.00 158.10 ? 100 GLU A CA  1 
ATOM   781  C C   . GLU A 1 100 ? 11.923  26.522  45.230  1.00 166.74 ? 100 GLU A C   1 
ATOM   782  O O   . GLU A 1 100 ? 11.128  27.438  45.440  1.00 171.94 ? 100 GLU A O   1 
ATOM   783  C CB  . GLU A 1 100 ? 11.571  24.030  45.406  1.00 153.47 ? 100 GLU A CB  1 
ATOM   784  C CG  . GLU A 1 100 ? 10.533  22.955  45.126  1.00 153.71 ? 100 GLU A CG  1 
ATOM   785  C CD  . GLU A 1 100 ? 9.139   23.352  45.583  1.00 154.18 ? 100 GLU A CD  1 
ATOM   786  O OE1 . GLU A 1 100 ? 8.938   24.529  45.948  1.00 154.94 ? 100 GLU A OE1 1 
ATOM   787  O OE2 . GLU A 1 100 ? 8.241   22.484  45.580  1.00 153.26 ? 100 GLU A OE2 1 
ATOM   788  N N   . PRO A 1 101 ? 13.209  26.576  45.619  1.00 169.08 ? 101 PRO A N   1 
ATOM   789  C CA  . PRO A 1 101 ? 13.691  27.789  46.291  1.00 170.46 ? 101 PRO A CA  1 
ATOM   790  C C   . PRO A 1 101 ? 13.651  28.976  45.333  1.00 169.60 ? 101 PRO A C   1 
ATOM   791  O O   . PRO A 1 101 ? 12.586  29.548  45.101  1.00 175.84 ? 101 PRO A O   1 
ATOM   792  C CB  . PRO A 1 101 ? 15.141  27.438  46.653  1.00 165.57 ? 101 PRO A CB  1 
ATOM   793  C CG  . PRO A 1 101 ? 15.210  25.938  46.589  1.00 162.67 ? 101 PRO A CG  1 
ATOM   794  C CD  . PRO A 1 101 ? 14.268  25.560  45.493  1.00 164.83 ? 101 PRO A CD  1 
ATOM   795  N N   . LYS A 1 102 ? 14.803  29.344  44.787  1.00 158.16 ? 102 LYS A N   1 
ATOM   796  C CA  . LYS A 1 102 ? 14.839  30.306  43.701  1.00 147.84 ? 102 LYS A CA  1 
ATOM   797  C C   . LYS A 1 102 ? 14.486  29.549  42.425  1.00 148.17 ? 102 LYS A C   1 
ATOM   798  O O   . LYS A 1 102 ? 13.461  28.870  42.358  1.00 149.78 ? 102 LYS A O   1 
ATOM   799  C CB  . LYS A 1 102 ? 16.227  30.934  43.591  1.00 138.53 ? 102 LYS A CB  1 
ATOM   800  N N   . ASN A 1 103 ? 15.335  29.663  41.414  1.00 143.83 ? 103 ASN A N   1 
ATOM   801  C CA  . ASN A 1 103 ? 15.229  28.810  40.242  1.00 141.93 ? 103 ASN A CA  1 
ATOM   802  C C   . ASN A 1 103 ? 16.575  28.142  40.022  1.00 136.71 ? 103 ASN A C   1 
ATOM   803  O O   . ASN A 1 103 ? 17.489  28.309  40.833  1.00 129.85 ? 103 ASN A O   1 
ATOM   804  C CB  . ASN A 1 103 ? 14.808  29.605  39.004  1.00 146.89 ? 103 ASN A CB  1 
ATOM   805  C CG  . ASN A 1 103 ? 14.500  28.709  37.809  1.00 151.19 ? 103 ASN A CG  1 
ATOM   806  O OD1 . ASN A 1 103 ? 14.034  27.580  37.969  1.00 148.77 ? 103 ASN A OD1 1 
ATOM   807  N ND2 . ASN A 1 103 ? 14.761  29.212  36.606  1.00 154.79 ? 103 ASN A ND2 1 
ATOM   808  N N   . LYS A 1 104 ? 16.699  27.396  38.929  1.00 130.59 ? 104 LYS A N   1 
ATOM   809  C CA  . LYS A 1 104 ? 17.937  26.690  38.631  1.00 119.44 ? 104 LYS A CA  1 
ATOM   810  C C   . LYS A 1 104 ? 18.530  26.115  39.916  1.00 115.50 ? 104 LYS A C   1 
ATOM   811  O O   . LYS A 1 104 ? 19.720  26.272  40.193  1.00 112.75 ? 104 LYS A O   1 
ATOM   812  C CB  . LYS A 1 104 ? 18.937  27.614  37.929  1.00 117.06 ? 104 LYS A CB  1 
ATOM   813  C CG  . LYS A 1 104 ? 18.468  28.129  36.566  1.00 122.28 ? 104 LYS A CG  1 
ATOM   814  C CD  . LYS A 1 104 ? 17.747  27.035  35.774  1.00 126.36 ? 104 LYS A CD  1 
ATOM   815  C CE  . LYS A 1 104 ? 17.622  27.370  34.286  1.00 116.63 ? 104 LYS A CE  1 
ATOM   816  N NZ  . LYS A 1 104 ? 18.857  27.026  33.530  1.00 104.05 ? 104 LYS A NZ  1 
ATOM   817  N N   . THR A 1 105 ? 17.674  25.471  40.704  1.00 111.38 ? 105 THR A N   1 
ATOM   818  C CA  . THR A 1 105 ? 18.095  24.766  41.908  1.00 107.57 ? 105 THR A CA  1 
ATOM   819  C C   . THR A 1 105 ? 18.155  23.278  41.585  1.00 105.26 ? 105 THR A C   1 
ATOM   820  O O   . THR A 1 105 ? 17.184  22.547  41.793  1.00 107.16 ? 105 THR A O   1 
ATOM   821  C CB  . THR A 1 105 ? 17.118  25.006  43.089  1.00 115.51 ? 105 THR A CB  1 
ATOM   822  O OG1 . THR A 1 105 ? 16.984  26.414  43.333  1.00 119.05 ? 105 THR A OG1 1 
ATOM   823  C CG2 . THR A 1 105 ? 17.618  24.323  44.359  1.00 105.09 ? 105 THR A CG2 1 
ATOM   824  N N   . PHE A 1 106 ? 19.298  22.836  41.066  1.00 97.83  ? 106 PHE A N   1 
ATOM   825  C CA  . PHE A 1 106 ? 19.450  21.462  40.591  1.00 100.16 ? 106 PHE A CA  1 
ATOM   826  C C   . PHE A 1 106 ? 19.782  20.488  41.713  1.00 96.37  ? 106 PHE A C   1 
ATOM   827  O O   . PHE A 1 106 ? 19.292  19.357  41.740  1.00 93.04  ? 106 PHE A O   1 
ATOM   828  C CB  . PHE A 1 106 ? 20.532  21.385  39.510  1.00 107.00 ? 106 PHE A CB  1 
ATOM   829  C CG  . PHE A 1 106 ? 20.161  22.070  38.225  1.00 102.32 ? 106 PHE A CG  1 
ATOM   830  C CD1 . PHE A 1 106 ? 19.327  21.448  37.308  1.00 100.65 ? 106 PHE A CD1 1 
ATOM   831  C CD2 . PHE A 1 106 ? 20.652  23.328  37.932  1.00 96.41  ? 106 PHE A CD2 1 
ATOM   832  C CE1 . PHE A 1 106 ? 18.982  22.072  36.128  1.00 104.48 ? 106 PHE A CE1 1 
ATOM   833  C CE2 . PHE A 1 106 ? 20.314  23.956  36.754  1.00 106.48 ? 106 PHE A CE2 1 
ATOM   834  C CZ  . PHE A 1 106 ? 19.476  23.328  35.846  1.00 108.53 ? 106 PHE A CZ  1 
ATOM   835  N N   . LEU A 1 107 ? 20.630  20.935  42.631  1.00 100.10 ? 107 LEU A N   1 
ATOM   836  C CA  . LEU A 1 107 ? 21.019  20.125  43.775  1.00 100.47 ? 107 LEU A CA  1 
ATOM   837  C C   . LEU A 1 107 ? 20.637  20.815  45.090  1.00 98.94  ? 107 LEU A C   1 
ATOM   838  O O   . LEU A 1 107 ? 20.897  22.001  45.277  1.00 96.35  ? 107 LEU A O   1 
ATOM   839  C CB  . LEU A 1 107 ? 22.515  19.793  43.714  1.00 93.74  ? 107 LEU A CB  1 
ATOM   840  C CG  . LEU A 1 107 ? 23.583  20.882  43.830  1.00 91.03  ? 107 LEU A CG  1 
ATOM   841  C CD1 . LEU A 1 107 ? 24.880  20.374  43.225  1.00 78.54  ? 107 LEU A CD1 1 
ATOM   842  C CD2 . LEU A 1 107 ? 23.160  22.180  43.162  1.00 99.52  ? 107 LEU A CD2 1 
ATOM   843  N N   . ARG A 1 108 ? 20.003  20.059  45.984  1.00 98.91  ? 108 ARG A N   1 
ATOM   844  C CA  . ARG A 1 108 ? 19.465  20.589  47.236  1.00 95.30  ? 108 ARG A CA  1 
ATOM   845  C C   . ARG A 1 108 ? 20.145  19.978  48.453  1.00 97.15  ? 108 ARG A C   1 
ATOM   846  O O   . ARG A 1 108 ? 20.726  18.897  48.375  1.00 100.07 ? 108 ARG A O   1 
ATOM   847  C CB  . ARG A 1 108 ? 17.964  20.321  47.314  1.00 101.70 ? 108 ARG A CB  1 
ATOM   848  C CG  . ARG A 1 108 ? 17.113  21.303  46.536  1.00 115.25 ? 108 ARG A CG  1 
ATOM   849  C CD  . ARG A 1 108 ? 16.584  22.403  47.442  1.00 123.70 ? 108 ARG A CD  1 
ATOM   850  N NE  . ARG A 1 108 ? 15.864  21.850  48.586  1.00 124.92 ? 108 ARG A NE  1 
ATOM   851  C CZ  . ARG A 1 108 ? 14.686  21.240  48.501  1.00 128.49 ? 108 ARG A CZ  1 
ATOM   852  N NH1 . ARG A 1 108 ? 14.096  21.098  47.321  1.00 131.88 ? 108 ARG A NH1 1 
ATOM   853  N NH2 . ARG A 1 108 ? 14.101  20.767  49.593  1.00 125.08 ? 108 ARG A NH2 1 
ATOM   854  N N   . CYS A 1 109 ? 20.044  20.666  49.587  1.00 96.45  ? 109 CYS A N   1 
ATOM   855  C CA  . CYS A 1 109 ? 20.722  20.231  50.805  1.00 84.57  ? 109 CYS A CA  1 
ATOM   856  C C   . CYS A 1 109 ? 19.891  20.399  52.082  1.00 83.95  ? 109 CYS A C   1 
ATOM   857  O O   . CYS A 1 109 ? 19.070  21.312  52.189  1.00 81.77  ? 109 CYS A O   1 
ATOM   858  C CB  . CYS A 1 109 ? 22.061  20.957  50.943  1.00 79.08  ? 109 CYS A CB  1 
ATOM   859  S SG  . CYS A 1 109 ? 23.236  20.610  49.604  1.00 77.45  ? 109 CYS A SG  1 
ATOM   860  N N   . GLU A 1 110 ? 20.115  19.494  53.036  1.00 84.42  ? 110 GLU A N   1 
ATOM   861  C CA  . GLU A 1 110 ? 19.512  19.556  54.368  1.00 78.04  ? 110 GLU A CA  1 
ATOM   862  C C   . GLU A 1 110 ? 20.492  19.076  55.434  1.00 84.51  ? 110 GLU A C   1 
ATOM   863  O O   . GLU A 1 110 ? 21.355  18.242  55.165  1.00 86.09  ? 110 GLU A O   1 
ATOM   864  C CB  . GLU A 1 110 ? 18.229  18.726  54.446  1.00 78.31  ? 110 GLU A CB  1 
ATOM   865  C CG  . GLU A 1 110 ? 16.961  19.510  54.177  1.00 96.35  ? 110 GLU A CG  1 
ATOM   866  C CD  . GLU A 1 110 ? 15.708  18.696  54.432  1.00 105.49 ? 110 GLU A CD  1 
ATOM   867  O OE1 . GLU A 1 110 ? 15.817  17.606  55.035  1.00 94.68  ? 110 GLU A OE1 1 
ATOM   868  O OE2 . GLU A 1 110 ? 14.615  19.150  54.027  1.00 112.52 ? 110 GLU A OE2 1 
ATOM   869  N N   . ALA A 1 111 ? 20.351  19.618  56.641  1.00 91.64  ? 111 ALA A N   1 
ATOM   870  C CA  . ALA A 1 111 ? 21.179  19.243  57.785  1.00 85.25  ? 111 ALA A CA  1 
ATOM   871  C C   . ALA A 1 111 ? 20.301  19.112  59.026  1.00 89.21  ? 111 ALA A C   1 
ATOM   872  O O   . ALA A 1 111 ? 19.433  19.956  59.256  1.00 93.35  ? 111 ALA A O   1 
ATOM   873  C CB  . ALA A 1 111 ? 22.259  20.285  58.016  1.00 73.85  ? 111 ALA A CB  1 
ATOM   874  N N   . LYS A 1 112 ? 20.520  18.063  59.820  1.00 84.14  ? 112 LYS A N   1 
ATOM   875  C CA  . LYS A 1 112 ? 19.696  17.827  61.003  1.00 82.58  ? 112 LYS A CA  1 
ATOM   876  C C   . LYS A 1 112 ? 20.302  18.428  62.265  1.00 90.78  ? 112 LYS A C   1 
ATOM   877  O O   . LYS A 1 112 ? 19.805  18.196  63.367  1.00 105.18 ? 112 LYS A O   1 
ATOM   878  C CB  . LYS A 1 112 ? 19.414  16.332  61.202  1.00 97.33  ? 112 LYS A CB  1 
ATOM   879  C CG  . LYS A 1 112 ? 20.639  15.433  61.169  1.00 112.27 ? 112 LYS A CG  1 
ATOM   880  C CD  . LYS A 1 112 ? 20.249  13.974  61.378  1.00 123.69 ? 112 LYS A CD  1 
ATOM   881  C CE  . LYS A 1 112 ? 21.349  13.017  60.924  1.00 129.88 ? 112 LYS A CE  1 
ATOM   882  N NZ  . LYS A 1 112 ? 22.673  13.323  61.536  1.00 135.82 ? 112 LYS A NZ  1 
ATOM   883  N N   . ASN A 1 113 ? 21.372  19.200  62.101  1.00 93.44  ? 113 ASN A N   1 
ATOM   884  C CA  . ASN A 1 113 ? 21.972  19.921  63.222  1.00 92.81  ? 113 ASN A CA  1 
ATOM   885  C C   . ASN A 1 113 ? 23.176  20.773  62.824  1.00 89.38  ? 113 ASN A C   1 
ATOM   886  O O   . ASN A 1 113 ? 23.445  20.977  61.641  1.00 88.34  ? 113 ASN A O   1 
ATOM   887  C CB  . ASN A 1 113 ? 22.346  18.960  64.354  1.00 86.24  ? 113 ASN A CB  1 
ATOM   888  C CG  . ASN A 1 113 ? 23.351  17.919  63.924  1.00 88.06  ? 113 ASN A CG  1 
ATOM   889  O OD1 . ASN A 1 113 ? 24.367  18.239  63.312  1.00 83.55  ? 113 ASN A OD1 1 
ATOM   890  N ND2 . ASN A 1 113 ? 23.074  16.661  64.247  1.00 93.49  ? 113 ASN A ND2 1 
ATOM   891  N N   . TYR A 1 114 ? 23.896  21.271  63.822  1.00 82.95  ? 114 TYR A N   1 
ATOM   892  C CA  . TYR A 1 114 ? 25.045  22.135  63.581  1.00 85.10  ? 114 TYR A CA  1 
ATOM   893  C C   . TYR A 1 114 ? 26.371  21.383  63.678  1.00 87.47  ? 114 TYR A C   1 
ATOM   894  O O   . TYR A 1 114 ? 27.409  21.981  63.944  1.00 93.84  ? 114 TYR A O   1 
ATOM   895  C CB  . TYR A 1 114 ? 25.033  23.310  64.564  1.00 80.38  ? 114 TYR A CB  1 
ATOM   896  C CG  . TYR A 1 114 ? 24.075  24.418  64.184  1.00 83.50  ? 114 TYR A CG  1 
ATOM   897  C CD1 . TYR A 1 114 ? 22.810  24.499  64.749  1.00 83.26  ? 114 TYR A CD1 1 
ATOM   898  C CD2 . TYR A 1 114 ? 24.440  25.387  63.259  1.00 80.73  ? 114 TYR A CD2 1 
ATOM   899  C CE1 . TYR A 1 114 ? 21.936  25.514  64.405  1.00 82.59  ? 114 TYR A CE1 1 
ATOM   900  C CE2 . TYR A 1 114 ? 23.576  26.403  62.910  1.00 85.23  ? 114 TYR A CE2 1 
ATOM   901  C CZ  . TYR A 1 114 ? 22.324  26.463  63.484  1.00 86.88  ? 114 TYR A CZ  1 
ATOM   902  O OH  . TYR A 1 114 ? 21.459  27.474  63.132  1.00 86.58  ? 114 TYR A OH  1 
ATOM   903  N N   . SER A 1 115 ? 26.336  20.075  63.451  1.00 87.23  ? 115 SER A N   1 
ATOM   904  C CA  . SER A 1 115 ? 27.521  19.244  63.630  1.00 86.22  ? 115 SER A CA  1 
ATOM   905  C C   . SER A 1 115 ? 28.509  19.387  62.483  1.00 88.18  ? 115 SER A C   1 
ATOM   906  O O   . SER A 1 115 ? 29.719  19.370  62.696  1.00 89.38  ? 115 SER A O   1 
ATOM   907  C CB  . SER A 1 115 ? 27.128  17.779  63.777  1.00 83.75  ? 115 SER A CB  1 
ATOM   908  O OG  . SER A 1 115 ? 26.608  17.289  62.554  1.00 98.82  ? 115 SER A OG  1 
ATOM   909  N N   . GLY A 1 116 ? 27.988  19.521  61.268  1.00 87.81  ? 116 GLY A N   1 
ATOM   910  C CA  . GLY A 1 116 ? 28.814  19.582  60.076  1.00 89.24  ? 116 GLY A CA  1 
ATOM   911  C C   . GLY A 1 116 ? 28.379  18.526  59.076  1.00 98.12  ? 116 GLY A C   1 
ATOM   912  O O   . GLY A 1 116 ? 28.688  18.606  57.884  1.00 80.82  ? 116 GLY A O   1 
ATOM   913  N N   . ARG A 1 117 ? 27.661  17.522  59.573  1.00 105.77 ? 117 ARG A N   1 
ATOM   914  C CA  . ARG A 1 117 ? 27.075  16.498  58.721  1.00 101.55 ? 117 ARG A CA  1 
ATOM   915  C C   . ARG A 1 117 ? 25.864  17.072  57.995  1.00 84.75  ? 117 ARG A C   1 
ATOM   916  O O   . ARG A 1 117 ? 24.969  17.631  58.624  1.00 82.43  ? 117 ARG A O   1 
ATOM   917  C CB  . ARG A 1 117 ? 26.661  15.268  59.550  1.00 113.27 ? 117 ARG A CB  1 
ATOM   918  C CG  . ARG A 1 117 ? 27.822  14.387  60.002  1.00 122.31 ? 117 ARG A CG  1 
ATOM   919  C CD  . ARG A 1 117 ? 27.384  13.232  60.903  1.00 130.21 ? 117 ARG A CD  1 
ATOM   920  N NE  . ARG A 1 117 ? 27.076  12.010  60.159  1.00 142.97 ? 117 ARG A NE  1 
ATOM   921  C CZ  . ARG A 1 117 ? 26.917  10.807  60.715  1.00 153.61 ? 117 ARG A CZ  1 
ATOM   922  N NH1 . ARG A 1 117 ? 27.040  10.653  62.029  1.00 155.95 ? 117 ARG A NH1 1 
ATOM   923  N NH2 . ARG A 1 117 ? 26.638  9.751   59.956  1.00 154.57 ? 117 ARG A NH2 1 
ATOM   924  N N   . PHE A 1 118 ? 25.848  16.946  56.672  1.00 79.87  ? 118 PHE A N   1 
ATOM   925  C CA  . PHE A 1 118 ? 24.662  17.276  55.881  1.00 81.10  ? 118 PHE A CA  1 
ATOM   926  C C   . PHE A 1 118 ? 24.474  16.293  54.726  1.00 79.76  ? 118 PHE A C   1 
ATOM   927  O O   . PHE A 1 118 ? 25.388  15.547  54.387  1.00 79.15  ? 118 PHE A O   1 
ATOM   928  C CB  . PHE A 1 118 ? 24.729  18.713  55.350  1.00 71.31  ? 118 PHE A CB  1 
ATOM   929  C CG  . PHE A 1 118 ? 25.880  18.967  54.422  1.00 77.52  ? 118 PHE A CG  1 
ATOM   930  C CD1 . PHE A 1 118 ? 27.042  19.552  54.886  1.00 79.93  ? 118 PHE A CD1 1 
ATOM   931  C CD2 . PHE A 1 118 ? 25.802  18.625  53.088  1.00 77.45  ? 118 PHE A CD2 1 
ATOM   932  C CE1 . PHE A 1 118 ? 28.107  19.791  54.035  1.00 74.38  ? 118 PHE A CE1 1 
ATOM   933  C CE2 . PHE A 1 118 ? 26.865  18.862  52.237  1.00 73.79  ? 118 PHE A CE2 1 
ATOM   934  C CZ  . PHE A 1 118 ? 28.016  19.445  52.716  1.00 71.52  ? 118 PHE A CZ  1 
ATOM   935  N N   . THR A 1 119 ? 23.284  16.297  54.129  1.00 84.05  ? 119 THR A N   1 
ATOM   936  C CA  . THR A 1 119 ? 22.980  15.419  53.001  1.00 84.77  ? 119 THR A CA  1 
ATOM   937  C C   . THR A 1 119 ? 22.379  16.167  51.815  1.00 81.63  ? 119 THR A C   1 
ATOM   938  O O   . THR A 1 119 ? 21.371  16.857  51.944  1.00 81.63  ? 119 THR A O   1 
ATOM   939  C CB  . THR A 1 119 ? 22.009  14.291  53.403  1.00 83.95  ? 119 THR A CB  1 
ATOM   940  O OG1 . THR A 1 119 ? 22.751  13.117  53.760  1.00 89.09  ? 119 THR A OG1 1 
ATOM   941  C CG2 . THR A 1 119 ? 21.074  13.961  52.250  1.00 74.48  ? 119 THR A CG2 1 
ATOM   942  N N   . CYS A 1 120 ? 23.000  16.014  50.651  1.00 85.52  ? 120 CYS A N   1 
ATOM   943  C CA  . CYS A 1 120 ? 22.472  16.588  49.415  1.00 87.22  ? 120 CYS A CA  1 
ATOM   944  C C   . CYS A 1 120 ? 21.767  15.545  48.545  1.00 97.00  ? 120 CYS A C   1 
ATOM   945  O O   . CYS A 1 120 ? 22.031  14.346  48.653  1.00 99.34  ? 120 CYS A O   1 
ATOM   946  C CB  . CYS A 1 120 ? 23.585  17.271  48.621  1.00 70.34  ? 120 CYS A CB  1 
ATOM   947  S SG  . CYS A 1 120 ? 24.153  18.813  49.353  1.00 112.49 ? 120 CYS A SG  1 
ATOM   948  N N   . TRP A 1 121 ? 20.870  16.009  47.682  1.00 95.78  ? 121 TRP A N   1 
ATOM   949  C CA  . TRP A 1 121 ? 20.132  15.114  46.799  1.00 94.21  ? 121 TRP A CA  1 
ATOM   950  C C   . TRP A 1 121 ? 19.637  15.813  45.535  1.00 92.65  ? 121 TRP A C   1 
ATOM   951  O O   . TRP A 1 121 ? 19.057  16.894  45.595  1.00 94.36  ? 121 TRP A O   1 
ATOM   952  C CB  . TRP A 1 121 ? 18.963  14.476  47.547  1.00 103.29 ? 121 TRP A CB  1 
ATOM   953  C CG  . TRP A 1 121 ? 18.258  15.420  48.464  1.00 126.51 ? 121 TRP A CG  1 
ATOM   954  C CD1 . TRP A 1 121 ? 18.715  15.899  49.661  1.00 134.84 ? 121 TRP A CD1 1 
ATOM   955  C CD2 . TRP A 1 121 ? 16.963  15.996  48.270  1.00 141.46 ? 121 TRP A CD2 1 
ATOM   956  N NE1 . TRP A 1 121 ? 17.784  16.740  50.222  1.00 139.01 ? 121 TRP A NE1 1 
ATOM   957  C CE2 . TRP A 1 121 ? 16.699  16.817  49.388  1.00 146.57 ? 121 TRP A CE2 1 
ATOM   958  C CE3 . TRP A 1 121 ? 16.001  15.899  47.259  1.00 148.41 ? 121 TRP A CE3 1 
ATOM   959  C CZ2 . TRP A 1 121 ? 15.513  17.536  49.523  1.00 155.22 ? 121 TRP A CZ2 1 
ATOM   960  C CZ3 . TRP A 1 121 ? 14.824  16.615  47.394  1.00 159.01 ? 121 TRP A CZ3 1 
ATOM   961  C CH2 . TRP A 1 121 ? 14.590  17.423  48.519  1.00 161.86 ? 121 TRP A CH2 1 
ATOM   962  N N   . TRP A 1 122 ? 19.876  15.184  44.390  1.00 88.72  ? 122 TRP A N   1 
ATOM   963  C CA  . TRP A 1 122 ? 19.418  15.715  43.113  1.00 89.16  ? 122 TRP A CA  1 
ATOM   964  C C   . TRP A 1 122 ? 18.443  14.757  42.447  1.00 85.08  ? 122 TRP A C   1 
ATOM   965  O O   . TRP A 1 122 ? 18.343  13.597  42.836  1.00 66.05  ? 122 TRP A O   1 
ATOM   966  C CB  . TRP A 1 122 ? 20.603  15.978  42.194  1.00 93.41  ? 122 TRP A CB  1 
ATOM   967  C CG  . TRP A 1 122 ? 21.600  14.878  42.212  1.00 91.51  ? 122 TRP A CG  1 
ATOM   968  C CD1 . TRP A 1 122 ? 21.607  13.774  41.423  1.00 99.57  ? 122 TRP A CD1 1 
ATOM   969  C CD2 . TRP A 1 122 ? 22.741  14.771  43.068  1.00 94.89  ? 122 TRP A CD2 1 
ATOM   970  N NE1 . TRP A 1 122 ? 22.686  12.982  41.728  1.00 107.87 ? 122 TRP A NE1 1 
ATOM   971  C CE2 . TRP A 1 122 ? 23.399  13.573  42.736  1.00 105.23 ? 122 TRP A CE2 1 
ATOM   972  C CE3 . TRP A 1 122 ? 23.272  15.572  44.082  1.00 100.25 ? 122 TRP A CE3 1 
ATOM   973  C CZ2 . TRP A 1 122 ? 24.559  13.155  43.380  1.00 113.38 ? 122 TRP A CZ2 1 
ATOM   974  C CZ3 . TRP A 1 122 ? 24.424  15.158  44.719  1.00 107.42 ? 122 TRP A CZ3 1 
ATOM   975  C CH2 . TRP A 1 122 ? 25.055  13.959  44.368  1.00 114.96 ? 122 TRP A CH2 1 
ATOM   976  N N   . LEU A 1 123 ? 17.724  15.257  41.446  1.00 86.58  ? 123 LEU A N   1 
ATOM   977  C CA  . LEU A 1 123 ? 16.727  14.468  40.722  1.00 83.48  ? 123 LEU A CA  1 
ATOM   978  C C   . LEU A 1 123 ? 17.069  14.326  39.239  1.00 85.62  ? 123 LEU A C   1 
ATOM   979  O O   . LEU A 1 123 ? 17.607  15.245  38.624  1.00 91.48  ? 123 LEU A O   1 
ATOM   980  C CB  . LEU A 1 123 ? 15.340  15.098  40.878  1.00 79.24  ? 123 LEU A CB  1 
ATOM   981  C CG  . LEU A 1 123 ? 14.422  14.521  41.960  1.00 79.36  ? 123 LEU A CG  1 
ATOM   982  C CD1 . LEU A 1 123 ? 15.196  14.193  43.222  1.00 74.17  ? 123 LEU A CD1 1 
ATOM   983  C CD2 . LEU A 1 123 ? 13.273  15.472  42.257  1.00 81.02  ? 123 LEU A CD2 1 
ATOM   984  N N   . THR A 1 124 ? 16.740  13.173  38.667  1.00 85.25  ? 124 THR A N   1 
ATOM   985  C CA  . THR A 1 124 ? 17.044  12.895  37.265  1.00 87.72  ? 124 THR A CA  1 
ATOM   986  C C   . THR A 1 124 ? 16.084  11.878  36.641  1.00 87.76  ? 124 THR A C   1 
ATOM   987  O O   . THR A 1 124 ? 15.705  10.903  37.283  1.00 95.54  ? 124 THR A O   1 
ATOM   988  C CB  . THR A 1 124 ? 18.488  12.386  37.107  1.00 88.28  ? 124 THR A CB  1 
ATOM   989  O OG1 . THR A 1 124 ? 18.595  11.618  35.907  1.00 86.49  ? 124 THR A OG1 1 
ATOM   990  C CG2 . THR A 1 124 ? 18.880  11.509  38.288  1.00 93.87  ? 124 THR A CG2 1 
ATOM   991  N N   . THR A 1 125 ? 15.694  12.108  35.389  1.00 87.68  ? 125 THR A N   1 
ATOM   992  C CA  . THR A 1 125 ? 14.826  11.171  34.668  1.00 90.53  ? 125 THR A CA  1 
ATOM   993  C C   . THR A 1 125 ? 15.628  10.049  34.023  1.00 86.78  ? 125 THR A C   1 
ATOM   994  O O   . THR A 1 125 ? 15.075  9.017   33.650  1.00 79.36  ? 125 THR A O   1 
ATOM   995  C CB  . THR A 1 125 ? 14.013  11.864  33.559  1.00 91.15  ? 125 THR A CB  1 
ATOM   996  O OG1 . THR A 1 125 ? 14.906  12.560  32.683  1.00 92.22  ? 125 THR A OG1 1 
ATOM   997  C CG2 . THR A 1 125 ? 13.013  12.844  34.152  1.00 88.81  ? 125 THR A CG2 1 
ATOM   998  N N   . ILE A 1 126 ? 16.932  10.271  33.883  1.00 95.05  ? 126 ILE A N   1 
ATOM   999  C CA  . ILE A 1 126 ? 17.842  9.282   33.313  1.00 93.75  ? 126 ILE A CA  1 
ATOM   1000 C C   . ILE A 1 126 ? 18.032  8.117   34.279  1.00 89.68  ? 126 ILE A C   1 
ATOM   1001 O O   . ILE A 1 126 ? 17.887  8.275   35.485  1.00 82.31  ? 126 ILE A O   1 
ATOM   1002 C CB  . ILE A 1 126 ? 19.221  9.906   32.966  1.00 99.61  ? 126 ILE A CB  1 
ATOM   1003 C CG1 . ILE A 1 126 ? 19.082  10.990  31.885  1.00 95.13  ? 126 ILE A CG1 1 
ATOM   1004 C CG2 . ILE A 1 126 ? 20.199  8.832   32.503  1.00 96.67  ? 126 ILE A CG2 1 
ATOM   1005 C CD1 . ILE A 1 126 ? 18.619  12.343  32.391  1.00 84.35  ? 126 ILE A CD1 1 
ATOM   1006 N N   . SER A 1 127 ? 18.355  6.946   33.742  1.00 97.20  ? 127 SER A N   1 
ATOM   1007 C CA  . SER A 1 127 ? 18.485  5.748   34.558  1.00 97.39  ? 127 SER A CA  1 
ATOM   1008 C C   . SER A 1 127 ? 19.576  4.814   34.054  1.00 95.96  ? 127 SER A C   1 
ATOM   1009 O O   . SER A 1 127 ? 19.601  3.640   34.404  1.00 105.79 ? 127 SER A O   1 
ATOM   1010 C CB  . SER A 1 127 ? 17.155  4.996   34.593  1.00 98.88  ? 127 SER A CB  1 
ATOM   1011 O OG  . SER A 1 127 ? 16.762  4.606   33.287  1.00 96.05  ? 127 SER A OG  1 
ATOM   1012 N N   . THR A 1 128 ? 20.476  5.329   33.227  1.00 90.58  ? 128 THR A N   1 
ATOM   1013 C CA  . THR A 1 128 ? 21.528  4.494   32.667  1.00 86.77  ? 128 THR A CA  1 
ATOM   1014 C C   . THR A 1 128 ? 22.789  5.295   32.347  1.00 84.19  ? 128 THR A C   1 
ATOM   1015 O O   . THR A 1 128 ? 22.725  6.494   32.071  1.00 83.04  ? 128 THR A O   1 
ATOM   1016 C CB  . THR A 1 128 ? 21.042  3.765   31.401  1.00 101.22 ? 128 THR A CB  1 
ATOM   1017 O OG1 . THR A 1 128 ? 21.975  2.738   31.051  1.00 111.63 ? 128 THR A OG1 1 
ATOM   1018 C CG2 . THR A 1 128 ? 20.895  4.741   30.237  1.00 101.97 ? 128 THR A CG2 1 
ATOM   1019 N N   . ASP A 1 129 ? 23.933  4.621   32.401  1.00 84.78  ? 129 ASP A N   1 
ATOM   1020 C CA  . ASP A 1 129 ? 25.215  5.231   32.066  1.00 81.41  ? 129 ASP A CA  1 
ATOM   1021 C C   . ASP A 1 129 ? 25.468  6.507   32.845  1.00 87.99  ? 129 ASP A C   1 
ATOM   1022 O O   . ASP A 1 129 ? 25.993  7.475   32.304  1.00 92.15  ? 129 ASP A O   1 
ATOM   1023 C CB  . ASP A 1 129 ? 25.291  5.509   30.571  1.00 81.23  ? 129 ASP A CB  1 
ATOM   1024 C CG  . ASP A 1 129 ? 25.080  4.264   29.749  1.00 93.50  ? 129 ASP A CG  1 
ATOM   1025 O OD1 . ASP A 1 129 ? 24.003  4.140   29.129  1.00 99.38  ? 129 ASP A OD1 1 
ATOM   1026 O OD2 . ASP A 1 129 ? 25.978  3.396   29.752  1.00 97.53  ? 129 ASP A OD2 1 
ATOM   1027 N N   . LEU A 1 130 ? 25.088  6.492   34.120  1.00 94.43  ? 130 LEU A N   1 
ATOM   1028 C CA  . LEU A 1 130 ? 25.288  7.630   35.014  1.00 82.11  ? 130 LEU A CA  1 
ATOM   1029 C C   . LEU A 1 130 ? 26.451  7.399   35.963  1.00 79.91  ? 130 LEU A C   1 
ATOM   1030 O O   . LEU A 1 130 ? 26.660  6.290   36.454  1.00 82.32  ? 130 LEU A O   1 
ATOM   1031 C CB  . LEU A 1 130 ? 24.020  7.915   35.812  1.00 70.46  ? 130 LEU A CB  1 
ATOM   1032 C CG  . LEU A 1 130 ? 23.000  8.712   35.011  1.00 72.39  ? 130 LEU A CG  1 
ATOM   1033 C CD1 . LEU A 1 130 ? 21.674  8.769   35.741  1.00 78.72  ? 130 LEU A CD1 1 
ATOM   1034 C CD2 . LEU A 1 130 ? 23.544  10.099  34.747  1.00 65.68  ? 130 LEU A CD2 1 
ATOM   1035 N N   . THR A 1 131 ? 27.209  8.459   36.210  1.00 73.44  ? 131 THR A N   1 
ATOM   1036 C CA  . THR A 1 131 ? 28.375  8.393   37.072  1.00 78.04  ? 131 THR A CA  1 
ATOM   1037 C C   . THR A 1 131 ? 28.648  9.768   37.667  1.00 89.65  ? 131 THR A C   1 
ATOM   1038 O O   . THR A 1 131 ? 28.986  10.710  36.952  1.00 87.00  ? 131 THR A O   1 
ATOM   1039 C CB  . THR A 1 131 ? 29.616  7.902   36.308  1.00 82.87  ? 131 THR A CB  1 
ATOM   1040 O OG1 . THR A 1 131 ? 30.772  8.603   36.782  1.00 87.58  ? 131 THR A OG1 1 
ATOM   1041 C CG2 . THR A 1 131 ? 29.463  8.155   34.813  1.00 83.17  ? 131 THR A CG2 1 
ATOM   1042 N N   . PHE A 1 132 ? 28.496  9.874   38.984  1.00 100.50 ? 132 PHE A N   1 
ATOM   1043 C CA  . PHE A 1 132 ? 28.667  11.148  39.675  1.00 89.46  ? 132 PHE A CA  1 
ATOM   1044 C C   . PHE A 1 132 ? 29.963  11.229  40.466  1.00 86.42  ? 132 PHE A C   1 
ATOM   1045 O O   . PHE A 1 132 ? 30.715  10.263  40.574  1.00 87.76  ? 132 PHE A O   1 
ATOM   1046 C CB  . PHE A 1 132 ? 27.479  11.431  40.598  1.00 72.46  ? 132 PHE A CB  1 
ATOM   1047 C CG  . PHE A 1 132 ? 26.174  11.535  39.878  1.00 74.25  ? 132 PHE A CG  1 
ATOM   1048 C CD1 . PHE A 1 132 ? 25.900  12.635  39.091  1.00 76.39  ? 132 PHE A CD1 1 
ATOM   1049 C CD2 . PHE A 1 132 ? 25.222  10.535  39.982  1.00 80.03  ? 132 PHE A CD2 1 
ATOM   1050 C CE1 . PHE A 1 132 ? 24.702  12.740  38.422  1.00 73.70  ? 132 PHE A CE1 1 
ATOM   1051 C CE2 . PHE A 1 132 ? 24.019  10.634  39.316  1.00 94.23  ? 132 PHE A CE2 1 
ATOM   1052 C CZ  . PHE A 1 132 ? 23.758  11.738  38.534  1.00 81.35  ? 132 PHE A CZ  1 
ATOM   1053 N N   . SER A 1 133 ? 30.215  12.405  41.016  1.00 60.64  ? 133 SER A N   1 
ATOM   1054 C CA  . SER A 1 133 ? 31.379  12.632  41.848  1.00 79.95  ? 133 SER A CA  1 
ATOM   1055 C C   . SER A 1 133 ? 31.126  13.904  42.620  1.00 79.96  ? 133 SER A C   1 
ATOM   1056 O O   . SER A 1 133 ? 30.780  14.923  42.030  1.00 85.01  ? 133 SER A O   1 
ATOM   1057 C CB  . SER A 1 133 ? 32.631  12.786  40.991  1.00 88.38  ? 133 SER A CB  1 
ATOM   1058 O OG  . SER A 1 133 ? 33.602  13.569  41.662  1.00 98.95  ? 133 SER A OG  1 
ATOM   1059 N N   . VAL A 1 134 ? 31.281  13.852  43.938  1.00 76.32  ? 134 VAL A N   1 
ATOM   1060 C CA  . VAL A 1 134 ? 31.015  15.028  44.754  1.00 69.88  ? 134 VAL A CA  1 
ATOM   1061 C C   . VAL A 1 134 ? 32.243  15.508  45.514  1.00 64.93  ? 134 VAL A C   1 
ATOM   1062 O O   . VAL A 1 134 ? 33.009  14.718  46.047  1.00 66.13  ? 134 VAL A O   1 
ATOM   1063 C CB  . VAL A 1 134 ? 29.865  14.793  45.734  1.00 69.07  ? 134 VAL A CB  1 
ATOM   1064 C CG1 . VAL A 1 134 ? 29.340  16.122  46.232  1.00 73.05  ? 134 VAL A CG1 1 
ATOM   1065 C CG2 . VAL A 1 134 ? 28.759  13.997  45.071  1.00 70.54  ? 134 VAL A CG2 1 
ATOM   1066 N N   . LYS A 1 135 ? 32.426  16.820  45.538  1.00 64.97  ? 135 LYS A N   1 
ATOM   1067 C CA  . LYS A 1 135 ? 33.509  17.447  46.285  1.00 80.56  ? 135 LYS A CA  1 
ATOM   1068 C C   . LYS A 1 135 ? 32.968  18.692  46.975  1.00 75.21  ? 135 LYS A C   1 
ATOM   1069 O O   . LYS A 1 135 ? 31.968  19.254  46.539  1.00 68.91  ? 135 LYS A O   1 
ATOM   1070 C CB  . LYS A 1 135 ? 34.699  17.791  45.373  1.00 88.80  ? 135 LYS A CB  1 
ATOM   1071 C CG  . LYS A 1 135 ? 34.424  18.812  44.261  1.00 98.84  ? 135 LYS A CG  1 
ATOM   1072 C CD  . LYS A 1 135 ? 33.828  18.166  43.004  1.00 104.55 ? 135 LYS A CD  1 
ATOM   1073 C CE  . LYS A 1 135 ? 34.846  17.311  42.266  1.00 103.23 ? 135 LYS A CE  1 
ATOM   1074 N NZ  . LYS A 1 135 ? 34.191  16.230  41.479  1.00 92.23  ? 135 LYS A NZ  1 
ATOM   1075 N N   . SER A 1 136 ? 33.609  19.116  48.062  1.00 82.76  ? 136 SER A N   1 
ATOM   1076 C CA  . SER A 1 136 ? 33.100  20.266  48.809  1.00 80.13  ? 136 SER A CA  1 
ATOM   1077 C C   . SER A 1 136 ? 34.147  20.989  49.650  1.00 86.77  ? 136 SER A C   1 
ATOM   1078 O O   . SER A 1 136 ? 35.199  20.439  49.968  1.00 99.12  ? 136 SER A O   1 
ATOM   1079 C CB  . SER A 1 136 ? 31.923  19.849  49.691  1.00 74.84  ? 136 SER A CB  1 
ATOM   1080 O OG  . SER A 1 136 ? 31.168  20.975  50.086  1.00 68.05  ? 136 SER A OG  1 
ATOM   1081 N N   . SER A 1 137 ? 33.836  22.229  50.011  1.00 89.19  ? 137 SER A N   1 
ATOM   1082 C CA  . SER A 1 137 ? 34.734  23.056  50.812  1.00 96.19  ? 137 SER A CA  1 
ATOM   1083 C C   . SER A 1 137 ? 34.077  24.374  51.214  1.00 97.32  ? 137 SER A C   1 
ATOM   1084 O O   . SER A 1 137 ? 33.196  24.877  50.515  1.00 100.61 ? 137 SER A O   1 
ATOM   1085 C CB  . SER A 1 137 ? 36.018  23.350  50.037  1.00 98.15  ? 137 SER A CB  1 
ATOM   1086 O OG  . SER A 1 137 ? 35.755  24.166  48.908  1.00 94.83  ? 137 SER A OG  1 
ATOM   1087 N N   . ARG A 1 138 ? 34.505  24.929  52.344  1.00 94.78  ? 138 ARG A N   1 
ATOM   1088 C CA  . ARG A 1 138 ? 34.037  26.243  52.763  1.00 96.97  ? 138 ARG A CA  1 
ATOM   1089 C C   . ARG A 1 138 ? 35.118  27.287  52.514  1.00 98.82  ? 138 ARG A C   1 
ATOM   1090 O O   . ARG A 1 138 ? 36.180  27.260  53.136  1.00 91.04  ? 138 ARG A O   1 
ATOM   1091 C CB  . ARG A 1 138 ? 33.618  26.246  54.235  1.00 99.19  ? 138 ARG A CB  1 
ATOM   1092 C CG  . ARG A 1 138 ? 32.825  27.484  54.647  1.00 91.58  ? 138 ARG A CG  1 
ATOM   1093 C CD  . ARG A 1 138 ? 32.613  27.546  56.145  1.00 75.59  ? 138 ARG A CD  1 
ATOM   1094 N NE  . ARG A 1 138 ? 31.831  26.422  56.653  1.00 75.02  ? 138 ARG A NE  1 
ATOM   1095 C CZ  . ARG A 1 138 ? 30.522  26.460  56.877  1.00 78.58  ? 138 ARG A CZ  1 
ATOM   1096 N NH1 . ARG A 1 138 ? 29.831  27.562  56.627  1.00 78.49  ? 138 ARG A NH1 1 
ATOM   1097 N NH2 . ARG A 1 138 ? 29.900  25.392  57.349  1.00 74.05  ? 138 ARG A NH2 1 
ATOM   1098 N N   . GLY A 1 139 ? 34.841  28.204  51.592  1.00 109.40 ? 139 GLY A N   1 
ATOM   1099 C CA  . GLY A 1 139 ? 35.782  29.252  51.252  1.00 116.36 ? 139 GLY A CA  1 
ATOM   1100 C C   . GLY A 1 139 ? 36.993  28.704  50.529  1.00 125.98 ? 139 GLY A C   1 
ATOM   1101 O O   . GLY A 1 139 ? 37.156  27.491  50.406  1.00 125.06 ? 139 GLY A O   1 
ATOM   1102 N N   . SER A 1 140 ? 37.844  29.603  50.046  1.00 136.94 ? 140 SER A N   1 
ATOM   1103 C CA  . SER A 1 140 ? 39.055  29.205  49.339  1.00 141.43 ? 140 SER A CA  1 
ATOM   1104 C C   . SER A 1 140 ? 40.073  28.610  50.304  1.00 146.11 ? 140 SER A C   1 
ATOM   1105 O O   . SER A 1 140 ? 41.060  28.008  49.886  1.00 146.69 ? 140 SER A O   1 
ATOM   1106 C CB  . SER A 1 140 ? 39.663  30.398  48.595  1.00 139.12 ? 140 SER A CB  1 
ATOM   1107 O OG  . SER A 1 140 ? 39.899  31.482  49.476  1.00 136.43 ? 140 SER A OG  1 
ATOM   1108 N N   . SER A 1 141 ? 39.822  28.778  51.599  1.00 147.37 ? 141 SER A N   1 
ATOM   1109 C CA  . SER A 1 141 ? 40.727  28.277  52.623  1.00 147.43 ? 141 SER A CA  1 
ATOM   1110 C C   . SER A 1 141 ? 40.649  26.754  52.731  1.00 156.87 ? 141 SER A C   1 
ATOM   1111 O O   . SER A 1 141 ? 40.267  26.079  51.773  1.00 161.70 ? 141 SER A O   1 
ATOM   1112 C CB  . SER A 1 141 ? 40.426  28.933  53.971  1.00 141.60 ? 141 SER A CB  1 
ATOM   1113 O OG  . SER A 1 141 ? 41.520  28.782  54.860  1.00 143.20 ? 141 SER A OG  1 
ATOM   1114 N N   . ASP A 1 142 ? 41.006  26.227  53.900  1.00 157.88 ? 142 ASP A N   1 
ATOM   1115 C CA  . ASP A 1 142 ? 41.102  24.782  54.133  1.00 155.06 ? 142 ASP A CA  1 
ATOM   1116 C C   . ASP A 1 142 ? 40.418  23.914  53.078  1.00 150.76 ? 142 ASP A C   1 
ATOM   1117 O O   . ASP A 1 142 ? 39.199  23.730  53.104  1.00 147.25 ? 142 ASP A O   1 
ATOM   1118 C CB  . ASP A 1 142 ? 40.595  24.422  55.537  1.00 158.93 ? 142 ASP A CB  1 
ATOM   1119 C CG  . ASP A 1 142 ? 39.211  24.975  55.822  1.00 159.46 ? 142 ASP A CG  1 
ATOM   1120 O OD1 . ASP A 1 142 ? 38.255  24.613  55.102  1.00 158.04 ? 142 ASP A OD1 1 
ATOM   1121 O OD2 . ASP A 1 142 ? 39.078  25.763  56.780  1.00 160.80 ? 142 ASP A OD2 1 
ATOM   1122 N N   . PRO A 1 143 ? 41.213  23.382  52.137  1.00 151.19 ? 143 PRO A N   1 
ATOM   1123 C CA  . PRO A 1 143 ? 40.735  22.459  51.102  1.00 148.14 ? 143 PRO A CA  1 
ATOM   1124 C C   . PRO A 1 143 ? 40.213  21.172  51.731  1.00 145.27 ? 143 PRO A C   1 
ATOM   1125 O O   . PRO A 1 143 ? 39.386  20.475  51.142  1.00 128.79 ? 143 PRO A O   1 
ATOM   1126 C CB  . PRO A 1 143 ? 41.997  22.171  50.281  1.00 147.93 ? 143 PRO A CB  1 
ATOM   1127 C CG  . PRO A 1 143 ? 42.916  23.316  50.569  1.00 149.36 ? 143 PRO A CG  1 
ATOM   1128 C CD  . PRO A 1 143 ? 42.647  23.680  51.992  1.00 149.92 ? 143 PRO A CD  1 
ATOM   1129 N N   . GLN A 1 144 ? 40.704  20.870  52.929  1.00 155.90 ? 144 GLN A N   1 
ATOM   1130 C CA  . GLN A 1 144 ? 40.241  19.715  53.686  1.00 156.34 ? 144 GLN A CA  1 
ATOM   1131 C C   . GLN A 1 144 ? 39.011  20.048  54.527  1.00 149.04 ? 144 GLN A C   1 
ATOM   1132 O O   . GLN A 1 144 ? 38.281  21.001  54.246  1.00 140.71 ? 144 GLN A O   1 
ATOM   1133 C CB  . GLN A 1 144 ? 41.359  19.171  54.581  1.00 164.73 ? 144 GLN A CB  1 
ATOM   1134 C CG  . GLN A 1 144 ? 42.023  17.897  54.069  1.00 169.46 ? 144 GLN A CG  1 
ATOM   1135 C CD  . GLN A 1 144 ? 42.822  18.106  52.797  1.00 169.62 ? 144 GLN A CD  1 
ATOM   1136 O OE1 . GLN A 1 144 ? 42.899  19.217  52.269  1.00 172.31 ? 144 GLN A OE1 1 
ATOM   1137 N NE2 . GLN A 1 144 ? 43.427  17.034  52.300  1.00 165.54 ? 144 GLN A NE2 1 
ATOM   1138 N N   . GLY A 1 145 ? 38.796  19.255  55.570  1.00 149.34 ? 145 GLY A N   1 
ATOM   1139 C CA  . GLY A 1 145 ? 37.616  19.399  56.398  1.00 141.08 ? 145 GLY A CA  1 
ATOM   1140 C C   . GLY A 1 145 ? 36.453  18.666  55.767  1.00 130.30 ? 145 GLY A C   1 
ATOM   1141 O O   . GLY A 1 145 ? 36.188  17.502  56.086  1.00 134.03 ? 145 GLY A O   1 
ATOM   1142 N N   . VAL A 1 146 ? 35.773  19.346  54.850  1.00 110.05 ? 146 VAL A N   1 
ATOM   1143 C CA  . VAL A 1 146 ? 34.625  18.771  54.157  1.00 98.66  ? 146 VAL A CA  1 
ATOM   1144 C C   . VAL A 1 146 ? 35.004  17.617  53.234  1.00 94.38  ? 146 VAL A C   1 
ATOM   1145 O O   . VAL A 1 146 ? 35.716  17.809  52.246  1.00 89.88  ? 146 VAL A O   1 
ATOM   1146 C CB  . VAL A 1 146 ? 33.903  19.821  53.322  1.00 86.07  ? 146 VAL A CB  1 
ATOM   1147 C CG1 . VAL A 1 146 ? 32.488  19.357  53.029  1.00 80.93  ? 146 VAL A CG1 1 
ATOM   1148 C CG2 . VAL A 1 146 ? 33.895  21.145  54.054  1.00 94.24  ? 146 VAL A CG2 1 
ATOM   1149 N N   . THR A 1 147 ? 34.522  16.423  53.566  1.00 83.90  ? 147 THR A N   1 
ATOM   1150 C CA  . THR A 1 147 ? 34.717  15.253  52.725  1.00 84.84  ? 147 THR A CA  1 
ATOM   1151 C C   . THR A 1 147 ? 33.366  14.623  52.427  1.00 89.53  ? 147 THR A C   1 
ATOM   1152 O O   . THR A 1 147 ? 32.434  14.732  53.223  1.00 89.57  ? 147 THR A O   1 
ATOM   1153 C CB  . THR A 1 147 ? 35.608  14.217  53.395  1.00 89.26  ? 147 THR A CB  1 
ATOM   1154 O OG1 . THR A 1 147 ? 34.865  13.539  54.415  1.00 98.96  ? 147 THR A OG1 1 
ATOM   1155 C CG2 . THR A 1 147 ? 36.829  14.886  54.000  1.00 90.78  ? 147 THR A CG2 1 
ATOM   1156 N N   . CYS A 1 148 ? 33.264  13.962  51.278  1.00 86.34  ? 148 CYS A N   1 
ATOM   1157 C CA  . CYS A 1 148 ? 31.977  13.479  50.802  1.00 85.89  ? 148 CYS A CA  1 
ATOM   1158 C C   . CYS A 1 148 ? 32.001  12.014  50.405  1.00 93.74  ? 148 CYS A C   1 
ATOM   1159 O O   . CYS A 1 148 ? 32.990  11.518  49.865  1.00 100.91 ? 148 CYS A O   1 
ATOM   1160 C CB  . CYS A 1 148 ? 31.503  14.323  49.623  1.00 81.65  ? 148 CYS A CB  1 
ATOM   1161 S SG  . CYS A 1 148 ? 30.858  15.935  50.090  1.00 127.94 ? 148 CYS A SG  1 
ATOM   1162 N N   . GLY A 1 149 ? 30.897  11.327  50.669  1.00 89.11  ? 149 GLY A N   1 
ATOM   1163 C CA  . GLY A 1 149 ? 30.770  9.935   50.296  1.00 88.87  ? 149 GLY A CA  1 
ATOM   1164 C C   . GLY A 1 149 ? 30.469  9.768   48.819  1.00 87.88  ? 149 GLY A C   1 
ATOM   1165 O O   . GLY A 1 149 ? 30.857  10.592  47.982  1.00 76.66  ? 149 GLY A O   1 
ATOM   1166 N N   . ALA A 1 150 ? 29.766  8.686   48.508  1.00 81.21  ? 150 ALA A N   1 
ATOM   1167 C CA  . ALA A 1 150 ? 29.423  8.357   47.143  1.00 74.41  ? 150 ALA A CA  1 
ATOM   1168 C C   . ALA A 1 150 ? 27.942  8.596   46.895  1.00 78.01  ? 150 ALA A C   1 
ATOM   1169 O O   . ALA A 1 150 ? 27.107  8.260   47.726  1.00 82.04  ? 150 ALA A O   1 
ATOM   1170 C CB  . ALA A 1 150 ? 29.780  6.918   46.865  1.00 77.28  ? 150 ALA A CB  1 
ATOM   1171 N N   . ALA A 1 151 ? 27.614  9.179   45.749  1.00 82.53  ? 151 ALA A N   1 
ATOM   1172 C CA  . ALA A 1 151 ? 26.221  9.413   45.419  1.00 80.91  ? 151 ALA A CA  1 
ATOM   1173 C C   . ALA A 1 151 ? 25.536  8.066   45.253  1.00 72.62  ? 151 ALA A C   1 
ATOM   1174 O O   . ALA A 1 151 ? 26.082  7.171   44.620  1.00 71.31  ? 151 ALA A O   1 
ATOM   1175 C CB  . ALA A 1 151 ? 26.109  10.243  44.152  1.00 63.64  ? 151 ALA A CB  1 
ATOM   1176 N N   . THR A 1 152 ? 24.355  7.912   45.842  1.00 75.48  ? 152 THR A N   1 
ATOM   1177 C CA  . THR A 1 152 ? 23.616  6.658   45.731  1.00 85.48  ? 152 THR A CA  1 
ATOM   1178 C C   . THR A 1 152 ? 22.156  6.882   45.348  1.00 90.80  ? 152 THR A C   1 
ATOM   1179 O O   . THR A 1 152 ? 21.626  7.981   45.504  1.00 87.33  ? 152 THR A O   1 
ATOM   1180 C CB  . THR A 1 152 ? 23.663  5.853   47.043  1.00 91.77  ? 152 THR A CB  1 
ATOM   1181 O OG1 . THR A 1 152 ? 23.068  6.621   48.097  1.00 106.39 ? 152 THR A OG1 1 
ATOM   1182 C CG2 . THR A 1 152 ? 25.097  5.511   47.416  1.00 85.56  ? 152 THR A CG2 1 
ATOM   1183 N N   . LEU A 1 153 ? 21.516  5.831   44.845  1.00 96.95  ? 153 LEU A N   1 
ATOM   1184 C CA  . LEU A 1 153 ? 20.098  5.877   44.511  1.00 100.85 ? 153 LEU A CA  1 
ATOM   1185 C C   . LEU A 1 153 ? 19.287  5.914   45.804  1.00 98.15  ? 153 LEU A C   1 
ATOM   1186 O O   . LEU A 1 153 ? 19.693  5.340   46.815  1.00 99.65  ? 153 LEU A O   1 
ATOM   1187 C CB  . LEU A 1 153 ? 19.715  4.665   43.655  1.00 103.48 ? 153 LEU A CB  1 
ATOM   1188 C CG  . LEU A 1 153 ? 18.361  4.647   42.935  1.00 105.56 ? 153 LEU A CG  1 
ATOM   1189 C CD1 . LEU A 1 153 ? 17.220  4.254   43.872  1.00 113.27 ? 153 LEU A CD1 1 
ATOM   1190 C CD2 . LEU A 1 153 ? 18.075  5.979   42.256  1.00 100.70 ? 153 LEU A CD2 1 
ATOM   1191 N N   . SER A 1 154 ? 18.145  6.591   45.778  1.00 99.75  ? 154 SER A N   1 
ATOM   1192 C CA  . SER A 1 154 ? 17.376  6.805   46.999  1.00 101.79 ? 154 SER A CA  1 
ATOM   1193 C C   . SER A 1 154 ? 15.858  6.724   46.811  1.00 112.07 ? 154 SER A C   1 
ATOM   1194 O O   . SER A 1 154 ? 15.131  6.454   47.768  1.00 109.08 ? 154 SER A O   1 
ATOM   1195 C CB  . SER A 1 154 ? 17.757  8.150   47.625  1.00 97.45  ? 154 SER A CB  1 
ATOM   1196 O OG  . SER A 1 154 ? 19.151  8.216   47.879  1.00 96.07  ? 154 SER A OG  1 
ATOM   1197 N N   . ALA A 1 155 ? 15.377  6.954   45.588  1.00 121.73 ? 155 ALA A N   1 
ATOM   1198 C CA  . ALA A 1 155 ? 13.932  6.963   45.336  1.00 128.11 ? 155 ALA A CA  1 
ATOM   1199 C C   . ALA A 1 155 ? 13.530  6.599   43.904  1.00 124.55 ? 155 ALA A C   1 
ATOM   1200 O O   . ALA A 1 155 ? 14.379  6.344   43.056  1.00 122.87 ? 155 ALA A O   1 
ATOM   1201 C CB  . ALA A 1 155 ? 13.338  8.314   45.719  1.00 131.83 ? 155 ALA A CB  1 
ATOM   1202 N N   . GLU A 1 156 ? 12.222  6.573   43.659  1.00 127.17 ? 156 GLU A N   1 
ATOM   1203 C CA  . GLU A 1 156 ? 11.676  6.338   42.327  1.00 132.22 ? 156 GLU A CA  1 
ATOM   1204 C C   . GLU A 1 156 ? 10.222  6.805   42.270  1.00 140.77 ? 156 GLU A C   1 
ATOM   1205 O O   . GLU A 1 156 ? 9.302   6.001   42.129  1.00 140.88 ? 156 GLU A O   1 
ATOM   1206 C CB  . GLU A 1 156 ? 11.793  4.862   41.935  1.00 140.01 ? 156 GLU A CB  1 
ATOM   1207 C CG  . GLU A 1 156 ? 11.565  4.594   40.449  1.00 151.93 ? 156 GLU A CG  1 
ATOM   1208 C CD  . GLU A 1 156 ? 11.990  3.196   40.023  1.00 155.94 ? 156 GLU A CD  1 
ATOM   1209 O OE1 . GLU A 1 156 ? 11.817  2.857   38.830  1.00 151.44 ? 156 GLU A OE1 1 
ATOM   1210 O OE2 . GLU A 1 156 ? 12.498  2.439   40.879  1.00 156.46 ? 156 GLU A OE2 1 
ATOM   1211 N N   . ARG A 1 157 ? 10.032  8.115   42.386  1.00 154.04 ? 157 ARG A N   1 
ATOM   1212 C CA  . ARG A 1 157 ? 8.704   8.721   42.422  1.00 164.51 ? 157 ARG A CA  1 
ATOM   1213 C C   . ARG A 1 157 ? 8.142   8.907   41.017  1.00 175.01 ? 157 ARG A C   1 
ATOM   1214 O O   . ARG A 1 157 ? 8.192   10.003  40.458  1.00 178.23 ? 157 ARG A O   1 
ATOM   1215 C CB  . ARG A 1 157 ? 8.769   10.075  43.129  1.00 154.72 ? 157 ARG A CB  1 
ATOM   1216 C CG  . ARG A 1 157 ? 9.721   10.098  44.303  1.00 145.19 ? 157 ARG A CG  1 
ATOM   1217 C CD  . ARG A 1 157 ? 9.876   11.494  44.857  1.00 148.74 ? 157 ARG A CD  1 
ATOM   1218 N NE  . ARG A 1 157 ? 10.742  11.513  46.033  1.00 164.28 ? 157 ARG A NE  1 
ATOM   1219 C CZ  . ARG A 1 157 ? 10.347  11.186  47.262  1.00 172.33 ? 157 ARG A CZ  1 
ATOM   1220 N NH1 . ARG A 1 157 ? 9.095   10.806  47.482  1.00 177.39 ? 157 ARG A NH1 1 
ATOM   1221 N NH2 . ARG A 1 157 ? 11.205  11.236  48.274  1.00 169.24 ? 157 ARG A NH2 1 
ATOM   1222 N N   . VAL A 1 158 ? 7.597   7.833   40.459  1.00 176.76 ? 158 VAL A N   1 
ATOM   1223 C CA  . VAL A 1 158 ? 7.112   7.840   39.084  1.00 173.76 ? 158 VAL A CA  1 
ATOM   1224 C C   . VAL A 1 158 ? 6.163   9.004   38.795  1.00 176.17 ? 158 VAL A C   1 
ATOM   1225 O O   . VAL A 1 158 ? 5.392   9.427   39.655  1.00 169.60 ? 158 VAL A O   1 
ATOM   1226 C CB  . VAL A 1 158 ? 6.425   6.509   38.727  1.00 172.53 ? 158 VAL A CB  1 
ATOM   1227 C CG1 . VAL A 1 158 ? 6.270   6.381   37.220  1.00 174.03 ? 158 VAL A CG1 1 
ATOM   1228 C CG2 . VAL A 1 158 ? 7.226   5.341   39.279  1.00 166.95 ? 158 VAL A CG2 1 
ATOM   1229 N N   . ARG A 1 159 ? 6.239   9.513   37.569  1.00 186.48 ? 159 ARG A N   1 
ATOM   1230 C CA  . ARG A 1 159 ? 5.419   10.632  37.121  1.00 194.27 ? 159 ARG A CA  1 
ATOM   1231 C C   . ARG A 1 159 ? 4.897   10.361  35.711  1.00 199.27 ? 159 ARG A C   1 
ATOM   1232 O O   . ARG A 1 159 ? 5.414   9.488   35.013  1.00 202.13 ? 159 ARG A O   1 
ATOM   1233 C CB  . ARG A 1 159 ? 6.237   11.926  37.154  1.00 191.17 ? 159 ARG A CB  1 
ATOM   1234 C CG  . ARG A 1 159 ? 5.824   12.974  36.133  1.00 190.14 ? 159 ARG A CG  1 
ATOM   1235 C CD  . ARG A 1 159 ? 6.674   14.227  36.248  1.00 187.46 ? 159 ARG A CD  1 
ATOM   1236 N NE  . ARG A 1 159 ? 6.217   15.108  37.320  1.00 190.32 ? 159 ARG A NE  1 
ATOM   1237 C CZ  . ARG A 1 159 ? 6.630   15.037  38.582  1.00 189.70 ? 159 ARG A CZ  1 
ATOM   1238 N NH1 . ARG A 1 159 ? 6.154   15.885  39.484  1.00 190.17 ? 159 ARG A NH1 1 
ATOM   1239 N NH2 . ARG A 1 159 ? 7.517   14.120  38.946  1.00 186.98 ? 159 ARG A NH2 1 
ATOM   1240 N N   . GLY A 1 160 ? 3.869   11.101  35.302  1.00 197.46 ? 160 GLY A N   1 
ATOM   1241 C CA  . GLY A 1 160 ? 3.296   10.964  33.972  1.00 194.22 ? 160 GLY A CA  1 
ATOM   1242 C C   . GLY A 1 160 ? 4.331   10.684  32.897  1.00 186.71 ? 160 GLY A C   1 
ATOM   1243 O O   . GLY A 1 160 ? 5.138   11.551  32.555  1.00 182.29 ? 160 GLY A O   1 
ATOM   1244 N N   . ASP A 1 161 ? 4.301   9.462   32.369  1.00 182.24 ? 161 ASP A N   1 
ATOM   1245 C CA  . ASP A 1 161 ? 5.246   9.012   31.348  1.00 174.49 ? 161 ASP A CA  1 
ATOM   1246 C C   . ASP A 1 161 ? 6.608   8.634   31.937  1.00 162.10 ? 161 ASP A C   1 
ATOM   1247 O O   . ASP A 1 161 ? 6.833   7.480   32.306  1.00 161.32 ? 161 ASP A O   1 
ATOM   1248 C CB  . ASP A 1 161 ? 5.408   10.063  30.244  1.00 176.24 ? 161 ASP A CB  1 
ATOM   1249 N N   . ASN A 1 162 ? 7.510   9.608   32.020  1.00 149.03 ? 162 ASN A N   1 
ATOM   1250 C CA  . ASN A 1 162 ? 8.869   9.359   32.493  1.00 137.73 ? 162 ASN A CA  1 
ATOM   1251 C C   . ASN A 1 162 ? 8.956   9.170   34.006  1.00 143.15 ? 162 ASN A C   1 
ATOM   1252 O O   . ASN A 1 162 ? 8.322   9.900   34.770  1.00 148.88 ? 162 ASN A O   1 
ATOM   1253 C CB  . ASN A 1 162 ? 9.804   10.486  32.048  1.00 126.34 ? 162 ASN A CB  1 
ATOM   1254 N N   . LYS A 1 163 ? 9.749   8.188   34.430  1.00 135.62 ? 163 LYS A N   1 
ATOM   1255 C CA  . LYS A 1 163 ? 9.946   7.901   35.851  1.00 121.46 ? 163 LYS A CA  1 
ATOM   1256 C C   . LYS A 1 163 ? 11.090  8.731   36.430  1.00 110.49 ? 163 LYS A C   1 
ATOM   1257 O O   . LYS A 1 163 ? 12.112  8.930   35.779  1.00 105.76 ? 163 LYS A O   1 
ATOM   1258 C CB  . LYS A 1 163 ? 10.214  6.408   36.067  1.00 112.01 ? 163 LYS A CB  1 
ATOM   1259 N N   . GLU A 1 164 ? 10.910  9.209   37.657  1.00 105.10 ? 164 GLU A N   1 
ATOM   1260 C CA  . GLU A 1 164 ? 11.899  10.062  38.305  1.00 100.82 ? 164 GLU A CA  1 
ATOM   1261 C C   . GLU A 1 164 ? 12.782  9.252   39.254  1.00 101.02 ? 164 GLU A C   1 
ATOM   1262 O O   . GLU A 1 164 ? 12.310  8.331   39.917  1.00 107.05 ? 164 GLU A O   1 
ATOM   1263 C CB  . GLU A 1 164 ? 11.196  11.193  39.057  1.00 101.08 ? 164 GLU A CB  1 
ATOM   1264 C CG  . GLU A 1 164 ? 12.037  12.437  39.284  1.00 98.26  ? 164 GLU A CG  1 
ATOM   1265 C CD  . GLU A 1 164 ? 11.261  13.545  39.981  1.00 97.73  ? 164 GLU A CD  1 
ATOM   1266 O OE1 . GLU A 1 164 ? 10.562  13.251  40.972  1.00 101.04 ? 164 GLU A OE1 1 
ATOM   1267 O OE2 . GLU A 1 164 ? 11.346  14.711  39.540  1.00 96.43  ? 164 GLU A OE2 1 
ATOM   1268 N N   . TYR A 1 165 ? 14.067  9.594   39.304  1.00 92.14  ? 165 TYR A N   1 
ATOM   1269 C CA  . TYR A 1 165 ? 15.042  8.871   40.113  1.00 82.57  ? 165 TYR A CA  1 
ATOM   1270 C C   . TYR A 1 165 ? 15.816  9.853   40.970  1.00 79.59  ? 165 TYR A C   1 
ATOM   1271 O O   . TYR A 1 165 ? 16.401  10.798  40.451  1.00 75.88  ? 165 TYR A O   1 
ATOM   1272 C CB  . TYR A 1 165 ? 16.036  8.126   39.224  1.00 80.58  ? 165 TYR A CB  1 
ATOM   1273 C CG  . TYR A 1 165 ? 15.415  7.161   38.242  1.00 100.16 ? 165 TYR A CG  1 
ATOM   1274 C CD1 . TYR A 1 165 ? 14.687  7.619   37.152  1.00 107.97 ? 165 TYR A CD1 1 
ATOM   1275 C CD2 . TYR A 1 165 ? 15.578  5.791   38.391  1.00 111.67 ? 165 TYR A CD2 1 
ATOM   1276 C CE1 . TYR A 1 165 ? 14.122  6.738   36.249  1.00 116.50 ? 165 TYR A CE1 1 
ATOM   1277 C CE2 . TYR A 1 165 ? 15.020  4.901   37.490  1.00 119.57 ? 165 TYR A CE2 1 
ATOM   1278 C CZ  . TYR A 1 165 ? 14.291  5.381   36.422  1.00 119.77 ? 165 TYR A CZ  1 
ATOM   1279 O OH  . TYR A 1 165 ? 13.734  4.498   35.526  1.00 116.86 ? 165 TYR A OH  1 
ATOM   1280 N N   . GLU A 1 166 ? 15.837  9.622   42.278  1.00 82.25  ? 166 GLU A N   1 
ATOM   1281 C CA  . GLU A 1 166 ? 16.515  10.530  43.201  1.00 88.55  ? 166 GLU A CA  1 
ATOM   1282 C C   . GLU A 1 166 ? 17.830  9.961   43.732  1.00 86.43  ? 166 GLU A C   1 
ATOM   1283 O O   . GLU A 1 166 ? 17.896  8.813   44.156  1.00 94.66  ? 166 GLU A O   1 
ATOM   1284 C CB  . GLU A 1 166 ? 15.585  10.905  44.358  1.00 93.97  ? 166 GLU A CB  1 
ATOM   1285 C CG  . GLU A 1 166 ? 16.270  11.559  45.543  1.00 93.15  ? 166 GLU A CG  1 
ATOM   1286 C CD  . GLU A 1 166 ? 15.317  11.790  46.694  1.00 109.06 ? 166 GLU A CD  1 
ATOM   1287 O OE1 . GLU A 1 166 ? 15.668  11.428  47.839  1.00 127.30 ? 166 GLU A OE1 1 
ATOM   1288 O OE2 . GLU A 1 166 ? 14.210  12.318  46.453  1.00 106.12 ? 166 GLU A OE2 1 
ATOM   1289 N N   . TYR A 1 167 ? 18.875  10.779  43.696  1.00 77.08  ? 167 TYR A N   1 
ATOM   1290 C CA  . TYR A 1 167 ? 20.186  10.390  44.194  1.00 79.04  ? 167 TYR A CA  1 
ATOM   1291 C C   . TYR A 1 167 ? 20.553  11.280  45.358  1.00 88.46  ? 167 TYR A C   1 
ATOM   1292 O O   . TYR A 1 167 ? 20.324  12.483  45.312  1.00 90.81  ? 167 TYR A O   1 
ATOM   1293 C CB  . TYR A 1 167 ? 21.248  10.556  43.107  1.00 77.71  ? 167 TYR A CB  1 
ATOM   1294 C CG  . TYR A 1 167 ? 21.211  9.499   42.029  1.00 87.68  ? 167 TYR A CG  1 
ATOM   1295 C CD1 . TYR A 1 167 ? 20.169  9.447   41.117  1.00 92.61  ? 167 TYR A CD1 1 
ATOM   1296 C CD2 . TYR A 1 167 ? 22.223  8.556   41.922  1.00 87.95  ? 167 TYR A CD2 1 
ATOM   1297 C CE1 . TYR A 1 167 ? 20.130  8.480   40.137  1.00 93.98  ? 167 TYR A CE1 1 
ATOM   1298 C CE2 . TYR A 1 167 ? 22.193  7.590   40.946  1.00 86.62  ? 167 TYR A CE2 1 
ATOM   1299 C CZ  . TYR A 1 167 ? 21.145  7.555   40.056  1.00 89.80  ? 167 TYR A CZ  1 
ATOM   1300 O OH  . TYR A 1 167 ? 21.110  6.592   39.076  1.00 93.17  ? 167 TYR A OH  1 
ATOM   1301 N N   . SER A 1 168 ? 21.134  10.699  46.400  1.00 95.30  ? 168 SER A N   1 
ATOM   1302 C CA  . SER A 1 168 ? 21.574  11.493  47.536  1.00 96.90  ? 168 SER A CA  1 
ATOM   1303 C C   . SER A 1 168 ? 23.026  11.203  47.892  1.00 92.51  ? 168 SER A C   1 
ATOM   1304 O O   . SER A 1 168 ? 23.597  10.194  47.476  1.00 82.02  ? 168 SER A O   1 
ATOM   1305 C CB  . SER A 1 168 ? 20.672  11.251  48.746  1.00 108.81 ? 168 SER A CB  1 
ATOM   1306 O OG  . SER A 1 168 ? 20.893  9.964   49.291  1.00 122.76 ? 168 SER A OG  1 
ATOM   1307 N N   . VAL A 1 169 ? 23.614  12.106  48.667  1.00 95.21  ? 169 VAL A N   1 
ATOM   1308 C CA  . VAL A 1 169 ? 24.993  11.971  49.114  1.00 91.08  ? 169 VAL A CA  1 
ATOM   1309 C C   . VAL A 1 169 ? 25.138  12.531  50.527  1.00 92.54  ? 169 VAL A C   1 
ATOM   1310 O O   . VAL A 1 169 ? 24.354  13.385  50.944  1.00 90.05  ? 169 VAL A O   1 
ATOM   1311 C CB  . VAL A 1 169 ? 25.951  12.712  48.170  1.00 81.72  ? 169 VAL A CB  1 
ATOM   1312 C CG1 . VAL A 1 169 ? 25.605  14.186  48.124  1.00 75.96  ? 169 VAL A CG1 1 
ATOM   1313 C CG2 . VAL A 1 169 ? 27.394  12.508  48.597  1.00 78.75  ? 169 VAL A CG2 1 
ATOM   1314 N N   . GLU A 1 170 ? 26.135  12.046  51.263  1.00 96.57  ? 170 GLU A N   1 
ATOM   1315 C CA  . GLU A 1 170 ? 26.365  12.497  52.634  1.00 92.26  ? 170 GLU A CA  1 
ATOM   1316 C C   . GLU A 1 170 ? 27.725  13.177  52.769  1.00 89.64  ? 170 GLU A C   1 
ATOM   1317 O O   . GLU A 1 170 ? 28.706  12.760  52.158  1.00 89.97  ? 170 GLU A O   1 
ATOM   1318 C CB  . GLU A 1 170 ? 26.249  11.325  53.612  1.00 93.37  ? 170 GLU A CB  1 
ATOM   1319 C CG  . GLU A 1 170 ? 25.846  11.715  55.021  1.00 106.96 ? 170 GLU A CG  1 
ATOM   1320 C CD  . GLU A 1 170 ? 25.373  10.527  55.848  1.00 113.03 ? 170 GLU A CD  1 
ATOM   1321 O OE1 . GLU A 1 170 ? 25.295  10.656  57.094  1.00 122.26 ? 170 GLU A OE1 1 
ATOM   1322 O OE2 . GLU A 1 170 ? 25.083  9.465   55.251  1.00 90.08  ? 170 GLU A OE2 1 
ATOM   1323 N N   . CYS A 1 171 ? 27.771  14.237  53.567  1.00 92.51  ? 171 CYS A N   1 
ATOM   1324 C CA  . CYS A 1 171 ? 28.989  15.023  53.728  1.00 88.35  ? 171 CYS A CA  1 
ATOM   1325 C C   . CYS A 1 171 ? 29.239  15.430  55.172  1.00 86.22  ? 171 CYS A C   1 
ATOM   1326 O O   . CYS A 1 171 ? 28.317  15.518  55.984  1.00 89.05  ? 171 CYS A O   1 
ATOM   1327 C CB  . CYS A 1 171 ? 28.963  16.260  52.837  1.00 84.89  ? 171 CYS A CB  1 
ATOM   1328 S SG  . CYS A 1 171 ? 29.083  15.893  51.083  1.00 88.61  ? 171 CYS A SG  1 
ATOM   1329 N N   . GLN A 1 172 ? 30.505  15.684  55.476  1.00 84.73  ? 172 GLN A N   1 
ATOM   1330 C CA  . GLN A 1 172 ? 30.933  15.953  56.833  1.00 86.90  ? 172 GLN A CA  1 
ATOM   1331 C C   . GLN A 1 172 ? 32.028  17.002  56.815  1.00 83.41  ? 172 GLN A C   1 
ATOM   1332 O O   . GLN A 1 172 ? 33.126  16.752  56.322  1.00 78.48  ? 172 GLN A O   1 
ATOM   1333 C CB  . GLN A 1 172 ? 31.438  14.658  57.474  1.00 103.23 ? 172 GLN A CB  1 
ATOM   1334 C CG  . GLN A 1 172 ? 32.434  14.836  58.616  1.00 122.26 ? 172 GLN A CG  1 
ATOM   1335 C CD  . GLN A 1 172 ? 31.771  14.961  59.978  1.00 134.08 ? 172 GLN A CD  1 
ATOM   1336 O OE1 . GLN A 1 172 ? 30.674  15.506  60.100  1.00 137.67 ? 172 GLN A OE1 1 
ATOM   1337 N NE2 . GLN A 1 172 ? 32.440  14.456  61.012  1.00 136.47 ? 172 GLN A NE2 1 
ATOM   1338 N N   . GLU A 1 173 ? 31.709  18.185  57.332  1.00 85.16  ? 173 GLU A N   1 
ATOM   1339 C CA  . GLU A 1 173 ? 32.711  19.216  57.568  1.00 88.88  ? 173 GLU A CA  1 
ATOM   1340 C C   . GLU A 1 173 ? 33.437  18.923  58.880  1.00 93.51  ? 173 GLU A C   1 
ATOM   1341 O O   . GLU A 1 173 ? 32.810  18.551  59.872  1.00 81.49  ? 173 GLU A O   1 
ATOM   1342 C CB  . GLU A 1 173 ? 32.067  20.607  57.625  1.00 89.85  ? 173 GLU A CB  1 
ATOM   1343 C CG  . GLU A 1 173 ? 33.076  21.756  57.652  1.00 97.25  ? 173 GLU A CG  1 
ATOM   1344 C CD  . GLU A 1 173 ? 32.438  23.126  57.853  1.00 94.29  ? 173 GLU A CD  1 
ATOM   1345 O OE1 . GLU A 1 173 ? 33.105  24.141  57.554  1.00 86.11  ? 173 GLU A OE1 1 
ATOM   1346 O OE2 . GLU A 1 173 ? 31.275  23.196  58.307  1.00 97.15  ? 173 GLU A OE2 1 
ATOM   1347 N N   . ASP A 1 174 ? 34.758  19.080  58.872  1.00 95.95  ? 174 ASP A N   1 
ATOM   1348 C CA  . ASP A 1 174 ? 35.575  18.854  60.057  1.00 109.33 ? 174 ASP A CA  1 
ATOM   1349 C C   . ASP A 1 174 ? 36.662  19.914  60.166  1.00 110.71 ? 174 ASP A C   1 
ATOM   1350 O O   . ASP A 1 174 ? 37.764  19.737  59.651  1.00 110.93 ? 174 ASP A O   1 
ATOM   1351 C CB  . ASP A 1 174 ? 36.213  17.461  60.015  1.00 127.18 ? 174 ASP A CB  1 
ATOM   1352 C CG  . ASP A 1 174 ? 37.027  17.152  61.265  1.00 142.97 ? 174 ASP A CG  1 
ATOM   1353 O OD1 . ASP A 1 174 ? 36.970  17.950  62.231  1.00 139.95 ? 174 ASP A OD1 1 
ATOM   1354 O OD2 . ASP A 1 174 ? 37.720  16.111  61.286  1.00 151.55 ? 174 ASP A OD2 1 
ATOM   1355 N N   . SER A 1 175 ? 36.347  21.016  60.838  1.00 116.93 ? 175 SER A N   1 
ATOM   1356 C CA  . SER A 1 175 ? 37.306  22.099  61.021  1.00 129.93 ? 175 SER A CA  1 
ATOM   1357 C C   . SER A 1 175 ? 38.241  21.817  62.191  1.00 133.95 ? 175 SER A C   1 
ATOM   1358 O O   . SER A 1 175 ? 37.792  21.457  63.282  1.00 137.11 ? 175 SER A O   1 
ATOM   1359 C CB  . SER A 1 175 ? 36.579  23.425  61.253  1.00 143.52 ? 175 SER A CB  1 
ATOM   1360 O OG  . SER A 1 175 ? 35.812  23.797  60.123  1.00 148.28 ? 175 SER A OG  1 
ATOM   1361 N N   . ALA A 1 176 ? 39.540  21.989  61.962  1.00 134.90 ? 176 ALA A N   1 
ATOM   1362 C CA  . ALA A 1 176 ? 40.534  21.785  63.009  1.00 145.96 ? 176 ALA A CA  1 
ATOM   1363 C C   . ALA A 1 176 ? 40.237  22.675  64.220  1.00 153.53 ? 176 ALA A C   1 
ATOM   1364 O O   . ALA A 1 176 ? 40.644  22.376  65.347  1.00 159.29 ? 176 ALA A O   1 
ATOM   1365 C CB  . ALA A 1 176 ? 41.934  22.047  62.472  1.00 145.96 ? 176 ALA A CB  1 
ATOM   1366 N N   . CYS A 1 177 ? 39.526  23.771  63.969  1.00 146.78 ? 177 CYS A N   1 
ATOM   1367 C CA  . CYS A 1 177 ? 39.061  24.663  65.023  1.00 133.89 ? 177 CYS A CA  1 
ATOM   1368 C C   . CYS A 1 177 ? 37.691  25.220  64.652  1.00 128.06 ? 177 CYS A C   1 
ATOM   1369 O O   . CYS A 1 177 ? 37.583  26.095  63.792  1.00 122.87 ? 177 CYS A O   1 
ATOM   1370 C CB  . CYS A 1 177 ? 40.055  25.801  65.247  1.00 128.78 ? 177 CYS A CB  1 
ATOM   1371 S SG  . CYS A 1 177 ? 41.643  25.288  65.934  1.00 173.53 ? 177 CYS A SG  1 
ATOM   1372 N N   . PRO A 1 178 ? 36.634  24.701  65.294  1.00 128.59 ? 178 PRO A N   1 
ATOM   1373 C CA  . PRO A 1 178 ? 35.251  25.101  65.012  1.00 123.65 ? 178 PRO A CA  1 
ATOM   1374 C C   . PRO A 1 178 ? 34.973  26.561  65.368  1.00 120.25 ? 178 PRO A C   1 
ATOM   1375 O O   . PRO A 1 178 ? 35.412  27.045  66.412  1.00 115.67 ? 178 PRO A O   1 
ATOM   1376 C CB  . PRO A 1 178 ? 34.428  24.168  65.907  1.00 125.02 ? 178 PRO A CB  1 
ATOM   1377 C CG  . PRO A 1 178 ? 35.329  23.012  66.195  1.00 128.85 ? 178 PRO A CG  1 
ATOM   1378 C CD  . PRO A 1 178 ? 36.697  23.610  66.281  1.00 132.08 ? 178 PRO A CD  1 
ATOM   1379 N N   . ALA A 1 179 ? 34.244  27.248  64.494  1.00 113.38 ? 179 ALA A N   1 
ATOM   1380 C CA  . ALA A 1 179 ? 33.895  28.647  64.699  1.00 102.57 ? 179 ALA A CA  1 
ATOM   1381 C C   . ALA A 1 179 ? 32.477  28.775  65.253  1.00 101.49 ? 179 ALA A C   1 
ATOM   1382 O O   . ALA A 1 179 ? 31.639  27.904  65.033  1.00 103.96 ? 179 ALA A O   1 
ATOM   1383 C CB  . ALA A 1 179 ? 34.032  29.414  63.392  1.00 88.27  ? 179 ALA A CB  1 
ATOM   1384 N N   . ALA A 1 180 ? 32.212  29.864  65.969  1.00 98.54  ? 180 ALA A N   1 
ATOM   1385 C CA  . ALA A 1 180 ? 30.906  30.072  66.589  1.00 100.46 ? 180 ALA A CA  1 
ATOM   1386 C C   . ALA A 1 180 ? 29.883  30.639  65.615  1.00 96.79  ? 180 ALA A C   1 
ATOM   1387 O O   . ALA A 1 180 ? 28.761  30.971  66.003  1.00 82.55  ? 180 ALA A O   1 
ATOM   1388 C CB  . ALA A 1 180 ? 31.041  30.987  67.797  1.00 106.41 ? 180 ALA A CB  1 
ATOM   1389 N N   . GLU A 1 181 ? 30.274  30.730  64.347  1.00 89.73  ? 181 GLU A N   1 
ATOM   1390 C CA  . GLU A 1 181 ? 29.486  31.433  63.345  1.00 81.48  ? 181 GLU A CA  1 
ATOM   1391 C C   . GLU A 1 181 ? 30.105  31.230  61.964  1.00 91.08  ? 181 GLU A C   1 
ATOM   1392 O O   . GLU A 1 181 ? 31.327  31.285  61.813  1.00 100.67 ? 181 GLU A O   1 
ATOM   1393 C CB  . GLU A 1 181 ? 29.470  32.921  63.681  1.00 84.21  ? 181 GLU A CB  1 
ATOM   1394 C CG  . GLU A 1 181 ? 28.220  33.662  63.263  1.00 93.30  ? 181 GLU A CG  1 
ATOM   1395 C CD  . GLU A 1 181 ? 28.354  35.159  63.477  1.00 97.42  ? 181 GLU A CD  1 
ATOM   1396 O OE1 . GLU A 1 181 ? 29.050  35.803  62.664  1.00 93.57  ? 181 GLU A OE1 1 
ATOM   1397 O OE2 . GLU A 1 181 ? 27.766  35.691  64.447  1.00 97.21  ? 181 GLU A OE2 1 
ATOM   1398 N N   . GLU A 1 182 ? 29.263  31.005  60.959  1.00 88.10  ? 182 GLU A N   1 
ATOM   1399 C CA  . GLU A 1 182 ? 29.730  30.765  59.597  1.00 80.85  ? 182 GLU A CA  1 
ATOM   1400 C C   . GLU A 1 182 ? 29.899  32.070  58.831  1.00 90.08  ? 182 GLU A C   1 
ATOM   1401 O O   . GLU A 1 182 ? 28.934  32.805  58.618  1.00 93.77  ? 182 GLU A O   1 
ATOM   1402 C CB  . GLU A 1 182 ? 28.732  29.893  58.848  1.00 83.03  ? 182 GLU A CB  1 
ATOM   1403 C CG  . GLU A 1 182 ? 28.514  28.527  59.438  1.00 85.69  ? 182 GLU A CG  1 
ATOM   1404 C CD  . GLU A 1 182 ? 27.284  27.865  58.865  1.00 87.65  ? 182 GLU A CD  1 
ATOM   1405 O OE1 . GLU A 1 182 ? 27.427  27.059  57.922  1.00 81.35  ? 182 GLU A OE1 1 
ATOM   1406 O OE2 . GLU A 1 182 ? 26.172  28.171  59.343  1.00 89.22  ? 182 GLU A OE2 1 
ATOM   1407 N N   . SER A 1 183 ? 31.119  32.355  58.396  1.00 94.42  ? 183 SER A N   1 
ATOM   1408 C CA  . SER A 1 183 ? 31.379  33.592  57.669  1.00 101.63 ? 183 SER A CA  1 
ATOM   1409 C C   . SER A 1 183 ? 31.412  33.365  56.158  1.00 106.24 ? 183 SER A C   1 
ATOM   1410 O O   . SER A 1 183 ? 31.167  34.287  55.378  1.00 100.47 ? 183 SER A O   1 
ATOM   1411 C CB  . SER A 1 183 ? 32.686  34.223  58.147  1.00 107.83 ? 183 SER A CB  1 
ATOM   1412 O OG  . SER A 1 183 ? 33.716  33.255  58.219  1.00 117.92 ? 183 SER A OG  1 
ATOM   1413 N N   . LEU A 1 184 ? 31.712  32.134  55.751  1.00 107.93 ? 184 LEU A N   1 
ATOM   1414 C CA  . LEU A 1 184 ? 31.729  31.770  54.336  1.00 100.15 ? 184 LEU A CA  1 
ATOM   1415 C C   . LEU A 1 184 ? 30.778  30.610  54.088  1.00 90.59  ? 184 LEU A C   1 
ATOM   1416 O O   . LEU A 1 184 ? 30.590  29.763  54.958  1.00 94.12  ? 184 LEU A O   1 
ATOM   1417 C CB  . LEU A 1 184 ? 33.142  31.391  53.890  1.00 100.13 ? 184 LEU A CB  1 
ATOM   1418 C CG  . LEU A 1 184 ? 34.195  32.494  53.986  1.00 99.72  ? 184 LEU A CG  1 
ATOM   1419 C CD1 . LEU A 1 184 ? 35.595  31.937  53.776  1.00 79.75  ? 184 LEU A CD1 1 
ATOM   1420 C CD2 . LEU A 1 184 ? 33.888  33.596  52.992  1.00 79.00  ? 184 LEU A CD2 1 
ATOM   1421 N N   . PRO A 1 185 ? 30.177  30.561  52.892  1.00 82.99  ? 185 PRO A N   1 
ATOM   1422 C CA  . PRO A 1 185 ? 29.195  29.522  52.586  1.00 76.43  ? 185 PRO A CA  1 
ATOM   1423 C C   . PRO A 1 185 ? 29.880  28.209  52.260  1.00 78.88  ? 185 PRO A C   1 
ATOM   1424 O O   . PRO A 1 185 ? 30.965  28.214  51.683  1.00 86.01  ? 185 PRO A O   1 
ATOM   1425 C CB  . PRO A 1 185 ? 28.503  30.050  51.319  1.00 75.61  ? 185 PRO A CB  1 
ATOM   1426 C CG  . PRO A 1 185 ? 29.132  31.380  51.011  1.00 80.65  ? 185 PRO A CG  1 
ATOM   1427 C CD  . PRO A 1 185 ? 30.437  31.413  51.725  1.00 85.93  ? 185 PRO A CD  1 
ATOM   1428 N N   . ILE A 1 186 ? 29.258  27.099  52.627  1.00 76.90  ? 186 ILE A N   1 
ATOM   1429 C CA  . ILE A 1 186 ? 29.705  25.805  52.148  1.00 79.88  ? 186 ILE A CA  1 
ATOM   1430 C C   . ILE A 1 186 ? 29.357  25.691  50.672  1.00 83.73  ? 186 ILE A C   1 
ATOM   1431 O O   . ILE A 1 186 ? 28.315  26.182  50.235  1.00 76.88  ? 186 ILE A O   1 
ATOM   1432 C CB  . ILE A 1 186 ? 29.021  24.659  52.896  1.00 78.96  ? 186 ILE A CB  1 
ATOM   1433 C CG1 . ILE A 1 186 ? 29.754  24.370  54.200  1.00 75.98  ? 186 ILE A CG1 1 
ATOM   1434 C CG2 . ILE A 1 186 ? 28.997  23.410  52.032  1.00 76.04  ? 186 ILE A CG2 1 
ATOM   1435 C CD1 . ILE A 1 186 ? 29.389  23.043  54.797  1.00 77.51  ? 186 ILE A CD1 1 
ATOM   1436 N N   . GLU A 1 187 ? 30.229  25.045  49.907  1.00 90.71  ? 187 GLU A N   1 
ATOM   1437 C CA  . GLU A 1 187 ? 30.032  24.926  48.469  1.00 92.47  ? 187 GLU A CA  1 
ATOM   1438 C C   . GLU A 1 187 ? 30.079  23.471  48.003  1.00 86.01  ? 187 GLU A C   1 
ATOM   1439 O O   . GLU A 1 187 ? 31.015  22.743  48.319  1.00 81.95  ? 187 GLU A O   1 
ATOM   1440 C CB  . GLU A 1 187 ? 31.087  25.752  47.735  1.00 98.62  ? 187 GLU A CB  1 
ATOM   1441 C CG  . GLU A 1 187 ? 30.847  25.886  46.242  1.00 110.92 ? 187 GLU A CG  1 
ATOM   1442 C CD  . GLU A 1 187 ? 31.651  27.020  45.637  1.00 124.32 ? 187 GLU A CD  1 
ATOM   1443 O OE1 . GLU A 1 187 ? 32.191  27.835  46.415  1.00 126.15 ? 187 GLU A OE1 1 
ATOM   1444 O OE2 . GLU A 1 187 ? 31.738  27.102  44.393  1.00 130.98 ? 187 GLU A OE2 1 
ATOM   1445 N N   . VAL A 1 188 ? 29.069  23.049  47.248  1.00 83.52  ? 188 VAL A N   1 
ATOM   1446 C CA  . VAL A 1 188 ? 29.030  21.687  46.711  1.00 78.34  ? 188 VAL A CA  1 
ATOM   1447 C C   . VAL A 1 188 ? 29.243  21.615  45.196  1.00 74.64  ? 188 VAL A C   1 
ATOM   1448 O O   . VAL A 1 188 ? 28.639  22.367  44.430  1.00 78.47  ? 188 VAL A O   1 
ATOM   1449 C CB  . VAL A 1 188 ? 27.711  20.982  47.043  1.00 76.32  ? 188 VAL A CB  1 
ATOM   1450 C CG1 . VAL A 1 188 ? 27.779  19.533  46.601  1.00 64.00  ? 188 VAL A CG1 1 
ATOM   1451 C CG2 . VAL A 1 188 ? 27.431  21.069  48.523  1.00 65.44  ? 188 VAL A CG2 1 
ATOM   1452 N N   . MET A 1 189 ? 30.097  20.689  44.778  1.00 70.70  ? 189 MET A N   1 
ATOM   1453 C CA  . MET A 1 189 ? 30.404  20.493  43.368  1.00 75.08  ? 189 MET A CA  1 
ATOM   1454 C C   . MET A 1 189 ? 30.124  19.067  42.902  1.00 75.18  ? 189 MET A C   1 
ATOM   1455 O O   . MET A 1 189 ? 30.798  18.130  43.312  1.00 62.57  ? 189 MET A O   1 
ATOM   1456 C CB  . MET A 1 189 ? 31.869  20.833  43.091  1.00 63.85  ? 189 MET A CB  1 
ATOM   1457 C CG  . MET A 1 189 ? 32.144  22.301  42.881  1.00 64.66  ? 189 MET A CG  1 
ATOM   1458 S SD  . MET A 1 189 ? 32.418  23.176  44.421  1.00 107.48 ? 189 MET A SD  1 
ATOM   1459 C CE  . MET A 1 189 ? 33.877  22.330  45.027  1.00 93.14  ? 189 MET A CE  1 
ATOM   1460 N N   . VAL A 1 190 ? 29.138  18.914  42.024  1.00 72.95  ? 190 VAL A N   1 
ATOM   1461 C CA  . VAL A 1 190 ? 28.822  17.612  41.444  1.00 66.64  ? 190 VAL A CA  1 
ATOM   1462 C C   . VAL A 1 190 ? 29.235  17.516  39.976  1.00 63.31  ? 190 VAL A C   1 
ATOM   1463 O O   . VAL A 1 190 ? 28.818  18.322  39.154  1.00 63.41  ? 190 VAL A O   1 
ATOM   1464 C CB  . VAL A 1 190 ? 27.316  17.290  41.550  1.00 64.12  ? 190 VAL A CB  1 
ATOM   1465 C CG1 . VAL A 1 190 ? 27.054  15.869  41.101  1.00 77.31  ? 190 VAL A CG1 1 
ATOM   1466 C CG2 . VAL A 1 190 ? 26.829  17.489  42.970  1.00 67.12  ? 190 VAL A CG2 1 
ATOM   1467 N N   . ASP A 1 191 ? 30.067  16.529  39.662  1.00 66.96  ? 191 ASP A N   1 
ATOM   1468 C CA  . ASP A 1 191 ? 30.387  16.188  38.280  1.00 65.90  ? 191 ASP A CA  1 
ATOM   1469 C C   . ASP A 1 191 ? 29.414  15.128  37.795  1.00 71.19  ? 191 ASP A C   1 
ATOM   1470 O O   . ASP A 1 191 ? 29.388  14.019  38.317  1.00 80.72  ? 191 ASP A O   1 
ATOM   1471 C CB  . ASP A 1 191 ? 31.812  15.645  38.166  1.00 59.57  ? 191 ASP A CB  1 
ATOM   1472 C CG  . ASP A 1 191 ? 32.859  16.735  38.206  1.00 86.64  ? 191 ASP A CG  1 
ATOM   1473 O OD1 . ASP A 1 191 ? 32.486  17.919  38.327  1.00 90.43  ? 191 ASP A OD1 1 
ATOM   1474 O OD2 . ASP A 1 191 ? 34.060  16.411  38.116  1.00 83.59  ? 191 ASP A OD2 1 
ATOM   1475 N N   . ALA A 1 192 ? 28.611  15.463  36.795  1.00 68.30  ? 192 ALA A N   1 
ATOM   1476 C CA  . ALA A 1 192 ? 27.655  14.511  36.248  1.00 69.47  ? 192 ALA A CA  1 
ATOM   1477 C C   . ALA A 1 192 ? 28.088  14.003  34.873  1.00 73.74  ? 192 ALA A C   1 
ATOM   1478 O O   . ALA A 1 192 ? 28.309  14.795  33.961  1.00 79.21  ? 192 ALA A O   1 
ATOM   1479 C CB  . ALA A 1 192 ? 26.285  15.151  36.167  1.00 68.95  ? 192 ALA A CB  1 
ATOM   1480 N N   . VAL A 1 193 ? 28.216  12.687  34.721  1.00 71.63  ? 193 VAL A N   1 
ATOM   1481 C CA  . VAL A 1 193 ? 28.523  12.113  33.407  1.00 73.96  ? 193 VAL A CA  1 
ATOM   1482 C C   . VAL A 1 193 ? 27.476  11.115  32.920  1.00 68.90  ? 193 VAL A C   1 
ATOM   1483 O O   . VAL A 1 193 ? 27.259  10.076  33.536  1.00 80.70  ? 193 VAL A O   1 
ATOM   1484 C CB  . VAL A 1 193 ? 29.903  11.433  33.355  1.00 71.86  ? 193 VAL A CB  1 
ATOM   1485 C CG1 . VAL A 1 193 ? 30.076  10.725  32.020  1.00 63.64  ? 193 VAL A CG1 1 
ATOM   1486 C CG2 . VAL A 1 193 ? 31.016  12.450  33.567  1.00 65.89  ? 193 VAL A CG2 1 
ATOM   1487 N N   . HIS A 1 194 ? 26.845  11.434  31.798  1.00 62.70  ? 194 HIS A N   1 
ATOM   1488 C CA  . HIS A 1 194 ? 25.837  10.562  31.211  1.00 72.53  ? 194 HIS A CA  1 
ATOM   1489 C C   . HIS A 1 194 ? 26.275  10.082  29.841  1.00 73.26  ? 194 HIS A C   1 
ATOM   1490 O O   . HIS A 1 194 ? 26.226  10.832  28.865  1.00 73.74  ? 194 HIS A O   1 
ATOM   1491 C CB  . HIS A 1 194 ? 24.501  11.289  31.103  1.00 84.08  ? 194 HIS A CB  1 
ATOM   1492 C CG  . HIS A 1 194 ? 23.479  10.554  30.293  1.00 82.91  ? 194 HIS A CG  1 
ATOM   1493 N ND1 . HIS A 1 194 ? 23.129  9.247   30.542  1.00 83.46  ? 194 HIS A ND1 1 
ATOM   1494 C CD2 . HIS A 1 194 ? 22.715  10.960  29.249  1.00 80.63  ? 194 HIS A CD2 1 
ATOM   1495 C CE1 . HIS A 1 194 ? 22.199  8.871   29.680  1.00 88.57  ? 194 HIS A CE1 1 
ATOM   1496 N NE2 . HIS A 1 194 ? 21.932  9.890   28.886  1.00 85.99  ? 194 HIS A NE2 1 
ATOM   1497 N N   . LYS A 1 195 ? 26.686  8.820   29.777  1.00 73.52  ? 195 LYS A N   1 
ATOM   1498 C CA  . LYS A 1 195 ? 27.301  8.274   28.576  1.00 71.49  ? 195 LYS A CA  1 
ATOM   1499 C C   . LYS A 1 195 ? 28.543  9.079   28.230  1.00 73.24  ? 195 LYS A C   1 
ATOM   1500 O O   . LYS A 1 195 ? 29.568  8.962   28.897  1.00 74.81  ? 195 LYS A O   1 
ATOM   1501 C CB  . LYS A 1 195 ? 26.316  8.268   27.404  1.00 68.60  ? 195 LYS A CB  1 
ATOM   1502 C CG  . LYS A 1 195 ? 25.331  7.116   27.455  1.00 74.75  ? 195 LYS A CG  1 
ATOM   1503 C CD  . LYS A 1 195 ? 24.627  6.903   26.126  1.00 76.15  ? 195 LYS A CD  1 
ATOM   1504 C CE  . LYS A 1 195 ? 23.480  7.881   25.947  1.00 88.78  ? 195 LYS A CE  1 
ATOM   1505 N NZ  . LYS A 1 195 ? 22.367  7.602   26.899  1.00 98.34  ? 195 LYS A NZ  1 
ATOM   1506 N N   . LEU A 1 196 ? 28.434  9.908   27.197  1.00 72.84  ? 196 LEU A N   1 
ATOM   1507 C CA  . LEU A 1 196 ? 29.550  10.728  26.732  1.00 75.04  ? 196 LEU A CA  1 
ATOM   1508 C C   . LEU A 1 196 ? 29.412  12.203  27.130  1.00 80.58  ? 196 LEU A C   1 
ATOM   1509 O O   . LEU A 1 196 ? 30.348  12.989  26.966  1.00 75.37  ? 196 LEU A O   1 
ATOM   1510 C CB  . LEU A 1 196 ? 29.679  10.603  25.214  1.00 73.49  ? 196 LEU A CB  1 
ATOM   1511 C CG  . LEU A 1 196 ? 30.071  9.206   24.732  1.00 71.85  ? 196 LEU A CG  1 
ATOM   1512 C CD1 . LEU A 1 196 ? 29.897  9.077   23.230  1.00 78.55  ? 196 LEU A CD1 1 
ATOM   1513 C CD2 . LEU A 1 196 ? 31.499  8.888   25.144  1.00 62.61  ? 196 LEU A CD2 1 
ATOM   1514 N N   . LYS A 1 197 ? 28.244  12.574  27.651  1.00 86.08  ? 197 LYS A N   1 
ATOM   1515 C CA  . LYS A 1 197 ? 27.978  13.962  28.026  1.00 82.06  ? 197 LYS A CA  1 
ATOM   1516 C C   . LYS A 1 197 ? 28.486  14.254  29.426  1.00 76.60  ? 197 LYS A C   1 
ATOM   1517 O O   . LYS A 1 197 ? 28.168  13.540  30.366  1.00 84.38  ? 197 LYS A O   1 
ATOM   1518 C CB  . LYS A 1 197 ? 26.483  14.283  27.952  1.00 56.89  ? 197 LYS A CB  1 
ATOM   1519 C CG  . LYS A 1 197 ? 26.197  15.772  27.951  1.00 70.77  ? 197 LYS A CG  1 
ATOM   1520 C CD  . LYS A 1 197 ? 24.720  16.076  28.101  1.00 77.81  ? 197 LYS A CD  1 
ATOM   1521 C CE  . LYS A 1 197 ? 23.878  15.381  27.044  1.00 75.34  ? 197 LYS A CE  1 
ATOM   1522 N NZ  . LYS A 1 197 ? 22.420  15.660  27.222  1.00 74.97  ? 197 LYS A NZ  1 
ATOM   1523 N N   . TYR A 1 198 ? 29.277  15.309  29.560  1.00 78.30  ? 198 TYR A N   1 
ATOM   1524 C CA  . TYR A 1 198 ? 29.750  15.750  30.867  1.00 74.68  ? 198 TYR A CA  1 
ATOM   1525 C C   . TYR A 1 198 ? 29.072  17.047  31.276  1.00 58.06  ? 198 TYR A C   1 
ATOM   1526 O O   . TYR A 1 198 ? 28.774  17.888  30.441  1.00 90.12  ? 198 TYR A O   1 
ATOM   1527 C CB  . TYR A 1 198 ? 31.262  15.950  30.843  1.00 66.38  ? 198 TYR A CB  1 
ATOM   1528 C CG  . TYR A 1 198 ? 31.786  16.711  32.031  1.00 65.77  ? 198 TYR A CG  1 
ATOM   1529 C CD1 . TYR A 1 198 ? 32.159  16.054  33.196  1.00 67.63  ? 198 TYR A CD1 1 
ATOM   1530 C CD2 . TYR A 1 198 ? 31.902  18.091  31.992  1.00 75.43  ? 198 TYR A CD2 1 
ATOM   1531 C CE1 . TYR A 1 198 ? 32.637  16.751  34.285  1.00 69.09  ? 198 TYR A CE1 1 
ATOM   1532 C CE2 . TYR A 1 198 ? 32.377  18.798  33.076  1.00 84.00  ? 198 TYR A CE2 1 
ATOM   1533 C CZ  . TYR A 1 198 ? 32.744  18.124  34.220  1.00 81.48  ? 198 TYR A CZ  1 
ATOM   1534 O OH  . TYR A 1 198 ? 33.216  18.828  35.305  1.00 87.74  ? 198 TYR A OH  1 
ATOM   1535 N N   . GLU A 1 199 ? 28.819  17.206  32.565  1.00 58.22  ? 199 GLU A N   1 
ATOM   1536 C CA  . GLU A 1 199 ? 28.280  18.452  33.095  1.00 76.77  ? 199 GLU A CA  1 
ATOM   1537 C C   . GLU A 1 199 ? 28.710  18.565  34.554  1.00 82.20  ? 199 GLU A C   1 
ATOM   1538 O O   . GLU A 1 199 ? 28.977  17.557  35.198  1.00 88.22  ? 199 GLU A O   1 
ATOM   1539 C CB  . GLU A 1 199 ? 26.753  18.455  33.006  1.00 71.75  ? 199 GLU A CB  1 
ATOM   1540 C CG  . GLU A 1 199 ? 26.182  18.369  31.606  1.00 59.75  ? 199 GLU A CG  1 
ATOM   1541 C CD  . GLU A 1 199 ? 24.664  18.354  31.599  1.00 75.29  ? 199 GLU A CD  1 
ATOM   1542 O OE1 . GLU A 1 199 ? 24.065  17.969  32.620  1.00 71.14  ? 199 GLU A OE1 1 
ATOM   1543 O OE2 . GLU A 1 199 ? 24.061  18.729  30.577  1.00 71.67  ? 199 GLU A OE2 1 
ATOM   1544 N N   . ASN A 1 200 ? 28.800  19.778  35.081  1.00 84.00  ? 200 ASN A N   1 
ATOM   1545 C CA  . ASN A 1 200 ? 29.023  19.929  36.516  1.00 90.12  ? 200 ASN A CA  1 
ATOM   1546 C C   . ASN A 1 200 ? 28.150  20.989  37.176  1.00 61.32  ? 200 ASN A C   1 
ATOM   1547 O O   . ASN A 1 200 ? 28.000  22.089  36.666  1.00 82.67  ? 200 ASN A O   1 
ATOM   1548 C CB  . ASN A 1 200 ? 30.511  20.097  36.872  1.00 94.78  ? 200 ASN A CB  1 
ATOM   1549 C CG  . ASN A 1 200 ? 31.141  21.331  36.262  1.00 61.92  ? 200 ASN A CG  1 
ATOM   1550 O OD1 . ASN A 1 200 ? 30.488  22.351  36.071  1.00 94.36  ? 200 ASN A OD1 1 
ATOM   1551 N ND2 . ASN A 1 200 ? 32.434  21.239  35.964  1.00 81.98  ? 200 ASN A ND2 1 
ATOM   1552 N N   . TYR A 1 201 ? 27.568  20.638  38.316  1.00 70.86  ? 201 TYR A N   1 
ATOM   1553 C CA  . TYR A 1 201 ? 26.710  21.559  39.051  1.00 75.73  ? 201 TYR A CA  1 
ATOM   1554 C C   . TYR A 1 201 ? 27.369  22.082  40.323  1.00 77.88  ? 201 TYR A C   1 
ATOM   1555 O O   . TYR A 1 201 ? 28.354  21.529  40.803  1.00 62.29  ? 201 TYR A O   1 
ATOM   1556 C CB  . TYR A 1 201 ? 25.374  20.899  39.380  1.00 77.42  ? 201 TYR A CB  1 
ATOM   1557 C CG  . TYR A 1 201 ? 24.656  20.340  38.174  1.00 73.81  ? 201 TYR A CG  1 
ATOM   1558 C CD1 . TYR A 1 201 ? 25.212  19.312  37.433  1.00 74.96  ? 201 TYR A CD1 1 
ATOM   1559 C CD2 . TYR A 1 201 ? 23.419  20.835  37.784  1.00 76.84  ? 201 TYR A CD2 1 
ATOM   1560 C CE1 . TYR A 1 201 ? 24.564  18.795  36.336  1.00 80.50  ? 201 TYR A CE1 1 
ATOM   1561 C CE2 . TYR A 1 201 ? 22.762  20.322  36.689  1.00 82.87  ? 201 TYR A CE2 1 
ATOM   1562 C CZ  . TYR A 1 201 ? 23.340  19.302  35.967  1.00 84.07  ? 201 TYR A CZ  1 
ATOM   1563 O OH  . TYR A 1 201 ? 22.697  18.781  34.869  1.00 85.68  ? 201 TYR A OH  1 
ATOM   1564 N N   . THR A 1 202 ? 26.811  23.163  40.854  1.00 82.24  ? 202 THR A N   1 
ATOM   1565 C CA  . THR A 1 202 ? 27.362  23.831  42.027  1.00 82.50  ? 202 THR A CA  1 
ATOM   1566 C C   . THR A 1 202 ? 26.247  24.429  42.880  1.00 86.99  ? 202 THR A C   1 
ATOM   1567 O O   . THR A 1 202 ? 25.261  24.936  42.350  1.00 98.12  ? 202 THR A O   1 
ATOM   1568 C CB  . THR A 1 202 ? 28.320  24.971  41.614  1.00 79.23  ? 202 THR A CB  1 
ATOM   1569 O OG1 . THR A 1 202 ? 29.385  24.440  40.818  1.00 89.65  ? 202 THR A OG1 1 
ATOM   1570 C CG2 . THR A 1 202 ? 28.911  25.642  42.828  1.00 82.39  ? 202 THR A CG2 1 
ATOM   1571 N N   . SER A 1 203 ? 26.399  24.362  44.197  1.00 79.13  ? 203 SER A N   1 
ATOM   1572 C CA  . SER A 1 203 ? 25.517  25.107  45.093  1.00 85.75  ? 203 SER A CA  1 
ATOM   1573 C C   . SER A 1 203 ? 26.254  25.619  46.330  1.00 83.00  ? 203 SER A C   1 
ATOM   1574 O O   . SER A 1 203 ? 27.073  24.914  46.909  1.00 85.01  ? 203 SER A O   1 
ATOM   1575 C CB  . SER A 1 203 ? 24.316  24.263  45.514  1.00 91.04  ? 203 SER A CB  1 
ATOM   1576 O OG  . SER A 1 203 ? 23.443  25.011  46.342  1.00 92.09  ? 203 SER A OG  1 
ATOM   1577 N N   . SER A 1 204 ? 25.957  26.854  46.724  1.00 79.49  ? 204 SER A N   1 
ATOM   1578 C CA  . SER A 1 204 ? 26.531  27.451  47.932  1.00 76.85  ? 204 SER A CA  1 
ATOM   1579 C C   . SER A 1 204 ? 25.465  27.632  48.998  1.00 76.24  ? 204 SER A C   1 
ATOM   1580 O O   . SER A 1 204 ? 24.340  28.008  48.695  1.00 76.58  ? 204 SER A O   1 
ATOM   1581 C CB  . SER A 1 204 ? 27.176  28.805  47.625  1.00 75.28  ? 204 SER A CB  1 
ATOM   1582 O OG  . SER A 1 204 ? 28.567  28.679  47.403  1.00 80.71  ? 204 SER A OG  1 
ATOM   1583 N N   . PHE A 1 205 ? 25.821  27.376  50.250  1.00 68.80  ? 205 PHE A N   1 
ATOM   1584 C CA  . PHE A 1 205 ? 24.872  27.575  51.337  1.00 84.23  ? 205 PHE A CA  1 
ATOM   1585 C C   . PHE A 1 205 ? 25.523  27.689  52.703  1.00 82.16  ? 205 PHE A C   1 
ATOM   1586 O O   . PHE A 1 205 ? 26.668  27.291  52.903  1.00 77.76  ? 205 PHE A O   1 
ATOM   1587 C CB  . PHE A 1 205 ? 23.870  26.430  51.375  1.00 83.28  ? 205 PHE A CB  1 
ATOM   1588 C CG  . PHE A 1 205 ? 24.506  25.091  51.562  1.00 85.85  ? 205 PHE A CG  1 
ATOM   1589 C CD1 . PHE A 1 205 ? 25.055  24.417  50.487  1.00 81.81  ? 205 PHE A CD1 1 
ATOM   1590 C CD2 . PHE A 1 205 ? 24.568  24.510  52.814  1.00 90.26  ? 205 PHE A CD2 1 
ATOM   1591 C CE1 . PHE A 1 205 ? 25.645  23.185  50.654  1.00 82.50  ? 205 PHE A CE1 1 
ATOM   1592 C CE2 . PHE A 1 205 ? 25.159  23.273  52.986  1.00 90.57  ? 205 PHE A CE2 1 
ATOM   1593 C CZ  . PHE A 1 205 ? 25.700  22.612  51.900  1.00 82.48  ? 205 PHE A CZ  1 
ATOM   1594 N N   . PHE A 1 206 ? 24.774  28.244  53.644  1.00 88.16  ? 206 PHE A N   1 
ATOM   1595 C CA  . PHE A 1 206 ? 25.165  28.180  55.039  1.00 89.55  ? 206 PHE A CA  1 
ATOM   1596 C C   . PHE A 1 206 ? 24.345  27.100  55.714  1.00 88.84  ? 206 PHE A C   1 
ATOM   1597 O O   . PHE A 1 206 ? 23.144  26.965  55.466  1.00 84.53  ? 206 PHE A O   1 
ATOM   1598 C CB  . PHE A 1 206 ? 24.966  29.523  55.735  1.00 85.01  ? 206 PHE A CB  1 
ATOM   1599 C CG  . PHE A 1 206 ? 25.810  30.620  55.167  1.00 88.63  ? 206 PHE A CG  1 
ATOM   1600 C CD1 . PHE A 1 206 ? 25.243  31.610  54.383  1.00 88.28  ? 206 PHE A CD1 1 
ATOM   1601 C CD2 . PHE A 1 206 ? 27.171  30.657  55.402  1.00 93.14  ? 206 PHE A CD2 1 
ATOM   1602 C CE1 . PHE A 1 206 ? 26.015  32.625  53.853  1.00 87.97  ? 206 PHE A CE1 1 
ATOM   1603 C CE2 . PHE A 1 206 ? 27.950  31.669  54.873  1.00 95.53  ? 206 PHE A CE2 1 
ATOM   1604 C CZ  . PHE A 1 206 ? 27.370  32.653  54.096  1.00 92.38  ? 206 PHE A CZ  1 
ATOM   1605 N N   . ILE A 1 207 ? 25.010  26.317  56.552  1.00 91.18  ? 207 ILE A N   1 
ATOM   1606 C CA  . ILE A 1 207 ? 24.344  25.286  57.326  1.00 90.85  ? 207 ILE A CA  1 
ATOM   1607 C C   . ILE A 1 207 ? 23.177  25.897  58.090  1.00 82.50  ? 207 ILE A C   1 
ATOM   1608 O O   . ILE A 1 207 ? 22.091  25.317  58.161  1.00 80.11  ? 207 ILE A O   1 
ATOM   1609 C CB  . ILE A 1 207 ? 25.321  24.608  58.292  1.00 73.11  ? 207 ILE A CB  1 
ATOM   1610 C CG1 . ILE A 1 207 ? 26.160  23.573  57.542  1.00 72.60  ? 207 ILE A CG1 1 
ATOM   1611 C CG2 . ILE A 1 207 ? 24.575  23.947  59.419  1.00 81.78  ? 207 ILE A CG2 1 
ATOM   1612 C CD1 . ILE A 1 207 ? 27.004  22.709  58.442  1.00 115.37 ? 207 ILE A CD1 1 
ATOM   1613 N N   . ARG A 1 208 ? 23.396  27.092  58.628  1.00 80.40  ? 208 ARG A N   1 
ATOM   1614 C CA  . ARG A 1 208 ? 22.364  27.797  59.371  1.00 84.14  ? 208 ARG A CA  1 
ATOM   1615 C C   . ARG A 1 208 ? 21.102  28.016  58.548  1.00 81.73  ? 208 ARG A C   1 
ATOM   1616 O O   . ARG A 1 208 ? 20.069  28.401  59.081  1.00 84.57  ? 208 ARG A O   1 
ATOM   1617 C CB  . ARG A 1 208 ? 22.896  29.139  59.877  1.00 92.00  ? 208 ARG A CB  1 
ATOM   1618 C CG  . ARG A 1 208 ? 23.259  30.144  58.790  1.00 93.65  ? 208 ARG A CG  1 
ATOM   1619 C CD  . ARG A 1 208 ? 23.434  31.544  59.387  1.00 89.51  ? 208 ARG A CD  1 
ATOM   1620 N NE  . ARG A 1 208 ? 23.989  32.506  58.437  1.00 88.29  ? 208 ARG A NE  1 
ATOM   1621 C CZ  . ARG A 1 208 ? 25.280  32.814  58.359  1.00 88.40  ? 208 ARG A CZ  1 
ATOM   1622 N NH1 . ARG A 1 208 ? 26.147  32.230  59.178  1.00 86.39  ? 208 ARG A NH1 1 
ATOM   1623 N NH2 . ARG A 1 208 ? 25.705  33.700  57.464  1.00 76.14  ? 208 ARG A NH2 1 
ATOM   1624 N N   . ASP A 1 209 ? 21.179  27.761  57.248  1.00 82.04  ? 209 ASP A N   1 
ATOM   1625 C CA  . ASP A 1 209 ? 20.047  28.025  56.370  1.00 86.78  ? 209 ASP A CA  1 
ATOM   1626 C C   . ASP A 1 209 ? 19.353  26.767  55.881  1.00 87.28  ? 209 ASP A C   1 
ATOM   1627 O O   . ASP A 1 209 ? 18.215  26.814  55.424  1.00 99.97  ? 209 ASP A O   1 
ATOM   1628 C CB  . ASP A 1 209 ? 20.490  28.854  55.175  1.00 90.21  ? 209 ASP A CB  1 
ATOM   1629 C CG  . ASP A 1 209 ? 20.960  30.218  55.572  1.00 99.36  ? 209 ASP A CG  1 
ATOM   1630 O OD1 . ASP A 1 209 ? 21.663  30.858  54.764  1.00 104.87 ? 209 ASP A OD1 1 
ATOM   1631 O OD2 . ASP A 1 209 ? 20.626  30.646  56.698  1.00 107.61 ? 209 ASP A OD2 1 
ATOM   1632 N N   . ILE A 1 210 ? 20.030  25.637  55.962  1.00 72.66  ? 210 ILE A N   1 
ATOM   1633 C CA  . ILE A 1 210 ? 19.442  24.426  55.429  1.00 76.72  ? 210 ILE A CA  1 
ATOM   1634 C C   . ILE A 1 210 ? 19.240  23.390  56.518  1.00 81.43  ? 210 ILE A C   1 
ATOM   1635 O O   . ILE A 1 210 ? 19.550  22.218  56.345  1.00 92.04  ? 210 ILE A O   1 
ATOM   1636 C CB  . ILE A 1 210 ? 20.270  23.884  54.265  1.00 89.77  ? 210 ILE A CB  1 
ATOM   1637 C CG1 . ILE A 1 210 ? 21.759  23.895  54.611  1.00 91.45  ? 210 ILE A CG1 1 
ATOM   1638 C CG2 . ILE A 1 210 ? 20.028  24.735  53.019  1.00 92.97  ? 210 ILE A CG2 1 
ATOM   1639 C CD1 . ILE A 1 210 ? 22.254  22.631  55.256  1.00 86.94  ? 210 ILE A CD1 1 
ATOM   1640 N N   . ILE A 1 211 ? 18.693  23.841  57.639  1.00 82.44  ? 211 ILE A N   1 
ATOM   1641 C CA  . ILE A 1 211 ? 18.528  22.991  58.813  1.00 86.49  ? 211 ILE A CA  1 
ATOM   1642 C C   . ILE A 1 211 ? 17.105  22.466  58.973  1.00 90.49  ? 211 ILE A C   1 
ATOM   1643 O O   . ILE A 1 211 ? 16.140  23.232  59.003  1.00 97.93  ? 211 ILE A O   1 
ATOM   1644 C CB  . ILE A 1 211 ? 18.970  23.717  60.109  1.00 85.57  ? 211 ILE A CB  1 
ATOM   1645 C CG1 . ILE A 1 211 ? 20.376  23.274  60.514  1.00 83.80  ? 211 ILE A CG1 1 
ATOM   1646 C CG2 . ILE A 1 211 ? 18.008  23.434  61.238  1.00 83.85  ? 211 ILE A CG2 1 
ATOM   1647 C CD1 . ILE A 1 211 ? 20.956  24.052  61.647  1.00 76.84  ? 211 ILE A CD1 1 
ATOM   1648 N N   . LYS A 1 212 ? 16.987  21.146  59.051  1.00 93.53  ? 212 LYS A N   1 
ATOM   1649 C CA  . LYS A 1 212 ? 15.738  20.500  59.428  1.00 107.98 ? 212 LYS A CA  1 
ATOM   1650 C C   . LYS A 1 212 ? 16.012  19.565  60.601  1.00 108.16 ? 212 LYS A C   1 
ATOM   1651 O O   . LYS A 1 212 ? 16.797  18.626  60.486  1.00 113.35 ? 212 LYS A O   1 
ATOM   1652 C CB  . LYS A 1 212 ? 15.141  19.722  58.252  1.00 119.74 ? 212 LYS A CB  1 
ATOM   1653 C CG  . LYS A 1 212 ? 14.021  18.764  58.654  1.00 129.46 ? 212 LYS A CG  1 
ATOM   1654 C CD  . LYS A 1 212 ? 13.633  17.817  57.525  1.00 133.31 ? 212 LYS A CD  1 
ATOM   1655 C CE  . LYS A 1 212 ? 12.659  18.468  56.553  1.00 136.53 ? 212 LYS A CE  1 
ATOM   1656 N NZ  . LYS A 1 212 ? 11.346  18.771  57.190  1.00 139.22 ? 212 LYS A NZ  1 
ATOM   1657 N N   . PRO A 1 213 ? 15.382  19.834  61.747  1.00 97.79  ? 213 PRO A N   1 
ATOM   1658 C CA  . PRO A 1 213 ? 15.588  18.994  62.924  1.00 104.61 ? 213 PRO A CA  1 
ATOM   1659 C C   . PRO A 1 213 ? 14.664  17.797  62.882  1.00 106.98 ? 213 PRO A C   1 
ATOM   1660 O O   . PRO A 1 213 ? 13.585  17.884  62.302  1.00 110.33 ? 213 PRO A O   1 
ATOM   1661 C CB  . PRO A 1 213 ? 15.177  19.911  64.085  1.00 107.01 ? 213 PRO A CB  1 
ATOM   1662 C CG  . PRO A 1 213 ? 14.936  21.276  63.478  1.00 103.46 ? 213 PRO A CG  1 
ATOM   1663 C CD  . PRO A 1 213 ? 14.570  21.016  62.060  1.00 101.53 ? 213 PRO A CD  1 
ATOM   1664 N N   . ASP A 1 214 ? 15.076  16.692  63.488  1.00 107.96 ? 214 ASP A N   1 
ATOM   1665 C CA  . ASP A 1 214 ? 14.178  15.561  63.630  1.00 111.57 ? 214 ASP A CA  1 
ATOM   1666 C C   . ASP A 1 214 ? 12.990  15.994  64.477  1.00 111.15 ? 214 ASP A C   1 
ATOM   1667 O O   . ASP A 1 214 ? 13.093  16.943  65.252  1.00 110.67 ? 214 ASP A O   1 
ATOM   1668 C CB  . ASP A 1 214 ? 14.910  14.378  64.256  1.00 116.45 ? 214 ASP A CB  1 
ATOM   1669 C CG  . ASP A 1 214 ? 15.843  13.698  63.278  1.00 126.82 ? 214 ASP A CG  1 
ATOM   1670 O OD1 . ASP A 1 214 ? 15.351  13.157  62.265  1.00 132.61 ? 214 ASP A OD1 1 
ATOM   1671 O OD2 . ASP A 1 214 ? 17.066  13.707  63.518  1.00 130.76 ? 214 ASP A OD2 1 
ATOM   1672 N N   . PRO A 1 215 ? 11.848  15.316  64.316  1.00 114.09 ? 215 PRO A N   1 
ATOM   1673 C CA  . PRO A 1 215 ? 10.634  15.690  65.050  1.00 125.25 ? 215 PRO A CA  1 
ATOM   1674 C C   . PRO A 1 215 ? 10.830  15.559  66.558  1.00 138.02 ? 215 PRO A C   1 
ATOM   1675 O O   . PRO A 1 215 ? 11.715  14.820  66.993  1.00 142.91 ? 215 PRO A O   1 
ATOM   1676 C CB  . PRO A 1 215 ? 9.602   14.665  64.565  1.00 126.70 ? 215 PRO A CB  1 
ATOM   1677 C CG  . PRO A 1 215 ? 10.148  14.136  63.277  1.00 121.56 ? 215 PRO A CG  1 
ATOM   1678 C CD  . PRO A 1 215 ? 11.631  14.162  63.431  1.00 115.28 ? 215 PRO A CD  1 
ATOM   1679 N N   . PRO A 1 216 ? 10.016  16.274  67.352  1.00 140.29 ? 216 PRO A N   1 
ATOM   1680 C CA  . PRO A 1 216 ? 10.104  16.176  68.812  1.00 137.06 ? 216 PRO A CA  1 
ATOM   1681 C C   . PRO A 1 216 ? 10.156  14.721  69.276  1.00 140.67 ? 216 PRO A C   1 
ATOM   1682 O O   . PRO A 1 216 ? 9.572   13.850  68.632  1.00 139.52 ? 216 PRO A O   1 
ATOM   1683 C CB  . PRO A 1 216 ? 8.814   16.849  69.275  1.00 135.47 ? 216 PRO A CB  1 
ATOM   1684 C CG  . PRO A 1 216 ? 8.541   17.866  68.216  1.00 131.75 ? 216 PRO A CG  1 
ATOM   1685 C CD  . PRO A 1 216 ? 8.984   17.235  66.923  1.00 136.63 ? 216 PRO A CD  1 
ATOM   1686 N N   . LYS A 1 217 ? 10.849  14.472  70.382  1.00 148.52 ? 217 LYS A N   1 
ATOM   1687 C CA  . LYS A 1 217 ? 11.106  13.110  70.852  1.00 155.44 ? 217 LYS A CA  1 
ATOM   1688 C C   . LYS A 1 217 ? 9.833   12.347  71.238  1.00 165.62 ? 217 LYS A C   1 
ATOM   1689 O O   . LYS A 1 217 ? 9.150   11.799  70.376  1.00 172.29 ? 217 LYS A O   1 
ATOM   1690 C CB  . LYS A 1 217 ? 12.101  13.127  72.016  1.00 150.10 ? 217 LYS A CB  1 
ATOM   1691 C CG  . LYS A 1 217 ? 12.887  11.839  72.177  1.00 148.44 ? 217 LYS A CG  1 
ATOM   1692 C CD  . LYS A 1 217 ? 14.064  12.026  73.119  1.00 150.22 ? 217 LYS A CD  1 
ATOM   1693 C CE  . LYS A 1 217 ? 14.771  10.706  73.379  1.00 155.76 ? 217 LYS A CE  1 
ATOM   1694 N NZ  . LYS A 1 217 ? 15.864  10.849  74.379  1.00 160.01 ? 217 LYS A NZ  1 
ATOM   1695 N N   . ASN A 1 218 ? 9.521   12.307  72.530  1.00 165.32 ? 218 ASN A N   1 
ATOM   1696 C CA  . ASN A 1 218 ? 8.360   11.557  73.005  1.00 166.60 ? 218 ASN A CA  1 
ATOM   1697 C C   . ASN A 1 218 ? 7.376   12.399  73.814  1.00 173.01 ? 218 ASN A C   1 
ATOM   1698 O O   . ASN A 1 218 ? 7.777   13.203  74.656  1.00 174.43 ? 218 ASN A O   1 
ATOM   1699 C CB  . ASN A 1 218 ? 8.804   10.320  73.793  1.00 160.92 ? 218 ASN A CB  1 
ATOM   1700 C CG  . ASN A 1 218 ? 10.084  10.552  74.571  1.00 150.18 ? 218 ASN A CG  1 
ATOM   1701 O OD1 . ASN A 1 218 ? 10.219  11.546  75.286  1.00 151.04 ? 218 ASN A OD1 1 
ATOM   1702 N ND2 . ASN A 1 218 ? 11.032  9.631   74.437  1.00 137.31 ? 218 ASN A ND2 1 
ATOM   1703 N N   . LEU A 1 219 ? 6.086   12.203  73.557  1.00 179.56 ? 219 LEU A N   1 
ATOM   1704 C CA  . LEU A 1 219 ? 5.049   13.044  74.148  1.00 190.38 ? 219 LEU A CA  1 
ATOM   1705 C C   . LEU A 1 219 ? 4.219   12.302  75.187  1.00 201.74 ? 219 LEU A C   1 
ATOM   1706 O O   . LEU A 1 219 ? 4.177   11.073  75.200  1.00 207.78 ? 219 LEU A O   1 
ATOM   1707 C CB  . LEU A 1 219 ? 4.124   13.586  73.059  1.00 189.97 ? 219 LEU A CB  1 
ATOM   1708 C CG  . LEU A 1 219 ? 4.768   13.923  71.715  1.00 188.95 ? 219 LEU A CG  1 
ATOM   1709 C CD1 . LEU A 1 219 ? 4.994   12.660  70.894  1.00 186.90 ? 219 LEU A CD1 1 
ATOM   1710 C CD2 . LEU A 1 219 ? 3.897   14.903  70.953  1.00 188.57 ? 219 LEU A CD2 1 
ATOM   1711 N N   . GLN A 1 220 ? 3.553   13.059  76.054  1.00 204.09 ? 220 GLN A N   1 
ATOM   1712 C CA  . GLN A 1 220 ? 2.678   12.475  77.064  1.00 208.17 ? 220 GLN A CA  1 
ATOM   1713 C C   . GLN A 1 220 ? 1.433   13.331  77.276  1.00 209.86 ? 220 GLN A C   1 
ATOM   1714 O O   . GLN A 1 220 ? 1.241   14.343  76.602  1.00 205.26 ? 220 GLN A O   1 
ATOM   1715 C CB  . GLN A 1 220 ? 3.421   12.291  78.392  1.00 208.55 ? 220 GLN A CB  1 
ATOM   1716 C CG  . GLN A 1 220 ? 4.690   11.457  78.297  1.00 207.79 ? 220 GLN A CG  1 
ATOM   1717 C CD  . GLN A 1 220 ? 5.899   12.276  77.889  1.00 206.16 ? 220 GLN A CD  1 
ATOM   1718 O OE1 . GLN A 1 220 ? 6.748   11.816  77.127  1.00 206.34 ? 220 GLN A OE1 1 
ATOM   1719 N NE2 . GLN A 1 220 ? 5.980   13.500  78.397  1.00 204.03 ? 220 GLN A NE2 1 
ATOM   1720 N N   . LEU A 1 221 ? 0.588   12.911  78.213  1.00 216.07 ? 221 LEU A N   1 
ATOM   1721 C CA  . LEU A 1 221 ? -0.627  13.644  78.556  1.00 218.94 ? 221 LEU A CA  1 
ATOM   1722 C C   . LEU A 1 221 ? -0.783  13.759  80.069  1.00 222.65 ? 221 LEU A C   1 
ATOM   1723 O O   . LEU A 1 221 ? 0.027   13.225  80.826  1.00 223.29 ? 221 LEU A O   1 
ATOM   1724 C CB  . LEU A 1 221 ? -1.861  12.964  77.958  1.00 220.95 ? 221 LEU A CB  1 
ATOM   1725 C CG  . LEU A 1 221 ? -2.272  13.321  76.527  1.00 220.88 ? 221 LEU A CG  1 
ATOM   1726 C CD1 . LEU A 1 221 ? -1.216  12.900  75.517  1.00 219.83 ? 221 LEU A CD1 1 
ATOM   1727 C CD2 . LEU A 1 221 ? -3.612  12.685  76.191  1.00 222.99 ? 221 LEU A CD2 1 
ATOM   1728 N N   . LYS A 1 222 ? -1.828  14.457  80.503  1.00 226.42 ? 222 LYS A N   1 
ATOM   1729 C CA  . LYS A 1 222 ? -2.114  14.610  81.927  1.00 230.63 ? 222 LYS A CA  1 
ATOM   1730 C C   . LYS A 1 222 ? -3.448  15.312  82.180  1.00 234.33 ? 222 LYS A C   1 
ATOM   1731 O O   . LYS A 1 222 ? -3.477  16.475  82.585  1.00 233.27 ? 222 LYS A O   1 
ATOM   1732 C CB  . LYS A 1 222 ? -0.985  15.374  82.626  1.00 228.80 ? 222 LYS A CB  1 
ATOM   1733 C CG  . LYS A 1 222 ? -1.206  15.588  84.115  1.00 226.08 ? 222 LYS A CG  1 
ATOM   1734 C CD  . LYS A 1 222 ? -0.310  16.691  84.649  1.00 222.26 ? 222 LYS A CD  1 
ATOM   1735 C CE  . LYS A 1 222 ? -0.731  17.113  86.044  1.00 219.81 ? 222 LYS A CE  1 
ATOM   1736 N NZ  . LYS A 1 222 ? 0.012   18.320  86.499  1.00 217.69 ? 222 LYS A NZ  1 
ATOM   1737 N N   . PRO A 1 223 ? -4.562  14.608  81.930  1.00 238.50 ? 223 PRO A N   1 
ATOM   1738 C CA  . PRO A 1 223 ? -5.885  15.144  82.265  1.00 242.98 ? 223 PRO A CA  1 
ATOM   1739 C C   . PRO A 1 223 ? -6.118  15.170  83.778  1.00 251.90 ? 223 PRO A C   1 
ATOM   1740 O O   . PRO A 1 223 ? -6.996  15.891  84.251  1.00 252.78 ? 223 PRO A O   1 
ATOM   1741 C CB  . PRO A 1 223 ? -6.844  14.150  81.599  1.00 240.88 ? 223 PRO A CB  1 
ATOM   1742 C CG  . PRO A 1 223 ? -6.026  13.451  80.561  1.00 239.18 ? 223 PRO A CG  1 
ATOM   1743 C CD  . PRO A 1 223 ? -4.655  13.365  81.147  1.00 239.01 ? 223 PRO A CD  1 
ATOM   1744 N N   . LEU A 1 224 ? -5.334  14.386  84.516  1.00 257.22 ? 224 LEU A N   1 
ATOM   1745 C CA  . LEU A 1 224 ? -5.434  14.304  85.975  1.00 258.06 ? 224 LEU A CA  1 
ATOM   1746 C C   . LEU A 1 224 ? -6.699  13.571  86.436  1.00 260.21 ? 224 LEU A C   1 
ATOM   1747 O O   . LEU A 1 224 ? -7.048  12.523  85.892  1.00 259.78 ? 224 LEU A O   1 
ATOM   1748 C CB  . LEU A 1 224 ? -5.342  15.695  86.615  1.00 254.48 ? 224 LEU A CB  1 
ATOM   1749 C CG  . LEU A 1 224 ? -4.949  15.747  88.095  1.00 251.63 ? 224 LEU A CG  1 
ATOM   1750 C CD1 . LEU A 1 224 ? -3.639  15.011  88.335  1.00 252.12 ? 224 LEU A CD1 1 
ATOM   1751 C CD2 . LEU A 1 224 ? -4.857  17.185  88.580  1.00 247.07 ? 224 LEU A CD2 1 
ATOM   1752 N N   . LYS A 1 225 ? -7.376  14.123  87.440  1.00 261.63 ? 225 LYS A N   1 
ATOM   1753 C CA  . LYS A 1 225 ? -8.562  13.488  88.016  1.00 260.80 ? 225 LYS A CA  1 
ATOM   1754 C C   . LYS A 1 225 ? -9.716  13.358  87.024  1.00 259.40 ? 225 LYS A C   1 
ATOM   1755 O O   . LYS A 1 225 ? -9.973  12.273  86.502  1.00 263.42 ? 225 LYS A O   1 
ATOM   1756 C CB  . LYS A 1 225 ? -9.026  14.231  89.274  1.00 256.04 ? 225 LYS A CB  1 
ATOM   1757 C CG  . LYS A 1 225 ? -8.439  13.698  90.575  1.00 252.95 ? 225 LYS A CG  1 
ATOM   1758 C CD  . LYS A 1 225 ? -6.932  13.887  90.635  1.00 250.11 ? 225 LYS A CD  1 
ATOM   1759 C CE  . LYS A 1 225 ? -6.369  13.375  91.952  1.00 247.06 ? 225 LYS A CE  1 
ATOM   1760 N NZ  . LYS A 1 225 ? -4.898  13.585  92.051  1.00 244.44 ? 225 LYS A NZ  1 
ATOM   1761 N N   . ASN A 1 226 ? -10.415 14.461  86.770  1.00 250.76 ? 226 ASN A N   1 
ATOM   1762 C CA  . ASN A 1 226 ? -11.576 14.425  85.885  1.00 241.90 ? 226 ASN A CA  1 
ATOM   1763 C C   . ASN A 1 226 ? -11.725 15.669  85.004  1.00 236.42 ? 226 ASN A C   1 
ATOM   1764 O O   . ASN A 1 226 ? -12.559 15.698  84.099  1.00 237.63 ? 226 ASN A O   1 
ATOM   1765 C CB  . ASN A 1 226 ? -12.853 14.176  86.695  1.00 235.24 ? 226 ASN A CB  1 
ATOM   1766 C CG  . ASN A 1 226 ? -13.913 13.436  85.900  1.00 230.60 ? 226 ASN A CG  1 
ATOM   1767 O OD1 . ASN A 1 226 ? -14.388 13.920  84.875  1.00 228.32 ? 226 ASN A OD1 1 
ATOM   1768 N ND2 . ASN A 1 226 ? -14.292 12.255  86.377  1.00 229.99 ? 226 ASN A ND2 1 
ATOM   1769 N N   . SER A 1 227 ? -10.917 16.694  85.267  1.00 228.37 ? 227 SER A N   1 
ATOM   1770 C CA  . SER A 1 227 ? -10.907 17.886  84.424  1.00 218.68 ? 227 SER A CA  1 
ATOM   1771 C C   . SER A 1 227 ? -10.185 17.568  83.121  1.00 225.77 ? 227 SER A C   1 
ATOM   1772 O O   . SER A 1 227 ? -9.154  16.897  83.129  1.00 227.63 ? 227 SER A O   1 
ATOM   1773 C CB  . SER A 1 227 ? -10.227 19.054  85.138  1.00 203.22 ? 227 SER A CB  1 
ATOM   1774 O OG  . SER A 1 227 ? -8.847  18.801  85.331  1.00 195.59 ? 227 SER A OG  1 
ATOM   1775 N N   . ARG A 1 228 ? -10.723 18.046  82.002  1.00 229.60 ? 228 ARG A N   1 
ATOM   1776 C CA  . ARG A 1 228 ? -10.181 17.687  80.691  1.00 231.51 ? 228 ARG A CA  1 
ATOM   1777 C C   . ARG A 1 228 ? -9.295  18.766  80.068  1.00 228.92 ? 228 ARG A C   1 
ATOM   1778 O O   . ARG A 1 228 ? -9.685  19.427  79.105  1.00 229.84 ? 228 ARG A O   1 
ATOM   1779 C CB  . ARG A 1 228 ? -11.305 17.292  79.727  1.00 230.16 ? 228 ARG A CB  1 
ATOM   1780 C CG  . ARG A 1 228 ? -12.190 16.164  80.240  1.00 230.57 ? 228 ARG A CG  1 
ATOM   1781 C CD  . ARG A 1 228 ? -11.368 14.991  80.769  1.00 230.38 ? 228 ARG A CD  1 
ATOM   1782 N NE  . ARG A 1 228 ? -10.946 14.070  79.716  1.00 230.97 ? 228 ARG A NE  1 
ATOM   1783 C CZ  . ARG A 1 228 ? -9.762  14.107  79.112  1.00 230.52 ? 228 ARG A CZ  1 
ATOM   1784 N NH1 . ARG A 1 228 ? -8.870  15.028  79.449  1.00 228.81 ? 228 ARG A NH1 1 
ATOM   1785 N NH2 . ARG A 1 228 ? -9.470  13.223  78.168  1.00 231.10 ? 228 ARG A NH2 1 
ATOM   1786 N N   . GLN A 1 229 ? -8.098  18.928  80.625  1.00 222.18 ? 229 GLN A N   1 
ATOM   1787 C CA  . GLN A 1 229 ? -7.097  19.827  80.066  1.00 209.05 ? 229 GLN A CA  1 
ATOM   1788 C C   . GLN A 1 229 ? -5.886  19.022  79.613  1.00 203.38 ? 229 GLN A C   1 
ATOM   1789 O O   . GLN A 1 229 ? -4.973  18.764  80.399  1.00 199.62 ? 229 GLN A O   1 
ATOM   1790 C CB  . GLN A 1 229 ? -6.665  20.867  81.099  1.00 201.69 ? 229 GLN A CB  1 
ATOM   1791 C CG  . GLN A 1 229 ? -7.787  21.747  81.617  1.00 196.98 ? 229 GLN A CG  1 
ATOM   1792 C CD  . GLN A 1 229 ? -7.310  22.727  82.671  1.00 191.60 ? 229 GLN A CD  1 
ATOM   1793 O OE1 . GLN A 1 229 ? -6.124  22.775  82.997  1.00 186.08 ? 229 GLN A OE1 1 
ATOM   1794 N NE2 . GLN A 1 229 ? -8.234  23.515  83.211  1.00 191.38 ? 229 GLN A NE2 1 
ATOM   1795 N N   . VAL A 1 230 ? -5.886  18.620  78.347  1.00 200.39 ? 230 VAL A N   1 
ATOM   1796 C CA  . VAL A 1 230 ? -4.791  17.832  77.793  1.00 195.53 ? 230 VAL A CA  1 
ATOM   1797 C C   . VAL A 1 230 ? -3.460  18.568  77.916  1.00 193.29 ? 230 VAL A C   1 
ATOM   1798 O O   . VAL A 1 230 ? -3.234  19.578  77.251  1.00 188.62 ? 230 VAL A O   1 
ATOM   1799 C CB  . VAL A 1 230 ? -5.037  17.479  76.314  1.00 189.94 ? 230 VAL A CB  1 
ATOM   1800 C CG1 . VAL A 1 230 ? -3.897  16.632  75.775  1.00 188.54 ? 230 VAL A CG1 1 
ATOM   1801 C CG2 . VAL A 1 230 ? -6.360  16.754  76.156  1.00 188.65 ? 230 VAL A CG2 1 
ATOM   1802 N N   . GLU A 1 231 ? -2.585  18.055  78.775  1.00 195.18 ? 231 GLU A N   1 
ATOM   1803 C CA  . GLU A 1 231 ? -1.260  18.635  78.968  1.00 194.52 ? 231 GLU A CA  1 
ATOM   1804 C C   . GLU A 1 231 ? -0.216  17.849  78.175  1.00 199.63 ? 231 GLU A C   1 
ATOM   1805 O O   . GLU A 1 231 ? -0.134  16.626  78.290  1.00 205.89 ? 231 GLU A O   1 
ATOM   1806 C CB  . GLU A 1 231 ? -0.909  18.667  80.459  1.00 190.43 ? 231 GLU A CB  1 
ATOM   1807 C CG  . GLU A 1 231 ? 0.541   19.005  80.770  1.00 187.52 ? 231 GLU A CG  1 
ATOM   1808 C CD  . GLU A 1 231 ? 1.432   17.776  80.813  1.00 189.05 ? 231 GLU A CD  1 
ATOM   1809 O OE1 . GLU A 1 231 ? 0.913   16.654  80.639  1.00 187.99 ? 231 GLU A OE1 1 
ATOM   1810 O OE2 . GLU A 1 231 ? 2.651   17.932  81.025  1.00 190.08 ? 231 GLU A OE2 1 
ATOM   1811 N N   . VAL A 1 232 ? 0.575   18.555  77.368  1.00 193.53 ? 232 VAL A N   1 
ATOM   1812 C CA  . VAL A 1 232 ? 1.551   17.907  76.493  1.00 181.44 ? 232 VAL A CA  1 
ATOM   1813 C C   . VAL A 1 232 ? 2.988   18.343  76.767  1.00 172.39 ? 232 VAL A C   1 
ATOM   1814 O O   . VAL A 1 232 ? 3.291   19.536  76.813  1.00 160.92 ? 232 VAL A O   1 
ATOM   1815 C CB  . VAL A 1 232 ? 1.244   18.163  75.006  1.00 172.39 ? 232 VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 232 ? 2.172   17.336  74.130  1.00 170.35 ? 232 VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 232 ? -0.208  17.842  74.699  1.00 171.64 ? 232 VAL A CG2 1 
ATOM   1818 N N   . SER A 1 233 ? 3.867   17.360  76.937  1.00 172.45 ? 233 SER A N   1 
ATOM   1819 C CA  . SER A 1 233 ? 5.289   17.617  77.129  1.00 168.76 ? 233 SER A CA  1 
ATOM   1820 C C   . SER A 1 233 ? 6.114   16.699  76.233  1.00 169.87 ? 233 SER A C   1 
ATOM   1821 O O   . SER A 1 233 ? 5.667   15.612  75.866  1.00 173.02 ? 233 SER A O   1 
ATOM   1822 C CB  . SER A 1 233 ? 5.680   17.420  78.595  1.00 161.76 ? 233 SER A CB  1 
ATOM   1823 O OG  . SER A 1 233 ? 5.419   16.094  79.020  1.00 160.08 ? 233 SER A OG  1 
ATOM   1824 N N   . TRP A 1 234 ? 7.316   17.144  75.880  1.00 163.33 ? 234 TRP A N   1 
ATOM   1825 C CA  . TRP A 1 234 ? 8.204   16.365  75.025  1.00 155.79 ? 234 TRP A CA  1 
ATOM   1826 C C   . TRP A 1 234 ? 9.650   16.537  75.469  1.00 147.54 ? 234 TRP A C   1 
ATOM   1827 O O   . TRP A 1 234 ? 9.917   16.887  76.616  1.00 151.64 ? 234 TRP A O   1 
ATOM   1828 C CB  . TRP A 1 234 ? 8.062   16.807  73.571  1.00 157.28 ? 234 TRP A CB  1 
ATOM   1829 C CG  . TRP A 1 234 ? 8.351   18.257  73.385  1.00 159.10 ? 234 TRP A CG  1 
ATOM   1830 C CD1 . TRP A 1 234 ? 9.575   18.834  73.225  1.00 158.82 ? 234 TRP A CD1 1 
ATOM   1831 C CD2 . TRP A 1 234 ? 7.397   19.324  73.355  1.00 159.82 ? 234 TRP A CD2 1 
ATOM   1832 N NE1 . TRP A 1 234 ? 9.444   20.194  73.091  1.00 157.66 ? 234 TRP A NE1 1 
ATOM   1833 C CE2 . TRP A 1 234 ? 8.116   20.521  73.168  1.00 159.06 ? 234 TRP A CE2 1 
ATOM   1834 C CE3 . TRP A 1 234 ? 6.006   19.384  73.467  1.00 161.34 ? 234 TRP A CE3 1 
ATOM   1835 C CZ2 . TRP A 1 234 ? 7.491   21.761  73.090  1.00 160.82 ? 234 TRP A CZ2 1 
ATOM   1836 C CZ3 . TRP A 1 234 ? 5.387   20.617  73.387  1.00 162.05 ? 234 TRP A CZ3 1 
ATOM   1837 C CH2 . TRP A 1 234 ? 6.129   21.789  73.201  1.00 161.82 ? 234 TRP A CH2 1 
ATOM   1838 N N   . GLU A 1 235 ? 10.579  16.299  74.550  1.00 139.13 ? 235 GLU A N   1 
ATOM   1839 C CA  . GLU A 1 235 ? 12.000  16.416  74.848  1.00 140.75 ? 235 GLU A CA  1 
ATOM   1840 C C   . GLU A 1 235 ? 12.765  16.700  73.555  1.00 144.63 ? 235 GLU A C   1 
ATOM   1841 O O   . GLU A 1 235 ? 12.322  16.312  72.474  1.00 153.87 ? 235 GLU A O   1 
ATOM   1842 C CB  . GLU A 1 235 ? 12.496  15.126  75.498  1.00 148.73 ? 235 GLU A CB  1 
ATOM   1843 C CG  . GLU A 1 235 ? 13.488  15.330  76.630  1.00 160.43 ? 235 GLU A CG  1 
ATOM   1844 C CD  . GLU A 1 235 ? 13.383  14.250  77.698  1.00 170.62 ? 235 GLU A CD  1 
ATOM   1845 O OE1 . GLU A 1 235 ? 12.493  13.379  77.586  1.00 170.98 ? 235 GLU A OE1 1 
ATOM   1846 O OE2 . GLU A 1 235 ? 14.186  14.277  78.655  1.00 175.41 ? 235 GLU A OE2 1 
ATOM   1847 N N   . TYR A 1 236 ? 13.903  17.384  73.659  1.00 133.27 ? 236 TYR A N   1 
ATOM   1848 C CA  . TYR A 1 236 ? 14.707  17.719  72.477  1.00 114.52 ? 236 TYR A CA  1 
ATOM   1849 C C   . TYR A 1 236 ? 15.179  16.473  71.727  1.00 118.99 ? 236 TYR A C   1 
ATOM   1850 O O   . TYR A 1 236 ? 15.625  15.504  72.344  1.00 130.12 ? 236 TYR A O   1 
ATOM   1851 C CB  . TYR A 1 236 ? 15.914  18.581  72.866  1.00 99.09  ? 236 TYR A CB  1 
ATOM   1852 C CG  . TYR A 1 236 ? 15.637  20.071  72.900  1.00 100.69 ? 236 TYR A CG  1 
ATOM   1853 C CD1 . TYR A 1 236 ? 16.644  20.992  72.635  1.00 92.87  ? 236 TYR A CD1 1 
ATOM   1854 C CD2 . TYR A 1 236 ? 14.369  20.556  73.184  1.00 105.09 ? 236 TYR A CD2 1 
ATOM   1855 C CE1 . TYR A 1 236 ? 16.398  22.352  72.671  1.00 89.39  ? 236 TYR A CE1 1 
ATOM   1856 C CE2 . TYR A 1 236 ? 14.113  21.915  73.215  1.00 98.97  ? 236 TYR A CE2 1 
ATOM   1857 C CZ  . TYR A 1 236 ? 15.129  22.808  72.959  1.00 94.04  ? 236 TYR A CZ  1 
ATOM   1858 O OH  . TYR A 1 236 ? 14.871  24.161  72.995  1.00 96.49  ? 236 TYR A OH  1 
ATOM   1859 N N   . PRO A 1 237 ? 15.081  16.498  70.389  1.00 113.37 ? 237 PRO A N   1 
ATOM   1860 C CA  . PRO A 1 237 ? 15.498  15.392  69.521  1.00 106.38 ? 237 PRO A CA  1 
ATOM   1861 C C   . PRO A 1 237 ? 16.926  14.960  69.820  1.00 102.18 ? 237 PRO A C   1 
ATOM   1862 O O   . PRO A 1 237 ? 17.751  15.790  70.206  1.00 97.61  ? 237 PRO A O   1 
ATOM   1863 C CB  . PRO A 1 237 ? 15.422  16.004  68.123  1.00 108.09 ? 237 PRO A CB  1 
ATOM   1864 C CG  . PRO A 1 237 ? 14.395  17.060  68.238  1.00 113.61 ? 237 PRO A CG  1 
ATOM   1865 C CD  . PRO A 1 237 ? 14.548  17.631  69.616  1.00 116.62 ? 237 PRO A CD  1 
ATOM   1866 N N   . ASP A 1 238 ? 17.209  13.674  69.635  1.00 101.51 ? 238 ASP A N   1 
ATOM   1867 C CA  . ASP A 1 238 ? 18.515  13.115  69.974  1.00 112.28 ? 238 ASP A CA  1 
ATOM   1868 C C   . ASP A 1 238 ? 19.621  13.646  69.067  1.00 110.54 ? 238 ASP A C   1 
ATOM   1869 O O   . ASP A 1 238 ? 20.757  13.838  69.501  1.00 114.93 ? 238 ASP A O   1 
ATOM   1870 C CB  . ASP A 1 238 ? 18.482  11.582  69.917  1.00 125.05 ? 238 ASP A CB  1 
ATOM   1871 C CG  . ASP A 1 238 ? 17.733  10.962  71.090  1.00 134.01 ? 238 ASP A CG  1 
ATOM   1872 O OD1 . ASP A 1 238 ? 17.619  9.717   71.128  1.00 135.58 ? 238 ASP A OD1 1 
ATOM   1873 O OD2 . ASP A 1 238 ? 17.264  11.715  71.971  1.00 136.63 ? 238 ASP A OD2 1 
ATOM   1874 N N   . THR A 1 239 ? 19.282  13.880  67.806  1.00 103.86 ? 239 THR A N   1 
ATOM   1875 C CA  . THR A 1 239 ? 20.265  14.310  66.820  1.00 94.27  ? 239 THR A CA  1 
ATOM   1876 C C   . THR A 1 239 ? 20.606  15.790  66.962  1.00 87.93  ? 239 THR A C   1 
ATOM   1877 O O   . THR A 1 239 ? 21.691  16.225  66.579  1.00 81.49  ? 239 THR A O   1 
ATOM   1878 C CB  . THR A 1 239 ? 19.760  14.048  65.403  1.00 91.58  ? 239 THR A CB  1 
ATOM   1879 O OG1 . THR A 1 239 ? 18.633  14.892  65.138  1.00 100.88 ? 239 THR A OG1 1 
ATOM   1880 C CG2 . THR A 1 239 ? 19.344  12.600  65.260  1.00 74.66  ? 239 THR A CG2 1 
ATOM   1881 N N   . TRP A 1 240 ? 19.678  16.562  67.517  1.00 84.95  ? 240 TRP A N   1 
ATOM   1882 C CA  . TRP A 1 240 ? 19.909  17.988  67.681  1.00 91.20  ? 240 TRP A CA  1 
ATOM   1883 C C   . TRP A 1 240 ? 21.189  18.284  68.455  1.00 101.96 ? 240 TRP A C   1 
ATOM   1884 O O   . TRP A 1 240 ? 21.540  17.574  69.397  1.00 103.78 ? 240 TRP A O   1 
ATOM   1885 C CB  . TRP A 1 240 ? 18.732  18.684  68.351  1.00 82.88  ? 240 TRP A CB  1 
ATOM   1886 C CG  . TRP A 1 240 ? 18.923  20.160  68.355  1.00 84.93  ? 240 TRP A CG  1 
ATOM   1887 C CD1 . TRP A 1 240 ? 19.306  20.936  69.408  1.00 89.78  ? 240 TRP A CD1 1 
ATOM   1888 C CD2 . TRP A 1 240 ? 18.784  21.040  67.235  1.00 97.29  ? 240 TRP A CD2 1 
ATOM   1889 N NE1 . TRP A 1 240 ? 19.395  22.250  69.020  1.00 95.60  ? 240 TRP A NE1 1 
ATOM   1890 C CE2 . TRP A 1 240 ? 19.079  22.342  67.690  1.00 95.19  ? 240 TRP A CE2 1 
ATOM   1891 C CE3 . TRP A 1 240 ? 18.429  20.857  65.892  1.00 99.16  ? 240 TRP A CE3 1 
ATOM   1892 C CZ2 . TRP A 1 240 ? 19.031  23.456  66.849  1.00 93.53  ? 240 TRP A CZ2 1 
ATOM   1893 C CZ3 . TRP A 1 240 ? 18.380  21.962  65.059  1.00 100.72 ? 240 TRP A CZ3 1 
ATOM   1894 C CH2 . TRP A 1 240 ? 18.679  23.246  65.541  1.00 100.94 ? 240 TRP A CH2 1 
ATOM   1895 N N   . SER A 1 241 ? 21.869  19.352  68.050  1.00 109.11 ? 241 SER A N   1 
ATOM   1896 C CA  . SER A 1 241 ? 23.167  19.712  68.606  1.00 110.08 ? 241 SER A CA  1 
ATOM   1897 C C   . SER A 1 241 ? 23.028  20.196  70.056  1.00 114.70 ? 241 SER A C   1 
ATOM   1898 O O   . SER A 1 241 ? 22.009  20.776  70.432  1.00 115.32 ? 241 SER A O   1 
ATOM   1899 C CB  . SER A 1 241 ? 23.825  20.783  67.727  1.00 98.38  ? 241 SER A CB  1 
ATOM   1900 O OG  . SER A 1 241 ? 25.177  20.461  67.436  1.00 92.56  ? 241 SER A OG  1 
ATOM   1901 N N   . THR A 1 242 ? 24.051  19.943  70.866  1.00 114.90 ? 242 THR A N   1 
ATOM   1902 C CA  . THR A 1 242 ? 24.041  20.334  72.275  1.00 112.24 ? 242 THR A CA  1 
ATOM   1903 C C   . THR A 1 242 ? 25.197  21.297  72.546  1.00 102.90 ? 242 THR A C   1 
ATOM   1904 O O   . THR A 1 242 ? 26.172  21.307  71.791  1.00 107.25 ? 242 THR A O   1 
ATOM   1905 C CB  . THR A 1 242 ? 24.140  19.093  73.200  1.00 117.63 ? 242 THR A CB  1 
ATOM   1906 O OG1 . THR A 1 242 ? 25.424  18.470  73.058  1.00 94.91  ? 242 THR A OG1 1 
ATOM   1907 C CG2 . THR A 1 242 ? 23.053  18.083  72.854  1.00 107.99 ? 242 THR A CG2 1 
ATOM   1908 N N   . PRO A 1 243 ? 25.106  22.114  73.614  1.00 93.35  ? 243 PRO A N   1 
ATOM   1909 C CA  . PRO A 1 243 ? 24.084  22.247  74.664  1.00 101.35 ? 243 PRO A CA  1 
ATOM   1910 C C   . PRO A 1 243 ? 22.804  22.928  74.193  1.00 99.98  ? 243 PRO A C   1 
ATOM   1911 O O   . PRO A 1 243 ? 22.871  23.987  73.577  1.00 101.39 ? 243 PRO A O   1 
ATOM   1912 C CB  . PRO A 1 243 ? 24.759  23.157  75.700  1.00 102.98 ? 243 PRO A CB  1 
ATOM   1913 C CG  . PRO A 1 243 ? 26.194  23.248  75.303  1.00 102.74 ? 243 PRO A CG  1 
ATOM   1914 C CD  . PRO A 1 243 ? 26.219  23.049  73.832  1.00 96.69  ? 243 PRO A CD  1 
ATOM   1915 N N   . HIS A 1 244 ? 21.656  22.346  74.522  1.00 91.33  ? 244 HIS A N   1 
ATOM   1916 C CA  . HIS A 1 244 ? 20.369  22.854  74.058  1.00 79.33  ? 244 HIS A CA  1 
ATOM   1917 C C   . HIS A 1 244 ? 20.126  24.324  74.383  1.00 84.32  ? 244 HIS A C   1 
ATOM   1918 O O   . HIS A 1 244 ? 19.184  24.924  73.868  1.00 94.14  ? 244 HIS A O   1 
ATOM   1919 C CB  . HIS A 1 244 ? 19.225  22.018  74.634  1.00 87.92  ? 244 HIS A CB  1 
ATOM   1920 C CG  . HIS A 1 244 ? 19.216  20.597  74.166  1.00 99.72  ? 244 HIS A CG  1 
ATOM   1921 N ND1 . HIS A 1 244 ? 19.589  20.233  72.889  1.00 104.02 ? 244 HIS A ND1 1 
ATOM   1922 C CD2 . HIS A 1 244 ? 18.854  19.453  74.791  1.00 101.50 ? 244 HIS A CD2 1 
ATOM   1923 C CE1 . HIS A 1 244 ? 19.474  18.924  72.754  1.00 107.02 ? 244 HIS A CE1 1 
ATOM   1924 N NE2 . HIS A 1 244 ? 19.027  18.427  73.895  1.00 106.86 ? 244 HIS A NE2 1 
ATOM   1925 N N   . SER A 1 245 ? 20.959  24.900  75.246  1.00 98.93  ? 245 SER A N   1 
ATOM   1926 C CA  . SER A 1 245 ? 20.789  26.291  75.667  1.00 104.25 ? 245 SER A CA  1 
ATOM   1927 C C   . SER A 1 245 ? 21.495  27.220  74.693  1.00 107.50 ? 245 SER A C   1 
ATOM   1928 O O   . SER A 1 245 ? 21.009  28.307  74.375  1.00 109.94 ? 245 SER A O   1 
ATOM   1929 C CB  . SER A 1 245 ? 21.364  26.497  77.067  1.00 94.99  ? 245 SER A CB  1 
ATOM   1930 O OG  . SER A 1 245 ? 22.781  26.451  77.048  1.00 91.55  ? 245 SER A OG  1 
ATOM   1931 N N   . TYR A 1 246 ? 22.660  26.776  74.239  1.00 105.58 ? 246 TYR A N   1 
ATOM   1932 C CA  . TYR A 1 246 ? 23.451  27.496  73.260  1.00 106.00 ? 246 TYR A CA  1 
ATOM   1933 C C   . TYR A 1 246 ? 22.846  27.269  71.887  1.00 111.51 ? 246 TYR A C   1 
ATOM   1934 O O   . TYR A 1 246 ? 23.092  28.024  70.952  1.00 116.48 ? 246 TYR A O   1 
ATOM   1935 C CB  . TYR A 1 246 ? 24.886  26.980  73.286  1.00 103.95 ? 246 TYR A CB  1 
ATOM   1936 C CG  . TYR A 1 246 ? 25.844  27.779  72.444  1.00 101.98 ? 246 TYR A CG  1 
ATOM   1937 C CD1 . TYR A 1 246 ? 26.193  27.361  71.173  1.00 99.87  ? 246 TYR A CD1 1 
ATOM   1938 C CD2 . TYR A 1 246 ? 26.402  28.953  72.921  1.00 106.17 ? 246 TYR A CD2 1 
ATOM   1939 C CE1 . TYR A 1 246 ? 27.073  28.087  70.398  1.00 94.35  ? 246 TYR A CE1 1 
ATOM   1940 C CE2 . TYR A 1 246 ? 27.284  29.687  72.152  1.00 101.96 ? 246 TYR A CE2 1 
ATOM   1941 C CZ  . TYR A 1 246 ? 27.616  29.249  70.893  1.00 90.18  ? 246 TYR A CZ  1 
ATOM   1942 O OH  . TYR A 1 246 ? 28.494  29.976  70.126  1.00 84.91  ? 246 TYR A OH  1 
ATOM   1943 N N   . PHE A 1 247 ? 22.051  26.209  71.782  1.00 105.65 ? 247 PHE A N   1 
ATOM   1944 C CA  . PHE A 1 247 ? 21.395  25.832  70.539  1.00 84.97  ? 247 PHE A CA  1 
ATOM   1945 C C   . PHE A 1 247 ? 19.902  25.692  70.768  1.00 81.13  ? 247 PHE A C   1 
ATOM   1946 O O   . PHE A 1 247 ? 19.349  24.601  70.650  1.00 78.10  ? 247 PHE A O   1 
ATOM   1947 C CB  . PHE A 1 247 ? 21.934  24.499  70.039  1.00 74.61  ? 247 PHE A CB  1 
ATOM   1948 C CG  . PHE A 1 247 ? 23.367  24.544  69.604  1.00 85.90  ? 247 PHE A CG  1 
ATOM   1949 C CD1 . PHE A 1 247 ? 24.342  23.892  70.331  1.00 89.82  ? 247 PHE A CD1 1 
ATOM   1950 C CD2 . PHE A 1 247 ? 23.738  25.226  68.460  1.00 89.23  ? 247 PHE A CD2 1 
ATOM   1951 C CE1 . PHE A 1 247 ? 25.660  23.922  69.927  1.00 86.41  ? 247 PHE A CE1 1 
ATOM   1952 C CE2 . PHE A 1 247 ? 25.055  25.261  68.056  1.00 83.19  ? 247 PHE A CE2 1 
ATOM   1953 C CZ  . PHE A 1 247 ? 26.016  24.609  68.789  1.00 79.08  ? 247 PHE A CZ  1 
ATOM   1954 N N   . SER A 1 248 ? 19.252  26.799  71.098  1.00 73.69  ? 248 SER A N   1 
ATOM   1955 C CA  . SER A 1 248 ? 17.834  26.786  71.435  1.00 81.74  ? 248 SER A CA  1 
ATOM   1956 C C   . SER A 1 248 ? 16.976  26.246  70.295  1.00 85.81  ? 248 SER A C   1 
ATOM   1957 O O   . SER A 1 248 ? 17.379  26.291  69.133  1.00 91.48  ? 248 SER A O   1 
ATOM   1958 C CB  . SER A 1 248 ? 17.379  28.197  71.794  1.00 84.82  ? 248 SER A CB  1 
ATOM   1959 O OG  . SER A 1 248 ? 18.420  28.919  72.430  1.00 92.68  ? 248 SER A OG  1 
ATOM   1960 N N   . LEU A 1 249 ? 15.796  25.732  70.633  1.00 80.87  ? 249 LEU A N   1 
ATOM   1961 C CA  . LEU A 1 249 ? 14.795  25.368  69.635  1.00 80.59  ? 249 LEU A CA  1 
ATOM   1962 C C   . LEU A 1 249 ? 13.489  26.113  69.865  1.00 93.38  ? 249 LEU A C   1 
ATOM   1963 O O   . LEU A 1 249 ? 13.292  26.756  70.903  1.00 92.95  ? 249 LEU A O   1 
ATOM   1964 C CB  . LEU A 1 249 ? 14.488  23.870  69.654  1.00 83.37  ? 249 LEU A CB  1 
ATOM   1965 C CG  . LEU A 1 249 ? 15.202  22.906  68.709  1.00 91.96  ? 249 LEU A CG  1 
ATOM   1966 C CD1 . LEU A 1 249 ? 15.717  23.635  67.483  1.00 92.33  ? 249 LEU A CD1 1 
ATOM   1967 C CD2 . LEU A 1 249 ? 16.332  22.212  69.428  1.00 97.38  ? 249 LEU A CD2 1 
ATOM   1968 N N   . THR A 1 250 ? 12.597  26.008  68.884  1.00 99.17  ? 250 THR A N   1 
ATOM   1969 C CA  . THR A 1 250 ? 11.238  26.520  68.999  1.00 101.39 ? 250 THR A CA  1 
ATOM   1970 C C   . THR A 1 250 ? 10.270  25.467  68.466  1.00 111.37 ? 250 THR A C   1 
ATOM   1971 O O   . THR A 1 250 ? 10.672  24.543  67.759  1.00 114.42 ? 250 THR A O   1 
ATOM   1972 C CB  . THR A 1 250 ? 11.054  27.836  68.233  1.00 94.10  ? 250 THR A CB  1 
ATOM   1973 O OG1 . THR A 1 250 ? 9.863   28.490  68.685  1.00 91.68  ? 250 THR A OG1 1 
ATOM   1974 C CG2 . THR A 1 250 ? 10.947  27.575  66.741  1.00 95.48  ? 250 THR A CG2 1 
ATOM   1975 N N   . PHE A 1 251 ? 8.994   25.599  68.807  1.00 114.93 ? 251 PHE A N   1 
ATOM   1976 C CA  . PHE A 1 251 ? 8.028   24.558  68.477  1.00 115.82 ? 251 PHE A CA  1 
ATOM   1977 C C   . PHE A 1 251 ? 6.690   25.123  68.034  1.00 115.73 ? 251 PHE A C   1 
ATOM   1978 O O   . PHE A 1 251 ? 6.324   26.245  68.393  1.00 106.58 ? 251 PHE A O   1 
ATOM   1979 C CB  . PHE A 1 251 ? 7.825   23.628  69.676  1.00 109.41 ? 251 PHE A CB  1 
ATOM   1980 C CG  . PHE A 1 251 ? 9.096   23.012  70.181  1.00 102.25 ? 251 PHE A CG  1 
ATOM   1981 C CD1 . PHE A 1 251 ? 9.948   23.725  71.009  1.00 96.74  ? 251 PHE A CD1 1 
ATOM   1982 C CD2 . PHE A 1 251 ? 9.444   21.724  69.822  1.00 97.18  ? 251 PHE A CD2 1 
ATOM   1983 C CE1 . PHE A 1 251 ? 11.121  23.164  71.466  1.00 97.31  ? 251 PHE A CE1 1 
ATOM   1984 C CE2 . PHE A 1 251 ? 10.614  21.156  70.278  1.00 94.25  ? 251 PHE A CE2 1 
ATOM   1985 C CZ  . PHE A 1 251 ? 11.454  21.876  71.101  1.00 96.22  ? 251 PHE A CZ  1 
ATOM   1986 N N   . CYS A 1 252 ? 5.963   24.337  67.250  1.00 116.72 ? 252 CYS A N   1 
ATOM   1987 C CA  . CYS A 1 252 ? 4.599   24.681  66.887  1.00 119.02 ? 252 CYS A CA  1 
ATOM   1988 C C   . CYS A 1 252 ? 3.668   23.524  67.208  1.00 131.38 ? 252 CYS A C   1 
ATOM   1989 O O   . CYS A 1 252 ? 3.792   22.442  66.636  1.00 135.91 ? 252 CYS A O   1 
ATOM   1990 C CB  . CYS A 1 252 ? 4.501   25.045  65.408  1.00 113.29 ? 252 CYS A CB  1 
ATOM   1991 S SG  . CYS A 1 252 ? 2.863   25.634  64.924  1.00 125.89 ? 252 CYS A SG  1 
ATOM   1992 N N   . VAL A 1 253 ? 2.741   23.763  68.133  1.00 137.38 ? 253 VAL A N   1 
ATOM   1993 C CA  . VAL A 1 253 ? 1.788   22.746  68.567  1.00 138.27 ? 253 VAL A CA  1 
ATOM   1994 C C   . VAL A 1 253 ? 0.463   22.870  67.812  1.00 144.11 ? 253 VAL A C   1 
ATOM   1995 O O   . VAL A 1 253 ? -0.214  23.896  67.896  1.00 139.75 ? 253 VAL A O   1 
ATOM   1996 C CB  . VAL A 1 253 ? 1.525   22.837  70.082  1.00 127.44 ? 253 VAL A CB  1 
ATOM   1997 C CG1 . VAL A 1 253 ? 0.709   21.646  70.549  1.00 129.32 ? 253 VAL A CG1 1 
ATOM   1998 C CG2 . VAL A 1 253 ? 2.839   22.916  70.844  1.00 118.97 ? 253 VAL A CG2 1 
ATOM   1999 N N   . GLN A 1 254 ? 0.098   21.820  67.078  1.00 149.94 ? 254 GLN A N   1 
ATOM   2000 C CA  . GLN A 1 254 ? -1.099  21.842  66.241  1.00 153.18 ? 254 GLN A CA  1 
ATOM   2001 C C   . GLN A 1 254 ? -2.180  20.887  66.748  1.00 160.00 ? 254 GLN A C   1 
ATOM   2002 O O   . GLN A 1 254 ? -2.283  20.621  67.946  1.00 155.38 ? 254 GLN A O   1 
ATOM   2003 C CB  . GLN A 1 254 ? -0.741  21.496  64.792  1.00 155.13 ? 254 GLN A CB  1 
ATOM   2004 C CG  . GLN A 1 254 ? -1.722  22.029  63.753  1.00 157.36 ? 254 GLN A CG  1 
ATOM   2005 C CD  . GLN A 1 254 ? -1.650  21.274  62.436  1.00 159.04 ? 254 GLN A CD  1 
ATOM   2006 O OE1 . GLN A 1 254 ? -1.585  21.876  61.364  1.00 159.54 ? 254 GLN A OE1 1 
ATOM   2007 N NE2 . GLN A 1 254 ? -1.659  19.946  62.513  1.00 157.74 ? 254 GLN A NE2 1 
ATOM   2008 N N   . VAL A 1 255 ? -2.975  20.371  65.815  1.00 169.97 ? 255 VAL A N   1 
ATOM   2009 C CA  . VAL A 1 255 ? -4.121  19.528  66.135  1.00 175.38 ? 255 VAL A CA  1 
ATOM   2010 C C   . VAL A 1 255 ? -4.752  19.031  64.825  1.00 176.80 ? 255 VAL A C   1 
ATOM   2011 O O   . VAL A 1 255 ? -4.065  18.936  63.806  1.00 176.43 ? 255 VAL A O   1 
ATOM   2012 C CB  . VAL A 1 255 ? -5.145  20.306  67.002  1.00 129.66 ? 255 VAL A CB  1 
ATOM   2013 C CG1 . VAL A 1 255 ? -5.880  21.351  66.165  1.00 131.64 ? 255 VAL A CG1 1 
ATOM   2014 C CG2 . VAL A 1 255 ? -6.114  19.356  67.697  1.00 124.84 ? 255 VAL A CG2 1 
ATOM   2015 N N   . GLN A 1 256 ? -6.041  18.701  64.848  1.00 176.44 ? 256 GLN A N   1 
ATOM   2016 C CA  . GLN A 1 256 ? -6.746  18.318  63.626  1.00 175.38 ? 256 GLN A CA  1 
ATOM   2017 C C   . GLN A 1 256 ? -7.704  19.418  63.179  1.00 169.19 ? 256 GLN A C   1 
ATOM   2018 O O   . GLN A 1 256 ? -7.714  20.516  63.741  1.00 161.76 ? 256 GLN A O   1 
ATOM   2019 C CB  . GLN A 1 256 ? -7.507  17.001  63.814  1.00 182.24 ? 256 GLN A CB  1 
ATOM   2020 C CG  . GLN A 1 256 ? -8.151  16.473  62.533  1.00 185.71 ? 256 GLN A CG  1 
ATOM   2021 C CD  . GLN A 1 256 ? -8.967  15.209  62.751  1.00 186.88 ? 256 GLN A CD  1 
ATOM   2022 O OE1 . GLN A 1 256 ? -9.149  14.408  61.833  1.00 188.59 ? 256 GLN A OE1 1 
ATOM   2023 N NE2 . GLN A 1 256 ? -9.464  15.026  63.970  1.00 183.01 ? 256 GLN A NE2 1 
ATOM   2024 N N   . LYS A 1 264 ? -5.861  31.082  63.895  1.00 192.74 ? 264 LYS A N   1 
ATOM   2025 C CA  . LYS A 1 264 ? -7.003  30.196  64.090  1.00 196.16 ? 264 LYS A CA  1 
ATOM   2026 C C   . LYS A 1 264 ? -6.947  29.489  65.445  1.00 202.43 ? 264 LYS A C   1 
ATOM   2027 O O   . LYS A 1 264 ? -7.788  29.725  66.314  1.00 200.56 ? 264 LYS A O   1 
ATOM   2028 C CB  . LYS A 1 264 ? -7.084  29.169  62.957  1.00 192.73 ? 264 LYS A CB  1 
ATOM   2029 C CG  . LYS A 1 264 ? -7.509  29.751  61.618  1.00 187.29 ? 264 LYS A CG  1 
ATOM   2030 C CD  . LYS A 1 264 ? -7.570  28.675  60.545  1.00 183.53 ? 264 LYS A CD  1 
ATOM   2031 C CE  . LYS A 1 264 ? -8.262  29.183  59.292  1.00 178.14 ? 264 LYS A CE  1 
ATOM   2032 N NZ  . LYS A 1 264 ? -7.576  30.375  58.726  1.00 175.35 ? 264 LYS A NZ  1 
ATOM   2033 N N   . ASP A 1 265 ? -5.953  28.623  65.619  1.00 208.48 ? 265 ASP A N   1 
ATOM   2034 C CA  . ASP A 1 265 ? -5.795  27.885  66.870  1.00 210.16 ? 265 ASP A CA  1 
ATOM   2035 C C   . ASP A 1 265 ? -4.370  27.367  67.094  1.00 210.40 ? 265 ASP A C   1 
ATOM   2036 O O   . ASP A 1 265 ? -4.107  26.678  68.081  1.00 213.62 ? 265 ASP A O   1 
ATOM   2037 C CB  . ASP A 1 265 ? -6.804  26.730  66.949  1.00 211.85 ? 265 ASP A CB  1 
ATOM   2038 C CG  . ASP A 1 265 ? -6.647  25.729  65.814  1.00 211.92 ? 265 ASP A CG  1 
ATOM   2039 O OD1 . ASP A 1 265 ? -5.765  25.924  64.950  1.00 212.62 ? 265 ASP A OD1 1 
ATOM   2040 O OD2 . ASP A 1 265 ? -7.411  24.741  65.785  1.00 209.76 ? 265 ASP A OD2 1 
ATOM   2041 N N   . ARG A 1 266 ? -3.456  27.704  66.186  1.00 202.89 ? 266 ARG A N   1 
ATOM   2042 C CA  . ARG A 1 266 ? -2.067  27.250  66.286  1.00 191.86 ? 266 ARG A CA  1 
ATOM   2043 C C   . ARG A 1 266 ? -1.310  27.979  67.399  1.00 186.08 ? 266 ARG A C   1 
ATOM   2044 O O   . ARG A 1 266 ? -1.440  29.194  67.553  1.00 185.31 ? 266 ARG A O   1 
ATOM   2045 C CB  . ARG A 1 266 ? -1.343  27.427  64.950  1.00 186.33 ? 266 ARG A CB  1 
ATOM   2046 N N   . VAL A 1 267 ? -0.517  27.234  68.166  1.00 179.81 ? 267 VAL A N   1 
ATOM   2047 C CA  . VAL A 1 267 ? 0.192   27.796  69.315  1.00 171.05 ? 267 VAL A CA  1 
ATOM   2048 C C   . VAL A 1 267 ? 1.701   27.565  69.263  1.00 161.53 ? 267 VAL A C   1 
ATOM   2049 O O   . VAL A 1 267 ? 2.175   26.449  69.461  1.00 164.07 ? 267 VAL A O   1 
ATOM   2050 C CB  . VAL A 1 267 ? -0.342  27.222  70.644  1.00 171.15 ? 267 VAL A CB  1 
ATOM   2051 C CG1 . VAL A 1 267 ? 0.454   27.775  71.815  1.00 168.95 ? 267 VAL A CG1 1 
ATOM   2052 C CG2 . VAL A 1 267 ? -1.824  27.531  70.803  1.00 171.51 ? 267 VAL A CG2 1 
ATOM   2053 N N   . PHE A 1 268 ? 2.450   28.632  69.009  1.00 152.37 ? 268 PHE A N   1 
ATOM   2054 C CA  . PHE A 1 268 ? 3.908   28.563  68.985  1.00 143.77 ? 268 PHE A CA  1 
ATOM   2055 C C   . PHE A 1 268 ? 4.471   28.811  70.381  1.00 135.29 ? 268 PHE A C   1 
ATOM   2056 O O   . PHE A 1 268 ? 3.845   29.488  71.195  1.00 127.32 ? 268 PHE A O   1 
ATOM   2057 C CB  . PHE A 1 268 ? 4.472   29.573  67.982  1.00 140.54 ? 268 PHE A CB  1 
ATOM   2058 C CG  . PHE A 1 268 ? 4.094   29.281  66.555  1.00 142.38 ? 268 PHE A CG  1 
ATOM   2059 C CD1 . PHE A 1 268 ? 2.816   29.551  66.092  1.00 142.16 ? 268 PHE A CD1 1 
ATOM   2060 C CD2 . PHE A 1 268 ? 5.014   28.729  65.680  1.00 148.17 ? 268 PHE A CD2 1 
ATOM   2061 C CE1 . PHE A 1 268 ? 2.464   29.278  64.781  1.00 145.19 ? 268 PHE A CE1 1 
ATOM   2062 C CE2 . PHE A 1 268 ? 4.668   28.456  64.366  1.00 150.01 ? 268 PHE A CE2 1 
ATOM   2063 C CZ  . PHE A 1 268 ? 3.391   28.731  63.916  1.00 147.49 ? 268 PHE A CZ  1 
ATOM   2064 N N   . THR A 1 269 ? 5.649   28.258  70.659  1.00 136.59 ? 269 THR A N   1 
ATOM   2065 C CA  . THR A 1 269 ? 6.243   28.370  71.989  1.00 141.03 ? 269 THR A CA  1 
ATOM   2066 C C   . THR A 1 269 ? 7.697   27.906  72.047  1.00 137.93 ? 269 THR A C   1 
ATOM   2067 O O   . THR A 1 269 ? 8.134   27.096  71.232  1.00 141.39 ? 269 THR A O   1 
ATOM   2068 C CB  . THR A 1 269 ? 5.437   27.565  73.021  1.00 152.99 ? 269 THR A CB  1 
ATOM   2069 O OG1 . THR A 1 269 ? 6.174   27.481  74.249  1.00 159.60 ? 269 THR A OG1 1 
ATOM   2070 C CG2 . THR A 1 269 ? 5.171   26.164  72.500  1.00 154.63 ? 269 THR A CG2 1 
ATOM   2071 N N   . ASP A 1 270 ? 8.433   28.419  73.031  1.00 133.42 ? 270 ASP A N   1 
ATOM   2072 C CA  . ASP A 1 270 ? 9.841   28.077  73.219  1.00 132.49 ? 270 ASP A CA  1 
ATOM   2073 C C   . ASP A 1 270 ? 10.063  26.962  74.235  1.00 136.76 ? 270 ASP A C   1 
ATOM   2074 O O   . ASP A 1 270 ? 10.743  25.978  73.946  1.00 138.23 ? 270 ASP A O   1 
ATOM   2075 C CB  . ASP A 1 270 ? 10.643  29.310  73.640  1.00 132.53 ? 270 ASP A CB  1 
ATOM   2076 C CG  . ASP A 1 270 ? 11.353  29.968  72.475  1.00 137.43 ? 270 ASP A CG  1 
ATOM   2077 O OD1 . ASP A 1 270 ? 11.169  31.189  72.283  1.00 140.93 ? 270 ASP A OD1 1 
ATOM   2078 O OD2 . ASP A 1 270 ? 12.092  29.263  71.753  1.00 133.41 ? 270 ASP A OD2 1 
ATOM   2079 N N   . LYS A 1 271 ? 9.501   27.122  75.427  1.00 141.36 ? 271 LYS A N   1 
ATOM   2080 C CA  . LYS A 1 271 ? 9.706   26.143  76.487  1.00 142.90 ? 271 LYS A CA  1 
ATOM   2081 C C   . LYS A 1 271 ? 9.369   24.725  76.025  1.00 143.28 ? 271 LYS A C   1 
ATOM   2082 O O   . LYS A 1 271 ? 8.693   24.532  75.015  1.00 139.97 ? 271 LYS A O   1 
ATOM   2083 C CB  . LYS A 1 271 ? 8.916   26.523  77.742  1.00 142.11 ? 271 LYS A CB  1 
ATOM   2084 C CG  . LYS A 1 271 ? 7.467   26.896  77.492  1.00 139.97 ? 271 LYS A CG  1 
ATOM   2085 C CD  . LYS A 1 271 ? 6.821   27.385  78.777  1.00 136.28 ? 271 LYS A CD  1 
ATOM   2086 C CE  . LYS A 1 271 ? 7.126   26.440  79.929  1.00 138.02 ? 271 LYS A CE  1 
ATOM   2087 N NZ  . LYS A 1 271 ? 6.556   26.921  81.214  1.00 137.60 ? 271 LYS A NZ  1 
ATOM   2088 N N   . THR A 1 272 ? 9.850   23.737  76.772  1.00 146.17 ? 272 THR A N   1 
ATOM   2089 C CA  . THR A 1 272 ? 9.754   22.342  76.360  1.00 149.78 ? 272 THR A CA  1 
ATOM   2090 C C   . THR A 1 272 ? 8.460   21.668  76.812  1.00 160.37 ? 272 THR A C   1 
ATOM   2091 O O   . THR A 1 272 ? 8.366   20.440  76.819  1.00 161.62 ? 272 THR A O   1 
ATOM   2092 C CB  . THR A 1 272 ? 10.950  21.529  76.891  1.00 144.09 ? 272 THR A CB  1 
ATOM   2093 O OG1 . THR A 1 272 ? 10.904  20.200  76.359  1.00 145.39 ? 272 THR A OG1 1 
ATOM   2094 C CG2 . THR A 1 272 ? 10.920  21.468  78.410  1.00 139.37 ? 272 THR A CG2 1 
ATOM   2095 N N   . SER A 1 273 ? 7.464   22.467  77.183  1.00 167.15 ? 273 SER A N   1 
ATOM   2096 C CA  . SER A 1 273 ? 6.195   21.919  77.653  1.00 171.53 ? 273 SER A CA  1 
ATOM   2097 C C   . SER A 1 273 ? 5.053   22.928  77.583  1.00 173.46 ? 273 SER A C   1 
ATOM   2098 O O   . SER A 1 273 ? 5.270   24.136  77.670  1.00 166.16 ? 273 SER A O   1 
ATOM   2099 C CB  . SER A 1 273 ? 6.337   21.399  79.083  1.00 171.93 ? 273 SER A CB  1 
ATOM   2100 O OG  . SER A 1 273 ? 5.123   20.818  79.527  1.00 173.72 ? 273 SER A OG  1 
ATOM   2101 N N   . ALA A 1 274 ? 3.833   22.417  77.433  1.00 184.30 ? 274 ALA A N   1 
ATOM   2102 C CA  . ALA A 1 274 ? 2.643   23.260  77.372  1.00 191.87 ? 274 ALA A CA  1 
ATOM   2103 C C   . ALA A 1 274 ? 1.367   22.451  77.611  1.00 197.90 ? 274 ALA A C   1 
ATOM   2104 O O   . ALA A 1 274 ? 1.420   21.234  77.793  1.00 201.79 ? 274 ALA A O   1 
ATOM   2105 C CB  . ALA A 1 274 ? 2.572   23.983  76.036  1.00 190.92 ? 274 ALA A CB  1 
ATOM   2106 N N   . THR A 1 275 ? 0.225   23.134  77.608  1.00 196.16 ? 275 THR A N   1 
ATOM   2107 C CA  . THR A 1 275 ? -1.066  22.485  77.826  1.00 195.31 ? 275 THR A CA  1 
ATOM   2108 C C   . THR A 1 275 ? -2.152  23.103  76.949  1.00 195.12 ? 275 THR A C   1 
ATOM   2109 O O   . THR A 1 275 ? -2.175  24.316  76.742  1.00 190.75 ? 275 THR A O   1 
ATOM   2110 C CB  . THR A 1 275 ? -1.498  22.577  79.300  1.00 192.95 ? 275 THR A CB  1 
ATOM   2111 O OG1 . THR A 1 275 ? -0.508  21.956  80.128  1.00 194.26 ? 275 THR A OG1 1 
ATOM   2112 C CG2 . THR A 1 275 ? -2.834  21.881  79.509  1.00 193.37 ? 275 THR A CG2 1 
ATOM   2113 N N   . VAL A 1 276 ? -3.053  22.267  76.441  1.00 200.41 ? 276 VAL A N   1 
ATOM   2114 C CA  . VAL A 1 276 ? -4.092  22.726  75.524  1.00 204.14 ? 276 VAL A CA  1 
ATOM   2115 C C   . VAL A 1 276 ? -5.494  22.277  75.931  1.00 213.17 ? 276 VAL A C   1 
ATOM   2116 O O   . VAL A 1 276 ? -5.733  21.905  77.081  1.00 213.19 ? 276 VAL A O   1 
ATOM   2117 C CB  . VAL A 1 276 ? -3.822  22.241  74.087  1.00 199.41 ? 276 VAL A CB  1 
ATOM   2118 C CG1 . VAL A 1 276 ? -2.626  22.966  73.499  1.00 198.69 ? 276 VAL A CG1 1 
ATOM   2119 C CG2 . VAL A 1 276 ? -3.604  20.739  74.071  1.00 199.22 ? 276 VAL A CG2 1 
ATOM   2120 N N   . ILE A 1 277 ? -6.416  22.318  74.971  1.00 219.56 ? 277 ILE A N   1 
ATOM   2121 C CA  . ILE A 1 277 ? -7.806  21.945  75.210  1.00 223.84 ? 277 ILE A CA  1 
ATOM   2122 C C   . ILE A 1 277 ? -8.195  20.718  74.382  1.00 224.48 ? 277 ILE A C   1 
ATOM   2123 O O   . ILE A 1 277 ? -7.848  20.617  73.206  1.00 221.34 ? 277 ILE A O   1 
ATOM   2124 C CB  . ILE A 1 277 ? -8.762  23.119  74.895  1.00 225.37 ? 277 ILE A CB  1 
ATOM   2125 C CG1 . ILE A 1 277 ? -10.153 22.845  75.469  1.00 228.69 ? 277 ILE A CG1 1 
ATOM   2126 C CG2 . ILE A 1 277 ? -8.816  23.388  73.395  1.00 223.26 ? 277 ILE A CG2 1 
ATOM   2127 C CD1 . ILE A 1 277 ? -10.174 22.707  76.978  1.00 228.19 ? 277 ILE A CD1 1 
ATOM   2128 N N   . CYS A 1 278 ? -8.917  19.789  75.004  1.00 227.22 ? 278 CYS A N   1 
ATOM   2129 C CA  . CYS A 1 278 ? -9.230  18.505  74.377  1.00 227.63 ? 278 CYS A CA  1 
ATOM   2130 C C   . CYS A 1 278 ? -10.351 18.593  73.340  1.00 228.54 ? 278 CYS A C   1 
ATOM   2131 O O   . CYS A 1 278 ? -11.022 19.619  73.219  1.00 231.04 ? 278 CYS A O   1 
ATOM   2132 C CB  . CYS A 1 278 ? -9.587  17.465  75.444  1.00 225.70 ? 278 CYS A CB  1 
ATOM   2133 S SG  . CYS A 1 278 ? -9.454  15.750  74.887  1.00 197.34 ? 278 CYS A SG  1 
ATOM   2134 N N   . ARG A 1 279 ? -10.544 17.507  72.596  1.00 223.84 ? 279 ARG A N   1 
ATOM   2135 C CA  . ARG A 1 279 ? -11.599 17.436  71.589  1.00 216.43 ? 279 ARG A CA  1 
ATOM   2136 C C   . ARG A 1 279 ? -12.504 16.225  71.806  1.00 217.96 ? 279 ARG A C   1 
ATOM   2137 O O   . ARG A 1 279 ? -12.154 15.297  72.536  1.00 218.21 ? 279 ARG A O   1 
ATOM   2138 C CB  . ARG A 1 279 ? -11.002 17.414  70.177  1.00 207.95 ? 279 ARG A CB  1 
ATOM   2139 C CG  . ARG A 1 279 ? -10.070 16.243  69.885  1.00 202.51 ? 279 ARG A CG  1 
ATOM   2140 C CD  . ARG A 1 279 ? -10.814 15.039  69.319  1.00 200.95 ? 279 ARG A CD  1 
ATOM   2141 N NE  . ARG A 1 279 ? -11.285 14.131  70.363  1.00 199.81 ? 279 ARG A NE  1 
ATOM   2142 C CZ  . ARG A 1 279 ? -11.819 12.936  70.131  1.00 199.83 ? 279 ARG A CZ  1 
ATOM   2143 N NH1 . ARG A 1 279 ? -12.217 12.180  71.143  1.00 199.33 ? 279 ARG A NH1 1 
ATOM   2144 N NH2 . ARG A 1 279 ? -11.951 12.495  68.887  1.00 200.42 ? 279 ARG A NH2 1 
ATOM   2145 N N   . SER A 1 283 ? -6.428  13.914  66.029  1.00 156.91 ? 283 SER A N   1 
ATOM   2146 C CA  . SER A 1 283 ? -4.969  13.867  66.007  1.00 152.99 ? 283 SER A CA  1 
ATOM   2147 C C   . SER A 1 283 ? -4.356  15.106  66.655  1.00 150.16 ? 283 SER A C   1 
ATOM   2148 O O   . SER A 1 283 ? -4.891  16.209  66.543  1.00 142.74 ? 283 SER A O   1 
ATOM   2149 C CB  . SER A 1 283 ? -4.451  13.730  64.570  1.00 146.40 ? 283 SER A CB  1 
ATOM   2150 O OG  . SER A 1 283 ? -4.853  12.505  63.982  1.00 141.23 ? 283 SER A OG  1 
ATOM   2151 N N   . ILE A 1 284 ? -3.232  14.908  67.336  1.00 153.81 ? 284 ILE A N   1 
ATOM   2152 C CA  . ILE A 1 284 ? -2.449  16.008  67.888  1.00 154.46 ? 284 ILE A CA  1 
ATOM   2153 C C   . ILE A 1 284 ? -1.036  15.907  67.320  1.00 158.84 ? 284 ILE A C   1 
ATOM   2154 O O   . ILE A 1 284 ? -0.629  14.839  66.867  1.00 166.16 ? 284 ILE A O   1 
ATOM   2155 C CB  . ILE A 1 284 ? -2.396  15.959  69.430  1.00 147.56 ? 284 ILE A CB  1 
ATOM   2156 C CG1 . ILE A 1 284 ? -3.805  16.003  70.023  1.00 145.44 ? 284 ILE A CG1 1 
ATOM   2157 C CG2 . ILE A 1 284 ? -1.560  17.105  69.979  1.00 142.49 ? 284 ILE A CG2 1 
ATOM   2158 C CD1 . ILE A 1 284 ? -4.553  14.690  69.951  1.00 145.82 ? 284 ILE A CD1 1 
ATOM   2159 N N   . SER A 1 285 ? -0.289  17.007  67.331  1.00 150.54 ? 285 SER A N   1 
ATOM   2160 C CA  . SER A 1 285 ? 1.055   17.000  66.764  1.00 139.13 ? 285 SER A CA  1 
ATOM   2161 C C   . SER A 1 285 ? 1.856   18.263  67.086  1.00 139.24 ? 285 SER A C   1 
ATOM   2162 O O   . SER A 1 285 ? 1.294   19.300  67.434  1.00 139.59 ? 285 SER A O   1 
ATOM   2163 C CB  . SER A 1 285 ? 0.990   16.767  65.249  1.00 129.28 ? 285 SER A CB  1 
ATOM   2164 O OG  . SER A 1 285 ? -0.131  17.421  64.674  1.00 119.35 ? 285 SER A OG  1 
ATOM   2165 N N   . VAL A 1 286 ? 3.177   18.164  66.967  1.00 136.87 ? 286 VAL A N   1 
ATOM   2166 C CA  . VAL A 1 286 ? 4.062   19.287  67.259  1.00 127.64 ? 286 VAL A CA  1 
ATOM   2167 C C   . VAL A 1 286 ? 5.313   19.260  66.375  1.00 135.37 ? 286 VAL A C   1 
ATOM   2168 O O   . VAL A 1 286 ? 5.971   18.226  66.247  1.00 141.10 ? 286 VAL A O   1 
ATOM   2169 C CB  . VAL A 1 286 ? 4.471   19.293  68.746  1.00 110.09 ? 286 VAL A CB  1 
ATOM   2170 C CG1 . VAL A 1 286 ? 4.870   17.896  69.191  1.00 109.32 ? 286 VAL A CG1 1 
ATOM   2171 C CG2 . VAL A 1 286 ? 5.595   20.280  68.989  1.00 106.25 ? 286 VAL A CG2 1 
ATOM   2172 N N   . ARG A 1 287 ? 5.625   20.397  65.755  1.00 130.51 ? 287 ARG A N   1 
ATOM   2173 C CA  . ARG A 1 287 ? 6.826   20.533  64.930  1.00 123.79 ? 287 ARG A CA  1 
ATOM   2174 C C   . ARG A 1 287 ? 7.947   21.187  65.729  1.00 122.27 ? 287 ARG A C   1 
ATOM   2175 O O   . ARG A 1 287 ? 7.738   21.615  66.863  1.00 133.52 ? 287 ARG A O   1 
ATOM   2176 C CB  . ARG A 1 287 ? 6.537   21.388  63.697  1.00 122.29 ? 287 ARG A CB  1 
ATOM   2177 C CG  . ARG A 1 287 ? 5.587   20.770  62.691  1.00 125.82 ? 287 ARG A CG  1 
ATOM   2178 C CD  . ARG A 1 287 ? 5.425   21.674  61.469  1.00 128.64 ? 287 ARG A CD  1 
ATOM   2179 N NE  . ARG A 1 287 ? 4.872   22.986  61.810  1.00 127.73 ? 287 ARG A NE  1 
ATOM   2180 C CZ  . ARG A 1 287 ? 4.538   23.912  60.914  1.00 125.19 ? 287 ARG A CZ  1 
ATOM   2181 N NH1 . ARG A 1 287 ? 4.699   23.667  59.621  1.00 134.59 ? 287 ARG A NH1 1 
ATOM   2182 N NH2 . ARG A 1 287 ? 4.044   25.081  61.305  1.00 110.18 ? 287 ARG A NH2 1 
ATOM   2183 N N   . ALA A 1 288 ? 9.132   21.276  65.132  1.00 109.60 ? 288 ALA A N   1 
ATOM   2184 C CA  . ALA A 1 288 ? 10.257  21.961  65.769  1.00 105.21 ? 288 ALA A CA  1 
ATOM   2185 C C   . ALA A 1 288 ? 11.128  22.716  64.760  1.00 104.01 ? 288 ALA A C   1 
ATOM   2186 O O   . ALA A 1 288 ? 11.394  22.223  63.668  1.00 109.53 ? 288 ALA A O   1 
ATOM   2187 C CB  . ALA A 1 288 ? 11.094  20.981  66.564  1.00 102.68 ? 288 ALA A CB  1 
ATOM   2188 N N   . GLN A 1 289 ? 11.578  23.907  65.141  1.00 99.03  ? 289 GLN A N   1 
ATOM   2189 C CA  . GLN A 1 289 ? 12.354  24.769  64.252  1.00 96.39  ? 289 GLN A CA  1 
ATOM   2190 C C   . GLN A 1 289 ? 13.511  25.441  64.992  1.00 90.17  ? 289 GLN A C   1 
ATOM   2191 O O   . GLN A 1 289 ? 13.404  25.743  66.177  1.00 85.95  ? 289 GLN A O   1 
ATOM   2192 C CB  . GLN A 1 289 ? 11.439  25.825  63.623  1.00 97.79  ? 289 GLN A CB  1 
ATOM   2193 C CG  . GLN A 1 289 ? 12.138  27.075  63.110  1.00 95.58  ? 289 GLN A CG  1 
ATOM   2194 C CD  . GLN A 1 289 ? 11.151  28.140  62.662  1.00 99.76  ? 289 GLN A CD  1 
ATOM   2195 O OE1 . GLN A 1 289 ? 10.359  27.920  61.746  1.00 96.79  ? 289 GLN A OE1 1 
ATOM   2196 N NE2 . GLN A 1 289 ? 11.194  29.302  63.310  1.00 103.46 ? 289 GLN A NE2 1 
ATOM   2197 N N   . ASP A 1 290 ? 14.621  25.669  64.299  1.00 87.13  ? 290 ASP A N   1 
ATOM   2198 C CA  . ASP A 1 290 ? 15.742  26.356  64.920  1.00 84.71  ? 290 ASP A CA  1 
ATOM   2199 C C   . ASP A 1 290 ? 15.227  27.655  65.503  1.00 95.26  ? 290 ASP A C   1 
ATOM   2200 O O   . ASP A 1 290 ? 14.616  28.457  64.800  1.00 99.25  ? 290 ASP A O   1 
ATOM   2201 C CB  . ASP A 1 290 ? 16.851  26.635  63.907  1.00 84.01  ? 290 ASP A CB  1 
ATOM   2202 C CG  . ASP A 1 290 ? 18.058  27.315  64.532  1.00 83.36  ? 290 ASP A CG  1 
ATOM   2203 O OD1 . ASP A 1 290 ? 17.875  28.170  65.424  1.00 79.72  ? 290 ASP A OD1 1 
ATOM   2204 O OD2 . ASP A 1 290 ? 19.198  26.998  64.128  1.00 85.50  ? 290 ASP A OD2 1 
ATOM   2205 N N   . ARG A 1 291 ? 15.466  27.859  66.793  1.00 102.90 ? 291 ARG A N   1 
ATOM   2206 C CA  . ARG A 1 291 ? 14.969  29.049  67.470  1.00 102.23 ? 291 ARG A CA  1 
ATOM   2207 C C   . ARG A 1 291 ? 15.370  30.324  66.741  1.00 91.19  ? 291 ARG A C   1 
ATOM   2208 O O   . ARG A 1 291 ? 14.547  31.210  66.531  1.00 94.07  ? 291 ARG A O   1 
ATOM   2209 C CB  . ARG A 1 291 ? 15.480  29.109  68.905  1.00 111.40 ? 291 ARG A CB  1 
ATOM   2210 C CG  . ARG A 1 291 ? 14.888  30.251  69.703  1.00 125.25 ? 291 ARG A CG  1 
ATOM   2211 C CD  . ARG A 1 291 ? 15.898  30.826  70.689  1.00 137.19 ? 291 ARG A CD  1 
ATOM   2212 N NE  . ARG A 1 291 ? 15.364  31.959  71.439  1.00 135.66 ? 291 ARG A NE  1 
ATOM   2213 C CZ  . ARG A 1 291 ? 14.714  31.847  72.593  1.00 128.93 ? 291 ARG A CZ  1 
ATOM   2214 N NH1 . ARG A 1 291 ? 14.259  32.932  73.207  1.00 124.10 ? 291 ARG A NH1 1 
ATOM   2215 N NH2 . ARG A 1 291 ? 14.517  30.650  73.131  1.00 126.39 ? 291 ARG A NH2 1 
ATOM   2216 N N   . TYR A 1 292 ? 16.633  30.407  66.344  1.00 79.97  ? 292 TYR A N   1 
ATOM   2217 C CA  . TYR A 1 292 ? 17.171  31.653  65.821  1.00 84.50  ? 292 TYR A CA  1 
ATOM   2218 C C   . TYR A 1 292 ? 16.749  31.989  64.389  1.00 92.80  ? 292 TYR A C   1 
ATOM   2219 O O   . TYR A 1 292 ? 16.280  33.093  64.133  1.00 100.51 ? 292 TYR A O   1 
ATOM   2220 C CB  . TYR A 1 292 ? 18.691  31.691  65.985  1.00 91.26  ? 292 TYR A CB  1 
ATOM   2221 C CG  . TYR A 1 292 ? 19.119  31.690  67.438  1.00 101.64 ? 292 TYR A CG  1 
ATOM   2222 C CD1 . TYR A 1 292 ? 19.781  30.602  67.991  1.00 106.18 ? 292 TYR A CD1 1 
ATOM   2223 C CD2 . TYR A 1 292 ? 18.839  32.774  68.265  1.00 102.32 ? 292 TYR A CD2 1 
ATOM   2224 C CE1 . TYR A 1 292 ? 20.166  30.599  69.322  1.00 109.08 ? 292 TYR A CE1 1 
ATOM   2225 C CE2 . TYR A 1 292 ? 19.221  32.778  69.597  1.00 102.86 ? 292 TYR A CE2 1 
ATOM   2226 C CZ  . TYR A 1 292 ? 19.884  31.688  70.119  1.00 106.47 ? 292 TYR A CZ  1 
ATOM   2227 O OH  . TYR A 1 292 ? 20.265  31.686  71.443  1.00 105.07 ? 292 TYR A OH  1 
ATOM   2228 N N   . TYR A 1 293 ? 16.902  31.048  63.463  1.00 89.17  ? 293 TYR A N   1 
ATOM   2229 C CA  . TYR A 1 293 ? 16.611  31.321  62.054  1.00 82.45  ? 293 TYR A CA  1 
ATOM   2230 C C   . TYR A 1 293 ? 15.318  30.656  61.585  1.00 88.59  ? 293 TYR A C   1 
ATOM   2231 O O   . TYR A 1 293 ? 14.921  29.626  62.114  1.00 94.49  ? 293 TYR A O   1 
ATOM   2232 C CB  . TYR A 1 293 ? 17.783  30.878  61.179  1.00 70.77  ? 293 TYR A CB  1 
ATOM   2233 C CG  . TYR A 1 293 ? 19.123  31.379  61.663  1.00 74.31  ? 293 TYR A CG  1 
ATOM   2234 C CD1 . TYR A 1 293 ? 19.473  32.716  61.548  1.00 81.06  ? 293 TYR A CD1 1 
ATOM   2235 C CD2 . TYR A 1 293 ? 20.038  30.514  62.233  1.00 82.17  ? 293 TYR A CD2 1 
ATOM   2236 C CE1 . TYR A 1 293 ? 20.700  33.176  61.992  1.00 89.90  ? 293 TYR A CE1 1 
ATOM   2237 C CE2 . TYR A 1 293 ? 21.270  30.964  62.679  1.00 84.54  ? 293 TYR A CE2 1 
ATOM   2238 C CZ  . TYR A 1 293 ? 21.597  32.293  62.557  1.00 89.64  ? 293 TYR A CZ  1 
ATOM   2239 O OH  . TYR A 1 293 ? 22.824  32.745  63.001  1.00 92.84  ? 293 TYR A OH  1 
ATOM   2240 N N   . SER A 1 294 ? 14.660  31.249  60.594  1.00 94.56  ? 294 SER A N   1 
ATOM   2241 C CA  . SER A 1 294 ? 13.425  30.679  60.062  1.00 97.33  ? 294 SER A CA  1 
ATOM   2242 C C   . SER A 1 294 ? 13.730  29.517  59.124  1.00 103.51 ? 294 SER A C   1 
ATOM   2243 O O   . SER A 1 294 ? 13.309  29.516  57.964  1.00 96.77  ? 294 SER A O   1 
ATOM   2244 C CB  . SER A 1 294 ? 12.616  31.743  59.319  1.00 97.11  ? 294 SER A CB  1 
ATOM   2245 O OG  . SER A 1 294 ? 12.647  32.981  60.012  1.00 104.42 ? 294 SER A OG  1 
ATOM   2246 N N   . SER A 1 295 ? 14.472  28.534  59.631  1.00 105.36 ? 295 SER A N   1 
ATOM   2247 C CA  . SER A 1 295 ? 14.847  27.360  58.846  1.00 96.28  ? 295 SER A CA  1 
ATOM   2248 C C   . SER A 1 295 ? 13.616  26.524  58.538  1.00 89.37  ? 295 SER A C   1 
ATOM   2249 O O   . SER A 1 295 ? 12.500  27.030  58.537  1.00 99.08  ? 295 SER A O   1 
ATOM   2250 C CB  . SER A 1 295 ? 15.891  26.516  59.589  1.00 94.02  ? 295 SER A CB  1 
ATOM   2251 O OG  . SER A 1 295 ? 17.101  27.237  59.776  1.00 84.71  ? 295 SER A OG  1 
ATOM   2252 N N   . SER A 1 296 ? 13.814  25.241  58.283  1.00 83.63  ? 296 SER A N   1 
ATOM   2253 C CA  . SER A 1 296 ? 12.695  24.371  57.937  1.00 95.64  ? 296 SER A CA  1 
ATOM   2254 C C   . SER A 1 296 ? 12.069  23.725  59.178  1.00 102.53 ? 296 SER A C   1 
ATOM   2255 O O   . SER A 1 296 ? 12.778  23.289  60.085  1.00 103.79 ? 296 SER A O   1 
ATOM   2256 C CB  . SER A 1 296 ? 13.157  23.294  56.953  1.00 92.33  ? 296 SER A CB  1 
ATOM   2257 O OG  . SER A 1 296 ? 14.124  23.818  56.057  1.00 88.19  ? 296 SER A OG  1 
ATOM   2258 N N   . TRP A 1 297 ? 10.740  23.675  59.218  1.00 99.32  ? 297 TRP A N   1 
ATOM   2259 C CA  . TRP A 1 297 ? 10.043  22.968  60.287  1.00 100.53 ? 297 TRP A CA  1 
ATOM   2260 C C   . TRP A 1 297 ? 10.296  21.468  60.178  1.00 107.45 ? 297 TRP A C   1 
ATOM   2261 O O   . TRP A 1 297 ? 10.490  20.939  59.082  1.00 114.12 ? 297 TRP A O   1 
ATOM   2262 C CB  . TRP A 1 297 ? 8.535   23.225  60.230  1.00 105.15 ? 297 TRP A CB  1 
ATOM   2263 C CG  . TRP A 1 297 ? 8.104   24.585  60.689  1.00 113.85 ? 297 TRP A CG  1 
ATOM   2264 C CD1 . TRP A 1 297 ? 7.694   25.620  59.902  1.00 118.59 ? 297 TRP A CD1 1 
ATOM   2265 C CD2 . TRP A 1 297 ? 8.019   25.051  62.044  1.00 113.02 ? 297 TRP A CD2 1 
ATOM   2266 N NE1 . TRP A 1 297 ? 7.367   26.705  60.680  1.00 118.40 ? 297 TRP A NE1 1 
ATOM   2267 C CE2 . TRP A 1 297 ? 7.558   26.383  61.998  1.00 114.75 ? 297 TRP A CE2 1 
ATOM   2268 C CE3 . TRP A 1 297 ? 8.293   24.476  63.289  1.00 110.34 ? 297 TRP A CE3 1 
ATOM   2269 C CZ2 . TRP A 1 297 ? 7.366   27.147  63.150  1.00 109.68 ? 297 TRP A CZ2 1 
ATOM   2270 C CZ3 . TRP A 1 297 ? 8.100   25.239  64.434  1.00 109.26 ? 297 TRP A CZ3 1 
ATOM   2271 C CH2 . TRP A 1 297 ? 7.640   26.559  64.355  1.00 106.14 ? 297 TRP A CH2 1 
ATOM   2272 N N   . SER A 1 298 ? 10.291  20.783  61.316  1.00 105.68 ? 298 SER A N   1 
ATOM   2273 C CA  . SER A 1 298 ? 10.447  19.335  61.333  1.00 106.70 ? 298 SER A CA  1 
ATOM   2274 C C   . SER A 1 298 ? 9.139   18.669  60.942  1.00 110.93 ? 298 SER A C   1 
ATOM   2275 O O   . SER A 1 298 ? 8.094   19.322  60.870  1.00 113.29 ? 298 SER A O   1 
ATOM   2276 C CB  . SER A 1 298 ? 10.862  18.851  62.723  1.00 105.55 ? 298 SER A CB  1 
ATOM   2277 O OG  . SER A 1 298 ? 9.731   18.649  63.554  1.00 103.20 ? 298 SER A OG  1 
ATOM   2278 N N   . GLU A 1 299 ? 9.199   17.367  60.690  1.00 110.27 ? 299 GLU A N   1 
ATOM   2279 C CA  . GLU A 1 299 ? 7.995   16.596  60.429  1.00 121.76 ? 299 GLU A CA  1 
ATOM   2280 C C   . GLU A 1 299 ? 7.139   16.580  61.693  1.00 133.19 ? 299 GLU A C   1 
ATOM   2281 O O   . GLU A 1 299 ? 7.573   17.041  62.751  1.00 131.74 ? 299 GLU A O   1 
ATOM   2282 C CB  . GLU A 1 299 ? 8.353   15.175  59.992  1.00 124.03 ? 299 GLU A CB  1 
ATOM   2283 C CG  . GLU A 1 299 ? 9.265   15.124  58.778  1.00 127.00 ? 299 GLU A CG  1 
ATOM   2284 C CD  . GLU A 1 299 ? 8.607   15.690  57.535  1.00 131.70 ? 299 GLU A CD  1 
ATOM   2285 O OE1 . GLU A 1 299 ? 7.409   15.405  57.327  1.00 140.00 ? 299 GLU A OE1 1 
ATOM   2286 O OE2 . GLU A 1 299 ? 9.282   16.414  56.769  1.00 121.88 ? 299 GLU A OE2 1 
ATOM   2287 N N   . TRP A 1 300 ? 5.922   16.058  61.585  1.00 138.86 ? 300 TRP A N   1 
ATOM   2288 C CA  . TRP A 1 300 ? 4.994   16.070  62.708  1.00 138.93 ? 300 TRP A CA  1 
ATOM   2289 C C   . TRP A 1 300 ? 5.130   14.839  63.598  1.00 140.30 ? 300 TRP A C   1 
ATOM   2290 O O   . TRP A 1 300 ? 5.613   13.794  63.163  1.00 131.53 ? 300 TRP A O   1 
ATOM   2291 C CB  . TRP A 1 300 ? 3.553   16.201  62.210  1.00 142.09 ? 300 TRP A CB  1 
ATOM   2292 C CG  . TRP A 1 300 ? 3.223   17.555  61.647  1.00 142.81 ? 300 TRP A CG  1 
ATOM   2293 C CD1 . TRP A 1 300 ? 3.168   17.905  60.329  1.00 140.17 ? 300 TRP A CD1 1 
ATOM   2294 C CD2 . TRP A 1 300 ? 2.897   18.737  62.388  1.00 140.97 ? 300 TRP A CD2 1 
ATOM   2295 N NE1 . TRP A 1 300 ? 2.829   19.231  60.204  1.00 134.01 ? 300 TRP A NE1 1 
ATOM   2296 C CE2 . TRP A 1 300 ? 2.657   19.764  61.454  1.00 138.17 ? 300 TRP A CE2 1 
ATOM   2297 C CE3 . TRP A 1 300 ? 2.786   19.026  63.752  1.00 141.31 ? 300 TRP A CE3 1 
ATOM   2298 C CZ2 . TRP A 1 300 ? 2.312   21.059  61.840  1.00 141.73 ? 300 TRP A CZ2 1 
ATOM   2299 C CZ3 . TRP A 1 300 ? 2.443   20.312  64.133  1.00 140.93 ? 300 TRP A CZ3 1 
ATOM   2300 C CH2 . TRP A 1 300 ? 2.212   21.313  63.181  1.00 141.67 ? 300 TRP A CH2 1 
ATOM   2301 N N   . ALA A 1 301 ? 4.700   14.978  64.848  1.00 151.40 ? 301 ALA A N   1 
ATOM   2302 C CA  . ALA A 1 301 ? 4.677   13.869  65.797  1.00 157.64 ? 301 ALA A CA  1 
ATOM   2303 C C   . ALA A 1 301 ? 3.284   13.736  66.409  1.00 163.33 ? 301 ALA A C   1 
ATOM   2304 O O   . ALA A 1 301 ? 2.888   14.546  67.246  1.00 163.98 ? 301 ALA A O   1 
ATOM   2305 C CB  . ALA A 1 301 ? 5.720   14.080  66.883  1.00 156.49 ? 301 ALA A CB  1 
ATOM   2306 N N   . SER A 1 302 ? 2.550   12.707  65.994  1.00 169.38 ? 302 SER A N   1 
ATOM   2307 C CA  . SER A 1 302 ? 1.143   12.553  66.367  1.00 173.82 ? 302 SER A CA  1 
ATOM   2308 C C   . SER A 1 302 ? 0.910   11.890  67.730  1.00 179.92 ? 302 SER A C   1 
ATOM   2309 O O   . SER A 1 302 ? 1.845   11.412  68.374  1.00 179.91 ? 302 SER A O   1 
ATOM   2310 C CB  . SER A 1 302 ? 0.380   11.794  65.276  1.00 171.00 ? 302 SER A CB  1 
ATOM   2311 O OG  . SER A 1 302 ? 0.362   12.523  64.060  1.00 167.70 ? 302 SER A OG  1 
ATOM   2312 N N   . VAL A 1 303 ? -0.354  11.869  68.151  1.00 182.85 ? 303 VAL A N   1 
ATOM   2313 C CA  . VAL A 1 303 ? -0.756  11.303  69.436  1.00 183.28 ? 303 VAL A CA  1 
ATOM   2314 C C   . VAL A 1 303 ? -2.286  11.271  69.512  1.00 185.05 ? 303 VAL A C   1 
ATOM   2315 O O   . VAL A 1 303 ? -2.956  12.098  68.891  1.00 181.01 ? 303 VAL A O   1 
ATOM   2316 C CB  . VAL A 1 303 ? -0.194  12.132  70.615  1.00 182.59 ? 303 VAL A CB  1 
ATOM   2317 C CG1 . VAL A 1 303 ? -1.238  13.114  71.123  1.00 182.39 ? 303 VAL A CG1 1 
ATOM   2318 C CG2 . VAL A 1 303 ? 0.270   11.224  71.742  1.00 182.25 ? 303 VAL A CG2 1 
ATOM   2319 N N   . PRO A 1 304 ? -2.845  10.308  70.262  1.00 190.88 ? 304 PRO A N   1 
ATOM   2320 C CA  . PRO A 1 304 ? -4.298  10.159  70.406  1.00 194.96 ? 304 PRO A CA  1 
ATOM   2321 C C   . PRO A 1 304 ? -4.963  11.378  71.038  1.00 201.23 ? 304 PRO A C   1 
ATOM   2322 O O   . PRO A 1 304 ? -4.321  12.124  71.777  1.00 199.36 ? 304 PRO A O   1 
ATOM   2323 C CB  . PRO A 1 304 ? -4.426  8.952   71.347  1.00 195.56 ? 304 PRO A CB  1 
ATOM   2324 C CG  . PRO A 1 304 ? -3.091  8.873   72.034  1.00 193.86 ? 304 PRO A CG  1 
ATOM   2325 C CD  . PRO A 1 304 ? -2.138  9.213   70.944  1.00 192.74 ? 304 PRO A CD  1 
ATOM   2326 N N   . CYS A 1 305 ? -6.248  11.563  70.752  1.00 209.01 ? 305 CYS A N   1 
ATOM   2327 C CA  . CYS A 1 305 ? -7.005  12.685  71.294  1.00 211.76 ? 305 CYS A CA  1 
ATOM   2328 C C   . CYS A 1 305 ? -7.446  12.421  72.730  1.00 209.78 ? 305 CYS A C   1 
ATOM   2329 O O   . CYS A 1 305 ? -7.359  11.294  73.220  1.00 208.50 ? 305 CYS A O   1 
ATOM   2330 C CB  . CYS A 1 305 ? -8.223  12.983  70.415  1.00 215.58 ? 305 CYS A CB  1 
ATOM   2331 S SG  . CYS A 1 305 ? -7.820  13.529  68.737  1.00 225.91 ? 305 CYS A SG  1 
ATOM   2332 N N   . MET B 2 12  ? 16.294  34.966  84.729  1.00 145.01 ? 12  MET B N   1 
ATOM   2333 C CA  . MET B 2 12  ? 17.060  35.093  85.964  1.00 147.24 ? 12  MET B CA  1 
ATOM   2334 C C   . MET B 2 12  ? 18.443  35.673  85.689  1.00 145.53 ? 12  MET B C   1 
ATOM   2335 O O   . MET B 2 12  ? 19.306  35.682  86.568  1.00 150.26 ? 12  MET B O   1 
ATOM   2336 C CB  . MET B 2 12  ? 17.186  33.738  86.666  1.00 136.74 ? 12  MET B CB  1 
ATOM   2337 N N   . PHE B 2 13  ? 18.641  36.159  84.466  1.00 130.51 ? 13  PHE B N   1 
ATOM   2338 C CA  . PHE B 2 13  ? 19.925  36.715  84.043  1.00 130.91 ? 13  PHE B CA  1 
ATOM   2339 C C   . PHE B 2 13  ? 19.725  38.051  83.327  1.00 147.92 ? 13  PHE B C   1 
ATOM   2340 O O   . PHE B 2 13  ? 18.892  38.157  82.426  1.00 153.61 ? 13  PHE B O   1 
ATOM   2341 C CB  . PHE B 2 13  ? 20.648  35.725  83.127  1.00 119.44 ? 13  PHE B CB  1 
ATOM   2342 C CG  . PHE B 2 13  ? 22.107  36.034  82.913  1.00 115.04 ? 13  PHE B CG  1 
ATOM   2343 C CD1 . PHE B 2 13  ? 22.607  36.232  81.636  1.00 114.02 ? 13  PHE B CD1 1 
ATOM   2344 C CD2 . PHE B 2 13  ? 22.980  36.110  83.983  1.00 117.40 ? 13  PHE B CD2 1 
ATOM   2345 C CE1 . PHE B 2 13  ? 23.951  36.506  81.430  1.00 109.84 ? 13  PHE B CE1 1 
ATOM   2346 C CE2 . PHE B 2 13  ? 24.325  36.385  83.784  1.00 117.29 ? 13  PHE B CE2 1 
ATOM   2347 C CZ  . PHE B 2 13  ? 24.810  36.583  82.506  1.00 113.98 ? 13  PHE B CZ  1 
ATOM   2348 N N   . PRO B 2 14  ? 20.494  39.077  83.729  1.00 152.99 ? 14  PRO B N   1 
ATOM   2349 C CA  . PRO B 2 14  ? 20.372  40.442  83.200  1.00 142.78 ? 14  PRO B CA  1 
ATOM   2350 C C   . PRO B 2 14  ? 20.646  40.530  81.704  1.00 133.35 ? 14  PRO B C   1 
ATOM   2351 O O   . PRO B 2 14  ? 19.848  41.109  80.969  1.00 137.90 ? 14  PRO B O   1 
ATOM   2352 C CB  . PRO B 2 14  ? 21.455  41.214  83.962  1.00 143.71 ? 14  PRO B CB  1 
ATOM   2353 C CG  . PRO B 2 14  ? 21.721  40.403  85.186  1.00 155.28 ? 14  PRO B CG  1 
ATOM   2354 C CD  . PRO B 2 14  ? 21.526  38.979  84.775  1.00 157.62 ? 14  PRO B CD  1 
ATOM   2355 N N   . CYS B 2 15  ? 21.764  39.964  81.264  1.00 117.92 ? 15  CYS B N   1 
ATOM   2356 C CA  . CYS B 2 15  ? 22.208  40.134  79.884  1.00 109.31 ? 15  CYS B CA  1 
ATOM   2357 C C   . CYS B 2 15  ? 21.267  39.519  78.858  1.00 109.79 ? 15  CYS B C   1 
ATOM   2358 O O   . CYS B 2 15  ? 20.929  40.162  77.870  1.00 112.80 ? 15  CYS B O   1 
ATOM   2359 C CB  . CYS B 2 15  ? 23.629  39.609  79.707  1.00 103.28 ? 15  CYS B CB  1 
ATOM   2360 S SG  . CYS B 2 15  ? 24.868  40.739  80.366  1.00 96.48  ? 15  CYS B SG  1 
ATOM   2361 N N   . LEU B 2 16  ? 20.848  38.279  79.088  1.00 107.57 ? 16  LEU B N   1 
ATOM   2362 C CA  . LEU B 2 16  ? 19.831  37.660  78.248  1.00 101.86 ? 16  LEU B CA  1 
ATOM   2363 C C   . LEU B 2 16  ? 18.739  38.656  77.908  1.00 112.43 ? 16  LEU B C   1 
ATOM   2364 O O   . LEU B 2 16  ? 18.313  38.756  76.759  1.00 118.00 ? 16  LEU B O   1 
ATOM   2365 C CB  . LEU B 2 16  ? 19.197  36.467  78.953  1.00 95.67  ? 16  LEU B CB  1 
ATOM   2366 C CG  . LEU B 2 16  ? 19.515  35.098  78.365  1.00 83.92  ? 16  LEU B CG  1 
ATOM   2367 C CD1 . LEU B 2 16  ? 18.391  34.156  78.716  1.00 85.93  ? 16  LEU B CD1 1 
ATOM   2368 C CD2 . LEU B 2 16  ? 19.663  35.196  76.863  1.00 81.64  ? 16  LEU B CD2 1 
ATOM   2369 N N   . HIS B 2 17  ? 18.285  39.388  78.918  1.00 112.77 ? 17  HIS B N   1 
ATOM   2370 C CA  . HIS B 2 17  ? 17.228  40.370  78.733  1.00 107.85 ? 17  HIS B CA  1 
ATOM   2371 C C   . HIS B 2 17  ? 17.564  41.343  77.606  1.00 96.84  ? 17  HIS B C   1 
ATOM   2372 O O   . HIS B 2 17  ? 16.728  41.612  76.749  1.00 96.64  ? 17  HIS B O   1 
ATOM   2373 C CB  . HIS B 2 17  ? 16.966  41.120  80.041  1.00 109.02 ? 17  HIS B CB  1 
ATOM   2374 C CG  . HIS B 2 17  ? 15.905  42.168  79.933  1.00 119.18 ? 17  HIS B CG  1 
ATOM   2375 N ND1 . HIS B 2 17  ? 16.174  43.512  80.069  1.00 129.09 ? 17  HIS B ND1 1 
ATOM   2376 C CD2 . HIS B 2 17  ? 14.577  42.070  79.697  1.00 129.17 ? 17  HIS B CD2 1 
ATOM   2377 C CE1 . HIS B 2 17  ? 15.053  44.199  79.925  1.00 138.15 ? 17  HIS B CE1 1 
ATOM   2378 N NE2 . HIS B 2 17  ? 14.070  43.347  79.698  1.00 140.47 ? 17  HIS B NE2 1 
ATOM   2379 N N   . HIS B 2 18  ? 18.791  41.858  77.610  1.00 90.83  ? 18  HIS B N   1 
ATOM   2380 C CA  . HIS B 2 18  ? 19.229  42.829  76.608  1.00 97.42  ? 18  HIS B CA  1 
ATOM   2381 C C   . HIS B 2 18  ? 19.601  42.158  75.299  1.00 90.47  ? 18  HIS B C   1 
ATOM   2382 O O   . HIS B 2 18  ? 19.309  42.666  74.217  1.00 93.04  ? 18  HIS B O   1 
ATOM   2383 C CB  . HIS B 2 18  ? 20.424  43.631  77.121  1.00 103.51 ? 18  HIS B CB  1 
ATOM   2384 C CG  . HIS B 2 18  ? 20.098  44.519  78.275  1.00 109.62 ? 18  HIS B CG  1 
ATOM   2385 N ND1 . HIS B 2 18  ? 19.099  45.468  78.221  1.00 117.22 ? 18  HIS B ND1 1 
ATOM   2386 C CD2 . HIS B 2 18  ? 20.635  44.607  79.513  1.00 106.57 ? 18  HIS B CD2 1 
ATOM   2387 C CE1 . HIS B 2 18  ? 19.032  46.098  79.379  1.00 117.13 ? 18  HIS B CE1 1 
ATOM   2388 N NE2 . HIS B 2 18  ? 19.956  45.597  80.181  1.00 111.03 ? 18  HIS B NE2 1 
ATOM   2389 N N   . SER B 2 19  ? 20.270  41.021  75.413  1.00 83.26  ? 19  SER B N   1 
ATOM   2390 C CA  . SER B 2 19  ? 20.607  40.198  74.270  1.00 79.08  ? 19  SER B CA  1 
ATOM   2391 C C   . SER B 2 19  ? 19.353  39.888  73.464  1.00 83.67  ? 19  SER B C   1 
ATOM   2392 O O   . SER B 2 19  ? 19.352  40.019  72.243  1.00 89.76  ? 19  SER B O   1 
ATOM   2393 C CB  . SER B 2 19  ? 21.277  38.911  74.749  1.00 88.10  ? 19  SER B CB  1 
ATOM   2394 O OG  . SER B 2 19  ? 20.999  37.833  73.882  1.00 101.14 ? 19  SER B OG  1 
ATOM   2395 N N   . GLN B 2 20  ? 18.290  39.481  74.151  1.00 82.53  ? 20  GLN B N   1 
ATOM   2396 C CA  . GLN B 2 20  ? 17.022  39.163  73.497  1.00 90.04  ? 20  GLN B CA  1 
ATOM   2397 C C   . GLN B 2 20  ? 16.378  40.404  72.899  1.00 92.80  ? 20  GLN B C   1 
ATOM   2398 O O   . GLN B 2 20  ? 15.817  40.356  71.806  1.00 96.35  ? 20  GLN B O   1 
ATOM   2399 C CB  . GLN B 2 20  ? 16.050  38.511  74.481  1.00 96.48  ? 20  GLN B CB  1 
ATOM   2400 C CG  . GLN B 2 20  ? 16.471  37.130  74.948  1.00 102.60 ? 20  GLN B CG  1 
ATOM   2401 C CD  . GLN B 2 20  ? 15.612  36.607  76.082  1.00 105.81 ? 20  GLN B CD  1 
ATOM   2402 O OE1 . GLN B 2 20  ? 14.642  37.248  76.487  1.00 113.23 ? 20  GLN B OE1 1 
ATOM   2403 N NE2 . GLN B 2 20  ? 15.968  35.437  76.604  1.00 97.63  ? 20  GLN B NE2 1 
ATOM   2404 N N   . ASN B 2 21  ? 16.453  41.510  73.630  1.00 89.91  ? 21  ASN B N   1 
ATOM   2405 C CA  . ASN B 2 21  ? 15.915  42.774  73.157  1.00 90.66  ? 21  ASN B CA  1 
ATOM   2406 C C   . ASN B 2 21  ? 16.628  43.229  71.900  1.00 89.83  ? 21  ASN B C   1 
ATOM   2407 O O   . ASN B 2 21  ? 16.028  43.853  71.030  1.00 96.52  ? 21  ASN B O   1 
ATOM   2408 C CB  . ASN B 2 21  ? 16.038  43.848  74.236  1.00 92.37  ? 21  ASN B CB  1 
ATOM   2409 C CG  . ASN B 2 21  ? 14.947  43.751  75.273  1.00 99.83  ? 21  ASN B CG  1 
ATOM   2410 O OD1 . ASN B 2 21  ? 13.998  42.983  75.116  1.00 100.55 ? 21  ASN B OD1 1 
ATOM   2411 N ND2 . ASN B 2 21  ? 15.070  44.534  76.341  1.00 108.29 ? 21  ASN B ND2 1 
ATOM   2412 N N   . LEU B 2 22  ? 17.915  42.914  71.811  1.00 82.88  ? 22  LEU B N   1 
ATOM   2413 C CA  . LEU B 2 22  ? 18.721  43.299  70.662  1.00 72.46  ? 22  LEU B CA  1 
ATOM   2414 C C   . LEU B 2 22  ? 18.356  42.444  69.458  1.00 93.03  ? 22  LEU B C   1 
ATOM   2415 O O   . LEU B 2 22  ? 17.966  42.965  68.415  1.00 92.67  ? 22  LEU B O   1 
ATOM   2416 C CB  . LEU B 2 22  ? 20.207  43.154  70.984  1.00 108.81 ? 22  LEU B CB  1 
ATOM   2417 C CG  . LEU B 2 22  ? 21.197  43.578  69.903  1.00 70.29  ? 22  LEU B CG  1 
ATOM   2418 C CD1 . LEU B 2 22  ? 20.856  44.955  69.377  1.00 70.00  ? 22  LEU B CD1 1 
ATOM   2419 C CD2 . LEU B 2 22  ? 22.603  43.551  70.453  1.00 70.18  ? 22  LEU B CD2 1 
ATOM   2420 N N   . LEU B 2 23  ? 18.478  41.129  69.609  1.00 89.14  ? 23  LEU B N   1 
ATOM   2421 C CA  . LEU B 2 23  ? 18.105  40.209  68.548  1.00 84.92  ? 23  LEU B CA  1 
ATOM   2422 C C   . LEU B 2 23  ? 16.745  40.605  67.976  1.00 87.90  ? 23  LEU B C   1 
ATOM   2423 O O   . LEU B 2 23  ? 16.560  40.628  66.763  1.00 100.15 ? 23  LEU B O   1 
ATOM   2424 C CB  . LEU B 2 23  ? 18.077  38.772  69.073  1.00 93.89  ? 23  LEU B CB  1 
ATOM   2425 C CG  . LEU B 2 23  ? 18.016  37.615  68.071  1.00 88.33  ? 23  LEU B CG  1 
ATOM   2426 C CD1 . LEU B 2 23  ? 16.600  37.382  67.560  1.00 82.68  ? 23  LEU B CD1 1 
ATOM   2427 C CD2 . LEU B 2 23  ? 18.981  37.842  66.919  1.00 83.27  ? 23  LEU B CD2 1 
ATOM   2428 N N   . ARG B 2 24  ? 15.801  40.930  68.853  1.00 82.03  ? 24  ARG B N   1 
ATOM   2429 C CA  . ARG B 2 24  ? 14.445  41.271  68.429  1.00 81.35  ? 24  ARG B CA  1 
ATOM   2430 C C   . ARG B 2 24  ? 14.424  42.564  67.633  1.00 76.72  ? 24  ARG B C   1 
ATOM   2431 O O   . ARG B 2 24  ? 13.743  42.671  66.614  1.00 90.49  ? 24  ARG B O   1 
ATOM   2432 C CB  . ARG B 2 24  ? 13.521  41.403  69.644  1.00 86.72  ? 24  ARG B CB  1 
ATOM   2433 C CG  . ARG B 2 24  ? 12.047  41.565  69.302  1.00 91.68  ? 24  ARG B CG  1 
ATOM   2434 C CD  . ARG B 2 24  ? 11.202  41.859  70.538  1.00 105.69 ? 24  ARG B CD  1 
ATOM   2435 N NE  . ARG B 2 24  ? 11.355  40.844  71.582  1.00 120.48 ? 24  ARG B NE  1 
ATOM   2436 C CZ  . ARG B 2 24  ? 11.912  41.063  72.772  1.00 117.29 ? 24  ARG B CZ  1 
ATOM   2437 N NH1 . ARG B 2 24  ? 12.369  42.269  73.085  1.00 116.11 ? 24  ARG B NH1 1 
ATOM   2438 N NH2 . ARG B 2 24  ? 12.009  40.076  73.655  1.00 109.15 ? 24  ARG B NH2 1 
ATOM   2439 N N   . ALA B 2 25  ? 15.179  43.544  68.113  1.00 74.48  ? 25  ALA B N   1 
ATOM   2440 C CA  . ALA B 2 25  ? 15.182  44.889  67.545  1.00 82.27  ? 25  ALA B CA  1 
ATOM   2441 C C   . ALA B 2 25  ? 15.771  44.900  66.147  1.00 78.96  ? 25  ALA B C   1 
ATOM   2442 O O   . ALA B 2 25  ? 15.256  45.568  65.254  1.00 78.74  ? 25  ALA B O   1 
ATOM   2443 C CB  . ALA B 2 25  ? 15.958  45.839  68.443  1.00 73.31  ? 25  ALA B CB  1 
ATOM   2444 N N   . VAL B 2 26  ? 16.863  44.163  65.978  1.00 77.14  ? 26  VAL B N   1 
ATOM   2445 C CA  . VAL B 2 26  ? 17.503  43.998  64.681  1.00 77.15  ? 26  VAL B CA  1 
ATOM   2446 C C   . VAL B 2 26  ? 16.636  43.161  63.749  1.00 80.59  ? 26  VAL B C   1 
ATOM   2447 O O   . VAL B 2 26  ? 16.508  43.469  62.568  1.00 71.01  ? 26  VAL B O   1 
ATOM   2448 C CB  . VAL B 2 26  ? 18.886  43.347  64.824  1.00 74.97  ? 26  VAL B CB  1 
ATOM   2449 C CG1 . VAL B 2 26  ? 19.463  42.998  63.469  1.00 68.51  ? 26  VAL B CG1 1 
ATOM   2450 C CG2 . VAL B 2 26  ? 19.813  44.271  65.580  1.00 68.59  ? 26  VAL B CG2 1 
ATOM   2451 N N   . SER B 2 27  ? 16.030  42.107  64.278  1.00 72.06  ? 27  SER B N   1 
ATOM   2452 C CA  . SER B 2 27  ? 15.123  41.305  63.471  1.00 95.39  ? 27  SER B CA  1 
ATOM   2453 C C   . SER B 2 27  ? 13.983  42.159  62.916  1.00 96.14  ? 27  SER B C   1 
ATOM   2454 O O   . SER B 2 27  ? 13.557  41.978  61.771  1.00 93.76  ? 27  SER B O   1 
ATOM   2455 C CB  . SER B 2 27  ? 14.573  40.123  64.269  1.00 84.54  ? 27  SER B CB  1 
ATOM   2456 O OG  . SER B 2 27  ? 15.491  39.047  64.254  1.00 80.83  ? 27  SER B OG  1 
ATOM   2457 N N   . ASN B 2 28  ? 13.501  43.097  63.724  1.00 87.10  ? 28  ASN B N   1 
ATOM   2458 C CA  . ASN B 2 28  ? 12.406  43.956  63.295  1.00 86.78  ? 28  ASN B CA  1 
ATOM   2459 C C   . ASN B 2 28  ? 12.859  45.114  62.414  1.00 95.67  ? 28  ASN B C   1 
ATOM   2460 O O   . ASN B 2 28  ? 12.083  45.620  61.609  1.00 101.46 ? 28  ASN B O   1 
ATOM   2461 C CB  . ASN B 2 28  ? 11.616  44.471  64.495  1.00 83.24  ? 28  ASN B CB  1 
ATOM   2462 C CG  . ASN B 2 28  ? 10.759  43.392  65.133  1.00 102.67 ? 28  ASN B CG  1 
ATOM   2463 O OD1 . ASN B 2 28  ? 10.038  43.648  66.097  1.00 111.70 ? 28  ASN B OD1 1 
ATOM   2464 N ND2 . ASN B 2 28  ? 10.835  42.175  64.596  1.00 102.93 ? 28  ASN B ND2 1 
ATOM   2465 N N   . MET B 2 29  ? 14.111  45.535  62.566  1.00 91.30  ? 29  MET B N   1 
ATOM   2466 C CA  . MET B 2 29  ? 14.651  46.601  61.728  1.00 78.20  ? 29  MET B CA  1 
ATOM   2467 C C   . MET B 2 29  ? 15.078  46.033  60.386  1.00 87.50  ? 29  MET B C   1 
ATOM   2468 O O   . MET B 2 29  ? 14.826  46.625  59.341  1.00 95.11  ? 29  MET B O   1 
ATOM   2469 C CB  . MET B 2 29  ? 15.823  47.308  62.412  1.00 73.70  ? 29  MET B CB  1 
ATOM   2470 C CG  . MET B 2 29  ? 16.441  48.437  61.591  1.00 82.59  ? 29  MET B CG  1 
ATOM   2471 S SD  . MET B 2 29  ? 15.311  49.806  61.233  1.00 91.06  ? 29  MET B SD  1 
ATOM   2472 C CE  . MET B 2 29  ? 16.075  50.528  59.791  1.00 71.98  ? 29  MET B CE  1 
ATOM   2473 N N   . LEU B 2 30  ? 15.726  44.877  60.416  1.00 88.74  ? 30  LEU B N   1 
ATOM   2474 C CA  . LEU B 2 30  ? 16.042  44.173  59.187  1.00 83.28  ? 30  LEU B CA  1 
ATOM   2475 C C   . LEU B 2 30  ? 14.783  44.014  58.339  1.00 81.54  ? 30  LEU B C   1 
ATOM   2476 O O   . LEU B 2 30  ? 14.792  44.312  57.155  1.00 87.17  ? 30  LEU B O   1 
ATOM   2477 C CB  . LEU B 2 30  ? 16.653  42.809  59.494  1.00 90.59  ? 30  LEU B CB  1 
ATOM   2478 C CG  . LEU B 2 30  ? 17.145  42.003  58.295  1.00 89.05  ? 30  LEU B CG  1 
ATOM   2479 C CD1 . LEU B 2 30  ? 18.191  42.784  57.523  1.00 77.06  ? 30  LEU B CD1 1 
ATOM   2480 C CD2 . LEU B 2 30  ? 17.702  40.674  58.764  1.00 87.30  ? 30  LEU B CD2 1 
ATOM   2481 N N   . GLN B 2 31  ? 13.694  43.563  58.952  1.00 90.35  ? 31  GLN B N   1 
ATOM   2482 C CA  . GLN B 2 31  ? 12.436  43.374  58.232  1.00 91.77  ? 31  GLN B CA  1 
ATOM   2483 C C   . GLN B 2 31  ? 11.895  44.668  57.630  1.00 94.01  ? 31  GLN B C   1 
ATOM   2484 O O   . GLN B 2 31  ? 11.297  44.646  56.563  1.00 100.56 ? 31  GLN B O   1 
ATOM   2485 C CB  . GLN B 2 31  ? 11.377  42.720  59.126  1.00 97.89  ? 31  GLN B CB  1 
ATOM   2486 C CG  . GLN B 2 31  ? 11.609  41.241  59.356  1.00 113.73 ? 31  GLN B CG  1 
ATOM   2487 C CD  . GLN B 2 31  ? 11.550  40.432  58.071  1.00 121.88 ? 31  GLN B CD  1 
ATOM   2488 O OE1 . GLN B 2 31  ? 10.565  40.488  57.335  1.00 129.24 ? 31  GLN B OE1 1 
ATOM   2489 N NE2 . GLN B 2 31  ? 12.607  39.672  57.800  1.00 117.13 ? 31  GLN B NE2 1 
ATOM   2490 N N   . LYS B 2 32  ? 12.100  45.789  58.315  1.00 90.71  ? 32  LYS B N   1 
ATOM   2491 C CA  . LYS B 2 32  ? 11.665  47.083  57.793  1.00 93.49  ? 32  LYS B CA  1 
ATOM   2492 C C   . LYS B 2 32  ? 12.416  47.408  56.513  1.00 88.88  ? 32  LYS B C   1 
ATOM   2493 O O   . LYS B 2 32  ? 11.812  47.725  55.492  1.00 91.56  ? 32  LYS B O   1 
ATOM   2494 C CB  . LYS B 2 32  ? 11.899  48.208  58.807  1.00 100.83 ? 32  LYS B CB  1 
ATOM   2495 C CG  . LYS B 2 32  ? 10.905  48.276  59.962  1.00 113.75 ? 32  LYS B CG  1 
ATOM   2496 C CD  . LYS B 2 32  ? 11.117  49.556  60.779  1.00 118.86 ? 32  LYS B CD  1 
ATOM   2497 C CE  . LYS B 2 32  ? 10.418  49.512  62.139  1.00 112.76 ? 32  LYS B CE  1 
ATOM   2498 N NZ  . LYS B 2 32  ? 11.158  48.694  63.141  1.00 101.15 ? 32  LYS B NZ  1 
ATOM   2499 N N   . ALA B 2 33  ? 13.740  47.334  56.582  1.00 89.80  ? 33  ALA B N   1 
ATOM   2500 C CA  . ALA B 2 33  ? 14.590  47.647  55.442  1.00 88.19  ? 33  ALA B CA  1 
ATOM   2501 C C   . ALA B 2 33  ? 14.163  46.860  54.210  1.00 93.35  ? 33  ALA B C   1 
ATOM   2502 O O   . ALA B 2 33  ? 13.716  47.436  53.220  1.00 96.26  ? 33  ALA B O   1 
ATOM   2503 C CB  . ALA B 2 33  ? 16.051  47.372  55.770  1.00 78.12  ? 33  ALA B CB  1 
ATOM   2504 N N   . ARG B 2 34  ? 14.285  45.541  54.275  1.00 97.03  ? 34  ARG B N   1 
ATOM   2505 C CA  . ARG B 2 34  ? 13.961  44.712  53.122  1.00 106.64 ? 34  ARG B CA  1 
ATOM   2506 C C   . ARG B 2 34  ? 12.453  44.633  52.854  1.00 117.19 ? 34  ARG B C   1 
ATOM   2507 O O   . ARG B 2 34  ? 11.986  43.743  52.144  1.00 129.61 ? 34  ARG B O   1 
ATOM   2508 C CB  . ARG B 2 34  ? 14.592  43.317  53.240  1.00 105.29 ? 34  ARG B CB  1 
ATOM   2509 C CG  . ARG B 2 34  ? 13.933  42.373  54.236  1.00 104.72 ? 34  ARG B CG  1 
ATOM   2510 C CD  . ARG B 2 34  ? 14.035  40.932  53.739  1.00 117.59 ? 34  ARG B CD  1 
ATOM   2511 N NE  . ARG B 2 34  ? 13.556  40.826  52.360  1.00 130.69 ? 34  ARG B NE  1 
ATOM   2512 C CZ  . ARG B 2 34  ? 13.551  39.708  51.640  1.00 130.59 ? 34  ARG B CZ  1 
ATOM   2513 N NH1 . ARG B 2 34  ? 13.998  38.575  52.162  1.00 134.06 ? 34  ARG B NH1 1 
ATOM   2514 N NH2 . ARG B 2 34  ? 13.095  39.725  50.393  1.00 123.94 ? 34  ARG B NH2 1 
ATOM   2515 N N   . GLN B 2 35  ? 11.699  45.570  53.420  1.00 114.55 ? 35  GLN B N   1 
ATOM   2516 C CA  . GLN B 2 35  ? 10.273  45.692  53.129  1.00 119.46 ? 35  GLN B CA  1 
ATOM   2517 C C   . GLN B 2 35  ? 9.944   47.084  52.608  1.00 122.13 ? 35  GLN B C   1 
ATOM   2518 O O   . GLN B 2 35  ? 8.829   47.337  52.158  1.00 129.85 ? 35  GLN B O   1 
ATOM   2519 C CB  . GLN B 2 35  ? 9.424   45.381  54.363  1.00 128.24 ? 35  GLN B CB  1 
ATOM   2520 C CG  . GLN B 2 35  ? 8.969   43.935  54.459  1.00 140.16 ? 35  GLN B CG  1 
ATOM   2521 C CD  . GLN B 2 35  ? 8.134   43.667  55.698  1.00 152.71 ? 35  GLN B CD  1 
ATOM   2522 O OE1 . GLN B 2 35  ? 8.530   44.006  56.814  1.00 156.84 ? 35  GLN B OE1 1 
ATOM   2523 N NE2 . GLN B 2 35  ? 6.975   43.047  55.509  1.00 157.57 ? 35  GLN B NE2 1 
ATOM   2524 N N   . THR B 2 36  ? 10.917  47.988  52.678  1.00 114.34 ? 36  THR B N   1 
ATOM   2525 C CA  . THR B 2 36  ? 10.743  49.332  52.134  1.00 114.37 ? 36  THR B CA  1 
ATOM   2526 C C   . THR B 2 36  ? 11.855  49.672  51.142  1.00 115.82 ? 36  THR B C   1 
ATOM   2527 O O   . THR B 2 36  ? 11.810  50.701  50.474  1.00 114.09 ? 36  THR B O   1 
ATOM   2528 C CB  . THR B 2 36  ? 10.660  50.411  53.241  1.00 107.91 ? 36  THR B CB  1 
ATOM   2529 O OG1 . THR B 2 36  ? 11.930  50.548  53.889  1.00 98.67  ? 36  THR B OG1 1 
ATOM   2530 C CG2 . THR B 2 36  ? 9.604   50.041  54.274  1.00 109.24 ? 36  THR B CG2 1 
ATOM   2531 N N   . LEU B 2 37  ? 12.852  48.800  51.051  1.00 120.96 ? 37  LEU B N   1 
ATOM   2532 C CA  . LEU B 2 37  ? 13.913  48.961  50.065  1.00 126.34 ? 37  LEU B CA  1 
ATOM   2533 C C   . LEU B 2 37  ? 13.801  47.896  48.981  1.00 142.45 ? 37  LEU B C   1 
ATOM   2534 O O   . LEU B 2 37  ? 14.314  46.784  49.123  1.00 140.08 ? 37  LEU B O   1 
ATOM   2535 C CB  . LEU B 2 37  ? 15.287  48.901  50.725  1.00 114.95 ? 37  LEU B CB  1 
ATOM   2536 C CG  . LEU B 2 37  ? 15.693  50.114  51.556  1.00 110.03 ? 37  LEU B CG  1 
ATOM   2537 C CD1 . LEU B 2 37  ? 17.195  50.102  51.774  1.00 114.13 ? 37  LEU B CD1 1 
ATOM   2538 C CD2 . LEU B 2 37  ? 15.250  51.412  50.898  1.00 109.64 ? 37  LEU B CD2 1 
ATOM   2539 N N   . GLU B 2 38  ? 13.126  48.251  47.896  1.00 159.08 ? 38  GLU B N   1 
ATOM   2540 C CA  . GLU B 2 38  ? 12.859  47.314  46.817  1.00 175.31 ? 38  GLU B CA  1 
ATOM   2541 C C   . GLU B 2 38  ? 13.940  47.354  45.742  1.00 185.41 ? 38  GLU B C   1 
ATOM   2542 O O   . GLU B 2 38  ? 14.654  46.372  45.537  1.00 187.68 ? 38  GLU B O   1 
ATOM   2543 C CB  . GLU B 2 38  ? 11.484  47.602  46.215  1.00 180.86 ? 38  GLU B CB  1 
ATOM   2544 C CG  . GLU B 2 38  ? 11.162  49.083  46.113  1.00 181.24 ? 38  GLU B CG  1 
ATOM   2545 C CD  . GLU B 2 38  ? 9.676   49.359  46.189  1.00 183.68 ? 38  GLU B CD  1 
ATOM   2546 O OE1 . GLU B 2 38  ? 9.272   50.517  45.956  1.00 184.26 ? 38  GLU B OE1 1 
ATOM   2547 O OE2 . GLU B 2 38  ? 8.910   48.417  46.485  1.00 185.55 ? 38  GLU B OE2 1 
ATOM   2548 N N   . PHE B 2 39  ? 14.059  48.492  45.062  1.00 189.82 ? 39  PHE B N   1 
ATOM   2549 C CA  . PHE B 2 39  ? 15.044  48.657  43.995  1.00 188.06 ? 39  PHE B CA  1 
ATOM   2550 C C   . PHE B 2 39  ? 16.464  48.686  44.555  1.00 186.94 ? 39  PHE B C   1 
ATOM   2551 O O   . PHE B 2 39  ? 17.251  49.578  44.239  1.00 190.57 ? 39  PHE B O   1 
ATOM   2552 C CB  . PHE B 2 39  ? 14.761  49.929  43.190  1.00 183.28 ? 39  PHE B CB  1 
ATOM   2553 N N   . TYR B 2 40  ? 16.777  47.700  45.390  1.00 179.31 ? 40  TYR B N   1 
ATOM   2554 C CA  . TYR B 2 40  ? 18.079  47.597  46.033  1.00 175.83 ? 40  TYR B CA  1 
ATOM   2555 C C   . TYR B 2 40  ? 18.409  46.128  46.295  1.00 175.15 ? 40  TYR B C   1 
ATOM   2556 O O   . TYR B 2 40  ? 17.521  45.340  46.622  1.00 178.91 ? 40  TYR B O   1 
ATOM   2557 C CB  . TYR B 2 40  ? 18.083  48.376  47.353  1.00 171.32 ? 40  TYR B CB  1 
ATOM   2558 C CG  . TYR B 2 40  ? 17.967  49.881  47.203  1.00 163.46 ? 40  TYR B CG  1 
ATOM   2559 C CD1 . TYR B 2 40  ? 19.092  50.690  47.254  1.00 161.42 ? 40  TYR B CD1 1 
ATOM   2560 C CD2 . TYR B 2 40  ? 16.732  50.492  47.022  1.00 159.42 ? 40  TYR B CD2 1 
ATOM   2561 C CE1 . TYR B 2 40  ? 18.996  52.060  47.123  1.00 163.36 ? 40  TYR B CE1 1 
ATOM   2562 C CE2 . TYR B 2 40  ? 16.625  51.864  46.886  1.00 160.36 ? 40  TYR B CE2 1 
ATOM   2563 C CZ  . TYR B 2 40  ? 17.762  52.644  46.938  1.00 163.91 ? 40  TYR B CZ  1 
ATOM   2564 O OH  . TYR B 2 40  ? 17.670  54.012  46.806  1.00 164.24 ? 40  TYR B OH  1 
ATOM   2565 N N   . PRO B 2 41  ? 19.689  45.752  46.142  1.00 167.42 ? 41  PRO B N   1 
ATOM   2566 C CA  . PRO B 2 41  ? 20.153  44.385  46.411  1.00 156.71 ? 41  PRO B CA  1 
ATOM   2567 C C   . PRO B 2 41  ? 20.049  43.988  47.886  1.00 136.76 ? 41  PRO B C   1 
ATOM   2568 O O   . PRO B 2 41  ? 21.069  43.882  48.565  1.00 115.48 ? 41  PRO B O   1 
ATOM   2569 C CB  . PRO B 2 41  ? 21.625  44.424  45.985  1.00 160.77 ? 41  PRO B CB  1 
ATOM   2570 C CG  . PRO B 2 41  ? 21.723  45.569  45.037  1.00 164.70 ? 41  PRO B CG  1 
ATOM   2571 C CD  . PRO B 2 41  ? 20.745  46.583  45.539  1.00 165.84 ? 41  PRO B CD  1 
ATOM   2572 N N   . CYS B 2 42  ? 18.830  43.768  48.368  1.00 140.47 ? 42  CYS B N   1 
ATOM   2573 C CA  . CYS B 2 42  ? 18.613  43.322  49.741  1.00 140.26 ? 42  CYS B CA  1 
ATOM   2574 C C   . CYS B 2 42  ? 17.882  41.985  49.767  1.00 147.18 ? 42  CYS B C   1 
ATOM   2575 O O   . CYS B 2 42  ? 16.752  41.895  50.245  1.00 150.35 ? 42  CYS B O   1 
ATOM   2576 C CB  . CYS B 2 42  ? 17.809  44.361  50.521  1.00 135.31 ? 42  CYS B CB  1 
ATOM   2577 S SG  . CYS B 2 42  ? 18.619  45.965  50.656  1.00 274.07 ? 42  CYS B SG  1 
ATOM   2578 N N   . THR B 2 43  ? 18.533  40.948  49.252  1.00 148.96 ? 43  THR B N   1 
ATOM   2579 C CA  . THR B 2 43  ? 17.907  39.638  49.127  1.00 149.23 ? 43  THR B CA  1 
ATOM   2580 C C   . THR B 2 43  ? 18.911  38.512  49.352  1.00 148.51 ? 43  THR B C   1 
ATOM   2581 O O   . THR B 2 43  ? 19.762  38.248  48.501  1.00 146.17 ? 43  THR B O   1 
ATOM   2582 C CB  . THR B 2 43  ? 17.272  39.461  47.739  1.00 145.81 ? 43  THR B CB  1 
ATOM   2583 O OG1 . THR B 2 43  ? 18.245  39.758  46.730  1.00 146.47 ? 43  THR B OG1 1 
ATOM   2584 C CG2 . THR B 2 43  ? 16.079  40.393  47.575  1.00 141.03 ? 43  THR B CG2 1 
ATOM   2585 N N   . SER B 2 44  ? 18.800  37.852  50.500  1.00 141.97 ? 44  SER B N   1 
ATOM   2586 C CA  . SER B 2 44  ? 19.703  36.762  50.857  1.00 131.58 ? 44  SER B CA  1 
ATOM   2587 C C   . SER B 2 44  ? 21.166  37.156  50.670  1.00 131.01 ? 44  SER B C   1 
ATOM   2588 O O   . SER B 2 44  ? 21.693  37.993  51.407  1.00 124.27 ? 44  SER B O   1 
ATOM   2589 C CB  . SER B 2 44  ? 19.378  35.502  50.048  1.00 121.85 ? 44  SER B CB  1 
ATOM   2590 O OG  . SER B 2 44  ? 19.513  35.725  48.655  1.00 115.21 ? 44  SER B OG  1 
ATOM   2591 N N   . ASP B 2 48  ? 25.641  38.027  48.557  1.00 107.72 ? 48  ASP B N   1 
ATOM   2592 C CA  . ASP B 2 48  ? 26.005  39.243  49.282  1.00 117.92 ? 48  ASP B CA  1 
ATOM   2593 C C   . ASP B 2 48  ? 25.961  39.041  50.799  1.00 125.26 ? 48  ASP B C   1 
ATOM   2594 O O   . ASP B 2 48  ? 24.883  38.992  51.397  1.00 121.40 ? 48  ASP B O   1 
ATOM   2595 C CB  . ASP B 2 48  ? 25.091  40.406  48.875  1.00 115.90 ? 48  ASP B CB  1 
ATOM   2596 N N   . HIS B 2 49  ? 27.140  38.934  51.412  1.00 131.33 ? 49  HIS B N   1 
ATOM   2597 C CA  . HIS B 2 49  ? 27.262  38.689  52.850  1.00 134.94 ? 49  HIS B CA  1 
ATOM   2598 C C   . HIS B 2 49  ? 28.657  39.040  53.388  1.00 136.60 ? 49  HIS B C   1 
ATOM   2599 O O   . HIS B 2 49  ? 29.632  38.346  53.098  1.00 135.07 ? 49  HIS B O   1 
ATOM   2600 C CB  . HIS B 2 49  ? 26.924  37.231  53.169  1.00 139.11 ? 49  HIS B CB  1 
ATOM   2601 C CG  . HIS B 2 49  ? 27.352  36.261  52.107  1.00 145.44 ? 49  HIS B CG  1 
ATOM   2602 N ND1 . HIS B 2 49  ? 26.509  35.832  51.105  1.00 145.60 ? 49  HIS B ND1 1 
ATOM   2603 C CD2 . HIS B 2 49  ? 28.535  35.635  51.896  1.00 147.16 ? 49  HIS B CD2 1 
ATOM   2604 C CE1 . HIS B 2 49  ? 27.152  34.986  50.321  1.00 145.69 ? 49  HIS B CE1 1 
ATOM   2605 N NE2 . HIS B 2 49  ? 28.384  34.848  50.778  1.00 147.66 ? 49  HIS B NE2 1 
ATOM   2606 N N   . GLU B 2 50  ? 28.743  40.109  54.180  1.00 137.50 ? 50  GLU B N   1 
ATOM   2607 C CA  . GLU B 2 50  ? 30.033  40.609  54.672  1.00 134.98 ? 50  GLU B CA  1 
ATOM   2608 C C   . GLU B 2 50  ? 30.035  40.956  56.169  1.00 132.29 ? 50  GLU B C   1 
ATOM   2609 O O   . GLU B 2 50  ? 29.045  41.461  56.702  1.00 132.94 ? 50  GLU B O   1 
ATOM   2610 C CB  . GLU B 2 50  ? 30.480  41.826  53.855  1.00 127.81 ? 50  GLU B CB  1 
ATOM   2611 N N   . ASP B 2 51  ? 31.159  40.686  56.833  1.00 122.13 ? 51  ASP B N   1 
ATOM   2612 C CA  . ASP B 2 51  ? 31.311  40.949  58.266  1.00 111.11 ? 51  ASP B CA  1 
ATOM   2613 C C   . ASP B 2 51  ? 32.419  41.972  58.512  1.00 102.03 ? 51  ASP B C   1 
ATOM   2614 O O   . ASP B 2 51  ? 33.569  41.750  58.134  1.00 106.89 ? 51  ASP B O   1 
ATOM   2615 C CB  . ASP B 2 51  ? 31.615  39.645  59.015  1.00 113.40 ? 51  ASP B CB  1 
ATOM   2616 C CG  . ASP B 2 51  ? 31.933  39.866  60.491  1.00 109.53 ? 51  ASP B CG  1 
ATOM   2617 O OD1 . ASP B 2 51  ? 32.840  39.178  61.005  1.00 106.62 ? 51  ASP B OD1 1 
ATOM   2618 O OD2 . ASP B 2 51  ? 31.282  40.717  61.138  1.00 103.09 ? 51  ASP B OD2 1 
ATOM   2619 N N   . ILE B 2 52  ? 32.068  43.086  59.152  1.00 88.06  ? 52  ILE B N   1 
ATOM   2620 C CA  . ILE B 2 52  ? 32.994  44.203  59.324  1.00 85.83  ? 52  ILE B CA  1 
ATOM   2621 C C   . ILE B 2 52  ? 34.043  43.953  60.402  1.00 90.81  ? 52  ILE B C   1 
ATOM   2622 O O   . ILE B 2 52  ? 35.050  44.658  60.474  1.00 86.43  ? 52  ILE B O   1 
ATOM   2623 C CB  . ILE B 2 52  ? 32.245  45.512  59.635  1.00 76.48  ? 52  ILE B CB  1 
ATOM   2624 C CG1 . ILE B 2 52  ? 31.643  45.467  61.034  1.00 86.71  ? 52  ILE B CG1 1 
ATOM   2625 C CG2 . ILE B 2 52  ? 31.148  45.746  58.625  1.00 79.94  ? 52  ILE B CG2 1 
ATOM   2626 C CD1 . ILE B 2 52  ? 30.732  46.625  61.329  1.00 77.24  ? 52  ILE B CD1 1 
ATOM   2627 N N   . THR B 2 53  ? 33.803  42.945  61.234  1.00 94.16  ? 53  THR B N   1 
ATOM   2628 C CA  . THR B 2 53  ? 34.721  42.606  62.313  1.00 99.16  ? 53  THR B CA  1 
ATOM   2629 C C   . THR B 2 53  ? 35.534  41.370  61.950  1.00 111.49 ? 53  THR B C   1 
ATOM   2630 O O   . THR B 2 53  ? 35.729  40.482  62.780  1.00 114.44 ? 53  THR B O   1 
ATOM   2631 C CB  . THR B 2 53  ? 33.960  42.331  63.611  1.00 94.23  ? 53  THR B CB  1 
ATOM   2632 O OG1 . THR B 2 53  ? 33.350  41.038  63.540  1.00 100.25 ? 53  THR B OG1 1 
ATOM   2633 C CG2 . THR B 2 53  ? 32.886  43.381  63.818  1.00 93.44  ? 53  THR B CG2 1 
ATOM   2634 N N   . LYS B 2 54  ? 36.002  41.330  60.703  1.00 114.38 ? 54  LYS B N   1 
ATOM   2635 C CA  . LYS B 2 54  ? 36.712  40.181  60.149  1.00 124.94 ? 54  LYS B CA  1 
ATOM   2636 C C   . LYS B 2 54  ? 37.819  39.668  61.065  1.00 132.12 ? 54  LYS B C   1 
ATOM   2637 O O   . LYS B 2 54  ? 37.550  39.027  62.081  1.00 139.53 ? 54  LYS B O   1 
ATOM   2638 C CB  . LYS B 2 54  ? 37.287  40.542  58.777  1.00 135.70 ? 54  LYS B CB  1 
ATOM   2639 C CG  . LYS B 2 54  ? 37.935  39.392  58.007  1.00 138.54 ? 54  LYS B CG  1 
ATOM   2640 C CD  . LYS B 2 54  ? 36.913  38.490  57.326  1.00 137.69 ? 54  LYS B CD  1 
ATOM   2641 C CE  . LYS B 2 54  ? 36.542  37.299  58.196  1.00 135.29 ? 54  LYS B CE  1 
ATOM   2642 N NZ  . LYS B 2 54  ? 35.742  36.289  57.445  1.00 133.71 ? 54  LYS B NZ  1 
ATOM   2643 N N   . ASP B 2 55  ? 39.068  39.934  60.695  1.00 133.55 ? 55  ASP B N   1 
ATOM   2644 C CA  . ASP B 2 55  ? 40.202  39.514  61.509  1.00 137.35 ? 55  ASP B CA  1 
ATOM   2645 C C   . ASP B 2 55  ? 40.476  40.577  62.567  1.00 136.30 ? 55  ASP B C   1 
ATOM   2646 O O   . ASP B 2 55  ? 41.511  40.567  63.238  1.00 133.74 ? 55  ASP B O   1 
ATOM   2647 C CB  . ASP B 2 55  ? 41.440  39.247  60.642  1.00 137.47 ? 55  ASP B CB  1 
ATOM   2648 C CG  . ASP B 2 55  ? 41.439  37.849  60.029  1.00 136.67 ? 55  ASP B CG  1 
ATOM   2649 O OD1 . ASP B 2 55  ? 40.359  37.227  59.941  1.00 134.23 ? 55  ASP B OD1 1 
ATOM   2650 O OD2 . ASP B 2 55  ? 42.525  37.371  59.637  1.00 137.24 ? 55  ASP B OD2 1 
ATOM   2651 N N   . LYS B 2 56  ? 39.520  41.488  62.710  1.00 138.17 ? 56  LYS B N   1 
ATOM   2652 C CA  . LYS B 2 56  ? 39.600  42.563  63.688  1.00 145.78 ? 56  LYS B CA  1 
ATOM   2653 C C   . LYS B 2 56  ? 39.285  42.053  65.094  1.00 144.74 ? 56  LYS B C   1 
ATOM   2654 O O   . LYS B 2 56  ? 39.947  42.422  66.063  1.00 145.75 ? 56  LYS B O   1 
ATOM   2655 C CB  . LYS B 2 56  ? 38.616  43.676  63.316  1.00 151.33 ? 56  LYS B CB  1 
ATOM   2656 C CG  . LYS B 2 56  ? 38.725  44.163  61.875  1.00 154.30 ? 56  LYS B CG  1 
ATOM   2657 C CD  . LYS B 2 56  ? 39.730  45.296  61.744  1.00 152.77 ? 56  LYS B CD  1 
ATOM   2658 C CE  . LYS B 2 56  ? 39.244  46.543  62.467  1.00 148.99 ? 56  LYS B CE  1 
ATOM   2659 N NZ  . LYS B 2 56  ? 40.267  47.627  62.478  1.00 151.26 ? 56  LYS B NZ  1 
ATOM   2660 N N   . THR B 2 57  ? 38.268  41.203  65.196  1.00 140.82 ? 57  THR B N   1 
ATOM   2661 C CA  . THR B 2 57  ? 37.810  40.712  66.491  1.00 130.98 ? 57  THR B CA  1 
ATOM   2662 C C   . THR B 2 57  ? 37.736  39.193  66.548  1.00 132.40 ? 57  THR B C   1 
ATOM   2663 O O   . THR B 2 57  ? 37.152  38.554  65.668  1.00 132.52 ? 57  THR B O   1 
ATOM   2664 C CB  . THR B 2 57  ? 36.427  41.264  66.835  1.00 119.69 ? 57  THR B CB  1 
ATOM   2665 O OG1 . THR B 2 57  ? 36.487  42.692  66.912  1.00 116.39 ? 57  THR B OG1 1 
ATOM   2666 C CG2 . THR B 2 57  ? 35.964  40.714  68.162  1.00 115.65 ? 57  THR B CG2 1 
ATOM   2667 N N   . SER B 2 58  ? 38.314  38.624  67.601  1.00 129.77 ? 58  SER B N   1 
ATOM   2668 C CA  . SER B 2 58  ? 38.347  37.177  67.774  1.00 124.82 ? 58  SER B CA  1 
ATOM   2669 C C   . SER B 2 58  ? 37.076  36.670  68.443  1.00 112.99 ? 58  SER B C   1 
ATOM   2670 O O   . SER B 2 58  ? 37.116  35.769  69.280  1.00 118.02 ? 58  SER B O   1 
ATOM   2671 C CB  . SER B 2 58  ? 39.573  36.771  68.589  1.00 127.76 ? 58  SER B CB  1 
ATOM   2672 O OG  . SER B 2 58  ? 39.704  37.593  69.733  1.00 127.70 ? 58  SER B OG  1 
ATOM   2673 N N   . THR B 2 59  ? 35.948  37.256  68.062  1.00 99.59  ? 59  THR B N   1 
ATOM   2674 C CA  . THR B 2 59  ? 34.656  36.868  68.602  1.00 91.99  ? 59  THR B CA  1 
ATOM   2675 C C   . THR B 2 59  ? 34.151  35.581  67.954  1.00 96.23  ? 59  THR B C   1 
ATOM   2676 O O   . THR B 2 59  ? 33.358  34.848  68.540  1.00 96.26  ? 59  THR B O   1 
ATOM   2677 C CB  . THR B 2 59  ? 33.626  37.988  68.390  1.00 91.13  ? 59  THR B CB  1 
ATOM   2678 O OG1 . THR B 2 59  ? 32.308  37.487  68.634  1.00 85.62  ? 59  THR B OG1 1 
ATOM   2679 C CG2 . THR B 2 59  ? 33.707  38.513  66.966  1.00 95.55  ? 59  THR B CG2 1 
ATOM   2680 N N   . VAL B 2 60  ? 34.620  35.305  66.742  1.00 103.09 ? 60  VAL B N   1 
ATOM   2681 C CA  . VAL B 2 60  ? 34.182  34.124  66.006  1.00 104.55 ? 60  VAL B CA  1 
ATOM   2682 C C   . VAL B 2 60  ? 34.954  32.887  66.450  1.00 112.10 ? 60  VAL B C   1 
ATOM   2683 O O   . VAL B 2 60  ? 34.377  31.812  66.629  1.00 112.23 ? 60  VAL B O   1 
ATOM   2684 C CB  . VAL B 2 60  ? 34.336  34.316  64.481  1.00 98.84  ? 60  VAL B CB  1 
ATOM   2685 C CG1 . VAL B 2 60  ? 35.798  34.553  64.121  1.00 105.07 ? 60  VAL B CG1 1 
ATOM   2686 C CG2 . VAL B 2 60  ? 33.777  33.120  63.733  1.00 82.05  ? 60  VAL B CG2 1 
ATOM   2687 N N   . GLU B 2 61  ? 36.260  33.048  66.631  1.00 114.98 ? 61  GLU B N   1 
ATOM   2688 C CA  . GLU B 2 61  ? 37.109  31.957  67.082  1.00 124.53 ? 61  GLU B CA  1 
ATOM   2689 C C   . GLU B 2 61  ? 36.607  31.343  68.389  1.00 116.53 ? 61  GLU B C   1 
ATOM   2690 O O   . GLU B 2 61  ? 36.322  30.150  68.452  1.00 123.77 ? 61  GLU B O   1 
ATOM   2691 C CB  . GLU B 2 61  ? 38.552  32.438  67.259  1.00 145.26 ? 61  GLU B CB  1 
ATOM   2692 C CG  . GLU B 2 61  ? 39.473  31.400  67.897  1.00 163.82 ? 61  GLU B CG  1 
ATOM   2693 C CD  . GLU B 2 61  ? 40.816  31.975  68.324  1.00 175.50 ? 61  GLU B CD  1 
ATOM   2694 O OE1 . GLU B 2 61  ? 41.103  33.141  67.980  1.00 178.32 ? 61  GLU B OE1 1 
ATOM   2695 O OE2 . GLU B 2 61  ? 41.583  31.260  69.006  1.00 179.69 ? 61  GLU B OE2 1 
ATOM   2696 N N   . ALA B 2 62  ? 36.493  32.160  69.429  1.00 105.09 ? 62  ALA B N   1 
ATOM   2697 C CA  . ALA B 2 62  ? 36.249  31.629  70.765  1.00 108.21 ? 62  ALA B CA  1 
ATOM   2698 C C   . ALA B 2 62  ? 34.981  32.139  71.438  1.00 101.68 ? 62  ALA B C   1 
ATOM   2699 O O   . ALA B 2 62  ? 35.050  32.853  72.433  1.00 94.81  ? 62  ALA B O   1 
ATOM   2700 C CB  . ALA B 2 62  ? 37.454  31.886  71.658  1.00 110.22 ? 62  ALA B CB  1 
ATOM   2701 N N   . CYS B 2 63  ? 33.826  31.756  70.907  1.00 100.77 ? 63  CYS B N   1 
ATOM   2702 C CA  . CYS B 2 63  ? 32.559  32.060  71.563  1.00 98.70  ? 63  CYS B CA  1 
ATOM   2703 C C   . CYS B 2 63  ? 31.642  30.846  71.654  1.00 110.34 ? 63  CYS B C   1 
ATOM   2704 O O   . CYS B 2 63  ? 30.448  30.982  71.915  1.00 110.26 ? 63  CYS B O   1 
ATOM   2705 C CB  . CYS B 2 63  ? 31.842  33.209  70.861  1.00 95.52  ? 63  CYS B CB  1 
ATOM   2706 S SG  . CYS B 2 63  ? 32.295  34.839  71.471  1.00 108.80 ? 63  CYS B SG  1 
ATOM   2707 N N   . LEU B 2 64  ? 32.202  29.661  71.436  1.00 121.50 ? 64  LEU B N   1 
ATOM   2708 C CA  . LEU B 2 64  ? 31.439  28.426  71.563  1.00 121.45 ? 64  LEU B CA  1 
ATOM   2709 C C   . LEU B 2 64  ? 31.529  27.943  73.001  1.00 112.93 ? 64  LEU B C   1 
ATOM   2710 O O   . LEU B 2 64  ? 32.501  28.243  73.690  1.00 113.26 ? 64  LEU B O   1 
ATOM   2711 C CB  . LEU B 2 64  ? 31.985  27.347  70.626  1.00 128.09 ? 64  LEU B CB  1 
ATOM   2712 C CG  . LEU B 2 64  ? 32.683  27.778  69.338  1.00 123.57 ? 64  LEU B CG  1 
ATOM   2713 C CD1 . LEU B 2 64  ? 34.142  28.104  69.627  1.00 125.30 ? 64  LEU B CD1 1 
ATOM   2714 C CD2 . LEU B 2 64  ? 32.580  26.684  68.286  1.00 116.21 ? 64  LEU B CD2 1 
ATOM   2715 N N   . PRO B 2 65  ? 30.515  27.192  73.462  1.00 109.41 ? 65  PRO B N   1 
ATOM   2716 C CA  . PRO B 2 65  ? 30.499  26.683  74.837  1.00 108.14 ? 65  PRO B CA  1 
ATOM   2717 C C   . PRO B 2 65  ? 31.832  26.064  75.227  1.00 107.08 ? 65  PRO B C   1 
ATOM   2718 O O   . PRO B 2 65  ? 32.617  25.699  74.357  1.00 103.81 ? 65  PRO B O   1 
ATOM   2719 C CB  . PRO B 2 65  ? 29.413  25.609  74.791  1.00 107.19 ? 65  PRO B CB  1 
ATOM   2720 C CG  . PRO B 2 65  ? 28.471  26.091  73.754  1.00 106.47 ? 65  PRO B CG  1 
ATOM   2721 C CD  . PRO B 2 65  ? 29.302  26.807  72.720  1.00 107.06 ? 65  PRO B CD  1 
ATOM   2722 N N   . LEU B 2 66  ? 32.092  25.959  76.523  1.00 115.17 ? 66  LEU B N   1 
ATOM   2723 C CA  . LEU B 2 66  ? 33.308  25.307  76.985  1.00 123.98 ? 66  LEU B CA  1 
ATOM   2724 C C   . LEU B 2 66  ? 33.214  23.818  76.693  1.00 121.86 ? 66  LEU B C   1 
ATOM   2725 O O   . LEU B 2 66  ? 34.217  23.108  76.681  1.00 129.38 ? 66  LEU B O   1 
ATOM   2726 C CB  . LEU B 2 66  ? 33.519  25.545  78.480  1.00 130.47 ? 66  LEU B CB  1 
ATOM   2727 C CG  . LEU B 2 66  ? 33.968  26.950  78.884  1.00 134.04 ? 66  LEU B CG  1 
ATOM   2728 C CD1 . LEU B 2 66  ? 32.935  27.989  78.474  1.00 132.84 ? 66  LEU B CD1 1 
ATOM   2729 C CD2 . LEU B 2 66  ? 34.232  27.016  80.377  1.00 136.17 ? 66  LEU B CD2 1 
ATOM   2730 N N   . GLU B 2 67  ? 31.992  23.358  76.451  1.00 111.22 ? 67  GLU B N   1 
ATOM   2731 C CA  . GLU B 2 67  ? 31.738  21.960  76.155  1.00 114.16 ? 67  GLU B CA  1 
ATOM   2732 C C   . GLU B 2 67  ? 32.323  21.553  74.802  1.00 121.13 ? 67  GLU B C   1 
ATOM   2733 O O   . GLU B 2 67  ? 32.855  20.454  74.649  1.00 124.34 ? 67  GLU B O   1 
ATOM   2734 C CB  . GLU B 2 67  ? 30.234  21.691  76.182  1.00 118.66 ? 67  GLU B CB  1 
ATOM   2735 C CG  . GLU B 2 67  ? 29.877  20.224  76.252  1.00 140.20 ? 67  GLU B CG  1 
ATOM   2736 C CD  . GLU B 2 67  ? 28.402  19.972  76.013  1.00 151.25 ? 67  GLU B CD  1 
ATOM   2737 O OE1 . GLU B 2 67  ? 27.788  20.738  75.243  1.00 151.10 ? 67  GLU B OE1 1 
ATOM   2738 O OE2 . GLU B 2 67  ? 27.858  19.006  76.590  1.00 158.39 ? 67  GLU B OE2 1 
ATOM   2739 N N   . LEU B 2 68  ? 32.225  22.445  73.823  1.00 126.41 ? 68  LEU B N   1 
ATOM   2740 C CA  . LEU B 2 68  ? 32.715  22.166  72.477  1.00 126.37 ? 68  LEU B CA  1 
ATOM   2741 C C   . LEU B 2 68  ? 34.186  22.538  72.344  1.00 140.78 ? 68  LEU B C   1 
ATOM   2742 O O   . LEU B 2 68  ? 34.956  21.832  71.699  1.00 142.79 ? 68  LEU B O   1 
ATOM   2743 C CB  . LEU B 2 68  ? 31.879  22.916  71.443  1.00 109.02 ? 68  LEU B CB  1 
ATOM   2744 C CG  . LEU B 2 68  ? 30.373  22.716  71.615  1.00 98.43  ? 68  LEU B CG  1 
ATOM   2745 C CD1 . LEU B 2 68  ? 29.613  23.440  70.529  1.00 91.25  ? 68  LEU B CD1 1 
ATOM   2746 C CD2 . LEU B 2 68  ? 30.026  21.239  71.615  1.00 96.17  ? 68  LEU B CD2 1 
ATOM   2747 N N   . THR B 2 69  ? 34.568  23.654  72.952  1.00 157.05 ? 69  THR B N   1 
ATOM   2748 C CA  . THR B 2 69  ? 35.974  24.009  73.065  1.00 173.93 ? 69  THR B CA  1 
ATOM   2749 C C   . THR B 2 69  ? 36.612  23.088  74.099  1.00 196.88 ? 69  THR B C   1 
ATOM   2750 O O   . THR B 2 69  ? 36.939  23.514  75.210  1.00 204.77 ? 69  THR B O   1 
ATOM   2751 C CB  . THR B 2 69  ? 36.162  25.478  73.499  1.00 168.13 ? 69  THR B CB  1 
ATOM   2752 O OG1 . THR B 2 69  ? 35.375  26.333  72.663  1.00 166.44 ? 69  THR B OG1 1 
ATOM   2753 C CG2 . THR B 2 69  ? 37.623  25.887  73.394  1.00 166.79 ? 69  THR B CG2 1 
ATOM   2754 N N   . LYS B 2 70  ? 36.765  21.817  73.731  1.00 204.97 ? 70  LYS B N   1 
ATOM   2755 C CA  . LYS B 2 70  ? 37.342  20.809  74.618  1.00 210.64 ? 70  LYS B CA  1 
ATOM   2756 C C   . LYS B 2 70  ? 38.637  21.295  75.267  1.00 224.51 ? 70  LYS B C   1 
ATOM   2757 O O   . LYS B 2 70  ? 38.929  20.961  76.416  1.00 228.70 ? 70  LYS B O   1 
ATOM   2758 C CB  . LYS B 2 70  ? 37.572  19.498  73.856  1.00 203.20 ? 70  LYS B CB  1 
ATOM   2759 C CG  . LYS B 2 70  ? 38.170  19.667  72.461  1.00 194.79 ? 70  LYS B CG  1 
ATOM   2760 C CD  . LYS B 2 70  ? 39.672  19.906  72.511  1.00 190.30 ? 70  LYS B CD  1 
ATOM   2761 C CE  . LYS B 2 70  ? 40.271  20.016  71.118  1.00 183.56 ? 70  LYS B CE  1 
ATOM   2762 N NZ  . LYS B 2 70  ? 40.185  18.731  70.372  1.00 180.74 ? 70  LYS B NZ  1 
ATOM   2763 N N   . ASN B 2 71  ? 39.400  22.089  74.520  1.00 231.47 ? 71  ASN B N   1 
ATOM   2764 C CA  . ASN B 2 71  ? 40.637  22.696  75.005  1.00 235.67 ? 71  ASN B CA  1 
ATOM   2765 C C   . ASN B 2 71  ? 41.074  23.839  74.088  1.00 231.34 ? 71  ASN B C   1 
ATOM   2766 O O   . ASN B 2 71  ? 40.585  23.961  72.964  1.00 230.78 ? 71  ASN B O   1 
ATOM   2767 C CB  . ASN B 2 71  ? 41.751  21.653  75.125  1.00 241.51 ? 71  ASN B CB  1 
ATOM   2768 C CG  . ASN B 2 71  ? 41.768  20.962  76.480  1.00 243.26 ? 71  ASN B CG  1 
ATOM   2769 O OD1 . ASN B 2 71  ? 42.181  19.806  76.596  1.00 245.80 ? 71  ASN B OD1 1 
ATOM   2770 N ND2 . ASN B 2 71  ? 41.322  21.668  77.512  1.00 241.02 ? 71  ASN B ND2 1 
ATOM   2771 N N   . GLU B 2 72  ? 41.992  24.673  74.569  1.00 226.31 ? 72  GLU B N   1 
ATOM   2772 C CA  . GLU B 2 72  ? 42.471  25.816  73.795  1.00 217.92 ? 72  GLU B CA  1 
ATOM   2773 C C   . GLU B 2 72  ? 43.395  25.390  72.657  1.00 217.84 ? 72  GLU B C   1 
ATOM   2774 O O   . GLU B 2 72  ? 44.481  25.945  72.488  1.00 223.68 ? 72  GLU B O   1 
ATOM   2775 C CB  . GLU B 2 72  ? 43.188  26.817  74.705  1.00 213.21 ? 72  GLU B CB  1 
ATOM   2776 N N   . SER B 2 73  ? 42.956  24.408  71.876  1.00 209.10 ? 73  SER B N   1 
ATOM   2777 C CA  . SER B 2 73  ? 43.747  23.898  70.764  1.00 203.15 ? 73  SER B CA  1 
ATOM   2778 C C   . SER B 2 73  ? 43.948  24.959  69.686  1.00 197.35 ? 73  SER B C   1 
ATOM   2779 O O   . SER B 2 73  ? 45.004  25.025  69.057  1.00 197.21 ? 73  SER B O   1 
ATOM   2780 C CB  . SER B 2 73  ? 43.084  22.656  70.164  1.00 201.85 ? 73  SER B CB  1 
ATOM   2781 N N   . CYS B 2 74  ? 42.931  25.791  69.481  1.00 191.17 ? 74  CYS B N   1 
ATOM   2782 C CA  . CYS B 2 74  ? 42.975  26.817  68.443  1.00 183.58 ? 74  CYS B CA  1 
ATOM   2783 C C   . CYS B 2 74  ? 43.705  28.071  68.913  1.00 177.68 ? 74  CYS B C   1 
ATOM   2784 O O   . CYS B 2 74  ? 43.576  29.136  68.309  1.00 169.83 ? 74  CYS B O   1 
ATOM   2785 C CB  . CYS B 2 74  ? 41.559  27.177  67.990  1.00 180.11 ? 74  CYS B CB  1 
ATOM   2786 S SG  . CYS B 2 74  ? 40.531  25.753  67.569  1.00 338.36 ? 74  CYS B SG  1 
ATOM   2787 N N   . GLU B 2 79  ? 44.354  36.904  76.558  1.00 200.67 ? 79  GLU B N   1 
ATOM   2788 C CA  . GLU B 2 79  ? 44.860  38.099  75.896  1.00 201.08 ? 79  GLU B CA  1 
ATOM   2789 C C   . GLU B 2 79  ? 44.304  39.379  76.513  1.00 202.55 ? 79  GLU B C   1 
ATOM   2790 O O   . GLU B 2 79  ? 45.028  40.143  77.153  1.00 207.29 ? 79  GLU B O   1 
ATOM   2791 C CB  . GLU B 2 79  ? 44.557  38.047  74.396  1.00 195.09 ? 79  GLU B CB  1 
ATOM   2792 C CG  . GLU B 2 79  ? 44.809  39.358  73.671  1.00 192.73 ? 79  GLU B CG  1 
ATOM   2793 C CD  . GLU B 2 79  ? 46.182  39.931  73.963  1.00 194.38 ? 79  GLU B CD  1 
ATOM   2794 O OE1 . GLU B 2 79  ? 47.137  39.143  74.132  1.00 196.63 ? 79  GLU B OE1 1 
ATOM   2795 O OE2 . GLU B 2 79  ? 46.306  41.172  74.024  1.00 191.90 ? 79  GLU B OE2 1 
ATOM   2796 N N   . THR B 2 80  ? 43.011  39.612  76.309  1.00 194.61 ? 80  THR B N   1 
ATOM   2797 C CA  . THR B 2 80  ? 42.337  40.786  76.869  1.00 183.74 ? 80  THR B CA  1 
ATOM   2798 C C   . THR B 2 80  ? 41.261  40.348  77.857  1.00 178.51 ? 80  THR B C   1 
ATOM   2799 O O   . THR B 2 80  ? 40.098  40.729  77.724  1.00 171.24 ? 80  THR B O   1 
ATOM   2800 C CB  . THR B 2 80  ? 41.688  41.661  75.777  1.00 175.85 ? 80  THR B CB  1 
ATOM   2801 N N   . SER B 2 81  ? 41.658  39.556  78.852  1.00 181.02 ? 81  SER B N   1 
ATOM   2802 C CA  . SER B 2 81  ? 40.713  38.976  79.802  1.00 180.00 ? 81  SER B CA  1 
ATOM   2803 C C   . SER B 2 81  ? 40.692  39.708  81.146  1.00 183.51 ? 81  SER B C   1 
ATOM   2804 O O   . SER B 2 81  ? 41.584  39.532  81.979  1.00 184.77 ? 81  SER B O   1 
ATOM   2805 C CB  . SER B 2 81  ? 41.017  37.489  80.006  1.00 178.87 ? 81  SER B CB  1 
ATOM   2806 O OG  . SER B 2 81  ? 42.410  37.264  80.140  1.00 179.23 ? 81  SER B OG  1 
ATOM   2807 N N   . PHE B 2 82  ? 39.664  40.526  81.346  1.00 180.96 ? 82  PHE B N   1 
ATOM   2808 C CA  . PHE B 2 82  ? 39.476  41.251  82.597  1.00 178.11 ? 82  PHE B CA  1 
ATOM   2809 C C   . PHE B 2 82  ? 38.099  41.910  82.629  1.00 167.46 ? 82  PHE B C   1 
ATOM   2810 O O   . PHE B 2 82  ? 37.930  43.039  82.169  1.00 166.14 ? 82  PHE B O   1 
ATOM   2811 C CB  . PHE B 2 82  ? 40.570  42.303  82.785  1.00 183.11 ? 82  PHE B CB  1 
ATOM   2812 N N   . ILE B 2 83  ? 37.117  41.192  83.167  1.00 157.39 ? 83  ILE B N   1 
ATOM   2813 C CA  . ILE B 2 83  ? 35.754  41.702  83.264  1.00 142.05 ? 83  ILE B CA  1 
ATOM   2814 C C   . ILE B 2 83  ? 35.665  42.840  84.277  1.00 148.72 ? 83  ILE B C   1 
ATOM   2815 O O   . ILE B 2 83  ? 36.664  43.226  84.886  1.00 149.01 ? 83  ILE B O   1 
ATOM   2816 C CB  . ILE B 2 83  ? 34.755  40.593  83.649  1.00 123.19 ? 83  ILE B CB  1 
ATOM   2817 N N   . THR B 2 84  ? 34.462  43.374  84.452  1.00 147.88 ? 84  THR B N   1 
ATOM   2818 C CA  . THR B 2 84  ? 34.254  44.519  85.325  1.00 142.68 ? 84  THR B CA  1 
ATOM   2819 C C   . THR B 2 84  ? 33.181  44.230  86.361  1.00 148.04 ? 84  THR B C   1 
ATOM   2820 O O   . THR B 2 84  ? 32.081  43.797  86.021  1.00 149.86 ? 84  THR B O   1 
ATOM   2821 C CB  . THR B 2 84  ? 33.834  45.758  84.524  1.00 136.26 ? 84  THR B CB  1 
ATOM   2822 O OG1 . THR B 2 84  ? 34.922  46.182  83.695  1.00 133.10 ? 84  THR B OG1 1 
ATOM   2823 C CG2 . THR B 2 84  ? 33.448  46.890  85.460  1.00 144.45 ? 84  THR B CG2 1 
ATOM   2824 N N   . ASN B 2 85  ? 33.507  44.473  87.626  1.00 150.77 ? 85  ASN B N   1 
ATOM   2825 C CA  . ASN B 2 85  ? 32.549  44.286  88.704  1.00 155.25 ? 85  ASN B CA  1 
ATOM   2826 C C   . ASN B 2 85  ? 31.293  45.107  88.444  1.00 150.41 ? 85  ASN B C   1 
ATOM   2827 O O   . ASN B 2 85  ? 31.360  46.325  88.286  1.00 144.94 ? 85  ASN B O   1 
ATOM   2828 C CB  . ASN B 2 85  ? 33.168  44.666  90.048  1.00 167.69 ? 85  ASN B CB  1 
ATOM   2829 C CG  . ASN B 2 85  ? 32.385  44.119  91.224  1.00 179.81 ? 85  ASN B CG  1 
ATOM   2830 O OD1 . ASN B 2 85  ? 31.245  43.678  91.074  1.00 182.53 ? 85  ASN B OD1 1 
ATOM   2831 N ND2 . ASN B 2 85  ? 32.997  44.139  92.403  1.00 187.27 ? 85  ASN B ND2 1 
ATOM   2832 N N   . GLY B 2 86  ? 30.150  44.431  88.397  1.00 153.45 ? 86  GLY B N   1 
ATOM   2833 C CA  . GLY B 2 86  ? 28.901  45.072  88.029  1.00 153.46 ? 86  GLY B CA  1 
ATOM   2834 C C   . GLY B 2 86  ? 28.657  44.938  86.538  1.00 148.62 ? 86  GLY B C   1 
ATOM   2835 O O   . GLY B 2 86  ? 28.902  45.868  85.769  1.00 150.70 ? 86  GLY B O   1 
ATOM   2836 N N   . SER B 2 87  ? 28.178  43.769  86.127  1.00 133.60 ? 87  SER B N   1 
ATOM   2837 C CA  . SER B 2 87  ? 27.943  43.490  84.718  1.00 118.20 ? 87  SER B CA  1 
ATOM   2838 C C   . SER B 2 87  ? 26.763  42.540  84.560  1.00 117.52 ? 87  SER B C   1 
ATOM   2839 O O   . SER B 2 87  ? 25.624  42.966  84.358  1.00 108.12 ? 87  SER B O   1 
ATOM   2840 C CB  . SER B 2 87  ? 29.200  42.881  84.093  1.00 116.41 ? 87  SER B CB  1 
ATOM   2841 O OG  . SER B 2 87  ? 28.873  41.984  83.048  1.00 110.81 ? 87  SER B OG  1 
ATOM   2842 N N   . CYS B 2 88  ? 27.060  41.248  84.649  1.00 124.09 ? 88  CYS B N   1 
ATOM   2843 C CA  . CYS B 2 88  ? 26.060  40.194  84.667  1.00 125.81 ? 88  CYS B CA  1 
ATOM   2844 C C   . CYS B 2 88  ? 26.706  38.994  85.351  1.00 130.69 ? 88  CYS B C   1 
ATOM   2845 O O   . CYS B 2 88  ? 27.798  38.579  84.956  1.00 132.27 ? 88  CYS B O   1 
ATOM   2846 C CB  . CYS B 2 88  ? 25.648  39.824  83.244  1.00 119.54 ? 88  CYS B CB  1 
ATOM   2847 S SG  . CYS B 2 88  ? 24.712  41.092  82.355  1.00 264.50 ? 88  CYS B SG  1 
ATOM   2848 N N   . LEU B 2 89  ? 26.061  38.435  86.375  1.00 124.32 ? 89  LEU B N   1 
ATOM   2849 C CA  . LEU B 2 89  ? 26.693  37.331  87.095  1.00 121.08 ? 89  LEU B CA  1 
ATOM   2850 C C   . LEU B 2 89  ? 25.845  36.102  87.441  1.00 122.56 ? 89  LEU B C   1 
ATOM   2851 O O   . LEU B 2 89  ? 25.535  35.859  88.602  1.00 124.90 ? 89  LEU B O   1 
ATOM   2852 C CB  . LEU B 2 89  ? 27.418  37.847  88.333  1.00 124.19 ? 89  LEU B CB  1 
ATOM   2853 C CG  . LEU B 2 89  ? 28.575  38.793  88.013  1.00 132.15 ? 89  LEU B CG  1 
ATOM   2854 C CD1 . LEU B 2 89  ? 29.153  39.388  89.288  1.00 152.89 ? 89  LEU B CD1 1 
ATOM   2855 C CD2 . LEU B 2 89  ? 29.653  38.085  87.212  1.00 123.35 ? 89  LEU B CD2 1 
ATOM   2856 N N   . ALA B 2 90  ? 25.477  35.337  86.417  1.00 127.97 ? 90  ALA B N   1 
ATOM   2857 C CA  . ALA B 2 90  ? 25.205  33.912  86.577  1.00 125.03 ? 90  ALA B CA  1 
ATOM   2858 C C   . ALA B 2 90  ? 26.506  33.279  86.112  1.00 131.64 ? 90  ALA B C   1 
ATOM   2859 O O   . ALA B 2 90  ? 26.518  32.337  85.320  1.00 115.57 ? 90  ALA B O   1 
ATOM   2860 C CB  . ALA B 2 90  ? 24.043  33.461  85.697  1.00 102.48 ? 90  ALA B CB  1 
ATOM   2861 N N   . SER B 2 91  ? 27.603  33.826  86.632  1.00 142.76 ? 91  SER B N   1 
ATOM   2862 C CA  . SER B 2 91  ? 28.926  33.684  86.034  1.00 141.37 ? 91  SER B CA  1 
ATOM   2863 C C   . SER B 2 91  ? 29.807  32.592  86.618  1.00 147.76 ? 91  SER B C   1 
ATOM   2864 O O   . SER B 2 91  ? 31.034  32.672  86.528  1.00 143.16 ? 91  SER B O   1 
ATOM   2865 C CB  . SER B 2 91  ? 29.673  35.018  86.111  1.00 138.63 ? 91  SER B CB  1 
ATOM   2866 N N   . ARG B 2 92  ? 29.197  31.573  87.208  1.00 157.96 ? 92  ARG B N   1 
ATOM   2867 C CA  . ARG B 2 92  ? 29.964  30.414  87.632  1.00 168.65 ? 92  ARG B CA  1 
ATOM   2868 C C   . ARG B 2 92  ? 30.563  29.749  86.393  1.00 176.79 ? 92  ARG B C   1 
ATOM   2869 O O   . ARG B 2 92  ? 31.049  28.618  86.457  1.00 184.98 ? 92  ARG B O   1 
ATOM   2870 C CB  . ARG B 2 92  ? 29.081  29.431  88.403  1.00 165.44 ? 92  ARG B CB  1 
ATOM   2871 N N   . LYS B 2 93  ? 30.526  30.466  85.267  1.00 164.28 ? 93  LYS B N   1 
ATOM   2872 C CA  . LYS B 2 93  ? 31.022  29.947  83.994  1.00 148.93 ? 93  LYS B CA  1 
ATOM   2873 C C   . LYS B 2 93  ? 31.415  31.031  82.979  1.00 137.34 ? 93  LYS B C   1 
ATOM   2874 O O   . LYS B 2 93  ? 32.020  30.725  81.953  1.00 127.78 ? 93  LYS B O   1 
ATOM   2875 C CB  . LYS B 2 93  ? 29.988  29.006  83.368  1.00 140.78 ? 93  LYS B CB  1 
ATOM   2876 N N   . THR B 2 94  ? 31.074  32.289  83.256  1.00 135.96 ? 94  THR B N   1 
ATOM   2877 C CA  . THR B 2 94  ? 31.363  33.373  82.310  1.00 126.16 ? 94  THR B CA  1 
ATOM   2878 C C   . THR B 2 94  ? 32.745  33.977  82.529  1.00 121.24 ? 94  THR B C   1 
ATOM   2879 O O   . THR B 2 94  ? 33.414  34.382  81.579  1.00 110.02 ? 94  THR B O   1 
ATOM   2880 C CB  . THR B 2 94  ? 30.327  34.512  82.384  1.00 121.13 ? 94  THR B CB  1 
ATOM   2881 O OG1 . THR B 2 94  ? 30.782  35.518  83.296  1.00 116.99 ? 94  THR B OG1 1 
ATOM   2882 C CG2 . THR B 2 94  ? 28.973  33.991  82.826  1.00 126.30 ? 94  THR B CG2 1 
ATOM   2883 N N   . SER B 2 95  ? 33.162  34.051  83.787  1.00 132.98 ? 95  SER B N   1 
ATOM   2884 C CA  . SER B 2 95  ? 34.507  34.504  84.111  1.00 141.70 ? 95  SER B CA  1 
ATOM   2885 C C   . SER B 2 95  ? 35.507  33.544  83.483  1.00 149.76 ? 95  SER B C   1 
ATOM   2886 O O   . SER B 2 95  ? 36.694  33.847  83.370  1.00 146.73 ? 95  SER B O   1 
ATOM   2887 C CB  . SER B 2 95  ? 34.709  34.553  85.631  1.00 146.37 ? 95  SER B CB  1 
ATOM   2888 O OG  . SER B 2 95  ? 33.889  35.535  86.244  1.00 141.94 ? 95  SER B OG  1 
ATOM   2889 N N   . PHE B 2 96  ? 35.004  32.385  83.066  1.00 160.13 ? 96  PHE B N   1 
ATOM   2890 C CA  . PHE B 2 96  ? 35.832  31.296  82.563  1.00 165.58 ? 96  PHE B CA  1 
ATOM   2891 C C   . PHE B 2 96  ? 36.538  31.676  81.263  1.00 164.48 ? 96  PHE B C   1 
ATOM   2892 O O   . PHE B 2 96  ? 36.796  32.850  81.005  1.00 161.52 ? 96  PHE B O   1 
ATOM   2893 C CB  . PHE B 2 96  ? 34.970  30.050  82.345  1.00 168.12 ? 96  PHE B CB  1 
ATOM   2894 C CG  . PHE B 2 96  ? 35.563  28.789  82.907  1.00 174.68 ? 96  PHE B CG  1 
ATOM   2895 C CD1 . PHE B 2 96  ? 34.977  28.161  83.993  1.00 179.95 ? 96  PHE B CD1 1 
ATOM   2896 C CD2 . PHE B 2 96  ? 36.700  28.229  82.349  1.00 181.39 ? 96  PHE B CD2 1 
ATOM   2897 C CE1 . PHE B 2 96  ? 35.514  26.997  84.511  1.00 190.40 ? 96  PHE B CE1 1 
ATOM   2898 C CE2 . PHE B 2 96  ? 37.241  27.065  82.865  1.00 189.55 ? 96  PHE B CE2 1 
ATOM   2899 C CZ  . PHE B 2 96  ? 36.648  26.448  83.948  1.00 193.46 ? 96  PHE B CZ  1 
ATOM   2900 N N   . MET B 2 97  ? 36.844  30.671  80.448  1.00 170.26 ? 97  MET B N   1 
ATOM   2901 C CA  . MET B 2 97  ? 37.544  30.880  79.183  1.00 172.56 ? 97  MET B CA  1 
ATOM   2902 C C   . MET B 2 97  ? 36.859  31.926  78.304  1.00 167.35 ? 97  MET B C   1 
ATOM   2903 O O   . MET B 2 97  ? 37.472  32.476  77.388  1.00 169.50 ? 97  MET B O   1 
ATOM   2904 C CB  . MET B 2 97  ? 37.661  29.561  78.406  1.00 174.65 ? 97  MET B CB  1 
ATOM   2905 C CG  . MET B 2 97  ? 38.560  28.510  79.044  1.00 178.73 ? 97  MET B CG  1 
ATOM   2906 S SD  . MET B 2 97  ? 38.682  27.016  78.034  1.00 238.61 ? 97  MET B SD  1 
ATOM   2907 C CE  . MET B 2 97  ? 39.747  25.996  79.050  1.00 175.62 ? 97  MET B CE  1 
ATOM   2908 N N   . MET B 2 98  ? 35.589  32.198  78.584  1.00 154.37 ? 98  MET B N   1 
ATOM   2909 C CA  . MET B 2 98  ? 34.800  33.092  77.746  1.00 134.83 ? 98  MET B CA  1 
ATOM   2910 C C   . MET B 2 98  ? 35.227  34.548  77.873  1.00 140.53 ? 98  MET B C   1 
ATOM   2911 O O   . MET B 2 98  ? 34.667  35.423  77.219  1.00 140.23 ? 98  MET B O   1 
ATOM   2912 C CB  . MET B 2 98  ? 33.314  32.950  78.069  1.00 120.59 ? 98  MET B CB  1 
ATOM   2913 C CG  . MET B 2 98  ? 32.833  31.516  78.095  1.00 115.32 ? 98  MET B CG  1 
ATOM   2914 S SD  . MET B 2 98  ? 31.094  31.371  77.660  1.00 117.13 ? 98  MET B SD  1 
ATOM   2915 C CE  . MET B 2 98  ? 31.163  31.748  75.910  1.00 251.05 ? 98  MET B CE  1 
ATOM   2916 N N   . ALA B 2 99  ? 36.219  34.804  78.717  1.00 129.96 ? 99  ALA B N   1 
ATOM   2917 C CA  . ALA B 2 99  ? 36.739  36.155  78.889  1.00 128.00 ? 99  ALA B CA  1 
ATOM   2918 C C   . ALA B 2 99  ? 37.176  36.750  77.553  1.00 119.04 ? 99  ALA B C   1 
ATOM   2919 O O   . ALA B 2 99  ? 37.026  37.946  77.318  1.00 107.55 ? 99  ALA B O   1 
ATOM   2920 C CB  . ALA B 2 99  ? 37.893  36.151  79.872  1.00 132.71 ? 99  ALA B CB  1 
ATOM   2921 N N   . LEU B 2 100 ? 37.714  35.904  76.681  1.00 122.19 ? 100 LEU B N   1 
ATOM   2922 C CA  . LEU B 2 100 ? 38.174  36.340  75.368  1.00 119.52 ? 100 LEU B CA  1 
ATOM   2923 C C   . LEU B 2 100 ? 36.986  36.586  74.445  1.00 117.71 ? 100 LEU B C   1 
ATOM   2924 O O   . LEU B 2 100 ? 37.104  37.257  73.423  1.00 114.05 ? 100 LEU B O   1 
ATOM   2925 C CB  . LEU B 2 100 ? 39.109  35.289  74.766  1.00 119.57 ? 100 LEU B CB  1 
ATOM   2926 C CG  . LEU B 2 100 ? 39.936  35.642  73.526  1.00 118.18 ? 100 LEU B CG  1 
ATOM   2927 C CD1 . LEU B 2 100 ? 39.183  35.332  72.238  1.00 111.77 ? 100 LEU B CD1 1 
ATOM   2928 C CD2 . LEU B 2 100 ? 40.387  37.094  73.570  1.00 120.78 ? 100 LEU B CD2 1 
ATOM   2929 N N   . CYS B 2 101 ? 35.838  36.039  74.830  1.00 119.18 ? 101 CYS B N   1 
ATOM   2930 C CA  . CYS B 2 101 ? 34.612  36.134  74.047  1.00 108.37 ? 101 CYS B CA  1 
ATOM   2931 C C   . CYS B 2 101 ? 33.852  37.415  74.365  1.00 91.15  ? 101 CYS B C   1 
ATOM   2932 O O   . CYS B 2 101 ? 33.471  38.157  73.463  1.00 83.88  ? 101 CYS B O   1 
ATOM   2933 C CB  . CYS B 2 101 ? 33.726  34.914  74.321  1.00 110.14 ? 101 CYS B CB  1 
ATOM   2934 S SG  . CYS B 2 101 ? 32.121  34.908  73.495  1.00 116.08 ? 101 CYS B SG  1 
ATOM   2935 N N   . LEU B 2 102 ? 33.630  37.666  75.651  1.00 87.80  ? 102 LEU B N   1 
ATOM   2936 C CA  . LEU B 2 102 ? 32.943  38.877  76.088  1.00 97.09  ? 102 LEU B CA  1 
ATOM   2937 C C   . LEU B 2 102 ? 33.719  40.137  75.703  1.00 98.19  ? 102 LEU B C   1 
ATOM   2938 O O   . LEU B 2 102 ? 33.141  41.107  75.216  1.00 85.77  ? 102 LEU B O   1 
ATOM   2939 C CB  . LEU B 2 102 ? 32.708  38.850  77.600  1.00 99.89  ? 102 LEU B CB  1 
ATOM   2940 C CG  . LEU B 2 102 ? 31.660  37.879  78.156  1.00 93.93  ? 102 LEU B CG  1 
ATOM   2941 C CD1 . LEU B 2 102 ? 30.466  37.789  77.220  1.00 78.26  ? 102 LEU B CD1 1 
ATOM   2942 C CD2 . LEU B 2 102 ? 32.255  36.506  78.401  1.00 99.83  ? 102 LEU B CD2 1 
ATOM   2943 N N   . SER B 2 103 ? 35.029  40.119  75.931  1.00 109.36 ? 103 SER B N   1 
ATOM   2944 C CA  . SER B 2 103 ? 35.892  41.226  75.535  1.00 111.90 ? 103 SER B CA  1 
ATOM   2945 C C   . SER B 2 103 ? 35.664  41.577  74.078  1.00 110.27 ? 103 SER B C   1 
ATOM   2946 O O   . SER B 2 103 ? 35.426  42.735  73.729  1.00 104.30 ? 103 SER B O   1 
ATOM   2947 C CB  . SER B 2 103 ? 37.360  40.852  75.727  1.00 118.84 ? 103 SER B CB  1 
ATOM   2948 O OG  . SER B 2 103 ? 38.188  41.633  74.882  1.00 120.47 ? 103 SER B OG  1 
ATOM   2949 N N   . SER B 2 104 ? 35.746  40.551  73.236  1.00 110.07 ? 104 SER B N   1 
ATOM   2950 C CA  . SER B 2 104 ? 35.584  40.679  71.794  1.00 101.98 ? 104 SER B CA  1 
ATOM   2951 C C   . SER B 2 104 ? 34.179  41.130  71.410  1.00 94.17  ? 104 SER B C   1 
ATOM   2952 O O   . SER B 2 104 ? 34.011  42.117  70.698  1.00 99.99  ? 104 SER B O   1 
ATOM   2953 C CB  . SER B 2 104 ? 35.899  39.344  71.135  1.00 100.07 ? 104 SER B CB  1 
ATOM   2954 O OG  . SER B 2 104 ? 35.376  38.289  71.916  1.00 109.12 ? 104 SER B OG  1 
ATOM   2955 N N   . ILE B 2 105 ? 33.175  40.396  71.877  1.00 80.24  ? 105 ILE B N   1 
ATOM   2956 C CA  . ILE B 2 105 ? 31.780  40.775  71.673  1.00 78.19  ? 105 ILE B CA  1 
ATOM   2957 C C   . ILE B 2 105 ? 31.533  42.259  71.926  1.00 76.65  ? 105 ILE B C   1 
ATOM   2958 O O   . ILE B 2 105 ? 30.950  42.950  71.092  1.00 74.23  ? 105 ILE B O   1 
ATOM   2959 C CB  . ILE B 2 105 ? 30.847  39.981  72.596  1.00 78.82  ? 105 ILE B CB  1 
ATOM   2960 C CG1 . ILE B 2 105 ? 30.665  38.555  72.078  1.00 78.67  ? 105 ILE B CG1 1 
ATOM   2961 C CG2 . ILE B 2 105 ? 29.498  40.680  72.721  1.00 69.29  ? 105 ILE B CG2 1 
ATOM   2962 C CD1 . ILE B 2 105 ? 29.606  37.776  72.829  1.00 82.41  ? 105 ILE B CD1 1 
ATOM   2963 N N   . TYR B 2 106 ? 31.961  42.744  73.086  1.00 83.04  ? 106 TYR B N   1 
ATOM   2964 C CA  . TYR B 2 106 ? 31.822  44.158  73.399  1.00 84.68  ? 106 TYR B CA  1 
ATOM   2965 C C   . TYR B 2 106 ? 32.502  44.980  72.314  1.00 83.01  ? 106 TYR B C   1 
ATOM   2966 O O   . TYR B 2 106 ? 31.955  45.967  71.826  1.00 69.88  ? 106 TYR B O   1 
ATOM   2967 C CB  . TYR B 2 106 ? 32.435  44.476  74.764  1.00 88.24  ? 106 TYR B CB  1 
ATOM   2968 C CG  . TYR B 2 106 ? 32.314  45.934  75.153  1.00 89.35  ? 106 TYR B CG  1 
ATOM   2969 C CD1 . TYR B 2 106 ? 31.118  46.442  75.643  1.00 88.49  ? 106 TYR B CD1 1 
ATOM   2970 C CD2 . TYR B 2 106 ? 33.390  46.805  75.017  1.00 87.72  ? 106 TYR B CD2 1 
ATOM   2971 C CE1 . TYR B 2 106 ? 30.997  47.770  75.988  1.00 88.59  ? 106 TYR B CE1 1 
ATOM   2972 C CE2 . TYR B 2 106 ? 33.277  48.135  75.360  1.00 85.13  ? 106 TYR B CE2 1 
ATOM   2973 C CZ  . TYR B 2 106 ? 32.076  48.613  75.847  1.00 93.83  ? 106 TYR B CZ  1 
ATOM   2974 O OH  . TYR B 2 106 ? 31.951  49.940  76.202  1.00 105.49 ? 106 TYR B OH  1 
ATOM   2975 N N   . GLU B 2 107 ? 33.702  44.553  71.935  1.00 94.41  ? 107 GLU B N   1 
ATOM   2976 C CA  . GLU B 2 107 ? 34.450  45.207  70.872  1.00 103.18 ? 107 GLU B CA  1 
ATOM   2977 C C   . GLU B 2 107 ? 33.668  45.190  69.561  1.00 104.20 ? 107 GLU B C   1 
ATOM   2978 O O   . GLU B 2 107 ? 33.822  46.076  68.721  1.00 111.66 ? 107 GLU B O   1 
ATOM   2979 C CB  . GLU B 2 107 ? 35.807  44.529  70.684  1.00 103.19 ? 107 GLU B CB  1 
ATOM   2980 C CG  . GLU B 2 107 ? 36.900  45.473  70.235  1.00 113.46 ? 107 GLU B CG  1 
ATOM   2981 C CD  . GLU B 2 107 ? 37.120  46.600  71.225  1.00 124.44 ? 107 GLU B CD  1 
ATOM   2982 O OE1 . GLU B 2 107 ? 37.583  47.685  70.809  1.00 125.42 ? 107 GLU B OE1 1 
ATOM   2983 O OE2 . GLU B 2 107 ? 36.822  46.402  72.424  1.00 128.89 ? 107 GLU B OE2 1 
ATOM   2984 N N   . ASP B 2 108 ? 32.832  44.174  69.384  1.00 89.90  ? 108 ASP B N   1 
ATOM   2985 C CA  . ASP B 2 108 ? 31.965  44.109  68.216  1.00 80.47  ? 108 ASP B CA  1 
ATOM   2986 C C   . ASP B 2 108 ? 30.919  45.207  68.292  1.00 75.14  ? 108 ASP B C   1 
ATOM   2987 O O   . ASP B 2 108 ? 30.729  45.968  67.347  1.00 76.68  ? 108 ASP B O   1 
ATOM   2988 C CB  . ASP B 2 108 ? 31.274  42.747  68.119  1.00 78.80  ? 108 ASP B CB  1 
ATOM   2989 C CG  . ASP B 2 108 ? 32.185  41.667  67.579  1.00 91.88  ? 108 ASP B CG  1 
ATOM   2990 O OD1 . ASP B 2 108 ? 33.351  41.972  67.254  1.00 100.32 ? 108 ASP B OD1 1 
ATOM   2991 O OD2 . ASP B 2 108 ? 31.731  40.510  67.478  1.00 91.74  ? 108 ASP B OD2 1 
ATOM   2992 N N   . LEU B 2 109 ? 30.236  45.281  69.426  1.00 69.93  ? 109 LEU B N   1 
ATOM   2993 C CA  . LEU B 2 109 ? 29.181  46.265  69.607  1.00 74.19  ? 109 LEU B CA  1 
ATOM   2994 C C   . LEU B 2 109 ? 29.710  47.679  69.410  1.00 81.24  ? 109 LEU B C   1 
ATOM   2995 O O   . LEU B 2 109 ? 28.961  48.573  69.032  1.00 90.33  ? 109 LEU B O   1 
ATOM   2996 C CB  . LEU B 2 109 ? 28.548  46.135  70.994  1.00 72.93  ? 109 LEU B CB  1 
ATOM   2997 C CG  . LEU B 2 109 ? 27.583  44.971  71.246  1.00 65.66  ? 109 LEU B CG  1 
ATOM   2998 C CD1 . LEU B 2 109 ? 26.234  45.243  70.615  1.00 59.94  ? 109 LEU B CD1 1 
ATOM   2999 C CD2 . LEU B 2 109 ? 28.159  43.672  70.730  1.00 63.72  ? 109 LEU B CD2 1 
ATOM   3000 N N   . LYS B 2 110 ? 30.998  47.882  69.668  1.00 78.32  ? 110 LYS B N   1 
ATOM   3001 C CA  . LYS B 2 110 ? 31.583  49.213  69.547  1.00 82.64  ? 110 LYS B CA  1 
ATOM   3002 C C   . LYS B 2 110 ? 31.746  49.607  68.083  1.00 82.50  ? 110 LYS B C   1 
ATOM   3003 O O   . LYS B 2 110 ? 31.629  50.779  67.721  1.00 75.43  ? 110 LYS B O   1 
ATOM   3004 C CB  . LYS B 2 110 ? 32.924  49.289  70.281  1.00 79.57  ? 110 LYS B CB  1 
ATOM   3005 C CG  . LYS B 2 110 ? 33.479  50.701  70.387  1.00 89.36  ? 110 LYS B CG  1 
ATOM   3006 C CD  . LYS B 2 110 ? 34.508  50.830  71.505  1.00 103.18 ? 110 LYS B CD  1 
ATOM   3007 C CE  . LYS B 2 110 ? 35.840  50.200  71.126  1.00 113.14 ? 110 LYS B CE  1 
ATOM   3008 N NZ  . LYS B 2 110 ? 36.872  50.412  72.181  1.00 113.82 ? 110 LYS B NZ  1 
ATOM   3009 N N   . MET B 2 111 ? 32.009  48.613  67.243  1.00 81.21  ? 111 MET B N   1 
ATOM   3010 C CA  . MET B 2 111 ? 32.155  48.835  65.811  1.00 83.91  ? 111 MET B CA  1 
ATOM   3011 C C   . MET B 2 111 ? 30.812  49.051  65.138  1.00 81.70  ? 111 MET B C   1 
ATOM   3012 O O   . MET B 2 111 ? 30.605  50.044  64.449  1.00 84.34  ? 111 MET B O   1 
ATOM   3013 C CB  . MET B 2 111 ? 32.838  47.641  65.155  1.00 82.09  ? 111 MET B CB  1 
ATOM   3014 C CG  . MET B 2 111 ? 34.208  47.332  65.693  1.00 78.70  ? 111 MET B CG  1 
ATOM   3015 S SD  . MET B 2 111 ? 34.997  46.123  64.632  1.00 123.02 ? 111 MET B SD  1 
ATOM   3016 C CE  . MET B 2 111 ? 35.070  47.038  63.093  1.00 115.92 ? 111 MET B CE  1 
ATOM   3017 N N   . TYR B 2 112 ? 29.905  48.101  65.323  1.00 79.89  ? 112 TYR B N   1 
ATOM   3018 C CA  . TYR B 2 112 ? 28.593  48.205  64.715  1.00 76.40  ? 112 TYR B CA  1 
ATOM   3019 C C   . TYR B 2 112 ? 27.931  49.472  65.210  1.00 72.83  ? 112 TYR B C   1 
ATOM   3020 O O   . TYR B 2 112 ? 27.045  50.022  64.558  1.00 73.72  ? 112 TYR B O   1 
ATOM   3021 C CB  . TYR B 2 112 ? 27.739  46.979  65.036  1.00 75.26  ? 112 TYR B CB  1 
ATOM   3022 C CG  . TYR B 2 112 ? 28.003  45.805  64.125  1.00 71.24  ? 112 TYR B CG  1 
ATOM   3023 C CD1 . TYR B 2 112 ? 27.544  45.807  62.816  1.00 79.23  ? 112 TYR B CD1 1 
ATOM   3024 C CD2 . TYR B 2 112 ? 28.712  44.698  64.572  1.00 67.31  ? 112 TYR B CD2 1 
ATOM   3025 C CE1 . TYR B 2 112 ? 27.781  44.731  61.968  1.00 90.91  ? 112 TYR B CE1 1 
ATOM   3026 C CE2 . TYR B 2 112 ? 28.955  43.623  63.737  1.00 83.09  ? 112 TYR B CE2 1 
ATOM   3027 C CZ  . TYR B 2 112 ? 28.487  43.644  62.435  1.00 91.77  ? 112 TYR B CZ  1 
ATOM   3028 O OH  . TYR B 2 112 ? 28.723  42.579  61.595  1.00 90.38  ? 112 TYR B OH  1 
ATOM   3029 N N   . GLN B 2 113 ? 28.391  49.946  66.359  1.00 69.52  ? 113 GLN B N   1 
ATOM   3030 C CA  . GLN B 2 113 ? 27.825  51.135  66.971  1.00 72.00  ? 113 GLN B CA  1 
ATOM   3031 C C   . GLN B 2 113 ? 28.135  52.388  66.165  1.00 71.22  ? 113 GLN B C   1 
ATOM   3032 O O   . GLN B 2 113 ? 27.233  53.162  65.855  1.00 68.96  ? 113 GLN B O   1 
ATOM   3033 C CB  . GLN B 2 113 ? 28.351  51.294  68.388  1.00 79.76  ? 113 GLN B CB  1 
ATOM   3034 C CG  . GLN B 2 113 ? 27.607  52.328  69.211  1.00 87.67  ? 113 GLN B CG  1 
ATOM   3035 C CD  . GLN B 2 113 ? 28.401  52.755  70.430  1.00 99.87  ? 113 GLN B CD  1 
ATOM   3036 O OE1 . GLN B 2 113 ? 27.858  52.870  71.529  1.00 101.63 ? 113 GLN B OE1 1 
ATOM   3037 N NE2 . GLN B 2 113 ? 29.700  52.986  70.242  1.00 100.73 ? 113 GLN B NE2 1 
ATOM   3038 N N   . VAL B 2 114 ? 29.408  52.592  65.833  1.00 75.83  ? 114 VAL B N   1 
ATOM   3039 C CA  . VAL B 2 114 ? 29.807  53.763  65.052  1.00 85.44  ? 114 VAL B CA  1 
ATOM   3040 C C   . VAL B 2 114 ? 29.205  53.703  63.653  1.00 85.76  ? 114 VAL B C   1 
ATOM   3041 O O   . VAL B 2 114 ? 28.882  54.731  63.059  1.00 83.96  ? 114 VAL B O   1 
ATOM   3042 C CB  . VAL B 2 114 ? 31.339  53.885  64.917  1.00 81.12  ? 114 VAL B CB  1 
ATOM   3043 C CG1 . VAL B 2 114 ? 32.020  53.520  66.219  1.00 75.38  ? 114 VAL B CG1 1 
ATOM   3044 C CG2 . VAL B 2 114 ? 31.844  53.005  63.788  1.00 86.01  ? 114 VAL B CG2 1 
ATOM   3045 N N   . GLU B 2 115 ? 29.058  52.491  63.133  1.00 76.15  ? 115 GLU B N   1 
ATOM   3046 C CA  . GLU B 2 115 ? 28.519  52.312  61.799  1.00 74.23  ? 115 GLU B CA  1 
ATOM   3047 C C   . GLU B 2 115 ? 27.069  52.752  61.751  1.00 72.99  ? 115 GLU B C   1 
ATOM   3048 O O   . GLU B 2 115 ? 26.716  53.643  60.991  1.00 87.59  ? 115 GLU B O   1 
ATOM   3049 C CB  . GLU B 2 115 ? 28.652  50.863  61.347  1.00 78.95  ? 115 GLU B CB  1 
ATOM   3050 C CG  . GLU B 2 115 ? 30.082  50.383  61.295  1.00 90.60  ? 115 GLU B CG  1 
ATOM   3051 C CD  . GLU B 2 115 ? 30.930  51.206  60.358  1.00 98.95  ? 115 GLU B CD  1 
ATOM   3052 O OE1 . GLU B 2 115 ? 32.106  51.465  60.695  1.00 108.10 ? 115 GLU B OE1 1 
ATOM   3053 O OE2 . GLU B 2 115 ? 30.420  51.599  59.288  1.00 96.34  ? 115 GLU B OE2 1 
ATOM   3054 N N   . PHE B 2 116 ? 26.223  52.136  62.562  1.00 64.20  ? 116 PHE B N   1 
ATOM   3055 C CA  . PHE B 2 116 ? 24.820  52.528  62.569  1.00 71.55  ? 116 PHE B CA  1 
ATOM   3056 C C   . PHE B 2 116 ? 24.682  54.012  62.918  1.00 76.91  ? 116 PHE B C   1 
ATOM   3057 O O   . PHE B 2 116 ? 23.825  54.707  62.380  1.00 83.71  ? 116 PHE B O   1 
ATOM   3058 C CB  . PHE B 2 116 ? 23.999  51.647  63.518  1.00 64.49  ? 116 PHE B CB  1 
ATOM   3059 C CG  . PHE B 2 116 ? 23.871  50.227  63.053  1.00 65.20  ? 116 PHE B CG  1 
ATOM   3060 C CD1 . PHE B 2 116 ? 23.143  49.921  61.914  1.00 67.86  ? 116 PHE B CD1 1 
ATOM   3061 C CD2 . PHE B 2 116 ? 24.484  49.196  63.741  1.00 69.71  ? 116 PHE B CD2 1 
ATOM   3062 C CE1 . PHE B 2 116 ? 23.029  48.612  61.468  1.00 65.94  ? 116 PHE B CE1 1 
ATOM   3063 C CE2 . PHE B 2 116 ? 24.370  47.882  63.302  1.00 72.37  ? 116 PHE B CE2 1 
ATOM   3064 C CZ  . PHE B 2 116 ? 23.642  47.592  62.163  1.00 69.56  ? 116 PHE B CZ  1 
ATOM   3065 N N   . LYS B 2 117 ? 25.538  54.490  63.814  1.00 68.06  ? 117 LYS B N   1 
ATOM   3066 C CA  . LYS B 2 117 ? 25.502  55.878  64.249  1.00 75.62  ? 117 LYS B CA  1 
ATOM   3067 C C   . LYS B 2 117 ? 25.725  56.785  63.046  1.00 74.97  ? 117 LYS B C   1 
ATOM   3068 O O   . LYS B 2 117 ? 24.977  57.737  62.797  1.00 63.98  ? 117 LYS B O   1 
ATOM   3069 C CB  . LYS B 2 117 ? 26.599  56.107  65.288  1.00 87.83  ? 117 LYS B CB  1 
ATOM   3070 C CG  . LYS B 2 117 ? 26.326  57.230  66.275  1.00 97.13  ? 117 LYS B CG  1 
ATOM   3071 C CD  . LYS B 2 117 ? 27.371  57.232  67.381  1.00 107.08 ? 117 LYS B CD  1 
ATOM   3072 C CE  . LYS B 2 117 ? 28.712  57.749  66.879  1.00 114.22 ? 117 LYS B CE  1 
ATOM   3073 N NZ  . LYS B 2 117 ? 28.661  59.210  66.577  1.00 114.79 ? 117 LYS B NZ  1 
ATOM   3074 N N   . THR B 2 118 ? 26.776  56.464  62.306  1.00 77.19  ? 118 THR B N   1 
ATOM   3075 C CA  . THR B 2 118 ? 27.150  57.197  61.109  1.00 82.18  ? 118 THR B CA  1 
ATOM   3076 C C   . THR B 2 118 ? 26.045  57.157  60.065  1.00 81.91  ? 118 THR B C   1 
ATOM   3077 O O   . THR B 2 118 ? 25.599  58.191  59.575  1.00 81.17  ? 118 THR B O   1 
ATOM   3078 C CB  . THR B 2 118 ? 28.427  56.600  60.509  1.00 86.48  ? 118 THR B CB  1 
ATOM   3079 O OG1 . THR B 2 118 ? 29.531  56.892  61.371  1.00 94.68  ? 118 THR B OG1 1 
ATOM   3080 C CG2 . THR B 2 118 ? 28.700  57.165  59.129  1.00 89.36  ? 118 THR B CG2 1 
ATOM   3081 N N   . MET B 2 119 ? 25.613  55.950  59.725  1.00 81.53  ? 119 MET B N   1 
ATOM   3082 C CA  . MET B 2 119 ? 24.551  55.760  58.747  1.00 83.87  ? 119 MET B CA  1 
ATOM   3083 C C   . MET B 2 119 ? 23.267  56.507  59.114  1.00 90.01  ? 119 MET B C   1 
ATOM   3084 O O   . MET B 2 119 ? 22.635  57.119  58.258  1.00 88.73  ? 119 MET B O   1 
ATOM   3085 C CB  . MET B 2 119 ? 24.279  54.269  58.544  1.00 80.07  ? 119 MET B CB  1 
ATOM   3086 C CG  . MET B 2 119 ? 25.503  53.504  58.066  1.00 88.85  ? 119 MET B CG  1 
ATOM   3087 S SD  . MET B 2 119 ? 25.104  52.077  57.040  1.00 180.21 ? 119 MET B SD  1 
ATOM   3088 C CE  . MET B 2 119 ? 23.932  51.241  58.098  1.00 70.07  ? 119 MET B CE  1 
ATOM   3089 N N   . ASN B 2 120 ? 22.883  56.464  60.385  1.00 96.58  ? 120 ASN B N   1 
ATOM   3090 C CA  . ASN B 2 120 ? 21.717  57.219  60.833  1.00 91.57  ? 120 ASN B CA  1 
ATOM   3091 C C   . ASN B 2 120 ? 21.915  58.719  60.660  1.00 86.18  ? 120 ASN B C   1 
ATOM   3092 O O   . ASN B 2 120 ? 20.967  59.453  60.382  1.00 86.77  ? 120 ASN B O   1 
ATOM   3093 C CB  . ASN B 2 120 ? 21.373  56.914  62.290  1.00 86.17  ? 120 ASN B CB  1 
ATOM   3094 C CG  . ASN B 2 120 ? 20.038  57.506  62.699  1.00 77.89  ? 120 ASN B CG  1 
ATOM   3095 O OD1 . ASN B 2 120 ? 19.884  58.016  63.805  1.00 56.50  ? 120 ASN B OD1 1 
ATOM   3096 N ND2 . ASN B 2 120 ? 19.063  57.451  61.791  1.00 85.89  ? 120 ASN B ND2 1 
ATOM   3097 N N   . ALA B 2 121 ? 23.148  59.176  60.842  1.00 77.96  ? 121 ALA B N   1 
ATOM   3098 C CA  . ALA B 2 121 ? 23.455  60.572  60.586  1.00 82.95  ? 121 ALA B CA  1 
ATOM   3099 C C   . ALA B 2 121 ? 23.043  60.900  59.160  1.00 90.69  ? 121 ALA B C   1 
ATOM   3100 O O   . ALA B 2 121 ? 22.356  61.893  58.915  1.00 95.65  ? 121 ALA B O   1 
ATOM   3101 C CB  . ALA B 2 121 ? 24.932  60.848  60.794  1.00 85.48  ? 121 ALA B CB  1 
ATOM   3102 N N   . LYS B 2 122 ? 23.454  60.046  58.225  1.00 86.23  ? 122 LYS B N   1 
ATOM   3103 C CA  . LYS B 2 122 ? 23.165  60.242  56.811  1.00 76.61  ? 122 LYS B CA  1 
ATOM   3104 C C   . LYS B 2 122 ? 21.679  60.110  56.505  1.00 75.69  ? 122 LYS B C   1 
ATOM   3105 O O   . LYS B 2 122 ? 21.079  61.019  55.948  1.00 75.54  ? 122 LYS B O   1 
ATOM   3106 C CB  . LYS B 2 122 ? 23.971  59.258  55.963  1.00 83.16  ? 122 LYS B CB  1 
ATOM   3107 C CG  . LYS B 2 122 ? 25.420  59.671  55.740  1.00 96.07  ? 122 LYS B CG  1 
ATOM   3108 C CD  . LYS B 2 122 ? 25.507  60.896  54.835  1.00 111.57 ? 122 LYS B CD  1 
ATOM   3109 C CE  . LYS B 2 122 ? 26.932  61.147  54.346  1.00 119.60 ? 122 LYS B CE  1 
ATOM   3110 N NZ  . LYS B 2 122 ? 27.826  61.696  55.406  1.00 119.04 ? 122 LYS B NZ  1 
ATOM   3111 N N   . LEU B 2 123 ? 21.085  58.982  56.880  1.00 82.81  ? 123 LEU B N   1 
ATOM   3112 C CA  . LEU B 2 123 ? 19.665  58.740  56.626  1.00 84.84  ? 123 LEU B CA  1 
ATOM   3113 C C   . LEU B 2 123 ? 18.777  59.907  57.044  1.00 88.26  ? 123 LEU B C   1 
ATOM   3114 O O   . LEU B 2 123 ? 17.709  60.115  56.473  1.00 86.21  ? 123 LEU B O   1 
ATOM   3115 C CB  . LEU B 2 123 ? 19.196  57.450  57.311  1.00 81.89  ? 123 LEU B CB  1 
ATOM   3116 C CG  . LEU B 2 123 ? 19.177  56.198  56.425  1.00 86.89  ? 123 LEU B CG  1 
ATOM   3117 C CD1 . LEU B 2 123 ? 18.507  56.518  55.099  1.00 92.68  ? 123 LEU B CD1 1 
ATOM   3118 C CD2 . LEU B 2 123 ? 20.573  55.657  56.190  1.00 89.58  ? 123 LEU B CD2 1 
ATOM   3119 N N   . LEU B 2 124 ? 19.224  60.664  58.042  1.00 91.96  ? 124 LEU B N   1 
ATOM   3120 C CA  . LEU B 2 124 ? 18.471  61.812  58.537  1.00 84.43  ? 124 LEU B CA  1 
ATOM   3121 C C   . LEU B 2 124 ? 18.559  62.993  57.575  1.00 85.26  ? 124 LEU B C   1 
ATOM   3122 O O   . LEU B 2 124 ? 17.608  63.760  57.432  1.00 93.26  ? 124 LEU B O   1 
ATOM   3123 C CB  . LEU B 2 124 ? 18.968  62.231  59.925  1.00 78.07  ? 124 LEU B CB  1 
ATOM   3124 C CG  . LEU B 2 124 ? 18.544  61.405  61.149  1.00 78.83  ? 124 LEU B CG  1 
ATOM   3125 C CD1 . LEU B 2 124 ? 19.363  61.796  62.365  1.00 77.13  ? 124 LEU B CD1 1 
ATOM   3126 C CD2 . LEU B 2 124 ? 17.058  61.560  61.444  1.00 74.22  ? 124 LEU B CD2 1 
ATOM   3127 N N   . MET B 2 125 ? 19.706  63.135  56.920  1.00 74.76  ? 125 MET B N   1 
ATOM   3128 C CA  . MET B 2 125 ? 19.928  64.237  55.990  1.00 78.36  ? 125 MET B CA  1 
ATOM   3129 C C   . MET B 2 125 ? 19.294  63.988  54.616  1.00 96.59  ? 125 MET B C   1 
ATOM   3130 O O   . MET B 2 125 ? 18.830  64.925  53.966  1.00 106.00 ? 125 MET B O   1 
ATOM   3131 C CB  . MET B 2 125 ? 21.426  64.521  55.837  1.00 71.96  ? 125 MET B CB  1 
ATOM   3132 C CG  . MET B 2 125 ? 22.070  65.181  57.046  1.00 67.75  ? 125 MET B CG  1 
ATOM   3133 S SD  . MET B 2 125 ? 21.167  66.641  57.616  1.00 75.60  ? 125 MET B SD  1 
ATOM   3134 C CE  . MET B 2 125 ? 21.449  67.773  56.291  1.00 71.01  ? 125 MET B CE  1 
ATOM   3135 N N   . ASP B 2 126 ? 19.283  62.729  54.182  1.00 100.19 ? 126 ASP B N   1 
ATOM   3136 C CA  . ASP B 2 126 ? 18.693  62.341  52.899  1.00 102.80 ? 126 ASP B CA  1 
ATOM   3137 C C   . ASP B 2 126 ? 17.316  62.965  52.695  1.00 102.29 ? 126 ASP B C   1 
ATOM   3138 O O   . ASP B 2 126 ? 16.381  62.665  53.436  1.00 103.08 ? 126 ASP B O   1 
ATOM   3139 C CB  . ASP B 2 126 ? 18.586  60.815  52.808  1.00 107.93 ? 126 ASP B CB  1 
ATOM   3140 C CG  . ASP B 2 126 ? 18.172  60.335  51.426  1.00 115.17 ? 126 ASP B CG  1 
ATOM   3141 O OD1 . ASP B 2 126 ? 17.968  59.111  51.260  1.00 122.90 ? 126 ASP B OD1 1 
ATOM   3142 O OD2 . ASP B 2 126 ? 18.057  61.175  50.504  1.00 107.09 ? 126 ASP B OD2 1 
ATOM   3143 N N   . PRO B 2 127 ? 17.189  63.841  51.685  1.00 101.05 ? 127 PRO B N   1 
ATOM   3144 C CA  . PRO B 2 127 ? 15.922  64.519  51.378  1.00 101.71 ? 127 PRO B CA  1 
ATOM   3145 C C   . PRO B 2 127 ? 14.864  63.549  50.855  1.00 108.36 ? 127 PRO B C   1 
ATOM   3146 O O   . PRO B 2 127 ? 13.674  63.775  51.056  1.00 109.83 ? 127 PRO B O   1 
ATOM   3147 C CB  . PRO B 2 127 ? 16.316  65.524  50.290  1.00 102.15 ? 127 PRO B CB  1 
ATOM   3148 C CG  . PRO B 2 127 ? 17.792  65.689  50.432  1.00 105.45 ? 127 PRO B CG  1 
ATOM   3149 C CD  . PRO B 2 127 ? 18.292  64.346  50.855  1.00 102.61 ? 127 PRO B CD  1 
ATOM   3150 N N   . LYS B 2 128 ? 15.302  62.485  50.188  1.00 105.96 ? 128 LYS B N   1 
ATOM   3151 C CA  . LYS B 2 128 ? 14.411  61.410  49.773  1.00 101.06 ? 128 LYS B CA  1 
ATOM   3152 C C   . LYS B 2 128 ? 14.146  60.528  50.990  1.00 104.72 ? 128 LYS B C   1 
ATOM   3153 O O   . LYS B 2 128 ? 14.753  59.471  51.143  1.00 114.51 ? 128 LYS B O   1 
ATOM   3154 C CB  . LYS B 2 128 ? 15.067  60.594  48.654  1.00 114.48 ? 128 LYS B CB  1 
ATOM   3155 C CG  . LYS B 2 128 ? 14.157  59.570  47.977  1.00 130.30 ? 128 LYS B CG  1 
ATOM   3156 C CD  . LYS B 2 128 ? 13.441  60.144  46.755  1.00 136.27 ? 128 LYS B CD  1 
ATOM   3157 C CE  . LYS B 2 128 ? 12.122  59.419  46.497  1.00 143.58 ? 128 LYS B CE  1 
ATOM   3158 N NZ  . LYS B 2 128 ? 12.222  57.952  46.761  1.00 147.46 ? 128 LYS B NZ  1 
ATOM   3159 N N   . ARG B 2 129 ? 13.248  60.975  51.865  1.00 111.35 ? 129 ARG B N   1 
ATOM   3160 C CA  . ARG B 2 129 ? 13.014  60.308  53.148  1.00 105.74 ? 129 ARG B CA  1 
ATOM   3161 C C   . ARG B 2 129 ? 12.517  58.879  52.985  1.00 99.81  ? 129 ARG B C   1 
ATOM   3162 O O   . ARG B 2 129 ? 11.325  58.614  53.123  1.00 98.62  ? 129 ARG B O   1 
ATOM   3163 C CB  . ARG B 2 129 ? 12.001  61.091  53.984  1.00 108.72 ? 129 ARG B CB  1 
ATOM   3164 C CG  . ARG B 2 129 ? 12.387  62.527  54.296  1.00 110.17 ? 129 ARG B CG  1 
ATOM   3165 C CD  . ARG B 2 129 ? 11.619  63.033  55.510  1.00 110.87 ? 129 ARG B CD  1 
ATOM   3166 N NE  . ARG B 2 129 ? 10.214  62.636  55.462  1.00 114.04 ? 129 ARG B NE  1 
ATOM   3167 C CZ  . ARG B 2 129 ? 9.393   62.660  56.507  1.00 112.68 ? 129 ARG B CZ  1 
ATOM   3168 N NH1 . ARG B 2 129 ? 9.839   63.059  57.687  1.00 106.06 ? 129 ARG B NH1 1 
ATOM   3169 N NH2 . ARG B 2 129 ? 8.130   62.279  56.375  1.00 114.61 ? 129 ARG B NH2 1 
ATOM   3170 N N   . GLN B 2 130 ? 13.433  57.955  52.727  1.00 98.46  ? 130 GLN B N   1 
ATOM   3171 C CA  . GLN B 2 130 ? 13.048  56.601  52.352  1.00 100.43 ? 130 GLN B CA  1 
ATOM   3172 C C   . GLN B 2 130 ? 12.877  55.690  53.563  1.00 102.10 ? 130 GLN B C   1 
ATOM   3173 O O   . GLN B 2 130 ? 11.770  55.251  53.875  1.00 101.21 ? 130 GLN B O   1 
ATOM   3174 C CB  . GLN B 2 130 ? 14.074  56.017  51.385  1.00 96.63  ? 130 GLN B CB  1 
ATOM   3175 C CG  . GLN B 2 130 ? 13.454  55.252  50.234  1.00 101.46 ? 130 GLN B CG  1 
ATOM   3176 C CD  . GLN B 2 130 ? 14.353  55.225  49.018  1.00 109.74 ? 130 GLN B CD  1 
ATOM   3177 O OE1 . GLN B 2 130 ? 15.398  54.574  49.021  1.00 115.99 ? 130 GLN B OE1 1 
ATOM   3178 N NE2 . GLN B 2 130 ? 13.953  55.938  47.966  1.00 106.62 ? 130 GLN B NE2 1 
ATOM   3179 N N   . ILE B 2 131 ? 13.982  55.403  54.236  1.00 104.54 ? 131 ILE B N   1 
ATOM   3180 C CA  . ILE B 2 131 ? 13.951  54.598  55.442  1.00 108.05 ? 131 ILE B CA  1 
ATOM   3181 C C   . ILE B 2 131 ? 14.686  55.324  56.557  1.00 108.38 ? 131 ILE B C   1 
ATOM   3182 O O   . ILE B 2 131 ? 15.615  56.093  56.306  1.00 109.72 ? 131 ILE B O   1 
ATOM   3183 C CB  . ILE B 2 131 ? 14.597  53.215  55.216  1.00 105.92 ? 131 ILE B CB  1 
ATOM   3184 C CG1 . ILE B 2 131 ? 14.479  52.347  56.475  1.00 103.56 ? 131 ILE B CG1 1 
ATOM   3185 C CG2 . ILE B 2 131 ? 16.050  53.372  54.802  1.00 103.64 ? 131 ILE B CG2 1 
ATOM   3186 C CD1 . ILE B 2 131 ? 13.059  52.130  56.942  1.00 107.70 ? 131 ILE B CD1 1 
ATOM   3187 N N   . PHE B 2 132 ? 14.254  55.093  57.789  1.00 105.02 ? 132 PHE B N   1 
ATOM   3188 C CA  . PHE B 2 132 ? 14.939  55.657  58.940  1.00 102.13 ? 132 PHE B CA  1 
ATOM   3189 C C   . PHE B 2 132 ? 15.384  54.556  59.885  1.00 98.17  ? 132 PHE B C   1 
ATOM   3190 O O   . PHE B 2 132 ? 14.703  53.540  60.033  1.00 97.47  ? 132 PHE B O   1 
ATOM   3191 C CB  . PHE B 2 132 ? 14.045  56.654  59.671  1.00 95.88  ? 132 PHE B CB  1 
ATOM   3192 C CG  . PHE B 2 132 ? 13.968  57.988  59.006  1.00 90.64  ? 132 PHE B CG  1 
ATOM   3193 C CD1 . PHE B 2 132 ? 15.117  58.716  58.764  1.00 89.70  ? 132 PHE B CD1 1 
ATOM   3194 C CD2 . PHE B 2 132 ? 12.751  58.523  58.633  1.00 89.07  ? 132 PHE B CD2 1 
ATOM   3195 C CE1 . PHE B 2 132 ? 15.054  59.948  58.153  1.00 92.26  ? 132 PHE B CE1 1 
ATOM   3196 C CE2 . PHE B 2 132 ? 12.683  59.756  58.025  1.00 90.21  ? 132 PHE B CE2 1 
ATOM   3197 C CZ  . PHE B 2 132 ? 13.836  60.471  57.784  1.00 92.31  ? 132 PHE B CZ  1 
ATOM   3198 N N   . LEU B 2 133 ? 16.530  54.767  60.521  1.00 92.53  ? 133 LEU B N   1 
ATOM   3199 C CA  . LEU B 2 133 ? 17.050  53.814  61.487  1.00 82.64  ? 133 LEU B CA  1 
ATOM   3200 C C   . LEU B 2 133 ? 16.275  53.922  62.794  1.00 89.53  ? 133 LEU B C   1 
ATOM   3201 O O   . LEU B 2 133 ? 16.307  54.953  63.467  1.00 92.71  ? 133 LEU B O   1 
ATOM   3202 C CB  . LEU B 2 133 ? 18.540  54.052  61.722  1.00 74.98  ? 133 LEU B CB  1 
ATOM   3203 C CG  . LEU B 2 133 ? 19.329  52.828  62.186  1.00 84.42  ? 133 LEU B CG  1 
ATOM   3204 C CD1 . LEU B 2 133 ? 18.778  52.293  63.499  1.00 92.04  ? 133 LEU B CD1 1 
ATOM   3205 C CD2 . LEU B 2 133 ? 19.300  51.748  61.127  1.00 64.47  ? 133 LEU B CD2 1 
ATOM   3206 N N   . ASP B 2 134 ? 15.571  52.850  63.138  1.00 96.31  ? 134 ASP B N   1 
ATOM   3207 C CA  . ASP B 2 134 ? 14.758  52.814  64.344  1.00 99.57  ? 134 ASP B CA  1 
ATOM   3208 C C   . ASP B 2 134 ? 15.628  53.129  65.553  1.00 91.51  ? 134 ASP B C   1 
ATOM   3209 O O   . ASP B 2 134 ? 16.569  52.396  65.855  1.00 84.97  ? 134 ASP B O   1 
ATOM   3210 C CB  . ASP B 2 134 ? 14.104  51.439  64.502  1.00 107.17 ? 134 ASP B CB  1 
ATOM   3211 C CG  . ASP B 2 134 ? 12.958  51.447  65.493  1.00 119.02 ? 134 ASP B CG  1 
ATOM   3212 O OD1 . ASP B 2 134 ? 12.445  50.359  65.826  1.00 128.77 ? 134 ASP B OD1 1 
ATOM   3213 O OD2 . ASP B 2 134 ? 12.568  52.543  65.940  1.00 119.96 ? 134 ASP B OD2 1 
ATOM   3214 N N   . GLN B 2 135 ? 15.314  54.229  66.232  1.00 87.42  ? 135 GLN B N   1 
ATOM   3215 C CA  . GLN B 2 135 ? 16.087  54.671  67.384  1.00 78.82  ? 135 GLN B CA  1 
ATOM   3216 C C   . GLN B 2 135 ? 16.183  53.553  68.400  1.00 81.70  ? 135 GLN B C   1 
ATOM   3217 O O   . GLN B 2 135 ? 17.223  53.360  69.023  1.00 81.67  ? 135 GLN B O   1 
ATOM   3218 C CB  . GLN B 2 135 ? 15.448  55.904  68.026  1.00 69.65  ? 135 GLN B CB  1 
ATOM   3219 C CG  . GLN B 2 135 ? 16.381  56.696  68.937  1.00 93.63  ? 135 GLN B CG  1 
ATOM   3220 C CD  . GLN B 2 135 ? 16.172  56.420  70.425  1.00 90.31  ? 135 GLN B CD  1 
ATOM   3221 O OE1 . GLN B 2 135 ? 16.549  57.230  71.269  1.00 83.17  ? 135 GLN B OE1 1 
ATOM   3222 N NE2 . GLN B 2 135 ? 15.570  55.284  70.748  1.00 70.87  ? 135 GLN B NE2 1 
ATOM   3223 N N   . ASN B 2 136 ? 15.092  52.813  68.556  1.00 86.73  ? 136 ASN B N   1 
ATOM   3224 C CA  . ASN B 2 136 ? 15.026  51.751  69.549  1.00 94.94  ? 136 ASN B CA  1 
ATOM   3225 C C   . ASN B 2 136 ? 16.192  50.774  69.437  1.00 89.24  ? 136 ASN B C   1 
ATOM   3226 O O   . ASN B 2 136 ? 16.717  50.303  70.449  1.00 79.58  ? 136 ASN B O   1 
ATOM   3227 C CB  . ASN B 2 136 ? 13.697  51.008  69.443  1.00 108.64 ? 136 ASN B CB  1 
ATOM   3228 C CG  . ASN B 2 136 ? 13.376  50.218  70.691  1.00 117.47 ? 136 ASN B CG  1 
ATOM   3229 O OD1 . ASN B 2 136 ? 12.394  49.478  70.736  1.00 126.55 ? 136 ASN B OD1 1 
ATOM   3230 N ND2 . ASN B 2 136 ? 14.204  50.373  71.716  1.00 115.30 ? 136 ASN B ND2 1 
ATOM   3231 N N   . MET B 2 137 ? 16.598  50.486  68.203  1.00 66.89  ? 137 MET B N   1 
ATOM   3232 C CA  . MET B 2 137 ? 17.691  49.555  67.939  1.00 73.78  ? 137 MET B CA  1 
ATOM   3233 C C   . MET B 2 137 ? 19.062  50.174  68.192  1.00 77.70  ? 137 MET B C   1 
ATOM   3234 O O   . MET B 2 137 ? 20.017  49.474  68.516  1.00 82.02  ? 137 MET B O   1 
ATOM   3235 C CB  . MET B 2 137 ? 17.625  49.046  66.500  1.00 76.73  ? 137 MET B CB  1 
ATOM   3236 C CG  . MET B 2 137 ? 18.818  48.185  66.109  1.00 73.79  ? 137 MET B CG  1 
ATOM   3237 S SD  . MET B 2 137 ? 19.270  48.296  64.378  1.00 73.84  ? 137 MET B SD  1 
ATOM   3238 C CE  . MET B 2 137 ? 20.939  47.670  64.433  1.00 73.19  ? 137 MET B CE  1 
ATOM   3239 N N   . LEU B 2 138 ? 19.162  51.485  68.023  1.00 77.31  ? 138 LEU B N   1 
ATOM   3240 C CA  . LEU B 2 138 ? 20.376  52.197  68.390  1.00 79.39  ? 138 LEU B CA  1 
ATOM   3241 C C   . LEU B 2 138 ? 20.545  52.182  69.908  1.00 87.10  ? 138 LEU B C   1 
ATOM   3242 O O   . LEU B 2 138 ? 21.663  52.083  70.420  1.00 89.13  ? 138 LEU B O   1 
ATOM   3243 C CB  . LEU B 2 138 ? 20.321  53.640  67.891  1.00 81.57  ? 138 LEU B CB  1 
ATOM   3244 C CG  . LEU B 2 138 ? 20.494  53.828  66.384  1.00 80.85  ? 138 LEU B CG  1 
ATOM   3245 C CD1 . LEU B 2 138 ? 20.397  55.299  66.021  1.00 83.38  ? 138 LEU B CD1 1 
ATOM   3246 C CD2 . LEU B 2 138 ? 21.821  53.245  65.945  1.00 73.15  ? 138 LEU B CD2 1 
ATOM   3247 N N   . ALA B 2 139 ? 19.425  52.265  70.621  1.00 85.75  ? 139 ALA B N   1 
ATOM   3248 C CA  . ALA B 2 139 ? 19.437  52.307  72.077  1.00 80.30  ? 139 ALA B CA  1 
ATOM   3249 C C   . ALA B 2 139 ? 19.803  50.965  72.699  1.00 80.04  ? 139 ALA B C   1 
ATOM   3250 O O   . ALA B 2 139 ? 20.585  50.925  73.643  1.00 80.83  ? 139 ALA B O   1 
ATOM   3251 C CB  . ALA B 2 139 ? 18.094  52.789  72.607  1.00 73.08  ? 139 ALA B CB  1 
ATOM   3252 N N   . VAL B 2 140 ? 19.245  49.873  72.179  1.00 76.70  ? 140 VAL B N   1 
ATOM   3253 C CA  . VAL B 2 140 ? 19.475  48.558  72.776  1.00 76.02  ? 140 VAL B CA  1 
ATOM   3254 C C   . VAL B 2 140 ? 20.908  48.086  72.571  1.00 75.03  ? 140 VAL B C   1 
ATOM   3255 O O   . VAL B 2 140 ? 21.356  47.148  73.231  1.00 72.08  ? 140 VAL B O   1 
ATOM   3256 C CB  . VAL B 2 140 ? 18.499  47.495  72.251  1.00 67.67  ? 140 VAL B CB  1 
ATOM   3257 C CG1 . VAL B 2 140 ? 17.088  47.786  72.724  1.00 68.80  ? 140 VAL B CG1 1 
ATOM   3258 C CG2 . VAL B 2 140 ? 18.552  47.446  70.742  1.00 148.05 ? 140 VAL B CG2 1 
ATOM   3259 N N   . ILE B 2 141 ? 21.626  48.738  71.661  1.00 73.91  ? 141 ILE B N   1 
ATOM   3260 C CA  . ILE B 2 141 ? 23.041  48.444  71.470  1.00 74.22  ? 141 ILE B CA  1 
ATOM   3261 C C   . ILE B 2 141 ? 23.858  49.133  72.556  1.00 82.97  ? 141 ILE B C   1 
ATOM   3262 O O   . ILE B 2 141 ? 24.938  48.678  72.926  1.00 83.21  ? 141 ILE B O   1 
ATOM   3263 C CB  . ILE B 2 141 ? 23.550  48.919  70.097  1.00 78.11  ? 141 ILE B CB  1 
ATOM   3264 C CG1 . ILE B 2 141 ? 22.704  48.333  68.967  1.00 82.53  ? 141 ILE B CG1 1 
ATOM   3265 C CG2 . ILE B 2 141 ? 25.011  48.532  69.906  1.00 70.49  ? 141 ILE B CG2 1 
ATOM   3266 C CD1 . ILE B 2 141 ? 23.234  48.663  67.585  1.00 73.51  ? 141 ILE B CD1 1 
ATOM   3267 N N   . ASP B 2 142 ? 23.332  50.241  73.063  1.00 88.05  ? 142 ASP B N   1 
ATOM   3268 C CA  . ASP B 2 142 ? 23.960  50.956  74.164  1.00 88.52  ? 142 ASP B CA  1 
ATOM   3269 C C   . ASP B 2 142 ? 23.556  50.310  75.488  1.00 88.45  ? 142 ASP B C   1 
ATOM   3270 O O   . ASP B 2 142 ? 24.399  50.031  76.336  1.00 85.99  ? 142 ASP B O   1 
ATOM   3271 C CB  . ASP B 2 142 ? 23.544  52.427  74.140  1.00 95.55  ? 142 ASP B CB  1 
ATOM   3272 C CG  . ASP B 2 142 ? 24.597  53.343  74.730  1.00 103.04 ? 142 ASP B CG  1 
ATOM   3273 O OD1 . ASP B 2 142 ? 25.761  53.284  74.278  1.00 100.99 ? 142 ASP B OD1 1 
ATOM   3274 O OD2 . ASP B 2 142 ? 24.258  54.132  75.638  1.00 108.79 ? 142 ASP B OD2 1 
ATOM   3275 N N   . GLU B 2 143 ? 22.259  50.067  75.651  1.00 87.18  ? 143 GLU B N   1 
ATOM   3276 C CA  . GLU B 2 143 ? 21.742  49.391  76.833  1.00 83.47  ? 143 GLU B CA  1 
ATOM   3277 C C   . GLU B 2 143 ? 22.448  48.058  77.067  1.00 90.63  ? 143 GLU B C   1 
ATOM   3278 O O   . GLU B 2 143 ? 22.346  47.476  78.144  1.00 101.76 ? 143 GLU B O   1 
ATOM   3279 C CB  . GLU B 2 143 ? 20.232  49.161  76.709  1.00 90.53  ? 143 GLU B CB  1 
ATOM   3280 C CG  . GLU B 2 143 ? 19.382  50.425  76.724  1.00 104.66 ? 143 GLU B CG  1 
ATOM   3281 C CD  . GLU B 2 143 ? 17.904  50.133  76.513  1.00 122.41 ? 143 GLU B CD  1 
ATOM   3282 O OE1 . GLU B 2 143 ? 17.496  48.964  76.695  1.00 136.13 ? 143 GLU B OE1 1 
ATOM   3283 O OE2 . GLU B 2 143 ? 17.151  51.067  76.161  1.00 117.50 ? 143 GLU B OE2 1 
ATOM   3284 N N   . LEU B 2 144 ? 23.161  47.571  76.058  1.00 91.11  ? 144 LEU B N   1 
ATOM   3285 C CA  . LEU B 2 144 ? 23.847  46.288  76.174  1.00 85.51  ? 144 LEU B CA  1 
ATOM   3286 C C   . LEU B 2 144 ? 25.305  46.465  76.581  1.00 86.36  ? 144 LEU B C   1 
ATOM   3287 O O   . LEU B 2 144 ? 25.859  45.643  77.310  1.00 90.29  ? 144 LEU B O   1 
ATOM   3288 C CB  . LEU B 2 144 ? 23.761  45.499  74.863  1.00 78.34  ? 144 LEU B CB  1 
ATOM   3289 C CG  . LEU B 2 144 ? 24.472  44.143  74.855  1.00 73.40  ? 144 LEU B CG  1 
ATOM   3290 C CD1 . LEU B 2 144 ? 23.915  43.215  75.932  1.00 70.60  ? 144 LEU B CD1 1 
ATOM   3291 C CD2 . LEU B 2 144 ? 24.372  43.500  73.491  1.00 69.14  ? 144 LEU B CD2 1 
ATOM   3292 N N   . MET B 2 145 ? 25.926  47.538  76.109  1.00 82.02  ? 145 MET B N   1 
ATOM   3293 C CA  . MET B 2 145 ? 27.326  47.795  76.418  1.00 85.39  ? 145 MET B CA  1 
ATOM   3294 C C   . MET B 2 145 ? 27.505  48.412  77.805  1.00 92.27  ? 145 MET B C   1 
ATOM   3295 O O   . MET B 2 145 ? 28.577  48.302  78.402  1.00 92.70  ? 145 MET B O   1 
ATOM   3296 C CB  . MET B 2 145 ? 27.953  48.699  75.360  1.00 84.70  ? 145 MET B CB  1 
ATOM   3297 C CG  . MET B 2 145 ? 27.695  48.255  73.940  1.00 84.92  ? 145 MET B CG  1 
ATOM   3298 S SD  . MET B 2 145 ? 28.309  49.448  72.746  1.00 87.82  ? 145 MET B SD  1 
ATOM   3299 C CE  . MET B 2 145 ? 30.063  49.366  73.082  1.00 76.88  ? 145 MET B CE  1 
ATOM   3300 N N   . GLN B 2 146 ? 26.467  49.072  78.312  1.00 91.43  ? 146 GLN B N   1 
ATOM   3301 C CA  . GLN B 2 146 ? 26.521  49.589  79.675  1.00 98.37  ? 146 GLN B CA  1 
ATOM   3302 C C   . GLN B 2 146 ? 26.048  48.539  80.676  1.00 99.53  ? 146 GLN B C   1 
ATOM   3303 O O   . GLN B 2 146 ? 26.030  48.784  81.882  1.00 113.81 ? 146 GLN B O   1 
ATOM   3304 C CB  . GLN B 2 146 ? 25.758  50.915  79.827  1.00 98.05  ? 146 GLN B CB  1 
ATOM   3305 C CG  . GLN B 2 146 ? 24.259  50.849  79.604  1.00 101.07 ? 146 GLN B CG  1 
ATOM   3306 C CD  . GLN B 2 146 ? 23.690  52.196  79.182  1.00 99.64  ? 146 GLN B CD  1 
ATOM   3307 O OE1 . GLN B 2 146 ? 22.487  52.345  78.959  1.00 95.47  ? 146 GLN B OE1 1 
ATOM   3308 N NE2 . GLN B 2 146 ? 24.565  53.186  79.062  1.00 99.63  ? 146 GLN B NE2 1 
ATOM   3309 N N   . ALA B 2 147 ? 25.676  47.370  80.163  1.00 84.26  ? 147 ALA B N   1 
ATOM   3310 C CA  . ALA B 2 147 ? 25.374  46.219  81.003  1.00 83.27  ? 147 ALA B CA  1 
ATOM   3311 C C   . ALA B 2 147 ? 26.603  45.330  81.075  1.00 93.01  ? 147 ALA B C   1 
ATOM   3312 O O   . ALA B 2 147 ? 26.852  44.675  82.080  1.00 100.27 ? 147 ALA B O   1 
ATOM   3313 C CB  . ALA B 2 147 ? 24.197  45.447  80.450  1.00 75.55  ? 147 ALA B CB  1 
ATOM   3314 N N   . LEU B 2 148 ? 27.371  45.313  79.994  1.00 99.37  ? 148 LEU B N   1 
ATOM   3315 C CA  . LEU B 2 148 ? 28.615  44.561  79.951  1.00 95.90  ? 148 LEU B CA  1 
ATOM   3316 C C   . LEU B 2 148 ? 29.709  45.397  80.580  1.00 92.22  ? 148 LEU B C   1 
ATOM   3317 O O   . LEU B 2 148 ? 30.771  44.892  80.924  1.00 94.22  ? 148 LEU B O   1 
ATOM   3318 C CB  . LEU B 2 148 ? 28.990  44.219  78.506  1.00 90.23  ? 148 LEU B CB  1 
ATOM   3319 C CG  . LEU B 2 148 ? 27.945  43.520  77.634  1.00 86.89  ? 148 LEU B CG  1 
ATOM   3320 C CD1 . LEU B 2 148 ? 28.495  43.287  76.237  1.00 85.93  ? 148 LEU B CD1 1 
ATOM   3321 C CD2 . LEU B 2 148 ? 27.497  42.210  78.252  1.00 85.94  ? 148 LEU B CD2 1 
ATOM   3322 N N   . ASN B 2 149 ? 29.429  46.684  80.727  1.00 93.46  ? 149 ASN B N   1 
ATOM   3323 C CA  . ASN B 2 149 ? 30.425  47.653  81.169  1.00 105.83 ? 149 ASN B CA  1 
ATOM   3324 C C   . ASN B 2 149 ? 31.675  47.675  80.298  1.00 106.07 ? 149 ASN B C   1 
ATOM   3325 O O   . ASN B 2 149 ? 31.644  48.200  79.186  1.00 113.32 ? 149 ASN B O   1 
ATOM   3326 C CB  . ASN B 2 149 ? 30.772  47.464  82.645  1.00 111.81 ? 149 ASN B CB  1 
ATOM   3327 C CG  . ASN B 2 149 ? 30.036  48.441  83.535  1.00 118.67 ? 149 ASN B CG  1 
ATOM   3328 O OD1 . ASN B 2 149 ? 30.390  49.618  83.606  1.00 113.90 ? 149 ASN B OD1 1 
ATOM   3329 N ND2 . ASN B 2 149 ? 28.996  47.965  84.205  1.00 126.92 ? 149 ASN B ND2 1 
ATOM   3330 N N   . PHE B 2 150 ? 32.770  47.119  80.803  1.00 96.92  ? 150 PHE B N   1 
ATOM   3331 C CA  . PHE B 2 150 ? 34.001  47.039  80.028  1.00 98.47  ? 150 PHE B CA  1 
ATOM   3332 C C   . PHE B 2 150 ? 34.588  48.404  79.697  1.00 104.10 ? 150 PHE B C   1 
ATOM   3333 O O   . PHE B 2 150 ? 33.932  49.252  79.093  1.00 98.88  ? 150 PHE B O   1 
ATOM   3334 C CB  . PHE B 2 150 ? 33.769  46.282  78.720  1.00 104.39 ? 150 PHE B CB  1 
ATOM   3335 C CG  . PHE B 2 150 ? 33.720  44.796  78.879  1.00 109.81 ? 150 PHE B CG  1 
ATOM   3336 C CD1 . PHE B 2 150 ? 34.843  44.096  79.287  1.00 116.19 ? 150 PHE B CD1 1 
ATOM   3337 C CD2 . PHE B 2 150 ? 32.558  44.095  78.605  1.00 109.72 ? 150 PHE B CD2 1 
ATOM   3338 C CE1 . PHE B 2 150 ? 34.807  42.728  79.432  1.00 120.61 ? 150 PHE B CE1 1 
ATOM   3339 C CE2 . PHE B 2 150 ? 32.514  42.724  78.747  1.00 115.26 ? 150 PHE B CE2 1 
ATOM   3340 C CZ  . PHE B 2 150 ? 33.641  42.038  79.161  1.00 119.81 ? 150 PHE B CZ  1 
ATOM   3341 N N   . ASN B 2 151 ? 35.838  48.606  80.086  1.00 123.03 ? 151 ASN B N   1 
ATOM   3342 C CA  . ASN B 2 151 ? 36.580  49.783  79.663  1.00 135.91 ? 151 ASN B CA  1 
ATOM   3343 C C   . ASN B 2 151 ? 37.469  49.407  78.486  1.00 137.39 ? 151 ASN B C   1 
ATOM   3344 O O   . ASN B 2 151 ? 38.185  48.409  78.542  1.00 137.77 ? 151 ASN B O   1 
ATOM   3345 C CB  . ASN B 2 151 ? 37.419  50.337  80.820  1.00 143.30 ? 151 ASN B CB  1 
ATOM   3346 C CG  . ASN B 2 151 ? 36.573  50.998  81.894  1.00 146.20 ? 151 ASN B CG  1 
ATOM   3347 O OD1 . ASN B 2 151 ? 35.364  51.169  81.731  1.00 146.18 ? 151 ASN B OD1 1 
ATOM   3348 N ND2 . ASN B 2 151 ? 37.208  51.379  82.998  1.00 148.13 ? 151 ASN B ND2 1 
ATOM   3349 N N   . SER B 2 152 ? 37.413  50.191  77.416  1.00 136.74 ? 152 SER B N   1 
ATOM   3350 C CA  . SER B 2 152 ? 38.232  49.903  76.243  1.00 139.11 ? 152 SER B CA  1 
ATOM   3351 C C   . SER B 2 152 ? 38.636  51.157  75.476  1.00 142.99 ? 152 SER B C   1 
ATOM   3352 O O   . SER B 2 152 ? 37.846  52.088  75.319  1.00 139.76 ? 152 SER B O   1 
ATOM   3353 C CB  . SER B 2 152 ? 37.519  48.916  75.310  1.00 133.95 ? 152 SER B CB  1 
ATOM   3354 O OG  . SER B 2 152 ? 36.344  49.481  74.752  1.00 128.30 ? 152 SER B OG  1 
ATOM   3355 N N   . GLU B 2 153 ? 39.879  51.176  75.009  1.00 150.78 ? 153 GLU B N   1 
ATOM   3356 C CA  . GLU B 2 153 ? 40.352  52.241  74.138  1.00 157.59 ? 153 GLU B CA  1 
ATOM   3357 C C   . GLU B 2 153 ? 40.607  51.667  72.748  1.00 162.93 ? 153 GLU B C   1 
ATOM   3358 O O   . GLU B 2 153 ? 41.295  50.654  72.603  1.00 166.63 ? 153 GLU B O   1 
ATOM   3359 C CB  . GLU B 2 153 ? 41.627  52.875  74.699  1.00 159.09 ? 153 GLU B CB  1 
ATOM   3360 N N   . THR B 2 154 ? 40.037  52.306  71.731  1.00 156.43 ? 154 THR B N   1 
ATOM   3361 C CA  . THR B 2 154 ? 40.194  51.840  70.357  1.00 147.51 ? 154 THR B CA  1 
ATOM   3362 C C   . THR B 2 154 ? 39.880  52.933  69.338  1.00 149.89 ? 154 THR B C   1 
ATOM   3363 O O   . THR B 2 154 ? 39.199  53.911  69.649  1.00 141.22 ? 154 THR B O   1 
ATOM   3364 C CB  . THR B 2 154 ? 39.309  50.610  70.075  1.00 137.20 ? 154 THR B CB  1 
ATOM   3365 N N   . VAL B 2 155 ? 40.386  52.753  68.122  1.00 159.16 ? 155 VAL B N   1 
ATOM   3366 C CA  . VAL B 2 155 ? 40.158  53.693  67.028  1.00 161.00 ? 155 VAL B CA  1 
ATOM   3367 C C   . VAL B 2 155 ? 38.749  53.522  66.453  1.00 160.31 ? 155 VAL B C   1 
ATOM   3368 O O   . VAL B 2 155 ? 38.007  52.637  66.882  1.00 159.46 ? 155 VAL B O   1 
ATOM   3369 C CB  . VAL B 2 155 ? 41.204  53.494  65.909  1.00 158.88 ? 155 VAL B CB  1 
ATOM   3370 N N   . PRO B 2 156 ? 38.369  54.377  65.487  1.00 159.26 ? 156 PRO B N   1 
ATOM   3371 C CA  . PRO B 2 156 ? 37.057  54.253  64.843  1.00 153.96 ? 156 PRO B CA  1 
ATOM   3372 C C   . PRO B 2 156 ? 36.690  52.804  64.526  1.00 147.72 ? 156 PRO B C   1 
ATOM   3373 O O   . PRO B 2 156 ? 37.191  52.250  63.547  1.00 145.76 ? 156 PRO B O   1 
ATOM   3374 C CB  . PRO B 2 156 ? 37.240  55.047  63.552  1.00 155.66 ? 156 PRO B CB  1 
ATOM   3375 C CG  . PRO B 2 156 ? 38.209  56.119  63.923  1.00 158.35 ? 156 PRO B CG  1 
ATOM   3376 C CD  . PRO B 2 156 ? 39.120  55.541  64.979  1.00 160.74 ? 156 PRO B CD  1 
ATOM   3377 N N   . SER B 2 160 ? 41.228  54.254  58.845  1.00 172.46 ? 160 SER B N   1 
ATOM   3378 C CA  . SER B 2 160 ? 41.117  54.597  57.431  1.00 172.19 ? 160 SER B CA  1 
ATOM   3379 C C   . SER B 2 160 ? 39.858  53.993  56.812  1.00 180.09 ? 160 SER B C   1 
ATOM   3380 O O   . SER B 2 160 ? 39.460  52.881  57.157  1.00 181.68 ? 160 SER B O   1 
ATOM   3381 C CB  . SER B 2 160 ? 42.361  54.134  56.664  1.00 164.73 ? 160 SER B CB  1 
ATOM   3382 O OG  . SER B 2 160 ? 43.528  54.788  57.129  1.00 159.71 ? 160 SER B OG  1 
ATOM   3383 N N   . LEU B 2 161 ? 39.238  54.739  55.900  1.00 184.85 ? 161 LEU B N   1 
ATOM   3384 C CA  . LEU B 2 161 ? 38.036  54.289  55.201  1.00 184.83 ? 161 LEU B CA  1 
ATOM   3385 C C   . LEU B 2 161 ? 37.589  55.317  54.160  1.00 179.54 ? 161 LEU B C   1 
ATOM   3386 O O   . LEU B 2 161 ? 38.346  56.221  53.805  1.00 174.36 ? 161 LEU B O   1 
ATOM   3387 C CB  . LEU B 2 161 ? 36.899  54.011  56.191  1.00 185.58 ? 161 LEU B CB  1 
ATOM   3388 N N   . GLU B 2 162 ? 36.358  55.176  53.676  1.00 179.07 ? 162 GLU B N   1 
ATOM   3389 C CA  . GLU B 2 162 ? 35.818  56.090  52.673  1.00 177.48 ? 162 GLU B CA  1 
ATOM   3390 C C   . GLU B 2 162 ? 34.364  56.452  52.971  1.00 178.58 ? 162 GLU B C   1 
ATOM   3391 O O   . GLU B 2 162 ? 33.669  55.728  53.684  1.00 179.64 ? 162 GLU B O   1 
ATOM   3392 C CB  . GLU B 2 162 ? 35.935  55.479  51.275  1.00 174.82 ? 162 GLU B CB  1 
ATOM   3393 N N   . GLU B 2 163 ? 33.907  57.572  52.416  1.00 177.93 ? 163 GLU B N   1 
ATOM   3394 C CA  . GLU B 2 163 ? 32.544  58.046  52.648  1.00 176.30 ? 163 GLU B CA  1 
ATOM   3395 C C   . GLU B 2 163 ? 31.646  57.870  51.421  1.00 173.84 ? 163 GLU B C   1 
ATOM   3396 O O   . GLU B 2 163 ? 32.099  58.019  50.284  1.00 179.00 ? 163 GLU B O   1 
ATOM   3397 C CB  . GLU B 2 163 ? 32.554  59.510  53.092  1.00 177.18 ? 163 GLU B CB  1 
ATOM   3398 C CG  . GLU B 2 163 ? 33.063  59.722  54.512  1.00 176.83 ? 163 GLU B CG  1 
ATOM   3399 C CD  . GLU B 2 163 ? 32.078  59.247  55.567  1.00 174.57 ? 163 GLU B CD  1 
ATOM   3400 O OE1 . GLU B 2 163 ? 30.877  59.576  55.459  1.00 173.94 ? 163 GLU B OE1 1 
ATOM   3401 O OE2 . GLU B 2 163 ? 32.505  58.549  56.509  1.00 173.30 ? 163 GLU B OE2 1 
ATOM   3402 N N   . PRO B 2 164 ? 30.366  57.540  51.656  1.00 161.87 ? 164 PRO B N   1 
ATOM   3403 C CA  . PRO B 2 164 ? 29.392  57.266  50.595  1.00 151.51 ? 164 PRO B CA  1 
ATOM   3404 C C   . PRO B 2 164 ? 28.434  58.428  50.354  1.00 134.57 ? 164 PRO B C   1 
ATOM   3405 O O   . PRO B 2 164 ? 28.566  59.487  50.969  1.00 127.97 ? 164 PRO B O   1 
ATOM   3406 C CB  . PRO B 2 164 ? 28.594  56.081  51.163  1.00 153.43 ? 164 PRO B CB  1 
ATOM   3407 C CG  . PRO B 2 164 ? 29.110  55.870  52.607  1.00 154.59 ? 164 PRO B CG  1 
ATOM   3408 C CD  . PRO B 2 164 ? 29.852  57.115  52.964  1.00 155.70 ? 164 PRO B CD  1 
ATOM   3409 N N   . ASP B 2 165 ? 27.476  58.219  49.457  1.00 124.65 ? 165 ASP B N   1 
ATOM   3410 C CA  . ASP B 2 165 ? 26.365  59.146  49.290  1.00 117.45 ? 165 ASP B CA  1 
ATOM   3411 C C   . ASP B 2 165 ? 25.122  58.529  49.914  1.00 114.75 ? 165 ASP B C   1 
ATOM   3412 O O   . ASP B 2 165 ? 25.211  57.514  50.598  1.00 112.88 ? 165 ASP B O   1 
ATOM   3413 C CB  . ASP B 2 165 ? 26.122  59.462  47.812  1.00 116.24 ? 165 ASP B CB  1 
ATOM   3414 C CG  . ASP B 2 165 ? 25.864  58.220  46.980  1.00 118.15 ? 165 ASP B CG  1 
ATOM   3415 O OD1 . ASP B 2 165 ? 26.762  57.358  46.905  1.00 120.18 ? 165 ASP B OD1 1 
ATOM   3416 O OD2 . ASP B 2 165 ? 24.769  58.117  46.384  1.00 117.55 ? 165 ASP B OD2 1 
ATOM   3417 N N   . PHE B 2 166 ? 23.965  59.137  49.676  1.00 117.98 ? 166 PHE B N   1 
ATOM   3418 C CA  . PHE B 2 166 ? 22.718  58.642  50.256  1.00 118.62 ? 166 PHE B CA  1 
ATOM   3419 C C   . PHE B 2 166 ? 22.321  57.262  49.724  1.00 117.08 ? 166 PHE B C   1 
ATOM   3420 O O   . PHE B 2 166 ? 22.046  56.350  50.502  1.00 111.31 ? 166 PHE B O   1 
ATOM   3421 C CB  . PHE B 2 166 ? 21.578  59.653  50.070  1.00 118.13 ? 166 PHE B CB  1 
ATOM   3422 C CG  . PHE B 2 166 ? 21.708  60.878  50.935  1.00 122.58 ? 166 PHE B CG  1 
ATOM   3423 C CD1 . PHE B 2 166 ? 21.543  62.146  50.400  1.00 120.65 ? 166 PHE B CD1 1 
ATOM   3424 C CD2 . PHE B 2 166 ? 22.008  60.761  52.289  1.00 120.54 ? 166 PHE B CD2 1 
ATOM   3425 C CE1 . PHE B 2 166 ? 21.665  63.272  51.201  1.00 117.29 ? 166 PHE B CE1 1 
ATOM   3426 C CE2 . PHE B 2 166 ? 22.134  61.887  53.092  1.00 109.68 ? 166 PHE B CE2 1 
ATOM   3427 C CZ  . PHE B 2 166 ? 21.962  63.142  52.548  1.00 108.57 ? 166 PHE B CZ  1 
ATOM   3428 N N   . TYR B 2 167 ? 22.295  57.108  48.404  1.00 120.24 ? 167 TYR B N   1 
ATOM   3429 C CA  . TYR B 2 167 ? 21.974  55.816  47.807  1.00 119.50 ? 167 TYR B CA  1 
ATOM   3430 C C   . TYR B 2 167 ? 22.984  54.748  48.227  1.00 119.61 ? 167 TYR B C   1 
ATOM   3431 O O   . TYR B 2 167 ? 22.605  53.645  48.622  1.00 113.82 ? 167 TYR B O   1 
ATOM   3432 C CB  . TYR B 2 167 ? 21.909  55.917  46.282  1.00 119.64 ? 167 TYR B CB  1 
ATOM   3433 C CG  . TYR B 2 167 ? 22.009  54.579  45.579  1.00 123.13 ? 167 TYR B CG  1 
ATOM   3434 C CD1 . TYR B 2 167 ? 20.874  53.834  45.292  1.00 121.29 ? 167 TYR B CD1 1 
ATOM   3435 C CD2 . TYR B 2 167 ? 23.242  54.062  45.202  1.00 126.77 ? 167 TYR B CD2 1 
ATOM   3436 C CE1 . TYR B 2 167 ? 20.963  52.611  44.649  1.00 121.11 ? 167 TYR B CE1 1 
ATOM   3437 C CE2 . TYR B 2 167 ? 23.342  52.842  44.561  1.00 131.07 ? 167 TYR B CE2 1 
ATOM   3438 C CZ  . TYR B 2 167 ? 22.200  52.119  44.286  1.00 128.16 ? 167 TYR B CZ  1 
ATOM   3439 O OH  . TYR B 2 167 ? 22.300  50.902  43.643  1.00 126.60 ? 167 TYR B OH  1 
ATOM   3440 N N   . LYS B 2 168 ? 24.268  55.080  48.136  1.00 123.81 ? 168 LYS B N   1 
ATOM   3441 C CA  . LYS B 2 168 ? 25.329  54.157  48.523  1.00 124.44 ? 168 LYS B CA  1 
ATOM   3442 C C   . LYS B 2 168 ? 25.106  53.663  49.952  1.00 113.97 ? 168 LYS B C   1 
ATOM   3443 O O   . LYS B 2 168 ? 25.160  52.464  50.220  1.00 104.12 ? 168 LYS B O   1 
ATOM   3444 C CB  . LYS B 2 168 ? 26.695  54.844  48.400  1.00 133.42 ? 168 LYS B CB  1 
ATOM   3445 C CG  . LYS B 2 168 ? 27.887  53.905  48.217  1.00 137.60 ? 168 LYS B CG  1 
ATOM   3446 C CD  . LYS B 2 168 ? 29.158  54.692  47.881  1.00 135.89 ? 168 LYS B CD  1 
ATOM   3447 C CE  . LYS B 2 168 ? 30.361  53.779  47.680  1.00 132.53 ? 168 LYS B CE  1 
ATOM   3448 N NZ  . LYS B 2 168 ? 30.758  53.075  48.932  1.00 129.37 ? 168 LYS B NZ  1 
ATOM   3449 N N   . THR B 2 169 ? 24.845  54.599  50.860  1.00 114.38 ? 169 THR B N   1 
ATOM   3450 C CA  . THR B 2 169 ? 24.614  54.280  52.268  1.00 113.24 ? 169 THR B CA  1 
ATOM   3451 C C   . THR B 2 169 ? 23.406  53.364  52.477  1.00 113.40 ? 169 THR B C   1 
ATOM   3452 O O   . THR B 2 169 ? 23.447  52.458  53.312  1.00 118.43 ? 169 THR B O   1 
ATOM   3453 C CB  . THR B 2 169 ? 24.459  55.562  53.127  1.00 94.02  ? 169 THR B CB  1 
ATOM   3454 O OG1 . THR B 2 169 ? 25.751  56.034  53.527  1.00 101.54 ? 169 THR B OG1 1 
ATOM   3455 C CG2 . THR B 2 169 ? 23.637  55.284  54.375  1.00 88.29  ? 169 THR B CG2 1 
ATOM   3456 N N   . LYS B 2 170 ? 22.334  53.600  51.724  1.00 102.97 ? 170 LYS B N   1 
ATOM   3457 C CA  . LYS B 2 170 ? 21.153  52.747  51.810  1.00 91.74  ? 170 LYS B CA  1 
ATOM   3458 C C   . LYS B 2 170 ? 21.490  51.312  51.405  1.00 92.69  ? 170 LYS B C   1 
ATOM   3459 O O   . LYS B 2 170 ? 20.797  50.369  51.785  1.00 96.77  ? 170 LYS B O   1 
ATOM   3460 C CB  . LYS B 2 170 ? 20.006  53.303  50.960  1.00 85.10  ? 170 LYS B CB  1 
ATOM   3461 C CG  . LYS B 2 170 ? 19.254  54.449  51.611  1.00 89.38  ? 170 LYS B CG  1 
ATOM   3462 C CD  . LYS B 2 170 ? 18.258  55.091  50.658  1.00 102.62 ? 170 LYS B CD  1 
ATOM   3463 C CE  . LYS B 2 170 ? 18.957  56.006  49.660  1.00 119.30 ? 170 LYS B CE  1 
ATOM   3464 N NZ  . LYS B 2 170 ? 18.007  56.670  48.717  1.00 123.98 ? 170 LYS B NZ  1 
ATOM   3465 N N   . ILE B 2 171 ? 22.563  51.148  50.639  1.00 86.77  ? 171 ILE B N   1 
ATOM   3466 C CA  . ILE B 2 171 ? 23.004  49.815  50.240  1.00 90.69  ? 171 ILE B CA  1 
ATOM   3467 C C   . ILE B 2 171 ? 23.737  49.155  51.395  1.00 89.23  ? 171 ILE B C   1 
ATOM   3468 O O   . ILE B 2 171 ? 23.422  48.033  51.789  1.00 89.31  ? 171 ILE B O   1 
ATOM   3469 C CB  . ILE B 2 171 ? 23.943  49.860  49.013  1.00 95.59  ? 171 ILE B CB  1 
ATOM   3470 C CG1 . ILE B 2 171 ? 23.173  50.278  47.759  1.00 101.46 ? 171 ILE B CG1 1 
ATOM   3471 C CG2 . ILE B 2 171 ? 24.591  48.506  48.781  1.00 85.43  ? 171 ILE B CG2 1 
ATOM   3472 C CD1 . ILE B 2 171 ? 22.053  49.332  47.404  1.00 104.00 ? 171 ILE B CD1 1 
ATOM   3473 N N   . LYS B 2 172 ? 24.720  49.876  51.927  1.00 87.38  ? 172 LYS B N   1 
ATOM   3474 C CA  . LYS B 2 172 ? 25.560  49.398  53.017  1.00 85.32  ? 172 LYS B CA  1 
ATOM   3475 C C   . LYS B 2 172 ? 24.723  49.096  54.261  1.00 85.67  ? 172 LYS B C   1 
ATOM   3476 O O   . LYS B 2 172 ? 25.194  48.456  55.205  1.00 81.97  ? 172 LYS B O   1 
ATOM   3477 C CB  . LYS B 2 172 ? 26.635  50.445  53.322  1.00 84.88  ? 172 LYS B CB  1 
ATOM   3478 C CG  . LYS B 2 172 ? 27.687  50.028  54.331  1.00 96.18  ? 172 LYS B CG  1 
ATOM   3479 C CD  . LYS B 2 172 ? 28.533  51.227  54.737  1.00 100.50 ? 172 LYS B CD  1 
ATOM   3480 C CE  . LYS B 2 172 ? 29.456  50.894  55.900  1.00 108.58 ? 172 LYS B CE  1 
ATOM   3481 N NZ  . LYS B 2 172 ? 30.110  52.110  56.473  1.00 109.87 ? 172 LYS B NZ  1 
ATOM   3482 N N   . LEU B 2 173 ? 23.475  49.552  54.254  1.00 78.48  ? 173 LEU B N   1 
ATOM   3483 C CA  . LEU B 2 173 ? 22.585  49.302  55.375  1.00 73.94  ? 173 LEU B CA  1 
ATOM   3484 C C   . LEU B 2 173 ? 22.165  47.844  55.373  1.00 81.44  ? 173 LEU B C   1 
ATOM   3485 O O   . LEU B 2 173 ? 22.451  47.110  56.316  1.00 93.17  ? 173 LEU B O   1 
ATOM   3486 C CB  . LEU B 2 173 ? 21.353  50.203  55.321  1.00 68.51  ? 173 LEU B CB  1 
ATOM   3487 C CG  . LEU B 2 173 ? 20.848  50.669  56.689  1.00 69.08  ? 173 LEU B CG  1 
ATOM   3488 C CD1 . LEU B 2 173 ? 19.442  51.232  56.606  1.00 70.93  ? 173 LEU B CD1 1 
ATOM   3489 C CD2 . LEU B 2 173 ? 20.892  49.540  57.690  1.00 67.70  ? 173 LEU B CD2 1 
ATOM   3490 N N   . CYS B 2 174 ? 21.483  47.424  54.315  1.00 74.65  ? 174 CYS B N   1 
ATOM   3491 C CA  . CYS B 2 174 ? 21.022  46.043  54.225  1.00 75.78  ? 174 CYS B CA  1 
ATOM   3492 C C   . CYS B 2 174 ? 22.137  45.048  54.542  1.00 76.40  ? 174 CYS B C   1 
ATOM   3493 O O   . CYS B 2 174 ? 21.907  44.015  55.164  1.00 72.63  ? 174 CYS B O   1 
ATOM   3494 C CB  . CYS B 2 174 ? 20.415  45.758  52.853  1.00 61.87  ? 174 CYS B CB  1 
ATOM   3495 S SG  . CYS B 2 174 ? 18.850  46.616  52.567  1.00 126.56 ? 174 CYS B SG  1 
ATOM   3496 N N   . ILE B 2 175 ? 23.350  45.375  54.124  1.00 75.46  ? 175 ILE B N   1 
ATOM   3497 C CA  . ILE B 2 175 ? 24.498  44.508  54.347  1.00 83.33  ? 175 ILE B CA  1 
ATOM   3498 C C   . ILE B 2 175 ? 24.784  44.363  55.843  1.00 90.87  ? 175 ILE B C   1 
ATOM   3499 O O   . ILE B 2 175 ? 25.015  43.255  56.334  1.00 94.66  ? 175 ILE B O   1 
ATOM   3500 C CB  . ILE B 2 175 ? 25.736  45.040  53.587  1.00 84.96  ? 175 ILE B CB  1 
ATOM   3501 C CG1 . ILE B 2 175 ? 25.347  45.387  52.145  1.00 92.69  ? 175 ILE B CG1 1 
ATOM   3502 C CG2 . ILE B 2 175 ? 26.868  44.028  53.585  1.00 76.49  ? 175 ILE B CG2 1 
ATOM   3503 C CD1 . ILE B 2 175 ? 24.692  44.235  51.395  1.00 91.04  ? 175 ILE B CD1 1 
ATOM   3504 N N   . LEU B 2 176 ? 24.740  45.483  56.563  1.00 91.27  ? 176 LEU B N   1 
ATOM   3505 C CA  . LEU B 2 176 ? 24.997  45.505  58.006  1.00 86.48  ? 176 LEU B CA  1 
ATOM   3506 C C   . LEU B 2 176 ? 23.879  44.878  58.839  1.00 86.81  ? 176 LEU B C   1 
ATOM   3507 O O   . LEU B 2 176 ? 24.142  44.049  59.709  1.00 94.20  ? 176 LEU B O   1 
ATOM   3508 C CB  . LEU B 2 176 ? 25.247  46.933  58.486  1.00 84.83  ? 176 LEU B CB  1 
ATOM   3509 C CG  . LEU B 2 176 ? 26.520  47.574  57.946  1.00 88.47  ? 176 LEU B CG  1 
ATOM   3510 C CD1 . LEU B 2 176 ? 26.954  48.723  58.848  1.00 83.97  ? 176 LEU B CD1 1 
ATOM   3511 C CD2 . LEU B 2 176 ? 27.622  46.528  57.829  1.00 89.27  ? 176 LEU B CD2 1 
ATOM   3512 N N   . LEU B 2 177 ? 22.639  45.284  58.582  1.00 82.68  ? 177 LEU B N   1 
ATOM   3513 C CA  . LEU B 2 177 ? 21.494  44.700  59.272  1.00 83.75  ? 177 LEU B CA  1 
ATOM   3514 C C   . LEU B 2 177 ? 21.495  43.171  59.170  1.00 89.11  ? 177 LEU B C   1 
ATOM   3515 O O   . LEU B 2 177 ? 21.149  42.482  60.127  1.00 86.45  ? 177 LEU B O   1 
ATOM   3516 C CB  . LEU B 2 177 ? 20.180  45.276  58.742  1.00 81.05  ? 177 LEU B CB  1 
ATOM   3517 C CG  . LEU B 2 177 ? 19.904  46.739  59.089  1.00 75.54  ? 177 LEU B CG  1 
ATOM   3518 C CD1 . LEU B 2 177 ? 18.511  47.169  58.646  1.00 71.62  ? 177 LEU B CD1 1 
ATOM   3519 C CD2 . LEU B 2 177 ? 20.067  46.944  60.572  1.00 83.72  ? 177 LEU B CD2 1 
ATOM   3520 N N   . HIS B 2 178 ? 21.888  42.645  58.013  1.00 91.34  ? 178 HIS B N   1 
ATOM   3521 C CA  . HIS B 2 178 ? 21.997  41.199  57.833  1.00 93.23  ? 178 HIS B CA  1 
ATOM   3522 C C   . HIS B 2 178 ? 23.149  40.623  58.649  1.00 86.55  ? 178 HIS B C   1 
ATOM   3523 O O   . HIS B 2 178 ? 22.961  39.686  59.419  1.00 82.08  ? 178 HIS B O   1 
ATOM   3524 C CB  . HIS B 2 178 ? 22.169  40.840  56.351  1.00 102.35 ? 178 HIS B CB  1 
ATOM   3525 C CG  . HIS B 2 178 ? 20.907  40.391  55.684  1.00 110.39 ? 178 HIS B CG  1 
ATOM   3526 N ND1 . HIS B 2 178 ? 20.432  39.099  55.788  1.00 117.02 ? 178 HIS B ND1 1 
ATOM   3527 C CD2 . HIS B 2 178 ? 20.025  41.054  54.900  1.00 110.44 ? 178 HIS B CD2 1 
ATOM   3528 C CE1 . HIS B 2 178 ? 19.309  38.991  55.099  1.00 119.31 ? 178 HIS B CE1 1 
ATOM   3529 N NE2 . HIS B 2 178 ? 19.040  40.163  54.552  1.00 115.16 ? 178 HIS B NE2 1 
ATOM   3530 N N   . ALA B 2 179 ? 24.341  41.182  58.473  1.00 81.92  ? 179 ALA B N   1 
ATOM   3531 C CA  . ALA B 2 179 ? 25.512  40.713  59.199  1.00 79.36  ? 179 ALA B CA  1 
ATOM   3532 C C   . ALA B 2 179 ? 25.304  40.848  60.700  1.00 79.15  ? 179 ALA B C   1 
ATOM   3533 O O   . ALA B 2 179 ? 25.764  40.013  61.480  1.00 79.59  ? 179 ALA B O   1 
ATOM   3534 C CB  . ALA B 2 179 ? 26.749  41.483  58.761  1.00 80.31  ? 179 ALA B CB  1 
ATOM   3535 N N   . PHE B 2 180 ? 24.593  41.902  61.093  1.00 72.65  ? 180 PHE B N   1 
ATOM   3536 C CA  . PHE B 2 180 ? 24.366  42.201  62.497  1.00 71.51  ? 180 PHE B CA  1 
ATOM   3537 C C   . PHE B 2 180 ? 23.390  41.240  63.157  1.00 75.29  ? 180 PHE B C   1 
ATOM   3538 O O   . PHE B 2 180 ? 23.600  40.861  64.302  1.00 83.52  ? 180 PHE B O   1 
ATOM   3539 C CB  . PHE B 2 180 ? 23.885  43.640  62.676  1.00 79.09  ? 180 PHE B CB  1 
ATOM   3540 C CG  . PHE B 2 180 ? 24.102  44.189  64.065  1.00 82.79  ? 180 PHE B CG  1 
ATOM   3541 C CD1 . PHE B 2 180 ? 23.073  44.808  64.752  1.00 83.14  ? 180 PHE B CD1 1 
ATOM   3542 C CD2 . PHE B 2 180 ? 25.335  44.083  64.680  1.00 78.96  ? 180 PHE B CD2 1 
ATOM   3543 C CE1 . PHE B 2 180 ? 23.273  45.320  66.029  1.00 81.47  ? 180 PHE B CE1 1 
ATOM   3544 C CE2 . PHE B 2 180 ? 25.540  44.586  65.950  1.00 73.76  ? 180 PHE B CE2 1 
ATOM   3545 C CZ  . PHE B 2 180 ? 24.505  45.206  66.627  1.00 73.65  ? 180 PHE B CZ  1 
ATOM   3546 N N   . ARG B 2 181 ? 22.328  40.848  62.458  1.00 70.92  ? 181 ARG B N   1 
ATOM   3547 C CA  . ARG B 2 181 ? 21.402  39.869  63.030  1.00 74.05  ? 181 ARG B CA  1 
ATOM   3548 C C   . ARG B 2 181 ? 22.137  38.570  63.287  1.00 74.07  ? 181 ARG B C   1 
ATOM   3549 O O   . ARG B 2 181 ? 21.979  37.952  64.333  1.00 85.34  ? 181 ARG B O   1 
ATOM   3550 C CB  . ARG B 2 181 ? 20.184  39.608  62.138  1.00 58.87  ? 181 ARG B CB  1 
ATOM   3551 C CG  . ARG B 2 181 ? 18.926  39.280  62.936  1.00 68.43  ? 181 ARG B CG  1 
ATOM   3552 C CD  . ARG B 2 181 ? 17.919  38.454  62.164  1.00 68.40  ? 181 ARG B CD  1 
ATOM   3553 N NE  . ARG B 2 181 ? 18.183  37.020  62.262  1.00 71.32  ? 181 ARG B NE  1 
ATOM   3554 C CZ  . ARG B 2 181 ? 17.516  36.182  63.054  1.00 72.96  ? 181 ARG B CZ  1 
ATOM   3555 N NH1 . ARG B 2 181 ? 17.835  34.894  63.075  1.00 76.04  ? 181 ARG B NH1 1 
ATOM   3556 N NH2 . ARG B 2 181 ? 16.530  36.621  63.824  1.00 66.19  ? 181 ARG B NH2 1 
ATOM   3557 N N   . ILE B 2 182 ? 22.955  38.161  62.328  1.00 64.75  ? 182 ILE B N   1 
ATOM   3558 C CA  . ILE B 2 182 ? 23.742  36.943  62.483  1.00 70.08  ? 182 ILE B CA  1 
ATOM   3559 C C   . ILE B 2 182 ? 24.647  37.092  63.704  1.00 73.33  ? 182 ILE B C   1 
ATOM   3560 O O   . ILE B 2 182 ? 24.781  36.176  64.509  1.00 80.64  ? 182 ILE B O   1 
ATOM   3561 C CB  . ILE B 2 182 ? 24.545  36.604  61.198  1.00 77.37  ? 182 ILE B CB  1 
ATOM   3562 C CG1 . ILE B 2 182 ? 23.686  35.783  60.227  1.00 76.01  ? 182 ILE B CG1 1 
ATOM   3563 C CG2 . ILE B 2 182 ? 25.793  35.818  61.523  1.00 80.65  ? 182 ILE B CG2 1 
ATOM   3564 C CD1 . ILE B 2 182 ? 22.543  36.543  59.591  1.00 77.76  ? 182 ILE B CD1 1 
ATOM   3565 N N   . ARG B 2 183 ? 25.244  38.264  63.860  1.00 66.14  ? 183 ARG B N   1 
ATOM   3566 C CA  . ARG B 2 183 ? 26.045  38.527  65.043  1.00 70.69  ? 183 ARG B CA  1 
ATOM   3567 C C   . ARG B 2 183 ? 25.195  38.532  66.309  1.00 83.36  ? 183 ARG B C   1 
ATOM   3568 O O   . ARG B 2 183 ? 25.559  37.909  67.300  1.00 98.67  ? 183 ARG B O   1 
ATOM   3569 C CB  . ARG B 2 183 ? 26.791  39.849  64.928  1.00 61.70  ? 183 ARG B CB  1 
ATOM   3570 C CG  . ARG B 2 183 ? 27.678  40.088  66.111  1.00 80.37  ? 183 ARG B CG  1 
ATOM   3571 C CD  . ARG B 2 183 ? 28.570  38.881  66.348  1.00 83.49  ? 183 ARG B CD  1 
ATOM   3572 N NE  . ARG B 2 183 ? 29.930  39.129  65.887  1.00 84.30  ? 183 ARG B NE  1 
ATOM   3573 C CZ  . ARG B 2 183 ? 30.534  38.468  64.908  1.00 89.91  ? 183 ARG B CZ  1 
ATOM   3574 N NH1 . ARG B 2 183 ? 29.907  37.492  64.271  1.00 93.50  ? 183 ARG B NH1 1 
ATOM   3575 N NH2 . ARG B 2 183 ? 31.776  38.783  64.574  1.00 90.90  ? 183 ARG B NH2 1 
ATOM   3576 N N   . ALA B 2 184 ? 24.070  39.243  66.278  1.00 76.90  ? 184 ALA B N   1 
ATOM   3577 C CA  . ALA B 2 184 ? 23.179  39.322  67.432  1.00 71.43  ? 184 ALA B CA  1 
ATOM   3578 C C   . ALA B 2 184 ? 22.755  37.934  67.877  1.00 84.83  ? 184 ALA B C   1 
ATOM   3579 O O   . ALA B 2 184 ? 22.635  37.666  69.071  1.00 102.81 ? 184 ALA B O   1 
ATOM   3580 C CB  . ALA B 2 184 ? 21.959  40.157  67.114  1.00 68.08  ? 184 ALA B CB  1 
ATOM   3581 N N   . VAL B 2 185 ? 22.522  37.052  66.914  1.00 77.38  ? 185 VAL B N   1 
ATOM   3582 C CA  . VAL B 2 185 ? 22.166  35.677  67.219  1.00 77.00  ? 185 VAL B CA  1 
ATOM   3583 C C   . VAL B 2 185 ? 23.258  35.005  68.040  1.00 85.22  ? 185 VAL B C   1 
ATOM   3584 O O   . VAL B 2 185 ? 22.989  34.433  69.098  1.00 94.48  ? 185 VAL B O   1 
ATOM   3585 C CB  . VAL B 2 185 ? 21.929  34.861  65.942  1.00 75.67  ? 185 VAL B CB  1 
ATOM   3586 C CG1 . VAL B 2 185 ? 21.987  33.372  66.249  1.00 68.59  ? 185 VAL B CG1 1 
ATOM   3587 C CG2 . VAL B 2 185 ? 20.599  35.237  65.317  1.00 73.72  ? 185 VAL B CG2 1 
ATOM   3588 N N   . THR B 2 186 ? 24.493  35.075  67.556  1.00 81.30  ? 186 THR B N   1 
ATOM   3589 C CA  . THR B 2 186 ? 25.605  34.471  68.277  1.00 83.95  ? 186 THR B CA  1 
ATOM   3590 C C   . THR B 2 186 ? 25.714  35.064  69.675  1.00 79.49  ? 186 THR B C   1 
ATOM   3591 O O   . THR B 2 186 ? 26.085  34.370  70.621  1.00 83.36  ? 186 THR B O   1 
ATOM   3592 C CB  . THR B 2 186 ? 26.937  34.633  67.525  1.00 91.94  ? 186 THR B CB  1 
ATOM   3593 O OG1 . THR B 2 186 ? 26.974  33.715  66.423  1.00 97.89  ? 186 THR B OG1 1 
ATOM   3594 C CG2 . THR B 2 186 ? 28.111  34.344  68.455  1.00 86.29  ? 186 THR B CG2 1 
ATOM   3595 N N   . ILE B 2 187 ? 25.374  36.343  69.800  1.00 71.60  ? 187 ILE B N   1 
ATOM   3596 C CA  . ILE B 2 187 ? 25.317  36.990  71.102  1.00 72.58  ? 187 ILE B CA  1 
ATOM   3597 C C   . ILE B 2 187 ? 24.290  36.307  71.997  1.00 86.08  ? 187 ILE B C   1 
ATOM   3598 O O   . ILE B 2 187 ? 24.614  35.859  73.098  1.00 96.96  ? 187 ILE B O   1 
ATOM   3599 C CB  . ILE B 2 187 ? 24.989  38.486  70.981  1.00 74.13  ? 187 ILE B CB  1 
ATOM   3600 C CG1 . ILE B 2 187 ? 26.262  39.286  70.722  1.00 75.75  ? 187 ILE B CG1 1 
ATOM   3601 C CG2 . ILE B 2 187 ? 24.310  39.001  72.243  1.00 79.10  ? 187 ILE B CG2 1 
ATOM   3602 C CD1 . ILE B 2 187 ? 26.072  40.770  70.880  1.00 77.95  ? 187 ILE B CD1 1 
ATOM   3603 N N   . ASP B 2 188 ? 23.055  36.213  71.518  1.00 82.81  ? 188 ASP B N   1 
ATOM   3604 C CA  . ASP B 2 188 ? 22.002  35.550  72.274  1.00 85.80  ? 188 ASP B CA  1 
ATOM   3605 C C   . ASP B 2 188 ? 22.419  34.131  72.672  1.00 89.71  ? 188 ASP B C   1 
ATOM   3606 O O   . ASP B 2 188 ? 22.177  33.706  73.804  1.00 93.24  ? 188 ASP B O   1 
ATOM   3607 C CB  . ASP B 2 188 ? 20.696  35.542  71.479  1.00 88.43  ? 188 ASP B CB  1 
ATOM   3608 C CG  . ASP B 2 188 ? 19.471  35.417  72.363  1.00 90.83  ? 188 ASP B CG  1 
ATOM   3609 O OD1 . ASP B 2 188 ? 18.583  36.285  72.251  1.00 86.84  ? 188 ASP B OD1 1 
ATOM   3610 O OD2 . ASP B 2 188 ? 19.397  34.460  73.164  1.00 94.41  ? 188 ASP B OD2 1 
ATOM   3611 N N   . ARG B 2 189 ? 23.057  33.412  71.750  1.00 89.48  ? 189 ARG B N   1 
ATOM   3612 C CA  . ARG B 2 189 ? 23.553  32.063  72.030  1.00 96.86  ? 189 ARG B CA  1 
ATOM   3613 C C   . ARG B 2 189 ? 24.427  32.009  73.278  1.00 98.14  ? 189 ARG B C   1 
ATOM   3614 O O   . ARG B 2 189 ? 24.298  31.100  74.095  1.00 96.38  ? 189 ARG B O   1 
ATOM   3615 C CB  . ARG B 2 189 ? 24.341  31.515  70.839  1.00 91.35  ? 189 ARG B CB  1 
ATOM   3616 C CG  . ARG B 2 189 ? 23.477  30.909  69.758  1.00 92.04  ? 189 ARG B CG  1 
ATOM   3617 C CD  . ARG B 2 189 ? 24.272  29.968  68.859  1.00 85.97  ? 189 ARG B CD  1 
ATOM   3618 N NE  . ARG B 2 189 ? 23.384  29.014  68.207  1.00 83.62  ? 189 ARG B NE  1 
ATOM   3619 C CZ  . ARG B 2 189 ? 22.760  29.240  67.058  1.00 86.16  ? 189 ARG B CZ  1 
ATOM   3620 N NH1 . ARG B 2 189 ? 22.940  30.385  66.420  1.00 89.33  ? 189 ARG B NH1 1 
ATOM   3621 N NH2 . ARG B 2 189 ? 21.958  28.319  66.541  1.00 88.43  ? 189 ARG B NH2 1 
ATOM   3622 N N   . VAL B 2 190 ? 25.324  32.979  73.413  1.00 98.53  ? 190 VAL B N   1 
ATOM   3623 C CA  . VAL B 2 190 ? 26.202  33.040  74.571  1.00 100.83 ? 190 VAL B CA  1 
ATOM   3624 C C   . VAL B 2 190 ? 25.400  33.370  75.822  1.00 103.18 ? 190 VAL B C   1 
ATOM   3625 O O   . VAL B 2 190 ? 25.497  32.680  76.833  1.00 103.38 ? 190 VAL B O   1 
ATOM   3626 C CB  . VAL B 2 190 ? 27.307  34.092  74.383  1.00 95.91  ? 190 VAL B CB  1 
ATOM   3627 C CG1 . VAL B 2 190 ? 28.189  34.163  75.617  1.00 84.44  ? 190 VAL B CG1 1 
ATOM   3628 C CG2 . VAL B 2 190 ? 28.135  33.768  73.143  1.00 95.14  ? 190 VAL B CG2 1 
ATOM   3629 N N   . MET B 2 191 ? 24.593  34.423  75.739  1.00 103.94 ? 191 MET B N   1 
ATOM   3630 C CA  . MET B 2 191 ? 23.788  34.867  76.874  1.00 112.13 ? 191 MET B CA  1 
ATOM   3631 C C   . MET B 2 191 ? 22.798  33.796  77.326  1.00 122.02 ? 191 MET B C   1 
ATOM   3632 O O   . MET B 2 191 ? 22.510  33.680  78.518  1.00 132.43 ? 191 MET B O   1 
ATOM   3633 C CB  . MET B 2 191 ? 23.069  36.180  76.548  1.00 115.53 ? 191 MET B CB  1 
ATOM   3634 C CG  . MET B 2 191 ? 23.856  37.437  76.903  1.00 117.98 ? 191 MET B CG  1 
ATOM   3635 S SD  . MET B 2 191 ? 25.627  37.150  77.102  1.00 92.68  ? 191 MET B SD  1 
ATOM   3636 C CE  . MET B 2 191 ? 26.283  38.790  76.861  1.00 75.63  ? 191 MET B CE  1 
ATOM   3637 N N   . SER B 2 192 ? 22.282  33.016  76.379  1.00 116.85 ? 192 SER B N   1 
ATOM   3638 C CA  . SER B 2 192 ? 21.380  31.915  76.707  1.00 108.08 ? 192 SER B CA  1 
ATOM   3639 C C   . SER B 2 192 ? 22.155  30.815  77.396  1.00 103.29 ? 192 SER B C   1 
ATOM   3640 O O   . SER B 2 192 ? 21.637  30.125  78.274  1.00 110.27 ? 192 SER B O   1 
ATOM   3641 C CB  . SER B 2 192 ? 20.713  31.362  75.452  1.00 107.34 ? 192 SER B CB  1 
ATOM   3642 O OG  . SER B 2 192 ? 19.770  32.287  74.937  1.00 121.72 ? 192 SER B OG  1 
ATOM   3643 N N   . TYR B 2 193 ? 23.408  30.667  76.990  1.00 96.57  ? 193 TYR B N   1 
ATOM   3644 C CA  . TYR B 2 193 ? 24.284  29.644  77.533  1.00 100.01 ? 193 TYR B CA  1 
ATOM   3645 C C   . TYR B 2 193 ? 24.656  29.952  78.975  1.00 109.70 ? 193 TYR B C   1 
ATOM   3646 O O   . TYR B 2 193 ? 24.522  29.102  79.854  1.00 113.00 ? 193 TYR B O   1 
ATOM   3647 C CB  . TYR B 2 193 ? 25.540  29.549  76.679  1.00 99.81  ? 193 TYR B CB  1 
ATOM   3648 C CG  . TYR B 2 193 ? 26.521  28.507  77.139  1.00 106.43 ? 193 TYR B CG  1 
ATOM   3649 C CD1 . TYR B 2 193 ? 26.176  27.161  77.158  1.00 110.97 ? 193 TYR B CD1 1 
ATOM   3650 C CD2 . TYR B 2 193 ? 27.800  28.865  77.537  1.00 107.90 ? 193 TYR B CD2 1 
ATOM   3651 C CE1 . TYR B 2 193 ? 27.078  26.202  77.573  1.00 112.24 ? 193 TYR B CE1 1 
ATOM   3652 C CE2 . TYR B 2 193 ? 28.708  27.912  77.954  1.00 113.34 ? 193 TYR B CE2 1 
ATOM   3653 C CZ  . TYR B 2 193 ? 28.343  26.585  77.969  1.00 114.46 ? 193 TYR B CZ  1 
ATOM   3654 O OH  . TYR B 2 193 ? 29.252  25.642  78.382  1.00 120.78 ? 193 TYR B OH  1 
ATOM   3655 N N   . LEU B 2 194 ? 25.119  31.175  79.213  1.00 113.34 ? 194 LEU B N   1 
ATOM   3656 C CA  . LEU B 2 194 ? 25.528  31.585  80.549  1.00 107.30 ? 194 LEU B CA  1 
ATOM   3657 C C   . LEU B 2 194 ? 24.369  31.501  81.532  1.00 111.43 ? 194 LEU B C   1 
ATOM   3658 O O   . LEU B 2 194 ? 24.501  30.913  82.602  1.00 124.12 ? 194 LEU B O   1 
ATOM   3659 C CB  . LEU B 2 194 ? 26.114  32.995  80.521  1.00 101.10 ? 194 LEU B CB  1 
ATOM   3660 C CG  . LEU B 2 194 ? 27.325  33.137  79.593  1.00 101.65 ? 194 LEU B CG  1 
ATOM   3661 C CD1 . LEU B 2 194 ? 27.817  34.577  79.505  1.00 83.82  ? 194 LEU B CD1 1 
ATOM   3662 C CD2 . LEU B 2 194 ? 28.449  32.198  80.024  1.00 103.40 ? 194 LEU B CD2 1 
ATOM   3663 N N   . ASN B 2 195 ? 23.231  32.076  81.158  1.00 104.74 ? 195 ASN B N   1 
ATOM   3664 C CA  . ASN B 2 195 ? 22.045  32.063  82.009  1.00 109.42 ? 195 ASN B CA  1 
ATOM   3665 C C   . ASN B 2 195 ? 21.716  30.681  82.583  1.00 123.73 ? 195 ASN B C   1 
ATOM   3666 O O   . ASN B 2 195 ? 21.164  30.573  83.682  1.00 135.20 ? 195 ASN B O   1 
ATOM   3667 C CB  . ASN B 2 195 ? 20.844  32.629  81.249  1.00 103.67 ? 195 ASN B CB  1 
ATOM   3668 C CG  . ASN B 2 195 ? 19.535  32.430  81.985  1.00 101.77 ? 195 ASN B CG  1 
ATOM   3669 O OD1 . ASN B 2 195 ? 18.997  33.360  82.582  1.00 100.06 ? 195 ASN B OD1 1 
ATOM   3670 N ND2 . ASN B 2 195 ? 19.012  31.213  81.938  1.00 100.69 ? 195 ASN B ND2 1 
ATOM   3671 N N   . ALA B 2 196 ? 22.066  29.630  81.846  1.00 122.61 ? 196 ALA B N   1 
ATOM   3672 C CA  . ALA B 2 196 ? 21.755  28.264  82.259  1.00 120.83 ? 196 ALA B CA  1 
ATOM   3673 C C   . ALA B 2 196 ? 22.909  27.583  82.989  1.00 130.21 ? 196 ALA B C   1 
ATOM   3674 O O   . ALA B 2 196 ? 22.718  26.548  83.624  1.00 137.75 ? 196 ALA B O   1 
ATOM   3675 C CB  . ALA B 2 196 ? 21.318  27.429  81.063  1.00 114.57 ? 196 ALA B CB  1 
ATOM   3676 N N   . SER B 2 197 ? 24.104  28.158  82.897  1.00 135.04 ? 197 SER B N   1 
ATOM   3677 C CA  . SER B 2 197 ? 25.268  27.584  83.570  1.00 147.05 ? 197 SER B CA  1 
ATOM   3678 C C   . SER B 2 197 ? 26.350  28.613  83.887  1.00 136.25 ? 197 SER B C   1 
ATOM   3679 O O   . SER B 2 197 ? 26.852  29.312  83.010  1.00 124.87 ? 197 SER B O   1 
ATOM   3680 C CB  . SER B 2 197 ? 25.857  26.438  82.740  1.00 159.75 ? 197 SER B CB  1 
ATOM   3681 O OG  . SER B 2 197 ? 25.109  25.243  82.906  1.00 165.22 ? 197 SER B OG  1 
ATOM   3682 O OXT . SER B 2 197 ? 26.757  28.751  85.039  1.00 137.91 ? 197 SER B OXT 1 
ATOM   3683 N N   . ASP C 3 1   ? 28.484  30.051  3.561   1.00 86.79  ? 1   ASP L N   1 
ATOM   3684 C CA  . ASP C 3 1   ? 29.240  28.805  3.526   1.00 83.39  ? 1   ASP L CA  1 
ATOM   3685 C C   . ASP C 3 1   ? 30.659  29.076  3.032   1.00 81.15  ? 1   ASP L C   1 
ATOM   3686 O O   . ASP C 3 1   ? 30.922  30.126  2.447   1.00 90.26  ? 1   ASP L O   1 
ATOM   3687 C CB  . ASP C 3 1   ? 28.541  27.789  2.624   1.00 86.55  ? 1   ASP L CB  1 
ATOM   3688 C CG  . ASP C 3 1   ? 27.031  27.752  2.839   1.00 96.53  ? 1   ASP L CG  1 
ATOM   3689 O OD1 . ASP C 3 1   ? 26.540  28.366  3.815   1.00 94.20  ? 1   ASP L OD1 1 
ATOM   3690 O OD2 . ASP C 3 1   ? 26.333  27.106  2.024   1.00 100.20 ? 1   ASP L OD2 1 
ATOM   3691 N N   . ILE C 3 2   ? 31.576  28.145  3.274   1.00 72.12  ? 2   ILE L N   1 
ATOM   3692 C CA  . ILE C 3 2   ? 32.963  28.342  2.855   1.00 79.70  ? 2   ILE L CA  1 
ATOM   3693 C C   . ILE C 3 2   ? 33.136  27.932  1.402   1.00 85.46  ? 2   ILE L C   1 
ATOM   3694 O O   . ILE C 3 2   ? 32.882  26.784  1.047   1.00 91.96  ? 2   ILE L O   1 
ATOM   3695 C CB  . ILE C 3 2   ? 33.962  27.538  3.717   1.00 77.74  ? 2   ILE L CB  1 
ATOM   3696 C CG1 . ILE C 3 2   ? 33.981  28.049  5.157   1.00 68.23  ? 2   ILE L CG1 1 
ATOM   3697 C CG2 . ILE C 3 2   ? 35.362  27.640  3.141   1.00 81.10  ? 2   ILE L CG2 1 
ATOM   3698 C CD1 . ILE C 3 2   ? 35.133  27.490  5.960   1.00 63.00  ? 2   ILE L CD1 1 
ATOM   3699 N N   . GLN C 3 3   ? 33.576  28.866  0.565   1.00 93.13  ? 3   GLN L N   1 
ATOM   3700 C CA  . GLN C 3 3   ? 33.682  28.606  -0.868  1.00 99.47  ? 3   GLN L CA  1 
ATOM   3701 C C   . GLN C 3 3   ? 34.940  27.826  -1.232  1.00 88.40  ? 3   GLN L C   1 
ATOM   3702 O O   . GLN C 3 3   ? 36.060  28.307  -1.058  1.00 83.33  ? 3   GLN L O   1 
ATOM   3703 C CB  . GLN C 3 3   ? 33.619  29.913  -1.665  1.00 110.52 ? 3   GLN L CB  1 
ATOM   3704 C CG  . GLN C 3 3   ? 32.471  30.832  -1.261  1.00 122.88 ? 3   GLN L CG  1 
ATOM   3705 C CD  . GLN C 3 3   ? 31.120  30.130  -1.271  1.00 129.56 ? 3   GLN L CD  1 
ATOM   3706 O OE1 . GLN C 3 3   ? 30.213  30.493  -0.519  1.00 130.50 ? 3   GLN L OE1 1 
ATOM   3707 N NE2 . GLN C 3 3   ? 30.982  29.119  -2.124  1.00 131.34 ? 3   GLN L NE2 1 
ATOM   3708 N N   . MET C 3 4   ? 34.745  26.615  -1.737  1.00 76.74  ? 4   MET L N   1 
ATOM   3709 C CA  . MET C 3 4   ? 35.860  25.808  -2.198  1.00 73.30  ? 4   MET L CA  1 
ATOM   3710 C C   . MET C 3 4   ? 36.049  26.022  -3.688  1.00 82.50  ? 4   MET L C   1 
ATOM   3711 O O   . MET C 3 4   ? 35.096  25.934  -4.462  1.00 90.39  ? 4   MET L O   1 
ATOM   3712 C CB  . MET C 3 4   ? 35.618  24.336  -1.888  1.00 72.93  ? 4   MET L CB  1 
ATOM   3713 C CG  . MET C 3 4   ? 35.494  24.057  -0.404  1.00 65.05  ? 4   MET L CG  1 
ATOM   3714 S SD  . MET C 3 4   ? 36.858  24.786  0.512   1.00 82.70  ? 4   MET L SD  1 
ATOM   3715 C CE  . MET C 3 4   ? 38.243  23.855  -0.119  1.00 48.53  ? 4   MET L CE  1 
ATOM   3716 N N   . THR C 3 5   ? 37.280  26.315  -4.087  1.00 77.47  ? 5   THR L N   1 
ATOM   3717 C CA  . THR C 3 5   ? 37.561  26.635  -5.478  1.00 75.08  ? 5   THR L CA  1 
ATOM   3718 C C   . THR C 3 5   ? 38.737  25.845  -6.018  1.00 70.43  ? 5   THR L C   1 
ATOM   3719 O O   . THR C 3 5   ? 39.888  26.144  -5.722  1.00 76.71  ? 5   THR L O   1 
ATOM   3720 C CB  . THR C 3 5   ? 37.840  28.135  -5.652  1.00 83.98  ? 5   THR L CB  1 
ATOM   3721 O OG1 . THR C 3 5   ? 36.615  28.862  -5.506  1.00 93.03  ? 5   THR L OG1 1 
ATOM   3722 C CG2 . THR C 3 5   ? 38.435  28.419  -7.024  1.00 77.49  ? 5   THR L CG2 1 
ATOM   3723 N N   . GLN C 3 6   ? 38.444  24.830  -6.816  1.00 61.21  ? 6   GLN L N   1 
ATOM   3724 C CA  . GLN C 3 6   ? 39.496  24.043  -7.438  1.00 75.48  ? 6   GLN L CA  1 
ATOM   3725 C C   . GLN C 3 6   ? 39.969  24.613  -8.775  1.00 86.64  ? 6   GLN L C   1 
ATOM   3726 O O   . GLN C 3 6   ? 39.217  25.269  -9.500  1.00 87.06  ? 6   GLN L O   1 
ATOM   3727 C CB  . GLN C 3 6   ? 39.041  22.603  -7.623  1.00 75.35  ? 6   GLN L CB  1 
ATOM   3728 C CG  . GLN C 3 6   ? 39.455  21.704  -6.502  1.00 84.98  ? 6   GLN L CG  1 
ATOM   3729 C CD  . GLN C 3 6   ? 38.611  20.462  -6.436  1.00 95.28  ? 6   GLN L CD  1 
ATOM   3730 O OE1 . GLN C 3 6   ? 37.409  20.526  -6.170  1.00 86.38  ? 6   GLN L OE1 1 
ATOM   3731 N NE2 . GLN C 3 6   ? 39.232  19.318  -6.680  1.00 108.89 ? 6   GLN L NE2 1 
ATOM   3732 N N   . SER C 3 7   ? 41.232  24.356  -9.089  1.00 89.50  ? 7   SER L N   1 
ATOM   3733 C CA  . SER C 3 7   ? 41.803  24.751  -10.365 1.00 98.99  ? 7   SER L CA  1 
ATOM   3734 C C   . SER C 3 7   ? 42.982  23.839  -10.672 1.00 101.35 ? 7   SER L C   1 
ATOM   3735 O O   . SER C 3 7   ? 43.718  23.448  -9.769  1.00 107.56 ? 7   SER L O   1 
ATOM   3736 C CB  . SER C 3 7   ? 42.247  26.211  -10.328 1.00 103.54 ? 7   SER L CB  1 
ATOM   3737 O OG  . SER C 3 7   ? 43.150  26.441  -9.259  1.00 112.50 ? 7   SER L OG  1 
ATOM   3738 N N   . PRO C 3 8   ? 43.162  23.486  -11.949 1.00 89.51  ? 8   PRO L N   1 
ATOM   3739 C CA  . PRO C 3 8   ? 42.382  23.959  -13.094 1.00 86.61  ? 8   PRO L CA  1 
ATOM   3740 C C   . PRO C 3 8   ? 41.060  23.232  -13.156 1.00 79.95  ? 8   PRO L C   1 
ATOM   3741 O O   . PRO C 3 8   ? 40.986  22.117  -12.661 1.00 87.34  ? 8   PRO L O   1 
ATOM   3742 C CB  . PRO C 3 8   ? 43.236  23.534  -14.295 1.00 98.37  ? 8   PRO L CB  1 
ATOM   3743 C CG  . PRO C 3 8   ? 44.508  22.944  -13.714 1.00 102.01 ? 8   PRO L CG  1 
ATOM   3744 C CD  . PRO C 3 8   ? 44.155  22.487  -12.354 1.00 86.31  ? 8   PRO L CD  1 
ATOM   3745 N N   . SER C 3 9   ? 40.038  23.835  -13.751 1.00 84.28  ? 9   SER L N   1 
ATOM   3746 C CA  . SER C 3 9   ? 38.753  23.159  -13.881 1.00 88.24  ? 9   SER L CA  1 
ATOM   3747 C C   . SER C 3 9   ? 38.942  21.828  -14.588 1.00 82.23  ? 9   SER L C   1 
ATOM   3748 O O   . SER C 3 9   ? 38.074  20.963  -14.545 1.00 81.27  ? 9   SER L O   1 
ATOM   3749 C CB  . SER C 3 9   ? 37.754  24.030  -14.642 1.00 95.90  ? 9   SER L CB  1 
ATOM   3750 O OG  . SER C 3 9   ? 37.273  25.075  -13.813 1.00 103.70 ? 9   SER L OG  1 
ATOM   3751 N N   . SER C 3 10  ? 40.096  21.672  -15.225 1.00 83.59  ? 10  SER L N   1 
ATOM   3752 C CA  . SER C 3 10  ? 40.408  20.473  -15.985 1.00 85.60  ? 10  SER L CA  1 
ATOM   3753 C C   . SER C 3 10  ? 41.836  20.520  -16.513 1.00 87.55  ? 10  SER L C   1 
ATOM   3754 O O   . SER C 3 10  ? 42.400  21.595  -16.707 1.00 89.73  ? 10  SER L O   1 
ATOM   3755 C CB  . SER C 3 10  ? 39.439  20.323  -17.157 1.00 87.93  ? 10  SER L CB  1 
ATOM   3756 O OG  . SER C 3 10  ? 39.924  19.380  -18.099 1.00 93.85  ? 10  SER L OG  1 
ATOM   3757 N N   . LEU C 3 11  ? 42.424  19.352  -16.735 1.00 88.85  ? 11  LEU L N   1 
ATOM   3758 C CA  . LEU C 3 11  ? 43.706  19.275  -17.427 1.00 104.27 ? 11  LEU L CA  1 
ATOM   3759 C C   . LEU C 3 11  ? 43.887  17.934  -18.133 1.00 113.04 ? 11  LEU L C   1 
ATOM   3760 O O   . LEU C 3 11  ? 43.030  17.057  -18.052 1.00 115.18 ? 11  LEU L O   1 
ATOM   3761 C CB  . LEU C 3 11  ? 44.881  19.570  -16.485 1.00 96.77  ? 11  LEU L CB  1 
ATOM   3762 C CG  . LEU C 3 11  ? 45.199  18.664  -15.293 1.00 96.61  ? 11  LEU L CG  1 
ATOM   3763 C CD1 . LEU C 3 11  ? 45.304  17.203  -15.684 1.00 105.85 ? 11  LEU L CD1 1 
ATOM   3764 C CD2 . LEU C 3 11  ? 46.492  19.120  -14.642 1.00 91.97  ? 11  LEU L CD2 1 
ATOM   3765 N N   . SER C 3 12  ? 45.011  17.788  -18.822 1.00 108.19 ? 12  SER L N   1 
ATOM   3766 C CA  . SER C 3 12  ? 45.313  16.564  -19.538 1.00 101.29 ? 12  SER L CA  1 
ATOM   3767 C C   . SER C 3 12  ? 46.750  16.150  -19.278 1.00 94.65  ? 12  SER L C   1 
ATOM   3768 O O   . SER C 3 12  ? 47.664  16.961  -19.398 1.00 100.24 ? 12  SER L O   1 
ATOM   3769 C CB  . SER C 3 12  ? 45.084  16.769  -21.032 1.00 110.32 ? 12  SER L CB  1 
ATOM   3770 O OG  . SER C 3 12  ? 45.625  18.011  -21.447 1.00 120.22 ? 12  SER L OG  1 
ATOM   3771 N N   . ALA C 3 13  ? 46.949  14.887  -18.919 1.00 90.62  ? 13  ALA L N   1 
ATOM   3772 C CA  . ALA C 3 13  ? 48.292  14.377  -18.660 1.00 94.70  ? 13  ALA L CA  1 
ATOM   3773 C C   . ALA C 3 13  ? 48.464  12.933  -19.121 1.00 100.44 ? 13  ALA L C   1 
ATOM   3774 O O   . ALA C 3 13  ? 47.493  12.236  -19.408 1.00 100.26 ? 13  ALA L O   1 
ATOM   3775 C CB  . ALA C 3 13  ? 48.634  14.509  -17.189 1.00 80.63  ? 13  ALA L CB  1 
ATOM   3776 N N   . SER C 3 14  ? 49.715  12.494  -19.186 1.00 102.77 ? 14  SER L N   1 
ATOM   3777 C CA  . SER C 3 14  ? 50.047  11.159  -19.660 1.00 110.97 ? 14  SER L CA  1 
ATOM   3778 C C   . SER C 3 14  ? 50.358  10.230  -18.498 1.00 111.92 ? 14  SER L C   1 
ATOM   3779 O O   . SER C 3 14  ? 50.603  10.684  -17.378 1.00 118.04 ? 14  SER L O   1 
ATOM   3780 C CB  . SER C 3 14  ? 51.255  11.218  -20.601 1.00 128.12 ? 14  SER L CB  1 
ATOM   3781 O OG  . SER C 3 14  ? 51.080  12.199  -21.609 1.00 134.36 ? 14  SER L OG  1 
ATOM   3782 N N   . VAL C 3 15  ? 50.360  8.929   -18.769 1.00 103.80 ? 15  VAL L N   1 
ATOM   3783 C CA  . VAL C 3 15  ? 50.701  7.941   -17.753 1.00 100.78 ? 15  VAL L CA  1 
ATOM   3784 C C   . VAL C 3 15  ? 52.158  8.078   -17.299 1.00 112.81 ? 15  VAL L C   1 
ATOM   3785 O O   . VAL C 3 15  ? 53.080  8.035   -18.117 1.00 114.56 ? 15  VAL L O   1 
ATOM   3786 C CB  . VAL C 3 15  ? 50.435  6.507   -18.254 1.00 92.73  ? 15  VAL L CB  1 
ATOM   3787 C CG1 . VAL C 3 15  ? 51.086  5.490   -17.337 1.00 96.31  ? 15  VAL L CG1 1 
ATOM   3788 C CG2 . VAL C 3 15  ? 48.942  6.254   -18.358 1.00 87.01  ? 15  VAL L CG2 1 
ATOM   3789 N N   . GLY C 3 16  ? 52.357  8.263   -15.995 1.00 113.96 ? 16  GLY L N   1 
ATOM   3790 C CA  . GLY C 3 16  ? 53.692  8.329   -15.424 1.00 109.00 ? 16  GLY L CA  1 
ATOM   3791 C C   . GLY C 3 16  ? 54.152  9.733   -15.082 1.00 106.94 ? 16  GLY L C   1 
ATOM   3792 O O   . GLY C 3 16  ? 55.287  9.934   -14.647 1.00 110.03 ? 16  GLY L O   1 
ATOM   3793 N N   . ASP C 3 17  ? 53.270  10.709  -15.278 1.00 106.27 ? 17  ASP L N   1 
ATOM   3794 C CA  . ASP C 3 17  ? 53.609  12.103  -15.021 1.00 109.79 ? 17  ASP L CA  1 
ATOM   3795 C C   . ASP C 3 17  ? 53.370  12.485  -13.574 1.00 107.15 ? 17  ASP L C   1 
ATOM   3796 O O   . ASP C 3 17  ? 52.591  11.843  -12.874 1.00 99.15  ? 17  ASP L O   1 
ATOM   3797 C CB  . ASP C 3 17  ? 52.779  13.031  -15.906 1.00 108.45 ? 17  ASP L CB  1 
ATOM   3798 C CG  . ASP C 3 17  ? 53.079  12.858  -17.366 1.00 113.94 ? 17  ASP L CG  1 
ATOM   3799 O OD1 . ASP C 3 17  ? 52.233  13.268  -18.187 1.00 117.31 ? 17  ASP L OD1 1 
ATOM   3800 O OD2 . ASP C 3 17  ? 54.155  12.312  -17.690 1.00 118.93 ? 17  ASP L OD2 1 
ATOM   3801 N N   . ARG C 3 18  ? 54.042  13.543  -13.136 1.00 112.98 ? 18  ARG L N   1 
ATOM   3802 C CA  . ARG C 3 18  ? 53.741  14.144  -11.848 1.00 120.67 ? 18  ARG L CA  1 
ATOM   3803 C C   . ARG C 3 18  ? 52.723  15.258  -12.062 1.00 123.22 ? 18  ARG L C   1 
ATOM   3804 O O   . ARG C 3 18  ? 53.007  16.251  -12.732 1.00 127.44 ? 18  ARG L O   1 
ATOM   3805 C CB  . ARG C 3 18  ? 55.010  14.688  -11.189 1.00 125.66 ? 18  ARG L CB  1 
ATOM   3806 C CG  . ARG C 3 18  ? 54.798  15.223  -9.780  1.00 116.79 ? 18  ARG L CG  1 
ATOM   3807 C CD  . ARG C 3 18  ? 56.110  15.656  -9.146  1.00 119.88 ? 18  ARG L CD  1 
ATOM   3808 N NE  . ARG C 3 18  ? 55.902  16.336  -7.869  1.00 126.93 ? 18  ARG L NE  1 
ATOM   3809 C CZ  . ARG C 3 18  ? 55.886  15.724  -6.687  1.00 132.22 ? 18  ARG L CZ  1 
ATOM   3810 N NH1 . ARG C 3 18  ? 56.067  14.412  -6.614  1.00 136.58 ? 18  ARG L NH1 1 
ATOM   3811 N NH2 . ARG C 3 18  ? 55.690  16.421  -5.575  1.00 129.39 ? 18  ARG L NH2 1 
ATOM   3812 N N   . VAL C 3 19  ? 51.531  15.075  -11.503 1.00 117.89 ? 19  VAL L N   1 
ATOM   3813 C CA  . VAL C 3 19  ? 50.450  16.042  -11.654 1.00 106.11 ? 19  VAL L CA  1 
ATOM   3814 C C   . VAL C 3 19  ? 50.019  16.600  -10.303 1.00 102.13 ? 19  VAL L C   1 
ATOM   3815 O O   . VAL C 3 19  ? 50.131  15.927  -9.279  1.00 98.10  ? 19  VAL L O   1 
ATOM   3816 C CB  . VAL C 3 19  ? 49.231  15.414  -12.353 1.00 92.41  ? 19  VAL L CB  1 
ATOM   3817 C CG1 . VAL C 3 19  ? 49.514  15.210  -13.823 1.00 93.79  ? 19  VAL L CG1 1 
ATOM   3818 C CG2 . VAL C 3 19  ? 48.869  14.099  -11.695 1.00 92.03  ? 19  VAL L CG2 1 
ATOM   3819 N N   . THR C 3 20  ? 49.524  17.833  -10.302 1.00 97.74  ? 20  THR L N   1 
ATOM   3820 C CA  . THR C 3 20  ? 49.117  18.466  -9.059  1.00 93.36  ? 20  THR L CA  1 
ATOM   3821 C C   . THR C 3 20  ? 47.885  19.351  -9.219  1.00 89.89  ? 20  THR L C   1 
ATOM   3822 O O   . THR C 3 20  ? 47.932  20.380  -9.887  1.00 89.07  ? 20  THR L O   1 
ATOM   3823 C CB  . THR C 3 20  ? 50.264  19.304  -8.449  1.00 105.72 ? 20  THR L CB  1 
ATOM   3824 O OG1 . THR C 3 20  ? 51.476  18.540  -8.447  1.00 109.30 ? 20  THR L OG1 1 
ATOM   3825 C CG2 . THR C 3 20  ? 49.930  19.708  -7.016  1.00 106.79 ? 20  THR L CG2 1 
ATOM   3826 N N   . ILE C 3 21  ? 46.787  18.940  -8.595  1.00 93.39  ? 21  ILE L N   1 
ATOM   3827 C CA  . ILE C 3 21  ? 45.596  19.771  -8.497  1.00 99.54  ? 21  ILE L CA  1 
ATOM   3828 C C   . ILE C 3 21  ? 45.720  20.661  -7.273  1.00 96.64  ? 21  ILE L C   1 
ATOM   3829 O O   . ILE C 3 21  ? 46.355  20.284  -6.292  1.00 104.47 ? 21  ILE L O   1 
ATOM   3830 C CB  . ILE C 3 21  ? 44.331  18.916  -8.332  1.00 105.12 ? 21  ILE L CB  1 
ATOM   3831 C CG1 . ILE C 3 21  ? 44.186  17.955  -9.509  1.00 111.84 ? 21  ILE L CG1 1 
ATOM   3832 C CG2 . ILE C 3 21  ? 43.089  19.799  -8.186  1.00 104.08 ? 21  ILE L CG2 1 
ATOM   3833 C CD1 . ILE C 3 21  ? 43.121  16.908  -9.288  1.00 117.99 ? 21  ILE L CD1 1 
ATOM   3834 N N   . THR C 3 22  ? 45.120  21.843  -7.327  1.00 86.76  ? 22  THR L N   1 
ATOM   3835 C CA  . THR C 3 22  ? 45.092  22.707  -6.158  1.00 90.77  ? 22  THR L CA  1 
ATOM   3836 C C   . THR C 3 22  ? 43.665  22.939  -5.692  1.00 81.23  ? 22  THR L C   1 
ATOM   3837 O O   . THR C 3 22  ? 42.705  22.663  -6.415  1.00 75.75  ? 22  THR L O   1 
ATOM   3838 C CB  . THR C 3 22  ? 45.767  24.069  -6.412  1.00 102.32 ? 22  THR L CB  1 
ATOM   3839 O OG1 . THR C 3 22  ? 44.892  24.912  -7.173  1.00 110.77 ? 22  THR L OG1 1 
ATOM   3840 C CG2 . THR C 3 22  ? 47.091  23.891  -7.149  1.00 102.50 ? 22  THR L CG2 1 
ATOM   3841 N N   . CYS C 3 23  ? 43.550  23.446  -4.471  1.00 77.28  ? 23  CYS L N   1 
ATOM   3842 C CA  . CYS C 3 23  ? 42.271  23.731  -3.848  1.00 81.12  ? 23  CYS L CA  1 
ATOM   3843 C C   . CYS C 3 23  ? 42.476  24.899  -2.902  1.00 92.92  ? 23  CYS L C   1 
ATOM   3844 O O   . CYS C 3 23  ? 43.529  25.021  -2.280  1.00 96.04  ? 23  CYS L O   1 
ATOM   3845 C CB  . CYS C 3 23  ? 41.782  22.512  -3.072  1.00 73.02  ? 23  CYS L CB  1 
ATOM   3846 S SG  . CYS C 3 23  ? 40.109  22.646  -2.423  1.00 91.16  ? 23  CYS L SG  1 
ATOM   3847 N N   . ARG C 3 24  ? 41.484  25.771  -2.797  1.00 97.36  ? 24  ARG L N   1 
ATOM   3848 C CA  . ARG C 3 24  ? 41.605  26.897  -1.882  1.00 109.86 ? 24  ARG L CA  1 
ATOM   3849 C C   . ARG C 3 24  ? 40.269  27.321  -1.299  1.00 103.39 ? 24  ARG L C   1 
ATOM   3850 O O   . ARG C 3 24  ? 39.232  27.272  -1.968  1.00 102.50 ? 24  ARG L O   1 
ATOM   3851 C CB  . ARG C 3 24  ? 42.331  28.078  -2.535  1.00 128.60 ? 24  ARG L CB  1 
ATOM   3852 C CG  . ARG C 3 24  ? 41.902  28.378  -3.957  1.00 140.16 ? 24  ARG L CG  1 
ATOM   3853 C CD  . ARG C 3 24  ? 42.632  29.589  -4.518  1.00 148.35 ? 24  ARG L CD  1 
ATOM   3854 N NE  . ARG C 3 24  ? 42.585  29.623  -5.979  1.00 154.79 ? 24  ARG L NE  1 
ATOM   3855 C CZ  . ARG C 3 24  ? 41.584  30.131  -6.691  1.00 154.31 ? 24  ARG L CZ  1 
ATOM   3856 N NH1 . ARG C 3 24  ? 40.531  30.657  -6.081  1.00 152.81 ? 24  ARG L NH1 1 
ATOM   3857 N NH2 . ARG C 3 24  ? 41.635  30.115  -8.016  1.00 154.14 ? 24  ARG L NH2 1 
ATOM   3858 N N   . ALA C 3 25  ? 40.317  27.736  -0.039  1.00 92.92  ? 25  ALA L N   1 
ATOM   3859 C CA  . ALA C 3 25  ? 39.120  28.002  0.737   1.00 92.68  ? 25  ALA L CA  1 
ATOM   3860 C C   . ALA C 3 25  ? 38.864  29.489  0.867   1.00 96.76  ? 25  ALA L C   1 
ATOM   3861 O O   . ALA C 3 25  ? 39.802  30.275  0.962   1.00 95.16  ? 25  ALA L O   1 
ATOM   3862 C CB  . ALA C 3 25  ? 39.249  27.377  2.114   1.00 92.40  ? 25  ALA L CB  1 
ATOM   3863 N N   . SER C 3 26  ? 37.591  29.867  0.893   1.00 94.61  ? 26  SER L N   1 
ATOM   3864 C CA  . SER C 3 26  ? 37.220  31.261  1.084   1.00 89.50  ? 26  SER L CA  1 
ATOM   3865 C C   . SER C 3 26  ? 37.615  31.764  2.471   1.00 99.69  ? 26  SER L C   1 
ATOM   3866 O O   . SER C 3 26  ? 37.715  32.972  2.691   1.00 107.30 ? 26  SER L O   1 
ATOM   3867 C CB  . SER C 3 26  ? 35.722  31.463  0.843   1.00 84.44  ? 26  SER L CB  1 
ATOM   3868 O OG  . SER C 3 26  ? 34.947  30.835  1.850   1.00 89.78  ? 26  SER L OG  1 
ATOM   3869 N N   . GLN C 3 27  ? 37.830  30.837  3.403   1.00 98.02  ? 27  GLN L N   1 
ATOM   3870 C CA  . GLN C 3 27  ? 38.292  31.180  4.747   1.00 98.99  ? 27  GLN L CA  1 
ATOM   3871 C C   . GLN C 3 27  ? 39.453  30.297  5.179   1.00 103.84 ? 27  GLN L C   1 
ATOM   3872 O O   . GLN C 3 27  ? 40.156  29.716  4.354   1.00 110.00 ? 27  GLN L O   1 
ATOM   3873 C CB  . GLN C 3 27  ? 37.169  31.024  5.772   1.00 90.79  ? 27  GLN L CB  1 
ATOM   3874 C CG  . GLN C 3 27  ? 36.029  31.996  5.627   1.00 97.04  ? 27  GLN L CG  1 
ATOM   3875 C CD  . GLN C 3 27  ? 34.867  31.636  6.525   1.00 110.50 ? 27  GLN L CD  1 
ATOM   3876 O OE1 . GLN C 3 27  ? 33.746  32.109  6.330   1.00 118.38 ? 27  GLN L OE1 1 
ATOM   3877 N NE2 . GLN C 3 27  ? 35.125  30.783  7.514   1.00 112.56 ? 27  GLN L NE2 1 
ATOM   3878 N N   . GLY C 3 28  ? 39.641  30.203  6.491   1.00 92.49  ? 28  GLY L N   1 
ATOM   3879 C CA  . GLY C 3 28  ? 40.616  29.297  7.061   1.00 75.96  ? 28  GLY L CA  1 
ATOM   3880 C C   . GLY C 3 28  ? 39.910  28.018  7.443   1.00 81.21  ? 28  GLY L C   1 
ATOM   3881 O O   . GLY C 3 28  ? 38.809  28.050  7.998   1.00 84.40  ? 28  GLY L O   1 
ATOM   3882 N N   . ILE C 3 29  ? 40.530  26.887  7.132   1.00 81.85  ? 29  ILE L N   1 
ATOM   3883 C CA  . ILE C 3 29  ? 39.921  25.598  7.419   1.00 80.36  ? 29  ILE L CA  1 
ATOM   3884 C C   . ILE C 3 29  ? 40.933  24.679  8.087   1.00 88.36  ? 29  ILE L C   1 
ATOM   3885 O O   . ILE C 3 29  ? 40.744  23.462  8.147   1.00 87.52  ? 29  ILE L O   1 
ATOM   3886 C CB  . ILE C 3 29  ? 39.350  24.944  6.143   1.00 69.69  ? 29  ILE L CB  1 
ATOM   3887 C CG1 . ILE C 3 29  ? 40.459  24.702  5.124   1.00 69.92  ? 29  ILE L CG1 1 
ATOM   3888 C CG2 . ILE C 3 29  ? 38.259  25.814  5.540   1.00 59.28  ? 29  ILE L CG2 1 
ATOM   3889 C CD1 . ILE C 3 29  ? 40.021  23.873  3.954   1.00 65.06  ? 29  ILE L CD1 1 
ATOM   3890 N N   . SER C 3 30  ? 42.006  25.280  8.594   1.00 91.46  ? 30  SER L N   1 
ATOM   3891 C CA  . SER C 3 30  ? 43.039  24.544  9.310   1.00 93.61  ? 30  SER L CA  1 
ATOM   3892 C C   . SER C 3 30  ? 43.661  23.506  8.391   1.00 88.42  ? 30  SER L C   1 
ATOM   3893 O O   . SER C 3 30  ? 44.178  23.843  7.336   1.00 93.36  ? 30  SER L O   1 
ATOM   3894 C CB  . SER C 3 30  ? 42.451  23.881  10.557  1.00 104.97 ? 30  SER L CB  1 
ATOM   3895 O OG  . SER C 3 30  ? 43.468  23.355  11.389  1.00 117.76 ? 30  SER L OG  1 
ATOM   3896 N N   . SER C 3 31  ? 43.614  22.241  8.784   1.00 83.79  ? 31  SER L N   1 
ATOM   3897 C CA  . SER C 3 31  ? 44.052  21.172  7.893   1.00 80.24  ? 31  SER L CA  1 
ATOM   3898 C C   . SER C 3 31  ? 42.886  20.240  7.587   1.00 78.41  ? 31  SER L C   1 
ATOM   3899 O O   . SER C 3 31  ? 43.073  19.107  7.138   1.00 81.03  ? 31  SER L O   1 
ATOM   3900 C CB  . SER C 3 31  ? 45.220  20.389  8.490   1.00 80.87  ? 31  SER L CB  1 
ATOM   3901 O OG  . SER C 3 31  ? 46.461  20.991  8.160   1.00 83.85  ? 31  SER L OG  1 
ATOM   3902 N N   . TRP C 3 32  ? 41.676  20.735  7.830   1.00 72.87  ? 32  TRP L N   1 
ATOM   3903 C CA  . TRP C 3 32  ? 40.471  19.941  7.647   1.00 74.79  ? 32  TRP L CA  1 
ATOM   3904 C C   . TRP C 3 32  ? 39.983  19.931  6.207   1.00 76.85  ? 32  TRP L C   1 
ATOM   3905 O O   . TRP C 3 32  ? 38.940  20.496  5.880   1.00 81.63  ? 32  TRP L O   1 
ATOM   3906 C CB  . TRP C 3 32  ? 39.372  20.414  8.597   1.00 83.77  ? 32  TRP L CB  1 
ATOM   3907 C CG  . TRP C 3 32  ? 39.825  20.458  10.026  1.00 92.28  ? 32  TRP L CG  1 
ATOM   3908 C CD1 . TRP C 3 32  ? 39.678  21.494  10.899  1.00 97.47  ? 32  TRP L CD1 1 
ATOM   3909 C CD2 . TRP C 3 32  ? 40.525  19.430  10.735  1.00 87.86  ? 32  TRP L CD2 1 
ATOM   3910 N NE1 . TRP C 3 32  ? 40.231  21.171  12.113  1.00 97.45  ? 32  TRP L NE1 1 
ATOM   3911 C CE2 . TRP C 3 32  ? 40.759  19.911  12.038  1.00 92.12  ? 32  TRP L CE2 1 
ATOM   3912 C CE3 . TRP C 3 32  ? 40.973  18.150  10.401  1.00 82.90  ? 32  TRP L CE3 1 
ATOM   3913 C CZ2 . TRP C 3 32  ? 41.417  19.155  13.002  1.00 93.43  ? 32  TRP L CZ2 1 
ATOM   3914 C CZ3 . TRP C 3 32  ? 41.627  17.402  11.359  1.00 81.47  ? 32  TRP L CZ3 1 
ATOM   3915 C CH2 . TRP C 3 32  ? 41.843  17.906  12.645  1.00 85.17  ? 32  TRP L CH2 1 
ATOM   3916 N N   . LEU C 3 33  ? 40.751  19.266  5.355   1.00 73.54  ? 33  LEU L N   1 
ATOM   3917 C CA  . LEU C 3 33  ? 40.382  19.092  3.963   1.00 69.33  ? 33  LEU L CA  1 
ATOM   3918 C C   . LEU C 3 33  ? 40.547  17.635  3.566   1.00 64.01  ? 33  LEU L C   1 
ATOM   3919 O O   . LEU C 3 33  ? 41.551  17.002  3.892   1.00 67.77  ? 33  LEU L O   1 
ATOM   3920 C CB  . LEU C 3 33  ? 41.250  19.967  3.060   1.00 70.58  ? 33  LEU L CB  1 
ATOM   3921 C CG  . LEU C 3 33  ? 40.891  19.949  1.575   1.00 72.91  ? 33  LEU L CG  1 
ATOM   3922 C CD1 . LEU C 3 33  ? 39.946  21.090  1.230   1.00 65.04  ? 33  LEU L CD1 1 
ATOM   3923 C CD2 . LEU C 3 33  ? 42.152  20.018  0.740   1.00 87.80  ? 33  LEU L CD2 1 
ATOM   3924 N N   . ALA C 3 34  ? 39.553  17.111  2.861   1.00 52.75  ? 34  ALA L N   1 
ATOM   3925 C CA  . ALA C 3 34  ? 39.630  15.768  2.310   1.00 59.40  ? 34  ALA L CA  1 
ATOM   3926 C C   . ALA C 3 34  ? 39.570  15.828  0.788   1.00 66.19  ? 34  ALA L C   1 
ATOM   3927 O O   . ALA C 3 34  ? 39.020  16.766  0.220   1.00 61.96  ? 34  ALA L O   1 
ATOM   3928 C CB  . ALA C 3 34  ? 38.502  14.904  2.856   1.00 55.03  ? 34  ALA L CB  1 
ATOM   3929 N N   . TRP C 3 35  ? 40.146  14.825  0.135   1.00 71.36  ? 35  TRP L N   1 
ATOM   3930 C CA  . TRP C 3 35  ? 40.104  14.721  -1.316  1.00 61.45  ? 35  TRP L CA  1 
ATOM   3931 C C   . TRP C 3 35  ? 39.356  13.462  -1.734  1.00 65.07  ? 35  TRP L C   1 
ATOM   3932 O O   . TRP C 3 35  ? 39.603  12.384  -1.196  1.00 68.82  ? 35  TRP L O   1 
ATOM   3933 C CB  . TRP C 3 35  ? 41.520  14.677  -1.885  1.00 64.52  ? 35  TRP L CB  1 
ATOM   3934 C CG  . TRP C 3 35  ? 42.238  15.983  -1.824  1.00 76.42  ? 35  TRP L CG  1 
ATOM   3935 C CD1 . TRP C 3 35  ? 43.081  16.413  -0.843  1.00 81.47  ? 35  TRP L CD1 1 
ATOM   3936 C CD2 . TRP C 3 35  ? 42.179  17.039  -2.791  1.00 81.82  ? 35  TRP L CD2 1 
ATOM   3937 N NE1 . TRP C 3 35  ? 43.549  17.672  -1.137  1.00 83.06  ? 35  TRP L NE1 1 
ATOM   3938 C CE2 . TRP C 3 35  ? 43.008  18.076  -2.329  1.00 85.47  ? 35  TRP L CE2 1 
ATOM   3939 C CE3 . TRP C 3 35  ? 41.500  17.203  -4.003  1.00 74.29  ? 35  TRP L CE3 1 
ATOM   3940 C CZ2 . TRP C 3 35  ? 43.178  19.263  -3.037  1.00 85.48  ? 35  TRP L CZ2 1 
ATOM   3941 C CZ3 . TRP C 3 35  ? 41.669  18.381  -4.700  1.00 75.01  ? 35  TRP L CZ3 1 
ATOM   3942 C CH2 . TRP C 3 35  ? 42.502  19.395  -4.218  1.00 78.40  ? 35  TRP L CH2 1 
ATOM   3943 N N   . TYR C 3 36  ? 38.438  13.598  -2.684  1.00 59.09  ? 36  TYR L N   1 
ATOM   3944 C CA  . TYR C 3 36  ? 37.761  12.436  -3.243  1.00 54.18  ? 36  TYR L CA  1 
ATOM   3945 C C   . TYR C 3 36  ? 38.016  12.316  -4.730  1.00 55.22  ? 36  TYR L C   1 
ATOM   3946 O O   . TYR C 3 36  ? 38.274  13.306  -5.411  1.00 66.97  ? 36  TYR L O   1 
ATOM   3947 C CB  . TYR C 3 36  ? 36.262  12.508  -3.000  1.00 48.70  ? 36  TYR L CB  1 
ATOM   3948 C CG  . TYR C 3 36  ? 35.926  12.851  -1.589  1.00 53.64  ? 36  TYR L CG  1 
ATOM   3949 C CD1 . TYR C 3 36  ? 35.688  11.860  -0.644  1.00 54.32  ? 36  TYR L CD1 1 
ATOM   3950 C CD2 . TYR C 3 36  ? 35.869  14.170  -1.187  1.00 58.70  ? 36  TYR L CD2 1 
ATOM   3951 C CE1 . TYR C 3 36  ? 35.388  12.181  0.655   1.00 57.72  ? 36  TYR L CE1 1 
ATOM   3952 C CE2 . TYR C 3 36  ? 35.570  14.502  0.116   1.00 63.44  ? 36  TYR L CE2 1 
ATOM   3953 C CZ  . TYR C 3 36  ? 35.333  13.508  1.027   1.00 62.59  ? 36  TYR L CZ  1 
ATOM   3954 O OH  . TYR C 3 36  ? 35.039  13.871  2.311   1.00 65.24  ? 36  TYR L OH  1 
ATOM   3955 N N   . GLN C 3 37  ? 37.928  11.089  -5.220  1.00 52.56  ? 37  GLN L N   1 
ATOM   3956 C CA  . GLN C 3 37  ? 38.035  10.786  -6.633  1.00 44.79  ? 37  GLN L CA  1 
ATOM   3957 C C   . GLN C 3 37  ? 36.721  10.189  -7.108  1.00 47.05  ? 37  GLN L C   1 
ATOM   3958 O O   . GLN C 3 37  ? 36.182  9.307   -6.457  1.00 57.08  ? 37  GLN L O   1 
ATOM   3959 C CB  . GLN C 3 37  ? 39.136  9.755   -6.835  1.00 47.39  ? 37  GLN L CB  1 
ATOM   3960 C CG  . GLN C 3 37  ? 38.892  8.871   -8.032  1.00 61.71  ? 37  GLN L CG  1 
ATOM   3961 C CD  . GLN C 3 37  ? 39.791  7.654   -8.074  1.00 69.99  ? 37  GLN L CD  1 
ATOM   3962 O OE1 . GLN C 3 37  ? 41.019  7.767   -8.188  1.00 70.01  ? 37  GLN L OE1 1 
ATOM   3963 N NE2 . GLN C 3 37  ? 39.178  6.473   -8.007  1.00 67.00  ? 37  GLN L NE2 1 
ATOM   3964 N N   . GLN C 3 38  ? 36.202  10.653  -8.241  1.00 53.83  ? 38  GLN L N   1 
ATOM   3965 C CA  . GLN C 3 38  ? 34.993  10.048  -8.819  1.00 57.42  ? 38  GLN L CA  1 
ATOM   3966 C C   . GLN C 3 38  ? 35.153  9.695   -10.300 1.00 58.80  ? 38  GLN L C   1 
ATOM   3967 O O   . GLN C 3 38  ? 35.783  10.434  -11.052 1.00 63.12  ? 38  GLN L O   1 
ATOM   3968 C CB  . GLN C 3 38  ? 33.772  10.955  -8.629  1.00 44.61  ? 38  GLN L CB  1 
ATOM   3969 C CG  . GLN C 3 38  ? 32.443  10.249  -8.863  1.00 48.69  ? 38  GLN L CG  1 
ATOM   3970 C CD  . GLN C 3 38  ? 31.256  11.163  -8.661  1.00 52.69  ? 38  GLN L CD  1 
ATOM   3971 O OE1 . GLN C 3 38  ? 31.378  12.378  -8.778  1.00 59.91  ? 38  GLN L OE1 1 
ATOM   3972 N NE2 . GLN C 3 38  ? 30.099  10.586  -8.347  1.00 48.24  ? 38  GLN L NE2 1 
ATOM   3973 N N   . LYS C 3 39  ? 34.583  8.565   -10.711 1.00 53.18  ? 39  LYS L N   1 
ATOM   3974 C CA  . LYS C 3 39  ? 34.564  8.178   -12.125 1.00 54.91  ? 39  LYS L CA  1 
ATOM   3975 C C   . LYS C 3 39  ? 33.135  8.191   -12.694 1.00 65.71  ? 39  LYS L C   1 
ATOM   3976 O O   . LYS C 3 39  ? 32.172  8.136   -11.939 1.00 80.02  ? 39  LYS L O   1 
ATOM   3977 C CB  . LYS C 3 39  ? 35.227  6.816   -12.309 1.00 40.89  ? 39  LYS L CB  1 
ATOM   3978 C CG  . LYS C 3 39  ? 36.738  6.852   -12.146 1.00 51.08  ? 39  LYS L CG  1 
ATOM   3979 C CD  . LYS C 3 39  ? 37.327  5.451   -12.022 1.00 54.83  ? 39  LYS L CD  1 
ATOM   3980 C CE  . LYS C 3 39  ? 38.828  5.488   -11.739 1.00 58.98  ? 39  LYS L CE  1 
ATOM   3981 N NZ  . LYS C 3 39  ? 39.419  4.122   -11.585 1.00 59.80  ? 39  LYS L NZ  1 
ATOM   3982 N N   . PRO C 3 40  ? 32.993  8.268   -14.028 1.00 80.28  ? 40  PRO L N   1 
ATOM   3983 C CA  . PRO C 3 40  ? 31.691  8.502   -14.664 1.00 82.83  ? 40  PRO L CA  1 
ATOM   3984 C C   . PRO C 3 40  ? 30.444  8.061   -13.894 1.00 80.98  ? 40  PRO L C   1 
ATOM   3985 O O   . PRO C 3 40  ? 29.788  8.922   -13.313 1.00 97.88  ? 40  PRO L O   1 
ATOM   3986 C CB  . PRO C 3 40  ? 31.833  7.769   -15.992 1.00 89.22  ? 40  PRO L CB  1 
ATOM   3987 C CG  . PRO C 3 40  ? 33.267  8.052   -16.362 1.00 92.15  ? 40  PRO L CG  1 
ATOM   3988 C CD  . PRO C 3 40  ? 34.050  8.127   -15.049 1.00 94.06  ? 40  PRO L CD  1 
ATOM   3989 N N   . GLU C 3 41  ? 30.100  6.783   -13.885 1.00 62.13  ? 41  GLU L N   1 
ATOM   3990 C CA  . GLU C 3 41  ? 28.824  6.405   -13.284 1.00 70.51  ? 41  GLU L CA  1 
ATOM   3991 C C   . GLU C 3 41  ? 28.991  5.878   -11.873 1.00 89.31  ? 41  GLU L C   1 
ATOM   3992 O O   . GLU C 3 41  ? 28.016  5.567   -11.180 1.00 96.16  ? 41  GLU L O   1 
ATOM   3993 C CB  . GLU C 3 41  ? 28.108  5.387   -14.153 1.00 73.21  ? 41  GLU L CB  1 
ATOM   3994 C CG  . GLU C 3 41  ? 27.697  5.952   -15.486 1.00 78.53  ? 41  GLU L CG  1 
ATOM   3995 C CD  . GLU C 3 41  ? 27.681  4.903   -16.552 1.00 84.07  ? 41  GLU L CD  1 
ATOM   3996 O OE1 . GLU C 3 41  ? 28.139  5.212   -17.672 1.00 87.99  ? 41  GLU L OE1 1 
ATOM   3997 O OE2 . GLU C 3 41  ? 27.232  3.771   -16.259 1.00 81.95  ? 41  GLU L OE2 1 
ATOM   3998 N N   . LYS C 3 42  ? 30.247  5.805   -11.453 1.00 90.55  ? 42  LYS L N   1 
ATOM   3999 C CA  . LYS C 3 42  ? 30.610  5.271   -10.154 1.00 79.49  ? 42  LYS L CA  1 
ATOM   4000 C C   . LYS C 3 42  ? 30.462  6.306   -9.054  1.00 74.13  ? 42  LYS L C   1 
ATOM   4001 O O   . LYS C 3 42  ? 30.353  7.504   -9.318  1.00 68.69  ? 42  LYS L O   1 
ATOM   4002 C CB  . LYS C 3 42  ? 32.052  4.763   -10.194 1.00 79.54  ? 42  LYS L CB  1 
ATOM   4003 C CG  . LYS C 3 42  ? 32.189  3.332   -10.684 1.00 85.16  ? 42  LYS L CG  1 
ATOM   4004 C CD  . LYS C 3 42  ? 31.415  3.082   -11.971 1.00 86.94  ? 42  LYS L CD  1 
ATOM   4005 C CE  . LYS C 3 42  ? 31.303  1.591   -12.243 1.00 95.17  ? 42  LYS L CE  1 
ATOM   4006 N NZ  . LYS C 3 42  ? 32.627  0.916   -12.113 1.00 100.27 ? 42  LYS L NZ  1 
ATOM   4007 N N   . ALA C 3 43  ? 30.456  5.822   -7.816  1.00 72.32  ? 43  ALA L N   1 
ATOM   4008 C CA  . ALA C 3 43  ? 30.466  6.679   -6.644  1.00 67.77  ? 43  ALA L CA  1 
ATOM   4009 C C   . ALA C 3 43  ? 31.882  7.169   -6.369  1.00 62.11  ? 43  ALA L C   1 
ATOM   4010 O O   . ALA C 3 43  ? 32.843  6.642   -6.929  1.00 64.63  ? 43  ALA L O   1 
ATOM   4011 C CB  . ALA C 3 43  ? 29.936  5.921   -5.449  1.00 75.29  ? 43  ALA L CB  1 
ATOM   4012 N N   . PRO C 3 44  ? 32.013  8.181   -5.498  1.00 56.34  ? 44  PRO L N   1 
ATOM   4013 C CA  . PRO C 3 44  ? 33.322  8.716   -5.105  1.00 57.29  ? 44  PRO L CA  1 
ATOM   4014 C C   . PRO C 3 44  ? 34.081  7.755   -4.191  1.00 59.57  ? 44  PRO L C   1 
ATOM   4015 O O   . PRO C 3 44  ? 33.464  7.070   -3.377  1.00 61.24  ? 44  PRO L O   1 
ATOM   4016 C CB  . PRO C 3 44  ? 32.967  9.987   -4.321  1.00 47.99  ? 44  PRO L CB  1 
ATOM   4017 C CG  . PRO C 3 44  ? 31.536  10.248  -4.585  1.00 40.25  ? 44  PRO L CG  1 
ATOM   4018 C CD  . PRO C 3 44  ? 30.905  8.941   -4.902  1.00 44.52  ? 44  PRO L CD  1 
ATOM   4019 N N   . LYS C 3 45  ? 35.402  7.714   -4.336  1.00 52.72  ? 45  LYS L N   1 
ATOM   4020 C CA  . LYS C 3 45  ? 36.272  6.956   -3.449  1.00 48.68  ? 45  LYS L CA  1 
ATOM   4021 C C   . LYS C 3 45  ? 36.981  7.978   -2.576  1.00 56.62  ? 45  LYS L C   1 
ATOM   4022 O O   . LYS C 3 45  ? 37.383  9.030   -3.063  1.00 55.79  ? 45  LYS L O   1 
ATOM   4023 C CB  . LYS C 3 45  ? 37.299  6.162   -4.262  1.00 43.21  ? 45  LYS L CB  1 
ATOM   4024 C CG  . LYS C 3 45  ? 37.790  4.871   -3.622  1.00 55.97  ? 45  LYS L CG  1 
ATOM   4025 C CD  . LYS C 3 45  ? 39.105  4.392   -4.233  1.00 70.01  ? 45  LYS L CD  1 
ATOM   4026 C CE  . LYS C 3 45  ? 39.734  3.259   -3.420  1.00 82.04  ? 45  LYS L CE  1 
ATOM   4027 N NZ  . LYS C 3 45  ? 41.230  3.205   -3.525  1.00 82.66  ? 45  LYS L NZ  1 
ATOM   4028 N N   . SER C 3 46  ? 37.125  7.686   -1.286  1.00 68.02  ? 46  SER L N   1 
ATOM   4029 C CA  . SER C 3 46  ? 37.814  8.600   -0.366  1.00 63.77  ? 46  SER L CA  1 
ATOM   4030 C C   . SER C 3 46  ? 39.322  8.364   -0.312  1.00 66.46  ? 46  SER L C   1 
ATOM   4031 O O   . SER C 3 46  ? 39.779  7.296   0.092   1.00 70.66  ? 46  SER L O   1 
ATOM   4032 C CB  . SER C 3 46  ? 37.215  8.493   1.030   1.00 52.94  ? 46  SER L CB  1 
ATOM   4033 O OG  . SER C 3 46  ? 35.842  8.833   0.980   1.00 63.52  ? 46  SER L OG  1 
ATOM   4034 N N   . LEU C 3 47  ? 40.092  9.369   -0.715  1.00 60.65  ? 47  LEU L N   1 
ATOM   4035 C CA  . LEU C 3 47  ? 41.539  9.216   -0.824  1.00 68.04  ? 47  LEU L CA  1 
ATOM   4036 C C   . LEU C 3 47  ? 42.326  9.831   0.338   1.00 73.88  ? 47  LEU L C   1 
ATOM   4037 O O   . LEU C 3 47  ? 43.055  9.132   1.052   1.00 74.17  ? 47  LEU L O   1 
ATOM   4038 C CB  . LEU C 3 47  ? 42.037  9.830   -2.136  1.00 66.63  ? 47  LEU L CB  1 
ATOM   4039 C CG  . LEU C 3 47  ? 41.586  9.220   -3.462  1.00 59.13  ? 47  LEU L CG  1 
ATOM   4040 C CD1 . LEU C 3 47  ? 41.903  10.167  -4.594  1.00 45.87  ? 47  LEU L CD1 1 
ATOM   4041 C CD2 . LEU C 3 47  ? 42.267  7.893   -3.676  1.00 65.19  ? 47  LEU L CD2 1 
ATOM   4042 N N   . ILE C 3 48  ? 42.192  11.141  0.512   1.00 62.30  ? 48  ILE L N   1 
ATOM   4043 C CA  . ILE C 3 48  ? 43.029  11.851  1.469   1.00 65.47  ? 48  ILE L CA  1 
ATOM   4044 C C   . ILE C 3 48  ? 42.223  12.678  2.465   1.00 61.91  ? 48  ILE L C   1 
ATOM   4045 O O   . ILE C 3 48  ? 41.209  13.275  2.107   1.00 63.50  ? 48  ILE L O   1 
ATOM   4046 C CB  . ILE C 3 48  ? 44.060  12.741  0.733   1.00 67.01  ? 48  ILE L CB  1 
ATOM   4047 C CG1 . ILE C 3 48  ? 45.076  11.855  0.014   1.00 64.68  ? 48  ILE L CG1 1 
ATOM   4048 C CG2 . ILE C 3 48  ? 44.750  13.718  1.692   1.00 41.87  ? 48  ILE L CG2 1 
ATOM   4049 C CD1 . ILE C 3 48  ? 46.370  12.557  -0.358  1.00 66.95  ? 48  ILE L CD1 1 
ATOM   4050 N N   . TYR C 3 49  ? 42.676  12.688  3.719   1.00 60.85  ? 49  TYR L N   1 
ATOM   4051 C CA  . TYR C 3 49  ? 42.093  13.541  4.757   1.00 57.21  ? 49  TYR L CA  1 
ATOM   4052 C C   . TYR C 3 49  ? 43.176  14.280  5.527   1.00 60.50  ? 49  TYR L C   1 
ATOM   4053 O O   . TYR C 3 49  ? 44.369  14.059  5.315   1.00 65.87  ? 49  TYR L O   1 
ATOM   4054 C CB  . TYR C 3 49  ? 41.238  12.725  5.730   1.00 58.72  ? 49  TYR L CB  1 
ATOM   4055 C CG  . TYR C 3 49  ? 41.997  11.656  6.483   1.00 62.74  ? 49  TYR L CG  1 
ATOM   4056 C CD1 . TYR C 3 49  ? 42.302  10.445  5.884   1.00 61.21  ? 49  TYR L CD1 1 
ATOM   4057 C CD2 . TYR C 3 49  ? 42.407  11.859  7.798   1.00 66.19  ? 49  TYR L CD2 1 
ATOM   4058 C CE1 . TYR C 3 49  ? 42.994  9.466   6.565   1.00 74.34  ? 49  TYR L CE1 1 
ATOM   4059 C CE2 . TYR C 3 49  ? 43.104  10.884  8.488   1.00 64.68  ? 49  TYR L CE2 1 
ATOM   4060 C CZ  . TYR C 3 49  ? 43.393  9.687   7.864   1.00 73.78  ? 49  TYR L CZ  1 
ATOM   4061 O OH  . TYR C 3 49  ? 44.086  8.707   8.540   1.00 71.12  ? 49  TYR L OH  1 
ATOM   4062 N N   . ALA C 3 50  ? 42.750  15.158  6.425   1.00 65.17  ? 50  ALA L N   1 
ATOM   4063 C CA  . ALA C 3 50  ? 43.675  15.966  7.216   1.00 74.05  ? 50  ALA L CA  1 
ATOM   4064 C C   . ALA C 3 50  ? 44.740  16.627  6.345   1.00 82.66  ? 50  ALA L C   1 
ATOM   4065 O O   . ALA C 3 50  ? 45.837  16.917  6.821   1.00 89.67  ? 50  ALA L O   1 
ATOM   4066 C CB  . ALA C 3 50  ? 44.327  15.128  8.301   1.00 75.56  ? 50  ALA L CB  1 
ATOM   4067 N N   . ALA C 3 51  ? 44.405  16.841  5.073   1.00 76.44  ? 51  ALA L N   1 
ATOM   4068 C CA  . ALA C 3 51  ? 45.254  17.560  4.116   1.00 83.50  ? 51  ALA L CA  1 
ATOM   4069 C C   . ALA C 3 51  ? 46.392  16.741  3.518   1.00 86.01  ? 51  ALA L C   1 
ATOM   4070 O O   . ALA C 3 51  ? 46.667  16.831  2.323   1.00 86.35  ? 51  ALA L O   1 
ATOM   4071 C CB  . ALA C 3 51  ? 45.791  18.849  4.725   1.00 91.14  ? 51  ALA L CB  1 
ATOM   4072 N N   . SER C 3 52  ? 47.050  15.942  4.349   1.00 90.65  ? 52  SER L N   1 
ATOM   4073 C CA  . SER C 3 52  ? 48.246  15.232  3.916   1.00 93.63  ? 52  SER L CA  1 
ATOM   4074 C C   . SER C 3 52  ? 48.259  13.750  4.280   1.00 92.59  ? 52  SER L C   1 
ATOM   4075 O O   . SER C 3 52  ? 49.261  13.079  4.064   1.00 102.75 ? 52  SER L O   1 
ATOM   4076 C CB  . SER C 3 52  ? 49.501  15.912  4.480   1.00 98.82  ? 52  SER L CB  1 
ATOM   4077 O OG  . SER C 3 52  ? 49.506  15.916  5.898   1.00 96.46  ? 52  SER L OG  1 
ATOM   4078 N N   . SER C 3 53  ? 47.163  13.230  4.825   1.00 83.38  ? 53  SER L N   1 
ATOM   4079 C CA  . SER C 3 53  ? 47.156  11.824  5.228   1.00 92.25  ? 53  SER L CA  1 
ATOM   4080 C C   . SER C 3 53  ? 46.307  10.907  4.345   1.00 78.95  ? 53  SER L C   1 
ATOM   4081 O O   . SER C 3 53  ? 45.151  11.197  4.046   1.00 75.72  ? 53  SER L O   1 
ATOM   4082 C CB  . SER C 3 53  ? 46.797  11.664  6.710   1.00 103.73 ? 53  SER L CB  1 
ATOM   4083 O OG  . SER C 3 53  ? 45.711  12.498  7.062   1.00 111.27 ? 53  SER L OG  1 
ATOM   4084 N N   . LEU C 3 54  ? 46.913  9.795   3.942   1.00 70.05  ? 54  LEU L N   1 
ATOM   4085 C CA  . LEU C 3 54  ? 46.279  8.788   3.099   1.00 73.20  ? 54  LEU L CA  1 
ATOM   4086 C C   . LEU C 3 54  ? 45.314  7.910   3.882   1.00 66.17  ? 54  LEU L C   1 
ATOM   4087 O O   . LEU C 3 54  ? 45.684  7.341   4.904   1.00 69.98  ? 54  LEU L O   1 
ATOM   4088 C CB  . LEU C 3 54  ? 47.348  7.879   2.498   1.00 76.56  ? 54  LEU L CB  1 
ATOM   4089 C CG  . LEU C 3 54  ? 48.067  8.267   1.211   1.00 78.35  ? 54  LEU L CG  1 
ATOM   4090 C CD1 . LEU C 3 54  ? 48.535  9.712   1.238   1.00 79.33  ? 54  LEU L CD1 1 
ATOM   4091 C CD2 . LEU C 3 54  ? 49.229  7.312   1.002   1.00 81.83  ? 54  LEU L CD2 1 
ATOM   4092 N N   . GLN C 3 55  ? 44.086  7.774   3.395   1.00 56.95  ? 55  GLN L N   1 
ATOM   4093 C CA  . GLN C 3 55  ? 43.142  6.857   4.017   1.00 41.80  ? 55  GLN L CA  1 
ATOM   4094 C C   . GLN C 3 55  ? 43.650  5.433   3.887   1.00 68.13  ? 55  GLN L C   1 
ATOM   4095 O O   . GLN C 3 55  ? 44.155  5.036   2.838   1.00 62.06  ? 55  GLN L O   1 
ATOM   4096 C CB  . GLN C 3 55  ? 41.751  6.982   3.398   1.00 42.00  ? 55  GLN L CB  1 
ATOM   4097 C CG  . GLN C 3 55  ? 40.778  5.903   3.846   1.00 39.47  ? 55  GLN L CG  1 
ATOM   4098 C CD  . GLN C 3 55  ? 39.325  6.304   3.669   1.00 58.21  ? 55  GLN L CD  1 
ATOM   4099 O OE1 . GLN C 3 55  ? 38.925  7.407   4.039   1.00 56.40  ? 55  GLN L OE1 1 
ATOM   4100 N NE2 . GLN C 3 55  ? 38.522  5.398   3.114   1.00 50.04  ? 55  GLN L NE2 1 
ATOM   4101 N N   . SER C 3 56  ? 43.528  4.672   4.968   1.00 75.56  ? 56  SER L N   1 
ATOM   4102 C CA  . SER C 3 56  ? 43.940  3.278   4.973   1.00 85.02  ? 56  SER L CA  1 
ATOM   4103 C C   . SER C 3 56  ? 43.487  2.621   3.672   1.00 82.52  ? 56  SER L C   1 
ATOM   4104 O O   . SER C 3 56  ? 42.293  2.497   3.417   1.00 80.94  ? 56  SER L O   1 
ATOM   4105 C CB  . SER C 3 56  ? 43.325  2.557   6.180   1.00 91.57  ? 56  SER L CB  1 
ATOM   4106 O OG  . SER C 3 56  ? 44.152  1.501   6.641   1.00 100.89 ? 56  SER L OG  1 
ATOM   4107 N N   . GLY C 3 57  ? 44.439  2.228   2.834   1.00 85.37  ? 57  GLY L N   1 
ATOM   4108 C CA  . GLY C 3 57  ? 44.101  1.523   1.612   1.00 89.85  ? 57  GLY L CA  1 
ATOM   4109 C C   . GLY C 3 57  ? 44.582  2.150   0.312   1.00 99.17  ? 57  GLY L C   1 
ATOM   4110 O O   . GLY C 3 57  ? 44.905  1.429   -0.634  1.00 112.11 ? 57  GLY L O   1 
ATOM   4111 N N   . VAL C 3 58  ? 44.630  3.480   0.247   1.00 88.78  ? 58  VAL L N   1 
ATOM   4112 C CA  . VAL C 3 58  ? 45.007  4.152   -0.999  1.00 82.26  ? 58  VAL L CA  1 
ATOM   4113 C C   . VAL C 3 58  ? 46.497  4.005   -1.313  1.00 93.53  ? 58  VAL L C   1 
ATOM   4114 O O   . VAL C 3 58  ? 47.323  3.913   -0.409  1.00 99.10  ? 58  VAL L O   1 
ATOM   4115 C CB  . VAL C 3 58  ? 44.625  5.647   -1.000  1.00 67.12  ? 58  VAL L CB  1 
ATOM   4116 C CG1 . VAL C 3 58  ? 43.251  5.846   -0.370  1.00 58.33  ? 58  VAL L CG1 1 
ATOM   4117 C CG2 . VAL C 3 58  ? 45.681  6.465   -0.285  1.00 70.62  ? 58  VAL L CG2 1 
ATOM   4118 N N   . PRO C 3 59  ? 46.839  3.976   -2.607  1.00 97.94  ? 59  PRO L N   1 
ATOM   4119 C CA  . PRO C 3 59  ? 48.207  3.746   -3.090  1.00 100.90 ? 59  PRO L CA  1 
ATOM   4120 C C   . PRO C 3 59  ? 49.234  4.743   -2.552  1.00 95.45  ? 59  PRO L C   1 
ATOM   4121 O O   . PRO C 3 59  ? 48.887  5.848   -2.141  1.00 86.30  ? 59  PRO L O   1 
ATOM   4122 C CB  . PRO C 3 59  ? 48.066  3.899   -4.604  1.00 101.44 ? 59  PRO L CB  1 
ATOM   4123 C CG  . PRO C 3 59  ? 46.653  3.526   -4.875  1.00 96.36  ? 59  PRO L CG  1 
ATOM   4124 C CD  . PRO C 3 59  ? 45.873  4.058   -3.716  1.00 91.93  ? 59  PRO L CD  1 
ATOM   4125 N N   . SER C 3 60  ? 50.498  4.336   -2.563  1.00 102.56 ? 60  SER L N   1 
ATOM   4126 C CA  . SER C 3 60  ? 51.585  5.166   -2.067  1.00 102.54 ? 60  SER L CA  1 
ATOM   4127 C C   . SER C 3 60  ? 51.738  6.414   -2.921  1.00 94.08  ? 60  SER L C   1 
ATOM   4128 O O   . SER C 3 60  ? 52.104  7.480   -2.422  1.00 83.24  ? 60  SER L O   1 
ATOM   4129 C CB  . SER C 3 60  ? 52.896  4.378   -2.091  1.00 113.93 ? 60  SER L CB  1 
ATOM   4130 O OG  . SER C 3 60  ? 52.723  3.072   -1.567  1.00 120.81 ? 60  SER L OG  1 
ATOM   4131 N N   . ARG C 3 61  ? 51.446  6.265   -4.211  1.00 95.61  ? 61  ARG L N   1 
ATOM   4132 C CA  . ARG C 3 61  ? 51.745  7.289   -5.211  1.00 97.12  ? 61  ARG L CA  1 
ATOM   4133 C C   . ARG C 3 61  ? 50.986  8.596   -4.989  1.00 98.61  ? 61  ARG L C   1 
ATOM   4134 O O   . ARG C 3 61  ? 51.304  9.615   -5.608  1.00 93.01  ? 61  ARG L O   1 
ATOM   4135 C CB  . ARG C 3 61  ? 51.493  6.752   -6.624  1.00 94.74  ? 61  ARG L CB  1 
ATOM   4136 C CG  . ARG C 3 61  ? 50.090  7.008   -7.153  1.00 95.85  ? 61  ARG L CG  1 
ATOM   4137 C CD  . ARG C 3 61  ? 49.803  6.193   -8.403  1.00 91.19  ? 61  ARG L CD  1 
ATOM   4138 N NE  . ARG C 3 61  ? 49.496  4.802   -8.082  1.00 95.97  ? 61  ARG L NE  1 
ATOM   4139 C CZ  . ARG C 3 61  ? 48.287  4.254   -8.192  1.00 89.59  ? 61  ARG L CZ  1 
ATOM   4140 N NH1 . ARG C 3 61  ? 47.265  4.975   -8.629  1.00 73.90  ? 61  ARG L NH1 1 
ATOM   4141 N NH2 . ARG C 3 61  ? 48.099  2.978   -7.873  1.00 92.55  ? 61  ARG L NH2 1 
ATOM   4142 N N   . PHE C 3 62  ? 49.994  8.563   -4.101  1.00 103.04 ? 62  PHE L N   1 
ATOM   4143 C CA  . PHE C 3 62  ? 49.221  9.757   -3.755  1.00 100.64 ? 62  PHE L CA  1 
ATOM   4144 C C   . PHE C 3 62  ? 49.810  10.513  -2.573  1.00 98.67  ? 62  PHE L C   1 
ATOM   4145 O O   . PHE C 3 62  ? 50.612  9.972   -1.814  1.00 106.08 ? 62  PHE L O   1 
ATOM   4146 C CB  . PHE C 3 62  ? 47.772  9.396   -3.450  1.00 94.21  ? 62  PHE L CB  1 
ATOM   4147 C CG  . PHE C 3 62  ? 46.992  9.006   -4.656  1.00 95.70  ? 62  PHE L CG  1 
ATOM   4148 C CD1 . PHE C 3 62  ? 46.348  9.965   -5.414  1.00 92.74  ? 62  PHE L CD1 1 
ATOM   4149 C CD2 . PHE C 3 62  ? 46.915  7.679   -5.046  1.00 97.78  ? 62  PHE L CD2 1 
ATOM   4150 C CE1 . PHE C 3 62  ? 45.629  9.607   -6.537  1.00 88.12  ? 62  PHE L CE1 1 
ATOM   4151 C CE2 . PHE C 3 62  ? 46.198  7.314   -6.164  1.00 93.43  ? 62  PHE L CE2 1 
ATOM   4152 C CZ  . PHE C 3 62  ? 45.553  8.278   -6.911  1.00 88.46  ? 62  PHE L CZ  1 
ATOM   4153 N N   . SER C 3 63  ? 49.394  11.766  -2.428  1.00 87.90  ? 63  SER L N   1 
ATOM   4154 C CA  . SER C 3 63  ? 49.896  12.635  -1.376  1.00 88.86  ? 63  SER L CA  1 
ATOM   4155 C C   . SER C 3 63  ? 49.249  14.010  -1.466  1.00 85.87  ? 63  SER L C   1 
ATOM   4156 O O   . SER C 3 63  ? 48.789  14.421  -2.522  1.00 84.01  ? 63  SER L O   1 
ATOM   4157 C CB  . SER C 3 63  ? 51.420  12.765  -1.463  1.00 91.25  ? 63  SER L CB  1 
ATOM   4158 O OG  . SER C 3 63  ? 51.817  13.372  -2.681  1.00 91.79  ? 63  SER L OG  1 
ATOM   4159 N N   . GLY C 3 64  ? 49.225  14.719  -0.348  1.00 87.68  ? 64  GLY L N   1 
ATOM   4160 C CA  . GLY C 3 64  ? 48.671  16.057  -0.307  1.00 89.00  ? 64  GLY L CA  1 
ATOM   4161 C C   . GLY C 3 64  ? 49.410  16.915  0.697   1.00 90.51  ? 64  GLY L C   1 
ATOM   4162 O O   . GLY C 3 64  ? 50.089  16.396  1.579   1.00 90.91  ? 64  GLY L O   1 
ATOM   4163 N N   . SER C 3 65  ? 49.292  18.230  0.556   1.00 90.38  ? 65  SER L N   1 
ATOM   4164 C CA  . SER C 3 65  ? 49.921  19.150  1.494   1.00 89.23  ? 65  SER L CA  1 
ATOM   4165 C C   . SER C 3 65  ? 49.179  20.481  1.544   1.00 91.48  ? 65  SER L C   1 
ATOM   4166 O O   . SER C 3 65  ? 48.295  20.744  0.730   1.00 82.27  ? 65  SER L O   1 
ATOM   4167 C CB  . SER C 3 65  ? 51.397  19.367  1.146   1.00 91.89  ? 65  SER L CB  1 
ATOM   4168 O OG  . SER C 3 65  ? 51.553  20.348  0.137   1.00 100.23 ? 65  SER L OG  1 
ATOM   4169 N N   . GLY C 3 66  ? 49.544  21.312  2.513   1.00 102.98 ? 66  GLY L N   1 
ATOM   4170 C CA  . GLY C 3 66  ? 48.902  22.598  2.699   1.00 106.13 ? 66  GLY L CA  1 
ATOM   4171 C C   . GLY C 3 66  ? 48.132  22.669  4.002   1.00 107.72 ? 66  GLY L C   1 
ATOM   4172 O O   . GLY C 3 66  ? 47.695  21.653  4.537   1.00 97.19  ? 66  GLY L O   1 
ATOM   4173 N N   . SER C 3 67  ? 47.974  23.883  4.516   1.00 123.69 ? 67  SER L N   1 
ATOM   4174 C CA  . SER C 3 67  ? 47.219  24.116  5.741   1.00 126.54 ? 67  SER L CA  1 
ATOM   4175 C C   . SER C 3 67  ? 46.722  25.556  5.788   1.00 120.71 ? 67  SER L C   1 
ATOM   4176 O O   . SER C 3 67  ? 47.391  26.472  5.313   1.00 114.42 ? 67  SER L O   1 
ATOM   4177 C CB  . SER C 3 67  ? 48.069  23.806  6.976   1.00 129.56 ? 67  SER L CB  1 
ATOM   4178 O OG  . SER C 3 67  ? 49.149  24.717  7.098   1.00 135.86 ? 67  SER L OG  1 
ATOM   4179 N N   . GLY C 3 68  ? 45.537  25.745  6.355   1.00 117.93 ? 68  GLY L N   1 
ATOM   4180 C CA  . GLY C 3 68  ? 44.949  27.062  6.473   1.00 115.17 ? 68  GLY L CA  1 
ATOM   4181 C C   . GLY C 3 68  ? 44.026  27.420  5.328   1.00 110.54 ? 68  GLY L C   1 
ATOM   4182 O O   . GLY C 3 68  ? 42.817  27.548  5.518   1.00 113.86 ? 68  GLY L O   1 
ATOM   4183 N N   . THR C 3 69  ? 44.587  27.574  4.132   1.00 106.04 ? 69  THR L N   1 
ATOM   4184 C CA  . THR C 3 69  ? 43.818  28.132  3.027   1.00 103.83 ? 69  THR L CA  1 
ATOM   4185 C C   . THR C 3 69  ? 44.193  27.624  1.624   1.00 103.22 ? 69  THR L C   1 
ATOM   4186 O O   . THR C 3 69  ? 43.368  27.668  0.710   1.00 96.84  ? 69  THR L O   1 
ATOM   4187 C CB  . THR C 3 69  ? 43.867  29.673  3.064   1.00 105.64 ? 69  THR L CB  1 
ATOM   4188 O OG1 . THR C 3 69  ? 42.999  30.205  2.059   1.00 119.43 ? 69  THR L OG1 1 
ATOM   4189 C CG2 . THR C 3 69  ? 45.289  30.176  2.841   1.00 103.58 ? 69  THR L CG2 1 
ATOM   4190 N N   . ASP C 3 70  ? 45.421  27.141  1.454   1.00 104.51 ? 70  ASP L N   1 
ATOM   4191 C CA  . ASP C 3 70  ? 45.869  26.643  0.153   1.00 103.72 ? 70  ASP L CA  1 
ATOM   4192 C C   . ASP C 3 70  ? 46.399  25.216  0.239   1.00 103.12 ? 70  ASP L C   1 
ATOM   4193 O O   . ASP C 3 70  ? 47.453  24.972  0.825   1.00 110.12 ? 70  ASP L O   1 
ATOM   4194 C CB  . ASP C 3 70  ? 46.946  27.554  -0.439  1.00 109.16 ? 70  ASP L CB  1 
ATOM   4195 C CG  . ASP C 3 70  ? 46.430  28.945  -0.752  1.00 115.39 ? 70  ASP L CG  1 
ATOM   4196 O OD1 . ASP C 3 70  ? 47.244  29.891  -0.764  1.00 119.87 ? 70  ASP L OD1 1 
ATOM   4197 O OD2 . ASP C 3 70  ? 45.213  29.097  -0.985  1.00 115.20 ? 70  ASP L OD2 1 
ATOM   4198 N N   . PHE C 3 71  ? 45.672  24.282  -0.367  1.00 96.19  ? 71  PHE L N   1 
ATOM   4199 C CA  . PHE C 3 71  ? 46.015  22.866  -0.298  1.00 90.98  ? 71  PHE L CA  1 
ATOM   4200 C C   . PHE C 3 71  ? 46.182  22.274  -1.687  1.00 96.45  ? 71  PHE L C   1 
ATOM   4201 O O   . PHE C 3 71  ? 45.650  22.800  -2.664  1.00 108.94 ? 71  PHE L O   1 
ATOM   4202 C CB  . PHE C 3 71  ? 44.926  22.097  0.446   1.00 88.90  ? 71  PHE L CB  1 
ATOM   4203 C CG  . PHE C 3 71  ? 44.433  22.792  1.676   1.00 92.26  ? 71  PHE L CG  1 
ATOM   4204 C CD1 . PHE C 3 71  ? 43.516  23.823  1.586   1.00 90.01  ? 71  PHE L CD1 1 
ATOM   4205 C CD2 . PHE C 3 71  ? 44.889  22.416  2.921   1.00 94.85  ? 71  PHE L CD2 1 
ATOM   4206 C CE1 . PHE C 3 71  ? 43.068  24.465  2.714   1.00 91.05  ? 71  PHE L CE1 1 
ATOM   4207 C CE2 . PHE C 3 71  ? 44.443  23.053  4.050   1.00 96.24  ? 71  PHE L CE2 1 
ATOM   4208 C CZ  . PHE C 3 71  ? 43.530  24.080  3.949   1.00 96.81  ? 71  PHE L CZ  1 
ATOM   4209 N N   . THR C 3 72  ? 46.915  21.171  -1.776  1.00 85.85  ? 72  THR L N   1 
ATOM   4210 C CA  . THR C 3 72  ? 47.117  20.522  -3.062  1.00 80.02  ? 72  THR L CA  1 
ATOM   4211 C C   . THR C 3 72  ? 47.023  19.013  -2.977  1.00 89.77  ? 72  THR L C   1 
ATOM   4212 O O   . THR C 3 72  ? 46.851  18.440  -1.901  1.00 95.49  ? 72  THR L O   1 
ATOM   4213 C CB  . THR C 3 72  ? 48.483  20.867  -3.669  1.00 82.41  ? 72  THR L CB  1 
ATOM   4214 O OG1 . THR C 3 72  ? 49.520  20.322  -2.844  1.00 84.22  ? 72  THR L OG1 1 
ATOM   4215 C CG2 . THR C 3 72  ? 48.653  22.371  -3.795  1.00 79.37  ? 72  THR L CG2 1 
ATOM   4216 N N   . LEU C 3 73  ? 47.149  18.385  -4.140  1.00 93.80  ? 73  LEU L N   1 
ATOM   4217 C CA  . LEU C 3 73  ? 47.104  16.941  -4.276  1.00 81.40  ? 73  LEU L CA  1 
ATOM   4218 C C   . LEU C 3 73  ? 48.066  16.570  -5.394  1.00 90.07  ? 73  LEU L C   1 
ATOM   4219 O O   . LEU C 3 73  ? 48.086  17.224  -6.435  1.00 98.96  ? 73  LEU L O   1 
ATOM   4220 C CB  . LEU C 3 73  ? 45.685  16.504  -4.625  1.00 67.57  ? 73  LEU L CB  1 
ATOM   4221 C CG  . LEU C 3 73  ? 45.438  15.006  -4.779  1.00 76.59  ? 73  LEU L CG  1 
ATOM   4222 C CD1 . LEU C 3 73  ? 46.222  14.224  -3.747  1.00 88.89  ? 73  LEU L CD1 1 
ATOM   4223 C CD2 . LEU C 3 73  ? 43.955  14.699  -4.662  1.00 77.96  ? 73  LEU L CD2 1 
ATOM   4224 N N   . THR C 3 74  ? 48.871  15.536  -5.188  1.00 86.89  ? 74  THR L N   1 
ATOM   4225 C CA  . THR C 3 74  ? 49.898  15.195  -6.167  1.00 93.95  ? 74  THR L CA  1 
ATOM   4226 C C   . THR C 3 74  ? 50.063  13.695  -6.380  1.00 98.13  ? 74  THR L C   1 
ATOM   4227 O O   . THR C 3 74  ? 50.045  12.916  -5.430  1.00 102.80 ? 74  THR L O   1 
ATOM   4228 C CB  . THR C 3 74  ? 51.261  15.799  -5.777  1.00 93.79  ? 74  THR L CB  1 
ATOM   4229 O OG1 . THR C 3 74  ? 51.172  17.227  -5.805  1.00 100.36 ? 74  THR L OG1 1 
ATOM   4230 C CG2 . THR C 3 74  ? 52.343  15.349  -6.740  1.00 92.06  ? 74  THR L CG2 1 
ATOM   4231 N N   . ILE C 3 75  ? 50.222  13.301  -7.640  1.00 86.78  ? 75  ILE L N   1 
ATOM   4232 C CA  . ILE C 3 75  ? 50.506  11.915  -7.976  1.00 77.66  ? 75  ILE L CA  1 
ATOM   4233 C C   . ILE C 3 75  ? 51.914  11.806  -8.533  1.00 89.53  ? 75  ILE L C   1 
ATOM   4234 O O   . ILE C 3 75  ? 52.173  12.231  -9.652  1.00 91.35  ? 75  ILE L O   1 
ATOM   4235 C CB  . ILE C 3 75  ? 49.505  11.370  -9.002  1.00 73.21  ? 75  ILE L CB  1 
ATOM   4236 C CG1 . ILE C 3 75  ? 48.077  11.668  -8.548  1.00 77.68  ? 75  ILE L CG1 1 
ATOM   4237 C CG2 . ILE C 3 75  ? 49.707  9.875   -9.194  1.00 75.95  ? 75  ILE L CG2 1 
ATOM   4238 C CD1 . ILE C 3 75  ? 47.012  11.003  -9.380  1.00 73.00  ? 75  ILE L CD1 1 
ATOM   4239 N N   . SER C 3 76  ? 52.827  11.252  -7.742  1.00 106.12 ? 76  SER L N   1 
ATOM   4240 C CA  . SER C 3 76  ? 54.232  11.196  -8.139  1.00 116.93 ? 76  SER L CA  1 
ATOM   4241 C C   . SER C 3 76  ? 54.400  10.571  -9.520  1.00 132.08 ? 76  SER L C   1 
ATOM   4242 O O   . SER C 3 76  ? 55.039  11.149  -10.400 1.00 141.67 ? 76  SER L O   1 
ATOM   4243 C CB  . SER C 3 76  ? 55.069  10.433  -7.108  1.00 112.83 ? 76  SER L CB  1 
ATOM   4244 O OG  . SER C 3 76  ? 54.574  9.119   -6.914  1.00 114.20 ? 76  SER L OG  1 
ATOM   4245 N N   . SER C 3 77  ? 53.810  9.395   -9.709  1.00 130.32 ? 77  SER L N   1 
ATOM   4246 C CA  . SER C 3 77  ? 53.957  8.653   -10.953 1.00 128.61 ? 77  SER L CA  1 
ATOM   4247 C C   . SER C 3 77  ? 52.600  8.118   -11.390 1.00 117.88 ? 77  SER L C   1 
ATOM   4248 O O   . SER C 3 77  ? 52.169  7.052   -10.955 1.00 115.52 ? 77  SER L O   1 
ATOM   4249 C CB  . SER C 3 77  ? 54.957  7.508   -10.769 1.00 141.94 ? 77  SER L CB  1 
ATOM   4250 O OG  . SER C 3 77  ? 55.707  7.284   -11.950 1.00 152.81 ? 77  SER L OG  1 
ATOM   4251 N N   . LEU C 3 78  ? 51.939  8.875   -12.259 1.00 114.30 ? 78  LEU L N   1 
ATOM   4252 C CA  . LEU C 3 78  ? 50.549  8.624   -12.640 1.00 103.14 ? 78  LEU L CA  1 
ATOM   4253 C C   . LEU C 3 78  ? 50.305  7.212   -13.182 1.00 108.49 ? 78  LEU L C   1 
ATOM   4254 O O   . LEU C 3 78  ? 51.245  6.517   -13.568 1.00 119.72 ? 78  LEU L O   1 
ATOM   4255 C CB  . LEU C 3 78  ? 50.104  9.673   -13.662 1.00 96.23  ? 78  LEU L CB  1 
ATOM   4256 C CG  . LEU C 3 78  ? 48.603  9.881   -13.816 1.00 91.58  ? 78  LEU L CG  1 
ATOM   4257 C CD1 . LEU C 3 78  ? 47.947  9.826   -12.458 1.00 90.66  ? 78  LEU L CD1 1 
ATOM   4258 C CD2 . LEU C 3 78  ? 48.317  11.205  -14.498 1.00 87.52  ? 78  LEU L CD2 1 
ATOM   4259 N N   . GLN C 3 79  ? 49.040  6.794   -13.201 1.00 97.56  ? 79  GLN L N   1 
ATOM   4260 C CA  . GLN C 3 79  ? 48.657  5.490   -13.743 1.00 99.30  ? 79  GLN L CA  1 
ATOM   4261 C C   . GLN C 3 79  ? 47.201  5.464   -14.206 1.00 106.20 ? 79  GLN L C   1 
ATOM   4262 O O   . GLN C 3 79  ? 46.404  6.301   -13.791 1.00 114.15 ? 79  GLN L O   1 
ATOM   4263 C CB  . GLN C 3 79  ? 48.920  4.373   -12.732 1.00 98.17  ? 79  GLN L CB  1 
ATOM   4264 C CG  . GLN C 3 79  ? 50.332  3.818   -12.796 1.00 107.07 ? 79  GLN L CG  1 
ATOM   4265 C CD  . GLN C 3 79  ? 50.375  2.318   -12.590 1.00 110.39 ? 79  GLN L CD  1 
ATOM   4266 O OE1 . GLN C 3 79  ? 51.207  1.622   -13.175 1.00 106.05 ? 79  GLN L OE1 1 
ATOM   4267 N NE2 . GLN C 3 79  ? 49.467  1.809   -11.764 1.00 110.13 ? 79  GLN L NE2 1 
ATOM   4268 N N   . PRO C 3 80  ? 46.853  4.496   -15.074 1.00 104.88 ? 80  PRO L N   1 
ATOM   4269 C CA  . PRO C 3 80  ? 45.530  4.367   -15.704 1.00 100.85 ? 80  PRO L CA  1 
ATOM   4270 C C   . PRO C 3 80  ? 44.338  4.526   -14.753 1.00 97.20  ? 80  PRO L C   1 
ATOM   4271 O O   . PRO C 3 80  ? 43.470  5.358   -15.020 1.00 95.13  ? 80  PRO L O   1 
ATOM   4272 C CB  . PRO C 3 80  ? 45.562  2.949   -16.275 1.00 101.82 ? 80  PRO L CB  1 
ATOM   4273 C CG  . PRO C 3 80  ? 46.994  2.724   -16.596 1.00 99.01  ? 80  PRO L CG  1 
ATOM   4274 C CD  . PRO C 3 80  ? 47.781  3.450   -15.542 1.00 103.98 ? 80  PRO L CD  1 
ATOM   4275 N N   . GLU C 3 81  ? 44.291  3.744   -13.676 1.00 94.66  ? 81  GLU L N   1 
ATOM   4276 C CA  . GLU C 3 81  ? 43.153  3.777   -12.757 1.00 85.36  ? 81  GLU L CA  1 
ATOM   4277 C C   . GLU C 3 81  ? 42.953  5.157   -12.153 1.00 73.63  ? 81  GLU L C   1 
ATOM   4278 O O   . GLU C 3 81  ? 41.920  5.422   -11.534 1.00 64.61  ? 81  GLU L O   1 
ATOM   4279 C CB  . GLU C 3 81  ? 43.325  2.770   -11.617 1.00 104.75 ? 81  GLU L CB  1 
ATOM   4280 C CG  . GLU C 3 81  ? 44.066  1.496   -11.987 1.00 123.39 ? 81  GLU L CG  1 
ATOM   4281 C CD  . GLU C 3 81  ? 45.559  1.602   -11.747 1.00 129.06 ? 81  GLU L CD  1 
ATOM   4282 O OE1 . GLU C 3 81  ? 46.335  1.246   -12.665 1.00 131.65 ? 81  GLU L OE1 1 
ATOM   4283 O OE2 . GLU C 3 81  ? 45.952  2.041   -10.641 1.00 122.13 ? 81  GLU L OE2 1 
ATOM   4284 N N   . ASP C 3 82  ? 43.948  6.025   -12.325 1.00 72.77  ? 82  ASP L N   1 
ATOM   4285 C CA  . ASP C 3 82  ? 43.945  7.338   -11.688 1.00 75.90  ? 82  ASP L CA  1 
ATOM   4286 C C   . ASP C 3 82  ? 43.262  8.399   -12.530 1.00 77.48  ? 82  ASP L C   1 
ATOM   4287 O O   . ASP C 3 82  ? 43.261  9.571   -12.168 1.00 83.27  ? 82  ASP L O   1 
ATOM   4288 C CB  . ASP C 3 82  ? 45.371  7.792   -11.372 1.00 75.61  ? 82  ASP L CB  1 
ATOM   4289 C CG  . ASP C 3 82  ? 46.008  6.986   -10.263 1.00 81.18  ? 82  ASP L CG  1 
ATOM   4290 O OD1 . ASP C 3 82  ? 47.239  7.102   -10.079 1.00 79.82  ? 82  ASP L OD1 1 
ATOM   4291 O OD2 . ASP C 3 82  ? 45.280  6.239   -9.573  1.00 86.67  ? 82  ASP L OD2 1 
ATOM   4292 N N   . PHE C 3 83  ? 42.684  7.999   -13.654 1.00 76.37  ? 83  PHE L N   1 
ATOM   4293 C CA  . PHE C 3 83  ? 42.005  8.963   -14.508 1.00 80.22  ? 83  PHE L CA  1 
ATOM   4294 C C   . PHE C 3 83  ? 40.553  9.155   -14.100 1.00 76.07  ? 83  PHE L C   1 
ATOM   4295 O O   . PHE C 3 83  ? 39.732  8.247   -14.225 1.00 79.53  ? 83  PHE L O   1 
ATOM   4296 C CB  . PHE C 3 83  ? 42.131  8.584   -15.984 1.00 84.48  ? 83  PHE L CB  1 
ATOM   4297 C CG  . PHE C 3 83  ? 43.467  8.927   -16.570 1.00 83.83  ? 83  PHE L CG  1 
ATOM   4298 C CD1 . PHE C 3 83  ? 43.774  10.237  -16.900 1.00 82.24  ? 83  PHE L CD1 1 
ATOM   4299 C CD2 . PHE C 3 83  ? 44.427  7.947   -16.761 1.00 88.85  ? 83  PHE L CD2 1 
ATOM   4300 C CE1 . PHE C 3 83  ? 45.008  10.561  -17.424 1.00 93.24  ? 83  PHE L CE1 1 
ATOM   4301 C CE2 . PHE C 3 83  ? 45.663  8.264   -17.283 1.00 97.06  ? 83  PHE L CE2 1 
ATOM   4302 C CZ  . PHE C 3 83  ? 45.957  9.573   -17.617 1.00 101.26 ? 83  PHE L CZ  1 
ATOM   4303 N N   . ALA C 3 84  ? 40.248  10.353  -13.613 1.00 68.17  ? 84  ALA L N   1 
ATOM   4304 C CA  . ALA C 3 84  ? 38.921  10.671  -13.106 1.00 74.56  ? 84  ALA L CA  1 
ATOM   4305 C C   . ALA C 3 84  ? 38.840  12.153  -12.773 1.00 70.55  ? 84  ALA L C   1 
ATOM   4306 O O   . ALA C 3 84  ? 39.777  12.899  -13.033 1.00 72.60  ? 84  ALA L O   1 
ATOM   4307 C CB  . ALA C 3 84  ? 38.617  9.832   -11.868 1.00 76.65  ? 84  ALA L CB  1 
ATOM   4308 N N   . THR C 3 85  ? 37.719  12.583  -12.204 1.00 66.41  ? 85  THR L N   1 
ATOM   4309 C CA  . THR C 3 85  ? 37.621  13.943  -11.682 1.00 69.58  ? 85  THR L CA  1 
ATOM   4310 C C   . THR C 3 85  ? 37.833  13.914  -10.154 1.00 68.45  ? 85  THR L C   1 
ATOM   4311 O O   . THR C 3 85  ? 37.503  12.930  -9.496  1.00 66.63  ? 85  THR L O   1 
ATOM   4312 C CB  . THR C 3 85  ? 36.287  14.631  -12.091 1.00 65.53  ? 85  THR L CB  1 
ATOM   4313 O OG1 . THR C 3 85  ? 35.225  14.203  -11.241 1.00 69.22  ? 85  THR L OG1 1 
ATOM   4314 C CG2 . THR C 3 85  ? 35.914  14.285  -13.514 1.00 70.46  ? 85  THR L CG2 1 
ATOM   4315 N N   . TYR C 3 86  ? 38.421  14.967  -9.598  1.00 58.11  ? 86  TYR L N   1 
ATOM   4316 C CA  . TYR C 3 86  ? 38.767  14.972  -8.177  1.00 58.92  ? 86  TYR L CA  1 
ATOM   4317 C C   . TYR C 3 86  ? 38.149  16.149  -7.434  1.00 61.98  ? 86  TYR L C   1 
ATOM   4318 O O   . TYR C 3 86  ? 38.201  17.288  -7.905  1.00 60.36  ? 86  TYR L O   1 
ATOM   4319 C CB  . TYR C 3 86  ? 40.289  14.965  -7.984  1.00 71.71  ? 86  TYR L CB  1 
ATOM   4320 C CG  . TYR C 3 86  ? 40.963  13.694  -8.462  1.00 81.93  ? 86  TYR L CG  1 
ATOM   4321 C CD1 . TYR C 3 86  ? 41.031  13.385  -9.820  1.00 82.19  ? 86  TYR L CD1 1 
ATOM   4322 C CD2 . TYR C 3 86  ? 41.533  12.802  -7.559  1.00 76.94  ? 86  TYR L CD2 1 
ATOM   4323 C CE1 . TYR C 3 86  ? 41.642  12.218  -10.264 1.00 82.08  ? 86  TYR L CE1 1 
ATOM   4324 C CE2 . TYR C 3 86  ? 42.147  11.637  -7.993  1.00 80.37  ? 86  TYR L CE2 1 
ATOM   4325 C CZ  . TYR C 3 86  ? 42.198  11.347  -9.347  1.00 82.26  ? 86  TYR L CZ  1 
ATOM   4326 O OH  . TYR C 3 86  ? 42.805  10.186  -9.779  1.00 75.05  ? 86  TYR L OH  1 
ATOM   4327 N N   . TYR C 3 87  ? 37.562  15.864  -6.274  1.00 55.23  ? 87  TYR L N   1 
ATOM   4328 C CA  . TYR C 3 87  ? 36.907  16.886  -5.469  1.00 59.30  ? 87  TYR L CA  1 
ATOM   4329 C C   . TYR C 3 87  ? 37.586  17.056  -4.109  1.00 61.98  ? 87  TYR L C   1 
ATOM   4330 O O   . TYR C 3 87  ? 37.972  16.081  -3.473  1.00 66.71  ? 87  TYR L O   1 
ATOM   4331 C CB  . TYR C 3 87  ? 35.436  16.528  -5.233  1.00 63.46  ? 87  TYR L CB  1 
ATOM   4332 C CG  . TYR C 3 87  ? 34.555  16.461  -6.466  1.00 61.66  ? 87  TYR L CG  1 
ATOM   4333 C CD1 . TYR C 3 87  ? 34.051  17.617  -7.054  1.00 62.32  ? 87  TYR L CD1 1 
ATOM   4334 C CD2 . TYR C 3 87  ? 34.190  15.239  -7.012  1.00 66.12  ? 87  TYR L CD2 1 
ATOM   4335 C CE1 . TYR C 3 87  ? 33.232  17.555  -8.169  1.00 67.16  ? 87  TYR L CE1 1 
ATOM   4336 C CE2 . TYR C 3 87  ? 33.368  15.166  -8.129  1.00 70.02  ? 87  TYR L CE2 1 
ATOM   4337 C CZ  . TYR C 3 87  ? 32.892  16.326  -8.702  1.00 67.19  ? 87  TYR L CZ  1 
ATOM   4338 O OH  . TYR C 3 87  ? 32.077  16.251  -9.808  1.00 61.10  ? 87  TYR L OH  1 
ATOM   4339 N N   . CYS C 3 88  ? 37.720  18.298  -3.659  1.00 64.03  ? 88  CYS L N   1 
ATOM   4340 C CA  . CYS C 3 88  ? 38.189  18.571  -2.306  1.00 56.94  ? 88  CYS L CA  1 
ATOM   4341 C C   . CYS C 3 88  ? 36.987  18.918  -1.434  1.00 57.15  ? 88  CYS L C   1 
ATOM   4342 O O   . CYS C 3 88  ? 35.942  19.315  -1.944  1.00 61.12  ? 88  CYS L O   1 
ATOM   4343 C CB  . CYS C 3 88  ? 39.219  19.706  -2.299  1.00 55.21  ? 88  CYS L CB  1 
ATOM   4344 S SG  . CYS C 3 88  ? 38.605  21.326  -2.840  1.00 82.67  ? 88  CYS L SG  1 
ATOM   4345 N N   . GLN C 3 89  ? 37.115  18.734  -0.125  1.00 60.62  ? 89  GLN L N   1 
ATOM   4346 C CA  . GLN C 3 89  ? 36.031  19.085  0.788   1.00 62.77  ? 89  GLN L CA  1 
ATOM   4347 C C   . GLN C 3 89  ? 36.527  19.700  2.083   1.00 65.22  ? 89  GLN L C   1 
ATOM   4348 O O   . GLN C 3 89  ? 37.452  19.195  2.709   1.00 64.70  ? 89  GLN L O   1 
ATOM   4349 C CB  . GLN C 3 89  ? 35.174  17.875  1.129   1.00 54.62  ? 89  GLN L CB  1 
ATOM   4350 C CG  . GLN C 3 89  ? 34.007  18.223  2.037   1.00 59.03  ? 89  GLN L CG  1 
ATOM   4351 C CD  . GLN C 3 89  ? 33.483  17.021  2.800   1.00 59.35  ? 89  GLN L CD  1 
ATOM   4352 O OE1 . GLN C 3 89  ? 34.241  16.114  3.148   1.00 53.81  ? 89  GLN L OE1 1 
ATOM   4353 N NE2 . GLN C 3 89  ? 32.180  17.011  3.069   1.00 47.99  ? 89  GLN L NE2 1 
ATOM   4354 N N   . GLN C 3 90  ? 35.895  20.794  2.482   1.00 68.74  ? 90  GLN L N   1 
ATOM   4355 C CA  . GLN C 3 90  ? 36.203  21.431  3.750   1.00 67.82  ? 90  GLN L CA  1 
ATOM   4356 C C   . GLN C 3 90  ? 35.321  20.832  4.841   1.00 72.13  ? 90  GLN L C   1 
ATOM   4357 O O   . GLN C 3 90  ? 34.100  20.877  4.731   1.00 86.15  ? 90  GLN L O   1 
ATOM   4358 C CB  . GLN C 3 90  ? 35.977  22.936  3.638   1.00 61.54  ? 90  GLN L CB  1 
ATOM   4359 C CG  . GLN C 3 90  ? 35.635  23.609  4.942   1.00 71.92  ? 90  GLN L CG  1 
ATOM   4360 C CD  . GLN C 3 90  ? 34.146  23.731  5.153   1.00 77.49  ? 90  GLN L CD  1 
ATOM   4361 O OE1 . GLN C 3 90  ? 33.397  23.984  4.214   1.00 81.27  ? 90  GLN L OE1 1 
ATOM   4362 N NE2 . GLN C 3 90  ? 33.707  23.561  6.389   1.00 77.11  ? 90  GLN L NE2 1 
ATOM   4363 N N   . TYR C 3 91  ? 35.924  20.239  5.872   1.00 59.36  ? 91  TYR L N   1 
ATOM   4364 C CA  . TYR C 3 91  ? 35.129  19.708  6.984   1.00 73.65  ? 91  TYR L CA  1 
ATOM   4365 C C   . TYR C 3 91  ? 35.443  20.372  8.330   1.00 82.81  ? 91  TYR L C   1 
ATOM   4366 O O   . TYR C 3 91  ? 35.574  19.709  9.363   1.00 75.53  ? 91  TYR L O   1 
ATOM   4367 C CB  . TYR C 3 91  ? 35.171  18.172  7.069   1.00 65.90  ? 91  TYR L CB  1 
ATOM   4368 C CG  . TYR C 3 91  ? 36.538  17.543  7.189   1.00 67.49  ? 91  TYR L CG  1 
ATOM   4369 C CD1 . TYR C 3 91  ? 37.278  17.252  6.062   1.00 72.71  ? 91  TYR L CD1 1 
ATOM   4370 C CD2 . TYR C 3 91  ? 37.070  17.204  8.424   1.00 74.12  ? 91  TYR L CD2 1 
ATOM   4371 C CE1 . TYR C 3 91  ? 38.522  16.660  6.156   1.00 72.74  ? 91  TYR L CE1 1 
ATOM   4372 C CE2 . TYR C 3 91  ? 38.319  16.609  8.525   1.00 71.50  ? 91  TYR L CE2 1 
ATOM   4373 C CZ  . TYR C 3 91  ? 39.037  16.343  7.388   1.00 67.20  ? 91  TYR L CZ  1 
ATOM   4374 O OH  . TYR C 3 91  ? 40.275  15.757  7.460   1.00 69.67  ? 91  TYR L OH  1 
ATOM   4375 N N   . ASN C 3 92  ? 35.522  21.700  8.289   1.00 81.73  ? 92  ASN L N   1 
ATOM   4376 C CA  . ASN C 3 92  ? 35.850  22.522  9.442   1.00 72.09  ? 92  ASN L CA  1 
ATOM   4377 C C   . ASN C 3 92  ? 34.609  23.203  10.026  1.00 71.02  ? 92  ASN L C   1 
ATOM   4378 O O   . ASN C 3 92  ? 34.358  23.137  11.231  1.00 81.60  ? 92  ASN L O   1 
ATOM   4379 C CB  . ASN C 3 92  ? 36.893  23.557  9.021   1.00 74.50  ? 92  ASN L CB  1 
ATOM   4380 C CG  . ASN C 3 92  ? 37.171  24.587  10.091  1.00 84.22  ? 92  ASN L CG  1 
ATOM   4381 O OD1 . ASN C 3 92  ? 36.715  24.464  11.225  1.00 97.84  ? 92  ASN L OD1 1 
ATOM   4382 N ND2 . ASN C 3 92  ? 37.929  25.617  9.733   1.00 77.39  ? 92  ASN L ND2 1 
ATOM   4383 N N   . ILE C 3 93  ? 33.828  23.840  9.161   1.00 64.72  ? 93  ILE L N   1 
ATOM   4384 C CA  . ILE C 3 93  ? 32.645  24.582  9.576   1.00 66.41  ? 93  ILE L CA  1 
ATOM   4385 C C   . ILE C 3 93  ? 31.421  24.164  8.777   1.00 67.61  ? 93  ILE L C   1 
ATOM   4386 O O   . ILE C 3 93  ? 31.462  24.123  7.549   1.00 77.48  ? 93  ILE L O   1 
ATOM   4387 C CB  . ILE C 3 93  ? 32.839  26.082  9.328   1.00 77.10  ? 93  ILE L CB  1 
ATOM   4388 C CG1 . ILE C 3 93  ? 34.037  26.614  10.119  1.00 79.16  ? 93  ILE L CG1 1 
ATOM   4389 C CG2 . ILE C 3 93  ? 31.572  26.847  9.673   1.00 86.78  ? 93  ILE L CG2 1 
ATOM   4390 C CD1 . ILE C 3 93  ? 34.436  28.013  9.718   1.00 86.65  ? 93  ILE L CD1 1 
ATOM   4391 N N   . TYR C 3 94  ? 30.322  23.869  9.457   1.00 64.47  ? 94  TYR L N   1 
ATOM   4392 C CA  . TYR C 3 94  ? 29.090  23.514  8.752   1.00 72.90  ? 94  TYR L CA  1 
ATOM   4393 C C   . TYR C 3 94  ? 28.558  24.696  7.942   1.00 69.40  ? 94  TYR L C   1 
ATOM   4394 O O   . TYR C 3 94  ? 28.554  25.826  8.425   1.00 64.67  ? 94  TYR L O   1 
ATOM   4395 C CB  . TYR C 3 94  ? 28.018  23.036  9.736   1.00 78.10  ? 94  TYR L CB  1 
ATOM   4396 C CG  . TYR C 3 94  ? 28.368  21.777  10.494  1.00 76.37  ? 94  TYR L CG  1 
ATOM   4397 C CD1 . TYR C 3 94  ? 28.024  21.635  11.835  1.00 80.12  ? 94  TYR L CD1 1 
ATOM   4398 C CD2 . TYR C 3 94  ? 29.042  20.733  9.876   1.00 73.99  ? 94  TYR L CD2 1 
ATOM   4399 C CE1 . TYR C 3 94  ? 28.335  20.488  12.541  1.00 78.04  ? 94  TYR L CE1 1 
ATOM   4400 C CE2 . TYR C 3 94  ? 29.361  19.580  10.576  1.00 82.07  ? 94  TYR L CE2 1 
ATOM   4401 C CZ  . TYR C 3 94  ? 29.003  19.463  11.910  1.00 80.23  ? 94  TYR L CZ  1 
ATOM   4402 O OH  . TYR C 3 94  ? 29.312  18.320  12.614  1.00 75.82  ? 94  TYR L OH  1 
ATOM   4403 N N   . PRO C 3 95  ? 28.097  24.435  6.709   1.00 72.53  ? 95  PRO L N   1 
ATOM   4404 C CA  . PRO C 3 95  ? 28.065  23.109  6.098   1.00 76.35  ? 95  PRO L CA  1 
ATOM   4405 C C   . PRO C 3 95  ? 29.399  22.813  5.433   1.00 83.77  ? 95  PRO L C   1 
ATOM   4406 O O   . PRO C 3 95  ? 30.066  23.747  4.966   1.00 80.26  ? 95  PRO L O   1 
ATOM   4407 C CB  . PRO C 3 95  ? 26.989  23.249  5.011   1.00 71.92  ? 95  PRO L CB  1 
ATOM   4408 C CG  . PRO C 3 95  ? 26.548  24.704  5.037   1.00 70.75  ? 95  PRO L CG  1 
ATOM   4409 C CD  . PRO C 3 95  ? 27.596  25.452  5.777   1.00 73.06  ? 95  PRO L CD  1 
ATOM   4410 N N   . TYR C 3 96  ? 29.782  21.537  5.400   1.00 84.41  ? 96  TYR L N   1 
ATOM   4411 C CA  . TYR C 3 96  ? 30.984  21.119  4.696   1.00 76.77  ? 96  TYR L CA  1 
ATOM   4412 C C   . TYR C 3 96  ? 30.725  21.225  3.204   1.00 77.15  ? 96  TYR L C   1 
ATOM   4413 O O   . TYR C 3 96  ? 29.697  20.772  2.717   1.00 91.30  ? 96  TYR L O   1 
ATOM   4414 C CB  . TYR C 3 96  ? 31.363  19.688  5.057   1.00 64.76  ? 96  TYR L CB  1 
ATOM   4415 C CG  . TYR C 3 96  ? 31.660  19.462  6.516   1.00 61.90  ? 96  TYR L CG  1 
ATOM   4416 C CD1 . TYR C 3 96  ? 31.533  18.199  7.073   1.00 70.50  ? 96  TYR L CD1 1 
ATOM   4417 C CD2 . TYR C 3 96  ? 32.051  20.507  7.345   1.00 65.70  ? 96  TYR L CD2 1 
ATOM   4418 C CE1 . TYR C 3 96  ? 31.803  17.974  8.413   1.00 74.32  ? 96  TYR L CE1 1 
ATOM   4419 C CE2 . TYR C 3 96  ? 32.320  20.293  8.691   1.00 67.55  ? 96  TYR L CE2 1 
ATOM   4420 C CZ  . TYR C 3 96  ? 32.196  19.024  9.217   1.00 70.38  ? 96  TYR L CZ  1 
ATOM   4421 O OH  . TYR C 3 96  ? 32.458  18.799  10.546  1.00 65.89  ? 96  TYR L OH  1 
ATOM   4422 N N   . THR C 3 97  ? 31.651  21.831  2.476   1.00 66.79  ? 97  THR L N   1 
ATOM   4423 C CA  . THR C 3 97  ? 31.401  22.123  1.074   1.00 74.26  ? 97  THR L CA  1 
ATOM   4424 C C   . THR C 3 97  ? 32.512  21.590  0.194   1.00 82.68  ? 97  THR L C   1 
ATOM   4425 O O   . THR C 3 97  ? 33.655  21.465  0.635   1.00 89.10  ? 97  THR L O   1 
ATOM   4426 C CB  . THR C 3 97  ? 31.255  23.624  0.839   1.00 71.23  ? 97  THR L CB  1 
ATOM   4427 O OG1 . THR C 3 97  ? 32.314  24.309  1.513   1.00 71.82  ? 97  THR L OG1 1 
ATOM   4428 C CG2 . THR C 3 97  ? 29.923  24.105  1.375   1.00 73.81  ? 97  THR L CG2 1 
ATOM   4429 N N   . PHE C 3 98  ? 32.169  21.274  -1.051  1.00 70.71  ? 98  PHE L N   1 
ATOM   4430 C CA  . PHE C 3 98  ? 33.118  20.657  -1.960  1.00 59.75  ? 98  PHE L CA  1 
ATOM   4431 C C   . PHE C 3 98  ? 33.619  21.647  -3.006  1.00 66.26  ? 98  PHE L C   1 
ATOM   4432 O O   . PHE C 3 98  ? 33.065  22.732  -3.181  1.00 66.96  ? 98  PHE L O   1 
ATOM   4433 C CB  . PHE C 3 98  ? 32.477  19.468  -2.680  1.00 59.55  ? 98  PHE L CB  1 
ATOM   4434 C CG  . PHE C 3 98  ? 31.952  18.393  -1.768  1.00 61.16  ? 98  PHE L CG  1 
ATOM   4435 C CD1 . PHE C 3 98  ? 30.645  18.427  -1.312  1.00 60.74  ? 98  PHE L CD1 1 
ATOM   4436 C CD2 . PHE C 3 98  ? 32.757  17.323  -1.402  1.00 63.13  ? 98  PHE L CD2 1 
ATOM   4437 C CE1 . PHE C 3 98  ? 30.159  17.424  -0.485  1.00 64.66  ? 98  PHE L CE1 1 
ATOM   4438 C CE2 . PHE C 3 98  ? 32.275  16.317  -0.575  1.00 52.50  ? 98  PHE L CE2 1 
ATOM   4439 C CZ  . PHE C 3 98  ? 30.977  16.367  -0.117  1.00 54.92  ? 98  PHE L CZ  1 
ATOM   4440 N N   . GLY C 3 99  ? 34.678  21.255  -3.704  1.00 73.57  ? 99  GLY L N   1 
ATOM   4441 C CA  . GLY C 3 99  ? 35.103  21.944  -4.905  1.00 76.13  ? 99  GLY L CA  1 
ATOM   4442 C C   . GLY C 3 99  ? 34.272  21.474  -6.091  1.00 71.81  ? 99  GLY L C   1 
ATOM   4443 O O   . GLY C 3 99  ? 33.587  20.448  -6.025  1.00 62.65  ? 99  GLY L O   1 
ATOM   4444 N N   . GLN C 3 100 ? 34.323  22.231  -7.180  1.00 72.99  ? 100 GLN L N   1 
ATOM   4445 C CA  . GLN C 3 100 ? 33.517  21.930  -8.355  1.00 69.58  ? 100 GLN L CA  1 
ATOM   4446 C C   . GLN C 3 100 ? 34.187  20.869  -9.223  1.00 71.09  ? 100 GLN L C   1 
ATOM   4447 O O   . GLN C 3 100 ? 33.646  20.452  -10.250 1.00 71.29  ? 100 GLN L O   1 
ATOM   4448 C CB  . GLN C 3 100 ? 33.222  23.206  -9.144  1.00 75.92  ? 100 GLN L CB  1 
ATOM   4449 C CG  . GLN C 3 100 ? 34.037  24.420  -8.706  1.00 94.02  ? 100 GLN L CG  1 
ATOM   4450 C CD  . GLN C 3 100 ? 35.537  24.216  -8.843  1.00 99.74  ? 100 GLN L CD  1 
ATOM   4451 O OE1 . GLN C 3 100 ? 36.279  24.322  -7.864  1.00 89.09  ? 100 GLN L OE1 1 
ATOM   4452 N NE2 . GLN C 3 100 ? 35.991  23.921  -10.059 1.00 102.24 ? 100 GLN L NE2 1 
ATOM   4453 N N   . GLY C 3 101 ? 35.361  20.427  -8.785  1.00 72.54  ? 101 GLY L N   1 
ATOM   4454 C CA  . GLY C 3 101 ? 36.035  19.308  -9.407  1.00 66.64  ? 101 GLY L CA  1 
ATOM   4455 C C   . GLY C 3 101 ? 37.177  19.687  -10.324 1.00 70.44  ? 101 GLY L C   1 
ATOM   4456 O O   . GLY C 3 101 ? 37.331  20.840  -10.727 1.00 78.20  ? 101 GLY L O   1 
ATOM   4457 N N   . THR C 3 102 ? 37.988  18.692  -10.650 1.00 71.81  ? 102 THR L N   1 
ATOM   4458 C CA  . THR C 3 102 ? 39.080  18.856  -11.592 1.00 73.49  ? 102 THR L CA  1 
ATOM   4459 C C   . THR C 3 102 ? 39.223  17.563  -12.385 1.00 77.24  ? 102 THR L C   1 
ATOM   4460 O O   . THR C 3 102 ? 39.640  16.545  -11.844 1.00 81.63  ? 102 THR L O   1 
ATOM   4461 C CB  . THR C 3 102 ? 40.403  19.152  -10.870 1.00 73.55  ? 102 THR L CB  1 
ATOM   4462 O OG1 . THR C 3 102 ? 40.337  20.443  -10.247 1.00 82.75  ? 102 THR L OG1 1 
ATOM   4463 C CG2 . THR C 3 102 ? 41.563  19.114  -11.855 1.00 65.98  ? 102 THR L CG2 1 
ATOM   4464 N N   . LYS C 3 103 ? 38.858  17.597  -13.661 1.00 81.02  ? 103 LYS L N   1 
ATOM   4465 C CA  . LYS C 3 103 ? 38.916  16.401  -14.485 1.00 68.35  ? 103 LYS L CA  1 
ATOM   4466 C C   . LYS C 3 103 ? 40.333  16.135  -14.969 1.00 62.22  ? 103 LYS L C   1 
ATOM   4467 O O   . LYS C 3 103 ? 41.064  17.055  -15.298 1.00 68.49  ? 103 LYS L O   1 
ATOM   4468 C CB  . LYS C 3 103 ? 37.944  16.507  -15.664 1.00 72.78  ? 103 LYS L CB  1 
ATOM   4469 C CG  . LYS C 3 103 ? 37.877  15.254  -16.553 1.00 85.25  ? 103 LYS L CG  1 
ATOM   4470 C CD  . LYS C 3 103 ? 36.529  15.145  -17.266 1.00 94.74  ? 103 LYS L CD  1 
ATOM   4471 C CE  . LYS C 3 103 ? 36.432  13.902  -18.147 1.00 106.72 ? 103 LYS L CE  1 
ATOM   4472 N NZ  . LYS C 3 103 ? 37.159  14.040  -19.448 1.00 117.58 ? 103 LYS L NZ  1 
ATOM   4473 N N   . LEU C 3 104 ? 40.718  14.865  -14.990 1.00 70.66  ? 104 LEU L N   1 
ATOM   4474 C CA  . LEU C 3 104 ? 41.988  14.447  -15.578 1.00 85.45  ? 104 LEU L CA  1 
ATOM   4475 C C   . LEU C 3 104 ? 41.779  13.623  -16.843 1.00 96.31  ? 104 LEU L C   1 
ATOM   4476 O O   . LEU C 3 104 ? 41.496  12.426  -16.787 1.00 94.93  ? 104 LEU L O   1 
ATOM   4477 C CB  . LEU C 3 104 ? 42.829  13.652  -14.581 1.00 87.06  ? 104 LEU L CB  1 
ATOM   4478 C CG  . LEU C 3 104 ? 43.996  14.414  -13.958 1.00 93.97  ? 104 LEU L CG  1 
ATOM   4479 C CD1 . LEU C 3 104 ? 43.484  15.510  -13.042 1.00 100.86 ? 104 LEU L CD1 1 
ATOM   4480 C CD2 . LEU C 3 104 ? 44.925  13.466  -13.211 1.00 91.03  ? 104 LEU L CD2 1 
ATOM   4481 N N   . GLU C 3 105 ? 41.918  14.289  -17.982 1.00 99.48  ? 105 GLU L N   1 
ATOM   4482 C CA  . GLU C 3 105 ? 41.807  13.656  -19.282 1.00 100.36 ? 105 GLU L CA  1 
ATOM   4483 C C   . GLU C 3 105 ? 43.189  13.164  -19.713 1.00 102.25 ? 105 GLU L C   1 
ATOM   4484 O O   . GLU C 3 105 ? 44.203  13.737  -19.321 1.00 101.71 ? 105 GLU L O   1 
ATOM   4485 C CB  . GLU C 3 105 ? 41.236  14.670  -20.275 1.00 111.30 ? 105 GLU L CB  1 
ATOM   4486 C CG  . GLU C 3 105 ? 41.821  14.623  -21.672 1.00 130.61 ? 105 GLU L CG  1 
ATOM   4487 C CD  . GLU C 3 105 ? 41.833  15.993  -22.333 1.00 145.05 ? 105 GLU L CD  1 
ATOM   4488 O OE1 . GLU C 3 105 ? 41.603  16.078  -23.558 1.00 142.09 ? 105 GLU L OE1 1 
ATOM   4489 O OE2 . GLU C 3 105 ? 42.071  16.990  -21.617 1.00 155.39 ? 105 GLU L OE2 1 
ATOM   4490 N N   . ILE C 3 106 ? 43.236  12.088  -20.492 1.00 110.98 ? 106 ILE L N   1 
ATOM   4491 C CA  . ILE C 3 106 ? 44.516  11.567  -20.979 1.00 118.31 ? 106 ILE L CA  1 
ATOM   4492 C C   . ILE C 3 106 ? 45.114  12.506  -22.023 1.00 120.51 ? 106 ILE L C   1 
ATOM   4493 O O   . ILE C 3 106 ? 44.388  13.146  -22.783 1.00 122.33 ? 106 ILE L O   1 
ATOM   4494 C CB  . ILE C 3 106 ? 44.387  10.160  -21.619 1.00 85.20  ? 106 ILE L CB  1 
ATOM   4495 C CG1 . ILE C 3 106 ? 43.532  9.225   -20.764 1.00 86.68  ? 106 ILE L CG1 1 
ATOM   4496 C CG2 . ILE C 3 106 ? 45.754  9.549   -21.837 1.00 87.21  ? 106 ILE L CG2 1 
ATOM   4497 C CD1 . ILE C 3 106 ? 42.090  9.146   -21.202 1.00 87.30  ? 106 ILE L CD1 1 
ATOM   4498 N N   . LYS C 3 107 ? 46.439  12.585  -22.065 1.00 118.76 ? 107 LYS L N   1 
ATOM   4499 C CA  . LYS C 3 107 ? 47.099  13.388  -23.084 1.00 116.37 ? 107 LYS L CA  1 
ATOM   4500 C C   . LYS C 3 107 ? 47.515  12.495  -24.243 1.00 118.34 ? 107 LYS L C   1 
ATOM   4501 O O   . LYS C 3 107 ? 48.230  11.511  -24.059 1.00 126.25 ? 107 LYS L O   1 
ATOM   4502 C CB  . LYS C 3 107 ? 48.304  14.132  -22.510 1.00 118.19 ? 107 LYS L CB  1 
ATOM   4503 C CG  . LYS C 3 107 ? 48.756  15.310  -23.359 1.00 123.71 ? 107 LYS L CG  1 
ATOM   4504 C CD  . LYS C 3 107 ? 49.756  16.187  -22.623 1.00 138.56 ? 107 LYS L CD  1 
ATOM   4505 C CE  . LYS C 3 107 ? 50.359  17.232  -23.553 1.00 151.18 ? 107 LYS L CE  1 
ATOM   4506 N NZ  . LYS C 3 107 ? 49.310  18.047  -24.231 1.00 151.81 ? 107 LYS L NZ  1 
ATOM   4507 N N   . ARG C 3 108 ? 47.053  12.843  -25.438 1.00 113.33 ? 108 ARG L N   1 
ATOM   4508 C CA  . ARG C 3 108 ? 47.300  12.043  -26.630 1.00 114.95 ? 108 ARG L CA  1 
ATOM   4509 C C   . ARG C 3 108 ? 47.408  12.949  -27.863 1.00 113.26 ? 108 ARG L C   1 
ATOM   4510 O O   . ARG C 3 108 ? 46.987  14.103  -27.826 1.00 110.79 ? 108 ARG L O   1 
ATOM   4511 C CB  . ARG C 3 108 ? 46.198  10.987  -26.773 1.00 116.72 ? 108 ARG L CB  1 
ATOM   4512 C CG  . ARG C 3 108 ? 45.946  10.496  -28.179 1.00 121.00 ? 108 ARG L CG  1 
ATOM   4513 C CD  . ARG C 3 108 ? 44.626  11.016  -28.732 1.00 111.98 ? 108 ARG L CD  1 
ATOM   4514 N NE  . ARG C 3 108 ? 44.642  11.000  -30.191 1.00 111.43 ? 108 ARG L NE  1 
ATOM   4515 C CZ  . ARG C 3 108 ? 44.698  9.894   -30.923 1.00 104.81 ? 108 ARG L CZ  1 
ATOM   4516 N NH1 . ARG C 3 108 ? 44.733  8.707   -30.334 1.00 105.66 ? 108 ARG L NH1 1 
ATOM   4517 N NH2 . ARG C 3 108 ? 44.721  9.978   -32.244 1.00 104.60 ? 108 ARG L NH2 1 
ATOM   4518 N N   . THR C 3 109 ? 47.991  12.442  -28.945 1.00 111.98 ? 109 THR L N   1 
ATOM   4519 C CA  . THR C 3 109 ? 48.260  13.280  -30.114 1.00 109.94 ? 109 THR L CA  1 
ATOM   4520 C C   . THR C 3 109 ? 46.987  13.733  -30.836 1.00 102.56 ? 109 THR L C   1 
ATOM   4521 O O   . THR C 3 109 ? 46.025  12.975  -30.953 1.00 97.55  ? 109 THR L O   1 
ATOM   4522 C CB  . THR C 3 109 ? 49.223  12.596  -31.107 1.00 116.45 ? 109 THR L CB  1 
ATOM   4523 O OG1 . THR C 3 109 ? 49.818  13.587  -31.951 1.00 122.21 ? 109 THR L OG1 1 
ATOM   4524 C CG2 . THR C 3 109 ? 48.491  11.574  -31.964 1.00 117.96 ? 109 THR L CG2 1 
ATOM   4525 N N   . VAL C 3 110 ? 46.994  14.975  -31.315 1.00 97.58  ? 110 VAL L N   1 
ATOM   4526 C CA  . VAL C 3 110 ? 45.827  15.577  -31.960 1.00 95.41  ? 110 VAL L CA  1 
ATOM   4527 C C   . VAL C 3 110 ? 45.248  14.704  -33.070 1.00 96.78  ? 110 VAL L C   1 
ATOM   4528 O O   . VAL C 3 110 ? 45.990  14.091  -33.833 1.00 97.07  ? 110 VAL L O   1 
ATOM   4529 C CB  . VAL C 3 110 ? 46.166  16.959  -32.550 1.00 88.60  ? 110 VAL L CB  1 
ATOM   4530 C CG1 . VAL C 3 110 ? 44.995  17.499  -33.350 1.00 82.66  ? 110 VAL L CG1 1 
ATOM   4531 C CG2 . VAL C 3 110 ? 46.561  17.927  -31.446 1.00 87.46  ? 110 VAL L CG2 1 
ATOM   4532 N N   . ALA C 3 111 ? 43.920  14.657  -33.154 1.00 93.72  ? 111 ALA L N   1 
ATOM   4533 C CA  . ALA C 3 111 ? 43.236  13.844  -34.156 1.00 89.05  ? 111 ALA L CA  1 
ATOM   4534 C C   . ALA C 3 111 ? 41.901  14.453  -34.583 1.00 85.85  ? 111 ALA L C   1 
ATOM   4535 O O   . ALA C 3 111 ? 41.104  14.884  -33.750 1.00 81.02  ? 111 ALA L O   1 
ATOM   4536 C CB  . ALA C 3 111 ? 43.036  12.426  -33.648 1.00 91.62  ? 111 ALA L CB  1 
ATOM   4537 N N   . ALA C 3 112 ? 41.662  14.471  -35.890 1.00 88.95  ? 112 ALA L N   1 
ATOM   4538 C CA  . ALA C 3 112 ? 40.476  15.105  -36.451 1.00 88.35  ? 112 ALA L CA  1 
ATOM   4539 C C   . ALA C 3 112 ? 39.279  14.156  -36.473 1.00 91.45  ? 112 ALA L C   1 
ATOM   4540 O O   . ALA C 3 112 ? 39.445  12.937  -36.511 1.00 94.16  ? 112 ALA L O   1 
ATOM   4541 C CB  . ALA C 3 112 ? 40.771  15.627  -37.844 1.00 86.11  ? 112 ALA L CB  1 
ATOM   4542 N N   . PRO C 3 113 ? 38.062  14.718  -36.451 1.00 87.50  ? 113 PRO L N   1 
ATOM   4543 C CA  . PRO C 3 113 ? 36.844  13.918  -36.359 1.00 80.49  ? 113 PRO L CA  1 
ATOM   4544 C C   . PRO C 3 113 ? 36.463  13.360  -37.713 1.00 80.45  ? 113 PRO L C   1 
ATOM   4545 O O   . PRO C 3 113 ? 36.520  14.092  -38.690 1.00 85.44  ? 113 PRO L O   1 
ATOM   4546 C CB  . PRO C 3 113 ? 35.780  14.949  -35.945 1.00 76.52  ? 113 PRO L CB  1 
ATOM   4547 C CG  . PRO C 3 113 ? 36.484  16.264  -35.817 1.00 71.06  ? 113 PRO L CG  1 
ATOM   4548 C CD  . PRO C 3 113 ? 37.754  16.149  -36.569 1.00 87.37  ? 113 PRO L CD  1 
ATOM   4549 N N   . SER C 3 114 ? 36.083  12.092  -37.780 1.00 87.23  ? 114 SER L N   1 
ATOM   4550 C CA  . SER C 3 114 ? 35.405  11.600  -38.971 1.00 92.92  ? 114 SER L CA  1 
ATOM   4551 C C   . SER C 3 114 ? 33.986  12.145  -38.921 1.00 90.18  ? 114 SER L C   1 
ATOM   4552 O O   . SER C 3 114 ? 33.296  11.996  -37.918 1.00 94.25  ? 114 SER L O   1 
ATOM   4553 C CB  . SER C 3 114 ? 35.383  10.072  -39.009 1.00 91.60  ? 114 SER L CB  1 
ATOM   4554 O OG  . SER C 3 114 ? 36.682  9.547   -39.203 1.00 96.22  ? 114 SER L OG  1 
ATOM   4555 N N   . VAL C 3 115 ? 33.548  12.794  -39.988 1.00 79.82  ? 115 VAL L N   1 
ATOM   4556 C CA  . VAL C 3 115 ? 32.230  13.399  -39.973 1.00 83.59  ? 115 VAL L CA  1 
ATOM   4557 C C   . VAL C 3 115 ? 31.239  12.611  -40.806 1.00 67.87  ? 115 VAL L C   1 
ATOM   4558 O O   . VAL C 3 115 ? 31.586  12.047  -41.834 1.00 95.66  ? 115 VAL L O   1 
ATOM   4559 C CB  . VAL C 3 115 ? 32.274  14.857  -40.440 1.00 85.58  ? 115 VAL L CB  1 
ATOM   4560 C CG1 . VAL C 3 115 ? 30.878  15.446  -40.447 1.00 79.13  ? 115 VAL L CG1 1 
ATOM   4561 C CG2 . VAL C 3 115 ? 33.182  15.654  -39.530 1.00 80.72  ? 115 VAL L CG2 1 
ATOM   4562 N N   . PHE C 3 116 ? 30.005  12.557  -40.332 1.00 66.73  ? 116 PHE L N   1 
ATOM   4563 C CA  . PHE C 3 116 ? 28.938  11.858  -41.015 1.00 66.49  ? 116 PHE L CA  1 
ATOM   4564 C C   . PHE C 3 116 ? 27.654  12.618  -40.766 1.00 89.24  ? 116 PHE L C   1 
ATOM   4565 O O   . PHE C 3 116 ? 27.425  13.115  -39.672 1.00 93.59  ? 116 PHE L O   1 
ATOM   4566 C CB  . PHE C 3 116 ? 28.798  10.436  -40.479 1.00 66.18  ? 116 PHE L CB  1 
ATOM   4567 C CG  . PHE C 3 116 ? 30.082  9.663   -40.468 1.00 74.68  ? 116 PHE L CG  1 
ATOM   4568 C CD1 . PHE C 3 116 ? 30.328  8.693   -41.418 1.00 71.41  ? 116 PHE L CD1 1 
ATOM   4569 C CD2 . PHE C 3 116 ? 31.039  9.899   -39.500 1.00 75.25  ? 116 PHE L CD2 1 
ATOM   4570 C CE1 . PHE C 3 116 ? 31.501  7.977   -41.408 1.00 71.36  ? 116 PHE L CE1 1 
ATOM   4571 C CE2 . PHE C 3 116 ? 32.215  9.187   -39.487 1.00 79.70  ? 116 PHE L CE2 1 
ATOM   4572 C CZ  . PHE C 3 116 ? 32.445  8.223   -40.443 1.00 83.11  ? 116 PHE L CZ  1 
ATOM   4573 N N   . ILE C 3 117 ? 26.815  12.718  -41.784 1.00 85.39  ? 117 ILE L N   1 
ATOM   4574 C CA  . ILE C 3 117 ? 25.511  13.335  -41.620 1.00 73.38  ? 117 ILE L CA  1 
ATOM   4575 C C   . ILE C 3 117 ? 24.449  12.298  -41.961 1.00 77.81  ? 117 ILE L C   1 
ATOM   4576 O O   . ILE C 3 117 ? 24.610  11.534  -42.908 1.00 88.91  ? 117 ILE L O   1 
ATOM   4577 C CB  . ILE C 3 117 ? 25.375  14.589  -42.494 1.00 71.62  ? 117 ILE L CB  1 
ATOM   4578 C CG1 . ILE C 3 117 ? 23.948  15.135  -42.435 1.00 74.41  ? 117 ILE L CG1 1 
ATOM   4579 C CG2 . ILE C 3 117 ? 25.798  14.292  -43.919 1.00 67.27  ? 117 ILE L CG2 1 
ATOM   4580 C CD1 . ILE C 3 117 ? 23.813  16.523  -43.021 1.00 79.90  ? 117 ILE L CD1 1 
ATOM   4581 N N   . PHE C 3 118 ? 23.387  12.242  -41.165 1.00 81.98  ? 118 PHE L N   1 
ATOM   4582 C CA  . PHE C 3 118 ? 22.347  11.240  -41.368 1.00 89.35  ? 118 PHE L CA  1 
ATOM   4583 C C   . PHE C 3 118 ? 20.996  11.854  -41.701 1.00 95.26  ? 118 PHE L C   1 
ATOM   4584 O O   . PHE C 3 118 ? 20.535  12.758  -41.015 1.00 95.84  ? 118 PHE L O   1 
ATOM   4585 C CB  . PHE C 3 118 ? 22.208  10.324  -40.146 1.00 83.22  ? 118 PHE L CB  1 
ATOM   4586 C CG  . PHE C 3 118 ? 23.352  9.367   -39.964 1.00 86.70  ? 118 PHE L CG  1 
ATOM   4587 C CD1 . PHE C 3 118 ? 23.677  8.451   -40.952 1.00 84.35  ? 118 PHE L CD1 1 
ATOM   4588 C CD2 . PHE C 3 118 ? 24.096  9.378   -38.793 1.00 82.24  ? 118 PHE L CD2 1 
ATOM   4589 C CE1 . PHE C 3 118 ? 24.735  7.569   -40.776 1.00 89.27  ? 118 PHE L CE1 1 
ATOM   4590 C CE2 . PHE C 3 118 ? 25.152  8.500   -38.609 1.00 75.05  ? 118 PHE L CE2 1 
ATOM   4591 C CZ  . PHE C 3 118 ? 25.473  7.596   -39.595 1.00 79.09  ? 118 PHE L CZ  1 
ATOM   4592 N N   . PRO C 3 119 ? 20.365  11.361  -42.774 1.00 98.39  ? 119 PRO L N   1 
ATOM   4593 C CA  . PRO C 3 119 ? 18.986  11.704  -43.125 1.00 97.74  ? 119 PRO L CA  1 
ATOM   4594 C C   . PRO C 3 119 ? 18.013  11.147  -42.093 1.00 94.48  ? 119 PRO L C   1 
ATOM   4595 O O   . PRO C 3 119 ? 18.336  10.166  -41.422 1.00 99.29  ? 119 PRO L O   1 
ATOM   4596 C CB  . PRO C 3 119 ? 18.783  10.948  -44.444 1.00 104.24 ? 119 PRO L CB  1 
ATOM   4597 C CG  . PRO C 3 119 ? 19.783  9.809   -44.364 1.00 101.94 ? 119 PRO L CG  1 
ATOM   4598 C CD  . PRO C 3 119 ? 20.975  10.500  -43.802 1.00 96.93  ? 119 PRO L CD  1 
ATOM   4599 N N   . PRO C 3 120 ? 16.836  11.771  -41.954 1.00 89.68  ? 120 PRO L N   1 
ATOM   4600 C CA  . PRO C 3 120 ? 15.765  11.195  -41.138 1.00 89.75  ? 120 PRO L CA  1 
ATOM   4601 C C   . PRO C 3 120 ? 15.213  9.940   -41.799 1.00 96.71  ? 120 PRO L C   1 
ATOM   4602 O O   . PRO C 3 120 ? 15.352  9.781   -43.010 1.00 102.28 ? 120 PRO L O   1 
ATOM   4603 C CB  . PRO C 3 120 ? 14.696  12.292  -41.143 1.00 83.90  ? 120 PRO L CB  1 
ATOM   4604 C CG  . PRO C 3 120 ? 15.422  13.538  -41.447 1.00 82.13  ? 120 PRO L CG  1 
ATOM   4605 C CD  . PRO C 3 120 ? 16.520  13.141  -42.384 1.00 86.87  ? 120 PRO L CD  1 
ATOM   4606 N N   . SER C 3 121 ? 14.602  9.055   -41.021 1.00 101.53 ? 121 SER L N   1 
ATOM   4607 C CA  . SER C 3 121 ? 14.000  7.860   -41.594 1.00 105.19 ? 121 SER L CA  1 
ATOM   4608 C C   . SER C 3 121 ? 12.664  8.214   -42.233 1.00 108.57 ? 121 SER L C   1 
ATOM   4609 O O   . SER C 3 121 ? 11.936  9.075   -41.735 1.00 100.31 ? 121 SER L O   1 
ATOM   4610 C CB  . SER C 3 121 ? 13.814  6.774   -40.531 1.00 107.48 ? 121 SER L CB  1 
ATOM   4611 O OG  . SER C 3 121 ? 12.988  7.228   -39.474 1.00 112.14 ? 121 SER L OG  1 
ATOM   4612 N N   . ASP C 3 122 ? 12.352  7.561   -43.347 1.00 114.40 ? 122 ASP L N   1 
ATOM   4613 C CA  . ASP C 3 122 ? 11.063  7.743   -43.990 1.00 109.23 ? 122 ASP L CA  1 
ATOM   4614 C C   . ASP C 3 122 ? 10.017  7.304   -42.993 1.00 105.25 ? 122 ASP L C   1 
ATOM   4615 O O   . ASP C 3 122 ? 8.859   7.709   -43.068 1.00 102.96 ? 122 ASP L O   1 
ATOM   4616 C CB  . ASP C 3 122 ? 10.979  6.894   -45.253 1.00 114.98 ? 122 ASP L CB  1 
ATOM   4617 C CG  . ASP C 3 122 ? 12.197  7.055   -46.138 1.00 124.92 ? 122 ASP L CG  1 
ATOM   4618 O OD1 . ASP C 3 122 ? 12.601  6.065   -46.782 1.00 127.40 ? 122 ASP L OD1 1 
ATOM   4619 O OD2 . ASP C 3 122 ? 12.759  8.171   -46.180 1.00 127.72 ? 122 ASP L OD2 1 
ATOM   4620 N N   . GLU C 3 123 ? 10.454  6.481   -42.043 1.00 106.76 ? 123 GLU L N   1 
ATOM   4621 C CA  . GLU C 3 123 ? 9.583   5.942   -41.008 1.00 105.03 ? 123 GLU L CA  1 
ATOM   4622 C C   . GLU C 3 123 ? 9.219   6.979   -39.951 1.00 103.54 ? 123 GLU L C   1 
ATOM   4623 O O   . GLU C 3 123 ? 8.159   6.899   -39.332 1.00 103.33 ? 123 GLU L O   1 
ATOM   4624 C CB  . GLU C 3 123 ? 10.240  4.737   -40.338 1.00 97.56  ? 123 GLU L CB  1 
ATOM   4625 C CG  . GLU C 3 123 ? 9.348   4.061   -39.321 1.00 108.03 ? 123 GLU L CG  1 
ATOM   4626 C CD  . GLU C 3 123 ? 10.087  3.036   -38.488 1.00 120.05 ? 123 GLU L CD  1 
ATOM   4627 O OE1 . GLU C 3 123 ? 11.306  2.858   -38.708 1.00 126.80 ? 123 GLU L OE1 1 
ATOM   4628 O OE2 . GLU C 3 123 ? 9.451   2.409   -37.610 1.00 115.15 ? 123 GLU L OE2 1 
ATOM   4629 N N   . GLN C 3 124 ? 10.098  7.953   -39.746 1.00 100.66 ? 124 GLN L N   1 
ATOM   4630 C CA  . GLN C 3 124 ? 9.864   8.967   -38.729 1.00 99.54  ? 124 GLN L CA  1 
ATOM   4631 C C   . GLN C 3 124 ? 9.081   10.161  -39.257 1.00 107.36 ? 124 GLN L C   1 
ATOM   4632 O O   . GLN C 3 124 ? 8.297   10.766  -38.527 1.00 111.89 ? 124 GLN L O   1 
ATOM   4633 C CB  . GLN C 3 124 ? 11.176  9.455   -38.127 1.00 95.20  ? 124 GLN L CB  1 
ATOM   4634 C CG  . GLN C 3 124 ? 10.978  10.610  -37.162 1.00 95.42  ? 124 GLN L CG  1 
ATOM   4635 C CD  . GLN C 3 124 ? 12.281  11.253  -36.748 1.00 94.08  ? 124 GLN L CD  1 
ATOM   4636 O OE1 . GLN C 3 124 ? 13.350  10.895  -37.245 1.00 101.06 ? 124 GLN L OE1 1 
ATOM   4637 N NE2 . GLN C 3 124 ? 12.201  12.210  -35.833 1.00 82.98  ? 124 GLN L NE2 1 
ATOM   4638 N N   . LEU C 3 125 ? 9.307   10.516  -40.517 1.00 109.17 ? 125 LEU L N   1 
ATOM   4639 C CA  . LEU C 3 125 ? 8.595   11.645  -41.102 1.00 114.26 ? 125 LEU L CA  1 
ATOM   4640 C C   . LEU C 3 125 ? 7.100   11.381  -41.112 1.00 123.33 ? 125 LEU L C   1 
ATOM   4641 O O   . LEU C 3 125 ? 6.312   12.227  -40.693 1.00 125.30 ? 125 LEU L O   1 
ATOM   4642 C CB  . LEU C 3 125 ? 9.090   11.947  -42.512 1.00 110.74 ? 125 LEU L CB  1 
ATOM   4643 C CG  . LEU C 3 125 ? 10.365  12.781  -42.592 1.00 106.12 ? 125 LEU L CG  1 
ATOM   4644 C CD1 . LEU C 3 125 ? 11.531  12.003  -42.024 1.00 106.91 ? 125 LEU L CD1 1 
ATOM   4645 C CD2 . LEU C 3 125 ? 10.636  13.180  -44.024 1.00 108.28 ? 125 LEU L CD2 1 
ATOM   4646 N N   . LYS C 3 126 ? 6.708   10.205  -41.593 1.00 129.24 ? 126 LYS L N   1 
ATOM   4647 C CA  . LYS C 3 126 ? 5.313   9.801   -41.508 1.00 135.93 ? 126 LYS L CA  1 
ATOM   4648 C C   . LYS C 3 126 ? 4.988   9.486   -40.055 1.00 131.94 ? 126 LYS L C   1 
ATOM   4649 O O   . LYS C 3 126 ? 4.489   8.412   -39.728 1.00 136.04 ? 126 LYS L O   1 
ATOM   4650 C CB  . LYS C 3 126 ? 5.013   8.613   -42.430 1.00 143.64 ? 126 LYS L CB  1 
ATOM   4651 C CG  . LYS C 3 126 ? 6.031   7.488   -42.376 1.00 145.41 ? 126 LYS L CG  1 
ATOM   4652 C CD  . LYS C 3 126 ? 6.029   6.679   -43.671 1.00 142.63 ? 126 LYS L CD  1 
ATOM   4653 C CE  . LYS C 3 126 ? 4.779   5.819   -43.806 1.00 139.44 ? 126 LYS L CE  1 
ATOM   4654 N NZ  . LYS C 3 126 ? 4.788   4.662   -42.865 1.00 136.27 ? 126 LYS L NZ  1 
ATOM   4655 N N   . SER C 3 127 ? 5.305   10.443  -39.191 1.00 124.20 ? 127 SER L N   1 
ATOM   4656 C CA  . SER C 3 127 ? 5.006   10.365  -37.770 1.00 123.83 ? 127 SER L CA  1 
ATOM   4657 C C   . SER C 3 127 ? 4.898   11.780  -37.215 1.00 119.30 ? 127 SER L C   1 
ATOM   4658 O O   . SER C 3 127 ? 4.227   12.012  -36.208 1.00 126.64 ? 127 SER L O   1 
ATOM   4659 C CB  . SER C 3 127 ? 6.082   9.573   -37.023 1.00 122.29 ? 127 SER L CB  1 
ATOM   4660 O OG  . SER C 3 127 ? 5.844   9.578   -35.625 1.00 115.93 ? 127 SER L OG  1 
ATOM   4661 N N   . GLY C 3 128 ? 5.562   12.727  -37.875 1.00 102.66 ? 128 GLY L N   1 
ATOM   4662 C CA  . GLY C 3 128 ? 5.398   14.128  -37.533 1.00 98.97  ? 128 GLY L CA  1 
ATOM   4663 C C   . GLY C 3 128 ? 6.652   14.978  -37.513 1.00 94.24  ? 128 GLY L C   1 
ATOM   4664 O O   . GLY C 3 128 ? 6.625   16.142  -37.908 1.00 86.76  ? 128 GLY L O   1 
ATOM   4665 N N   . THR C 3 129 ? 7.753   14.410  -37.038 1.00 96.44  ? 129 THR L N   1 
ATOM   4666 C CA  . THR C 3 129 ? 8.980   15.181  -36.894 1.00 93.01  ? 129 THR L CA  1 
ATOM   4667 C C   . THR C 3 129 ? 10.107  14.577  -37.702 1.00 88.43  ? 129 THR L C   1 
ATOM   4668 O O   . THR C 3 129 ? 9.995   13.464  -38.215 1.00 92.35  ? 129 THR L O   1 
ATOM   4669 C CB  . THR C 3 129 ? 9.442   15.272  -35.425 1.00 89.44  ? 129 THR L CB  1 
ATOM   4670 O OG1 . THR C 3 129 ? 9.762   13.962  -34.944 1.00 89.24  ? 129 THR L OG1 1 
ATOM   4671 C CG2 . THR C 3 129 ? 8.358   15.880  -34.553 1.00 89.76  ? 129 THR L CG2 1 
ATOM   4672 N N   . ALA C 3 130 ? 11.199  15.323  -37.796 1.00 80.30  ? 130 ALA L N   1 
ATOM   4673 C CA  . ALA C 3 130 ? 12.377  14.873  -38.509 1.00 82.15  ? 130 ALA L CA  1 
ATOM   4674 C C   . ALA C 3 130 ? 13.622  15.142  -37.679 1.00 82.14  ? 130 ALA L C   1 
ATOM   4675 O O   . ALA C 3 130 ? 13.806  16.236  -37.159 1.00 74.84  ? 130 ALA L O   1 
ATOM   4676 C CB  . ALA C 3 130 ? 12.476  15.573  -39.854 1.00 79.37  ? 130 ALA L CB  1 
ATOM   4677 N N   . SER C 3 131 ? 14.481  14.139  -37.565 1.00 83.71  ? 131 SER L N   1 
ATOM   4678 C CA  . SER C 3 131 ? 15.735  14.298  -36.848 1.00 82.01  ? 131 SER L CA  1 
ATOM   4679 C C   . SER C 3 131 ? 16.916  14.124  -37.787 1.00 72.81  ? 131 SER L C   1 
ATOM   4680 O O   . SER C 3 131 ? 17.241  13.015  -38.205 1.00 69.84  ? 131 SER L O   1 
ATOM   4681 C CB  . SER C 3 131 ? 15.841  13.288  -35.707 1.00 79.92  ? 131 SER L CB  1 
ATOM   4682 O OG  . SER C 3 131 ? 14.699  13.338  -34.881 1.00 75.59  ? 131 SER L OG  1 
ATOM   4683 N N   . VAL C 3 132 ? 17.558  15.229  -38.124 1.00 69.73  ? 132 VAL L N   1 
ATOM   4684 C CA  . VAL C 3 132 ? 18.788  15.157  -38.890 1.00 80.44  ? 132 VAL L CA  1 
ATOM   4685 C C   . VAL C 3 132 ? 19.934  15.141  -37.899 1.00 75.67  ? 132 VAL L C   1 
ATOM   4686 O O   . VAL C 3 132 ? 20.074  16.051  -37.088 1.00 84.79  ? 132 VAL L O   1 
ATOM   4687 C CB  . VAL C 3 132 ? 18.930  16.334  -39.893 1.00 98.76  ? 132 VAL L CB  1 
ATOM   4688 C CG1 . VAL C 3 132 ? 18.684  17.665  -39.210 1.00 96.72  ? 132 VAL L CG1 1 
ATOM   4689 C CG2 . VAL C 3 132 ? 20.299  16.307  -40.568 1.00 98.02  ? 132 VAL L CG2 1 
ATOM   4690 N N   . VAL C 3 133 ? 20.741  14.093  -37.946 1.00 65.09  ? 133 VAL L N   1 
ATOM   4691 C CA  . VAL C 3 133 ? 21.826  13.959  -36.990 1.00 72.07  ? 133 VAL L CA  1 
ATOM   4692 C C   . VAL C 3 133 ? 23.194  13.936  -37.667 1.00 72.30  ? 133 VAL L C   1 
ATOM   4693 O O   . VAL C 3 133 ? 23.363  13.358  -38.734 1.00 68.83  ? 133 VAL L O   1 
ATOM   4694 C CB  . VAL C 3 133 ? 21.622  12.728  -36.072 1.00 63.82  ? 133 VAL L CB  1 
ATOM   4695 C CG1 . VAL C 3 133 ? 20.640  11.756  -36.696 1.00 76.58  ? 133 VAL L CG1 1 
ATOM   4696 C CG2 . VAL C 3 133 ? 22.946  12.057  -35.765 1.00 61.68  ? 133 VAL L CG2 1 
ATOM   4697 N N   . CYS C 3 134 ? 24.161  14.589  -37.033 1.00 74.07  ? 134 CYS L N   1 
ATOM   4698 C CA  . CYS C 3 134 ? 25.518  14.706  -37.550 1.00 74.08  ? 134 CYS L CA  1 
ATOM   4699 C C   . CYS C 3 134 ? 26.495  14.127  -36.534 1.00 78.25  ? 134 CYS L C   1 
ATOM   4700 O O   . CYS C 3 134 ? 26.433  14.452  -35.347 1.00 82.19  ? 134 CYS L O   1 
ATOM   4701 C CB  . CYS C 3 134 ? 25.835  16.179  -37.821 1.00 77.94  ? 134 CYS L CB  1 
ATOM   4702 S SG  . CYS C 3 134 ? 27.555  16.586  -38.173 1.00 114.22 ? 134 CYS L SG  1 
ATOM   4703 N N   . LEU C 3 135 ? 27.394  13.270  -37.004 1.00 71.52  ? 135 LEU L N   1 
ATOM   4704 C CA  . LEU C 3 135 ? 28.304  12.546  -36.128 1.00 65.63  ? 135 LEU L CA  1 
ATOM   4705 C C   . LEU C 3 135 ? 29.773  12.888  -36.340 1.00 64.62  ? 135 LEU L C   1 
ATOM   4706 O O   . LEU C 3 135 ? 30.363  12.507  -37.337 1.00 82.38  ? 135 LEU L O   1 
ATOM   4707 C CB  . LEU C 3 135 ? 28.117  11.039  -36.323 1.00 69.10  ? 135 LEU L CB  1 
ATOM   4708 C CG  . LEU C 3 135 ? 29.236  10.134  -35.788 1.00 75.97  ? 135 LEU L CG  1 
ATOM   4709 C CD1 . LEU C 3 135 ? 29.534  10.427  -34.325 1.00 70.11  ? 135 LEU L CD1 1 
ATOM   4710 C CD2 . LEU C 3 135 ? 28.898  8.662   -35.972 1.00 72.91  ? 135 LEU L CD2 1 
ATOM   4711 N N   . LEU C 3 136 ? 30.377  13.582  -35.390 1.00 64.74  ? 136 LEU L N   1 
ATOM   4712 C CA  . LEU C 3 136 ? 31.825  13.706  -35.385 1.00 69.09  ? 136 LEU L CA  1 
ATOM   4713 C C   . LEU C 3 136 ? 32.388  12.492  -34.662 1.00 71.81  ? 136 LEU L C   1 
ATOM   4714 O O   . LEU C 3 136 ? 32.027  12.217  -33.523 1.00 77.82  ? 136 LEU L O   1 
ATOM   4715 C CB  . LEU C 3 136 ? 32.265  14.985  -34.685 1.00 66.21  ? 136 LEU L CB  1 
ATOM   4716 C CG  . LEU C 3 136 ? 31.854  16.310  -35.327 1.00 80.58  ? 136 LEU L CG  1 
ATOM   4717 C CD1 . LEU C 3 136 ? 30.353  16.376  -35.570 1.00 78.42  ? 136 LEU L CD1 1 
ATOM   4718 C CD2 . LEU C 3 136 ? 32.306  17.455  -34.446 1.00 80.72  ? 136 LEU L CD2 1 
ATOM   4719 N N   . ASN C 3 137 ? 33.269  11.757  -35.323 1.00 69.98  ? 137 ASN L N   1 
ATOM   4720 C CA  . ASN C 3 137 ? 33.732  10.492  -34.775 1.00 75.47  ? 137 ASN L CA  1 
ATOM   4721 C C   . ASN C 3 137 ? 35.217  10.466  -34.415 1.00 83.14  ? 137 ASN L C   1 
ATOM   4722 O O   . ASN C 3 137 ? 36.070  10.885  -35.203 1.00 94.82  ? 137 ASN L O   1 
ATOM   4723 C CB  . ASN C 3 137 ? 33.396  9.340   -35.723 1.00 78.72  ? 137 ASN L CB  1 
ATOM   4724 C CG  . ASN C 3 137 ? 33.804  7.993   -35.166 1.00 89.37  ? 137 ASN L CG  1 
ATOM   4725 O OD1 . ASN C 3 137 ? 33.849  7.801   -33.950 1.00 101.53 ? 137 ASN L OD1 1 
ATOM   4726 N ND2 . ASN C 3 137 ? 34.110  7.052   -36.049 1.00 84.80  ? 137 ASN L ND2 1 
ATOM   4727 N N   . ASN C 3 138 ? 35.505  9.959   -33.218 1.00 70.41  ? 138 ASN L N   1 
ATOM   4728 C CA  . ASN C 3 138 ? 36.867  9.821   -32.700 1.00 72.85  ? 138 ASN L CA  1 
ATOM   4729 C C   . ASN C 3 138 ? 37.794  10.997  -32.995 1.00 84.81  ? 138 ASN L C   1 
ATOM   4730 O O   . ASN C 3 138 ? 38.334  11.108  -34.090 1.00 94.92  ? 138 ASN L O   1 
ATOM   4731 C CB  . ASN C 3 138 ? 37.497  8.510   -33.177 1.00 77.81  ? 138 ASN L CB  1 
ATOM   4732 C CG  . ASN C 3 138 ? 36.846  7.282   -32.550 1.00 93.33  ? 138 ASN L CG  1 
ATOM   4733 O OD1 . ASN C 3 138 ? 36.053  7.388   -31.613 1.00 103.19 ? 138 ASN L OD1 1 
ATOM   4734 N ND2 . ASN C 3 138 ? 37.186  6.110   -33.064 1.00 94.96  ? 138 ASN L ND2 1 
ATOM   4735 N N   . PHE C 3 139 ? 37.987  11.862  -32.002 1.00 96.22  ? 139 PHE L N   1 
ATOM   4736 C CA  . PHE C 3 139 ? 38.823  13.054  -32.158 1.00 98.02  ? 139 PHE L CA  1 
ATOM   4737 C C   . PHE C 3 139 ? 39.475  13.493  -30.844 1.00 97.12  ? 139 PHE L C   1 
ATOM   4738 O O   . PHE C 3 139 ? 39.330  12.828  -29.823 1.00 100.07 ? 139 PHE L O   1 
ATOM   4739 C CB  . PHE C 3 139 ? 37.997  14.200  -32.735 1.00 90.76  ? 139 PHE L CB  1 
ATOM   4740 C CG  . PHE C 3 139 ? 36.770  14.521  -31.936 1.00 80.95  ? 139 PHE L CG  1 
ATOM   4741 C CD1 . PHE C 3 139 ? 36.756  15.604  -31.070 1.00 84.32  ? 139 PHE L CD1 1 
ATOM   4742 C CD2 . PHE C 3 139 ? 35.632  13.741  -32.048 1.00 68.46  ? 139 PHE L CD2 1 
ATOM   4743 C CE1 . PHE C 3 139 ? 35.627  15.906  -30.337 1.00 85.00  ? 139 PHE L CE1 1 
ATOM   4744 C CE2 . PHE C 3 139 ? 34.504  14.034  -31.323 1.00 74.99  ? 139 PHE L CE2 1 
ATOM   4745 C CZ  . PHE C 3 139 ? 34.499  15.117  -30.463 1.00 87.25  ? 139 PHE L CZ  1 
ATOM   4746 N N   . TYR C 3 140 ? 40.184  14.620  -30.881 1.00 95.17  ? 140 TYR L N   1 
ATOM   4747 C CA  . TYR C 3 140 ? 40.912  15.132  -29.720 1.00 92.67  ? 140 TYR L CA  1 
ATOM   4748 C C   . TYR C 3 140 ? 41.567  16.475  -30.045 1.00 91.14  ? 140 TYR L C   1 
ATOM   4749 O O   . TYR C 3 140 ? 42.313  16.573  -31.014 1.00 89.72  ? 140 TYR L O   1 
ATOM   4750 C CB  . TYR C 3 140 ? 41.989  14.133  -29.294 1.00 93.09  ? 140 TYR L CB  1 
ATOM   4751 C CG  . TYR C 3 140 ? 42.682  14.512  -28.010 1.00 96.77  ? 140 TYR L CG  1 
ATOM   4752 C CD1 . TYR C 3 140 ? 43.533  15.607  -27.956 1.00 104.73 ? 140 TYR L CD1 1 
ATOM   4753 C CD2 . TYR C 3 140 ? 42.485  13.780  -26.852 1.00 95.25  ? 140 TYR L CD2 1 
ATOM   4754 C CE1 . TYR C 3 140 ? 44.169  15.964  -26.782 1.00 103.64 ? 140 TYR L CE1 1 
ATOM   4755 C CE2 . TYR C 3 140 ? 43.119  14.129  -25.673 1.00 101.73 ? 140 TYR L CE2 1 
ATOM   4756 C CZ  . TYR C 3 140 ? 43.960  15.221  -25.642 1.00 100.88 ? 140 TYR L CZ  1 
ATOM   4757 O OH  . TYR C 3 140 ? 44.592  15.575  -24.469 1.00 100.33 ? 140 TYR L OH  1 
ATOM   4758 N N   . PRO C 3 141 ? 41.325  17.511  -29.221 1.00 87.09  ? 141 PRO L N   1 
ATOM   4759 C CA  . PRO C 3 141 ? 40.561  17.548  -27.968 1.00 85.73  ? 141 PRO L CA  1 
ATOM   4760 C C   . PRO C 3 141 ? 39.055  17.572  -28.204 1.00 93.02  ? 141 PRO L C   1 
ATOM   4761 O O   . PRO C 3 141 ? 38.619  17.677  -29.349 1.00 105.00 ? 141 PRO L O   1 
ATOM   4762 C CB  . PRO C 3 141 ? 40.985  18.883  -27.337 1.00 86.51  ? 141 PRO L CB  1 
ATOM   4763 C CG  . PRO C 3 141 ? 42.113  19.404  -28.189 1.00 84.69  ? 141 PRO L CG  1 
ATOM   4764 C CD  . PRO C 3 141 ? 41.894  18.830  -29.535 1.00 79.46  ? 141 PRO L CD  1 
ATOM   4765 N N   . ARG C 3 142 ? 38.266  17.486  -27.138 1.00 91.46  ? 142 ARG L N   1 
ATOM   4766 C CA  . ARG C 3 142 ? 36.817  17.504  -27.297 1.00 95.84  ? 142 ARG L CA  1 
ATOM   4767 C C   . ARG C 3 142 ? 36.319  18.904  -27.632 1.00 100.19 ? 142 ARG L C   1 
ATOM   4768 O O   . ARG C 3 142 ? 35.113  19.144  -27.713 1.00 102.31 ? 142 ARG L O   1 
ATOM   4769 C CB  . ARG C 3 142 ? 36.105  16.947  -26.060 1.00 93.65  ? 142 ARG L CB  1 
ATOM   4770 C CG  . ARG C 3 142 ? 36.479  17.603  -24.749 1.00 101.20 ? 142 ARG L CG  1 
ATOM   4771 C CD  . ARG C 3 142 ? 35.503  17.191  -23.656 1.00 101.90 ? 142 ARG L CD  1 
ATOM   4772 N NE  . ARG C 3 142 ? 34.272  17.973  -23.700 1.00 100.04 ? 142 ARG L NE  1 
ATOM   4773 C CZ  . ARG C 3 142 ? 33.114  17.576  -23.188 1.00 93.43  ? 142 ARG L CZ  1 
ATOM   4774 N NH1 . ARG C 3 142 ? 33.014  16.388  -22.603 1.00 88.44  ? 142 ARG L NH1 1 
ATOM   4775 N NH2 . ARG C 3 142 ? 32.053  18.365  -23.271 1.00 91.06  ? 142 ARG L NH2 1 
ATOM   4776 N N   . GLU C 3 143 ? 37.257  19.825  -27.823 1.00 102.39 ? 143 GLU L N   1 
ATOM   4777 C CA  . GLU C 3 143 ? 36.916  21.172  -28.254 1.00 109.42 ? 143 GLU L CA  1 
ATOM   4778 C C   . GLU C 3 143 ? 36.518  21.164  -29.725 1.00 97.70  ? 143 GLU L C   1 
ATOM   4779 O O   . GLU C 3 143 ? 37.370  21.071  -30.607 1.00 99.88  ? 143 GLU L O   1 
ATOM   4780 C CB  . GLU C 3 143 ? 38.088  22.127  -28.017 1.00 122.70 ? 143 GLU L CB  1 
ATOM   4781 C CG  . GLU C 3 143 ? 38.013  23.430  -28.815 1.00 134.02 ? 143 GLU L CG  1 
ATOM   4782 C CD  . GLU C 3 143 ? 36.826  24.301  -28.433 1.00 138.09 ? 143 GLU L CD  1 
ATOM   4783 O OE1 . GLU C 3 143 ? 36.559  24.458  -27.222 1.00 143.41 ? 143 GLU L OE1 1 
ATOM   4784 O OE2 . GLU C 3 143 ? 36.163  24.839  -29.347 1.00 133.64 ? 143 GLU L OE2 1 
ATOM   4785 N N   . ALA C 3 144 ? 35.218  21.247  -29.986 1.00 85.08  ? 144 ALA L N   1 
ATOM   4786 C CA  . ALA C 3 144 ? 34.721  21.271  -31.356 1.00 80.23  ? 144 ALA L CA  1 
ATOM   4787 C C   . ALA C 3 144 ? 33.460  22.118  -31.489 1.00 83.78  ? 144 ALA L C   1 
ATOM   4788 O O   . ALA C 3 144 ? 32.618  22.161  -30.588 1.00 85.61  ? 144 ALA L O   1 
ATOM   4789 C CB  . ALA C 3 144 ? 34.475  19.861  -31.858 1.00 75.35  ? 144 ALA L CB  1 
ATOM   4790 N N   . LYS C 3 145 ? 33.346  22.792  -32.625 1.00 75.84  ? 145 LYS L N   1 
ATOM   4791 C CA  . LYS C 3 145 ? 32.215  23.653  -32.910 1.00 84.89  ? 145 LYS L CA  1 
ATOM   4792 C C   . LYS C 3 145 ? 31.420  23.026  -34.043 1.00 89.14  ? 145 LYS L C   1 
ATOM   4793 O O   . LYS C 3 145 ? 31.983  22.699  -35.083 1.00 90.06  ? 145 LYS L O   1 
ATOM   4794 C CB  . LYS C 3 145 ? 32.734  25.025  -33.337 1.00 102.33 ? 145 LYS L CB  1 
ATOM   4795 C CG  . LYS C 3 145 ? 31.712  26.149  -33.368 1.00 115.31 ? 145 LYS L CG  1 
ATOM   4796 C CD  . LYS C 3 145 ? 32.359  27.406  -33.945 1.00 123.93 ? 145 LYS L CD  1 
ATOM   4797 C CE  . LYS C 3 145 ? 31.552  28.662  -33.669 1.00 125.65 ? 145 LYS L CE  1 
ATOM   4798 N NZ  . LYS C 3 145 ? 32.290  29.883  -34.112 1.00 121.98 ? 145 LYS L NZ  1 
ATOM   4799 N N   . VAL C 3 146 ? 30.118  22.839  -33.842 1.00 93.16  ? 146 VAL L N   1 
ATOM   4800 C CA  . VAL C 3 146 ? 29.257  22.305  -34.898 1.00 85.10  ? 146 VAL L CA  1 
ATOM   4801 C C   . VAL C 3 146 ? 28.133  23.267  -35.255 1.00 79.85  ? 146 VAL L C   1 
ATOM   4802 O O   . VAL C 3 146 ? 27.379  23.707  -34.393 1.00 85.50  ? 146 VAL L O   1 
ATOM   4803 C CB  . VAL C 3 146 ? 28.634  20.946  -34.521 1.00 80.15  ? 146 VAL L CB  1 
ATOM   4804 C CG1 . VAL C 3 146 ? 27.437  20.657  -35.405 1.00 66.29  ? 146 VAL L CG1 1 
ATOM   4805 C CG2 . VAL C 3 146 ? 29.660  19.840  -34.641 1.00 74.84  ? 146 VAL L CG2 1 
ATOM   4806 N N   . GLN C 3 147 ? 28.023  23.590  -36.535 1.00 77.94  ? 147 GLN L N   1 
ATOM   4807 C CA  . GLN C 3 147 ? 26.976  24.483  -37.000 1.00 84.90  ? 147 GLN L CA  1 
ATOM   4808 C C   . GLN C 3 147 ? 26.164  23.821  -38.103 1.00 87.17  ? 147 GLN L C   1 
ATOM   4809 O O   . GLN C 3 147 ? 26.721  23.230  -39.028 1.00 91.23  ? 147 GLN L O   1 
ATOM   4810 C CB  . GLN C 3 147 ? 27.585  25.790  -37.508 1.00 94.50  ? 147 GLN L CB  1 
ATOM   4811 C CG  . GLN C 3 147 ? 28.543  26.431  -36.525 1.00 111.97 ? 147 GLN L CG  1 
ATOM   4812 C CD  . GLN C 3 147 ? 29.228  27.659  -37.087 1.00 126.33 ? 147 GLN L CD  1 
ATOM   4813 O OE1 . GLN C 3 147 ? 29.908  28.390  -36.363 1.00 126.20 ? 147 GLN L OE1 1 
ATOM   4814 N NE2 . GLN C 3 147 ? 29.056  27.892  -38.385 1.00 136.17 ? 147 GLN L NE2 1 
ATOM   4815 N N   . TRP C 3 148 ? 24.845  23.909  -37.989 1.00 76.57  ? 148 TRP L N   1 
ATOM   4816 C CA  . TRP C 3 148 ? 23.961  23.451  -39.046 1.00 78.32  ? 148 TRP L CA  1 
ATOM   4817 C C   . TRP C 3 148 ? 23.679  24.600  -39.996 1.00 86.37  ? 148 TRP L C   1 
ATOM   4818 O O   . TRP C 3 148 ? 23.651  25.756  -39.587 1.00 90.24  ? 148 TRP L O   1 
ATOM   4819 C CB  . TRP C 3 148 ? 22.650  22.929  -38.467 1.00 77.90  ? 148 TRP L CB  1 
ATOM   4820 C CG  . TRP C 3 148 ? 22.802  21.658  -37.707 1.00 79.47  ? 148 TRP L CG  1 
ATOM   4821 C CD1 . TRP C 3 148 ? 22.926  21.524  -36.361 1.00 81.34  ? 148 TRP L CD1 1 
ATOM   4822 C CD2 . TRP C 3 148 ? 22.851  20.334  -38.251 1.00 81.78  ? 148 TRP L CD2 1 
ATOM   4823 N NE1 . TRP C 3 148 ? 23.049  20.199  -36.026 1.00 82.32  ? 148 TRP L NE1 1 
ATOM   4824 C CE2 . TRP C 3 148 ? 23.006  19.446  -37.169 1.00 81.67  ? 148 TRP L CE2 1 
ATOM   4825 C CE3 . TRP C 3 148 ? 22.777  19.812  -39.545 1.00 79.74  ? 148 TRP L CE3 1 
ATOM   4826 C CZ2 . TRP C 3 148 ? 23.089  18.068  -37.340 1.00 73.90  ? 148 TRP L CZ2 1 
ATOM   4827 C CZ3 . TRP C 3 148 ? 22.860  18.440  -39.711 1.00 79.43  ? 148 TRP L CZ3 1 
ATOM   4828 C CH2 . TRP C 3 148 ? 23.013  17.585  -38.614 1.00 68.90  ? 148 TRP L CH2 1 
ATOM   4829 N N   . LYS C 3 149 ? 23.477  24.276  -41.267 1.00 89.58  ? 149 LYS L N   1 
ATOM   4830 C CA  . LYS C 3 149 ? 23.130  25.272  -42.272 1.00 86.75  ? 149 LYS L CA  1 
ATOM   4831 C C   . LYS C 3 149 ? 22.151  24.691  -43.275 1.00 100.24 ? 149 LYS L C   1 
ATOM   4832 O O   . LYS C 3 149 ? 22.547  23.921  -44.151 1.00 107.41 ? 149 LYS L O   1 
ATOM   4833 C CB  . LYS C 3 149 ? 24.368  25.736  -43.029 1.00 74.75  ? 149 LYS L CB  1 
ATOM   4834 C CG  . LYS C 3 149 ? 25.266  26.688  -42.286 1.00 82.47  ? 149 LYS L CG  1 
ATOM   4835 C CD  . LYS C 3 149 ? 25.805  27.731  -43.251 1.00 102.21 ? 149 LYS L CD  1 
ATOM   4836 C CE  . LYS C 3 149 ? 27.248  28.094  -42.957 1.00 114.01 ? 149 LYS L CE  1 
ATOM   4837 N NZ  . LYS C 3 149 ? 28.176  27.014  -43.396 1.00 117.70 ? 149 LYS L NZ  1 
ATOM   4838 N N   . VAL C 3 150 ? 20.878  25.057  -43.163 1.00 103.88 ? 150 VAL L N   1 
ATOM   4839 C CA  . VAL C 3 150 ? 19.889  24.605  -44.143 1.00 103.05 ? 150 VAL L CA  1 
ATOM   4840 C C   . VAL C 3 150 ? 19.690  25.651  -45.248 1.00 94.39  ? 150 VAL L C   1 
ATOM   4841 O O   . VAL C 3 150 ? 19.266  26.782  -44.999 1.00 83.36  ? 150 VAL L O   1 
ATOM   4842 C CB  . VAL C 3 150 ? 18.554  24.190  -43.480 1.00 96.27  ? 150 VAL L CB  1 
ATOM   4843 C CG1 . VAL C 3 150 ? 18.798  23.796  -42.027 1.00 84.18  ? 150 VAL L CG1 1 
ATOM   4844 C CG2 . VAL C 3 150 ? 17.519  25.301  -43.574 1.00 97.43  ? 150 VAL L CG2 1 
ATOM   4845 N N   . ASP C 3 151 ? 20.022  25.259  -46.472 1.00 99.49  ? 151 ASP L N   1 
ATOM   4846 C CA  . ASP C 3 151 ? 20.079  26.199  -47.583 1.00 108.41 ? 151 ASP L CA  1 
ATOM   4847 C C   . ASP C 3 151 ? 20.996  27.361  -47.217 1.00 107.30 ? 151 ASP L C   1 
ATOM   4848 O O   . ASP C 3 151 ? 20.589  28.520  -47.246 1.00 106.19 ? 151 ASP L O   1 
ATOM   4849 C CB  . ASP C 3 151 ? 18.683  26.708  -47.955 1.00 110.54 ? 151 ASP L CB  1 
ATOM   4850 C CG  . ASP C 3 151 ? 17.862  25.678  -48.714 1.00 110.80 ? 151 ASP L CG  1 
ATOM   4851 O OD1 . ASP C 3 151 ? 18.408  24.610  -49.065 1.00 107.35 ? 151 ASP L OD1 1 
ATOM   4852 O OD2 . ASP C 3 151 ? 16.665  25.939  -48.961 1.00 112.09 ? 151 ASP L OD2 1 
ATOM   4853 N N   . ASN C 3 152 ? 22.232  27.035  -46.853 1.00 106.32 ? 152 ASN L N   1 
ATOM   4854 C CA  . ASN C 3 152 ? 23.232  28.044  -46.532 1.00 108.23 ? 152 ASN L CA  1 
ATOM   4855 C C   . ASN C 3 152 ? 22.847  28.901  -45.319 1.00 106.45 ? 152 ASN L C   1 
ATOM   4856 O O   . ASN C 3 152 ? 23.652  29.692  -44.825 1.00 102.26 ? 152 ASN L O   1 
ATOM   4857 C CB  . ASN C 3 152 ? 23.493  28.927  -47.756 1.00 117.03 ? 152 ASN L CB  1 
ATOM   4858 C CG  . ASN C 3 152 ? 24.807  29.684  -47.666 1.00 123.52 ? 152 ASN L CG  1 
ATOM   4859 O OD1 . ASN C 3 152 ? 25.725  29.278  -46.950 1.00 124.74 ? 152 ASN L OD1 1 
ATOM   4860 N ND2 . ASN C 3 152 ? 24.907  30.788  -48.403 1.00 119.91 ? 152 ASN L ND2 1 
ATOM   4861 N N   . ALA C 3 153 ? 21.617  28.732  -44.839 1.00 110.17 ? 153 ALA L N   1 
ATOM   4862 C CA  . ALA C 3 153 ? 21.121  29.495  -43.695 1.00 109.60 ? 153 ALA L CA  1 
ATOM   4863 C C   . ALA C 3 153 ? 21.512  28.850  -42.368 1.00 109.22 ? 153 ALA L C   1 
ATOM   4864 O O   . ALA C 3 153 ? 21.362  27.640  -42.183 1.00 110.33 ? 153 ALA L O   1 
ATOM   4865 C CB  . ALA C 3 153 ? 19.610  29.657  -43.779 1.00 100.86 ? 153 ALA L CB  1 
ATOM   4866 N N   . LEU C 3 154 ? 22.009  29.662  -41.442 1.00 105.07 ? 154 LEU L N   1 
ATOM   4867 C CA  . LEU C 3 154 ? 22.404  29.166  -40.129 1.00 104.31 ? 154 LEU L CA  1 
ATOM   4868 C C   . LEU C 3 154 ? 21.162  28.805  -39.318 1.00 99.14  ? 154 LEU L C   1 
ATOM   4869 O O   . LEU C 3 154 ? 20.071  29.306  -39.590 1.00 104.08 ? 154 LEU L O   1 
ATOM   4870 C CB  . LEU C 3 154 ? 23.222  30.227  -39.393 1.00 110.98 ? 154 LEU L CB  1 
ATOM   4871 C CG  . LEU C 3 154 ? 24.502  29.780  -38.684 1.00 114.01 ? 154 LEU L CG  1 
ATOM   4872 C CD1 . LEU C 3 154 ? 24.239  28.720  -37.615 1.00 107.45 ? 154 LEU L CD1 1 
ATOM   4873 C CD2 . LEU C 3 154 ? 25.518  29.282  -39.705 1.00 117.69 ? 154 LEU L CD2 1 
ATOM   4874 N N   . GLN C 3 155 ? 21.329  27.930  -38.331 1.00 92.34  ? 155 GLN L N   1 
ATOM   4875 C CA  . GLN C 3 155 ? 20.232  27.544  -37.448 1.00 88.55  ? 155 GLN L CA  1 
ATOM   4876 C C   . GLN C 3 155 ? 20.652  27.748  -36.000 1.00 91.31  ? 155 GLN L C   1 
ATOM   4877 O O   . GLN C 3 155 ? 21.779  27.430  -35.632 1.00 93.24  ? 155 GLN L O   1 
ATOM   4878 C CB  . GLN C 3 155 ? 19.848  26.080  -37.670 1.00 82.99  ? 155 GLN L CB  1 
ATOM   4879 C CG  . GLN C 3 155 ? 19.591  25.714  -39.124 1.00 88.84  ? 155 GLN L CG  1 
ATOM   4880 C CD  . GLN C 3 155 ? 18.261  26.234  -39.645 1.00 91.06  ? 155 GLN L CD  1 
ATOM   4881 O OE1 . GLN C 3 155 ? 17.215  26.036  -39.028 1.00 82.83  ? 155 GLN L OE1 1 
ATOM   4882 N NE2 . GLN C 3 155 ? 18.297  26.894  -40.797 1.00 97.04  ? 155 GLN L NE2 1 
ATOM   4883 N N   . SER C 3 156 ? 19.749  28.279  -35.182 1.00 99.70  ? 156 SER L N   1 
ATOM   4884 C CA  . SER C 3 156 ? 20.047  28.503  -33.769 1.00 103.37 ? 156 SER L CA  1 
ATOM   4885 C C   . SER C 3 156 ? 18.955  27.984  -32.840 1.00 98.15  ? 156 SER L C   1 
ATOM   4886 O O   . SER C 3 156 ? 17.776  27.970  -33.194 1.00 93.88  ? 156 SER L O   1 
ATOM   4887 C CB  . SER C 3 156 ? 20.306  29.982  -33.494 1.00 111.20 ? 156 SER L CB  1 
ATOM   4888 O OG  . SER C 3 156 ? 21.541  30.396  -34.047 1.00 118.48 ? 156 SER L OG  1 
ATOM   4889 N N   . GLY C 3 157 ? 19.362  27.567  -31.645 1.00 103.91 ? 157 GLY L N   1 
ATOM   4890 C CA  . GLY C 3 157 ? 18.438  27.020  -30.669 1.00 107.04 ? 157 GLY L CA  1 
ATOM   4891 C C   . GLY C 3 157 ? 17.577  25.945  -31.292 1.00 105.82 ? 157 GLY L C   1 
ATOM   4892 O O   . GLY C 3 157 ? 16.361  25.916  -31.099 1.00 113.82 ? 157 GLY L O   1 
ATOM   4893 N N   . ASN C 3 158 ? 18.212  25.059  -32.048 1.00 97.64  ? 158 ASN L N   1 
ATOM   4894 C CA  . ASN C 3 158 ? 17.479  24.029  -32.759 1.00 102.13 ? 158 ASN L CA  1 
ATOM   4895 C C   . ASN C 3 158 ? 18.106  22.648  -32.611 1.00 100.47 ? 158 ASN L C   1 
ATOM   4896 O O   . ASN C 3 158 ? 17.428  21.630  -32.739 1.00 99.58  ? 158 ASN L O   1 
ATOM   4897 C CB  . ASN C 3 158 ? 17.354  24.402  -34.232 1.00 113.19 ? 158 ASN L CB  1 
ATOM   4898 C CG  . ASN C 3 158 ? 16.126  23.808  -34.871 1.00 123.30 ? 158 ASN L CG  1 
ATOM   4899 O OD1 . ASN C 3 158 ? 15.535  22.862  -34.344 1.00 126.70 ? 158 ASN L OD1 1 
ATOM   4900 N ND2 . ASN C 3 158 ? 15.725  24.362  -36.008 1.00 125.49 ? 158 ASN L ND2 1 
ATOM   4901 N N   . SER C 3 159 ? 19.402  22.626  -32.323 1.00 95.69  ? 159 SER L N   1 
ATOM   4902 C CA  . SER C 3 159 ? 20.145  21.382  -32.194 1.00 85.39  ? 159 SER L CA  1 
ATOM   4903 C C   . SER C 3 159 ? 20.313  20.964  -30.741 1.00 81.80  ? 159 SER L C   1 
ATOM   4904 O O   . SER C 3 159 ? 20.101  21.760  -29.827 1.00 87.81  ? 159 SER L O   1 
ATOM   4905 C CB  . SER C 3 159 ? 21.526  21.546  -32.823 1.00 91.40  ? 159 SER L CB  1 
ATOM   4906 O OG  . SER C 3 159 ? 22.237  22.610  -32.208 1.00 92.09  ? 159 SER L OG  1 
ATOM   4907 N N   . GLN C 3 160 ? 20.695  19.707  -30.538 1.00 78.05  ? 160 GLN L N   1 
ATOM   4908 C CA  . GLN C 3 160 ? 21.090  19.216  -29.221 1.00 78.63  ? 160 GLN L CA  1 
ATOM   4909 C C   . GLN C 3 160 ? 22.361  18.388  -29.339 1.00 79.06  ? 160 GLN L C   1 
ATOM   4910 O O   . GLN C 3 160 ? 22.424  17.428  -30.106 1.00 86.66  ? 160 GLN L O   1 
ATOM   4911 C CB  . GLN C 3 160 ? 19.972  18.399  -28.569 1.00 72.80  ? 160 GLN L CB  1 
ATOM   4912 C CG  . GLN C 3 160 ? 19.228  19.142  -27.466 1.00 73.35  ? 160 GLN L CG  1 
ATOM   4913 C CD  . GLN C 3 160 ? 18.008  18.386  -26.972 1.00 80.34  ? 160 GLN L CD  1 
ATOM   4914 O OE1 . GLN C 3 160 ? 17.430  17.571  -27.698 1.00 81.55  ? 160 GLN L OE1 1 
ATOM   4915 N NE2 . GLN C 3 160 ? 17.603  18.659  -25.736 1.00 77.03  ? 160 GLN L NE2 1 
ATOM   4916 N N   . GLU C 3 161 ? 23.373  18.771  -28.575 1.00 70.54  ? 161 GLU L N   1 
ATOM   4917 C CA  . GLU C 3 161 ? 24.666  18.118  -28.642 1.00 73.78  ? 161 GLU L CA  1 
ATOM   4918 C C   . GLU C 3 161 ? 24.704  16.942  -27.677 1.00 70.53  ? 161 GLU L C   1 
ATOM   4919 O O   . GLU C 3 161 ? 23.774  16.741  -26.904 1.00 70.31  ? 161 GLU L O   1 
ATOM   4920 C CB  . GLU C 3 161 ? 25.761  19.128  -28.304 1.00 82.02  ? 161 GLU L CB  1 
ATOM   4921 C CG  . GLU C 3 161 ? 26.989  19.060  -29.182 1.00 94.07  ? 161 GLU L CG  1 
ATOM   4922 C CD  . GLU C 3 161 ? 27.463  20.440  -29.590 1.00 110.84 ? 161 GLU L CD  1 
ATOM   4923 O OE1 . GLU C 3 161 ? 26.636  21.210  -30.123 1.00 116.05 ? 161 GLU L OE1 1 
ATOM   4924 O OE2 . GLU C 3 161 ? 28.655  20.754  -29.382 1.00 120.71 ? 161 GLU L OE2 1 
ATOM   4925 N N   . SER C 3 162 ? 25.778  16.164  -27.733 1.00 66.57  ? 162 SER L N   1 
ATOM   4926 C CA  . SER C 3 162 ? 25.971  15.035  -26.828 1.00 70.25  ? 162 SER L CA  1 
ATOM   4927 C C   . SER C 3 162 ? 27.327  14.403  -27.088 1.00 76.58  ? 162 SER L C   1 
ATOM   4928 O O   . SER C 3 162 ? 27.596  13.947  -28.196 1.00 86.44  ? 162 SER L O   1 
ATOM   4929 C CB  . SER C 3 162 ? 24.876  13.987  -27.018 1.00 69.90  ? 162 SER L CB  1 
ATOM   4930 O OG  . SER C 3 162 ? 25.191  12.799  -26.317 1.00 70.62  ? 162 SER L OG  1 
ATOM   4931 N N   . VAL C 3 163 ? 28.185  14.375  -26.077 1.00 71.16  ? 163 VAL L N   1 
ATOM   4932 C CA  . VAL C 3 163 ? 29.527  13.839  -26.268 1.00 71.71  ? 163 VAL L CA  1 
ATOM   4933 C C   . VAL C 3 163 ? 29.900  12.753  -25.263 1.00 67.59  ? 163 VAL L C   1 
ATOM   4934 O O   . VAL C 3 163 ? 29.468  12.779  -24.119 1.00 66.11  ? 163 VAL L O   1 
ATOM   4935 C CB  . VAL C 3 163 ? 30.592  14.956  -26.298 1.00 73.48  ? 163 VAL L CB  1 
ATOM   4936 C CG1 . VAL C 3 163 ? 30.046  16.228  -25.677 1.00 64.13  ? 163 VAL L CG1 1 
ATOM   4937 C CG2 . VAL C 3 163 ? 31.868  14.498  -25.615 1.00 64.85  ? 163 VAL L CG2 1 
ATOM   4938 N N   . THR C 3 164 ? 30.704  11.797  -25.717 1.00 71.74  ? 164 THR L N   1 
ATOM   4939 C CA  . THR C 3 164 ? 31.064  10.626  -24.929 1.00 79.22  ? 164 THR L CA  1 
ATOM   4940 C C   . THR C 3 164 ? 32.224  10.910  -23.982 1.00 77.86  ? 164 THR L C   1 
ATOM   4941 O O   . THR C 3 164 ? 32.836  11.974  -24.031 1.00 71.89  ? 164 THR L O   1 
ATOM   4942 C CB  . THR C 3 164 ? 31.456  9.439   -25.844 1.00 87.64  ? 164 THR L CB  1 
ATOM   4943 O OG1 . THR C 3 164 ? 32.773  9.646   -26.373 1.00 95.95  ? 164 THR L OG1 1 
ATOM   4944 C CG2 . THR C 3 164 ? 30.470  9.291   -26.998 1.00 76.13  ? 164 THR L CG2 1 
ATOM   4945 N N   . GLU C 3 165 ? 32.519  9.943   -23.120 1.00 83.67  ? 165 GLU L N   1 
ATOM   4946 C CA  . GLU C 3 165 ? 33.647  10.041  -22.202 1.00 86.48  ? 165 GLU L CA  1 
ATOM   4947 C C   . GLU C 3 165 ? 34.878  9.375   -22.809 1.00 83.79  ? 165 GLU L C   1 
ATOM   4948 O O   . GLU C 3 165 ? 34.824  8.215   -23.201 1.00 86.37  ? 165 GLU L O   1 
ATOM   4949 C CB  . GLU C 3 165 ? 33.301  9.389   -20.860 1.00 87.31  ? 165 GLU L CB  1 
ATOM   4950 C CG  . GLU C 3 165 ? 32.277  10.151  -20.018 1.00 83.75  ? 165 GLU L CG  1 
ATOM   4951 C CD  . GLU C 3 165 ? 32.875  11.349  -19.297 1.00 94.68  ? 165 GLU L CD  1 
ATOM   4952 O OE1 . GLU C 3 165 ? 32.098  12.231  -18.868 1.00 95.05  ? 165 GLU L OE1 1 
ATOM   4953 O OE2 . GLU C 3 165 ? 34.119  11.406  -19.158 1.00 98.47  ? 165 GLU L OE2 1 
ATOM   4954 N N   . GLN C 3 166 ? 35.981  10.114  -22.881 1.00 86.22  ? 166 GLN L N   1 
ATOM   4955 C CA  . GLN C 3 166 ? 37.210  9.633   -23.514 1.00 86.44  ? 166 GLN L CA  1 
ATOM   4956 C C   . GLN C 3 166 ? 37.293  8.125   -23.594 1.00 86.28  ? 166 GLN L C   1 
ATOM   4957 O O   . GLN C 3 166 ? 37.345  7.451   -22.572 1.00 82.51  ? 166 GLN L O   1 
ATOM   4958 C CB  . GLN C 3 166 ? 38.441  10.153  -22.778 1.00 92.68  ? 166 GLN L CB  1 
ATOM   4959 C CG  . GLN C 3 166 ? 39.226  11.201  -23.541 1.00 101.60 ? 166 GLN L CG  1 
ATOM   4960 C CD  . GLN C 3 166 ? 40.504  11.593  -22.827 1.00 109.73 ? 166 GLN L CD  1 
ATOM   4961 O OE1 . GLN C 3 166 ? 40.507  11.820  -21.615 1.00 117.23 ? 166 GLN L OE1 1 
ATOM   4962 N NE2 . GLN C 3 166 ? 41.598  11.679  -23.573 1.00 106.93 ? 166 GLN L NE2 1 
ATOM   4963 N N   . ASP C 3 167 ? 37.317  7.600   -24.814 1.00 89.22  ? 167 ASP L N   1 
ATOM   4964 C CA  . ASP C 3 167 ? 37.410  6.161   -25.012 1.00 96.05  ? 167 ASP L CA  1 
ATOM   4965 C C   . ASP C 3 167 ? 38.522  5.564   -24.151 1.00 104.31 ? 167 ASP L C   1 
ATOM   4966 O O   . ASP C 3 167 ? 39.600  6.146   -24.010 1.00 100.44 ? 167 ASP L O   1 
ATOM   4967 C CB  . ASP C 3 167 ? 37.628  5.823   -26.485 1.00 92.15  ? 167 ASP L CB  1 
ATOM   4968 C CG  . ASP C 3 167 ? 37.393  4.358   -26.782 1.00 99.28  ? 167 ASP L CG  1 
ATOM   4969 O OD1 . ASP C 3 167 ? 36.492  4.059   -27.594 1.00 106.02 ? 167 ASP L OD1 1 
ATOM   4970 O OD2 . ASP C 3 167 ? 38.093  3.507   -26.194 1.00 98.07  ? 167 ASP L OD2 1 
ATOM   4971 N N   . SER C 3 168 ? 38.247  4.401   -23.572 1.00 111.01 ? 168 SER L N   1 
ATOM   4972 C CA  . SER C 3 168 ? 39.165  3.778   -22.627 1.00 116.47 ? 168 SER L CA  1 
ATOM   4973 C C   . SER C 3 168 ? 40.397  3.197   -23.312 1.00 112.08 ? 168 SER L C   1 
ATOM   4974 O O   . SER C 3 168 ? 41.403  2.919   -22.660 1.00 104.58 ? 168 SER L O   1 
ATOM   4975 C CB  . SER C 3 168 ? 38.442  2.686   -21.831 1.00 127.47 ? 168 SER L CB  1 
ATOM   4976 O OG  . SER C 3 168 ? 37.792  1.768   -22.696 1.00 135.15 ? 168 SER L OG  1 
ATOM   4977 N N   . LYS C 3 169 ? 40.318  3.025   -24.629 1.00 113.34 ? 169 LYS L N   1 
ATOM   4978 C CA  . LYS C 3 169 ? 41.357  2.313   -25.365 1.00 102.38 ? 169 LYS L CA  1 
ATOM   4979 C C   . LYS C 3 169 ? 42.141  3.186   -26.349 1.00 96.92  ? 169 LYS L C   1 
ATOM   4980 O O   . LYS C 3 169 ? 43.367  3.110   -26.403 1.00 80.12  ? 169 LYS L O   1 
ATOM   4981 C CB  . LYS C 3 169 ? 40.755  1.084   -26.052 1.00 102.70 ? 169 LYS L CB  1 
ATOM   4982 C CG  . LYS C 3 169 ? 40.243  0.043   -25.055 1.00 113.07 ? 169 LYS L CG  1 
ATOM   4983 C CD  . LYS C 3 169 ? 39.145  -0.834  -25.638 1.00 123.73 ? 169 LYS L CD  1 
ATOM   4984 C CE  . LYS C 3 169 ? 38.743  -1.941  -24.671 1.00 130.92 ? 169 LYS L CE  1 
ATOM   4985 N NZ  . LYS C 3 169 ? 38.315  -1.410  -23.342 1.00 131.92 ? 169 LYS L NZ  1 
ATOM   4986 N N   . ASP C 3 170 ? 41.443  4.021   -27.114 1.00 99.74  ? 170 ASP L N   1 
ATOM   4987 C CA  . ASP C 3 170 ? 42.118  4.920   -28.055 1.00 106.21 ? 170 ASP L CA  1 
ATOM   4988 C C   . ASP C 3 170 ? 42.176  6.365   -27.551 1.00 105.69 ? 170 ASP L C   1 
ATOM   4989 O O   . ASP C 3 170 ? 42.636  7.262   -28.262 1.00 101.50 ? 170 ASP L O   1 
ATOM   4990 C CB  . ASP C 3 170 ? 41.492  4.842   -29.459 1.00 114.16 ? 170 ASP L CB  1 
ATOM   4991 C CG  . ASP C 3 170 ? 40.117  5.486   -29.533 1.00 118.16 ? 170 ASP L CG  1 
ATOM   4992 O OD1 . ASP C 3 170 ? 39.527  5.495   -30.636 1.00 115.48 ? 170 ASP L OD1 1 
ATOM   4993 O OD2 . ASP C 3 170 ? 39.630  5.978   -28.492 1.00 116.90 ? 170 ASP L OD2 1 
ATOM   4994 N N   . SER C 3 171 ? 41.707  6.569   -26.320 1.00 104.82 ? 171 SER L N   1 
ATOM   4995 C CA  . SER C 3 171 ? 41.763  7.866   -25.645 1.00 94.92  ? 171 SER L CA  1 
ATOM   4996 C C   . SER C 3 171 ? 41.155  8.988   -26.475 1.00 89.94  ? 171 SER L C   1 
ATOM   4997 O O   . SER C 3 171 ? 41.816  9.983   -26.768 1.00 86.95  ? 171 SER L O   1 
ATOM   4998 C CB  . SER C 3 171 ? 43.205  8.218   -25.280 1.00 98.52  ? 171 SER L CB  1 
ATOM   4999 O OG  . SER C 3 171 ? 43.830  7.147   -24.592 1.00 102.59 ? 171 SER L OG  1 
ATOM   5000 N N   . THR C 3 172 ? 39.887  8.833   -26.837 1.00 89.89  ? 172 THR L N   1 
ATOM   5001 C CA  . THR C 3 172 ? 39.259  9.753   -27.774 1.00 87.21  ? 172 THR L CA  1 
ATOM   5002 C C   . THR C 3 172 ? 37.818  10.108  -27.399 1.00 85.62  ? 172 THR L C   1 
ATOM   5003 O O   . THR C 3 172 ? 37.167  9.409   -26.618 1.00 86.86  ? 172 THR L O   1 
ATOM   5004 C CB  . THR C 3 172 ? 39.293  9.179   -29.206 1.00 87.61  ? 172 THR L CB  1 
ATOM   5005 O OG1 . THR C 3 172 ? 39.467  10.241  -30.148 1.00 89.93  ? 172 THR L OG1 1 
ATOM   5006 C CG2 . THR C 3 172 ? 38.012  8.408   -29.516 1.00 70.64  ? 172 THR L CG2 1 
ATOM   5007 N N   . TYR C 3 173 ? 37.333  11.208  -27.961 1.00 75.61  ? 173 TYR L N   1 
ATOM   5008 C CA  . TYR C 3 173 ? 35.968  11.652  -27.743 1.00 74.40  ? 173 TYR L CA  1 
ATOM   5009 C C   . TYR C 3 173 ? 35.184  11.394  -29.012 1.00 75.21  ? 173 TYR L C   1 
ATOM   5010 O O   . TYR C 3 173 ? 35.759  10.990  -30.011 1.00 79.87  ? 173 TYR L O   1 
ATOM   5011 C CB  . TYR C 3 173 ? 35.946  13.141  -27.399 1.00 76.55  ? 173 TYR L CB  1 
ATOM   5012 C CG  . TYR C 3 173 ? 36.580  13.472  -26.064 1.00 90.00  ? 173 TYR L CG  1 
ATOM   5013 C CD1 . TYR C 3 173 ? 35.865  13.332  -24.885 1.00 96.90  ? 173 TYR L CD1 1 
ATOM   5014 C CD2 . TYR C 3 173 ? 37.893  13.920  -25.984 1.00 93.81  ? 173 TYR L CD2 1 
ATOM   5015 C CE1 . TYR C 3 173 ? 36.435  13.628  -23.666 1.00 109.77 ? 173 TYR L CE1 1 
ATOM   5016 C CE2 . TYR C 3 173 ? 38.474  14.220  -24.769 1.00 100.17 ? 173 TYR L CE2 1 
ATOM   5017 C CZ  . TYR C 3 173 ? 37.740  14.072  -23.607 1.00 115.01 ? 173 TYR L CZ  1 
ATOM   5018 O OH  . TYR C 3 173 ? 38.305  14.370  -22.378 1.00 122.15 ? 173 TYR L OH  1 
ATOM   5019 N N   . SER C 3 174 ? 33.876  11.616  -28.970 1.00 73.37  ? 174 SER L N   1 
ATOM   5020 C CA  . SER C 3 174 ? 33.039  11.541  -30.162 1.00 77.73  ? 174 SER L CA  1 
ATOM   5021 C C   . SER C 3 174 ? 31.720  12.194  -29.841 1.00 72.46  ? 174 SER L C   1 
ATOM   5022 O O   . SER C 3 174 ? 31.127  11.889  -28.818 1.00 73.37  ? 174 SER L O   1 
ATOM   5023 C CB  . SER C 3 174 ? 32.780  10.090  -30.561 1.00 91.23  ? 174 SER L CB  1 
ATOM   5024 O OG  . SER C 3 174 ? 33.978  9.340   -30.626 1.00 103.47 ? 174 SER L OG  1 
ATOM   5025 N N   . LEU C 3 175 ? 31.245  13.086  -30.701 1.00 71.59  ? 175 LEU L N   1 
ATOM   5026 C CA  . LEU C 3 175 ? 29.959  13.719  -30.428 1.00 81.52  ? 175 LEU L CA  1 
ATOM   5027 C C   . LEU C 3 175 ? 28.913  13.567  -31.529 1.00 88.14  ? 175 LEU L C   1 
ATOM   5028 O O   . LEU C 3 175 ? 29.206  13.141  -32.640 1.00 63.15  ? 175 LEU L O   1 
ATOM   5029 C CB  . LEU C 3 175 ? 30.130  15.184  -30.015 1.00 80.74  ? 175 LEU L CB  1 
ATOM   5030 C CG  . LEU C 3 175 ? 29.986  16.332  -31.008 1.00 79.36  ? 175 LEU L CG  1 
ATOM   5031 C CD1 . LEU C 3 175 ? 28.528  16.657  -31.280 1.00 63.47  ? 175 LEU L CD1 1 
ATOM   5032 C CD2 . LEU C 3 175 ? 30.680  17.537  -30.418 1.00 82.62  ? 175 LEU L CD2 1 
ATOM   5033 N N   . SER C 3 176 ? 27.678  13.901  -31.179 1.00 62.17  ? 176 SER L N   1 
ATOM   5034 C CA  . SER C 3 176 ? 26.564  13.822  -32.100 1.00 68.15  ? 176 SER L CA  1 
ATOM   5035 C C   . SER C 3 176 ? 25.710  15.066  -31.946 1.00 74.34  ? 176 SER L C   1 
ATOM   5036 O O   . SER C 3 176 ? 25.221  15.357  -30.852 1.00 78.40  ? 176 SER L O   1 
ATOM   5037 C CB  . SER C 3 176 ? 25.721  12.580  -31.808 1.00 69.78  ? 176 SER L CB  1 
ATOM   5038 O OG  . SER C 3 176 ? 24.806  12.806  -30.748 1.00 71.58  ? 176 SER L OG  1 
ATOM   5039 N N   . SER C 3 177 ? 25.537  15.805  -33.037 1.00 65.69  ? 177 SER L N   1 
ATOM   5040 C CA  . SER C 3 177 ? 24.637  16.944  -33.031 1.00 66.15  ? 177 SER L CA  1 
ATOM   5041 C C   . SER C 3 177 ? 23.315  16.515  -33.630 1.00 61.92  ? 177 SER L C   1 
ATOM   5042 O O   . SER C 3 177 ? 23.285  15.725  -34.563 1.00 61.90  ? 177 SER L O   1 
ATOM   5043 C CB  . SER C 3 177 ? 25.226  18.103  -33.826 1.00 70.89  ? 177 SER L CB  1 
ATOM   5044 O OG  . SER C 3 177 ? 24.626  19.330  -33.453 1.00 71.98  ? 177 SER L OG  1 
ATOM   5045 N N   . THR C 3 178 ? 22.218  17.020  -33.086 1.00 61.80  ? 178 THR L N   1 
ATOM   5046 C CA  . THR C 3 178 ? 20.910  16.602  -33.558 1.00 73.20  ? 178 THR L CA  1 
ATOM   5047 C C   . THR C 3 178 ? 19.976  17.779  -33.769 1.00 82.67  ? 178 THR L C   1 
ATOM   5048 O O   . THR C 3 178 ? 19.434  18.335  -32.811 1.00 79.17  ? 178 THR L O   1 
ATOM   5049 C CB  . THR C 3 178 ? 20.245  15.618  -32.591 1.00 74.82  ? 178 THR L CB  1 
ATOM   5050 O OG1 . THR C 3 178 ? 21.228  14.712  -32.076 1.00 81.32  ? 178 THR L OG1 1 
ATOM   5051 C CG2 . THR C 3 178 ? 19.173  14.834  -33.316 1.00 77.81  ? 178 THR L CG2 1 
ATOM   5052 N N   . LEU C 3 179 ? 19.807  18.155  -35.035 1.00 90.55  ? 179 LEU L N   1 
ATOM   5053 C CA  . LEU C 3 179 ? 18.852  19.179  -35.427 1.00 80.98  ? 179 LEU L CA  1 
ATOM   5054 C C   . LEU C 3 179 ? 17.510  18.497  -35.640 1.00 77.07  ? 179 LEU L C   1 
ATOM   5055 O O   . LEU C 3 179 ? 17.435  17.451  -36.284 1.00 80.67  ? 179 LEU L O   1 
ATOM   5056 C CB  . LEU C 3 179 ? 19.310  19.865  -36.716 1.00 80.02  ? 179 LEU L CB  1 
ATOM   5057 C CG  . LEU C 3 179 ? 18.482  21.036  -37.259 1.00 86.41  ? 179 LEU L CG  1 
ATOM   5058 C CD1 . LEU C 3 179 ? 18.897  22.344  -36.603 1.00 92.15  ? 179 LEU L CD1 1 
ATOM   5059 C CD2 . LEU C 3 179 ? 18.629  21.139  -38.767 1.00 81.15  ? 179 LEU L CD2 1 
ATOM   5060 N N   . THR C 3 180 ? 16.451  19.080  -35.091 1.00 73.62  ? 180 THR L N   1 
ATOM   5061 C CA  . THR C 3 180 ? 15.137  18.451  -35.150 1.00 83.28  ? 180 THR L CA  1 
ATOM   5062 C C   . THR C 3 180 ? 14.051  19.429  -35.594 1.00 87.23  ? 180 THR L C   1 
ATOM   5063 O O   . THR C 3 180 ? 13.926  20.523  -35.048 1.00 94.16  ? 180 THR L O   1 
ATOM   5064 C CB  . THR C 3 180 ? 14.773  17.745  -33.810 1.00 77.62  ? 180 THR L CB  1 
ATOM   5065 O OG1 . THR C 3 180 ? 13.351  17.740  -33.631 1.00 79.46  ? 180 THR L OG1 1 
ATOM   5066 C CG2 . THR C 3 180 ? 15.429  18.445  -32.631 1.00 69.57  ? 180 THR L CG2 1 
ATOM   5067 N N   . LEU C 3 181 ? 13.287  19.027  -36.608 1.00 88.31  ? 181 LEU L N   1 
ATOM   5068 C CA  . LEU C 3 181 ? 12.265  19.878  -37.211 1.00 86.78  ? 181 LEU L CA  1 
ATOM   5069 C C   . LEU C 3 181 ? 10.992  19.098  -37.470 1.00 89.71  ? 181 LEU L C   1 
ATOM   5070 O O   . LEU C 3 181 ? 11.015  17.871  -37.559 1.00 94.32  ? 181 LEU L O   1 
ATOM   5071 C CB  . LEU C 3 181 ? 12.768  20.455  -38.529 1.00 82.95  ? 181 LEU L CB  1 
ATOM   5072 C CG  . LEU C 3 181 ? 14.088  21.206  -38.421 1.00 79.50  ? 181 LEU L CG  1 
ATOM   5073 C CD1 . LEU C 3 181 ? 14.684  21.429  -39.792 1.00 73.48  ? 181 LEU L CD1 1 
ATOM   5074 C CD2 . LEU C 3 181 ? 13.862  22.517  -37.694 1.00 85.20  ? 181 LEU L CD2 1 
ATOM   5075 N N   . SER C 3 182 ? 9.879   19.811  -37.597 1.00 90.42  ? 182 SER L N   1 
ATOM   5076 C CA  . SER C 3 182 ? 8.623   19.162  -37.929 1.00 104.21 ? 182 SER L CA  1 
ATOM   5077 C C   . SER C 3 182 ? 8.659   18.732  -39.387 1.00 110.05 ? 182 SER L C   1 
ATOM   5078 O O   . SER C 3 182 ? 9.397   19.298  -40.197 1.00 105.26 ? 182 SER L O   1 
ATOM   5079 C CB  . SER C 3 182 ? 7.438   20.094  -37.677 1.00 114.13 ? 182 SER L CB  1 
ATOM   5080 O OG  . SER C 3 182 ? 7.379   21.124  -38.649 1.00 119.87 ? 182 SER L OG  1 
ATOM   5081 N N   . LYS C 3 183 ? 7.868   17.720  -39.717 1.00 109.77 ? 183 LYS L N   1 
ATOM   5082 C CA  . LYS C 3 183 ? 7.804   17.227  -41.079 1.00 111.10 ? 183 LYS L CA  1 
ATOM   5083 C C   . LYS C 3 183 ? 7.643   18.406  -42.031 1.00 113.60 ? 183 LYS L C   1 
ATOM   5084 O O   . LYS C 3 183 ? 8.319   18.487  -43.054 1.00 106.39 ? 183 LYS L O   1 
ATOM   5085 C CB  . LYS C 3 183 ? 6.634   16.254  -41.221 1.00 116.12 ? 183 LYS L CB  1 
ATOM   5086 C CG  . LYS C 3 183 ? 6.638   15.439  -42.496 1.00 123.94 ? 183 LYS L CG  1 
ATOM   5087 C CD  . LYS C 3 183 ? 5.430   14.518  -42.541 1.00 126.89 ? 183 LYS L CD  1 
ATOM   5088 C CE  . LYS C 3 183 ? 5.314   13.808  -43.876 1.00 127.43 ? 183 LYS L CE  1 
ATOM   5089 N NZ  . LYS C 3 183 ? 4.180   12.845  -43.879 1.00 127.71 ? 183 LYS L NZ  1 
ATOM   5090 N N   . ALA C 3 184 ? 6.760   19.331  -41.666 1.00 118.38 ? 184 ALA L N   1 
ATOM   5091 C CA  . ALA C 3 184 ? 6.465   20.499  -42.488 1.00 112.80 ? 184 ALA L CA  1 
ATOM   5092 C C   . ALA C 3 184 ? 7.715   21.303  -42.832 1.00 110.84 ? 184 ALA L C   1 
ATOM   5093 O O   . ALA C 3 184 ? 8.135   21.331  -43.985 1.00 112.93 ? 184 ALA L O   1 
ATOM   5094 C CB  . ALA C 3 184 ? 5.433   21.382  -41.805 1.00 112.77 ? 184 ALA L CB  1 
ATOM   5095 N N   . ASP C 3 185 ? 8.311   21.953  -41.837 1.00 112.38 ? 185 ASP L N   1 
ATOM   5096 C CA  . ASP C 3 185 ? 9.508   22.763  -42.067 1.00 109.88 ? 185 ASP L CA  1 
ATOM   5097 C C   . ASP C 3 185 ? 10.630  21.976  -42.733 1.00 103.89 ? 185 ASP L C   1 
ATOM   5098 O O   . ASP C 3 185 ? 11.536  22.554  -43.335 1.00 101.46 ? 185 ASP L O   1 
ATOM   5099 C CB  . ASP C 3 185 ? 10.016  23.379  -40.760 1.00 110.53 ? 185 ASP L CB  1 
ATOM   5100 C CG  . ASP C 3 185 ? 9.422   24.743  -40.491 1.00 113.56 ? 185 ASP L CG  1 
ATOM   5101 O OD1 . ASP C 3 185 ? 8.280   24.989  -40.929 1.00 116.17 ? 185 ASP L OD1 1 
ATOM   5102 O OD2 . ASP C 3 185 ? 10.101  25.565  -39.844 1.00 112.60 ? 185 ASP L OD2 1 
ATOM   5103 N N   . TYR C 3 186 ? 10.574  20.656  -42.617 1.00 97.08  ? 186 TYR L N   1 
ATOM   5104 C CA  . TYR C 3 186 ? 11.588  19.812  -43.226 1.00 91.21  ? 186 TYR L CA  1 
ATOM   5105 C C   . TYR C 3 186 ? 11.406  19.782  -44.736 1.00 93.11  ? 186 TYR L C   1 
ATOM   5106 O O   . TYR C 3 186 ? 12.360  19.979  -45.488 1.00 96.33  ? 186 TYR L O   1 
ATOM   5107 C CB  . TYR C 3 186 ? 11.527  18.399  -42.652 1.00 89.90  ? 186 TYR L CB  1 
ATOM   5108 C CG  . TYR C 3 186 ? 12.501  17.428  -43.281 1.00 91.57  ? 186 TYR L CG  1 
ATOM   5109 C CD1 . TYR C 3 186 ? 13.871  17.576  -43.111 1.00 87.82  ? 186 TYR L CD1 1 
ATOM   5110 C CD2 . TYR C 3 186 ? 12.049  16.350  -44.035 1.00 93.36  ? 186 TYR L CD2 1 
ATOM   5111 C CE1 . TYR C 3 186 ? 14.766  16.679  -43.682 1.00 85.13  ? 186 TYR L CE1 1 
ATOM   5112 C CE2 . TYR C 3 186 ? 12.936  15.451  -44.610 1.00 92.03  ? 186 TYR L CE2 1 
ATOM   5113 C CZ  . TYR C 3 186 ? 14.293  15.621  -44.430 1.00 84.02  ? 186 TYR L CZ  1 
ATOM   5114 O OH  . TYR C 3 186 ? 15.174  14.727  -44.999 1.00 68.80  ? 186 TYR L OH  1 
ATOM   5115 N N   . GLU C 3 187 ? 10.173  19.547  -45.175 1.00 95.84  ? 187 GLU L N   1 
ATOM   5116 C CA  . GLU C 3 187 ? 9.877   19.455  -46.600 1.00 101.66 ? 187 GLU L CA  1 
ATOM   5117 C C   . GLU C 3 187 ? 10.246  20.754  -47.300 1.00 107.97 ? 187 GLU L C   1 
ATOM   5118 O O   . GLU C 3 187 ? 10.568  20.765  -48.486 1.00 117.22 ? 187 GLU L O   1 
ATOM   5119 C CB  . GLU C 3 187 ? 8.397   19.137  -46.829 1.00 105.75 ? 187 GLU L CB  1 
ATOM   5120 C CG  . GLU C 3 187 ? 7.836   18.028  -45.943 1.00 113.61 ? 187 GLU L CG  1 
ATOM   5121 C CD  . GLU C 3 187 ? 8.314   16.638  -46.332 1.00 112.45 ? 187 GLU L CD  1 
ATOM   5122 O OE1 . GLU C 3 187 ? 9.455   16.503  -46.824 1.00 108.39 ? 187 GLU L OE1 1 
ATOM   5123 O OE2 . GLU C 3 187 ? 7.543   15.673  -46.136 1.00 111.57 ? 187 GLU L OE2 1 
ATOM   5124 N N   . LYS C 3 188 ? 10.214  21.846  -46.546 1.00 105.73 ? 188 LYS L N   1 
ATOM   5125 C CA  . LYS C 3 188 ? 10.428  23.178  -47.095 1.00 105.47 ? 188 LYS L CA  1 
ATOM   5126 C C   . LYS C 3 188 ? 11.898  23.534  -47.310 1.00 107.52 ? 188 LYS L C   1 
ATOM   5127 O O   . LYS C 3 188 ? 12.254  24.711  -47.288 1.00 116.58 ? 188 LYS L O   1 
ATOM   5128 C CB  . LYS C 3 188 ? 9.791   24.230  -46.181 1.00 105.06 ? 188 LYS L CB  1 
ATOM   5129 C CG  . LYS C 3 188 ? 8.303   24.049  -45.943 1.00 103.94 ? 188 LYS L CG  1 
ATOM   5130 C CD  . LYS C 3 188 ? 7.771   25.129  -45.011 1.00 103.07 ? 188 LYS L CD  1 
ATOM   5131 C CE  . LYS C 3 188 ? 6.288   24.946  -44.731 1.00 106.54 ? 188 LYS L CE  1 
ATOM   5132 N NZ  . LYS C 3 188 ? 5.438   25.294  -45.903 1.00 103.04 ? 188 LYS L NZ  1 
ATOM   5133 N N   . HIS C 3 189 ? 12.752  22.537  -47.517 1.00 97.63  ? 189 HIS L N   1 
ATOM   5134 C CA  . HIS C 3 189 ? 14.163  22.817  -47.778 1.00 99.40  ? 189 HIS L CA  1 
ATOM   5135 C C   . HIS C 3 189 ? 14.858  21.687  -48.530 1.00 90.98  ? 189 HIS L C   1 
ATOM   5136 O O   . HIS C 3 189 ? 14.351  20.565  -48.591 1.00 88.32  ? 189 HIS L O   1 
ATOM   5137 C CB  . HIS C 3 189 ? 14.909  23.147  -46.482 1.00 111.39 ? 189 HIS L CB  1 
ATOM   5138 C CG  . HIS C 3 189 ? 14.551  24.481  -45.900 1.00 118.20 ? 189 HIS L CG  1 
ATOM   5139 N ND1 . HIS C 3 189 ? 14.879  25.670  -46.512 1.00 121.40 ? 189 HIS L ND1 1 
ATOM   5140 C CD2 . HIS C 3 189 ? 13.891  24.811  -44.763 1.00 118.90 ? 189 HIS L CD2 1 
ATOM   5141 C CE1 . HIS C 3 189 ? 14.438  26.678  -45.779 1.00 125.40 ? 189 HIS L CE1 1 
ATOM   5142 N NE2 . HIS C 3 189 ? 13.836  26.184  -44.713 1.00 126.78 ? 189 HIS L NE2 1 
ATOM   5143 N N   . LYS C 3 190 ? 16.018  21.993  -49.107 1.00 87.31  ? 190 LYS L N   1 
ATOM   5144 C CA  . LYS C 3 190 ? 16.750  21.018  -49.911 1.00 99.12  ? 190 LYS L CA  1 
ATOM   5145 C C   . LYS C 3 190 ? 18.112  20.672  -49.331 1.00 91.76  ? 190 LYS L C   1 
ATOM   5146 O O   . LYS C 3 190 ? 18.418  19.502  -49.126 1.00 98.32  ? 190 LYS L O   1 
ATOM   5147 C CB  . LYS C 3 190 ? 16.931  21.503  -51.358 1.00 117.27 ? 190 LYS L CB  1 
ATOM   5148 C CG  . LYS C 3 190 ? 17.623  20.474  -52.262 1.00 118.65 ? 190 LYS L CG  1 
ATOM   5149 C CD  . LYS C 3 190 ? 18.545  21.117  -53.295 1.00 118.06 ? 190 LYS L CD  1 
ATOM   5150 C CE  . LYS C 3 190 ? 17.771  21.685  -54.465 1.00 125.64 ? 190 LYS L CE  1 
ATOM   5151 N NZ  . LYS C 3 190 ? 18.676  22.037  -55.593 1.00 127.83 ? 190 LYS L NZ  1 
ATOM   5152 N N   . VAL C 3 191 ? 18.936  21.687  -49.089 1.00 87.74  ? 191 VAL L N   1 
ATOM   5153 C CA  . VAL C 3 191 ? 20.308  21.453  -48.642 1.00 94.57  ? 191 VAL L CA  1 
ATOM   5154 C C   . VAL C 3 191 ? 20.447  21.402  -47.120 1.00 93.54  ? 191 VAL L C   1 
ATOM   5155 O O   . VAL C 3 191 ? 20.413  22.437  -46.447 1.00 94.23  ? 191 VAL L O   1 
ATOM   5156 C CB  . VAL C 3 191 ? 21.287  22.509  -49.205 1.00 88.41  ? 191 VAL L CB  1 
ATOM   5157 C CG1 . VAL C 3 191 ? 22.712  22.227  -48.729 1.00 74.70  ? 191 VAL L CG1 1 
ATOM   5158 C CG2 . VAL C 3 191 ? 21.221  22.542  -50.723 1.00 80.00  ? 191 VAL L CG2 1 
ATOM   5159 N N   . TYR C 3 192 ? 20.606  20.194  -46.587 1.00 87.58  ? 192 TYR L N   1 
ATOM   5160 C CA  . TYR C 3 192 ? 20.906  20.017  -45.170 1.00 92.28  ? 192 TYR L CA  1 
ATOM   5161 C C   . TYR C 3 192 ? 22.384  19.673  -44.977 1.00 91.67  ? 192 TYR L C   1 
ATOM   5162 O O   . TYR C 3 192 ? 22.909  18.759  -45.615 1.00 91.88  ? 192 TYR L O   1 
ATOM   5163 C CB  . TYR C 3 192 ? 19.994  18.956  -44.544 1.00 94.77  ? 192 TYR L CB  1 
ATOM   5164 C CG  . TYR C 3 192 ? 18.544  19.385  -44.475 1.00 101.77 ? 192 TYR L CG  1 
ATOM   5165 C CD1 . TYR C 3 192 ? 18.164  20.495  -43.735 1.00 107.34 ? 192 TYR L CD1 1 
ATOM   5166 C CD2 . TYR C 3 192 ? 17.558  18.687  -45.153 1.00 108.32 ? 192 TYR L CD2 1 
ATOM   5167 C CE1 . TYR C 3 192 ? 16.843  20.900  -43.673 1.00 109.00 ? 192 TYR L CE1 1 
ATOM   5168 C CE2 . TYR C 3 192 ? 16.233  19.085  -45.096 1.00 110.92 ? 192 TYR L CE2 1 
ATOM   5169 C CZ  . TYR C 3 192 ? 15.882  20.191  -44.353 1.00 108.40 ? 192 TYR L CZ  1 
ATOM   5170 O OH  . TYR C 3 192 ? 14.568  20.592  -44.289 1.00 109.23 ? 192 TYR L OH  1 
ATOM   5171 N N   . ALA C 3 193 ? 23.055  20.420  -44.106 1.00 85.97  ? 193 ALA L N   1 
ATOM   5172 C CA  . ALA C 3 193 ? 24.491  20.267  -43.928 1.00 87.37  ? 193 ALA L CA  1 
ATOM   5173 C C   . ALA C 3 193 ? 24.953  20.718  -42.553 1.00 92.81  ? 193 ALA L C   1 
ATOM   5174 O O   . ALA C 3 193 ? 24.420  21.672  -41.988 1.00 98.59  ? 193 ALA L O   1 
ATOM   5175 C CB  . ALA C 3 193 ? 25.233  21.045  -44.997 1.00 83.82  ? 193 ALA L CB  1 
ATOM   5176 N N   . CYS C 3 194 ? 25.953  20.029  -42.018 1.00 87.93  ? 194 CYS L N   1 
ATOM   5177 C CA  . CYS C 3 194 ? 26.595  20.483  -40.797 1.00 94.82  ? 194 CYS L CA  1 
ATOM   5178 C C   . CYS C 3 194 ? 28.082  20.687  -41.037 1.00 95.11  ? 194 CYS L C   1 
ATOM   5179 O O   . CYS C 3 194 ? 28.779  19.784  -41.501 1.00 89.44  ? 194 CYS L O   1 
ATOM   5180 C CB  . CYS C 3 194 ? 26.322  19.533  -39.619 1.00 105.24 ? 194 CYS L CB  1 
ATOM   5181 S SG  . CYS C 3 194 ? 27.121  17.913  -39.657 1.00 110.93 ? 194 CYS L SG  1 
ATOM   5182 N N   . GLU C 3 195 ? 28.547  21.897  -40.747 1.00 97.70  ? 195 GLU L N   1 
ATOM   5183 C CA  . GLU C 3 195 ? 29.941  22.260  -40.945 1.00 99.23  ? 195 GLU L CA  1 
ATOM   5184 C C   . GLU C 3 195 ? 30.680  22.158  -39.617 1.00 98.48  ? 195 GLU L C   1 
ATOM   5185 O O   . GLU C 3 195 ? 30.252  22.722  -38.611 1.00 98.71  ? 195 GLU L O   1 
ATOM   5186 C CB  . GLU C 3 195 ? 30.044  23.678  -41.508 1.00 107.43 ? 195 GLU L CB  1 
ATOM   5187 C CG  . GLU C 3 195 ? 31.354  23.977  -42.217 1.00 124.57 ? 195 GLU L CG  1 
ATOM   5188 C CD  . GLU C 3 195 ? 31.362  25.346  -42.878 1.00 133.10 ? 195 GLU L CD  1 
ATOM   5189 O OE1 . GLU C 3 195 ? 31.047  26.339  -42.186 1.00 137.83 ? 195 GLU L OE1 1 
ATOM   5190 O OE2 . GLU C 3 195 ? 31.688  25.429  -44.084 1.00 126.21 ? 195 GLU L OE2 1 
ATOM   5191 N N   . VAL C 3 196 ? 31.795  21.437  -39.621 1.00 96.22  ? 196 VAL L N   1 
ATOM   5192 C CA  . VAL C 3 196 ? 32.518  21.132  -38.395 1.00 94.24  ? 196 VAL L CA  1 
ATOM   5193 C C   . VAL C 3 196 ? 33.885  21.803  -38.325 1.00 94.63  ? 196 VAL L C   1 
ATOM   5194 O O   . VAL C 3 196 ? 34.759  21.533  -39.144 1.00 94.06  ? 196 VAL L O   1 
ATOM   5195 C CB  . VAL C 3 196 ? 32.711  19.614  -38.239 1.00 99.05  ? 196 VAL L CB  1 
ATOM   5196 C CG1 . VAL C 3 196 ? 33.757  19.312  -37.178 1.00 95.03  ? 196 VAL L CG1 1 
ATOM   5197 C CG2 . VAL C 3 196 ? 31.384  18.940  -37.910 1.00 102.93 ? 196 VAL L CG2 1 
ATOM   5198 N N   . THR C 3 197 ? 34.063  22.671  -37.333 1.00 97.47  ? 197 THR L N   1 
ATOM   5199 C CA  . THR C 3 197 ? 35.361  23.277  -37.061 1.00 93.17  ? 197 THR L CA  1 
ATOM   5200 C C   . THR C 3 197 ? 36.041  22.562  -35.897 1.00 85.67  ? 197 THR L C   1 
ATOM   5201 O O   . THR C 3 197 ? 35.382  22.114  -34.963 1.00 80.78  ? 197 THR L O   1 
ATOM   5202 C CB  . THR C 3 197 ? 35.235  24.775  -36.733 1.00 94.13  ? 197 THR L CB  1 
ATOM   5203 O OG1 . THR C 3 197 ? 34.262  25.372  -37.596 1.00 99.93  ? 197 THR L OG1 1 
ATOM   5204 C CG2 . THR C 3 197 ? 36.570  25.476  -36.921 1.00 97.40  ? 197 THR L CG2 1 
ATOM   5205 N N   . HIS C 3 198 ? 37.362  22.458  -35.966 1.00 91.12  ? 198 HIS L N   1 
ATOM   5206 C CA  . HIS C 3 198 ? 38.145  21.726  -34.977 1.00 96.19  ? 198 HIS L CA  1 
ATOM   5207 C C   . HIS C 3 198 ? 39.621  22.009  -35.236 1.00 109.05 ? 198 HIS L C   1 
ATOM   5208 O O   . HIS C 3 198 ? 40.017  22.221  -36.384 1.00 107.04 ? 198 HIS L O   1 
ATOM   5209 C CB  . HIS C 3 198 ? 37.859  20.229  -35.093 1.00 89.25  ? 198 HIS L CB  1 
ATOM   5210 C CG  . HIS C 3 198 ? 38.638  19.383  -34.137 1.00 96.68  ? 198 HIS L CG  1 
ATOM   5211 N ND1 . HIS C 3 198 ? 38.301  19.262  -32.805 1.00 101.45 ? 198 HIS L ND1 1 
ATOM   5212 C CD2 . HIS C 3 198 ? 39.730  18.605  -34.319 1.00 96.80  ? 198 HIS L CD2 1 
ATOM   5213 C CE1 . HIS C 3 198 ? 39.158  18.451  -32.208 1.00 97.49  ? 198 HIS L CE1 1 
ATOM   5214 N NE2 . HIS C 3 198 ? 40.034  18.039  -33.106 1.00 95.19  ? 198 HIS L NE2 1 
ATOM   5215 N N   . GLN C 3 199 ? 40.441  22.024  -34.186 1.00 110.44 ? 199 GLN L N   1 
ATOM   5216 C CA  . GLN C 3 199 ? 41.858  22.346  -34.366 1.00 113.61 ? 199 GLN L CA  1 
ATOM   5217 C C   . GLN C 3 199 ? 42.600  21.267  -35.161 1.00 117.21 ? 199 GLN L C   1 
ATOM   5218 O O   . GLN C 3 199 ? 43.727  21.479  -35.607 1.00 125.53 ? 199 GLN L O   1 
ATOM   5219 C CB  . GLN C 3 199 ? 42.558  22.596  -33.027 1.00 111.77 ? 199 GLN L CB  1 
ATOM   5220 C CG  . GLN C 3 199 ? 43.205  21.362  -32.420 1.00 116.52 ? 199 GLN L CG  1 
ATOM   5221 C CD  . GLN C 3 199 ? 44.212  21.700  -31.333 1.00 124.33 ? 199 GLN L CD  1 
ATOM   5222 O OE1 . GLN C 3 199 ? 44.599  22.858  -31.162 1.00 129.67 ? 199 GLN L OE1 1 
ATOM   5223 N NE2 . GLN C 3 199 ? 44.647  20.686  -30.597 1.00 123.60 ? 199 GLN L NE2 1 
ATOM   5224 N N   . GLY C 3 200 ? 41.961  20.116  -35.338 1.00 109.88 ? 200 GLY L N   1 
ATOM   5225 C CA  . GLY C 3 200 ? 42.531  19.039  -36.127 1.00 105.21 ? 200 GLY L CA  1 
ATOM   5226 C C   . GLY C 3 200 ? 42.161  19.158  -37.594 1.00 103.58 ? 200 GLY L C   1 
ATOM   5227 O O   . GLY C 3 200 ? 42.481  18.283  -38.397 1.00 100.88 ? 200 GLY L O   1 
ATOM   5228 N N   . LEU C 3 201 ? 41.486  20.252  -37.935 1.00 107.42 ? 201 LEU L N   1 
ATOM   5229 C CA  . LEU C 3 201 ? 41.055  20.519  -39.305 1.00 107.74 ? 201 LEU L CA  1 
ATOM   5230 C C   . LEU C 3 201 ? 41.636  21.830  -39.822 1.00 121.48 ? 201 LEU L C   1 
ATOM   5231 O O   . LEU C 3 201 ? 41.390  22.894  -39.253 1.00 128.51 ? 201 LEU L O   1 
ATOM   5232 C CB  . LEU C 3 201 ? 39.532  20.592  -39.375 1.00 88.45  ? 201 LEU L CB  1 
ATOM   5233 C CG  . LEU C 3 201 ? 38.783  19.381  -38.836 1.00 83.43  ? 201 LEU L CG  1 
ATOM   5234 C CD1 . LEU C 3 201 ? 37.306  19.699  -38.690 1.00 85.96  ? 201 LEU L CD1 1 
ATOM   5235 C CD2 . LEU C 3 201 ? 39.003  18.190  -39.743 1.00 76.84  ? 201 LEU L CD2 1 
ATOM   5236 N N   . SER C 3 202 ? 42.394  21.755  -40.910 1.00 125.49 ? 202 SER L N   1 
ATOM   5237 C CA  . SER C 3 202 ? 43.002  22.946  -41.488 1.00 132.55 ? 202 SER L CA  1 
ATOM   5238 C C   . SER C 3 202 ? 41.961  23.841  -42.159 1.00 138.30 ? 202 SER L C   1 
ATOM   5239 O O   . SER C 3 202 ? 42.305  24.853  -42.772 1.00 148.26 ? 202 SER L O   1 
ATOM   5240 C CB  . SER C 3 202 ? 44.107  22.565  -42.478 1.00 131.02 ? 202 SER L CB  1 
ATOM   5241 O OG  . SER C 3 202 ? 43.641  21.630  -43.435 1.00 126.74 ? 202 SER L OG  1 
ATOM   5242 N N   . SER C 3 203 ? 40.691  23.465  -42.034 1.00 125.25 ? 203 SER L N   1 
ATOM   5243 C CA  . SER C 3 203 ? 39.597  24.222  -42.635 1.00 116.68 ? 203 SER L CA  1 
ATOM   5244 C C   . SER C 3 203 ? 38.272  23.500  -42.437 1.00 110.54 ? 203 SER L C   1 
ATOM   5245 O O   . SER C 3 203 ? 38.191  22.290  -42.623 1.00 115.10 ? 203 SER L O   1 
ATOM   5246 C CB  . SER C 3 203 ? 39.851  24.443  -44.130 1.00 114.92 ? 203 SER L CB  1 
ATOM   5247 O OG  . SER C 3 203 ? 40.180  23.226  -44.777 1.00 110.56 ? 203 SER L OG  1 
ATOM   5248 N N   . PRO C 3 204 ? 37.224  24.251  -42.073 1.00 105.06 ? 204 PRO L N   1 
ATOM   5249 C CA  . PRO C 3 204 ? 35.882  23.731  -41.779 1.00 98.59  ? 204 PRO L CA  1 
ATOM   5250 C C   . PRO C 3 204 ? 35.372  22.699  -42.787 1.00 93.87  ? 204 PRO L C   1 
ATOM   5251 O O   . PRO C 3 204 ? 35.029  23.061  -43.912 1.00 101.93 ? 204 PRO L O   1 
ATOM   5252 C CB  . PRO C 3 204 ? 35.008  24.986  -41.836 1.00 98.32  ? 204 PRO L CB  1 
ATOM   5253 C CG  . PRO C 3 204 ? 35.924  26.086  -41.443 1.00 105.55 ? 204 PRO L CG  1 
ATOM   5254 C CD  . PRO C 3 204 ? 37.280  25.720  -41.978 1.00 106.82 ? 204 PRO L CD  1 
ATOM   5255 N N   . VAL C 3 205 ? 35.321  21.432  -42.381 1.00 88.18  ? 205 VAL L N   1 
ATOM   5256 C CA  . VAL C 3 205 ? 34.754  20.376  -43.221 1.00 88.52  ? 205 VAL L CA  1 
ATOM   5257 C C   . VAL C 3 205 ? 33.246  20.237  -43.030 1.00 90.13  ? 205 VAL L C   1 
ATOM   5258 O O   . VAL C 3 205 ? 32.756  20.081  -41.911 1.00 78.87  ? 205 VAL L O   1 
ATOM   5259 C CB  . VAL C 3 205 ? 35.444  19.004  -43.013 1.00 80.59  ? 205 VAL L CB  1 
ATOM   5260 C CG1 . VAL C 3 205 ? 36.203  18.975  -41.716 1.00 75.21  ? 205 VAL L CG1 1 
ATOM   5261 C CG2 . VAL C 3 205 ? 34.426  17.869  -43.081 1.00 76.03  ? 205 VAL L CG2 1 
ATOM   5262 N N   . THR C 3 206 ? 32.525  20.290  -44.144 1.00 95.70  ? 206 THR L N   1 
ATOM   5263 C CA  . THR C 3 206 ? 31.072  20.272  -44.137 1.00 91.47  ? 206 THR L CA  1 
ATOM   5264 C C   . THR C 3 206 ? 30.520  19.069  -44.902 1.00 90.77  ? 206 THR L C   1 
ATOM   5265 O O   . THR C 3 206 ? 30.829  18.872  -46.075 1.00 93.10  ? 206 THR L O   1 
ATOM   5266 C CB  . THR C 3 206 ? 30.509  21.595  -44.715 1.00 86.29  ? 206 THR L CB  1 
ATOM   5267 O OG1 . THR C 3 206 ? 29.319  21.330  -45.465 1.00 86.51  ? 206 THR L OG1 1 
ATOM   5268 C CG2 . THR C 3 206 ? 31.530  22.255  -45.625 1.00 76.25  ? 206 THR L CG2 1 
ATOM   5269 N N   . LYS C 3 207 ? 29.716  18.256  -44.225 1.00 70.94  ? 207 LYS L N   1 
ATOM   5270 C CA  . LYS C 3 207 ? 29.029  17.151  -44.877 1.00 84.88  ? 207 LYS L CA  1 
ATOM   5271 C C   . LYS C 3 207 ? 27.564  17.510  -45.079 1.00 93.73  ? 207 LYS L C   1 
ATOM   5272 O O   . LYS C 3 207 ? 26.916  18.028  -44.172 1.00 97.84  ? 207 LYS L O   1 
ATOM   5273 C CB  . LYS C 3 207 ? 29.138  15.877  -44.043 1.00 86.16  ? 207 LYS L CB  1 
ATOM   5274 C CG  . LYS C 3 207 ? 30.551  15.378  -43.842 1.00 91.49  ? 207 LYS L CG  1 
ATOM   5275 C CD  . LYS C 3 207 ? 31.261  15.187  -45.159 1.00 100.04 ? 207 LYS L CD  1 
ATOM   5276 C CE  . LYS C 3 207 ? 32.317  14.105  -45.054 1.00 109.03 ? 207 LYS L CE  1 
ATOM   5277 N NZ  . LYS C 3 207 ? 31.699  12.776  -44.776 1.00 112.87 ? 207 LYS L NZ  1 
ATOM   5278 N N   . SER C 3 208 ? 27.043  17.226  -46.269 1.00 98.84  ? 208 SER L N   1 
ATOM   5279 C CA  . SER C 3 208 ? 25.666  17.571  -46.601 1.00 93.71  ? 208 SER L CA  1 
ATOM   5280 C C   . SER C 3 208 ? 24.944  16.452  -47.345 1.00 89.44  ? 208 SER L C   1 
ATOM   5281 O O   . SER C 3 208 ? 25.536  15.427  -47.685 1.00 82.31  ? 208 SER L O   1 
ATOM   5282 C CB  . SER C 3 208 ? 25.625  18.858  -47.427 1.00 92.34  ? 208 SER L CB  1 
ATOM   5283 O OG  . SER C 3 208 ? 26.575  18.814  -48.475 1.00 99.81  ? 208 SER L OG  1 
ATOM   5284 N N   . PHE C 3 209 ? 23.654  16.665  -47.584 1.00 89.60  ? 209 PHE L N   1 
ATOM   5285 C CA  . PHE C 3 209 ? 22.833  15.748  -48.362 1.00 87.94  ? 209 PHE L CA  1 
ATOM   5286 C C   . PHE C 3 209 ? 21.566  16.469  -48.809 1.00 98.26  ? 209 PHE L C   1 
ATOM   5287 O O   . PHE C 3 209 ? 20.949  17.180  -48.016 1.00 98.29  ? 209 PHE L O   1 
ATOM   5288 C CB  . PHE C 3 209 ? 22.472  14.509  -47.544 1.00 83.13  ? 209 PHE L CB  1 
ATOM   5289 C CG  . PHE C 3 209 ? 21.367  14.735  -46.550 1.00 90.19  ? 209 PHE L CG  1 
ATOM   5290 C CD1 . PHE C 3 209 ? 20.042  14.615  -46.927 1.00 93.09  ? 209 PHE L CD1 1 
ATOM   5291 C CD2 . PHE C 3 209 ? 21.653  15.057  -45.234 1.00 95.76  ? 209 PHE L CD2 1 
ATOM   5292 C CE1 . PHE C 3 209 ? 19.024  14.822  -46.010 1.00 92.85  ? 209 PHE L CE1 1 
ATOM   5293 C CE2 . PHE C 3 209 ? 20.639  15.263  -44.318 1.00 93.24  ? 209 PHE L CE2 1 
ATOM   5294 C CZ  . PHE C 3 209 ? 19.324  15.144  -44.709 1.00 91.01  ? 209 PHE L CZ  1 
ATOM   5295 N N   . ASN C 3 210 ? 21.182  16.290  -50.073 1.00 103.66 ? 210 ASN L N   1 
ATOM   5296 C CA  . ASN C 3 210 ? 20.004  16.965  -50.619 1.00 98.16  ? 210 ASN L CA  1 
ATOM   5297 C C   . ASN C 3 210 ? 18.709  16.176  -50.434 1.00 107.19 ? 210 ASN L C   1 
ATOM   5298 O O   . ASN C 3 210 ? 17.911  16.497  -49.555 1.00 111.27 ? 210 ASN L O   1 
ATOM   5299 C CB  . ASN C 3 210 ? 20.213  17.320  -52.090 1.00 97.73  ? 210 ASN L CB  1 
ATOM   5300 C CG  . ASN C 3 210 ? 21.248  18.416  -52.285 1.00 103.16 ? 210 ASN L CG  1 
ATOM   5301 O OD1 . ASN C 3 210 ? 21.313  19.042  -53.343 1.00 104.03 ? 210 ASN L OD1 1 
ATOM   5302 N ND2 . ASN C 3 210 ? 22.062  18.653  -51.261 1.00 102.04 ? 210 ASN L ND2 1 
ATOM   5303 N N   . ARG C 3 211 ? 18.509  15.149  -51.261 1.00 119.20 ? 211 ARG L N   1 
ATOM   5304 C CA  . ARG C 3 211 ? 17.332  14.273  -51.169 1.00 122.09 ? 211 ARG L CA  1 
ATOM   5305 C C   . ARG C 3 211 ? 17.237  13.235  -52.299 1.00 118.70 ? 211 ARG L C   1 
ATOM   5306 O O   . ARG C 3 211 ? 16.140  12.843  -52.697 1.00 116.64 ? 211 ARG L O   1 
ATOM   5307 C CB  . ARG C 3 211 ? 16.038  15.093  -51.105 1.00 117.04 ? 211 ARG L CB  1 
ATOM   5308 C CG  . ARG C 3 211 ? 15.518  15.359  -49.696 1.00 114.68 ? 211 ARG L CG  1 
ATOM   5309 C CD  . ARG C 3 211 ? 14.723  16.653  -49.661 1.00 119.64 ? 211 ARG L CD  1 
ATOM   5310 N NE  . ARG C 3 211 ? 13.835  16.730  -48.508 1.00 119.36 ? 211 ARG L NE  1 
ATOM   5311 C CZ  . ARG C 3 211 ? 12.736  17.477  -48.465 1.00 119.83 ? 211 ARG L CZ  1 
ATOM   5312 N NH1 . ARG C 3 211 ? 12.382  18.211  -49.513 1.00 109.31 ? 211 ARG L NH1 1 
ATOM   5313 N NH2 . ARG C 3 211 ? 11.985  17.481  -47.376 1.00 124.85 ? 211 ARG L NH2 1 
ATOM   5314 N N   . GLY C 3 212 ? 18.382  12.788  -52.808 1.00 111.25 ? 212 GLY L N   1 
ATOM   5315 C CA  . GLY C 3 212 ? 18.401  11.766  -53.840 1.00 116.55 ? 212 GLY L CA  1 
ATOM   5316 C C   . GLY C 3 212 ? 18.920  10.434  -53.327 1.00 128.56 ? 212 GLY L C   1 
ATOM   5317 O O   . GLY C 3 212 ? 18.533  9.986   -52.249 1.00 127.73 ? 212 GLY L O   1 
ATOM   5318 N N   . GLU C 3 213 ? 19.783  9.797   -54.115 1.00 143.98 ? 213 GLU L N   1 
ATOM   5319 C CA  . GLU C 3 213 ? 20.499  8.586   -53.701 1.00 156.19 ? 213 GLU L CA  1 
ATOM   5320 C C   . GLU C 3 213 ? 19.630  7.321   -53.682 1.00 154.39 ? 213 GLU L C   1 
ATOM   5321 O O   . GLU C 3 213 ? 18.857  7.098   -52.746 1.00 154.79 ? 213 GLU L O   1 
ATOM   5322 C CB  . GLU C 3 213 ? 21.168  8.797   -52.334 1.00 166.11 ? 213 GLU L CB  1 
ATOM   5323 C CG  . GLU C 3 213 ? 22.542  8.148   -52.192 1.00 172.72 ? 213 GLU L CG  1 
ATOM   5324 C CD  . GLU C 3 213 ? 23.628  8.883   -52.968 1.00 175.24 ? 213 GLU L CD  1 
ATOM   5325 O OE1 . GLU C 3 213 ? 24.812  8.777   -52.576 1.00 175.20 ? 213 GLU L OE1 1 
ATOM   5326 O OE2 . GLU C 3 213 ? 23.302  9.570   -53.963 1.00 173.37 ? 213 GLU L OE2 1 
ATOM   5327 N N   . CYS C 3 214 ? 19.778  6.493   -54.715 1.00 149.09 ? 214 CYS L N   1 
ATOM   5328 C CA  . CYS C 3 214 ? 19.030  5.242   -54.825 1.00 135.39 ? 214 CYS L CA  1 
ATOM   5329 C C   . CYS C 3 214 ? 19.885  4.042   -54.422 1.00 120.50 ? 214 CYS L C   1 
ATOM   5330 O O   . CYS C 3 214 ? 21.114  4.107   -54.442 1.00 103.72 ? 214 CYS L O   1 
ATOM   5331 C CB  . CYS C 3 214 ? 18.500  5.054   -56.252 1.00 128.01 ? 214 CYS L CB  1 
ATOM   5332 N N   . GLU D 4 1   ? 35.251  -4.736  4.295   1.00 78.66  ? 1   GLU H N   1 
ATOM   5333 C CA  . GLU D 4 1   ? 33.896  -5.231  4.077   1.00 88.35  ? 1   GLU H CA  1 
ATOM   5334 C C   . GLU D 4 1   ? 32.846  -4.225  4.543   1.00 81.85  ? 1   GLU H C   1 
ATOM   5335 O O   . GLU D 4 1   ? 31.681  -4.574  4.746   1.00 75.70  ? 1   GLU H O   1 
ATOM   5336 C CB  . GLU D 4 1   ? 33.683  -6.579  4.769   1.00 111.04 ? 1   GLU H CB  1 
ATOM   5337 C CG  . GLU D 4 1   ? 34.203  -7.789  3.992   1.00 125.93 ? 1   GLU H CG  1 
ATOM   5338 C CD  . GLU D 4 1   ? 35.686  -8.051  4.214   1.00 135.95 ? 1   GLU H CD  1 
ATOM   5339 O OE1 . GLU D 4 1   ? 36.471  -7.079  4.239   1.00 138.66 ? 1   GLU H OE1 1 
ATOM   5340 O OE2 . GLU D 4 1   ? 36.066  -9.233  4.361   1.00 141.04 ? 1   GLU H OE2 1 
ATOM   5341 N N   . VAL D 4 2   ? 33.272  -2.979  4.722   1.00 46.06  ? 2   VAL H N   1 
ATOM   5342 C CA  . VAL D 4 2   ? 32.342  -1.898  4.981   1.00 42.71  ? 2   VAL H CA  1 
ATOM   5343 C C   . VAL D 4 2   ? 31.461  -1.767  3.757   1.00 72.45  ? 2   VAL H C   1 
ATOM   5344 O O   . VAL D 4 2   ? 31.962  -1.724  2.633   1.00 80.87  ? 2   VAL H O   1 
ATOM   5345 C CB  . VAL D 4 2   ? 33.076  -0.577  5.163   1.00 49.52  ? 2   VAL H CB  1 
ATOM   5346 C CG1 . VAL D 4 2   ? 32.101  0.521   5.542   1.00 39.18  ? 2   VAL H CG1 1 
ATOM   5347 C CG2 . VAL D 4 2   ? 34.166  -0.717  6.202   1.00 63.93  ? 2   VAL H CG2 1 
ATOM   5348 N N   . GLN D 4 3   ? 30.152  -1.708  3.953   1.00 57.75  ? 3   GLN H N   1 
ATOM   5349 C CA  . GLN D 4 3   ? 29.259  -1.612  2.811   1.00 68.66  ? 3   GLN H CA  1 
ATOM   5350 C C   . GLN D 4 3   ? 28.031  -0.772  3.087   1.00 76.28  ? 3   GLN H C   1 
ATOM   5351 O O   . GLN D 4 3   ? 27.235  -1.082  3.970   1.00 73.88  ? 3   GLN H O   1 
ATOM   5352 C CB  . GLN D 4 3   ? 28.848  -2.999  2.313   1.00 75.59  ? 3   GLN H CB  1 
ATOM   5353 C CG  . GLN D 4 3   ? 29.951  -3.732  1.582   1.00 87.04  ? 3   GLN H CG  1 
ATOM   5354 C CD  . GLN D 4 3   ? 29.424  -4.869  0.738   1.00 104.25 ? 3   GLN H CD  1 
ATOM   5355 O OE1 . GLN D 4 3   ? 28.439  -4.713  0.015   1.00 106.56 ? 3   GLN H OE1 1 
ATOM   5356 N NE2 . GLN D 4 3   ? 30.081  -6.024  0.817   1.00 112.22 ? 3   GLN H NE2 1 
ATOM   5357 N N   . LEU D 4 4   ? 27.893  0.301   2.317   1.00 80.34  ? 4   LEU H N   1 
ATOM   5358 C CA  . LEU D 4 4   ? 26.679  1.096   2.321   1.00 72.34  ? 4   LEU H CA  1 
ATOM   5359 C C   . LEU D 4 4   ? 25.921  0.733   1.065   1.00 61.65  ? 4   LEU H C   1 
ATOM   5360 O O   . LEU D 4 4   ? 26.338  1.091   -0.025  1.00 67.83  ? 4   LEU H O   1 
ATOM   5361 C CB  . LEU D 4 4   ? 27.010  2.589   2.336   1.00 59.71  ? 4   LEU H CB  1 
ATOM   5362 C CG  . LEU D 4 4   ? 27.939  3.023   3.471   1.00 48.53  ? 4   LEU H CG  1 
ATOM   5363 C CD1 . LEU D 4 4   ? 28.276  4.496   3.380   1.00 57.99  ? 4   LEU H CD1 1 
ATOM   5364 C CD2 . LEU D 4 4   ? 27.297  2.715   4.790   1.00 42.30  ? 4   LEU H CD2 1 
ATOM   5365 N N   . VAL D 4 5   ? 24.823  0.000   1.218   1.00 48.40  ? 5   VAL H N   1 
ATOM   5366 C CA  . VAL D 4 5   ? 24.026  -0.413  0.071   1.00 54.80  ? 5   VAL H CA  1 
ATOM   5367 C C   . VAL D 4 5   ? 22.688  0.317   0.005   1.00 61.52  ? 5   VAL H C   1 
ATOM   5368 O O   . VAL D 4 5   ? 21.821  0.133   0.857   1.00 64.86  ? 5   VAL H O   1 
ATOM   5369 C CB  . VAL D 4 5   ? 23.795  -1.938  0.054   1.00 56.21  ? 5   VAL H CB  1 
ATOM   5370 C CG1 . VAL D 4 5   ? 22.720  -2.302  -0.945  1.00 44.12  ? 5   VAL H CG1 1 
ATOM   5371 C CG2 . VAL D 4 5   ? 25.087  -2.662  -0.261  1.00 43.77  ? 5   VAL H CG2 1 
ATOM   5372 N N   . GLN D 4 6   ? 22.522  1.135   -1.027  1.00 56.52  ? 6   GLN H N   1 
ATOM   5373 C CA  . GLN D 4 6   ? 21.334  1.964   -1.151  1.00 60.98  ? 6   GLN H CA  1 
ATOM   5374 C C   . GLN D 4 6   ? 20.219  1.353   -2.009  1.00 68.64  ? 6   GLN H C   1 
ATOM   5375 O O   . GLN D 4 6   ? 20.462  0.486   -2.855  1.00 67.06  ? 6   GLN H O   1 
ATOM   5376 C CB  . GLN D 4 6   ? 21.720  3.327   -1.710  1.00 55.79  ? 6   GLN H CB  1 
ATOM   5377 C CG  . GLN D 4 6   ? 23.061  3.833   -1.238  1.00 52.17  ? 6   GLN H CG  1 
ATOM   5378 C CD  . GLN D 4 6   ? 23.243  5.303   -1.544  1.00 61.63  ? 6   GLN H CD  1 
ATOM   5379 O OE1 . GLN D 4 6   ? 24.367  5.792   -1.684  1.00 62.72  ? 6   GLN H OE1 1 
ATOM   5380 N NE2 . GLN D 4 6   ? 22.129  6.018   -1.662  1.00 58.42  ? 6   GLN H NE2 1 
ATOM   5381 N N   . SER D 4 7   ? 18.995  1.832   -1.785  1.00 70.41  ? 7   SER H N   1 
ATOM   5382 C CA  . SER D 4 7   ? 17.816  1.352   -2.502  1.00 69.26  ? 7   SER H CA  1 
ATOM   5383 C C   . SER D 4 7   ? 17.826  1.779   -3.962  1.00 68.04  ? 7   SER H C   1 
ATOM   5384 O O   . SER D 4 7   ? 18.507  2.731   -4.334  1.00 66.49  ? 7   SER H O   1 
ATOM   5385 C CB  . SER D 4 7   ? 16.536  1.832   -1.817  1.00 64.12  ? 7   SER H CB  1 
ATOM   5386 O OG  . SER D 4 7   ? 16.656  3.180   -1.405  1.00 63.53  ? 7   SER H OG  1 
ATOM   5387 N N   . GLY D 4 8   ? 17.050  1.073   -4.777  1.00 74.86  ? 8   GLY H N   1 
ATOM   5388 C CA  . GLY D 4 8   ? 17.114  1.208   -6.220  1.00 74.43  ? 8   GLY H CA  1 
ATOM   5389 C C   . GLY D 4 8   ? 16.546  2.495   -6.771  1.00 73.65  ? 8   GLY H C   1 
ATOM   5390 O O   . GLY D 4 8   ? 15.784  3.189   -6.102  1.00 86.48  ? 8   GLY H O   1 
ATOM   5391 N N   . ALA D 4 9   ? 16.920  2.806   -8.007  1.00 68.95  ? 9   ALA H N   1 
ATOM   5392 C CA  . ALA D 4 9   ? 16.523  4.055   -8.647  1.00 64.51  ? 9   ALA H CA  1 
ATOM   5393 C C   . ALA D 4 9   ? 15.012  4.258   -8.638  1.00 62.11  ? 9   ALA H C   1 
ATOM   5394 O O   . ALA D 4 9   ? 14.247  3.344   -8.930  1.00 59.91  ? 9   ALA H O   1 
ATOM   5395 C CB  . ALA D 4 9   ? 17.063  4.113   -10.062 1.00 57.17  ? 9   ALA H CB  1 
ATOM   5396 N N   . GLU D 4 10  ? 14.589  5.469   -8.301  1.00 68.58  ? 10  GLU H N   1 
ATOM   5397 C CA  . GLU D 4 10  ? 13.170  5.773   -8.210  1.00 79.61  ? 10  GLU H CA  1 
ATOM   5398 C C   . GLU D 4 10  ? 12.804  6.872   -9.200  1.00 74.46  ? 10  GLU H C   1 
ATOM   5399 O O   . GLU D 4 10  ? 13.653  7.659   -9.603  1.00 74.66  ? 10  GLU H O   1 
ATOM   5400 C CB  . GLU D 4 10  ? 12.806  6.195   -6.783  1.00 84.68  ? 10  GLU H CB  1 
ATOM   5401 C CG  . GLU D 4 10  ? 13.167  5.173   -5.703  1.00 92.16  ? 10  GLU H CG  1 
ATOM   5402 C CD  . GLU D 4 10  ? 12.117  4.089   -5.538  1.00 110.32 ? 10  GLU H CD  1 
ATOM   5403 O OE1 . GLU D 4 10  ? 10.911  4.412   -5.599  1.00 118.21 ? 10  GLU H OE1 1 
ATOM   5404 O OE2 . GLU D 4 10  ? 12.496  2.912   -5.339  1.00 114.81 ? 10  GLU H OE2 1 
ATOM   5405 N N   . VAL D 4 11  ? 11.536  6.912   -9.597  1.00 73.06  ? 11  VAL H N   1 
ATOM   5406 C CA  . VAL D 4 11  ? 11.036  7.949   -10.498 1.00 76.14  ? 11  VAL H CA  1 
ATOM   5407 C C   . VAL D 4 11  ? 9.662   8.437   -10.029 1.00 83.48  ? 11  VAL H C   1 
ATOM   5408 O O   . VAL D 4 11  ? 8.755   7.632   -9.797  1.00 81.05  ? 11  VAL H O   1 
ATOM   5409 C CB  . VAL D 4 11  ? 10.967  7.459   -11.971 1.00 80.48  ? 11  VAL H CB  1 
ATOM   5410 C CG1 . VAL D 4 11  ? 12.288  6.809   -12.379 1.00 80.29  ? 11  VAL H CG1 1 
ATOM   5411 C CG2 . VAL D 4 11  ? 9.819   6.488   -12.171 1.00 78.23  ? 11  VAL H CG2 1 
ATOM   5412 N N   . LYS D 4 12  ? 9.516   9.753   -9.878  1.00 84.69  ? 12  LYS H N   1 
ATOM   5413 C CA  . LYS D 4 12  ? 8.291   10.332  -9.318  1.00 85.33  ? 12  LYS H CA  1 
ATOM   5414 C C   . LYS D 4 12  ? 7.845   11.620  -10.024 1.00 90.18  ? 12  LYS H C   1 
ATOM   5415 O O   . LYS D 4 12  ? 8.623   12.246  -10.741 1.00 87.92  ? 12  LYS H O   1 
ATOM   5416 C CB  . LYS D 4 12  ? 8.481   10.605  -7.819  1.00 71.92  ? 12  LYS H CB  1 
ATOM   5417 C CG  . LYS D 4 12  ? 8.867   9.387   -6.989  1.00 62.34  ? 12  LYS H CG  1 
ATOM   5418 C CD  . LYS D 4 12  ? 7.683   8.456   -6.746  1.00 73.24  ? 12  LYS H CD  1 
ATOM   5419 C CE  . LYS D 4 12  ? 8.110   7.232   -5.940  1.00 90.01  ? 12  LYS H CE  1 
ATOM   5420 N NZ  . LYS D 4 12  ? 6.990   6.299   -5.618  1.00 100.28 ? 12  LYS H NZ  1 
ATOM   5421 N N   . LYS D 4 13  ? 6.590   12.010  -9.806  1.00 94.92  ? 13  LYS H N   1 
ATOM   5422 C CA  . LYS D 4 13  ? 6.057   13.262  -10.343 1.00 99.62  ? 13  LYS H CA  1 
ATOM   5423 C C   . LYS D 4 13  ? 6.050   14.339  -9.260  1.00 98.36  ? 13  LYS H C   1 
ATOM   5424 O O   . LYS D 4 13  ? 5.799   14.040  -8.093  1.00 104.20 ? 13  LYS H O   1 
ATOM   5425 C CB  . LYS D 4 13  ? 4.636   13.054  -10.876 1.00 109.53 ? 13  LYS H CB  1 
ATOM   5426 C CG  . LYS D 4 13  ? 4.535   12.063  -12.032 1.00 116.17 ? 13  LYS H CG  1 
ATOM   5427 C CD  . LYS D 4 13  ? 3.081   11.707  -12.318 1.00 124.10 ? 13  LYS H CD  1 
ATOM   5428 C CE  . LYS D 4 13  ? 2.958   10.713  -13.464 1.00 122.46 ? 13  LYS H CE  1 
ATOM   5429 N NZ  . LYS D 4 13  ? 3.423   11.293  -14.748 1.00 120.29 ? 13  LYS H NZ  1 
ATOM   5430 N N   . PRO D 4 14  ? 6.320   15.600  -9.642  1.00 91.37  ? 14  PRO H N   1 
ATOM   5431 C CA  . PRO D 4 14  ? 6.420   16.699  -8.675  1.00 91.60  ? 14  PRO H CA  1 
ATOM   5432 C C   . PRO D 4 14  ? 5.237   16.750  -7.709  1.00 95.24  ? 14  PRO H C   1 
ATOM   5433 O O   . PRO D 4 14  ? 4.088   16.813  -8.146  1.00 103.91 ? 14  PRO H O   1 
ATOM   5434 C CB  . PRO D 4 14  ? 6.432   17.942  -9.569  1.00 89.56  ? 14  PRO H CB  1 
ATOM   5435 C CG  . PRO D 4 14  ? 7.026   17.475  -10.831 1.00 83.33  ? 14  PRO H CG  1 
ATOM   5436 C CD  . PRO D 4 14  ? 6.510   16.075  -11.022 1.00 85.84  ? 14  PRO H CD  1 
ATOM   5437 N N   . GLY D 4 15  ? 5.520   16.717  -6.411  1.00 89.19  ? 15  GLY H N   1 
ATOM   5438 C CA  . GLY D 4 15  ? 4.472   16.757  -5.409  1.00 92.81  ? 15  GLY H CA  1 
ATOM   5439 C C   . GLY D 4 15  ? 4.294   15.449  -4.669  1.00 91.68  ? 15  GLY H C   1 
ATOM   5440 O O   . GLY D 4 15  ? 3.738   15.418  -3.581  1.00 100.18 ? 15  GLY H O   1 
ATOM   5441 N N   . GLU D 4 16  ? 4.757   14.361  -5.269  1.00 91.68  ? 16  GLU H N   1 
ATOM   5442 C CA  . GLU D 4 16  ? 4.762   13.074  -4.591  1.00 90.29  ? 16  GLU H CA  1 
ATOM   5443 C C   . GLU D 4 16  ? 5.820   13.078  -3.494  1.00 89.88  ? 16  GLU H C   1 
ATOM   5444 O O   . GLU D 4 16  ? 6.765   13.867  -3.528  1.00 87.75  ? 16  GLU H O   1 
ATOM   5445 C CB  . GLU D 4 16  ? 5.059   11.941  -5.578  1.00 94.47  ? 16  GLU H CB  1 
ATOM   5446 C CG  . GLU D 4 16  ? 3.853   11.408  -6.336  1.00 101.80 ? 16  GLU H CG  1 
ATOM   5447 C CD  . GLU D 4 16  ? 4.215   10.261  -7.267  1.00 96.48  ? 16  GLU H CD  1 
ATOM   5448 O OE1 . GLU D 4 16  ? 5.411   10.121  -7.586  1.00 87.01  ? 16  GLU H OE1 1 
ATOM   5449 O OE2 . GLU D 4 16  ? 3.312   9.502   -7.679  1.00 98.80  ? 16  GLU H OE2 1 
ATOM   5450 N N   . SER D 4 17  ? 5.653   12.189  -2.522  1.00 93.26  ? 17  SER H N   1 
ATOM   5451 C CA  . SER D 4 17  ? 6.635   12.010  -1.463  1.00 86.41  ? 17  SER H CA  1 
ATOM   5452 C C   . SER D 4 17  ? 7.504   10.805  -1.787  1.00 78.83  ? 17  SER H C   1 
ATOM   5453 O O   . SER D 4 17  ? 7.157   10.006  -2.656  1.00 78.15  ? 17  SER H O   1 
ATOM   5454 C CB  . SER D 4 17  ? 5.931   11.807  -0.123  1.00 92.10  ? 17  SER H CB  1 
ATOM   5455 O OG  . SER D 4 17  ? 4.832   10.923  -0.262  1.00 97.84  ? 17  SER H OG  1 
ATOM   5456 N N   . LEU D 4 18  ? 8.624   10.665  -1.085  1.00 74.02  ? 18  LEU H N   1 
ATOM   5457 C CA  . LEU D 4 18  ? 9.561   9.578   -1.358  1.00 72.45  ? 18  LEU H CA  1 
ATOM   5458 C C   . LEU D 4 18  ? 10.580  9.389   -0.242  1.00 75.36  ? 18  LEU H C   1 
ATOM   5459 O O   . LEU D 4 18  ? 11.141  10.356  0.274   1.00 79.82  ? 18  LEU H O   1 
ATOM   5460 C CB  . LEU D 4 18  ? 10.295  9.826   -2.678  1.00 79.02  ? 18  LEU H CB  1 
ATOM   5461 C CG  . LEU D 4 18  ? 11.611  9.075   -2.893  1.00 74.33  ? 18  LEU H CG  1 
ATOM   5462 C CD1 . LEU D 4 18  ? 11.368  7.599   -3.188  1.00 82.97  ? 18  LEU H CD1 1 
ATOM   5463 C CD2 . LEU D 4 18  ? 12.429  9.719   -4.002  1.00 56.44  ? 18  LEU H CD2 1 
ATOM   5464 N N   . LYS D 4 19  ? 10.826  8.134   0.118   1.00 76.07  ? 19  LYS H N   1 
ATOM   5465 C CA  . LYS D 4 19  ? 11.802  7.806   1.153   1.00 78.78  ? 19  LYS H CA  1 
ATOM   5466 C C   . LYS D 4 19  ? 12.797  6.782   0.620   1.00 74.39  ? 19  LYS H C   1 
ATOM   5467 O O   . LYS D 4 19  ? 12.413  5.675   0.241   1.00 83.04  ? 19  LYS H O   1 
ATOM   5468 C CB  . LYS D 4 19  ? 11.094  7.260   2.397   1.00 80.02  ? 19  LYS H CB  1 
ATOM   5469 C CG  . LYS D 4 19  ? 11.938  7.251   3.657   1.00 82.90  ? 19  LYS H CG  1 
ATOM   5470 C CD  . LYS D 4 19  ? 11.112  6.837   4.877   1.00 92.64  ? 19  LYS H CD  1 
ATOM   5471 C CE  . LYS D 4 19  ? 10.700  5.372   4.807   1.00 102.44 ? 19  LYS H CE  1 
ATOM   5472 N NZ  . LYS D 4 19  ? 10.000  4.909   6.046   1.00 105.99 ? 19  LYS H NZ  1 
ATOM   5473 N N   . ILE D 4 20  ? 14.071  7.155   0.582   1.00 60.68  ? 20  ILE H N   1 
ATOM   5474 C CA  . ILE D 4 20  ? 15.108  6.238   0.130   1.00 60.70  ? 20  ILE H CA  1 
ATOM   5475 C C   . ILE D 4 20  ? 15.993  5.784   1.290   1.00 71.21  ? 20  ILE H C   1 
ATOM   5476 O O   . ILE D 4 20  ? 16.168  6.505   2.275   1.00 71.26  ? 20  ILE H O   1 
ATOM   5477 C CB  . ILE D 4 20  ? 15.970  6.863   -0.971  1.00 61.36  ? 20  ILE H CB  1 
ATOM   5478 C CG1 . ILE D 4 20  ? 16.838  7.983   -0.400  1.00 64.59  ? 20  ILE H CG1 1 
ATOM   5479 C CG2 . ILE D 4 20  ? 15.093  7.399   -2.070  1.00 65.97  ? 20  ILE H CG2 1 
ATOM   5480 C CD1 . ILE D 4 20  ? 17.665  8.705   -1.425  1.00 57.35  ? 20  ILE H CD1 1 
ATOM   5481 N N   . SER D 4 21  ? 16.553  4.585   1.168   1.00 67.84  ? 21  SER H N   1 
ATOM   5482 C CA  . SER D 4 21  ? 17.302  3.989   2.262   1.00 57.75  ? 21  SER H CA  1 
ATOM   5483 C C   . SER D 4 21  ? 18.740  3.681   1.878   1.00 64.54  ? 21  SER H C   1 
ATOM   5484 O O   . SER D 4 21  ? 19.163  3.926   0.747   1.00 76.85  ? 21  SER H O   1 
ATOM   5485 C CB  . SER D 4 21  ? 16.607  2.719   2.744   1.00 58.08  ? 21  SER H CB  1 
ATOM   5486 O OG  . SER D 4 21  ? 16.681  1.698   1.767   1.00 60.62  ? 21  SER H OG  1 
ATOM   5487 N N   . CYS D 4 22  ? 19.485  3.149   2.842   1.00 62.55  ? 22  CYS H N   1 
ATOM   5488 C CA  . CYS D 4 22  ? 20.882  2.784   2.658   1.00 60.34  ? 22  CYS H CA  1 
ATOM   5489 C C   . CYS D 4 22  ? 21.295  1.886   3.801   1.00 67.57  ? 22  CYS H C   1 
ATOM   5490 O O   . CYS D 4 22  ? 21.593  2.364   4.886   1.00 72.69  ? 22  CYS H O   1 
ATOM   5491 C CB  . CYS D 4 22  ? 21.766  4.026   2.666   1.00 59.23  ? 22  CYS H CB  1 
ATOM   5492 S SG  . CYS D 4 22  ? 23.535  3.707   2.959   1.00 83.32  ? 22  CYS H SG  1 
ATOM   5493 N N   . LYS D 4 23  ? 21.307  0.582   3.560   1.00 65.82  ? 23  LYS H N   1 
ATOM   5494 C CA  . LYS D 4 23  ? 21.658  -0.372  4.599   1.00 60.27  ? 23  LYS H CA  1 
ATOM   5495 C C   . LYS D 4 23  ? 23.169  -0.554  4.717   1.00 64.17  ? 23  LYS H C   1 
ATOM   5496 O O   . LYS D 4 23  ? 23.856  -0.829  3.731   1.00 67.14  ? 23  LYS H O   1 
ATOM   5497 C CB  . LYS D 4 23  ? 20.964  -1.713  4.358   1.00 62.05  ? 23  LYS H CB  1 
ATOM   5498 C CG  . LYS D 4 23  ? 21.355  -2.787  5.353   1.00 72.75  ? 23  LYS H CG  1 
ATOM   5499 C CD  . LYS D 4 23  ? 20.369  -3.942  5.353   1.00 81.97  ? 23  LYS H CD  1 
ATOM   5500 C CE  . LYS D 4 23  ? 20.836  -5.066  6.268   1.00 86.80  ? 23  LYS H CE  1 
ATOM   5501 N NZ  . LYS D 4 23  ? 21.267  -4.557  7.600   1.00 85.26  ? 23  LYS H NZ  1 
ATOM   5502 N N   . GLY D 4 24  ? 23.677  -0.389  5.935   1.00 60.57  ? 24  GLY H N   1 
ATOM   5503 C CA  . GLY D 4 24  ? 25.095  -0.537  6.208   1.00 57.96  ? 24  GLY H CA  1 
ATOM   5504 C C   . GLY D 4 24  ? 25.409  -1.853  6.898   1.00 67.14  ? 24  GLY H C   1 
ATOM   5505 O O   . GLY D 4 24  ? 24.560  -2.424  7.585   1.00 72.88  ? 24  GLY H O   1 
ATOM   5506 N N   . SER D 4 25  ? 26.637  -2.329  6.718   1.00 56.96  ? 25  SER H N   1 
ATOM   5507 C CA  . SER D 4 25  ? 27.052  -3.624  7.233   1.00 56.85  ? 25  SER H CA  1 
ATOM   5508 C C   . SER D 4 25  ? 28.570  -3.759  7.149   1.00 59.35  ? 25  SER H C   1 
ATOM   5509 O O   . SER D 4 25  ? 29.224  -3.001  6.451   1.00 61.54  ? 25  SER H O   1 
ATOM   5510 C CB  . SER D 4 25  ? 26.371  -4.745  6.449   1.00 62.47  ? 25  SER H CB  1 
ATOM   5511 O OG  . SER D 4 25  ? 26.610  -4.611  5.056   1.00 82.20  ? 25  SER H OG  1 
ATOM   5512 N N   . GLY D 4 26  ? 29.132  -4.717  7.874   1.00 67.54  ? 26  GLY H N   1 
ATOM   5513 C CA  . GLY D 4 26  ? 30.572  -4.932  7.870   1.00 71.63  ? 26  GLY H CA  1 
ATOM   5514 C C   . GLY D 4 26  ? 31.334  -4.012  8.807   1.00 74.29  ? 26  GLY H C   1 
ATOM   5515 O O   . GLY D 4 26  ? 32.563  -3.935  8.767   1.00 81.50  ? 26  GLY H O   1 
ATOM   5516 N N   . TYR D 4 27  ? 30.602  -3.312  9.664   1.00 66.70  ? 27  TYR H N   1 
ATOM   5517 C CA  . TYR D 4 27  ? 31.223  -2.376  10.585  1.00 72.78  ? 27  TYR H CA  1 
ATOM   5518 C C   . TYR D 4 27  ? 30.286  -2.108  11.764  1.00 73.95  ? 27  TYR H C   1 
ATOM   5519 O O   . TYR D 4 27  ? 29.080  -2.324  11.654  1.00 73.34  ? 27  TYR H O   1 
ATOM   5520 C CB  . TYR D 4 27  ? 31.596  -1.081  9.848   1.00 75.89  ? 27  TYR H CB  1 
ATOM   5521 C CG  . TYR D 4 27  ? 30.464  -0.088  9.702   1.00 74.25  ? 27  TYR H CG  1 
ATOM   5522 C CD1 . TYR D 4 27  ? 30.325  0.959   10.600  1.00 77.75  ? 27  TYR H CD1 1 
ATOM   5523 C CD2 . TYR D 4 27  ? 29.538  -0.191  8.668   1.00 73.09  ? 27  TYR H CD2 1 
ATOM   5524 C CE1 . TYR D 4 27  ? 29.301  1.872   10.483  1.00 83.92  ? 27  TYR H CE1 1 
ATOM   5525 C CE2 . TYR D 4 27  ? 28.502  0.723   8.543   1.00 72.25  ? 27  TYR H CE2 1 
ATOM   5526 C CZ  . TYR D 4 27  ? 28.392  1.750   9.458   1.00 81.44  ? 27  TYR H CZ  1 
ATOM   5527 O OH  . TYR D 4 27  ? 27.376  2.672   9.369   1.00 82.35  ? 27  TYR H OH  1 
ATOM   5528 N N   . SER D 4 28  ? 30.842  -1.659  12.890  1.00 73.90  ? 28  SER H N   1 
ATOM   5529 C CA  . SER D 4 28  ? 30.043  -1.380  14.087  1.00 73.95  ? 28  SER H CA  1 
ATOM   5530 C C   . SER D 4 28  ? 29.128  -0.182  13.867  1.00 68.39  ? 28  SER H C   1 
ATOM   5531 O O   . SER D 4 28  ? 29.555  0.968   13.928  1.00 55.89  ? 28  SER H O   1 
ATOM   5532 C CB  . SER D 4 28  ? 30.938  -1.156  15.303  1.00 72.51  ? 28  SER H CB  1 
ATOM   5533 O OG  . SER D 4 28  ? 32.006  -0.290  14.974  1.00 81.04  ? 28  SER H OG  1 
ATOM   5534 N N   . PHE D 4 29  ? 27.858  -0.474  13.626  1.00 64.32  ? 29  PHE H N   1 
ATOM   5535 C CA  . PHE D 4 29  ? 26.916  0.517   13.125  1.00 59.26  ? 29  PHE H CA  1 
ATOM   5536 C C   . PHE D 4 29  ? 26.720  1.719   14.030  1.00 62.07  ? 29  PHE H C   1 
ATOM   5537 O O   . PHE D 4 29  ? 26.366  2.797   13.567  1.00 86.74  ? 29  PHE H O   1 
ATOM   5538 C CB  . PHE D 4 29  ? 25.565  -0.143  12.852  1.00 69.47  ? 29  PHE H CB  1 
ATOM   5539 C CG  . PHE D 4 29  ? 24.556  0.776   12.244  1.00 69.86  ? 29  PHE H CG  1 
ATOM   5540 C CD1 . PHE D 4 29  ? 23.442  1.166   12.956  1.00 67.54  ? 29  PHE H CD1 1 
ATOM   5541 C CD2 . PHE D 4 29  ? 24.724  1.254   10.958  1.00 79.13  ? 29  PHE H CD2 1 
ATOM   5542 C CE1 . PHE D 4 29  ? 22.512  2.010   12.399  1.00 73.35  ? 29  PHE H CE1 1 
ATOM   5543 C CE2 . PHE D 4 29  ? 23.797  2.099   10.396  1.00 81.18  ? 29  PHE H CE2 1 
ATOM   5544 C CZ  . PHE D 4 29  ? 22.689  2.478   11.118  1.00 79.66  ? 29  PHE H CZ  1 
ATOM   5545 N N   . THR D 4 30  ? 26.941  1.549   15.321  1.00 61.44  ? 30  THR H N   1 
ATOM   5546 C CA  . THR D 4 30  ? 26.587  2.609   16.251  1.00 66.54  ? 30  THR H CA  1 
ATOM   5547 C C   . THR D 4 30  ? 27.760  3.526   16.577  1.00 69.60  ? 30  THR H C   1 
ATOM   5548 O O   . THR D 4 30  ? 27.635  4.451   17.376  1.00 86.50  ? 30  THR H O   1 
ATOM   5549 C CB  . THR D 4 30  ? 25.975  2.033   17.530  1.00 68.27  ? 30  THR H CB  1 
ATOM   5550 O OG1 . THR D 4 30  ? 26.754  0.916   17.969  1.00 69.61  ? 30  THR H OG1 1 
ATOM   5551 C CG2 . THR D 4 30  ? 24.558  1.564   17.249  1.00 68.00  ? 30  THR H CG2 1 
ATOM   5552 N N   . THR D 4 31  ? 28.889  3.277   15.930  1.00 60.26  ? 31  THR H N   1 
ATOM   5553 C CA  . THR D 4 31  ? 30.123  3.996   16.207  1.00 54.12  ? 31  THR H CA  1 
ATOM   5554 C C   . THR D 4 31  ? 30.329  5.136   15.226  1.00 64.14  ? 31  THR H C   1 
ATOM   5555 O O   . THR D 4 31  ? 30.987  6.134   15.538  1.00 73.15  ? 31  THR H O   1 
ATOM   5556 C CB  . THR D 4 31  ? 31.320  3.056   16.068  1.00 55.23  ? 31  THR H CB  1 
ATOM   5557 O OG1 . THR D 4 31  ? 31.155  1.934   16.941  1.00 60.84  ? 31  THR H OG1 1 
ATOM   5558 C CG2 . THR D 4 31  ? 32.608  3.769   16.403  1.00 44.83  ? 31  THR H CG2 1 
ATOM   5559 N N   . TYR D 4 32  ? 29.768  4.968   14.032  1.00 71.36  ? 32  TYR H N   1 
ATOM   5560 C CA  . TYR D 4 32  ? 29.991  5.885   12.924  1.00 61.15  ? 32  TYR H CA  1 
ATOM   5561 C C   . TYR D 4 32  ? 28.716  6.630   12.563  1.00 58.32  ? 32  TYR H C   1 
ATOM   5562 O O   . TYR D 4 32  ? 27.640  6.035   12.478  1.00 59.28  ? 32  TYR H O   1 
ATOM   5563 C CB  . TYR D 4 32  ? 30.496  5.109   11.710  1.00 54.60  ? 32  TYR H CB  1 
ATOM   5564 C CG  . TYR D 4 32  ? 31.837  4.455   11.933  1.00 52.12  ? 32  TYR H CG  1 
ATOM   5565 C CD1 . TYR D 4 32  ? 31.936  3.116   12.298  1.00 46.77  ? 32  TYR H CD1 1 
ATOM   5566 C CD2 . TYR D 4 32  ? 33.003  5.177   11.784  1.00 45.20  ? 32  TYR H CD2 1 
ATOM   5567 C CE1 . TYR D 4 32  ? 33.168  2.522   12.506  1.00 44.86  ? 32  TYR H CE1 1 
ATOM   5568 C CE2 . TYR D 4 32  ? 34.233  4.594   11.990  1.00 46.05  ? 32  TYR H CE2 1 
ATOM   5569 C CZ  . TYR D 4 32  ? 34.312  3.269   12.352  1.00 52.29  ? 32  TYR H CZ  1 
ATOM   5570 O OH  . TYR D 4 32  ? 35.548  2.697   12.552  1.00 64.14  ? 32  TYR H OH  1 
ATOM   5571 N N   . TRP D 4 33  ? 28.853  7.934   12.349  1.00 52.81  ? 33  TRP H N   1 
ATOM   5572 C CA  . TRP D 4 33  ? 27.749  8.779   11.924  1.00 53.80  ? 33  TRP H CA  1 
ATOM   5573 C C   . TRP D 4 33  ? 27.481  8.609   10.432  1.00 48.92  ? 33  TRP H C   1 
ATOM   5574 O O   . TRP D 4 33  ? 28.388  8.335   9.661   1.00 54.97  ? 33  TRP H O   1 
ATOM   5575 C CB  . TRP D 4 33  ? 28.080  10.239  12.234  1.00 59.28  ? 33  TRP H CB  1 
ATOM   5576 C CG  . TRP D 4 33  ? 27.758  10.657  13.635  1.00 65.07  ? 33  TRP H CG  1 
ATOM   5577 C CD1 . TRP D 4 33  ? 27.961  9.942   14.770  1.00 72.64  ? 33  TRP H CD1 1 
ATOM   5578 C CD2 . TRP D 4 33  ? 27.185  11.900  14.042  1.00 71.71  ? 33  TRP H CD2 1 
ATOM   5579 N NE1 . TRP D 4 33  ? 27.541  10.658  15.862  1.00 74.32  ? 33  TRP H NE1 1 
ATOM   5580 C CE2 . TRP D 4 33  ? 27.062  11.867  15.438  1.00 72.95  ? 33  TRP H CE2 1 
ATOM   5581 C CE3 . TRP D 4 33  ? 26.759  13.039  13.355  1.00 78.76  ? 33  TRP H CE3 1 
ATOM   5582 C CZ2 . TRP D 4 33  ? 26.534  12.928  16.164  1.00 81.96  ? 33  TRP H CZ2 1 
ATOM   5583 C CZ3 . TRP D 4 33  ? 26.235  14.097  14.080  1.00 77.59  ? 33  TRP H CZ3 1 
ATOM   5584 C CH2 . TRP D 4 33  ? 26.129  14.034  15.467  1.00 75.82  ? 33  TRP H CH2 1 
ATOM   5585 N N   . LEU D 4 34  ? 26.231  8.771   10.025  1.00 46.49  ? 34  LEU H N   1 
ATOM   5586 C CA  . LEU D 4 34  ? 25.885  8.637   8.617   1.00 56.21  ? 34  LEU H CA  1 
ATOM   5587 C C   . LEU D 4 34  ? 25.418  9.948   7.979   1.00 63.14  ? 34  LEU H C   1 
ATOM   5588 O O   . LEU D 4 34  ? 24.772  10.776  8.623   1.00 68.82  ? 34  LEU H O   1 
ATOM   5589 C CB  . LEU D 4 34  ? 24.830  7.553   8.427   1.00 48.91  ? 34  LEU H CB  1 
ATOM   5590 C CG  . LEU D 4 34  ? 25.358  6.157   8.713   1.00 48.64  ? 34  LEU H CG  1 
ATOM   5591 C CD1 . LEU D 4 34  ? 24.334  5.114   8.314   1.00 52.67  ? 34  LEU H CD1 1 
ATOM   5592 C CD2 . LEU D 4 34  ? 26.675  5.934   7.982   1.00 46.42  ? 34  LEU H CD2 1 
ATOM   5593 N N   . GLY D 4 35  ? 25.741  10.132  6.705   1.00 57.98  ? 35  GLY H N   1 
ATOM   5594 C CA  . GLY D 4 35  ? 25.428  11.379  6.028   1.00 61.83  ? 35  GLY H CA  1 
ATOM   5595 C C   . GLY D 4 35  ? 24.938  11.178  4.611   1.00 61.30  ? 35  GLY H C   1 
ATOM   5596 O O   . GLY D 4 35  ? 25.173  10.137  4.003   1.00 61.59  ? 35  GLY H O   1 
ATOM   5597 N N   . TRP D 4 36  ? 24.243  12.175  4.083   1.00 59.26  ? 36  TRP H N   1 
ATOM   5598 C CA  . TRP D 4 36  ? 23.762  12.107  2.714   1.00 53.92  ? 36  TRP H CA  1 
ATOM   5599 C C   . TRP D 4 36  ? 24.356  13.230  1.884   1.00 53.38  ? 36  TRP H C   1 
ATOM   5600 O O   . TRP D 4 36  ? 24.729  14.274  2.403   1.00 59.46  ? 36  TRP H O   1 
ATOM   5601 C CB  . TRP D 4 36  ? 22.239  12.184  2.647   1.00 58.68  ? 36  TRP H CB  1 
ATOM   5602 C CG  . TRP D 4 36  ? 21.529  11.002  3.212   1.00 63.03  ? 36  TRP H CG  1 
ATOM   5603 C CD1 . TRP D 4 36  ? 21.147  10.829  4.498   1.00 53.41  ? 36  TRP H CD1 1 
ATOM   5604 C CD2 . TRP D 4 36  ? 21.087  9.835   2.501   1.00 74.18  ? 36  TRP H CD2 1 
ATOM   5605 N NE1 . TRP D 4 36  ? 20.503  9.627   4.647   1.00 66.91  ? 36  TRP H NE1 1 
ATOM   5606 C CE2 . TRP D 4 36  ? 20.456  8.996   3.433   1.00 69.17  ? 36  TRP H CE2 1 
ATOM   5607 C CE3 . TRP D 4 36  ? 21.171  9.419   1.166   1.00 67.06  ? 36  TRP H CE3 1 
ATOM   5608 C CZ2 . TRP D 4 36  ? 19.913  7.766   3.082   1.00 73.56  ? 36  TRP H CZ2 1 
ATOM   5609 C CZ3 . TRP D 4 36  ? 20.631  8.194   0.817   1.00 62.42  ? 36  TRP H CZ3 1 
ATOM   5610 C CH2 . TRP D 4 36  ? 20.010  7.382   1.769   1.00 72.01  ? 36  TRP H CH2 1 
ATOM   5611 N N   . VAL D 4 37  ? 24.437  12.995  0.583   1.00 55.76  ? 37  VAL H N   1 
ATOM   5612 C CA  . VAL D 4 37  ? 24.960  13.966  -0.374  1.00 50.98  ? 37  VAL H CA  1 
ATOM   5613 C C   . VAL D 4 37  ? 24.182  13.882  -1.676  1.00 53.75  ? 37  VAL H C   1 
ATOM   5614 O O   . VAL D 4 37  ? 23.879  12.786  -2.149  1.00 57.32  ? 37  VAL H O   1 
ATOM   5615 C CB  . VAL D 4 37  ? 26.420  13.668  -0.703  1.00 48.08  ? 37  VAL H CB  1 
ATOM   5616 C CG1 . VAL D 4 37  ? 26.933  14.658  -1.723  1.00 51.41  ? 37  VAL H CG1 1 
ATOM   5617 C CG2 . VAL D 4 37  ? 27.256  13.700  0.560   1.00 26.84  ? 37  VAL H CG2 1 
ATOM   5618 N N   . ARG D 4 38  ? 23.845  15.032  -2.251  1.00 53.16  ? 38  ARG H N   1 
ATOM   5619 C CA  . ARG D 4 38  ? 23.224  15.032  -3.573  1.00 59.57  ? 38  ARG H CA  1 
ATOM   5620 C C   . ARG D 4 38  ? 24.218  15.428  -4.671  1.00 56.53  ? 38  ARG H C   1 
ATOM   5621 O O   . ARG D 4 38  ? 25.177  16.167  -4.418  1.00 45.62  ? 38  ARG H O   1 
ATOM   5622 C CB  . ARG D 4 38  ? 21.978  15.922  -3.620  1.00 59.49  ? 38  ARG H CB  1 
ATOM   5623 C CG  . ARG D 4 38  ? 22.254  17.328  -4.076  1.00 66.10  ? 38  ARG H CG  1 
ATOM   5624 C CD  . ARG D 4 38  ? 21.324  17.729  -5.200  1.00 63.29  ? 38  ARG H CD  1 
ATOM   5625 N NE  . ARG D 4 38  ? 20.030  18.217  -4.731  1.00 70.32  ? 38  ARG H NE  1 
ATOM   5626 C CZ  . ARG D 4 38  ? 19.742  19.502  -4.544  1.00 74.57  ? 38  ARG H CZ  1 
ATOM   5627 N NH1 . ARG D 4 38  ? 18.533  19.862  -4.132  1.00 74.45  ? 38  ARG H NH1 1 
ATOM   5628 N NH2 . ARG D 4 38  ? 20.666  20.425  -4.770  1.00 40.21  ? 38  ARG H NH2 1 
ATOM   5629 N N   . GLN D 4 39  ? 23.992  14.898  -5.875  1.00 54.21  ? 39  GLN H N   1 
ATOM   5630 C CA  . GLN D 4 39  ? 24.778  15.252  -7.058  1.00 54.73  ? 39  GLN H CA  1 
ATOM   5631 C C   . GLN D 4 39  ? 23.847  15.415  -8.254  1.00 64.20  ? 39  GLN H C   1 
ATOM   5632 O O   . GLN D 4 39  ? 23.367  14.430  -8.822  1.00 58.47  ? 39  GLN H O   1 
ATOM   5633 C CB  . GLN D 4 39  ? 25.843  14.188  -7.358  1.00 40.90  ? 39  GLN H CB  1 
ATOM   5634 C CG  . GLN D 4 39  ? 26.714  14.499  -8.572  1.00 45.10  ? 39  GLN H CG  1 
ATOM   5635 C CD  . GLN D 4 39  ? 27.920  13.565  -8.723  1.00 50.17  ? 39  GLN H CD  1 
ATOM   5636 O OE1 . GLN D 4 39  ? 29.029  14.023  -8.977  1.00 45.39  ? 39  GLN H OE1 1 
ATOM   5637 N NE2 . GLN D 4 39  ? 27.701  12.256  -8.580  1.00 44.56  ? 39  GLN H NE2 1 
ATOM   5638 N N   . MET D 4 40  ? 23.594  16.668  -8.627  1.00 75.11  ? 40  MET H N   1 
ATOM   5639 C CA  . MET D 4 40  ? 22.678  16.989  -9.725  1.00 74.55  ? 40  MET H CA  1 
ATOM   5640 C C   . MET D 4 40  ? 23.321  16.745  -11.083 1.00 72.87  ? 40  MET H C   1 
ATOM   5641 O O   . MET D 4 40  ? 24.522  16.949  -11.240 1.00 81.14  ? 40  MET H O   1 
ATOM   5642 C CB  . MET D 4 40  ? 22.192  18.441  -9.634  1.00 68.65  ? 40  MET H CB  1 
ATOM   5643 C CG  . MET D 4 40  ? 21.576  18.804  -8.294  1.00 58.90  ? 40  MET H CG  1 
ATOM   5644 S SD  . MET D 4 40  ? 20.497  20.232  -8.366  1.00 84.24  ? 40  MET H SD  1 
ATOM   5645 C CE  . MET D 4 40  ? 19.243  19.664  -9.516  1.00 140.38 ? 40  MET H CE  1 
ATOM   5646 N N   . PRO D 4 41  ? 22.509  16.311  -12.069 1.00 68.10  ? 41  PRO H N   1 
ATOM   5647 C CA  . PRO D 4 41  ? 22.883  15.963  -13.446 1.00 54.04  ? 41  PRO H CA  1 
ATOM   5648 C C   . PRO D 4 41  ? 24.094  16.723  -13.945 1.00 52.86  ? 41  PRO H C   1 
ATOM   5649 O O   . PRO D 4 41  ? 23.972  17.892  -14.299 1.00 45.51  ? 41  PRO H O   1 
ATOM   5650 C CB  . PRO D 4 41  ? 21.659  16.395  -14.241 1.00 42.68  ? 41  PRO H CB  1 
ATOM   5651 C CG  . PRO D 4 41  ? 20.527  16.089  -13.317 1.00 83.27  ? 41  PRO H CG  1 
ATOM   5652 C CD  . PRO D 4 41  ? 21.047  16.242  -11.891 1.00 71.34  ? 41  PRO H CD  1 
ATOM   5653 N N   . GLY D 4 42  ? 25.248  16.065  -13.971 1.00 66.25  ? 42  GLY H N   1 
ATOM   5654 C CA  . GLY D 4 42  ? 26.456  16.674  -14.492 1.00 70.58  ? 42  GLY H CA  1 
ATOM   5655 C C   . GLY D 4 42  ? 26.979  17.809  -13.639 1.00 72.13  ? 42  GLY H C   1 
ATOM   5656 O O   . GLY D 4 42  ? 27.548  18.762  -14.157 1.00 80.25  ? 42  GLY H O   1 
ATOM   5657 N N   . LYS D 4 43  ? 26.800  17.710  -12.326 1.00 73.53  ? 43  LYS H N   1 
ATOM   5658 C CA  . LYS D 4 43  ? 27.264  18.767  -11.433 1.00 74.80  ? 43  LYS H CA  1 
ATOM   5659 C C   . LYS D 4 43  ? 28.100  18.252  -10.261 1.00 68.50  ? 43  LYS H C   1 
ATOM   5660 O O   . LYS D 4 43  ? 28.532  17.097  -10.245 1.00 58.54  ? 43  LYS H O   1 
ATOM   5661 C CB  . LYS D 4 43  ? 26.091  19.630  -10.947 1.00 69.85  ? 43  LYS H CB  1 
ATOM   5662 C CG  . LYS D 4 43  ? 25.199  20.128  -12.086 1.00 85.11  ? 43  LYS H CG  1 
ATOM   5663 C CD  . LYS D 4 43  ? 24.529  21.463  -11.770 1.00 97.87  ? 43  LYS H CD  1 
ATOM   5664 C CE  . LYS D 4 43  ? 25.486  22.641  -11.962 1.00 106.04 ? 43  LYS H CE  1 
ATOM   5665 N NZ  . LYS D 4 43  ? 25.763  22.952  -13.396 1.00 106.51 ? 43  LYS H NZ  1 
ATOM   5666 N N   . GLY D 4 44  ? 28.341  19.125  -9.291  1.00 59.28  ? 44  GLY H N   1 
ATOM   5667 C CA  . GLY D 4 44  ? 29.153  18.768  -8.147  1.00 58.56  ? 44  GLY H CA  1 
ATOM   5668 C C   . GLY D 4 44  ? 28.333  18.139  -7.041  1.00 69.66  ? 44  GLY H C   1 
ATOM   5669 O O   . GLY D 4 44  ? 27.197  17.711  -7.261  1.00 79.12  ? 44  GLY H O   1 
ATOM   5670 N N   . LEU D 4 45  ? 28.910  18.101  -5.843  1.00 69.18  ? 45  LEU H N   1 
ATOM   5671 C CA  . LEU D 4 45  ? 28.297  17.424  -4.699  1.00 61.87  ? 45  LEU H CA  1 
ATOM   5672 C C   . LEU D 4 45  ? 27.735  18.382  -3.651  1.00 60.46  ? 45  LEU H C   1 
ATOM   5673 O O   . LEU D 4 45  ? 28.459  19.184  -3.077  1.00 62.22  ? 45  LEU H O   1 
ATOM   5674 C CB  . LEU D 4 45  ? 29.329  16.516  -4.033  1.00 49.43  ? 45  LEU H CB  1 
ATOM   5675 C CG  . LEU D 4 45  ? 30.018  15.586  -5.015  1.00 46.72  ? 45  LEU H CG  1 
ATOM   5676 C CD1 . LEU D 4 45  ? 31.277  14.988  -4.430  1.00 33.97  ? 45  LEU H CD1 1 
ATOM   5677 C CD2 . LEU D 4 45  ? 29.032  14.519  -5.426  1.00 51.93  ? 45  LEU H CD2 1 
ATOM   5678 N N   . ASP D 4 46  ? 26.443  18.280  -3.386  1.00 56.49  ? 46  ASP H N   1 
ATOM   5679 C CA  . ASP D 4 46  ? 25.855  19.057  -2.317  1.00 60.08  ? 46  ASP H CA  1 
ATOM   5680 C C   . ASP D 4 46  ? 25.822  18.237  -1.022  1.00 74.02  ? 46  ASP H C   1 
ATOM   5681 O O   . ASP D 4 46  ? 25.215  17.168  -0.956  1.00 81.78  ? 46  ASP H O   1 
ATOM   5682 C CB  . ASP D 4 46  ? 24.463  19.528  -2.717  1.00 74.30  ? 46  ASP H CB  1 
ATOM   5683 C CG  . ASP D 4 46  ? 24.444  20.185  -4.091  1.00 84.26  ? 46  ASP H CG  1 
ATOM   5684 O OD1 . ASP D 4 46  ? 25.532  20.540  -4.591  1.00 85.22  ? 46  ASP H OD1 1 
ATOM   5685 O OD2 . ASP D 4 46  ? 23.346  20.343  -4.674  1.00 81.42  ? 46  ASP H OD2 1 
ATOM   5686 N N   . TRP D 4 47  ? 26.514  18.738  -0.006  1.00 74.67  ? 47  TRP H N   1 
ATOM   5687 C CA  . TRP D 4 47  ? 26.507  18.153  1.328   1.00 64.23  ? 47  TRP H CA  1 
ATOM   5688 C C   . TRP D 4 47  ? 25.151  18.438  1.962   1.00 64.23  ? 47  TRP H C   1 
ATOM   5689 O O   . TRP D 4 47  ? 24.849  19.579  2.299   1.00 72.36  ? 47  TRP H O   1 
ATOM   5690 C CB  . TRP D 4 47  ? 27.633  18.783  2.152   1.00 59.33  ? 47  TRP H CB  1 
ATOM   5691 C CG  . TRP D 4 47  ? 27.926  18.152  3.500   1.00 65.68  ? 47  TRP H CG  1 
ATOM   5692 C CD1 . TRP D 4 47  ? 28.695  17.050  3.744   1.00 64.80  ? 47  TRP H CD1 1 
ATOM   5693 C CD2 . TRP D 4 47  ? 27.489  18.621  4.783   1.00 69.70  ? 47  TRP H CD2 1 
ATOM   5694 N NE1 . TRP D 4 47  ? 28.747  16.793  5.092   1.00 59.68  ? 47  TRP H NE1 1 
ATOM   5695 C CE2 . TRP D 4 47  ? 28.014  17.744  5.750   1.00 63.32  ? 47  TRP H CE2 1 
ATOM   5696 C CE3 . TRP D 4 47  ? 26.694  19.691  5.203   1.00 74.32  ? 47  TRP H CE3 1 
ATOM   5697 C CZ2 . TRP D 4 47  ? 27.771  17.902  7.105   1.00 61.85  ? 47  TRP H CZ2 1 
ATOM   5698 C CZ3 . TRP D 4 47  ? 26.452  19.842  6.552   1.00 72.58  ? 47  TRP H CZ3 1 
ATOM   5699 C CH2 . TRP D 4 47  ? 26.991  18.954  7.487   1.00 63.39  ? 47  TRP H CH2 1 
ATOM   5700 N N   . ILE D 4 48  ? 24.329  17.403  2.106   1.00 62.79  ? 48  ILE H N   1 
ATOM   5701 C CA  . ILE D 4 48  ? 22.981  17.560  2.647   1.00 70.36  ? 48  ILE H CA  1 
ATOM   5702 C C   . ILE D 4 48  ? 22.995  17.656  4.167   1.00 63.82  ? 48  ILE H C   1 
ATOM   5703 O O   . ILE D 4 48  ? 22.275  18.464  4.759   1.00 53.35  ? 48  ILE H O   1 
ATOM   5704 C CB  . ILE D 4 48  ? 22.066  16.384  2.250   1.00 75.74  ? 48  ILE H CB  1 
ATOM   5705 C CG1 . ILE D 4 48  ? 21.968  16.261  0.728   1.00 70.03  ? 48  ILE H CG1 1 
ATOM   5706 C CG2 . ILE D 4 48  ? 20.683  16.563  2.847   1.00 78.51  ? 48  ILE H CG2 1 
ATOM   5707 C CD1 . ILE D 4 48  ? 21.212  15.026  0.269   1.00 57.49  ? 48  ILE H CD1 1 
ATOM   5708 N N   . GLY D 4 49  ? 23.816  16.822  4.793   1.00 65.84  ? 49  GLY H N   1 
ATOM   5709 C CA  . GLY D 4 49  ? 23.915  16.822  6.239   1.00 68.81  ? 49  GLY H CA  1 
ATOM   5710 C C   . GLY D 4 49  ? 24.390  15.504  6.821   1.00 66.96  ? 49  GLY H C   1 
ATOM   5711 O O   . GLY D 4 49  ? 24.762  14.572  6.096   1.00 73.64  ? 49  GLY H O   1 
ATOM   5712 N N   . ILE D 4 50  ? 24.346  15.417  8.143   1.00 59.95  ? 50  ILE H N   1 
ATOM   5713 C CA  . ILE D 4 50  ? 25.028  14.354  8.852   1.00 53.95  ? 50  ILE H CA  1 
ATOM   5714 C C   . ILE D 4 50  ? 24.207  14.013  10.102  1.00 56.89  ? 50  ILE H C   1 
ATOM   5715 O O   . ILE D 4 50  ? 23.412  14.835  10.551  1.00 66.71  ? 50  ILE H O   1 
ATOM   5716 C CB  . ILE D 4 50  ? 26.466  14.822  9.175   1.00 55.67  ? 50  ILE H CB  1 
ATOM   5717 C CG1 . ILE D 4 50  ? 27.494  13.925  8.486   1.00 67.46  ? 50  ILE H CG1 1 
ATOM   5718 C CG2 . ILE D 4 50  ? 26.702  14.999  10.678  1.00 51.24  ? 50  ILE H CG2 1 
ATOM   5719 C CD1 . ILE D 4 50  ? 27.253  12.461  8.706   1.00 83.33  ? 50  ILE H CD1 1 
ATOM   5720 N N   . MET D 4 51  ? 24.365  12.812  10.656  1.00 52.19  ? 51  MET H N   1 
ATOM   5721 C CA  . MET D 4 51  ? 23.517  12.386  11.780  1.00 58.16  ? 51  MET H CA  1 
ATOM   5722 C C   . MET D 4 51  ? 24.013  11.145  12.520  1.00 58.51  ? 51  MET H C   1 
ATOM   5723 O O   . MET D 4 51  ? 24.824  10.379  12.011  1.00 64.22  ? 51  MET H O   1 
ATOM   5724 C CB  . MET D 4 51  ? 22.095  12.115  11.294  1.00 58.85  ? 51  MET H CB  1 
ATOM   5725 C CG  . MET D 4 51  ? 22.011  10.948  10.336  1.00 51.93  ? 51  MET H CG  1 
ATOM   5726 S SD  . MET D 4 51  ? 20.329  10.453  9.972   1.00 86.04  ? 51  MET H SD  1 
ATOM   5727 C CE  . MET D 4 51  ? 20.580  9.712   8.352   1.00 102.42 ? 51  MET H CE  1 
ATOM   5728 N N   . SER D 4 52  ? 23.489  10.934  13.719  1.00 58.32  ? 52  SER H N   1 
ATOM   5729 C CA  . SER D 4 52  ? 23.932  9.819   14.538  1.00 65.22  ? 52  SER H CA  1 
ATOM   5730 C C   . SER D 4 52  ? 23.014  8.609   14.418  1.00 59.02  ? 52  SER H C   1 
ATOM   5731 O O   . SER D 4 52  ? 21.805  8.758   14.250  1.00 61.26  ? 52  SER H O   1 
ATOM   5732 C CB  . SER D 4 52  ? 24.060  10.252  15.997  1.00 77.83  ? 52  SER H CB  1 
ATOM   5733 O OG  . SER D 4 52  ? 24.447  9.161   16.813  1.00 88.22  ? 52  SER H OG  1 
ATOM   5734 N N   . PRO D 4 53  ? 23.601  7.406   14.495  1.00 55.97  ? 53  PRO H N   1 
ATOM   5735 C CA  . PRO D 4 53  ? 22.928  6.104   14.432  1.00 64.01  ? 53  PRO H CA  1 
ATOM   5736 C C   . PRO D 4 53  ? 22.123  5.777   15.695  1.00 87.21  ? 53  PRO H C   1 
ATOM   5737 O O   . PRO D 4 53  ? 21.072  5.135   15.608  1.00 95.06  ? 53  PRO H O   1 
ATOM   5738 C CB  . PRO D 4 53  ? 24.100  5.128   14.304  1.00 53.86  ? 53  PRO H CB  1 
ATOM   5739 C CG  . PRO D 4 53  ? 25.239  5.850   14.920  1.00 52.71  ? 53  PRO H CG  1 
ATOM   5740 C CD  . PRO D 4 53  ? 25.062  7.246   14.446  1.00 55.48  ? 53  PRO H CD  1 
ATOM   5741 N N   . VAL D 4 54  ? 22.615  6.214   16.851  1.00 88.19  ? 54  VAL H N   1 
ATOM   5742 C CA  . VAL D 4 54  ? 21.990  5.894   18.129  1.00 86.39  ? 54  VAL H CA  1 
ATOM   5743 C C   . VAL D 4 54  ? 20.953  6.936   18.527  1.00 86.85  ? 54  VAL H C   1 
ATOM   5744 O O   . VAL D 4 54  ? 19.746  6.711   18.414  1.00 84.83  ? 54  VAL H O   1 
ATOM   5745 C CB  . VAL D 4 54  ? 23.042  5.821   19.242  1.00 88.49  ? 54  VAL H CB  1 
ATOM   5746 C CG1 . VAL D 4 54  ? 22.444  5.203   20.494  1.00 102.66 ? 54  VAL H CG1 1 
ATOM   5747 C CG2 . VAL D 4 54  ? 24.246  5.028   18.771  1.00 83.91  ? 54  VAL H CG2 1 
ATOM   5748 N N   . ASP D 4 55  ? 21.438  8.079   19.000  1.00 92.75  ? 55  ASP H N   1 
ATOM   5749 C CA  . ASP D 4 55  ? 20.567  9.181   19.393  1.00 108.51 ? 55  ASP H CA  1 
ATOM   5750 C C   . ASP D 4 55  ? 20.203  10.050  18.189  1.00 104.71 ? 55  ASP H C   1 
ATOM   5751 O O   . ASP D 4 55  ? 20.911  10.054  17.183  1.00 108.29 ? 55  ASP H O   1 
ATOM   5752 C CB  . ASP D 4 55  ? 21.218  10.021  20.504  1.00 123.53 ? 55  ASP H CB  1 
ATOM   5753 C CG  . ASP D 4 55  ? 22.660  10.423  20.186  1.00 129.56 ? 55  ASP H CG  1 
ATOM   5754 O OD1 . ASP D 4 55  ? 23.105  10.237  19.034  1.00 136.67 ? 55  ASP H OD1 1 
ATOM   5755 O OD2 . ASP D 4 55  ? 23.351  10.931  21.097  1.00 122.84 ? 55  ASP H OD2 1 
ATOM   5756 N N   . SER D 4 56  ? 19.093  10.775  18.292  1.00 98.01  ? 56  SER H N   1 
ATOM   5757 C CA  . SER D 4 56  ? 18.634  11.622  17.196  1.00 97.19  ? 56  SER H CA  1 
ATOM   5758 C C   . SER D 4 56  ? 19.344  12.973  17.186  1.00 98.72  ? 56  SER H C   1 
ATOM   5759 O O   . SER D 4 56  ? 18.724  14.016  17.387  1.00 103.47 ? 56  SER H O   1 
ATOM   5760 C CB  . SER D 4 56  ? 17.120  11.821  17.262  1.00 102.74 ? 56  SER H CB  1 
ATOM   5761 O OG  . SER D 4 56  ? 16.743  12.473  18.462  1.00 110.41 ? 56  SER H OG  1 
ATOM   5762 N N   . ASP D 4 57  ? 20.650  12.940  16.945  1.00 97.38  ? 57  ASP H N   1 
ATOM   5763 C CA  . ASP D 4 57  ? 21.460  14.146  16.844  1.00 89.82  ? 57  ASP H CA  1 
ATOM   5764 C C   . ASP D 4 57  ? 21.802  14.373  15.371  1.00 80.07  ? 57  ASP H C   1 
ATOM   5765 O O   . ASP D 4 57  ? 22.769  13.805  14.867  1.00 77.81  ? 57  ASP H O   1 
ATOM   5766 C CB  . ASP D 4 57  ? 22.740  13.972  17.670  1.00 94.44  ? 57  ASP H CB  1 
ATOM   5767 C CG  . ASP D 4 57  ? 23.271  15.283  18.231  1.00 102.37 ? 57  ASP H CG  1 
ATOM   5768 O OD1 . ASP D 4 57  ? 24.427  15.298  18.717  1.00 96.33  ? 57  ASP H OD1 1 
ATOM   5769 O OD2 . ASP D 4 57  ? 22.537  16.293  18.194  1.00 112.91 ? 57  ASP H OD2 1 
ATOM   5770 N N   . ILE D 4 58  ? 21.000  15.190  14.685  1.00 76.31  ? 58  ILE H N   1 
ATOM   5771 C CA  . ILE D 4 58  ? 21.186  15.463  13.255  1.00 70.36  ? 58  ILE H CA  1 
ATOM   5772 C C   . ILE D 4 58  ? 21.813  16.834  12.986  1.00 73.83  ? 58  ILE H C   1 
ATOM   5773 O O   . ILE D 4 58  ? 21.743  17.726  13.821  1.00 84.17  ? 58  ILE H O   1 
ATOM   5774 C CB  . ILE D 4 58  ? 19.851  15.427  12.495  1.00 70.85  ? 58  ILE H CB  1 
ATOM   5775 C CG1 . ILE D 4 58  ? 19.000  14.232  12.921  1.00 75.89  ? 58  ILE H CG1 1 
ATOM   5776 C CG2 . ILE D 4 58  ? 20.087  15.400  10.988  1.00 63.74  ? 58  ILE H CG2 1 
ATOM   5777 C CD1 . ILE D 4 58  ? 17.684  14.124  12.140  1.00 77.76  ? 58  ILE H CD1 1 
ATOM   5778 N N   . ARG D 4 59  ? 22.391  17.007  11.801  1.00 72.99  ? 59  ARG H N   1 
ATOM   5779 C CA  . ARG D 4 59  ? 23.052  18.258  11.440  1.00 74.40  ? 59  ARG H CA  1 
ATOM   5780 C C   . ARG D 4 59  ? 22.810  18.646  9.965   1.00 70.59  ? 59  ARG H C   1 
ATOM   5781 O O   . ARG D 4 59  ? 23.649  18.385  9.113   1.00 76.55  ? 59  ARG H O   1 
ATOM   5782 C CB  . ARG D 4 59  ? 24.554  18.118  11.695  1.00 71.93  ? 59  ARG H CB  1 
ATOM   5783 C CG  . ARG D 4 59  ? 25.222  19.317  12.333  1.00 71.80  ? 59  ARG H CG  1 
ATOM   5784 C CD  . ARG D 4 59  ? 25.508  19.051  13.802  1.00 79.89  ? 59  ARG H CD  1 
ATOM   5785 N NE  . ARG D 4 59  ? 24.285  18.879  14.583  1.00 86.99  ? 59  ARG H NE  1 
ATOM   5786 C CZ  . ARG D 4 59  ? 24.257  18.499  15.858  1.00 74.80  ? 59  ARG H CZ  1 
ATOM   5787 N NH1 . ARG D 4 59  ? 25.387  18.241  16.495  1.00 76.31  ? 59  ARG H NH1 1 
ATOM   5788 N NH2 . ARG D 4 59  ? 23.099  18.366  16.497  1.00 64.29  ? 59  ARG H NH2 1 
ATOM   5789 N N   . TYR D 4 60  ? 21.676  19.276  9.663   1.00 60.59  ? 60  TYR H N   1 
ATOM   5790 C CA  . TYR D 4 60  ? 21.338  19.650  8.282   1.00 57.35  ? 60  TYR H CA  1 
ATOM   5791 C C   . TYR D 4 60  ? 22.090  20.862  7.728   1.00 62.45  ? 60  TYR H C   1 
ATOM   5792 O O   . TYR D 4 60  ? 22.222  21.875  8.392   1.00 74.03  ? 60  TYR H O   1 
ATOM   5793 C CB  . TYR D 4 60  ? 19.849  19.967  8.168   1.00 61.05  ? 60  TYR H CB  1 
ATOM   5794 C CG  . TYR D 4 60  ? 18.918  18.815  8.420   1.00 67.88  ? 60  TYR H CG  1 
ATOM   5795 C CD1 . TYR D 4 60  ? 18.631  17.896  7.422   1.00 72.48  ? 60  TYR H CD1 1 
ATOM   5796 C CD2 . TYR D 4 60  ? 18.295  18.667  9.644   1.00 75.09  ? 60  TYR H CD2 1 
ATOM   5797 C CE1 . TYR D 4 60  ? 17.762  16.847  7.646   1.00 74.65  ? 60  TYR H CE1 1 
ATOM   5798 C CE2 . TYR D 4 60  ? 17.425  17.626  9.877   1.00 85.31  ? 60  TYR H CE2 1 
ATOM   5799 C CZ  . TYR D 4 60  ? 17.161  16.717  8.875   1.00 84.40  ? 60  TYR H CZ  1 
ATOM   5800 O OH  . TYR D 4 60  ? 16.292  15.678  9.112   1.00 92.55  ? 60  TYR H OH  1 
ATOM   5801 N N   . SER D 4 61  ? 22.546  20.777  6.486   1.00 72.18  ? 61  SER H N   1 
ATOM   5802 C CA  . SER D 4 61  ? 23.027  21.965  5.793   1.00 77.85  ? 61  SER H CA  1 
ATOM   5803 C C   . SER D 4 61  ? 21.867  22.952  5.668   1.00 83.51  ? 61  SER H C   1 
ATOM   5804 O O   . SER D 4 61  ? 20.782  22.580  5.230   1.00 83.37  ? 61  SER H O   1 
ATOM   5805 C CB  . SER D 4 61  ? 23.558  21.604  4.407   1.00 75.23  ? 61  SER H CB  1 
ATOM   5806 O OG  . SER D 4 61  ? 23.886  22.774  3.677   1.00 83.21  ? 61  SER H OG  1 
ATOM   5807 N N   . PRO D 4 62  ? 22.090  24.216  6.056   1.00 90.99  ? 62  PRO H N   1 
ATOM   5808 C CA  . PRO D 4 62  ? 21.005  25.202  6.117   1.00 88.79  ? 62  PRO H CA  1 
ATOM   5809 C C   . PRO D 4 62  ? 20.165  25.229  4.849   1.00 89.41  ? 62  PRO H C   1 
ATOM   5810 O O   . PRO D 4 62  ? 18.995  25.606  4.893   1.00 96.34  ? 62  PRO H O   1 
ATOM   5811 C CB  . PRO D 4 62  ? 21.751  26.525  6.274   1.00 86.46  ? 62  PRO H CB  1 
ATOM   5812 C CG  . PRO D 4 62  ? 23.005  26.158  6.963   1.00 89.27  ? 62  PRO H CG  1 
ATOM   5813 C CD  . PRO D 4 62  ? 23.389  24.809  6.419   1.00 94.18  ? 62  PRO H CD  1 
ATOM   5814 N N   . SER D 4 63  ? 20.760  24.827  3.734   1.00 87.55  ? 63  SER H N   1 
ATOM   5815 C CA  . SER D 4 63  ? 20.070  24.848  2.452   1.00 92.37  ? 63  SER H CA  1 
ATOM   5816 C C   . SER D 4 63  ? 19.054  23.717  2.334   1.00 84.63  ? 63  SER H C   1 
ATOM   5817 O O   . SER D 4 63  ? 18.070  23.831  1.603   1.00 87.45  ? 63  SER H O   1 
ATOM   5818 C CB  . SER D 4 63  ? 21.076  24.769  1.304   1.00 95.61  ? 63  SER H CB  1 
ATOM   5819 O OG  . SER D 4 63  ? 22.114  25.719  1.472   1.00 96.63  ? 63  SER H OG  1 
ATOM   5820 N N   . PHE D 4 64  ? 19.300  22.625  3.050   1.00 68.69  ? 64  PHE H N   1 
ATOM   5821 C CA  . PHE D 4 64  ? 18.411  21.475  3.002   1.00 61.56  ? 64  PHE H CA  1 
ATOM   5822 C C   . PHE D 4 64  ? 17.510  21.403  4.228   1.00 72.54  ? 64  PHE H C   1 
ATOM   5823 O O   . PHE D 4 64  ? 16.534  20.655  4.235   1.00 80.39  ? 64  PHE H O   1 
ATOM   5824 C CB  . PHE D 4 64  ? 19.208  20.184  2.857   1.00 58.02  ? 64  PHE H CB  1 
ATOM   5825 C CG  . PHE D 4 64  ? 19.900  20.043  1.529   1.00 72.58  ? 64  PHE H CG  1 
ATOM   5826 C CD1 . PHE D 4 64  ? 19.394  19.198  0.551   1.00 76.95  ? 64  PHE H CD1 1 
ATOM   5827 C CD2 . PHE D 4 64  ? 21.060  20.751  1.257   1.00 77.70  ? 64  PHE H CD2 1 
ATOM   5828 C CE1 . PHE D 4 64  ? 20.032  19.064  -0.676  1.00 74.96  ? 64  PHE H CE1 1 
ATOM   5829 C CE2 . PHE D 4 64  ? 21.701  20.619  0.033   1.00 78.47  ? 64  PHE H CE2 1 
ATOM   5830 C CZ  . PHE D 4 64  ? 21.185  19.774  -0.934  1.00 72.18  ? 64  PHE H CZ  1 
ATOM   5831 N N   . GLN D 4 65  ? 17.840  22.177  5.259   1.00 72.95  ? 65  GLN H N   1 
ATOM   5832 C CA  . GLN D 4 65  ? 17.023  22.235  6.464   1.00 77.05  ? 65  GLN H CA  1 
ATOM   5833 C C   . GLN D 4 65  ? 15.554  22.388  6.081   1.00 80.07  ? 65  GLN H C   1 
ATOM   5834 O O   . GLN D 4 65  ? 15.204  23.236  5.263   1.00 79.90  ? 65  GLN H O   1 
ATOM   5835 C CB  . GLN D 4 65  ? 17.457  23.407  7.352   1.00 89.13  ? 65  GLN H CB  1 
ATOM   5836 C CG  . GLN D 4 65  ? 16.885  23.380  8.769   1.00 91.39  ? 65  GLN H CG  1 
ATOM   5837 C CD  . GLN D 4 65  ? 17.861  22.825  9.795   1.00 91.42  ? 65  GLN H CD  1 
ATOM   5838 O OE1 . GLN D 4 65  ? 19.033  23.210  9.833   1.00 90.48  ? 65  GLN H OE1 1 
ATOM   5839 N NE2 . GLN D 4 65  ? 17.375  21.927  10.642  1.00 89.61  ? 65  GLN H NE2 1 
ATOM   5840 N N   . GLY D 4 66  ? 14.697  21.553  6.658   1.00 83.12  ? 66  GLY H N   1 
ATOM   5841 C CA  . GLY D 4 66  ? 13.267  21.649  6.421   1.00 91.15  ? 66  GLY H CA  1 
ATOM   5842 C C   . GLY D 4 66  ? 12.831  21.305  5.009   1.00 98.48  ? 66  GLY H C   1 
ATOM   5843 O O   . GLY D 4 66  ? 11.643  21.372  4.687   1.00 96.97  ? 66  GLY H O   1 
ATOM   5844 N N   . GLN D 4 67  ? 13.790  20.943  4.160   1.00 99.14  ? 67  GLN H N   1 
ATOM   5845 C CA  . GLN D 4 67  ? 13.486  20.498  2.803   1.00 98.52  ? 67  GLN H CA  1 
ATOM   5846 C C   . GLN D 4 67  ? 13.471  18.976  2.750   1.00 88.87  ? 67  GLN H C   1 
ATOM   5847 O O   . GLN D 4 67  ? 12.705  18.370  2.001   1.00 89.92  ? 67  GLN H O   1 
ATOM   5848 C CB  . GLN D 4 67  ? 14.524  21.031  1.811   1.00 102.82 ? 67  GLN H CB  1 
ATOM   5849 C CG  . GLN D 4 67  ? 14.600  22.545  1.711   1.00 110.26 ? 67  GLN H CG  1 
ATOM   5850 C CD  . GLN D 4 67  ? 13.442  23.145  0.940   1.00 122.34 ? 67  GLN H CD  1 
ATOM   5851 O OE1 . GLN D 4 67  ? 12.655  22.430  0.319   1.00 129.79 ? 67  GLN H OE1 1 
ATOM   5852 N NE2 . GLN D 4 67  ? 13.334  24.467  0.974   1.00 126.35 ? 67  GLN H NE2 1 
ATOM   5853 N N   . VAL D 4 68  ? 14.333  18.364  3.552   1.00 80.30  ? 68  VAL H N   1 
ATOM   5854 C CA  . VAL D 4 68  ? 14.441  16.916  3.599   1.00 81.66  ? 68  VAL H CA  1 
ATOM   5855 C C   . VAL D 4 68  ? 14.469  16.433  5.042   1.00 82.57  ? 68  VAL H C   1 
ATOM   5856 O O   . VAL D 4 68  ? 14.515  17.233  5.976   1.00 97.66  ? 68  VAL H O   1 
ATOM   5857 C CB  . VAL D 4 68  ? 15.709  16.433  2.889   1.00 82.11  ? 68  VAL H CB  1 
ATOM   5858 C CG1 . VAL D 4 68  ? 15.760  16.983  1.472   1.00 85.54  ? 68  VAL H CG1 1 
ATOM   5859 C CG2 . VAL D 4 68  ? 16.933  16.866  3.664   1.00 83.51  ? 68  VAL H CG2 1 
ATOM   5860 N N   . THR D 4 69  ? 14.446  15.119  5.221   1.00 71.91  ? 69  THR H N   1 
ATOM   5861 C CA  . THR D 4 69  ? 14.382  14.529  6.552   1.00 78.35  ? 69  THR H CA  1 
ATOM   5862 C C   . THR D 4 69  ? 15.318  13.330  6.651   1.00 78.22  ? 69  THR H C   1 
ATOM   5863 O O   . THR D 4 69  ? 15.202  12.382  5.879   1.00 83.49  ? 69  THR H O   1 
ATOM   5864 C CB  . THR D 4 69  ? 12.934  14.099  6.903   1.00 73.23  ? 69  THR H CB  1 
ATOM   5865 O OG1 . THR D 4 69  ? 12.188  15.232  7.372   1.00 65.70  ? 69  THR H OG1 1 
ATOM   5866 C CG2 . THR D 4 69  ? 12.931  13.014  7.970   1.00 63.44  ? 69  THR H CG2 1 
ATOM   5867 N N   . MET D 4 70  ? 16.254  13.385  7.594   1.00 79.54  ? 70  MET H N   1 
ATOM   5868 C CA  . MET D 4 70  ? 17.165  12.271  7.852   1.00 76.18  ? 70  MET H CA  1 
ATOM   5869 C C   . MET D 4 70  ? 16.716  11.463  9.049   1.00 80.19  ? 70  MET H C   1 
ATOM   5870 O O   . MET D 4 70  ? 16.249  12.014  10.048  1.00 93.23  ? 70  MET H O   1 
ATOM   5871 C CB  . MET D 4 70  ? 18.579  12.764  8.118   1.00 74.83  ? 70  MET H CB  1 
ATOM   5872 C CG  . MET D 4 70  ? 19.280  13.304  6.914   1.00 74.54  ? 70  MET H CG  1 
ATOM   5873 S SD  . MET D 4 70  ? 21.024  13.457  7.255   1.00 68.02  ? 70  MET H SD  1 
ATOM   5874 C CE  . MET D 4 70  ? 21.520  14.413  5.813   1.00 57.16  ? 70  MET H CE  1 
ATOM   5875 N N   . SER D 4 71  ? 16.888  10.153  8.952   1.00 73.92  ? 71  SER H N   1 
ATOM   5876 C CA  . SER D 4 71  ? 16.445  9.246   9.992   1.00 76.68  ? 71  SER H CA  1 
ATOM   5877 C C   . SER D 4 71  ? 17.352  8.037   10.000  1.00 75.07  ? 71  SER H C   1 
ATOM   5878 O O   . SER D 4 71  ? 18.241  7.925   9.167   1.00 79.96  ? 71  SER H O   1 
ATOM   5879 C CB  . SER D 4 71  ? 14.997  8.828   9.739   1.00 85.54  ? 71  SER H CB  1 
ATOM   5880 O OG  . SER D 4 71  ? 14.723  8.789   8.349   1.00 91.52  ? 71  SER H OG  1 
ATOM   5881 N N   . VAL D 4 72  ? 17.129  7.132   10.942  1.00 77.33  ? 72  VAL H N   1 
ATOM   5882 C CA  . VAL D 4 72  ? 17.926  5.918   11.011  1.00 69.61  ? 72  VAL H CA  1 
ATOM   5883 C C   . VAL D 4 72  ? 17.317  4.913   11.968  1.00 70.97  ? 72  VAL H C   1 
ATOM   5884 O O   . VAL D 4 72  ? 17.197  5.170   13.160  1.00 82.12  ? 72  VAL H O   1 
ATOM   5885 C CB  . VAL D 4 72  ? 19.386  6.209   11.410  1.00 65.07  ? 72  VAL H CB  1 
ATOM   5886 C CG1 . VAL D 4 72  ? 19.438  7.092   12.654  1.00 79.26  ? 72  VAL H CG1 1 
ATOM   5887 C CG2 . VAL D 4 72  ? 20.139  4.916   11.627  1.00 55.52  ? 72  VAL H CG2 1 
ATOM   5888 N N   . ASP D 4 73  ? 16.918  3.771   11.421  1.00 80.17  ? 73  ASP H N   1 
ATOM   5889 C CA  . ASP D 4 73  ? 16.375  2.662   12.199  1.00 89.24  ? 73  ASP H CA  1 
ATOM   5890 C C   . ASP D 4 73  ? 17.493  1.673   12.516  1.00 89.97  ? 73  ASP H C   1 
ATOM   5891 O O   . ASP D 4 73  ? 17.722  0.714   11.774  1.00 88.38  ? 73  ASP H O   1 
ATOM   5892 C CB  . ASP D 4 73  ? 15.257  1.975   11.416  1.00 91.01  ? 73  ASP H CB  1 
ATOM   5893 C CG  . ASP D 4 73  ? 14.805  0.684   12.053  1.00 97.51  ? 73  ASP H CG  1 
ATOM   5894 O OD1 . ASP D 4 73  ? 14.820  0.592   13.296  1.00 105.93 ? 73  ASP H OD1 1 
ATOM   5895 O OD2 . ASP D 4 73  ? 14.427  -0.240  11.305  1.00 99.70  ? 73  ASP H OD2 1 
ATOM   5896 N N   . LYS D 4 74  ? 18.187  1.915   13.624  1.00 83.60  ? 74  LYS H N   1 
ATOM   5897 C CA  . LYS D 4 74  ? 19.409  1.181   13.934  1.00 83.18  ? 74  LYS H CA  1 
ATOM   5898 C C   . LYS D 4 74  ? 19.205  -0.323  14.114  1.00 84.71  ? 74  LYS H C   1 
ATOM   5899 O O   . LYS D 4 74  ? 20.155  -1.098  14.015  1.00 88.66  ? 74  LYS H O   1 
ATOM   5900 C CB  . LYS D 4 74  ? 20.129  1.789   15.146  1.00 84.71  ? 74  LYS H CB  1 
ATOM   5901 C CG  . LYS D 4 74  ? 19.394  1.678   16.472  1.00 93.52  ? 74  LYS H CG  1 
ATOM   5902 C CD  . LYS D 4 74  ? 20.379  1.826   17.630  1.00 102.31 ? 74  LYS H CD  1 
ATOM   5903 C CE  . LYS D 4 74  ? 19.715  1.657   18.991  1.00 103.20 ? 74  LYS H CE  1 
ATOM   5904 N NZ  . LYS D 4 74  ? 18.860  2.824   19.345  1.00 104.99 ? 74  LYS H NZ  1 
ATOM   5905 N N   . SER D 4 75  ? 17.968  -0.735  14.367  1.00 81.43  ? 75  SER H N   1 
ATOM   5906 C CA  . SER D 4 75  ? 17.674  -2.148  14.560  1.00 84.75  ? 75  SER H CA  1 
ATOM   5907 C C   . SER D 4 75  ? 17.960  -2.953  13.298  1.00 94.36  ? 75  SER H C   1 
ATOM   5908 O O   . SER D 4 75  ? 18.343  -4.120  13.375  1.00 92.92  ? 75  SER H O   1 
ATOM   5909 C CB  . SER D 4 75  ? 16.226  -2.347  15.016  1.00 90.78  ? 75  SER H CB  1 
ATOM   5910 O OG  . SER D 4 75  ? 15.314  -1.776  14.097  1.00 91.59  ? 75  SER H OG  1 
ATOM   5911 N N   . ILE D 4 76  ? 17.773  -2.322  12.140  1.00 104.21 ? 76  ILE H N   1 
ATOM   5912 C CA  . ILE D 4 76  ? 18.083  -2.953  10.856  1.00 101.94 ? 76  ILE H CA  1 
ATOM   5913 C C   . ILE D 4 76  ? 19.286  -2.295  10.190  1.00 88.42  ? 76  ILE H C   1 
ATOM   5914 O O   . ILE D 4 76  ? 19.623  -2.613  9.052   1.00 87.48  ? 76  ILE H O   1 
ATOM   5915 C CB  . ILE D 4 76  ? 16.892  -2.904  9.870   1.00 99.39  ? 76  ILE H CB  1 
ATOM   5916 C CG1 . ILE D 4 76  ? 16.540  -1.457  9.529   1.00 104.36 ? 76  ILE H CG1 1 
ATOM   5917 C CG2 . ILE D 4 76  ? 15.689  -3.633  10.439  1.00 101.03 ? 76  ILE H CG2 1 
ATOM   5918 C CD1 . ILE D 4 76  ? 15.406  -1.331  8.540   1.00 106.74 ? 76  ILE H CD1 1 
ATOM   5919 N N   . THR D 4 77  ? 19.924  -1.376  10.905  1.00 74.73  ? 77  THR H N   1 
ATOM   5920 C CA  . THR D 4 77  ? 21.111  -0.687  10.407  1.00 85.43  ? 77  THR H CA  1 
ATOM   5921 C C   . THR D 4 77  ? 20.875  -0.023  9.051   1.00 86.23  ? 77  THR H C   1 
ATOM   5922 O O   . THR D 4 77  ? 21.578  -0.300  8.083   1.00 86.95  ? 77  THR H O   1 
ATOM   5923 C CB  . THR D 4 77  ? 22.329  -1.635  10.320  1.00 83.60  ? 77  THR H CB  1 
ATOM   5924 O OG1 . THR D 4 77  ? 22.033  -2.727  9.445   1.00 84.65  ? 77  THR H OG1 1 
ATOM   5925 C CG2 . THR D 4 77  ? 22.672  -2.182  11.688  1.00 85.76  ? 77  THR H CG2 1 
ATOM   5926 N N   . THR D 4 78  ? 19.892  0.868   8.997   1.00 80.88  ? 78  THR H N   1 
ATOM   5927 C CA  . THR D 4 78  ? 19.512  1.508   7.748   1.00 79.34  ? 78  THR H CA  1 
ATOM   5928 C C   . THR D 4 78  ? 19.191  2.983   7.951   1.00 77.01  ? 78  THR H C   1 
ATOM   5929 O O   . THR D 4 78  ? 18.333  3.325   8.755   1.00 77.13  ? 78  THR H O   1 
ATOM   5930 C CB  . THR D 4 78  ? 18.280  0.823   7.143   1.00 82.72  ? 78  THR H CB  1 
ATOM   5931 O OG1 . THR D 4 78  ? 18.628  -0.492  6.699   1.00 89.59  ? 78  THR H OG1 1 
ATOM   5932 C CG2 . THR D 4 78  ? 17.755  1.617   5.971   1.00 79.75  ? 78  THR H CG2 1 
ATOM   5933 N N   . ALA D 4 79  ? 19.876  3.855   7.216   1.00 74.41  ? 79  ALA H N   1 
ATOM   5934 C CA  . ALA D 4 79  ? 19.592  5.291   7.264   1.00 62.27  ? 79  ALA H CA  1 
ATOM   5935 C C   . ALA D 4 79  ? 18.585  5.664   6.185   1.00 67.39  ? 79  ALA H C   1 
ATOM   5936 O O   . ALA D 4 79  ? 18.501  5.005   5.152   1.00 76.45  ? 79  ALA H O   1 
ATOM   5937 C CB  . ALA D 4 79  ? 20.867  6.105   7.099   1.00 44.40  ? 79  ALA H CB  1 
ATOM   5938 N N   . TYR D 4 80  ? 17.824  6.725   6.424   1.00 66.37  ? 80  TYR H N   1 
ATOM   5939 C CA  . TYR D 4 80  ? 16.785  7.134   5.487   1.00 72.51  ? 80  TYR H CA  1 
ATOM   5940 C C   . TYR D 4 80  ? 16.858  8.621   5.142   1.00 78.99  ? 80  TYR H C   1 
ATOM   5941 O O   . TYR D 4 80  ? 17.085  9.464   6.015   1.00 79.61  ? 80  TYR H O   1 
ATOM   5942 C CB  . TYR D 4 80  ? 15.400  6.831   6.060   1.00 65.66  ? 80  TYR H CB  1 
ATOM   5943 C CG  . TYR D 4 80  ? 15.110  5.364   6.298   1.00 69.41  ? 80  TYR H CG  1 
ATOM   5944 C CD1 . TYR D 4 80  ? 14.697  4.544   5.261   1.00 67.70  ? 80  TYR H CD1 1 
ATOM   5945 C CD2 . TYR D 4 80  ? 15.224  4.808   7.569   1.00 74.94  ? 80  TYR H CD2 1 
ATOM   5946 C CE1 . TYR D 4 80  ? 14.420  3.211   5.475   1.00 76.75  ? 80  TYR H CE1 1 
ATOM   5947 C CE2 . TYR D 4 80  ? 14.949  3.475   7.794   1.00 81.26  ? 80  TYR H CE2 1 
ATOM   5948 C CZ  . TYR D 4 80  ? 14.546  2.678   6.743   1.00 90.51  ? 80  TYR H CZ  1 
ATOM   5949 O OH  . TYR D 4 80  ? 14.268  1.346   6.958   1.00 103.74 ? 80  TYR H OH  1 
ATOM   5950 N N   . LEU D 4 81  ? 16.667  8.935   3.863   1.00 67.76  ? 81  LEU H N   1 
ATOM   5951 C CA  . LEU D 4 81  ? 16.454  10.313  3.438   1.00 56.80  ? 81  LEU H CA  1 
ATOM   5952 C C   . LEU D 4 81  ? 15.043  10.404  2.859   1.00 61.81  ? 81  LEU H C   1 
ATOM   5953 O O   . LEU D 4 81  ? 14.588  9.485   2.183   1.00 73.58  ? 81  LEU H O   1 
ATOM   5954 C CB  . LEU D 4 81  ? 17.519  10.737  2.434   1.00 57.16  ? 81  LEU H CB  1 
ATOM   5955 C CG  . LEU D 4 81  ? 17.406  12.099  1.745   1.00 66.53  ? 81  LEU H CG  1 
ATOM   5956 C CD1 . LEU D 4 81  ? 17.123  13.224  2.726   1.00 63.75  ? 81  LEU H CD1 1 
ATOM   5957 C CD2 . LEU D 4 81  ? 18.666  12.402  0.927   1.00 65.06  ? 81  LEU H CD2 1 
ATOM   5958 N N   . GLN D 4 82  ? 14.343  11.499  3.139   1.00 62.97  ? 82  GLN H N   1 
ATOM   5959 C CA  . GLN D 4 82  ? 12.911  11.573  2.852   1.00 74.29  ? 82  GLN H CA  1 
ATOM   5960 C C   . GLN D 4 82  ? 12.453  12.959  2.396   1.00 80.23  ? 82  GLN H C   1 
ATOM   5961 O O   . GLN D 4 82  ? 12.958  13.978  2.863   1.00 87.56  ? 82  GLN H O   1 
ATOM   5962 C CB  . GLN D 4 82  ? 12.111  11.127  4.082   1.00 84.04  ? 82  GLN H CB  1 
ATOM   5963 C CG  . GLN D 4 82  ? 10.603  11.015  3.870   1.00 99.22  ? 82  GLN H CG  1 
ATOM   5964 C CD  . GLN D 4 82  ? 9.821   12.162  4.495   1.00 111.62 ? 82  GLN H CD  1 
ATOM   5965 O OE1 . GLN D 4 82  ? 10.375  12.990  5.220   1.00 116.23 ? 82  GLN H OE1 1 
ATOM   5966 N NE2 . GLN D 4 82  ? 8.520   12.207  4.222   1.00 115.43 ? 82  GLN H NE2 1 
ATOM   5967 N N   . TRP D 4 83  ? 11.504  12.985  1.467   1.00 74.25  ? 83  TRP H N   1 
ATOM   5968 C CA  . TRP D 4 83  ? 10.883  14.224  1.027   1.00 74.57  ? 83  TRP H CA  1 
ATOM   5969 C C   . TRP D 4 83  ? 9.381   14.095  1.257   1.00 93.59  ? 83  TRP H C   1 
ATOM   5970 O O   . TRP D 4 83  ? 8.850   12.986  1.283   1.00 104.11 ? 83  TRP H O   1 
ATOM   5971 C CB  . TRP D 4 83  ? 11.145  14.458  -0.464  1.00 72.00  ? 83  TRP H CB  1 
ATOM   5972 C CG  . TRP D 4 83  ? 12.564  14.841  -0.843  1.00 70.20  ? 83  TRP H CG  1 
ATOM   5973 C CD1 . TRP D 4 83  ? 13.069  16.106  -0.968  1.00 69.68  ? 83  TRP H CD1 1 
ATOM   5974 C CD2 . TRP D 4 83  ? 13.638  13.950  -1.183  1.00 61.20  ? 83  TRP H CD2 1 
ATOM   5975 N NE1 . TRP D 4 83  ? 14.392  16.055  -1.345  1.00 62.51  ? 83  TRP H NE1 1 
ATOM   5976 C CE2 . TRP D 4 83  ? 14.762  14.745  -1.486  1.00 58.72  ? 83  TRP H CE2 1 
ATOM   5977 C CE3 . TRP D 4 83  ? 13.756  12.560  -1.253  1.00 56.81  ? 83  TRP H CE3 1 
ATOM   5978 C CZ2 . TRP D 4 83  ? 15.986  14.195  -1.855  1.00 61.07  ? 83  TRP H CZ2 1 
ATOM   5979 C CZ3 . TRP D 4 83  ? 14.972  12.018  -1.616  1.00 58.69  ? 83  TRP H CZ3 1 
ATOM   5980 C CH2 . TRP D 4 83  ? 16.072  12.833  -1.912  1.00 63.08  ? 83  TRP H CH2 1 
ATOM   5981 N N   . ASN D 4 84  ? 8.687   15.212  1.429   1.00 96.07  ? 84  ASN H N   1 
ATOM   5982 C CA  . ASN D 4 84  ? 7.234   15.155  1.525   1.00 98.00  ? 84  ASN H CA  1 
ATOM   5983 C C   . ASN D 4 84  ? 6.589   15.637  0.235   1.00 102.20 ? 84  ASN H C   1 
ATOM   5984 O O   . ASN D 4 84  ? 5.505   15.194  -0.142  1.00 111.21 ? 84  ASN H O   1 
ATOM   5985 C CB  . ASN D 4 84  ? 6.727   15.940  2.734   1.00 106.15 ? 84  ASN H CB  1 
ATOM   5986 C CG  . ASN D 4 84  ? 6.715   15.104  4.001   1.00 116.37 ? 84  ASN H CG  1 
ATOM   5987 O OD1 . ASN D 4 84  ? 6.247   13.964  3.996   1.00 120.36 ? 84  ASN H OD1 1 
ATOM   5988 N ND2 . ASN D 4 84  ? 7.230   15.665  5.092   1.00 116.10 ? 84  ASN H ND2 1 
ATOM   5989 N N   . SER D 4 85  ? 7.280   16.538  -0.449  1.00 97.79  ? 85  SER H N   1 
ATOM   5990 C CA  . SER D 4 85  ? 6.803   17.060  -1.714  1.00 97.03  ? 85  SER H CA  1 
ATOM   5991 C C   . SER D 4 85  ? 7.983   17.349  -2.629  1.00 98.51  ? 85  SER H C   1 
ATOM   5992 O O   . SER D 4 85  ? 8.683   18.345  -2.463  1.00 99.36  ? 85  SER H O   1 
ATOM   5993 C CB  . SER D 4 85  ? 5.968   18.321  -1.491  1.00 101.61 ? 85  SER H CB  1 
ATOM   5994 O OG  . SER D 4 85  ? 5.479   18.833  -2.717  1.00 109.75 ? 85  SER H OG  1 
ATOM   5995 N N   . LEU D 4 86  ? 8.199   16.452  -3.586  1.00 103.20 ? 86  LEU H N   1 
ATOM   5996 C CA  . LEU D 4 86  ? 9.292   16.567  -4.548  1.00 91.68  ? 86  LEU H CA  1 
ATOM   5997 C C   . LEU D 4 86  ? 9.048   17.649  -5.590  1.00 86.80  ? 86  LEU H C   1 
ATOM   5998 O O   . LEU D 4 86  ? 7.914   17.868  -6.031  1.00 81.61  ? 86  LEU H O   1 
ATOM   5999 C CB  . LEU D 4 86  ? 9.507   15.238  -5.263  1.00 82.32  ? 86  LEU H CB  1 
ATOM   6000 C CG  . LEU D 4 86  ? 10.208  14.172  -4.432  1.00 80.98  ? 86  LEU H CG  1 
ATOM   6001 C CD1 . LEU D 4 86  ? 9.864   12.786  -4.946  1.00 78.70  ? 86  LEU H CD1 1 
ATOM   6002 C CD2 . LEU D 4 86  ? 11.708  14.415  -4.452  1.00 83.87  ? 86  LEU H CD2 1 
ATOM   6003 N N   . LYS D 4 87  ? 10.124  18.323  -5.975  1.00 78.93  ? 87  LYS H N   1 
ATOM   6004 C CA  . LYS D 4 87  ? 10.075  19.295  -7.053  1.00 82.27  ? 87  LYS H CA  1 
ATOM   6005 C C   . LYS D 4 87  ? 10.886  18.737  -8.206  1.00 75.29  ? 87  LYS H C   1 
ATOM   6006 O O   . LYS D 4 87  ? 11.667  17.805  -8.029  1.00 68.09  ? 87  LYS H O   1 
ATOM   6007 C CB  . LYS D 4 87  ? 10.688  20.620  -6.603  1.00 89.99  ? 87  LYS H CB  1 
ATOM   6008 C CG  . LYS D 4 87  ? 10.135  21.160  -5.305  1.00 94.69  ? 87  LYS H CG  1 
ATOM   6009 C CD  . LYS D 4 87  ? 11.039  22.243  -4.752  1.00 96.63  ? 87  LYS H CD  1 
ATOM   6010 C CE  . LYS D 4 87  ? 10.888  22.366  -3.247  1.00 100.16 ? 87  LYS H CE  1 
ATOM   6011 N NZ  . LYS D 4 87  ? 11.983  23.186  -2.666  1.00 96.78  ? 87  LYS H NZ  1 
ATOM   6012 N N   . ALA D 4 88  ? 10.710  19.303  -9.389  1.00 73.66  ? 88  ALA H N   1 
ATOM   6013 C CA  . ALA D 4 88  ? 11.538  18.897  -10.506 1.00 70.93  ? 88  ALA H CA  1 
ATOM   6014 C C   . ALA D 4 88  ? 13.010  19.036  -10.124 1.00 74.14  ? 88  ALA H C   1 
ATOM   6015 O O   . ALA D 4 88  ? 13.826  18.181  -10.450 1.00 67.33  ? 88  ALA H O   1 
ATOM   6016 C CB  . ALA D 4 88  ? 11.224  19.729  -11.734 1.00 66.86  ? 88  ALA H CB  1 
ATOM   6017 N N   . SER D 4 89  ? 13.339  20.113  -9.413  1.00 77.80  ? 89  SER H N   1 
ATOM   6018 C CA  . SER D 4 89  ? 14.731  20.459  -9.141  1.00 71.26  ? 89  SER H CA  1 
ATOM   6019 C C   . SER D 4 89  ? 15.420  19.407  -8.293  1.00 64.94  ? 89  SER H C   1 
ATOM   6020 O O   . SER D 4 89  ? 16.645  19.395  -8.181  1.00 56.87  ? 89  SER H O   1 
ATOM   6021 C CB  . SER D 4 89  ? 14.814  21.808  -8.435  1.00 78.70  ? 89  SER H CB  1 
ATOM   6022 O OG  . SER D 4 89  ? 14.485  21.673  -7.064  1.00 88.62  ? 89  SER H OG  1 
ATOM   6023 N N   . ASP D 4 90  ? 14.617  18.532  -7.695  1.00 73.48  ? 90  ASP H N   1 
ATOM   6024 C CA  . ASP D 4 90  ? 15.111  17.537  -6.747  1.00 77.57  ? 90  ASP H CA  1 
ATOM   6025 C C   . ASP D 4 90  ? 15.771  16.342  -7.435  1.00 71.04  ? 90  ASP H C   1 
ATOM   6026 O O   . ASP D 4 90  ? 16.531  15.608  -6.816  1.00 65.26  ? 90  ASP H O   1 
ATOM   6027 C CB  . ASP D 4 90  ? 13.981  17.067  -5.820  1.00 83.12  ? 90  ASP H CB  1 
ATOM   6028 C CG  . ASP D 4 90  ? 13.784  17.988  -4.621  1.00 87.47  ? 90  ASP H CG  1 
ATOM   6029 O OD1 . ASP D 4 90  ? 12.625  18.162  -4.165  1.00 77.29  ? 90  ASP H OD1 1 
ATOM   6030 O OD2 . ASP D 4 90  ? 14.802  18.535  -4.135  1.00 90.18  ? 90  ASP H OD2 1 
ATOM   6031 N N   . THR D 4 91  ? 15.496  16.162  -8.722  1.00 78.02  ? 91  THR H N   1 
ATOM   6032 C CA  . THR D 4 91  ? 16.030  15.026  -9.469  1.00 76.87  ? 91  THR H CA  1 
ATOM   6033 C C   . THR D 4 91  ? 17.553  15.038  -9.504  1.00 67.91  ? 91  THR H C   1 
ATOM   6034 O O   . THR D 4 91  ? 18.172  15.953  -10.045 1.00 76.56  ? 91  THR H O   1 
ATOM   6035 C CB  . THR D 4 91  ? 15.517  14.985  -10.938 1.00 68.21  ? 91  THR H CB  1 
ATOM   6036 O OG1 . THR D 4 91  ? 16.500  15.558  -11.801 1.00 70.57  ? 91  THR H OG1 1 
ATOM   6037 C CG2 . THR D 4 91  ? 14.231  15.745  -11.092 1.00 64.66  ? 91  THR H CG2 1 
ATOM   6038 N N   . ALA D 4 92  ? 18.158  14.007  -8.936  1.00 56.18  ? 92  ALA H N   1 
ATOM   6039 C CA  . ALA D 4 92  ? 19.608  13.895  -8.948  1.00 52.60  ? 92  ALA H CA  1 
ATOM   6040 C C   . ALA D 4 92  ? 20.025  12.520  -8.468  1.00 55.56  ? 92  ALA H C   1 
ATOM   6041 O O   . ALA D 4 92  ? 19.190  11.626  -8.313  1.00 54.10  ? 92  ALA H O   1 
ATOM   6042 C CB  . ALA D 4 92  ? 20.223  14.961  -8.074  1.00 52.11  ? 92  ALA H CB  1 
ATOM   6043 N N   . MET D 4 93  ? 21.324  12.356  -8.248  1.00 57.25  ? 93  MET H N   1 
ATOM   6044 C CA  . MET D 4 93  ? 21.847  11.144  -7.645  1.00 59.82  ? 93  MET H CA  1 
ATOM   6045 C C   . MET D 4 93  ? 22.017  11.425  -6.166  1.00 65.45  ? 93  MET H C   1 
ATOM   6046 O O   . MET D 4 93  ? 22.573  12.456  -5.793  1.00 72.52  ? 93  MET H O   1 
ATOM   6047 C CB  . MET D 4 93  ? 23.198  10.762  -8.261  1.00 51.80  ? 93  MET H CB  1 
ATOM   6048 C CG  . MET D 4 93  ? 23.787  9.470   -7.702  1.00 56.59  ? 93  MET H CG  1 
ATOM   6049 S SD  . MET D 4 93  ? 23.003  7.992   -8.370  1.00 74.94  ? 93  MET H SD  1 
ATOM   6050 C CE  . MET D 4 93  ? 24.201  7.514   -9.617  1.00 133.46 ? 93  MET H CE  1 
ATOM   6051 N N   . TYR D 4 94  ? 21.538  10.519  -5.322  1.00 64.88  ? 94  TYR H N   1 
ATOM   6052 C CA  . TYR D 4 94  ? 21.673  10.697  -3.879  1.00 58.16  ? 94  TYR H CA  1 
ATOM   6053 C C   . TYR D 4 94  ? 22.564  9.632   -3.241  1.00 53.41  ? 94  TYR H C   1 
ATOM   6054 O O   . TYR D 4 94  ? 22.177  8.473   -3.111  1.00 54.43  ? 94  TYR H O   1 
ATOM   6055 C CB  . TYR D 4 94  ? 20.295  10.791  -3.219  1.00 47.01  ? 94  TYR H CB  1 
ATOM   6056 C CG  . TYR D 4 94  ? 19.593  12.087  -3.571  1.00 64.14  ? 94  TYR H CG  1 
ATOM   6057 C CD1 . TYR D 4 94  ? 19.791  13.238  -2.814  1.00 72.00  ? 94  TYR H CD1 1 
ATOM   6058 C CD2 . TYR D 4 94  ? 18.766  12.176  -4.680  1.00 70.15  ? 94  TYR H CD2 1 
ATOM   6059 C CE1 . TYR D 4 94  ? 19.166  14.431  -3.140  1.00 71.29  ? 94  TYR H CE1 1 
ATOM   6060 C CE2 . TYR D 4 94  ? 18.137  13.370  -5.014  1.00 72.69  ? 94  TYR H CE2 1 
ATOM   6061 C CZ  . TYR D 4 94  ? 18.340  14.493  -4.244  1.00 72.63  ? 94  TYR H CZ  1 
ATOM   6062 O OH  . TYR D 4 94  ? 17.717  15.681  -4.573  1.00 73.64  ? 94  TYR H OH  1 
ATOM   6063 N N   . TYR D 4 95  ? 23.779  10.038  -2.882  1.00 52.54  ? 95  TYR H N   1 
ATOM   6064 C CA  . TYR D 4 95  ? 24.717  9.164   -2.178  1.00 57.65  ? 95  TYR H CA  1 
ATOM   6065 C C   . TYR D 4 95  ? 24.522  9.260   -0.659  1.00 62.61  ? 95  TYR H C   1 
ATOM   6066 O O   . TYR D 4 95  ? 24.242  10.335  -0.129  1.00 63.49  ? 95  TYR H O   1 
ATOM   6067 C CB  . TYR D 4 95  ? 26.174  9.517   -2.534  1.00 50.43  ? 95  TYR H CB  1 
ATOM   6068 C CG  . TYR D 4 95  ? 26.537  9.299   -3.986  1.00 57.80  ? 95  TYR H CG  1 
ATOM   6069 C CD1 . TYR D 4 95  ? 26.606  10.365  -4.874  1.00 63.13  ? 95  TYR H CD1 1 
ATOM   6070 C CD2 . TYR D 4 95  ? 26.806  8.027   -4.472  1.00 68.71  ? 95  TYR H CD2 1 
ATOM   6071 C CE1 . TYR D 4 95  ? 26.929  10.169  -6.209  1.00 71.98  ? 95  TYR H CE1 1 
ATOM   6072 C CE2 . TYR D 4 95  ? 27.128  7.820   -5.806  1.00 78.90  ? 95  TYR H CE2 1 
ATOM   6073 C CZ  . TYR D 4 95  ? 27.187  8.896   -6.668  1.00 79.96  ? 95  TYR H CZ  1 
ATOM   6074 O OH  . TYR D 4 95  ? 27.507  8.693   -7.990  1.00 85.17  ? 95  TYR H OH  1 
ATOM   6075 N N   . CYS D 4 96  ? 24.653  8.134   0.037   1.00 59.40  ? 96  CYS H N   1 
ATOM   6076 C CA  . CYS D 4 96  ? 24.767  8.160   1.487   1.00 61.24  ? 96  CYS H CA  1 
ATOM   6077 C C   . CYS D 4 96  ? 26.190  7.745   1.821   1.00 63.89  ? 96  CYS H C   1 
ATOM   6078 O O   . CYS D 4 96  ? 26.748  6.867   1.168   1.00 66.51  ? 96  CYS H O   1 
ATOM   6079 C CB  . CYS D 4 96  ? 23.737  7.237   2.157   1.00 56.52  ? 96  CYS H CB  1 
ATOM   6080 S SG  . CYS D 4 96  ? 24.287  5.541   2.498   1.00 96.96  ? 96  CYS H SG  1 
ATOM   6081 N N   . ALA D 4 97  ? 26.786  8.391   2.816   1.00 57.19  ? 97  ALA H N   1 
ATOM   6082 C CA  . ALA D 4 97  ? 28.180  8.122   3.145   1.00 57.95  ? 97  ALA H CA  1 
ATOM   6083 C C   . ALA D 4 97  ? 28.431  7.993   4.650   1.00 56.73  ? 97  ALA H C   1 
ATOM   6084 O O   . ALA D 4 97  ? 27.602  8.415   5.456   1.00 53.78  ? 97  ALA H O   1 
ATOM   6085 C CB  . ALA D 4 97  ? 29.072  9.194   2.537   1.00 49.33  ? 97  ALA H CB  1 
ATOM   6086 N N   . ARG D 4 98  ? 29.574  7.404   5.009   1.00 52.57  ? 98  ARG H N   1 
ATOM   6087 C CA  . ARG D 4 98  ? 29.941  7.177   6.404   1.00 47.79  ? 98  ARG H CA  1 
ATOM   6088 C C   . ARG D 4 98  ? 30.982  8.170   6.882   1.00 60.69  ? 98  ARG H C   1 
ATOM   6089 O O   . ARG D 4 98  ? 32.025  8.318   6.258   1.00 70.68  ? 98  ARG H O   1 
ATOM   6090 C CB  . ARG D 4 98  ? 30.486  5.766   6.607   1.00 48.86  ? 98  ARG H CB  1 
ATOM   6091 C CG  . ARG D 4 98  ? 30.901  5.501   8.055   1.00 60.89  ? 98  ARG H CG  1 
ATOM   6092 C CD  . ARG D 4 98  ? 31.368  4.059   8.295   1.00 60.30  ? 98  ARG H CD  1 
ATOM   6093 N NE  . ARG D 4 98  ? 32.826  3.927   8.318   1.00 61.34  ? 98  ARG H NE  1 
ATOM   6094 C CZ  . ARG D 4 98  ? 33.472  2.786   8.550   1.00 68.45  ? 98  ARG H CZ  1 
ATOM   6095 N NH1 . ARG D 4 98  ? 34.795  2.756   8.553   1.00 62.39  ? 98  ARG H NH1 1 
ATOM   6096 N NH2 . ARG D 4 98  ? 32.799  1.669   8.782   1.00 80.13  ? 98  ARG H NH2 1 
ATOM   6097 N N   . ARG D 4 99  ? 30.709  8.821   8.010   1.00 59.37  ? 99  ARG H N   1 
ATOM   6098 C CA  . ARG D 4 99  ? 31.575  9.871   8.522   1.00 48.32  ? 99  ARG H CA  1 
ATOM   6099 C C   . ARG D 4 99  ? 32.658  9.332   9.448   1.00 54.35  ? 99  ARG H C   1 
ATOM   6100 O O   . ARG D 4 99  ? 32.376  8.863   10.546  1.00 69.57  ? 99  ARG H O   1 
ATOM   6101 C CB  . ARG D 4 99  ? 30.746  10.919  9.256   1.00 54.62  ? 99  ARG H CB  1 
ATOM   6102 C CG  . ARG D 4 99  ? 31.576  11.892  10.068  1.00 59.10  ? 99  ARG H CG  1 
ATOM   6103 C CD  . ARG D 4 99  ? 30.724  12.607  11.094  1.00 58.69  ? 99  ARG H CD  1 
ATOM   6104 N NE  . ARG D 4 99  ? 31.476  12.841  12.321  1.00 57.28  ? 99  ARG H NE  1 
ATOM   6105 C CZ  . ARG D 4 99  ? 31.871  14.036  12.737  1.00 64.42  ? 99  ARG H CZ  1 
ATOM   6106 N NH1 . ARG D 4 99  ? 32.548  14.145  13.865  1.00 70.57  ? 99  ARG H NH1 1 
ATOM   6107 N NH2 . ARG D 4 99  ? 31.583  15.121  12.032  1.00 68.49  ? 99  ARG H NH2 1 
ATOM   6108 N N   . ARG D 4 100 ? 33.902  9.416   8.990   1.00 49.12  ? 100 ARG H N   1 
ATOM   6109 C CA  . ARG D 4 100 ? 35.067  8.958   9.739   1.00 52.21  ? 100 ARG H CA  1 
ATOM   6110 C C   . ARG D 4 100 ? 35.255  9.789   11.019  1.00 65.68  ? 100 ARG H C   1 
ATOM   6111 O O   . ARG D 4 100 ? 35.458  11.008  10.961  1.00 66.30  ? 100 ARG H O   1 
ATOM   6112 C CB  . ARG D 4 100 ? 36.301  9.013   8.824   1.00 57.18  ? 100 ARG H CB  1 
ATOM   6113 C CG  . ARG D 4 100 ? 37.625  9.308   9.488   1.00 65.90  ? 100 ARG H CG  1 
ATOM   6114 C CD  . ARG D 4 100 ? 38.082  8.190   10.402  1.00 64.30  ? 100 ARG H CD  1 
ATOM   6115 N NE  . ARG D 4 100 ? 38.938  8.702   11.474  1.00 69.61  ? 100 ARG H NE  1 
ATOM   6116 C CZ  . ARG D 4 100 ? 40.255  8.851   11.368  1.00 73.78  ? 100 ARG H CZ  1 
ATOM   6117 N NH1 . ARG D 4 100 ? 40.863  8.528   10.231  1.00 72.98  ? 100 ARG H NH1 1 
ATOM   6118 N NH2 . ARG D 4 100 ? 40.962  9.324   12.393  1.00 68.40  ? 100 ARG H NH2 1 
ATOM   6119 N N   . PRO D 4 101 ? 35.182  9.122   12.186  1.00 67.53  ? 101 PRO H N   1 
ATOM   6120 C CA  . PRO D 4 101 ? 35.180  9.721   13.528  1.00 57.88  ? 101 PRO H CA  1 
ATOM   6121 C C   . PRO D 4 101 ? 36.514  10.345  13.886  1.00 54.41  ? 101 PRO H C   1 
ATOM   6122 O O   . PRO D 4 101 ? 37.574  9.764   13.634  1.00 49.90  ? 101 PRO H O   1 
ATOM   6123 C CB  . PRO D 4 101 ? 34.906  8.526   14.450  1.00 55.74  ? 101 PRO H CB  1 
ATOM   6124 C CG  . PRO D 4 101 ? 34.413  7.451   13.565  1.00 61.34  ? 101 PRO H CG  1 
ATOM   6125 C CD  . PRO D 4 101 ? 35.102  7.658   12.263  1.00 64.02  ? 101 PRO H CD  1 
ATOM   6126 N N   . GLY D 4 102 ? 36.445  11.529  14.481  1.00 48.10  ? 102 GLY H N   1 
ATOM   6127 C CA  . GLY D 4 102 ? 37.635  12.259  14.862  1.00 51.23  ? 102 GLY H CA  1 
ATOM   6128 C C   . GLY D 4 102 ? 38.185  13.034  13.687  1.00 58.19  ? 102 GLY H C   1 
ATOM   6129 O O   . GLY D 4 102 ? 39.341  13.444  13.672  1.00 57.61  ? 102 GLY H O   1 
ATOM   6130 N N   . GLN D 4 103 ? 37.343  13.230  12.685  1.00 56.63  ? 103 GLN H N   1 
ATOM   6131 C CA  . GLN D 4 103 ? 37.738  13.984  11.510  1.00 53.27  ? 103 GLN H CA  1 
ATOM   6132 C C   . GLN D 4 103 ? 36.543  14.760  10.986  1.00 55.17  ? 103 GLN H C   1 
ATOM   6133 O O   . GLN D 4 103 ? 36.521  15.991  11.076  1.00 63.60  ? 103 GLN H O   1 
ATOM   6134 C CB  . GLN D 4 103 ? 38.307  13.063  10.433  1.00 51.19  ? 103 GLN H CB  1 
ATOM   6135 C CG  . GLN D 4 103 ? 39.668  12.483  10.762  1.00 40.30  ? 103 GLN H CG  1 
ATOM   6136 C CD  . GLN D 4 103 ? 40.755  13.522  10.726  1.00 50.51  ? 103 GLN H CD  1 
ATOM   6137 O OE1 . GLN D 4 103 ? 41.732  13.447  11.474  1.00 72.73  ? 103 GLN H OE1 1 
ATOM   6138 N NE2 . GLN D 4 103 ? 40.589  14.513  9.868   1.00 55.22  ? 103 GLN H NE2 1 
ATOM   6139 N N   . GLY D 4 104 ? 35.559  14.039  10.446  1.00 41.49  ? 104 GLY H N   1 
ATOM   6140 C CA  . GLY D 4 104 ? 34.341  14.653  9.946   1.00 41.71  ? 104 GLY H CA  1 
ATOM   6141 C C   . GLY D 4 104 ? 34.060  14.420  8.470   1.00 49.46  ? 104 GLY H C   1 
ATOM   6142 O O   . GLY D 4 104 ? 32.960  14.709  7.987   1.00 46.43  ? 104 GLY H O   1 
ATOM   6143 N N   . TYR D 4 105 ? 35.048  13.907  7.741   1.00 50.14  ? 105 TYR H N   1 
ATOM   6144 C CA  . TYR D 4 105 ? 34.861  13.648  6.321   1.00 42.16  ? 105 TYR H CA  1 
ATOM   6145 C C   . TYR D 4 105 ? 34.231  12.286  6.089   1.00 56.43  ? 105 TYR H C   1 
ATOM   6146 O O   . TYR D 4 105 ? 33.951  11.549  7.039   1.00 70.98  ? 105 TYR H O   1 
ATOM   6147 C CB  . TYR D 4 105 ? 36.179  13.764  5.566   1.00 45.35  ? 105 TYR H CB  1 
ATOM   6148 C CG  . TYR D 4 105 ? 37.035  12.520  5.588   1.00 50.91  ? 105 TYR H CG  1 
ATOM   6149 C CD1 . TYR D 4 105 ? 37.889  12.266  6.643   1.00 61.32  ? 105 TYR H CD1 1 
ATOM   6150 C CD2 . TYR D 4 105 ? 37.012  11.616  4.534   1.00 53.06  ? 105 TYR H CD2 1 
ATOM   6151 C CE1 . TYR D 4 105 ? 38.680  11.145  6.662   1.00 65.35  ? 105 TYR H CE1 1 
ATOM   6152 C CE2 . TYR D 4 105 ? 37.802  10.487  4.543   1.00 58.39  ? 105 TYR H CE2 1 
ATOM   6153 C CZ  . TYR D 4 105 ? 38.636  10.261  5.612   1.00 63.57  ? 105 TYR H CZ  1 
ATOM   6154 O OH  . TYR D 4 105 ? 39.431  9.145   5.640   1.00 69.32  ? 105 TYR H OH  1 
ATOM   6155 N N   . PHE D 4 106 ? 34.011  11.948  4.824   1.00 55.21  ? 106 PHE H N   1 
ATOM   6156 C CA  . PHE D 4 106 ? 33.360  10.689  4.492   1.00 49.42  ? 106 PHE H CA  1 
ATOM   6157 C C   . PHE D 4 106 ? 34.344  9.561   4.195   1.00 51.78  ? 106 PHE H C   1 
ATOM   6158 O O   . PHE D 4 106 ? 35.090  9.598   3.229   1.00 59.90  ? 106 PHE H O   1 
ATOM   6159 C CB  . PHE D 4 106 ? 32.338  10.875  3.376   1.00 39.06  ? 106 PHE H CB  1 
ATOM   6160 C CG  . PHE D 4 106 ? 31.060  11.540  3.837   1.00 43.83  ? 106 PHE H CG  1 
ATOM   6161 C CD1 . PHE D 4 106 ? 30.542  12.628  3.158   1.00 44.73  ? 106 PHE H CD1 1 
ATOM   6162 C CD2 . PHE D 4 106 ? 30.385  11.083  4.960   1.00 46.98  ? 106 PHE H CD2 1 
ATOM   6163 C CE1 . PHE D 4 106 ? 29.362  13.249  3.583   1.00 49.74  ? 106 PHE H CE1 1 
ATOM   6164 C CE2 . PHE D 4 106 ? 29.209  11.694  5.388   1.00 45.56  ? 106 PHE H CE2 1 
ATOM   6165 C CZ  . PHE D 4 106 ? 28.701  12.777  4.694   1.00 46.92  ? 106 PHE H CZ  1 
ATOM   6166 N N   . ASP D 4 107 ? 34.323  8.572   5.080   1.00 58.87  ? 107 ASP H N   1 
ATOM   6167 C CA  . ASP D 4 107 ? 35.103  7.340   5.034   1.00 56.45  ? 107 ASP H CA  1 
ATOM   6168 C C   . ASP D 4 107 ? 34.797  6.510   3.786   1.00 58.87  ? 107 ASP H C   1 
ATOM   6169 O O   . ASP D 4 107 ? 35.688  6.114   3.034   1.00 44.00  ? 107 ASP H O   1 
ATOM   6170 C CB  . ASP D 4 107 ? 34.655  6.514   6.242   1.00 50.43  ? 107 ASP H CB  1 
ATOM   6171 C CG  . ASP D 4 107 ? 35.796  6.011   7.068   1.00 70.58  ? 107 ASP H CG  1 
ATOM   6172 O OD1 . ASP D 4 107 ? 36.913  6.552   6.958   1.00 92.48  ? 107 ASP H OD1 1 
ATOM   6173 O OD2 . ASP D 4 107 ? 35.564  5.075   7.853   1.00 72.33  ? 107 ASP H OD2 1 
ATOM   6174 N N   . PHE D 4 108 ? 33.508  6.231   3.609   1.00 60.36  ? 108 PHE H N   1 
ATOM   6175 C CA  . PHE D 4 108 ? 33.019  5.284   2.620   1.00 52.15  ? 108 PHE H CA  1 
ATOM   6176 C C   . PHE D 4 108 ? 31.697  5.765   2.035   1.00 55.75  ? 108 PHE H C   1 
ATOM   6177 O O   . PHE D 4 108 ? 30.965  6.519   2.674   1.00 49.92  ? 108 PHE H O   1 
ATOM   6178 C CB  . PHE D 4 108 ? 32.850  3.904   3.250   1.00 45.78  ? 108 PHE H CB  1 
ATOM   6179 C CG  . PHE D 4 108 ? 34.152  3.223   3.551   1.00 45.42  ? 108 PHE H CG  1 
ATOM   6180 C CD1 . PHE D 4 108 ? 34.670  2.279   2.692   1.00 50.07  ? 108 PHE H CD1 1 
ATOM   6181 C CD2 . PHE D 4 108 ? 34.867  3.539   4.688   1.00 55.54  ? 108 PHE H CD2 1 
ATOM   6182 C CE1 . PHE D 4 108 ? 35.875  1.665   2.967   1.00 63.12  ? 108 PHE H CE1 1 
ATOM   6183 C CE2 . PHE D 4 108 ? 36.071  2.922   4.965   1.00 58.46  ? 108 PHE H CE2 1 
ATOM   6184 C CZ  . PHE D 4 108 ? 36.576  1.991   4.105   1.00 56.44  ? 108 PHE H CZ  1 
ATOM   6185 N N   . TRP D 4 109 ? 31.386  5.315   0.822   1.00 59.29  ? 109 TRP H N   1 
ATOM   6186 C CA  . TRP D 4 109 ? 30.231  5.836   0.092   1.00 58.88  ? 109 TRP H CA  1 
ATOM   6187 C C   . TRP D 4 109 ? 29.237  4.768   -0.338  1.00 55.47  ? 109 TRP H C   1 
ATOM   6188 O O   . TRP D 4 109 ? 29.605  3.630   -0.585  1.00 52.88  ? 109 TRP H O   1 
ATOM   6189 C CB  . TRP D 4 109 ? 30.704  6.574   -1.155  1.00 57.83  ? 109 TRP H CB  1 
ATOM   6190 C CG  . TRP D 4 109 ? 31.438  7.831   -0.872  1.00 53.28  ? 109 TRP H CG  1 
ATOM   6191 C CD1 . TRP D 4 109 ? 32.734  7.955   -0.452  1.00 55.56  ? 109 TRP H CD1 1 
ATOM   6192 C CD2 . TRP D 4 109 ? 30.923  9.153   -0.995  1.00 48.06  ? 109 TRP H CD2 1 
ATOM   6193 N NE1 . TRP D 4 109 ? 33.055  9.283   -0.302  1.00 48.08  ? 109 TRP H NE1 1 
ATOM   6194 C CE2 . TRP D 4 109 ? 31.961  10.038  -0.633  1.00 48.50  ? 109 TRP H CE2 1 
ATOM   6195 C CE3 . TRP D 4 109 ? 29.688  9.679   -1.379  1.00 47.54  ? 109 TRP H CE3 1 
ATOM   6196 C CZ2 . TRP D 4 109 ? 31.799  11.415  -0.651  1.00 45.92  ? 109 TRP H CZ2 1 
ATOM   6197 C CZ3 . TRP D 4 109 ? 29.527  11.047  -1.392  1.00 43.73  ? 109 TRP H CZ3 1 
ATOM   6198 C CH2 . TRP D 4 109 ? 30.578  11.901  -1.032  1.00 44.48  ? 109 TRP H CH2 1 
ATOM   6199 N N   . GLY D 4 110 ? 27.970  5.149   -0.436  1.00 55.23  ? 110 GLY H N   1 
ATOM   6200 C CA  . GLY D 4 110 ? 26.962  4.275   -1.003  1.00 58.85  ? 110 GLY H CA  1 
ATOM   6201 C C   . GLY D 4 110 ? 27.154  4.266   -2.507  1.00 70.27  ? 110 GLY H C   1 
ATOM   6202 O O   . GLY D 4 110 ? 27.936  5.059   -3.033  1.00 72.77  ? 110 GLY H O   1 
ATOM   6203 N N   . GLN D 4 111 ? 26.459  3.377   -3.209  1.00 72.46  ? 111 GLN H N   1 
ATOM   6204 C CA  . GLN D 4 111 ? 26.612  3.299   -4.660  1.00 66.55  ? 111 GLN H CA  1 
ATOM   6205 C C   . GLN D 4 111 ? 25.685  4.274   -5.387  1.00 65.17  ? 111 GLN H C   1 
ATOM   6206 O O   . GLN D 4 111 ? 25.678  4.335   -6.614  1.00 78.56  ? 111 GLN H O   1 
ATOM   6207 C CB  . GLN D 4 111 ? 26.399  1.871   -5.168  1.00 64.25  ? 111 GLN H CB  1 
ATOM   6208 C CG  . GLN D 4 111 ? 24.948  1.476   -5.372  1.00 65.29  ? 111 GLN H CG  1 
ATOM   6209 C CD  . GLN D 4 111 ? 24.278  1.012   -4.097  1.00 77.23  ? 111 GLN H CD  1 
ATOM   6210 O OE1 . GLN D 4 111 ? 24.933  0.836   -3.070  1.00 85.03  ? 111 GLN H OE1 1 
ATOM   6211 N NE2 . GLN D 4 111 ? 22.966  0.809   -4.154  1.00 76.49  ? 111 GLN H NE2 1 
ATOM   6212 N N   . GLY D 4 112 ? 24.913  5.040   -4.624  1.00 59.81  ? 112 GLY H N   1 
ATOM   6213 C CA  . GLY D 4 112 ? 24.037  6.047   -5.189  1.00 57.97  ? 112 GLY H CA  1 
ATOM   6214 C C   . GLY D 4 112 ? 22.627  5.548   -5.414  1.00 55.43  ? 112 GLY H C   1 
ATOM   6215 O O   . GLY D 4 112 ? 22.404  4.356   -5.614  1.00 54.08  ? 112 GLY H O   1 
ATOM   6216 N N   . THR D 4 113 ? 21.670  6.467   -5.360  1.00 57.58  ? 113 THR H N   1 
ATOM   6217 C CA  . THR D 4 113 ? 20.289  6.168   -5.715  1.00 65.25  ? 113 THR H CA  1 
ATOM   6218 C C   . THR D 4 113 ? 19.817  7.208   -6.722  1.00 70.83  ? 113 THR H C   1 
ATOM   6219 O O   . THR D 4 113 ? 19.623  8.374   -6.380  1.00 70.27  ? 113 THR H O   1 
ATOM   6220 C CB  . THR D 4 113 ? 19.349  6.190   -4.486  1.00 63.47  ? 113 THR H CB  1 
ATOM   6221 O OG1 . THR D 4 113 ? 19.659  5.101   -3.610  1.00 64.17  ? 113 THR H OG1 1 
ATOM   6222 C CG2 . THR D 4 113 ? 17.892  6.082   -4.919  1.00 59.20  ? 113 THR H CG2 1 
ATOM   6223 N N   . LEU D 4 114 ? 19.648  6.797   -7.971  1.00 74.19  ? 114 LEU H N   1 
ATOM   6224 C CA  . LEU D 4 114 ? 19.182  7.725   -8.984  1.00 68.77  ? 114 LEU H CA  1 
ATOM   6225 C C   . LEU D 4 114 ? 17.744  8.129   -8.694  1.00 74.93  ? 114 LEU H C   1 
ATOM   6226 O O   . LEU D 4 114 ? 16.864  7.277   -8.562  1.00 84.00  ? 114 LEU H O   1 
ATOM   6227 C CB  . LEU D 4 114 ? 19.284  7.116   -10.377 1.00 70.39  ? 114 LEU H CB  1 
ATOM   6228 C CG  . LEU D 4 114 ? 19.000  8.120   -11.495 1.00 82.21  ? 114 LEU H CG  1 
ATOM   6229 C CD1 . LEU D 4 114 ? 19.849  9.370   -11.293 1.00 80.16  ? 114 LEU H CD1 1 
ATOM   6230 C CD2 . LEU D 4 114 ? 19.245  7.509   -12.873 1.00 95.56  ? 114 LEU H CD2 1 
ATOM   6231 N N   . VAL D 4 115 ? 17.504  9.430   -8.580  1.00 68.81  ? 115 VAL H N   1 
ATOM   6232 C CA  . VAL D 4 115 ? 16.149  9.919   -8.375  1.00 69.52  ? 115 VAL H CA  1 
ATOM   6233 C C   . VAL D 4 115 ? 15.726  10.883  -9.480  1.00 74.86  ? 115 VAL H C   1 
ATOM   6234 O O   . VAL D 4 115 ? 16.382  11.892  -9.726  1.00 74.43  ? 115 VAL H O   1 
ATOM   6235 C CB  . VAL D 4 115 ? 15.969  10.569  -6.988  1.00 64.48  ? 115 VAL H CB  1 
ATOM   6236 C CG1 . VAL D 4 115 ? 14.590  11.211  -6.873  1.00 58.96  ? 115 VAL H CG1 1 
ATOM   6237 C CG2 . VAL D 4 115 ? 16.153  9.530   -5.901  1.00 67.75  ? 115 VAL H CG2 1 
ATOM   6238 N N   . THR D 4 116 ? 14.623  10.550  -10.142 1.00 79.70  ? 116 THR H N   1 
ATOM   6239 C CA  . THR D 4 116 ? 14.088  11.361  -11.222 1.00 79.70  ? 116 THR H CA  1 
ATOM   6240 C C   . THR D 4 116 ? 12.715  11.906  -10.847 1.00 85.87  ? 116 THR H C   1 
ATOM   6241 O O   . THR D 4 116 ? 11.793  11.144  -10.549 1.00 78.98  ? 116 THR H O   1 
ATOM   6242 C CB  . THR D 4 116 ? 13.955  10.550  -12.533 1.00 73.28  ? 116 THR H CB  1 
ATOM   6243 O OG1 . THR D 4 116 ? 15.201  9.914   -12.841 1.00 70.75  ? 116 THR H OG1 1 
ATOM   6244 C CG2 . THR D 4 116 ? 13.556  11.456  -13.689 1.00 67.59  ? 116 THR H CG2 1 
ATOM   6245 N N   . VAL D 4 117 ? 12.597  13.231  -10.862 1.00 93.08  ? 117 VAL H N   1 
ATOM   6246 C CA  . VAL D 4 117 ? 11.327  13.918  -10.664 1.00 89.19  ? 117 VAL H CA  1 
ATOM   6247 C C   . VAL D 4 117 ? 10.933  14.643  -11.947 1.00 92.88  ? 117 VAL H C   1 
ATOM   6248 O O   . VAL D 4 117 ? 11.569  15.619  -12.337 1.00 101.87 ? 117 VAL H O   1 
ATOM   6249 C CB  . VAL D 4 117 ? 11.419  14.957  -9.531  1.00 84.50  ? 117 VAL H CB  1 
ATOM   6250 C CG1 . VAL D 4 117 ? 10.083  15.647  -9.334  1.00 91.26  ? 117 VAL H CG1 1 
ATOM   6251 C CG2 . VAL D 4 117 ? 11.892  14.308  -8.239  1.00 86.74  ? 117 VAL H CG2 1 
ATOM   6252 N N   . SER D 4 118 ? 9.888   14.162  -12.610 1.00 86.79  ? 118 SER H N   1 
ATOM   6253 C CA  . SER D 4 118 ? 9.394   14.820  -13.812 1.00 97.78  ? 118 SER H CA  1 
ATOM   6254 C C   . SER D 4 118 ? 7.883   14.685  -13.908 1.00 107.58 ? 118 SER H C   1 
ATOM   6255 O O   . SER D 4 118 ? 7.298   13.751  -13.357 1.00 110.47 ? 118 SER H O   1 
ATOM   6256 C CB  . SER D 4 118 ? 10.052  14.225  -15.063 1.00 104.76 ? 118 SER H CB  1 
ATOM   6257 O OG  . SER D 4 118 ? 9.658   14.903  -16.246 1.00 98.97  ? 118 SER H OG  1 
ATOM   6258 N N   . SER D 4 119 ? 7.256   15.626  -14.607 1.00 109.13 ? 119 SER H N   1 
ATOM   6259 C CA  . SER D 4 119 ? 5.823   15.563  -14.868 1.00 106.57 ? 119 SER H CA  1 
ATOM   6260 C C   . SER D 4 119 ? 5.551   14.665  -16.064 1.00 97.13  ? 119 SER H C   1 
ATOM   6261 O O   . SER D 4 119 ? 4.445   14.640  -16.601 1.00 108.58 ? 119 SER H O   1 
ATOM   6262 C CB  . SER D 4 119 ? 5.248   16.963  -15.096 1.00 113.78 ? 119 SER H CB  1 
ATOM   6263 O OG  . SER D 4 119 ? 6.141   17.758  -15.856 1.00 116.15 ? 119 SER H OG  1 
ATOM   6264 N N   . SER D 4 120 ? 6.570   13.924  -16.477 1.00 69.71  ? 120 SER H N   1 
ATOM   6265 C CA  . SER D 4 120 ? 6.427   12.988  -17.576 1.00 81.74  ? 120 SER H CA  1 
ATOM   6266 C C   . SER D 4 120 ? 6.035   11.610  -17.059 1.00 89.41  ? 120 SER H C   1 
ATOM   6267 O O   . SER D 4 120 ? 6.511   11.173  -16.015 1.00 90.10  ? 120 SER H O   1 
ATOM   6268 C CB  . SER D 4 120 ? 7.733   12.902  -18.368 1.00 85.83  ? 120 SER H CB  1 
ATOM   6269 O OG  . SER D 4 120 ? 8.072   14.157  -18.939 1.00 89.05  ? 120 SER H OG  1 
ATOM   6270 N N   . SER D 4 121 ? 5.157   10.932  -17.792 1.00 93.93  ? 121 SER H N   1 
ATOM   6271 C CA  . SER D 4 121 ? 4.797   9.553   -17.479 1.00 93.46  ? 121 SER H CA  1 
ATOM   6272 C C   . SER D 4 121 ? 5.688   8.584   -18.256 1.00 86.34  ? 121 SER H C   1 
ATOM   6273 O O   . SER D 4 121 ? 6.226   8.929   -19.313 1.00 75.90  ? 121 SER H O   1 
ATOM   6274 C CB  . SER D 4 121 ? 3.322   9.283   -17.790 1.00 97.19  ? 121 SER H CB  1 
ATOM   6275 O OG  . SER D 4 121 ? 2.482   10.246  -17.178 1.00 103.69 ? 121 SER H OG  1 
ATOM   6276 N N   . THR D 4 122 ? 5.838   7.376   -17.722 1.00 89.28  ? 122 THR H N   1 
ATOM   6277 C CA  . THR D 4 122 ? 6.710   6.364   -18.310 1.00 91.58  ? 122 THR H CA  1 
ATOM   6278 C C   . THR D 4 122 ? 6.334   6.030   -19.748 1.00 88.71  ? 122 THR H C   1 
ATOM   6279 O O   . THR D 4 122 ? 5.159   5.901   -20.080 1.00 94.64  ? 122 THR H O   1 
ATOM   6280 C CB  . THR D 4 122 ? 6.699   5.068   -17.485 1.00 95.60  ? 122 THR H CB  1 
ATOM   6281 O OG1 . THR D 4 122 ? 7.356   5.294   -16.232 1.00 95.51  ? 122 THR H OG1 1 
ATOM   6282 C CG2 . THR D 4 122 ? 7.411   3.954   -18.240 1.00 95.23  ? 122 THR H CG2 1 
ATOM   6283 N N   . LYS D 4 123 ? 7.342   5.880   -20.598 1.00 88.85  ? 123 LYS H N   1 
ATOM   6284 C CA  . LYS D 4 123 ? 7.106   5.583   -22.004 1.00 95.09  ? 123 LYS H CA  1 
ATOM   6285 C C   . LYS D 4 123 ? 8.301   4.895   -22.641 1.00 93.01  ? 123 LYS H C   1 
ATOM   6286 O O   . LYS D 4 123 ? 9.446   5.275   -22.406 1.00 97.25  ? 123 LYS H O   1 
ATOM   6287 C CB  . LYS D 4 123 ? 6.797   6.870   -22.765 1.00 99.05  ? 123 LYS H CB  1 
ATOM   6288 C CG  . LYS D 4 123 ? 6.664   6.685   -24.263 1.00 104.00 ? 123 LYS H CG  1 
ATOM   6289 C CD  . LYS D 4 123 ? 6.521   8.025   -24.966 1.00 104.94 ? 123 LYS H CD  1 
ATOM   6290 C CE  . LYS D 4 123 ? 6.124   7.843   -26.422 1.00 107.79 ? 123 LYS H CE  1 
ATOM   6291 N NZ  . LYS D 4 123 ? 7.110   7.023   -27.181 1.00 105.23 ? 123 LYS H NZ  1 
ATOM   6292 N N   . GLY D 4 124 ? 8.025   3.876   -23.446 1.00 92.25  ? 124 GLY H N   1 
ATOM   6293 C CA  . GLY D 4 124 ? 9.056   3.224   -24.228 1.00 93.56  ? 124 GLY H CA  1 
ATOM   6294 C C   . GLY D 4 124 ? 9.482   4.139   -25.358 1.00 93.29  ? 124 GLY H C   1 
ATOM   6295 O O   . GLY D 4 124 ? 8.801   5.121   -25.649 1.00 95.04  ? 124 GLY H O   1 
ATOM   6296 N N   . PRO D 4 125 ? 10.612  3.824   -26.004 1.00 90.82  ? 125 PRO H N   1 
ATOM   6297 C CA  . PRO D 4 125 ? 11.158  4.681   -27.053 1.00 88.18  ? 125 PRO H CA  1 
ATOM   6298 C C   . PRO D 4 125 ? 10.726  4.257   -28.449 1.00 97.50  ? 125 PRO H C   1 
ATOM   6299 O O   . PRO D 4 125 ? 10.190  3.165   -28.648 1.00 103.10 ? 125 PRO H O   1 
ATOM   6300 C CB  . PRO D 4 125 ? 12.656  4.451   -26.899 1.00 80.04  ? 125 PRO H CB  1 
ATOM   6301 C CG  . PRO D 4 125 ? 12.736  2.983   -26.596 1.00 78.51  ? 125 PRO H CG  1 
ATOM   6302 C CD  . PRO D 4 125 ? 11.481  2.656   -25.774 1.00 89.70  ? 125 PRO H CD  1 
ATOM   6303 N N   . SER D 4 126 ? 10.953  5.139   -29.411 1.00 99.30  ? 126 SER H N   1 
ATOM   6304 C CA  . SER D 4 126 ? 10.831  4.780   -30.811 1.00 96.47  ? 126 SER H CA  1 
ATOM   6305 C C   . SER D 4 126 ? 12.244  4.569   -31.313 1.00 95.00  ? 126 SER H C   1 
ATOM   6306 O O   . SER D 4 126 ? 13.143  5.349   -30.998 1.00 91.50  ? 126 SER H O   1 
ATOM   6307 C CB  . SER D 4 126 ? 10.152  5.898   -31.600 1.00 90.67  ? 126 SER H CB  1 
ATOM   6308 O OG  . SER D 4 126 ? 8.813   6.080   -31.174 1.00 90.96  ? 126 SER H OG  1 
ATOM   6309 N N   . VAL D 4 127 ? 12.451  3.503   -32.071 1.00 90.89  ? 127 VAL H N   1 
ATOM   6310 C CA  . VAL D 4 127 ? 13.758  3.263   -32.649 1.00 80.60  ? 127 VAL H CA  1 
ATOM   6311 C C   . VAL D 4 127 ? 13.703  3.488   -34.149 1.00 79.37  ? 127 VAL H C   1 
ATOM   6312 O O   . VAL D 4 127 ? 12.831  2.961   -34.838 1.00 84.79  ? 127 VAL H O   1 
ATOM   6313 C CB  . VAL D 4 127 ? 14.261  1.855   -32.335 1.00 76.67  ? 127 VAL H CB  1 
ATOM   6314 C CG1 . VAL D 4 127 ? 15.761  1.787   -32.525 1.00 78.96  ? 127 VAL H CG1 1 
ATOM   6315 C CG2 . VAL D 4 127 ? 13.899  1.497   -30.917 1.00 77.19  ? 127 VAL H CG2 1 
ATOM   6316 N N   . PHE D 4 128 ? 14.623  4.310   -34.639 1.00 78.56  ? 128 PHE H N   1 
ATOM   6317 C CA  . PHE D 4 128 ? 14.714  4.605   -36.061 1.00 87.43  ? 128 PHE H CA  1 
ATOM   6318 C C   . PHE D 4 128 ? 16.132  4.345   -36.539 1.00 90.63  ? 128 PHE H C   1 
ATOM   6319 O O   . PHE D 4 128 ? 17.079  4.452   -35.765 1.00 94.76  ? 128 PHE H O   1 
ATOM   6320 C CB  . PHE D 4 128 ? 14.319  6.056   -36.341 1.00 85.31  ? 128 PHE H CB  1 
ATOM   6321 C CG  . PHE D 4 128 ? 12.931  6.399   -35.898 1.00 82.59  ? 128 PHE H CG  1 
ATOM   6322 C CD1 . PHE D 4 128 ? 11.882  5.529   -36.126 1.00 83.18  ? 128 PHE H CD1 1 
ATOM   6323 C CD2 . PHE D 4 128 ? 12.673  7.594   -35.262 1.00 84.81  ? 128 PHE H CD2 1 
ATOM   6324 C CE1 . PHE D 4 128 ? 10.604  5.842   -35.719 1.00 88.61  ? 128 PHE H CE1 1 
ATOM   6325 C CE2 . PHE D 4 128 ? 11.392  7.914   -34.854 1.00 90.07  ? 128 PHE H CE2 1 
ATOM   6326 C CZ  . PHE D 4 128 ? 10.356  7.036   -35.083 1.00 90.92  ? 128 PHE H CZ  1 
ATOM   6327 N N   . PRO D 4 129 ? 16.280  3.986   -37.819 1.00 90.96  ? 129 PRO H N   1 
ATOM   6328 C CA  . PRO D 4 129 ? 17.597  3.671   -38.377 1.00 88.18  ? 129 PRO H CA  1 
ATOM   6329 C C   . PRO D 4 129 ? 18.361  4.917   -38.799 1.00 83.46  ? 129 PRO H C   1 
ATOM   6330 O O   . PRO D 4 129 ? 17.755  5.930   -39.137 1.00 88.15  ? 129 PRO H O   1 
ATOM   6331 C CB  . PRO D 4 129 ? 17.258  2.823   -39.614 1.00 91.00  ? 129 PRO H CB  1 
ATOM   6332 C CG  . PRO D 4 129 ? 15.783  2.475   -39.476 1.00 94.46  ? 129 PRO H CG  1 
ATOM   6333 C CD  . PRO D 4 129 ? 15.195  3.624   -38.742 1.00 92.20  ? 129 PRO H CD  1 
ATOM   6334 N N   . LEU D 4 130 ? 19.686  4.837   -38.763 1.00 76.06  ? 130 LEU H N   1 
ATOM   6335 C CA  . LEU D 4 130 ? 20.531  5.869   -39.342 1.00 80.35  ? 130 LEU H CA  1 
ATOM   6336 C C   . LEU D 4 130 ? 21.377  5.230   -40.431 1.00 102.17 ? 130 LEU H C   1 
ATOM   6337 O O   . LEU D 4 130 ? 22.552  4.932   -40.230 1.00 109.78 ? 130 LEU H O   1 
ATOM   6338 C CB  . LEU D 4 130 ? 21.408  6.525   -38.281 1.00 81.17  ? 130 LEU H CB  1 
ATOM   6339 C CG  . LEU D 4 130 ? 20.675  7.379   -37.241 1.00 84.45  ? 130 LEU H CG  1 
ATOM   6340 C CD1 . LEU D 4 130 ? 21.633  7.832   -36.157 1.00 78.21  ? 130 LEU H CD1 1 
ATOM   6341 C CD2 . LEU D 4 130 ? 19.967  8.578   -37.880 1.00 81.50  ? 130 LEU H CD2 1 
ATOM   6342 N N   . ALA D 4 131 ? 20.751  5.020   -41.584 1.00 108.20 ? 131 ALA H N   1 
ATOM   6343 C CA  . ALA D 4 131 ? 21.342  4.272   -42.683 1.00 107.04 ? 131 ALA H CA  1 
ATOM   6344 C C   . ALA D 4 131 ? 22.601  4.927   -43.231 1.00 111.67 ? 131 ALA H C   1 
ATOM   6345 O O   . ALA D 4 131 ? 22.677  6.152   -43.327 1.00 114.68 ? 131 ALA H O   1 
ATOM   6346 C CB  . ALA D 4 131 ? 20.319  4.094   -43.792 1.00 113.11 ? 131 ALA H CB  1 
ATOM   6347 N N   . PRO D 4 132 ? 23.597  4.105   -43.601 1.00 108.80 ? 132 PRO H N   1 
ATOM   6348 C CA  . PRO D 4 132 ? 24.836  4.589   -44.219 1.00 107.90 ? 132 PRO H CA  1 
ATOM   6349 C C   . PRO D 4 132 ? 24.553  5.187   -45.595 1.00 110.07 ? 132 PRO H C   1 
ATOM   6350 O O   . PRO D 4 132 ? 23.762  4.618   -46.346 1.00 108.08 ? 132 PRO H O   1 
ATOM   6351 C CB  . PRO D 4 132 ? 25.674  3.314   -44.363 1.00 104.71 ? 132 PRO H CB  1 
ATOM   6352 C CG  . PRO D 4 132 ? 25.056  2.323   -43.422 1.00 92.87  ? 132 PRO H CG  1 
ATOM   6353 C CD  . PRO D 4 132 ? 23.605  2.644   -43.420 1.00 93.98  ? 132 PRO H CD  1 
ATOM   6354 N N   . SER D 4 133 ? 25.188  6.310   -45.920 1.00 116.62 ? 133 SER H N   1 
ATOM   6355 C CA  . SER D 4 133 ? 24.931  6.992   -47.190 1.00 130.91 ? 133 SER H CA  1 
ATOM   6356 C C   . SER D 4 133 ? 25.563  6.288   -48.397 1.00 147.25 ? 133 SER H C   1 
ATOM   6357 O O   . SER D 4 133 ? 24.998  5.330   -48.933 1.00 155.84 ? 133 SER H O   1 
ATOM   6358 C CB  . SER D 4 133 ? 25.377  8.458   -47.130 1.00 130.87 ? 133 SER H CB  1 
ATOM   6359 O OG  . SER D 4 133 ? 26.788  8.582   -47.125 1.00 131.32 ? 133 SER H OG  1 
ATOM   6360 N N   . SER D 4 134 ? 26.724  6.773   -48.832 1.00 152.05 ? 134 SER H N   1 
ATOM   6361 C CA  . SER D 4 134 ? 27.412  6.205   -49.992 1.00 152.92 ? 134 SER H CA  1 
ATOM   6362 C C   . SER D 4 134 ? 28.902  6.557   -49.988 1.00 156.49 ? 134 SER H C   1 
ATOM   6363 O O   . SER D 4 134 ? 29.280  7.712   -50.206 1.00 147.29 ? 134 SER H O   1 
ATOM   6364 C CB  . SER D 4 134 ? 26.760  6.654   -51.297 1.00 141.30 ? 134 SER H CB  1 
ATOM   6365 N N   . LYS D 4 135 ? 29.742  5.550   -49.748 1.00 164.01 ? 135 LYS H N   1 
ATOM   6366 C CA  . LYS D 4 135 ? 31.189  5.748   -49.630 1.00 163.76 ? 135 LYS H CA  1 
ATOM   6367 C C   . LYS D 4 135 ? 31.993  4.697   -50.409 1.00 165.04 ? 135 LYS H C   1 
ATOM   6368 O O   . LYS D 4 135 ? 32.849  4.020   -49.845 1.00 168.51 ? 135 LYS H O   1 
ATOM   6369 C CB  . LYS D 4 135 ? 31.609  5.751   -48.166 1.00 154.23 ? 135 LYS H CB  1 
ATOM   6370 N N   . SER D 4 136 ? 31.727  4.576   -51.709 1.00 159.90 ? 136 SER H N   1 
ATOM   6371 C CA  . SER D 4 136 ? 32.406  3.577   -52.540 1.00 159.22 ? 136 SER H CA  1 
ATOM   6372 C C   . SER D 4 136 ? 33.900  3.868   -52.659 1.00 158.07 ? 136 SER H C   1 
ATOM   6373 O O   . SER D 4 136 ? 34.723  3.274   -51.959 1.00 154.88 ? 136 SER H O   1 
ATOM   6374 C CB  . SER D 4 136 ? 31.762  3.495   -53.920 1.00 159.07 ? 136 SER H CB  1 
ATOM   6375 N N   . GLY D 4 140 ? 36.813  0.970   -47.894 1.00 121.65 ? 140 GLY H N   1 
ATOM   6376 C CA  . GLY D 4 140 ? 36.212  2.150   -47.294 1.00 123.00 ? 140 GLY H CA  1 
ATOM   6377 C C   . GLY D 4 140 ? 35.781  1.953   -45.850 1.00 122.05 ? 140 GLY H C   1 
ATOM   6378 O O   . GLY D 4 140 ? 35.993  0.886   -45.269 1.00 123.59 ? 140 GLY H O   1 
ATOM   6379 N N   . THR D 4 141 ? 35.174  2.987   -45.269 1.00 119.84 ? 141 THR H N   1 
ATOM   6380 C CA  . THR D 4 141 ? 34.712  2.938   -43.883 1.00 120.36 ? 141 THR H CA  1 
ATOM   6381 C C   . THR D 4 141 ? 33.451  3.774   -43.691 1.00 114.06 ? 141 THR H C   1 
ATOM   6382 O O   . THR D 4 141 ? 33.495  5.000   -43.790 1.00 108.77 ? 141 THR H O   1 
ATOM   6383 C CB  . THR D 4 141 ? 35.781  3.466   -42.911 1.00 123.28 ? 141 THR H CB  1 
ATOM   6384 O OG1 . THR D 4 141 ? 37.070  2.976   -43.300 1.00 136.50 ? 141 THR H OG1 1 
ATOM   6385 C CG2 . THR D 4 141 ? 35.469  3.034   -41.473 1.00 103.22 ? 141 THR H CG2 1 
ATOM   6386 N N   . ALA D 4 142 ? 32.331  3.115   -43.403 1.00 110.46 ? 142 ALA H N   1 
ATOM   6387 C CA  . ALA D 4 142 ? 31.055  3.816   -43.267 1.00 111.77 ? 142 ALA H CA  1 
ATOM   6388 C C   . ALA D 4 142 ? 30.454  3.733   -41.861 1.00 108.39 ? 142 ALA H C   1 
ATOM   6389 O O   . ALA D 4 142 ? 30.795  2.850   -41.073 1.00 113.20 ? 142 ALA H O   1 
ATOM   6390 C CB  . ALA D 4 142 ? 30.061  3.315   -44.303 1.00 116.28 ? 142 ALA H CB  1 
ATOM   6391 N N   . ALA D 4 143 ? 29.544  4.657   -41.569 1.00 95.71  ? 143 ALA H N   1 
ATOM   6392 C CA  . ALA D 4 143 ? 28.928  4.770   -40.256 1.00 76.04  ? 143 ALA H CA  1 
ATOM   6393 C C   . ALA D 4 143 ? 27.427  4.489   -40.313 1.00 78.33  ? 143 ALA H C   1 
ATOM   6394 O O   . ALA D 4 143 ? 26.794  4.629   -41.358 1.00 82.94  ? 143 ALA H O   1 
ATOM   6395 C CB  . ALA D 4 143 ? 29.172  6.154   -39.703 1.00 68.47  ? 143 ALA H CB  1 
ATOM   6396 N N   . LEU D 4 144 ? 26.865  4.095   -39.179 1.00 62.35  ? 144 LEU H N   1 
ATOM   6397 C CA  . LEU D 4 144 ? 25.436  3.843   -39.065 1.00 82.01  ? 144 LEU H CA  1 
ATOM   6398 C C   . LEU D 4 144 ? 25.024  3.768   -37.600 1.00 89.18  ? 144 LEU H C   1 
ATOM   6399 O O   . LEU D 4 144 ? 25.862  3.869   -36.702 1.00 89.68  ? 144 LEU H O   1 
ATOM   6400 C CB  . LEU D 4 144 ? 25.071  2.525   -39.742 1.00 79.14  ? 144 LEU H CB  1 
ATOM   6401 C CG  . LEU D 4 144 ? 25.730  1.291   -39.121 1.00 74.12  ? 144 LEU H CG  1 
ATOM   6402 C CD1 . LEU D 4 144 ? 24.892  0.045   -39.323 1.00 66.23  ? 144 LEU H CD1 1 
ATOM   6403 C CD2 . LEU D 4 144 ? 27.133  1.102   -39.667 1.00 83.56  ? 144 LEU H CD2 1 
ATOM   6404 N N   . GLY D 4 145 ? 23.731  3.582   -37.359 1.00 89.28  ? 145 GLY H N   1 
ATOM   6405 C CA  . GLY D 4 145 ? 23.254  3.389   -36.005 1.00 88.02  ? 145 GLY H CA  1 
ATOM   6406 C C   . GLY D 4 145 ? 21.767  3.596   -35.830 1.00 93.62  ? 145 GLY H C   1 
ATOM   6407 O O   . GLY D 4 145 ? 21.068  3.965   -36.770 1.00 101.53 ? 145 GLY H O   1 
ATOM   6408 N N   . CYS D 4 146 ? 21.288  3.353   -34.613 1.00 89.75  ? 146 CYS H N   1 
ATOM   6409 C CA  . CYS D 4 146 ? 19.881  3.531   -34.280 1.00 77.72  ? 146 CYS H CA  1 
ATOM   6410 C C   . CYS D 4 146 ? 19.662  4.793   -33.468 1.00 80.37  ? 146 CYS H C   1 
ATOM   6411 O O   . CYS D 4 146 ? 20.403  5.081   -32.530 1.00 84.15  ? 146 CYS H O   1 
ATOM   6412 C CB  . CYS D 4 146 ? 19.356  2.332   -33.493 1.00 62.55  ? 146 CYS H CB  1 
ATOM   6413 S SG  . CYS D 4 146 ? 19.161  0.863   -34.486 1.00 130.67 ? 146 CYS H SG  1 
ATOM   6414 N N   . LEU D 4 147 ? 18.638  5.547   -33.841 1.00 75.66  ? 147 LEU H N   1 
ATOM   6415 C CA  . LEU D 4 147 ? 18.239  6.720   -33.092 1.00 68.05  ? 147 LEU H CA  1 
ATOM   6416 C C   . LEU D 4 147 ? 17.128  6.350   -32.123 1.00 67.25  ? 147 LEU H C   1 
ATOM   6417 O O   . LEU D 4 147 ? 16.006  6.067   -32.537 1.00 74.47  ? 147 LEU H O   1 
ATOM   6418 C CB  . LEU D 4 147 ? 17.777  7.817   -34.046 1.00 68.22  ? 147 LEU H CB  1 
ATOM   6419 C CG  . LEU D 4 147 ? 16.824  8.872   -33.482 1.00 77.71  ? 147 LEU H CG  1 
ATOM   6420 C CD1 . LEU D 4 147 ? 17.392  9.537   -32.240 1.00 70.72  ? 147 LEU H CD1 1 
ATOM   6421 C CD2 . LEU D 4 147 ? 16.523  9.906   -34.552 1.00 88.21  ? 147 LEU H CD2 1 
ATOM   6422 N N   . VAL D 4 148 ? 17.456  6.341   -30.835 1.00 67.06  ? 148 VAL H N   1 
ATOM   6423 C CA  . VAL D 4 148 ? 16.491  6.039   -29.785 1.00 60.75  ? 148 VAL H CA  1 
ATOM   6424 C C   . VAL D 4 148 ? 15.881  7.328   -29.262 1.00 63.78  ? 148 VAL H C   1 
ATOM   6425 O O   . VAL D 4 148 ? 16.548  8.121   -28.599 1.00 61.79  ? 148 VAL H O   1 
ATOM   6426 C CB  . VAL D 4 148 ? 17.145  5.297   -28.613 1.00 60.15  ? 148 VAL H CB  1 
ATOM   6427 C CG1 . VAL D 4 148 ? 16.072  4.763   -27.676 1.00 65.83  ? 148 VAL H CG1 1 
ATOM   6428 C CG2 . VAL D 4 148 ? 18.022  4.172   -29.129 1.00 58.17  ? 148 VAL H CG2 1 
ATOM   6429 N N   . LYS D 4 149 ? 14.606  7.534   -29.564 1.00 61.90  ? 149 LYS H N   1 
ATOM   6430 C CA  . LYS D 4 149 ? 13.990  8.836   -29.359 1.00 66.43  ? 149 LYS H CA  1 
ATOM   6431 C C   . LYS D 4 149 ? 12.669  8.767   -28.617 1.00 74.75  ? 149 LYS H C   1 
ATOM   6432 O O   . LYS D 4 149 ? 11.857  7.875   -28.852 1.00 73.04  ? 149 LYS H O   1 
ATOM   6433 C CB  . LYS D 4 149 ? 13.791  9.547   -30.703 1.00 76.73  ? 149 LYS H CB  1 
ATOM   6434 C CG  . LYS D 4 149 ? 13.085  10.886  -30.586 1.00 81.62  ? 149 LYS H CG  1 
ATOM   6435 C CD  . LYS D 4 149 ? 13.152  11.691  -31.870 1.00 80.67  ? 149 LYS H CD  1 
ATOM   6436 C CE  . LYS D 4 149 ? 12.579  13.094  -31.670 1.00 83.23  ? 149 LYS H CE  1 
ATOM   6437 N NZ  . LYS D 4 149 ? 11.084  13.123  -31.632 1.00 85.94  ? 149 LYS H NZ  1 
ATOM   6438 N N   . ASP D 4 150 ? 12.474  9.723   -27.714 1.00 85.14  ? 150 ASP H N   1 
ATOM   6439 C CA  . ASP D 4 150 ? 11.205  9.905   -27.023 1.00 86.17  ? 150 ASP H CA  1 
ATOM   6440 C C   . ASP D 4 150 ? 10.887  8.768   -26.061 1.00 83.15  ? 150 ASP H C   1 
ATOM   6441 O O   . ASP D 4 150 ? 9.986   7.972   -26.311 1.00 90.24  ? 150 ASP H O   1 
ATOM   6442 C CB  . ASP D 4 150 ? 10.068  10.071  -28.033 1.00 90.02  ? 150 ASP H CB  1 
ATOM   6443 C CG  . ASP D 4 150 ? 10.155  11.378  -28.803 1.00 88.00  ? 150 ASP H CG  1 
ATOM   6444 O OD1 . ASP D 4 150 ? 10.755  12.347  -28.283 1.00 74.38  ? 150 ASP H OD1 1 
ATOM   6445 O OD2 . ASP D 4 150 ? 9.613   11.439  -29.930 1.00 95.68  ? 150 ASP H OD2 1 
ATOM   6446 N N   . TYR D 4 151 ? 11.631  8.693   -24.964 1.00 84.95  ? 151 TYR H N   1 
ATOM   6447 C CA  . TYR D 4 151 ? 11.346  7.714   -23.910 1.00 91.17  ? 151 TYR H CA  1 
ATOM   6448 C C   . TYR D 4 151 ? 11.510  8.311   -22.511 1.00 94.48  ? 151 TYR H C   1 
ATOM   6449 O O   . TYR D 4 151 ? 12.085  9.389   -22.341 1.00 92.12  ? 151 TYR H O   1 
ATOM   6450 C CB  . TYR D 4 151 ? 12.233  6.480   -24.047 1.00 83.88  ? 151 TYR H CB  1 
ATOM   6451 C CG  . TYR D 4 151 ? 13.687  6.758   -23.768 1.00 81.72  ? 151 TYR H CG  1 
ATOM   6452 C CD1 . TYR D 4 151 ? 14.546  7.145   -24.786 1.00 85.63  ? 151 TYR H CD1 1 
ATOM   6453 C CD2 . TYR D 4 151 ? 14.199  6.643   -22.486 1.00 79.36  ? 151 TYR H CD2 1 
ATOM   6454 C CE1 . TYR D 4 151 ? 15.873  7.405   -24.537 1.00 80.66  ? 151 TYR H CE1 1 
ATOM   6455 C CE2 . TYR D 4 151 ? 15.530  6.901   -22.227 1.00 81.38  ? 151 TYR H CE2 1 
ATOM   6456 C CZ  . TYR D 4 151 ? 16.361  7.282   -23.262 1.00 79.34  ? 151 TYR H CZ  1 
ATOM   6457 O OH  . TYR D 4 151 ? 17.687  7.541   -23.018 1.00 76.51  ? 151 TYR H OH  1 
ATOM   6458 N N   . PHE D 4 152 ? 11.009  7.593   -21.513 1.00 90.94  ? 152 PHE H N   1 
ATOM   6459 C CA  . PHE D 4 152 ? 11.057  8.062   -20.135 1.00 88.67  ? 152 PHE H CA  1 
ATOM   6460 C C   . PHE D 4 152 ? 10.740  6.927   -19.164 1.00 95.74  ? 152 PHE H C   1 
ATOM   6461 O O   . PHE D 4 152 ? 9.776   6.186   -19.361 1.00 104.41 ? 152 PHE H O   1 
ATOM   6462 C CB  . PHE D 4 152 ? 10.077  9.220   -19.935 1.00 84.21  ? 152 PHE H CB  1 
ATOM   6463 C CG  . PHE D 4 152 ? 10.184  9.881   -18.592 1.00 83.86  ? 152 PHE H CG  1 
ATOM   6464 C CD1 . PHE D 4 152 ? 9.302   9.560   -17.576 1.00 87.61  ? 152 PHE H CD1 1 
ATOM   6465 C CD2 . PHE D 4 152 ? 11.166  10.823  -18.346 1.00 80.69  ? 152 PHE H CD2 1 
ATOM   6466 C CE1 . PHE D 4 152 ? 9.395   10.164  -16.341 1.00 91.75  ? 152 PHE H CE1 1 
ATOM   6467 C CE2 . PHE D 4 152 ? 11.267  11.430  -17.115 1.00 88.69  ? 152 PHE H CE2 1 
ATOM   6468 C CZ  . PHE D 4 152 ? 10.378  11.099  -16.109 1.00 93.14  ? 152 PHE H CZ  1 
ATOM   6469 N N   . PRO D 4 153 ? 11.569  6.774   -18.121 1.00 91.66  ? 153 PRO H N   1 
ATOM   6470 C CA  . PRO D 4 153 ? 12.774  7.570   -17.895 1.00 92.75  ? 153 PRO H CA  1 
ATOM   6471 C C   . PRO D 4 153 ? 14.009  6.829   -18.376 1.00 87.33  ? 153 PRO H C   1 
ATOM   6472 O O   . PRO D 4 153 ? 13.894  5.896   -19.167 1.00 88.24  ? 153 PRO H O   1 
ATOM   6473 C CB  . PRO D 4 153 ? 12.808  7.653   -16.380 1.00 93.29  ? 153 PRO H CB  1 
ATOM   6474 C CG  . PRO D 4 153 ? 12.385  6.269   -15.976 1.00 92.60  ? 153 PRO H CG  1 
ATOM   6475 C CD  . PRO D 4 153 ? 11.365  5.816   -17.022 1.00 91.18  ? 153 PRO H CD  1 
ATOM   6476 N N   . GLU D 4 154 ? 15.181  7.244   -17.911 1.00 81.13  ? 154 GLU H N   1 
ATOM   6477 C CA  . GLU D 4 154 ? 16.382  6.457   -18.128 1.00 82.27  ? 154 GLU H CA  1 
ATOM   6478 C C   . GLU D 4 154 ? 16.431  5.394   -17.042 1.00 89.38  ? 154 GLU H C   1 
ATOM   6479 O O   . GLU D 4 154 ? 15.734  5.505   -16.036 1.00 101.35 ? 154 GLU H O   1 
ATOM   6480 C CB  . GLU D 4 154 ? 17.631  7.342   -18.114 1.00 82.07  ? 154 GLU H CB  1 
ATOM   6481 C CG  . GLU D 4 154 ? 17.993  7.893   -19.488 1.00 82.84  ? 154 GLU H CG  1 
ATOM   6482 C CD  . GLU D 4 154 ? 19.465  8.236   -19.619 1.00 79.54  ? 154 GLU H CD  1 
ATOM   6483 O OE1 . GLU D 4 154 ? 20.171  7.554   -20.400 1.00 72.55  ? 154 GLU H OE1 1 
ATOM   6484 O OE2 . GLU D 4 154 ? 19.917  9.185   -18.940 1.00 71.21  ? 154 GLU H OE2 1 
ATOM   6485 N N   . PRO D 4 155 ? 17.252  4.357   -17.237 1.00 85.15  ? 155 PRO H N   1 
ATOM   6486 C CA  . PRO D 4 155 ? 18.166  4.234   -18.368 1.00 85.27  ? 155 PRO H CA  1 
ATOM   6487 C C   . PRO D 4 155 ? 17.553  3.483   -19.541 1.00 83.40  ? 155 PRO H C   1 
ATOM   6488 O O   . PRO D 4 155 ? 16.360  3.183   -19.564 1.00 77.67  ? 155 PRO H O   1 
ATOM   6489 C CB  . PRO D 4 155 ? 19.317  3.394   -17.790 1.00 86.37  ? 155 PRO H CB  1 
ATOM   6490 C CG  . PRO D 4 155 ? 18.934  3.087   -16.355 1.00 95.81  ? 155 PRO H CG  1 
ATOM   6491 C CD  . PRO D 4 155 ? 17.464  3.273   -16.274 1.00 92.85  ? 155 PRO H CD  1 
ATOM   6492 N N   . VAL D 4 156 ? 18.396  3.196   -20.523 1.00 80.80  ? 156 VAL H N   1 
ATOM   6493 C CA  . VAL D 4 156 ? 18.050  2.286   -21.595 1.00 78.11  ? 156 VAL H CA  1 
ATOM   6494 C C   . VAL D 4 156 ? 19.347  1.634   -22.050 1.00 77.24  ? 156 VAL H C   1 
ATOM   6495 O O   . VAL D 4 156 ? 20.414  2.248   -21.976 1.00 72.93  ? 156 VAL H O   1 
ATOM   6496 C CB  . VAL D 4 156 ? 17.359  3.011   -22.764 1.00 84.93  ? 156 VAL H CB  1 
ATOM   6497 C CG1 . VAL D 4 156 ? 18.381  3.713   -23.636 1.00 88.13  ? 156 VAL H CG1 1 
ATOM   6498 C CG2 . VAL D 4 156 ? 16.548  2.031   -23.589 1.00 91.14  ? 156 VAL H CG2 1 
ATOM   6499 N N   . THR D 4 157 ? 19.259  0.385   -22.494 1.00 79.29  ? 157 THR H N   1 
ATOM   6500 C CA  . THR D 4 157 ? 20.440  -0.362  -22.901 1.00 80.35  ? 157 THR H CA  1 
ATOM   6501 C C   . THR D 4 157 ? 20.452  -0.513  -24.412 1.00 76.57  ? 157 THR H C   1 
ATOM   6502 O O   . THR D 4 157 ? 19.400  -0.620  -25.029 1.00 88.51  ? 157 THR H O   1 
ATOM   6503 C CB  . THR D 4 157 ? 20.457  -1.761  -22.270 1.00 88.23  ? 157 THR H CB  1 
ATOM   6504 O OG1 . THR D 4 157 ? 19.710  -1.748  -21.049 1.00 90.42  ? 157 THR H OG1 1 
ATOM   6505 C CG2 . THR D 4 157 ? 21.885  -2.203  -21.993 1.00 93.37  ? 157 THR H CG2 1 
ATOM   6506 N N   . VAL D 4 158 ? 21.640  -0.527  -25.007 1.00 75.12  ? 158 VAL H N   1 
ATOM   6507 C CA  . VAL D 4 158 ? 21.765  -0.671  -26.460 1.00 79.68  ? 158 VAL H CA  1 
ATOM   6508 C C   . VAL D 4 158 ? 22.993  -1.469  -26.893 1.00 82.47  ? 158 VAL H C   1 
ATOM   6509 O O   . VAL D 4 158 ? 24.134  -1.060  -26.657 1.00 78.71  ? 158 VAL H O   1 
ATOM   6510 C CB  . VAL D 4 158 ? 21.790  0.695   -27.171 1.00 70.48  ? 158 VAL H CB  1 
ATOM   6511 C CG1 . VAL D 4 158 ? 22.376  0.556   -28.557 1.00 71.30  ? 158 VAL H CG1 1 
ATOM   6512 C CG2 . VAL D 4 158 ? 20.397  1.281   -27.238 1.00 72.62  ? 158 VAL H CG2 1 
ATOM   6513 N N   . SER D 4 159 ? 22.748  -2.607  -27.537 1.00 83.05  ? 159 SER H N   1 
ATOM   6514 C CA  . SER D 4 159 ? 23.821  -3.425  -28.093 1.00 84.65  ? 159 SER H CA  1 
ATOM   6515 C C   . SER D 4 159 ? 23.592  -3.682  -29.577 1.00 85.23  ? 159 SER H C   1 
ATOM   6516 O O   . SER D 4 159 ? 22.565  -3.300  -30.135 1.00 84.07  ? 159 SER H O   1 
ATOM   6517 C CB  . SER D 4 159 ? 23.931  -4.757  -27.348 1.00 88.45  ? 159 SER H CB  1 
ATOM   6518 O OG  . SER D 4 159 ? 22.773  -5.550  -27.543 1.00 92.78  ? 159 SER H OG  1 
ATOM   6519 N N   . TRP D 4 160 ? 24.556  -4.338  -30.210 1.00 85.82  ? 160 TRP H N   1 
ATOM   6520 C CA  . TRP D 4 160 ? 24.449  -4.645  -31.625 1.00 92.00  ? 160 TRP H CA  1 
ATOM   6521 C C   . TRP D 4 160 ? 24.645  -6.129  -31.891 1.00 102.29 ? 160 TRP H C   1 
ATOM   6522 O O   . TRP D 4 160 ? 25.522  -6.762  -31.303 1.00 106.79 ? 160 TRP H O   1 
ATOM   6523 C CB  . TRP D 4 160 ? 25.458  -3.823  -32.421 1.00 97.46  ? 160 TRP H CB  1 
ATOM   6524 C CG  . TRP D 4 160 ? 25.114  -2.368  -32.466 1.00 99.51  ? 160 TRP H CG  1 
ATOM   6525 C CD1 . TRP D 4 160 ? 25.424  -1.421  -31.534 1.00 99.52  ? 160 TRP H CD1 1 
ATOM   6526 C CD2 . TRP D 4 160 ? 24.383  -1.693  -33.494 1.00 98.21  ? 160 TRP H CD2 1 
ATOM   6527 N NE1 . TRP D 4 160 ? 24.936  -0.197  -31.919 1.00 93.03  ? 160 TRP H NE1 1 
ATOM   6528 C CE2 . TRP D 4 160 ? 24.293  -0.337  -33.119 1.00 93.43  ? 160 TRP H CE2 1 
ATOM   6529 C CE3 . TRP D 4 160 ? 23.798  -2.103  -34.695 1.00 101.33 ? 160 TRP H CE3 1 
ATOM   6530 C CZ2 . TRP D 4 160 ? 23.641  0.609   -33.903 1.00 94.08  ? 160 TRP H CZ2 1 
ATOM   6531 C CZ3 . TRP D 4 160 ? 23.152  -1.160  -35.472 1.00 102.43 ? 160 TRP H CZ3 1 
ATOM   6532 C CH2 . TRP D 4 160 ? 23.079  0.179   -35.075 1.00 98.10  ? 160 TRP H CH2 1 
ATOM   6533 N N   . ASN D 4 161 ? 23.821  -6.672  -32.783 1.00 105.69 ? 161 ASN H N   1 
ATOM   6534 C CA  . ASN D 4 161 ? 23.854  -8.091  -33.116 1.00 105.13 ? 161 ASN H CA  1 
ATOM   6535 C C   . ASN D 4 161 ? 23.847  -8.976  -31.872 1.00 107.47 ? 161 ASN H C   1 
ATOM   6536 O O   . ASN D 4 161 ? 24.694  -9.854  -31.717 1.00 106.19 ? 161 ASN H O   1 
ATOM   6537 C CB  . ASN D 4 161 ? 25.051  -8.407  -34.014 1.00 108.99 ? 161 ASN H CB  1 
ATOM   6538 C CG  . ASN D 4 161 ? 24.980  -7.694  -35.355 1.00 118.83 ? 161 ASN H CG  1 
ATOM   6539 O OD1 . ASN D 4 161 ? 25.847  -7.869  -36.213 1.00 128.18 ? 161 ASN H OD1 1 
ATOM   6540 N ND2 . ASN D 4 161 ? 23.943  -6.888  -35.541 1.00 111.24 ? 161 ASN H ND2 1 
ATOM   6541 N N   . SER D 4 162 ? 22.888  -8.725  -30.985 1.00 102.20 ? 162 SER H N   1 
ATOM   6542 C CA  . SER D 4 162 ? 22.718  -9.522  -29.776 1.00 101.02 ? 162 SER H CA  1 
ATOM   6543 C C   . SER D 4 162 ? 23.968  -9.534  -28.908 1.00 103.17 ? 162 SER H C   1 
ATOM   6544 O O   . SER D 4 162 ? 24.136  -10.408 -28.061 1.00 108.72 ? 162 SER H O   1 
ATOM   6545 C CB  . SER D 4 162 ? 22.313  -10.953 -30.129 1.00 117.49 ? 162 SER H CB  1 
ATOM   6546 O OG  . SER D 4 162 ? 21.106  -10.974 -30.870 1.00 128.28 ? 162 SER H OG  1 
ATOM   6547 N N   . GLY D 4 163 ? 24.846  -8.564  -29.126 1.00 104.91 ? 163 GLY H N   1 
ATOM   6548 C CA  . GLY D 4 163 ? 26.055  -8.447  -28.332 1.00 110.37 ? 163 GLY H CA  1 
ATOM   6549 C C   . GLY D 4 163 ? 27.294  -8.937  -29.053 1.00 114.17 ? 163 GLY H C   1 
ATOM   6550 O O   . GLY D 4 163 ? 28.380  -8.994  -28.472 1.00 113.76 ? 163 GLY H O   1 
ATOM   6551 N N   . ALA D 4 164 ? 27.132  -9.294  -30.322 1.00 112.64 ? 164 ALA H N   1 
ATOM   6552 C CA  . ALA D 4 164 ? 28.254  -9.734  -31.135 1.00 116.52 ? 164 ALA H CA  1 
ATOM   6553 C C   . ALA D 4 164 ? 29.166  -8.558  -31.443 1.00 115.05 ? 164 ALA H C   1 
ATOM   6554 O O   . ALA D 4 164 ? 30.389  -8.672  -31.384 1.00 121.68 ? 164 ALA H O   1 
ATOM   6555 C CB  . ALA D 4 164 ? 27.753  -10.360 -32.425 1.00 121.07 ? 164 ALA H CB  1 
ATOM   6556 N N   . LEU D 4 165 ? 28.553  -7.422  -31.757 1.00 104.64 ? 165 LEU H N   1 
ATOM   6557 C CA  . LEU D 4 165 ? 29.285  -6.242  -32.196 1.00 98.15  ? 165 LEU H CA  1 
ATOM   6558 C C   . LEU D 4 165 ? 29.445  -5.210  -31.079 1.00 104.34 ? 165 LEU H C   1 
ATOM   6559 O O   . LEU D 4 165 ? 28.457  -4.704  -30.535 1.00 96.21  ? 165 LEU H O   1 
ATOM   6560 C CB  . LEU D 4 165 ? 28.582  -5.615  -33.400 1.00 90.02  ? 165 LEU H CB  1 
ATOM   6561 C CG  . LEU D 4 165 ? 29.229  -4.361  -33.982 1.00 91.21  ? 165 LEU H CG  1 
ATOM   6562 C CD1 . LEU D 4 165 ? 30.687  -4.619  -34.325 1.00 95.55  ? 165 LEU H CD1 1 
ATOM   6563 C CD2 . LEU D 4 165 ? 28.461  -3.878  -35.199 1.00 88.45  ? 165 LEU H CD2 1 
ATOM   6564 N N   . THR D 4 166 ? 30.699  -4.908  -30.746 1.00 111.67 ? 166 THR H N   1 
ATOM   6565 C CA  . THR D 4 166 ? 31.029  -3.968  -29.677 1.00 104.81 ? 166 THR H CA  1 
ATOM   6566 C C   . THR D 4 166 ? 32.115  -2.993  -30.119 1.00 107.94 ? 166 THR H C   1 
ATOM   6567 O O   . THR D 4 166 ? 31.918  -1.782  -30.100 1.00 106.68 ? 166 THR H O   1 
ATOM   6568 C CB  . THR D 4 166 ? 31.523  -4.699  -28.414 1.00 100.09 ? 166 THR H CB  1 
ATOM   6569 O OG1 . THR D 4 166 ? 32.648  -5.527  -28.741 1.00 99.79  ? 166 THR H OG1 1 
ATOM   6570 C CG2 . THR D 4 166 ? 30.419  -5.563  -27.825 1.00 98.84  ? 166 THR H CG2 1 
ATOM   6571 N N   . SER D 4 167 ? 33.262  -3.533  -30.517 1.00 114.85 ? 167 SER H N   1 
ATOM   6572 C CA  . SER D 4 167 ? 34.390  -2.728  -30.979 1.00 110.72 ? 167 SER H CA  1 
ATOM   6573 C C   . SER D 4 167 ? 33.993  -1.734  -32.069 1.00 96.37  ? 167 SER H C   1 
ATOM   6574 O O   . SER D 4 167 ? 33.911  -2.093  -33.243 1.00 91.34  ? 167 SER H O   1 
ATOM   6575 C CB  . SER D 4 167 ? 35.508  -3.642  -31.485 1.00 114.90 ? 167 SER H CB  1 
ATOM   6576 O OG  . SER D 4 167 ? 34.976  -4.708  -32.254 1.00 117.60 ? 167 SER H OG  1 
ATOM   6577 N N   . GLY D 4 168 ? 33.749  -0.488  -31.671 1.00 84.64  ? 168 GLY H N   1 
ATOM   6578 C CA  . GLY D 4 168 ? 33.381  0.565   -32.601 1.00 85.61  ? 168 GLY H CA  1 
ATOM   6579 C C   . GLY D 4 168 ? 32.069  1.246   -32.253 1.00 85.94  ? 168 GLY H C   1 
ATOM   6580 O O   . GLY D 4 168 ? 31.732  2.284   -32.825 1.00 85.20  ? 168 GLY H O   1 
ATOM   6581 N N   . VAL D 4 169 ? 31.329  0.653   -31.321 1.00 78.09  ? 169 VAL H N   1 
ATOM   6582 C CA  . VAL D 4 169 ? 30.059  1.208   -30.873 1.00 78.35  ? 169 VAL H CA  1 
ATOM   6583 C C   . VAL D 4 169 ? 30.259  2.461   -30.043 1.00 79.16  ? 169 VAL H C   1 
ATOM   6584 O O   . VAL D 4 169 ? 31.151  2.532   -29.199 1.00 77.47  ? 169 VAL H O   1 
ATOM   6585 C CB  . VAL D 4 169 ? 29.248  0.193   -30.036 1.00 84.79  ? 169 VAL H CB  1 
ATOM   6586 C CG1 . VAL D 4 169 ? 28.004  0.851   -29.440 1.00 53.70  ? 169 VAL H CG1 1 
ATOM   6587 C CG2 . VAL D 4 169 ? 28.881  -1.018  -30.885 1.00 91.80  ? 169 VAL H CG2 1 
ATOM   6588 N N   . HIS D 4 170 ? 29.423  3.456   -30.306 1.00 81.44  ? 170 HIS H N   1 
ATOM   6589 C CA  . HIS D 4 170 ? 29.410  4.695   -29.546 1.00 76.43  ? 170 HIS H CA  1 
ATOM   6590 C C   . HIS D 4 170 ? 27.964  4.996   -29.211 1.00 76.08  ? 170 HIS H C   1 
ATOM   6591 O O   . HIS D 4 170 ? 27.242  5.582   -30.014 1.00 79.62  ? 170 HIS H O   1 
ATOM   6592 C CB  . HIS D 4 170 ? 29.999  5.835   -30.376 1.00 75.93  ? 170 HIS H CB  1 
ATOM   6593 C CG  . HIS D 4 170 ? 31.492  5.918   -30.324 1.00 78.83  ? 170 HIS H CG  1 
ATOM   6594 N ND1 . HIS D 4 170 ? 32.302  4.803   -30.333 1.00 93.79  ? 170 HIS H ND1 1 
ATOM   6595 C CD2 . HIS D 4 170 ? 32.322  6.985   -30.287 1.00 77.01  ? 170 HIS H CD2 1 
ATOM   6596 C CE1 . HIS D 4 170 ? 33.568  5.180   -30.287 1.00 96.03  ? 170 HIS H CE1 1 
ATOM   6597 N NE2 . HIS D 4 170 ? 33.607  6.500   -30.259 1.00 87.79  ? 170 HIS H NE2 1 
ATOM   6598 N N   . THR D 4 171 ? 27.534  4.570   -28.033 1.00 74.85  ? 171 THR H N   1 
ATOM   6599 C CA  . THR D 4 171 ? 26.200  4.895   -27.558 1.00 66.84  ? 171 THR H CA  1 
ATOM   6600 C C   . THR D 4 171 ? 26.275  6.188   -26.772 1.00 67.69  ? 171 THR H C   1 
ATOM   6601 O O   . THR D 4 171 ? 26.813  6.213   -25.673 1.00 82.51  ? 171 THR H O   1 
ATOM   6602 C CB  . THR D 4 171 ? 25.664  3.809   -26.638 1.00 61.46  ? 171 THR H CB  1 
ATOM   6603 O OG1 . THR D 4 171 ? 25.643  2.565   -27.343 1.00 72.71  ? 171 THR H OG1 1 
ATOM   6604 C CG2 . THR D 4 171 ? 24.264  4.159   -26.187 1.00 53.78  ? 171 THR H CG2 1 
ATOM   6605 N N   . PHE D 4 172 ? 25.751  7.269   -27.327 1.00 64.08  ? 172 PHE H N   1 
ATOM   6606 C CA  . PHE D 4 172 ? 25.883  8.563   -26.670 1.00 65.45  ? 172 PHE H CA  1 
ATOM   6607 C C   . PHE D 4 172 ? 25.058  8.659   -25.387 1.00 64.80  ? 172 PHE H C   1 
ATOM   6608 O O   . PHE D 4 172 ? 24.070  7.944   -25.225 1.00 67.00  ? 172 PHE H O   1 
ATOM   6609 C CB  . PHE D 4 172 ? 25.535  9.695   -27.636 1.00 56.93  ? 172 PHE H CB  1 
ATOM   6610 C CG  . PHE D 4 172 ? 26.538  9.860   -28.725 1.00 60.16  ? 172 PHE H CG  1 
ATOM   6611 C CD1 . PHE D 4 172 ? 26.345  9.262   -29.961 1.00 70.37  ? 172 PHE H CD1 1 
ATOM   6612 C CD2 . PHE D 4 172 ? 27.698  10.572  -28.504 1.00 60.79  ? 172 PHE H CD2 1 
ATOM   6613 C CE1 . PHE D 4 172 ? 27.286  9.393   -30.972 1.00 67.42  ? 172 PHE H CE1 1 
ATOM   6614 C CE2 . PHE D 4 172 ? 28.637  10.706  -29.499 1.00 68.58  ? 172 PHE H CE2 1 
ATOM   6615 C CZ  . PHE D 4 172 ? 28.434  10.115  -30.740 1.00 67.99  ? 172 PHE H CZ  1 
ATOM   6616 N N   . PRO D 4 173 ? 25.487  9.523   -24.453 1.00 58.89  ? 173 PRO H N   1 
ATOM   6617 C CA  . PRO D 4 173 ? 24.687  9.881   -23.280 1.00 54.54  ? 173 PRO H CA  1 
ATOM   6618 C C   . PRO D 4 173 ? 23.359  10.441  -23.734 1.00 60.64  ? 173 PRO H C   1 
ATOM   6619 O O   . PRO D 4 173 ? 23.335  11.213  -24.689 1.00 73.71  ? 173 PRO H O   1 
ATOM   6620 C CB  . PRO D 4 173 ? 25.508  10.991  -22.641 1.00 46.63  ? 173 PRO H CB  1 
ATOM   6621 C CG  . PRO D 4 173 ? 26.901  10.653  -22.999 1.00 57.77  ? 173 PRO H CG  1 
ATOM   6622 C CD  . PRO D 4 173 ? 26.841  10.094  -24.386 1.00 59.38  ? 173 PRO H CD  1 
ATOM   6623 N N   . ALA D 4 174 ? 22.271  10.050  -23.084 1.00 64.97  ? 174 ALA H N   1 
ATOM   6624 C CA  . ALA D 4 174 ? 20.956  10.516  -23.498 1.00 68.86  ? 174 ALA H CA  1 
ATOM   6625 C C   . ALA D 4 174 ? 20.879  12.022  -23.337 1.00 70.45  ? 174 ALA H C   1 
ATOM   6626 O O   . ALA D 4 174 ? 21.737  12.627  -22.695 1.00 66.17  ? 174 ALA H O   1 
ATOM   6627 C CB  . ALA D 4 174 ? 19.867  9.842   -22.689 1.00 66.91  ? 174 ALA H CB  1 
ATOM   6628 N N   . VAL D 4 175 ? 19.852  12.625  -23.926 1.00 73.48  ? 175 VAL H N   1 
ATOM   6629 C CA  . VAL D 4 175 ? 19.661  14.066  -23.844 1.00 74.43  ? 175 VAL H CA  1 
ATOM   6630 C C   . VAL D 4 175 ? 18.217  14.390  -23.472 1.00 77.49  ? 175 VAL H C   1 
ATOM   6631 O O   . VAL D 4 175 ? 17.278  13.909  -24.111 1.00 81.41  ? 175 VAL H O   1 
ATOM   6632 C CB  . VAL D 4 175 ? 20.024  14.759  -25.175 1.00 76.56  ? 175 VAL H CB  1 
ATOM   6633 C CG1 . VAL D 4 175 ? 20.005  16.263  -25.008 1.00 83.68  ? 175 VAL H CG1 1 
ATOM   6634 C CG2 . VAL D 4 175 ? 21.391  14.300  -25.658 1.00 79.10  ? 175 VAL H CG2 1 
ATOM   6635 N N   . LEU D 4 176 ? 18.040  15.202  -22.435 1.00 76.67  ? 176 LEU H N   1 
ATOM   6636 C CA  . LEU D 4 176 ? 16.704  15.596  -22.015 1.00 77.27  ? 176 LEU H CA  1 
ATOM   6637 C C   . LEU D 4 176 ? 16.093  16.613  -22.974 1.00 79.44  ? 176 LEU H C   1 
ATOM   6638 O O   . LEU D 4 176 ? 16.452  17.790  -22.946 1.00 81.93  ? 176 LEU H O   1 
ATOM   6639 C CB  . LEU D 4 176 ? 16.737  16.167  -20.601 1.00 72.98  ? 176 LEU H CB  1 
ATOM   6640 C CG  . LEU D 4 176 ? 15.356  16.439  -20.001 1.00 71.66  ? 176 LEU H CG  1 
ATOM   6641 C CD1 . LEU D 4 176 ? 14.339  15.415  -20.492 1.00 63.82  ? 176 LEU H CD1 1 
ATOM   6642 C CD2 . LEU D 4 176 ? 15.418  16.460  -18.483 1.00 65.36  ? 176 LEU H CD2 1 
ATOM   6643 N N   . GLN D 4 177 ? 15.174  16.152  -23.821 1.00 67.47  ? 177 GLN H N   1 
ATOM   6644 C CA  . GLN D 4 177 ? 14.495  17.029  -24.770 1.00 63.30  ? 177 GLN H CA  1 
ATOM   6645 C C   . GLN D 4 177 ? 13.571  18.000  -24.049 1.00 77.07  ? 177 GLN H C   1 
ATOM   6646 O O   . GLN D 4 177 ? 13.181  17.763  -22.905 1.00 88.43  ? 177 GLN H O   1 
ATOM   6647 C CB  . GLN D 4 177 ? 13.689  16.207  -25.767 1.00 52.99  ? 177 GLN H CB  1 
ATOM   6648 C CG  . GLN D 4 177 ? 14.520  15.243  -26.577 1.00 58.10  ? 177 GLN H CG  1 
ATOM   6649 C CD  . GLN D 4 177 ? 13.674  14.359  -27.467 1.00 71.33  ? 177 GLN H CD  1 
ATOM   6650 O OE1 . GLN D 4 177 ? 14.184  13.708  -28.379 1.00 82.76  ? 177 GLN H OE1 1 
ATOM   6651 N NE2 . GLN D 4 177 ? 12.372  14.334  -27.211 1.00 77.80  ? 177 GLN H NE2 1 
ATOM   6652 N N   . SER D 4 178 ? 13.215  19.093  -24.714 1.00 76.43  ? 178 SER H N   1 
ATOM   6653 C CA  . SER D 4 178 ? 12.375  20.104  -24.083 1.00 82.94  ? 178 SER H CA  1 
ATOM   6654 C C   . SER D 4 178 ? 10.967  19.568  -23.824 1.00 85.40  ? 178 SER H C   1 
ATOM   6655 O O   . SER D 4 178 ? 10.206  20.137  -23.038 1.00 89.01  ? 178 SER H O   1 
ATOM   6656 C CB  . SER D 4 178 ? 12.324  21.385  -24.926 1.00 83.10  ? 178 SER H CB  1 
ATOM   6657 O OG  . SER D 4 178 ? 11.256  21.364  -25.854 1.00 83.67  ? 178 SER H OG  1 
ATOM   6658 N N   . SER D 4 179 ? 10.631  18.464  -24.483 1.00 73.80  ? 179 SER H N   1 
ATOM   6659 C CA  . SER D 4 179 ? 9.331   17.838  -24.311 1.00 75.99  ? 179 SER H CA  1 
ATOM   6660 C C   . SER D 4 179 ? 9.268   17.087  -22.988 1.00 91.18  ? 179 SER H C   1 
ATOM   6661 O O   . SER D 4 179 ? 8.226   16.545  -22.616 1.00 104.20 ? 179 SER H O   1 
ATOM   6662 C CB  . SER D 4 179 ? 9.067   16.868  -25.457 1.00 77.27  ? 179 SER H CB  1 
ATOM   6663 O OG  . SER D 4 179 ? 10.034  15.833  -25.469 1.00 74.91  ? 179 SER H OG  1 
ATOM   6664 N N   . GLY D 4 180 ? 10.392  17.049  -22.281 1.00 80.80  ? 180 GLY H N   1 
ATOM   6665 C CA  . GLY D 4 180 ? 10.471  16.330  -21.026 1.00 75.77  ? 180 GLY H CA  1 
ATOM   6666 C C   . GLY D 4 180 ? 10.867  14.881  -21.210 1.00 82.30  ? 180 GLY H C   1 
ATOM   6667 O O   . GLY D 4 180 ? 11.070  14.162  -20.234 1.00 84.03  ? 180 GLY H O   1 
ATOM   6668 N N   . LEU D 4 181 ? 10.977  14.451  -22.465 1.00 88.27  ? 181 LEU H N   1 
ATOM   6669 C CA  . LEU D 4 181 ? 11.362  13.074  -22.787 1.00 83.83  ? 181 LEU H CA  1 
ATOM   6670 C C   . LEU D 4 181 ? 12.837  12.965  -23.178 1.00 71.81  ? 181 LEU H C   1 
ATOM   6671 O O   . LEU D 4 181 ? 13.442  13.922  -23.661 1.00 63.49  ? 181 LEU H O   1 
ATOM   6672 C CB  . LEU D 4 181 ? 10.489  12.506  -23.913 1.00 86.02  ? 181 LEU H CB  1 
ATOM   6673 C CG  . LEU D 4 181 ? 8.986   12.349  -23.668 1.00 80.61  ? 181 LEU H CG  1 
ATOM   6674 C CD1 . LEU D 4 181 ? 8.339   11.648  -24.849 1.00 66.68  ? 181 LEU H CD1 1 
ATOM   6675 C CD2 . LEU D 4 181 ? 8.727   11.577  -22.385 1.00 85.28  ? 181 LEU H CD2 1 
ATOM   6676 N N   . TYR D 4 182 ? 13.411  11.787  -22.966 1.00 64.31  ? 182 TYR H N   1 
ATOM   6677 C CA  . TYR D 4 182 ? 14.818  11.563  -23.277 1.00 71.06  ? 182 TYR H CA  1 
ATOM   6678 C C   . TYR D 4 182 ? 15.012  11.054  -24.705 1.00 73.16  ? 182 TYR H C   1 
ATOM   6679 O O   . TYR D 4 182 ? 14.064  10.631  -25.362 1.00 82.63  ? 182 TYR H O   1 
ATOM   6680 C CB  . TYR D 4 182 ? 15.441  10.566  -22.298 1.00 75.82  ? 182 TYR H CB  1 
ATOM   6681 C CG  . TYR D 4 182 ? 15.568  11.042  -20.865 1.00 75.45  ? 182 TYR H CG  1 
ATOM   6682 C CD1 . TYR D 4 182 ? 14.548  10.828  -19.949 1.00 73.34  ? 182 TYR H CD1 1 
ATOM   6683 C CD2 . TYR D 4 182 ? 16.720  11.672  -20.422 1.00 80.11  ? 182 TYR H CD2 1 
ATOM   6684 C CE1 . TYR D 4 182 ? 14.664  11.246  -18.642 1.00 85.27  ? 182 TYR H CE1 1 
ATOM   6685 C CE2 . TYR D 4 182 ? 16.844  12.091  -19.115 1.00 85.17  ? 182 TYR H CE2 1 
ATOM   6686 C CZ  . TYR D 4 182 ? 15.815  11.877  -18.227 1.00 90.84  ? 182 TYR H CZ  1 
ATOM   6687 O OH  . TYR D 4 182 ? 15.929  12.293  -16.918 1.00 95.97  ? 182 TYR H OH  1 
ATOM   6688 N N   . SER D 4 183 ? 16.254  11.091  -25.168 1.00 62.21  ? 183 SER H N   1 
ATOM   6689 C CA  . SER D 4 183 ? 16.601  10.621  -26.498 1.00 59.35  ? 183 SER H CA  1 
ATOM   6690 C C   . SER D 4 183 ? 18.112  10.467  -26.611 1.00 71.05  ? 183 SER H C   1 
ATOM   6691 O O   . SER D 4 183 ? 18.861  11.333  -26.169 1.00 72.26  ? 183 SER H O   1 
ATOM   6692 C CB  . SER D 4 183 ? 16.087  11.601  -27.552 1.00 58.50  ? 183 SER H CB  1 
ATOM   6693 O OG  . SER D 4 183 ? 16.695  11.382  -28.815 1.00 57.80  ? 183 SER H OG  1 
ATOM   6694 N N   . LEU D 4 184 ? 18.559  9.355   -27.183 1.00 72.89  ? 184 LEU H N   1 
ATOM   6695 C CA  . LEU D 4 184 ? 19.980  9.157   -27.429 1.00 72.45  ? 184 LEU H CA  1 
ATOM   6696 C C   . LEU D 4 184 ? 20.196  8.618   -28.829 1.00 80.75  ? 184 LEU H C   1 
ATOM   6697 O O   . LEU D 4 184 ? 19.247  8.406   -29.577 1.00 80.49  ? 184 LEU H O   1 
ATOM   6698 C CB  . LEU D 4 184 ? 20.603  8.211   -26.399 1.00 67.29  ? 184 LEU H CB  1 
ATOM   6699 C CG  . LEU D 4 184 ? 20.178  6.737   -26.388 1.00 72.19  ? 184 LEU H CG  1 
ATOM   6700 C CD1 . LEU D 4 184 ? 20.813  5.932   -27.521 1.00 66.84  ? 184 LEU H CD1 1 
ATOM   6701 C CD2 . LEU D 4 184 ? 20.528  6.117   -25.045 1.00 70.70  ? 184 LEU H CD2 1 
ATOM   6702 N N   . SER D 4 185 ? 21.456  8.388   -29.168 1.00 84.88  ? 185 SER H N   1 
ATOM   6703 C CA  . SER D 4 185 ? 21.818  7.869   -30.469 1.00 82.40  ? 185 SER H CA  1 
ATOM   6704 C C   . SER D 4 185 ? 22.971  6.894   -30.278 1.00 78.07  ? 185 SER H C   1 
ATOM   6705 O O   . SER D 4 185 ? 23.920  7.191   -29.560 1.00 75.58  ? 185 SER H O   1 
ATOM   6706 C CB  . SER D 4 185 ? 22.234  9.027   -31.374 1.00 91.14  ? 185 SER H CB  1 
ATOM   6707 O OG  . SER D 4 185 ? 22.845  8.564   -32.564 1.00 95.51  ? 185 SER H OG  1 
ATOM   6708 N N   . SER D 4 186 ? 22.885  5.722   -30.895 1.00 48.06  ? 186 SER H N   1 
ATOM   6709 C CA  . SER D 4 186 ? 23.975  4.756   -30.811 1.00 69.48  ? 186 SER H CA  1 
ATOM   6710 C C   . SER D 4 186 ? 24.470  4.373   -32.197 1.00 64.91  ? 186 SER H C   1 
ATOM   6711 O O   . SER D 4 186 ? 23.704  3.853   -33.005 1.00 64.24  ? 186 SER H O   1 
ATOM   6712 C CB  . SER D 4 186 ? 23.543  3.507   -30.044 1.00 68.92  ? 186 SER H CB  1 
ATOM   6713 O OG  . SER D 4 186 ? 24.641  2.635   -29.825 1.00 65.98  ? 186 SER H OG  1 
ATOM   6714 N N   . VAL D 4 187 ? 25.749  4.631   -32.464 1.00 67.12  ? 187 VAL H N   1 
ATOM   6715 C CA  . VAL D 4 187 ? 26.314  4.426   -33.797 1.00 74.81  ? 187 VAL H CA  1 
ATOM   6716 C C   . VAL D 4 187 ? 27.469  3.428   -33.812 1.00 71.70  ? 187 VAL H C   1 
ATOM   6717 O O   . VAL D 4 187 ? 27.987  3.037   -32.773 1.00 73.98  ? 187 VAL H O   1 
ATOM   6718 C CB  . VAL D 4 187 ? 26.828  5.748   -34.415 1.00 72.12  ? 187 VAL H CB  1 
ATOM   6719 C CG1 . VAL D 4 187 ? 25.767  6.839   -34.326 1.00 58.53  ? 187 VAL H CG1 1 
ATOM   6720 C CG2 . VAL D 4 187 ? 28.122  6.183   -33.751 1.00 63.03  ? 187 VAL H CG2 1 
ATOM   6721 N N   . VAL D 4 188 ? 27.869  3.035   -35.016 1.00 66.75  ? 188 VAL H N   1 
ATOM   6722 C CA  . VAL D 4 188 ? 28.948  2.077   -35.208 1.00 77.15  ? 188 VAL H CA  1 
ATOM   6723 C C   . VAL D 4 188 ? 29.776  2.419   -36.433 1.00 91.10  ? 188 VAL H C   1 
ATOM   6724 O O   . VAL D 4 188 ? 29.250  2.876   -37.443 1.00 101.02 ? 188 VAL H O   1 
ATOM   6725 C CB  . VAL D 4 188 ? 28.402  0.657   -35.387 1.00 74.89  ? 188 VAL H CB  1 
ATOM   6726 C CG1 . VAL D 4 188 ? 28.342  -0.054  -34.053 1.00 78.60  ? 188 VAL H CG1 1 
ATOM   6727 C CG2 . VAL D 4 188 ? 27.031  0.711   -36.025 1.00 71.50  ? 188 VAL H CG2 1 
ATOM   6728 N N   . THR D 4 189 ? 31.080  2.203   -36.344 1.00 92.94  ? 189 THR H N   1 
ATOM   6729 C CA  . THR D 4 189 ? 31.944  2.419   -37.493 1.00 94.83  ? 189 THR H CA  1 
ATOM   6730 C C   . THR D 4 189 ? 32.423  1.093   -38.055 1.00 93.27  ? 189 THR H C   1 
ATOM   6731 O O   . THR D 4 189 ? 33.111  0.335   -37.375 1.00 92.21  ? 189 THR H O   1 
ATOM   6732 C CB  . THR D 4 189 ? 33.138  3.320   -37.152 1.00 99.65  ? 189 THR H CB  1 
ATOM   6733 O OG1 . THR D 4 189 ? 33.307  3.370   -35.730 1.00 108.14 ? 189 THR H OG1 1 
ATOM   6734 C CG2 . THR D 4 189 ? 32.885  4.726   -37.658 1.00 93.69  ? 189 THR H CG2 1 
ATOM   6735 N N   . VAL D 4 190 ? 32.038  0.827   -39.301 1.00 97.42  ? 190 VAL H N   1 
ATOM   6736 C CA  . VAL D 4 190 ? 32.384  -0.411  -39.990 1.00 98.85  ? 190 VAL H CA  1 
ATOM   6737 C C   . VAL D 4 190 ? 33.055  -0.120  -41.324 1.00 108.31 ? 190 VAL H C   1 
ATOM   6738 O O   . VAL D 4 190 ? 33.045  1.017   -41.790 1.00 109.96 ? 190 VAL H O   1 
ATOM   6739 C CB  . VAL D 4 190 ? 31.130  -1.271  -40.255 1.00 89.85  ? 190 VAL H CB  1 
ATOM   6740 C CG1 . VAL D 4 190 ? 30.617  -1.878  -38.955 1.00 85.64  ? 190 VAL H CG1 1 
ATOM   6741 C CG2 . VAL D 4 190 ? 30.050  -0.445  -40.949 1.00 74.99  ? 190 VAL H CG2 1 
ATOM   6742 N N   . PRO D 4 191 ? 33.657  -1.149  -41.941 1.00 119.23 ? 191 PRO H N   1 
ATOM   6743 C CA  . PRO D 4 191 ? 34.192  -0.997  -43.298 1.00 126.31 ? 191 PRO H CA  1 
ATOM   6744 C C   . PRO D 4 191 ? 33.061  -1.032  -44.320 1.00 125.22 ? 191 PRO H C   1 
ATOM   6745 O O   . PRO D 4 191 ? 32.127  -1.818  -44.168 1.00 126.43 ? 191 PRO H O   1 
ATOM   6746 C CB  . PRO D 4 191 ? 35.090  -2.229  -43.466 1.00 127.96 ? 191 PRO H CB  1 
ATOM   6747 C CG  . PRO D 4 191 ? 35.251  -2.808  -42.082 1.00 122.65 ? 191 PRO H CG  1 
ATOM   6748 C CD  . PRO D 4 191 ? 33.996  -2.460  -41.366 1.00 118.15 ? 191 PRO H CD  1 
ATOM   6749 N N   . SER D 4 192 ? 33.145  -0.197  -45.350 1.00 123.77 ? 192 SER H N   1 
ATOM   6750 C CA  . SER D 4 192 ? 32.078  -0.107  -46.342 1.00 120.91 ? 192 SER H CA  1 
ATOM   6751 C C   . SER D 4 192 ? 31.799  -1.447  -47.022 1.00 131.47 ? 192 SER H C   1 
ATOM   6752 O O   . SER D 4 192 ? 30.808  -1.592  -47.733 1.00 142.62 ? 192 SER H O   1 
ATOM   6753 C CB  . SER D 4 192 ? 32.420  0.945   -47.402 1.00 114.11 ? 192 SER H CB  1 
ATOM   6754 O OG  . SER D 4 192 ? 32.404  2.256   -46.861 1.00 106.15 ? 192 SER H OG  1 
ATOM   6755 N N   . SER D 4 193 ? 32.668  -2.427  -46.792 1.00 131.78 ? 193 SER H N   1 
ATOM   6756 C CA  . SER D 4 193 ? 32.613  -3.695  -47.519 1.00 133.59 ? 193 SER H CA  1 
ATOM   6757 C C   . SER D 4 193 ? 31.753  -4.762  -46.846 1.00 126.68 ? 193 SER H C   1 
ATOM   6758 O O   . SER D 4 193 ? 31.638  -5.880  -47.352 1.00 119.50 ? 193 SER H O   1 
ATOM   6759 C CB  . SER D 4 193 ? 34.027  -4.240  -47.732 1.00 141.18 ? 193 SER H CB  1 
ATOM   6760 O OG  . SER D 4 193 ? 34.841  -3.300  -48.409 1.00 143.56 ? 193 SER H OG  1 
ATOM   6761 N N   . SER D 4 194 ? 31.154  -4.421  -45.709 1.00 126.51 ? 194 SER H N   1 
ATOM   6762 C CA  . SER D 4 194 ? 30.344  -5.382  -44.962 1.00 129.58 ? 194 SER H CA  1 
ATOM   6763 C C   . SER D 4 194 ? 28.848  -5.107  -45.094 1.00 119.35 ? 194 SER H C   1 
ATOM   6764 O O   . SER D 4 194 ? 28.018  -5.878  -44.608 1.00 115.02 ? 194 SER H O   1 
ATOM   6765 C CB  . SER D 4 194 ? 30.759  -5.416  -43.488 1.00 133.86 ? 194 SER H CB  1 
ATOM   6766 O OG  . SER D 4 194 ? 30.857  -4.109  -42.951 1.00 135.69 ? 194 SER H OG  1 
ATOM   6767 N N   . LEU D 4 195 ? 28.514  -4.006  -45.757 1.00 113.97 ? 195 LEU H N   1 
ATOM   6768 C CA  . LEU D 4 195 ? 27.126  -3.664  -46.037 1.00 120.92 ? 195 LEU H CA  1 
ATOM   6769 C C   . LEU D 4 195 ? 26.542  -4.602  -47.098 1.00 144.13 ? 195 LEU H C   1 
ATOM   6770 O O   . LEU D 4 195 ? 26.951  -4.579  -48.261 1.00 142.93 ? 195 LEU H O   1 
ATOM   6771 C CB  . LEU D 4 195 ? 27.026  -2.207  -46.492 1.00 111.04 ? 195 LEU H CB  1 
ATOM   6772 C CG  . LEU D 4 195 ? 27.700  -1.186  -45.571 1.00 96.06  ? 195 LEU H CG  1 
ATOM   6773 C CD1 . LEU D 4 195 ? 27.763  0.198   -46.208 1.00 82.70  ? 195 LEU H CD1 1 
ATOM   6774 C CD2 . LEU D 4 195 ? 26.987  -1.134  -44.229 1.00 91.51  ? 195 LEU H CD2 1 
ATOM   6775 N N   . GLY D 4 196 ? 25.588  -5.432  -46.688 1.00 155.88 ? 196 GLY H N   1 
ATOM   6776 C CA  . GLY D 4 196 ? 24.985  -6.407  -47.580 1.00 158.31 ? 196 GLY H CA  1 
ATOM   6777 C C   . GLY D 4 196 ? 25.338  -7.834  -47.201 1.00 162.23 ? 196 GLY H C   1 
ATOM   6778 O O   . GLY D 4 196 ? 24.535  -8.750  -47.377 1.00 164.29 ? 196 GLY H O   1 
ATOM   6779 N N   . THR D 4 197 ? 26.543  -8.020  -46.672 1.00 165.86 ? 197 THR H N   1 
ATOM   6780 C CA  . THR D 4 197 ? 27.018  -9.344  -46.283 1.00 170.88 ? 197 THR H CA  1 
ATOM   6781 C C   . THR D 4 197 ? 26.501  -9.774  -44.899 1.00 173.94 ? 197 THR H C   1 
ATOM   6782 O O   . THR D 4 197 ? 25.596  -10.607 -44.808 1.00 174.89 ? 197 THR H O   1 
ATOM   6783 C CB  . THR D 4 197 ? 28.559  -9.432  -46.347 1.00 167.13 ? 197 THR H CB  1 
ATOM   6784 O OG1 . THR D 4 197 ? 29.136  -8.520  -45.406 1.00 169.56 ? 197 THR H OG1 1 
ATOM   6785 C CG2 . THR D 4 197 ? 29.049  -9.073  -47.739 1.00 160.21 ? 197 THR H CG2 1 
ATOM   6786 N N   . GLN D 4 198 ? 27.069  -9.214  -43.832 1.00 172.61 ? 198 GLN H N   1 
ATOM   6787 C CA  . GLN D 4 198 ? 26.593  -9.498  -42.475 1.00 170.93 ? 198 GLN H CA  1 
ATOM   6788 C C   . GLN D 4 198 ? 25.787  -8.327  -41.927 1.00 153.44 ? 198 GLN H C   1 
ATOM   6789 O O   . GLN D 4 198 ? 26.355  -7.365  -41.416 1.00 146.13 ? 198 GLN H O   1 
ATOM   6790 C CB  . GLN D 4 198 ? 27.750  -9.802  -41.516 1.00 181.21 ? 198 GLN H CB  1 
ATOM   6791 C CG  . GLN D 4 198 ? 28.957  -10.468 -42.150 1.00 192.56 ? 198 GLN H CG  1 
ATOM   6792 C CD  . GLN D 4 198 ? 30.101  -9.496  -42.372 1.00 196.05 ? 198 GLN H CD  1 
ATOM   6793 O OE1 . GLN D 4 198 ? 30.982  -9.733  -43.199 1.00 203.41 ? 198 GLN H OE1 1 
ATOM   6794 N NE2 . GLN D 4 198 ? 30.094  -8.394  -41.628 1.00 188.96 ? 198 GLN H NE2 1 
ATOM   6795 N N   . THR D 4 199 ? 24.464  -8.425  -42.024 1.00 148.38 ? 199 THR H N   1 
ATOM   6796 C CA  . THR D 4 199 ? 23.569  -7.349  -41.603 1.00 145.28 ? 199 THR H CA  1 
ATOM   6797 C C   . THR D 4 199 ? 23.849  -6.864  -40.181 1.00 150.19 ? 199 THR H C   1 
ATOM   6798 O O   . THR D 4 199 ? 24.528  -7.542  -39.407 1.00 158.83 ? 199 THR H O   1 
ATOM   6799 C CB  . THR D 4 199 ? 22.090  -7.773  -41.704 1.00 135.71 ? 199 THR H CB  1 
ATOM   6800 O OG1 . THR D 4 199 ? 21.875  -8.959  -40.931 1.00 121.22 ? 199 THR H OG1 1 
ATOM   6801 C CG2 . THR D 4 199 ? 21.709  -8.043  -43.151 1.00 143.72 ? 199 THR H CG2 1 
ATOM   6802 N N   . TYR D 4 200 ? 23.319  -5.688  -39.848 1.00 141.10 ? 200 TYR H N   1 
ATOM   6803 C CA  . TYR D 4 200 ? 23.491  -5.100  -38.521 1.00 127.44 ? 200 TYR H CA  1 
ATOM   6804 C C   . TYR D 4 200 ? 22.150  -4.758  -37.882 1.00 115.63 ? 200 TYR H C   1 
ATOM   6805 O O   . TYR D 4 200 ? 21.291  -4.141  -38.514 1.00 116.12 ? 200 TYR H O   1 
ATOM   6806 C CB  . TYR D 4 200 ? 24.354  -3.840  -38.601 1.00 122.77 ? 200 TYR H CB  1 
ATOM   6807 C CG  . TYR D 4 200 ? 25.735  -4.085  -39.152 1.00 123.98 ? 200 TYR H CG  1 
ATOM   6808 C CD1 . TYR D 4 200 ? 26.667  -4.820  -38.433 1.00 128.20 ? 200 TYR H CD1 1 
ATOM   6809 C CD2 . TYR D 4 200 ? 26.108  -3.583  -40.389 1.00 123.41 ? 200 TYR H CD2 1 
ATOM   6810 C CE1 . TYR D 4 200 ? 27.931  -5.050  -38.933 1.00 132.39 ? 200 TYR H CE1 1 
ATOM   6811 C CE2 . TYR D 4 200 ? 27.371  -3.806  -40.897 1.00 127.28 ? 200 TYR H CE2 1 
ATOM   6812 C CZ  . TYR D 4 200 ? 28.278  -4.541  -40.165 1.00 131.81 ? 200 TYR H CZ  1 
ATOM   6813 O OH  . TYR D 4 200 ? 29.538  -4.770  -40.663 1.00 135.68 ? 200 TYR H OH  1 
ATOM   6814 N N   . ILE D 4 201 ? 21.979  -5.154  -36.624 1.00 101.91 ? 201 ILE H N   1 
ATOM   6815 C CA  . ILE D 4 201 ? 20.748  -4.875  -35.892 1.00 94.83  ? 201 ILE H CA  1 
ATOM   6816 C C   . ILE D 4 201 ? 21.040  -4.325  -34.505 1.00 85.98  ? 201 ILE H C   1 
ATOM   6817 O O   . ILE D 4 201 ? 21.792  -4.917  -33.741 1.00 90.24  ? 201 ILE H O   1 
ATOM   6818 C CB  . ILE D 4 201 ? 19.868  -6.133  -35.771 1.00 107.63 ? 201 ILE H CB  1 
ATOM   6819 C CG1 . ILE D 4 201 ? 20.696  -7.333  -35.301 1.00 113.61 ? 201 ILE H CG1 1 
ATOM   6820 C CG2 . ILE D 4 201 ? 19.220  -6.457  -37.101 1.00 114.85 ? 201 ILE H CG2 1 
ATOM   6821 C CD1 . ILE D 4 201 ? 20.556  -7.643  -33.827 1.00 109.53 ? 201 ILE H CD1 1 
ATOM   6822 N N   . CYS D 4 202 ? 20.448  -3.182  -34.184 1.00 82.66  ? 202 CYS H N   1 
ATOM   6823 C CA  . CYS D 4 202 ? 20.625  -2.594  -32.863 1.00 79.89  ? 202 CYS H CA  1 
ATOM   6824 C C   . CYS D 4 202 ? 19.542  -3.087  -31.912 1.00 78.94  ? 202 CYS H C   1 
ATOM   6825 O O   . CYS D 4 202 ? 18.354  -3.062  -32.229 1.00 69.34  ? 202 CYS H O   1 
ATOM   6826 C CB  . CYS D 4 202 ? 20.630  -1.065  -32.929 1.00 78.77  ? 202 CYS H CB  1 
ATOM   6827 S SG  . CYS D 4 202 ? 19.008  -0.279  -32.814 1.00 98.09  ? 202 CYS H SG  1 
ATOM   6828 N N   . ASN D 4 203 ? 19.970  -3.546  -30.743 1.00 88.90  ? 203 ASN H N   1 
ATOM   6829 C CA  . ASN D 4 203 ? 19.056  -4.076  -29.740 1.00 93.67  ? 203 ASN H CA  1 
ATOM   6830 C C   . ASN D 4 203 ? 18.779  -3.053  -28.645 1.00 88.78  ? 203 ASN H C   1 
ATOM   6831 O O   . ASN D 4 203 ? 19.639  -2.765  -27.815 1.00 86.78  ? 203 ASN H O   1 
ATOM   6832 C CB  . ASN D 4 203 ? 19.620  -5.363  -29.147 1.00 96.02  ? 203 ASN H CB  1 
ATOM   6833 C CG  . ASN D 4 203 ? 20.107  -6.323  -30.210 1.00 95.54  ? 203 ASN H CG  1 
ATOM   6834 O OD1 . ASN D 4 203 ? 20.023  -6.038  -31.403 1.00 90.94  ? 203 ASN H OD1 1 
ATOM   6835 N ND2 . ASN D 4 203 ? 20.619  -7.469  -29.784 1.00 99.69  ? 203 ASN H ND2 1 
ATOM   6836 N N   . VAL D 4 204 ? 17.575  -2.496  -28.659 1.00 82.95  ? 204 VAL H N   1 
ATOM   6837 C CA  . VAL D 4 204 ? 17.193  -1.499  -27.670 1.00 81.83  ? 204 VAL H CA  1 
ATOM   6838 C C   . VAL D 4 204 ? 16.329  -2.119  -26.581 1.00 82.00  ? 204 VAL H C   1 
ATOM   6839 O O   . VAL D 4 204 ? 15.347  -2.803  -26.861 1.00 88.83  ? 204 VAL H O   1 
ATOM   6840 C CB  . VAL D 4 204 ? 16.456  -0.306  -28.307 1.00 80.17  ? 204 VAL H CB  1 
ATOM   6841 C CG1 . VAL D 4 204 ? 15.953  0.654   -27.230 1.00 73.63  ? 204 VAL H CG1 1 
ATOM   6842 C CG2 . VAL D 4 204 ? 17.367  0.422   -29.274 1.00 82.54  ? 204 VAL H CG2 1 
ATOM   6843 N N   . ASN D 4 205 ? 16.708  -1.875  -25.335 1.00 77.12  ? 205 ASN H N   1 
ATOM   6844 C CA  . ASN D 4 205 ? 15.980  -2.406  -24.201 1.00 90.84  ? 205 ASN H CA  1 
ATOM   6845 C C   . ASN D 4 205 ? 15.729  -1.326  -23.151 1.00 95.86  ? 205 ASN H C   1 
ATOM   6846 O O   . ASN D 4 205 ? 16.670  -0.773  -22.582 1.00 96.84  ? 205 ASN H O   1 
ATOM   6847 C CB  . ASN D 4 205 ? 16.749  -3.585  -23.598 1.00 100.27 ? 205 ASN H CB  1 
ATOM   6848 C CG  . ASN D 4 205 ? 16.081  -4.148  -22.362 1.00 110.57 ? 205 ASN H CG  1 
ATOM   6849 O OD1 . ASN D 4 205 ? 14.913  -3.867  -22.090 1.00 117.36 ? 205 ASN H OD1 1 
ATOM   6850 N ND2 . ASN D 4 205 ? 16.820  -4.950  -21.604 1.00 110.86 ? 205 ASN H ND2 1 
ATOM   6851 N N   . HIS D 4 206 ? 14.454  -1.027  -22.911 1.00 96.35  ? 206 HIS H N   1 
ATOM   6852 C CA  . HIS D 4 206 ? 14.050  -0.026  -21.928 1.00 94.48  ? 206 HIS H CA  1 
ATOM   6853 C C   . HIS D 4 206 ? 13.211  -0.690  -20.846 1.00 99.22  ? 206 HIS H C   1 
ATOM   6854 O O   . HIS D 4 206 ? 11.987  -0.766  -20.959 1.00 99.48  ? 206 HIS H O   1 
ATOM   6855 C CB  . HIS D 4 206 ? 13.248  1.078   -22.614 1.00 92.98  ? 206 HIS H CB  1 
ATOM   6856 C CG  . HIS D 4 206 ? 12.727  2.128   -21.683 1.00 91.75  ? 206 HIS H CG  1 
ATOM   6857 N ND1 . HIS D 4 206 ? 13.552  2.928   -20.924 1.00 84.59  ? 206 HIS H ND1 1 
ATOM   6858 C CD2 . HIS D 4 206 ? 11.462  2.534   -21.418 1.00 91.87  ? 206 HIS H CD2 1 
ATOM   6859 C CE1 . HIS D 4 206 ? 12.817  3.769   -20.220 1.00 81.82  ? 206 HIS H CE1 1 
ATOM   6860 N NE2 . HIS D 4 206 ? 11.546  3.553   -20.502 1.00 82.23  ? 206 HIS H NE2 1 
ATOM   6861 N N   . LYS D 4 207 ? 13.874  -1.170  -19.799 1.00 102.11 ? 207 LYS H N   1 
ATOM   6862 C CA  . LYS D 4 207 ? 13.212  -1.970  -18.765 1.00 108.22 ? 207 LYS H CA  1 
ATOM   6863 C C   . LYS D 4 207 ? 11.974  -1.326  -18.121 1.00 104.43 ? 207 LYS H C   1 
ATOM   6864 O O   . LYS D 4 207 ? 10.983  -2.011  -17.877 1.00 105.05 ? 207 LYS H O   1 
ATOM   6865 C CB  . LYS D 4 207 ? 14.215  -2.418  -17.693 1.00 113.40 ? 207 LYS H CB  1 
ATOM   6866 C CG  . LYS D 4 207 ? 15.241  -3.430  -18.191 1.00 118.57 ? 207 LYS H CG  1 
ATOM   6867 C CD  . LYS D 4 207 ? 16.298  -3.729  -17.133 1.00 121.16 ? 207 LYS H CD  1 
ATOM   6868 C CE  . LYS D 4 207 ? 17.372  -4.674  -17.664 1.00 117.93 ? 207 LYS H CE  1 
ATOM   6869 N NZ  . LYS D 4 207 ? 18.448  -4.939  -16.665 1.00 114.39 ? 207 LYS H NZ  1 
ATOM   6870 N N   . PRO D 4 208 ? 12.028  -0.015  -17.835 1.00 97.36  ? 208 PRO H N   1 
ATOM   6871 C CA  . PRO D 4 208 ? 10.881  0.668   -17.225 1.00 92.81  ? 208 PRO H CA  1 
ATOM   6872 C C   . PRO D 4 208 ? 9.557   0.539   -17.984 1.00 100.07 ? 208 PRO H C   1 
ATOM   6873 O O   . PRO D 4 208 ? 8.607   1.228   -17.629 1.00 105.80 ? 208 PRO H O   1 
ATOM   6874 C CB  . PRO D 4 208 ? 11.325  2.132   -17.203 1.00 81.79  ? 208 PRO H CB  1 
ATOM   6875 C CG  . PRO D 4 208 ? 12.791  2.065   -17.096 1.00 82.77  ? 208 PRO H CG  1 
ATOM   6876 C CD  . PRO D 4 208 ? 13.216  0.855   -17.879 1.00 91.43  ? 208 PRO H CD  1 
ATOM   6877 N N   . SER D 4 209 ? 9.485   -0.311  -19.002 1.00 97.88  ? 209 SER H N   1 
ATOM   6878 C CA  . SER D 4 209 ? 8.210   -0.558  -19.673 1.00 103.57 ? 209 SER H CA  1 
ATOM   6879 C C   . SER D 4 209 ? 8.239   -1.805  -20.552 1.00 116.04 ? 209 SER H C   1 
ATOM   6880 O O   . SER D 4 209 ? 7.552   -1.874  -21.571 1.00 114.56 ? 209 SER H O   1 
ATOM   6881 C CB  . SER D 4 209 ? 7.750   0.670   -20.469 1.00 101.59 ? 209 SER H CB  1 
ATOM   6882 O OG  . SER D 4 209 ? 8.768   1.150   -21.328 1.00 102.19 ? 209 SER H OG  1 
ATOM   6883 N N   . ASN D 4 210 ? 9.041   -2.786  -20.144 1.00 128.10 ? 210 ASN H N   1 
ATOM   6884 C CA  . ASN D 4 210 ? 9.086   -4.092  -20.799 1.00 140.27 ? 210 ASN H CA  1 
ATOM   6885 C C   . ASN D 4 210 ? 9.514   -4.023  -22.258 1.00 144.12 ? 210 ASN H C   1 
ATOM   6886 O O   . ASN D 4 210 ? 9.737   -5.050  -22.896 1.00 155.17 ? 210 ASN H O   1 
ATOM   6887 C CB  . ASN D 4 210 ? 7.725   -4.785  -20.706 1.00 148.76 ? 210 ASN H CB  1 
ATOM   6888 C CG  . ASN D 4 210 ? 7.133   -4.721  -19.317 1.00 160.43 ? 210 ASN H CG  1 
ATOM   6889 O OD1 . ASN D 4 210 ? 7.856   -4.740  -18.320 1.00 167.76 ? 210 ASN H OD1 1 
ATOM   6890 N ND2 . ASN D 4 210 ? 5.808   -4.644  -19.241 1.00 163.45 ? 210 ASN H ND2 1 
ATOM   6891 N N   . THR D 4 211 ? 9.628   -2.808  -22.780 1.00 133.22 ? 211 THR H N   1 
ATOM   6892 C CA  . THR D 4 211 ? 9.877   -2.605  -24.199 1.00 127.42 ? 211 THR H CA  1 
ATOM   6893 C C   . THR D 4 211 ? 11.262  -3.059  -24.629 1.00 119.89 ? 211 THR H C   1 
ATOM   6894 O O   . THR D 4 211 ? 12.271  -2.606  -24.093 1.00 113.56 ? 211 THR H O   1 
ATOM   6895 C CB  . THR D 4 211 ? 9.720   -1.127  -24.591 1.00 128.95 ? 211 THR H CB  1 
ATOM   6896 O OG1 . THR D 4 211 ? 8.482   -0.624  -24.077 1.00 135.67 ? 211 THR H OG1 1 
ATOM   6897 C CG2 . THR D 4 211 ? 9.744   -0.973  -26.107 1.00 125.70 ? 211 THR H CG2 1 
ATOM   6898 N N   . LYS D 4 212 ? 11.297  -3.966  -25.597 1.00 121.96 ? 212 LYS H N   1 
ATOM   6899 C CA  . LYS D 4 212 ? 12.528  -4.273  -26.309 1.00 125.77 ? 212 LYS H CA  1 
ATOM   6900 C C   . LYS D 4 212 ? 12.279  -4.160  -27.806 1.00 121.64 ? 212 LYS H C   1 
ATOM   6901 O O   . LYS D 4 212 ? 11.312  -4.718  -28.326 1.00 127.36 ? 212 LYS H O   1 
ATOM   6902 C CB  . LYS D 4 212 ? 13.058  -5.665  -25.961 1.00 135.12 ? 212 LYS H CB  1 
ATOM   6903 C CG  . LYS D 4 212 ? 14.179  -6.121  -26.890 1.00 142.61 ? 212 LYS H CG  1 
ATOM   6904 C CD  . LYS D 4 212 ? 15.001  -7.246  -26.289 1.00 147.27 ? 212 LYS H CD  1 
ATOM   6905 C CE  . LYS D 4 212 ? 16.062  -7.738  -27.267 1.00 145.85 ? 212 LYS H CE  1 
ATOM   6906 N NZ  . LYS D 4 212 ? 15.477  -8.496  -28.411 1.00 142.06 ? 212 LYS H NZ  1 
ATOM   6907 N N   . VAL D 4 213 ? 13.148  -3.426  -28.491 1.00 115.43 ? 213 VAL H N   1 
ATOM   6908 C CA  . VAL D 4 213 ? 13.009  -3.212  -29.927 1.00 116.48 ? 213 VAL H CA  1 
ATOM   6909 C C   . VAL D 4 213 ? 14.286  -3.609  -30.664 1.00 119.71 ? 213 VAL H C   1 
ATOM   6910 O O   . VAL D 4 213 ? 15.394  -3.319  -30.209 1.00 121.00 ? 213 VAL H O   1 
ATOM   6911 C CB  . VAL D 4 213 ? 12.667  -1.739  -30.249 1.00 107.49 ? 213 VAL H CB  1 
ATOM   6912 C CG1 . VAL D 4 213 ? 12.426  -1.564  -31.741 1.00 109.81 ? 213 VAL H CG1 1 
ATOM   6913 C CG2 . VAL D 4 213 ? 11.449  -1.292  -29.456 1.00 101.84 ? 213 VAL H CG2 1 
ATOM   6914 N N   . ASP D 4 214 ? 14.120  -4.282  -31.798 1.00 118.95 ? 214 ASP H N   1 
ATOM   6915 C CA  . ASP D 4 214 ? 15.250  -4.714  -32.609 1.00 120.22 ? 214 ASP H CA  1 
ATOM   6916 C C   . ASP D 4 214 ? 15.110  -4.188  -34.030 1.00 119.98 ? 214 ASP H C   1 
ATOM   6917 O O   . ASP D 4 214 ? 14.416  -4.783  -34.855 1.00 127.61 ? 214 ASP H O   1 
ATOM   6918 C CB  . ASP D 4 214 ? 15.339  -6.241  -32.627 1.00 124.08 ? 214 ASP H CB  1 
ATOM   6919 C CG  . ASP D 4 214 ? 15.503  -6.831  -31.243 1.00 125.42 ? 214 ASP H CG  1 
ATOM   6920 O OD1 . ASP D 4 214 ? 14.669  -7.677  -30.859 1.00 128.73 ? 214 ASP H OD1 1 
ATOM   6921 O OD2 . ASP D 4 214 ? 16.458  -6.445  -30.533 1.00 124.89 ? 214 ASP H OD2 1 
ATOM   6922 N N   . LYS D 4 215 ? 15.763  -3.067  -34.314 1.00 111.66 ? 215 LYS H N   1 
ATOM   6923 C CA  . LYS D 4 215 ? 15.723  -2.488  -35.650 1.00 109.13 ? 215 LYS H CA  1 
ATOM   6924 C C   . LYS D 4 215 ? 16.965  -2.851  -36.455 1.00 115.15 ? 215 LYS H C   1 
ATOM   6925 O O   . LYS D 4 215 ? 18.090  -2.742  -35.973 1.00 115.44 ? 215 LYS H O   1 
ATOM   6926 C CB  . LYS D 4 215 ? 15.554  -0.969  -35.581 1.00 99.60  ? 215 LYS H CB  1 
ATOM   6927 C CG  . LYS D 4 215 ? 14.106  -0.507  -35.563 1.00 105.86 ? 215 LYS H CG  1 
ATOM   6928 C CD  . LYS D 4 215 ? 13.447  -0.703  -36.923 1.00 110.42 ? 215 LYS H CD  1 
ATOM   6929 C CE  . LYS D 4 215 ? 12.185  0.141   -37.063 1.00 108.34 ? 215 LYS H CE  1 
ATOM   6930 N NZ  . LYS D 4 215 ? 11.120  -0.249  -36.099 1.00 112.16 ? 215 LYS H NZ  1 
ATOM   6931 N N   . ARG D 4 216 ? 16.743  -3.296  -37.685 1.00 116.89 ? 216 ARG H N   1 
ATOM   6932 C CA  . ARG D 4 216 ? 17.828  -3.624  -38.592 1.00 112.40 ? 216 ARG H CA  1 
ATOM   6933 C C   . ARG D 4 216 ? 18.190  -2.386  -39.404 1.00 105.30 ? 216 ARG H C   1 
ATOM   6934 O O   . ARG D 4 216 ? 17.313  -1.655  -39.856 1.00 109.08 ? 216 ARG H O   1 
ATOM   6935 C CB  . ARG D 4 216 ? 17.418  -4.802  -39.489 1.00 119.95 ? 216 ARG H CB  1 
ATOM   6936 C CG  . ARG D 4 216 ? 18.106  -4.879  -40.851 1.00 124.79 ? 216 ARG H CG  1 
ATOM   6937 C CD  . ARG D 4 216 ? 18.116  -6.307  -41.408 1.00 120.61 ? 216 ARG H CD  1 
ATOM   6938 N NE  . ARG D 4 216 ? 16.994  -7.114  -40.932 1.00 118.41 ? 216 ARG H NE  1 
ATOM   6939 C CZ  . ARG D 4 216 ? 15.755  -7.040  -41.409 1.00 109.37 ? 216 ARG H CZ  1 
ATOM   6940 N NH1 . ARG D 4 216 ? 15.467  -6.183  -42.378 1.00 99.10  ? 216 ARG H NH1 1 
ATOM   6941 N NH2 . ARG D 4 216 ? 14.803  -7.818  -40.911 1.00 105.79 ? 216 ARG H NH2 1 
ATOM   6942 N N   . VAL D 4 217 ? 19.482  -2.134  -39.569 1.00 100.26 ? 217 VAL H N   1 
ATOM   6943 C CA  . VAL D 4 217 ? 19.918  -0.976  -40.340 1.00 111.07 ? 217 VAL H CA  1 
ATOM   6944 C C   . VAL D 4 217 ? 20.538  -1.399  -41.670 1.00 117.90 ? 217 VAL H C   1 
ATOM   6945 O O   . VAL D 4 217 ? 21.428  -2.252  -41.708 1.00 114.20 ? 217 VAL H O   1 
ATOM   6946 C CB  . VAL D 4 217 ? 20.904  -0.096  -39.542 1.00 116.08 ? 217 VAL H CB  1 
ATOM   6947 C CG1 . VAL D 4 217 ? 21.301  1.129   -40.351 1.00 120.22 ? 217 VAL H CG1 1 
ATOM   6948 C CG2 . VAL D 4 217 ? 20.284  0.326   -38.222 1.00 111.60 ? 217 VAL H CG2 1 
ATOM   6949 N N   . GLU D 4 218 ? 20.050  -0.801  -42.755 1.00 124.57 ? 218 GLU H N   1 
ATOM   6950 C CA  . GLU D 4 218 ? 20.504  -1.120  -44.107 1.00 131.78 ? 218 GLU H CA  1 
ATOM   6951 C C   . GLU D 4 218 ? 20.598  0.143   -44.959 1.00 138.83 ? 218 GLU H C   1 
ATOM   6952 O O   . GLU D 4 218 ? 19.953  1.147   -44.660 1.00 141.95 ? 218 GLU H O   1 
ATOM   6953 C CB  . GLU D 4 218 ? 19.534  -2.090  -44.779 1.00 129.41 ? 218 GLU H CB  1 
ATOM   6954 C CG  . GLU D 4 218 ? 19.140  -3.280  -43.937 1.00 129.74 ? 218 GLU H CG  1 
ATOM   6955 C CD  . GLU D 4 218 ? 17.806  -3.855  -44.360 1.00 134.63 ? 218 GLU H CD  1 
ATOM   6956 O OE1 . GLU D 4 218 ? 17.026  -3.129  -45.016 1.00 122.35 ? 218 GLU H OE1 1 
ATOM   6957 O OE2 . GLU D 4 218 ? 17.537  -5.030  -44.036 1.00 146.16 ? 218 GLU H OE2 1 
ATOM   6958 N N   . PRO D 4 219 ? 21.401  0.093   -46.034 1.00 140.03 ? 219 PRO H N   1 
ATOM   6959 C CA  . PRO D 4 219 ? 21.532  1.221   -46.966 1.00 147.52 ? 219 PRO H CA  1 
ATOM   6960 C C   . PRO D 4 219 ? 20.279  1.413   -47.822 1.00 155.48 ? 219 PRO H C   1 
ATOM   6961 O O   . PRO D 4 219 ? 19.291  0.704   -47.630 1.00 159.52 ? 219 PRO H O   1 
ATOM   6962 C CB  . PRO D 4 219 ? 22.717  0.811   -47.849 1.00 148.03 ? 219 PRO H CB  1 
ATOM   6963 C CG  . PRO D 4 219 ? 23.431  -0.259  -47.073 1.00 142.78 ? 219 PRO H CG  1 
ATOM   6964 C CD  . PRO D 4 219 ? 22.359  -0.982  -46.335 1.00 136.26 ? 219 PRO H CD  1 
ATOM   6965 N N   . LYS D 4 220 ? 20.324  2.366   -48.750 1.00 155.34 ? 220 LYS H N   1 
ATOM   6966 C CA  . LYS D 4 220 ? 19.202  2.632   -49.652 1.00 153.25 ? 220 LYS H CA  1 
ATOM   6967 C C   . LYS D 4 220 ? 19.491  3.768   -50.632 1.00 156.30 ? 220 LYS H C   1 
ATOM   6968 O O   . LYS D 4 220 ? 18.764  3.953   -51.610 1.00 158.61 ? 220 LYS H O   1 
ATOM   6969 C CB  . LYS D 4 220 ? 17.912  2.924   -48.874 1.00 147.18 ? 220 LYS H CB  1 
ATOM   6970 C CG  . LYS D 4 220 ? 18.084  3.692   -47.563 1.00 143.26 ? 220 LYS H CG  1 
ATOM   6971 C CD  . LYS D 4 220 ? 18.851  4.999   -47.725 1.00 142.88 ? 220 LYS H CD  1 
ATOM   6972 C CE  . LYS D 4 220 ? 20.300  4.856   -47.275 1.00 143.11 ? 220 LYS H CE  1 
ATOM   6973 N NZ  . LYS D 4 220 ? 20.987  6.171   -47.161 1.00 143.34 ? 220 LYS H NZ  1 
HETATM 6974 C C1  . NAG E 5 .   ? 33.024  22.539  35.772  1.00 90.55  ? 1   NAG C C1  1 
HETATM 6975 C C2  . NAG E 5 .   ? 34.461  22.240  36.187  1.00 91.30  ? 1   NAG C C2  1 
HETATM 6976 C C3  . NAG E 5 .   ? 35.371  23.390  35.786  1.00 90.49  ? 1   NAG C C3  1 
HETATM 6977 C C4  . NAG E 5 .   ? 35.271  23.617  34.287  1.00 88.98  ? 1   NAG C C4  1 
HETATM 6978 C C5  . NAG E 5 .   ? 33.826  23.975  33.969  1.00 93.53  ? 1   NAG C C5  1 
HETATM 6979 C C6  . NAG E 5 .   ? 33.653  24.099  32.461  1.00 92.52  ? 1   NAG C C6  1 
HETATM 6980 C C7  . NAG E 5 .   ? 35.304  21.012  38.131  1.00 105.00 ? 1   NAG C C7  1 
HETATM 6981 C C8  . NAG E 5 .   ? 36.718  21.375  38.483  1.00 106.67 ? 1   NAG C C8  1 
HETATM 6982 N N2  . NAG E 5 .   ? 34.553  21.992  37.618  1.00 101.00 ? 1   NAG C N2  1 
HETATM 6983 O O3  . NAG E 5 .   ? 36.702  23.142  36.183  1.00 97.26  ? 1   NAG C O3  1 
HETATM 6984 O O4  . NAG E 5 .   ? 36.157  24.653  33.901  1.00 84.19  ? 1   NAG C O4  1 
HETATM 6985 O O5  . NAG E 5 .   ? 32.922  22.983  34.430  1.00 94.67  ? 1   NAG C O5  1 
HETATM 6986 O O6  . NAG E 5 .   ? 33.885  22.836  31.886  1.00 90.70  ? 1   NAG C O6  1 
HETATM 6987 O O7  . NAG E 5 .   ? 34.897  19.862  38.326  1.00 102.66 ? 1   NAG C O7  1 
HETATM 6988 C C1  . NAG E 5 .   ? 37.326  24.148  33.218  1.00 89.68  ? 2   NAG C C1  1 
HETATM 6989 C C2  . NAG E 5 .   ? 37.914  25.284  32.379  1.00 96.23  ? 2   NAG C C2  1 
HETATM 6990 C C3  . NAG E 5 .   ? 39.274  24.940  31.780  1.00 82.32  ? 2   NAG C C3  1 
HETATM 6991 C C4  . NAG E 5 .   ? 40.223  24.358  32.806  1.00 98.31  ? 2   NAG C C4  1 
HETATM 6992 C C5  . NAG E 5 .   ? 39.570  23.300  33.683  1.00 80.78  ? 2   NAG C C5  1 
HETATM 6993 C C6  . NAG E 5 .   ? 40.443  23.106  34.919  1.00 109.59 ? 2   NAG C C6  1 
HETATM 6994 C C7  . NAG E 5 .   ? 36.633  27.044  31.361  1.00 106.35 ? 2   NAG C C7  1 
HETATM 6995 C C8  . NAG E 5 .   ? 36.168  27.614  30.053  1.00 99.53  ? 2   NAG C C8  1 
HETATM 6996 N N2  . NAG E 5 .   ? 36.987  25.756  31.370  1.00 101.32 ? 2   NAG C N2  1 
HETATM 6997 O O3  . NAG E 5 .   ? 39.889  26.099  31.277  1.00 94.51  ? 2   NAG C O3  1 
HETATM 6998 O O4  . NAG E 5 .   ? 41.324  23.844  32.082  1.00 100.92 ? 2   NAG C O4  1 
HETATM 6999 O O5  . NAG E 5 .   ? 38.277  23.651  34.136  1.00 95.43  ? 2   NAG C O5  1 
HETATM 7000 O O6  . NAG E 5 .   ? 41.715  22.646  34.529  1.00 111.30 ? 2   NAG C O6  1 
HETATM 7001 O O7  . NAG E 5 .   ? 36.683  27.766  32.361  1.00 100.55 ? 2   NAG C O7  1 
HETATM 7002 C C1  . BMA E 5 .   ? 42.461  24.460  32.450  1.00 109.74 ? 3   BMA C C1  1 
HETATM 7003 C C2  . BMA E 5 .   ? 43.545  23.505  32.071  1.00 112.30 ? 3   BMA C C2  1 
HETATM 7004 C C3  . BMA E 5 .   ? 44.937  24.046  32.394  1.00 118.66 ? 3   BMA C C3  1 
HETATM 7005 C C4  . BMA E 5 .   ? 45.013  25.392  31.750  1.00 117.37 ? 3   BMA C C4  1 
HETATM 7006 C C5  . BMA E 5 .   ? 43.732  26.213  32.030  1.00 122.33 ? 3   BMA C C5  1 
HETATM 7007 C C6  . BMA E 5 .   ? 43.812  27.663  31.512  1.00 129.94 ? 3   BMA C C6  1 
HETATM 7008 O O2  . BMA E 5 .   ? 43.313  23.085  30.718  1.00 114.57 ? 3   BMA C O2  1 
HETATM 7009 O O3  . BMA E 5 .   ? 45.929  23.229  31.827  1.00 124.15 ? 3   BMA C O3  1 
HETATM 7010 O O4  . BMA E 5 .   ? 46.206  25.977  32.148  1.00 116.02 ? 3   BMA C O4  1 
HETATM 7011 O O5  . BMA E 5 .   ? 42.511  25.565  31.636  1.00 114.94 ? 3   BMA C O5  1 
HETATM 7012 O O6  . BMA E 5 .   ? 43.118  28.028  30.344  1.00 137.45 ? 3   BMA C O6  1 
HETATM 7013 C C1  . MAN E 5 .   ? 47.017  22.712  32.570  1.00 131.12 ? 4   MAN C C1  1 
HETATM 7014 C C2  . MAN E 5 .   ? 46.462  21.779  33.640  1.00 135.43 ? 4   MAN C C2  1 
HETATM 7015 C C3  . MAN E 5 .   ? 47.596  20.858  34.071  1.00 139.65 ? 4   MAN C C3  1 
HETATM 7016 C C4  . MAN E 5 .   ? 48.898  21.652  34.133  1.00 134.03 ? 4   MAN C C4  1 
HETATM 7017 C C5  . MAN E 5 .   ? 48.620  23.153  34.276  1.00 138.06 ? 4   MAN C C5  1 
HETATM 7018 C C6  . MAN E 5 .   ? 49.907  23.973  34.393  1.00 140.17 ? 4   MAN C C6  1 
HETATM 7019 O O2  . MAN E 5 .   ? 45.412  21.001  33.117  1.00 138.50 ? 4   MAN C O2  1 
HETATM 7020 O O3  . MAN E 5 .   ? 47.739  19.793  33.156  1.00 144.30 ? 4   MAN C O3  1 
HETATM 7021 O O4  . MAN E 5 .   ? 49.664  21.189  35.223  1.00 119.99 ? 4   MAN C O4  1 
HETATM 7022 O O5  . MAN E 5 .   ? 47.874  23.660  33.177  1.00 133.50 ? 4   MAN C O5  1 
HETATM 7023 O O6  . MAN E 5 .   ? 50.351  24.033  35.731  1.00 138.01 ? 4   MAN C O6  1 
HETATM 7024 C C1  . MAN E 5 .   ? 43.927  28.459  29.193  1.00 147.02 ? 5   MAN C C1  1 
HETATM 7025 C C2  . MAN E 5 .   ? 42.943  28.732  28.033  1.00 152.66 ? 5   MAN C C2  1 
HETATM 7026 C C3  . MAN E 5 .   ? 43.785  29.221  26.832  1.00 157.09 ? 5   MAN C C3  1 
HETATM 7027 C C4  . MAN E 5 .   ? 44.956  28.243  26.452  1.00 156.41 ? 5   MAN C C4  1 
HETATM 7028 C C5  . MAN E 5 .   ? 45.915  28.183  27.672  1.00 155.95 ? 5   MAN C C5  1 
HETATM 7029 C C6  . MAN E 5 .   ? 46.725  29.525  27.924  1.00 159.52 ? 5   MAN C C6  1 
HETATM 7030 O O2  . MAN E 5 .   ? 41.903  29.627  28.510  1.00 152.40 ? 5   MAN C O2  1 
HETATM 7031 O O3  . MAN E 5 .   ? 44.310  30.568  27.073  1.00 157.99 ? 5   MAN C O3  1 
HETATM 7032 O O4  . MAN E 5 .   ? 44.628  26.944  25.941  1.00 154.32 ? 5   MAN C O4  1 
HETATM 7033 O O5  . MAN E 5 .   ? 45.127  27.721  28.799  1.00 151.40 ? 5   MAN C O5  1 
HETATM 7034 O O6  . MAN E 5 .   ? 48.092  29.661  27.536  1.00 159.66 ? 5   MAN C O6  1 
HETATM 7035 O O   . HOH F 6 .   ? 32.422  11.248  37.027  1.00 47.86  ? 307 HOH A O   1 
HETATM 7036 O O   . HOH F 6 .   ? 27.627  19.002  28.240  1.00 64.01  ? 308 HOH A O   1 
HETATM 7037 O O   . HOH F 6 .   ? 31.502  7.642   19.923  1.00 48.22  ? 309 HOH A O   1 
HETATM 7038 O O   . HOH F 6 .   ? 27.760  36.693  57.419  1.00 71.68  ? 310 HOH A O   1 
HETATM 7039 O O   . HOH F 6 .   ? 42.521  24.518  22.744  1.00 61.44  ? 311 HOH A O   1 
HETATM 7040 O O   . HOH F 6 .   ? 38.660  30.337  28.931  1.00 62.81  ? 312 HOH A O   1 
HETATM 7041 O O   . HOH F 6 .   ? 48.210  8.645   9.821   1.00 69.57  ? 313 HOH A O   1 
HETATM 7042 O O   . HOH F 6 .   ? 12.785  15.170  52.014  1.00 95.54  ? 314 HOH A O   1 
HETATM 7043 O O   . HOH F 6 .   ? 16.067  13.223  50.992  1.00 79.09  ? 315 HOH A O   1 
HETATM 7044 O O   . HOH F 6 .   ? 32.314  4.366   25.711  1.00 48.20  ? 316 HOH A O   1 
HETATM 7045 O O   . HOH F 6 .   ? 48.373  19.772  30.007  1.00 96.95  ? 317 HOH A O   1 
HETATM 7046 O O   . HOH F 6 .   ? 40.929  0.664   8.891   1.00 69.31  ? 318 HOH A O   1 
HETATM 7047 O O   . HOH F 6 .   ? 43.313  19.900  34.053  1.00 75.03  ? 319 HOH A O   1 
HETATM 7048 O O   . HOH F 6 .   ? 30.751  6.923   30.421  1.00 44.70  ? 320 HOH A O   1 
HETATM 7049 O O   . HOH F 6 .   ? 26.029  10.921  24.876  1.00 55.12  ? 321 HOH A O   1 
HETATM 7050 O O   . HOH G 6 .   ? 39.141  52.615  61.673  1.00 88.28  ? 198 HOH B O   1 
HETATM 7051 O O   . HOH G 6 .   ? 35.659  53.202  60.345  1.00 88.52  ? 199 HOH B O   1 
HETATM 7052 O O   . HOH H 6 .   ? 53.075  21.345  -8.066  1.00 69.09  ? 215 HOH L O   1 
HETATM 7053 O O   . HOH H 6 .   ? 3.830   19.347  -38.202 1.00 100.20 ? 216 HOH L O   1 
HETATM 7054 O O   . HOH H 6 .   ? 44.063  6.242   7.770   1.00 38.36  ? 217 HOH L O   1 
HETATM 7055 O O   . HOH H 6 .   ? 20.002  12.329  -29.957 1.00 64.26  ? 218 HOH L O   1 
HETATM 7056 O O   . HOH H 6 .   ? 32.474  20.453  -26.977 1.00 63.12  ? 219 HOH L O   1 
HETATM 7057 O O   . HOH H 6 .   ? 28.269  10.050  -11.582 1.00 53.55  ? 220 HOH L O   1 
HETATM 7058 O O   . HOH H 6 .   ? 32.105  13.092  -12.144 1.00 84.94  ? 221 HOH L O   1 
HETATM 7059 O O   . HOH H 6 .   ? 31.851  18.385  -12.476 1.00 63.72  ? 222 HOH L O   1 
HETATM 7060 O O   . HOH H 6 .   ? 35.215  20.066  -13.363 1.00 57.22  ? 223 HOH L O   1 
HETATM 7061 O O   . HOH H 6 .   ? 35.579  6.270   -8.472  1.00 54.06  ? 224 HOH L O   1 
HETATM 7062 O O   . HOH H 6 .   ? 21.731  25.672  -30.373 1.00 68.68  ? 225 HOH L O   1 
HETATM 7063 O O   . HOH I 6 .   ? 20.420  4.291   -8.847  1.00 62.90  ? 227 HOH H O   1 
HETATM 7064 O O   . HOH I 6 .   ? 20.517  2.478   -6.652  1.00 41.17  ? 228 HOH H O   1 
HETATM 7065 O O   . HOH I 6 .   ? 26.760  10.002  18.761  1.00 42.48  ? 229 HOH H O   1 
HETATM 7066 O O   . HOH I 6 .   ? 12.701  0.505   -6.318  1.00 68.02  ? 230 HOH H O   1 
HETATM 7067 O O   . HOH I 6 .   ? 10.232  17.711  3.692   1.00 60.47  ? 231 HOH H O   1 
HETATM 7068 O O   . HOH I 6 .   ? 28.003  7.698   17.921  1.00 49.33  ? 232 HOH H O   1 
HETATM 7069 O O   . HOH I 6 .   ? 21.867  5.700   -21.144 1.00 51.39  ? 233 HOH H O   1 
HETATM 7070 O O   . HOH I 6 .   ? 24.613  6.028   -21.857 1.00 54.72  ? 234 HOH H O   1 
HETATM 7071 O O   . HOH I 6 .   ? 23.770  1.119   -22.806 1.00 72.80  ? 235 HOH H O   1 
HETATM 7072 O O   . HOH I 6 .   ? 18.641  23.020  -1.932  1.00 44.97  ? 236 HOH H O   1 
HETATM 7073 O O   . HOH I 6 .   ? 18.297  22.907  -6.229  1.00 60.38  ? 237 HOH H O   1 
HETATM 7074 O O   . HOH I 6 .   ? 27.803  14.772  -12.883 1.00 43.54  ? 238 HOH H O   1 
HETATM 7075 O O   . HOH I 6 .   ? 23.496  12.321  -11.952 1.00 49.06  ? 239 HOH H O   1 
HETATM 7076 O O   . HOH I 6 .   ? 20.809  21.129  12.003  1.00 53.11  ? 240 HOH H O   1 
HETATM 7077 O O   . HOH I 6 .   ? 31.387  9.296   13.291  1.00 63.54  ? 241 HOH H O   1 
HETATM 7078 O O   . HOH I 6 .   ? 21.404  6.950   -16.737 1.00 71.12  ? 242 HOH H O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ILE A 1   ? 1.2353 0.7342 0.6821 -0.1948 -0.1960 0.0556  1   ILE A N   
2    C CA  . ILE A 1   ? 1.2150 0.7505 0.6828 -0.1815 -0.1788 0.0529  1   ILE A CA  
3    C C   . ILE A 1   ? 1.2105 0.7268 0.6476 -0.1842 -0.1880 0.0496  1   ILE A C   
4    O O   . ILE A 1   ? 1.3034 0.8241 0.7350 -0.2048 -0.2079 0.0538  1   ILE A O   
5    C CB  . ILE A 1   ? 1.3577 0.9581 0.8718 -0.1902 -0.1739 0.0608  1   ILE A CB  
6    C CG1 . ILE A 1   ? 1.2326 0.8600 0.7661 -0.1720 -0.1570 0.0573  1   ILE A CG1 
7    C CG2 . ILE A 1   ? 1.3805 1.0050 0.8993 -0.2169 -0.1920 0.0667  1   ILE A CG2 
8    C CD1 . ILE A 1   ? 1.0602 0.7446 0.6304 -0.1790 -0.1598 0.0615  1   ILE A CD1 
9    N N   . TRP A 2   ? 1.3531 0.8477 0.7686 -0.1645 -0.1736 0.0415  2   TRP A N   
10   C CA  . TRP A 2   ? 1.4212 0.8908 0.7985 -0.1645 -0.1824 0.0385  2   TRP A CA  
11   C C   . TRP A 2   ? 1.3728 0.8575 0.7520 -0.1514 -0.1653 0.0388  2   TRP A C   
12   O O   . TRP A 2   ? 1.3978 0.9098 0.8081 -0.1419 -0.1442 0.0397  2   TRP A O   
13   C CB  . TRP A 2   ? 1.4632 0.8698 0.7865 -0.1574 -0.1866 0.0277  2   TRP A CB  
14   C CG  . TRP A 2   ? 1.4154 0.8036 0.7337 -0.1364 -0.1631 0.0162  2   TRP A CG  
15   C CD1 . TRP A 2   ? 1.4080 0.7903 0.7428 -0.1308 -0.1629 0.0117  2   TRP A CD1 
16   C CD2 . TRP A 2   ? 1.4128 0.7858 0.7071 -0.1185 -0.1377 0.0056  2   TRP A CD2 
17   N NE1 . TRP A 2   ? 1.4844 0.8558 0.8157 -0.1079 -0.1399 -0.0038 2   TRP A NE1 
18   C CE2 . TRP A 2   ? 1.3743 0.7425 0.6815 -0.1021 -0.1213 -0.0076 2   TRP A CE2 
19   C CE3 . TRP A 2   ? 1.4629 0.8245 0.7236 -0.1158 -0.1274 0.0058  2   TRP A CE3 
20   C CZ2 . TRP A 2   ? 1.3246 0.6866 0.6193 -0.0848 -0.0914 -0.0225 2   TRP A CZ2 
21   C CZ3 . TRP A 2   ? 1.3867 0.7343 0.6258 -0.1013 -0.0968 -0.0056 2   TRP A CZ3 
22   C CH2 . TRP A 2   ? 1.3616 0.7143 0.6214 -0.0869 -0.0772 -0.0205 2   TRP A CH2 
23   N N   . GLU A 3   ? 1.3805 0.8426 0.7231 -0.1518 -0.1772 0.0381  3   GLU A N   
24   C CA  . GLU A 3   ? 1.3488 0.8145 0.6827 -0.1422 -0.1671 0.0407  3   GLU A CA  
25   C C   . GLU A 3   ? 1.3701 0.7868 0.6494 -0.1305 -0.1463 0.0344  3   GLU A C   
26   O O   . GLU A 3   ? 1.4852 0.8562 0.7141 -0.1301 -0.1541 0.0276  3   GLU A O   
27   C CB  . GLU A 3   ? 1.3924 0.8642 0.7193 -0.1484 -0.1966 0.0436  3   GLU A CB  
28   C CG  . GLU A 3   ? 1.5611 1.0261 0.8716 -0.1375 -0.1931 0.0471  3   GLU A CG  
29   C CD  . GLU A 3   ? 1.6470 1.1221 0.9582 -0.1392 -0.2275 0.0471  3   GLU A CD  
30   O OE1 . GLU A 3   ? 1.6989 1.2206 1.0571 -0.1496 -0.2460 0.0452  3   GLU A OE1 
31   O OE2 . GLU A 3   ? 1.6692 1.1056 0.9333 -0.1306 -0.2365 0.0481  3   GLU A OE2 
32   N N   . LEU A 4   ? 1.2430 0.6698 0.5315 -0.1225 -0.1187 0.0359  4   LEU A N   
33   C CA  . LEU A 4   ? 1.4463 0.8332 0.6836 -0.1157 -0.0934 0.0305  4   LEU A CA  
34   C C   . LEU A 4   ? 1.5970 0.9538 0.7860 -0.1174 -0.1043 0.0385  4   LEU A C   
35   O O   . LEU A 4   ? 1.7826 1.0977 0.9172 -0.1186 -0.1246 0.0367  4   LEU A O   
36   C CB  . LEU A 4   ? 1.5326 0.9470 0.8065 -0.1105 -0.0578 0.0277  4   LEU A CB  
37   C CG  . LEU A 4   ? 1.3075 0.6970 0.5478 -0.1048 -0.0231 0.0154  4   LEU A CG  
38   C CD1 . LEU A 4   ? 1.5446 0.9068 0.7587 -0.0982 -0.0289 0.0007  4   LEU A CD1 
39   C CD2 . LEU A 4   ? 1.2636 0.6948 0.5601 -0.1012 0.0073  0.0104  4   LEU A CD2 
40   N N   . LYS A 5   ? 1.6490 1.0216 0.8546 -0.1170 -0.0938 0.0470  5   LYS A N   
41   C CA  . LYS A 5   ? 1.5786 0.9241 0.7462 -0.1171 -0.1136 0.0561  5   LYS A CA  
42   C C   . LYS A 5   ? 1.5800 0.9674 0.7979 -0.1166 -0.1487 0.0589  5   LYS A C   
43   O O   . LYS A 5   ? 1.3770 0.8107 0.6513 -0.1198 -0.1527 0.0557  5   LYS A O   
44   C CB  . LYS A 5   ? 1.4989 0.8372 0.6599 -0.1178 -0.0894 0.0639  5   LYS A CB  
45   C CG  . LYS A 5   ? 1.5323 0.8232 0.6291 -0.1226 -0.0551 0.0626  5   LYS A CG  
46   C CD  . LYS A 5   ? 1.5777 0.9019 0.7158 -0.1236 -0.0148 0.0527  5   LYS A CD  
47   C CE  . LYS A 5   ? 1.6773 0.9693 0.7653 -0.1320 0.0255  0.0513  5   LYS A CE  
48   N NZ  . LYS A 5   ? 1.6142 0.9314 0.7278 -0.1290 0.0602  0.0333  5   LYS A NZ  
49   N N   . LYS A 6   ? 1.7513 1.1219 0.9471 -0.1125 -0.1744 0.0639  6   LYS A N   
50   C CA  . LYS A 6   ? 1.8070 1.2264 1.0581 -0.1093 -0.2048 0.0630  6   LYS A CA  
51   C C   . LYS A 6   ? 1.7046 1.1718 1.0168 -0.1068 -0.1857 0.0658  6   LYS A C   
52   O O   . LYS A 6   ? 1.6978 1.1436 0.9932 -0.1042 -0.1663 0.0717  6   LYS A O   
53   C CB  . LYS A 6   ? 1.9996 1.3858 1.2118 -0.1005 -0.2392 0.0648  6   LYS A CB  
54   C CG  . LYS A 6   ? 2.0949 1.5357 1.3654 -0.0949 -0.2757 0.0576  6   LYS A CG  
55   C CD  . LYS A 6   ? 2.2104 1.6677 1.4904 -0.1035 -0.2999 0.0487  6   LYS A CD  
56   C CE  . LYS A 6   ? 2.1441 1.6651 1.4879 -0.1003 -0.3335 0.0383  6   LYS A CE  
57   N NZ  . LYS A 6   ? 2.0005 1.5976 1.4239 -0.1048 -0.3158 0.0365  6   LYS A NZ  
58   N N   . ASP A 7   ? 1.7240 1.2536 1.1035 -0.1097 -0.1907 0.0616  7   ASP A N   
59   C CA  . ASP A 7   ? 1.6597 1.2371 1.0976 -0.1064 -0.1762 0.0625  7   ASP A CA  
60   C C   . ASP A 7   ? 1.5639 1.1390 1.0096 -0.1093 -0.1394 0.0639  7   ASP A C   
61   O O   . ASP A 7   ? 1.5472 1.1468 1.0284 -0.1057 -0.1245 0.0651  7   ASP A O   
62   C CB  . ASP A 7   ? 1.6060 1.1768 1.0422 -0.0949 -0.1880 0.0651  7   ASP A CB  
63   C CG  . ASP A 7   ? 1.6055 1.2115 1.0712 -0.0875 -0.2249 0.0577  7   ASP A CG  
64   O OD1 . ASP A 7   ? 1.4528 1.0266 0.8869 -0.0766 -0.2499 0.0575  7   ASP A OD1 
65   O OD2 . ASP A 7   ? 1.7155 1.3816 1.2355 -0.0928 -0.2292 0.0510  7   ASP A OD2 
66   N N   . VAL A 8   ? 1.5004 1.0467 0.9146 -0.1143 -0.1270 0.0613  8   VAL A N   
67   C CA  . VAL A 8   ? 1.3339 0.8832 0.7614 -0.1144 -0.0958 0.0578  8   VAL A CA  
68   C C   . VAL A 8   ? 1.2943 0.8442 0.7240 -0.1185 -0.1005 0.0518  8   VAL A C   
69   O O   . VAL A 8   ? 1.3535 0.8646 0.7363 -0.1208 -0.1086 0.0488  8   VAL A O   
70   C CB  . VAL A 8   ? 1.1492 0.6527 0.5264 -0.1137 -0.0701 0.0571  8   VAL A CB  
71   C CG1 . VAL A 8   ? 1.3177 0.8372 0.7227 -0.1118 -0.0382 0.0490  8   VAL A CG1 
72   C CG2 . VAL A 8   ? 1.2645 0.7517 0.6244 -0.1133 -0.0691 0.0656  8   VAL A CG2 
73   N N   . TYR A 9   ? 1.1382 0.7261 0.6173 -0.1196 -0.0977 0.0503  9   TYR A N   
74   C CA  . TYR A 9   ? 1.0861 0.6694 0.5656 -0.1253 -0.1071 0.0467  9   TYR A CA  
75   C C   . TYR A 9   ? 1.0656 0.6472 0.5608 -0.1175 -0.0874 0.0392  9   TYR A C   
76   O O   . TYR A 9   ? 1.0072 0.6150 0.5380 -0.1108 -0.0705 0.0379  9   TYR A O   
77   C CB  . TYR A 9   ? 1.0126 0.6363 0.5283 -0.1367 -0.1275 0.0517  9   TYR A CB  
78   C CG  . TYR A 9   ? 1.1780 0.8223 0.6987 -0.1405 -0.1464 0.0549  9   TYR A CG  
79   C CD1 . TYR A 9   ? 1.1997 0.8761 0.7503 -0.1327 -0.1431 0.0566  9   TYR A CD1 
80   C CD2 . TYR A 9   ? 1.2202 0.8515 0.7176 -0.1504 -0.1704 0.0541  9   TYR A CD2 
81   C CE1 . TYR A 9   ? 1.3105 1.0057 0.8681 -0.1317 -0.1639 0.0560  9   TYR A CE1 
82   C CE2 . TYR A 9   ? 1.2525 0.9069 0.7604 -0.1509 -0.1910 0.0533  9   TYR A CE2 
83   C CZ  . TYR A 9   ? 1.3259 1.0125 0.8643 -0.1401 -0.1880 0.0536  9   TYR A CZ  
84   O OH  . TYR A 9   ? 1.3561 1.0659 0.9074 -0.1362 -0.2118 0.0495  9   TYR A OH  
85   N N   . VAL A 10  ? 1.0741 0.6234 0.5432 -0.1171 -0.0927 0.0324  10  VAL A N   
86   C CA  . VAL A 10  ? 1.0941 0.6387 0.5780 -0.1062 -0.0807 0.0218  10  VAL A CA  
87   C C   . VAL A 10  ? 1.2820 0.8255 0.7767 -0.1133 -0.1026 0.0248  10  VAL A C   
88   O O   . VAL A 10  ? 1.3584 0.8808 0.8267 -0.1268 -0.1244 0.0298  10  VAL A O   
89   C CB  . VAL A 10  ? 1.1284 0.6302 0.5699 -0.0960 -0.0695 0.0076  10  VAL A CB  
90   C CG1 . VAL A 10  ? 1.1368 0.6286 0.5916 -0.0832 -0.0697 -0.0062 10  VAL A CG1 
91   C CG2 . VAL A 10  ? 1.2866 0.7918 0.7204 -0.0901 -0.0392 0.0031  10  VAL A CG2 
92   N N   . VAL A 11  ? 1.0393 0.6027 0.5702 -0.1062 -0.0985 0.0223  11  VAL A N   
93   C CA  . VAL A 11  ? 1.2025 0.7510 0.7316 -0.1124 -0.1194 0.0251  11  VAL A CA  
94   C C   . VAL A 11  ? 1.2430 0.7665 0.7736 -0.0918 -0.1165 0.0092  11  VAL A C   
95   O O   . VAL A 11  ? 1.2347 0.7808 0.7971 -0.0749 -0.0970 -0.0017 11  VAL A O   
96   C CB  . VAL A 11  ? 1.1272 0.7160 0.6904 -0.1238 -0.1257 0.0372  11  VAL A CB  
97   C CG1 . VAL A 11  ? 0.9753 0.6029 0.5523 -0.1349 -0.1225 0.0461  11  VAL A CG1 
98   C CG2 . VAL A 11  ? 0.9773 0.5878 0.5783 -0.1070 -0.1141 0.0305  11  VAL A CG2 
99   N N   . GLU A 12  ? 1.1202 0.5963 0.6175 -0.0931 -0.1377 0.0061  12  GLU A N   
100  C CA  . GLU A 12  ? 1.2640 0.7101 0.7591 -0.0699 -0.1410 -0.0125 12  GLU A CA  
101  C C   . GLU A 12  ? 1.2660 0.7030 0.7728 -0.0695 -0.1621 -0.0077 12  GLU A C   
102  O O   . GLU A 12  ? 1.2646 0.6888 0.7529 -0.0929 -0.1817 0.0100  12  GLU A O   
103  C CB  . GLU A 12  ? 1.2172 0.6058 0.6606 -0.0676 -0.1544 -0.0217 12  GLU A CB  
104  C CG  . GLU A 12  ? 1.3917 0.7637 0.7993 -0.0953 -0.1695 -0.0053 12  GLU A CG  
105  C CD  . GLU A 12  ? 1.5071 0.8270 0.8633 -0.0910 -0.1777 -0.0169 12  GLU A CD  
106  O OE1 . GLU A 12  ? 1.5655 0.8324 0.8920 -0.0874 -0.2011 -0.0238 12  GLU A OE1 
107  O OE2 . GLU A 12  ? 1.4606 0.7871 0.8013 -0.0910 -0.1628 -0.0194 12  GLU A OE2 
108  N N   . LEU A 13  ? 1.1480 0.5922 0.6850 -0.0441 -0.1583 -0.0241 13  LEU A N   
109  C CA  . LEU A 13  ? 1.3446 0.7688 0.8843 -0.0397 -0.1831 -0.0215 13  LEU A CA  
110  C C   . LEU A 13  ? 1.3754 0.7797 0.9306 -0.0047 -0.1913 -0.0481 13  LEU A C   
111  O O   . LEU A 13  ? 1.4286 0.8684 1.0229 0.0167  -0.1675 -0.0690 13  LEU A O   
112  C CB  . LEU A 13  ? 1.1084 0.5800 0.6811 -0.0518 -0.1776 -0.0061 13  LEU A CB  
113  C CG  . LEU A 13  ? 1.1799 0.7150 0.8031 -0.0450 -0.1469 -0.0108 13  LEU A CG  
114  C CD1 . LEU A 13  ? 1.3437 0.8951 1.0096 -0.0151 -0.1393 -0.0342 13  LEU A CD1 
115  C CD2 . LEU A 13  ? 1.0601 0.6330 0.6997 -0.0639 -0.1460 0.0081  13  LEU A CD2 
116  N N   . ASP A 14  ? 1.4113 0.7578 0.9348 -0.0002 -0.2263 -0.0477 14  ASP A N   
117  C CA  . ASP A 14  ? 1.4582 0.7743 0.9898 0.0359  -0.2442 -0.0747 14  ASP A CA  
118  C C   . ASP A 14  ? 1.3840 0.7309 0.9624 0.0531  -0.2491 -0.0810 14  ASP A C   
119  O O   . ASP A 14  ? 1.3729 0.7331 0.9516 0.0334  -0.2540 -0.0589 14  ASP A O   
120  C CB  . ASP A 14  ? 1.6309 0.8585 1.0990 0.0332  -0.2858 -0.0705 14  ASP A CB  
121  C CG  . ASP A 14  ? 1.7838 0.9716 1.2511 0.0745  -0.3042 -0.1047 14  ASP A CG  
122  O OD1 . ASP A 14  ? 1.7668 0.9147 1.1990 0.0793  -0.3090 -0.1159 14  ASP A OD1 
123  O OD2 . ASP A 14  ? 1.8583 1.0551 1.3609 0.1037  -0.3158 -0.1227 14  ASP A OD2 
124  N N   . TRP A 15  ? 1.4406 0.8013 1.0597 0.0901  -0.2483 -0.1132 15  TRP A N   
125  C CA  . TRP A 15  ? 1.5899 0.9859 1.2614 0.1087  -0.2534 -0.1234 15  TRP A CA  
126  C C   . TRP A 15  ? 1.8079 1.1463 1.4605 0.1302  -0.3008 -0.1304 15  TRP A C   
127  O O   . TRP A 15  ? 1.8431 1.2062 1.5450 0.1594  -0.3092 -0.1528 15  TRP A O   
128  C CB  . TRP A 15  ? 1.6553 1.1196 1.3989 0.1329  -0.2206 -0.1550 15  TRP A CB  
129  C CG  . TRP A 15  ? 1.8468 1.3815 1.6340 0.1141  -0.1859 -0.1431 15  TRP A CG  
130  C CD1 . TRP A 15  ? 1.8664 1.4656 1.7126 0.1216  -0.1495 -0.1624 15  TRP A CD1 
131  C CD2 . TRP A 15  ? 1.9778 1.5234 1.7512 0.0840  -0.1849 -0.1104 15  TRP A CD2 
132  N NE1 . TRP A 15  ? 1.8667 1.5088 1.7336 0.0988  -0.1294 -0.1425 15  TRP A NE1 
133  C CE2 . TRP A 15  ? 1.9174 1.5297 1.7421 0.0778  -0.1507 -0.1121 15  TRP A CE2 
134  C CE3 . TRP A 15  ? 2.0236 1.5301 1.7463 0.0607  -0.2085 -0.0812 15  TRP A CE3 
135  C CZ2 . TRP A 15  ? 1.8801 1.5188 1.7072 0.0539  -0.1428 -0.0876 15  TRP A CZ2 
136  C CZ3 . TRP A 15  ? 1.8969 1.4380 1.6257 0.0360  -0.1966 -0.0583 15  TRP A CZ3 
137  C CH2 . TRP A 15  ? 1.8518 1.4572 1.6327 0.0351  -0.1657 -0.0624 15  TRP A CH2 
138  N N   . TYR A 16  ? 1.9396 1.1993 1.5202 0.1152  -0.3337 -0.1114 16  TYR A N   
139  C CA  . TYR A 16  ? 2.0559 1.2509 1.6053 0.1289  -0.3815 -0.1104 16  TYR A CA  
140  C C   . TYR A 16  ? 2.0647 1.2727 1.6065 0.1041  -0.3852 -0.0820 16  TYR A C   
141  O O   . TYR A 16  ? 2.0092 1.2264 1.5231 0.0640  -0.3695 -0.0518 16  TYR A O   
142  C CB  . TYR A 16  ? 2.2053 1.2992 1.6758 0.1247  -0.4198 -0.1041 16  TYR A CB  
143  C CG  . TYR A 16  ? 2.2730 1.3338 1.6803 0.0751  -0.4169 -0.0675 16  TYR A CG  
144  C CD1 . TYR A 16  ? 2.2528 1.3461 1.6634 0.0555  -0.3842 -0.0633 16  TYR A CD1 
145  C CD2 . TYR A 16  ? 2.2998 1.2935 1.6414 0.0473  -0.4487 -0.0386 16  TYR A CD2 
146  C CE1 . TYR A 16  ? 2.2017 1.2693 1.5614 0.0111  -0.3843 -0.0333 16  TYR A CE1 
147  C CE2 . TYR A 16  ? 2.2445 1.2142 1.5342 -0.0008 -0.4448 -0.0077 16  TYR A CE2 
148  C CZ  . TYR A 16  ? 2.1366 1.1465 1.4400 -0.0176 -0.4134 -0.0064 16  TYR A CZ  
149  O OH  . TYR A 16  ? 1.9652 0.9575 1.2249 -0.0646 -0.4115 0.0211  16  TYR A OH  
150  N N   . PRO A 17  ? 2.1062 1.3175 1.6747 0.1295  -0.4068 -0.0945 17  PRO A N   
151  C CA  . PRO A 17  ? 2.0226 1.2612 1.5989 0.1148  -0.4063 -0.0761 17  PRO A CA  
152  C C   . PRO A 17  ? 1.9741 1.1732 1.4773 0.0690  -0.4121 -0.0359 17  PRO A C   
153  O O   . PRO A 17  ? 1.8579 1.1108 1.3745 0.0414  -0.3832 -0.0175 17  PRO A O   
154  C CB  . PRO A 17  ? 2.0345 1.2356 1.6163 0.1525  -0.4501 -0.0961 17  PRO A CB  
155  C CG  . PRO A 17  ? 2.0138 1.2180 1.6369 0.1941  -0.4554 -0.1357 17  PRO A CG  
156  C CD  . PRO A 17  ? 2.0783 1.2552 1.6629 0.1770  -0.4412 -0.1291 17  PRO A CD  
157  N N   . ASP A 18  ? 1.9876 1.0933 1.4148 0.0609  -0.4493 -0.0242 18  ASP A N   
158  C CA  . ASP A 18  ? 1.9182 0.9798 1.2708 0.0137  -0.4563 0.0131  18  ASP A CA  
159  C C   . ASP A 18  ? 1.8071 0.8762 1.1411 -0.0211 -0.4321 0.0277  18  ASP A C   
160  O O   . ASP A 18  ? 1.8643 0.8629 1.1286 -0.0490 -0.4520 0.0464  18  ASP A O   
161  C CB  . ASP A 18  ? 2.0265 0.9756 1.2988 0.0167  -0.5096 0.0210  18  ASP A CB  
162  C CG  . ASP A 18  ? 2.1709 1.0636 1.4420 0.0580  -0.5408 -0.0082 18  ASP A CG  
163  O OD1 . ASP A 18  ? 2.2734 1.1742 1.5556 0.0584  -0.5250 -0.0180 18  ASP A OD1 
164  O OD2 . ASP A 18  ? 2.1592 0.9992 1.4176 0.0920  -0.5828 -0.0231 18  ASP A OD2 
165  N N   . ALA A 19  ? 1.5735 0.7251 0.9680 -0.0201 -0.3912 0.0189  19  ALA A N   
166  C CA  . ALA A 19  ? 1.4570 0.6252 0.8409 -0.0505 -0.3680 0.0309  19  ALA A CA  
167  C C   . ALA A 19  ? 1.5693 0.8173 0.9846 -0.0773 -0.3333 0.0467  19  ALA A C   
168  O O   . ALA A 19  ? 1.5939 0.8991 1.0596 -0.0615 -0.3178 0.0387  19  ALA A O   
169  C CB  . ALA A 19  ? 1.4859 0.6721 0.9044 -0.0240 -0.3530 0.0051  19  ALA A CB  
170  N N   . PRO A 20  ? 1.5593 0.8125 0.9479 -0.1169 -0.3226 0.0668  20  PRO A N   
171  C CA  . PRO A 20  ? 1.4292 0.7546 0.8429 -0.1436 -0.2941 0.0810  20  PRO A CA  
172  C C   . PRO A 20  ? 1.4019 0.7990 0.8753 -0.1304 -0.2618 0.0682  20  PRO A C   
173  O O   . PRO A 20  ? 1.4417 0.8364 0.9368 -0.1030 -0.2569 0.0488  20  PRO A O   
174  C CB  . PRO A 20  ? 1.3924 0.6926 0.7577 -0.1888 -0.2986 0.1021  20  PRO A CB  
175  C CG  . PRO A 20  ? 1.5286 0.7342 0.8366 -0.1875 -0.3320 0.1020  20  PRO A CG  
176  C CD  . PRO A 20  ? 1.5507 0.7398 0.8842 -0.1383 -0.3401 0.0752  20  PRO A CD  
177  N N   . GLY A 21  ? 1.3781 0.8371 0.8747 -0.1505 -0.2402 0.0785  21  GLY A N   
178  C CA  . GLY A 21  ? 1.2762 0.7931 0.8153 -0.1460 -0.2135 0.0715  21  GLY A CA  
179  C C   . GLY A 21  ? 1.2742 0.7944 0.7908 -0.1786 -0.2114 0.0839  21  GLY A C   
180  O O   . GLY A 21  ? 1.4511 0.9307 0.9233 -0.2049 -0.2285 0.0967  21  GLY A O   
181  N N   . GLU A 22  ? 1.1111 0.6771 0.6567 -0.1781 -0.1925 0.0800  22  GLU A N   
182  C CA  . GLU A 22  ? 1.1656 0.7396 0.6967 -0.2057 -0.1932 0.0881  22  GLU A CA  
183  C C   . GLU A 22  ? 1.1801 0.8234 0.7419 -0.2222 -0.1798 0.0942  22  GLU A C   
184  O O   . GLU A 22  ? 1.2315 0.9196 0.8319 -0.2044 -0.1647 0.0877  22  GLU A O   
185  C CB  . GLU A 22  ? 1.1377 0.7012 0.6688 -0.1917 -0.1877 0.0772  22  GLU A CB  
186  C CG  . GLU A 22  ? 1.2373 0.8139 0.7594 -0.2154 -0.1903 0.0826  22  GLU A CG  
187  C CD  . GLU A 22  ? 1.3727 0.9119 0.8719 -0.2043 -0.1934 0.0730  22  GLU A CD  
188  O OE1 . GLU A 22  ? 1.4346 0.9277 0.9151 -0.1842 -0.1971 0.0633  22  GLU A OE1 
189  O OE2 . GLU A 22  ? 1.2895 0.8459 0.7887 -0.2143 -0.1934 0.0735  22  GLU A OE2 
190  N N   . MET A 23  ? 1.1460 0.7985 0.6916 -0.2567 -0.1856 0.1052  23  MET A N   
191  C CA  . MET A 23  ? 1.0897 0.8141 0.6675 -0.2724 -0.1733 0.1071  23  MET A CA  
192  C C   . MET A 23  ? 0.9695 0.7247 0.5683 -0.2729 -0.1705 0.1004  23  MET A C   
193  O O   . MET A 23  ? 1.3970 1.1458 0.9809 -0.2978 -0.1803 0.1038  23  MET A O   
194  C CB  . MET A 23  ? 1.1665 0.8962 0.7213 -0.3123 -0.1775 0.1199  23  MET A CB  
195  C CG  . MET A 23  ? 0.9962 0.8040 0.5856 -0.3341 -0.1661 0.1176  23  MET A CG  
196  S SD  . MET A 23  ? 1.5297 1.3480 1.0921 -0.3892 -0.1665 0.1312  23  MET A SD  
197  C CE  . MET A 23  ? 2.4000 2.2121 1.9425 -0.3859 -0.1589 0.1386  23  MET A CE  
198  N N   . VAL A 24  ? 0.9243 0.7099 0.5559 -0.2460 -0.1595 0.0909  24  VAL A N   
199  C CA  . VAL A 24  ? 0.9111 0.7162 0.5559 -0.2418 -0.1604 0.0844  24  VAL A CA  
200  C C   . VAL A 24  ? 0.9476 0.8251 0.6335 -0.2452 -0.1552 0.0797  24  VAL A C   
201  O O   . VAL A 24  ? 0.9258 0.8393 0.6367 -0.2369 -0.1451 0.0777  24  VAL A O   
202  C CB  . VAL A 24  ? 0.9032 0.6813 0.5460 -0.2113 -0.1539 0.0770  24  VAL A CB  
203  C CG1 . VAL A 24  ? 1.0864 0.8468 0.7331 -0.1920 -0.1448 0.0752  24  VAL A CG1 
204  C CG2 . VAL A 24  ? 0.8693 0.6882 0.5406 -0.1986 -0.1485 0.0709  24  VAL A CG2 
205  N N   . VAL A 25  ? 1.0273 0.9253 0.7203 -0.2556 -0.1645 0.0755  25  VAL A N   
206  C CA  . VAL A 25  ? 1.0374 1.0064 0.7726 -0.2569 -0.1639 0.0667  25  VAL A CA  
207  C C   . VAL A 25  ? 1.0299 1.0005 0.7757 -0.2321 -0.1706 0.0577  25  VAL A C   
208  O O   . VAL A 25  ? 1.1326 1.0771 0.8593 -0.2346 -0.1843 0.0562  25  VAL A O   
209  C CB  . VAL A 25  ? 1.0620 1.0651 0.8049 -0.2920 -0.1722 0.0663  25  VAL A CB  
210  C CG1 . VAL A 25  ? 1.0416 1.1256 0.8355 -0.2897 -0.1727 0.0519  25  VAL A CG1 
211  C CG2 . VAL A 25  ? 1.1223 1.1180 0.8460 -0.3210 -0.1649 0.0776  25  VAL A CG2 
212  N N   . LEU A 26  ? 0.8719 0.8674 0.6430 -0.2085 -0.1629 0.0519  26  LEU A N   
213  C CA  . LEU A 26  ? 0.8295 0.8179 0.6037 -0.1849 -0.1703 0.0452  26  LEU A CA  
214  C C   . LEU A 26  ? 0.9897 1.0365 0.7995 -0.1842 -0.1848 0.0324  26  LEU A C   
215  O O   . LEU A 26  ? 1.0218 1.1278 0.8700 -0.1837 -0.1800 0.0244  26  LEU A O   
216  C CB  . LEU A 26  ? 0.8186 0.7986 0.6008 -0.1611 -0.1574 0.0451  26  LEU A CB  
217  C CG  . LEU A 26  ? 0.9352 0.8690 0.6945 -0.1583 -0.1427 0.0531  26  LEU A CG  
218  C CD1 . LEU A 26  ? 0.9128 0.8478 0.6890 -0.1374 -0.1308 0.0506  26  LEU A CD1 
219  C CD2 . LEU A 26  ? 0.9136 0.7884 0.6306 -0.1593 -0.1454 0.0569  26  LEU A CD2 
220  N N   . THR A 27  ? 1.1635 1.1938 0.9602 -0.1826 -0.2039 0.0283  27  THR A N   
221  C CA  . THR A 27  ? 1.1721 1.2555 1.0048 -0.1770 -0.2233 0.0127  27  THR A CA  
222  C C   . THR A 27  ? 1.2045 1.2646 1.0304 -0.1449 -0.2343 0.0078  27  THR A C   
223  O O   . THR A 27  ? 1.3227 1.3166 1.1050 -0.1348 -0.2304 0.0178  27  THR A O   
224  C CB  . THR A 27  ? 1.1848 1.2675 1.0104 -0.1955 -0.2440 0.0087  27  THR A CB  
225  O OG1 . THR A 27  ? 0.8523 0.9216 0.6609 -0.2266 -0.2341 0.0193  27  THR A OG1 
226  C CG2 . THR A 27  ? 0.8265 0.9900 0.7081 -0.1969 -0.2601 -0.0112 27  THR A CG2 
227  N N   . CYS A 28  ? 1.1720 1.2858 1.0398 -0.1295 -0.2477 -0.0085 28  CYS A N   
228  C CA  . CYS A 28  ? 1.2206 1.3077 1.0795 -0.0988 -0.2628 -0.0135 28  CYS A CA  
229  C C   . CYS A 28  ? 1.3602 1.4277 1.2037 -0.0896 -0.2962 -0.0216 28  CYS A C   
230  O O   . CYS A 28  ? 1.3619 1.4811 1.2392 -0.0975 -0.3137 -0.0360 28  CYS A O   
231  C CB  . CYS A 28  ? 1.1078 1.2541 1.0163 -0.0808 -0.2628 -0.0287 28  CYS A CB  
232  S SG  . CYS A 28  ? 1.3265 1.4237 1.2159 -0.0447 -0.2787 -0.0308 28  CYS A SG  
233  N N   . ASP A 29  ? 1.4705 1.4627 1.2615 -0.0740 -0.3053 -0.0128 29  ASP A N   
234  C CA  . ASP A 29  ? 1.5213 1.4773 1.2821 -0.0630 -0.3396 -0.0182 29  ASP A CA  
235  C C   . ASP A 29  ? 1.4296 1.4253 1.2295 -0.0365 -0.3709 -0.0391 29  ASP A C   
236  O O   . ASP A 29  ? 1.4528 1.3963 1.2194 -0.0131 -0.3902 -0.0382 29  ASP A O   
237  C CB  . ASP A 29  ? 1.5990 1.4573 1.2829 -0.0565 -0.3357 -0.0010 29  ASP A CB  
238  C CG  . ASP A 29  ? 1.7011 1.5075 1.3351 -0.0528 -0.3666 -0.0021 29  ASP A CG  
239  O OD1 . ASP A 29  ? 1.7611 1.6095 1.4260 -0.0541 -0.3940 -0.0173 29  ASP A OD1 
240  O OD2 . ASP A 29  ? 1.7250 1.4499 1.2885 -0.0497 -0.3632 0.0113  29  ASP A OD2 
241  N N   . THR A 30  ? 1.3184 1.4056 1.1876 -0.0406 -0.3761 -0.0588 30  THR A N   
242  C CA  . THR A 30  ? 1.2558 1.3949 1.1738 -0.0127 -0.4048 -0.0845 30  THR A CA  
243  C C   . THR A 30  ? 1.2752 1.5025 1.2562 -0.0214 -0.4224 -0.1090 30  THR A C   
244  O O   . THR A 30  ? 1.1534 1.4210 1.1538 -0.0542 -0.4021 -0.1057 30  THR A O   
245  C CB  . THR A 30  ? 1.2123 1.3916 1.1672 -0.0003 -0.3852 -0.0904 30  THR A CB  
246  O OG1 . THR A 30  ? 1.2208 1.4678 1.2343 0.0255  -0.4121 -0.1211 30  THR A OG1 
247  C CG2 . THR A 30  ? 1.1387 1.3696 1.1209 -0.0300 -0.3453 -0.0837 30  THR A CG2 
248  N N   . PRO A 31  ? 1.5361 1.7925 1.5492 0.0077  -0.4620 -0.1349 31  PRO A N   
249  C CA  . PRO A 31  ? 1.5796 1.9324 1.6657 0.0042  -0.4820 -0.1651 31  PRO A CA  
250  C C   . PRO A 31  ? 1.5547 2.0175 1.7184 -0.0017 -0.4562 -0.1845 31  PRO A C   
251  O O   . PRO A 31  ? 1.5084 2.0457 1.7161 -0.0340 -0.4385 -0.1917 31  PRO A O   
252  C CB  . PRO A 31  ? 1.6544 1.9886 1.7425 0.0466  -0.5356 -0.1871 31  PRO A CB  
253  C CG  . PRO A 31  ? 1.7185 1.9266 1.7143 0.0625  -0.5437 -0.1610 31  PRO A CG  
254  C CD  . PRO A 31  ? 1.6865 1.8731 1.6599 0.0454  -0.4946 -0.1363 31  PRO A CD  
255  N N   . GLU A 32  ? 1.6058 2.0755 1.7822 0.0277  -0.4543 -0.1930 32  GLU A N   
256  C CA  . GLU A 32  ? 1.6249 2.1967 1.8703 0.0271  -0.4313 -0.2145 32  GLU A CA  
257  C C   . GLU A 32  ? 1.4921 2.0618 1.7188 -0.0052 -0.3812 -0.1900 32  GLU A C   
258  O O   . GLU A 32  ? 1.4692 1.9522 1.6333 -0.0099 -0.3671 -0.1603 32  GLU A O   
259  C CB  . GLU A 32  ? 1.7463 2.3259 2.0130 0.0743  -0.4532 -0.2371 32  GLU A CB  
260  C CG  . GLU A 32  ? 1.8584 2.3257 2.0538 0.0942  -0.4575 -0.2126 32  GLU A CG  
261  C CD  . GLU A 32  ? 1.9610 2.4260 2.1738 0.1420  -0.4896 -0.2368 32  GLU A CD  
262  O OE1 . GLU A 32  ? 1.9489 2.5107 2.2350 0.1603  -0.5001 -0.2739 32  GLU A OE1 
263  O OE2 . GLU A 32  ? 2.0429 2.4094 2.1957 0.1606  -0.5046 -0.2200 32  GLU A OE2 
264  N N   . GLU A 33  ? 1.4421 2.1086 1.7229 -0.0277 -0.3551 -0.2041 33  GLU A N   
265  C CA  . GLU A 33  ? 1.5009 2.1667 1.7613 -0.0635 -0.3112 -0.1813 33  GLU A CA  
266  C C   . GLU A 33  ? 1.4564 2.1848 1.7510 -0.0543 -0.2875 -0.1959 33  GLU A C   
267  O O   . GLU A 33  ? 1.4489 2.2069 1.7423 -0.0853 -0.2527 -0.1865 33  GLU A O   
268  C CB  . GLU A 33  ? 1.5490 2.2579 1.8242 -0.1102 -0.2980 -0.1780 33  GLU A CB  
269  C CG  . GLU A 33  ? 1.5922 2.2482 1.8401 -0.1174 -0.3263 -0.1697 33  GLU A CG  
270  C CD  . GLU A 33  ? 1.5743 2.2825 1.8480 -0.1622 -0.3199 -0.1729 33  GLU A CD  
271  O OE1 . GLU A 33  ? 1.5680 2.3734 1.8968 -0.1834 -0.2994 -0.1901 33  GLU A OE1 
272  O OE2 . GLU A 33  ? 1.5799 2.2310 1.8169 -0.1776 -0.3350 -0.1586 33  GLU A OE2 
273  N N   . ASP A 34  ? 1.3786 2.1200 1.6974 -0.0108 -0.3088 -0.2190 34  ASP A N   
274  C CA  . ASP A 34  ? 1.2297 2.0326 1.5833 0.0043  -0.2916 -0.2388 34  ASP A CA  
275  C C   . ASP A 34  ? 1.0908 1.8249 1.3946 0.0069  -0.2710 -0.2137 34  ASP A C   
276  O O   . ASP A 34  ? 1.1026 1.7830 1.3602 -0.0222 -0.2498 -0.1821 34  ASP A O   
277  C CB  . ASP A 34  ? 1.3716 2.2144 1.7726 0.0529  -0.3269 -0.2771 34  ASP A CB  
278  C CG  . ASP A 34  ? 1.4902 2.4023 1.9464 0.0551  -0.3532 -0.3060 34  ASP A CG  
279  O OD1 . ASP A 34  ? 1.4557 2.4782 1.9836 0.0640  -0.3511 -0.3444 34  ASP A OD1 
280  O OD2 . ASP A 34  ? 1.5272 2.3863 1.9566 0.0481  -0.3762 -0.2922 34  ASP A OD2 
281  N N   . GLY A 35  ? 1.0358 1.7713 1.3511 0.0434  -0.2799 -0.2299 35  GLY A N   
282  C CA  . GLY A 35  ? 1.0221 1.7116 1.3038 0.0466  -0.2604 -0.2133 35  GLY A CA  
283  C C   . GLY A 35  ? 1.0116 1.5861 1.2310 0.0483  -0.2655 -0.1805 35  GLY A C   
284  O O   . GLY A 35  ? 0.9375 1.4621 1.1422 0.0777  -0.2824 -0.1819 35  GLY A O   
285  N N   . ILE A 36  ? 1.0437 1.5762 1.2263 0.0157  -0.2502 -0.1520 36  ILE A N   
286  C CA  . ILE A 36  ? 1.0829 1.5156 1.2094 0.0137  -0.2487 -0.1227 36  ILE A CA  
287  C C   . ILE A 36  ? 1.0411 1.4578 1.1476 -0.0053 -0.2172 -0.1044 36  ILE A C   
288  O O   . ILE A 36  ? 1.0151 1.4869 1.1384 -0.0250 -0.1965 -0.1080 36  ILE A O   
289  C CB  . ILE A 36  ? 1.1654 1.5520 1.2592 -0.0047 -0.2563 -0.1053 36  ILE A CB  
290  C CG1 . ILE A 36  ? 1.2467 1.6513 1.3331 -0.0439 -0.2302 -0.0909 36  ILE A CG1 
291  C CG2 . ILE A 36  ? 1.1922 1.6083 1.3111 0.0094  -0.2886 -0.1260 36  ILE A CG2 
292  C CD1 . ILE A 36  ? 1.3120 1.8141 1.4470 -0.0594 -0.2213 -0.1106 36  ILE A CD1 
293  N N   . THR A 37  ? 0.9466 1.2871 1.0161 -0.0002 -0.2145 -0.0855 37  THR A N   
294  C CA  . THR A 37  ? 0.7695 1.0893 0.8224 -0.0130 -0.1901 -0.0704 37  THR A CA  
295  C C   . THR A 37  ? 0.8686 1.1073 0.8782 -0.0218 -0.1850 -0.0460 37  THR A C   
296  O O   . THR A 37  ? 0.9484 1.1403 0.9372 -0.0127 -0.2000 -0.0416 37  THR A O   
297  C CB  . THR A 37  ? 0.8207 1.1493 0.8900 0.0102  -0.1909 -0.0826 37  THR A CB  
298  O OG1 . THR A 37  ? 0.8017 1.0785 0.8604 0.0342  -0.2117 -0.0838 37  THR A OG1 
299  C CG2 . THR A 37  ? 0.9751 1.3885 1.0867 0.0203  -0.1929 -0.1101 37  THR A CG2 
300  N N   . TRP A 38  ? 0.8551 1.0766 0.8493 -0.0387 -0.1644 -0.0317 38  TRP A N   
301  C CA  . TRP A 38  ? 0.8598 1.0143 0.8184 -0.0475 -0.1566 -0.0125 38  TRP A CA  
302  C C   . TRP A 38  ? 0.8418 0.9642 0.7976 -0.0392 -0.1466 -0.0076 38  TRP A C   
303  O O   . TRP A 38  ? 0.8468 0.9975 0.8241 -0.0313 -0.1437 -0.0161 38  TRP A O   
304  C CB  . TRP A 38  ? 0.9187 1.0705 0.8595 -0.0737 -0.1452 -0.0008 38  TRP A CB  
305  C CG  . TRP A 38  ? 0.8751 1.0454 0.8142 -0.0856 -0.1561 -0.0034 38  TRP A CG  
306  C CD1 . TRP A 38  ? 0.8747 1.1105 0.8437 -0.0912 -0.1620 -0.0173 38  TRP A CD1 
307  C CD2 . TRP A 38  ? 1.0022 1.1280 0.9101 -0.0939 -0.1628 0.0060  38  TRP A CD2 
308  N NE1 . TRP A 38  ? 1.0086 1.2443 0.9710 -0.1032 -0.1736 -0.0171 38  TRP A NE1 
309  C CE2 . TRP A 38  ? 1.0573 1.2226 0.9792 -0.1043 -0.1756 -0.0024 38  TRP A CE2 
310  C CE3 . TRP A 38  ? 1.0069 1.0659 0.8769 -0.0937 -0.1585 0.0188  38  TRP A CE3 
311  C CZ2 . TRP A 38  ? 1.0270 1.1618 0.9237 -0.1136 -0.1874 0.0025  38  TRP A CZ2 
312  C CZ3 . TRP A 38  ? 1.0158 1.0444 0.8570 -0.1023 -0.1680 0.0235  38  TRP A CZ3 
313  C CH2 . TRP A 38  ? 0.9896 1.0534 0.8430 -0.1117 -0.1839 0.0158  38  TRP A CH2 
314  N N   . THR A 39  ? 0.8035 0.8689 0.7334 -0.0419 -0.1410 0.0046  39  THR A N   
315  C CA  . THR A 39  ? 0.7896 0.8255 0.7212 -0.0365 -0.1311 0.0079  39  THR A CA  
316  C C   . THR A 39  ? 0.7790 0.7711 0.6845 -0.0492 -0.1166 0.0206  39  THR A C   
317  O O   . THR A 39  ? 0.9148 0.8943 0.7971 -0.0593 -0.1173 0.0264  39  THR A O   
318  C CB  . THR A 39  ? 0.9180 0.9297 0.8496 -0.0204 -0.1434 0.0035  39  THR A CB  
319  O OG1 . THR A 39  ? 0.9095 0.9199 0.8608 -0.0131 -0.1387 -0.0007 39  THR A OG1 
320  C CG2 . THR A 39  ? 0.8668 0.8191 0.7606 -0.0260 -0.1418 0.0152  39  THR A CG2 
321  N N   . LEU A 40  ? 0.7649 0.7366 0.6765 -0.0484 -0.1039 0.0224  40  LEU A N   
322  C CA  . LEU A 40  ? 0.8307 0.7672 0.7232 -0.0578 -0.0883 0.0298  40  LEU A CA  
323  C C   . LEU A 40  ? 0.8244 0.7318 0.7198 -0.0562 -0.0769 0.0301  40  LEU A C   
324  O O   . LEU A 40  ? 0.8046 0.7244 0.7282 -0.0499 -0.0770 0.0242  40  LEU A O   
325  C CB  . LEU A 40  ? 0.8773 0.8269 0.7799 -0.0625 -0.0815 0.0291  40  LEU A CB  
326  C CG  . LEU A 40  ? 0.8712 0.7889 0.7603 -0.0676 -0.0670 0.0316  40  LEU A CG  
327  C CD1 . LEU A 40  ? 0.9227 0.8203 0.7761 -0.0769 -0.0692 0.0378  40  LEU A CD1 
328  C CD2 . LEU A 40  ? 0.6596 0.5863 0.5689 -0.0645 -0.0641 0.0266  40  LEU A CD2 
329  N N   . ASP A 41  ? 0.8136 0.6821 0.6783 -0.0638 -0.0661 0.0364  41  ASP A N   
330  C CA  . ASP A 41  ? 0.8939 0.7339 0.7562 -0.0681 -0.0519 0.0377  41  ASP A CA  
331  C C   . ASP A 41  ? 0.9420 0.7783 0.8134 -0.0609 -0.0660 0.0363  41  ASP A C   
332  O O   . ASP A 41  ? 0.9878 0.8189 0.8424 -0.0536 -0.0859 0.0375  41  ASP A O   
333  C CB  . ASP A 41  ? 0.9213 0.7753 0.8168 -0.0704 -0.0338 0.0308  41  ASP A CB  
334  C CG  . ASP A 41  ? 1.2168 1.0636 1.0994 -0.0754 -0.0193 0.0298  41  ASP A CG  
335  O OD1 . ASP A 41  ? 1.2904 1.1088 1.1314 -0.0814 -0.0157 0.0360  41  ASP A OD1 
336  O OD2 . ASP A 41  ? 1.3249 1.1915 1.2372 -0.0715 -0.0141 0.0215  41  ASP A OD2 
337  N N   . GLN A 42  ? 0.8204 0.6598 0.7207 -0.0618 -0.0582 0.0317  42  GLN A N   
338  C CA  . GLN A 42  ? 0.9820 0.8069 0.8868 -0.0566 -0.0719 0.0303  42  GLN A CA  
339  C C   . GLN A 42  ? 1.0683 0.9333 1.0116 -0.0407 -0.0891 0.0188  42  GLN A C   
340  O O   . GLN A 42  ? 1.1717 1.0267 1.1214 -0.0327 -0.1039 0.0144  42  GLN A O   
341  C CB  . GLN A 42  ? 1.2255 1.0202 1.1319 -0.0716 -0.0536 0.0330  42  GLN A CB  
342  C CG  . GLN A 42  ? 1.3318 1.1466 1.2655 -0.0815 -0.0273 0.0280  42  GLN A CG  
343  C CD  . GLN A 42  ? 1.3997 1.2543 1.3884 -0.0731 -0.0317 0.0154  42  GLN A CD  
344  O OE1 . GLN A 42  ? 1.4671 1.3459 1.4838 -0.0738 -0.0193 0.0078  42  GLN A OE1 
345  N NE2 . GLN A 42  ? 1.4203 1.2794 1.4230 -0.0630 -0.0520 0.0112  42  GLN A NE2 
346  N N   . SER A 43  ? 1.0419 0.9478 1.0053 -0.0365 -0.0879 0.0136  43  SER A N   
347  C CA  . SER A 43  ? 0.9214 0.8668 0.9136 -0.0230 -0.1016 0.0025  43  SER A CA  
348  C C   . SER A 43  ? 0.9033 0.8638 0.8868 -0.0107 -0.1215 -0.0021 43  SER A C   
349  O O   . SER A 43  ? 0.8820 0.8352 0.8411 -0.0136 -0.1250 0.0035  43  SER A O   
350  C CB  . SER A 43  ? 0.8733 0.8490 0.8768 -0.0253 -0.0949 0.0008  43  SER A CB  
351  O OG  . SER A 43  ? 0.9780 0.9894 1.0002 -0.0145 -0.1063 -0.0090 43  SER A OG  
352  N N   . SER A 44  ? 0.9081 0.8916 0.9133 0.0043  -0.1358 -0.0147 44  SER A N   
353  C CA  . SER A 44  ? 0.8510 0.8566 0.8561 0.0199  -0.1555 -0.0248 44  SER A CA  
354  C C   . SER A 44  ? 0.8690 0.9331 0.8884 0.0220  -0.1540 -0.0332 44  SER A C   
355  O O   . SER A 44  ? 0.7985 0.8961 0.8246 0.0331  -0.1664 -0.0446 44  SER A O   
356  C CB  . SER A 44  ? 0.9053 0.9015 0.9238 0.0375  -0.1733 -0.0373 44  SER A CB  
357  O OG  . SER A 44  ? 1.0688 1.0203 1.0856 0.0289  -0.1675 -0.0305 44  SER A OG  
358  N N   . GLU A 45  ? 0.8572 0.9329 0.8804 0.0108  -0.1394 -0.0284 45  GLU A N   
359  C CA  . GLU A 45  ? 0.7863 0.9095 0.8156 0.0091  -0.1368 -0.0346 45  GLU A CA  
360  C C   . GLU A 45  ? 0.8471 0.9905 0.8621 -0.0040 -0.1330 -0.0290 45  GLU A C   
361  O O   . GLU A 45  ? 1.0662 1.1834 1.0625 -0.0182 -0.1253 -0.0156 45  GLU A O   
362  C CB  . GLU A 45  ? 0.8359 0.9542 0.8673 0.0025  -0.1275 -0.0309 45  GLU A CB  
363  C CG  . GLU A 45  ? 0.9010 1.0016 0.9515 0.0131  -0.1321 -0.0377 45  GLU A CG  
364  C CD  . GLU A 45  ? 0.9230 1.0284 0.9790 0.0116  -0.1296 -0.0395 45  GLU A CD  
365  O OE1 . GLU A 45  ? 0.8833 1.0122 0.9252 0.0069  -0.1281 -0.0391 45  GLU A OE1 
366  O OE2 . GLU A 45  ? 0.9996 1.0840 1.0728 0.0142  -0.1302 -0.0417 45  GLU A OE2 
367  N N   . VAL A 46  ? 0.7326 0.9254 0.7585 0.0007  -0.1386 -0.0414 46  VAL A N   
368  C CA  . VAL A 46  ? 0.7830 1.0063 0.8023 -0.0147 -0.1350 -0.0392 46  VAL A CA  
369  C C   . VAL A 46  ? 0.8148 1.0311 0.8134 -0.0378 -0.1212 -0.0252 46  VAL A C   
370  O O   . VAL A 46  ? 0.7792 1.0013 0.7748 -0.0398 -0.1154 -0.0256 46  VAL A O   
371  C CB  . VAL A 46  ? 0.7720 1.0627 0.8142 -0.0071 -0.1391 -0.0593 46  VAL A CB  
372  C CG1 . VAL A 46  ? 0.7000 1.0301 0.7356 -0.0325 -0.1272 -0.0558 46  VAL A CG1 
373  C CG2 . VAL A 46  ? 0.7295 1.0292 0.7886 0.0123  -0.1578 -0.0729 46  VAL A CG2 
374  N N   . LEU A 47  ? 0.7690 0.9679 0.7496 -0.0542 -0.1190 -0.0136 47  LEU A N   
375  C CA  . LEU A 47  ? 0.7375 0.9231 0.6941 -0.0763 -0.1101 -0.0007 47  LEU A CA  
376  C C   . LEU A 47  ? 0.7801 1.0125 0.7354 -0.0957 -0.1072 -0.0034 47  LEU A C   
377  O O   . LEU A 47  ? 0.8323 1.0637 0.7665 -0.1157 -0.1001 0.0048  47  LEU A O   
378  C CB  . LEU A 47  ? 0.7634 0.8982 0.6982 -0.0834 -0.1096 0.0122  47  LEU A CB  
379  C CG  . LEU A 47  ? 0.7826 0.8744 0.7186 -0.0691 -0.1077 0.0144  47  LEU A CG  
380  C CD1 . LEU A 47  ? 0.6287 0.6754 0.5397 -0.0787 -0.1023 0.0254  47  LEU A CD1 
381  C CD2 . LEU A 47  ? 0.8440 0.9386 0.7945 -0.0595 -0.1050 0.0097  47  LEU A CD2 
382  N N   . GLY A 48  ? 0.7934 1.0658 0.7709 -0.0908 -0.1138 -0.0155 48  GLY A N   
383  C CA  . GLY A 48  ? 0.9401 1.2664 0.9255 -0.1112 -0.1101 -0.0213 48  GLY A CA  
384  C C   . GLY A 48  ? 0.9055 1.2691 0.9207 -0.1002 -0.1230 -0.0370 48  GLY A C   
385  O O   . GLY A 48  ? 0.8435 1.1832 0.8660 -0.0759 -0.1367 -0.0417 48  GLY A O   
386  N N   . SER A 49  ? 0.8734 1.2947 0.9053 -0.1191 -0.1199 -0.0458 49  SER A N   
387  C CA  . SER A 49  ? 0.9059 1.3733 0.9740 -0.1067 -0.1350 -0.0656 49  SER A CA  
388  C C   . SER A 49  ? 1.0651 1.5520 1.1349 -0.1354 -0.1370 -0.0627 49  SER A C   
389  O O   . SER A 49  ? 1.1160 1.5914 1.1606 -0.1681 -0.1237 -0.0471 49  SER A O   
390  C CB  . SER A 49  ? 0.9174 1.4629 1.0261 -0.0921 -0.1315 -0.0924 49  SER A CB  
391  O OG  . SER A 49  ? 0.9125 1.4357 1.0181 -0.0655 -0.1324 -0.0959 49  SER A OG  
392  N N   . GLY A 50  ? 1.1267 1.6391 1.2246 -0.1228 -0.1568 -0.0783 50  GLY A N   
393  C CA  . GLY A 50  ? 1.1275 1.6559 1.2305 -0.1473 -0.1642 -0.0779 50  GLY A CA  
394  C C   . GLY A 50  ? 1.1015 1.5570 1.1749 -0.1372 -0.1853 -0.0662 50  GLY A C   
395  O O   . GLY A 50  ? 1.1010 1.4839 1.1370 -0.1249 -0.1844 -0.0500 50  GLY A O   
396  N N   . LYS A 51  ? 1.0790 1.5560 1.1694 -0.1426 -0.2042 -0.0762 51  LYS A N   
397  C CA  . LYS A 51  ? 1.0776 1.4845 1.1331 -0.1354 -0.2253 -0.0658 51  LYS A CA  
398  C C   . LYS A 51  ? 1.1274 1.4638 1.1293 -0.1585 -0.2105 -0.0386 51  LYS A C   
399  O O   . LYS A 51  ? 1.2546 1.5187 1.2153 -0.1506 -0.2194 -0.0264 51  LYS A O   
400  C CB  . LYS A 51  ? 0.9800 1.4272 1.0634 -0.1436 -0.2483 -0.0817 51  LYS A CB  
401  C CG  . LYS A 51  ? 0.8923 1.2704 0.9396 -0.1300 -0.2763 -0.0760 51  LYS A CG  
402  C CD  . LYS A 51  ? 0.8634 1.2848 0.9407 -0.1414 -0.3005 -0.0927 51  LYS A CD  
403  C CE  . LYS A 51  ? 0.9719 1.3155 1.0013 -0.1331 -0.3279 -0.0844 51  LYS A CE  
404  N NZ  . LYS A 51  ? 1.0206 1.4079 1.0837 -0.1397 -0.3577 -0.1042 51  LYS A NZ  
405  N N   . THR A 52  ? 1.0625 1.4187 1.0624 -0.1864 -0.1882 -0.0304 52  THR A N   
406  C CA  . THR A 52  ? 1.1361 1.4269 1.0871 -0.2069 -0.1774 -0.0073 52  THR A CA  
407  C C   . THR A 52  ? 1.0896 1.3647 1.0268 -0.2040 -0.1567 0.0026  52  THR A C   
408  O O   . THR A 52  ? 1.1329 1.4623 1.0955 -0.2066 -0.1448 -0.0057 52  THR A O   
409  C CB  . THR A 52  ? 1.2186 1.5258 1.1652 -0.2478 -0.1761 -0.0027 52  THR A CB  
410  O OG1 . THR A 52  ? 1.2679 1.4951 1.1626 -0.2591 -0.1789 0.0160  52  THR A OG1 
411  C CG2 . THR A 52  ? 1.2030 1.5596 1.1618 -0.2738 -0.1543 -0.0018 52  THR A CG2 
412  N N   . LEU A 53  ? 1.0852 1.2877 0.9829 -0.1976 -0.1531 0.0181  53  LEU A N   
413  C CA  . LEU A 53  ? 1.0907 1.2722 0.9749 -0.1942 -0.1377 0.0268  53  LEU A CA  
414  C C   . LEU A 53  ? 1.1237 1.2473 0.9653 -0.2133 -0.1341 0.0435  53  LEU A C   
415  O O   . LEU A 53  ? 1.1118 1.1783 0.9267 -0.2059 -0.1390 0.0498  53  LEU A O   
416  C CB  . LEU A 53  ? 0.8860 1.0401 0.7728 -0.1619 -0.1370 0.0248  53  LEU A CB  
417  C CG  . LEU A 53  ? 0.7850 0.9230 0.6656 -0.1561 -0.1240 0.0303  53  LEU A CG  
418  C CD1 . LEU A 53  ? 0.8512 1.0489 0.7562 -0.1599 -0.1172 0.0215  53  LEU A CD1 
419  C CD2 . LEU A 53  ? 0.7538 0.8594 0.6365 -0.1297 -0.1230 0.0292  53  LEU A CD2 
420  N N   . THR A 54  ? 1.1105 1.2464 0.9422 -0.2374 -0.1262 0.0497  54  THR A N   
421  C CA  . THR A 54  ? 1.0576 1.1329 0.8451 -0.2540 -0.1270 0.0650  54  THR A CA  
422  C C   . THR A 54  ? 1.0205 1.0625 0.7972 -0.2337 -0.1212 0.0688  54  THR A C   
423  O O   . THR A 54  ? 1.1216 1.1969 0.9154 -0.2262 -0.1134 0.0641  54  THR A O   
424  C CB  . THR A 54  ? 0.9933 1.0868 0.7656 -0.2931 -0.1236 0.0721  54  THR A CB  
425  O OG1 . THR A 54  ? 0.9621 1.1091 0.7606 -0.3126 -0.1264 0.0637  54  THR A OG1 
426  C CG2 . THR A 54  ? 0.9926 1.0113 0.7134 -0.3108 -0.1318 0.0878  54  THR A CG2 
427  N N   . ILE A 55  ? 0.9365 0.9155 0.6871 -0.2236 -0.1259 0.0745  55  ILE A N   
428  C CA  . ILE A 55  ? 0.8781 0.8272 0.6245 -0.2031 -0.1226 0.0750  55  ILE A CA  
429  C C   . ILE A 55  ? 0.9655 0.8491 0.6719 -0.2088 -0.1312 0.0831  55  ILE A C   
430  O O   . ILE A 55  ? 1.0443 0.9013 0.7239 -0.2279 -0.1395 0.0889  55  ILE A O   
431  C CB  . ILE A 55  ? 0.7572 0.7023 0.5263 -0.1736 -0.1176 0.0665  55  ILE A CB  
432  C CG1 . ILE A 55  ? 0.8695 0.7690 0.6169 -0.1704 -0.1209 0.0676  55  ILE A CG1 
433  C CG2 . ILE A 55  ? 0.7249 0.7223 0.5278 -0.1654 -0.1148 0.0580  55  ILE A CG2 
434  C CD1 . ILE A 55  ? 0.8794 0.7680 0.6394 -0.1470 -0.1128 0.0611  55  ILE A CD1 
435  N N   . GLN A 56  ? 0.8551 0.7121 0.5586 -0.1911 -0.1319 0.0816  56  GLN A N   
436  C CA  . GLN A 56  ? 0.9535 0.7470 0.6252 -0.1868 -0.1429 0.0840  56  GLN A CA  
437  C C   . GLN A 56  ? 1.0008 0.7805 0.6930 -0.1567 -0.1370 0.0724  56  GLN A C   
438  O O   . GLN A 56  ? 0.9615 0.7711 0.6882 -0.1394 -0.1272 0.0650  56  GLN A O   
439  C CB  . GLN A 56  ? 0.9014 0.6696 0.5490 -0.1911 -0.1533 0.0899  56  GLN A CB  
440  C CG  . GLN A 56  ? 1.1063 0.8230 0.7453 -0.1667 -0.1643 0.0832  56  GLN A CG  
441  C CD  . GLN A 56  ? 1.2363 0.9057 0.8340 -0.1735 -0.1839 0.0910  56  GLN A CD  
442  O OE1 . GLN A 56  ? 1.2587 0.8882 0.8516 -0.1509 -0.1975 0.0833  56  GLN A OE1 
443  N NE2 . GLN A 56  ? 1.3848 1.0576 0.9512 -0.2049 -0.1861 0.1053  56  GLN A NE2 
444  N N   . VAL A 57  ? 1.0655 0.7996 0.7358 -0.1519 -0.1423 0.0696  57  VAL A N   
445  C CA  . VAL A 57  ? 0.9951 0.7181 0.6829 -0.1261 -0.1330 0.0565  57  VAL A CA  
446  C C   . VAL A 57  ? 1.0013 0.6784 0.6750 -0.1114 -0.1449 0.0490  57  VAL A C   
447  O O   . VAL A 57  ? 1.1218 0.7527 0.7594 -0.1165 -0.1576 0.0501  57  VAL A O   
448  C CB  . VAL A 57  ? 0.9418 0.6559 0.6187 -0.1272 -0.1256 0.0540  57  VAL A CB  
449  C CG1 . VAL A 57  ? 0.9694 0.6799 0.6646 -0.1043 -0.1097 0.0403  57  VAL A CG1 
450  C CG2 . VAL A 57  ? 0.9123 0.6670 0.6009 -0.1397 -0.1208 0.0600  57  VAL A CG2 
451  N N   . LYS A 58  ? 0.9583 0.6474 0.6618 -0.0917 -0.1434 0.0397  58  LYS A N   
452  C CA  . LYS A 58  ? 1.0845 0.7352 0.7822 -0.0729 -0.1588 0.0289  58  LYS A CA  
453  C C   . LYS A 58  ? 1.0411 0.7113 0.7845 -0.0457 -0.1445 0.0079  58  LYS A C   
454  O O   . LYS A 58  ? 1.0595 0.7020 0.8028 -0.0270 -0.1514 -0.0076 58  LYS A O   
455  C CB  . LYS A 58  ? 0.9427 0.5838 0.6289 -0.0760 -0.1779 0.0362  58  LYS A CB  
456  C CG  . LYS A 58  ? 1.3354 0.9329 1.0147 -0.0531 -0.2009 0.0241  58  LYS A CG  
457  C CD  . LYS A 58  ? 1.3587 0.8868 0.9759 -0.0650 -0.2274 0.0340  58  LYS A CD  
458  C CE  . LYS A 58  ? 1.4400 0.9297 1.0478 -0.0490 -0.2328 0.0194  58  LYS A CE  
459  N NZ  . LYS A 58  ? 1.4580 0.9289 1.0878 -0.0127 -0.2483 -0.0040 58  LYS A NZ  
460  N N   . GLU A 59  ? 0.9347 0.6529 0.7177 -0.0442 -0.1248 0.0058  59  GLU A N   
461  C CA  . GLU A 59  ? 0.9487 0.6908 0.7785 -0.0245 -0.1086 -0.0132 59  GLU A CA  
462  C C   . GLU A 59  ? 0.9152 0.6863 0.7609 -0.0318 -0.0812 -0.0121 59  GLU A C   
463  O O   . GLU A 59  ? 0.8289 0.6076 0.6566 -0.0481 -0.0787 0.0027  59  GLU A O   
464  C CB  . GLU A 59  ? 0.9940 0.7585 0.8607 -0.0123 -0.1177 -0.0200 59  GLU A CB  
465  C CG  . GLU A 59  ? 0.9617 0.6901 0.8084 -0.0022 -0.1479 -0.0222 59  GLU A CG  
466  C CD  . GLU A 59  ? 1.0103 0.7098 0.8590 0.0185  -0.1553 -0.0416 59  GLU A CD  
467  O OE1 . GLU A 59  ? 1.0812 0.8006 0.9576 0.0261  -0.1324 -0.0564 59  GLU A OE1 
468  O OE2 . GLU A 59  ? 1.0760 0.7310 0.8962 0.0272  -0.1843 -0.0428 59  GLU A OE2 
469  N N   . PHE A 60  ? 0.9607 0.7475 0.8394 -0.0202 -0.0616 -0.0287 60  PHE A N   
470  C CA  . PHE A 60  ? 0.9159 0.7230 0.8045 -0.0292 -0.0357 -0.0266 60  PHE A CA  
471  C C   . PHE A 60  ? 0.8186 0.6540 0.7263 -0.0370 -0.0370 -0.0158 60  PHE A C   
472  O O   . PHE A 60  ? 0.8628 0.7059 0.7679 -0.0462 -0.0231 -0.0095 60  PHE A O   
473  C CB  . PHE A 60  ? 0.8846 0.7084 0.8094 -0.0193 -0.0120 -0.0472 60  PHE A CB  
474  C CG  . PHE A 60  ? 0.9712 0.7712 0.8703 -0.0149 -0.0001 -0.0582 60  PHE A CG  
475  C CD1 . PHE A 60  ? 1.0633 0.8677 0.9892 0.0044  0.0022  -0.0830 60  PHE A CD1 
476  C CD2 . PHE A 60  ? 1.0778 0.8513 0.9260 -0.0278 0.0070  -0.0464 60  PHE A CD2 
477  C CE1 . PHE A 60  ? 1.1274 0.9113 1.0289 0.0108  0.0137  -0.0966 60  PHE A CE1 
478  C CE2 . PHE A 60  ? 1.1493 0.8982 0.9688 -0.0228 0.0176  -0.0580 60  PHE A CE2 
479  C CZ  . PHE A 60  ? 1.1651 0.9198 1.0108 -0.0034 0.0221  -0.0834 60  PHE A CZ  
480  N N   . GLY A 61  ? 0.8416 0.6879 0.7643 -0.0322 -0.0553 -0.0147 61  GLY A N   
481  C CA  . GLY A 61  ? 0.8306 0.7029 0.7678 -0.0373 -0.0591 -0.0068 61  GLY A CA  
482  C C   . GLY A 61  ? 0.9099 0.7800 0.8124 -0.0519 -0.0650 0.0096  61  GLY A C   
483  O O   . GLY A 61  ? 0.9776 0.8706 0.8898 -0.0555 -0.0657 0.0143  61  GLY A O   
484  N N   . ASP A 62  ? 0.8568 0.7005 0.7212 -0.0596 -0.0709 0.0159  62  ASP A N   
485  C CA  . ASP A 62  ? 0.9085 0.7534 0.7439 -0.0753 -0.0776 0.0289  62  ASP A CA  
486  C C   . ASP A 62  ? 1.0044 0.8377 0.8217 -0.0803 -0.0673 0.0314  62  ASP A C   
487  O O   . ASP A 62  ? 0.9899 0.8265 0.7881 -0.0913 -0.0739 0.0395  62  ASP A O   
488  C CB  . ASP A 62  ? 0.9983 0.8174 0.7993 -0.0850 -0.0934 0.0354  62  ASP A CB  
489  C CG  . ASP A 62  ? 1.1130 0.9317 0.9175 -0.0820 -0.1068 0.0354  62  ASP A CG  
490  O OD1 . ASP A 62  ? 1.0797 0.9301 0.9057 -0.0803 -0.1068 0.0354  62  ASP A OD1 
491  O OD2 . ASP A 62  ? 1.0990 0.8812 0.8802 -0.0805 -0.1195 0.0348  62  ASP A OD2 
492  N N   . ALA A 63  ? 0.9873 0.8072 0.8096 -0.0727 -0.0512 0.0231  63  ALA A N   
493  C CA  . ALA A 63  ? 1.0374 0.8372 0.8319 -0.0778 -0.0406 0.0255  63  ALA A CA  
494  C C   . ALA A 63  ? 1.1391 0.9526 0.9462 -0.0788 -0.0316 0.0283  63  ALA A C   
495  O O   . ALA A 63  ? 1.1046 0.9450 0.9448 -0.0749 -0.0343 0.0272  63  ALA A O   
496  C CB  . ALA A 63  ? 1.0593 0.8356 0.8449 -0.0713 -0.0253 0.0143  63  ALA A CB  
497  N N   . GLY A 64  ? 1.1048 0.8939 0.8805 -0.0837 -0.0231 0.0318  64  GLY A N   
498  C CA  . GLY A 64  ? 1.0637 0.8528 0.8403 -0.0857 -0.0185 0.0362  64  GLY A CA  
499  C C   . GLY A 64  ? 0.9975 0.7832 0.7508 -0.0886 -0.0385 0.0448  64  GLY A C   
500  O O   . GLY A 64  ? 0.8421 0.6246 0.5765 -0.0923 -0.0517 0.0472  64  GLY A O   
501  N N   . GLN A 65  ? 0.8035 0.5897 0.5600 -0.0866 -0.0431 0.0480  65  GLN A N   
502  C CA  . GLN A 65  ? 1.0070 0.7867 0.7406 -0.0859 -0.0641 0.0528  65  GLN A CA  
503  C C   . GLN A 65  ? 0.9443 0.7681 0.7129 -0.0795 -0.0827 0.0494  65  GLN A C   
504  O O   . GLN A 65  ? 0.9864 0.8263 0.7819 -0.0723 -0.0840 0.0462  65  GLN A O   
505  C CB  . GLN A 65  ? 1.0893 0.8283 0.7884 -0.0864 -0.0633 0.0582  65  GLN A CB  
506  C CG  . GLN A 65  ? 1.0105 0.7503 0.7317 -0.0839 -0.0568 0.0578  65  GLN A CG  
507  C CD  . GLN A 65  ? 1.0334 0.7347 0.7196 -0.0818 -0.0720 0.0641  65  GLN A CD  
508  O OE1 . GLN A 65  ? 0.9915 0.6980 0.6720 -0.0724 -0.0989 0.0630  65  GLN A OE1 
509  N NE2 . GLN A 65  ? 1.0705 0.7321 0.7326 -0.0910 -0.0556 0.0697  65  GLN A NE2 
510  N N   . TYR A 66  ? 0.9371 0.7810 0.7047 -0.0835 -0.0963 0.0489  66  TYR A N   
511  C CA  . TYR A 66  ? 0.9143 0.8053 0.7120 -0.0798 -0.1121 0.0435  66  TYR A CA  
512  C C   . TYR A 66  ? 0.9914 0.8773 0.7787 -0.0715 -0.1318 0.0411  66  TYR A C   
513  O O   . TYR A 66  ? 1.0305 0.8855 0.7830 -0.0747 -0.1403 0.0446  66  TYR A O   
514  C CB  . TYR A 66  ? 0.8786 0.7940 0.6790 -0.0924 -0.1167 0.0438  66  TYR A CB  
515  C CG  . TYR A 66  ? 0.9181 0.8347 0.7260 -0.0980 -0.1039 0.0456  66  TYR A CG  
516  C CD1 . TYR A 66  ? 0.9253 0.8030 0.7096 -0.1014 -0.0938 0.0489  66  TYR A CD1 
517  C CD2 . TYR A 66  ? 1.0791 1.0337 0.9154 -0.0978 -0.1038 0.0423  66  TYR A CD2 
518  C CE1 . TYR A 66  ? 1.1393 1.0147 0.9309 -0.1026 -0.0873 0.0483  66  TYR A CE1 
519  C CE2 . TYR A 66  ? 1.0272 0.9757 0.8648 -0.1012 -0.0970 0.0440  66  TYR A CE2 
520  C CZ  . TYR A 66  ? 1.0929 1.0012 0.9097 -0.1025 -0.0905 0.0467  66  TYR A CZ  
521  O OH  . TYR A 66  ? 1.0301 0.9293 0.8486 -0.1021 -0.0889 0.0462  66  TYR A OH  
522  N N   . THR A 67  ? 0.9507 0.8635 0.7661 -0.0587 -0.1418 0.0335  67  THR A N   
523  C CA  . THR A 67  ? 0.9382 0.8448 0.7467 -0.0458 -0.1655 0.0281  67  THR A CA  
524  C C   . THR A 67  ? 1.0163 0.9883 0.8676 -0.0370 -0.1809 0.0133  67  THR A C   
525  O O   . THR A 67  ? 1.0739 1.0827 0.9582 -0.0326 -0.1738 0.0067  67  THR A O   
526  C CB  . THR A 67  ? 0.9254 0.7927 0.7229 -0.0349 -0.1666 0.0303  67  THR A CB  
527  O OG1 . THR A 67  ? 0.9233 0.7383 0.6855 -0.0466 -0.1460 0.0425  67  THR A OG1 
528  C CG2 . THR A 67  ? 0.8352 0.6814 0.6149 -0.0199 -0.1962 0.0256  67  THR A CG2 
529  N N   . CYS A 68  ? 0.9550 0.9441 0.8066 -0.0345 -0.2019 0.0060  68  CYS A N   
530  C CA  . CYS A 68  ? 0.9509 1.0092 0.8476 -0.0252 -0.2163 -0.0125 68  CYS A CA  
531  C C   . CYS A 68  ? 0.9900 1.0406 0.8932 0.0021  -0.2423 -0.0251 68  CYS A C   
532  O O   . CYS A 68  ? 0.9568 0.9487 0.8221 0.0098  -0.2586 -0.0192 68  CYS A O   
533  C CB  . CYS A 68  ? 0.8293 0.9229 0.7341 -0.0391 -0.2251 -0.0174 68  CYS A CB  
534  S SG  . CYS A 68  ? 1.2850 1.3234 1.1456 -0.0376 -0.2498 -0.0129 68  CYS A SG  
535  N N   . HIS A 69  ? 1.0157 1.1212 0.9624 0.0170  -0.2473 -0.0429 69  HIS A N   
536  C CA  . HIS A 69  ? 1.0393 1.1355 0.9941 0.0465  -0.2740 -0.0576 69  HIS A CA  
537  C C   . HIS A 69  ? 1.0636 1.2351 1.0661 0.0633  -0.2952 -0.0854 69  HIS A C   
538  O O   . HIS A 69  ? 1.0793 1.3169 1.1121 0.0480  -0.2841 -0.0928 69  HIS A O   
539  C CB  . HIS A 69  ? 0.9431 1.0317 0.9078 0.0557  -0.2636 -0.0585 69  HIS A CB  
540  C CG  . HIS A 69  ? 1.0160 1.0432 0.9464 0.0398  -0.2414 -0.0358 69  HIS A CG  
541  N ND1 . HIS A 69  ? 1.0139 1.0505 0.9432 0.0169  -0.2128 -0.0236 69  HIS A ND1 
542  C CD2 . HIS A 69  ? 1.1347 1.0927 1.0330 0.0429  -0.2438 -0.0250 69  HIS A CD2 
543  C CE1 . HIS A 69  ? 1.0415 1.0240 0.9456 0.0090  -0.1983 -0.0089 69  HIS A CE1 
544  N NE2 . HIS A 69  ? 1.1245 1.0602 1.0095 0.0220  -0.2145 -0.0087 69  HIS A NE2 
545  N N   . LYS A 70  ? 1.0305 1.1913 1.0398 0.0942  -0.3260 -0.1020 70  LYS A N   
546  C CA  . LYS A 70  ? 1.0127 1.2519 1.0763 0.1169  -0.3466 -0.1348 70  LYS A CA  
547  C C   . LYS A 70  ? 1.1186 1.3255 1.1807 0.1553  -0.3826 -0.1515 70  LYS A C   
548  O O   . LYS A 70  ? 1.0627 1.2043 1.0882 0.1686  -0.4136 -0.1471 70  LYS A O   
549  C CB  . LYS A 70  ? 0.8695 1.1480 0.9495 0.1101  -0.3610 -0.1443 70  LYS A CB  
550  C CG  . LYS A 70  ? 0.8619 1.2388 1.0095 0.1301  -0.3775 -0.1821 70  LYS A CG  
551  C CD  . LYS A 70  ? 0.9571 1.3690 1.1233 0.1236  -0.3966 -0.1928 70  LYS A CD  
552  C CE  . LYS A 70  ? 0.9156 1.4375 1.1587 0.1422  -0.4108 -0.2344 70  LYS A CE  
553  N NZ  . LYS A 70  ? 0.8834 1.4978 1.1693 0.1155  -0.3702 -0.2415 70  LYS A NZ  
554  N N   . GLY A 71  ? 1.1758 1.4228 1.2723 0.1733  -0.3801 -0.1706 71  GLY A N   
555  C CA  . GLY A 71  ? 1.2489 1.4637 1.3447 0.2114  -0.4154 -0.1886 71  GLY A CA  
556  C C   . GLY A 71  ? 1.3746 1.4864 1.4156 0.2085  -0.4155 -0.1638 71  GLY A C   
557  O O   . GLY A 71  ? 1.4633 1.5141 1.4808 0.2341  -0.4500 -0.1693 71  GLY A O   
558  N N   . GLY A 72  ? 1.3648 1.4566 1.3859 0.1766  -0.3779 -0.1375 72  GLY A N   
559  C CA  . GLY A 72  ? 1.4690 1.4754 1.4468 0.1682  -0.3714 -0.1153 72  GLY A CA  
560  C C   . GLY A 72  ? 1.5538 1.4797 1.4718 0.1466  -0.3675 -0.0861 72  GLY A C   
561  O O   . GLY A 72  ? 1.6186 1.5076 1.5121 0.1215  -0.3389 -0.0634 72  GLY A O   
562  N N   . GLU A 73  ? 1.5195 1.4201 1.4142 0.1574  -0.3970 -0.0888 73  GLU A N   
563  C CA  . GLU A 73  ? 1.4804 1.3024 1.3106 0.1389  -0.3963 -0.0633 73  GLU A CA  
564  C C   . GLU A 73  ? 1.2801 1.1366 1.1131 0.1107  -0.3659 -0.0515 73  GLU A C   
565  O O   . GLU A 73  ? 1.1356 1.0729 1.0157 0.1103  -0.3615 -0.0663 73  GLU A O   
566  C CB  . GLU A 73  ? 1.6320 1.4078 1.4302 0.1631  -0.4443 -0.0715 73  GLU A CB  
567  C CG  . GLU A 73  ? 1.8141 1.5458 1.6039 0.1943  -0.4815 -0.0845 73  GLU A CG  
568  C CD  . GLU A 73  ? 2.0011 1.6601 1.7402 0.2160  -0.5316 -0.0867 73  GLU A CD  
569  O OE1 . GLU A 73  ? 2.0454 1.6681 1.7398 0.2011  -0.5327 -0.0712 73  GLU A OE1 
570  O OE2 . GLU A 73  ? 2.0534 1.6871 1.7938 0.2494  -0.5726 -0.1049 73  GLU A OE2 
571  N N   . VAL A 74  ? 1.2511 1.0445 1.0321 0.0861  -0.3447 -0.0257 74  VAL A N   
572  C CA  . VAL A 74  ? 1.1117 0.9225 0.8863 0.0601  -0.3168 -0.0136 74  VAL A CA  
573  C C   . VAL A 74  ? 1.1791 1.0031 0.9462 0.0626  -0.3387 -0.0199 74  VAL A C   
574  O O   . VAL A 74  ? 1.3550 1.1386 1.0932 0.0799  -0.3743 -0.0245 74  VAL A O   
575  C CB  . VAL A 74  ? 1.1538 0.8908 0.8721 0.0369  -0.2906 0.0116  74  VAL A CB  
576  C CG1 . VAL A 74  ? 1.2674 1.0005 0.9611 0.0172  -0.2752 0.0217  74  VAL A CG1 
577  C CG2 . VAL A 74  ? 1.1210 0.8714 0.8644 0.0262  -0.2593 0.0163  74  VAL A CG2 
578  N N   . LEU A 75  ? 1.0564 0.9323 0.8473 0.0447  -0.3198 -0.0200 75  LEU A N   
579  C CA  . LEU A 75  ? 1.1199 1.0173 0.9120 0.0431  -0.3393 -0.0275 75  LEU A CA  
580  C C   . LEU A 75  ? 1.1749 1.0172 0.9108 0.0211  -0.3268 -0.0080 75  LEU A C   
581  O O   . LEU A 75  ? 1.2043 0.9953 0.8944 0.0264  -0.3514 -0.0053 75  LEU A O   
582  C CB  . LEU A 75  ? 1.1023 1.0992 0.9611 0.0362  -0.3302 -0.0438 75  LEU A CB  
583  C CG  . LEU A 75  ? 1.0924 1.1452 0.9887 0.0495  -0.3626 -0.0678 75  LEU A CG  
584  C CD1 . LEU A 75  ? 1.0406 1.1050 0.9613 0.0848  -0.3931 -0.0892 75  LEU A CD1 
585  C CD2 . LEU A 75  ? 1.1216 1.2673 1.0738 0.0302  -0.3437 -0.0785 75  LEU A CD2 
586  N N   . SER A 76  ? 1.1199 0.9717 0.8578 -0.0016 -0.2909 0.0036  76  SER A N   
587  C CA  . SER A 76  ? 1.1560 0.9545 0.8411 -0.0205 -0.2749 0.0202  76  SER A CA  
588  C C   . SER A 76  ? 1.0928 0.8959 0.7859 -0.0366 -0.2357 0.0303  76  SER A C   
589  O O   . SER A 76  ? 1.1299 0.9667 0.8615 -0.0325 -0.2241 0.0265  76  SER A O   
590  C CB  . SER A 76  ? 1.1780 0.9971 0.8631 -0.0304 -0.2881 0.0152  76  SER A CB  
591  O OG  . SER A 76  ? 1.2762 1.1452 0.9953 -0.0493 -0.2658 0.0153  76  SER A OG  
592  N N   . HIS A 77  ? 1.1386 0.9073 0.7953 -0.0527 -0.2177 0.0410  77  HIS A N   
593  C CA  . HIS A 77  ? 1.1007 0.8730 0.7666 -0.0647 -0.1841 0.0476  77  HIS A CA  
594  C C   . HIS A 77  ? 1.1972 0.9575 0.8415 -0.0803 -0.1728 0.0518  77  HIS A C   
595  O O   . HIS A 77  ? 1.1882 0.9228 0.7979 -0.0836 -0.1878 0.0523  77  HIS A O   
596  C CB  . HIS A 77  ? 1.0988 0.8226 0.7380 -0.0638 -0.1657 0.0560  77  HIS A CB  
597  C CG  . HIS A 77  ? 1.3171 0.9730 0.8891 -0.0707 -0.1603 0.0652  77  HIS A CG  
598  N ND1 . HIS A 77  ? 1.3732 0.9763 0.8969 -0.0642 -0.1795 0.0697  77  HIS A ND1 
599  C CD2 . HIS A 77  ? 1.3965 1.0260 0.9371 -0.0827 -0.1389 0.0696  77  HIS A CD2 
600  C CE1 . HIS A 77  ? 1.4527 0.9997 0.9147 -0.0742 -0.1677 0.0778  77  HIS A CE1 
601  N NE2 . HIS A 77  ? 1.4481 1.0130 0.9215 -0.0847 -0.1422 0.0766  77  HIS A NE2 
602  N N   . SER A 78  ? 1.2162 0.9925 0.8803 -0.0882 -0.1495 0.0534  78  SER A N   
603  C CA  . SER A 78  ? 1.1134 0.8716 0.7564 -0.1002 -0.1385 0.0562  78  SER A CA  
604  C C   . SER A 78  ? 1.1089 0.8540 0.7553 -0.1002 -0.1104 0.0579  78  SER A C   
605  O O   . SER A 78  ? 1.1930 0.9714 0.8791 -0.0985 -0.1020 0.0556  78  SER A O   
606  C CB  . SER A 78  ? 0.9738 0.7754 0.6458 -0.1109 -0.1470 0.0530  78  SER A CB  
607  O OG  . SER A 78  ? 0.9189 0.7472 0.6010 -0.1121 -0.1717 0.0478  78  SER A OG  
608  N N   . LEU A 79  ? 1.0829 0.7810 0.6879 -0.1017 -0.0958 0.0602  79  LEU A N   
609  C CA  . LEU A 79  ? 1.0639 0.7560 0.6772 -0.1019 -0.0684 0.0576  79  LEU A CA  
610  C C   . LEU A 79  ? 1.0911 0.7832 0.7030 -0.1056 -0.0675 0.0534  79  LEU A C   
611  O O   . LEU A 79  ? 1.1765 0.8522 0.7602 -0.1110 -0.0826 0.0544  79  LEU A O   
612  C CB  . LEU A 79  ? 0.9698 0.6160 0.5393 -0.1037 -0.0497 0.0595  79  LEU A CB  
613  C CG  . LEU A 79  ? 1.2362 0.8796 0.8150 -0.1048 -0.0176 0.0530  79  LEU A CG  
614  C CD1 . LEU A 79  ? 1.0914 0.7731 0.7277 -0.1015 -0.0088 0.0499  79  LEU A CD1 
615  C CD2 . LEU A 79  ? 1.3906 0.9890 0.9178 -0.1115 0.0023  0.0556  79  LEU A CD2 
616  N N   . LEU A 80  ? 0.8942 0.6020 0.5361 -0.1023 -0.0534 0.0480  80  LEU A N   
617  C CA  . LEU A 80  ? 0.9720 0.6703 0.6086 -0.1032 -0.0553 0.0431  80  LEU A CA  
618  C C   . LEU A 80  ? 1.0308 0.7176 0.6723 -0.0950 -0.0319 0.0325  80  LEU A C   
619  O O   . LEU A 80  ? 1.0593 0.7684 0.7363 -0.0898 -0.0175 0.0283  80  LEU A O   
620  C CB  . LEU A 80  ? 0.9571 0.6877 0.6277 -0.1057 -0.0682 0.0447  80  LEU A CB  
621  C CG  . LEU A 80  ? 0.9773 0.7365 0.6577 -0.1157 -0.0880 0.0516  80  LEU A CG  
622  C CD1 . LEU A 80  ? 0.9133 0.6768 0.5970 -0.1246 -0.0982 0.0533  80  LEU A CD1 
623  C CD2 . LEU A 80  ? 1.0638 0.8079 0.7132 -0.1225 -0.1013 0.0546  80  LEU A CD2 
624  N N   . LEU A 81  ? 0.9517 0.6062 0.5605 -0.0931 -0.0291 0.0255  81  LEU A N   
625  C CA  . LEU A 81  ? 0.9646 0.6147 0.5833 -0.0827 -0.0078 0.0104  81  LEU A CA  
626  C C   . LEU A 81  ? 1.2135 0.8525 0.8342 -0.0758 -0.0231 0.0028  81  LEU A C   
627  O O   . LEU A 81  ? 1.2472 0.8679 0.8433 -0.0835 -0.0461 0.0104  81  LEU A O   
628  C CB  . LEU A 81  ? 1.1460 0.7640 0.7193 -0.0836 0.0119  0.0047  81  LEU A CB  
629  C CG  . LEU A 81  ? 1.0285 0.6378 0.5774 -0.0936 0.0186  0.0167  81  LEU A CG  
630  C CD1 . LEU A 81  ? 1.2889 0.8551 0.7754 -0.0969 0.0325  0.0136  81  LEU A CD1 
631  C CD2 . LEU A 81  ? 1.2316 0.8706 0.8219 -0.0948 0.0380  0.0167  81  LEU A CD2 
632  N N   . LEU A 82  ? 1.1269 0.7755 0.7772 -0.0618 -0.0126 -0.0130 82  LEU A N   
633  C CA  . LEU A 82  ? 1.0977 0.7279 0.7471 -0.0519 -0.0313 -0.0215 82  LEU A CA  
634  C C   . LEU A 82  ? 1.1156 0.7171 0.7412 -0.0385 -0.0210 -0.0414 82  LEU A C   
635  O O   . LEU A 82  ? 1.0936 0.7117 0.7358 -0.0302 0.0069  -0.0567 82  LEU A O   
636  C CB  . LEU A 82  ? 1.0841 0.7431 0.7852 -0.0407 -0.0357 -0.0279 82  LEU A CB  
637  C CG  . LEU A 82  ? 1.0545 0.7444 0.7824 -0.0500 -0.0452 -0.0127 82  LEU A CG  
638  C CD1 . LEU A 82  ? 0.9889 0.6866 0.7471 -0.0380 -0.0604 -0.0193 82  LEU A CD1 
639  C CD2 . LEU A 82  ? 0.9075 0.5864 0.6029 -0.0685 -0.0632 0.0063  82  LEU A CD2 
640  N N   . HIS A 83  ? 1.1381 0.6972 0.7243 -0.0377 -0.0429 -0.0424 83  HIS A N   
641  C CA  . HIS A 83  ? 1.1877 0.7167 0.7527 -0.0203 -0.0389 -0.0651 83  HIS A CA  
642  C C   . HIS A 83  ? 1.3218 0.8387 0.9069 -0.0035 -0.0625 -0.0762 83  HIS A C   
643  O O   . HIS A 83  ? 1.1384 0.6276 0.7045 -0.0123 -0.0930 -0.0627 83  HIS A O   
644  C CB  . HIS A 83  ? 1.1721 0.6528 0.6726 -0.0291 -0.0502 -0.0609 83  HIS A CB  
645  C CG  . HIS A 83  ? 1.2262 0.6814 0.6983 -0.0123 -0.0356 -0.0854 83  HIS A CG  
646  N ND1 . HIS A 83  ? 1.4452 0.9295 0.9502 0.0060  -0.0059 -0.1095 83  HIS A ND1 
647  C CD2 . HIS A 83  ? 1.2849 0.6912 0.6995 -0.0110 -0.0452 -0.0919 83  HIS A CD2 
648  C CE1 . HIS A 83  ? 1.4374 0.8938 0.9058 0.0185  0.0037  -0.1306 83  HIS A CE1 
649  N NE2 . HIS A 83  ? 1.3204 0.7261 0.7310 0.0093  -0.0209 -0.1200 83  HIS A NE2 
650  N N   . LYS A 84  ? 1.4169 0.9551 1.0407 0.0198  -0.0484 -0.1014 84  LYS A N   
651  C CA  . LYS A 84  ? 1.4046 0.9379 1.0576 0.0405  -0.0713 -0.1148 84  LYS A CA  
652  C C   . LYS A 84  ? 1.4827 0.9688 1.1083 0.0633  -0.0887 -0.1383 84  LYS A C   
653  O O   . LYS A 84  ? 1.5635 1.0564 1.1909 0.0793  -0.0667 -0.1637 84  LYS A O   
654  C CB  . LYS A 84  ? 1.4473 1.0385 1.1697 0.0545  -0.0499 -0.1319 84  LYS A CB  
655  C CG  . LYS A 84  ? 1.6158 1.2058 1.3737 0.0792  -0.0758 -0.1483 84  LYS A CG  
656  C CD  . LYS A 84  ? 1.7037 1.3467 1.5210 0.0774  -0.0681 -0.1452 84  LYS A CD  
657  C CE  . LYS A 84  ? 1.7147 1.3587 1.5132 0.0491  -0.0747 -0.1102 84  LYS A CE  
658  N NZ  . LYS A 84  ? 1.7132 1.4060 1.5653 0.0473  -0.0675 -0.1074 84  LYS A NZ  
659  N N   . LYS A 85  ? 1.5044 0.9406 1.1019 0.0642  -0.1284 -0.1302 85  LYS A N   
660  C CA  . LYS A 85  ? 1.5779 0.9553 1.1412 0.0853  -0.1541 -0.1500 85  LYS A CA  
661  C C   . LYS A 85  ? 1.8311 1.2025 1.4279 0.1138  -0.1794 -0.1679 85  LYS A C   
662  O O   . LYS A 85  ? 1.9984 1.3380 1.5800 0.1057  -0.2120 -0.1498 85  LYS A O   
663  C CB  . LYS A 85  ? 1.4726 0.7867 0.9705 0.0609  -0.1847 -0.1252 85  LYS A CB  
664  C CG  . LYS A 85  ? 1.6001 0.8406 1.0496 0.0767  -0.2151 -0.1411 85  LYS A CG  
665  C CD  . LYS A 85  ? 1.7429 0.9261 1.1340 0.0441  -0.2457 -0.1119 85  LYS A CD  
666  C CE  . LYS A 85  ? 1.9695 1.0705 1.3046 0.0557  -0.2781 -0.1259 85  LYS A CE  
667  N NZ  . LYS A 85  ? 1.9759 1.0735 1.2893 0.0656  -0.2583 -0.1454 85  LYS A NZ  
668  N N   . GLU A 86  ? 1.9499 1.3522 1.5917 0.1466  -0.1649 -0.2044 86  GLU A N   
669  C CA  . GLU A 86  ? 2.0033 1.4151 1.6921 0.1767  -0.1869 -0.2253 86  GLU A CA  
670  C C   . GLU A 86  ? 1.9869 1.3155 1.6306 0.1930  -0.2410 -0.2277 86  GLU A C   
671  O O   . GLU A 86  ? 2.0194 1.3289 1.6676 0.1965  -0.2725 -0.2182 86  GLU A O   
672  C CB  . GLU A 86  ? 2.1190 1.5883 1.8707 0.2085  -0.1584 -0.2690 86  GLU A CB  
673  C CG  . GLU A 86  ? 2.1512 1.6915 1.9833 0.2158  -0.1454 -0.2782 86  GLU A CG  
674  C CD  . GLU A 86  ? 2.2204 1.7337 2.0668 0.2362  -0.1933 -0.2807 86  GLU A CD  
675  O OE1 . GLU A 86  ? 2.1571 1.6997 2.0331 0.2242  -0.1953 -0.2639 86  GLU A OE1 
676  O OE2 . GLU A 86  ? 2.2831 1.7411 2.1066 0.2649  -0.2309 -0.3000 86  GLU A OE2 
677  N N   . ASP A 87  ? 1.9605 1.2343 1.5556 0.2025  -0.2531 -0.2402 87  ASP A N   
678  C CA  . ASP A 87  ? 2.0412 1.2239 1.5840 0.2162  -0.3065 -0.2422 87  ASP A CA  
679  C C   . ASP A 87  ? 2.0678 1.1988 1.5574 0.2219  -0.3106 -0.2558 87  ASP A C   
680  O O   . ASP A 87  ? 2.0689 1.1826 1.5649 0.2613  -0.3209 -0.2950 87  ASP A O   
681  C CB  . ASP A 87  ? 2.1533 1.3328 1.7378 0.2616  -0.3350 -0.2758 87  ASP A CB  
682  C CG  . ASP A 87  ? 2.1750 1.4071 1.8153 0.3015  -0.3091 -0.3260 87  ASP A CG  
683  O OD1 . ASP A 87  ? 2.2100 1.4204 1.8694 0.3451  -0.3402 -0.3619 87  ASP A OD1 
684  O OD2 . ASP A 87  ? 2.1075 1.4019 1.7709 0.2891  -0.2581 -0.3306 87  ASP A OD2 
685  N N   . GLY A 88  ? 2.2694 1.1901 1.1451 0.1509  0.2031  0.0570  88  GLY A N   
686  C CA  . GLY A 88  ? 2.1852 1.0751 1.0504 0.1382  0.2164  0.0543  88  GLY A CA  
687  C C   . GLY A 88  ? 1.9714 0.9642 0.9420 0.1320  0.2006  0.0502  88  GLY A C   
688  O O   . GLY A 88  ? 1.9893 0.9973 0.9973 0.0940  0.2094  0.0391  88  GLY A O   
689  N N   . ILE A 89  ? 1.9421 1.0050 0.9580 0.1693  0.1778  0.0567  89  ILE A N   
690  C CA  . ILE A 89  ? 1.9109 1.0630 1.0169 0.1649  0.1653  0.0528  89  ILE A CA  
691  C C   . ILE A 89  ? 1.8238 1.0582 1.0142 0.1375  0.1567  0.0449  89  ILE A C   
692  O O   . ILE A 89  ? 1.7015 0.9486 0.8934 0.1372  0.1530  0.0444  89  ILE A O   
693  C CB  . ILE A 89  ? 1.9520 1.1430 1.0690 0.2139  0.1493  0.0582  89  ILE A CB  
694  C CG1 . ILE A 89  ? 1.9744 1.2555 1.1547 0.2274  0.1318  0.0542  89  ILE A CG1 
695  C CG2 . ILE A 89  ? 1.9628 1.0726 0.9850 0.2557  0.1524  0.0669  89  ILE A CG2 
696  C CD1 . ILE A 89  ? 1.9365 1.2751 1.1453 0.2676  0.1181  0.0511  89  ILE A CD1 
697  N N   . TRP A 90  ? 1.7520 1.0371 1.0073 0.1156  0.1537  0.0387  90  TRP A N   
698  C CA  . TRP A 90  ? 1.5243 0.8837 0.8576 0.0927  0.1457  0.0313  90  TRP A CA  
699  C C   . TRP A 90  ? 1.4525 0.8845 0.8341 0.1185  0.1318  0.0336  90  TRP A C   
700  O O   . TRP A 90  ? 1.5196 0.9533 0.8866 0.1498  0.1279  0.0375  90  TRP A O   
701  C CB  . TRP A 90  ? 1.4038 0.7772 0.7753 0.0614  0.1479  0.0224  90  TRP A CB  
702  C CG  . TRP A 90  ? 1.3055 0.6242 0.6433 0.0299  0.1627  0.0122  90  TRP A CG  
703  C CD1 . TRP A 90  ? 1.3528 0.6171 0.6468 0.0240  0.1744  0.0095  90  TRP A CD1 
704  C CD2 . TRP A 90  ? 1.6645 0.9812 1.0119 -0.0035 0.1700  -0.0010 90  TRP A CD2 
705  N NE1 . TRP A 90  ? 1.5326 0.7628 0.8084 -0.0121 0.1895  -0.0065 90  TRP A NE1 
706  C CE2 . TRP A 90  ? 1.5993 0.8613 0.9080 -0.0295 0.1871  -0.0139 90  TRP A CE2 
707  C CE3 . TRP A 90  ? 1.7070 1.0642 1.0929 -0.0156 0.1654  -0.0053 90  TRP A CE3 
708  C CZ2 . TRP A 90  ? 1.6836 0.9329 0.9926 -0.0680 0.2002  -0.0338 90  TRP A CZ2 
709  C CZ3 . TRP A 90  ? 1.6950 1.0371 1.0807 -0.0523 0.1770  -0.0223 90  TRP A CZ3 
710  C CH2 . TRP A 90  ? 1.3225 0.6123 0.6708 -0.0785 0.1945  -0.0377 90  TRP A CH2 
711  N N   . SER A 91  ? 1.2333 0.7267 0.6735 0.1036  0.1263  0.0282  91  SER A N   
712  C CA  . SER A 91  ? 1.2081 0.7726 0.6948 0.1218  0.1176  0.0258  91  SER A CA  
713  C C   . SER A 91  ? 1.3364 0.9302 0.8582 0.1202  0.1172  0.0231  91  SER A C   
714  O O   . SER A 91  ? 1.2220 0.8032 0.7565 0.0967  0.1197  0.0219  91  SER A O   
715  C CB  . SER A 91  ? 1.1771 0.7927 0.7112 0.1032  0.1154  0.0202  91  SER A CB  
716  O OG  . SER A 91  ? 1.1646 0.7847 0.7323 0.0681  0.1186  0.0157  91  SER A OG  
717  N N   . THR A 92  ? 1.4020 1.0350 0.9372 0.1459  0.1141  0.0196  92  THR A N   
718  C CA  . THR A 92  ? 1.3527 1.0134 0.9173 0.1443  0.1168  0.0146  92  THR A CA  
719  C C   . THR A 92  ? 1.3646 1.0990 0.9735 0.1531  0.1168  0.0024  92  THR A C   
720  O O   . THR A 92  ? 1.4053 1.1645 1.0162 0.1755  0.1178  -0.0060 92  THR A O   
721  C CB  . THR A 92  ? 1.3795 1.0040 0.9054 0.1671  0.1183  0.0176  92  THR A CB  
722  O OG1 . THR A 92  ? 1.4466 1.0822 0.9513 0.2040  0.1133  0.0146  92  THR A OG1 
723  C CG2 . THR A 92  ? 1.3365 0.8867 0.8147 0.1567  0.1218  0.0270  92  THR A CG2 
724  N N   . ASP A 93  ? 1.2656 1.0373 0.9113 0.1338  0.1175  -0.0016 93  ASP A N   
725  C CA  . ASP A 93  ? 1.2414 1.0850 0.9278 0.1389  0.1200  -0.0160 93  ASP A CA  
726  C C   . ASP A 93  ? 1.2104 1.0855 0.9329 0.1211  0.1316  -0.0261 93  ASP A C   
727  O O   . ASP A 93  ? 1.2349 1.1604 0.9793 0.1303  0.1383  -0.0426 93  ASP A O   
728  C CB  . ASP A 93  ? 1.2585 1.1265 0.9642 0.1263  0.1175  -0.0165 93  ASP A CB  
729  C CG  . ASP A 93  ? 1.2479 1.0882 0.9119 0.1475  0.1080  -0.0099 93  ASP A CG  
730  O OD1 . ASP A 93  ? 1.1647 0.9793 0.7881 0.1788  0.1026  -0.0077 93  ASP A OD1 
731  O OD2 . ASP A 93  ? 1.2360 1.0755 0.9034 0.1331  0.1067  -0.0073 93  ASP A OD2 
732  N N   . ILE A 94  ? 1.1978 1.0415 0.9227 0.0961  0.1346  -0.0187 94  ILE A N   
733  C CA  . ILE A 94  ? 1.2141 1.0747 0.9630 0.0774  0.1467  -0.0267 94  ILE A CA  
734  C C   . ILE A 94  ? 1.2541 1.1020 0.9883 0.0841  0.1548  -0.0320 94  ILE A C   
735  O O   . ILE A 94  ? 1.2804 1.1620 1.0332 0.0777  0.1694  -0.0474 94  ILE A O   
736  C CB  . ILE A 94  ? 1.2093 1.0398 0.9621 0.0533  0.1447  -0.0184 94  ILE A CB  
737  C CG1 . ILE A 94  ? 1.1555 0.9355 0.8801 0.0547  0.1322  -0.0062 94  ILE A CG1 
738  C CG2 . ILE A 94  ? 1.2176 1.0845 1.0040 0.0380  0.1470  -0.0228 94  ILE A CG2 
739  C CD1 . ILE A 94  ? 1.1498 0.9156 0.8865 0.0339  0.1269  -0.0038 94  ILE A CD1 
740  N N   . LEU A 95  ? 1.3105 1.1088 1.0099 0.0940  0.1481  -0.0213 95  LEU A N   
741  C CA  . LEU A 95  ? 1.2740 1.0561 0.9566 0.1000  0.1558  -0.0258 95  LEU A CA  
742  C C   . LEU A 95  ? 1.3268 1.1360 1.0057 0.1282  0.1557  -0.0358 95  LEU A C   
743  O O   . LEU A 95  ? 1.4172 1.2181 1.0790 0.1490  0.1444  -0.0292 95  LEU A O   
744  C CB  . LEU A 95  ? 1.1899 0.9078 0.8373 0.0967  0.1493  -0.0116 95  LEU A CB  
745  C CG  . LEU A 95  ? 1.1646 0.8569 0.8134 0.0740  0.1466  -0.0056 95  LEU A CG  
746  C CD1 . LEU A 95  ? 1.1923 0.8298 0.8077 0.0731  0.1392  0.0036  95  LEU A CD1 
747  C CD2 . LEU A 95  ? 1.1642 0.8700 0.8248 0.0606  0.1605  -0.0151 95  LEU A CD2 
748  N N   . LYS A 96  ? 1.2860 1.1250 0.9774 0.1297  0.1690  -0.0537 96  LYS A N   
749  C CA  . LYS A 96  ? 1.3892 1.2632 1.0827 0.1592  0.1681  -0.0688 96  LYS A CA  
750  C C   . LYS A 96  ? 1.5116 1.3331 1.1651 0.1769  0.1632  -0.0585 96  LYS A C   
751  O O   . LYS A 96  ? 1.5297 1.3033 1.1630 0.1608  0.1684  -0.0494 96  LYS A O   
752  C CB  . LYS A 96  ? 1.3959 1.3301 1.1227 0.1518  0.1867  -0.0987 96  LYS A CB  
753  C CG  . LYS A 96  ? 1.5269 1.5229 1.2705 0.1852  0.1823  -0.1219 96  LYS A CG  
754  C CD  . LYS A 96  ? 1.5796 1.6201 1.3457 0.1802  0.2024  -0.1545 96  LYS A CD  
755  C CE  . LYS A 96  ? 1.5935 1.7031 1.3795 0.2190  0.1940  -0.1816 96  LYS A CE  
756  N NZ  . LYS A 96  ? 1.5872 1.6560 1.3340 0.2602  0.1707  -0.1621 96  LYS A NZ  
757  N N   . ASP A 97  ? 1.6115 1.4389 1.2493 0.2117  0.1528  -0.0603 97  ASP A N   
758  C CA  . ASP A 97  ? 1.7071 1.4846 1.3044 0.2313  0.1502  -0.0524 97  ASP A CA  
759  C C   . ASP A 97  ? 1.7743 1.5842 1.3864 0.2395  0.1616  -0.0751 97  ASP A C   
760  O O   . ASP A 97  ? 1.8289 1.6860 1.4528 0.2704  0.1578  -0.0943 97  ASP A O   
761  C CB  . ASP A 97  ? 1.8109 1.5690 1.3739 0.2681  0.1354  -0.0444 97  ASP A CB  
762  C CG  . ASP A 97  ? 1.8523 1.5631 1.3723 0.2934  0.1350  -0.0402 97  ASP A CG  
763  O OD1 . ASP A 97  ? 1.7176 1.3875 1.2242 0.2744  0.1440  -0.0333 97  ASP A OD1 
764  O OD2 . ASP A 97  ? 1.9348 1.6471 1.4314 0.3338  0.1253  -0.0442 97  ASP A OD2 
765  N N   . GLN A 98  ? 1.8504 1.6355 1.4605 0.2125  0.1754  -0.0751 98  GLN A N   
766  C CA  . GLN A 98  ? 1.9757 1.7784 1.5923 0.2154  0.1894  -0.0962 98  GLN A CA  
767  C C   . GLN A 98  ? 2.1828 1.9416 1.7611 0.2431  0.1827  -0.0875 98  GLN A C   
768  O O   . GLN A 98  ? 2.2580 1.9577 1.8060 0.2299  0.1876  -0.0739 98  GLN A O   
769  C CB  . GLN A 98  ? 1.8873 1.6644 1.5022 0.1771  0.2074  -0.0974 98  GLN A CB  
770  C CG  . GLN A 98  ? 1.8191 1.5296 1.4053 0.1565  0.2004  -0.0687 98  GLN A CG  
771  C CD  . GLN A 98  ? 1.7625 1.4519 1.3451 0.1228  0.2154  -0.0712 98  GLN A CD  
772  O OE1 . GLN A 98  ? 1.7243 1.3797 1.2954 0.1066  0.2090  -0.0547 98  GLN A OE1 
773  N NE2 . GLN A 98  ? 1.7586 1.4654 1.3475 0.1129  0.2360  -0.0938 98  GLN A NE2 
774  N N   . LYS A 99  ? 2.2361 2.0218 1.8123 0.2833  0.1712  -0.0957 99  LYS A N   
775  C CA  . LYS A 99  ? 2.2618 2.0007 1.7947 0.3152  0.1645  -0.0870 99  LYS A CA  
776  C C   . LYS A 99  ? 2.2252 1.9690 1.7620 0.3162  0.1782  -0.1048 99  LYS A C   
777  O O   . LYS A 99  ? 2.2044 1.9819 1.7467 0.3513  0.1752  -0.1252 99  LYS A O   
778  C CB  . LYS A 99  ? 2.2828 2.0475 1.8066 0.3634  0.1474  -0.0933 99  LYS A CB  
779  N N   . GLU A 100 ? 2.2073 1.9166 1.7392 0.2789  0.1925  -0.0986 100 GLU A N   
780  C CA  . GLU A 100 ? 2.2565 1.9626 1.7880 0.2730  0.2084  -0.1148 100 GLU A CA  
781  C C   . GLU A 100 ? 2.4077 2.0387 1.8890 0.2831  0.2067  -0.0951 100 GLU A C   
782  O O   . GLU A 100 ? 2.4754 2.1101 1.9477 0.3128  0.2071  -0.1067 100 GLU A O   
783  C CB  . GLU A 100 ? 2.1925 1.8993 1.7392 0.2278  0.2275  -0.1224 100 GLU A CB  
784  C CG  . GLU A 100 ? 2.1522 1.9394 1.7485 0.2176  0.2414  -0.1574 100 GLU A CG  
785  C CD  . GLU A 100 ? 2.1347 1.9707 1.7526 0.2334  0.2537  -0.1937 100 GLU A CD  
786  O OE1 . GLU A 100 ? 2.1605 1.9707 1.7557 0.2599  0.2474  -0.1897 100 GLU A OE1 
787  O OE2 . GLU A 100 ? 2.0883 1.9891 1.7458 0.2183  0.2712  -0.2290 100 GLU A OE2 
788  N N   . PRO A 101 ? 2.4701 2.0350 1.9191 0.2590  0.2051  -0.0678 101 PRO A N   
789  C CA  . PRO A 101 ? 2.5271 2.0217 1.9277 0.2654  0.2058  -0.0512 101 PRO A CA  
790  C C   . PRO A 101 ? 2.5334 2.0074 1.9034 0.3051  0.1941  -0.0426 101 PRO A C   
791  O O   . PRO A 101 ? 2.6024 2.1032 1.9754 0.3410  0.1922  -0.0584 101 PRO A O   
792  C CB  . PRO A 101 ? 2.4887 1.9331 1.8693 0.2315  0.2040  -0.0291 101 PRO A CB  
793  C CG  . PRO A 101 ? 2.4262 1.9106 1.8438 0.2055  0.2062  -0.0366 101 PRO A CG  
794  C CD  . PRO A 101 ? 2.4178 1.9717 1.8733 0.2261  0.2029  -0.0541 101 PRO A CD  
795  N N   . LYS A 102 ? 2.4160 1.8401 1.7531 0.2993  0.1871  -0.0200 102 LYS A N   
796  C CA  . LYS A 102 ? 2.3067 1.7038 1.6070 0.3337  0.1778  -0.0115 102 LYS A CA  
797  C C   . LYS A 102 ? 2.2789 1.7374 1.6134 0.3467  0.1656  -0.0197 102 LYS A C   
798  O O   . LYS A 102 ? 2.2594 1.7909 1.6406 0.3556  0.1648  -0.0421 102 LYS A O   
799  C CB  . LYS A 102 ? 2.2308 1.5507 1.4819 0.3157  0.1797  0.0113  102 LYS A CB  
800  N N   . ASN A 103 ? 2.2412 1.6713 1.5526 0.3453  0.1581  -0.0044 103 ASN A N   
801  C CA  . ASN A 103 ? 2.1878 1.6724 1.5326 0.3482  0.1476  -0.0099 103 ASN A CA  
802  C C   . ASN A 103 ? 2.1260 1.5914 1.4768 0.3078  0.1484  0.0044  103 ASN A C   
803  O O   . ASN A 103 ? 2.0606 1.4794 1.3939 0.2804  0.1557  0.0147  103 ASN A O   
804  C CB  . ASN A 103 ? 2.2665 1.7397 1.5749 0.3933  0.1354  -0.0085 103 ASN A CB  
805  C CG  . ASN A 103 ? 2.2857 1.8261 1.6327 0.3998  0.1238  -0.0182 103 ASN A CG  
806  O OD1 . ASN A 103 ? 2.2094 1.8248 1.6182 0.3834  0.1258  -0.0351 103 ASN A OD1 
807  N ND2 . ASN A 103 ? 2.3555 1.8647 1.6612 0.4223  0.1137  -0.0082 103 ASN A ND2 
808  N N   . LYS A 104 ? 2.0270 1.5313 1.4034 0.3051  0.1404  0.0026  104 LYS A N   
809  C CA  . LYS A 104 ? 1.8855 1.3796 1.2733 0.2688  0.1403  0.0127  104 LYS A CA  
810  C C   . LYS A 104 ? 1.8328 1.3183 1.2375 0.2339  0.1481  0.0139  104 LYS A C   
811  O O   . LYS A 104 ? 1.8187 1.2605 1.2047 0.2104  0.1495  0.0242  104 LYS A O   
812  C CB  . LYS A 104 ? 1.8966 1.3213 1.2299 0.2687  0.1396  0.0280  104 LYS A CB  
813  C CG  . LYS A 104 ? 1.9737 1.3942 1.2780 0.3031  0.1312  0.0289  104 LYS A CG  
814  C CD  . LYS A 104 ? 1.9790 1.4838 1.3382 0.3106  0.1216  0.0161  104 LYS A CD  
815  C CE  . LYS A 104 ? 1.8680 1.3656 1.1978 0.3368  0.1115  0.0188  104 LYS A CE  
816  N NZ  . LYS A 104 ? 1.7193 1.1909 1.0431 0.3049  0.1136  0.0290  104 LYS A NZ  
817  N N   . THR A 105 ? 1.7562 1.2828 1.1929 0.2315  0.1538  0.0006  105 THR A N   
818  C CA  . THR A 105 ? 1.7070 1.2250 1.1552 0.2010  0.1611  0.0004  105 THR A CA  
819  C C   . THR A 105 ? 1.6473 1.2130 1.1390 0.1805  0.1613  -0.0066 105 THR A C   
820  O O   . THR A 105 ? 1.6464 1.2579 1.1672 0.1797  0.1697  -0.0231 105 THR A O   
821  C CB  . THR A 105 ? 1.8076 1.3277 1.2534 0.2071  0.1719  -0.0108 105 THR A CB  
822  O OG1 . THR A 105 ? 1.8808 1.3569 1.2855 0.2291  0.1724  -0.0049 105 THR A OG1 
823  C CG2 . THR A 105 ? 1.6836 1.1813 1.1282 0.1761  0.1793  -0.0092 105 THR A CG2 
824  N N   . PHE A 106 ? 1.5557 1.1103 1.0510 0.1629  0.1543  0.0033  106 PHE A N   
825  C CA  . PHE A 106 ? 1.5591 1.1542 1.0922 0.1455  0.1541  -0.0019 106 PHE A CA  
826  C C   . PHE A 106 ? 1.5142 1.0967 1.0509 0.1214  0.1603  -0.0034 106 PHE A C   
827  O O   . PHE A 106 ? 1.4531 1.0677 1.0143 0.1106  0.1687  -0.0137 106 PHE A O   
828  C CB  . PHE A 106 ? 1.6467 1.2361 1.1827 0.1378  0.1440  0.0073  106 PHE A CB  
829  C CG  . PHE A 106 ? 1.5855 1.1872 1.1149 0.1601  0.1388  0.0079  106 PHE A CG  
830  C CD1 . PHE A 106 ? 1.5342 1.1944 1.0955 0.1700  0.1382  -0.0027 106 PHE A CD1 
831  C CD2 . PHE A 106 ? 1.5420 1.0932 1.0280 0.1711  0.1357  0.0178  106 PHE A CD2 
832  C CE1 . PHE A 106 ? 1.5839 1.2527 1.1331 0.1942  0.1309  -0.0023 106 PHE A CE1 
833  C CE2 . PHE A 106 ? 1.6760 1.2264 1.1435 0.1941  0.1311  0.0193  106 PHE A CE2 
834  C CZ  . PHE A 106 ? 1.6717 1.2815 1.1704 0.2076  0.1269  0.0098  106 PHE A CZ  
835  N N   . LEU A 107 ? 1.5880 1.1201 1.0953 0.1132  0.1568  0.0059  107 LEU A N   
836  C CA  . LEU A 107 ? 1.6034 1.1124 1.1018 0.0952  0.1596  0.0057  107 LEU A CA  
837  C C   . LEU A 107 ? 1.6067 1.0794 1.0734 0.0977  0.1667  0.0054  107 LEU A C   
838  O O   . LEU A 107 ? 1.5907 1.0357 1.0344 0.1063  0.1635  0.0115  107 LEU A O   
839  C CB  . LEU A 107 ? 1.5263 1.0142 1.0213 0.0823  0.1458  0.0134  107 LEU A CB  
840  C CG  . LEU A 107 ? 1.5108 0.9648 0.9832 0.0819  0.1363  0.0198  107 LEU A CG  
841  C CD1 . LEU A 107 ? 1.3450 0.8057 0.8333 0.0699  0.1238  0.0195  107 LEU A CD1 
842  C CD2 . LEU A 107 ? 1.6240 1.0733 1.0841 0.0969  0.1401  0.0224  107 LEU A CD2 
843  N N   . ARG A 108 ? 1.6090 1.0781 1.0711 0.0882  0.1791  -0.0027 108 ARG A N   
844  C CA  . ARG A 108 ? 1.5831 1.0210 1.0168 0.0880  0.1894  -0.0060 108 ARG A CA  
845  C C   . ARG A 108 ? 1.6337 1.0230 1.0347 0.0718  0.1886  -0.0014 108 ARG A C   
846  O O   . ARG A 108 ? 1.6718 1.0565 1.0738 0.0619  0.1839  0.0004  108 ARG A O   
847  C CB  . ARG A 108 ? 1.6468 1.1199 1.0974 0.0903  0.2087  -0.0248 108 ARG A CB  
848  C CG  . ARG A 108 ? 1.7993 1.3109 1.2690 0.1149  0.2083  -0.0321 108 ARG A CG  
849  C CD  . ARG A 108 ? 1.9230 1.4087 1.3684 0.1252  0.2148  -0.0347 108 ARG A CD  
850  N NE  . ARG A 108 ? 1.9438 1.4212 1.3814 0.1084  0.2341  -0.0495 108 ARG A NE  
851  C CZ  . ARG A 108 ? 1.9646 1.4886 1.4289 0.1046  0.2513  -0.0742 108 ARG A CZ  
852  N NH1 . ARG A 108 ? 1.9732 1.5609 1.4768 0.1192  0.2486  -0.0867 108 ARG A NH1 
853  N NH2 . ARG A 108 ? 1.9320 1.4386 1.3817 0.0847  0.2724  -0.0890 108 ARG A NH2 
854  N N   . CYS A 109 ? 1.6484 0.9991 1.0170 0.0711  0.1929  0.0000  109 CYS A N   
855  C CA  . CYS A 109 ? 1.5282 0.8274 0.8575 0.0594  0.1894  0.0046  109 CYS A CA  
856  C C   . CYS A 109 ? 1.5421 0.8081 0.8393 0.0524  0.2072  -0.0022 109 CYS A C   
857  O O   . CYS A 109 ? 1.5093 0.7859 0.8118 0.0592  0.2177  -0.0079 109 CYS A O   
858  C CB  . CYS A 109 ? 1.4710 0.7476 0.7863 0.0624  0.1694  0.0150  109 CYS A CB  
859  S SG  . CYS A 109 ? 1.4286 0.7371 0.7769 0.0644  0.1498  0.0189  109 CYS A SG  
860  N N   . GLU A 110 ? 1.5750 0.7974 0.8351 0.0399  0.2106  -0.0022 110 GLU A N   
861  C CA  . GLU A 110 ? 1.5233 0.7004 0.7414 0.0295  0.2274  -0.0079 110 GLU A CA  
862  C C   . GLU A 110 ? 1.6445 0.7583 0.8082 0.0248  0.2151  0.0011  110 GLU A C   
863  O O   . GLU A 110 ? 1.6691 0.7750 0.8269 0.0277  0.1996  0.0069  110 GLU A O   
864  C CB  . GLU A 110 ? 1.5225 0.7095 0.7435 0.0155  0.2563  -0.0260 110 GLU A CB  
865  C CG  . GLU A 110 ? 1.7244 0.9571 0.9792 0.0196  0.2736  -0.0423 110 GLU A CG  
866  C CD  . GLU A 110 ? 1.8362 1.0796 1.0923 0.0011  0.3054  -0.0672 110 GLU A CD  
867  O OE1 . GLU A 110 ? 1.7284 0.9248 0.9444 -0.0180 0.3178  -0.0694 110 GLU A OE1 
868  O OE2 . GLU A 110 ? 1.8946 1.1919 1.1889 0.0061  0.3187  -0.0868 110 GLU A OE2 
869  N N   . ALA A 111 ? 1.7632 0.8326 0.8860 0.0198  0.2211  0.0010  111 ALA A N   
870  C CA  . ALA A 111 ? 1.7235 0.7289 0.7867 0.0178  0.2092  0.0078  111 ALA A CA  
871  C C   . ALA A 111 ? 1.8083 0.7602 0.8210 0.0024  0.2339  0.0004  111 ALA A C   
872  O O   . ALA A 111 ? 1.8524 0.8169 0.8777 -0.0030 0.2514  -0.0072 111 ALA A O   
873  C CB  . ALA A 111 ? 1.5796 0.5848 0.6417 0.0276  0.1854  0.0157  111 ALA A CB  
874  N N   . LYS A 112 ? 1.7857 0.6738 0.7373 -0.0038 0.2360  0.0016  112 LYS A N   
875  C CA  . LYS A 112 ? 1.8059 0.6323 0.6995 -0.0220 0.2629  -0.0068 112 LYS A CA  
876  C C   . LYS A 112 ? 1.9464 0.7174 0.7853 -0.0193 0.2501  0.0009  112 LYS A C   
877  O O   . LYS A 112 ? 2.1705 0.8772 0.9485 -0.0340 0.2691  -0.0041 112 LYS A O   
878  C CB  . LYS A 112 ? 2.0267 0.8009 0.8706 -0.0339 0.2804  -0.0120 112 LYS A CB  
879  C CG  . LYS A 112 ? 2.2403 0.9779 1.0474 -0.0168 0.2523  0.0013  112 LYS A CG  
880  C CD  . LYS A 112 ? 2.4258 1.1000 1.1737 -0.0291 0.2751  -0.0041 112 LYS A CD  
881  C CE  . LYS A 112 ? 2.5150 1.1735 1.2466 -0.0083 0.2481  0.0070  112 LYS A CE  
882  N NZ  . LYS A 112 ? 2.6100 1.2416 1.3089 0.0179  0.2072  0.0197  112 LYS A NZ  
883  N N   . ASN A 113 ? 1.9652 0.7608 0.8243 -0.0027 0.2195  0.0105  113 ASN A N   
884  C CA  . ASN A 113 ? 1.9845 0.7409 0.8010 -0.0004 0.2067  0.0149  113 ASN A CA  
885  C C   . ASN A 113 ? 1.9158 0.7139 0.7663 0.0149  0.1758  0.0200  113 ASN A C   
886  O O   . ASN A 113 ? 1.8632 0.7207 0.7727 0.0221  0.1676  0.0205  113 ASN A O   
887  C CB  . ASN A 113 ? 1.9588 0.6302 0.6875 0.0002  0.2011  0.0177  113 ASN A CB  
888  C CG  . ASN A 113 ? 1.9880 0.6534 0.7045 0.0193  0.1740  0.0233  113 ASN A CG  
889  O OD1 . ASN A 113 ? 1.9012 0.6150 0.6585 0.0357  0.1450  0.0257  113 ASN A OD1 
890  N ND2 . ASN A 113 ? 2.0974 0.7000 0.7545 0.0166  0.1852  0.0234  113 ASN A ND2 
891  N N   . TYR A 114 ? 1.8584 0.6243 0.6690 0.0178  0.1607  0.0213  114 TYR A N   
892  C CA  . TYR A 114 ? 1.8637 0.6677 0.7022 0.0274  0.1356  0.0203  114 TYR A CA  
893  C C   . TYR A 114 ? 1.9018 0.7011 0.7204 0.0452  0.1006  0.0187  114 TYR A C   
894  O O   . TYR A 114 ? 1.9762 0.7923 0.7970 0.0516  0.0786  0.0124  114 TYR A O   
895  C CB  . TYR A 114 ? 1.8183 0.6021 0.6337 0.0183  0.1417  0.0180  114 TYR A CB  
896  C CG  . TYR A 114 ? 1.8368 0.6460 0.6898 0.0073  0.1686  0.0173  114 TYR A CG  
897  C CD1 . TYR A 114 ? 1.8499 0.6297 0.6840 -0.0054 0.1976  0.0156  114 TYR A CD1 
898  C CD2 . TYR A 114 ? 1.7682 0.6276 0.6716 0.0106  0.1655  0.0163  114 TYR A CD2 
899  C CE1 . TYR A 114 ? 1.8215 0.6268 0.6899 -0.0101 0.2195  0.0127  114 TYR A CE1 
900  C CE2 . TYR A 114 ? 1.8115 0.6864 0.7404 0.0061  0.1883  0.0162  114 TYR A CE2 
901  C CZ  . TYR A 114 ? 1.8457 0.6963 0.7589 -0.0020 0.2135  0.0143  114 TYR A CZ  
902  O OH  . TYR A 114 ? 1.8274 0.6960 0.7663 -0.0013 0.2337  0.0119  114 TYR A OH  
903  N N   . SER A 115 ? 1.9124 0.6905 0.7116 0.0537  0.0963  0.0217  115 SER A N   
904  C CA  . SER A 115 ? 1.9133 0.6784 0.6844 0.0757  0.0623  0.0194  115 SER A CA  
905  C C   . SER A 115 ? 1.8911 0.7300 0.7294 0.0861  0.0398  0.0128  115 SER A C   
906  O O   . SER A 115 ? 1.9027 0.7563 0.7369 0.1023  0.0084  0.0032  115 SER A O   
907  C CB  . SER A 115 ? 1.9185 0.6257 0.6378 0.0816  0.0683  0.0251  115 SER A CB  
908  O OG  . SER A 115 ? 2.0793 0.8252 0.8501 0.0756  0.0834  0.0268  115 SER A OG  
909  N N   . GLY A 116 ? 1.8502 0.7367 0.7494 0.0768  0.0561  0.0152  116 GLY A N   
910  C CA  . GLY A 116 ? 1.8262 0.7776 0.7870 0.0830  0.0397  0.0090  116 GLY A CA  
911  C C   . GLY A 116 ? 1.9265 0.8907 0.9110 0.0848  0.0474  0.0142  116 GLY A C   
912  O O   . GLY A 116 ? 1.6699 0.6891 0.7119 0.0844  0.0437  0.0112  116 GLY A O   
913  N N   . ARG A 117 ? 2.0580 0.9672 0.9937 0.0847  0.0605  0.0206  117 ARG A N   
914  C CA  . ARG A 117 ? 1.9971 0.9122 0.9490 0.0817  0.0748  0.0239  117 ARG A CA  
915  C C   . ARG A 117 ? 1.7564 0.7086 0.7549 0.0634  0.1054  0.0245  117 ARG A C   
916  O O   . ARG A 117 ? 1.7402 0.6711 0.7206 0.0515  0.1268  0.0243  117 ARG A O   
917  C CB  . ARG A 117 ? 2.1982 1.0329 1.0728 0.0839  0.0845  0.0277  117 ARG A CB  
918  C CG  . ARG A 117 ? 2.3413 1.1381 1.1676 0.1099  0.0521  0.0274  117 ARG A CG  
919  C CD  . ARG A 117 ? 2.5055 1.2043 1.2374 0.1130  0.0644  0.0324  117 ARG A CD  
920  N NE  . ARG A 117 ? 2.6718 1.3585 1.4018 0.1118  0.0780  0.0341  117 ARG A NE  
921  C CZ  . ARG A 117 ? 2.8642 1.4627 1.5096 0.1179  0.0868  0.0376  117 ARG A CZ  
922  N NH1 . ARG A 117 ? 2.9539 1.4655 1.5061 0.1274  0.0815  0.0405  117 ARG A NH1 
923  N NH2 . ARG A 117 ? 2.8776 1.4695 1.5259 0.1140  0.1022  0.0378  117 ARG A NH2 
924  N N   . PHE A 118 ? 1.6559 0.6649 0.7139 0.0629  0.1063  0.0236  118 PHE A N   
925  C CA  . PHE A 118 ? 1.6451 0.6914 0.7450 0.0508  0.1328  0.0222  118 PHE A CA  
926  C C   . PHE A 118 ? 1.6058 0.6847 0.7402 0.0500  0.1376  0.0209  118 PHE A C   
927  O O   . PHE A 118 ? 1.5972 0.6774 0.7328 0.0592  0.1185  0.0221  118 PHE A O   
928  C CB  . PHE A 118 ? 1.4917 0.5830 0.6347 0.0510  0.1307  0.0218  118 PHE A CB  
929  C CG  . PHE A 118 ? 1.5435 0.6764 0.7255 0.0582  0.1082  0.0209  118 PHE A CG  
930  C CD1 . PHE A 118 ? 1.5791 0.7072 0.7508 0.0627  0.0873  0.0173  118 PHE A CD1 
931  C CD2 . PHE A 118 ? 1.5117 0.6904 0.7407 0.0585  0.1096  0.0205  118 PHE A CD2 
932  C CE1 . PHE A 118 ? 1.4829 0.6515 0.6916 0.0652  0.0700  0.0111  118 PHE A CE1 
933  C CE2 . PHE A 118 ? 1.4423 0.6562 0.7050 0.0618  0.0916  0.0174  118 PHE A CE2 
934  C CZ  . PHE A 118 ? 1.4186 0.6274 0.6714 0.0642  0.0729  0.0116  118 PHE A CZ  
935  N N   . THR A 119 ? 1.6407 0.7489 0.8040 0.0397  0.1628  0.0160  119 THR A N   
936  C CA  . THR A 119 ? 1.6255 0.7706 0.8246 0.0364  0.1706  0.0125  119 THR A CA  
937  C C   . THR A 119 ? 1.5423 0.7560 0.8034 0.0367  0.1772  0.0087  119 THR A C   
938  O O   . THR A 119 ? 1.5351 0.7623 0.8044 0.0336  0.1942  0.0026  119 THR A O   
939  C CB  . THR A 119 ? 1.6378 0.7485 0.8034 0.0218  0.1992  0.0047  119 THR A CB  
940  O OG1 . THR A 119 ? 1.7354 0.7944 0.8553 0.0260  0.1901  0.0093  119 THR A OG1 
941  C CG2 . THR A 119 ? 1.4809 0.6508 0.6983 0.0127  0.2192  -0.0059 119 THR A CG2 
942  N N   . CYS A 120 ? 1.5641 0.8193 0.8659 0.0421  0.1633  0.0112  120 CYS A N   
943  C CA  . CYS A 120 ? 1.5484 0.8636 0.9021 0.0447  0.1680  0.0081  120 CYS A CA  
944  C C   . CYS A 120 ? 1.6514 1.0014 1.0329 0.0375  0.1830  0.0000  120 CYS A C   
945  O O   . CYS A 120 ? 1.6931 1.0224 1.0590 0.0307  0.1857  -0.0007 120 CYS A O   
946  C CB  . CYS A 120 ? 1.3186 0.6564 0.6974 0.0526  0.1457  0.0142  120 CYS A CB  
947  S SG  . CYS A 120 ? 1.8684 1.1808 1.2249 0.0578  0.1359  0.0184  120 CYS A SG  
948  N N   . TRP A 121 ? 1.6060 1.0076 1.0255 0.0404  0.1929  -0.0074 121 TRP A N   
949  C CA  . TRP A 121 ? 1.5612 1.0063 1.0122 0.0331  0.2079  -0.0189 121 TRP A CA  
950  C C   . TRP A 121 ? 1.5050 1.0133 1.0022 0.0448  0.2048  -0.0232 121 TRP A C   
951  O O   . TRP A 121 ? 1.5217 1.0419 1.0218 0.0570  0.2056  -0.0260 121 TRP A O   
952  C CB  . TRP A 121 ? 1.6863 1.1196 1.1184 0.0183  0.2372  -0.0354 121 TRP A CB  
953  C CG  . TRP A 121 ? 1.9915 1.4099 1.4055 0.0212  0.2461  -0.0410 121 TRP A CG  
954  C CD1 . TRP A 121 ? 2.1313 1.4913 1.5006 0.0219  0.2403  -0.0315 121 TRP A CD1 
955  C CD2 . TRP A 121 ? 2.1564 1.6214 1.5971 0.0249  0.2619  -0.0596 121 TRP A CD2 
956  N NE1 . TRP A 121 ? 2.1837 1.5479 1.5501 0.0235  0.2535  -0.0415 121 TRP A NE1 
957  C CE2 . TRP A 121 ? 2.2431 1.6722 1.6536 0.0267  0.2663  -0.0596 121 TRP A CE2 
958  C CE3 . TRP A 121 ? 2.2046 1.7416 1.6926 0.0285  0.2717  -0.0785 121 TRP A CE3 
959  C CZ2 . TRP A 121 ? 2.3361 1.7982 1.7634 0.0325  0.2804  -0.0781 121 TRP A CZ2 
960  C CZ3 . TRP A 121 ? 2.3212 1.8944 1.8261 0.0366  0.2837  -0.0983 121 TRP A CZ3 
961  C CH2 . TRP A 121 ? 2.3798 1.9151 1.8549 0.0389  0.2880  -0.0981 121 TRP A CH2 
962  N N   . TRP A 122 ? 1.4322 0.9773 0.9615 0.0427  0.2009  -0.0240 122 TRP A N   
963  C CA  . TRP A 122 ? 1.4058 1.0083 0.9737 0.0547  0.1972  -0.0284 122 TRP A CA  
964  C C   . TRP A 122 ? 1.3261 0.9810 0.9256 0.0458  0.2152  -0.0470 122 TRP A C   
965  O O   . TRP A 122 ? 1.0922 0.7340 0.6833 0.0272  0.2308  -0.0539 122 TRP A O   
966  C CB  . TRP A 122 ? 1.4552 1.0593 1.0346 0.0593  0.1763  -0.0148 122 TRP A CB  
967  C CG  . TRP A 122 ? 1.4376 1.0237 1.0157 0.0457  0.1708  -0.0099 122 TRP A CG  
968  C CD1 . TRP A 122 ? 1.5219 1.1362 1.1251 0.0358  0.1760  -0.0148 122 TRP A CD1 
969  C CD2 . TRP A 122 ? 1.5065 1.0431 1.0557 0.0429  0.1580  -0.0008 122 TRP A CD2 
970  N NE1 . TRP A 122 ? 1.6421 1.2243 1.2323 0.0287  0.1673  -0.0085 122 TRP A NE1 
971  C CE2 . TRP A 122 ? 1.6347 1.1712 1.1923 0.0345  0.1546  -0.0008 122 TRP A CE2 
972  C CE3 . TRP A 122 ? 1.5992 1.0937 1.1160 0.0480  0.1486  0.0054  122 TRP A CE3 
973  C CZ2 . TRP A 122 ? 1.7586 1.2560 1.2933 0.0349  0.1397  0.0042  122 TRP A CZ2 
974  C CZ3 . TRP A 122 ? 1.7088 1.1682 1.2046 0.0461  0.1342  0.0096  122 TRP A CZ3 
975  C CH2 . TRP A 122 ? 1.8005 1.2623 1.3052 0.0416  0.1286  0.0085  122 TRP A CH2 
976  N N   . LEU A 123 ? 1.3155 1.0274 0.9470 0.0600  0.2136  -0.0564 123 LEU A N   
977  C CA  . LEU A 123 ? 1.2431 1.0182 0.9104 0.0534  0.2297  -0.0788 123 LEU A CA  
978  C C   . LEU A 123 ? 1.2456 1.0630 0.9446 0.0594  0.2171  -0.0751 123 LEU A C   
979  O O   . LEU A 123 ? 1.3228 1.1344 1.0186 0.0771  0.1974  -0.0609 123 LEU A O   
980  C CB  . LEU A 123 ? 1.1707 0.9888 0.8512 0.0671  0.2402  -0.1018 123 LEU A CB  
981  C CG  . LEU A 123 ? 1.1763 0.9910 0.8480 0.0478  0.2687  -0.1248 123 LEU A CG  
982  C CD1 . LEU A 123 ? 1.1544 0.8861 0.7778 0.0307  0.2731  -0.1086 123 LEU A CD1 
983  C CD2 . LEU A 123 ? 1.1826 1.0317 0.8641 0.0665  0.2731  -0.1452 123 LEU A CD2 
984  N N   . THR A 124 ? 1.2191 1.0753 0.9448 0.0426  0.2312  -0.0891 124 THR A N   
985  C CA  . THR A 124 ? 1.2265 1.1237 0.9828 0.0446  0.2217  -0.0871 124 THR A CA  
986  C C   . THR A 124 ? 1.1930 1.1561 0.9853 0.0306  0.2425  -0.1137 124 THR A C   
987  O O   . THR A 124 ? 1.2956 1.2515 1.0830 0.0072  0.2672  -0.1278 124 THR A O   
988  C CB  . THR A 124 ? 1.2512 1.1054 0.9976 0.0322  0.2107  -0.0659 124 THR A CB  
989  O OG1 . THR A 124 ? 1.2035 1.1000 0.9825 0.0230  0.2123  -0.0707 124 THR A OG1 
990  C CG2 . THR A 124 ? 1.3496 1.1500 1.0671 0.0135  0.2228  -0.0631 124 THR A CG2 
991  N N   . THR A 125 ? 1.1610 1.1854 0.9850 0.0442  0.2338  -0.1220 125 THR A N   
992  C CA  . THR A 125 ? 1.1602 1.2566 1.0229 0.0309  0.2521  -0.1498 125 THR A CA  
993  C C   . THR A 125 ? 1.1110 1.2015 0.9847 0.0071  0.2569  -0.1414 125 THR A C   
994  O O   . THR A 125 ? 0.9944 1.1281 0.8928 -0.0136 0.2788  -0.1632 125 THR A O   
995  C CB  . THR A 125 ? 1.1338 1.3042 1.0251 0.0589  0.2388  -0.1653 125 THR A CB  
996  O OG1 . THR A 125 ? 1.1586 1.3066 1.0387 0.0769  0.2121  -0.1394 125 THR A OG1 
997  C CG2 . THR A 125 ? 1.0997 1.2888 0.9858 0.0846  0.2367  -0.1814 125 THR A CG2 
998  N N   . ILE A 126 ? 1.2389 1.2776 1.0950 0.0094  0.2377  -0.1126 126 ILE A N   
999  C CA  . ILE A 126 ? 1.2230 1.2507 1.0884 -0.0104 0.2391  -0.1034 126 ILE A CA  
1000 C C   . ILE A 126 ? 1.1929 1.1770 1.0377 -0.0351 0.2610  -0.1059 126 ILE A C   
1001 O O   . ILE A 126 ? 1.1249 1.0651 0.9374 -0.0350 0.2675  -0.1049 126 ILE A O   
1002 C CB  . ILE A 126 ? 1.3153 1.3013 1.1682 -0.0014 0.2128  -0.0768 126 ILE A CB  
1003 C CG1 . ILE A 126 ? 1.2453 1.2619 1.1072 0.0207  0.1945  -0.0738 126 ILE A CG1 
1004 C CG2 . ILE A 126 ? 1.2784 1.2523 1.1424 -0.0217 0.2146  -0.0702 126 ILE A CG2 
1005 C CD1 . ILE A 126 ? 1.1223 1.1236 0.9591 0.0474  0.1842  -0.0709 126 ILE A CD1 
1006 N N   . SER A 127 ? 1.2815 1.2722 1.1395 -0.0556 0.2731  -0.1089 127 SER A N   
1007 C CA  . SER A 127 ? 1.3094 1.2519 1.1392 -0.0777 0.2967  -0.1123 127 SER A CA  
1008 C C   . SER A 127 ? 1.2988 1.2171 1.1302 -0.0885 0.2932  -0.1001 127 SER A C   
1009 O O   . SER A 127 ? 1.4410 1.3269 1.2516 -0.1073 0.3158  -0.1057 127 SER A O   
1010 C CB  . SER A 127 ? 1.3109 1.2944 1.1515 -0.0988 0.3332  -0.1441 127 SER A CB  
1011 O OG  . SER A 127 ? 1.2351 1.2926 1.1220 -0.1068 0.3391  -0.1592 127 SER A OG  
1012 N N   . THR A 128 ? 1.2197 1.1499 1.0721 -0.0771 0.2665  -0.0851 128 THR A N   
1013 C CA  . THR A 128 ? 1.1736 1.0890 1.0344 -0.0866 0.2619  -0.0766 128 THR A CA  
1014 C C   . THR A 128 ? 1.1442 1.0444 1.0104 -0.0721 0.2296  -0.0587 128 THR A C   
1015 O O   . THR A 128 ? 1.1217 1.0389 0.9944 -0.0579 0.2135  -0.0542 128 THR A O   
1016 C CB  . THR A 128 ? 1.3224 1.2999 1.2237 -0.1036 0.2779  -0.0911 128 THR A CB  
1017 O OG1 . THR A 128 ? 1.4612 1.4155 1.3647 -0.1159 0.2800  -0.0852 128 THR A OG1 
1018 C CG2 . THR A 128 ? 1.3008 1.3366 1.2371 -0.0916 0.2596  -0.0908 128 THR A CG2 
1019 N N   . ASP A 129 ? 1.1649 1.0309 1.0254 -0.0758 0.2218  -0.0511 129 ASP A N   
1020 C CA  . ASP A 129 ? 1.1220 0.9788 0.9923 -0.0671 0.1946  -0.0408 129 ASP A CA  
1021 C C   . ASP A 129 ? 1.2219 1.0522 1.0690 -0.0502 0.1765  -0.0327 129 ASP A C   
1022 O O   . ASP A 129 ? 1.2672 1.1083 1.1258 -0.0450 0.1603  -0.0288 129 ASP A O   
1023 C CB  . ASP A 129 ? 1.0884 0.9981 0.9997 -0.0741 0.1905  -0.0435 129 ASP A CB  
1024 C CG  . ASP A 129 ? 1.2255 1.1648 1.1624 -0.0927 0.2088  -0.0523 129 ASP A CG  
1025 O OD1 . ASP A 129 ? 1.2784 1.2644 1.2331 -0.1000 0.2248  -0.0625 129 ASP A OD1 
1026 O OD2 . ASP A 129 ? 1.2834 1.2002 1.2220 -0.0990 0.2074  -0.0510 129 ASP A OD2 
1027 N N   . LEU A 130 ? 1.3290 1.1197 1.1390 -0.0437 0.1820  -0.0312 130 LEU A N   
1028 C CA  . LEU A 130 ? 1.1916 0.9526 0.9755 -0.0288 0.1673  -0.0241 130 LEU A CA  
1029 C C   . LEU A 130 ? 1.1901 0.8995 0.9466 -0.0213 0.1512  -0.0188 130 LEU A C   
1030 O O   . LEU A 130 ? 1.2377 0.9160 0.9741 -0.0231 0.1572  -0.0198 130 LEU A O   
1031 C CB  . LEU A 130 ? 1.0536 0.8088 0.8149 -0.0258 0.1835  -0.0281 130 LEU A CB  
1032 C CG  . LEU A 130 ? 1.0521 0.8604 0.8381 -0.0219 0.1884  -0.0344 130 LEU A CG  
1033 C CD1 . LEU A 130 ? 1.1352 0.9487 0.9070 -0.0213 0.2077  -0.0454 130 LEU A CD1 
1034 C CD2 . LEU A 130 ? 0.9690 0.7733 0.7532 -0.0077 0.1672  -0.0251 130 LEU A CD2 
1035 N N   . THR A 131 ? 1.1131 0.8122 0.8653 -0.0119 0.1311  -0.0149 131 THR A N   
1036 C CA  . THR A 131 ? 1.1909 0.8521 0.9220 -0.0025 0.1120  -0.0142 131 THR A CA  
1037 C C   . THR A 131 ? 1.3478 0.9953 1.0633 0.0058  0.0994  -0.0117 131 THR A C   
1038 O O   . THR A 131 ? 1.3004 0.9699 1.0354 0.0024  0.0934  -0.0133 131 THR A O   
1039 C CB  . THR A 131 ? 1.2359 0.9150 0.9977 -0.0060 0.0979  -0.0208 131 THR A CB  
1040 O OG1 . THR A 131 ? 1.3007 0.9686 1.0583 0.0022  0.0754  -0.0258 131 THR A OG1 
1041 C CG2 . THR A 131 ? 1.2090 0.9374 1.0135 -0.0200 0.1042  -0.0235 131 THR A CG2 
1042 N N   . PHE A 132 ? 1.5127 1.1182 1.1875 0.0154  0.0976  -0.0082 132 PHE A N   
1043 C CA  . PHE A 132 ? 1.3848 0.9737 1.0406 0.0223  0.0885  -0.0062 132 PHE A CA  
1044 C C   . PHE A 132 ? 1.3594 0.9242 0.9998 0.0311  0.0660  -0.0114 132 PHE A C   
1045 O O   . PHE A 132 ? 1.3786 0.9365 1.0194 0.0363  0.0550  -0.0165 132 PHE A O   
1046 C CB  . PHE A 132 ? 1.1890 0.7528 0.8114 0.0259  0.1034  -0.0008 132 PHE A CB  
1047 C CG  . PHE A 132 ? 1.1945 0.7913 0.8352 0.0202  0.1235  -0.0013 132 PHE A CG  
1048 C CD1 . PHE A 132 ? 1.2059 0.8313 0.8651 0.0224  0.1226  -0.0005 132 PHE A CD1 
1049 C CD2 . PHE A 132 ? 1.2689 0.8672 0.9048 0.0134  0.1439  -0.0053 132 PHE A CD2 
1050 C CE1 . PHE A 132 ? 1.1548 0.8151 0.8302 0.0226  0.1373  -0.0037 132 PHE A CE1 
1051 C CE2 . PHE A 132 ? 1.4278 1.0672 1.0855 0.0088  0.1614  -0.0115 132 PHE A CE2 
1052 C CZ  . PHE A 132 ? 1.2462 0.9196 0.9252 0.0158  0.1559  -0.0108 132 PHE A CZ  
1053 N N   . SER A 133 ? 1.0414 0.5950 0.6676 0.0340  0.0590  -0.0121 133 SER A N   
1054 C CA  . SER A 133 ? 1.2964 0.8333 0.9081 0.0421  0.0379  -0.0210 133 SER A CA  
1055 C C   . SER A 133 ? 1.3119 0.8284 0.8976 0.0432  0.0400  -0.0181 133 SER A C   
1056 O O   . SER A 133 ? 1.3683 0.8975 0.9639 0.0351  0.0500  -0.0161 133 SER A O   
1057 C CB  . SER A 133 ? 1.3781 0.9510 1.0288 0.0351  0.0244  -0.0367 133 SER A CB  
1058 O OG  . SER A 133 ? 1.5162 1.0849 1.1585 0.0376  0.0090  -0.0500 133 SER A OG  
1059 N N   . VAL A 134 ? 1.2908 0.7709 0.8381 0.0541  0.0312  -0.0177 134 VAL A N   
1060 C CA  . VAL A 134 ? 1.2254 0.6837 0.7459 0.0542  0.0346  -0.0151 134 VAL A CA  
1061 C C   . VAL A 134 ? 1.1681 0.6209 0.6781 0.0589  0.0138  -0.0290 134 VAL A C   
1062 O O   . VAL A 134 ? 1.1886 0.6347 0.6892 0.0713  -0.0054 -0.0371 134 VAL A O   
1063 C CB  . VAL A 134 ? 1.2419 0.6606 0.7217 0.0595  0.0480  -0.0032 134 VAL A CB  
1064 C CG1 . VAL A 134 ? 1.3027 0.7079 0.7651 0.0568  0.0573  0.0006  134 VAL A CG1 
1065 C CG2 . VAL A 134 ? 1.2530 0.6824 0.7448 0.0545  0.0676  0.0035  134 VAL A CG2 
1066 N N   . LYS A 135 ? 1.1676 0.6236 0.6772 0.0500  0.0181  -0.0338 135 LYS A N   
1067 C CA  . LYS A 135 ? 1.3685 0.8237 0.8686 0.0503  0.0027  -0.0508 135 LYS A CA  
1068 C C   . LYS A 135 ? 1.3205 0.7475 0.7898 0.0454  0.0158  -0.0445 135 LYS A C   
1069 O O   . LYS A 135 ? 1.2448 0.6630 0.7105 0.0405  0.0358  -0.0311 135 LYS A O   
1070 C CB  . LYS A 135 ? 1.4457 0.9428 0.9857 0.0371  -0.0039 -0.0734 135 LYS A CB  
1071 C CG  . LYS A 135 ? 1.5653 1.0708 1.1194 0.0176  0.0174  -0.0719 135 LYS A CG  
1072 C CD  . LYS A 135 ? 1.6232 1.1460 1.2032 0.0151  0.0268  -0.0606 135 LYS A CD  
1073 C CE  . LYS A 135 ? 1.5802 1.1413 1.2005 0.0108  0.0137  -0.0779 135 LYS A CE  
1074 N NZ  . LYS A 135 ? 1.4308 1.0036 1.0699 0.0148  0.0181  -0.0645 135 LYS A NZ  
1075 N N   . SER A 136 ? 1.4282 0.8420 0.8744 0.0487  0.0040  -0.0555 136 SER A N   
1076 C CA  . SER A 136 ? 1.4156 0.7992 0.8297 0.0437  0.0172  -0.0496 136 SER A CA  
1077 C C   . SER A 136 ? 1.5033 0.8885 0.9051 0.0395  0.0057  -0.0703 136 SER A C   
1078 O O   . SER A 136 ? 1.6493 1.0562 1.0606 0.0469  -0.0177 -0.0892 136 SER A O   
1079 C CB  . SER A 136 ? 1.3740 0.7177 0.7519 0.0546  0.0246  -0.0300 136 SER A CB  
1080 O OG  . SER A 136 ? 1.3035 0.6229 0.6590 0.0487  0.0430  -0.0221 136 SER A OG  
1081 N N   . SER A 137 ? 1.5485 0.9120 0.9285 0.0288  0.0222  -0.0684 137 SER A N   
1082 C CA  . SER A 137 ? 1.6412 1.0059 1.0078 0.0205  0.0166  -0.0893 137 SER A CA  
1083 C C   . SER A 137 ? 1.6780 1.0066 1.0130 0.0099  0.0405  -0.0806 137 SER A C   
1084 O O   . SER A 137 ? 1.7261 1.0384 1.0583 0.0062  0.0618  -0.0647 137 SER A O   
1085 C CB  . SER A 137 ? 1.6394 1.0481 1.0417 0.0045  0.0123  -0.1194 137 SER A CB  
1086 O OG  . SER A 137 ? 1.5959 1.0006 1.0066 -0.0141 0.0375  -0.1164 137 SER A OG  
1087 N N   . ARG A 138 ? 1.6585 0.9747 0.9681 0.0069  0.0362  -0.0921 138 ARG A N   
1088 C CA  . ARG A 138 ? 1.7079 0.9897 0.9868 -0.0052 0.0596  -0.0874 138 ARG A CA  
1089 C C   . ARG A 138 ? 1.7241 1.0218 1.0087 -0.0290 0.0689  -0.1158 138 ARG A C   
1090 O O   . ARG A 138 ? 1.6148 0.9390 0.9052 -0.0338 0.0532  -0.1426 138 ARG A O   
1091 C CB  . ARG A 138 ? 1.7596 1.0092 1.0001 0.0039  0.0545  -0.0796 138 ARG A CB  
1092 C CG  . ARG A 138 ? 1.6876 0.8962 0.8957 -0.0051 0.0811  -0.0689 138 ARG A CG  
1093 C CD  . ARG A 138 ? 1.5073 0.6868 0.6781 -0.0005 0.0760  -0.0664 138 ARG A CD  
1094 N NE  . ARG A 138 ? 1.5105 0.6721 0.6680 0.0174  0.0659  -0.0487 138 ARG A NE  
1095 C CZ  . ARG A 138 ? 1.5723 0.7016 0.7118 0.0216  0.0832  -0.0288 138 ARG A CZ  
1096 N NH1 . ARG A 138 ? 1.5784 0.6914 0.7123 0.0143  0.1080  -0.0221 138 ARG A NH1 
1097 N NH2 . ARG A 138 ? 1.5259 0.6373 0.6503 0.0331  0.0771  -0.0177 138 ARG A NH2 
1098 N N   . GLY A 139 ? 1.8656 1.1457 1.1453 -0.0435 0.0954  -0.1122 139 GLY A N   
1099 C CA  . GLY A 139 ? 1.9537 1.2372 1.2301 -0.0711 0.1125  -0.1397 139 GLY A CA  
1100 C C   . GLY A 139 ? 2.0434 1.3805 1.3627 -0.0823 0.0994  -0.1693 139 GLY A C   
1101 O O   . GLY A 139 ? 2.0097 1.3814 1.3604 -0.0656 0.0738  -0.1679 139 GLY A O   
1102 N N   . SER A 140 ? 2.1810 1.5226 1.4994 -0.1121 0.1194  -0.1982 140 SER A N   
1103 C CA  . SER A 140 ? 2.2057 1.6013 1.5668 -0.1282 0.1114  -0.2335 140 SER A CA  
1104 C C   . SER A 140 ? 2.2369 1.6892 1.6255 -0.1217 0.0805  -0.2650 140 SER A C   
1105 O O   . SER A 140 ? 2.2110 1.7199 1.6429 -0.1258 0.0643  -0.2956 140 SER A O   
1106 C CB  . SER A 140 ? 2.1875 1.5657 1.5327 -0.1666 0.1470  -0.2597 140 SER A CB  
1107 O OG  . SER A 140 ? 2.1727 1.5275 1.4834 -0.1843 0.1649  -0.2753 140 SER A OG  
1108 N N   . SER A 141 ? 2.2669 1.7036 1.6287 -0.1097 0.0713  -0.2587 141 SER A N   
1109 C CA  . SER A 141 ? 2.2467 1.7309 1.6241 -0.0986 0.0397  -0.2876 141 SER A CA  
1110 C C   . SER A 141 ? 2.3517 1.8587 1.7500 -0.0627 0.0022  -0.2745 141 SER A C   
1111 O O   . SER A 141 ? 2.4063 1.9133 1.8242 -0.0556 0.0020  -0.2566 141 SER A O   
1112 C CB  . SER A 141 ? 2.1973 1.6504 1.5325 -0.0968 0.0425  -0.2827 141 SER A CB  
1113 O OG  . SER A 141 ? 2.1962 1.7001 1.5445 -0.0939 0.0174  -0.3220 141 SER A OG  
1114 N N   . ASP A 142 ? 2.3628 1.8845 1.7514 -0.0398 -0.0285 -0.2838 142 ASP A N   
1115 C CA  . ASP A 142 ? 2.3189 1.8561 1.7166 -0.0034 -0.0656 -0.2768 142 ASP A CA  
1116 C C   . ASP A 142 ? 2.2633 1.7877 1.6773 0.0058  -0.0622 -0.2475 142 ASP A C   
1117 O O   . ASP A 142 ? 2.2450 1.7184 1.6313 0.0138  -0.0501 -0.2078 142 ASP A O   
1118 C CB  . ASP A 142 ? 2.3980 1.8946 1.7459 0.0234  -0.0839 -0.2572 142 ASP A CB  
1119 C CG  . ASP A 142 ? 2.4418 1.8696 1.7474 0.0165  -0.0556 -0.2167 142 ASP A CG  
1120 O OD1 . ASP A 142 ? 2.4324 1.8331 1.7394 0.0189  -0.0415 -0.1856 142 ASP A OD1 
1121 O OD2 . ASP A 142 ? 2.4776 1.8819 1.7501 0.0092  -0.0478 -0.2182 142 ASP A OD2 
1122 N N   . PRO A 143 ? 2.2359 1.8112 1.6977 0.0033  -0.0720 -0.2705 143 PRO A N   
1123 C CA  . PRO A 143 ? 2.1910 1.7637 1.6738 0.0118  -0.0716 -0.2484 143 PRO A CA  
1124 C C   . PRO A 143 ? 2.1719 1.7177 1.6302 0.0487  -0.0963 -0.2230 143 PRO A C   
1125 O O   . PRO A 143 ? 1.9710 1.4936 1.4287 0.0557  -0.0892 -0.1939 143 PRO A O   
1126 C CB  . PRO A 143 ? 2.1471 1.7882 1.6855 0.0027  -0.0830 -0.2896 143 PRO A CB  
1127 C CG  . PRO A 143 ? 2.1519 1.8245 1.6985 -0.0243 -0.0733 -0.3313 143 PRO A CG  
1128 C CD  . PRO A 143 ? 2.1839 1.8270 1.6853 -0.0111 -0.0818 -0.3239 143 PRO A CD  
1129 N N   . GLN A 144 ? 2.3146 1.8609 1.7481 0.0716  -0.1239 -0.2360 144 GLN A N   
1130 C CA  . GLN A 144 ? 2.3474 1.8526 1.7402 0.1068  -0.1456 -0.2131 144 GLN A CA  
1131 C C   . GLN A 144 ? 2.2970 1.7326 1.6331 0.1062  -0.1278 -0.1786 144 GLN A C   
1132 O O   . GLN A 144 ? 2.1977 1.6158 1.5327 0.0815  -0.0967 -0.1644 144 GLN A O   
1133 C CB  . GLN A 144 ? 2.4476 1.9798 1.8315 0.1372  -0.1867 -0.2438 144 GLN A CB  
1134 C CG  . GLN A 144 ? 2.4892 2.0514 1.8982 0.1643  -0.2147 -0.2565 144 GLN A CG  
1135 C CD  . GLN A 144 ? 2.4427 2.0770 1.9250 0.1422  -0.2088 -0.2867 144 GLN A CD  
1136 O OE1 . GLN A 144 ? 2.4599 2.1173 1.9696 0.1053  -0.1823 -0.2986 144 GLN A OE1 
1137 N NE2 . GLN A 144 ? 2.3718 2.0367 1.8812 0.1644  -0.2321 -0.3002 144 GLN A NE2 
1138 N N   . GLY A 145 ? 2.3322 1.7249 1.6173 0.1347  -0.1473 -0.1668 145 GLY A N   
1139 C CA  . GLY A 145 ? 2.2691 1.5930 1.4982 0.1341  -0.1301 -0.1361 145 GLY A CA  
1140 C C   . GLY A 145 ? 2.1460 1.4350 1.3699 0.1331  -0.1100 -0.1047 145 GLY A C   
1141 O O   . GLY A 145 ? 2.2176 1.4685 1.4065 0.1547  -0.1205 -0.0923 145 GLY A O   
1142 N N   . VAL A 146 ? 1.8748 1.1758 1.1306 0.1083  -0.0803 -0.0939 146 VAL A N   
1143 C CA  . VAL A 146 ? 1.7366 1.0166 0.9954 0.1048  -0.0593 -0.0685 146 VAL A CA  
1144 C C   . VAL A 146 ? 1.6638 0.9692 0.9529 0.1151  -0.0710 -0.0715 146 VAL A C   
1145 O O   . VAL A 146 ? 1.5726 0.9299 0.9126 0.1063  -0.0746 -0.0875 146 VAL A O   
1146 C CB  . VAL A 146 ? 1.5638 0.8564 0.8501 0.0809  -0.0291 -0.0600 146 VAL A CB  
1147 C CG1 . VAL A 146 ? 1.5113 0.7759 0.7876 0.0799  -0.0070 -0.0352 146 VAL A CG1 
1148 C CG2 . VAL A 146 ? 1.6783 0.9577 0.9446 0.0688  -0.0193 -0.0648 146 VAL A CG2 
1149 N N   . THR A 147 ? 1.5566 0.8209 0.8104 0.1318  -0.0744 -0.0572 147 THR A N   
1150 C CA  . THR A 147 ? 1.5565 0.8350 0.8320 0.1412  -0.0811 -0.0567 147 THR A CA  
1151 C C   . THR A 147 ? 1.6332 0.8763 0.8924 0.1338  -0.0536 -0.0330 147 THR A C   
1152 O O   . THR A 147 ? 1.6648 0.8593 0.8791 0.1304  -0.0374 -0.0196 147 THR A O   
1153 C CB  . THR A 147 ? 1.6299 0.8896 0.8721 0.1726  -0.1137 -0.0674 147 THR A CB  
1154 O OG1 . THR A 147 ? 1.8037 0.9854 0.9710 0.1855  -0.1087 -0.0494 147 THR A OG1 
1155 C CG2 . THR A 147 ? 1.6360 0.9286 0.8847 0.1823  -0.1417 -0.0945 147 THR A CG2 
1156 N N   . CYS A 148 ? 1.5709 0.8414 0.8682 0.1294  -0.0471 -0.0311 148 CYS A N   
1157 C CA  . CYS A 148 ? 1.5717 0.8252 0.8665 0.1177  -0.0182 -0.0140 148 CYS A CA  
1158 C C   . CYS A 148 ? 1.6786 0.9175 0.9657 0.1274  -0.0197 -0.0113 148 CYS A C   
1159 O O   . CYS A 148 ? 1.7508 1.0187 1.0648 0.1380  -0.0399 -0.0224 148 CYS A O   
1160 C CB  . CYS A 148 ? 1.4829 0.7861 0.8333 0.0971  0.0003  -0.0125 148 CYS A CB  
1161 S SG  . CYS A 148 ? 2.0737 1.3715 1.4161 0.0845  0.0161  -0.0084 148 CYS A SG  
1162 N N   . GLY A 149 ? 1.6474 0.8411 0.8972 0.1221  0.0042  0.0012  149 GLY A N   
1163 C CA  . GLY A 149 ? 1.6567 0.8279 0.8919 0.1271  0.0103  0.0042  149 GLY A CA  
1164 C C   . GLY A 149 ? 1.6031 0.8324 0.9034 0.1109  0.0245  0.0034  149 GLY A C   
1165 O O   . GLY A 149 ? 1.4215 0.7111 0.7800 0.1032  0.0180  -0.0025 149 GLY A O   
1166 N N   . ALA A 150 ? 1.5313 0.7380 0.8164 0.1043  0.0460  0.0082  150 ALA A N   
1167 C CA  . ALA A 150 ? 1.4093 0.6676 0.7505 0.0892  0.0606  0.0067  150 ALA A CA  
1168 C C   . ALA A 150 ? 1.4487 0.7174 0.7980 0.0674  0.0950  0.0099  150 ALA A C   
1169 O O   . ALA A 150 ? 1.5332 0.7516 0.8322 0.0620  0.1154  0.0120  150 ALA A O   
1170 C CB  . ALA A 150 ? 1.4599 0.6929 0.7835 0.0972  0.0601  0.0057  150 ALA A CB  
1171 N N   . ALA A 151 ? 1.4637 0.7977 0.8745 0.0554  0.1015  0.0077  151 ALA A N   
1172 C CA  . ALA A 151 ? 1.4312 0.7868 0.8561 0.0391  0.1306  0.0064  151 ALA A CA  
1173 C C   . ALA A 151 ? 1.3382 0.6751 0.7460 0.0276  0.1562  0.0025  151 ALA A C   
1174 O O   . ALA A 151 ? 1.3157 0.6582 0.7354 0.0285  0.1520  0.0017  151 ALA A O   
1175 C CB  . ALA A 151 ? 1.1683 0.5937 0.6559 0.0340  0.1286  0.0045  151 ALA A CB  
1176 N N   . THR A 152 ? 1.3923 0.7052 0.7704 0.0151  0.1847  -0.0023 152 THR A N   
1177 C CA  . THR A 152 ? 1.5330 0.8249 0.8899 -0.0015 0.2158  -0.0104 152 THR A CA  
1178 C C   . THR A 152 ? 1.5755 0.9133 0.9612 -0.0216 0.2475  -0.0250 152 THR A C   
1179 O O   . THR A 152 ? 1.5156 0.8824 0.9201 -0.0194 0.2461  -0.0274 152 THR A O   
1180 C CB  . THR A 152 ? 1.6741 0.8689 0.9438 0.0000  0.2260  -0.0082 152 THR A CB  
1181 O OG1 . THR A 152 ? 1.8792 1.0463 1.1170 -0.0026 0.2335  -0.0093 152 THR A OG1 
1182 C CG2 . THR A 152 ? 1.6204 0.7718 0.8587 0.0253  0.1923  0.0028  152 THR A CG2 
1183 N N   . LEU A 153 ? 1.6496 0.9956 1.0385 -0.0405 0.2762  -0.0371 153 LEU A N   
1184 C CA  . LEU A 153 ? 1.6738 1.0682 1.0899 -0.0610 0.3088  -0.0580 153 LEU A CA  
1185 C C   . LEU A 153 ? 1.6764 1.0162 1.0368 -0.0726 0.3338  -0.0678 153 LEU A C   
1186 O O   . LEU A 153 ? 1.7486 1.0004 1.0373 -0.0724 0.3376  -0.0605 153 LEU A O   
1187 C CB  . LEU A 153 ? 1.6947 1.1108 1.1264 -0.0812 0.3350  -0.0716 153 LEU A CB  
1188 C CG  . LEU A 153 ? 1.6793 1.1724 1.1589 -0.1016 0.3647  -0.0984 153 LEU A CG  
1189 C CD1 . LEU A 153 ? 1.8025 1.2618 1.2396 -0.1259 0.4061  -0.1216 153 LEU A CD1 
1190 C CD2 . LEU A 153 ? 1.5697 1.1447 1.1119 -0.0851 0.3429  -0.0990 153 LEU A CD2 
1191 N N   . SER A 154 ? 1.6697 1.0601 1.0602 -0.0813 0.3504  -0.0858 154 SER A N   
1192 C CA  . SER A 154 ? 1.7258 1.0715 1.0702 -0.0927 0.3729  -0.0972 154 SER A CA  
1193 C C   . SER A 154 ? 1.8283 1.2286 1.2010 -0.1167 0.4114  -0.1318 154 SER A C   
1194 O O   . SER A 154 ? 1.8204 1.1763 1.1480 -0.1372 0.4429  -0.1489 154 SER A O   
1195 C CB  . SER A 154 ? 1.6740 1.0124 1.0163 -0.0708 0.3443  -0.0820 154 SER A CB  
1196 O OG  . SER A 154 ? 1.6805 0.9728 0.9969 -0.0508 0.3106  -0.0561 154 SER A OG  
1197 N N   . ALA A 155 ? 1.8941 1.3912 1.3399 -0.1144 0.4092  -0.1450 155 ALA A N   
1198 C CA  . ALA A 155 ? 1.9396 1.5058 1.4222 -0.1326 0.4413  -0.1831 155 ALA A CA  
1199 C C   . ALA A 155 ? 1.8415 1.5005 1.3903 -0.1363 0.4453  -0.2001 155 ALA A C   
1200 O O   . ALA A 155 ? 1.8112 1.4794 1.3780 -0.1260 0.4239  -0.1804 155 ALA A O   
1201 C CB  . ALA A 155 ? 1.9676 1.5690 1.4722 -0.1158 0.4303  -0.1897 155 ALA A CB  
1202 N N   . GLU A 156 ? 1.8387 1.5691 1.4242 -0.1516 0.4733  -0.2397 156 GLU A N   
1203 C CA  . GLU A 156 ? 1.8469 1.6780 1.4990 -0.1532 0.4768  -0.2619 156 GLU A CA  
1204 C C   . GLU A 156 ? 1.9113 1.8299 1.6075 -0.1570 0.4960  -0.3067 156 GLU A C   
1205 O O   . GLU A 156 ? 1.8942 1.8533 1.6051 -0.1878 0.5351  -0.3473 156 GLU A O   
1206 C CB  . GLU A 156 ? 1.9562 1.7692 1.5941 -0.1846 0.5064  -0.2711 156 GLU A CB  
1207 C CG  . GLU A 156 ? 2.0530 1.9623 1.7574 -0.1834 0.5023  -0.2847 156 GLU A CG  
1208 C CD  . GLU A 156 ? 2.1201 1.9985 1.8062 -0.2102 0.5249  -0.2837 156 GLU A CD  
1209 O OE1 . GLU A 156 ? 2.0214 1.9742 1.7585 -0.2137 0.5253  -0.2958 156 GLU A OE1 
1210 O OE2 . GLU A 156 ? 2.1838 1.9603 1.8008 -0.2260 0.5420  -0.2709 156 GLU A OE2 
1211 N N   . ARG A 157 ? 2.0630 2.0105 1.7793 -0.1253 0.4690  -0.3014 157 ARG A N   
1212 C CA  . ARG A 157 ? 2.1548 2.1840 1.9120 -0.1204 0.4810  -0.3434 157 ARG A CA  
1213 C C   . ARG A 157 ? 2.2256 2.3708 2.0532 -0.1017 0.4678  -0.3652 157 ARG A C   
1214 O O   . ARG A 157 ? 2.2445 2.4292 2.0983 -0.0613 0.4320  -0.3532 157 ARG A O   
1215 C CB  . ARG A 157 ? 2.0432 2.0485 1.7871 -0.0903 0.4564  -0.3270 157 ARG A CB  
1216 C CG  . ARG A 157 ? 1.9850 1.8725 1.6592 -0.0969 0.4527  -0.2913 157 ARG A CG  
1217 C CD  . ARG A 157 ? 2.0391 1.9080 1.7042 -0.0662 0.4261  -0.2732 157 ARG A CD  
1218 N NE  . ARG A 157 ? 2.2939 2.0553 1.8928 -0.0735 0.4234  -0.2432 157 ARG A NE  
1219 C CZ  . ARG A 157 ? 2.4296 2.1348 1.9833 -0.0990 0.4529  -0.2567 157 ARG A CZ  
1220 N NH1 . ARG A 157 ? 2.4745 2.2214 2.0440 -0.1233 0.4906  -0.3022 157 ARG A NH1 
1221 N NH2 . ARG A 157 ? 2.4439 2.0516 1.9347 -0.1009 0.4454  -0.2276 157 ARG A NH2 
1222 N N   . VAL A 158 ? 2.2225 2.4182 2.0753 -0.1312 0.4981  -0.3983 158 VAL A N   
1223 C CA  . VAL A 158 ? 2.1264 2.4323 2.0436 -0.1165 0.4869  -0.4203 158 VAL A CA  
1224 C C   . VAL A 158 ? 2.1113 2.5080 2.0745 -0.0788 0.4668  -0.4470 158 VAL A C   
1225 O O   . VAL A 158 ? 2.0259 2.4310 1.9872 -0.0806 0.4815  -0.4735 158 VAL A O   
1226 C CB  . VAL A 158 ? 2.0879 2.4416 2.0258 -0.1604 0.5318  -0.4641 158 VAL A CB  
1227 C CG1 . VAL A 158 ? 2.0548 2.5063 2.0511 -0.1460 0.5154  -0.4755 158 VAL A CG1 
1228 C CG2 . VAL A 158 ? 2.0729 2.3199 1.9503 -0.1986 0.5588  -0.4421 158 VAL A CG2 
1229 N N   . ARG A 159 ? 2.2081 2.6688 2.2086 -0.0434 0.4330  -0.4401 159 ARG A N   
1230 C CA  . ARG A 159 ? 2.2665 2.8103 2.3046 0.0017  0.4076  -0.4621 159 ARG A CA  
1231 C C   . ARG A 159 ? 2.2753 2.9280 2.3679 0.0148  0.3986  -0.4899 159 ARG A C   
1232 O O   . ARG A 159 ? 2.3108 2.9614 2.4079 -0.0068 0.4047  -0.4794 159 ARG A O   
1233 C CB  . ARG A 159 ? 2.2584 2.7410 2.2643 0.0459  0.3645  -0.4130 159 ARG A CB  
1234 C CG  . ARG A 159 ? 2.2132 2.7650 2.2461 0.1003  0.3276  -0.4185 159 ARG A CG  
1235 C CD  . ARG A 159 ? 2.2197 2.6943 2.2087 0.1378  0.2923  -0.3702 159 ARG A CD  
1236 N NE  . ARG A 159 ? 2.2693 2.7207 2.2411 0.1529  0.2936  -0.3769 159 ARG A NE  
1237 C CZ  . ARG A 159 ? 2.3002 2.6716 2.2359 0.1268  0.3106  -0.3610 159 ARG A CZ  
1238 N NH1 . ARG A 159 ? 2.3156 2.6719 2.2383 0.1420  0.3114  -0.3693 159 ARG A NH1 
1239 N NH2 . ARG A 159 ? 2.2964 2.6015 2.2065 0.0876  0.3260  -0.3374 159 ARG A NH2 
1240 N N   . GLY A 160 ? 2.2072 2.9555 2.3399 0.0515  0.3835  -0.5269 160 GLY A N   
1241 C CA  . GLY A 160 ? 2.1126 2.9711 2.2957 0.0715  0.3701  -0.5567 160 GLY A CA  
1242 C C   . GLY A 160 ? 2.0312 2.8601 2.2030 0.0751  0.3488  -0.5147 160 GLY A C   
1243 O O   . GLY A 160 ? 2.0043 2.7774 2.1445 0.1103  0.3122  -0.4688 160 GLY A O   
1244 N N   . ASP A 161 ? 1.9545 2.8193 2.1505 0.0359  0.3747  -0.5330 161 ASP A N   
1245 C CA  . ASP A 161 ? 1.8659 2.7079 2.0561 0.0313  0.3608  -0.4987 161 ASP A CA  
1246 C C   . ASP A 161 ? 1.7687 2.4834 1.9070 0.0050  0.3660  -0.4450 161 ASP A C   
1247 O O   . ASP A 161 ? 1.7720 2.4555 1.9020 -0.0418 0.4009  -0.4492 161 ASP A O   
1248 C CB  . ASP A 161 ? 1.8783 2.7475 2.0707 0.0880  0.3121  -0.4798 161 ASP A CB  
1249 N N   . ASN A 162 ? 1.6401 2.2811 1.7412 0.0360  0.3318  -0.3971 162 ASN A N   
1250 C CA  . ASN A 162 ? 1.5492 2.0788 1.6051 0.0175  0.3303  -0.3484 162 ASN A CA  
1251 C C   . ASN A 162 ? 1.6543 2.1106 1.6742 -0.0064 0.3539  -0.3447 162 ASN A C   
1252 O O   . ASN A 162 ? 1.7273 2.1876 1.7417 0.0086  0.3541  -0.3586 162 ASN A O   
1253 C CB  . ASN A 162 ? 1.4307 1.9104 1.4593 0.0554  0.2887  -0.3041 162 ASN A CB  
1254 N N   . LYS A 163 ? 1.5914 1.9780 1.5836 -0.0418 0.3733  -0.3262 163 LYS A N   
1255 C CA  . LYS A 163 ? 1.4548 1.7586 1.4015 -0.0646 0.3952  -0.3195 163 LYS A CA  
1256 C C   . LYS A 163 ? 1.3604 1.5741 1.2635 -0.0436 0.3655  -0.2720 163 LYS A C   
1257 O O   . LYS A 163 ? 1.3099 1.4993 1.2090 -0.0307 0.3392  -0.2397 163 LYS A O   
1258 C CB  . LYS A 163 ? 1.3542 1.6193 1.2821 -0.1097 0.4311  -0.3246 163 LYS A CB  
1259 N N   . GLU A 164 ? 1.3186 1.4848 1.1898 -0.0426 0.3715  -0.2710 164 GLU A N   
1260 C CA  . GLU A 164 ? 1.3046 1.3909 1.1351 -0.0237 0.3455  -0.2314 164 GLU A CA  
1261 C C   . GLU A 164 ? 1.3557 1.3470 1.1357 -0.0494 0.3583  -0.2108 164 GLU A C   
1262 O O   . GLU A 164 ? 1.4452 1.4161 1.2061 -0.0796 0.3927  -0.2310 164 GLU A O   
1263 C CB  . GLU A 164 ? 1.3083 1.3997 1.1327 -0.0028 0.3410  -0.2416 164 GLU A CB  
1264 C CG  . GLU A 164 ? 1.2992 1.3379 1.0962 0.0273  0.3079  -0.2054 164 GLU A CG  
1265 C CD  . GLU A 164 ? 1.2918 1.3381 1.0835 0.0486  0.3056  -0.2176 164 GLU A CD  
1266 O OE1 . GLU A 164 ? 1.3390 1.3784 1.1216 0.0295  0.3320  -0.2404 164 GLU A OE1 
1267 O OE2 . GLU A 164 ? 1.2721 1.3269 1.0648 0.0839  0.2792  -0.2053 164 GLU A OE2 
1268 N N   . TYR A 165 ? 1.2711 1.2033 1.0264 -0.0367 0.3311  -0.1731 165 TYR A N   
1269 C CA  . TYR A 165 ? 1.1951 1.0398 0.9023 -0.0527 0.3352  -0.1525 165 TYR A CA  
1270 C C   . TYR A 165 ? 1.1896 0.9729 0.8614 -0.0340 0.3111  -0.1262 165 TYR A C   
1271 O O   . TYR A 165 ? 1.1350 0.9282 0.8198 -0.0113 0.2823  -0.1085 165 TYR A O   
1272 C CB  . TYR A 165 ? 1.1680 1.0081 0.8854 -0.0574 0.3245  -0.1361 165 TYR A CB  
1273 C CG  . TYR A 165 ? 1.3833 1.2850 1.1375 -0.0762 0.3463  -0.1595 165 TYR A CG  
1274 C CD1 . TYR A 165 ? 1.4350 1.4263 1.2411 -0.0649 0.3406  -0.1766 165 TYR A CD1 
1275 C CD2 . TYR A 165 ? 1.5476 1.4150 1.2803 -0.1038 0.3723  -0.1650 165 TYR A CD2 
1276 C CE1 . TYR A 165 ? 1.5107 1.5636 1.3521 -0.0828 0.3604  -0.2004 165 TYR A CE1 
1277 C CE2 . TYR A 165 ? 1.6179 1.5416 1.3837 -0.1239 0.3950  -0.1879 165 TYR A CE2 
1278 C CZ  . TYR A 165 ? 1.5691 1.5895 1.3922 -0.1144 0.3889  -0.2064 165 TYR A CZ  
1279 O OH  . TYR A 165 ? 1.5005 1.5818 1.3579 -0.1352 0.4114  -0.2316 165 TYR A OH  
1280 N N   . GLU A 166 ? 1.2620 0.9783 0.8848 -0.0452 0.3246  -0.1248 166 GLU A N   
1281 C CA  . GLU A 166 ? 1.3728 1.0317 0.9600 -0.0297 0.3041  -0.1031 166 GLU A CA  
1282 C C   . GLU A 166 ? 1.3854 0.9689 0.9295 -0.0319 0.2913  -0.0797 166 GLU A C   
1283 O O   . GLU A 166 ? 1.5152 1.0555 1.0260 -0.0495 0.3099  -0.0835 166 GLU A O   
1284 C CB  . GLU A 166 ? 1.4566 1.0956 1.0181 -0.0360 0.3242  -0.1189 166 GLU A CB  
1285 C CG  . GLU A 166 ? 1.4868 1.0528 0.9998 -0.0273 0.3100  -0.0986 166 GLU A CG  
1286 C CD  . GLU A 166 ? 1.7052 1.2482 1.1904 -0.0382 0.3341  -0.1162 166 GLU A CD  
1287 O OE1 . GLU A 166 ? 1.9815 1.4466 1.4087 -0.0489 0.3415  -0.1086 166 GLU A OE1 
1288 O OE2 . GLU A 166 ? 1.6364 1.2392 1.1564 -0.0351 0.3454  -0.1393 166 GLU A OE2 
1289 N N   . TYR A 167 ? 1.2729 0.8404 0.8153 -0.0130 0.2600  -0.0580 167 TYR A N   
1290 C CA  . TYR A 167 ? 1.3296 0.8366 0.8370 -0.0097 0.2423  -0.0396 167 TYR A CA  
1291 C C   . TYR A 167 ? 1.4777 0.9361 0.9471 0.0007  0.2297  -0.0295 167 TYR A C   
1292 O O   . TYR A 167 ? 1.4950 0.9758 0.9797 0.0116  0.2214  -0.0280 167 TYR A O   
1293 C CB  . TYR A 167 ? 1.2915 0.8275 0.8338 0.0003  0.2164  -0.0279 167 TYR A CB  
1294 C CG  . TYR A 167 ? 1.3959 0.9669 0.9685 -0.0107 0.2255  -0.0344 167 TYR A CG  
1295 C CD1 . TYR A 167 ? 1.4235 1.0587 1.0364 -0.0173 0.2418  -0.0497 167 TYR A CD1 
1296 C CD2 . TYR A 167 ? 1.4128 0.9549 0.9741 -0.0128 0.2172  -0.0270 167 TYR A CD2 
1297 C CE1 . TYR A 167 ? 1.4205 1.0892 1.0612 -0.0293 0.2514  -0.0567 167 TYR A CE1 
1298 C CE2 . TYR A 167 ? 1.3770 0.9489 0.9652 -0.0239 0.2271  -0.0330 167 TYR A CE2 
1299 C CZ  . TYR A 167 ? 1.3832 1.0180 1.0110 -0.0338 0.2451  -0.0474 167 TYR A CZ  
1300 O OH  . TYR A 167 ? 1.4062 1.0726 1.0612 -0.0467 0.2562  -0.0544 167 TYR A OH  
1301 N N   . SER A 168 ? 1.6054 0.9944 1.0212 -0.0012 0.2279  -0.0227 168 SER A N   
1302 C CA  . SER A 168 ? 1.6540 0.9962 1.0314 0.0085  0.2143  -0.0137 168 SER A CA  
1303 C C   . SER A 168 ? 1.6211 0.9221 0.9718 0.0206  0.1868  -0.0009 168 SER A C   
1304 O O   . SER A 168 ? 1.4910 0.7849 0.8407 0.0210  0.1822  0.0004  168 SER A O   
1305 C CB  . SER A 168 ? 1.8382 1.1308 1.1653 -0.0038 0.2402  -0.0224 168 SER A CB  
1306 O OG  . SER A 168 ? 2.0533 1.2833 1.3275 -0.0122 0.2513  -0.0224 168 SER A OG  
1307 N N   . VAL A 169 ? 1.6701 0.9471 1.0003 0.0313  0.1686  0.0060  169 VAL A N   
1308 C CA  . VAL A 169 ? 1.6362 0.8817 0.9428 0.0451  0.1401  0.0128  169 VAL A CA  
1309 C C   . VAL A 169 ? 1.6899 0.8821 0.9439 0.0506  0.1341  0.0160  169 VAL A C   
1310 O O   . VAL A 169 ? 1.6590 0.8521 0.9102 0.0446  0.1475  0.0146  169 VAL A O   
1311 C CB  . VAL A 169 ? 1.4833 0.7807 0.8411 0.0523  0.1165  0.0139  169 VAL A CB  
1312 C CG1 . VAL A 169 ? 1.3966 0.7173 0.7723 0.0516  0.1182  0.0145  169 VAL A CG1 
1313 C CG2 . VAL A 169 ? 1.4583 0.7349 0.7990 0.0661  0.0871  0.0139  169 VAL A CG2 
1314 N N   . GLU A 170 ? 1.7704 0.9169 0.9818 0.0639  0.1133  0.0188  170 GLU A N   
1315 C CA  . GLU A 170 ? 1.7518 0.8453 0.9081 0.0709  0.1049  0.0212  170 GLU A CA  
1316 C C   . GLU A 170 ? 1.7086 0.8200 0.8772 0.0864  0.0704  0.0194  170 GLU A C   
1317 O O   . GLU A 170 ? 1.6960 0.8330 0.8893 0.0969  0.0494  0.0154  170 GLU A O   
1318 C CB  . GLU A 170 ? 1.8194 0.8309 0.8972 0.0747  0.1119  0.0232  170 GLU A CB  
1319 C CG  . GLU A 170 ? 2.0337 0.9828 1.0473 0.0723  0.1197  0.0249  170 GLU A CG  
1320 C CD  . GLU A 170 ? 2.1681 1.0284 1.0980 0.0686  0.1393  0.0258  170 GLU A CD  
1321 O OE1 . GLU A 170 ? 2.3300 1.1237 1.1917 0.0705  0.1406  0.0279  170 GLU A OE1 
1322 O OE2 . GLU A 170 ? 1.8808 0.7334 0.8084 0.0625  0.1551  0.0239  170 GLU A OE2 
1323 N N   . CYS A 171 ? 1.7538 0.8545 0.9068 0.0861  0.0665  0.0192  171 CYS A N   
1324 C CA  . CYS A 171 ? 1.6891 0.8121 0.8558 0.0960  0.0386  0.0127  171 CYS A CA  
1325 C C   . CYS A 171 ? 1.6973 0.7715 0.8071 0.1029  0.0290  0.0121  171 CYS A C   
1326 O O   . CYS A 171 ? 1.7620 0.7912 0.8302 0.0951  0.0487  0.0181  171 CYS A O   
1327 C CB  . CYS A 171 ? 1.6070 0.7872 0.8312 0.0847  0.0440  0.0099  171 CYS A CB  
1328 S SG  . CYS A 171 ? 1.6114 0.8530 0.9022 0.0798  0.0460  0.0078  171 CYS A SG  
1329 N N   . GLN A 172 ? 1.6740 0.7613 0.7840 0.1165  -0.0009 0.0017  172 GLN A N   
1330 C CA  . GLN A 172 ? 1.7338 0.7791 0.7889 0.1270  -0.0159 -0.0017 172 GLN A CA  
1331 C C   . GLN A 172 ? 1.6625 0.7561 0.7507 0.1277  -0.0362 -0.0179 172 GLN A C   
1332 O O   . GLN A 172 ? 1.5760 0.7106 0.6951 0.1386  -0.0602 -0.0327 172 GLN A O   
1333 C CB  . GLN A 172 ? 1.9773 0.9712 0.9739 0.1517  -0.0366 -0.0019 172 GLN A CB  
1334 C CG  . GLN A 172 ? 2.2403 1.2124 1.1925 0.1731  -0.0682 -0.0126 172 GLN A CG  
1335 C CD  . GLN A 172 ? 2.4413 1.3373 1.3158 0.1712  -0.0571 -0.0033 172 GLN A CD  
1336 O OE1 . GLN A 172 ? 2.4919 1.3735 1.3655 0.1476  -0.0255 0.0061  172 GLN A OE1 
1337 N NE2 . GLN A 172 ? 2.5104 1.3572 1.3174 0.1976  -0.0840 -0.0077 172 GLN A NE2 
1338 N N   . GLU A 173 ? 1.6877 0.7776 0.7705 0.1140  -0.0239 -0.0177 173 GLU A N   
1339 C CA  . GLU A 173 ? 1.7177 0.8416 0.8178 0.1115  -0.0390 -0.0355 173 GLU A CA  
1340 C C   . GLU A 173 ? 1.8049 0.8970 0.8510 0.1308  -0.0659 -0.0449 173 GLU A C   
1341 O O   . GLU A 173 ? 1.6943 0.7231 0.6788 0.1364  -0.0608 -0.0326 173 GLU A O   
1342 C CB  . GLU A 173 ? 1.7266 0.8520 0.8355 0.0897  -0.0131 -0.0313 173 GLU A CB  
1343 C CG  . GLU A 173 ? 1.8005 0.9631 0.9314 0.0803  -0.0209 -0.0520 173 GLU A CG  
1344 C CD  . GLU A 173 ? 1.7690 0.9188 0.8948 0.0609  0.0060  -0.0469 173 GLU A CD  
1345 O OE1 . GLU A 173 ? 1.6484 0.8272 0.7962 0.0474  0.0094  -0.0626 173 GLU A OE1 
1346 O OE2 . GLU A 173 ? 1.8280 0.9373 0.9260 0.0585  0.0253  -0.0294 173 GLU A OE2 
1347 N N   . ASP A 174 ? 1.8136 0.9505 0.8816 0.1411  -0.0943 -0.0693 174 ASP A N   
1348 C CA  . ASP A 174 ? 2.0047 1.1234 1.0261 0.1638  -0.1252 -0.0836 174 ASP A CA  
1349 C C   . ASP A 174 ? 1.9908 1.1693 1.0465 0.1558  -0.1383 -0.1139 174 ASP A C   
1350 O O   . ASP A 174 ? 1.9601 1.1975 1.0573 0.1645  -0.1609 -0.1399 174 ASP A O   
1351 C CB  . ASP A 174 ? 2.2394 1.3501 1.2426 0.1973  -0.1561 -0.0887 174 ASP A CB  
1352 C CG  . ASP A 174 ? 2.4669 1.5531 1.4124 0.2284  -0.1920 -0.1034 174 ASP A CG  
1353 O OD1 . ASP A 174 ? 2.4445 1.5135 1.3594 0.2215  -0.1902 -0.1066 174 ASP A OD1 
1354 O OD2 . ASP A 174 ? 2.5823 1.6653 1.5105 0.2618  -0.2227 -0.1124 174 ASP A OD2 
1355 N N   . SER A 175 ? 2.0799 1.2441 1.1187 0.1373  -0.1219 -0.1132 175 SER A N   
1356 C CA  . SER A 175 ? 2.2187 1.4341 1.2839 0.1244  -0.1281 -0.1436 175 SER A CA  
1357 C C   . SER A 175 ? 2.2814 1.4988 1.3093 0.1499  -0.1650 -0.1661 175 SER A C   
1358 O O   . SER A 175 ? 2.3644 1.5194 1.3256 0.1651  -0.1716 -0.1511 175 SER A O   
1359 C CB  . SER A 175 ? 2.3995 1.5952 1.4586 0.0942  -0.0933 -0.1341 175 SER A CB  
1360 O OG  . SER A 175 ? 2.4469 1.6465 1.5406 0.0746  -0.0624 -0.1178 175 SER A OG  
1361 N N   . ALA A 176 ? 2.2555 1.5452 1.3249 0.1544  -0.1887 -0.2047 176 ALA A N   
1362 C CA  . ALA A 176 ? 2.3991 1.7060 1.4405 0.1815  -0.2276 -0.2335 176 ALA A CA  
1363 C C   . ALA A 176 ? 2.5222 1.7947 1.5167 0.1696  -0.2180 -0.2314 176 ALA A C   
1364 O O   . ALA A 176 ? 2.6179 1.8723 1.5619 0.1958  -0.2473 -0.2415 176 ALA A O   
1365 C CB  . ALA A 176 ? 2.3449 1.7495 1.4516 0.1801  -0.2476 -0.2826 176 ALA A CB  
1366 N N   . CYS A 177 ? 2.4357 1.6970 1.4441 0.1316  -0.1771 -0.2186 177 CYS A N   
1367 C CA  . CYS A 177 ? 2.3000 1.5220 1.2653 0.1159  -0.1605 -0.2120 177 CYS A CA  
1368 C C   . CYS A 177 ? 2.2440 1.4167 1.2051 0.0892  -0.1158 -0.1766 177 CYS A C   
1369 O O   . CYS A 177 ? 2.1550 1.3544 1.1593 0.0615  -0.0879 -0.1798 177 CYS A O   
1370 C CB  . CYS A 177 ? 2.2048 1.4890 1.1994 0.0949  -0.1602 -0.2529 177 CYS A CB  
1371 S SG  . CYS A 177 ? 2.7488 2.0992 1.7454 0.1281  -0.2150 -0.3026 177 CYS A SG  
1372 N N   . PRO A 178 ? 2.2939 1.3924 1.1995 0.0986  -0.1086 -0.1449 178 PRO A N   
1373 C CA  . PRO A 178 ? 2.2476 1.3019 1.1485 0.0781  -0.0688 -0.1143 178 PRO A CA  
1374 C C   . PRO A 178 ? 2.2058 1.2564 1.1066 0.0491  -0.0401 -0.1176 178 PRO A C   
1375 O O   . PRO A 178 ? 2.1601 1.2045 1.0303 0.0467  -0.0484 -0.1319 178 PRO A O   
1376 C CB  . PRO A 178 ? 2.3133 1.2913 1.1458 0.0949  -0.0721 -0.0907 178 PRO A CB  
1377 C CG  . PRO A 178 ? 2.3688 1.3494 1.1774 0.1289  -0.1135 -0.1024 178 PRO A CG  
1378 C CD  . PRO A 178 ? 2.3759 1.4261 1.2165 0.1313  -0.1381 -0.1387 178 PRO A CD  
1379 N N   . ALA A 179 ? 2.1081 1.1602 1.0397 0.0290  -0.0070 -0.1050 179 ALA A N   
1380 C CA  . ALA A 179 ? 1.9758 1.0169 0.9045 0.0034  0.0237  -0.1059 179 ALA A CA  
1381 C C   . ALA A 179 ? 1.9949 0.9741 0.8871 0.0000  0.0483  -0.0785 179 ALA A C   
1382 O O   . ALA A 179 ? 2.0365 0.9914 0.9222 0.0113  0.0504  -0.0588 179 ALA A O   
1383 C CB  . ALA A 179 ? 1.7670 0.8427 0.7440 -0.0139 0.0449  -0.1119 179 ALA A CB  
1384 N N   . ALA A 180 ? 1.9731 0.9287 0.8424 -0.0173 0.0687  -0.0801 180 ALA A N   
1385 C CA  . ALA A 180 ? 2.0269 0.9271 0.8629 -0.0222 0.0928  -0.0590 180 ALA A CA  
1386 C C   . ALA A 180 ? 1.9718 0.8696 0.8360 -0.0289 0.1238  -0.0444 180 ALA A C   
1387 O O   . ALA A 180 ? 1.8101 0.6710 0.6556 -0.0333 0.1467  -0.0311 180 ALA A O   
1388 C CB  . ALA A 180 ? 2.1232 0.9982 0.9217 -0.0369 0.1015  -0.0676 180 ALA A CB  
1389 N N   . GLU A 181 ? 1.8547 0.7923 0.7625 -0.0281 0.1235  -0.0487 181 GLU A N   
1390 C CA  . GLU A 181 ? 1.7430 0.6797 0.6733 -0.0320 0.1504  -0.0382 181 GLU A CA  
1391 C C   . GLU A 181 ? 1.8361 0.8157 0.8089 -0.0292 0.1430  -0.0444 181 GLU A C   
1392 O O   . GLU A 181 ? 1.9425 0.9540 0.9286 -0.0359 0.1287  -0.0647 181 GLU A O   
1393 C CB  . GLU A 181 ? 1.7905 0.7061 0.7028 -0.0494 0.1758  -0.0440 181 GLU A CB  
1394 C CG  . GLU A 181 ? 1.9156 0.8037 0.8256 -0.0471 0.2054  -0.0284 181 GLU A CG  
1395 C CD  . GLU A 181 ? 1.9836 0.8463 0.8714 -0.0633 0.2312  -0.0353 181 GLU A CD  
1396 O OE1 . GLU A 181 ? 1.9281 0.8022 0.8251 -0.0722 0.2390  -0.0455 181 GLU A OE1 
1397 O OE2 . GLU A 181 ? 2.0025 0.8303 0.8608 -0.0687 0.2459  -0.0315 181 GLU A OE2 
1398 N N   . GLU A 182 ? 1.7898 0.7730 0.7847 -0.0201 0.1531  -0.0298 182 GLU A N   
1399 C CA  . GLU A 182 ? 1.6732 0.6928 0.7060 -0.0175 0.1476  -0.0335 182 GLU A CA  
1400 C C   . GLU A 182 ? 1.7918 0.8055 0.8254 -0.0297 0.1707  -0.0388 182 GLU A C   
1401 O O   . GLU A 182 ? 1.8526 0.8374 0.8727 -0.0260 0.1932  -0.0263 182 GLU A O   
1402 C CB  . GLU A 182 ? 1.6917 0.7183 0.7450 -0.0018 0.1479  -0.0167 182 GLU A CB  
1403 C CG  . GLU A 182 ? 1.7282 0.7525 0.7752 0.0086  0.1302  -0.0115 182 GLU A CG  
1404 C CD  . GLU A 182 ? 1.7478 0.7731 0.8093 0.0188  0.1401  0.0025  182 GLU A CD  
1405 O OE1 . GLU A 182 ? 1.6482 0.7029 0.7396 0.0256  0.1304  0.0037  182 GLU A OE1 
1406 O OE2 . GLU A 182 ? 1.7816 0.7818 0.8266 0.0190  0.1585  0.0095  182 GLU A OE2 
1407 N N   . SER A 183 ? 1.8341 0.8729 0.8806 -0.0438 0.1662  -0.0593 183 SER A N   
1408 C CA  . SER A 183 ? 1.9338 0.9570 0.9709 -0.0595 0.1919  -0.0671 183 SER A CA  
1409 C C   . SER A 183 ? 1.9780 1.0180 1.0408 -0.0553 0.1938  -0.0640 183 SER A C   
1410 O O   . SER A 183 ? 1.9202 0.9314 0.9656 -0.0598 0.2177  -0.0607 183 SER A O   
1411 C CB  . SER A 183 ? 2.0105 1.0463 1.0401 -0.0846 0.1939  -0.0974 183 SER A CB  
1412 O OG  . SER A 183 ? 2.1105 1.1986 1.1714 -0.0837 0.1639  -0.1167 183 SER A OG  
1413 N N   . LEU A 184 ? 1.9736 1.0550 1.0724 -0.0458 0.1691  -0.0650 184 LEU A N   
1414 C CA  . LEU A 184 ? 1.8593 0.9605 0.9854 -0.0418 0.1687  -0.0618 184 LEU A CA  
1415 C C   . LEU A 184 ? 1.7269 0.8415 0.8737 -0.0187 0.1550  -0.0411 184 LEU A C   
1416 O O   . LEU A 184 ? 1.7696 0.8898 0.9169 -0.0097 0.1389  -0.0371 184 LEU A O   
1417 C CB  . LEU A 184 ? 1.8344 0.9797 0.9903 -0.0566 0.1546  -0.0886 184 LEU A CB  
1418 C CG  . LEU A 184 ? 1.8357 0.9767 0.9766 -0.0853 0.1714  -0.1173 184 LEU A CG  
1419 C CD1 . LEU A 184 ? 1.5513 0.7496 0.7293 -0.0980 0.1525  -0.1503 184 LEU A CD1 
1420 C CD2 . LEU A 184 ? 1.5963 0.6947 0.7105 -0.0964 0.2043  -0.1124 184 LEU A CD2 
1421 N N   . PRO A 185 ? 1.6257 0.7425 0.7853 -0.0098 0.1629  -0.0296 185 PRO A N   
1422 C CA  . PRO A 185 ? 1.5303 0.6632 0.7107 0.0096  0.1542  -0.0133 185 PRO A CA  
1423 C C   . PRO A 185 ? 1.5359 0.7100 0.7513 0.0104  0.1311  -0.0198 185 PRO A C   
1424 O O   . PRO A 185 ? 1.6129 0.8094 0.8457 -0.0013 0.1248  -0.0354 185 PRO A O   
1425 C CB  . PRO A 185 ? 1.5222 0.6474 0.7031 0.0184  0.1695  -0.0036 185 PRO A CB  
1426 C CG  . PRO A 185 ? 1.6067 0.7000 0.7579 0.0037  0.1876  -0.0128 185 PRO A CG  
1427 C CD  . PRO A 185 ? 1.6694 0.7736 0.8219 -0.0183 0.1803  -0.0337 185 PRO A CD  
1428 N N   . ILE A 186 ? 1.5055 0.6873 0.7290 0.0229  0.1207  -0.0102 186 ILE A N   
1429 C CA  . ILE A 186 ? 1.5223 0.7371 0.7758 0.0273  0.1020  -0.0131 186 ILE A CA  
1430 C C   . ILE A 186 ? 1.5539 0.7912 0.8361 0.0298  0.1088  -0.0078 186 ILE A C   
1431 O O   . ILE A 186 ? 1.4725 0.6993 0.7492 0.0369  0.1247  0.0032  186 ILE A O   
1432 C CB  . ILE A 186 ? 1.5169 0.7222 0.7610 0.0383  0.0950  -0.0038 186 ILE A CB  
1433 C CG1 . ILE A 186 ? 1.4940 0.6820 0.7108 0.0386  0.0786  -0.0119 186 ILE A CG1 
1434 C CG2 . ILE A 186 ? 1.4602 0.6942 0.7349 0.0445  0.0859  -0.0013 186 ILE A CG2 
1435 C CD1 . ILE A 186 ? 1.5242 0.6962 0.7246 0.0494  0.0690  -0.0052 186 ILE A CD1 
1436 N N   . GLU A 187 ? 1.6215 0.8911 0.9337 0.0255  0.0959  -0.0172 187 GLU A N   
1437 C CA  . GLU A 187 ? 1.6281 0.9191 0.9664 0.0256  0.1015  -0.0137 187 GLU A CA  
1438 C C   . GLU A 187 ? 1.5248 0.8480 0.8953 0.0316  0.0874  -0.0124 187 GLU A C   
1439 O O   . GLU A 187 ? 1.4645 0.8030 0.8462 0.0301  0.0696  -0.0235 187 GLU A O   
1440 C CB  . GLU A 187 ? 1.7034 0.9985 1.0453 0.0088  0.1064  -0.0293 187 GLU A CB  
1441 C CG  . GLU A 187 ? 1.8518 1.1553 1.2073 0.0077  0.1161  -0.0249 187 GLU A CG  
1442 C CD  . GLU A 187 ? 2.0335 1.3184 1.3718 -0.0113 0.1305  -0.0388 187 GLU A CD  
1443 O OE1 . GLU A 187 ? 2.0717 1.3355 1.3860 -0.0232 0.1370  -0.0504 187 GLU A OE1 
1444 O OE2 . GLU A 187 ? 2.1143 1.4026 1.4596 -0.0161 0.1375  -0.0394 187 GLU A OE2 
1445 N N   . VAL A 188 ? 1.4849 0.8192 0.8692 0.0397  0.0954  -0.0007 188 VAL A N   
1446 C CA  . VAL A 188 ? 1.4000 0.7631 0.8136 0.0430  0.0867  0.0005  188 VAL A CA  
1447 C C   . VAL A 188 ? 1.3327 0.7257 0.7776 0.0383  0.0885  -0.0016 188 VAL A C   
1448 O O   . VAL A 188 ? 1.3833 0.7736 0.8245 0.0407  0.1012  0.0039  188 VAL A O   
1449 C CB  . VAL A 188 ? 1.3773 0.7365 0.7859 0.0524  0.0955  0.0110  188 VAL A CB  
1450 C CG1 . VAL A 188 ? 1.2059 0.5877 0.6380 0.0529  0.0888  0.0104  188 VAL A CG1 
1451 C CG2 . VAL A 188 ? 1.2637 0.5869 0.6360 0.0548  0.0968  0.0129  188 VAL A CG2 
1452 N N   . MET A 189 ? 1.2651 0.6840 0.7373 0.0335  0.0753  -0.0101 189 MET A N   
1453 C CA  . MET A 189 ? 1.3005 0.7484 0.8038 0.0264  0.0765  -0.0138 189 MET A CA  
1454 C C   . MET A 189 ? 1.2835 0.7582 0.8147 0.0306  0.0714  -0.0103 189 MET A C   
1455 O O   . MET A 189 ? 1.1187 0.6001 0.6585 0.0320  0.0574  -0.0169 189 MET A O   
1456 C CB  . MET A 189 ? 1.1505 0.6094 0.6660 0.0114  0.0684  -0.0334 189 MET A CB  
1457 C CG  . MET A 189 ? 1.1765 0.6119 0.6684 -0.0004 0.0821  -0.0394 189 MET A CG  
1458 S SD  . MET A 189 ? 1.7416 1.1452 1.1971 -0.0011 0.0818  -0.0452 189 MET A SD  
1459 C CE  . MET A 189 ? 1.5404 0.9770 1.0215 -0.0053 0.0568  -0.0698 189 MET A CE  
1460 N N   . VAL A 190 ? 1.2463 0.7361 0.7895 0.0338  0.0829  -0.0016 190 VAL A N   
1461 C CA  . VAL A 190 ? 1.1480 0.6655 0.7186 0.0342  0.0824  0.0000  190 VAL A CA  
1462 C C   . VAL A 190 ? 1.0852 0.6331 0.6872 0.0253  0.0826  -0.0044 190 VAL A C   
1463 O O   . VAL A 190 ? 1.0869 0.6368 0.6856 0.0256  0.0913  -0.0011 190 VAL A O   
1464 C CB  . VAL A 190 ? 1.1162 0.6378 0.6822 0.0424  0.0967  0.0082  190 VAL A CB  
1465 C CG1 . VAL A 190 ? 1.2671 0.8131 0.8570 0.0390  0.0994  0.0068  190 VAL A CG1 
1466 C CG2 . VAL A 190 ? 1.1769 0.6646 0.7087 0.0483  0.1003  0.0112  190 VAL A CG2 
1467 N N   . ASP A 191 ? 1.1161 0.6838 0.7441 0.0189  0.0727  -0.0122 191 ASP A N   
1468 C CA  . ASP A 191 ? 1.0814 0.6802 0.7422 0.0088  0.0741  -0.0168 191 ASP A CA  
1469 C C   . ASP A 191 ? 1.1350 0.7564 0.8133 0.0120  0.0822  -0.0097 191 ASP A C   
1470 O O   . ASP A 191 ? 1.2553 0.8756 0.9360 0.0147  0.0797  -0.0098 191 ASP A O   
1471 C CB  . ASP A 191 ? 0.9885 0.6020 0.6730 -0.0002 0.0597  -0.0326 191 ASP A CB  
1472 C CG  . ASP A 191 ? 1.3360 0.9416 1.0143 -0.0112 0.0562  -0.0474 191 ASP A CG  
1473 O OD1 . ASP A 191 ? 1.4018 0.9825 1.0516 -0.0120 0.0662  -0.0425 191 ASP A OD1 
1474 O OD2 . ASP A 191 ? 1.2834 0.9079 0.9845 -0.0192 0.0447  -0.0664 191 ASP A OD2 
1475 N N   . ALA A 192 ? 1.0899 0.7294 0.7759 0.0123  0.0927  -0.0052 192 ALA A N   
1476 C CA  . ALA A 192 ? 1.0879 0.7575 0.7941 0.0132  0.1021  -0.0030 192 ALA A CA  
1477 C C   . ALA A 192 ? 1.1202 0.8220 0.8597 0.0016  0.1018  -0.0075 192 ALA A C   
1478 O O   . ALA A 192 ? 1.1887 0.8931 0.9278 -0.0017 0.1019  -0.0081 192 ALA A O   
1479 C CB  . ALA A 192 ? 1.0834 0.7594 0.7769 0.0256  0.1129  0.0016  192 ALA A CB  
1480 N N   . VAL A 193 ? 1.0795 0.7997 0.8424 -0.0051 0.1031  -0.0109 193 VAL A N   
1481 C CA  . VAL A 193 ? 1.0867 0.8401 0.8833 -0.0173 0.1049  -0.0155 193 VAL A CA  
1482 C C   . VAL A 193 ? 1.0059 0.7912 0.8209 -0.0197 0.1189  -0.0156 193 VAL A C   
1483 O O   . VAL A 193 ? 1.1577 0.9374 0.9711 -0.0210 0.1250  -0.0169 193 VAL A O   
1484 C CB  . VAL A 193 ? 1.0536 0.8071 0.8697 -0.0270 0.0938  -0.0244 193 VAL A CB  
1485 C CG1 . VAL A 193 ? 0.9257 0.7144 0.7778 -0.0409 0.0986  -0.0293 193 VAL A CG1 
1486 C CG2 . VAL A 193 ? 0.9870 0.7225 0.7940 -0.0301 0.0822  -0.0318 193 VAL A CG2 
1487 N N   . HIS A 194 ? 0.9128 0.7289 0.7408 -0.0205 0.1248  -0.0160 194 HIS A N   
1488 C CA  . HIS A 194 ? 1.0164 0.8730 0.8662 -0.0243 0.1386  -0.0206 194 HIS A CA  
1489 C C   . HIS A 194 ? 1.0052 0.8926 0.8859 -0.0382 0.1391  -0.0245 194 HIS A C   
1490 O O   . HIS A 194 ? 1.0075 0.9062 0.8882 -0.0362 0.1357  -0.0236 194 HIS A O   
1491 C CB  . HIS A 194 ? 1.1595 1.0359 0.9993 -0.0092 0.1446  -0.0218 194 HIS A CB  
1492 C CG  . HIS A 194 ? 1.1176 1.0480 0.9846 -0.0131 0.1577  -0.0320 194 HIS A CG  
1493 N ND1 . HIS A 194 ? 1.1134 1.0606 0.9970 -0.0274 0.1737  -0.0405 194 HIS A ND1 
1494 C CD2 . HIS A 194 ? 1.0719 1.0428 0.9491 -0.0041 0.1577  -0.0372 194 HIS A CD2 
1495 C CE1 . HIS A 194 ? 1.1518 1.1534 1.0600 -0.0303 0.1846  -0.0524 194 HIS A CE1 
1496 N NE2 . HIS A 194 ? 1.1136 1.1334 1.0200 -0.0146 0.1732  -0.0508 194 HIS A NE2 
1497 N N   . LYS A 195 ? 0.9985 0.8944 0.9006 -0.0516 0.1443  -0.0289 195 LYS A N   
1498 C CA  . LYS A 195 ? 0.9540 0.8751 0.8872 -0.0673 0.1446  -0.0334 195 LYS A CA  
1499 C C   . LYS A 195 ? 0.9831 0.8851 0.9145 -0.0715 0.1302  -0.0336 195 LYS A C   
1500 O O   . LYS A 195 ? 1.0117 0.8898 0.9410 -0.0725 0.1205  -0.0366 195 LYS A O   
1501 C CB  . LYS A 195 ? 0.8965 0.8634 0.8464 -0.0700 0.1544  -0.0369 195 LYS A CB  
1502 C CG  . LYS A 195 ? 0.9586 0.9574 0.9244 -0.0766 0.1732  -0.0448 195 LYS A CG  
1503 C CD  . LYS A 195 ? 0.9494 1.0029 0.9412 -0.0833 0.1813  -0.0527 195 LYS A CD  
1504 C CE  . LYS A 195 ? 1.1055 1.1830 1.0849 -0.0634 0.1788  -0.0554 195 LYS A CE  
1505 N NZ  . LYS A 195 ? 1.2243 1.3138 1.1982 -0.0574 0.1922  -0.0644 195 LYS A NZ  
1506 N N   . LEU A 196 ? 0.9759 0.8871 0.9045 -0.0735 0.1297  -0.0330 196 LEU A N   
1507 C CA  . LEU A 196 ? 1.0135 0.9029 0.9349 -0.0829 0.1222  -0.0366 196 LEU A CA  
1508 C C   . LEU A 196 ? 1.1104 0.9625 0.9887 -0.0699 0.1182  -0.0309 196 LEU A C   
1509 O O   . LEU A 196 ? 1.0584 0.8831 0.9221 -0.0794 0.1153  -0.0360 196 LEU A O   
1510 C CB  . LEU A 196 ? 0.9805 0.8928 0.9190 -0.0983 0.1274  -0.0408 196 LEU A CB  
1511 C CG  . LEU A 196 ? 0.9342 0.8794 0.9164 -0.1153 0.1321  -0.0483 196 LEU A CG  
1512 C CD1 . LEU A 196 ? 1.0054 0.9771 1.0020 -0.1290 0.1393  -0.0511 196 LEU A CD1 
1513 C CD2 . LEU A 196 ? 0.8159 0.7481 0.8147 -0.1263 0.1241  -0.0590 196 LEU A CD2 
1514 N N   . LYS A 197 ? 1.1875 1.0383 1.0450 -0.0497 0.1203  -0.0229 197 LYS A N   
1515 C CA  . LYS A 197 ? 1.1635 0.9772 0.9771 -0.0342 0.1177  -0.0167 197 LYS A CA  
1516 C C   . LYS A 197 ? 1.1098 0.8921 0.9087 -0.0312 0.1125  -0.0163 197 LYS A C   
1517 O O   . LYS A 197 ? 1.2026 0.9924 1.0110 -0.0261 0.1123  -0.0154 197 LYS A O   
1518 C CB  . LYS A 197 ? 0.8439 0.6743 0.6432 -0.0108 0.1208  -0.0115 197 LYS A CB  
1519 C CG  . LYS A 197 ? 1.0498 0.8398 0.7993 0.0079  0.1183  -0.0051 197 LYS A CG  
1520 C CD  . LYS A 197 ? 1.1358 0.9462 0.8742 0.0361  0.1186  -0.0036 197 LYS A CD  
1521 C CE  . LYS A 197 ? 1.0767 0.9435 0.8423 0.0403  0.1204  -0.0101 197 LYS A CE  
1522 N NZ  . LYS A 197 ? 1.0634 0.9612 0.8241 0.0690  0.1199  -0.0153 197 LYS A NZ  
1523 N N   . TYR A 198 ? 1.1532 0.8972 0.9247 -0.0355 0.1102  -0.0184 198 TYR A N   
1524 C CA  . TYR A 198 ? 1.1228 0.8377 0.8769 -0.0322 0.1051  -0.0196 198 TYR A CA  
1525 C C   . TYR A 198 ? 0.9397 0.6187 0.6475 -0.0154 0.1087  -0.0110 198 TYR A C   
1526 O O   . TYR A 198 ? 1.3610 1.0220 1.0411 -0.0107 0.1139  -0.0075 198 TYR A O   
1527 C CB  . TYR A 198 ? 1.0194 0.7222 0.7804 -0.0527 0.1012  -0.0344 198 TYR A CB  
1528 C CG  . TYR A 198 ? 1.0303 0.7018 0.7667 -0.0503 0.0971  -0.0387 198 TYR A CG  
1529 C CD1 . TYR A 198 ? 1.0475 0.7254 0.7968 -0.0451 0.0860  -0.0428 198 TYR A CD1 
1530 C CD2 . TYR A 198 ? 1.1802 0.8111 0.8747 -0.0526 0.1049  -0.0392 198 TYR A CD2 
1531 C CE1 . TYR A 198 ? 1.0821 0.7344 0.8086 -0.0427 0.0813  -0.0481 198 TYR A CE1 
1532 C CE2 . TYR A 198 ? 1.3050 0.9092 0.9774 -0.0527 0.1031  -0.0448 198 TYR A CE2 
1533 C CZ  . TYR A 198 ? 1.2620 0.8807 0.9532 -0.0479 0.0904  -0.0497 198 TYR A CZ  
1534 O OH  . TYR A 198 ? 1.3565 0.9516 1.0255 -0.0477 0.0876  -0.0566 198 TYR A OH  
1535 N N   . GLU A 199 ? 0.9511 0.6152 0.6457 -0.0048 0.1060  -0.0077 199 GLU A N   
1536 C CA  . GLU A 199 ? 1.2130 0.8401 0.8639 0.0104  0.1097  -0.0009 199 GLU A CA  
1537 C C   . GLU A 199 ? 1.2918 0.8982 0.9331 0.0099  0.1052  -0.0028 199 GLU A C   
1538 O O   . GLU A 199 ? 1.3546 0.9780 1.0195 0.0062  0.0989  -0.0061 199 GLU A O   
1539 C CB  . GLU A 199 ? 1.1450 0.7900 0.7910 0.0335  0.1133  0.0069  199 GLU A CB  
1540 C CG  . GLU A 199 ? 0.9826 0.6524 0.6351 0.0396  0.1153  0.0076  199 GLU A CG  
1541 C CD  . GLU A 199 ? 1.1697 0.8682 0.8228 0.0646  0.1170  0.0090  199 GLU A CD  
1542 O OE1 . GLU A 199 ? 1.1096 0.8208 0.7727 0.0698  0.1193  0.0073  199 GLU A OE1 
1543 O OE2 . GLU A 199 ? 1.1241 0.8330 0.7659 0.0796  0.1162  0.0095  199 GLU A OE2 
1544 N N   . ASN A 200 ? 1.3413 0.9069 0.9435 0.0141  0.1088  -0.0012 200 ASN A N   
1545 C CA  . ASN A 200 ? 1.4290 0.9761 1.0191 0.0160  0.1049  -0.0023 200 ASN A CA  
1546 C C   . ASN A 200 ? 1.0885 0.6028 0.6386 0.0328  0.1119  0.0065  200 ASN A C   
1547 O O   . ASN A 200 ? 1.3800 0.8643 0.8968 0.0376  0.1197  0.0094  200 ASN A O   
1548 C CB  . ASN A 200 ? 1.4904 1.0275 1.0835 -0.0031 0.0993  -0.0173 200 ASN A CB  
1549 C CG  . ASN A 200 ? 1.0944 0.5995 0.6586 -0.0166 0.1098  -0.0249 200 ASN A CG  
1550 O OD1 . ASN A 200 ? 1.5304 1.0005 1.0544 -0.0068 0.1206  -0.0157 200 ASN A OD1 
1551 N ND2 . ASN A 200 ? 1.3396 0.8540 0.9212 -0.0391 0.1080  -0.0442 200 ASN A ND2 
1552 N N   . TYR A 201 ? 1.2091 0.7246 0.7586 0.0419  0.1101  0.0101  201 TYR A N   
1553 C CA  . TYR A 201 ? 1.2911 0.7791 0.8071 0.0575  0.1169  0.0165  201 TYR A CA  
1554 C C   . TYR A 201 ? 1.3374 0.7918 0.8300 0.0508  0.1153  0.0136  201 TYR A C   
1555 O O   . TYR A 201 ? 1.1340 0.5932 0.6394 0.0379  0.1061  0.0060  201 TYR A O   
1556 C CB  . TYR A 201 ? 1.2994 0.8135 0.8287 0.0717  0.1204  0.0195  201 TYR A CB  
1557 C CG  . TYR A 201 ? 1.2309 0.7867 0.7867 0.0784  0.1222  0.0185  201 TYR A CG  
1558 C CD1 . TYR A 201 ? 1.2248 0.8098 0.8135 0.0646  0.1180  0.0150  201 TYR A CD1 
1559 C CD2 . TYR A 201 ? 1.2674 0.8364 0.8158 0.0999  0.1273  0.0189  201 TYR A CD2 
1560 C CE1 . TYR A 201 ? 1.2736 0.8985 0.8865 0.0690  0.1203  0.0130  201 TYR A CE1 
1561 C CE2 . TYR A 201 ? 1.3207 0.9337 0.8942 0.1072  0.1275  0.0150  201 TYR A CE2 
1562 C CZ  . TYR A 201 ? 1.3162 0.9565 0.9215 0.0902  0.1247  0.0126  201 TYR A CZ  
1563 O OH  . TYR A 201 ? 1.3130 0.9989 0.9434 0.0956  0.1256  0.0076  201 TYR A OH  
1564 N N   . THR A 202 ? 1.4153 0.8369 0.8725 0.0615  0.1234  0.0185  202 THR A N   
1565 C CA  . THR A 202 ? 1.4389 0.8263 0.8693 0.0548  0.1243  0.0155  202 THR A CA  
1566 C C   . THR A 202 ? 1.5114 0.8778 0.9161 0.0711  0.1324  0.0227  202 THR A C   
1567 O O   . THR A 202 ? 1.6565 1.0211 1.0505 0.0888  0.1396  0.0280  202 THR A O   
1568 C CB  . THR A 202 ? 1.4176 0.7718 0.8208 0.0416  0.1312  0.0088  202 THR A CB  
1569 O OG1 . THR A 202 ? 1.5333 0.9100 0.9630 0.0237  0.1254  -0.0023 202 THR A OG1 
1570 C CG2 . THR A 202 ? 1.4758 0.8005 0.8541 0.0323  0.1333  0.0023  202 THR A CG2 
1571 N N   . SER A 203 ? 1.4205 0.7716 0.8142 0.0666  0.1305  0.0211  203 SER A N   
1572 C CA  . SER A 203 ? 1.5228 0.8474 0.8880 0.0778  0.1401  0.0256  203 SER A CA  
1573 C C   . SER A 203 ? 1.5076 0.7992 0.8468 0.0663  0.1395  0.0219  203 SER A C   
1574 O O   . SER A 203 ? 1.5277 0.8263 0.8762 0.0553  0.1280  0.0160  203 SER A O   
1575 C CB  . SER A 203 ? 1.5768 0.9245 0.9578 0.0878  0.1427  0.0270  203 SER A CB  
1576 O OG  . SER A 203 ? 1.6058 0.9310 0.9623 0.0979  0.1532  0.0284  203 SER A OG  
1577 N N   . SER A 204 ? 1.4870 0.7421 0.7913 0.0710  0.1514  0.0243  204 SER A N   
1578 C CA  . SER A 204 ? 1.4730 0.6966 0.7501 0.0598  0.1535  0.0200  204 SER A CA  
1579 C C   . SER A 204 ? 1.4765 0.6836 0.7366 0.0700  0.1611  0.0252  204 SER A C   
1580 O O   . SER A 204 ? 1.4825 0.6887 0.7386 0.0870  0.1707  0.0302  204 SER A O   
1581 C CB  . SER A 204 ? 1.4761 0.6633 0.7207 0.0511  0.1656  0.0156  204 SER A CB  
1582 O OG  . SER A 204 ? 1.5383 0.7352 0.7930 0.0299  0.1591  0.0018  204 SER A OG  
1583 N N   . PHE A 205 ? 1.3903 0.5847 0.6390 0.0605  0.1564  0.0219  205 PHE A N   
1584 C CA  . PHE A 205 ? 1.5994 0.7731 0.8281 0.0659  0.1658  0.0251  205 PHE A CA  
1585 C C   . PHE A 205 ? 1.5907 0.7375 0.7934 0.0532  0.1619  0.0209  205 PHE A C   
1586 O O   . PHE A 205 ? 1.5319 0.6850 0.7377 0.0431  0.1473  0.0140  205 PHE A O   
1587 C CB  . PHE A 205 ? 1.5722 0.7703 0.8216 0.0730  0.1659  0.0265  205 PHE A CB  
1588 C CG  . PHE A 205 ? 1.5960 0.8076 0.8582 0.0647  0.1515  0.0243  205 PHE A CG  
1589 C CD1 . PHE A 205 ? 1.5244 0.7675 0.8166 0.0642  0.1410  0.0233  205 PHE A CD1 
1590 C CD2 . PHE A 205 ? 1.6678 0.8552 0.9066 0.0585  0.1486  0.0231  205 PHE A CD2 
1591 C CE1 . PHE A 205 ? 1.5272 0.7792 0.8281 0.0595  0.1276  0.0210  205 PHE A CE1 
1592 C CE2 . PHE A 205 ? 1.6699 0.8606 0.9108 0.0554  0.1346  0.0216  205 PHE A CE2 
1593 C CZ  . PHE A 205 ? 1.5456 0.7695 0.8188 0.0568  0.1239  0.0204  205 PHE A CZ  
1594 N N   . PHE A 206 ? 1.6844 0.8035 0.8619 0.0552  0.1743  0.0231  206 PHE A N   
1595 C CA  . PHE A 206 ? 1.7198 0.8127 0.8701 0.0447  0.1707  0.0199  206 PHE A CA  
1596 C C   . PHE A 206 ? 1.7124 0.8030 0.8602 0.0469  0.1712  0.0219  206 PHE A C   
1597 O O   . PHE A 206 ? 1.6510 0.7511 0.8097 0.0546  0.1844  0.0233  206 PHE A O   
1598 C CB  . PHE A 206 ? 1.6848 0.7419 0.8032 0.0410  0.1865  0.0196  206 PHE A CB  
1599 C CG  . PHE A 206 ? 1.7366 0.7845 0.8464 0.0344  0.1913  0.0153  206 PHE A CG  
1600 C CD1 . PHE A 206 ? 1.7397 0.7734 0.8410 0.0446  0.2076  0.0199  206 PHE A CD1 
1601 C CD2 . PHE A 206 ? 1.7934 0.8454 0.9002 0.0185  0.1805  0.0038  206 PHE A CD2 
1602 C CE1 . PHE A 206 ? 1.7490 0.7619 0.8314 0.0358  0.2168  0.0151  206 PHE A CE1 
1603 C CE2 . PHE A 206 ? 1.8303 0.8723 0.9271 0.0070  0.1901  -0.0048 206 PHE A CE2 
1604 C CZ  . PHE A 206 ? 1.8039 0.8213 0.8849 0.0141  0.2100  0.0019  206 PHE A CZ  
1605 N N   . ILE A 207 ? 1.7524 0.8294 0.8826 0.0405  0.1574  0.0195  207 ILE A N   
1606 C CA  . ILE A 207 ? 1.7607 0.8187 0.8725 0.0395  0.1605  0.0207  207 ILE A CA  
1607 C C   . ILE A 207 ? 1.6699 0.7030 0.7617 0.0364  0.1830  0.0204  207 ILE A C   
1608 O O   . ILE A 207 ? 1.6382 0.6725 0.7330 0.0359  0.1974  0.0180  207 ILE A O   
1609 C CB  . ILE A 207 ? 1.5558 0.5876 0.6347 0.0367  0.1413  0.0184  207 ILE A CB  
1610 C CG1 . ILE A 207 ? 1.5332 0.5914 0.6339 0.0432  0.1206  0.0168  207 ILE A CG1 
1611 C CG2 . ILE A 207 ? 1.6941 0.6820 0.7312 0.0326  0.1511  0.0199  207 ILE A CG2 
1612 C CD1 . ILE A 207 ? 2.0960 1.1270 1.1606 0.0480  0.0993  0.0137  207 ILE A CD1 
1613 N N   . ARG A 208 ? 1.6562 0.6692 0.7294 0.0328  0.1881  0.0201  208 ARG A N   
1614 C CA  . ARG A 208 ? 1.7179 0.7068 0.7725 0.0303  0.2094  0.0187  208 ARG A CA  
1615 C C   . ARG A 208 ? 1.6677 0.6848 0.7527 0.0419  0.2256  0.0164  208 ARG A C   
1616 O O   . ARG A 208 ? 1.7099 0.7164 0.7872 0.0419  0.2438  0.0111  208 ARG A O   
1617 C CB  . ARG A 208 ? 1.8326 0.7978 0.8651 0.0253  0.2131  0.0186  208 ARG A CB  
1618 C CG  . ARG A 208 ? 1.8421 0.8238 0.8925 0.0322  0.2150  0.0199  208 ARG A CG  
1619 C CD  . ARG A 208 ? 1.8105 0.7588 0.8314 0.0257  0.2285  0.0185  208 ARG A CD  
1620 N NE  . ARG A 208 ? 1.7938 0.7434 0.8174 0.0280  0.2326  0.0183  208 ARG A NE  
1621 C CZ  . ARG A 208 ? 1.7976 0.7465 0.8147 0.0145  0.2253  0.0115  208 ARG A CZ  
1622 N NH1 . ARG A 208 ? 1.7725 0.7260 0.7838 0.0023  0.2092  0.0043  208 ARG A NH1 
1623 N NH2 . ARG A 208 ? 1.6458 0.5883 0.6590 0.0134  0.2345  0.0096  208 ARG A NH2 
1624 N N   . ASP A 209 ? 1.6472 0.7028 0.7671 0.0525  0.2184  0.0180  209 ASP A N   
1625 C CA  . ASP A 209 ? 1.6870 0.7747 0.8356 0.0682  0.2298  0.0139  209 ASP A CA  
1626 C C   . ASP A 209 ? 1.6716 0.7954 0.8492 0.0688  0.2316  0.0071  209 ASP A C   
1627 O O   . ASP A 209 ? 1.8140 0.9690 1.0153 0.0796  0.2432  -0.0026 209 ASP A O   
1628 C CB  . ASP A 209 ? 1.7217 0.8230 0.8828 0.0820  0.2237  0.0195  209 ASP A CB  
1629 C CG  . ASP A 209 ? 1.8611 0.9238 0.9902 0.0808  0.2295  0.0231  209 ASP A CG  
1630 O OD1 . ASP A 209 ? 1.9335 0.9919 1.0592 0.0843  0.2257  0.0270  209 ASP A OD1 
1631 O OD2 . ASP A 209 ? 1.9835 1.0171 1.0881 0.0742  0.2402  0.0207  209 ASP A OD2 
1632 N N   . ILE A 210 ? 1.4884 0.6091 0.6633 0.0581  0.2206  0.0097  210 ILE A N   
1633 C CA  . ILE A 210 ? 1.5215 0.6727 0.7207 0.0564  0.2249  0.0028  210 ILE A CA  
1634 C C   . ILE A 210 ? 1.6036 0.7197 0.7707 0.0394  0.2338  -0.0020 210 ILE A C   
1635 O O   . ILE A 210 ? 1.7391 0.8537 0.9041 0.0335  0.2290  -0.0015 210 ILE A O   
1636 C CB  . ILE A 210 ? 1.6681 0.8487 0.8942 0.0612  0.2073  0.0090  210 ILE A CB  
1637 C CG1 . ILE A 210 ? 1.7053 0.8591 0.9104 0.0560  0.1874  0.0176  210 ILE A CG1 
1638 C CG2 . ILE A 210 ? 1.6862 0.9033 0.9429 0.0782  0.2057  0.0100  210 ILE A CG2 
1639 C CD1 . ILE A 210 ? 1.6636 0.7936 0.8462 0.0473  0.1793  0.0178  210 ILE A CD1 
1640 N N   . ILE A 211 ? 1.6376 0.7200 0.7747 0.0314  0.2486  -0.0072 211 ILE A N   
1641 C CA  . ILE A 211 ? 1.7203 0.7536 0.8122 0.0137  0.2593  -0.0114 211 ILE A CA  
1642 C C   . ILE A 211 ? 1.7651 0.8094 0.8639 0.0019  0.2889  -0.0311 211 ILE A C   
1643 O O   . ILE A 211 ? 1.8447 0.9125 0.9636 0.0048  0.3045  -0.0435 211 ILE A O   
1644 C CB  . ILE A 211 ? 1.7424 0.7219 0.7868 0.0076  0.2573  -0.0059 211 ILE A CB  
1645 C CG1 . ILE A 211 ? 1.7425 0.6883 0.7531 0.0085  0.2320  0.0057  211 ILE A CG1 
1646 C CG2 . ILE A 211 ? 1.7460 0.6859 0.7542 -0.0100 0.2831  -0.0178 211 ILE A CG2 
1647 C CD1 . ILE A 211 ? 1.6821 0.5858 0.6517 0.0047  0.2258  0.0097  211 ILE A CD1 
1648 N N   . LYS A 212 ? 1.8148 0.8426 0.8964 -0.0114 0.2975  -0.0366 212 LYS A N   
1649 C CA  . LYS A 212 ? 2.0013 1.0257 1.0758 -0.0310 0.3306  -0.0594 212 LYS A CA  
1650 C C   . LYS A 212 ? 2.0562 0.9972 1.0560 -0.0508 0.3402  -0.0574 212 LYS A C   
1651 O O   . LYS A 212 ? 2.1407 1.0524 1.1137 -0.0495 0.3274  -0.0464 212 LYS A O   
1652 C CB  . LYS A 212 ? 2.1141 1.1988 1.2368 -0.0313 0.3397  -0.0734 212 LYS A CB  
1653 C CG  . LYS A 212 ? 2.2453 1.3204 1.3532 -0.0582 0.3768  -0.1006 212 LYS A CG  
1654 C CD  . LYS A 212 ? 2.2627 1.3914 1.4112 -0.0617 0.3852  -0.1139 212 LYS A CD  
1655 C CE  . LYS A 212 ? 2.2472 1.4704 1.4697 -0.0481 0.3894  -0.1346 212 LYS A CE  
1656 N NZ  . LYS A 212 ? 2.2740 1.5129 1.5027 -0.0626 0.4209  -0.1673 212 LYS A NZ  
1657 N N   . PRO A 213 ? 1.7538 0.7100 1.2519 -0.1186 0.4333  -0.0120 213 PRO A N   
1658 C CA  . PRO A 213 ? 1.8481 0.7867 1.3397 -0.0986 0.4535  -0.0058 213 PRO A CA  
1659 C C   . PRO A 213 ? 1.8729 0.8078 1.3842 -0.1083 0.4744  -0.0028 213 PRO A C   
1660 O O   . PRO A 213 ? 1.9039 0.8533 1.4349 -0.1239 0.4725  -0.0035 213 PRO A O   
1661 C CB  . PRO A 213 ? 1.8780 0.8214 1.3663 -0.0743 0.4494  0.0043  213 PRO A CB  
1662 C CG  . PRO A 213 ? 1.8264 0.7882 1.3165 -0.0824 0.4261  0.0022  213 PRO A CG  
1663 C CD  . PRO A 213 ? 1.7949 0.7656 1.2971 -0.1115 0.4212  -0.0054 213 PRO A CD  
1664 N N   . ASP A 214 ? 1.8933 0.8095 1.3992 -0.0985 0.4953  -0.0008 214 ASP A N   
1665 C CA  . ASP A 214 ? 1.9345 0.8449 1.4599 -0.1042 0.5189  0.0028  214 ASP A CA  
1666 C C   . ASP A 214 ? 1.9242 0.8397 1.4595 -0.0915 0.5227  0.0133  214 ASP A C   
1667 O O   . ASP A 214 ? 1.9208 0.8395 1.4444 -0.0719 0.5115  0.0198  214 ASP A O   
1668 C CB  . ASP A 214 ? 2.0077 0.8949 1.5219 -0.0917 0.5419  0.0046  214 ASP A CB  
1669 C CG  . ASP A 214 ? 2.1417 1.0251 1.6517 -0.1103 0.5407  -0.0066 214 ASP A CG  
1670 O OD1 . ASP A 214 ? 2.2039 1.0977 1.7370 -0.1358 0.5432  -0.0132 214 ASP A OD1 
1671 O OD2 . ASP A 214 ? 2.2039 1.0759 1.6885 -0.0991 0.5369  -0.0101 214 ASP A OD2 
1672 N N   . PRO A 215 ? 1.9529 0.8709 1.5112 -0.1031 0.5381  0.0136  215 PRO A N   
1673 C CA  . PRO A 215 ? 2.0894 1.0123 1.6575 -0.0937 0.5412  0.0219  215 PRO A CA  
1674 C C   . PRO A 215 ? 2.2606 1.1672 1.8164 -0.0621 0.5539  0.0350  215 PRO A C   
1675 O O   . PRO A 215 ? 2.3325 1.2213 1.8761 -0.0496 0.5686  0.0366  215 PRO A O   
1676 C CB  . PRO A 215 ? 2.0985 1.0226 1.6930 -0.1122 0.5615  0.0163  215 PRO A CB  
1677 C CG  . PRO A 215 ? 2.0285 0.9592 1.6311 -0.1361 0.5600  0.0034  215 PRO A CG  
1678 C CD  . PRO A 215 ? 1.9615 0.8793 1.5395 -0.1259 0.5537  0.0046  215 PRO A CD  
1679 N N   . PRO A 216 ? 2.2860 1.1999 1.8445 -0.0485 0.5479  0.0439  216 PRO A N   
1680 C CA  . PRO A 216 ? 2.2517 1.1542 1.8020 -0.0168 0.5596  0.0568  216 PRO A CA  
1681 C C   . PRO A 216 ? 2.3041 1.1831 1.8576 -0.0095 0.5926  0.0602  216 PRO A C   
1682 O O   . PRO A 216 ? 2.2855 1.1599 1.8558 -0.0301 0.6082  0.0542  216 PRO A O   
1683 C CB  . PRO A 216 ? 2.2231 1.1385 1.7855 -0.0141 0.5517  0.0634  216 PRO A CB  
1684 C CG  . PRO A 216 ? 2.1680 1.1048 1.7330 -0.0358 0.5254  0.0549  216 PRO A CG  
1685 C CD  . PRO A 216 ? 2.2292 1.1642 1.7979 -0.0610 0.5290  0.0421  216 PRO A CD  
1686 N N   . LYS A 217 ? 2.4130 1.2789 1.9512 0.0207  0.6043  0.0688  217 LYS A N   
1687 C CA  . LYS A 217 ? 2.5094 1.3510 2.0454 0.0312  0.6367  0.0725  217 LYS A CA  
1688 C C   . LYS A 217 ? 2.6345 1.4667 2.1915 0.0293  0.6608  0.0788  217 LYS A C   
1689 O O   . LYS A 217 ? 2.7124 1.5451 2.2887 0.0023  0.6688  0.0706  217 LYS A O   
1690 C CB  . LYS A 217 ? 2.4524 1.2851 1.9655 0.0682  0.6432  0.0802  217 LYS A CB  
1691 C CG  . LYS A 217 ? 2.4436 1.2521 1.9443 0.0768  0.6709  0.0796  217 LYS A CG  
1692 C CD  . LYS A 217 ? 2.4765 1.2813 1.9500 0.1122  0.6720  0.0823  217 LYS A CD  
1693 C CE  . LYS A 217 ? 2.5601 1.3395 2.0185 0.1237  0.7020  0.0826  217 LYS A CE  
1694 N NZ  . LYS A 217 ? 2.6239 1.4011 2.0545 0.1622  0.7056  0.0842  217 LYS A NZ  
1695 N N   . ASN A 218 ? 2.6340 1.4589 2.1886 0.0587  0.6729  0.0921  218 ASN A N   
1696 C CA  . ASN A 218 ? 2.6480 1.4609 2.2210 0.0598  0.6979  0.0983  218 ASN A CA  
1697 C C   . ASN A 218 ? 2.7225 1.5481 2.3028 0.0727  0.6859  0.1076  218 ASN A C   
1698 O O   . ASN A 218 ? 2.7411 1.5767 2.3096 0.0985  0.6714  0.1162  218 ASN A O   
1699 C CB  . ASN A 218 ? 2.5876 1.3732 2.1534 0.0823  0.7336  0.1063  218 ASN A CB  
1700 C CG  . ASN A 218 ? 2.4615 1.2444 2.0002 0.1147  0.7306  0.1123  218 ASN A CG  
1701 O OD1 . ASN A 218 ? 2.4697 1.2682 2.0009 0.1363  0.7119  0.1184  218 ASN A OD1 
1702 N ND2 . ASN A 218 ? 2.3094 1.0741 1.8338 0.1188  0.7494  0.1092  218 ASN A ND2 
1703 N N   . LEU A 219 ? 2.7983 1.6251 2.3990 0.0548  0.6921  0.1046  219 LEU A N   
1704 C CA  . LEU A 219 ? 2.9282 1.7690 2.5361 0.0610  0.6771  0.1109  219 LEU A CA  
1705 C C   . LEU A 219 ? 3.0746 1.8980 2.6925 0.0782  0.7046  0.1213  219 LEU A C   
1706 O O   . LEU A 219 ? 3.1566 1.9570 2.7812 0.0770  0.7376  0.1205  219 LEU A O   
1707 C CB  . LEU A 219 ? 2.9126 1.7717 2.5335 0.0278  0.6587  0.0976  219 LEU A CB  
1708 C CG  . LEU A 219 ? 2.8967 1.7687 2.5138 0.0031  0.6408  0.0840  219 LEU A CG  
1709 C CD1 . LEU A 219 ? 2.8720 1.7300 2.4995 -0.0158 0.6659  0.0735  219 LEU A CD1 
1710 C CD2 . LEU A 219 ? 2.8815 1.7779 2.5056 -0.0186 0.6149  0.0750  219 LEU A CD2 
1711 N N   . GLN A 220 ? 3.1000 1.9347 2.7197 0.0940  0.6911  0.1309  220 GLN A N   
1712 C CA  . GLN A 220 ? 3.1533 1.9733 2.7830 0.1105  0.7141  0.1411  220 GLN A CA  
1713 C C   . GLN A 220 ? 3.1656 2.0031 2.8050 0.1036  0.6932  0.1414  220 GLN A C   
1714 O O   . GLN A 220 ? 3.1002 1.9607 2.7380 0.0857  0.6624  0.1336  220 GLN A O   
1715 C CB  . GLN A 220 ? 3.1648 1.9762 2.7830 0.1526  0.7263  0.1582  220 GLN A CB  
1716 C CG  . GLN A 220 ? 3.1657 1.9594 2.7698 0.1634  0.7471  0.1580  220 GLN A CG  
1717 C CD  . GLN A 220 ? 3.1449 1.9563 2.7319 0.1651  0.7205  0.1530  220 GLN A CD  
1718 O OE1 . GLN A 220 ? 3.1530 1.9560 2.7309 0.1529  0.7261  0.1441  220 GLN A OE1 
1719 N NE2 . GLN A 220 ? 3.1108 1.9472 2.6943 0.1799  0.6916  0.1581  220 GLN A NE2 
1720 N N   . LEU A 221 ? 3.2452 2.0710 2.8935 0.1183  0.7106  0.1503  221 LEU A N   
1721 C CA  . LEU A 221 ? 3.2740 2.1145 2.9302 0.1142  0.6922  0.1513  221 LEU A CA  
1722 C C   . LEU A 221 ? 3.3214 2.1606 2.9777 0.1507  0.6958  0.1705  221 LEU A C   
1723 O O   . LEU A 221 ? 3.3356 2.1622 2.9861 0.1799  0.7149  0.1824  221 LEU A O   
1724 C CB  . LEU A 221 ? 3.2979 2.1271 2.9699 0.0864  0.7101  0.1369  221 LEU A CB  
1725 C CG  . LEU A 221 ? 3.2905 2.1354 2.9665 0.0487  0.6940  0.1159  221 LEU A CG  
1726 C CD1 . LEU A 221 ? 3.2791 2.1213 2.9520 0.0355  0.7000  0.1074  221 LEU A CD1 
1727 C CD2 . LEU A 221 ? 3.3143 2.1510 3.0075 0.0275  0.7130  0.1013  221 LEU A CD2 
1728 N N   . LYS A 222 ? 3.3622 2.2158 3.0249 0.1498  0.6771  0.1731  222 LYS A N   
1729 C CA  . LYS A 222 ? 3.4136 2.2695 3.0797 0.1832  0.6779  0.1910  222 LYS A CA  
1730 C C   . LYS A 222 ? 3.4529 2.3236 3.1268 0.1733  0.6565  0.1898  222 LYS A C   
1731 O O   . LYS A 222 ? 3.4308 2.3298 3.1028 0.1824  0.6230  0.1963  222 LYS A O   
1732 C CB  . LYS A 222 ? 3.3864 2.2632 3.0438 0.2146  0.6593  0.2039  222 LYS A CB  
1733 C CG  . LYS A 222 ? 3.3470 2.2326 3.0106 0.2524  0.6584  0.2224  222 LYS A CG  
1734 C CD  . LYS A 222 ? 3.2888 2.2074 2.9487 0.2772  0.6299  0.2303  222 LYS A CD  
1735 C CE  . LYS A 222 ? 3.2479 2.1847 2.9190 0.3107  0.6214  0.2469  222 LYS A CE  
1736 N NZ  . LYS A 222 ? 3.2076 2.1832 2.8803 0.3317  0.5904  0.2518  222 LYS A NZ  
1737 N N   . PRO A 223 ? 3.5087 2.3612 3.1919 0.1541  0.6759  0.1800  223 PRO A N   
1738 C CA  . PRO A 223 ? 3.5601 2.4231 3.2490 0.1464  0.6590  0.1779  223 PRO A CA  
1739 C C   . PRO A 223 ? 3.6715 2.5341 3.3655 0.1818  0.6618  0.1983  223 PRO A C   
1740 O O   . PRO A 223 ? 3.6761 2.5552 3.3731 0.1819  0.6384  0.2009  223 PRO A O   
1741 C CB  . PRO A 223 ? 3.5383 2.3776 3.2365 0.1193  0.6877  0.1598  223 PRO A CB  
1742 C CG  . PRO A 223 ? 3.5209 2.3484 3.2184 0.1039  0.7070  0.1490  223 PRO A CG  
1743 C CD  . PRO A 223 ? 3.5225 2.3472 3.2117 0.1341  0.7117  0.1665  223 PRO A CD  
1744 N N   . LEU A 224 ? 3.7445 2.5896 3.4392 0.2120  0.6899  0.2124  224 LEU A N   
1745 C CA  . LEU A 224 ? 3.7532 2.5982 3.4536 0.2505  0.6967  0.2328  224 LEU A CA  
1746 C C   . LEU A 224 ? 3.7847 2.6064 3.4958 0.2474  0.7199  0.2321  224 LEU A C   
1747 O O   . LEU A 224 ? 3.7878 2.5796 3.5029 0.2295  0.7532  0.2206  224 LEU A O   
1748 C CB  . LEU A 224 ? 3.6944 2.5794 3.3952 0.2670  0.6538  0.2432  224 LEU A CB  
1749 C CG  . LEU A 224 ? 3.6528 2.5481 3.3598 0.3142  0.6571  0.2655  224 LEU A CG  
1750 C CD1 . LEU A 224 ? 3.6659 2.5475 3.3660 0.3416  0.6854  0.2728  224 LEU A CD1 
1751 C CD2 . LEU A 224 ? 3.5788 2.5187 3.2901 0.3263  0.6126  0.2726  224 LEU A CD2 
1752 N N   . LYS A 225 ? 3.7957 2.6321 3.5130 0.2649  0.7027  0.2437  225 LYS A N   
1753 C CA  . LYS A 225 ? 3.7891 2.6040 3.5162 0.2656  0.7232  0.2444  225 LYS A CA  
1754 C C   . LYS A 225 ? 3.7741 2.5793 3.5028 0.2225  0.7233  0.2200  225 LYS A C   
1755 O O   . LYS A 225 ? 3.8335 2.6082 3.5670 0.2070  0.7599  0.2077  225 LYS A O   
1756 C CB  . LYS A 225 ? 3.7189 2.5569 3.4526 0.2927  0.6989  0.2617  225 LYS A CB  
1757 C CG  . LYS A 225 ? 3.6802 2.5111 3.4195 0.3406  0.7221  0.2852  225 LYS A CG  
1758 C CD  . LYS A 225 ? 3.6419 2.4873 3.3740 0.3647  0.7202  0.2940  225 LYS A CD  
1759 C CE  . LYS A 225 ? 3.6030 2.4445 3.3398 0.4155  0.7436  0.3161  225 LYS A CE  
1760 N NZ  . LYS A 225 ? 3.5669 2.4252 3.2955 0.4410  0.7414  0.3223  225 LYS A NZ  
1761 N N   . ASN A 226 ? 3.6565 2.4894 3.3818 0.2040  0.6831  0.2121  226 ASN A N   
1762 C CA  . ASN A 226 ? 3.5461 2.3740 3.2710 0.1656  0.6808  0.1874  226 ASN A CA  
1763 C C   . ASN A 226 ? 3.4692 2.3302 3.1833 0.1400  0.6370  0.1746  226 ASN A C   
1764 O O   . ASN A 226 ? 3.4856 2.3465 3.1969 0.1077  0.6339  0.1516  226 ASN A O   
1765 C CB  . ASN A 226 ? 3.4632 2.2793 3.1954 0.1692  0.6879  0.1876  226 ASN A CB  
1766 C CG  . ASN A 226 ? 3.4105 2.2044 3.1469 0.1363  0.7119  0.1605  226 ASN A CG  
1767 O OD1 . ASN A 226 ? 3.3788 2.1873 3.1088 0.1046  0.6931  0.1385  226 ASN A OD1 
1768 N ND2 . ASN A 226 ? 3.4104 2.1698 3.1583 0.1450  0.7550  0.1610  226 ASN A ND2 
1769 N N   . SER A 227 ? 3.3594 2.2495 3.0679 0.1555  0.6047  0.1886  227 SER A N   
1770 C CA  . SER A 227 ? 3.2302 2.1507 2.9280 0.1337  0.5654  0.1784  227 SER A CA  
1771 C C   . SER A 227 ? 3.3240 2.2378 3.0163 0.1126  0.5769  0.1638  227 SER A C   
1772 O O   . SER A 227 ? 3.3517 2.2510 3.0463 0.1261  0.6004  0.1709  227 SER A O   
1773 C CB  . SER A 227 ? 3.0237 1.9774 2.7205 0.1580  0.5302  0.1974  227 SER A CB  
1774 O OG  . SER A 227 ? 2.9273 1.8789 2.6254 0.1811  0.5430  0.2095  227 SER A OG  
1775 N N   . ARG A 228 ? 3.3711 2.2968 3.0559 0.0803  0.5602  0.1433  228 ARG A N   
1776 C CA  . ARG A 228 ? 3.3978 2.3185 3.0798 0.0582  0.5719  0.1272  228 ARG A CA  
1777 C C   . ARG A 228 ? 3.3600 2.3070 3.0310 0.0545  0.5404  0.1291  228 ARG A C   
1778 O O   . ARG A 228 ? 3.3688 2.3327 3.0315 0.0302  0.5198  0.1136  228 ARG A O   
1779 C CB  . ARG A 228 ? 3.3822 2.2971 3.0657 0.0253  0.5822  0.0998  228 ARG A CB  
1780 C CG  . ARG A 228 ? 3.3925 2.2795 3.0885 0.0263  0.6172  0.0942  228 ARG A CG  
1781 C CD  . ARG A 228 ? 3.3961 2.2542 3.1032 0.0472  0.6564  0.1078  228 ARG A CD  
1782 N NE  . ARG A 228 ? 3.4057 2.2497 3.1202 0.0293  0.6853  0.0923  228 ARG A NE  
1783 C CZ  . ARG A 228 ? 3.3998 2.2488 3.1102 0.0292  0.6830  0.0955  228 ARG A CZ  
1784 N NH1 . ARG A 228 ? 3.3761 2.2430 3.0746 0.0463  0.6545  0.1125  228 ARG A NH1 
1785 N NH2 . ARG A 228 ? 3.4080 2.2453 3.1274 0.0119  0.7094  0.0806  228 ARG A NH2 
1786 N N   . GLN A 229 ? 3.2735 2.2239 2.9443 0.0800  0.5382  0.1472  229 GLN A N   
1787 C CA  . GLN A 229 ? 3.1032 2.0747 2.7652 0.0787  0.5140  0.1487  229 GLN A CA  
1788 C C   . GLN A 229 ? 3.0371 1.9915 2.6990 0.0823  0.5389  0.1484  229 GLN A C   
1789 O O   . GLN A 229 ? 2.9909 1.9397 2.6542 0.1103  0.5490  0.1636  229 GLN A O   
1790 C CB  . GLN A 229 ? 3.0017 1.9978 2.6639 0.1061  0.4863  0.1678  229 GLN A CB  
1791 C CG  . GLN A 229 ? 2.9350 1.9514 2.5977 0.1042  0.4579  0.1699  229 GLN A CG  
1792 C CD  . GLN A 229 ? 2.8560 1.9000 2.5239 0.1327  0.4319  0.1888  229 GLN A CD  
1793 O OE1 . GLN A 229 ? 2.7835 1.8324 2.4544 0.1546  0.4355  0.1988  229 GLN A OE1 
1794 N NE2 . GLN A 229 ? 2.8459 1.9100 2.5158 0.1329  0.4055  0.1925  229 GLN A NE2 
1795 N N   . VAL A 230 ? 3.0019 1.9497 2.6621 0.0546  0.5484  0.1302  230 VAL A N   
1796 C CA  . VAL A 230 ? 2.9457 1.8779 2.6058 0.0538  0.5707  0.1278  230 VAL A CA  
1797 C C   . VAL A 230 ? 2.9157 1.8620 2.5663 0.0705  0.5521  0.1384  230 VAL A C   
1798 O O   . VAL A 230 ? 2.8521 1.8198 2.4950 0.0586  0.5241  0.1331  230 VAL A O   
1799 C CB  . VAL A 230 ? 2.8746 1.8058 2.5364 0.0197  0.5773  0.1053  230 VAL A CB  
1800 C CG1 . VAL A 230 ? 2.8616 1.7776 2.5246 0.0188  0.5995  0.1034  230 VAL A CG1 
1801 C CG2 . VAL A 230 ? 2.8582 1.7782 2.5314 0.0031  0.5972  0.0911  230 VAL A CG2 
1802 N N   . GLU A 231 ? 2.9437 1.8779 2.5946 0.0990  0.5691  0.1524  231 GLU A N   
1803 C CA  . GLU A 231 ? 2.9340 1.8805 2.5763 0.1177  0.5559  0.1602  231 GLU A CA  
1804 C C   . GLU A 231 ? 3.0064 1.9359 2.6427 0.1099  0.5755  0.1526  231 GLU A C   
1805 O O   . GLU A 231 ? 3.0930 1.9969 2.7329 0.1133  0.6084  0.1529  231 GLU A O   
1806 C CB  . GLU A 231 ? 2.8802 1.8297 2.5256 0.1576  0.5598  0.1791  231 GLU A CB  
1807 C CG  . GLU A 231 ? 2.8427 1.8019 2.4804 0.1817  0.5548  0.1852  231 GLU A CG  
1808 C CD  . GLU A 231 ? 2.8731 1.8052 2.5048 0.1935  0.5890  0.1859  231 GLU A CD  
1809 O OE1 . GLU A 231 ? 2.8671 1.7728 2.5030 0.1836  0.6177  0.1832  231 GLU A OE1 
1810 O OE2 . GLU A 231 ? 2.8873 1.8249 2.5101 0.2130  0.5879  0.1882  231 GLU A OE2 
1811 N N   . VAL A 232 ? 2.9274 1.8712 2.5547 0.0993  0.5553  0.1457  232 VAL A N   
1812 C CA  . VAL A 232 ? 2.7808 1.7113 2.4018 0.0883  0.5693  0.1368  232 VAL A CA  
1813 C C   . VAL A 232 ? 2.6680 1.6053 2.2768 0.1091  0.5605  0.1418  232 VAL A C   
1814 O O   . VAL A 232 ? 2.5162 1.4769 2.1210 0.1138  0.5324  0.1431  232 VAL A O   
1815 C CB  . VAL A 232 ? 2.6634 1.6019 2.2846 0.0518  0.5573  0.1196  232 VAL A CB  
1816 C CG1 . VAL A 232 ? 2.6434 1.5677 2.2614 0.0399  0.5739  0.1106  232 VAL A CG1 
1817 C CG2 . VAL A 232 ? 2.6507 1.5872 2.2837 0.0315  0.5641  0.1110  232 VAL A CG2 
1818 N N   . SER A 233 ? 2.6774 1.5944 2.2805 0.1215  0.5858  0.1433  233 SER A N   
1819 C CA  . SER A 233 ? 2.6340 1.5550 2.2233 0.1406  0.5812  0.1445  233 SER A CA  
1820 C C   . SER A 233 ? 2.6574 1.5589 2.2381 0.1257  0.5987  0.1343  233 SER A C   
1821 O O   . SER A 233 ? 2.7017 1.5831 2.2892 0.1115  0.6229  0.1309  233 SER A O   
1822 C CB  . SER A 233 ? 2.5464 1.4660 2.1339 0.1823  0.5937  0.1589  233 SER A CB  
1823 O OG  . SER A 233 ? 2.5333 1.4256 2.1233 0.1908  0.6287  0.1643  233 SER A OG  
1824 N N   . TRP A 234 ? 2.5769 1.4852 2.1438 0.1287  0.5863  0.1286  234 TRP A N   
1825 C CA  . TRP A 234 ? 2.4901 1.3823 2.0471 0.1149  0.5988  0.1185  234 TRP A CA  
1826 C C   . TRP A 234 ? 2.3916 1.2846 1.9297 0.1399  0.5972  0.1181  234 TRP A C   
1827 O O   . TRP A 234 ? 2.4418 1.3431 1.9767 0.1730  0.5969  0.1270  234 TRP A O   
1828 C CB  . TRP A 234 ? 2.5047 1.4066 2.0647 0.0782  0.5800  0.1049  234 TRP A CB  
1829 C CG  . TRP A 234 ? 2.5213 1.4478 2.0762 0.0781  0.5473  0.1026  234 TRP A CG  
1830 C CD1 . TRP A 234 ? 2.5202 1.4534 2.0608 0.0856  0.5342  0.0975  234 TRP A CD1 
1831 C CD2 . TRP A 234 ? 2.5203 1.4677 2.0843 0.0706  0.5246  0.1047  234 TRP A CD2 
1832 N NE1 . TRP A 234 ? 2.4972 1.4538 2.0394 0.0831  0.5060  0.0966  234 TRP A NE1 
1833 C CE2 . TRP A 234 ? 2.5073 1.4732 2.0632 0.0741  0.4993  0.1015  234 TRP A CE2 
1834 C CE3 . TRP A 234 ? 2.5336 1.4856 2.1110 0.0613  0.5237  0.1079  234 TRP A CE3 
1835 C CZ2 . TRP A 234 ? 2.5203 1.5089 2.0813 0.0687  0.4737  0.1028  234 TRP A CZ2 
1836 C CZ3 . TRP A 234 ? 2.5339 1.5089 2.1142 0.0558  0.4966  0.1086  234 TRP A CZ3 
1837 C CH2 . TRP A 234 ? 2.5277 1.5206 2.1000 0.0596  0.4722  0.1067  234 TRP A CH2 
1838 N N   . GLU A 235 ? 2.2912 1.1777 1.8175 0.1244  0.5958  0.1065  235 GLU A N   
1839 C CA  . GLU A 235 ? 2.3186 1.2047 1.8244 0.1453  0.5946  0.1023  235 GLU A CA  
1840 C C   . GLU A 235 ? 2.3701 1.2584 1.8668 0.1186  0.5786  0.0872  235 GLU A C   
1841 O O   . GLU A 235 ? 2.4859 1.3691 1.9911 0.0867  0.5790  0.0811  235 GLU A O   
1842 C CB  . GLU A 235 ? 2.4314 1.2935 1.9264 0.1664  0.6270  0.1067  235 GLU A CB  
1843 C CG  . GLU A 235 ? 2.5834 1.4506 2.0617 0.2078  0.6310  0.1096  235 GLU A CG  
1844 C CD  . GLU A 235 ? 2.7196 1.5685 2.1946 0.2373  0.6639  0.1213  235 GLU A CD  
1845 O OE1 . GLU A 235 ? 2.7261 1.5572 2.2134 0.2247  0.6837  0.1277  235 GLU A OE1 
1846 O OE2 . GLU A 235 ? 2.7837 1.6368 2.2445 0.2743  0.6711  0.1234  235 GLU A OE2 
1847 N N   . TYR A 236 ? 2.2284 1.1260 1.7092 0.1320  0.5649  0.0803  236 TYR A N   
1848 C CA  . TYR A 236 ? 1.9937 0.8931 1.4645 0.1086  0.5490  0.0658  236 TYR A CA  
1849 C C   . TYR A 236 ? 2.0604 0.9377 1.5230 0.0912  0.5661  0.0588  236 TYR A C   
1850 O O   . TYR A 236 ? 2.2108 1.0708 1.6625 0.1094  0.5894  0.0616  236 TYR A O   
1851 C CB  . TYR A 236 ? 1.7998 0.7109 1.2541 0.1300  0.5355  0.0581  236 TYR A CB  
1852 C CG  . TYR A 236 ? 1.8081 0.7452 1.2723 0.1306  0.5093  0.0581  236 TYR A CG  
1853 C CD1 . TYR A 236 ? 1.7089 0.6574 1.1625 0.1334  0.4922  0.0460  236 TYR A CD1 
1854 C CD2 . TYR A 236 ? 1.8531 0.8029 1.3370 0.1277  0.5022  0.0692  236 TYR A CD2 
1855 C CE1 . TYR A 236 ? 1.6535 0.6255 1.1176 0.1342  0.4702  0.0460  236 TYR A CE1 
1856 C CE2 . TYR A 236 ? 1.7648 0.7385 1.2573 0.1281  0.4784  0.0695  236 TYR A CE2 
1857 C CZ  . TYR A 236 ? 1.7016 0.6864 1.1850 0.1315  0.4631  0.0583  236 TYR A CZ  
1858 O OH  . TYR A 236 ? 1.7214 0.7299 1.2149 0.1321  0.4412  0.0587  236 TYR A OH  
1859 N N   . PRO A 237 ? 1.9866 0.8658 1.4551 0.0567  0.5549  0.0496  237 PRO A N   
1860 C CA  . PRO A 237 ? 1.9045 0.7678 1.3697 0.0359  0.5673  0.0417  237 PRO A CA  
1861 C C   . PRO A 237 ? 1.8647 0.7147 1.3030 0.0528  0.5745  0.0351  237 PRO A C   
1862 O O   . PRO A 237 ? 1.8094 0.6676 1.2316 0.0705  0.5610  0.0303  237 PRO A O   
1863 C CB  . PRO A 237 ? 1.9190 0.7961 1.3920 0.0031  0.5444  0.0314  237 PRO A CB  
1864 C CG  . PRO A 237 ? 1.9777 0.8737 1.4654 0.0016  0.5288  0.0373  237 PRO A CG  
1865 C CD  . PRO A 237 ? 2.0173 0.9166 1.4969 0.0363  0.5289  0.0462  237 PRO A CD  
1866 N N   . ASP A 238 ? 1.8642 0.6948 1.2978 0.0474  0.5960  0.0335  238 ASP A N   
1867 C CA  . ASP A 238 ? 2.0150 0.8309 1.4202 0.0646  0.6059  0.0272  238 ASP A CA  
1868 C C   . ASP A 238 ? 1.9967 0.8180 1.3854 0.0497  0.5833  0.0111  238 ASP A C   
1869 O O   . ASP A 238 ? 2.0622 0.8802 1.4246 0.0697  0.5808  0.0032  238 ASP A O   
1870 C CB  . ASP A 238 ? 2.1840 0.9777 1.5896 0.0596  0.6349  0.0297  238 ASP A CB  
1871 C CG  . ASP A 238 ? 2.2988 1.0814 1.7116 0.0848  0.6627  0.0449  238 ASP A CG  
1872 O OD1 . ASP A 238 ? 2.3243 1.0877 1.7393 0.0828  0.6896  0.0482  238 ASP A OD1 
1873 O OD2 . ASP A 238 ? 2.3270 1.1204 1.7441 0.1068  0.6581  0.0536  238 ASP A OD2 
1874 N N   . THR A 239 ? 1.9038 0.7344 1.3082 0.0153  0.5673  0.0053  239 THR A N   
1875 C CA  . THR A 239 ? 1.7852 0.6200 1.1765 -0.0021 0.5463  -0.0096 239 THR A CA  
1876 C C   . THR A 239 ? 1.7021 0.5527 1.0862 0.0077  0.5226  -0.0140 239 THR A C   
1877 O O   . THR A 239 ? 1.6268 0.4776 0.9920 0.0060  0.5088  -0.0271 239 THR A O   
1878 C CB  . THR A 239 ? 1.7416 0.5837 1.1544 -0.0406 0.5379  -0.0140 239 THR A CB  
1879 O OG1 . THR A 239 ? 1.8454 0.7059 1.2816 -0.0504 0.5259  -0.0084 239 THR A OG1 
1880 C CG2 . THR A 239 ? 1.5272 0.3568 0.9528 -0.0510 0.5627  -0.0105 239 THR A CG2 
1881 N N   . TRP A 240 ? 1.6546 0.5187 1.0546 0.0177  0.5184  -0.0037 240 TRP A N   
1882 C CA  . TRP A 240 ? 1.7290 0.6099 1.1262 0.0270  0.4972  -0.0071 240 TRP A CA  
1883 C C   . TRP A 240 ? 1.8747 0.7531 1.2463 0.0555  0.4976  -0.0164 240 TRP A C   
1884 O O   . TRP A 240 ? 1.9053 0.7734 1.2644 0.0807  0.5167  -0.0139 240 TRP A O   
1885 C CB  . TRP A 240 ? 1.6121 0.5078 1.0290 0.0374  0.4945  0.0063  240 TRP A CB  
1886 C CG  . TRP A 240 ? 1.6316 0.5462 1.0490 0.0424  0.4720  0.0024  240 TRP A CG  
1887 C CD1 . TRP A 240 ? 1.6911 0.6166 1.1036 0.0725  0.4689  0.0028  240 TRP A CD1 
1888 C CD2 . TRP A 240 ? 1.7823 0.7081 1.2063 0.0174  0.4507  -0.0033 240 TRP A CD2 
1889 N NE1 . TRP A 240 ? 1.7577 0.7000 1.1747 0.0666  0.4474  -0.0023 240 TRP A NE1 
1890 C CE2 . TRP A 240 ? 1.7510 0.6924 1.1735 0.0333  0.4362  -0.0056 240 TRP A CE2 
1891 C CE3 . TRP A 240 ? 1.8030 0.7292 1.2354 -0.0156 0.4433  -0.0071 240 TRP A CE3 
1892 C CZ2 . TRP A 240 ? 1.7242 0.6780 1.1514 0.0169  0.4157  -0.0104 240 TRP A CZ2 
1893 C CZ3 . TRP A 240 ? 1.8169 0.7567 1.2531 -0.0304 0.4223  -0.0118 240 TRP A CZ3 
1894 C CH2 . TRP A 240 ? 1.8169 0.7688 1.2496 -0.0143 0.4092  -0.0130 240 TRP A CH2 
1895 N N   . SER A 241 ? 1.9642 0.8530 1.3286 0.0524  0.4775  -0.0280 241 SER A N   
1896 C CA  . SER A 241 ? 1.9845 0.8731 1.3250 0.0762  0.4762  -0.0420 241 SER A CA  
1897 C C   . SER A 241 ? 2.0375 0.9392 1.3813 0.1144  0.4833  -0.0357 241 SER A C   
1898 O O   . SER A 241 ? 2.0332 0.9493 1.3991 0.1180  0.4790  -0.0228 241 SER A O   
1899 C CB  . SER A 241 ? 1.8352 0.7319 1.1711 0.0606  0.4535  -0.0565 241 SER A CB  
1900 O OG  . SER A 241 ? 1.7745 0.6591 1.0833 0.0610  0.4532  -0.0748 241 SER A OG  
1901 N N   . THR A 242 ? 2.0484 0.9468 1.3704 0.1436  0.4940  -0.0457 242 THR A N   
1902 C CA  . THR A 242 ? 2.0083 0.9225 1.3337 0.1837  0.5021  -0.0418 242 THR A CA  
1903 C C   . THR A 242 ? 1.8892 0.8182 1.2022 0.2023  0.4922  -0.0620 242 THR A C   
1904 O O   . THR A 242 ? 1.9540 0.8735 1.2474 0.1885  0.4853  -0.0798 242 THR A O   
1905 C CB  . THR A 242 ? 2.0857 0.9859 1.3978 0.2096  0.5290  -0.0351 242 THR A CB  
1906 O OG1 . THR A 242 ? 1.8137 0.6990 1.0935 0.2156  0.5365  -0.0525 242 THR A OG1 
1907 C CG2 . THR A 242 ? 1.9648 0.8483 1.2899 0.1890  0.5411  -0.0177 242 THR A CG2 
1908 N N   . PRO A 243 ? 1.7557 0.7095 1.0815 0.2336  0.4915  -0.0607 243 PRO A N   
1909 C CA  . PRO A 243 ? 1.8439 0.8138 1.1929 0.2556  0.4977  -0.0417 243 PRO A CA  
1910 C C   . PRO A 243 ? 1.8141 0.7933 1.1912 0.2310  0.4821  -0.0263 243 PRO A C   
1911 O O   . PRO A 243 ? 1.8254 0.8162 1.2107 0.2153  0.4631  -0.0332 243 PRO A O   
1912 C CB  . PRO A 243 ? 1.8538 0.8525 1.2063 0.2935  0.4959  -0.0536 243 PRO A CB  
1913 C CG  . PRO A 243 ? 1.8614 0.8546 1.1876 0.2949  0.4943  -0.0800 243 PRO A CG  
1914 C CD  . PRO A 243 ? 1.7955 0.7657 1.1128 0.2507  0.4833  -0.0829 243 PRO A CD  
1915 N N   . HIS A 244 ? 1.7015 0.6759 1.0926 0.2296  0.4911  -0.0065 244 HIS A N   
1916 C CA  . HIS A 244 ? 1.5394 0.5208 0.9542 0.2056  0.4779  0.0073  244 HIS A CA  
1917 C C   . HIS A 244 ? 1.5863 0.5976 1.0200 0.2138  0.4587  0.0073  244 HIS A C   
1918 O O   . HIS A 244 ? 1.7028 0.7213 1.1527 0.1923  0.4445  0.0156  244 HIS A O   
1919 C CB  . HIS A 244 ? 1.6467 0.6207 1.0733 0.2105  0.4931  0.0267  244 HIS A CB  
1920 C CG  . HIS A 244 ? 1.8100 0.7547 1.2243 0.1960  0.5122  0.0286  244 HIS A CG  
1921 N ND1 . HIS A 244 ? 1.8730 0.8021 1.2771 0.1637  0.5078  0.0188  244 HIS A ND1 
1922 C CD2 . HIS A 244 ? 1.8382 0.7675 1.2508 0.2092  0.5361  0.0393  244 HIS A CD2 
1923 C CE1 . HIS A 244 ? 1.9206 0.8273 1.3183 0.1573  0.5279  0.0228  244 HIS A CE1 
1924 N NE2 . HIS A 244 ? 1.9177 0.8227 1.3198 0.1845  0.5462  0.0352  244 HIS A NE2 
1925 N N   . SER A 245 ? 1.7654 0.7959 1.1978 0.2458  0.4589  -0.0028 245 SER A N   
1926 C CA  . SER A 245 ? 1.8150 0.8773 1.2686 0.2570  0.4425  -0.0037 245 SER A CA  
1927 C C   . SER A 245 ? 1.8570 0.9217 1.3058 0.2373  0.4266  -0.0206 245 SER A C   
1928 O O   . SER A 245 ? 1.8770 0.9576 1.3428 0.2253  0.4097  -0.0179 245 SER A O   
1929 C CB  . SER A 245 ? 1.6879 0.7745 1.1468 0.3025  0.4512  -0.0087 245 SER A CB  
1930 O OG  . SER A 245 ? 1.6518 0.7364 1.0902 0.3160  0.4572  -0.0314 245 SER A OG  
1931 N N   . TYR A 246 ? 1.8463 0.8946 1.2707 0.2348  0.4328  -0.0382 246 TYR A N   
1932 C CA  . TYR A 246 ? 1.8553 0.9009 1.2713 0.2157  0.4203  -0.0559 246 TYR A CA  
1933 C C   . TYR A 246 ? 1.9325 0.9584 1.3461 0.1739  0.4114  -0.0488 246 TYR A C   
1934 O O   . TYR A 246 ? 1.9955 1.0213 1.4088 0.1530  0.3977  -0.0572 246 TYR A O   
1935 C CB  . TYR A 246 ? 1.8425 0.8763 1.2310 0.2280  0.4305  -0.0777 246 TYR A CB  
1936 C CG  . TYR A 246 ? 1.8209 0.8535 1.2003 0.2137  0.4189  -0.0991 246 TYR A CG  
1937 C CD1 . TYR A 246 ? 1.8085 0.8161 1.1699 0.1814  0.4140  -0.1054 246 TYR A CD1 
1938 C CD2 . TYR A 246 ? 1.8619 0.9196 1.2527 0.2330  0.4135  -0.1137 246 TYR A CD2 
1939 C CE1 . TYR A 246 ? 1.7424 0.7476 1.0951 0.1687  0.4038  -0.1249 246 TYR A CE1 
1940 C CE2 . TYR A 246 ? 1.8120 0.8670 1.1950 0.2201  0.4048  -0.1342 246 TYR A CE2 
1941 C CZ  . TYR A 246 ? 1.6787 0.7063 1.0416 0.1880  0.3999  -0.1393 246 TYR A CZ  
1942 O OH  . TYR A 246 ? 1.6159 0.6396 0.9707 0.1755  0.3916  -0.1596 246 TYR A OH  
1943 N N   . PHE A 247 ? 1.8636 0.8740 1.2767 0.1632  0.4205  -0.0341 247 PHE A N   
1944 C CA  . PHE A 247 ? 1.6066 0.6014 1.0204 0.1258  0.4148  -0.0278 247 PHE A CA  
1945 C C   . PHE A 247 ? 1.5495 0.5497 0.9832 0.1200  0.4154  -0.0076 247 PHE A C   
1946 O O   . PHE A 247 ? 1.5166 0.5015 0.9495 0.1109  0.4276  0.0009  247 PHE A O   
1947 C CB  . PHE A 247 ? 1.4908 0.4597 0.8844 0.1146  0.4277  -0.0332 247 PHE A CB  
1948 C CG  . PHE A 247 ? 1.6442 0.6045 1.0150 0.1140  0.4254  -0.0544 247 PHE A CG  
1949 C CD1 . PHE A 247 ? 1.7031 0.6560 1.0536 0.1387  0.4397  -0.0646 247 PHE A CD1 
1950 C CD2 . PHE A 247 ? 1.6876 0.6470 1.0558 0.0895  0.4093  -0.0647 247 PHE A CD2 
1951 C CE1 . PHE A 247 ? 1.6705 0.6151 0.9977 0.1376  0.4372  -0.0861 247 PHE A CE1 
1952 C CE2 . PHE A 247 ? 1.6213 0.5717 0.9679 0.0882  0.4070  -0.0852 247 PHE A CE2 
1953 C CZ  . PHE A 247 ? 1.5786 0.5216 0.9043 0.1117  0.4204  -0.0966 247 PHE A CZ  
1954 N N   . SER A 248 ? 1.4419 0.4642 0.8937 0.1251  0.4025  -0.0009 248 SER A N   
1955 C CA  . SER A 248 ? 1.5352 0.5652 1.0051 0.1223  0.4013  0.0170  248 SER A CA  
1956 C C   . SER A 248 ? 1.5910 0.6073 1.0621 0.0879  0.4000  0.0220  248 SER A C   
1957 O O   . SER A 248 ? 1.6683 0.6764 1.1312 0.0645  0.3936  0.0126  248 SER A O   
1958 C CB  . SER A 248 ? 1.5595 0.6165 1.0468 0.1296  0.3842  0.0210  248 SER A CB  
1959 O OG  . SER A 248 ? 1.6541 0.7263 1.1410 0.1544  0.3821  0.0096  248 SER A OG  
1960 N N   . LEU A 249 ? 1.5249 0.5403 1.0076 0.0860  0.4066  0.0356  249 LEU A N   
1961 C CA  . LEU A 249 ? 1.5214 0.5305 1.0101 0.0554  0.4048  0.0392  249 LEU A CA  
1962 C C   . LEU A 249 ? 1.6724 0.6988 1.1769 0.0527  0.3934  0.0499  249 LEU A C   
1963 O O   . LEU A 249 ? 1.6590 0.7010 1.1716 0.0750  0.3884  0.0569  249 LEU A O   
1964 C CB  . LEU A 249 ? 1.5636 0.5527 1.0513 0.0504  0.4264  0.0427  249 LEU A CB  
1965 C CG  . LEU A 249 ? 1.6824 0.6527 1.1588 0.0322  0.4355  0.0325  249 LEU A CG  
1966 C CD1 . LEU A 249 ? 1.6872 0.6627 1.1583 0.0107  0.4176  0.0212  249 LEU A CD1 
1967 C CD2 . LEU A 249 ? 1.7609 0.7178 1.2215 0.0547  0.4506  0.0285  249 LEU A CD2 
1968 N N   . THR A 250 ? 1.7444 0.7698 1.2537 0.0256  0.3891  0.0501  250 THR A N   
1969 C CA  . THR A 250 ? 1.7639 0.8031 1.2853 0.0198  0.3801  0.0587  250 THR A CA  
1970 C C   . THR A 250 ? 1.8918 0.9206 1.4191 0.0001  0.3925  0.0592  250 THR A C   
1971 O O   . THR A 250 ? 1.9365 0.9509 1.4601 -0.0134 0.4042  0.0521  250 THR A O   
1972 C CB  . THR A 250 ? 1.6661 0.7219 1.1874 0.0068  0.3583  0.0553  250 THR A CB  
1973 O OG1 . THR A 250 ? 1.6268 0.6986 1.1578 0.0091  0.3480  0.0645  250 THR A OG1 
1974 C CG2 . THR A 250 ? 1.6868 0.7370 1.2039 -0.0223 0.3566  0.0464  250 THR A CG2 
1975 N N   . PHE A 251 ? 1.9307 0.9678 1.4681 -0.0016 0.3903  0.0665  251 PHE A N   
1976 C CA  . PHE A 251 ? 1.9425 0.9704 1.4877 -0.0170 0.4052  0.0656  251 PHE A CA  
1977 C C   . PHE A 251 ? 1.9342 0.9770 1.4858 -0.0325 0.3932  0.0652  251 PHE A C   
1978 O O   . PHE A 251 ? 1.8132 0.8723 1.3642 -0.0256 0.3752  0.0703  251 PHE A O   
1979 C CB  . PHE A 251 ? 1.8639 0.8790 1.4143 0.0026  0.4253  0.0747  251 PHE A CB  
1980 C CG  . PHE A 251 ? 1.7809 0.7815 1.3225 0.0208  0.4391  0.0748  251 PHE A CG  
1981 C CD1 . PHE A 251 ? 1.7104 0.7192 1.2459 0.0461  0.4310  0.0781  251 PHE A CD1 
1982 C CD2 . PHE A 251 ? 1.7240 0.7045 1.2638 0.0131  0.4605  0.0701  251 PHE A CD2 
1983 C CE1 . PHE A 251 ? 1.7252 0.7220 1.2503 0.0642  0.4441  0.0759  251 PHE A CE1 
1984 C CE2 . PHE A 251 ? 1.6953 0.6622 1.2238 0.0302  0.4730  0.0695  251 PHE A CE2 
1985 C CZ  . PHE A 251 ? 1.7204 0.6953 1.2402 0.0563  0.4648  0.0719  251 PHE A CZ  
1986 N N   . CYS A 252 ? 1.9460 0.9847 1.5042 -0.0532 0.4038  0.0577  252 CYS A N   
1987 C CA  . CYS A 252 ? 1.9688 1.0210 1.5326 -0.0667 0.3965  0.0549  252 CYS A CA  
1988 C C   . CYS A 252 ? 2.1247 1.1667 1.7004 -0.0705 0.4179  0.0538  252 CYS A C   
1989 O O   . CYS A 252 ? 2.1832 1.2145 1.7661 -0.0825 0.4364  0.0457  252 CYS A O   
1990 C CB  . CYS A 252 ? 1.8929 0.9571 1.4545 -0.0899 0.3866  0.0425  252 CYS A CB  
1991 S SG  . CYS A 252 ? 2.0449 1.1294 1.6088 -0.1040 0.3756  0.0367  252 CYS A SG  
1992 N N   . VAL A 253 ? 2.1984 1.2441 1.7774 -0.0603 0.4156  0.0615  253 VAL A N   
1993 C CA  . VAL A 253 ? 2.2094 1.2444 1.7998 -0.0619 0.4362  0.0608  253 VAL A CA  
1994 C C   . VAL A 253 ? 2.2774 1.3256 1.8724 -0.0828 0.4321  0.0486  253 VAL A C   
1995 O O   . VAL A 253 ? 2.2189 1.2835 1.8075 -0.0830 0.4116  0.0499  253 VAL A O   
1996 C CB  . VAL A 253 ? 2.0732 1.1038 1.6650 -0.0371 0.4377  0.0759  253 VAL A CB  
1997 C CG1 . VAL A 253 ? 2.0985 1.1130 1.7020 -0.0372 0.4635  0.0754  253 VAL A CG1 
1998 C CG2 . VAL A 253 ? 1.9701 0.9941 1.5562 -0.0131 0.4388  0.0863  253 VAL A CG2 
1999 N N   . GLN A 254 ? 2.3494 1.3918 1.9559 -0.0998 0.4522  0.0355  254 GLN A N   
2000 C CA  . GLN A 254 ? 2.3834 1.4410 1.9958 -0.1196 0.4511  0.0196  254 GLN A CA  
2001 C C   . GLN A 254 ? 2.4684 1.5162 2.0945 -0.1216 0.4734  0.0146  254 GLN A C   
2002 O O   . GLN A 254 ? 2.4145 1.4475 2.0415 -0.1047 0.4816  0.0272  254 GLN A O   
2003 C CB  . GLN A 254 ? 2.4031 1.4696 2.0216 -0.1395 0.4550  0.0040  254 GLN A CB  
2004 C CG  . GLN A 254 ? 2.4230 1.5146 2.0416 -0.1565 0.4439  -0.0123 254 GLN A CG  
2005 C CD  . GLN A 254 ? 2.4359 1.5373 2.0697 -0.1756 0.4567  -0.0306 254 GLN A CD  
2006 O OE1 . GLN A 254 ? 2.4369 1.5585 2.0665 -0.1853 0.4428  -0.0396 254 GLN A OE1 
2007 N NE2 . GLN A 254 ? 2.4173 1.5059 2.0704 -0.1801 0.4839  -0.0363 254 GLN A NE2 
2008 N N   . VAL A 255 ? 2.5876 1.6449 2.2255 -0.1414 0.4842  -0.0048 255 VAL A N   
2009 C CA  . VAL A 255 ? 2.6535 1.7045 2.3056 -0.1462 0.5058  -0.0144 255 VAL A CA  
2010 C C   . VAL A 255 ? 2.6608 1.7289 2.3279 -0.1692 0.5164  -0.0399 255 VAL A C   
2011 O O   . VAL A 255 ? 2.6514 1.7293 2.3229 -0.1791 0.5150  -0.0469 255 VAL A O   
2012 C CB  . VAL A 255 ? 2.0764 1.1321 1.7178 -0.1378 0.4906  -0.0089 255 VAL A CB  
2013 C CG1 . VAL A 255 ? 2.0962 1.1794 1.7262 -0.1503 0.4667  -0.0216 255 VAL A CG1 
2014 C CG2 . VAL A 255 ? 2.0159 1.0567 1.6708 -0.1369 0.5153  -0.0136 255 VAL A CG2 
2015 N N   . GLN A 256 ? 2.6515 1.7248 2.3277 -0.1770 0.5274  -0.0549 256 GLN A N   
2016 C CA  . GLN A 256 ? 2.6257 1.7209 2.3172 -0.1970 0.5368  -0.0821 256 GLN A CA  
2017 C C   . GLN A 256 ? 2.5437 1.6651 2.2195 -0.2023 0.5131  -0.0936 256 GLN A C   
2018 O O   . GLN A 256 ? 2.4569 1.5793 2.1100 -0.1920 0.4879  -0.0791 256 GLN A O   
2019 C CB  . GLN A 256 ? 2.7076 1.7923 2.4245 -0.2036 0.5716  -0.0968 256 GLN A CB  
2020 C CG  . GLN A 256 ? 2.7356 1.8460 2.4744 -0.2234 0.5852  -0.1275 256 GLN A CG  
2021 C CD  . GLN A 256 ? 2.7445 1.8453 2.5107 -0.2299 0.6211  -0.1442 256 GLN A CD  
2022 O OE1 . GLN A 256 ? 2.7520 1.8684 2.5452 -0.2440 0.6412  -0.1666 256 GLN A OE1 
2023 N NE2 . GLN A 256 ? 2.7053 1.7818 2.4665 -0.2191 0.6301  -0.1340 256 GLN A NE2 
2024 N N   . LYS A 264 ? 2.8709 2.0814 2.3710 -0.1411 0.2742  0.0036  264 LYS A N   
2025 C CA  . LYS A 264 ? 2.9128 2.1216 2.4187 -0.1483 0.2874  -0.0092 264 LYS A CA  
2026 C C   . LYS A 264 ? 2.9940 2.1840 2.5136 -0.1376 0.2973  0.0029  264 LYS A C   
2027 O O   . LYS A 264 ? 2.9709 2.1627 2.4866 -0.1328 0.2890  0.0068  264 LYS A O   
2028 C CB  . LYS A 264 ? 2.8653 2.0756 2.3820 -0.1626 0.3089  -0.0293 264 LYS A CB  
2029 C CG  . LYS A 264 ? 2.7929 2.0266 2.2967 -0.1725 0.3013  -0.0457 264 LYS A CG  
2030 C CD  . LYS A 264 ? 2.7380 1.9774 2.2580 -0.1852 0.3232  -0.0662 264 LYS A CD  
2031 C CE  . LYS A 264 ? 2.6644 1.9316 2.1725 -0.1930 0.3173  -0.0857 264 LYS A CE  
2032 N NZ  . LYS A 264 ? 2.6320 1.9077 2.1228 -0.1880 0.2984  -0.0759 264 LYS A NZ  
2033 N N   . ASP A 265 ? 3.0715 2.2438 2.6061 -0.1332 0.3149  0.0088  265 ASP A N   
2034 C CA  . ASP A 265 ? 3.0947 2.2483 2.6420 -0.1206 0.3274  0.0207  265 ASP A CA  
2035 C C   . ASP A 265 ? 3.1000 2.2372 2.6569 -0.1107 0.3394  0.0314  265 ASP A C   
2036 O O   . ASP A 265 ? 3.1428 2.2639 2.7098 -0.0981 0.3526  0.0413  265 ASP A O   
2037 C CB  . ASP A 265 ? 3.1154 2.2605 2.6733 -0.1293 0.3493  0.0073  265 ASP A CB  
2038 C CG  . ASP A 265 ? 3.1133 2.2559 2.6827 -0.1446 0.3717  -0.0105 265 ASP A CG  
2039 O OD1 . ASP A 265 ? 3.1210 2.2685 2.6889 -0.1488 0.3688  -0.0118 265 ASP A OD1 
2040 O OD2 . ASP A 265 ? 3.0839 2.2207 2.6653 -0.1526 0.3925  -0.0238 265 ASP A OD2 
2041 N N   . ARG A 266 ? 3.0049 2.1464 2.5576 -0.1155 0.3349  0.0290  266 ARG A N   
2042 C CA  . ARG A 266 ? 2.8681 1.9949 2.4270 -0.1076 0.3450  0.0364  266 ARG A CA  
2043 C C   . ARG A 266 ? 2.7963 1.9216 2.3524 -0.0859 0.3324  0.0544  266 ARG A C   
2044 O O   . ARG A 266 ? 2.7842 1.9250 2.3317 -0.0811 0.3103  0.0599  266 ARG A O   
2045 C CB  . ARG A 266 ? 2.7974 1.9300 2.3522 -0.1199 0.3427  0.0271  266 ARG A CB  
2046 N N   . VAL A 267 ? 2.7198 1.8283 2.2839 -0.0719 0.3474  0.0627  267 VAL A N   
2047 C CA  . VAL A 267 ? 2.6082 1.7179 2.1730 -0.0481 0.3386  0.0780  267 VAL A CA  
2048 C C   . VAL A 267 ? 2.4913 1.5907 2.0555 -0.0390 0.3460  0.0801  267 VAL A C   
2049 O O   . VAL A 267 ? 2.5278 1.6090 2.0969 -0.0350 0.3673  0.0798  267 VAL A O   
2050 C CB  . VAL A 267 ? 2.6088 1.7111 2.1829 -0.0319 0.3485  0.0880  267 VAL A CB  
2051 C CG1 . VAL A 267 ? 2.5780 1.6859 2.1555 -0.0049 0.3404  0.1026  267 VAL A CG1 
2052 C CG2 . VAL A 267 ? 2.6102 1.7230 2.1834 -0.0399 0.3389  0.0857  267 VAL A CG2 
2053 N N   . PHE A 268 ? 2.3737 1.4843 1.9313 -0.0353 0.3290  0.0814  268 PHE A N   
2054 C CA  . PHE A 268 ? 2.2682 1.3708 1.8235 -0.0259 0.3336  0.0814  268 PHE A CA  
2055 C C   . PHE A 268 ? 2.1580 1.2637 1.7188 0.0027  0.3326  0.0929  268 PHE A C   
2056 O O   . PHE A 268 ? 2.0501 1.1709 1.6165 0.0138  0.3201  0.1014  268 PHE A O   
2057 C CB  . PHE A 268 ? 2.2270 1.3395 1.7733 -0.0359 0.3180  0.0752  268 PHE A CB  
2058 C CG  . PHE A 268 ? 2.2522 1.3637 1.7940 -0.0612 0.3203  0.0631  268 PHE A CG  
2059 C CD1 . PHE A 268 ? 2.2459 1.3692 1.7862 -0.0746 0.3134  0.0591  268 PHE A CD1 
2060 C CD2 . PHE A 268 ? 2.3299 1.4307 1.8691 -0.0708 0.3292  0.0548  268 PHE A CD2 
2061 C CE1 . PHE A 268 ? 2.2841 1.4107 1.8219 -0.0954 0.3164  0.0465  268 PHE A CE1 
2062 C CE2 . PHE A 268 ? 2.3525 1.4565 1.8907 -0.0926 0.3311  0.0434  268 PHE A CE2 
2063 C CZ  . PHE A 268 ? 2.3159 1.4339 1.8542 -0.1041 0.3253  0.0390  268 PHE A CZ  
2064 N N   . THR A 269 ? 2.1790 1.2723 1.7386 0.0154  0.3454  0.0924  269 THR A N   
2065 C CA  . THR A 269 ? 2.2317 1.3296 1.7972 0.0455  0.3476  0.1013  269 THR A CA  
2066 C C   . THR A 269 ? 2.1984 1.2844 1.7577 0.0575  0.3599  0.0964  269 THR A C   
2067 O O   . THR A 269 ? 2.2508 1.3188 1.8024 0.0431  0.3722  0.0883  269 THR A O   
2068 C CB  . THR A 269 ? 2.3821 1.4741 1.9565 0.0581  0.3607  0.1109  269 THR A CB  
2069 O OG1 . THR A 269 ? 2.4630 1.5584 2.0426 0.0897  0.3670  0.1184  269 THR A OG1 
2070 C CG2 . THR A 269 ? 2.4118 1.4794 1.9841 0.0433  0.3840  0.1058  269 THR A CG2 
2071 N N   . ASP A 270 ? 2.1360 1.2340 1.6994 0.0846  0.3563  0.1002  270 ASP A N   
2072 C CA  . ASP A 270 ? 2.1295 1.2192 1.6855 0.1001  0.3671  0.0938  270 ASP A CA  
2073 C C   . ASP A 270 ? 2.1873 1.2649 1.7442 0.1233  0.3891  0.0996  270 ASP A C   
2074 O O   . ASP A 270 ? 2.2166 1.2731 1.7625 0.1215  0.4065  0.0940  270 ASP A O   
2075 C CB  . ASP A 270 ? 2.1211 1.2333 1.6813 0.1177  0.3523  0.0906  270 ASP A CB  
2076 C CG  . ASP A 270 ? 2.1869 1.2976 1.7373 0.0993  0.3424  0.0784  270 ASP A CG  
2077 O OD1 . ASP A 270 ? 2.2230 1.3525 1.7793 0.0956  0.3244  0.0781  270 ASP A OD1 
2078 O OD2 . ASP A 270 ? 2.1469 1.2379 1.6842 0.0886  0.3528  0.0692  270 ASP A OD2 
2079 N N   . LYS A 271 ? 2.2368 1.3281 1.8063 0.1458  0.3883  0.1110  271 LYS A N   
2080 C CA  . LYS A 271 ? 2.2590 1.3409 1.8298 0.1723  0.4097  0.1179  271 LYS A CA  
2081 C C   . LYS A 271 ? 2.2765 1.3276 1.8398 0.1570  0.4327  0.1178  271 LYS A C   
2082 O O   . LYS A 271 ? 2.2381 1.2798 1.8001 0.1265  0.4305  0.1139  271 LYS A O   
2083 C CB  . LYS A 271 ? 2.2364 1.3388 1.8245 0.1954  0.4039  0.1314  271 LYS A CB  
2084 C CG  . LYS A 271 ? 2.2045 1.3127 1.8009 0.1747  0.3903  0.1377  271 LYS A CG  
2085 C CD  . LYS A 271 ? 2.1441 1.2759 1.7580 0.1992  0.3813  0.1505  271 LYS A CD  
2086 C CE  . LYS A 271 ? 2.1674 1.2919 1.7848 0.2313  0.4039  0.1586  271 LYS A CE  
2087 N NZ  . LYS A 271 ? 2.1470 1.2976 1.7834 0.2578  0.3947  0.1713  271 LYS A NZ  
2088 N N   . THR A 272 ? 2.3192 1.3563 1.8783 0.1796  0.4557  0.1214  272 THR A N   
2089 C CA  . THR A 272 ? 2.3773 1.3844 1.9292 0.1676  0.4806  0.1203  272 THR A CA  
2090 C C   . THR A 272 ? 2.5107 1.5085 2.0742 0.1660  0.4936  0.1310  272 THR A C   
2091 O O   . THR A 272 ? 2.5354 1.5091 2.0964 0.1646  0.5192  0.1323  272 THR A O   
2092 C CB  . THR A 272 ? 2.3142 1.3076 1.8528 0.1926  0.5018  0.1181  272 THR A CB  
2093 O OG1 . THR A 272 ? 2.3427 1.3069 1.8744 0.1776  0.5254  0.1160  272 THR A OG1 
2094 C CG2 . THR A 272 ? 2.2489 1.2524 1.7942 0.2328  0.5111  0.1299  272 THR A CG2 
2095 N N   . SER A 273 ? 2.5860 1.6027 2.1622 0.1657  0.4764  0.1379  273 SER A N   
2096 C CA  . SER A 273 ? 2.6404 1.6496 2.2275 0.1643  0.4868  0.1468  273 SER A CA  
2097 C C   . SER A 273 ? 2.6546 1.6846 2.2516 0.1513  0.4619  0.1492  273 SER A C   
2098 O O   . SER A 273 ? 2.5531 1.6080 2.1521 0.1559  0.4372  0.1493  273 SER A O   
2099 C CB  . SER A 273 ? 2.6447 1.6515 2.2363 0.2020  0.5043  0.1596  273 SER A CB  
2100 O OG  . SER A 273 ? 2.6673 1.6640 2.2691 0.2004  0.5162  0.1678  273 SER A OG  
2101 N N   . ALA A 274 ? 2.7933 1.8129 2.3963 0.1352  0.4694  0.1501  274 ALA A N   
2102 C CA  . ALA A 274 ? 2.8811 1.9183 2.4908 0.1220  0.4474  0.1512  274 ALA A CA  
2103 C C   . ALA A 274 ? 2.9599 1.9826 2.5770 0.1143  0.4629  0.1532  274 ALA A C   
2104 O O   . ALA A 274 ? 3.0167 2.0150 2.6352 0.1187  0.4921  0.1541  274 ALA A O   
2105 C CB  . ALA A 274 ? 2.8683 1.9145 2.4711 0.0918  0.4283  0.1386  274 ALA A CB  
2106 N N   . THR A 275 ? 2.9316 1.9689 2.5527 0.1028  0.4439  0.1530  275 THR A N   
2107 C CA  . THR A 275 ? 2.9225 1.9481 2.5502 0.0943  0.4562  0.1524  275 THR A CA  
2108 C C   . THR A 275 ? 2.9174 1.9546 2.5418 0.0647  0.4373  0.1406  275 THR A C   
2109 O O   . THR A 275 ? 2.8558 1.9165 2.4755 0.0609  0.4083  0.1405  275 THR A O   
2110 C CB  . THR A 275 ? 2.8873 1.9194 2.5245 0.1227  0.4549  0.1683  275 THR A CB  
2111 O OG1 . THR A 275 ? 2.9064 1.9287 2.5458 0.1530  0.4748  0.1786  275 THR A OG1 
2112 C CG2 . THR A 275 ? 2.8955 1.9130 2.5387 0.1130  0.4688  0.1664  275 THR A CG2 
2113 N N   . VAL A 276 ? 2.9887 2.0101 2.6157 0.0449  0.4549  0.1297  276 VAL A N   
2114 C CA  . VAL A 276 ? 3.0338 2.0662 2.6564 0.0171  0.4407  0.1150  276 VAL A CA  
2115 C C   . VAL A 276 ? 3.1485 2.1742 2.7769 0.0113  0.4492  0.1108  276 VAL A C   
2116 O O   . VAL A 276 ? 3.1492 2.1662 2.7848 0.0312  0.4587  0.1230  276 VAL A O   
2117 C CB  . VAL A 276 ? 2.9769 2.0028 2.5970 -0.0082 0.4518  0.0976  276 VAL A CB  
2118 C CG1 . VAL A 276 ? 2.9669 2.0039 2.5785 -0.0077 0.4360  0.0987  276 VAL A CG1 
2119 C CG2 . VAL A 276 ? 2.9802 1.9790 2.6102 -0.0084 0.4888  0.0943  276 VAL A CG2 
2120 N N   . ILE A 277 ? 3.2290 2.2595 2.8539 -0.0152 0.4462  0.0925  277 ILE A N   
2121 C CA  . ILE A 277 ? 3.2836 2.3092 2.9122 -0.0241 0.4534  0.0836  277 ILE A CA  
2122 C C   . ILE A 277 ? 3.2944 2.3026 2.9321 -0.0437 0.4853  0.0642  277 ILE A C   
2123 O O   . ILE A 277 ? 3.2534 2.2664 2.8902 -0.0610 0.4881  0.0507  277 ILE A O   
2124 C CB  . ILE A 277 ? 3.2988 2.3493 2.9151 -0.0372 0.4213  0.0757  277 ILE A CB  
2125 C CG1 . ILE A 277 ? 3.3416 2.3876 2.9601 -0.0406 0.4251  0.0696  277 ILE A CG1 
2126 C CG2 . ILE A 277 ? 3.2709 2.3330 2.8790 -0.0621 0.4157  0.0560  277 ILE A CG2 
2127 C CD1 . ILE A 277 ? 3.3352 2.3733 2.9617 -0.0146 0.4270  0.0902  277 ILE A CD1 
2128 N N   . CYS A 278 ? 3.3319 2.3210 2.9803 -0.0403 0.5100  0.0626  278 CYS A N   
2129 C CA  . CYS A 278 ? 3.3386 2.3096 3.0006 -0.0557 0.5453  0.0451  278 CYS A CA  
2130 C C   . CYS A 278 ? 3.3457 2.3305 3.0074 -0.0832 0.5425  0.0177  278 CYS A C   
2131 O O   . CYS A 278 ? 3.3749 2.3804 3.0231 -0.0894 0.5137  0.0129  278 CYS A O   
2132 C CB  . CYS A 278 ? 3.3190 2.2631 2.9935 -0.0409 0.5757  0.0529  278 CYS A CB  
2133 S SG  . CYS A 278 ? 2.9621 1.8789 2.6570 -0.0517 0.6256  0.0389  278 CYS A SG  
2134 N N   . ARG A 279 ? 3.2843 2.2591 2.9615 -0.0988 0.5732  -0.0012 279 ARG A N   
2135 C CA  . ARG A 279 ? 3.1843 2.1739 2.8650 -0.1233 0.5758  -0.0307 279 ARG A CA  
2136 C C   . ARG A 279 ? 3.2035 2.1743 2.9036 -0.1296 0.6123  -0.0464 279 ARG A C   
2137 O O   . ARG A 279 ? 3.2113 2.1556 2.9239 -0.1169 0.6399  -0.0346 279 ARG A O   
2138 C CB  . ARG A 279 ? 3.0703 2.0761 2.7548 -0.1399 0.5753  -0.0449 279 ARG A CB  
2139 C CG  . ARG A 279 ? 3.0009 1.9894 2.7042 -0.1400 0.6063  -0.0435 279 ARG A CG  
2140 C CD  . ARG A 279 ? 2.9745 1.9581 2.7026 -0.1567 0.6417  -0.0691 279 ARG A CD  
2141 N NE  . ARG A 279 ? 2.9656 1.9209 2.7054 -0.1466 0.6708  -0.0641 279 ARG A NE  
2142 C CZ  . ARG A 279 ? 2.9614 1.9053 2.7258 -0.1568 0.7081  -0.0825 279 ARG A CZ  
2143 N NH1 . ARG A 279 ? 2.9614 1.8775 2.7347 -0.1456 0.7344  -0.0758 279 ARG A NH1 
2144 N NH2 . ARG A 279 ? 2.9572 1.9186 2.7391 -0.1775 0.7199  -0.1081 279 ARG A NH2 
2145 N N   . SER A 283 ? 2.4026 1.4043 2.1551 -0.1794 0.6517  -0.0683 283 SER A N   
2146 C CA  . SER A 283 ? 2.3587 1.3508 2.1034 -0.1714 0.6470  -0.0519 283 SER A CA  
2147 C C   . SER A 283 ? 2.3324 1.3245 2.0483 -0.1539 0.6148  -0.0304 283 SER A C   
2148 O O   . SER A 283 ? 2.2369 1.2473 1.9392 -0.1554 0.5883  -0.0321 283 SER A O   
2149 C CB  . SER A 283 ? 2.2643 1.2780 2.0202 -0.1901 0.6435  -0.0674 283 SER A CB  
2150 O OG  . SER A 283 ? 2.1878 1.2036 1.9748 -0.2050 0.6750  -0.0869 283 SER A OG  
2151 N N   . ILE A 284 ? 2.3883 1.3605 2.0954 -0.1367 0.6183  -0.0111 284 ILE A N   
2152 C CA  . ILE A 284 ? 2.4038 1.3780 2.0872 -0.1195 0.5903  0.0074  284 ILE A CA  
2153 C C   . ILE A 284 ? 2.4616 1.4340 2.1397 -0.1202 0.5868  0.0104  284 ILE A C   
2154 O O   . ILE A 284 ? 2.5530 1.5158 2.2444 -0.1285 0.6095  0.0037  284 ILE A O   
2155 C CB  . ILE A 284 ? 2.3255 1.2797 2.0016 -0.0927 0.5965  0.0278  284 ILE A CB  
2156 C CG1 . ILE A 284 ? 2.2966 1.2510 1.9784 -0.0924 0.6002  0.0247  284 ILE A CG1 
2157 C CG2 . ILE A 284 ? 2.2658 1.2268 1.9215 -0.0742 0.5681  0.0445  284 ILE A CG2 
2158 C CD1 . ILE A 284 ? 2.2992 1.2386 2.0026 -0.1021 0.6363  0.0120  284 ILE A CD1 
2159 N N   . SER A 285 ? 2.3596 1.3415 2.0188 -0.1121 0.5589  0.0195  285 SER A N   
2160 C CA  . SER A 285 ? 2.2180 1.1986 1.8700 -0.1134 0.5535  0.0207  285 SER A CA  
2161 C C   . SER A 285 ? 2.2240 1.2118 1.8549 -0.0992 0.5249  0.0323  285 SER A C   
2162 O O   . SER A 285 ? 2.2265 1.2273 1.8500 -0.0937 0.5048  0.0368  285 SER A O   
2163 C CB  . SER A 285 ? 2.0835 1.0810 1.7476 -0.1396 0.5528  0.0017  285 SER A CB  
2164 O OG  . SER A 285 ? 1.9489 0.9693 1.6165 -0.1524 0.5397  -0.0100 285 SER A OG  
2165 N N   . VAL A 286 ? 2.1995 1.1796 1.8213 -0.0933 0.5238  0.0360  286 VAL A N   
2166 C CA  . VAL A 286 ? 2.0866 1.0729 1.6902 -0.0793 0.5000  0.0446  286 VAL A CA  
2167 C C   . VAL A 286 ? 2.1871 1.1729 1.7833 -0.0876 0.4946  0.0383  286 VAL A C   
2168 O O   . VAL A 286 ? 2.2639 1.2346 1.8627 -0.0892 0.5130  0.0359  286 VAL A O   
2169 C CB  . VAL A 286 ? 1.8711 0.8446 1.4672 -0.0492 0.5055  0.0606  286 VAL A CB  
2170 C CG1 . VAL A 286 ? 1.8680 0.8172 1.4684 -0.0412 0.5364  0.0632  286 VAL A CG1 
2171 C CG2 . VAL A 286 ? 1.8256 0.8057 1.4058 -0.0343 0.4854  0.0661  286 VAL A CG2 
2172 N N   . ARG A 287 ? 2.1231 1.1254 1.7101 -0.0931 0.4695  0.0355  287 ARG A N   
2173 C CA  . ARG A 287 ? 2.0408 1.0433 1.6192 -0.1002 0.4613  0.0295  287 ARG A CA  
2174 C C   . ARG A 287 ? 2.0293 1.0258 1.5906 -0.0778 0.4516  0.0381  287 ARG A C   
2175 O O   . ARG A 287 ? 2.1727 1.1692 1.7311 -0.0570 0.4494  0.0487  287 ARG A O   
2176 C CB  . ARG A 287 ? 2.0147 1.0385 1.5934 -0.1191 0.4415  0.0201  287 ARG A CB  
2177 C CG  . ARG A 287 ? 2.0497 1.0849 1.6460 -0.1416 0.4501  0.0073  287 ARG A CG  
2178 C CD  . ARG A 287 ? 2.0785 1.1364 1.6727 -0.1565 0.4302  -0.0017 287 ARG A CD  
2179 N NE  . ARG A 287 ? 2.0667 1.1365 1.6498 -0.1485 0.4107  0.0044  287 ARG A NE  
2180 C CZ  . ARG A 287 ? 2.0295 1.1190 1.6082 -0.1577 0.3936  -0.0015 287 ARG A CZ  
2181 N NH1 . ARG A 287 ? 2.1424 1.2435 1.7279 -0.1745 0.3935  -0.0137 287 ARG A NH1 
2182 N NH2 . ARG A 287 ? 1.8398 0.9388 1.4077 -0.1496 0.3769  0.0049  287 ARG A NH2 
2183 N N   . ALA A 288 ? 1.8732 0.8667 1.4244 -0.0816 0.4455  0.0323  288 ALA A N   
2184 C CA  . ALA A 288 ? 1.8240 0.8143 1.3591 -0.0614 0.4360  0.0363  288 ALA A CA  
2185 C C   . ALA A 288 ? 1.8097 0.8071 1.3352 -0.0727 0.4181  0.0274  288 ALA A C   
2186 O O   . ALA A 288 ? 1.8793 0.8754 1.4070 -0.0926 0.4196  0.0181  288 ALA A O   
2187 C CB  . ALA A 288 ? 1.8010 0.7713 1.3291 -0.0443 0.4554  0.0391  288 ALA A CB  
2188 N N   . GLN A 289 ? 1.7467 0.7525 1.2633 -0.0593 0.4019  0.0299  289 GLN A N   
2189 C CA  . GLN A 289 ? 1.7142 0.7264 1.2219 -0.0683 0.3852  0.0218  289 GLN A CA  
2190 C C   . GLN A 289 ? 1.6404 0.6502 1.1355 -0.0465 0.3796  0.0213  289 GLN A C   
2191 O O   . GLN A 289 ? 1.5852 0.5986 1.0819 -0.0238 0.3812  0.0290  289 GLN A O   
2192 C CB  . GLN A 289 ? 1.7238 0.7550 1.2368 -0.0799 0.3686  0.0226  289 GLN A CB  
2193 C CG  . GLN A 289 ? 1.6963 0.7355 1.2000 -0.0803 0.3507  0.0184  289 GLN A CG  
2194 C CD  . GLN A 289 ? 1.7418 0.7994 1.2492 -0.0878 0.3360  0.0211  289 GLN A CD  
2195 O OE1 . GLN A 289 ? 1.6998 0.7650 1.2127 -0.1059 0.3355  0.0175  289 GLN A OE1 
2196 N NE2 . GLN A 289 ? 1.7863 0.8532 1.2913 -0.0731 0.3245  0.0267  289 GLN A NE2 
2197 N N   . ASP A 290 ? 1.6072 0.6124 1.0911 -0.0527 0.3733  0.0111  290 ASP A N   
2198 C CA  . ASP A 290 ? 1.5805 0.5851 1.0531 -0.0328 0.3684  0.0069  290 ASP A CA  
2199 C C   . ASP A 290 ? 1.7055 0.7284 1.1853 -0.0203 0.3558  0.0136  290 ASP A C   
2200 O O   . ASP A 290 ? 1.7507 0.7850 1.2352 -0.0340 0.3430  0.0148  290 ASP A O   
2201 C CB  . ASP A 290 ? 1.5774 0.5767 1.0379 -0.0454 0.3602  -0.0064 290 ASP A CB  
2202 C CG  . ASP A 290 ? 1.5734 0.5719 1.0222 -0.0249 0.3569  -0.0143 290 ASP A CG  
2203 O OD1 . ASP A 290 ? 1.5209 0.5323 0.9757 -0.0056 0.3528  -0.0095 290 ASP A OD1 
2204 O OD2 . ASP A 290 ? 1.6092 0.5958 1.0438 -0.0281 0.3584  -0.0266 290 ASP A OD2 
2205 N N   . ARG A 291 ? 1.8003 0.8278 1.2816 0.0067  0.3597  0.0179  291 ARG A N   
2206 C CA  . ARG A 291 ? 1.7816 0.8293 1.2732 0.0204  0.3480  0.0248  291 ARG A CA  
2207 C C   . ARG A 291 ? 1.6393 0.6967 1.1287 0.0122  0.3320  0.0178  291 ARG A C   
2208 O O   . ARG A 291 ? 1.6685 0.7401 1.1656 0.0060  0.3199  0.0237  291 ARG A O   
2209 C CB  . ARG A 291 ? 1.8947 0.9490 1.3890 0.0531  0.3544  0.0269  291 ARG A CB  
2210 C CG  . ARG A 291 ? 2.0569 1.1356 1.5663 0.0682  0.3425  0.0350  291 ARG A CG  
2211 C CD  . ARG A 291 ? 2.2028 1.2946 1.7151 0.0977  0.3431  0.0286  291 ARG A CD  
2212 N NE  . ARG A 291 ? 2.1684 1.2874 1.6989 0.1121  0.3308  0.0357  291 ARG A NE  
2213 C CZ  . ARG A 291 ? 2.0739 1.2067 1.6182 0.1321  0.3329  0.0473  291 ARG A CZ  
2214 N NH1 . ARG A 291 ? 1.9977 1.1576 1.5599 0.1435  0.3196  0.0531  291 ARG A NH1 
2215 N NH2 . ARG A 291 ? 2.0473 1.1671 1.5880 0.1410  0.3484  0.0533  291 ARG A NH2 
2216 N N   . TYR A 292 ? 1.5040 0.5528 0.9818 0.0123  0.3326  0.0047  292 TYR A N   
2217 C CA  . TYR A 292 ? 1.5593 0.6159 1.0355 0.0092  0.3202  -0.0030 292 TYR A CA  
2218 C C   . TYR A 292 ? 1.6658 0.7208 1.1394 -0.0182 0.3108  -0.0039 292 TYR A C   
2219 O O   . TYR A 292 ? 1.7572 0.8253 1.2363 -0.0211 0.2997  -0.0004 292 TYR A O   
2220 C CB  . TYR A 292 ? 1.6512 0.7001 1.1161 0.0211  0.3246  -0.0188 292 TYR A CB  
2221 C CG  . TYR A 292 ? 1.7780 0.8362 1.2476 0.0529  0.3322  -0.0197 292 TYR A CG  
2222 C CD1 . TYR A 292 ? 1.8432 0.8890 1.3021 0.0659  0.3464  -0.0247 292 TYR A CD1 
2223 C CD2 . TYR A 292 ? 1.7735 0.8550 1.2593 0.0710  0.3255  -0.0156 292 TYR A CD2 
2224 C CE1 . TYR A 292 ? 1.8749 0.9318 1.3380 0.0978  0.3543  -0.0260 292 TYR A CE1 
2225 C CE2 . TYR A 292 ? 1.7734 0.8681 1.2667 0.1020  0.3323  -0.0171 292 TYR A CE2 
2226 C CZ  . TYR A 292 ? 1.8272 0.9098 1.3086 0.1161  0.3471  -0.0225 292 TYR A CZ  
2227 O OH  . TYR A 292 ? 1.8019 0.8999 1.2905 0.1497  0.3549  -0.0245 292 TYR A OH  
2228 N N   . TYR A 293 ? 1.6271 0.6679 1.0930 -0.0371 0.3155  -0.0086 293 TYR A N   
2229 C CA  . TYR A 293 ? 1.5422 0.5840 1.0064 -0.0611 0.3073  -0.0111 293 TYR A CA  
2230 C C   . TYR A 293 ? 1.6157 0.6621 1.0882 -0.0767 0.3095  -0.0034 293 TYR A C   
2231 O O   . TYR A 293 ? 1.6907 0.7319 1.1677 -0.0741 0.3205  0.0008  293 TYR A O   
2232 C CB  . TYR A 293 ? 1.4033 0.4303 0.8554 -0.0725 0.3086  -0.0243 293 TYR A CB  
2233 C CG  . TYR A 293 ? 1.4535 0.4743 0.8957 -0.0570 0.3087  -0.0355 293 TYR A CG  
2234 C CD1 . TYR A 293 ? 1.5363 0.5646 0.9789 -0.0520 0.3001  -0.0396 293 TYR A CD1 
2235 C CD2 . TYR A 293 ? 1.5606 0.5686 0.9931 -0.0467 0.3187  -0.0433 293 TYR A CD2 
2236 C CE1 . TYR A 293 ? 1.6521 0.6761 1.0877 -0.0376 0.3018  -0.0526 293 TYR A CE1 
2237 C CE2 . TYR A 293 ? 1.5953 0.5992 1.0178 -0.0315 0.3195  -0.0565 293 TYR A CE2 
2238 C CZ  . TYR A 293 ? 1.6560 0.6686 1.0813 -0.0271 0.3112  -0.0619 293 TYR A CZ  
2239 O OH  . TYR A 293 ? 1.7000 0.7101 1.1173 -0.0117 0.3136  -0.0778 293 TYR A OH  
2240 N N   . SER A 294 ? 1.6872 0.7439 1.1618 -0.0918 0.3003  -0.0025 294 SER A N   
2241 C CA  . SER A 294 ? 1.7170 0.7814 1.1998 -0.1063 0.3025  0.0013  294 SER A CA  
2242 C C   . SER A 294 ? 1.7974 0.8541 1.2813 -0.1238 0.3099  -0.0068 294 SER A C   
2243 O O   . SER A 294 ? 1.7078 0.7738 1.1953 -0.1405 0.3059  -0.0107 294 SER A O   
2244 C CB  . SER A 294 ? 1.7087 0.7894 1.1918 -0.1141 0.2906  0.0036  294 SER A CB  
2245 O OG  . SER A 294 ? 1.7997 0.8871 1.2808 -0.0991 0.2821  0.0091  294 SER A OG  
2246 N N   . SER A 295 ? 1.8268 0.8682 1.3082 -0.1189 0.3207  -0.0096 295 SER A N   
2247 C CA  . SER A 295 ? 1.7136 0.7475 1.1970 -0.1347 0.3282  -0.0172 295 SER A CA  
2248 C C   . SER A 295 ? 1.6179 0.6607 1.1172 -0.1469 0.3367  -0.0149 295 SER A C   
2249 O O   . SER A 295 ? 1.7340 0.7907 1.2399 -0.1477 0.3328  -0.0101 295 SER A O   
2250 C CB  . SER A 295 ? 1.6942 0.7092 1.1689 -0.1242 0.3390  -0.0203 295 SER A CB  
2251 O OG  . SER A 295 ? 1.5836 0.5915 1.0434 -0.1138 0.3320  -0.0264 295 SER A OG  
2252 N N   . SER A 296 ? 1.5455 0.5808 1.0511 -0.1564 0.3487  -0.0196 296 SER A N   
2253 C CA  . SER A 296 ? 1.6884 0.7331 1.2124 -0.1687 0.3592  -0.0203 296 SER A CA  
2254 C C   . SER A 296 ? 1.7769 0.8126 1.3060 -0.1561 0.3746  -0.0123 296 SER A C   
2255 O O   . SER A 296 ? 1.8015 0.8200 1.3221 -0.1420 0.3833  -0.0088 296 SER A O   
2256 C CB  . SER A 296 ? 1.6436 0.6881 1.1766 -0.1868 0.3654  -0.0302 296 SER A CB  
2257 O OG  . SER A 296 ? 1.5937 0.6397 1.1174 -0.1940 0.3516  -0.0369 296 SER A OG  
2258 N N   . TRP A 297 ? 1.7279 0.7758 1.2700 -0.1600 0.3785  -0.0100 297 TRP A N   
2259 C CA  . TRP A 297 ? 1.7437 0.7830 1.2929 -0.1501 0.3946  -0.0033 297 TRP A CA  
2260 C C   . TRP A 297 ? 1.8319 0.8593 1.3914 -0.1577 0.4150  -0.0079 297 TRP A C   
2261 O O   . TRP A 297 ? 1.9110 0.9453 1.4799 -0.1759 0.4163  -0.0179 297 TRP A O   
2262 C CB  . TRP A 297 ? 1.7930 0.8486 1.3536 -0.1552 0.3940  -0.0028 297 TRP A CB  
2263 C CG  . TRP A 297 ? 1.9033 0.9684 1.4540 -0.1442 0.3771  0.0046  297 TRP A CG  
2264 C CD1 . TRP A 297 ? 1.9585 1.0417 1.5055 -0.1516 0.3608  0.0014  297 TRP A CD1 
2265 C CD2 . TRP A 297 ? 1.8970 0.9559 1.4413 -0.1232 0.3753  0.0164  297 TRP A CD2 
2266 N NE1 . TRP A 297 ? 1.9576 1.0452 1.4960 -0.1377 0.3488  0.0106  297 TRP A NE1 
2267 C CE2 . TRP A 297 ? 1.9158 0.9901 1.4540 -0.1204 0.3566  0.0197  297 TRP A CE2 
2268 C CE3 . TRP A 297 ? 1.8683 0.9117 1.4123 -0.1054 0.3878  0.0245  297 TRP A CE3 
2269 C CZ2 . TRP A 297 ? 1.8523 0.9287 1.3864 -0.1016 0.3491  0.0304  297 TRP A CZ2 
2270 C CZ3 . TRP A 297 ? 1.8550 0.9013 1.3950 -0.0853 0.3805  0.0352  297 TRP A CZ3 
2271 C CH2 . TRP A 297 ? 1.8111 0.8745 1.3474 -0.0843 0.3607  0.0379  297 TRP A CH2 
2272 N N   . SER A 298 ? 1.8153 0.8260 1.3741 -0.1430 0.4313  -0.0005 298 SER A N   
2273 C CA  . SER A 298 ? 1.8294 0.8269 1.3980 -0.1483 0.4537  -0.0036 298 SER A CA  
2274 C C   . SER A 298 ? 1.8713 0.8794 1.4639 -0.1627 0.4669  -0.0087 298 SER A C   
2275 O O   . SER A 298 ? 1.8944 0.9176 1.4925 -0.1650 0.4593  -0.0088 298 SER A O   
2276 C CB  . SER A 298 ? 1.8254 0.8010 1.3838 -0.1247 0.4687  0.0065  298 SER A CB  
2277 O OG  . SER A 298 ? 1.7927 0.7671 1.3613 -0.1161 0.4806  0.0140  298 SER A OG  
2278 N N   . GLU A 299 ? 1.8607 0.8615 1.4677 -0.1722 0.4873  -0.0142 299 GLU A N   
2279 C CA  . GLU A 299 ? 1.9948 1.0043 1.6274 -0.1843 0.5047  -0.0209 299 GLU A CA  
2280 C C   . GLU A 299 ? 2.1434 1.1418 1.7753 -0.1677 0.5163  -0.0108 299 GLU A C   
2281 O O   . GLU A 299 ? 2.1359 1.1205 1.7493 -0.1464 0.5121  0.0017  299 GLU A O   
2282 C CB  . GLU A 299 ? 2.0201 1.0229 1.6697 -0.1965 0.5260  -0.0284 299 GLU A CB  
2283 C CG  . GLU A 299 ? 2.0533 1.0675 1.7044 -0.2127 0.5137  -0.0380 299 GLU A CG  
2284 C CD  . GLU A 299 ? 2.0971 1.1433 1.7637 -0.2301 0.4992  -0.0498 299 GLU A CD  
2285 O OE1 . GLU A 299 ? 2.1899 1.2511 1.8785 -0.2377 0.5099  -0.0572 299 GLU A OE1 
2286 O OE2 . GLU A 299 ? 1.9726 1.0292 1.6292 -0.2354 0.4780  -0.0526 299 GLU A OE2 
2287 N N   . TRP A 300 ? 2.2057 1.2116 1.8588 -0.1767 0.5310  -0.0173 300 TRP A N   
2288 C CA  . TRP A 300 ? 2.2094 1.2062 1.8629 -0.1628 0.5410  -0.0090 300 TRP A CA  
2289 C C   . TRP A 300 ? 2.2335 1.2045 1.8927 -0.1522 0.5707  -0.0027 300 TRP A C   
2290 O O   . TRP A 300 ? 2.1212 1.0850 1.7912 -0.1612 0.5879  -0.0086 300 TRP A O   
2291 C CB  . TRP A 300 ? 2.2369 1.2541 1.9078 -0.1766 0.5418  -0.0207 300 TRP A CB  
2292 C CG  . TRP A 300 ? 2.2418 1.2822 1.9022 -0.1807 0.5132  -0.0236 300 TRP A CG  
2293 C CD1 . TRP A 300 ? 2.1982 1.2629 1.8648 -0.1977 0.5009  -0.0368 300 TRP A CD1 
2294 C CD2 . TRP A 300 ? 2.2238 1.2662 1.8662 -0.1664 0.4943  -0.0127 300 TRP A CD2 
2295 N NE1 . TRP A 300 ? 2.1203 1.1999 1.7717 -0.1945 0.4766  -0.0345 300 TRP A NE1 
2296 C CE2 . TRP A 300 ? 2.1822 1.2486 1.8191 -0.1762 0.4718  -0.0200 300 TRP A CE2 
2297 C CE3 . TRP A 300 ? 2.2366 1.2645 1.8682 -0.1455 0.4942  0.0024  300 TRP A CE3 
2298 C CZ2 . TRP A 300 ? 2.2300 1.3048 1.8504 -0.1669 0.4499  -0.0125 300 TRP A CZ2 
2299 C CZ3 . TRP A 300 ? 2.2328 1.2716 1.8505 -0.1367 0.4710  0.0095  300 TRP A CZ3 
2300 C CH2 . TRP A 300 ? 2.2366 1.2979 1.8485 -0.1480 0.4494  0.0020  300 TRP A CH2 
2301 N N   . ALA A 301 ? 2.3808 1.3388 2.0329 -0.1321 0.5768  0.0097  301 ALA A N   
2302 C CA  . ALA A 301 ? 2.4666 1.3996 2.1236 -0.1188 0.6067  0.0172  301 ALA A CA  
2303 C C   . ALA A 301 ? 2.5346 1.4666 2.2045 -0.1161 0.6190  0.0179  301 ALA A C   
2304 O O   . ALA A 301 ? 2.5460 1.4794 2.2050 -0.1006 0.6062  0.0281  301 ALA A O   
2305 C CB  . ALA A 301 ? 2.4657 1.3812 2.0993 -0.0912 0.6046  0.0331  301 ALA A CB  
2306 N N   . SER A 302 ? 2.6038 1.5341 2.2979 -0.1313 0.6439  0.0062  302 SER A N   
2307 C CA  . SER A 302 ? 2.6547 1.5863 2.3633 -0.1334 0.6559  0.0016  302 SER A CA  
2308 C C   . SER A 302 ? 2.7414 1.6454 2.4493 -0.1117 0.6810  0.0154  302 SER A C   
2309 O O   . SER A 302 ? 2.7517 1.6350 2.4491 -0.0944 0.6929  0.0280  302 SER A O   
2310 C CB  . SER A 302 ? 2.6044 1.5503 2.3424 -0.1594 0.6724  -0.0206 302 SER A CB  
2311 O OG  . SER A 302 ? 2.5522 1.5278 2.2916 -0.1771 0.6481  -0.0337 302 SER A OG  
2312 N N   . VAL A 303 ? 2.7750 1.6793 2.4932 -0.1122 0.6892  0.0120  303 VAL A N   
2313 C CA  . VAL A 303 ? 2.7883 1.6680 2.5076 -0.0919 0.7126  0.0245  303 VAL A CA  
2314 C C   . VAL A 303 ? 2.8037 1.6890 2.5382 -0.1016 0.7199  0.0132  303 VAL A C   
2315 O O   . VAL A 303 ? 2.7446 1.6543 2.4787 -0.1158 0.6971  0.0016  303 VAL A O   
2316 C CB  . VAL A 303 ? 2.7897 1.6635 2.4845 -0.0625 0.6945  0.0465  303 VAL A CB  
2317 C CG1 . VAL A 303 ? 2.7840 1.6710 2.4749 -0.0584 0.6740  0.0492  303 VAL A CG1 
2318 C CG2 . VAL A 303 ? 2.7961 1.6404 2.4880 -0.0372 0.7235  0.0619  303 VAL A CG2 
2319 N N   . PRO A 304 ? 2.8811 1.7434 2.6283 -0.0934 0.7529  0.0156  304 PRO A N   
2320 C CA  . PRO A 304 ? 2.9271 1.7912 2.6892 -0.1019 0.7639  0.0034  304 PRO A CA  
2321 C C   . PRO A 304 ? 3.0081 1.8840 2.7535 -0.0925 0.7338  0.0108  304 PRO A C   
2322 O O   . PRO A 304 ? 2.9915 1.8665 2.7168 -0.0718 0.7132  0.0306  304 PRO A O   
2323 C CB  . PRO A 304 ? 2.9421 1.7730 2.7152 -0.0871 0.8047  0.0118  304 PRO A CB  
2324 C CG  . PRO A 304 ? 2.9324 1.7465 2.6868 -0.0625 0.8049  0.0346  304 PRO A CG  
2325 C CD  . PRO A 304 ? 2.9140 1.7463 2.6629 -0.0767 0.7849  0.0280  304 PRO A CD  
2326 N N   . CYS A 305 ? 3.0994 1.9878 2.8540 -0.1074 0.7319  -0.0064 305 CYS A N   
2327 C CA  . CYS A 305 ? 3.1353 2.0360 2.8746 -0.1012 0.7034  -0.0017 305 CYS A CA  
2328 C C   . CYS A 305 ? 3.1183 1.9962 2.8560 -0.0789 0.7168  0.0143  305 CYS A C   
2329 O O   . CYS A 305 ? 3.1066 1.9584 2.8569 -0.0705 0.7522  0.0183  305 CYS A O   
2330 C CB  . CYS A 305 ? 3.1736 2.0972 2.9204 -0.1253 0.6959  -0.0283 305 CYS A CB  
2331 S SG  . CYS A 305 ? 3.2933 2.2503 3.0399 -0.1484 0.6746  -0.0466 305 CYS A SG  
2332 N N   . MET B 12  ? 2.5828 1.4863 1.4405 0.3259  0.4765  0.0875  12  MET B N   
2333 C CA  . MET B 12  ? 2.6581 1.5177 1.4188 0.3654  0.4716  0.0920  12  MET B CA  
2334 C C   . MET B 12  ? 2.6414 1.5137 1.3743 0.3640  0.4118  0.0793  12  MET B C   
2335 O O   . MET B 12  ? 2.7368 1.5788 1.3937 0.3926  0.3976  0.0824  12  MET B O   
2336 C CB  . MET B 12  ? 2.5520 1.3721 1.2716 0.3848  0.5144  0.1130  12  MET B CB  
2337 N N   . PHE B 13  ? 2.4154 1.3328 1.2107 0.3303  0.3765  0.0656  13  PHE B N   
2338 C CA  . PHE B 13  ? 2.4182 1.3546 1.2014 0.3231  0.3215  0.0539  13  PHE B CA  
2339 C C   . PHE B 13  ? 2.6111 1.5776 1.4317 0.3016  0.2844  0.0356  13  PHE B C   
2340 O O   . PHE B 13  ? 2.6515 1.6455 1.5394 0.2750  0.2920  0.0319  13  PHE B O   
2341 C CB  . PHE B 13  ? 2.2536 1.2122 1.0723 0.3020  0.3170  0.0585  13  PHE B CB  
2342 C CG  . PHE B 13  ? 2.1993 1.1733 0.9984 0.3020  0.2691  0.0520  13  PHE B CG  
2343 C CD1 . PHE B 13  ? 2.1548 1.1693 1.0082 0.2694  0.2402  0.0424  13  PHE B CD1 
2344 C CD2 . PHE B 13  ? 2.2617 1.2101 0.9889 0.3344  0.2533  0.0561  13  PHE B CD2 
2345 C CE1 . PHE B 13  ? 2.0996 1.1320 0.9419 0.2686  0.1994  0.0377  13  PHE B CE1 
2346 C CE2 . PHE B 13  ? 2.2567 1.2252 0.9748 0.3331  0.2082  0.0509  13  PHE B CE2 
2347 C CZ  . PHE B 13  ? 2.1800 1.1921 0.9587 0.3000  0.1828  0.0420  13  PHE B CZ  
2348 N N   . PRO B 14  ? 2.6926 1.6520 1.4682 0.3129  0.2426  0.0243  14  PRO B N   
2349 C CA  . PRO B 14  ? 2.5496 1.5277 1.3478 0.2966  0.2063  0.0072  14  PRO B CA  
2350 C C   . PRO B 14  ? 2.3911 1.4153 1.2602 0.2568  0.1810  0.0002  14  PRO B C   
2351 O O   . PRO B 14  ? 2.4256 1.4696 1.3445 0.2367  0.1785  -0.0066 14  PRO B O   
2352 C CB  . PRO B 14  ? 2.5914 1.5487 1.3202 0.3154  0.1653  -0.0013 14  PRO B CB  
2353 C CG  . PRO B 14  ? 2.7742 1.6921 1.4337 0.3504  0.1891  0.0119  14  PRO B CG  
2354 C CD  . PRO B 14  ? 2.7879 1.7170 1.4842 0.3429  0.2268  0.0279  14  PRO B CD  
2355 N N   . CYS B 15  ? 2.1894 1.2295 1.0616 0.2471  0.1631  0.0025  15  CYS B N   
2356 C CA  . CYS B 15  ? 2.0487 1.1280 0.9765 0.2115  0.1364  -0.0048 15  CYS B CA  
2357 C C   . CYS B 15  ? 2.0267 1.1256 1.0192 0.1851  0.1625  -0.0018 15  CYS B C   
2358 O O   . CYS B 15  ? 2.0422 1.1649 1.0787 0.1585  0.1439  -0.0109 15  CYS B O   
2359 C CB  . CYS B 15  ? 1.9722 1.0635 0.8886 0.2105  0.1164  -0.0016 15  CYS B CB  
2360 S SG  . CYS B 15  ? 1.9035 0.9916 0.7707 0.2235  0.0641  -0.0113 15  CYS B SG  
2361 N N   . LEU B 16  ? 2.0016 1.0879 0.9978 0.1917  0.2039  0.0110  16  LEU B N   
2362 C CA  . LEU B 16  ? 1.9049 1.0051 0.9603 0.1670  0.2305  0.0138  16  LEU B CA  
2363 C C   . LEU B 16  ? 2.0213 1.1364 1.1143 0.1551  0.2235  0.0055  16  LEU B C   
2364 O O   . LEU B 16  ? 2.0649 1.2063 1.2123 0.1244  0.2135  0.0000  16  LEU B O   
2365 C CB  . LEU B 16  ? 1.8382 0.9126 0.8842 0.1827  0.2815  0.0290  16  LEU B CB  
2366 C CG  . LEU B 16  ? 1.6840 0.7572 0.7476 0.1686  0.3017  0.0370  16  LEU B CG  
2367 C CD1 . LEU B 16  ? 1.7098 0.7646 0.7907 0.1702  0.3524  0.0490  16  LEU B CD1 
2368 C CD2 . LEU B 16  ? 1.6271 0.7322 0.7426 0.1303  0.2775  0.0265  16  LEU B CD2 
2369 N N   . HIS B 17  ? 2.0427 1.1384 1.1038 0.1810  0.2289  0.0048  17  HIS B N   
2370 C CA  . HIS B 17  ? 1.9657 1.0725 1.0595 0.1762  0.2252  -0.0018 17  HIS B CA  
2371 C C   . HIS B 17  ? 1.8074 0.9412 0.9307 0.1493  0.1791  -0.0151 17  HIS B C   
2372 O O   . HIS B 17  ? 1.7784 0.9359 0.9577 0.1278  0.1760  -0.0181 17  HIS B O   
2373 C CB  . HIS B 17  ? 2.0094 1.0840 1.0489 0.2121  0.2332  -0.0024 17  HIS B CB  
2374 C CG  . HIS B 17  ? 2.1252 1.2079 1.1951 0.2124  0.2315  -0.0087 17  HIS B CG  
2375 N ND1 . HIS B 17  ? 2.2629 1.3364 1.3055 0.2197  0.1970  -0.0213 17  HIS B ND1 
2376 C CD2 . HIS B 17  ? 2.2268 1.3264 1.3547 0.2067  0.2597  -0.0036 17  HIS B CD2 
2377 C CE1 . HIS B 17  ? 2.3624 1.4446 1.4423 0.2209  0.2052  -0.0234 17  HIS B CE1 
2378 N NE2 . HIS B 17  ? 2.3671 1.4683 1.5018 0.2134  0.2426  -0.0125 17  HIS B NE2 
2379 N N   . HIS B 18  ? 1.7448 0.8751 0.8311 0.1504  0.1432  -0.0222 18  HIS B N   
2380 C CA  . HIS B 18  ? 1.8145 0.9657 0.9215 0.1257  0.1000  -0.0339 18  HIS B CA  
2381 C C   . HIS B 18  ? 1.7037 0.8816 0.8524 0.0929  0.0932  -0.0333 18  HIS B C   
2382 O O   . HIS B 18  ? 1.7167 0.9146 0.9039 0.0669  0.0736  -0.0394 18  HIS B O   
2383 C CB  . HIS B 18  ? 1.9134 1.0513 0.9684 0.1370  0.0648  -0.0414 18  HIS B CB  
2384 C CG  . HIS B 18  ? 2.0169 1.1235 1.0248 0.1659  0.0634  -0.0459 18  HIS B CG  
2385 N ND1 . HIS B 18  ? 2.1093 1.2115 1.1331 0.1677  0.0625  -0.0517 18  HIS B ND1 
2386 C CD2 . HIS B 18  ? 2.0108 1.0858 0.9527 0.1954  0.0624  -0.0458 18  HIS B CD2 
2387 C CE1 . HIS B 18  ? 2.1385 1.2054 1.1065 0.1973  0.0636  -0.0555 18  HIS B CE1 
2388 N NE2 . HIS B 18  ? 2.0849 1.1336 1.0001 0.2138  0.0625  -0.0525 18  HIS B NE2 
2389 N N   . SER B 19  ? 1.6178 0.7922 0.7537 0.0959  0.1096  -0.0257 19  SER B N   
2390 C CA  . SER B 19  ? 1.5482 0.7402 0.7164 0.0687  0.1112  -0.0244 19  SER B CA  
2391 C C   . SER B 19  ? 1.5845 0.7886 0.8058 0.0462  0.1272  -0.0242 19  SER B C   
2392 O O   . SER B 19  ? 1.6452 0.8673 0.8980 0.0168  0.1092  -0.0299 19  SER B O   
2393 C CB  . SER B 19  ? 1.6751 0.8536 0.8188 0.0829  0.1364  -0.0140 19  SER B CB  
2394 O OG  . SER B 19  ? 1.8274 1.0111 1.0043 0.0616  0.1575  -0.0103 19  SER B OG  
2395 N N   . GLN B 20  ? 1.5704 0.7644 0.8012 0.0598  0.1608  -0.0172 20  GLN B N   
2396 C CA  . GLN B 20  ? 1.6416 0.8504 0.9292 0.0392  0.1766  -0.0160 20  GLN B CA  
2397 C C   . GLN B 20  ? 1.6593 0.8880 0.9786 0.0269  0.1477  -0.0245 20  GLN B C   
2398 O O   . GLN B 20  ? 1.6822 0.9310 1.0477 -0.0014 0.1376  -0.0278 20  GLN B O   
2399 C CB  . GLN B 20  ? 1.7259 0.9208 1.0190 0.0585  0.2216  -0.0050 20  GLN B CB  
2400 C CG  . GLN B 20  ? 1.8190 0.9915 1.0879 0.0672  0.2553  0.0056  20  GLN B CG  
2401 C CD  . GLN B 20  ? 1.8681 1.0209 1.1312 0.0905  0.3009  0.0178  20  GLN B CD  
2402 O OE1 . GLN B 20  ? 1.9534 1.1125 1.2363 0.0995  0.3097  0.0184  20  GLN B OE1 
2403 N NE2 . GLN B 20  ? 1.7825 0.9095 1.0176 0.1017  0.3321  0.0288  20  GLN B NE2 
2404 N N   . ASN B 21  ? 1.6351 0.8549 0.9263 0.0490  0.1337  -0.0282 21  ASN B N   
2405 C CA  . ASN B 21  ? 1.6325 0.8652 0.9468 0.0421  0.1058  -0.0358 21  ASN B CA  
2406 C C   . ASN B 21  ? 1.6150 0.8614 0.9365 0.0132  0.0665  -0.0439 21  ASN B C   
2407 O O   . ASN B 21  ? 1.6826 0.9452 1.0396 -0.0048 0.0465  -0.0479 21  ASN B O   
2408 C CB  . ASN B 21  ? 1.6760 0.8870 0.9465 0.0727  0.0983  -0.0393 21  ASN B CB  
2409 C CG  . ASN B 21  ? 1.7729 0.9730 1.0473 0.0996  0.1357  -0.0323 21  ASN B CG  
2410 O OD1 . ASN B 21  ? 1.7616 0.9764 1.0825 0.0927  0.1653  -0.0245 21  ASN B OD1 
2411 N ND2 . ASN B 21  ? 1.9055 1.0783 1.1307 0.1298  0.1353  -0.0352 21  ASN B ND2 
2412 N N   . LEU B 22  ? 1.5404 0.7804 0.8284 0.0098  0.0562  -0.0452 22  LEU B N   
2413 C CA  . LEU B 22  ? 1.4038 0.6549 0.6946 -0.0165 0.0234  -0.0516 22  LEU B CA  
2414 C C   . LEU B 22  ? 1.6471 0.9122 0.9755 -0.0462 0.0300  -0.0506 22  LEU B C   
2415 O O   . LEU B 22  ? 1.6301 0.9071 0.9840 -0.0691 0.0079  -0.0551 22  LEU B O   
2416 C CB  . LEU B 22  ? 1.8803 1.1242 1.1300 -0.0094 0.0141  -0.0519 22  LEU B CB  
2417 C CG  . LEU B 22  ? 1.3883 0.6437 0.6387 -0.0343 -0.0165 -0.0573 22  LEU B CG  
2418 C CD1 . LEU B 22  ? 1.3808 0.6387 0.6403 -0.0459 -0.0482 -0.0644 22  LEU B CD1 
2419 C CD2 . LEU B 22  ? 1.3995 0.6520 0.6151 -0.0224 -0.0255 -0.0565 22  LEU B CD2 
2420 N N   . LEU B 23  ? 1.6000 0.8595 0.9275 -0.0456 0.0597  -0.0446 23  LEU B N   
2421 C CA  . LEU B 23  ? 1.5344 0.8001 0.8921 -0.0734 0.0687  -0.0446 23  LEU B CA  
2422 C C   . LEU B 23  ? 1.5512 0.8324 0.9562 -0.0892 0.0611  -0.0467 23  LEU B C   
2423 O O   . LEU B 23  ? 1.6967 0.9867 1.1219 -0.1176 0.0426  -0.0516 23  LEU B O   
2424 C CB  . LEU B 23  ? 1.6542 0.9058 1.0072 -0.0651 0.1085  -0.0367 23  LEU B CB  
2425 C CG  . LEU B 23  ? 1.5797 0.8272 0.9493 -0.0921 0.1209  -0.0374 23  LEU B CG  
2426 C CD1 . LEU B 23  ? 1.4882 0.7458 0.9074 -0.1128 0.1268  -0.0384 23  LEU B CD1 
2427 C CD2 . LEU B 23  ? 1.5192 0.7696 0.8752 -0.1130 0.0945  -0.0446 23  LEU B CD2 
2428 N N   . ARG B 24  ? 1.4703 0.7545 0.8921 -0.0696 0.0753  -0.0427 24  ARG B N   
2429 C CA  . ARG B 24  ? 1.4372 0.7413 0.9124 -0.0807 0.0709  -0.0427 24  ARG B CA  
2430 C C   . ARG B 24  ? 1.3731 0.6876 0.8542 -0.0914 0.0290  -0.0495 24  ARG B C   
2431 O O   . ARG B 24  ? 1.5296 0.8603 1.0481 -0.1150 0.0116  -0.0517 24  ARG B O   
2432 C CB  . ARG B 24  ? 1.5000 0.8047 0.9901 -0.0525 0.0990  -0.0356 24  ARG B CB  
2433 C CG  . ARG B 24  ? 1.5319 0.8628 1.0886 -0.0620 0.1016  -0.0331 24  ARG B CG  
2434 C CD  . ARG B 24  ? 1.7052 1.0364 1.2743 -0.0305 0.1310  -0.0257 24  ARG B CD  
2435 N NE  . ARG B 24  ? 1.9070 1.2182 1.4525 -0.0130 0.1745  -0.0175 24  ARG B NE  
2436 C CZ  . ARG B 24  ? 1.8941 1.1785 1.3839 0.0197  0.1897  -0.0151 24  ARG B CZ  
2437 N NH1 . ARG B 24  ? 1.8945 1.1689 1.3481 0.0371  0.1645  -0.0216 24  ARG B NH1 
2438 N NH2 . ARG B 24  ? 1.8051 1.0695 1.2725 0.0348  0.2292  -0.0061 24  ARG B NH2 
2439 N N   . ALA B 25  ? 1.3616 0.6645 0.8036 -0.0742 0.0120  -0.0527 25  ALA B N   
2440 C CA  . ALA B 25  ? 1.4595 0.7655 0.9010 -0.0799 -0.0254 -0.0583 25  ALA B CA  
2441 C C   . ALA B 25  ? 1.4176 0.7267 0.8559 -0.1119 -0.0525 -0.0628 25  ALA B C   
2442 O O   . ALA B 25  ? 1.4050 0.7226 0.8642 -0.1275 -0.0785 -0.0649 25  ALA B O   
2443 C CB  . ALA B 25  ? 1.3677 0.6547 0.7629 -0.0559 -0.0356 -0.0614 25  ALA B CB  
2444 N N   . VAL B 26  ? 1.4069 0.7075 0.8167 -0.1197 -0.0455 -0.0635 26  VAL B N   
2445 C CA  . VAL B 26  ? 1.4098 0.7098 0.8116 -0.1488 -0.0635 -0.0671 26  VAL B CA  
2446 C C   . VAL B 26  ? 1.4397 0.7473 0.8748 -0.1731 -0.0582 -0.0673 26  VAL B C   
2447 O O   . VAL B 26  ? 1.3164 0.6255 0.7562 -0.1972 -0.0827 -0.0708 26  VAL B O   
2448 C CB  . VAL B 26  ? 1.3971 0.6875 0.7638 -0.1471 -0.0522 -0.0667 26  VAL B CB  
2449 C CG1 . VAL B 26  ? 1.3186 0.6064 0.6780 -0.1763 -0.0624 -0.0698 26  VAL B CG1 
2450 C CG2 . VAL B 26  ? 1.3284 0.6136 0.6642 -0.1287 -0.0660 -0.0677 26  VAL B CG2 
2451 N N   . SER B 27  ? 1.3241 0.6339 0.7801 -0.1677 -0.0270 -0.0634 27  SER B N   
2452 C CA  . SER B 27  ? 1.6053 0.9220 1.0969 -0.1922 -0.0228 -0.0642 27  SER B CA  
2453 C C   . SER B 27  ? 1.5950 0.9310 1.1268 -0.2016 -0.0498 -0.0651 27  SER B C   
2454 O O   . SER B 27  ? 1.5583 0.8983 1.1060 -0.2291 -0.0687 -0.0686 27  SER B O   
2455 C CB  . SER B 27  ? 1.4616 0.7771 0.9735 -0.1837 0.0170  -0.0586 27  SER B CB  
2456 O OG  . SER B 27  ? 1.4320 0.7271 0.9120 -0.1866 0.0381  -0.0586 27  SER B OG  
2457 N N   . ASN B 28  ? 1.4727 0.8186 1.0182 -0.1776 -0.0526 -0.0618 28  ASN B N   
2458 C CA  . ASN B 28  ? 1.4483 0.8139 1.0351 -0.1810 -0.0768 -0.0610 28  ASN B CA  
2459 C C   . ASN B 28  ? 1.5713 0.9298 1.1340 -0.1906 -0.1175 -0.0650 28  ASN B C   
2460 O O   . ASN B 28  ? 1.6310 1.0020 1.2221 -0.2031 -0.1440 -0.0648 28  ASN B O   
2461 C CB  . ASN B 28  ? 1.3909 0.7678 1.0041 -0.1497 -0.0595 -0.0553 28  ASN B CB  
2462 C CG  . ASN B 28  ? 1.6188 1.0088 1.2733 -0.1456 -0.0214 -0.0492 28  ASN B CG  
2463 O OD1 . ASN B 28  ? 1.7218 1.1214 1.4010 -0.1209 -0.0007 -0.0434 28  ASN B OD1 
2464 N ND2 . ASN B 28  ? 1.6209 1.0085 1.2815 -0.1699 -0.0102 -0.0504 28  ASN B ND2 
2465 N N   . MET B 29  ? 1.5396 0.8781 1.0513 -0.1849 -0.1230 -0.0678 29  MET B N   
2466 C CA  . MET B 29  ? 1.3860 0.7138 0.8714 -0.1959 -0.1584 -0.0707 29  MET B CA  
2467 C C   . MET B 29  ? 1.5114 0.8318 0.9815 -0.2282 -0.1703 -0.0738 29  MET B C   
2468 O O   . MET B 29  ? 1.6090 0.9268 1.0781 -0.2454 -0.2003 -0.0746 29  MET B O   
2469 C CB  . MET B 29  ? 1.3493 0.6601 0.7907 -0.1797 -0.1603 -0.0723 29  MET B CB  
2470 C CG  . MET B 29  ? 1.4756 0.7726 0.8897 -0.1923 -0.1944 -0.0744 29  MET B CG  
2471 S SD  . MET B 29  ? 1.5744 0.8732 1.0123 -0.1874 -0.2258 -0.0722 29  MET B SD  
2472 C CE  . MET B 29  ? 1.3508 0.6303 0.7537 -0.2155 -0.2603 -0.0730 29  MET B CE  
2473 N N   . LEU B 30  ? 1.5348 0.8482 0.9888 -0.2351 -0.1460 -0.0753 30  LEU B N   
2474 C CA  . LEU B 30  ? 1.4747 0.7769 0.9125 -0.2644 -0.1513 -0.0791 30  LEU B CA  
2475 C C   . LEU B 30  ? 1.4378 0.7499 0.9105 -0.2841 -0.1688 -0.0802 30  LEU B C   
2476 O O   . LEU B 30  ? 1.5177 0.8200 0.9744 -0.3059 -0.1954 -0.0828 30  LEU B O   
2477 C CB  . LEU B 30  ? 1.5747 0.8680 0.9992 -0.2647 -0.1169 -0.0799 30  LEU B CB  
2478 C CG  . LEU B 30  ? 1.5702 0.8447 0.9687 -0.2920 -0.1166 -0.0848 30  LEU B CG  
2479 C CD1 . LEU B 30  ? 1.4358 0.6976 0.7943 -0.3009 -0.1366 -0.0861 30  LEU B CD1 
2480 C CD2 . LEU B 30  ? 1.5553 0.8191 0.9427 -0.2866 -0.0795 -0.0846 30  LEU B CD2 
2481 N N   . GLN B 31  ? 1.5268 0.8585 1.0476 -0.2764 -0.1543 -0.0775 31  GLN B N   
2482 C CA  . GLN B 31  ? 1.5249 0.8726 1.0894 -0.2952 -0.1718 -0.0780 31  GLN B CA  
2483 C C   . GLN B 31  ? 1.5465 0.9033 1.1221 -0.2960 -0.2120 -0.0760 31  GLN B C   
2484 O O   . GLN B 31  ? 1.6247 0.9843 1.2118 -0.3186 -0.2392 -0.0778 31  GLN B O   
2485 C CB  . GLN B 31  ? 1.5753 0.9469 1.1973 -0.2848 -0.1454 -0.0737 31  GLN B CB  
2486 C CG  . GLN B 31  ? 1.7815 1.1411 1.3988 -0.2940 -0.1107 -0.0756 31  GLN B CG  
2487 C CD  . GLN B 31  ? 1.8932 1.2379 1.4999 -0.3299 -0.1241 -0.0830 31  GLN B CD  
2488 O OE1 . GLN B 31  ? 1.9696 1.3290 1.6119 -0.3496 -0.1492 -0.0846 31  GLN B OE1 
2489 N NE2 . GLN B 31  ? 1.8597 1.1740 1.4166 -0.3378 -0.1080 -0.0877 31  GLN B NE2 
2490 N N   . LYS B 32  ? 1.5063 0.8645 1.0758 -0.2710 -0.2168 -0.0723 32  LYS B N   
2491 C CA  . LYS B 32  ? 1.5388 0.8997 1.1136 -0.2686 -0.2535 -0.0695 32  LYS B CA  
2492 C C   . LYS B 32  ? 1.5057 0.8408 1.0304 -0.2922 -0.2812 -0.0725 32  LYS B C   
2493 O O   . LYS B 32  ? 1.5370 0.8731 1.0687 -0.3083 -0.3129 -0.0716 32  LYS B O   
2494 C CB  . LYS B 32  ? 1.6356 0.9931 1.2025 -0.2373 -0.2507 -0.0664 32  LYS B CB  
2495 C CG  . LYS B 32  ? 1.7745 1.1558 1.3917 -0.2099 -0.2301 -0.0618 32  LYS B CG  
2496 C CD  . LYS B 32  ? 1.8491 1.2183 1.4486 -0.1804 -0.2340 -0.0604 32  LYS B CD  
2497 C CE  . LYS B 32  ? 1.7563 1.1397 1.3886 -0.1490 -0.2031 -0.0569 32  LYS B CE  
2498 N NZ  . LYS B 32  ? 1.6218 0.9946 1.2269 -0.1387 -0.1670 -0.0589 32  LYS B NZ  
2499 N N   . ALA B 33  ? 1.5418 0.8542 1.0159 -0.2935 -0.2689 -0.0753 33  ALA B N   
2500 C CA  . ALA B 33  ? 1.5470 0.8331 0.9705 -0.3145 -0.2884 -0.0771 33  ALA B CA  
2501 C C   . ALA B 33  ? 1.6162 0.8954 1.0351 -0.3437 -0.3006 -0.0807 33  ALA B C   
2502 O O   . ALA B 33  ? 1.6582 0.9299 1.0692 -0.3571 -0.3340 -0.0793 33  ALA B O   
2503 C CB  . ALA B 33  ? 1.4387 0.7089 0.8206 -0.3123 -0.2656 -0.0792 33  ALA B CB  
2504 N N   . ARG B 34  ? 1.6626 0.9408 1.0832 -0.3532 -0.2745 -0.0855 34  ARG B N   
2505 C CA  . ARG B 34  ? 1.7930 1.0575 1.2014 -0.3825 -0.2846 -0.0911 34  ARG B CA  
2506 C C   . ARG B 34  ? 1.9011 1.1889 1.3627 -0.3907 -0.3072 -0.0905 34  ARG B C   
2507 O O   . ARG B 34  ? 2.0595 1.3412 1.5239 -0.4144 -0.3125 -0.0963 34  ARG B O   
2508 C CB  . ARG B 34  ? 1.7868 1.0369 1.1768 -0.3904 -0.2490 -0.0970 34  ARG B CB  
2509 C CG  . ARG B 34  ? 1.7565 1.0273 1.1951 -0.3809 -0.2205 -0.0969 34  ARG B CG  
2510 C CD  . ARG B 34  ? 1.9320 1.1812 1.3545 -0.4024 -0.2013 -0.1044 34  ARG B CD  
2511 N NE  . ARG B 34  ? 2.1093 1.3416 1.5145 -0.4326 -0.2325 -0.1107 34  ARG B NE  
2512 C CZ  . ARG B 34  ? 2.1247 1.3302 1.5069 -0.4567 -0.2257 -0.1195 34  ARG B CZ  
2513 N NH1 . ARG B 34  ? 2.1749 1.3676 1.5513 -0.4536 -0.1867 -0.1222 34  ARG B NH1 
2514 N NH2 . ARG B 34  ? 2.0534 1.2413 1.4145 -0.4834 -0.2586 -0.1256 34  ARG B NH2 
2515 N N   . GLN B 35  ? 1.8445 1.1588 1.3492 -0.3710 -0.3210 -0.0837 35  GLN B N   
2516 C CA  . GLN B 35  ? 1.8782 1.2205 1.4401 -0.3762 -0.3466 -0.0810 35  GLN B CA  
2517 C C   . GLN B 35  ? 1.9132 1.2557 1.4715 -0.3694 -0.3867 -0.0746 35  GLN B C   
2518 O O   . GLN B 35  ? 1.9898 1.3538 1.5900 -0.3741 -0.4162 -0.0712 35  GLN B O   
2519 C CB  . GLN B 35  ? 1.9537 1.3333 1.5857 -0.3562 -0.3211 -0.0769 35  GLN B CB  
2520 C CG  . GLN B 35  ? 2.0915 1.4800 1.7539 -0.3733 -0.2982 -0.0815 35  GLN B CG  
2521 C CD  . GLN B 35  ? 2.2157 1.6397 1.9470 -0.3530 -0.2693 -0.0755 35  GLN B CD  
2522 O OE1 . GLN B 35  ? 2.2688 1.6943 1.9963 -0.3244 -0.2426 -0.0714 35  GLN B OE1 
2523 N NE2 . GLN B 35  ? 2.2472 1.6989 2.0408 -0.3684 -0.2742 -0.0749 35  GLN B NE2 
2524 N N   . THR B 36  ? 1.8384 1.1572 1.3488 -0.3583 -0.3880 -0.0724 36  THR B N   
2525 C CA  . THR B 36  ? 1.8467 1.1559 1.3430 -0.3528 -0.4245 -0.0659 36  THR B CA  
2526 C C   . THR B 36  ? 1.9051 1.1714 1.3243 -0.3701 -0.4365 -0.0672 36  THR B C   
2527 O O   . THR B 36  ? 1.8968 1.1460 1.2919 -0.3709 -0.4675 -0.0615 36  THR B O   
2528 C CB  . THR B 36  ? 1.7538 1.0739 1.2723 -0.3193 -0.4181 -0.0599 36  THR B CB  
2529 O OG1 . THR B 36  ? 1.6576 0.9571 1.1342 -0.3105 -0.3927 -0.0625 36  THR B OG1 
2530 C CG2 . THR B 36  ? 1.7326 1.0933 1.3247 -0.3001 -0.3993 -0.0579 36  THR B CG2 
2531 N N   . LEU B 37  ? 1.9888 1.2370 1.3700 -0.3830 -0.4100 -0.0737 37  LEU B N   
2532 C CA  . LEU B 37  ? 2.0935 1.3025 1.4042 -0.4010 -0.4155 -0.0748 37  LEU B CA  
2533 C C   . LEU B 37  ? 2.3126 1.5036 1.5961 -0.4296 -0.4196 -0.0819 37  LEU B C   
2534 O O   . LEU B 37  ? 2.2880 1.4734 1.5609 -0.4372 -0.3895 -0.0888 37  LEU B O   
2535 C CB  . LEU B 37  ? 1.9618 1.1609 1.2450 -0.3925 -0.3822 -0.0760 37  LEU B CB  
2536 C CG  . LEU B 37  ? 1.8970 1.0992 1.1843 -0.3700 -0.3835 -0.0702 37  LEU B CG  
2537 C CD1 . LEU B 37  ? 1.9670 1.1535 1.2158 -0.3710 -0.3602 -0.0712 37  LEU B CD1 
2538 C CD2 . LEU B 37  ? 1.9010 1.0886 1.1763 -0.3701 -0.4215 -0.0631 37  LEU B CD2 
2539 N N   . GLU B 38  ? 2.5321 1.7109 1.8012 -0.4445 -0.4582 -0.0801 38  GLU B N   
2540 C CA  . GLU B 38  ? 2.7541 1.9123 1.9946 -0.4724 -0.4693 -0.0878 38  GLU B CA  
2541 C C   . GLU B 38  ? 2.9276 2.0356 2.0817 -0.4898 -0.4680 -0.0894 38  GLU B C   
2542 O O   . GLU B 38  ? 2.9743 2.0618 2.0950 -0.5017 -0.4398 -0.0973 38  GLU B O   
2543 C CB  . GLU B 38  ? 2.8088 1.9820 2.0810 -0.4797 -0.5147 -0.0852 38  GLU B CB  
2544 C CG  . GLU B 38  ? 2.8110 1.9875 2.0878 -0.4636 -0.5469 -0.0732 38  GLU B CG  
2545 C CD  . GLU B 38  ? 2.8057 2.0211 2.1523 -0.4568 -0.5803 -0.0684 38  GLU B CD  
2546 O OE1 . GLU B 38  ? 2.8117 2.0275 2.1618 -0.4442 -0.6115 -0.0582 38  GLU B OE1 
2547 O OE2 . GLU B 38  ? 2.8012 2.0471 2.2017 -0.4637 -0.5744 -0.0740 38  GLU B OE2 
2548 N N   . PHE B 39  ? 3.0029 2.0893 2.1203 -0.4901 -0.4962 -0.0812 39  PHE B N   
2549 C CA  . PHE B 39  ? 3.0250 2.0617 2.0586 -0.5062 -0.4949 -0.0804 39  PHE B CA  
2550 C C   . PHE B 39  ? 3.0193 2.0499 2.0338 -0.4980 -0.4533 -0.0793 39  PHE B C   
2551 O O   . PHE B 39  ? 3.0857 2.0938 2.0612 -0.4974 -0.4542 -0.0716 39  PHE B O   
2552 C CB  . PHE B 39  ? 2.9828 1.9971 1.9839 -0.5070 -0.5353 -0.0697 39  PHE B CB  
2553 N N   . TYR B 40  ? 2.9058 1.9570 1.9501 -0.4920 -0.4177 -0.0863 40  TYR B N   
2554 C CA  . TYR B 40  ? 2.8638 1.9168 1.9001 -0.4823 -0.3789 -0.0854 40  TYR B CA  
2555 C C   . TYR B 40  ? 2.8536 1.9081 1.8930 -0.4860 -0.3432 -0.0950 40  TYR B C   
2556 O O   . TYR B 40  ? 2.8833 1.9546 1.9597 -0.4868 -0.3435 -0.1011 40  TYR B O   
2557 C CB  . TYR B 40  ? 2.7777 1.8657 1.8661 -0.4567 -0.3751 -0.0797 40  TYR B CB  
2558 C CG  . TYR B 40  ? 2.6828 1.7637 1.7642 -0.4504 -0.4046 -0.0700 40  TYR B CG  
2559 C CD1 . TYR B 40  ? 2.6712 1.7375 1.7247 -0.4483 -0.3959 -0.0640 40  TYR B CD1 
2560 C CD2 . TYR B 40  ? 2.6210 1.7098 1.7266 -0.4465 -0.4409 -0.0663 40  TYR B CD2 
2561 C CE1 . TYR B 40  ? 2.7026 1.7569 1.7473 -0.4436 -0.4216 -0.0552 40  TYR B CE1 
2562 C CE2 . TYR B 40  ? 2.6395 1.7172 1.7363 -0.4388 -0.4669 -0.0569 40  TYR B CE2 
2563 C CZ  . TYR B 40  ? 2.7021 1.7597 1.7659 -0.4379 -0.4567 -0.0516 40  TYR B CZ  
2564 O OH  . TYR B 40  ? 2.7157 1.7567 1.7681 -0.4313 -0.4814 -0.0422 40  TYR B OH  
2565 N N   . PRO B 41  ? 2.7741 1.8107 1.7763 -0.4882 -0.3112 -0.0956 41  PRO B N   
2566 C CA  . PRO B 41  ? 2.6396 1.6739 1.6410 -0.4883 -0.2737 -0.1034 41  PRO B CA  
2567 C C   . PRO B 41  ? 2.3532 1.4272 1.4158 -0.4660 -0.2526 -0.1032 41  PRO B C   
2568 O O   . PRO B 41  ? 2.0785 1.1634 1.1458 -0.4520 -0.2244 -0.1002 41  PRO B O   
2569 C CB  . PRO B 41  ? 2.7139 1.7263 1.6685 -0.4906 -0.2468 -0.1001 41  PRO B CB  
2570 C CG  . PRO B 41  ? 2.7852 1.7737 1.6988 -0.5022 -0.2737 -0.0933 41  PRO B CG  
2571 C CD  . PRO B 41  ? 2.7776 1.7907 1.7327 -0.4930 -0.3093 -0.0883 41  PRO B CD  
2572 N N   . CYS B 42  ? 2.3775 1.4731 1.4864 -0.4627 -0.2661 -0.1057 42  CYS B N   
2573 C CA  . CYS B 42  ? 2.3460 1.4746 1.5086 -0.4419 -0.2443 -0.1051 42  CYS B CA  
2574 C C   . CYS B 42  ? 2.4285 1.5546 1.6089 -0.4512 -0.2311 -0.1130 42  CYS B C   
2575 O O   . CYS B 42  ? 2.4445 1.5942 1.6741 -0.4483 -0.2414 -0.1131 42  CYS B O   
2576 C CB  . CYS B 42  ? 2.2568 1.4171 1.4673 -0.4253 -0.2665 -0.0989 42  CYS B CB  
2577 S SG  . CYS B 42  ? 4.0202 3.1803 3.2131 -0.4136 -0.2816 -0.0902 42  CYS B SG  
2578 N N   . THR B 43  ? 2.4742 1.5704 1.6154 -0.4623 -0.2067 -0.1194 43  THR B N   
2579 C CA  . THR B 43  ? 2.4795 1.5627 1.6277 -0.4752 -0.1944 -0.1282 43  THR B CA  
2580 C C   . THR B 43  ? 2.4857 1.5482 1.6086 -0.4695 -0.1505 -0.1314 43  THR B C   
2581 O O   . THR B 43  ? 2.4860 1.5141 1.5536 -0.4789 -0.1397 -0.1349 43  THR B O   
2582 C CB  . THR B 43  ? 2.4590 1.5099 1.5712 -0.5054 -0.2236 -0.1366 43  THR B CB  
2583 O OG1 . THR B 43  ? 2.5024 1.5170 1.5458 -0.5142 -0.2236 -0.1373 43  THR B OG1 
2584 C CG2 . THR B 43  ? 2.3785 1.4538 1.5263 -0.5101 -0.2683 -0.1331 43  THR B CG2 
2585 N N   . SER B 44  ? 2.3834 1.4651 1.5457 -0.4526 -0.1239 -0.1292 44  SER B N   
2586 C CA  . SER B 44  ? 2.2638 1.3279 1.4077 -0.4426 -0.0816 -0.1304 44  SER B CA  
2587 C C   . SER B 44  ? 2.2708 1.3287 1.3782 -0.4316 -0.0675 -0.1256 44  SER B C   
2588 O O   . SER B 44  ? 2.1691 1.2567 1.2959 -0.4122 -0.0693 -0.1169 44  SER B O   
2589 C CB  . SER B 44  ? 2.1647 1.1862 1.2788 -0.4655 -0.0710 -0.1419 44  SER B CB  
2590 O OG  . SER B 44  ? 2.1101 1.0974 1.1702 -0.4885 -0.0909 -0.1489 44  SER B OG  
2591 N N   . ASP B 48  ? 2.0518 0.9650 1.0762 0.1311  -0.2720 -0.0373 48  ASP B N   
2592 C CA  . ASP B 48  ? 2.1649 1.1044 1.2111 0.1081  -0.2430 -0.0250 48  ASP B CA  
2593 C C   . ASP B 48  ? 2.2278 1.1960 1.3356 0.0992  -0.2403 -0.0233 48  ASP B C   
2594 O O   . ASP B 48  ? 2.1744 1.1228 1.3156 0.0928  -0.2589 -0.0151 48  ASP B O   
2595 C CB  . ASP B 48  ? 2.1549 1.0606 1.1881 0.0949  -0.2465 -0.0075 48  ASP B CB  
2596 N N   . HIS B 49  ? 2.2842 1.2996 1.4060 0.0992  -0.2167 -0.0328 49  HIS B N   
2597 C CA  . HIS B 49  ? 2.3026 1.3484 1.4762 0.0948  -0.2129 -0.0329 49  HIS B CA  
2598 C C   . HIS B 49  ? 2.3002 1.4043 1.4855 0.0919  -0.1807 -0.0443 49  HIS B C   
2599 O O   . HIS B 49  ? 2.2799 1.4052 1.4471 0.1086  -0.1758 -0.0626 49  HIS B O   
2600 C CB  . HIS B 49  ? 2.3581 1.3867 1.5408 0.1145  -0.2392 -0.0410 49  HIS B CB  
2601 C CG  . HIS B 49  ? 2.4561 1.4722 1.5977 0.1373  -0.2506 -0.0565 49  HIS B CG  
2602 N ND1 . HIS B 49  ? 2.4818 1.4533 1.5970 0.1463  -0.2752 -0.0569 49  HIS B ND1 
2603 C CD2 . HIS B 49  ? 2.4739 1.5188 1.5986 0.1534  -0.2414 -0.0745 49  HIS B CD2 
2604 C CE1 . HIS B 49  ? 2.4929 1.4662 1.5766 0.1661  -0.2799 -0.0732 49  HIS B CE1 
2605 N NE2 . HIS B 49  ? 2.5016 1.5185 1.5903 0.1705  -0.2597 -0.0841 49  HIS B NE2 
2606 N N   . GLU B 50  ? 2.2911 1.4233 1.5099 0.0711  -0.1593 -0.0361 50  GLU B N   
2607 C CA  . GLU B 50  ? 2.2342 1.4255 1.4690 0.0661  -0.1261 -0.0497 50  GLU B CA  
2608 C C   . GLU B 50  ? 2.1688 1.3977 1.4599 0.0557  -0.1177 -0.0466 50  GLU B C   
2609 O O   . GLU B 50  ? 2.1736 1.3855 1.4918 0.0400  -0.1254 -0.0289 50  GLU B O   
2610 C CB  . GLU B 50  ? 2.1498 1.3459 1.3604 0.0492  -0.0962 -0.0484 50  GLU B CB  
2611 N N   . ASP B 51  ? 2.0165 1.2983 1.3254 0.0655  -0.1025 -0.0659 51  ASP B N   
2612 C CA  . ASP B 51  ? 1.8463 1.1699 1.2055 0.0599  -0.0941 -0.0666 51  ASP B CA  
2613 C C   . ASP B 51  ? 1.7035 1.0890 1.0843 0.0478  -0.0563 -0.0826 51  ASP B C   
2614 O O   . ASP B 51  ? 1.7589 1.1772 1.1253 0.0594  -0.0411 -0.1068 51  ASP B O   
2615 C CB  . ASP B 51  ? 1.8708 1.2029 1.2349 0.0866  -0.1126 -0.0774 51  ASP B CB  
2616 C CG  . ASP B 51  ? 1.7911 1.1700 1.2005 0.0856  -0.1032 -0.0812 51  ASP B CG  
2617 O OD1 . ASP B 51  ? 1.7425 1.1549 1.1535 0.1085  -0.1034 -0.1007 51  ASP B OD1 
2618 O OD2 . ASP B 51  ? 1.6969 1.0799 1.1399 0.0634  -0.0968 -0.0660 51  ASP B OD2 
2619 N N   . ILE B 52  ? 1.5081 0.9110 0.9267 0.0238  -0.0406 -0.0714 52  ILE B N   
2620 C CA  . ILE B 52  ? 1.4534 0.9115 0.8964 0.0078  -0.0017 -0.0859 52  ILE B CA  
2621 C C   . ILE B 52  ? 1.4811 1.0086 0.9608 0.0207  0.0099  -0.1117 52  ILE B C   
2622 O O   . ILE B 52  ? 1.4011 0.9824 0.9003 0.0132  0.0427  -0.1336 52  ILE B O   
2623 C CB  . ILE B 52  ? 1.3264 0.7796 0.8000 -0.0224 0.0114  -0.0660 52  ILE B CB  
2624 C CG1 . ILE B 52  ? 1.4334 0.9041 0.9570 -0.0260 -0.0016 -0.0572 52  ILE B CG1 
2625 C CG2 . ILE B 52  ? 1.4057 0.7890 0.8427 -0.0316 -0.0045 -0.0417 52  ILE B CG2 
2626 C CD1 . ILE B 52  ? 1.3068 0.7667 0.8614 -0.0548 0.0047  -0.0367 52  ILE B CD1 
2627 N N   . THR B 53  ? 1.5215 1.0464 1.0096 0.0410  -0.0164 -0.1104 53  THR B N   
2628 C CA  . THR B 53  ? 1.5549 1.1404 1.0723 0.0588  -0.0111 -0.1338 53  THR B CA  
2629 C C   . THR B 53  ? 1.7212 1.3091 1.2058 0.0916  -0.0245 -0.1557 53  THR B C   
2630 O O   . THR B 53  ? 1.7536 1.3518 1.2427 0.1162  -0.0422 -0.1626 53  THR B O   
2631 C CB  . THR B 53  ? 1.4845 1.0652 1.0308 0.0611  -0.0297 -0.1177 53  THR B CB  
2632 O OG1 . THR B 53  ? 1.5897 1.1155 1.1039 0.0816  -0.0630 -0.1060 53  THR B OG1 
2633 C CG2 . THR B 53  ? 1.4715 1.0338 1.0449 0.0287  -0.0244 -0.0924 53  THR B CG2 
2634 N N   . LYS B 54  ? 1.7731 1.3499 1.2229 0.0920  -0.0157 -0.1666 54  LYS B N   
2635 C CA  . LYS B 54  ? 1.9189 1.4932 1.3348 0.1208  -0.0289 -0.1876 54  LYS B CA  
2636 C C   . LYS B 54  ? 1.9823 1.6173 1.4205 0.1468  -0.0276 -0.2190 54  LYS B C   
2637 O O   . LYS B 54  ? 2.0732 1.7056 1.5226 0.1643  -0.0483 -0.2128 54  LYS B O   
2638 C CB  . LYS B 54  ? 2.0665 1.6385 1.4508 0.1118  -0.0082 -0.2011 54  LYS B CB  
2639 C CG  . LYS B 54  ? 2.1174 1.6821 1.4642 0.1384  -0.0221 -0.2222 54  LYS B CG  
2640 C CD  . LYS B 54  ? 2.1441 1.6361 1.4514 0.1475  -0.0557 -0.1985 54  LYS B CD  
2641 C CE  . LYS B 54  ? 2.1173 1.5926 1.4306 0.1732  -0.0884 -0.1931 54  LYS B CE  
2642 N NZ  . LYS B 54  ? 2.1312 1.5417 1.4077 0.1849  -0.1184 -0.1789 54  LYS B NZ  
2643 N N   . ASP B 55  ? 1.9811 1.6692 1.4238 0.1503  -0.0031 -0.2544 55  ASP B N   
2644 C CA  . ASP B 55  ? 2.0001 1.7523 1.4661 0.1767  -0.0015 -0.2906 55  ASP B CA  
2645 C C   . ASP B 55  ? 1.9486 1.7613 1.4689 0.1625  0.0226  -0.2994 55  ASP B C   
2646 O O   . ASP B 55  ? 1.8844 1.7642 1.4332 0.1795  0.0321  -0.3349 55  ASP B O   
2647 C CB  . ASP B 55  ? 1.9958 1.7814 1.4462 0.1883  0.0128  -0.3305 55  ASP B CB  
2648 C CG  . ASP B 55  ? 2.0140 1.7587 1.4202 0.2168  -0.0187 -0.3324 55  ASP B CG  
2649 O OD1 . ASP B 55  ? 2.0131 1.6925 1.3946 0.2202  -0.0466 -0.2989 55  ASP B OD1 
2650 O OD2 . ASP B 55  ? 2.0120 1.7913 1.4110 0.2354  -0.0147 -0.3698 55  ASP B OD2 
2651 N N   . LYS B 56  ? 1.9748 1.7643 1.5108 0.1321  0.0312  -0.2685 56  LYS B N   
2652 C CA  . LYS B 56  ? 2.0359 1.8772 1.6256 0.1146  0.0536  -0.2723 56  LYS B CA  
2653 C C   . LYS B 56  ? 2.0120 1.8646 1.6229 0.1340  0.0303  -0.2650 56  LYS B C   
2654 O O   . LYS B 56  ? 1.9889 1.9081 1.6409 0.1409  0.0427  -0.2885 56  LYS B O   
2655 C CB  . LYS B 56  ? 2.1156 1.9221 1.7123 0.0760  0.0682  -0.2403 56  LYS B CB  
2656 C CG  . LYS B 56  ? 2.1739 1.9515 1.7374 0.0571  0.0885  -0.2393 56  LYS B CG  
2657 C CD  . LYS B 56  ? 2.1240 1.9621 1.7184 0.0378  0.1349  -0.2689 56  LYS B CD  
2658 C CE  . LYS B 56  ? 2.0535 1.9113 1.6961 0.0092  0.1548  -0.2547 56  LYS B CE  
2659 N NZ  . LYS B 56  ? 2.0482 1.9704 1.7287 -0.0090 0.2024  -0.2874 56  LYS B NZ  
2660 N N   . THR B 57  ? 1.9939 1.7806 1.5759 0.1429  -0.0023 -0.2338 57  THR B N   
2661 C CA  . THR B 57  ? 1.8663 1.6497 1.4608 0.1581  -0.0231 -0.2213 57  THR B CA  
2662 C C   . THR B 57  ? 1.9131 1.6524 1.4650 0.1934  -0.0565 -0.2180 57  THR B C   
2663 O O   . THR B 57  ? 1.9481 1.6247 1.4623 0.1936  -0.0728 -0.2014 57  THR B O   
2664 C CB  . THR B 57  ? 1.7324 1.4740 1.3414 0.1292  -0.0274 -0.1830 57  THR B CB  
2665 O OG1 . THR B 57  ? 1.6623 1.4458 1.3142 0.0976  0.0032  -0.1858 57  THR B OG1 
2666 C CG2 . THR B 57  ? 1.6805 1.4153 1.2984 0.1441  -0.0467 -0.1709 57  THR B CG2 
2667 N N   . SER B 58  ? 1.8671 1.6385 1.4250 0.2241  -0.0667 -0.2343 58  SER B N   
2668 C CA  . SER B 58  ? 1.8315 1.5625 1.3485 0.2610  -0.0970 -0.2330 58  SER B CA  
2669 C C   . SER B 58  ? 1.7081 1.3730 1.2118 0.2581  -0.1174 -0.1951 58  SER B C   
2670 O O   . SER B 58  ? 1.7837 1.4318 1.2687 0.2876  -0.1359 -0.1933 58  SER B O   
2671 C CB  . SER B 58  ? 1.8461 1.6379 1.3701 0.2991  -0.1000 -0.2690 58  SER B CB  
2672 O OG  . SER B 58  ? 1.8130 1.6596 1.3795 0.2930  -0.0863 -0.2746 58  SER B OG  
2673 N N   . THR B 59  ? 1.5489 1.1743 1.0610 0.2228  -0.1132 -0.1663 59  THR B N   
2674 C CA  . THR B 59  ? 1.4761 1.0383 0.9807 0.2141  -0.1295 -0.1328 59  THR B CA  
2675 C C   . THR B 59  ? 1.5703 1.0574 1.0285 0.2302  -0.1540 -0.1211 59  THR B C   
2676 O O   . THR B 59  ? 1.5934 1.0274 1.0368 0.2362  -0.1698 -0.1014 59  THR B O   
2677 C CB  . THR B 59  ? 1.4595 1.0094 0.9936 0.1709  -0.1173 -0.1104 59  THR B CB  
2678 O OG1 . THR B 59  ? 1.4165 0.8967 0.9399 0.1615  -0.1349 -0.0813 59  THR B OG1 
2679 C CG2 . THR B 59  ? 1.5196 1.0648 1.0458 0.1532  -0.1071 -0.1142 59  THR B CG2 
2680 N N   . VAL B 60  ? 1.6661 1.1488 1.1020 0.2364  -0.1554 -0.1348 60  VAL B N   
2681 C CA  . VAL B 60  ? 1.7203 1.1365 1.1157 0.2508  -0.1776 -0.1269 60  VAL B CA  
2682 C C   . VAL B 60  ? 1.8260 1.2399 1.1936 0.2936  -0.1936 -0.1429 60  VAL B C   
2683 O O   . VAL B 60  ? 1.8570 1.2096 1.1975 0.3086  -0.2129 -0.1290 60  VAL B O   
2684 C CB  . VAL B 60  ? 1.6548 1.0656 1.0351 0.2405  -0.1735 -0.1350 60  VAL B CB  
2685 C CG1 . VAL B 60  ? 1.7110 1.1880 1.0931 0.2546  -0.1586 -0.1698 60  VAL B CG1 
2686 C CG2 . VAL B 60  ? 1.4771 0.8202 0.8201 0.2539  -0.1971 -0.1270 60  VAL B CG2 
2687 N N   . GLU B 61  ? 1.8377 1.3179 1.2129 0.3136  -0.1848 -0.1739 61  GLU B N   
2688 C CA  . GLU B 61  ? 1.9652 1.4508 1.3155 0.3576  -0.2008 -0.1934 61  GLU B CA  
2689 C C   . GLU B 61  ? 1.8796 1.3296 1.2183 0.3745  -0.2141 -0.1745 61  GLU B C   
2690 O O   . GLU B 61  ? 2.0033 1.3936 1.3057 0.3974  -0.2339 -0.1652 61  GLU B O   
2691 C CB  . GLU B 61  ? 2.1918 1.7648 1.5626 0.3737  -0.1871 -0.2332 61  GLU B CB  
2692 C CG  . GLU B 61  ? 2.4301 2.0160 1.7785 0.4228  -0.2052 -0.2565 61  GLU B CG  
2693 C CD  . GLU B 61  ? 2.5373 2.2162 1.9147 0.4388  -0.1918 -0.2983 61  GLU B CD  
2694 O OE1 . GLU B 61  ? 2.5427 2.2756 1.9570 0.4103  -0.1657 -0.3113 61  GLU B OE1 
2695 O OE2 . GLU B 61  ? 2.5889 2.2862 1.9522 0.4808  -0.2071 -0.3196 61  GLU B OE2 
2696 N N   . ALA B 62  ? 1.7131 1.1979 1.0817 0.3628  -0.2018 -0.1689 62  ALA B N   
2697 C CA  . ALA B 62  ? 1.7649 1.2269 1.1198 0.3833  -0.2119 -0.1561 62  ALA B CA  
2698 C C   . ALA B 62  ? 1.6874 1.1161 1.0600 0.3508  -0.2055 -0.1232 62  ALA B C   
2699 O O   . ALA B 62  ? 1.5775 1.0479 0.9772 0.3447  -0.1948 -0.1232 62  ALA B O   
2700 C CB  . ALA B 62  ? 1.7607 1.2984 1.1286 0.4121  -0.2078 -0.1857 62  ALA B CB  
2701 N N   . CYS B 63  ? 1.7044 1.0604 1.0641 0.3307  -0.2124 -0.0980 63  CYS B N   
2702 C CA  . CYS B 63  ? 1.6866 1.0029 1.0606 0.3020  -0.2086 -0.0690 63  CYS B CA  
2703 C C   . CYS B 63  ? 1.8772 1.1009 1.2142 0.3093  -0.2237 -0.0480 63  CYS B C   
2704 O O   . CYS B 63  ? 1.8873 1.0667 1.2352 0.2817  -0.2211 -0.0258 63  CYS B O   
2705 C CB  . CYS B 63  ? 1.6297 0.9576 1.0421 0.2572  -0.1958 -0.0601 63  CYS B CB  
2706 S SG  . CYS B 63  ? 1.7490 1.1680 1.2170 0.2345  -0.1716 -0.0701 63  CYS B SG  
2707 N N   . LEU B 64  ? 2.0422 1.2370 1.3374 0.3461  -0.2385 -0.0573 64  LEU B N   
2708 C CA  . LEU B 64  ? 2.0838 1.1892 1.3417 0.3566  -0.2509 -0.0399 64  LEU B CA  
2709 C C   . LEU B 64  ? 1.9907 1.0762 1.2238 0.3800  -0.2519 -0.0307 64  LEU B C   
2710 O O   . LEU B 64  ? 1.9755 1.1185 1.2094 0.4030  -0.2502 -0.0454 64  LEU B O   
2711 C CB  . LEU B 64  ? 2.1877 1.2677 1.4115 0.3857  -0.2664 -0.0541 64  LEU B CB  
2712 C CG  . LEU B 64  ? 2.1089 1.2392 1.3468 0.3825  -0.2661 -0.0766 64  LEU B CG  
2713 C CD1 . LEU B 64  ? 2.1032 1.3124 1.3451 0.4093  -0.2631 -0.1048 64  LEU B CD1 
2714 C CD2 . LEU B 64  ? 2.0424 1.1217 1.2514 0.3963  -0.2812 -0.0810 64  LEU B CD2 
2715 N N   . PRO B 65  ? 1.9814 0.9845 1.1913 0.3747  -0.2537 -0.0078 65  PRO B N   
2716 C CA  . PRO B 65  ? 1.9864 0.9578 1.1645 0.3959  -0.2528 0.0044  65  PRO B CA  
2717 C C   . PRO B 65  ? 1.9775 0.9733 1.1179 0.4487  -0.2647 -0.0137 65  PRO B C   
2718 O O   . PRO B 65  ? 1.9321 0.9478 1.0644 0.4698  -0.2756 -0.0340 65  PRO B O   
2719 C CB  . PRO B 65  ? 2.0192 0.8865 1.1672 0.3897  -0.2551 0.0246  65  PRO B CB  
2720 C CG  . PRO B 65  ? 1.9997 0.8590 1.1868 0.3476  -0.2515 0.0276  65  PRO B CG  
2721 C CD  . PRO B 65  ? 1.9733 0.9082 1.1864 0.3475  -0.2551 0.0061  65  PRO B CD  
2722 N N   . LEU B 66  ? 2.0877 1.0833 1.2049 0.4708  -0.2633 -0.0082 66  LEU B N   
2723 C CA  . LEU B 66  ? 2.2071 1.2198 1.2837 0.5256  -0.2774 -0.0258 66  LEU B CA  
2724 C C   . LEU B 66  ? 2.2288 1.1525 1.2487 0.5546  -0.2914 -0.0187 66  LEU B C   
2725 O O   . LEU B 66  ? 2.3334 1.2632 1.3191 0.6009  -0.3073 -0.0365 66  LEU B O   
2726 C CB  . LEU B 66  ? 2.2892 1.3177 1.3503 0.5435  -0.2734 -0.0201 66  LEU B CB  
2727 C CG  . LEU B 66  ? 2.2819 1.4137 1.3975 0.5278  -0.2621 -0.0357 66  LEU B CG  
2728 C CD1 . LEU B 66  ? 2.2438 1.3875 1.4159 0.4679  -0.2444 -0.0220 66  LEU B CD1 
2729 C CD2 . LEU B 66  ? 2.3124 1.4562 1.4053 0.5529  -0.2612 -0.0321 66  LEU B CD2 
2730 N N   . GLU B 67  ? 2.1235 0.9656 1.1368 0.5269  -0.2851 0.0052  67  GLU B N   
2731 C CA  . GLU B 67  ? 2.2073 0.9582 1.1720 0.5481  -0.2945 0.0133  67  GLU B CA  
2732 C C   . GLU B 67  ? 2.2877 1.0564 1.2582 0.5604  -0.3086 -0.0089 67  GLU B C   
2733 O O   . GLU B 67  ? 2.3551 1.0860 1.2831 0.5993  -0.3230 -0.0161 67  GLU B O   
2734 C CB  . GLU B 67  ? 2.2913 0.9586 1.2585 0.5096  -0.2810 0.0396  67  GLU B CB  
2735 C CG  . GLU B 67  ? 2.6178 1.1796 1.5297 0.5316  -0.2849 0.0517  67  GLU B CG  
2736 C CD  . GLU B 67  ? 2.7782 1.2648 1.7038 0.4897  -0.2706 0.0697  67  GLU B CD  
2737 O OE1 . GLU B 67  ? 2.7476 1.2663 1.7271 0.4493  -0.2661 0.0655  67  GLU B OE1 
2738 O OE2 . GLU B 67  ? 2.9139 1.3081 1.7960 0.4979  -0.2634 0.0864  67  GLU B OE2 
2739 N N   . LEU B 68  ? 2.3187 1.1437 1.3405 0.5275  -0.3041 -0.0198 68  LEU B N   
2740 C CA  . LEU B 68  ? 2.3091 1.1538 1.3385 0.5339  -0.3151 -0.0408 68  LEU B CA  
2741 C C   . LEU B 68  ? 2.4602 1.3928 1.4960 0.5634  -0.3227 -0.0721 68  LEU B C   
2742 O O   . LEU B 68  ? 2.4905 1.4270 1.5077 0.5930  -0.3370 -0.0925 68  LEU B O   
2743 C CB  . LEU B 68  ? 2.0704 0.9267 1.1452 0.4860  -0.3065 -0.0373 68  LEU B CB  
2744 C CG  . LEU B 68  ? 1.9604 0.7402 1.0394 0.4529  -0.2978 -0.0111 68  LEU B CG  
2745 C CD1 . LEU B 68  ? 1.8503 0.6446 0.9724 0.4111  -0.2934 -0.0117 68  LEU B CD1 
2746 C CD2 . LEU B 68  ? 1.9771 0.6648 1.0121 0.4748  -0.3057 -0.0034 68  LEU B CD2 
2747 N N   . THR B 69  ? 2.6323 1.6373 1.6977 0.5542  -0.3123 -0.0786 69  THR B N   
2748 C CA  . THR B 69  ? 2.8152 1.9051 1.8881 0.5842  -0.3173 -0.1113 69  THR B CA  
2749 C C   . THR B 69  ? 3.1311 2.1959 2.1534 0.6370  -0.3320 -0.1148 69  THR B C   
2750 O O   . THR B 69  ? 3.2206 2.3182 2.2416 0.6506  -0.3288 -0.1162 69  THR B O   
2751 C CB  . THR B 69  ? 2.6974 1.8714 1.8195 0.5589  -0.2999 -0.1182 69  THR B CB  
2752 O OG1 . THR B 69  ? 2.6596 1.8417 1.8227 0.5086  -0.2858 -0.1082 69  THR B OG1 
2753 C CG2 . THR B 69  ? 2.6437 1.9111 1.7823 0.5853  -0.3023 -0.1587 69  THR B CG2 
2754 N N   . LYS B 70  ? 3.2681 2.2726 2.2474 0.6676  -0.3485 -0.1164 70  LYS B N   
2755 C CA  . LYS B 70  ? 3.3710 2.3383 2.2939 0.7214  -0.3648 -0.1184 70  LYS B CA  
2756 C C   . LYS B 70  ? 3.5153 2.5707 2.4443 0.7567  -0.3716 -0.1501 70  LYS B C   
2757 O O   . LYS B 70  ? 3.5862 2.6259 2.4774 0.7925  -0.3792 -0.1463 70  LYS B O   
2758 C CB  . LYS B 70  ? 3.3077 2.2186 2.1945 0.7499  -0.3825 -0.1257 70  LYS B CB  
2759 C CG  . LYS B 70  ? 3.1714 2.1380 2.0916 0.7424  -0.3873 -0.1557 70  LYS B CG  
2760 C CD  . LYS B 70  ? 3.0822 2.1378 2.0106 0.7791  -0.3984 -0.1979 70  LYS B CD  
2761 C CE  . LYS B 70  ? 2.9703 2.0762 1.9281 0.7710  -0.4010 -0.2287 70  LYS B CE  
2762 N NZ  . LYS B 70  ? 2.9671 2.0073 1.8929 0.7900  -0.4174 -0.2288 70  LYS B NZ  
2763 N N   . ASN B 71  ? 3.5572 2.7041 2.5334 0.7465  -0.3680 -0.1826 71  ASN B N   
2764 C CA  . ASN B 71  ? 3.5717 2.8152 2.5676 0.7736  -0.3709 -0.2196 71  ASN B CA  
2765 C C   . ASN B 71  ? 3.4652 2.8004 2.5244 0.7400  -0.3551 -0.2466 71  ASN B C   
2766 O O   . ASN B 71  ? 3.4571 2.7770 2.5343 0.7056  -0.3475 -0.2396 71  ASN B O   
2767 C CB  . ASN B 71  ? 3.6597 2.9024 2.6142 0.8359  -0.3969 -0.2485 71  ASN B CB  
2768 C CG  . ASN B 71  ? 3.7180 2.9098 2.6149 0.8801  -0.4104 -0.2336 71  ASN B CG  
2769 O OD1 . ASN B 71  ? 3.7840 2.9263 2.6288 0.9269  -0.4321 -0.2386 71  ASN B OD1 
2770 N ND2 . ASN B 71  ? 3.6840 2.8859 2.5880 0.8660  -0.3974 -0.2153 71  ASN B ND2 
2771 N N   . GLU B 72  ? 3.3595 2.7882 2.4510 0.7506  -0.3494 -0.2783 72  GLU B N   
2772 C CA  . GLU B 72  ? 3.2040 2.7207 2.3552 0.7189  -0.3301 -0.3059 72  GLU B CA  
2773 C C   . GLU B 72  ? 3.1927 2.7382 2.3461 0.7348  -0.3384 -0.3429 72  GLU B C   
2774 O O   . GLU B 72  ? 3.2262 2.8599 2.4128 0.7438  -0.3323 -0.3866 72  GLU B O   
2775 C CB  . GLU B 72  ? 3.1010 2.7104 2.2895 0.7260  -0.3195 -0.3322 72  GLU B CB  
2776 N N   . SER B 73  ? 3.1174 2.5898 2.2378 0.7371  -0.3509 -0.3274 73  SER B N   
2777 C CA  . SER B 73  ? 3.0359 2.5277 2.1550 0.7517  -0.3600 -0.3602 73  SER B CA  
2778 C C   . SER B 73  ? 2.9255 2.4799 2.0932 0.7092  -0.3364 -0.3783 73  SER B C   
2779 O O   . SER B 73  ? 2.8980 2.5128 2.0821 0.7210  -0.3356 -0.4211 73  SER B O   
2780 C CB  . SER B 73  ? 3.0657 2.4618 2.1419 0.7587  -0.3767 -0.3362 73  SER B CB  
2781 N N   . CYS B 74  ? 2.8455 2.3833 2.0348 0.6601  -0.3165 -0.3465 74  CYS B N   
2782 C CA  . CYS B 74  ? 2.7213 2.3045 1.9494 0.6178  -0.2927 -0.3568 74  CYS B CA  
2783 C C   . CYS B 74  ? 2.5994 2.2771 1.8746 0.6072  -0.2704 -0.3843 74  CYS B C   
2784 O O   . CYS B 74  ? 2.4773 2.1887 1.7868 0.5667  -0.2453 -0.3854 74  CYS B O   
2785 C CB  . CYS B 74  ? 2.6966 2.2200 1.9268 0.5718  -0.2827 -0.3126 74  CYS B CB  
2786 S SG  . CYS B 74  ? 4.7548 4.1650 3.9363 0.5806  -0.3061 -0.2796 74  CYS B SG  
2787 N N   . GLU B 79  ? 2.8553 1.9590 2.8105 0.2750  -0.6594 -0.0547 79  GLU B N   
2788 C CA  . GLU B 79  ? 2.8253 1.9621 2.8528 0.2800  -0.6519 -0.0666 79  GLU B CA  
2789 C C   . GLU B 79  ? 2.8781 1.9993 2.8188 0.2825  -0.6634 -0.0745 79  GLU B C   
2790 O O   . GLU B 79  ? 2.9425 2.0345 2.8990 0.2881  -0.7143 -0.0756 79  GLU B O   
2791 C CB  . GLU B 79  ? 2.7063 1.9111 2.7950 0.2762  -0.5821 -0.0760 79  GLU B CB  
2792 C CG  . GLU B 79  ? 2.6449 1.8892 2.7888 0.2797  -0.5656 -0.0866 79  GLU B CG  
2793 C CD  . GLU B 79  ? 2.6390 1.8651 2.8813 0.2901  -0.6162 -0.0859 79  GLU B CD  
2794 O OE1 . GLU B 79  ? 2.6507 1.8514 2.9691 0.2910  -0.6451 -0.0783 79  GLU B OE1 
2795 O OE2 . GLU B 79  ? 2.6005 1.8375 2.8533 0.2973  -0.6281 -0.0921 79  GLU B OE2 
2796 N N   . THR B 80  ? 2.7994 1.9388 2.6561 0.2774  -0.6157 -0.0802 80  THR B N   
2797 C CA  . THR B 80  ? 2.6920 1.8180 2.4711 0.2761  -0.6164 -0.0892 80  THR B CA  
2798 C C   . THR B 80  ? 2.6905 1.7633 2.3289 0.2698  -0.6118 -0.0859 80  THR B C   
2799 O O   . THR B 80  ? 2.6148 1.6973 2.1943 0.2639  -0.5677 -0.0915 80  THR B O   
2800 C CB  . THR B 80  ? 2.5590 1.7497 2.3729 0.2721  -0.5617 -0.0981 80  THR B CB  
2801 N N   . SER B 81  ? 2.7583 1.7716 2.3480 0.2697  -0.6576 -0.0753 81  SER B N   
2802 C CA  . SER B 81  ? 2.8086 1.7660 2.2645 0.2638  -0.6526 -0.0697 81  SER B CA  
2803 C C   . SER B 81  ? 2.9132 1.7981 2.2613 0.2579  -0.6936 -0.0750 81  SER B C   
2804 O O   . SER B 81  ? 2.9506 1.7848 2.2849 0.2562  -0.7584 -0.0669 81  SER B O   
2805 C CB  . SER B 81  ? 2.7979 1.7372 2.2611 0.2643  -0.6709 -0.0517 81  SER B CB  
2806 O OG  . SER B 81  ? 2.7762 1.7062 2.3274 0.2658  -0.7296 -0.0431 81  SER B OG  
2807 N N   . PHE B 82  ? 2.9080 1.7851 2.1824 0.2522  -0.6554 -0.0886 82  PHE B N   
2808 C CA  . PHE B 82  ? 2.9336 1.7392 2.0945 0.2429  -0.6809 -0.0986 82  PHE B CA  
2809 C C   . PHE B 82  ? 2.8216 1.6249 1.9161 0.2344  -0.6178 -0.1128 82  PHE B C   
2810 O O   . PHE B 82  ? 2.7739 1.6183 1.9202 0.2326  -0.5963 -0.1271 82  PHE B O   
2811 C CB  . PHE B 82  ? 2.9776 1.7846 2.1951 0.2458  -0.7335 -0.1080 82  PHE B CB  
2812 N N   . ILE B 83  ? 2.7452 1.5000 1.7350 0.2288  -0.5876 -0.1074 83  ILE B N   
2813 C CA  . ILE B 83  ? 2.5753 1.3157 1.5062 0.2196  -0.5245 -0.1190 83  ILE B CA  
2814 C C   . ILE B 83  ? 2.7055 1.3890 1.5564 0.2057  -0.5348 -0.1394 83  ILE B C   
2815 O O   . ILE B 83  ? 2.7231 1.3790 1.5597 0.2044  -0.5945 -0.1440 83  ILE B O   
2816 C CB  . ILE B 83  ? 2.3817 1.0757 1.2233 0.2193  -0.4892 -0.1073 83  ILE B CB  
2817 N N   . THR B 84  ? 2.7172 1.3803 1.5214 0.1940  -0.4761 -0.1520 84  THR B N   
2818 C CA  . THR B 84  ? 2.6896 1.3035 1.4283 0.1776  -0.4726 -0.1757 84  THR B CA  
2819 C C   . THR B 84  ? 2.8378 1.3564 1.4307 0.1628  -0.4317 -0.1818 84  THR B C   
2820 O O   . THR B 84  ? 2.8607 1.3803 1.4532 0.1628  -0.3719 -0.1755 84  THR B O   
2821 C CB  . THR B 84  ? 2.5489 1.2328 1.3956 0.1724  -0.4335 -0.1899 84  THR B CB  
2822 O OG1 . THR B 84  ? 2.4403 1.2037 1.4130 0.1851  -0.4737 -0.1867 84  THR B OG1 
2823 C CG2 . THR B 84  ? 2.6922 1.3229 1.4734 0.1527  -0.4184 -0.2168 84  THR B CG2 
2824 N N   . ASN B 85  ? 2.9431 1.3744 1.4113 0.1493  -0.4639 -0.1939 85  ASN B N   
2825 C CA  . ASN B 85  ? 3.0845 1.4135 1.4006 0.1318  -0.4230 -0.2027 85  ASN B CA  
2826 C C   . ASN B 85  ? 3.0103 1.3471 1.3576 0.1195  -0.3402 -0.2212 85  ASN B C   
2827 O O   . ASN B 85  ? 2.9099 1.2786 1.3186 0.1099  -0.3327 -0.2421 85  ASN B O   
2828 C CB  . ASN B 85  ? 3.3192 1.5541 1.4980 0.1139  -0.4725 -0.2172 85  ASN B CB  
2829 C CG  . ASN B 85  ? 3.5722 1.6888 1.5709 0.0963  -0.4417 -0.2194 85  ASN B CG  
2830 O OD1 . ASN B 85  ? 3.6158 1.7191 1.6004 0.0972  -0.3718 -0.2155 85  ASN B OD1 
2831 N ND2 . ASN B 85  ? 3.7436 1.7690 1.6028 0.0796  -0.4948 -0.2245 85  ASN B ND2 
2832 N N   . GLY B 86  ? 3.0688 1.3768 1.3848 0.1197  -0.2790 -0.2122 86  GLY B N   
2833 C CA  . GLY B 86  ? 3.0483 1.3650 1.4174 0.1084  -0.1997 -0.2239 86  GLY B CA  
2834 C C   . GLY B 86  ? 2.8978 1.3215 1.4277 0.1233  -0.1834 -0.2060 86  GLY B C   
2835 O O   . GLY B 86  ? 2.8589 1.3600 1.5071 0.1206  -0.1878 -0.2124 86  GLY B O   
2836 N N   . SER B 87  ? 2.7056 1.1326 1.2381 0.1384  -0.1657 -0.1830 87  SER B N   
2837 C CA  . SER B 87  ? 2.4345 0.9537 1.1027 0.1510  -0.1529 -0.1649 87  SER B CA  
2838 C C   . SER B 87  ? 2.4415 0.9293 1.0944 0.1580  -0.1004 -0.1489 87  SER B C   
2839 O O   . SER B 87  ? 2.3149 0.7886 1.0046 0.1467  -0.0416 -0.1519 87  SER B O   
2840 C CB  . SER B 87  ? 2.3724 0.9586 1.0922 0.1699  -0.2168 -0.1503 87  SER B CB  
2841 O OG  . SER B 87  ? 2.2599 0.8988 1.0515 0.1842  -0.2014 -0.1294 87  SER B OG  
2842 N N   . CYS B 88  ? 2.5426 1.0204 1.1519 0.1766  -0.1237 -0.1308 88  CYS B N   
2843 C CA  . CYS B 88  ? 2.5857 1.0265 1.1680 0.1879  -0.0815 -0.1148 88  CYS B CA  
2844 C C   . CYS B 88  ? 2.6890 1.0951 1.1817 0.2022  -0.1224 -0.1017 88  CYS B C   
2845 O O   . CYS B 88  ? 2.6770 1.1386 1.2102 0.2122  -0.1783 -0.0931 88  CYS B O   
2846 C CB  . CYS B 88  ? 2.4364 0.9586 1.1469 0.1991  -0.0649 -0.0980 88  CYS B CB  
2847 S SG  . CYS B 88  ? 4.2209 2.7815 3.0474 0.1791  -0.0171 -0.1044 88  CYS B SG  
2848 N N   . LEU B 89  ? 2.6776 0.9911 1.0550 0.2018  -0.0947 -0.0992 89  LEU B N   
2849 C CA  . LEU B 89  ? 2.6770 0.9556 0.9679 0.2119  -0.1381 -0.0841 89  LEU B CA  
2850 C C   . LEU B 89  ? 2.7283 0.9590 0.9693 0.2273  -0.1030 -0.0653 89  LEU B C   
2851 O O   . LEU B 89  ? 2.8331 0.9687 0.9437 0.2202  -0.0899 -0.0659 89  LEU B O   
2852 C CB  . LEU B 89  ? 2.7827 0.9888 0.9470 0.1925  -0.1782 -0.0977 89  LEU B CB  
2853 C CG  . LEU B 89  ? 2.8461 1.1073 1.0679 0.1841  -0.2338 -0.1107 89  LEU B CG  
2854 C CD1 . LEU B 89  ? 3.1803 1.3583 1.2703 0.1628  -0.2701 -0.1264 89  LEU B CD1 
2855 C CD2 . LEU B 89  ? 2.6741 1.0196 0.9931 0.2014  -0.2926 -0.0920 89  LEU B CD2 
2856 N N   . ALA B 90  ? 2.7404 1.0364 1.0855 0.2481  -0.0877 -0.0488 90  ALA B N   
2857 C CA  . ALA B 90  ? 2.7131 0.9972 1.0404 0.2695  -0.0846 -0.0258 90  ALA B CA  
2858 C C   . ALA B 90  ? 2.7518 1.1115 1.1384 0.2778  -0.1540 -0.0142 90  ALA B C   
2859 O O   . ALA B 90  ? 2.4989 0.9205 0.9716 0.2966  -0.1565 0.0010  90  ALA B O   
2860 C CB  . ALA B 90  ? 2.3890 0.7000 0.8046 0.2870  -0.0281 -0.0162 90  ALA B CB  
2861 N N   . SER B 91  ? 2.9103 1.2600 1.2538 0.2622  -0.2096 -0.0224 91  SER B N   
2862 C CA  . SER B 91  ? 2.8393 1.2648 1.2675 0.2643  -0.2732 -0.0178 91  SER B CA  
2863 C C   . SER B 91  ? 2.9333 1.3477 1.3331 0.2684  -0.3316 0.0028  91  SER B C   
2864 O O   . SER B 91  ? 2.8506 1.2964 1.2923 0.2628  -0.3929 0.0047  91  SER B O   
2865 C CB  . SER B 91  ? 2.8030 1.2330 1.2315 0.2461  -0.3036 -0.0381 91  SER B CB  
2866 N N   . ARG B 92  ? 3.0979 1.4676 1.4364 0.2779  -0.3136 0.0199  92  ARG B N   
2867 C CA  . ARG B 92  ? 3.2333 1.6052 1.5695 0.2821  -0.3674 0.0441  92  ARG B CA  
2868 C C   . ARG B 92  ? 3.2464 1.7263 1.7446 0.2966  -0.3838 0.0516  92  ARG B C   
2869 O O   . ARG B 92  ? 3.3288 1.8319 1.8678 0.3038  -0.4156 0.0724  92  ARG B O   
2870 C CB  . ARG B 92  ? 3.2407 1.5521 1.4932 0.2920  -0.3372 0.0622  92  ARG B CB  
2871 N N   . LYS B 93  ? 3.0355 1.5795 1.6268 0.2983  -0.3606 0.0346  93  LYS B N   
2872 C CA  . LYS B 93  ? 2.7597 1.4014 1.4977 0.3085  -0.3656 0.0371  93  LYS B CA  
2873 C C   . LYS B 93  ? 2.5672 1.2657 1.3852 0.3010  -0.3619 0.0176  93  LYS B C   
2874 O O   . LYS B 93  ? 2.3831 1.1563 1.3155 0.3047  -0.3703 0.0172  93  LYS B O   
2875 C CB  . LYS B 93  ? 2.6312 1.3026 1.4150 0.3286  -0.3133 0.0456  93  LYS B CB  
2876 N N   . THR B 94  ? 2.5803 1.2437 1.3418 0.2892  -0.3469 0.0013  94  THR B N   
2877 C CA  . THR B 94  ? 2.4119 1.1305 1.2512 0.2819  -0.3411 -0.0152 94  THR B CA  
2878 C C   . THR B 94  ? 2.3398 1.0666 1.2003 0.2721  -0.4020 -0.0212 94  THR B C   
2879 O O   . THR B 94  ? 2.1422 0.9341 1.1040 0.2713  -0.4116 -0.0278 94  THR B O   
2880 C CB  . THR B 94  ? 2.3727 1.0611 1.1688 0.2727  -0.2938 -0.0300 94  THR B CB  
2881 O OG1 . THR B 94  ? 2.3609 0.9994 1.0849 0.2577  -0.3214 -0.0430 94  THR B OG1 
2882 C CG2 . THR B 94  ? 2.4785 1.1120 1.2084 0.2796  -0.2420 -0.0230 94  THR B CG2 
2883 N N   . SER B 95  ? 2.5447 1.2001 1.3078 0.2638  -0.4434 -0.0182 95  SER B N   
2884 C CA  . SER B 95  ? 2.6500 1.3019 1.4320 0.2552  -0.5104 -0.0201 95  SER B CA  
2885 C C   . SER B 95  ? 2.6947 1.4034 1.5921 0.2626  -0.5453 -0.0055 95  SER B C   
2886 O O   . SER B 95  ? 2.6288 1.3547 1.5914 0.2584  -0.5950 -0.0062 95  SER B O   
2887 C CB  . SER B 95  ? 2.7879 1.3422 1.4313 0.2424  -0.5526 -0.0154 95  SER B CB  
2888 O OG  . SER B 95  ? 2.7859 1.2827 1.3246 0.2318  -0.5186 -0.0335 95  SER B OG  
2889 N N   . PHE B 96  ? 2.8059 1.5424 1.7361 0.2736  -0.5163 0.0069  96  PHE B N   
2890 C CA  . PHE B 96  ? 2.8226 1.6080 1.8607 0.2787  -0.5423 0.0208  96  PHE B CA  
2891 C C   . PHE B 96  ? 2.7371 1.6006 1.9116 0.2794  -0.5361 0.0088  96  PHE B C   
2892 O O   . PHE B 96  ? 2.6935 1.5651 1.8785 0.2742  -0.5380 -0.0062 96  PHE B O   
2893 C CB  . PHE B 96  ? 2.8471 1.6491 1.8915 0.2915  -0.5029 0.0331  96  PHE B CB  
2894 C CG  . PHE B 96  ? 2.9260 1.7190 1.9919 0.2921  -0.5453 0.0563  96  PHE B CG  
2895 C CD1 . PHE B 96  ? 3.0484 1.7796 2.0094 0.2938  -0.5502 0.0733  96  PHE B CD1 
2896 C CD2 . PHE B 96  ? 2.9501 1.7949 2.1472 0.2891  -0.5783 0.0620  96  PHE B CD2 
2897 C CE1 . PHE B 96  ? 3.1734 1.8998 2.1609 0.2923  -0.5921 0.0980  96  PHE B CE1 
2898 C CE2 . PHE B 96  ? 3.0433 1.8826 2.2762 0.2868  -0.6186 0.0853  96  PHE B CE2 
2899 C CZ  . PHE B 96  ? 3.1466 1.9291 2.2751 0.2882  -0.6280 0.1046  96  PHE B CZ  
2900 N N   . MET B 97  ? 2.7564 1.6764 2.0361 0.2849  -0.5260 0.0149  97  MET B N   
2901 C CA  . MET B 97  ? 2.7197 1.7090 2.1278 0.2833  -0.5146 0.0034  97  MET B CA  
2902 C C   . MET B 97  ? 2.6445 1.6645 2.0494 0.2826  -0.4661 -0.0143 97  MET B C   
2903 O O   . MET B 97  ? 2.6285 1.6941 2.1175 0.2783  -0.4609 -0.0251 97  MET B O   
2904 C CB  . MET B 97  ? 2.6961 1.7378 2.2022 0.2877  -0.4939 0.0092  97  MET B CB  
2905 C CG  . MET B 97  ? 2.7354 1.7640 2.2915 0.2848  -0.5439 0.0277  97  MET B CG  
2906 S SD  . MET B 97  ? 3.4259 2.5247 3.1155 0.2880  -0.5112 0.0297  97  MET B SD  
2907 C CE  . MET B 97  ? 2.6183 1.6906 2.3637 0.2803  -0.5815 0.0559  97  MET B CE  
2908 N N   . MET B 98  ? 2.5199 1.5124 1.8332 0.2853  -0.4304 -0.0156 98  MET B N   
2909 C CA  . MET B 98  ? 2.2615 1.2820 1.5794 0.2819  -0.3841 -0.0279 98  MET B CA  
2910 C C   . MET B 98  ? 2.3371 1.3523 1.6503 0.2730  -0.4018 -0.0401 98  MET B C   
2911 O O   . MET B 98  ? 2.3204 1.3610 1.6468 0.2672  -0.3694 -0.0488 98  MET B O   
2912 C CB  . MET B 98  ? 2.1204 1.1058 1.3555 0.2863  -0.3417 -0.0240 98  MET B CB  
2913 C CG  . MET B 98  ? 2.0537 1.0388 1.2890 0.2987  -0.3262 -0.0108 98  MET B CG  
2914 S SD  . MET B 98  ? 2.0897 1.0669 1.2939 0.3055  -0.2616 -0.0083 98  MET B SD  
2915 C CE  . MET B 98  ? 3.7247 2.7815 3.0323 0.2959  -0.2358 -0.0179 98  MET B CE  
2916 N N   . ALA B 99  ? 2.0637 1.2926 1.5814 0.4854  -0.1106 -0.3986 99  ALA B N   
2917 C CA  . ALA B 99  ? 1.9929 1.2813 1.5893 0.4864  -0.1336 -0.4175 99  ALA B CA  
2918 C C   . ALA B 99  ? 1.8475 1.1763 1.4991 0.4324  -0.1283 -0.4189 99  ALA B C   
2919 O O   . ALA B 99  ? 1.6697 1.0353 1.3813 0.4065  -0.1383 -0.4143 99  ALA B O   
2920 C CB  . ALA B 99  ? 2.0417 1.3499 1.6508 0.5492  -0.1523 -0.4607 99  ALA B CB  
2921 N N   . LEU B 100 ? 1.8997 1.2172 1.5259 0.4182  -0.1109 -0.4241 100 LEU B N   
2922 C CA  . LEU B 100 ? 1.8415 1.1900 1.5099 0.3729  -0.1010 -0.4237 100 LEU B CA  
2923 C C   . LEU B 100 ? 1.8288 1.1590 1.4849 0.3188  -0.0902 -0.3852 100 LEU B C   
2924 O O   . LEU B 100 ? 1.7615 1.1165 1.4555 0.2807  -0.0835 -0.3788 100 LEU B O   
2925 C CB  . LEU B 100 ? 1.8567 1.1941 1.4924 0.3817  -0.0857 -0.4403 100 LEU B CB  
2926 C CG  . LEU B 100 ? 1.8128 1.1850 1.4926 0.3507  -0.0732 -0.4469 100 LEU B CG  
2927 C CD1 . LEU B 100 ? 1.7553 1.0950 1.3964 0.3029  -0.0546 -0.4146 100 LEU B CD1 
2928 C CD2 . LEU B 100 ? 1.7932 1.2260 1.5699 0.3395  -0.0843 -0.4594 100 LEU B CD2 
2929 N N   . CYS B 101 ? 1.8795 1.1656 1.4831 0.3183  -0.0879 -0.3602 101 CYS B N   
2930 C CA  . CYS B 101 ? 1.7542 1.0209 1.3424 0.2710  -0.0803 -0.3255 101 CYS B CA  
2931 C C   . CYS B 101 ? 1.5121 0.8064 1.1448 0.2572  -0.0934 -0.3095 101 CYS B C   
2932 O O   . CYS B 101 ? 1.4056 0.7175 1.0640 0.2170  -0.0912 -0.2951 101 CYS B O   
2933 C CB  . CYS B 101 ? 1.8194 1.0273 1.3381 0.2754  -0.0705 -0.3067 101 CYS B CB  
2934 S SG  . CYS B 101 ? 1.9077 1.0920 1.4109 0.2209  -0.0650 -0.2672 101 CYS B SG  
2935 N N   . LEU B 102 ? 1.4686 0.7631 1.1043 0.2945  -0.1066 -0.3119 102 LEU B N   
2936 C CA  . LEU B 102 ? 1.5662 0.8843 1.2386 0.2890  -0.1209 -0.2976 102 LEU B CA  
2937 C C   . LEU B 102 ? 1.5398 0.9088 1.2821 0.2759  -0.1307 -0.3153 102 LEU B C   
2938 O O   . LEU B 102 ? 1.3676 0.7540 1.1372 0.2434  -0.1326 -0.2977 102 LEU B O   
2939 C CB  . LEU B 102 ? 1.6113 0.9161 1.2681 0.3414  -0.1335 -0.2999 102 LEU B CB  
2940 C CG  . LEU B 102 ? 1.5732 0.8268 1.1688 0.3545  -0.1212 -0.2735 102 LEU B CG  
2941 C CD1 . LEU B 102 ? 1.3819 0.6233 0.9681 0.3000  -0.1091 -0.2390 102 LEU B CD1 
2942 C CD2 . LEU B 102 ? 1.6779 0.8932 1.2219 0.3850  -0.1081 -0.2893 102 LEU B CD2 
2943 N N   . SER B 103 ? 1.6636 1.0560 1.4358 0.3021  -0.1361 -0.3506 103 SER B N   
2944 C CA  . SER B 103 ? 1.6546 1.0954 1.5018 0.2885  -0.1418 -0.3702 103 SER B CA  
2945 C C   . SER B 103 ? 1.6285 1.0747 1.4866 0.2343  -0.1224 -0.3508 103 SER B C   
2946 O O   . SER B 103 ? 1.5314 1.0001 1.4315 0.2092  -0.1243 -0.3416 103 SER B O   
2947 C CB  . SER B 103 ? 1.7256 1.1893 1.6004 0.3185  -0.1443 -0.4105 103 SER B CB  
2948 O OG  . SER B 103 ? 1.7098 1.2143 1.6531 0.2909  -0.1370 -0.4233 103 SER B OG  
2949 N N   . SER B 104 ? 1.6488 1.0699 1.4634 0.2202  -0.1036 -0.3450 104 SER B N   
2950 C CA  . SER B 104 ? 1.5487 0.9665 1.3596 0.1764  -0.0842 -0.3281 104 SER B CA  
2951 C C   . SER B 104 ? 1.4620 0.8642 1.2519 0.1447  -0.0848 -0.2941 104 SER B C   
2952 O O   . SER B 104 ? 1.5201 0.9398 1.3395 0.1169  -0.0796 -0.2838 104 SER B O   
2953 C CB  . SER B 104 ? 1.5532 0.9393 1.3096 0.1766  -0.0685 -0.3301 104 SER B CB  
2954 O OG  . SER B 104 ? 1.6994 1.0478 1.3990 0.1999  -0.0742 -0.3264 104 SER B OG  
2955 N N   . ILE B 105 ? 1.3136 0.6822 1.0528 0.1500  -0.0896 -0.2769 105 ILE B N   
2956 C CA  . ILE B 105 ? 1.2967 0.6545 1.0197 0.1241  -0.0928 -0.2459 105 ILE B CA  
2957 C C   . ILE B 105 ? 1.2503 0.6413 1.0209 0.1179  -0.1034 -0.2400 105 ILE B C   
2958 O O   . ILE B 105 ? 1.2161 0.6129 0.9912 0.0864  -0.0988 -0.2225 105 ILE B O   
2959 C CB  . ILE B 105 ? 1.3287 0.6553 1.0108 0.1415  -0.0985 -0.2316 105 ILE B CB  
2960 C CG1 . ILE B 105 ? 1.3591 0.6433 0.9867 0.1332  -0.0861 -0.2278 105 ILE B CG1 
2961 C CG2 . ILE B 105 ? 1.2058 0.5362 0.8906 0.1233  -0.1059 -0.2025 105 ILE B CG2 
2962 C CD1 . ILE B 105 ? 1.4302 0.6797 1.0213 0.1422  -0.0862 -0.2090 105 ILE B CD1 
2963 N N   . TYR B 106 ? 1.3146 0.7242 1.1162 0.1511  -0.1186 -0.2555 106 TYR B N   
2964 C CA  . TYR B 106 ? 1.3108 0.7491 1.1575 0.1487  -0.1309 -0.2531 106 TYR B CA  
2965 C C   . TYR B 106 ? 1.2675 0.7295 1.1569 0.1195  -0.1182 -0.2603 106 TYR B C   
2966 O O   . TYR B 106 ? 1.0944 0.5646 0.9962 0.0951  -0.1160 -0.2435 106 TYR B O   
2967 C CB  . TYR B 106 ? 1.3411 0.7946 1.2169 0.1938  -0.1517 -0.2768 106 TYR B CB  
2968 C CG  . TYR B 106 ? 1.3317 0.8107 1.2526 0.1939  -0.1675 -0.2764 106 TYR B CG  
2969 C CD1 . TYR B 106 ? 1.3310 0.8009 1.2303 0.1957  -0.1777 -0.2493 106 TYR B CD1 
2970 C CD2 . TYR B 106 ? 1.2783 0.7897 1.2649 0.1917  -0.1712 -0.3027 106 TYR B CD2 
2971 C CE1 . TYR B 106 ? 1.3143 0.8034 1.2482 0.1972  -0.1927 -0.2484 106 TYR B CE1 
2972 C CE2 . TYR B 106 ? 1.2259 0.7557 1.2529 0.1906  -0.1858 -0.3030 106 TYR B CE2 
2973 C CZ  . TYR B 106 ? 1.3507 0.8675 1.3470 0.1943  -0.1972 -0.2757 106 TYR B CZ  
2974 O OH  . TYR B 106 ? 1.4823 1.0135 1.5123 0.1954  -0.2126 -0.2755 106 TYR B OH  
2975 N N   . GLU B 107 ? 1.4021 0.8734 1.3119 0.1243  -0.1074 -0.2844 107 GLU B N   
2976 C CA  . GLU B 107 ? 1.4928 0.9838 1.4440 0.0993  -0.0890 -0.2905 107 GLU B CA  
2977 C C   . GLU B 107 ? 1.5263 0.9954 1.4375 0.0633  -0.0704 -0.2625 107 GLU B C   
2978 O O   . GLU B 107 ? 1.6089 1.0882 1.5456 0.0409  -0.0555 -0.2562 107 GLU B O   
2979 C CB  . GLU B 107 ? 1.4822 0.9845 1.4542 0.1136  -0.0784 -0.3185 107 GLU B CB  
2980 C CG  . GLU B 107 ? 1.5746 1.1131 1.6234 0.1035  -0.0663 -0.3359 107 GLU B CG  
2981 C CD  . GLU B 107 ? 1.6820 1.2507 1.7953 0.1166  -0.0880 -0.3521 107 GLU B CD  
2982 O OE1 . GLU B 107 ? 1.6661 1.2580 1.8414 0.0980  -0.0780 -0.3563 107 GLU B OE1 
2983 O OE2 . GLU B 107 ? 1.7438 1.3095 1.8440 0.1474  -0.1144 -0.3602 107 GLU B OE2 
2984 N N   . ASP B 108 ? 1.3770 0.8137 1.2252 0.0596  -0.0712 -0.2467 108 ASP B N   
2985 C CA  . ASP B 108 ? 1.2785 0.6933 1.0855 0.0292  -0.0601 -0.2227 108 ASP B CA  
2986 C C   . ASP B 108 ? 1.2063 0.6294 1.0192 0.0149  -0.0687 -0.2016 108 ASP B C   
2987 O O   . ASP B 108 ? 1.2247 0.6495 1.0394 -0.0065 -0.0567 -0.1906 108 ASP B O   
2988 C CB  . ASP B 108 ? 1.2901 0.6687 1.0351 0.0286  -0.0630 -0.2136 108 ASP B CB  
2989 C CG  . ASP B 108 ? 1.4691 0.8303 1.1915 0.0355  -0.0499 -0.2291 108 ASP B CG  
2990 O OD1 . ASP B 108 ? 1.5582 0.9387 1.3147 0.0410  -0.0372 -0.2457 108 ASP B OD1 
2991 O OD2 . ASP B 108 ? 1.4956 0.8230 1.1671 0.0354  -0.0514 -0.2243 108 ASP B OD2 
2992 N N   . LEU B 109 ? 1.1398 0.5658 0.9513 0.0301  -0.0881 -0.1952 109 LEU B N   
2993 C CA  . LEU B 109 ? 1.1910 0.6248 1.0032 0.0206  -0.0978 -0.1739 109 LEU B CA  
2994 C C   . LEU B 109 ? 1.2567 0.7143 1.1156 0.0144  -0.0934 -0.1792 109 LEU B C   
2995 O O   . LEU B 109 ? 1.3733 0.8331 1.2258 -0.0012 -0.0930 -0.1609 109 LEU B O   
2996 C CB  . LEU B 109 ? 1.1767 0.6104 0.9839 0.0459  -0.1177 -0.1675 109 LEU B CB  
2997 C CG  . LEU B 109 ? 1.1086 0.5164 0.8700 0.0474  -0.1202 -0.1517 109 LEU B CG  
2998 C CD1 . LEU B 109 ? 1.0453 0.4492 0.7831 0.0202  -0.1210 -0.1241 109 LEU B CD1 
2999 C CD2 . LEU B 109 ? 1.0998 0.4846 0.8366 0.0453  -0.1085 -0.1647 109 LEU B CD2 
3000 N N   . LYS B 110 ? 1.1978 0.6731 1.1051 0.0270  -0.0898 -0.2051 110 LYS B N   
3001 C CA  . LYS B 110 ? 1.2270 0.7241 1.1888 0.0204  -0.0847 -0.2129 110 LYS B CA  
3002 C C   . LYS B 110 ? 1.2291 0.7188 1.1868 -0.0081 -0.0558 -0.2032 110 LYS B C   
3003 O O   . LYS B 110 ? 1.1314 0.6261 1.1085 -0.0214 -0.0473 -0.1948 110 LYS B O   
3004 C CB  . LYS B 110 ? 1.1592 0.6808 1.1832 0.0424  -0.0910 -0.2465 110 LYS B CB  
3005 C CG  . LYS B 110 ? 1.2535 0.7981 1.3437 0.0368  -0.0907 -0.2570 110 LYS B CG  
3006 C CD  . LYS B 110 ? 1.3993 0.9701 1.5511 0.0658  -0.1111 -0.2920 110 LYS B CD  
3007 C CE  . LYS B 110 ? 1.5070 1.0941 1.6976 0.0688  -0.0957 -0.3186 110 LYS B CE  
3008 N NZ  . LYS B 110 ? 1.4830 1.1007 1.7411 0.0977  -0.1180 -0.3568 110 LYS B NZ  
3009 N N   . MET B 111 ? 1.2284 0.7017 1.1553 -0.0142 -0.0399 -0.2039 111 MET B N   
3010 C CA  . MET B 111 ? 1.2726 0.7319 1.1838 -0.0345 -0.0114 -0.1938 111 MET B CA  
3011 C C   . MET B 111 ? 1.2709 0.7086 1.1248 -0.0501 -0.0127 -0.1669 111 MET B C   
3012 O O   . MET B 111 ? 1.3056 0.7398 1.1591 -0.0624 0.0020  -0.1549 111 MET B O   
3013 C CB  . MET B 111 ? 1.2619 0.7068 1.1505 -0.0310 0.0032  -0.2031 111 MET B CB  
3014 C CG  . MET B 111 ? 1.1935 0.6614 1.1353 -0.0138 0.0063  -0.2309 111 MET B CG  
3015 S SD  . MET B 111 ? 1.7727 1.2206 1.6810 -0.0113 0.0301  -0.2365 111 MET B SD  
3016 C CE  . MET B 111 ? 1.6879 1.1231 1.5933 -0.0321 0.0661  -0.2180 111 MET B CE  
3017 N N   . TYR B 112 ? 1.2691 0.6913 1.0749 -0.0488 -0.0295 -0.1582 112 TYR B N   
3018 C CA  . TYR B 112 ? 1.2470 0.6530 1.0029 -0.0629 -0.0347 -0.1359 112 TYR B CA  
3019 C C   . TYR B 112 ? 1.1910 0.6132 0.9629 -0.0646 -0.0440 -0.1232 112 TYR B C   
3020 O O   . TYR B 112 ? 1.2154 0.6299 0.9558 -0.0757 -0.0424 -0.1058 112 TYR B O   
3021 C CB  . TYR B 112 ? 1.2506 0.6417 0.9673 -0.0618 -0.0530 -0.1308 112 TYR B CB  
3022 C CG  . TYR B 112 ? 1.2216 0.5851 0.9000 -0.0660 -0.0439 -0.1368 112 TYR B CG  
3023 C CD1 . TYR B 112 ? 1.3441 0.6862 0.9801 -0.0790 -0.0357 -0.1277 112 TYR B CD1 
3024 C CD2 . TYR B 112 ? 1.1742 0.5299 0.8534 -0.0534 -0.0446 -0.1524 112 TYR B CD2 
3025 C CE1 . TYR B 112 ? 1.5152 0.8278 1.1112 -0.0797 -0.0299 -0.1339 112 TYR B CE1 
3026 C CE2 . TYR B 112 ? 1.3971 0.7238 1.0361 -0.0557 -0.0371 -0.1576 112 TYR B CE2 
3027 C CZ  . TYR B 112 ? 1.5280 0.8328 1.1259 -0.0692 -0.0306 -0.1483 112 TYR B CZ  
3028 O OH  . TYR B 112 ? 1.5362 0.8082 1.0896 -0.0685 -0.0256 -0.1541 112 TYR B OH  
3029 N N   . GLN B 113 ? 1.1265 0.5700 0.9449 -0.0506 -0.0549 -0.1334 113 GLN B N   
3030 C CA  . GLN B 113 ? 1.1487 0.6056 0.9816 -0.0480 -0.0667 -0.1227 113 GLN B CA  
3031 C C   . GLN B 113 ? 1.1341 0.5902 0.9816 -0.0607 -0.0456 -0.1188 113 GLN B C   
3032 O O   . GLN B 113 ? 1.1164 0.5674 0.9364 -0.0678 -0.0464 -0.0999 113 GLN B O   
3033 C CB  . GLN B 113 ? 1.2258 0.7015 1.1032 -0.0251 -0.0854 -0.1383 113 GLN B CB  
3034 C CG  . GLN B 113 ? 1.3216 0.8066 1.2029 -0.0163 -0.1038 -0.1256 113 GLN B CG  
3035 C CD  . GLN B 113 ? 1.4536 0.9551 1.3858 0.0082  -0.1204 -0.1467 113 GLN B CD  
3036 O OE1 . GLN B 113 ? 1.4771 0.9817 1.4027 0.0302  -0.1434 -0.1412 113 GLN B OE1 
3037 N NE2 . GLN B 113 ? 1.4435 0.9556 1.4282 0.0067  -0.1092 -0.1716 113 GLN B NE2 
3038 N N   . VAL B 114 ? 1.1763 0.6370 1.0678 -0.0623 -0.0250 -0.1362 114 VAL B N   
3039 C CA  . VAL B 114 ? 1.2932 0.7491 1.2039 -0.0743 0.0016  -0.1322 114 VAL B CA  
3040 C C   . VAL B 114 ? 1.3269 0.7553 1.1763 -0.0860 0.0226  -0.1133 114 VAL B C   
3041 O O   . VAL B 114 ? 1.3129 0.7295 1.1478 -0.0927 0.0384  -0.0998 114 VAL B O   
3042 C CB  . VAL B 114 ? 1.2123 0.6801 1.1898 -0.0746 0.0236  -0.1544 114 VAL B CB  
3043 C CG1 . VAL B 114 ? 1.1131 0.6075 1.1436 -0.0576 -0.0009 -0.1795 114 VAL B CG1 
3044 C CG2 . VAL B 114 ? 1.2877 0.7393 1.2411 -0.0789 0.0498  -0.1550 114 VAL B CG2 
3045 N N   . GLU B 115 ? 1.2229 0.6379 1.0326 -0.0857 0.0221  -0.1136 115 GLU B N   
3046 C CA  . GLU B 115 ? 1.2286 0.6151 0.9766 -0.0919 0.0376  -0.0997 115 GLU B CA  
3047 C C   . GLU B 115 ? 1.2300 0.6120 0.9313 -0.0950 0.0200  -0.0807 115 GLU B C   
3048 O O   . GLU B 115 ? 1.4285 0.7964 1.1031 -0.0974 0.0357  -0.0683 115 GLU B O   
3049 C CB  . GLU B 115 ? 1.3042 0.6756 1.0198 -0.0894 0.0352  -0.1066 115 GLU B CB  
3050 C CG  . GLU B 115 ? 1.4372 0.8129 1.1922 -0.0837 0.0542  -0.1246 115 GLU B CG  
3051 C CD  . GLU B 115 ? 1.5398 0.9065 1.3134 -0.0857 0.0933  -0.1224 115 GLU B CD  
3052 O OE1 . GLU B 115 ? 1.6274 1.0136 1.4662 -0.0838 0.1084  -0.1366 115 GLU B OE1 
3053 O OE2 . GLU B 115 ? 1.5321 0.8720 1.2563 -0.0875 0.1096  -0.1067 115 GLU B OE2 
3054 N N   . PHE B 116 ? 1.1182 0.5118 0.8092 -0.0933 -0.0107 -0.0778 116 PHE B N   
3055 C CA  . PHE B 116 ? 1.2234 0.6187 0.8764 -0.0958 -0.0282 -0.0597 116 PHE B CA  
3056 C C   . PHE B 116 ? 1.2829 0.6877 0.9518 -0.0936 -0.0245 -0.0504 116 PHE B C   
3057 O O   . PHE B 116 ? 1.3844 0.7819 1.0141 -0.0950 -0.0232 -0.0354 116 PHE B O   
3058 C CB  . PHE B 116 ? 1.1303 0.5388 0.7811 -0.0937 -0.0581 -0.0567 116 PHE B CB  
3059 C CG  . PHE B 116 ? 1.1532 0.5460 0.7780 -0.0984 -0.0628 -0.0629 116 PHE B CG  
3060 C CD1 . PHE B 116 ? 1.2096 0.5840 0.7848 -0.1061 -0.0633 -0.0574 116 PHE B CD1 
3061 C CD2 . PHE B 116 ? 1.2029 0.5963 0.8495 -0.0928 -0.0677 -0.0760 116 PHE B CD2 
3062 C CE1 . PHE B 116 ? 1.1994 0.5556 0.7504 -0.1105 -0.0700 -0.0651 116 PHE B CE1 
3063 C CE2 . PHE B 116 ? 1.2524 0.6261 0.8713 -0.0973 -0.0713 -0.0818 116 PHE B CE2 
3064 C CZ  . PHE B 116 ? 1.2385 0.5932 0.8112 -0.1073 -0.0732 -0.0765 116 PHE B CZ  
3065 N N   . LYS B 117 ? 1.1470 0.5668 0.8721 -0.0884 -0.0240 -0.0611 117 LYS B N   
3066 C CA  . LYS B 117 ? 1.2341 0.6601 0.9790 -0.0858 -0.0228 -0.0551 117 LYS B CA  
3067 C C   . LYS B 117 ? 1.2399 0.6432 0.9655 -0.0930 0.0101  -0.0481 117 LYS B C   
3068 O O   . LYS B 117 ? 1.1144 0.5092 0.8072 -0.0923 0.0122  -0.0324 117 LYS B O   
3069 C CB  . LYS B 117 ? 1.3596 0.8030 1.1746 -0.0785 -0.0277 -0.0746 117 LYS B CB  
3070 C CG  . LYS B 117 ? 1.4670 0.9210 1.3026 -0.0696 -0.0447 -0.0706 117 LYS B CG  
3071 C CD  . LYS B 117 ? 1.5643 1.0363 1.4678 -0.0577 -0.0576 -0.0948 117 LYS B CD  
3072 C CE  . LYS B 117 ? 1.6360 1.1071 1.5967 -0.0679 -0.0300 -0.1130 117 LYS B CE  
3073 N NZ  . LYS B 117 ? 1.6447 1.1038 1.6129 -0.0761 -0.0150 -0.1043 117 LYS B NZ  
3074 N N   . THR B 118 ? 1.2658 0.6574 1.0096 -0.0973 0.0380  -0.0592 118 THR B N   
3075 C CA  . THR B 118 ? 1.3436 0.7083 1.0704 -0.1008 0.0766  -0.0524 118 THR B CA  
3076 C C   . THR B 118 ? 1.3760 0.7165 1.0197 -0.0974 0.0790  -0.0353 118 THR B C   
3077 O O   . THR B 118 ? 1.3832 0.7064 0.9946 -0.0946 0.0935  -0.0219 118 THR B O   
3078 C CB  . THR B 118 ? 1.3902 0.7480 1.1477 -0.1026 0.1051  -0.0660 118 THR B CB  
3079 O OG1 . THR B 118 ? 1.4581 0.8396 1.2996 -0.1052 0.1068  -0.0837 118 THR B OG1 
3080 C CG2 . THR B 118 ? 1.4487 0.7719 1.1747 -0.1016 0.1486  -0.0549 118 THR B CG2 
3081 N N   . MET B 119 ? 1.3839 0.7217 0.9923 -0.0961 0.0640  -0.0376 119 MET B N   
3082 C CA  . MET B 119 ? 1.4455 0.7629 0.9783 -0.0912 0.0596  -0.0266 119 MET B CA  
3083 C C   . MET B 119 ? 1.5292 0.8576 1.0330 -0.0890 0.0379  -0.0121 119 MET B C   
3084 O O   . MET B 119 ? 1.5381 0.8466 0.9867 -0.0814 0.0476  -0.0015 119 MET B O   
3085 C CB  . MET B 119 ? 1.4051 0.7212 0.9162 -0.0924 0.0396  -0.0348 119 MET B CB  
3086 C CG  . MET B 119 ? 1.5157 0.8172 1.0431 -0.0909 0.0616  -0.0477 119 MET B CG  
3087 S SD  . MET B 119 ? 2.7028 1.9771 2.1671 -0.0861 0.0511  -0.0532 119 MET B SD  
3088 C CE  . MET B 119 ? 1.2968 0.5984 0.7673 -0.0962 0.0038  -0.0543 119 MET B CE  
3089 N N   . ASN B 120 ? 1.5912 0.9500 1.1286 -0.0920 0.0095  -0.0113 120 ASN B N   
3090 C CA  . ASN B 120 ? 1.5311 0.9030 1.0450 -0.0878 -0.0099 0.0041  120 ASN B CA  
3091 C C   . ASN B 120 ? 1.4695 0.8274 0.9776 -0.0831 0.0122  0.0128  120 ASN B C   
3092 O O   . ASN B 120 ? 1.4943 0.8475 0.9551 -0.0760 0.0084  0.0269  120 ASN B O   
3093 C CB  . ASN B 120 ? 1.4395 0.8430 0.9913 -0.0872 -0.0408 0.0051  120 ASN B CB  
3094 C CG  . ASN B 120 ? 1.3395 0.7583 0.8616 -0.0810 -0.0622 0.0234  120 ASN B CG  
3095 O OD1 . ASN B 120 ? 1.0550 0.4906 0.6010 -0.0742 -0.0764 0.0296  120 ASN B OD1 
3096 N ND2 . ASN B 120 ? 1.4609 0.8737 0.9287 -0.0804 -0.0654 0.0314  120 ASN B ND2 
3097 N N   . ALA B 121 ? 1.3508 0.7022 0.9090 -0.0868 0.0353  0.0036  121 ALA B N   
3098 C CA  . ALA B 121 ? 1.4209 0.7524 0.9783 -0.0848 0.0619  0.0106  121 ALA B CA  
3099 C C   . ALA B 121 ? 1.5545 0.8511 1.0400 -0.0771 0.0884  0.0215  121 ALA B C   
3100 O O   . ALA B 121 ? 1.6370 0.9196 1.0777 -0.0688 0.0935  0.0353  121 ALA B O   
3101 C CB  . ALA B 121 ? 1.4297 0.7588 1.0593 -0.0925 0.0867  -0.0039 121 ALA B CB  
3102 N N   . LYS B 122 ? 1.5090 0.7893 0.9780 -0.0762 0.1043  0.0149  122 LYS B N   
3103 C CA  . LYS B 122 ? 1.4242 0.6662 0.8206 -0.0628 0.1301  0.0230  122 LYS B CA  
3104 C C   . LYS B 122 ? 1.4350 0.6805 0.7605 -0.0522 0.1011  0.0310  122 LYS B C   
3105 O O   . LYS B 122 ? 1.4587 0.6832 0.7281 -0.0384 0.1126  0.0425  122 LYS B O   
3106 C CB  . LYS B 122 ? 1.5137 0.7373 0.9085 -0.0609 0.1498  0.0132  122 LYS B CB  
3107 C CG  . LYS B 122 ? 1.6655 0.8731 1.1115 -0.0648 0.1946  0.0098  122 LYS B CG  
3108 C CD  . LYS B 122 ? 1.8891 1.0544 1.2956 -0.0526 0.2390  0.0244  122 LYS B CD  
3109 C CE  . LYS B 122 ? 1.9824 1.1265 1.4354 -0.0548 0.2908  0.0229  122 LYS B CE  
3110 N NZ  . LYS B 122 ? 1.9329 1.1044 1.4858 -0.0748 0.2947  0.0141  122 LYS B NZ  
3111 N N   . LEU B 123 ? 1.5149 0.7870 0.8446 -0.0579 0.0642  0.0242  123 LEU B N   
3112 C CA  . LEU B 123 ? 1.5552 0.8375 0.8308 -0.0505 0.0337  0.0291  123 LEU B CA  
3113 C C   . LEU B 123 ? 1.6025 0.8956 0.8553 -0.0433 0.0251  0.0440  123 LEU B C   
3114 O O   . LEU B 123 ? 1.5972 0.8880 0.7903 -0.0303 0.0131  0.0495  123 LEU B O   
3115 C CB  . LEU B 123 ? 1.4971 0.8121 0.8023 -0.0629 -0.0043 0.0212  123 LEU B CB  
3116 C CG  . LEU B 123 ? 1.5744 0.8737 0.8534 -0.0622 -0.0109 0.0084  123 LEU B CG  
3117 C CD1 . LEU B 123 ? 1.6834 0.9545 0.8836 -0.0430 -0.0059 0.0097  123 LEU B CD1 
3118 C CD2 . LEU B 123 ? 1.6056 0.8850 0.9130 -0.0657 0.0149  -0.0021 123 LEU B CD2 
3119 N N   . LEU B 124 ? 1.6300 0.9347 0.9294 -0.0496 0.0295  0.0492  124 LEU B N   
3120 C CA  . LEU B 124 ? 1.5392 0.8514 0.8174 -0.0415 0.0215  0.0640  124 LEU B CA  
3121 C C   . LEU B 124 ? 1.5824 0.8526 0.8044 -0.0267 0.0572  0.0725  124 LEU B C   
3122 O O   . LEU B 124 ? 1.7028 0.9704 0.8704 -0.0124 0.0507  0.0845  124 LEU B O   
3123 C CB  . LEU B 124 ? 1.4301 0.7628 0.7735 -0.0498 0.0126  0.0649  124 LEU B CB  
3124 C CG  . LEU B 124 ? 1.4121 0.7861 0.7970 -0.0554 -0.0257 0.0635  124 LEU B CG  
3125 C CD1 . LEU B 124 ? 1.3661 0.7498 0.8146 -0.0582 -0.0289 0.0589  124 LEU B CD1 
3126 C CD2 . LEU B 124 ? 1.3589 0.7564 0.7046 -0.0460 -0.0543 0.0791  124 LEU B CD2 
3127 N N   . MET B 125 ? 1.4565 0.6930 0.6910 -0.0283 0.0969  0.0670  125 MET B N   
3128 C CA  . MET B 125 ? 1.5346 0.7238 0.7190 -0.0133 0.1391  0.0763  125 MET B CA  
3129 C C   . MET B 125 ? 1.8047 0.9647 0.9005 0.0098  0.1475  0.0777  125 MET B C   
3130 O O   . MET B 125 ? 1.9574 1.0857 0.9845 0.0308  0.1667  0.0883  125 MET B O   
3131 C CB  . MET B 125 ? 1.4436 0.6079 0.6827 -0.0234 0.1828  0.0716  125 MET B CB  
3132 C CG  . MET B 125 ? 1.3583 0.5403 0.6757 -0.0403 0.1804  0.0693  125 MET B CG  
3133 S SD  . MET B 125 ? 1.4724 0.6485 0.7515 -0.0307 0.1707  0.0856  125 MET B SD  
3134 C CE  . MET B 125 ? 1.4574 0.5673 0.6733 -0.0147 0.2308  0.0979  125 MET B CE  
3135 N N   . ASP B 126 ? 1.8482 1.0160 0.9424 0.0084  0.1323  0.0658  126 ASP B N   
3136 C CA  . ASP B 126 ? 1.9175 1.0584 0.9301 0.0326  0.1330  0.0624  126 ASP B CA  
3137 C C   . ASP B 126 ? 1.9329 1.0785 0.8752 0.0524  0.1119  0.0697  126 ASP B C   
3138 O O   . ASP B 126 ? 1.9227 1.1134 0.8806 0.0436  0.0693  0.0691  126 ASP B O   
3139 C CB  . ASP B 126 ? 1.9701 1.1314 0.9995 0.0239  0.1020  0.0468  126 ASP B CB  
3140 C CG  . ASP B 126 ? 2.0998 1.2273 1.0488 0.0506  0.1026  0.0393  126 ASP B CG  
3141 O OD1 . ASP B 126 ? 2.1920 1.3315 1.1460 0.0455  0.0744  0.0254  126 ASP B OD1 
3142 O OD2 . ASP B 126 ? 2.0351 1.1207 0.9132 0.0788  0.1312  0.0466  126 ASP B OD2 
3143 N N   . PRO B 127 ? 1.9592 1.0575 0.8227 0.0817  0.1437  0.0771  127 PRO B N   
3144 C CA  . PRO B 127 ? 1.9933 1.0915 0.7798 0.1068  0.1274  0.0829  127 PRO B CA  
3145 C C   . PRO B 127 ? 2.0830 1.2028 0.8312 0.1189  0.0842  0.0684  127 PRO B C   
3146 O O   . PRO B 127 ? 2.1012 1.2505 0.8211 0.1276  0.0517  0.0696  127 PRO B O   
3147 C CB  . PRO B 127 ? 2.0465 1.0773 0.7573 0.1383  0.1806  0.0922  127 PRO B CB  
3148 C CG  . PRO B 127 ? 2.0762 1.0821 0.8483 0.1203  0.2258  0.0965  127 PRO B CG  
3149 C CD  . PRO B 127 ? 2.0039 1.0449 0.8498 0.0941  0.2017  0.0824  127 PRO B CD  
3150 N N   . LYS B 128 ? 2.0571 1.1625 0.8064 0.1199  0.0834  0.0542  128 LYS B N   
3151 C CA  . LYS B 128 ? 1.9947 1.1215 0.7235 0.1257  0.0387  0.0366  128 LYS B CA  
3152 C C   . LYS B 128 ? 1.9916 1.1792 0.8082 0.0881  -0.0016 0.0325  128 LYS B C   
3153 O O   . LYS B 128 ? 2.0983 1.2905 0.9620 0.0693  -0.0073 0.0227  128 LYS B O   
3154 C CB  . LYS B 128 ? 2.1901 1.2729 0.8866 0.1417  0.0537  0.0234  128 LYS B CB  
3155 C CG  . LYS B 128 ? 2.3999 1.4912 1.0596 0.1553  0.0088  0.0019  128 LYS B CG  
3156 C CD  . LYS B 128 ? 2.5241 1.5778 1.0755 0.2041  0.0111  -0.0036 128 LYS B CD  
3157 C CE  . LYS B 128 ? 2.6116 1.6993 1.1445 0.2116  -0.0483 -0.0254 128 LYS B CE  
3158 N NZ  . LYS B 128 ? 2.6322 1.7442 1.2264 0.1826  -0.0819 -0.0420 128 LYS B NZ  
3159 N N   . ARG B 129 ? 1.8375 1.2095 1.1838 0.3852  -0.0914 -0.2355 129 ARG B N   
3160 C CA  . ARG B 129 ? 1.7227 1.1644 1.1305 0.3727  -0.0861 -0.2340 129 ARG B CA  
3161 C C   . ARG B 129 ? 1.6229 1.1007 1.0685 0.3666  -0.0918 -0.2341 129 ARG B C   
3162 O O   . ARG B 129 ? 1.5869 1.0979 1.0623 0.3766  -0.1080 -0.2443 129 ARG B O   
3163 C CB  . ARG B 129 ? 1.7446 1.2160 1.1702 0.3860  -0.0967 -0.2447 129 ARG B CB  
3164 C CG  . ARG B 129 ? 1.7853 1.2254 1.1753 0.3925  -0.0924 -0.2452 129 ARG B CG  
3165 C CD  . ARG B 129 ? 1.7711 1.2517 1.1898 0.3984  -0.0944 -0.2520 129 ARG B CD  
3166 N NE  . ARG B 129 ? 1.7878 1.3038 1.2416 0.4120  -0.1106 -0.2641 129 ARG B NE  
3167 C CZ  . ARG B 129 ? 1.7418 1.3034 1.2360 0.4150  -0.1087 -0.2703 129 ARG B CZ  
3168 N NH1 . ARG B 129 ? 1.6538 1.2262 1.1499 0.4058  -0.0927 -0.2651 129 ARG B NH1 
3169 N NH2 . ARG B 129 ? 1.7429 1.3361 1.2757 0.4271  -0.1225 -0.2819 129 ARG B NH2 
3170 N N   . GLN B 130 ? 1.6067 1.0791 1.0551 0.3498  -0.0777 -0.2230 130 GLN B N   
3171 C CA  . GLN B 130 ? 1.6160 1.1107 1.0892 0.3446  -0.0835 -0.2224 130 GLN B CA  
3172 C C   . GLN B 130 ? 1.5955 1.1563 1.1275 0.3295  -0.0762 -0.2201 130 GLN B C   
3173 O O   . GLN B 130 ? 1.5592 1.1599 1.1266 0.3345  -0.0880 -0.2286 130 GLN B O   
3174 C CB  . GLN B 130 ? 1.5926 1.0435 1.0354 0.3355  -0.0714 -0.2118 130 GLN B CB  
3175 C CG  . GLN B 130 ? 1.6668 1.0958 1.0926 0.3441  -0.0878 -0.2155 130 GLN B CG  
3176 C CD  . GLN B 130 ? 1.8144 1.1719 1.1833 0.3438  -0.0768 -0.2079 130 GLN B CD  
3177 O OE1 . GLN B 130 ? 1.8927 1.2468 1.2677 0.3271  -0.0546 -0.1961 130 GLN B OE1 
3178 N NE2 . GLN B 130 ? 1.8144 1.1107 1.1261 0.3627  -0.0915 -0.2147 130 GLN B NE2 
3179 N N   . ILE B 131 ? 1.6200 1.1892 1.1628 0.3109  -0.0567 -0.2090 131 ILE B N   
3180 C CA  . ILE B 131 ? 1.6316 1.2534 1.2204 0.2961  -0.0491 -0.2063 131 ILE B CA  
3181 C C   . ILE B 131 ? 1.6349 1.2588 1.2243 0.2880  -0.0375 -0.2017 131 ILE B C   
3182 O O   . ILE B 131 ? 1.6735 1.2601 1.2353 0.2868  -0.0310 -0.1964 131 ILE B O   
3183 C CB  . ILE B 131 ? 1.5963 1.2270 1.2010 0.2793  -0.0404 -0.1968 131 ILE B CB  
3184 C CG1 . ILE B 131 ? 1.5351 1.2168 1.1830 0.2648  -0.0340 -0.1949 131 ILE B CG1 
3185 C CG2 . ILE B 131 ? 1.5882 1.1796 1.1699 0.2696  -0.0255 -0.1854 131 ILE B CG2 
3186 C CD1 . ILE B 131 ? 1.5645 1.2861 1.2415 0.2726  -0.0433 -0.2062 131 ILE B CD1 
3187 N N   . PHE B 132 ? 1.5691 1.2328 1.1882 0.2827  -0.0350 -0.2040 132 PHE B N   
3188 C CA  . PHE B 132 ? 1.5334 1.1962 1.1507 0.2742  -0.0265 -0.1994 132 PHE B CA  
3189 C C   . PHE B 132 ? 1.4646 1.1553 1.1102 0.2554  -0.0183 -0.1928 132 PHE B C   
3190 O O   . PHE B 132 ? 1.4365 1.1592 1.1077 0.2521  -0.0183 -0.1955 132 PHE B O   
3191 C CB  . PHE B 132 ? 1.4532 1.1239 1.0660 0.2875  -0.0305 -0.2087 132 PHE B CB  
3192 C CG  . PHE B 132 ? 1.4108 1.0451 0.9880 0.3039  -0.0376 -0.2132 132 PHE B CG  
3193 C CD1 . PHE B 132 ? 1.4217 1.0165 0.9699 0.2996  -0.0330 -0.2060 132 PHE B CD1 
3194 C CD2 . PHE B 132 ? 1.3905 1.0288 0.9652 0.3236  -0.0491 -0.2252 132 PHE B CD2 
3195 C CE1 . PHE B 132 ? 1.4790 1.0363 0.9901 0.3142  -0.0383 -0.2103 132 PHE B CE1 
3196 C CE2 . PHE B 132 ? 1.4296 1.0305 0.9673 0.3393  -0.0569 -0.2297 132 PHE B CE2 
3197 C CZ  . PHE B 132 ? 1.4818 1.0408 0.9845 0.3344  -0.0508 -0.2221 132 PHE B CZ  
3198 N N   . LEU B 133 ? 1.3996 1.0756 1.0405 0.2432  -0.0125 -0.1845 133 LEU B N   
3199 C CA  . LEU B 133 ? 1.2610 0.9557 0.9233 0.2260  -0.0077 -0.1784 133 LEU B CA  
3200 C C   . LEU B 133 ? 1.3407 1.0547 1.0063 0.2274  -0.0067 -0.1840 133 LEU B C   
3201 O O   . LEU B 133 ? 1.3927 1.0906 1.0393 0.2325  -0.0079 -0.1858 133 LEU B O   
3202 C CB  . LEU B 133 ? 1.1734 0.8427 0.8327 0.2136  -0.0054 -0.1686 133 LEU B CB  
3203 C CG  . LEU B 133 ? 1.2806 0.9625 0.9644 0.1956  -0.0028 -0.1608 133 LEU B CG  
3204 C CD1 . LEU B 133 ? 1.3676 1.0718 1.0577 0.1904  -0.0040 -0.1636 133 LEU B CD1 
3205 C CD2 . LEU B 133 ? 1.0199 0.7121 0.7175 0.1928  0.0015  -0.1582 133 LEU B CD2 
3206 N N   . ASP B 134 ? 1.4088 1.1541 1.0966 0.2228  -0.0030 -0.1867 134 ASP B N   
3207 C CA  . ASP B 134 ? 1.4435 1.2050 1.1348 0.2235  0.0029  -0.1924 134 ASP B CA  
3208 C C   . ASP B 134 ? 1.3555 1.0941 1.0273 0.2139  0.0039  -0.1865 134 ASP B C   
3209 O O   . ASP B 134 ? 1.2731 1.0062 0.9493 0.1990  0.0027  -0.1787 134 ASP B O   
3210 C CB  . ASP B 134 ? 1.5193 1.3139 1.2386 0.2159  0.0092  -0.1944 134 ASP B CB  
3211 C CG  . ASP B 134 ? 1.6609 1.4734 1.3880 0.2201  0.0195  -0.2029 134 ASP B CG  
3212 O OD1 . ASP B 134 ? 1.7691 1.6057 1.5178 0.2123  0.0277  -0.2046 134 ASP B OD1 
3213 O OD2 . ASP B 134 ? 1.6820 1.4827 1.3934 0.2313  0.0211  -0.2079 134 ASP B OD2 
3214 N N   . GLN B 135 ? 1.3167 1.0391 0.9659 0.2230  0.0044  -0.1906 135 GLN B N   
3215 C CA  . GLN B 135 ? 1.2259 0.9188 0.8500 0.2158  0.0021  -0.1858 135 GLN B CA  
3216 C C   . GLN B 135 ? 1.2597 0.9575 0.8869 0.2020  0.0071  -0.1831 135 GLN B C   
3217 O O   . GLN B 135 ? 1.2706 0.9456 0.8868 0.1902  -0.0003 -0.1761 135 GLN B O   
3218 C CB  . GLN B 135 ? 1.1244 0.8006 0.7214 0.2293  0.0045  -0.1920 135 GLN B CB  
3219 C CG  . GLN B 135 ? 1.4528 1.0881 1.0165 0.2247  -0.0032 -0.1866 135 GLN B CG  
3220 C CD  . GLN B 135 ? 1.4238 1.0430 0.9645 0.2194  0.0024  -0.1870 135 GLN B CD  
3221 O OE1 . GLN B 135 ? 1.3573 0.9396 0.8632 0.2205  -0.0031 -0.1853 135 GLN B OE1 
3222 N NE2 . GLN B 135 ? 1.1649 0.8068 0.7212 0.2137  0.0138  -0.1891 135 GLN B NE2 
3223 N N   . ASN B 136 ? 1.3088 1.0346 0.9519 0.2035  0.0190  -0.1892 136 ASN B N   
3224 C CA  . ASN B 136 ? 1.4130 1.1403 1.0542 0.1913  0.0270  -0.1879 136 ASN B CA  
3225 C C   . ASN B 136 ? 1.3394 1.0625 0.9886 0.1751  0.0180  -0.1787 136 ASN B C   
3226 O O   . ASN B 136 ? 1.2302 0.9320 0.8614 0.1644  0.0161  -0.1750 136 ASN B O   
3227 C CB  . ASN B 136 ? 1.5656 1.3289 1.2334 0.1944  0.0423  -0.1959 136 ASN B CB  
3228 C CG  . ASN B 136 ? 1.6838 1.4400 1.3394 0.1849  0.0567  -0.1968 136 ASN B CG  
3229 O OD1 . ASN B 136 ? 1.7821 1.5653 1.4611 0.1842  0.0715  -0.2027 136 ASN B OD1 
3230 N ND2 . ASN B 136 ? 1.6826 1.3985 1.2998 0.1776  0.0519  -0.1913 136 ASN B ND2 
3231 N N   . MET B 137 ? 1.0429 0.7819 0.7166 0.1742  0.0123  -0.1754 137 MET B N   
3232 C CA  . MET B 137 ? 1.1262 0.8637 0.8135 0.1601  0.0057  -0.1669 137 MET B CA  
3233 C C   . MET B 137 ? 1.1902 0.8949 0.8671 0.1547  -0.0072 -0.1598 137 MET B C   
3234 O O   . MET B 137 ? 1.2455 0.9410 0.9297 0.1420  -0.0143 -0.1535 137 MET B O   
3235 C CB  . MET B 137 ? 1.1470 0.9076 0.8609 0.1618  0.0066  -0.1658 137 MET B CB  
3236 C CG  . MET B 137 ? 1.1059 0.8626 0.8351 0.1487  0.0020  -0.1567 137 MET B CG  
3237 S SD  . MET B 137 ? 1.1018 0.8582 0.8454 0.1533  0.0021  -0.1529 137 MET B SD  
3238 C CE  . MET B 137 ? 1.0933 0.8341 0.8534 0.1374  -0.0018 -0.1418 137 MET B CE  
3239 N N   . LEU B 138 ? 1.1960 0.8828 0.8585 0.1644  -0.0110 -0.1613 138 LEU B N   
3240 C CA  . LEU B 138 ? 1.2364 0.8902 0.8898 0.1595  -0.0236 -0.1557 138 LEU B CA  
3241 C C   . LEU B 138 ? 1.3519 0.9793 0.9783 0.1538  -0.0310 -0.1555 138 LEU B C   
3242 O O   . LEU B 138 ? 1.3853 0.9889 1.0125 0.1437  -0.0454 -0.1499 138 LEU B O   
3243 C CB  . LEU B 138 ? 1.2737 0.9123 0.9134 0.1717  -0.0249 -0.1581 138 LEU B CB  
3244 C CG  . LEU B 138 ? 1.2559 0.9029 0.9130 0.1766  -0.0205 -0.1569 138 LEU B CG  
3245 C CD1 . LEU B 138 ? 1.3021 0.9280 0.9379 0.1891  -0.0220 -0.1600 138 LEU B CD1 
3246 C CD2 . LEU B 138 ? 1.1516 0.7926 0.8353 0.1633  -0.0236 -0.1484 138 LEU B CD2 
3247 N N   . ALA B 139 ? 1.3423 0.9711 0.9448 0.1606  -0.0211 -0.1619 139 ALA B N   
3248 C CA  . ALA B 139 ? 1.2970 0.8919 0.8622 0.1571  -0.0247 -0.1624 139 ALA B CA  
3249 C C   . ALA B 139 ? 1.2945 0.8858 0.8609 0.1433  -0.0275 -0.1592 139 ALA B C   
3250 O O   . ALA B 139 ? 1.3251 0.8783 0.8678 0.1360  -0.0426 -0.1558 139 ALA B O   
3251 C CB  . ALA B 139 ? 1.2138 0.8088 0.7539 0.1690  -0.0081 -0.1705 139 ALA B CB  
3252 N N   . VAL B 140 ? 1.2317 0.8592 0.8234 0.1399  -0.0151 -0.1606 140 VAL B N   
3253 C CA  . VAL B 140 ? 1.2251 0.8489 0.8143 0.1273  -0.0157 -0.1582 140 VAL B CA  
3254 C C   . VAL B 140 ? 1.2093 0.8235 0.8181 0.1160  -0.0354 -0.1504 140 VAL B C   
3255 O O   . VAL B 140 ? 1.1795 0.7789 0.7802 0.1057  -0.0426 -0.1479 140 VAL B O   
3256 C CB  . VAL B 140 ? 1.0977 0.7629 0.7108 0.1260  0.0026  -0.1619 140 VAL B CB  
3257 C CG1 . VAL B 140 ? 1.1150 0.7864 0.7128 0.1350  0.0230  -0.1704 140 VAL B CG1 
3258 C CG2 . VAL B 140 ? 2.0898 1.7915 1.7440 0.1294  0.0027  -0.1604 140 VAL B CG2 
3259 N N   . ILE B 141 ? 1.1843 0.8047 0.8191 0.1183  -0.0431 -0.1468 141 ILE B N   
3260 C CA  . ILE B 141 ? 1.1833 0.7932 0.8436 0.1083  -0.0602 -0.1398 141 ILE B CA  
3261 C C   . ILE B 141 ? 1.3178 0.8811 0.9538 0.1057  -0.0818 -0.1383 141 ILE B C   
3262 O O   . ILE B 141 ? 1.3224 0.8677 0.9715 0.0959  -0.1005 -0.1340 141 ILE B O   
3263 C CB  . ILE B 141 ? 1.2143 0.8422 0.9114 0.1112  -0.0571 -0.1366 141 ILE B CB  
3264 C CG1 . ILE B 141 ? 1.2517 0.9181 0.9659 0.1156  -0.0387 -0.1384 141 ILE B CG1 
3265 C CG2 . ILE B 141 ? 1.1093 0.7282 0.8409 0.1002  -0.0708 -0.1296 141 ILE B CG2 
3266 C CD1 . ILE B 141 ? 1.1253 0.8004 0.8674 0.1182  -0.0341 -0.1348 141 ILE B CD1 
3267 N N   . ASP B 142 ? 1.4008 0.9429 1.0016 0.1150  -0.0807 -0.1422 142 ASP B N   
3268 C CA  . ASP B 142 ? 1.4346 0.9262 1.0026 0.1138  -0.1019 -0.1413 142 ASP B CA  
3269 C C   . ASP B 142 ? 1.4603 0.9197 0.9806 0.1106  -0.1041 -0.1437 142 ASP B C   
3270 O O   . ASP B 142 ? 1.4474 0.8676 0.9520 0.1031  -0.1273 -0.1412 142 ASP B O   
3271 C CB  . ASP B 142 ? 1.5358 1.0141 1.0807 0.1257  -0.0985 -0.1443 142 ASP B CB  
3272 C CG  . ASP B 142 ? 1.6496 1.0832 1.1825 0.1234  -0.1244 -0.1415 142 ASP B CG  
3273 O OD1 . ASP B 142 ? 1.6090 1.0446 1.1834 0.1154  -0.1393 -0.1368 142 ASP B OD1 
3274 O OD2 . ASP B 142 ? 1.7516 1.1468 1.2351 0.1296  -0.1293 -0.1440 142 ASP B OD2 
3275 N N   . GLU B 143 ? 1.4471 0.9203 0.9450 0.1166  -0.0799 -0.1489 143 GLU B N   
3276 C CA  . GLU B 143 ? 1.4262 0.8683 0.8771 0.1135  -0.0743 -0.1516 143 GLU B CA  
3277 C C   . GLU B 143 ? 1.5152 0.9524 0.9760 0.1005  -0.0866 -0.1481 143 GLU B C   
3278 O O   . GLU B 143 ? 1.6844 1.0817 1.1002 0.0962  -0.0892 -0.1494 143 GLU B O   
3279 C CB  . GLU B 143 ? 1.5078 0.9789 0.9531 0.1204  -0.0414 -0.1580 143 GLU B CB  
3280 C CG  . GLU B 143 ? 1.6935 1.1622 1.1210 0.1346  -0.0279 -0.1629 143 GLU B CG  
3281 C CD  . GLU B 143 ? 1.9038 1.4072 1.3402 0.1413  0.0038  -0.1700 143 GLU B CD  
3282 O OE1 . GLU B 143 ? 2.0717 1.5876 1.5132 0.1339  0.0165  -0.1714 143 GLU B OE1 
3283 O OE2 . GLU B 143 ? 1.8351 1.3532 1.2762 0.1540  0.0153  -0.1747 143 GLU B OE2 
3284 N N   . LEU B 144 ? 1.4906 0.9641 1.0070 0.0947  -0.0932 -0.1438 144 LEU B N   
3285 C CA  . LEU B 144 ? 1.4148 0.8877 0.9463 0.0831  -0.1045 -0.1404 144 LEU B CA  
3286 C C   . LEU B 144 ? 1.4346 0.8718 0.9750 0.0769  -0.1390 -0.1361 144 LEU B C   
3287 O O   . LEU B 144 ? 1.4991 0.9069 1.0247 0.0691  -0.1567 -0.1350 144 LEU B O   
3288 C CB  . LEU B 144 ? 1.2865 0.8172 0.8730 0.0801  -0.0903 -0.1382 144 LEU B CB  
3289 C CG  . LEU B 144 ? 1.2160 0.7503 0.8226 0.0686  -0.1002 -0.1344 144 LEU B CG  
3290 C CD1 . LEU B 144 ? 1.2051 0.7132 0.7644 0.0639  -0.0960 -0.1376 144 LEU B CD1 
3291 C CD2 . LEU B 144 ? 1.1276 0.7149 0.7844 0.0670  -0.0850 -0.1319 144 LEU B CD2 
3292 N N   . MET B 145 ? 1.3706 0.8091 0.9367 0.0803  -0.1494 -0.1340 145 MET B N   
3293 C CA  . MET B 145 ? 1.4166 0.8250 1.0029 0.0743  -0.1824 -0.1305 145 MET B CA  
3294 C C   . MET B 145 ? 1.5458 0.8875 1.0726 0.0761  -0.2066 -0.1326 145 MET B C   
3295 O O   . MET B 145 ? 1.5620 0.8670 1.0932 0.0701  -0.2397 -0.1309 145 MET B O   
3296 C CB  . MET B 145 ? 1.3822 0.8149 1.0211 0.0762  -0.1821 -0.1276 145 MET B CB  
3297 C CG  . MET B 145 ? 1.3505 0.8395 1.0365 0.0766  -0.1564 -0.1257 145 MET B CG  
3298 S SD  . MET B 145 ? 1.3666 0.8716 1.0986 0.0802  -0.1511 -0.1231 145 MET B SD  
3299 C CE  . MET B 145 ? 1.2204 0.7005 1.0001 0.0688  -0.1833 -0.1188 145 MET B CE  
3300 N N   . GLN B 146 ? 1.5597 0.8828 1.0313 0.0850  -0.1911 -0.1365 146 GLN B N   
3301 C CA  . GLN B 146 ? 1.6941 0.9463 1.0971 0.0875  -0.2107 -0.1385 146 GLN B CA  
3302 C C   . GLN B 146 ? 1.7393 0.9558 1.0865 0.0842  -0.2074 -0.1409 146 GLN B C   
3303 O O   . GLN B 146 ? 1.9660 1.1140 1.2444 0.0862  -0.2217 -0.1427 146 GLN B O   
3304 C CB  . GLN B 146 ? 1.7069 0.9457 1.0730 0.0991  -0.1971 -0.1412 146 GLN B CB  
3305 C CG  . GLN B 146 ? 1.7417 1.0101 1.0885 0.1072  -0.1570 -0.1456 146 GLN B CG  
3306 C CD  . GLN B 146 ? 1.7206 1.0007 1.0646 0.1191  -0.1435 -0.1476 146 GLN B CD  
3307 O OE1 . GLN B 146 ? 1.6628 0.9672 0.9974 0.1275  -0.1135 -0.1519 146 GLN B OE1 
3308 N NE2 . GLN B 146 ? 1.7225 0.9851 1.0777 0.1198  -0.1665 -0.1449 146 GLN B NE2 
3309 N N   . ALA B 147 ? 1.5231 0.7817 0.8966 0.0792  -0.1883 -0.1409 147 ALA B N   
3310 C CA  . ALA B 147 ? 1.5360 0.7634 0.8643 0.0739  -0.1858 -0.1427 147 ALA B CA  
3311 C C   . ALA B 147 ? 1.6539 0.8703 1.0099 0.0640  -0.2180 -0.1395 147 ALA B C   
3312 O O   . ALA B 147 ? 1.7804 0.9418 1.0875 0.0600  -0.2356 -0.1407 147 ALA B O   
3313 C CB  . ALA B 147 ? 1.4176 0.6953 0.7575 0.0740  -0.1462 -0.1452 147 ALA B CB  
3314 N N   . LEU B 148 ? 1.6919 0.9581 1.1257 0.0606  -0.2250 -0.1356 148 LEU B N   
3315 C CA  . LEU B 148 ? 1.6360 0.8976 1.1100 0.0519  -0.2551 -0.1326 148 LEU B CA  
3316 C C   . LEU B 148 ? 1.6067 0.8183 1.0789 0.0520  -0.2962 -0.1320 148 LEU B C   
3317 O O   . LEU B 148 ? 1.6336 0.8208 1.1255 0.0460  -0.3301 -0.1311 148 LEU B O   
3318 C CB  . LEU B 148 ? 1.5122 0.8446 1.0715 0.0485  -0.2418 -0.1286 148 LEU B CB  
3319 C CG  . LEU B 148 ? 1.4470 0.8354 1.0190 0.0491  -0.2028 -0.1288 148 LEU B CG  
3320 C CD1 . LEU B 148 ? 1.3902 0.8346 1.0399 0.0463  -0.1945 -0.1243 148 LEU B CD1 
3321 C CD2 . LEU B 148 ? 1.4524 0.8261 0.9867 0.0438  -0.1977 -0.1307 148 LEU B CD2 
3322 N N   . ASN B 149 ? 1.6352 0.8309 1.0850 0.0592  -0.2942 -0.1330 149 ASN B N   
3323 C CA  . ASN B 149 ? 1.8040 0.9580 1.2590 0.0596  -0.3314 -0.1324 149 ASN B CA  
3324 C C   . ASN B 149 ? 1.7637 0.9538 1.3128 0.0532  -0.3487 -0.1288 149 ASN B C   
3325 O O   . ASN B 149 ? 1.8208 1.0624 1.4226 0.0547  -0.3270 -0.1267 149 ASN B O   
3326 C CB  . ASN B 149 ? 1.9322 1.0001 1.3160 0.0589  -0.3677 -0.1349 149 ASN B CB  
3327 C CG  . ASN B 149 ? 2.0662 1.0779 1.3648 0.0676  -0.3639 -0.1375 149 ASN B CG  
3328 O OD1 . ASN B 149 ? 2.0113 1.0046 1.3116 0.0713  -0.3794 -0.1370 149 ASN B OD1 
3329 N ND2 . ASN B 149 ? 2.2050 1.1881 1.4291 0.0707  -0.3409 -0.1403 149 ASN B ND2 
3330 N N   . PHE B 150 ? 1.6510 0.8108 1.2207 0.0467  -0.3872 -0.1287 150 PHE B N   
3331 C CA  . PHE B 150 ? 1.6275 0.8203 1.2935 0.0401  -0.4026 -0.1258 150 PHE B CA  
3332 C C   . PHE B 150 ? 1.6859 0.8790 1.3904 0.0414  -0.4123 -0.1248 150 PHE B C   
3333 O O   . PHE B 150 ? 1.6133 0.8319 1.3120 0.0468  -0.3831 -0.1241 150 PHE B O   
3334 C CB  . PHE B 150 ? 1.6587 0.9249 1.3828 0.0373  -0.3655 -0.1226 150 PHE B CB  
3335 C CG  . PHE B 150 ? 1.7274 0.9987 1.4463 0.0326  -0.3654 -0.1226 150 PHE B CG  
3336 C CD1 . PHE B 150 ? 1.8044 1.0536 1.5567 0.0264  -0.4017 -0.1228 150 PHE B CD1 
3337 C CD2 . PHE B 150 ? 1.7289 1.0272 1.4128 0.0344  -0.3298 -0.1229 150 PHE B CD2 
3338 C CE1 . PHE B 150 ? 1.8620 1.1136 1.6069 0.0225  -0.4022 -0.1229 150 PHE B CE1 
3339 C CE2 . PHE B 150 ? 1.8000 1.1016 1.4778 0.0295  -0.3293 -0.1229 150 PHE B CE2 
3340 C CZ  . PHE B 150 ? 1.8564 1.1339 1.5620 0.0237  -0.3651 -0.1228 150 PHE B CZ  
3341 N N   . ASN B 151 ? 1.9216 1.0854 1.6677 0.0363  -0.4544 -0.1252 151 ASN B N   
3342 C CA  . ASN B 151 ? 2.0646 1.2338 1.8655 0.0351  -0.4640 -0.1242 151 ASN B CA  
3343 C C   . ASN B 151 ? 2.0283 1.2539 1.9380 0.0279  -0.4523 -0.1211 151 ASN B C   
3344 O O   . ASN B 151 ? 2.0169 1.2472 1.9706 0.0220  -0.4695 -0.1210 151 ASN B O   
3345 C CB  . ASN B 151 ? 2.1871 1.2864 1.9715 0.0338  -0.5188 -0.1271 151 ASN B CB  
3346 C CG  . ASN B 151 ? 2.2812 1.3185 1.9553 0.0420  -0.5266 -0.1295 151 ASN B CG  
3347 O OD1 . ASN B 151 ? 2.2948 1.3462 1.9132 0.0487  -0.4886 -0.1293 151 ASN B OD1 
3348 N ND2 . ASN B 151 ? 2.3399 1.3055 1.9829 0.0418  -0.5765 -0.1321 151 ASN B ND2 
3349 N N   . SER B 152 ? 1.9934 1.2585 1.9437 0.0288  -0.4215 -0.1186 152 SER B N   
3350 C CA  . SER B 152 ? 1.9746 1.2876 2.0234 0.0224  -0.4043 -0.1154 152 SER B CA  
3351 C C   . SER B 152 ? 2.0044 1.3299 2.0987 0.0218  -0.3903 -0.1140 152 SER B C   
3352 O O   . SER B 152 ? 1.9807 1.3031 2.0264 0.0286  -0.3718 -0.1144 152 SER B O   
3353 C CB  . SER B 152 ? 1.8923 1.2550 1.9422 0.0236  -0.3623 -0.1126 152 SER B CB  
3354 O OG  . SER B 152 ? 1.8304 1.2121 1.8322 0.0315  -0.3258 -0.1122 152 SER B OG  
3355 N N   . GLU B 153 ? 2.0674 1.4050 2.2565 0.0136  -0.3987 -0.1129 153 GLU B N   
3356 C CA  . GLU B 153 ? 2.1313 1.4829 2.3734 0.0114  -0.3792 -0.1113 153 GLU B CA  
3357 C C   . GLU B 153 ? 2.1609 1.5613 2.4683 0.0081  -0.3369 -0.1073 153 GLU B C   
3358 O O   . GLU B 153 ? 2.1829 1.5992 2.5489 0.0023  -0.3418 -0.1063 153 GLU B O   
3359 C CB  . GLU B 153 ? 2.1396 1.4611 2.4438 0.0040  -0.4204 -0.1137 153 GLU B CB  
3360 N N   . THR B 154 ? 2.0769 1.4969 2.3698 0.0126  -0.2957 -0.1052 154 THR B N   
3361 C CA  . THR B 154 ? 1.9356 1.3927 2.2765 0.0108  -0.2526 -0.1012 154 THR B CA  
3362 C C   . THR B 154 ? 1.9677 1.4287 2.2989 0.0149  -0.2163 -0.0999 154 THR B C   
3363 O O   . THR B 154 ? 1.8839 1.3266 2.1552 0.0215  -0.2198 -0.1021 154 THR B O   
3364 C CB  . THR B 154 ? 1.8098 1.2922 2.1109 0.0151  -0.2335 -0.0995 154 THR B CB  
3365 N N   . VAL B 155 ? 2.0598 1.5405 2.4472 0.0113  -0.1809 -0.0964 155 VAL B N   
3366 C CA  . VAL B 155 ? 2.0870 1.5659 2.4645 0.0151  -0.1431 -0.0951 155 VAL B CA  
3367 C C   . VAL B 155 ? 2.1012 1.5921 2.3976 0.0267  -0.1168 -0.0947 155 VAL B C   
3368 O O   . VAL B 155 ? 2.0994 1.6034 2.3560 0.0305  -0.1255 -0.0953 155 VAL B O   
3369 C CB  . VAL B 155 ? 2.0288 1.5172 2.4908 0.0073  -0.1111 -0.0914 155 VAL B CB  
3370 N N   . PRO B 156 ? 2.0986 1.5825 2.3701 0.0325  -0.0856 -0.0943 156 PRO B N   
3371 C CA  . PRO B 156 ? 2.0520 1.5456 2.2524 0.0444  -0.0623 -0.0947 156 PRO B CA  
3372 C C   . PRO B 156 ? 1.9644 1.4844 2.1640 0.0447  -0.0524 -0.0923 156 PRO B C   
3373 O O   . PRO B 156 ? 1.9244 1.4514 2.1623 0.0412  -0.0260 -0.0883 156 PRO B O   
3374 C CB  . PRO B 156 ? 2.0767 1.5560 2.2817 0.0468  -0.0258 -0.0931 156 PRO B CB  
3375 C CG  . PRO B 156 ? 2.1045 1.5612 2.3508 0.0395  -0.0376 -0.0941 156 PRO B CG  
3376 C CD  . PRO B 156 ? 2.1127 1.5757 2.4189 0.0287  -0.0722 -0.0941 156 PRO B CD  
3377 N N   . SER B 160 ? 2.4513 1.9200 2.1812 0.1771  -0.1754 -0.4051 160 SER B N   
3378 C CA  . SER B 160 ? 2.4079 1.9481 2.1866 0.1589  -0.1553 -0.3942 160 SER B CA  
3379 C C   . SER B 160 ? 2.5090 2.0707 2.2629 0.1395  -0.1346 -0.3726 160 SER B C   
3380 O O   . SER B 160 ? 2.5556 2.0826 2.2649 0.1389  -0.1409 -0.3756 160 SER B O   
3381 C CB  . SER B 160 ? 2.2925 1.8567 2.1099 0.1601  -0.1683 -0.4194 160 SER B CB  
3382 O OG  . SER B 160 ? 2.2230 1.7730 2.0723 0.1771  -0.1858 -0.4386 160 SER B OG  
3383 N N   . LEU B 161 ? 2.5396 2.1588 2.3252 0.1244  -0.1102 -0.3505 161 LEU B N   
3384 C CA  . LEU B 161 ? 2.5356 2.1824 2.3048 0.1057  -0.0894 -0.3297 161 LEU B CA  
3385 C C   . LEU B 161 ? 2.4305 2.1464 2.2447 0.0917  -0.0642 -0.3073 161 LEU B C   
3386 O O   . LEU B 161 ? 2.3375 2.0860 2.2013 0.0956  -0.0632 -0.3099 161 LEU B O   
3387 C CB  . LEU B 161 ? 2.5810 2.1772 2.2929 0.1064  -0.0853 -0.3139 161 LEU B CB  
3388 N N   . GLU B 162 ? 2.4222 2.1604 2.2211 0.0758  -0.0437 -0.2846 162 GLU B N   
3389 C CA  . GLU B 162 ? 2.3670 2.1714 2.2049 0.0617  -0.0188 -0.2611 162 GLU B CA  
3390 C C   . GLU B 162 ? 2.3926 2.1892 2.2033 0.0513  0.0006  -0.2322 162 GLU B C   
3391 O O   . GLU B 162 ? 2.4388 2.1872 2.1996 0.0518  -0.0029 -0.2302 162 GLU B O   
3392 C CB  . GLU B 162 ? 2.3060 2.1694 2.1671 0.0503  -0.0118 -0.2656 162 GLU B CB  
3393 N N   . GLU B 163 ? 2.3568 2.2014 2.2025 0.0420  0.0214  -0.2091 163 GLU B N   
3394 C CA  . GLU B 163 ? 2.3437 2.1851 2.1699 0.0312  0.0410  -0.1808 163 GLU B CA  
3395 C C   . GLU B 163 ? 2.2902 2.1883 2.1266 0.0122  0.0624  -0.1626 163 GLU B C   
3396 O O   . GLU B 163 ? 2.3218 2.2806 2.1989 0.0072  0.0686  -0.1639 163 GLU B O   
3397 C CB  . GLU B 163 ? 2.3427 2.1902 2.1990 0.0348  0.0486  -0.1663 163 GLU B CB  
3398 C CG  . GLU B 163 ? 2.3668 2.1502 2.2017 0.0536  0.0292  -0.1805 163 GLU B CG  
3399 C CD  . GLU B 163 ? 2.3791 2.1026 2.1512 0.0552  0.0287  -0.1728 163 GLU B CD  
3400 O OE1 . GLU B 163 ? 2.3711 2.1049 2.1329 0.0422  0.0489  -0.1474 163 GLU B OE1 
3401 O OE2 . GLU B 163 ? 2.3949 2.0610 2.1285 0.0700  0.0085  -0.1915 163 GLU B OE2 
3402 N N   . PRO B 164 ? 2.1575 2.0360 1.9568 0.0024  0.0738  -0.1457 164 PRO B N   
3403 C CA  . PRO B 164 ? 2.0097 1.9346 1.8126 -0.0149 0.0926  -0.1297 164 PRO B CA  
3404 C C   . PRO B 164 ? 1.7784 1.7349 1.5998 -0.0269 0.1167  -0.0981 164 PRO B C   
3405 O O   . PRO B 164 ? 1.6934 1.6394 1.5296 -0.0221 0.1191  -0.0890 164 PRO B O   
3406 C CB  . PRO B 164 ? 2.0691 1.9421 1.8184 -0.0163 0.0877  -0.1326 164 PRO B CB  
3407 C CG  . PRO B 164 ? 2.1199 1.9183 1.8354 0.0007  0.0682  -0.1463 164 PRO B CG  
3408 C CD  . PRO B 164 ? 2.1215 1.9266 1.8677 0.0095  0.0658  -0.1457 164 PRO B CD  
3409 N N   . ASP B 165 ? 1.6392 1.6349 1.4618 -0.0421 0.1338  -0.0827 165 ASP B N   
3410 C CA  . ASP B 165 ? 1.5373 1.5557 1.3694 -0.0552 0.1568  -0.0518 165 ASP B CA  
3411 C C   . ASP B 165 ? 1.5354 1.5059 1.3188 -0.0614 0.1616  -0.0419 165 ASP B C   
3412 O O   . ASP B 165 ? 1.5423 1.4596 1.2872 -0.0536 0.1467  -0.0579 165 ASP B O   
3413 C CB  . ASP B 165 ? 1.4819 1.5819 1.3527 -0.0676 0.1741  -0.0388 165 ASP B CB  
3414 C CG  . ASP B 165 ? 1.5046 1.6242 1.3603 -0.0726 0.1714  -0.0511 165 ASP B CG  
3415 O OD1 . ASP B 165 ? 1.5347 1.6456 1.3859 -0.0633 0.1535  -0.0779 165 ASP B OD1 
3416 O OD2 . ASP B 165 ? 1.4902 1.6353 1.3410 -0.0856 0.1869  -0.0349 165 ASP B OD2 
3417 N N   . PHE B 166 ? 1.5688 1.5582 1.3558 -0.0752 0.1826  -0.0149 166 PHE B N   
3418 C CA  . PHE B 166 ? 1.6057 1.5510 1.3504 -0.0818 0.1896  -0.0027 166 PHE B CA  
3419 C C   . PHE B 166 ? 1.5933 1.5379 1.3172 -0.0860 0.1857  -0.0140 166 PHE B C   
3420 O O   . PHE B 166 ? 1.5524 1.4397 1.2370 -0.0807 0.1767  -0.0217 166 PHE B O   
3421 C CB  . PHE B 166 ? 1.5876 1.5558 1.3451 -0.0965 0.2134  0.0287  166 PHE B CB  
3422 C CG  . PHE B 166 ? 1.6467 1.5962 1.4146 -0.0918 0.2164  0.0402  166 PHE B CG  
3423 C CD1 . PHE B 166 ? 1.5903 1.5910 1.4029 -0.1007 0.2326  0.0605  166 PHE B CD1 
3424 C CD2 . PHE B 166 ? 1.6544 1.5365 1.3893 -0.0776 0.2024  0.0300  166 PHE B CD2 
3425 C CE1 . PHE B 166 ? 1.5483 1.5329 1.3753 -0.0962 0.2345  0.0694  166 PHE B CE1 
3426 C CE2 . PHE B 166 ? 1.5183 1.3847 1.2643 -0.0720 0.2038  0.0379  166 PHE B CE2 
3427 C CZ  . PHE B 166 ? 1.4713 1.3889 1.2649 -0.0816 0.2196  0.0570  166 PHE B CZ  
3428 N N   . TYR B 167 ? 1.6023 1.6118 1.3545 -0.0945 0.1924  -0.0149 167 TYR B N   
3429 C CA  . TYR B 167 ? 1.5951 1.6110 1.3345 -0.0977 0.1875  -0.0286 167 TYR B CA  
3430 C C   . TYR B 167 ? 1.6137 1.5940 1.3371 -0.0839 0.1634  -0.0592 167 TYR B C   
3431 O O   . TYR B 167 ? 1.5637 1.5030 1.2580 -0.0821 0.1555  -0.0684 167 TYR B O   
3432 C CB  . TYR B 167 ? 1.5576 1.6556 1.3326 -0.1067 0.1975  -0.0267 167 TYR B CB  
3433 C CG  . TYR B 167 ? 1.5981 1.7115 1.3689 -0.1057 0.1867  -0.0500 167 TYR B CG  
3434 C CD1 . TYR B 167 ? 1.5806 1.6909 1.3369 -0.1144 0.1928  -0.0461 167 TYR B CD1 
3435 C CD2 . TYR B 167 ? 1.6337 1.7648 1.4181 -0.0957 0.1700  -0.0769 167 TYR B CD2 
3436 C CE1 . TYR B 167 ? 1.5728 1.6987 1.3300 -0.1128 0.1820  -0.0692 167 TYR B CE1 
3437 C CE2 . TYR B 167 ? 1.6834 1.8301 1.4667 -0.0946 0.1594  -0.0997 167 TYR B CE2 
3438 C CZ  . TYR B 167 ? 1.6515 1.7961 1.4220 -0.1030 0.1652  -0.0962 167 TYR B CZ  
3439 O OH  . TYR B 167 ? 1.6249 1.7867 1.3988 -0.1013 0.1538  -0.1207 167 TYR B OH  
3440 N N   . LYS B 168 ? 1.6541 1.6506 1.3996 -0.0741 0.1520  -0.0743 168 LYS B N   
3441 C CA  . LYS B 168 ? 1.6765 1.6412 1.4106 -0.0608 0.1284  -0.1039 168 LYS B CA  
3442 C C   . LYS B 168 ? 1.5865 1.4681 1.2757 -0.0522 0.1181  -0.1060 168 LYS B C   
3443 O O   . LYS B 168 ? 1.4805 1.3286 1.1470 -0.0476 0.1051  -0.1222 168 LYS B O   
3444 C CB  . LYS B 168 ? 1.7720 1.7595 1.5378 -0.0511 0.1195  -0.1157 168 LYS B CB  
3445 C CG  . LYS B 168 ? 1.8246 1.8092 1.5945 -0.0406 0.0976  -0.1480 168 LYS B CG  
3446 C CD  . LYS B 168 ? 1.7782 1.7971 1.5880 -0.0329 0.0927  -0.1566 168 LYS B CD  
3447 C CE  . LYS B 168 ? 1.7344 1.7509 1.5501 -0.0230 0.0712  -0.1891 168 LYS B CE  
3448 N NZ  . LYS B 168 ? 1.7320 1.6717 1.5117 -0.0111 0.0503  -0.2061 168 LYS B NZ  
3449 N N   . THR B 169 ? 1.6058 1.4564 1.2838 -0.0495 0.1243  -0.0890 169 THR B N   
3450 C CA  . THR B 169 ? 1.6316 1.4054 1.2655 -0.0396 0.1163  -0.0882 169 THR B CA  
3451 C C   . THR B 169 ? 1.6548 1.3977 1.2564 -0.0463 0.1234  -0.0782 169 THR B C   
3452 O O   . THR B 169 ? 1.7482 1.4351 1.3164 -0.0368 0.1113  -0.0874 169 THR B O   
3453 C CB  . THR B 169 ? 1.3958 1.1495 1.0269 -0.0359 0.1236  -0.0708 169 THR B CB  
3454 O OG1 . THR B 169 ? 1.4883 1.2357 1.1342 -0.0215 0.1075  -0.0879 169 THR B OG1 
3455 C CG2 . THR B 169 ? 1.3623 1.0475 0.9449 -0.0311 0.1251  -0.0595 169 THR B CG2 
3456 N N   . LYS B 170 ? 1.5064 1.2857 1.1201 -0.0622 0.1432  -0.0591 170 LYS B N   
3457 C CA  . LYS B 170 ? 1.3801 1.1350 0.9705 -0.0694 0.1510  -0.0496 170 LYS B CA  
3458 C C   . LYS B 170 ? 1.3931 1.1464 0.9825 -0.0661 0.1361  -0.0736 170 LYS B C   
3459 O O   . LYS B 170 ? 1.4648 1.1804 1.0318 -0.0662 0.1357  -0.0720 170 LYS B O   
3460 C CB  . LYS B 170 ? 1.2746 1.0751 0.8836 -0.0871 0.1740  -0.0267 170 LYS B CB  
3461 C CG  . LYS B 170 ? 1.3376 1.1209 0.9377 -0.0918 0.1906  0.0009  170 LYS B CG  
3462 C CD  . LYS B 170 ? 1.4795 1.3154 1.1043 -0.1097 0.2125  0.0226  170 LYS B CD  
3463 C CE  . LYS B 170 ? 1.6525 1.5594 1.3211 -0.1133 0.2159  0.0219  170 LYS B CE  
3464 N NZ  . LYS B 170 ? 1.6855 1.6464 1.3787 -0.1300 0.2374  0.0444  170 LYS B NZ  
3465 N N   . ILE B 171 ? 1.2953 1.0898 0.9116 -0.0629 0.1240  -0.0958 171 ILE B N   
3466 C CA  . ILE B 171 ? 1.3435 1.1394 0.9629 -0.0592 0.1081  -0.1216 171 ILE B CA  
3467 C C   . ILE B 171 ? 1.3563 1.0866 0.9476 -0.0435 0.0882  -0.1368 171 ILE B C   
3468 O O   . ILE B 171 ? 1.3762 1.0684 0.9488 -0.0404 0.0810  -0.1432 171 ILE B O   
3469 C CB  . ILE B 171 ? 1.3700 1.2340 1.0280 -0.0603 0.1020  -0.1410 171 ILE B CB  
3470 C CG1 . ILE B 171 ? 1.4125 1.3454 1.0973 -0.0748 0.1206  -0.1280 171 ILE B CG1 
3471 C CG2 . ILE B 171 ? 1.2424 1.1008 0.9028 -0.0541 0.0821  -0.1711 171 ILE B CG2 
3472 C CD1 . ILE B 171 ? 1.4471 1.3791 1.1255 -0.0830 0.1258  -0.1263 171 ILE B CD1 
3473 N N   . LYS B 172 ? 1.3368 1.0554 0.9278 -0.0331 0.0793  -0.1424 172 LYS B N   
3474 C CA  . LYS B 172 ? 1.3387 0.9987 0.9045 -0.0165 0.0589  -0.1580 172 LYS B CA  
3475 C C   . LYS B 172 ? 1.3805 0.9721 0.9023 -0.0111 0.0623  -0.1418 172 LYS B C   
3476 O O   . LYS B 172 ? 1.3606 0.8985 0.8555 0.0028  0.0465  -0.1523 172 LYS B O   
3477 C CB  . LYS B 172 ? 1.3274 0.9924 0.9054 -0.0070 0.0515  -0.1640 172 LYS B CB  
3478 C CG  . LYS B 172 ? 1.4951 1.1070 1.0524 0.0114  0.0281  -0.1841 172 LYS B CG  
3479 C CD  . LYS B 172 ? 1.5450 1.1587 1.1150 0.0208  0.0235  -0.1861 172 LYS B CD  
3480 C CE  . LYS B 172 ? 1.6756 1.2302 1.2198 0.0406  0.0004  -0.2040 172 LYS B CE  
3481 N NZ  . LYS B 172 ? 1.6907 1.2395 1.2444 0.0513  -0.0038 -0.2044 172 LYS B NZ  
3482 N N   . LEU B 173 ? 1.2910 0.8851 0.8057 -0.0218 0.0834  -0.1154 173 LEU B N   
3483 C CA  . LEU B 173 ? 1.2675 0.8001 0.7419 -0.0174 0.0897  -0.0972 173 LEU B CA  
3484 C C   . LEU B 173 ? 1.3738 0.8821 0.8382 -0.0173 0.0846  -0.1036 173 LEU B C   
3485 O O   . LEU B 173 ? 1.5498 1.0038 0.9864 -0.0039 0.0720  -0.1097 173 LEU B O   
3486 C CB  . LEU B 173 ? 1.1955 0.7392 0.6684 -0.0298 0.1143  -0.0673 173 LEU B CB  
3487 C CG  . LEU B 173 ? 1.2357 0.7203 0.6688 -0.0209 0.1201  -0.0483 173 LEU B CG  
3488 C CD1 . LEU B 173 ? 1.2581 0.7484 0.6886 -0.0348 0.1450  -0.0189 173 LEU B CD1 
3489 C CD2 . LEU B 173 ? 1.2519 0.6724 0.6479 -0.0066 0.1082  -0.0536 173 LEU B CD2 
3490 N N   . CYS B 174 ? 1.2659 0.8155 0.7552 -0.0317 0.0942  -0.1022 174 CYS B N   
3491 C CA  . CYS B 174 ? 1.2865 0.8179 0.7747 -0.0324 0.0899  -0.1089 174 CYS B CA  
3492 C C   . CYS B 174 ? 1.3034 0.8108 0.7887 -0.0191 0.0654  -0.1359 174 CYS B C   
3493 O O   . CYS B 174 ? 1.2762 0.7382 0.7452 -0.0123 0.0592  -0.1369 174 CYS B O   
3494 C CB  . CYS B 174 ? 1.0784 0.6699 0.6024 -0.0481 0.0989  -0.1120 174 CYS B CB  
3495 S SG  . CYS B 174 ? 1.8915 1.5005 1.4165 -0.0640 0.1279  -0.0786 174 CYS B SG  
3496 N N   . ILE B 175 ? 1.2754 0.8131 0.7785 -0.0152 0.0520  -0.1568 175 ILE B N   
3497 C CA  . ILE B 175 ? 1.3809 0.9002 0.8850 -0.0034 0.0280  -0.1842 175 ILE B CA  
3498 C C   . ILE B 175 ? 1.5145 0.9608 0.9773 0.0135  0.0183  -0.1796 175 ILE B C   
3499 O O   . ILE B 175 ? 1.5788 0.9874 1.0305 0.0221  0.0049  -0.1899 175 ILE B O   
3500 C CB  . ILE B 175 ? 1.3755 0.9438 0.9087 -0.0028 0.0175  -0.2057 175 ILE B CB  
3501 C CG1 . ILE B 175 ? 1.4360 1.0796 1.0061 -0.0185 0.0309  -0.2047 175 ILE B CG1 
3502 C CG2 . ILE B 175 ? 1.2689 0.8270 0.8103 0.0065  -0.0068 -0.2364 175 ILE B CG2 
3503 C CD1 . ILE B 175 ? 1.4030 1.0664 0.9895 -0.0268 0.0317  -0.2127 175 ILE B CD1 
3504 N N   . LEU B 176 ? 1.5330 0.9607 0.9741 0.0188  0.0253  -0.1637 176 LEU B N   
3505 C CA  . LEU B 176 ? 1.5084 0.8700 0.9076 0.0366  0.0167  -0.1586 176 LEU B CA  
3506 C C   . LEU B 176 ? 1.5405 0.8511 0.9068 0.0395  0.0270  -0.1365 176 LEU B C   
3507 O O   . LEU B 176 ? 1.6592 0.9196 1.0003 0.0536  0.0149  -0.1405 176 LEU B O   
3508 C CB  . LEU B 176 ? 1.4905 0.8520 0.8805 0.0417  0.0211  -0.1496 176 LEU B CB  
3509 C CG  . LEU B 176 ? 1.5137 0.9136 0.9341 0.0441  0.0083  -0.1714 176 LEU B CG  
3510 C CD1 . LEU B 176 ? 1.4693 0.8470 0.8740 0.0566  0.0054  -0.1671 176 LEU B CD1 
3511 C CD2 . LEU B 176 ? 1.5237 0.9161 0.9522 0.0523  -0.0154 -0.2009 176 LEU B CD2 
3512 N N   . LEU B 177 ? 1.4836 0.8067 0.8510 0.0268  0.0498  -0.1122 177 LEU B N   
3513 C CA  . LEU B 177 ? 1.5208 0.7991 0.8620 0.0281  0.0622  -0.0895 177 LEU B CA  
3514 C C   . LEU B 177 ? 1.5915 0.8531 0.9412 0.0305  0.0522  -0.1008 177 LEU B C   
3515 O O   . LEU B 177 ? 1.5851 0.7927 0.9070 0.0415  0.0518  -0.0897 177 LEU B O   
3516 C CB  . LEU B 177 ? 1.4746 0.7787 0.8263 0.0109  0.0877  -0.0654 177 LEU B CB  
3517 C CG  . LEU B 177 ? 1.4076 0.7161 0.7465 0.0092  0.1010  -0.0474 177 LEU B CG  
3518 C CD1 . LEU B 177 ? 1.3488 0.6760 0.6962 -0.0078 0.1263  -0.0220 177 LEU B CD1 
3519 C CD2 . LEU B 177 ? 1.5472 0.7938 0.8398 0.0284  0.0965  -0.0386 177 LEU B CD2 
3520 N N   . HIS B 178 ? 1.5905 0.8997 0.9803 0.0208  0.0442  -0.1227 178 HIS B N   
3521 C CA  . HIS B 178 ? 1.6125 0.9117 1.0181 0.0228  0.0324  -0.1377 178 HIS B CA  
3522 C C   . HIS B 178 ? 1.5473 0.8063 0.9350 0.0407  0.0092  -0.1549 178 HIS B C   
3523 O O   . HIS B 178 ? 1.5120 0.7234 0.8833 0.0506  0.0047  -0.1496 178 HIS B O   
3524 C CB  . HIS B 178 ? 1.6899 1.0549 1.1440 0.0087  0.0288  -0.1594 178 HIS B CB  
3525 C CG  . HIS B 178 ? 1.7777 1.1629 1.2537 -0.0048 0.0446  -0.1481 178 HIS B CG  
3526 N ND1 . HIS B 178 ? 1.8655 1.2277 1.3530 -0.0034 0.0415  -0.1502 178 HIS B ND1 
3527 C CD2 . HIS B 178 ? 1.7594 1.1859 1.2509 -0.0197 0.0633  -0.1350 178 HIS B CD2 
3528 C CE1 . HIS B 178 ? 1.8785 1.2665 1.3882 -0.0163 0.0571  -0.1400 178 HIS B CE1 
3529 N NE2 . HIS B 178 ? 1.8127 1.2396 1.3234 -0.0264 0.0704  -0.1306 178 HIS B NE2 
3530 N N   . ALA B 179 ? 1.4802 0.7591 0.8732 0.0452  -0.0052 -0.1751 179 ALA B N   
3531 C CA  . ALA B 179 ? 1.4646 0.7081 0.8426 0.0621  -0.0285 -0.1936 179 ALA B CA  
3532 C C   . ALA B 179 ? 1.5010 0.6778 0.8287 0.0794  -0.0275 -0.1742 179 ALA B C   
3533 O O   . ALA B 179 ? 1.5270 0.6601 0.8368 0.0940  -0.0422 -0.1802 179 ALA B O   
3534 C CB  . ALA B 179 ? 1.4603 0.7374 0.8539 0.0636  -0.0416 -0.2160 179 ALA B CB  
3535 N N   . PHE B 180 ? 1.4279 0.5988 0.7335 0.0782  -0.0098 -0.1505 180 PHE B N   
3536 C CA  . PHE B 180 ? 1.4493 0.5622 0.7056 0.0954  -0.0073 -0.1317 180 PHE B CA  
3537 C C   . PHE B 180 ? 1.5191 0.5873 0.7544 0.0999  0.0024  -0.1100 180 PHE B C   
3538 O O   . PHE B 180 ? 1.6530 0.6686 0.8519 0.1189  -0.0052 -0.1042 180 PHE B O   
3539 C CB  . PHE B 180 ? 1.5462 0.6696 0.7892 0.0921  0.0089  -0.1139 180 PHE B CB  
3540 C CG  . PHE B 180 ? 1.6256 0.6989 0.8212 0.1129  0.0046  -0.1050 180 PHE B CG  
3541 C CD1 . PHE B 180 ? 1.6477 0.6978 0.8134 0.1147  0.0240  -0.0766 180 PHE B CD1 
3542 C CD2 . PHE B 180 ? 1.5896 0.6396 0.7710 0.1314  -0.0193 -0.1260 180 PHE B CD2 
3543 C CE1 . PHE B 180 ? 1.6559 0.6622 0.7773 0.1354  0.0195  -0.0699 180 PHE B CE1 
3544 C CE2 . PHE B 180 ? 1.5530 0.5589 0.6907 0.1522  -0.0245 -0.1196 180 PHE B CE2 
3545 C CZ  . PHE B 180 ? 1.5688 0.5536 0.6759 0.1547  -0.0050 -0.0918 180 PHE B CZ  
3546 N N   . ARG B 181 ? 1.4489 0.5378 0.7081 0.0838  0.0193  -0.0977 181 ARG B N   
3547 C CA  . ARG B 181 ? 1.5063 0.5540 0.7533 0.0880  0.0288  -0.0773 181 ARG B CA  
3548 C C   . ARG B 181 ? 1.5124 0.5361 0.7658 0.0991  0.0085  -0.0943 181 ARG B C   
3549 O O   . ARG B 181 ? 1.6823 0.6535 0.9068 0.1148  0.0074  -0.0804 181 ARG B O   
3550 C CB  . ARG B 181 ? 1.2935 0.3705 0.5729 0.0686  0.0484  -0.0648 181 ARG B CB  
3551 C CG  . ARG B 181 ? 1.4373 0.4692 0.6937 0.0726  0.0680  -0.0317 181 ARG B CG  
3552 C CD  . ARG B 181 ? 1.4180 0.4673 0.7136 0.0581  0.0799  -0.0257 181 ARG B CD  
3553 N NE  . ARG B 181 ? 1.4553 0.4849 0.7698 0.0652  0.0669  -0.0362 181 ARG B NE  
3554 C CZ  . ARG B 181 ? 1.4952 0.4771 0.7997 0.0747  0.0747  -0.0150 181 ARG B CZ  
3555 N NH1 . ARG B 181 ? 1.5307 0.4994 0.8590 0.0806  0.0616  -0.0263 181 ARG B NH1 
3556 N NH2 . ARG B 181 ? 1.4313 0.3794 0.7042 0.0787  0.0958  0.0178  181 ARG B NH2 
3557 N N   . ILE B 182 ? 1.3681 0.4316 0.6604 0.0914  -0.0075 -0.1242 182 ILE B N   
3558 C CA  . ILE B 182 ? 1.4379 0.4832 0.7418 0.1005  -0.0285 -0.1437 182 ILE B CA  
3559 C C   . ILE B 182 ? 1.5093 0.5068 0.7701 0.1229  -0.0442 -0.1460 182 ILE B C   
3560 O O   . ILE B 182 ? 1.6219 0.5750 0.8671 0.1371  -0.0524 -0.1417 182 ILE B O   
3561 C CB  . ILE B 182 ? 1.4953 0.5961 0.8485 0.0883  -0.0436 -0.1778 182 ILE B CB  
3562 C CG1 . ILE B 182 ? 1.4528 0.5851 0.8502 0.0725  -0.0345 -0.1786 182 ILE B CG1 
3563 C CG2 . ILE B 182 ? 1.5424 0.6239 0.8981 0.1008  -0.0700 -0.2027 182 ILE B CG2 
3564 C CD1 . ILE B 182 ? 1.4613 0.6262 0.8671 0.0568  -0.0105 -0.1603 182 ILE B CD1 
3565 N N   . ARG B 183 ? 1.4213 0.4280 0.6638 0.1270  -0.0480 -0.1520 183 ARG B N   
3566 C CA  . ARG B 183 ? 1.5077 0.4700 0.7081 0.1494  -0.0625 -0.1544 183 ARG B CA  
3567 C C   . ARG B 183 ? 1.7025 0.6104 0.8543 0.1642  -0.0491 -0.1223 183 ARG B C   
3568 O O   . ARG B 183 ? 1.9217 0.7828 1.0445 0.1837  -0.0603 -0.1198 183 ARG B O   
3569 C CB  . ARG B 183 ? 1.3874 0.3730 0.5838 0.1507  -0.0684 -0.1673 183 ARG B CB  
3570 C CG  . ARG B 183 ? 1.6517 0.5935 0.8084 0.1750  -0.0861 -0.1739 183 ARG B CG  
3571 C CD  . ARG B 183 ? 1.6977 0.6159 0.8587 0.1857  -0.1092 -0.1934 183 ARG B CD  
3572 N NE  . ARG B 183 ? 1.6923 0.6344 0.8763 0.1866  -0.1314 -0.2267 183 ARG B NE  
3573 C CZ  . ARG B 183 ? 1.7378 0.7130 0.9654 0.1751  -0.1428 -0.2509 183 ARG B CZ  
3574 N NH1 . ARG B 183 ? 1.7694 0.7591 1.0242 0.1620  -0.1355 -0.2474 183 ARG B NH1 
3575 N NH2 . ARG B 183 ? 1.7379 0.7319 0.9837 0.1775  -0.1620 -0.2795 183 ARG B NH2 
3576 N N   . ALA B 184 ? 1.6214 0.5360 0.7643 0.1556  -0.0249 -0.0973 184 ALA B N   
3577 C CA  . ALA B 184 ? 1.5834 0.4495 0.6809 0.1687  -0.0094 -0.0652 184 ALA B CA  
3578 C C   . ALA B 184 ? 1.7660 0.5954 0.8617 0.1761  -0.0081 -0.0523 184 ALA B C   
3579 O O   . ALA B 184 ? 2.0247 0.8035 1.0781 0.1966  -0.0075 -0.0349 184 ALA B O   
3580 C CB  . ALA B 184 ? 1.5343 0.4192 0.6334 0.1539  0.0174  -0.0417 184 ALA B CB  
3581 N N   . VAL B 185 ? 1.6468 0.5030 0.7901 0.1603  -0.0076 -0.0607 185 VAL B N   
3582 C CA  . VAL B 185 ? 1.6486 0.4750 0.8019 0.1660  -0.0075 -0.0510 185 VAL B CA  
3583 C C   . VAL B 185 ? 1.7716 0.5617 0.9047 0.1872  -0.0311 -0.0636 185 VAL B C   
3584 O O   . VAL B 185 ? 1.9153 0.6564 1.0182 0.2051  -0.0281 -0.0427 185 VAL B O   
3585 C CB  . VAL B 185 ? 1.5972 0.4654 0.8125 0.1457  -0.0079 -0.0659 185 VAL B CB  
3586 C CG1 . VAL B 185 ? 1.5110 0.3508 0.7443 0.1539  -0.0164 -0.0656 185 VAL B CG1 
3587 C CG2 . VAL B 185 ? 1.5584 0.4507 0.7918 0.1277  0.0178  -0.0465 185 VAL B CG2 
3588 N N   . THR B 186 ? 1.7082 0.5225 0.8585 0.1859  -0.0542 -0.0971 186 THR B N   
3589 C CA  . THR B 186 ? 1.7580 0.5400 0.8916 0.2052  -0.0784 -0.1119 186 THR B CA  
3590 C C   . THR B 186 ? 1.7386 0.4728 0.8087 0.2298  -0.0785 -0.0950 186 THR B C   
3591 O O   . THR B 186 ? 1.8108 0.5017 0.8550 0.2501  -0.0892 -0.0900 186 THR B O   
3592 C CB  . THR B 186 ? 1.8383 0.6554 0.9995 0.1996  -0.1024 -0.1513 186 THR B CB  
3593 O OG1 . THR B 186 ? 1.8832 0.7352 1.1010 0.1825  -0.1070 -0.1688 186 THR B OG1 
3594 C CG2 . THR B 186 ? 1.7891 0.5679 0.9218 0.2223  -0.1271 -0.1650 186 THR B CG2 
3595 N N   . ILE B 187 ? 1.6436 0.3870 0.6896 0.2284  -0.0666 -0.0861 187 ILE B N   
3596 C CA  . ILE B 187 ? 1.6900 0.3916 0.6760 0.2515  -0.0641 -0.0690 187 ILE B CA  
3597 C C   . ILE B 187 ? 1.8853 0.5425 0.8429 0.2633  -0.0466 -0.0332 187 ILE B C   
3598 O O   . ILE B 187 ? 2.0508 0.6633 0.9700 0.2877  -0.0553 -0.0252 187 ILE B O   
3599 C CB  . ILE B 187 ? 1.7064 0.4305 0.6798 0.2451  -0.0519 -0.0648 187 ILE B CB  
3600 C CG1 . ILE B 187 ? 1.7166 0.4640 0.6974 0.2475  -0.0736 -0.0972 187 ILE B CG1 
3601 C CG2 . ILE B 187 ? 1.8024 0.4846 0.7184 0.2643  -0.0382 -0.0358 187 ILE B CG2 
3602 C CD1 . ILE B 187 ? 1.7456 0.5065 0.7096 0.2475  -0.0647 -0.0928 187 ILE B CD1 
3603 N N   . ASP B 188 ? 1.8330 0.5028 0.8105 0.2468  -0.0219 -0.0112 188 ASP B N   
3604 C CA  . ASP B 188 ? 1.8906 0.5208 0.8484 0.2563  -0.0027 0.0244  188 ASP B CA  
3605 C C   . ASP B 188 ? 1.9472 0.5480 0.9135 0.2692  -0.0157 0.0238  188 ASP B C   
3606 O O   . ASP B 188 ? 2.0202 0.5745 0.9481 0.2912  -0.0111 0.0479  188 ASP B O   
3607 C CB  . ASP B 188 ? 1.9047 0.5588 0.8966 0.2333  0.0232  0.0425  188 ASP B CB  
3608 C CG  . ASP B 188 ? 1.9586 0.5731 0.9196 0.2434  0.0486  0.0835  188 ASP B CG  
3609 O OD1 . ASP B 188 ? 1.9075 0.5321 0.8600 0.2338  0.0693  0.1000  188 ASP B OD1 
3610 O OD2 . ASP B 188 ? 2.0221 0.5961 0.9688 0.2610  0.0483  0.0999  188 ASP B OD2 
3611 N N   . ARG B 189 ? 1.9179 0.5469 0.9349 0.2561  -0.0319 -0.0034 189 ARG B N   
3612 C CA  . ARG B 189 ? 2.0139 0.6197 1.0467 0.2664  -0.0467 -0.0079 189 ARG B CA  
3613 C C   . ARG B 189 ? 2.0619 0.6239 1.0429 0.2956  -0.0639 -0.0080 189 ARG B C   
3614 O O   . ARG B 189 ? 2.0573 0.5801 1.0244 0.3128  -0.0634 0.0111  189 ARG B O   
3615 C CB  . ARG B 189 ? 1.9106 0.5579 1.0024 0.2487  -0.0659 -0.0444 189 ARG B CB  
3616 C CG  . ARG B 189 ? 1.8887 0.5689 1.0397 0.2255  -0.0525 -0.0426 189 ARG B CG  
3617 C CD  . ARG B 189 ? 1.7834 0.4923 0.9908 0.2150  -0.0735 -0.0757 189 ARG B CD  
3618 N NE  . ARG B 189 ? 1.7310 0.4542 0.9920 0.2012  -0.0619 -0.0683 189 ARG B NE  
3619 C CZ  . ARG B 189 ? 1.7343 0.5039 1.0356 0.1789  -0.0511 -0.0755 189 ARG B CZ  
3620 N NH1 . ARG B 189 ? 1.7644 0.5713 1.0584 0.1673  -0.0497 -0.0889 189 ARG B NH1 
3621 N NH2 . ARG B 189 ? 1.7431 0.5227 1.0941 0.1689  -0.0420 -0.0696 189 ARG B NH2 
3622 N N   . VAL B 190 ? 2.0729 0.6429 1.0279 0.3019  -0.0794 -0.0296 190 VAL B N   
3623 C CA  . VAL B 190 ? 2.1316 0.6628 1.0367 0.3304  -0.0977 -0.0333 190 VAL B CA  
3624 C C   . VAL B 190 ? 2.1952 0.6846 1.0405 0.3522  -0.0797 0.0031  190 VAL B C   
3625 O O   . VAL B 190 ? 2.2220 0.6696 1.0362 0.3757  -0.0834 0.0192  190 VAL B O   
3626 C CB  . VAL B 190 ? 2.0654 0.6172 0.9615 0.3317  -0.1179 -0.0660 190 VAL B CB  
3627 C CG1 . VAL B 190 ? 1.9512 0.4619 0.7953 0.3630  -0.1377 -0.0708 190 VAL B CG1 
3628 C CG2 . VAL B 190 ? 2.0221 0.6161 0.9768 0.3112  -0.1351 -0.1017 190 VAL B CG2 
3629 N N   . MET B 191 ? 2.2055 0.7079 1.0358 0.3445  -0.0596 0.0168  191 MET B N   
3630 C CA  . MET B 191 ? 2.3399 0.8068 1.1136 0.3639  -0.0411 0.0503  191 MET B CA  
3631 C C   . MET B 191 ? 2.4755 0.9117 1.2490 0.3698  -0.0213 0.0868  191 MET B C   
3632 O O   . MET B 191 ? 2.6379 1.0328 1.3609 0.3954  -0.0142 0.1128  191 MET B O   
3633 C CB  . MET B 191 ? 2.3768 0.8685 1.1443 0.3503  -0.0226 0.0565  191 MET B CB  
3634 C CG  . MET B 191 ? 2.4162 0.9143 1.1521 0.3613  -0.0373 0.0357  191 MET B CG  
3635 S SD  . MET B 191 ? 2.0984 0.5907 0.8323 0.3775  -0.0768 -0.0035 191 MET B SD  
3636 C CE  . MET B 191 ? 1.8733 0.3966 0.6037 0.3747  -0.0874 -0.0308 191 MET B CE  
3637 N N   . SER B 192 ? 2.3836 0.8410 1.2150 0.3473  -0.0125 0.0886  192 SER B N   
3638 C CA  . SER B 192 ? 2.2773 0.7082 1.1210 0.3515  0.0052  0.1212  192 SER B CA  
3639 C C   . SER B 192 ? 2.2296 0.6286 1.0662 0.3729  -0.0131 0.1201  192 SER B C   
3640 O O   . SER B 192 ? 2.3374 0.6984 1.1541 0.3913  -0.0011 0.1524  192 SER B O   
3641 C CB  . SER B 192 ? 2.2330 0.6983 1.1471 0.3220  0.0160  0.1182  192 SER B CB  
3642 O OG  . SER B 192 ? 2.4060 0.8948 1.3239 0.3042  0.0376  0.1277  192 SER B OG  
3643 N N   . TYR B 193 ? 2.1333 0.5484 0.9874 0.3706  -0.0418 0.0833  193 TYR B N   
3644 C CA  . TYR B 193 ? 2.1861 0.5751 1.0388 0.3886  -0.0628 0.0768  193 TYR B CA  
3645 C C   . TYR B 193 ? 2.3479 0.6935 1.1269 0.4231  -0.0687 0.0908  193 TYR B C   
3646 O O   . TYR B 193 ? 2.4083 0.7166 1.1686 0.4443  -0.0658 0.1155  193 TYR B O   
3647 C CB  . TYR B 193 ? 2.1608 0.5808 1.0507 0.3760  -0.0920 0.0314  193 TYR B CB  
3648 C CG  . TYR B 193 ? 2.2513 0.6475 1.1451 0.3920  -0.1158 0.0207  193 TYR B CG  
3649 C CD1 . TYR B 193 ? 2.3011 0.6835 1.2316 0.3921  -0.1115 0.0367  193 TYR B CD1 
3650 C CD2 . TYR B 193 ? 2.2822 0.6704 1.1472 0.4068  -0.1432 -0.0061 193 TYR B CD2 
3651 C CE1 . TYR B 193 ? 2.3220 0.6835 1.2590 0.4063  -0.1334 0.0273  193 TYR B CE1 
3652 C CE2 . TYR B 193 ? 2.3569 0.7231 1.2262 0.4212  -0.1656 -0.0163 193 TYR B CE2 
3653 C CZ  . TYR B 193 ? 2.3636 0.7168 1.2685 0.4205  -0.1605 0.0008  193 TYR B CZ  
3654 O OH  . TYR B 193 ? 2.4486 0.7805 1.3600 0.4344  -0.1830 -0.0088 193 TYR B OH  
3655 N N   . LEU B 194 ? 2.4053 0.7570 1.1442 0.4297  -0.0769 0.0750  194 LEU B N   
3656 C CA  . LEU B 194 ? 2.3647 0.6795 1.0328 0.4635  -0.0849 0.0832  194 LEU B CA  
3657 C C   . LEU B 194 ? 2.4425 0.7235 1.0679 0.4813  -0.0572 0.1296  194 LEU B C   
3658 O O   . LEU B 194 ? 2.6287 0.8713 1.2160 0.5097  -0.0598 0.1489  194 LEU B O   
3659 C CB  . LEU B 194 ? 2.2890 0.6217 0.9308 0.4647  -0.0967 0.0571  194 LEU B CB  
3660 C CG  . LEU B 194 ? 2.2713 0.6368 0.9540 0.4492  -0.1241 0.0116  194 LEU B CG  
3661 C CD1 . LEU B 194 ? 2.0447 0.4306 0.7096 0.4490  -0.1330 -0.0121 194 LEU B CD1 
3662 C CD2 . LEU B 194 ? 2.3017 0.6442 0.9827 0.4665  -0.1516 -0.0043 194 LEU B CD2 
3663 N N   . ASN B 195 ? 2.3504 0.6461 0.9832 0.4650  -0.0303 0.1480  195 ASN B N   
3664 C CA  . ASN B 195 ? 2.4317 0.6978 1.0278 0.4794  -0.0013 0.1925  195 ASN B CA  
3665 C C   . ASN B 195 ? 2.6222 0.8548 1.2242 0.4944  0.0067  0.2232  195 ASN B C   
3666 O O   . ASN B 195 ? 2.7953 0.9927 1.3492 0.5198  0.0222  0.2581  195 ASN B O   
3667 C CB  . ASN B 195 ? 2.3414 0.6327 0.9647 0.4528  0.0262  0.2058  195 ASN B CB  
3668 C CG  . ASN B 195 ? 2.3357 0.5972 0.9339 0.4639  0.0583  0.2532  195 ASN B CG  
3669 O OD1 . ASN B 195 ? 2.3326 0.5850 0.8842 0.4737  0.0728  0.2687  195 ASN B OD1 
3670 N ND2 . ASN B 195 ? 2.3155 0.5625 0.9477 0.4624  0.0699  0.2764  195 ASN B ND2 
3671 N N   . ALA B 196 ? 2.5838 0.8286 1.2461 0.4795  -0.0040 0.2102  196 ALA B N   
3672 C CA  . ALA B 196 ? 2.5640 0.7815 1.2456 0.4906  0.0033  0.2379  196 ALA B CA  
3673 C C   . ALA B 196 ? 2.6981 0.8908 1.3584 0.5157  -0.0231 0.2282  196 ALA B C   
3674 O O   . ALA B 196 ? 2.8029 0.9664 1.4645 0.5327  -0.0174 0.2558  196 ALA B O   
3675 C CB  . ALA B 196 ? 2.4477 0.6921 1.2134 0.4604  0.0095  0.2328  196 ALA B CB  
3676 N N   . SER B 197 ? 2.7611 0.9654 1.4043 0.5184  -0.0518 0.1898  197 SER B N   
3677 C CA  . SER B 197 ? 2.9279 1.1092 1.5500 0.5421  -0.0791 0.1771  197 SER B CA  
3678 C C   . SER B 197 ? 2.8055 0.9897 1.3818 0.5549  -0.1046 0.1440  197 SER B C   
3679 O O   . SER B 197 ? 2.6419 0.8598 1.2427 0.5341  -0.1171 0.1086  197 SER B O   
3680 C CB  . SER B 197 ? 3.0601 1.2564 1.7533 0.5246  -0.0958 0.1565  197 SER B CB  
3681 O OG  . SER B 197 ? 3.1245 1.3036 1.8496 0.5267  -0.0784 0.1905  197 SER B OG  
3682 O OXT . SER B 197 ? 2.8572 1.0103 1.3725 0.5874  -0.1134 0.1519  197 SER B OXT 
3683 N N   . ASP C 1   ? 1.6444 0.7789 0.8742 0.0876  -0.0540 0.0337  1   ASP L N   
3684 C CA  . ASP C 1   ? 1.5357 0.7754 0.8573 0.0352  -0.0436 0.0402  1   ASP L CA  
3685 C C   . ASP C 1   ? 1.5335 0.7281 0.8216 -0.0313 -0.0562 0.0583  1   ASP L C   
3686 O O   . ASP C 1   ? 1.7103 0.8055 0.9135 -0.0389 -0.0736 0.0685  1   ASP L O   
3687 C CB  . ASP C 1   ? 1.5039 0.8649 0.9198 0.0545  -0.0350 0.0398  1   ASP L CB  
3688 C CG  . ASP C 1   ? 1.6092 1.0148 1.0439 0.1221  -0.0266 0.0253  1   ASP L CG  
3689 O OD1 . ASP C 1   ? 1.6118 0.9691 0.9981 0.1565  -0.0242 0.0126  1   ASP L OD1 
3690 O OD2 . ASP C 1   ? 1.6055 1.0999 1.1019 0.1404  -0.0223 0.0263  1   ASP L OD2 
3691 N N   . ILE C 2   ? 1.3741 0.6423 0.7238 -0.0797 -0.0489 0.0630  2   ILE L N   
3692 C CA  . ILE C 2   ? 1.4850 0.7339 0.8093 -0.1437 -0.0595 0.0798  2   ILE L CA  
3693 C C   . ILE C 2   ? 1.5228 0.8340 0.8904 -0.1542 -0.0627 0.0891  2   ILE L C   
3694 O O   . ILE C 2   ? 1.5390 0.9567 0.9984 -0.1436 -0.0512 0.0837  2   ILE L O   
3695 C CB  . ILE C 2   ? 1.4252 0.7332 0.7953 -0.1883 -0.0518 0.0812  2   ILE L CB  
3696 C CG1 . ILE C 2   ? 1.3460 0.5845 0.6618 -0.1901 -0.0506 0.0746  2   ILE L CG1 
3697 C CG2 . ILE C 2   ? 1.4690 0.7875 0.8249 -0.2512 -0.0617 0.0986  2   ILE L CG2 
3698 C CD1 . ILE C 2   ? 1.2572 0.5376 0.5989 -0.2420 -0.0479 0.0807  2   ILE L CD1 
3699 N N   . GLN C 3   ? 1.6674 0.9082 0.9631 -0.1780 -0.0795 0.1033  3   GLN L N   
3700 C CA  . GLN C 3   ? 1.7196 1.0134 1.0464 -0.1876 -0.0836 0.1122  3   GLN L CA  
3701 C C   . GLN C 3   ? 1.5313 0.9161 0.9114 -0.2429 -0.0800 0.1197  3   GLN L C   
3702 O O   . GLN C 3   ? 1.4932 0.8484 0.8244 -0.2969 -0.0892 0.1319  3   GLN L O   
3703 C CB  . GLN C 3   ? 1.9305 1.1134 1.1551 -0.1925 -0.1051 0.1258  3   GLN L CB  
3704 C CG  . GLN C 3   ? 2.1460 1.2224 1.3004 -0.1328 -0.1122 0.1180  3   GLN L CG  
3705 C CD  . GLN C 3   ? 2.1792 1.3329 1.4105 -0.0641 -0.0969 0.1018  3   GLN L CD  
3706 O OE1 . GLN C 3   ? 2.2133 1.3258 1.4192 -0.0119 -0.0940 0.0889  3   GLN L OE1 
3707 N NE2 . GLN C 3   ? 2.1326 1.4025 1.4551 -0.0655 -0.0873 0.1021  3   GLN L NE2 
3708 N N   . MET C 4   ? 1.3139 0.8115 0.7906 -0.2285 -0.0674 0.1119  4   MET L N   
3709 C CA  . MET C 4   ? 1.2215 0.8122 0.7514 -0.2688 -0.0639 0.1156  4   MET L CA  
3710 C C   . MET C 4   ? 1.3333 0.9460 0.8554 -0.2844 -0.0716 0.1247  4   MET L C   
3711 O O   . MET C 4   ? 1.4254 1.0450 0.9642 -0.2496 -0.0707 0.1211  4   MET L O   
3712 C CB  . MET C 4   ? 1.1508 0.8402 0.7799 -0.2455 -0.0483 0.1008  4   MET L CB  
3713 C CG  . MET C 4   ? 1.0527 0.7279 0.6910 -0.2362 -0.0416 0.0933  4   MET L CG  
3714 S SD  . MET C 4   ? 1.3125 0.9407 0.8892 -0.2910 -0.0499 0.1054  4   MET L SD  
3715 C CE  . MET C 4   ? 0.8211 0.5650 0.4579 -0.3290 -0.0487 0.1099  4   MET L CE  
3716 N N   . THR C 5   ? 1.2727 0.9027 0.7680 -0.3394 -0.0795 0.1374  5   THR L N   
3717 C CA  . THR C 5   ? 1.2422 0.8915 0.7190 -0.3633 -0.0883 0.1480  5   THR L CA  
3718 C C   . THR C 5   ? 1.1255 0.8944 0.6562 -0.4001 -0.0827 0.1480  5   THR L C   
3719 O O   . THR C 5   ? 1.2096 0.9935 0.7115 -0.4499 -0.0881 0.1582  5   THR L O   
3720 C CB  . THR C 5   ? 1.4328 0.9664 0.7918 -0.4008 -0.1098 0.1679  5   THR L CB  
3721 O OG1 . THR C 5   ? 1.6002 1.0262 0.9084 -0.3541 -0.1169 0.1662  5   THR L OG1 
3722 C CG2 . THR C 5   ? 1.3460 0.9145 0.6839 -0.4432 -0.1202 0.1821  5   THR L CG2 
3723 N N   . GLN C 6   ? 0.9540 0.8113 0.5603 -0.3745 -0.0721 0.1358  6   GLN L N   
3724 C CA  . GLN C 6   ? 1.0789 1.0531 0.7358 -0.3994 -0.0665 0.1319  6   GLN L CA  
3725 C C   . GLN C 6   ? 1.2243 1.2220 0.8455 -0.4378 -0.0758 0.1444  6   GLN L C   
3726 O O   . GLN C 6   ? 1.2630 1.2013 0.8438 -0.4311 -0.0844 0.1521  6   GLN L O   
3727 C CB  . GLN C 6   ? 1.0204 1.0738 0.7688 -0.3550 -0.0517 0.1107  6   GLN L CB  
3728 C CG  . GLN C 6   ? 1.1142 1.2045 0.9101 -0.3430 -0.0435 0.0999  6   GLN L CG  
3729 C CD  . GLN C 6   ? 1.2123 1.3326 1.0753 -0.2953 -0.0333 0.0812  6   GLN L CD  
3730 O OE1 . GLN C 6   ? 1.1178 1.1859 0.9785 -0.2655 -0.0316 0.0784  6   GLN L OE1 
3731 N NE2 . GLN C 6   ? 1.3377 1.5432 1.2566 -0.2878 -0.0275 0.0681  6   GLN L NE2 
3732 N N   . SER C 7   ? 1.2248 1.3155 0.8603 -0.4780 -0.0749 0.1468  7   SER L N   
3733 C CA  . SER C 7   ? 1.3375 1.4766 0.9472 -0.5194 -0.0820 0.1572  7   SER L CA  
3734 C C   . SER C 7   ? 1.2980 1.5848 0.9679 -0.5342 -0.0720 0.1468  7   SER L C   
3735 O O   . SER C 7   ? 1.3548 1.6837 1.0482 -0.5386 -0.0676 0.1432  7   SER L O   
3736 C CB  . SER C 7   ? 1.4591 1.5134 0.9615 -0.5798 -0.1023 0.1838  7   SER L CB  
3737 O OG  . SER C 7   ? 1.5803 1.6348 1.0595 -0.6139 -0.1049 0.1909  7   SER L OG  
3738 N N   . PRO C 8   ? 1.1125 1.4818 0.8068 -0.5390 -0.0686 0.1411  8   PRO L N   
3739 C CA  . PRO C 8   ? 1.0988 1.4281 0.7638 -0.5397 -0.0751 0.1475  8   PRO L CA  
3740 C C   . PRO C 8   ? 1.0087 1.3061 0.7229 -0.4749 -0.0659 0.1305  8   PRO L C   
3741 O O   . PRO C 8   ? 1.0649 1.4075 0.8460 -0.4359 -0.0528 0.1104  8   PRO L O   
3742 C CB  . PRO C 8   ? 1.1948 1.6564 0.8865 -0.5655 -0.0704 0.1419  8   PRO L CB  
3743 C CG  . PRO C 8   ? 1.1923 1.7620 0.9214 -0.5780 -0.0626 0.1338  8   PRO L CG  
3744 C CD  . PRO C 8   ? 1.0016 1.5186 0.7591 -0.5379 -0.0573 0.1253  8   PRO L CD  
3745 N N   . SER C 9   ? 1.1003 1.3231 0.7790 -0.4647 -0.0741 0.1393  9   SER L N   
3746 C CA  . SER C 9   ? 1.1407 1.3471 0.8649 -0.4077 -0.0659 0.1250  9   SER L CA  
3747 C C   . SER C 9   ? 1.0021 1.3204 0.8019 -0.3888 -0.0514 0.1025  9   SER L C   
3748 O O   . SER C 9   ? 0.9727 1.2954 0.8197 -0.3452 -0.0427 0.0869  9   SER L O   
3749 C CB  . SER C 9   ? 1.2795 1.4108 0.9536 -0.4031 -0.0785 0.1395  9   SER L CB  
3750 O OG  . SER C 9   ? 1.4401 1.4512 1.0490 -0.3980 -0.0908 0.1538  9   SER L OG  
3751 N N   . SER C 10  ? 0.9868 1.3963 0.7928 -0.4230 -0.0496 0.1006  10  SER L N   
3752 C CA  . SER C 10  ? 0.9561 1.4727 0.8237 -0.4050 -0.0369 0.0774  10  SER L CA  
3753 C C   . SER C 10  ? 0.9465 1.5692 0.8109 -0.4464 -0.0360 0.0774  10  SER L C   
3754 O O   . SER C 10  ? 0.9964 1.6100 0.8030 -0.4992 -0.0474 0.0996  10  SER L O   
3755 C CB  . SER C 10  ? 0.9851 1.4979 0.8580 -0.3903 -0.0366 0.0739  10  SER L CB  
3756 O OG  . SER C 10  ? 1.0115 1.6286 0.9260 -0.3855 -0.0265 0.0533  10  SER L OG  
3757 N N   . LEU C 11  ? 0.9100 1.6340 0.8321 -0.4224 -0.0236 0.0525  11  LEU L N   
3758 C CA  . LEU C 11  ? 1.0622 1.9109 0.9888 -0.4535 -0.0206 0.0481  11  LEU L CA  
3759 C C   . LEU C 11  ? 1.1223 2.0654 1.1073 -0.4123 -0.0071 0.0155  11  LEU L C   
3760 O O   . LEU C 11  ? 1.1522 2.0547 1.1696 -0.3643 -0.0017 -0.0021 11  LEU L O   
3761 C CB  . LEU C 11  ? 0.9565 1.8465 0.8739 -0.4806 -0.0232 0.0570  11  LEU L CB  
3762 C CG  . LEU C 11  ? 0.9343 1.8378 0.8987 -0.4391 -0.0166 0.0415  11  LEU L CG  
3763 C CD1 . LEU C 11  ? 1.0049 1.9842 1.0327 -0.3837 -0.0045 0.0080  11  LEU L CD1 
3764 C CD2 . LEU C 11  ? 0.8592 1.8276 0.8076 -0.4790 -0.0207 0.0544  11  LEU L CD2 
3765 N N   . SER C 12  ? 1.0161 2.0855 1.0091 -0.4325 -0.0026 0.0072  12  SER L N   
3766 C CA  . SER C 12  ? 0.8814 2.0452 0.9218 -0.3918 0.0097  -0.0262 12  SER L CA  
3767 C C   . SER C 12  ? 0.7458 2.0397 0.8109 -0.3888 0.0151  -0.0388 12  SER L C   
3768 O O   . SER C 12  ? 0.8012 2.1676 0.8399 -0.4417 0.0110  -0.0212 12  SER L O   
3769 C CB  . SER C 12  ? 0.9873 2.1923 1.0120 -0.4141 0.0113  -0.0282 12  SER L CB  
3770 O OG  . SER C 12  ? 1.1196 2.3536 1.0945 -0.4830 0.0022  -0.0003 12  SER L OG  
3771 N N   . ALA C 13  ? 0.6695 1.9930 0.7809 -0.3275 0.0225  -0.0683 13  ALA L N   
3772 C CA  . ALA C 13  ? 0.6688 2.1216 0.8078 -0.3115 0.0271  -0.0833 13  ALA L CA  
3773 C C   . ALA C 13  ? 0.7094 2.2183 0.8884 -0.2419 0.0362  -0.1245 13  ALA L C   
3774 O O   . ALA C 13  ? 0.7322 2.1604 0.9170 -0.2060 0.0376  -0.1407 13  ALA L O   
3775 C CB  . ALA C 13  ? 0.5008 1.9188 0.6441 -0.3095 0.0210  -0.0695 13  ALA L CB  
3776 N N   . SER C 14  ? 0.6847 2.3334 0.8868 -0.2231 0.0411  -0.1415 14  SER L N   
3777 C CA  . SER C 14  ? 0.7576 2.4687 0.9900 -0.1526 0.0484  -0.1833 14  SER L CA  
3778 C C   . SER C 14  ? 0.7692 2.4558 1.0275 -0.0921 0.0438  -0.1970 14  SER L C   
3779 O O   . SER C 14  ? 0.8544 2.5177 1.1131 -0.1111 0.0370  -0.1740 14  SER L O   
3780 C CB  . SER C 14  ? 0.9098 2.8080 1.1502 -0.1621 0.0572  -0.1975 14  SER L CB  
3781 O OG  . SER C 14  ? 0.9889 2.9164 1.1998 -0.2293 0.0591  -0.1793 14  SER L OG  
3782 N N   . VAL C 15  ? 0.6609 2.3481 0.9351 -0.0201 0.0459  -0.2345 15  VAL L N   
3783 C CA  . VAL C 15  ? 0.6247 2.2868 0.9175 0.0433  0.0386  -0.2499 15  VAL L CA  
3784 C C   . VAL C 15  ? 0.7190 2.5330 1.0341 0.0499  0.0390  -0.2485 15  VAL L C   
3785 O O   . VAL C 15  ? 0.6865 2.6543 1.0121 0.0576  0.0474  -0.2654 15  VAL L O   
3786 C CB  . VAL C 15  ? 0.5357 2.1597 0.8278 0.1199  0.0380  -0.2923 15  VAL L CB  
3787 C CG1 . VAL C 15  ? 0.5755 2.2020 0.8820 0.1899  0.0286  -0.3106 15  VAL L CG1 
3788 C CG2 . VAL C 15  ? 0.5258 1.9850 0.7951 0.1135  0.0339  -0.2898 15  VAL L CG2 
3789 N N   . GLY C 16  ? 0.7431 2.5216 1.0651 0.0444  0.0301  -0.2276 16  GLY L N   
3790 C CA  . GLY C 16  ? 0.6268 2.5442 0.9706 0.0524  0.0284  -0.2241 16  GLY L CA  
3791 C C   . GLY C 16  ? 0.5851 2.5614 0.9168 -0.0340 0.0284  -0.1845 16  GLY L C   
3792 O O   . GLY C 16  ? 0.5760 2.6821 0.9224 -0.0419 0.0270  -0.1768 16  GLY L O   
3793 N N   . ASP C 17  ? 0.6193 2.4988 0.9195 -0.0990 0.0284  -0.1588 17  ASP L N   
3794 C CA  . ASP C 17  ? 0.6634 2.5722 0.9361 -0.1857 0.0255  -0.1205 17  ASP L CA  
3795 C C   . ASP C 17  ? 0.6672 2.4742 0.9300 -0.2039 0.0155  -0.0946 17  ASP L C   
3796 O O   . ASP C 17  ? 0.6043 2.2871 0.8758 -0.1613 0.0113  -0.1017 17  ASP L O   
3797 C CB  . ASP C 17  ? 0.6812 2.5239 0.9153 -0.2447 0.0273  -0.1043 17  ASP L CB  
3798 C CG  . ASP C 17  ? 0.7125 2.6666 0.9502 -0.2434 0.0369  -0.1246 17  ASP L CG  
3799 O OD1 . ASP C 17  ? 0.7860 2.6726 0.9987 -0.2705 0.0383  -0.1196 17  ASP L OD1 
3800 O OD2 . ASP C 17  ? 0.7136 2.8265 0.9785 -0.2135 0.0429  -0.1460 17  ASP L OD2 
3801 N N   . ARG C 18  ? 0.7312 2.5911 0.9706 -0.2717 0.0110  -0.0641 18  ARG L N   
3802 C CA  . ARG C 18  ? 0.8718 2.6242 1.0887 -0.3034 0.0017  -0.0364 18  ARG L CA  
3803 C C   . ARG C 18  ? 0.9661 2.5848 1.1307 -0.3621 -0.0016 -0.0124 18  ARG L C   
3804 O O   . ARG C 18  ? 1.0185 2.6789 1.1445 -0.4275 -0.0030 0.0059  18  ARG L O   
3805 C CB  . ARG C 18  ? 0.8969 2.7691 1.1085 -0.3470 -0.0034 -0.0157 18  ARG L CB  
3806 C CG  . ARG C 18  ? 0.8275 2.5947 1.0154 -0.3764 -0.0131 0.0105  18  ARG L CG  
3807 C CD  . ARG C 18  ? 0.8245 2.7221 1.0083 -0.4186 -0.0186 0.0298  18  ARG L CD  
3808 N NE  . ARG C 18  ? 0.9605 2.7525 1.1099 -0.4595 -0.0282 0.0571  18  ARG L NE  
3809 C CZ  . ARG C 18  ? 1.0326 2.7837 1.2074 -0.4195 -0.0325 0.0547  18  ARG L CZ  
3810 N NH1 . ARG C 18  ? 1.0529 2.8521 1.2843 -0.3364 -0.0301 0.0271  18  ARG L NH1 
3811 N NH2 . ARG C 18  ? 1.0404 2.6970 1.1786 -0.4623 -0.0404 0.0794  18  ARG L NH2 
3812 N N   . VAL C 19  ? 0.9530 2.4130 1.1134 -0.3373 -0.0039 -0.0125 19  VAL L N   
3813 C CA  . VAL C 19  ? 0.8639 2.1907 0.9770 -0.3779 -0.0075 0.0072  19  VAL L CA  
3814 C C   . VAL C 19  ? 0.8618 2.0703 0.9483 -0.3964 -0.0154 0.0285  19  VAL L C   
3815 O O   . VAL C 19  ? 0.8059 2.0009 0.9206 -0.3609 -0.0166 0.0221  19  VAL L O   
3816 C CB  . VAL C 19  ? 0.7125 1.9590 0.8398 -0.3337 -0.0023 -0.0124 19  VAL L CB  
3817 C CG1 . VAL C 19  ? 0.6949 2.0388 0.8301 -0.3331 0.0048  -0.0282 19  VAL L CG1 
3818 C CG2 . VAL C 19  ? 0.7065 1.9138 0.8763 -0.2629 -0.0009 -0.0356 19  VAL L CG2 
3819 N N   . THR C 20  ? 0.8557 1.9748 0.8833 -0.4507 -0.0219 0.0533  20  THR L N   
3820 C CA  . THR C 20  ? 0.8499 1.8540 0.8431 -0.4697 -0.0293 0.0723  20  THR L CA  
3821 C C   . THR C 20  ? 0.8713 1.7310 0.8133 -0.4861 -0.0339 0.0851  20  THR L C   
3822 O O   . THR C 20  ? 0.8845 1.7279 0.7717 -0.5367 -0.0405 0.1025  20  THR L O   
3823 C CB  . THR C 20  ? 1.0012 2.0591 0.9564 -0.5327 -0.0374 0.0961  20  THR L CB  
3824 O OG1 . THR C 20  ? 0.9778 2.1942 0.9811 -0.5177 -0.0334 0.0850  20  THR L OG1 
3825 C CG2 . THR C 20  ? 1.0606 2.0081 0.9887 -0.5414 -0.0437 0.1101  20  THR L CG2 
3826 N N   . ILE C 21  ? 0.9445 1.7021 0.9019 -0.4427 -0.0316 0.0769  21  ILE L N   
3827 C CA  . ILE C 21  ? 1.0832 1.7054 0.9935 -0.4498 -0.0363 0.0886  21  ILE L CA  
3828 C C   . ILE C 21  ? 1.0895 1.6334 0.9489 -0.4824 -0.0445 0.1081  21  ILE L C   
3829 O O   . ILE C 21  ? 1.1713 1.7476 1.0507 -0.4806 -0.0440 0.1076  21  ILE L O   
3830 C CB  . ILE C 21  ? 1.1615 1.7219 1.1109 -0.3902 -0.0298 0.0709  21  ILE L CB  
3831 C CG1 . ILE C 21  ? 1.2085 1.8376 1.2033 -0.3578 -0.0223 0.0498  21  ILE L CG1 
3832 C CG2 . ILE C 21  ? 1.2061 1.6398 1.1085 -0.3921 -0.0343 0.0824  21  ILE L CG2 
3833 C CD1 . ILE C 21  ? 1.2884 1.8724 1.3224 -0.3038 -0.0172 0.0316  21  ILE L CD1 
3834 N N   . THR C 22  ? 1.0233 1.4607 0.8125 -0.5106 -0.0534 0.1251  22  THR L N   
3835 C CA  . THR C 22  ? 1.1249 1.4675 0.8564 -0.5365 -0.0617 0.1409  22  THR L CA  
3836 C C   . THR C 22  ? 1.0521 1.2675 0.7668 -0.4981 -0.0612 0.1370  22  THR L C   
3837 O O   . THR C 22  ? 0.9819 1.1791 0.7172 -0.4627 -0.0571 0.1275  22  THR L O   
3838 C CB  . THR C 22  ? 1.3114 1.6241 0.9523 -0.6098 -0.0767 0.1665  22  THR L CB  
3839 O OG1 . THR C 22  ? 1.4697 1.6856 1.0535 -0.6138 -0.0851 0.1745  22  THR L OG1 
3840 C CG2 . THR C 22  ? 1.2602 1.7179 0.9165 -0.6514 -0.0769 0.1709  22  THR L CG2 
3841 N N   . CYS C 23  ? 1.0415 1.1768 0.7179 -0.5062 -0.0653 0.1442  23  CYS L N   
3842 C CA  . CYS C 23  ? 1.1347 1.1569 0.7907 -0.4700 -0.0646 0.1400  23  CYS L CA  
3843 C C   . CYS C 23  ? 1.3463 1.2683 0.9160 -0.5064 -0.0756 0.1555  23  CYS L C   
3844 O O   . CYS C 23  ? 1.3801 1.3341 0.9351 -0.5473 -0.0792 0.1646  23  CYS L O   
3845 C CB  . CYS C 23  ? 0.9972 1.0487 0.7283 -0.4203 -0.0525 0.1217  23  CYS L CB  
3846 S SG  . CYS C 23  ? 1.2647 1.2121 0.9866 -0.3709 -0.0486 0.1132  23  CYS L SG  
3847 N N   . ARG C 24  ? 1.4633 1.2644 0.9715 -0.4910 -0.0819 0.1584  24  ARG L N   
3848 C CA  . ARG C 24  ? 1.6900 1.3787 1.1055 -0.5205 -0.0934 0.1703  24  ARG L CA  
3849 C C   . ARG C 24  ? 1.6562 1.2319 1.0403 -0.4710 -0.0926 0.1614  24  ARG L C   
3850 O O   . ARG C 24  ? 1.6461 1.2039 1.0444 -0.4275 -0.0904 0.1542  24  ARG L O   
3851 C CB  . ARG C 24  ? 1.9750 1.6168 1.2944 -0.5850 -0.1123 0.1924  24  ARG L CB  
3852 C CG  . ARG C 24  ? 2.1283 1.7640 1.4331 -0.5803 -0.1187 0.1968  24  ARG L CG  
3853 C CD  . ARG C 24  ? 2.2869 1.8654 1.4844 -0.6517 -0.1407 0.2213  24  ARG L CD  
3854 N NE  . ARG C 24  ? 2.3527 1.9736 1.5552 -0.6607 -0.1454 0.2270  24  ARG L NE  
3855 C CZ  . ARG C 24  ? 2.3864 1.9243 1.5524 -0.6310 -0.1538 0.2285  24  ARG L CZ  
3856 N NH1 . ARG C 24  ? 2.4244 1.8352 1.5464 -0.5855 -0.1581 0.2234  24  ARG L NH1 
3857 N NH2 . ARG C 24  ? 2.3656 1.9526 1.5385 -0.6451 -0.1581 0.2347  24  ARG L NH2 
3858 N N   . ALA C 25  ? 1.5607 1.0680 0.9017 -0.4781 -0.0944 0.1616  25  ALA L N   
3859 C CA  . ALA C 25  ? 1.5938 1.0136 0.9141 -0.4273 -0.0906 0.1493  25  ALA L CA  
3860 C C   . ALA C 25  ? 1.7382 1.0059 0.9323 -0.4389 -0.1080 0.1583  25  ALA L C   
3861 O O   . ALA C 25  ? 1.7609 0.9788 0.8760 -0.4991 -0.1225 0.1746  25  ALA L O   
3862 C CB  . ALA C 25  ? 1.5684 1.0150 0.9273 -0.4210 -0.0798 0.1403  25  ALA L CB  
3863 N N   . SER C 26  ? 1.7434 0.9370 0.9141 -0.3807 -0.1077 0.1475  26  SER L N   
3864 C CA  . SER C 26  ? 1.7736 0.8087 0.8185 -0.3772 -0.1253 0.1523  26  SER L CA  
3865 C C   . SER C 26  ? 1.9499 0.9075 0.9301 -0.3999 -0.1280 0.1507  26  SER L C   
3866 O O   . SER C 26  ? 2.1341 0.9514 0.9912 -0.4190 -0.1464 0.1581  26  SER L O   
3867 C CB  . SER C 26  ? 1.7249 0.7153 0.7682 -0.2988 -0.1231 0.1385  26  SER L CB  
3868 O OG  . SER C 26  ? 1.7611 0.7884 0.8616 -0.2496 -0.1050 0.1187  26  SER L OG  
3869 N N   . GLN C 27  ? 1.8748 0.9175 0.9321 -0.3986 -0.1111 0.1413  27  GLN L N   
3870 C CA  . GLN C 27  ? 1.9221 0.9101 0.9290 -0.4256 -0.1120 0.1405  27  GLN L CA  
3871 C C   . GLN C 27  ? 1.9221 1.0257 0.9976 -0.4749 -0.1046 0.1479  27  GLN L C   
3872 O O   . GLN C 27  ? 1.9478 1.1521 1.0798 -0.5015 -0.1040 0.1574  27  GLN L O   
3873 C CB  . GLN C 27  ? 1.8226 0.7832 0.8437 -0.3629 -0.0990 0.1185  27  GLN L CB  
3874 C CG  . GLN C 27  ? 1.9685 0.8084 0.9100 -0.3071 -0.1067 0.1083  27  GLN L CG  
3875 C CD  . GLN C 27  ? 2.1215 0.9768 1.1002 -0.2403 -0.0902 0.0848  27  GLN L CD  
3876 O OE1 . GLN C 27  ? 2.2484 1.0521 1.1973 -0.1779 -0.0913 0.0727  27  GLN L OE1 
3877 N NE2 . GLN C 27  ? 2.0998 1.0331 1.1438 -0.2528 -0.0755 0.0788  27  GLN L NE2 
3878 N N   . GLY C 28  ? 1.7852 0.8756 0.8535 -0.4839 -0.0993 0.1428  28  GLY L N   
3879 C CA  . GLY C 28  ? 1.5160 0.7166 0.6535 -0.5196 -0.0922 0.1483  28  GLY L CA  
3880 C C   . GLY C 28  ? 1.5149 0.8069 0.7640 -0.4665 -0.0738 0.1314  28  GLY L C   
3881 O O   . GLY C 28  ? 1.5704 0.8191 0.8173 -0.4179 -0.0660 0.1156  28  GLY L O   
3882 N N   . ILE C 29  ? 1.4496 0.8684 0.7918 -0.4751 -0.0679 0.1346  29  ILE L N   
3883 C CA  . ILE C 29  ? 1.3706 0.8707 0.8122 -0.4306 -0.0539 0.1206  29  ILE L CA  
3884 C C   . ILE C 29  ? 1.4231 1.0131 0.9210 -0.4579 -0.0524 0.1263  29  ILE L C   
3885 O O   . ILE C 29  ? 1.3581 1.0272 0.9400 -0.4307 -0.0451 0.1186  29  ILE L O   
3886 C CB  . ILE C 29  ? 1.1944 0.7542 0.6995 -0.3940 -0.0491 0.1142  29  ILE L CB  
3887 C CG1 . ILE C 29  ? 1.1644 0.7994 0.6928 -0.4283 -0.0548 0.1259  29  ILE L CG1 
3888 C CG2 . ILE C 29  ? 1.1078 0.5838 0.5608 -0.3609 -0.0512 0.1089  29  ILE L CG2 
3889 C CD1 . ILE C 29  ? 1.0562 0.7617 0.6540 -0.3948 -0.0491 0.1180  29  ILE L CD1 
3890 N N   . SER C 30  ? 1.4857 1.0590 0.9305 -0.5126 -0.0614 0.1408  30  SER L N   
3891 C CA  . SER C 30  ? 1.4704 1.1275 0.9588 -0.5407 -0.0622 0.1487  30  SER L CA  
3892 C C   . SER C 30  ? 1.3357 1.1164 0.9076 -0.5328 -0.0611 0.1501  30  SER L C   
3893 O O   . SER C 30  ? 1.3932 1.2017 0.9525 -0.5530 -0.0660 0.1576  30  SER L O   
3894 C CB  . SER C 30  ? 1.6039 1.2582 1.1261 -0.5142 -0.0544 0.1381  30  SER L CB  
3895 O OG  . SER C 30  ? 1.7368 1.4535 1.2840 -0.5453 -0.0582 0.1482  30  SER L OG  
3896 N N   . SER C 31  ? 1.2266 1.0785 0.8784 -0.5034 -0.0558 0.1425  31  SER L N   
3897 C CA  . SER C 31  ? 1.1212 1.0784 0.8492 -0.4833 -0.0549 0.1390  31  SER L CA  
3898 C C   . SER C 31  ? 1.0794 1.0371 0.8628 -0.4272 -0.0470 0.1217  31  SER L C   
3899 O O   . SER C 31  ? 1.0666 1.0975 0.9148 -0.4022 -0.0466 0.1151  31  SER L O   
3900 C CB  . SER C 31  ? 1.0849 1.1332 0.8547 -0.4984 -0.0601 0.1466  31  SER L CB  
3901 O OG  . SER C 31  ? 1.1156 1.2145 0.8560 -0.5471 -0.0673 0.1623  31  SER L OG  
3902 N N   . TRP C 32  ? 1.0469 0.9226 0.7993 -0.4078 -0.0418 0.1141  32  TRP L N   
3903 C CA  . TRP C 32  ? 1.0558 0.9331 0.8529 -0.3611 -0.0346 0.0995  32  TRP L CA  
3904 C C   . TRP C 32  ? 1.0726 0.9632 0.8841 -0.3389 -0.0322 0.0937  32  TRP L C   
3905 O O   . TRP C 32  ? 1.1594 0.9974 0.9447 -0.3187 -0.0283 0.0883  32  TRP L O   
3906 C CB  . TRP C 32  ? 1.2057 1.0091 0.9681 -0.3473 -0.0293 0.0931  32  TRP L CB  
3907 C CG  . TRP C 32  ? 1.3246 1.1127 1.0688 -0.3717 -0.0314 0.0983  32  TRP L CG  
3908 C CD1 . TRP C 32  ? 1.4385 1.1507 1.1142 -0.3888 -0.0310 0.1000  32  TRP L CD1 
3909 C CD2 . TRP C 32  ? 1.2336 1.0808 1.0239 -0.3815 -0.0356 0.1028  32  TRP L CD2 
3910 N NE1 . TRP C 32  ? 1.4328 1.1579 1.1119 -0.4122 -0.0335 0.1055  32  TRP L NE1 
3911 C CE2 . TRP C 32  ? 1.3138 1.1225 1.0638 -0.4079 -0.0370 0.1083  32  TRP L CE2 
3912 C CE3 . TRP C 32  ? 1.1233 1.0465 0.9799 -0.3681 -0.0399 0.1021  32  TRP L CE3 
3913 C CZ2 . TRP C 32  ? 1.3075 1.1569 1.0854 -0.4232 -0.0425 0.1151  32  TRP L CZ2 
3914 C CZ3 . TRP C 32  ? 1.0858 1.0430 0.9666 -0.3789 -0.0466 0.1081  32  TRP L CZ3 
3915 C CH2 . TRP C 32  ? 1.1564 1.0797 1.0000 -0.4073 -0.0480 0.1156  32  TRP L CH2 
3916 N N   . LEU C 33  ? 0.9917 0.9577 0.8448 -0.3404 -0.0347 0.0942  33  LEU L N   
3917 C CA  . LEU C 33  ? 0.9236 0.9142 0.7966 -0.3210 -0.0323 0.0879  33  LEU L CA  
3918 C C   . LEU C 33  ? 0.8084 0.8729 0.7506 -0.2954 -0.0319 0.0775  33  LEU L C   
3919 O O   . LEU C 33  ? 0.8290 0.9484 0.7975 -0.3023 -0.0364 0.0794  33  LEU L O   
3920 C CB  . LEU C 33  ? 0.9470 0.9510 0.7837 -0.3541 -0.0371 0.0986  33  LEU L CB  
3921 C CG  . LEU C 33  ? 0.9653 0.9912 0.8137 -0.3396 -0.0353 0.0938  33  LEU L CG  
3922 C CD1 . LEU C 33  ? 0.9142 0.8527 0.7042 -0.3367 -0.0363 0.0973  33  LEU L CD1 
3923 C CD2 . LEU C 33  ? 1.1280 1.2287 0.9794 -0.3695 -0.0395 0.1006  33  LEU L CD2 
3924 N N   . ALA C 34  ? 0.6580 0.7213 0.6248 -0.2647 -0.0278 0.0666  34  ALA L N   
3925 C CA  . ALA C 34  ? 0.7061 0.8246 0.7262 -0.2404 -0.0289 0.0552  34  ALA L CA  
3926 C C   . ALA C 34  ? 0.7796 0.9284 0.8069 -0.2328 -0.0265 0.0499  34  ALA L C   
3927 O O   . ALA C 34  ? 0.7475 0.8632 0.7435 -0.2385 -0.0237 0.0542  34  ALA L O   
3928 C CB  . ALA C 34  ? 0.6523 0.7458 0.6929 -0.2166 -0.0281 0.0469  34  ALA L CB  
3929 N N   . TRP C 35  ? 0.8124 1.0218 0.8774 -0.2181 -0.0285 0.0401  35  TRP L N   
3930 C CA  . TRP C 35  ? 0.6715 0.9167 0.7466 -0.2096 -0.0258 0.0326  35  TRP L CA  
3931 C C   . TRP C 35  ? 0.7056 0.9537 0.8129 -0.1773 -0.0260 0.0167  35  TRP L C   
3932 O O   . TRP C 35  ? 0.7429 0.9992 0.8726 -0.1609 -0.0316 0.0092  35  TRP L O   
3933 C CB  . TRP C 35  ? 0.6809 1.0046 0.7660 -0.2210 -0.0278 0.0324  35  TRP L CB  
3934 C CG  . TRP C 35  ? 0.8438 1.1711 0.8885 -0.2625 -0.0288 0.0494  35  TRP L CG  
3935 C CD1 . TRP C 35  ? 0.9116 1.2448 0.9390 -0.2889 -0.0330 0.0616  35  TRP L CD1 
3936 C CD2 . TRP C 35  ? 0.9267 1.2468 0.9353 -0.2873 -0.0279 0.0577  35  TRP L CD2 
3937 N NE1 . TRP C 35  ? 0.9501 1.2771 0.9289 -0.3316 -0.0351 0.0769  35  TRP L NE1 
3938 C CE2 . TRP C 35  ? 0.9889 1.3045 0.9539 -0.3309 -0.0328 0.0751  35  TRP L CE2 
3939 C CE3 . TRP C 35  ? 0.8345 1.1488 0.8393 -0.2793 -0.0250 0.0533  35  TRP L CE3 
3940 C CZ2 . TRP C 35  ? 1.0124 1.3103 0.9250 -0.3681 -0.0364 0.0885  35  TRP L CZ2 
3941 C CZ3 . TRP C 35  ? 0.8638 1.1647 0.8217 -0.3127 -0.0281 0.0667  35  TRP L CZ3 
3942 C CH2 . TRP C 35  ? 0.9266 1.2157 0.8364 -0.3572 -0.0345 0.0843  35  TRP L CH2 
3943 N N   . TYR C 36  ? 0.6348 0.8716 0.7387 -0.1699 -0.0218 0.0127  36  TYR L N   
3944 C CA  . TYR C 36  ? 0.5633 0.8049 0.6905 -0.1459 -0.0229 -0.0018 36  TYR L CA  
3945 C C   . TYR C 36  ? 0.5591 0.8453 0.6937 -0.1410 -0.0203 -0.0108 36  TYR L C   
3946 O O   . TYR C 36  ? 0.7080 1.0105 0.8260 -0.1580 -0.0168 -0.0031 36  TYR L O   
3947 C CB  . TYR C 36  ? 0.5116 0.7081 0.6306 -0.1414 -0.0207 0.0006  36  TYR L CB  
3948 C CG  . TYR C 36  ? 0.5916 0.7486 0.6980 -0.1485 -0.0212 0.0096  36  TYR L CG  
3949 C CD1 . TYR C 36  ? 0.6011 0.7435 0.7194 -0.1432 -0.0269 0.0061  36  TYR L CD1 
3950 C CD2 . TYR C 36  ? 0.6749 0.8042 0.7511 -0.1617 -0.0174 0.0214  36  TYR L CD2 
3951 C CE1 . TYR C 36  ? 0.6584 0.7702 0.7644 -0.1520 -0.0268 0.0140  36  TYR L CE1 
3952 C CE2 . TYR C 36  ? 0.7522 0.8451 0.8132 -0.1669 -0.0172 0.0275  36  TYR L CE2 
3953 C CZ  . TYR C 36  ? 0.7364 0.8263 0.8153 -0.1625 -0.0209 0.0236  36  TYR L CZ  
3954 O OH  . TYR C 36  ? 0.7857 0.8447 0.8484 -0.1699 -0.0199 0.0294  36  TYR L OH  
3955 N N   . GLN C 37  ? 0.5144 0.8146 0.6682 -0.1193 -0.0234 -0.0272 37  GLN L N   
3956 C CA  . GLN C 37  ? 0.4007 0.7402 0.5609 -0.1112 -0.0207 -0.0396 37  GLN L CA  
3957 C C   . GLN C 37  ? 0.4403 0.7480 0.5992 -0.1028 -0.0213 -0.0461 37  GLN L C   
3958 O O   . GLN C 37  ? 0.5789 0.8506 0.7391 -0.0939 -0.0275 -0.0504 37  GLN L O   
3959 C CB  . GLN C 37  ? 0.4135 0.7963 0.5908 -0.0890 -0.0252 -0.0568 37  GLN L CB  
3960 C CG  . GLN C 37  ? 0.5886 0.9860 0.7699 -0.0696 -0.0254 -0.0767 37  GLN L CG  
3961 C CD  . GLN C 37  ? 0.6830 1.1027 0.8738 -0.0363 -0.0326 -0.0976 37  GLN L CD  
3962 O OE1 . GLN C 37  ? 0.6574 1.1430 0.8595 -0.0280 -0.0313 -0.1021 37  GLN L OE1 
3963 N NE2 . GLN C 37  ? 0.6661 1.0319 0.8477 -0.0167 -0.0417 -0.1106 37  GLN L NE2 
3964 N N   . GLN C 38  ? 0.5232 0.8459 0.6761 -0.1091 -0.0162 -0.0454 38  GLN L N   
3965 C CA  . GLN C 38  ? 0.5751 0.8801 0.7265 -0.1039 -0.0171 -0.0514 38  GLN L CA  
3966 C C   . GLN C 38  ? 0.5793 0.9222 0.7326 -0.0998 -0.0148 -0.0649 38  GLN L C   
3967 O O   . GLN C 38  ? 0.6213 1.0043 0.7729 -0.1086 -0.0100 -0.0622 38  GLN L O   
3968 C CB  . GLN C 38  ? 0.4245 0.7057 0.5646 -0.1140 -0.0139 -0.0351 38  GLN L CB  
3969 C CG  . GLN C 38  ? 0.4804 0.7495 0.6203 -0.1117 -0.0161 -0.0383 38  GLN L CG  
3970 C CD  . GLN C 38  ? 0.5367 0.7975 0.6680 -0.1151 -0.0128 -0.0230 38  GLN L CD  
3971 O OE1 . GLN C 38  ? 0.6325 0.8916 0.7522 -0.1167 -0.0094 -0.0117 38  GLN L OE1 
3972 N NE2 . GLN C 38  ? 0.4816 0.7375 0.6137 -0.1160 -0.0152 -0.0224 38  GLN L NE2 
3973 N N   . LYS C 39  ? 0.5137 0.8419 0.6651 -0.0903 -0.0192 -0.0790 39  LYS L N   
3974 C CA  . LYS C 39  ? 0.5268 0.8845 0.6750 -0.0874 -0.0171 -0.0931 39  LYS L CA  
3975 C C   . LYS C 39  ? 0.6712 1.0156 0.8101 -0.0999 -0.0170 -0.0870 39  LYS L C   
3976 O O   . LYS C 39  ? 0.8640 1.1771 0.9995 -0.1060 -0.0202 -0.0767 39  LYS L O   
3977 C CB  . LYS C 39  ? 0.3523 0.7045 0.4971 -0.0643 -0.0236 -0.1181 39  LYS L CB  
3978 C CG  . LYS C 39  ? 0.4631 0.8577 0.6201 -0.0474 -0.0222 -0.1268 39  LYS L CG  
3979 C CD  . LYS C 39  ? 0.5196 0.8947 0.6692 -0.0145 -0.0320 -0.1511 39  LYS L CD  
3980 C CE  . LYS C 39  ? 0.5486 0.9784 0.7140 0.0072  -0.0313 -0.1586 39  LYS L CE  
3981 N NZ  . LYS C 39  ? 0.5703 0.9771 0.7247 0.0486  -0.0430 -0.1832 39  LYS L NZ  
3982 N N   . PRO C 40  ? 0.8463 1.2229 0.9813 -0.1049 -0.0133 -0.0928 40  PRO L N   
3983 C CA  . PRO C 40  ? 0.8804 1.2587 1.0082 -0.1185 -0.0128 -0.0832 40  PRO L CA  
3984 C C   . PRO C 40  ? 0.8698 1.2146 0.9924 -0.1242 -0.0183 -0.0754 40  PRO L C   
3985 O O   . PRO C 40  ? 1.0830 1.4268 1.2093 -0.1277 -0.0163 -0.0570 40  PRO L O   
3986 C CB  . PRO C 40  ? 0.9565 1.3574 1.0759 -0.1183 -0.0126 -0.1022 40  PRO L CB  
3987 C CG  . PRO C 40  ? 0.9782 1.4179 1.1052 -0.1093 -0.0075 -0.1121 40  PRO L CG  
3988 C CD  . PRO C 40  ? 1.0049 1.4272 1.1417 -0.0982 -0.0094 -0.1090 40  PRO L CD  
3989 N N   . GLU C 41  ? 0.6446 0.9626 0.7536 -0.1263 -0.0261 -0.0886 41  GLU L N   
3990 C CA  . GLU C 41  ? 0.7600 1.0592 0.8599 -0.1411 -0.0320 -0.0786 41  GLU L CA  
3991 C C   . GLU C 41  ? 1.0135 1.2700 1.1098 -0.1390 -0.0391 -0.0779 41  GLU L C   
3992 O O   . GLU C 41  ? 1.1072 1.3515 1.1949 -0.1545 -0.0444 -0.0686 41  GLU L O   
3993 C CB  . GLU C 41  ? 0.8040 1.0971 0.8806 -0.1567 -0.0388 -0.0886 41  GLU L CB  
3994 C CG  . GLU C 41  ? 0.8546 1.1949 0.9346 -0.1636 -0.0324 -0.0852 41  GLU L CG  
3995 C CD  . GLU C 41  ? 0.9367 1.2665 0.9911 -0.1722 -0.0376 -0.1042 41  GLU L CD  
3996 O OE1 . GLU C 41  ? 0.9748 1.3360 1.0323 -0.1680 -0.0314 -0.1119 41  GLU L OE1 
3997 O OE2 . GLU C 41  ? 0.9338 1.2203 0.9597 -0.1852 -0.0488 -0.1116 41  GLU L OE2 
3998 N N   . LYS C 42  ? 1.0321 1.2738 1.1348 -0.1214 -0.0394 -0.0867 42  LYS L N   
3999 C CA  . LYS C 42  ? 0.9072 1.1073 1.0056 -0.1170 -0.0476 -0.0868 42  LYS L CA  
4000 C C   . LYS C 42  ? 0.8313 1.0396 0.9458 -0.1202 -0.0415 -0.0681 42  LYS L C   
4001 O O   . LYS C 42  ? 0.7478 0.9878 0.8742 -0.1198 -0.0314 -0.0572 42  LYS L O   
4002 C CB  . LYS C 42  ? 0.9110 1.1010 1.0101 -0.0928 -0.0511 -0.1042 42  LYS L CB  
4003 C CG  . LYS C 42  ? 1.0062 1.1542 1.0754 -0.0835 -0.0639 -0.1258 42  LYS L CG  
4004 C CD  . LYS C 42  ? 1.0303 1.1893 1.0836 -0.0966 -0.0623 -0.1326 42  LYS L CD  
4005 C CE  . LYS C 42  ? 1.1710 1.2655 1.1796 -0.0943 -0.0787 -0.1519 42  LYS L CE  
4006 N NZ  . LYS C 42  ? 1.2471 1.3157 1.2471 -0.0568 -0.0858 -0.1732 42  LYS L NZ  
4007 N N   . ALA C 43  ? 0.8220 0.9952 0.9305 -0.1236 -0.0494 -0.0648 43  ALA L N   
4008 C CA  . ALA C 43  ? 0.7604 0.9349 0.8798 -0.1252 -0.0445 -0.0502 43  ALA L CA  
4009 C C   . ALA C 43  ? 0.6833 0.8620 0.8146 -0.1106 -0.0413 -0.0524 43  ALA L C   
4010 O O   . ALA C 43  ? 0.7132 0.8964 0.8458 -0.0970 -0.0445 -0.0662 43  ALA L O   
4011 C CB  . ALA C 43  ? 0.8715 1.0115 0.9778 -0.1388 -0.0548 -0.0457 43  ALA L CB  
4012 N N   . PRO C 44  ? 0.6076 0.7885 0.7445 -0.1135 -0.0353 -0.0393 44  PRO L N   
4013 C CA  . PRO C 44  ? 0.6150 0.8030 0.7588 -0.1077 -0.0332 -0.0379 44  PRO L CA  
4014 C C   . PRO C 44  ? 0.6515 0.8160 0.7960 -0.1011 -0.0439 -0.0435 44  PRO L C   
4015 O O   . PRO C 44  ? 0.6868 0.8177 0.8224 -0.1076 -0.0520 -0.0413 44  PRO L O   
4016 C CB  . PRO C 44  ? 0.5014 0.6826 0.6395 -0.1165 -0.0261 -0.0218 44  PRO L CB  
4017 C CG  . PRO C 44  ? 0.4044 0.5880 0.5370 -0.1191 -0.0225 -0.0167 44  PRO L CG  
4018 C CD  . PRO C 44  ? 0.4590 0.6403 0.5923 -0.1221 -0.0300 -0.0256 44  PRO L CD  
4019 N N   . LYS C 45  ? 0.5544 0.7413 0.7075 -0.0889 -0.0450 -0.0498 45  LYS L N   
4020 C CA  . LYS C 45  ? 0.5075 0.6798 0.6623 -0.0776 -0.0559 -0.0534 45  LYS L CA  
4021 C C   . LYS C 45  ? 0.6004 0.7897 0.7611 -0.0887 -0.0508 -0.0394 45  LYS L C   
4022 O O   . LYS C 45  ? 0.5778 0.8015 0.7405 -0.0974 -0.0412 -0.0339 45  LYS L O   
4023 C CB  . LYS C 45  ? 0.4280 0.6259 0.5878 -0.0509 -0.0611 -0.0720 45  LYS L CB  
4024 C CG  . LYS C 45  ? 0.6048 0.7664 0.7555 -0.0288 -0.0784 -0.0816 45  LYS L CG  
4025 C CD  . LYS C 45  ? 0.7652 0.9704 0.9245 0.0055  -0.0817 -0.0991 45  LYS L CD  
4026 C CE  . LYS C 45  ? 0.9335 1.1018 1.0817 0.0334  -0.1009 -0.1060 45  LYS L CE  
4027 N NZ  . LYS C 45  ? 0.9129 1.1485 1.0792 0.0657  -0.1020 -0.1151 45  LYS L NZ  
4028 N N   . SER C 46  ? 0.7552 0.9167 0.9128 -0.0924 -0.0585 -0.0325 46  SER L N   
4029 C CA  . SER C 46  ? 0.6970 0.8705 0.8554 -0.1061 -0.0549 -0.0190 46  SER L CA  
4030 C C   . SER C 46  ? 0.7126 0.9291 0.8834 -0.0937 -0.0601 -0.0224 46  SER L C   
4031 O O   . SER C 46  ? 0.7675 0.9750 0.9423 -0.0741 -0.0729 -0.0292 46  SER L O   
4032 C CB  . SER C 46  ? 0.5777 0.7076 0.7262 -0.1194 -0.0596 -0.0089 46  SER L CB  
4033 O OG  . SER C 46  ? 0.7222 0.8305 0.8608 -0.1298 -0.0531 -0.0057 46  SER L OG  
4034 N N   . LEU C 47  ? 0.6223 0.8871 0.7951 -0.1056 -0.0518 -0.0169 47  LEU L N   
4035 C CA  . LEU C 47  ? 0.6898 1.0190 0.8763 -0.0957 -0.0553 -0.0200 47  LEU L CA  
4036 C C   . LEU C 47  ? 0.7608 1.1034 0.9431 -0.1167 -0.0575 -0.0038 47  LEU L C   
4037 O O   . LEU C 47  ? 0.7558 1.1136 0.9489 -0.1020 -0.0678 -0.0044 47  LEU L O   
4038 C CB  . LEU C 47  ? 0.6501 1.0420 0.8396 -0.1007 -0.0463 -0.0244 47  LEU L CB  
4039 C CG  . LEU C 47  ? 0.5504 0.9505 0.7457 -0.0795 -0.0438 -0.0423 47  LEU L CG  
4040 C CD1 . LEU C 47  ? 0.3660 0.8200 0.5571 -0.0980 -0.0339 -0.0400 47  LEU L CD1 
4041 C CD2 . LEU C 47  ? 0.6140 1.0392 0.8236 -0.0393 -0.0531 -0.0620 47  LEU L CD2 
4042 N N   . ILE C 48  ? 0.6240 0.9575 0.7856 -0.1507 -0.0493 0.0108  48  ILE L N   
4043 C CA  . ILE C 48  ? 0.6629 1.0122 0.8126 -0.1775 -0.0511 0.0264  48  ILE L CA  
4044 C C   . ILE C 48  ? 0.6515 0.9293 0.7716 -0.2025 -0.0479 0.0391  48  ILE L C   
4045 O O   . ILE C 48  ? 0.6926 0.9260 0.7942 -0.2073 -0.0410 0.0393  48  ILE L O   
4046 C CB  . ILE C 48  ? 0.6620 1.0811 0.8031 -0.2014 -0.0469 0.0327  48  ILE L CB  
4047 C CG1 . ILE C 48  ? 0.5916 1.1010 0.7651 -0.1732 -0.0504 0.0193  48  ILE L CG1 
4048 C CG2 . ILE C 48  ? 0.3516 0.7733 0.4659 -0.2418 -0.0486 0.0521  48  ILE L CG2 
4049 C CD1 . ILE C 48  ? 0.5900 1.1940 0.7598 -0.1998 -0.0489 0.0278  48  ILE L CD1 
4050 N N   . TYR C 49  ? 0.6426 0.9122 0.7573 -0.2154 -0.0535 0.0489  49  TYR L N   
4051 C CA  . TYR C 49  ? 0.6280 0.8358 0.7099 -0.2406 -0.0503 0.0600  49  TYR L CA  
4052 C C   . TYR C 49  ? 0.6699 0.8981 0.7306 -0.2742 -0.0533 0.0750  49  TYR L C   
4053 O O   . TYR C 49  ? 0.7088 1.0087 0.7854 -0.2777 -0.0583 0.0779  49  TYR L O   
4054 C CB  . TYR C 49  ? 0.6596 0.8219 0.7497 -0.2272 -0.0545 0.0569  49  TYR L CB  
4055 C CG  . TYR C 49  ? 0.6949 0.8815 0.8074 -0.2169 -0.0673 0.0580  49  TYR L CG  
4056 C CD1 . TYR C 49  ? 0.6566 0.8719 0.7973 -0.1844 -0.0759 0.0466  49  TYR L CD1 
4057 C CD2 . TYR C 49  ? 0.7461 0.9222 0.8465 -0.2378 -0.0721 0.0702  49  TYR L CD2 
4058 C CE1 . TYR C 49  ? 0.8134 1.0427 0.9683 -0.1691 -0.0906 0.0476  49  TYR L CE1 
4059 C CE2 . TYR C 49  ? 0.7138 0.9112 0.8326 -0.2267 -0.0860 0.0729  49  TYR L CE2 
4060 C CZ  . TYR C 49  ? 0.8119 1.0342 0.9574 -0.1902 -0.0960 0.0617  49  TYR L CZ  
4061 O OH  . TYR C 49  ? 0.7694 1.0051 0.9275 -0.1732 -0.1127 0.0642  49  TYR L OH  
4062 N N   . ALA C 50  ? 0.7618 0.9304 0.7839 -0.2988 -0.0505 0.0840  50  ALA L N   
4063 C CA  . ALA C 50  ? 0.8832 1.0572 0.8732 -0.3379 -0.0538 0.0991  50  ALA L CA  
4064 C C   . ALA C 50  ? 0.9777 1.2089 0.9541 -0.3636 -0.0548 0.1067  50  ALA L C   
4065 O O   . ALA C 50  ? 1.0558 1.3305 1.0209 -0.3943 -0.0604 0.1192  50  ALA L O   
4066 C CB  . ALA C 50  ? 0.8836 1.0888 0.8983 -0.3362 -0.0627 0.1038  50  ALA L CB  
4067 N N   . ALA C 51  ? 0.8970 1.1339 0.8735 -0.3539 -0.0501 0.1000  51  ALA L N   
4068 C CA  . ALA C 51  ? 0.9764 1.2633 0.9328 -0.3829 -0.0509 0.1075  51  ALA L CA  
4069 C C   . ALA C 51  ? 0.9532 1.3585 0.9562 -0.3718 -0.0540 0.1034  51  ALA L C   
4070 O O   . ALA C 51  ? 0.9385 1.3947 0.9476 -0.3719 -0.0515 0.0994  51  ALA L O   
4071 C CB  . ALA C 51  ? 1.1064 1.3591 0.9975 -0.4380 -0.0551 0.1261  51  ALA L CB  
4072 N N   . SER C 52  ? 0.9862 1.4377 1.0203 -0.3599 -0.0598 0.1041  52  SER L N   
4073 C CA  . SER C 52  ? 0.9708 1.5421 1.0447 -0.3457 -0.0642 0.1006  52  SER L CA  
4074 C C   . SER C 52  ? 0.9342 1.5257 1.0582 -0.2916 -0.0702 0.0869  52  SER L C   
4075 O O   . SER C 52  ? 1.0201 1.7080 1.1761 -0.2700 -0.0756 0.0825  52  SER L O   
4076 C CB  . SER C 52  ? 1.0217 1.6593 1.0735 -0.3940 -0.0698 0.1202  52  SER L CB  
4077 O OG  . SER C 52  ? 1.0099 1.6048 1.0502 -0.4064 -0.0753 0.1305  52  SER L OG  
4078 N N   . SER C 53  ? 0.8463 1.3489 0.9730 -0.2691 -0.0708 0.0804  53  SER L N   
4079 C CA  . SER C 53  ? 0.9461 1.4514 1.1078 -0.2235 -0.0805 0.0697  53  SER L CA  
4080 C C   . SER C 53  ? 0.7820 1.2562 0.9617 -0.1811 -0.0795 0.0495  53  SER L C   
4081 O O   . SER C 53  ? 0.7682 1.1756 0.9332 -0.1860 -0.0722 0.0460  53  SER L O   
4082 C CB  . SER C 53  ? 1.1160 1.5586 1.2666 -0.2336 -0.0874 0.0798  53  SER L CB  
4083 O OG  . SER C 53  ? 1.2509 1.6087 1.3682 -0.2600 -0.0787 0.0845  53  SER L OG  
4084 N N   . LEU C 54  ? 0.6427 1.1678 0.8511 -0.1381 -0.0879 0.0360  54  LEU L N   
4085 C CA  . LEU C 54  ? 0.6883 1.1851 0.9080 -0.0964 -0.0899 0.0154  54  LEU L CA  
4086 C C   . LEU C 54  ? 0.6332 1.0358 0.8450 -0.0824 -0.1001 0.0133  54  LEU L C   
4087 O O   . LEU C 54  ? 0.6848 1.0760 0.8982 -0.0741 -0.1135 0.0195  54  LEU L O   
4088 C CB  . LEU C 54  ? 0.6953 1.2737 0.9398 -0.0510 -0.0977 0.0001  54  LEU L CB  
4089 C CG  . LEU C 54  ? 0.6811 1.3582 0.9377 -0.0477 -0.0878 -0.0091 54  LEU L CG  
4090 C CD1 . LEU C 54  ? 0.6811 1.4085 0.9246 -0.1042 -0.0777 0.0106  54  LEU L CD1 
4091 C CD2 . LEU C 54  ? 0.6878 1.4527 0.9688 0.0029  -0.0978 -0.0233 54  LEU L CD2 
4092 N N   . GLN C 55  ? 0.5407 0.8807 0.7423 -0.0819 -0.0952 0.0056  55  GLN L N   
4093 C CA  . GLN C 55  ? 0.3796 0.6385 0.5700 -0.0730 -0.1061 0.0033  55  GLN L CA  
4094 C C   . GLN C 55  ? 0.7132 0.9676 0.9080 -0.0283 -0.1245 -0.0104 55  GLN L C   
4095 O O   . GLN C 55  ? 0.6191 0.9150 0.8239 0.0031  -0.1243 -0.0267 55  GLN L O   
4096 C CB  . GLN C 55  ? 0.4026 0.6119 0.5813 -0.0824 -0.0973 -0.0022 55  GLN L CB  
4097 C CG  . GLN C 55  ? 0.4001 0.5360 0.5637 -0.0763 -0.1102 -0.0056 55  GLN L CG  
4098 C CD  . GLN C 55  ? 0.6539 0.7526 0.8053 -0.0985 -0.1001 -0.0036 55  GLN L CD  
4099 O OE1 . GLN C 55  ? 0.6311 0.7331 0.7787 -0.1231 -0.0874 0.0069  55  GLN L OE1 
4100 N NE2 . GLN C 55  ? 0.5660 0.6286 0.7067 -0.0889 -0.1069 -0.0139 55  GLN L NE2 
4101 N N   . SER C 56  ? 0.8290 1.0303 1.0117 -0.0246 -0.1416 -0.0040 56  SER L N   
4102 C CA  . SER C 56  ? 0.9605 1.1348 1.1350 0.0192  -0.1639 -0.0156 56  SER L CA  
4103 C C   . SER C 56  ? 0.9391 1.0918 1.1046 0.0464  -0.1638 -0.0376 56  SER L C   
4104 O O   . SER C 56  ? 0.9448 1.0383 1.0924 0.0276  -0.1611 -0.0394 56  SER L O   
4105 C CB  . SER C 56  ? 1.0811 1.1688 1.2295 0.0068  -0.1827 -0.0047 56  SER L CB  
4106 O OG  . SER C 56  ? 1.2070 1.2800 1.3465 0.0447  -0.2075 -0.0070 56  SER L OG  
4107 N N   . GLY C 57  ? 0.9527 1.1610 1.1300 0.0897  -0.1661 -0.0547 57  GLY L N   
4108 C CA  . GLY C 57  ? 1.0215 1.2070 1.1854 0.1191  -0.1674 -0.0781 57  GLY L CA  
4109 C C   . GLY C 57  ? 1.1012 1.3780 1.2888 0.1279  -0.1481 -0.0910 57  GLY L C   
4110 O O   . GLY C 57  ? 1.2632 1.5516 1.4450 0.1698  -0.1522 -0.1142 57  GLY L O   
4111 N N   . VAL C 58  ? 0.9426 1.2798 1.1508 0.0882  -0.1283 -0.0767 58  VAL L N   
4112 C CA  . VAL C 58  ? 0.8269 1.2469 1.0516 0.0868  -0.1111 -0.0857 58  VAL L CA  
4113 C C   . VAL C 58  ? 0.9265 1.4546 1.1726 0.1216  -0.1126 -0.0956 58  VAL L C   
4114 O O   . VAL C 58  ? 0.9833 1.5436 1.2386 0.1306  -0.1219 -0.0864 58  VAL L O   
4115 C CB  . VAL C 58  ? 0.6263 1.0682 0.8555 0.0324  -0.0928 -0.0663 58  VAL L CB  
4116 C CG1 . VAL C 58  ? 0.5526 0.9006 0.7633 0.0023  -0.0923 -0.0542 58  VAL L CG1 
4117 C CG2 . VAL C 58  ? 0.6431 1.1552 0.8848 0.0119  -0.0905 -0.0492 58  VAL L CG2 
4118 N N   . PRO C 59  ? 0.9583 1.5506 1.2123 0.1412  -0.1036 -0.1146 59  PRO L N   
4119 C CA  . PRO C 59  ? 0.9498 1.6599 1.2240 0.1801  -0.1038 -0.1289 59  PRO L CA  
4120 C C   . PRO C 59  ? 0.8379 1.6546 1.1341 0.1497  -0.0976 -0.1082 59  PRO L C   
4121 O O   . PRO C 59  ? 0.7274 1.5320 1.0195 0.0921  -0.0888 -0.0848 59  PRO L O   
4122 C CB  . PRO C 59  ? 0.9415 1.6958 1.2169 0.1836  -0.0898 -0.1475 59  PRO L CB  
4123 C CG  . PRO C 59  ? 0.9263 1.5592 1.1759 0.1742  -0.0913 -0.1520 59  PRO L CG  
4124 C CD  . PRO C 59  ? 0.8979 1.4548 1.1401 0.1302  -0.0935 -0.1252 59  PRO L CD  
4125 N N   . SER C 60  ? 0.8868 1.8080 1.2020 0.1898  -0.1034 -0.1176 60  SER L N   
4126 C CA  . SER C 60  ? 0.8413 1.8792 1.1758 0.1616  -0.0998 -0.0983 60  SER L CA  
4127 C C   . SER C 60  ? 0.7066 1.8247 1.0433 0.1071  -0.0809 -0.0894 60  SER L C   
4128 O O   . SER C 60  ? 0.5563 1.7160 0.8903 0.0515  -0.0763 -0.0643 60  SER L O   
4129 C CB  . SER C 60  ? 0.9405 2.0918 1.2966 0.2243  -0.1097 -0.1140 60  SER L CB  
4130 O OG  . SER C 60  ? 1.0603 2.1248 1.4049 0.2860  -0.1301 -0.1278 60  SER L OG  
4131 N N   . ARG C 61  ? 0.7217 1.8542 1.0568 0.1210  -0.0716 -0.1097 61  ARG L N   
4132 C CA  . ARG C 61  ? 0.7099 1.9346 1.0456 0.0772  -0.0561 -0.1049 61  ARG L CA  
4133 C C   . ARG C 61  ? 0.7591 1.9172 1.0704 0.0021  -0.0487 -0.0771 61  ARG L C   
4134 O O   . ARG C 61  ? 0.6691 1.8938 0.9712 -0.0458 -0.0395 -0.0658 61  ARG L O   
4135 C CB  . ARG C 61  ? 0.6737 1.9159 1.0101 0.1107  -0.0488 -0.1339 61  ARG L CB  
4136 C CG  . ARG C 61  ? 0.7345 1.8589 1.0486 0.0847  -0.0428 -0.1328 61  ARG L CG  
4137 C CD  . ARG C 61  ? 0.6758 1.8011 0.9878 0.1269  -0.0392 -0.1643 61  ARG L CD  
4138 N NE  . ARG C 61  ? 0.7665 1.8085 1.0715 0.1892  -0.0530 -0.1860 61  ARG L NE  
4139 C CZ  . ARG C 61  ? 0.7361 1.6498 1.0183 0.1947  -0.0576 -0.1927 61  ARG L CZ  
4140 N NH1 . ARG C 61  ? 0.5577 1.4214 0.8288 0.1475  -0.0481 -0.1805 61  ARG L NH1 
4141 N NH2 . ARG C 61  ? 0.8051 1.6402 1.0712 0.2469  -0.0734 -0.2110 61  ARG L NH2 
4142 N N   . PHE C 62  ? 0.8639 1.8907 1.1605 -0.0073 -0.0541 -0.0664 62  PHE L N   
4143 C CA  . PHE C 62  ? 0.8670 1.8204 1.1365 -0.0684 -0.0486 -0.0422 62  PHE L CA  
4144 C C   . PHE C 62  ? 0.8402 1.8088 1.1002 -0.1086 -0.0528 -0.0166 62  PHE L C   
4145 O O   . PHE C 62  ? 0.9124 1.9281 1.1899 -0.0865 -0.0616 -0.0160 62  PHE L O   
4146 C CB  . PHE C 62  ? 0.8363 1.6504 1.0929 -0.0594 -0.0506 -0.0446 62  PHE L CB  
4147 C CG  . PHE C 62  ? 0.8645 1.6521 1.1195 -0.0408 -0.0450 -0.0631 62  PHE L CG  
4148 C CD1 . PHE C 62  ? 0.8389 1.6086 1.0760 -0.0779 -0.0352 -0.0549 62  PHE L CD1 
4149 C CD2 . PHE C 62  ? 0.8911 1.6674 1.1567 0.0139  -0.0512 -0.0885 62  PHE L CD2 
4150 C CE1 . PHE C 62  ? 0.7873 1.5377 1.0230 -0.0627 -0.0304 -0.0708 62  PHE L CE1 
4151 C CE2 . PHE C 62  ? 0.8466 1.5972 1.1061 0.0273  -0.0464 -0.1056 62  PHE L CE2 
4152 C CZ  . PHE C 62  ? 0.7902 1.5330 1.0377 -0.0120 -0.0353 -0.0962 62  PHE L CZ  
4153 N N   . SER C 63  ? 0.7297 1.6532 0.9570 -0.1665 -0.0478 0.0043  63  SER L N   
4154 C CA  . SER C 63  ? 0.7481 1.6743 0.9539 -0.2136 -0.0516 0.0290  63  SER L CA  
4155 C C   . SER C 63  ? 0.7507 1.6037 0.9082 -0.2710 -0.0468 0.0473  63  SER L C   
4156 O O   . SER C 63  ? 0.7354 1.5774 0.8793 -0.2806 -0.0408 0.0436  63  SER L O   
4157 C CB  . SER C 63  ? 0.7247 1.7992 0.9434 -0.2268 -0.0539 0.0346  63  SER L CB  
4158 O OG  . SER C 63  ? 0.7084 1.8619 0.9173 -0.2540 -0.0468 0.0341  63  SER L OG  
4159 N N   . GLY C 64  ? 0.8016 1.6009 0.9289 -0.3075 -0.0508 0.0668  64  GLY L N   
4160 C CA  . GLY C 64  ? 0.8643 1.5823 0.9350 -0.3585 -0.0490 0.0837  64  GLY L CA  
4161 C C   . GLY C 64  ? 0.8947 1.6166 0.9278 -0.4110 -0.0552 0.1063  64  GLY L C   
4162 O O   . GLY C 64  ? 0.8767 1.6450 0.9326 -0.4032 -0.0602 0.1091  64  GLY L O   
4163 N N   . SER C 65  ? 0.9317 1.6009 0.9016 -0.4654 -0.0566 0.1230  65  SER L N   
4164 C CA  . SER C 65  ? 0.9391 1.5932 0.8579 -0.5228 -0.0638 0.1451  65  SER L CA  
4165 C C   . SER C 65  ? 1.0377 1.5620 0.8762 -0.5632 -0.0664 0.1576  65  SER L C   
4166 O O   . SER C 65  ? 0.9456 1.4098 0.7704 -0.5487 -0.0630 0.1510  65  SER L O   
4167 C CB  . SER C 65  ? 0.9266 1.7206 0.8443 -0.5646 -0.0685 0.1572  65  SER L CB  
4168 O OG  . SER C 65  ? 1.0472 1.8464 0.9147 -0.6130 -0.0703 0.1676  65  SER L OG  
4169 N N   . GLY C 66  ? 1.2177 1.6962 0.9991 -0.6120 -0.0736 0.1755  66  GLY L N   
4170 C CA  . GLY C 66  ? 1.3324 1.6746 1.0255 -0.6477 -0.0786 0.1864  66  GLY L CA  
4171 C C   . GLY C 66  ? 1.3941 1.6290 1.0697 -0.6310 -0.0773 0.1834  66  GLY L C   
4172 O O   . GLY C 66  ? 1.2362 1.4834 0.9733 -0.5817 -0.0708 0.1696  66  GLY L O   
4173 N N   . SER C 67  ? 1.6628 1.7891 1.2477 -0.6739 -0.0847 0.1961  67  SER L N   
4174 C CA  . SER C 67  ? 1.7447 1.7631 1.3002 -0.6608 -0.0832 0.1921  67  SER L CA  
4175 C C   . SER C 67  ? 1.7555 1.6303 1.2006 -0.6919 -0.0914 0.2000  67  SER L C   
4176 O O   . SER C 67  ? 1.7039 1.5648 1.0787 -0.7494 -0.1030 0.2168  67  SER L O   
4177 C CB  . SER C 67  ? 1.7635 1.8291 1.3302 -0.6858 -0.0861 0.2007  67  SER L CB  
4178 O OG  . SER C 67  ? 1.8620 1.9403 1.3597 -0.7601 -0.0977 0.2224  67  SER L OG  
4179 N N   . GLY C 68  ? 1.7623 1.5304 1.1880 -0.6531 -0.0865 0.1876  68  GLY L N   
4180 C CA  . GLY C 68  ? 1.8124 1.4328 1.1306 -0.6679 -0.0947 0.1910  68  GLY L CA  
4181 C C   . GLY C 68  ? 1.7764 1.3444 1.0793 -0.6344 -0.0951 0.1844  68  GLY L C   
4182 O O   . GLY C 68  ? 1.8470 1.3375 1.1417 -0.5844 -0.0898 0.1704  68  GLY L O   
4183 N N   . THR C 69  ? 1.7037 1.3218 1.0034 -0.6618 -0.1016 0.1947  69  THR L N   
4184 C CA  . THR C 69  ? 1.7084 1.2633 0.9732 -0.6422 -0.1063 0.1933  69  THR L CA  
4185 C C   . THR C 69  ? 1.6466 1.3091 0.9660 -0.6453 -0.1047 0.1956  69  THR L C   
4186 O O   . THR C 69  ? 1.5717 1.2100 0.8979 -0.6109 -0.1036 0.1893  69  THR L O   
4187 C CB  . THR C 69  ? 1.8265 1.2354 0.9521 -0.6872 -0.1256 0.2083  69  THR L CB  
4188 O OG1 . THR C 69  ? 2.0370 1.3738 1.1270 -0.6589 -0.1318 0.2064  69  THR L OG1 
4189 C CG2 . THR C 69  ? 1.8046 1.2534 0.8775 -0.7743 -0.1398 0.2320  69  THR L CG2 
4190 N N   . ASP C 70  ? 1.6091 1.3952 0.9668 -0.6842 -0.1045 0.2039  70  ASP L N   
4191 C CA  . ASP C 70  ? 1.5444 1.4438 0.9526 -0.6876 -0.1021 0.2041  70  ASP L CA  
4192 C C   . ASP C 70  ? 1.4502 1.4980 0.9701 -0.6584 -0.0889 0.1915  70  ASP L C   
4193 O O   . ASP C 70  ? 1.5083 1.6336 1.0422 -0.6891 -0.0904 0.1989  70  ASP L O   
4194 C CB  . ASP C 70  ? 1.6317 1.5503 0.9655 -0.7676 -0.1176 0.2274  70  ASP L CB  
4195 C CG  . ASP C 70  ? 1.8024 1.5656 1.0164 -0.7964 -0.1347 0.2407  70  ASP L CG  
4196 O OD1 . ASP C 70  ? 1.9000 1.6321 1.0226 -0.8719 -0.1518 0.2627  70  ASP L OD1 
4197 O OD2 . ASP C 70  ? 1.8332 1.5044 1.0396 -0.7442 -0.1328 0.2298  70  ASP L OD2 
4198 N N   . PHE C 71  ? 1.3254 1.4102 0.9194 -0.5990 -0.0778 0.1730  71  PHE L N   
4199 C CA  . PHE C 71  ? 1.1877 1.3894 0.8797 -0.5614 -0.0674 0.1581  71  PHE L CA  
4200 C C   . PHE C 71  ? 1.2100 1.5053 0.9495 -0.5451 -0.0628 0.1490  71  PHE L C   
4201 O O   . PHE C 71  ? 1.3907 1.6478 1.1008 -0.5483 -0.0648 0.1508  71  PHE L O   
4202 C CB  . PHE C 71  ? 1.1630 1.3158 0.8989 -0.5027 -0.0588 0.1415  71  PHE L CB  
4203 C CG  . PHE C 71  ? 1.2599 1.3034 0.9421 -0.5111 -0.0618 0.1470  71  PHE L CG  
4204 C CD1 . PHE C 71  ? 1.2937 1.2187 0.9075 -0.5103 -0.0655 0.1498  71  PHE L CD1 
4205 C CD2 . PHE C 71  ? 1.2825 1.3416 0.9796 -0.5170 -0.0615 0.1486  71  PHE L CD2 
4206 C CE1 . PHE C 71  ? 1.3582 1.1829 0.9185 -0.5132 -0.0678 0.1517  71  PHE L CE1 
4207 C CE2 . PHE C 71  ? 1.3501 1.3112 0.9956 -0.5254 -0.0635 0.1520  71  PHE L CE2 
4208 C CZ  . PHE C 71  ? 1.4194 1.2631 0.9957 -0.5224 -0.0661 0.1524  71  PHE L CZ  
4209 N N   . THR C 72  ? 1.0119 1.4281 0.8220 -0.5248 -0.0573 0.1386  72  THR L N   
4210 C CA  . THR C 72  ? 0.8916 1.4016 0.7472 -0.5047 -0.0520 0.1262  72  THR L CA  
4211 C C   . THR C 72  ? 0.9678 1.5379 0.9050 -0.4430 -0.0441 0.1035  72  THR L C   
4212 O O   . THR C 72  ? 1.0412 1.5854 1.0015 -0.4186 -0.0439 0.0992  72  THR L O   
4213 C CB  . THR C 72  ? 0.8870 1.5144 0.7297 -0.5545 -0.0563 0.1375  72  THR L CB  
4214 O OG1 . THR C 72  ? 0.8691 1.5864 0.7445 -0.5565 -0.0570 0.1385  72  THR L OG1 
4215 C CG2 . THR C 72  ? 0.9015 1.4637 0.6506 -0.6252 -0.0679 0.1625  72  THR L CG2 
4216 N N   . LEU C 73  ? 0.9812 1.6275 0.9554 -0.4201 -0.0391 0.0892  73  LEU L N   
4217 C CA  . LEU C 73  ? 0.7845 1.4830 0.8252 -0.3611 -0.0339 0.0656  73  LEU L CA  
4218 C C   . LEU C 73  ? 0.8420 1.6723 0.9080 -0.3596 -0.0310 0.0560  73  LEU L C   
4219 O O   . LEU C 73  ? 0.9563 1.8068 0.9969 -0.3887 -0.0298 0.0610  73  LEU L O   
4220 C CB  . LEU C 73  ? 0.6335 1.2483 0.6857 -0.3224 -0.0295 0.0524  73  LEU L CB  
4221 C CG  . LEU C 73  ? 0.7212 1.3611 0.8279 -0.2646 -0.0266 0.0282  73  LEU L CG  
4222 C CD1 . LEU C 73  ? 0.8549 1.5334 0.9893 -0.2455 -0.0314 0.0249  73  LEU L CD1 
4223 C CD2 . LEU C 73  ? 0.7713 1.3125 0.8785 -0.2391 -0.0248 0.0219  73  LEU L CD2 
4224 N N   . THR C 74  ? 0.7556 1.6775 0.8685 -0.3247 -0.0306 0.0420  74  THR L N   
4225 C CA  . THR C 74  ? 0.7898 1.8534 0.9264 -0.3197 -0.0274 0.0311  74  THR L CA  
4226 C C   . THR C 74  ? 0.8075 1.9227 0.9982 -0.2477 -0.0252 0.0019  74  THR L C   
4227 O O   . THR C 74  ? 0.8692 1.9554 1.0814 -0.2113 -0.0303 -0.0038 74  THR L O   
4228 C CB  . THR C 74  ? 0.7564 1.9272 0.8800 -0.3665 -0.0319 0.0491  74  THR L CB  
4229 O OG1 . THR C 74  ? 0.8773 1.9985 0.9373 -0.4392 -0.0360 0.0756  74  THR L OG1 
4230 C CG2 . THR C 74  ? 0.6688 2.0062 0.8228 -0.3548 -0.0277 0.0354  74  THR L CG2 
4231 N N   . ILE C 75  ? 0.6349 1.8209 0.8413 -0.2279 -0.0191 -0.0168 75  ILE L N   
4232 C CA  . ILE C 75  ? 0.4877 1.7274 0.7354 -0.1585 -0.0181 -0.0472 75  ILE L CA  
4233 C C   . ILE C 75  ? 0.5739 1.9868 0.8409 -0.1551 -0.0154 -0.0552 75  ILE L C   
4234 O O   . ILE C 75  ? 0.5746 2.0624 0.8339 -0.1790 -0.0085 -0.0579 75  ILE L O   
4235 C CB  . ILE C 75  ? 0.4499 1.6322 0.6994 -0.1288 -0.0128 -0.0679 75  ILE L CB  
4236 C CG1 . ILE C 75  ? 0.5648 1.5943 0.7925 -0.1415 -0.0147 -0.0565 75  ILE L CG1 
4237 C CG2 . ILE C 75  ? 0.4667 1.6729 0.7463 -0.0546 -0.0150 -0.1002 75  ILE L CG2 
4238 C CD1 . ILE C 75  ? 0.5250 1.4933 0.7552 -0.1113 -0.0115 -0.0755 75  ILE L CD1 
4239 N N   . SER C 76  ? 0.7525 2.2357 1.0440 -0.1262 -0.0213 -0.0580 76  SER L N   
4240 C CA  . SER C 76  ? 0.8215 2.4880 1.1332 -0.1228 -0.0192 -0.0636 76  SER L CA  
4241 C C   . SER C 76  ? 0.9803 2.7291 1.3090 -0.0822 -0.0106 -0.0944 76  SER L C   
4242 O O   . SER C 76  ? 1.0625 2.9337 1.3864 -0.1178 -0.0036 -0.0921 76  SER L O   
4243 C CB  . SER C 76  ? 0.7410 2.4643 1.0817 -0.0775 -0.0284 -0.0674 76  SER L CB  
4244 O OG  . SER C 76  ? 0.7785 2.4233 1.1372 0.0016  -0.0341 -0.0932 76  SER L OG  
4245 N N   . SER C 77  ? 0.9770 2.6547 1.3198 -0.0114 -0.0121 -0.1230 77  SER L N   
4246 C CA  . SER C 77  ? 0.9292 2.6731 1.2842 0.0365  -0.0049 -0.1568 77  SER L CA  
4247 C C   . SER C 77  ? 0.8487 2.4412 1.1888 0.0592  -0.0045 -0.1716 77  SER L C   
4248 O O   . SER C 77  ? 0.8477 2.3511 1.1904 0.1162  -0.0130 -0.1888 77  SER L O   
4249 C CB  . SER C 77  ? 1.0551 2.8981 1.4398 0.1166  -0.0101 -0.1839 77  SER L CB  
4250 O OG  . SER C 77  ? 1.1386 3.1316 1.5360 0.1406  -0.0004 -0.2089 77  SER L OG  
4251 N N   . LEU C 78  ? 0.8192 2.3846 1.1392 0.0109  0.0037  -0.1633 78  LEU L N   
4252 C CA  . LEU C 78  ? 0.7305 2.1552 1.0333 0.0157  0.0042  -0.1692 78  LEU L CA  
4253 C C   . LEU C 78  ? 0.8054 2.2028 1.1142 0.0891  0.0026  -0.2074 78  LEU L C   
4254 O O   . LEU C 78  ? 0.9077 2.4089 1.2321 0.1380  0.0037  -0.2332 78  LEU L O   
4255 C CB  . LEU C 78  ? 0.6473 2.0804 0.9287 -0.0441 0.0128  -0.1556 78  LEU L CB  
4256 C CG  . LEU C 78  ? 0.6441 1.9316 0.9038 -0.0609 0.0121  -0.1473 78  LEU L CG  
4257 C CD1 . LEU C 78  ? 0.6736 1.8414 0.9295 -0.0582 0.0034  -0.1319 78  LEU L CD1 
4258 C CD2 . LEU C 78  ? 0.5997 1.8934 0.8325 -0.1284 0.0163  -0.1233 78  LEU L CD2 
4259 N N   . GLN C 79  ? 0.7190 1.9769 1.0109 0.0966  -0.0010 -0.2111 79  GLN L N   
4260 C CA  . GLN C 79  ? 0.7607 1.9680 1.0443 0.1564  -0.0047 -0.2453 79  GLN L CA  
4261 C C   . GLN C 79  ? 0.8959 1.9828 1.1564 0.1354  -0.0040 -0.2430 79  GLN L C   
4262 O O   . GLN C 79  ? 1.0202 2.0430 1.2739 0.0869  -0.0034 -0.2148 79  GLN L O   
4263 C CB  . GLN C 79  ? 0.7636 1.9182 1.0482 0.2151  -0.0199 -0.2577 79  GLN L CB  
4264 C CG  . GLN C 79  ? 0.8278 2.1093 1.1310 0.2703  -0.0216 -0.2798 79  GLN L CG  
4265 C CD  . GLN C 79  ? 0.8981 2.1112 1.1850 0.3506  -0.0368 -0.3109 79  GLN L CD  
4266 O OE1 . GLN C 79  ? 0.8151 2.1101 1.1044 0.4106  -0.0368 -0.3425 79  GLN L OE1 
4267 N NE2 . GLN C 79  ? 0.9531 2.0135 1.2178 0.3525  -0.0510 -0.3027 79  GLN L NE2 
4268 N N   . PRO C 80  ? 0.8938 1.9519 1.1391 0.1734  -0.0046 -0.2734 80  PRO L N   
4269 C CA  . PRO C 80  ? 0.8824 1.8451 1.1043 0.1547  -0.0038 -0.2745 80  PRO L CA  
4270 C C   . PRO C 80  ? 0.8823 1.7177 1.0933 0.1274  -0.0118 -0.2498 80  PRO L C   
4271 O O   . PRO C 80  ? 0.8666 1.6747 1.0731 0.0815  -0.0062 -0.2294 80  PRO L O   
4272 C CB  . PRO C 80  ? 0.9125 1.8432 1.1128 0.2151  -0.0101 -0.3138 80  PRO L CB  
4273 C CG  . PRO C 80  ? 0.8276 1.8889 1.0453 0.2570  -0.0057 -0.3361 80  PRO L CG  
4274 C CD  . PRO C 80  ? 0.8603 1.9839 1.1065 0.2401  -0.0066 -0.3106 80  PRO L CD  
4275 N N   . GLU C 81  ? 0.8763 1.6390 1.0812 0.1563  -0.0255 -0.2518 81  GLU L N   
4276 C CA  . GLU C 81  ? 0.8005 1.4496 0.9931 0.1317  -0.0335 -0.2310 81  GLU L CA  
4277 C C   . GLU C 81  ? 0.6420 1.3057 0.8498 0.0806  -0.0264 -0.1966 81  GLU L C   
4278 O O   . GLU C 81  ? 0.5569 1.1420 0.7559 0.0554  -0.0294 -0.1783 81  GLU L O   
4279 C CB  . GLU C 81  ? 1.0726 1.6525 1.2547 0.1675  -0.0509 -0.2364 81  GLU L CB  
4280 C CG  . GLU C 81  ? 1.3127 1.8968 1.4789 0.2313  -0.0609 -0.2710 81  GLU L CG  
4281 C CD  . GLU C 81  ? 1.3384 2.0337 1.5316 0.2643  -0.0593 -0.2775 81  GLU L CD  
4282 O OE1 . GLU C 81  ? 1.3439 2.1189 1.5393 0.3020  -0.0544 -0.3046 81  GLU L OE1 
4283 O OE2 . GLU C 81  ? 1.2400 1.9489 1.4514 0.2520  -0.0628 -0.2559 81  GLU L OE2 
4284 N N   . ASP C 82  ? 0.5916 1.3563 0.8171 0.0651  -0.0180 -0.1886 82  ASP L N   
4285 C CA  . ASP C 82  ? 0.6271 1.4003 0.8565 0.0175  -0.0140 -0.1569 82  ASP L CA  
4286 C C   . ASP C 82  ? 0.6510 1.4244 0.8686 -0.0262 -0.0052 -0.1421 82  ASP L C   
4287 O