data_3HNC
# 
_entry.id   3HNC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3HNC         
RCSB  RCSB053345   
WWPDB D_1000053345 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3HND 'Crystal structure of human ribonucleotide reductase 1 bound to the effector TTP and Substrate GDP' unspecified 
PDB 3HNE 'Crystal structure of human ribonucleotide reductase 1 bound to the effectors TTP and ATP'          unspecified 
PDB 3HNF 'Crystal structure of human ribonucleotide reductase 1 bound to the effectors TTP and dATP'         unspecified 
# 
_pdbx_database_status.entry_id                        3HNC 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-31 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fairman, J.W.'    1 
'Wijerathna, S.R.' 2 
'Xu, H.'           3 
'Dealwis, C.G.'    4 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for allosteric regulation of human ribonucleotide reductase by nucleotide-induced oligomerization.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            18 
_citation.page_first                316 
_citation.page_last                 322 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21336276 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2007 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fairman, J.W.'    1  
primary 'Wijerathna, S.R.' 2  
primary 'Ahmad, M.F.'      3  
primary 'Xu, H.'           4  
primary 'Nakano, R.'       5  
primary 'Jha, S.'          6  
primary 'Prendergast, J.'  7  
primary 'Welin, R.M.'      8  
primary 'Flodin, S.'       9  
primary 'Roos, A.'         10 
primary 'Nordlund, P.'     11 
primary 'Li, Z.'           12 
primary 'Walz, T.'         13 
primary 'Dealwis, C.G.'    14 
# 
_cell.entry_id           3HNC 
_cell.length_a           68.980 
_cell.length_b           114.104 
_cell.length_c           219.283 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3HNC 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ribonucleoside-diphosphate reductase large subunit' 90179.023 2   1.17.4.1 ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'                                      24.305    2   ?        ? ? ? 
3 non-polymer syn "THYMIDINE-5'-TRIPHOSPHATE"                          482.168   2   ?        ? ? ? 
4 non-polymer syn 'SULFATE ION'                                        96.063    6   ?        ? ? ? 
5 water       nat water                                                18.015    360 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Ribonucleoside-diphosphate reductase subunit M1, Ribonucleotide reductase large subunit' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAAR
IAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKIN
GKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGK
EEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTET
GTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKI
IDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSP
VSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPH
LLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAAR
IAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKIN
GKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGK
EEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTET
GTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKI
IDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSP
VSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPH
LLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   VAL n 
1 4   ILE n 
1 5   LYS n 
1 6   ARG n 
1 7   ASP n 
1 8   GLY n 
1 9   ARG n 
1 10  GLN n 
1 11  GLU n 
1 12  ARG n 
1 13  VAL n 
1 14  MET n 
1 15  PHE n 
1 16  ASP n 
1 17  LYS n 
1 18  ILE n 
1 19  THR n 
1 20  SER n 
1 21  ARG n 
1 22  ILE n 
1 23  GLN n 
1 24  LYS n 
1 25  LEU n 
1 26  CYS n 
1 27  TYR n 
1 28  GLY n 
1 29  LEU n 
1 30  ASN n 
1 31  MET n 
1 32  ASP n 
1 33  PHE n 
1 34  VAL n 
1 35  ASP n 
1 36  PRO n 
1 37  ALA n 
1 38  GLN n 
1 39  ILE n 
1 40  THR n 
1 41  MET n 
1 42  LYS n 
1 43  VAL n 
1 44  ILE n 
1 45  GLN n 
1 46  GLY n 
1 47  LEU n 
1 48  TYR n 
1 49  SER n 
1 50  GLY n 
1 51  VAL n 
1 52  THR n 
1 53  THR n 
1 54  VAL n 
1 55  GLU n 
1 56  LEU n 
1 57  ASP n 
1 58  THR n 
1 59  LEU n 
1 60  ALA n 
1 61  ALA n 
1 62  GLU n 
1 63  THR n 
1 64  ALA n 
1 65  ALA n 
1 66  THR n 
1 67  LEU n 
1 68  THR n 
1 69  THR n 
1 70  LYS n 
1 71  HIS n 
1 72  PRO n 
1 73  ASP n 
1 74  TYR n 
1 75  ALA n 
1 76  ILE n 
1 77  LEU n 
1 78  ALA n 
1 79  ALA n 
1 80  ARG n 
1 81  ILE n 
1 82  ALA n 
1 83  VAL n 
1 84  SER n 
1 85  ASN n 
1 86  LEU n 
1 87  HIS n 
1 88  LYS n 
1 89  GLU n 
1 90  THR n 
1 91  LYS n 
1 92  LYS n 
1 93  VAL n 
1 94  PHE n 
1 95  SER n 
1 96  ASP n 
1 97  VAL n 
1 98  MET n 
1 99  GLU n 
1 100 ASP n 
1 101 LEU n 
1 102 TYR n 
1 103 ASN n 
1 104 TYR n 
1 105 ILE n 
1 106 ASN n 
1 107 PRO n 
1 108 HIS n 
1 109 ASN n 
1 110 GLY n 
1 111 LYS n 
1 112 HIS n 
1 113 SER n 
1 114 PRO n 
1 115 MET n 
1 116 VAL n 
1 117 ALA n 
1 118 LYS n 
1 119 SER n 
1 120 THR n 
1 121 LEU n 
1 122 ASP n 
1 123 ILE n 
1 124 VAL n 
1 125 LEU n 
1 126 ALA n 
1 127 ASN n 
1 128 LYS n 
1 129 ASP n 
1 130 ARG n 
1 131 LEU n 
1 132 ASN n 
1 133 SER n 
1 134 ALA n 
1 135 ILE n 
1 136 ILE n 
1 137 TYR n 
1 138 ASP n 
1 139 ARG n 
1 140 ASP n 
1 141 PHE n 
1 142 SER n 
1 143 TYR n 
1 144 ASN n 
1 145 TYR n 
1 146 PHE n 
1 147 GLY n 
1 148 PHE n 
1 149 LYS n 
1 150 THR n 
1 151 LEU n 
1 152 GLU n 
1 153 ARG n 
1 154 SER n 
1 155 TYR n 
1 156 LEU n 
1 157 LEU n 
1 158 LYS n 
1 159 ILE n 
1 160 ASN n 
1 161 GLY n 
1 162 LYS n 
1 163 VAL n 
1 164 ALA n 
1 165 GLU n 
1 166 ARG n 
1 167 PRO n 
1 168 GLN n 
1 169 HIS n 
1 170 MET n 
1 171 LEU n 
1 172 MET n 
1 173 ARG n 
1 174 VAL n 
1 175 SER n 
1 176 VAL n 
1 177 GLY n 
1 178 ILE n 
1 179 HIS n 
1 180 LYS n 
1 181 GLU n 
1 182 ASP n 
1 183 ILE n 
1 184 ASP n 
1 185 ALA n 
1 186 ALA n 
1 187 ILE n 
1 188 GLU n 
1 189 THR n 
1 190 TYR n 
1 191 ASN n 
1 192 LEU n 
1 193 LEU n 
1 194 SER n 
1 195 GLU n 
1 196 ARG n 
1 197 TRP n 
1 198 PHE n 
1 199 THR n 
1 200 HIS n 
1 201 ALA n 
1 202 SER n 
1 203 PRO n 
1 204 THR n 
1 205 LEU n 
1 206 PHE n 
1 207 ASN n 
1 208 ALA n 
1 209 GLY n 
1 210 THR n 
1 211 ASN n 
1 212 ARG n 
1 213 PRO n 
1 214 GLN n 
1 215 LEU n 
1 216 SER n 
1 217 SER n 
1 218 CYS n 
1 219 PHE n 
1 220 LEU n 
1 221 LEU n 
1 222 SER n 
1 223 MET n 
1 224 LYS n 
1 225 ASP n 
1 226 ASP n 
1 227 SER n 
1 228 ILE n 
1 229 GLU n 
1 230 GLY n 
1 231 ILE n 
1 232 TYR n 
1 233 ASP n 
1 234 THR n 
1 235 LEU n 
1 236 LYS n 
1 237 GLN n 
1 238 CYS n 
1 239 ALA n 
1 240 LEU n 
1 241 ILE n 
1 242 SER n 
1 243 LYS n 
1 244 SER n 
1 245 ALA n 
1 246 GLY n 
1 247 GLY n 
1 248 ILE n 
1 249 GLY n 
1 250 VAL n 
1 251 ALA n 
1 252 VAL n 
1 253 SER n 
1 254 CYS n 
1 255 ILE n 
1 256 ARG n 
1 257 ALA n 
1 258 THR n 
1 259 GLY n 
1 260 SER n 
1 261 TYR n 
1 262 ILE n 
1 263 ALA n 
1 264 GLY n 
1 265 THR n 
1 266 ASN n 
1 267 GLY n 
1 268 ASN n 
1 269 SER n 
1 270 ASN n 
1 271 GLY n 
1 272 LEU n 
1 273 VAL n 
1 274 PRO n 
1 275 MET n 
1 276 LEU n 
1 277 ARG n 
1 278 VAL n 
1 279 TYR n 
1 280 ASN n 
1 281 ASN n 
1 282 THR n 
1 283 ALA n 
1 284 ARG n 
1 285 TYR n 
1 286 VAL n 
1 287 ASP n 
1 288 GLN n 
1 289 GLY n 
1 290 GLY n 
1 291 ASN n 
1 292 LYS n 
1 293 ARG n 
1 294 PRO n 
1 295 GLY n 
1 296 ALA n 
1 297 PHE n 
1 298 ALA n 
1 299 ILE n 
1 300 TYR n 
1 301 LEU n 
1 302 GLU n 
1 303 PRO n 
1 304 TRP n 
1 305 HIS n 
1 306 LEU n 
1 307 ASP n 
1 308 ILE n 
1 309 PHE n 
1 310 GLU n 
1 311 PHE n 
1 312 LEU n 
1 313 ASP n 
1 314 LEU n 
1 315 LYS n 
1 316 LYS n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 LYS n 
1 321 GLU n 
1 322 GLU n 
1 323 GLN n 
1 324 ARG n 
1 325 ALA n 
1 326 ARG n 
1 327 ASP n 
1 328 LEU n 
1 329 PHE n 
1 330 PHE n 
1 331 ALA n 
1 332 LEU n 
1 333 TRP n 
1 334 ILE n 
1 335 PRO n 
1 336 ASP n 
1 337 LEU n 
1 338 PHE n 
1 339 MET n 
1 340 LYS n 
1 341 ARG n 
1 342 VAL n 
1 343 GLU n 
1 344 THR n 
1 345 ASN n 
1 346 GLN n 
1 347 ASP n 
1 348 TRP n 
1 349 SER n 
1 350 LEU n 
1 351 MET n 
1 352 CYS n 
1 353 PRO n 
1 354 ASN n 
1 355 GLU n 
1 356 CYS n 
1 357 PRO n 
1 358 GLY n 
1 359 LEU n 
1 360 ASP n 
1 361 GLU n 
1 362 VAL n 
1 363 TRP n 
1 364 GLY n 
1 365 GLU n 
1 366 GLU n 
1 367 PHE n 
1 368 GLU n 
1 369 LYS n 
1 370 LEU n 
1 371 TYR n 
1 372 ALA n 
1 373 SER n 
1 374 TYR n 
1 375 GLU n 
1 376 LYS n 
1 377 GLN n 
1 378 GLY n 
1 379 ARG n 
1 380 VAL n 
1 381 ARG n 
1 382 LYS n 
1 383 VAL n 
1 384 VAL n 
1 385 LYS n 
1 386 ALA n 
1 387 GLN n 
1 388 GLN n 
1 389 LEU n 
1 390 TRP n 
1 391 TYR n 
1 392 ALA n 
1 393 ILE n 
1 394 ILE n 
1 395 GLU n 
1 396 SER n 
1 397 GLN n 
1 398 THR n 
1 399 GLU n 
1 400 THR n 
1 401 GLY n 
1 402 THR n 
1 403 PRO n 
1 404 TYR n 
1 405 MET n 
1 406 LEU n 
1 407 TYR n 
1 408 LYS n 
1 409 ASP n 
1 410 SER n 
1 411 CYS n 
1 412 ASN n 
1 413 ARG n 
1 414 LYS n 
1 415 SER n 
1 416 ASN n 
1 417 GLN n 
1 418 GLN n 
1 419 ASN n 
1 420 LEU n 
1 421 GLY n 
1 422 THR n 
1 423 ILE n 
1 424 LYS n 
1 425 CYS n 
1 426 SER n 
1 427 ASN n 
1 428 LEU n 
1 429 CYS n 
1 430 THR n 
1 431 GLU n 
1 432 ILE n 
1 433 VAL n 
1 434 GLU n 
1 435 TYR n 
1 436 THR n 
1 437 SER n 
1 438 LYS n 
1 439 ASP n 
1 440 GLU n 
1 441 VAL n 
1 442 ALA n 
1 443 VAL n 
1 444 CYS n 
1 445 ASN n 
1 446 LEU n 
1 447 ALA n 
1 448 SER n 
1 449 LEU n 
1 450 ALA n 
1 451 LEU n 
1 452 ASN n 
1 453 MET n 
1 454 TYR n 
1 455 VAL n 
1 456 THR n 
1 457 SER n 
1 458 GLU n 
1 459 HIS n 
1 460 THR n 
1 461 TYR n 
1 462 ASP n 
1 463 PHE n 
1 464 LYS n 
1 465 LYS n 
1 466 LEU n 
1 467 ALA n 
1 468 GLU n 
1 469 VAL n 
1 470 THR n 
1 471 LYS n 
1 472 VAL n 
1 473 VAL n 
1 474 VAL n 
1 475 ARG n 
1 476 ASN n 
1 477 LEU n 
1 478 ASN n 
1 479 LYS n 
1 480 ILE n 
1 481 ILE n 
1 482 ASP n 
1 483 ILE n 
1 484 ASN n 
1 485 TYR n 
1 486 TYR n 
1 487 PRO n 
1 488 VAL n 
1 489 PRO n 
1 490 GLU n 
1 491 ALA n 
1 492 CYS n 
1 493 LEU n 
1 494 SER n 
1 495 ASN n 
1 496 LYS n 
1 497 ARG n 
1 498 HIS n 
1 499 ARG n 
1 500 PRO n 
1 501 ILE n 
1 502 GLY n 
1 503 ILE n 
1 504 GLY n 
1 505 VAL n 
1 506 GLN n 
1 507 GLY n 
1 508 LEU n 
1 509 ALA n 
1 510 ASP n 
1 511 ALA n 
1 512 PHE n 
1 513 ILE n 
1 514 LEU n 
1 515 MET n 
1 516 ARG n 
1 517 TYR n 
1 518 PRO n 
1 519 PHE n 
1 520 GLU n 
1 521 SER n 
1 522 ALA n 
1 523 GLU n 
1 524 ALA n 
1 525 GLN n 
1 526 LEU n 
1 527 LEU n 
1 528 ASN n 
1 529 LYS n 
1 530 GLN n 
1 531 ILE n 
1 532 PHE n 
1 533 GLU n 
1 534 THR n 
1 535 ILE n 
1 536 TYR n 
1 537 TYR n 
1 538 GLY n 
1 539 ALA n 
1 540 LEU n 
1 541 GLU n 
1 542 ALA n 
1 543 SER n 
1 544 CYS n 
1 545 ASP n 
1 546 LEU n 
1 547 ALA n 
1 548 LYS n 
1 549 GLU n 
1 550 GLN n 
1 551 GLY n 
1 552 PRO n 
1 553 TYR n 
1 554 GLU n 
1 555 THR n 
1 556 TYR n 
1 557 GLU n 
1 558 GLY n 
1 559 SER n 
1 560 PRO n 
1 561 VAL n 
1 562 SER n 
1 563 LYS n 
1 564 GLY n 
1 565 ILE n 
1 566 LEU n 
1 567 GLN n 
1 568 TYR n 
1 569 ASP n 
1 570 MET n 
1 571 TRP n 
1 572 ASN n 
1 573 VAL n 
1 574 THR n 
1 575 PRO n 
1 576 THR n 
1 577 ASP n 
1 578 LEU n 
1 579 TRP n 
1 580 ASP n 
1 581 TRP n 
1 582 LYS n 
1 583 VAL n 
1 584 LEU n 
1 585 LYS n 
1 586 GLU n 
1 587 LYS n 
1 588 ILE n 
1 589 ALA n 
1 590 LYS n 
1 591 TYR n 
1 592 GLY n 
1 593 ILE n 
1 594 ARG n 
1 595 ASN n 
1 596 SER n 
1 597 LEU n 
1 598 LEU n 
1 599 ILE n 
1 600 ALA n 
1 601 PRO n 
1 602 MET n 
1 603 PRO n 
1 604 THR n 
1 605 ALA n 
1 606 SER n 
1 607 THR n 
1 608 ALA n 
1 609 GLN n 
1 610 ILE n 
1 611 LEU n 
1 612 GLY n 
1 613 ASN n 
1 614 ASN n 
1 615 GLU n 
1 616 SER n 
1 617 ILE n 
1 618 GLU n 
1 619 PRO n 
1 620 TYR n 
1 621 THR n 
1 622 SER n 
1 623 ASN n 
1 624 ILE n 
1 625 TYR n 
1 626 THR n 
1 627 ARG n 
1 628 ARG n 
1 629 VAL n 
1 630 LEU n 
1 631 SER n 
1 632 GLY n 
1 633 GLU n 
1 634 PHE n 
1 635 GLN n 
1 636 ILE n 
1 637 VAL n 
1 638 ASN n 
1 639 PRO n 
1 640 HIS n 
1 641 LEU n 
1 642 LEU n 
1 643 LYS n 
1 644 ASP n 
1 645 LEU n 
1 646 THR n 
1 647 GLU n 
1 648 ARG n 
1 649 GLY n 
1 650 LEU n 
1 651 TRP n 
1 652 HIS n 
1 653 GLU n 
1 654 GLU n 
1 655 MET n 
1 656 LYS n 
1 657 ASN n 
1 658 GLN n 
1 659 ILE n 
1 660 ILE n 
1 661 ALA n 
1 662 CYS n 
1 663 ASN n 
1 664 GLY n 
1 665 SER n 
1 666 ILE n 
1 667 GLN n 
1 668 SER n 
1 669 ILE n 
1 670 PRO n 
1 671 GLU n 
1 672 ILE n 
1 673 PRO n 
1 674 ASP n 
1 675 ASP n 
1 676 LEU n 
1 677 LYS n 
1 678 GLN n 
1 679 LEU n 
1 680 TYR n 
1 681 LYS n 
1 682 THR n 
1 683 VAL n 
1 684 TRP n 
1 685 GLU n 
1 686 ILE n 
1 687 SER n 
1 688 GLN n 
1 689 LYS n 
1 690 THR n 
1 691 VAL n 
1 692 LEU n 
1 693 LYS n 
1 694 MET n 
1 695 ALA n 
1 696 ALA n 
1 697 GLU n 
1 698 ARG n 
1 699 GLY n 
1 700 ALA n 
1 701 PHE n 
1 702 ILE n 
1 703 ASP n 
1 704 GLN n 
1 705 SER n 
1 706 GLN n 
1 707 SER n 
1 708 LEU n 
1 709 ASN n 
1 710 ILE n 
1 711 HIS n 
1 712 ILE n 
1 713 ALA n 
1 714 GLU n 
1 715 PRO n 
1 716 ASN n 
1 717 TYR n 
1 718 GLY n 
1 719 LYS n 
1 720 LEU n 
1 721 THR n 
1 722 SER n 
1 723 MET n 
1 724 HIS n 
1 725 PHE n 
1 726 TYR n 
1 727 GLY n 
1 728 TRP n 
1 729 LYS n 
1 730 GLN n 
1 731 GLY n 
1 732 LEU n 
1 733 LYS n 
1 734 THR n 
1 735 GLY n 
1 736 MET n 
1 737 TYR n 
1 738 TYR n 
1 739 LEU n 
1 740 ARG n 
1 741 THR n 
1 742 ARG n 
1 743 PRO n 
1 744 ALA n 
1 745 ALA n 
1 746 ASN n 
1 747 PRO n 
1 748 ILE n 
1 749 GLN n 
1 750 PHE n 
1 751 THR n 
1 752 LEU n 
1 753 ASN n 
1 754 LYS n 
1 755 GLU n 
1 756 LYS n 
1 757 LEU n 
1 758 LYS n 
1 759 ASP n 
1 760 LYS n 
1 761 GLU n 
1 762 LYS n 
1 763 VAL n 
1 764 SER n 
1 765 LYS n 
1 766 GLU n 
1 767 GLU n 
1 768 GLU n 
1 769 GLU n 
1 770 LYS n 
1 771 GLU n 
1 772 ARG n 
1 773 ASN n 
1 774 THR n 
1 775 ALA n 
1 776 ALA n 
1 777 MET n 
1 778 VAL n 
1 779 CYS n 
1 780 SER n 
1 781 LEU n 
1 782 GLU n 
1 783 ASN n 
1 784 ARG n 
1 785 ASP n 
1 786 GLU n 
1 787 CYS n 
1 788 LEU n 
1 789 MET n 
1 790 CYS n 
1 791 GLY n 
1 792 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'RR1, RRM1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RIR1_HUMAN 
_struct_ref.pdbx_db_accession          P23921 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAAR
IAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKIN
GKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGK
EEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTET
GTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKI
IDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSP
VSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPH
LLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3HNC A 1 ? 792 ? P23921 1 ? 792 ? 1 792 
2 1 3HNC B 1 ? 792 ? P23921 1 ? 792 ? 1 792 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                       ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'             ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'               ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TTP non-polymer         . "THYMIDINE-5'-TRIPHOSPHATE" ? 'C10 H17 N2 O14 P3' 482.168 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3HNC 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   48.59 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.9 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'0.1 M Tris-HCl pH 7.9, 0.2 M LiSO4, 19% PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2008-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9000 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
# 
_reflns.entry_id                     3HNC 
_reflns.d_resolution_high            2.300 
_reflns.d_resolution_low             40.000 
_reflns.number_obs                   75994 
_reflns.pdbx_Rmerge_I_obs            0.091 
_reflns.pdbx_netI_over_sigmaI        13.144 
_reflns.pdbx_chi_squared             1.221 
_reflns.pdbx_redundancy              3.400 
_reflns.percent_possible_obs         97.800 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.30 2.38  ? ? ? 0.566 ? ? 1.076 2.40 ? 7349 95.90 ? 1  
2.38 2.48  ? ? ? 0.525 ? ? 1.053 2.80 ? 7468 97.70 ? 2  
2.48 2.59  ? ? ? 0.472 ? ? 1.070 3.10 ? 7545 98.60 ? 3  
2.59 2.73  ? ? ? 0.395 ? ? 1.123 3.50 ? 7621 99.00 ? 4  
2.73 2.90  ? ? ? 0.284 ? ? 1.107 3.70 ? 7619 99.00 ? 5  
2.90 3.12  ? ? ? 0.196 ? ? 1.099 3.70 ? 7651 99.00 ? 6  
3.12 3.44  ? ? ? 0.129 ? ? 1.119 3.80 ? 7684 98.80 ? 7  
3.44 3.93  ? ? ? 0.084 ? ? 1.510 3.80 ? 7649 98.20 ? 8  
3.93 4.95  ? ? ? 0.054 ? ? 1.449 3.80 ? 7674 97.40 ? 9  
4.95 40.00 ? ? ? 0.037 ? ? 1.409 3.70 ? 7734 94.50 ? 10 
# 
_refine.entry_id                                 3HNC 
_refine.ls_d_res_high                            2.410 
_refine.ls_d_res_low                             39.530 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    97.000 
_refine.ls_number_reflns_obs                     65388 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.188 
_refine.ls_R_factor_R_work                       0.186 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.236 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  3306 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               46.798 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.440 
_refine.aniso_B[2][2]                            -0.410 
_refine.aniso_B[3][3]                            -0.020 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.954 
_refine.correlation_coeff_Fo_to_Fc_free          0.926 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.408 
_refine.pdbx_overall_ESU_R_Free                  0.256 
_refine.overall_SU_ML                            0.190 
_refine.overall_SU_B                             16.325 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                85.11 
_refine.B_iso_min                                20.00 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11328 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         90 
_refine_hist.number_atoms_solvent             360 
_refine_hist.number_atoms_total               11778 
_refine_hist.d_res_high                       2.410 
_refine_hist.d_res_low                        39.530 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         11648 0.009  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      15854 1.231  1.959  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   1442  5.822  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   508   37.767 24.409 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1900  18.579 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   54    20.336 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1787  0.088  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     8748  0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            5627  0.195  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          7993  0.304  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    614   0.141  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      1     0.083  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   56    0.198  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 6     0.139  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              7379  0.436  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             11604 0.761  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4901  1.108  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             4250  1.795  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.41 
_refine_ls_shell.d_res_low                        2.48 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               82.710 
_refine_ls_shell.number_reflns_R_work             3871 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.245 
_refine_ls_shell.R_factor_R_free                  0.316 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             199 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                4070 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3HNC 
_struct.title                     'Crystal structure of human ribonucleotide reductase 1 bound to the effector TTP' 
_struct.pdbx_descriptor           'Ribonucleoside-diphosphate reductase large subunit (E.C.1.17.4.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3HNC 
_struct_keywords.text            
'oxidoreductase, ribonucleotide reductase, Allosteric enzyme, ATP-binding, DNA replication, Nucleotide-binding' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 14  ? LYS A 24  ? MET A 14  LYS A 24  1 ? 11 
HELX_P HELX_P2  2  ASP A 35  ? GLN A 45  ? ASP A 35  GLN A 45  1 ? 11 
HELX_P HELX_P3  3  THR A 52  ? LEU A 67  ? THR A 52  LEU A 67  1 ? 16 
HELX_P HELX_P4  4  THR A 68  ? HIS A 71  ? THR A 68  HIS A 71  5 ? 4  
HELX_P HELX_P5  5  PRO A 72  ? GLU A 89  ? PRO A 72  GLU A 89  1 ? 18 
HELX_P HELX_P6  6  VAL A 93  ? ASN A 103 ? VAL A 93  ASN A 103 1 ? 11 
HELX_P HELX_P7  7  ALA A 117 ? ASN A 127 ? ALA A 117 ASN A 127 1 ? 11 
HELX_P HELX_P8  8  ASN A 127 ? ILE A 135 ? ASN A 127 ILE A 135 1 ? 9  
HELX_P HELX_P9  9  ILE A 136 ? TYR A 143 ? ILE A 136 TYR A 143 5 ? 8  
HELX_P HELX_P10 10 ASN A 144 ? TYR A 155 ? ASN A 144 TYR A 155 1 ? 12 
HELX_P HELX_P11 11 ARG A 166 ? LYS A 180 ? ARG A 166 LYS A 180 1 ? 15 
HELX_P HELX_P12 12 ASP A 182 ? GLU A 195 ? ASP A 182 GLU A 195 1 ? 14 
HELX_P HELX_P13 13 ALA A 201 ? ALA A 208 ? ALA A 201 ALA A 208 1 ? 8  
HELX_P HELX_P14 14 SER A 227 ? SER A 244 ? SER A 227 SER A 244 1 ? 18 
HELX_P HELX_P15 15 LEU A 272 ? VAL A 286 ? LEU A 272 VAL A 286 1 ? 15 
HELX_P HELX_P16 16 ASP A 307 ? LEU A 312 ? ASP A 307 LEU A 312 1 ? 6  
HELX_P HELX_P17 17 PRO A 335 ? THR A 344 ? PRO A 335 THR A 344 1 ? 10 
HELX_P HELX_P18 18 GLY A 358 ? VAL A 362 ? GLY A 358 VAL A 362 5 ? 5  
HELX_P HELX_P19 19 TRP A 363 ? GLN A 377 ? TRP A 363 GLN A 377 1 ? 15 
HELX_P HELX_P20 20 ALA A 386 ? GLY A 401 ? ALA A 386 GLY A 401 1 ? 16 
HELX_P HELX_P21 21 LYS A 408 ? LYS A 414 ? LYS A 408 LYS A 414 1 ? 7  
HELX_P HELX_P22 22 GLN A 417 ? GLY A 421 ? GLN A 417 GLY A 421 5 ? 5  
HELX_P HELX_P23 23 ASN A 452 ? VAL A 455 ? ASN A 452 VAL A 455 5 ? 4  
HELX_P HELX_P24 24 ASP A 462 ? ASN A 484 ? ASP A 462 ASN A 484 1 ? 23 
HELX_P HELX_P25 25 VAL A 488 ? ARG A 499 ? VAL A 488 ARG A 499 1 ? 12 
HELX_P HELX_P26 26 GLY A 507 ? MET A 515 ? GLY A 507 MET A 515 1 ? 9  
HELX_P HELX_P27 27 SER A 521 ? GLY A 551 ? SER A 521 GLY A 551 1 ? 31 
HELX_P HELX_P28 28 SER A 559 ? GLY A 564 ? SER A 559 GLY A 564 5 ? 6  
HELX_P HELX_P29 29 LEU A 566 ? TRP A 571 ? LEU A 566 TRP A 571 1 ? 6  
HELX_P HELX_P30 30 ASP A 580 ? GLY A 592 ? ASP A 580 GLY A 592 1 ? 13 
HELX_P HELX_P31 31 THR A 604 ? GLY A 612 ? THR A 604 GLY A 612 1 ? 9  
HELX_P HELX_P32 32 ASN A 638 ? ARG A 648 ? ASN A 638 ARG A 648 1 ? 11 
HELX_P HELX_P33 33 HIS A 652 ? CYS A 662 ? HIS A 652 CYS A 662 1 ? 11 
HELX_P HELX_P34 34 PRO A 673 ? TYR A 680 ? PRO A 673 TYR A 680 1 ? 8  
HELX_P HELX_P35 35 SER A 687 ? ALA A 700 ? SER A 687 ALA A 700 1 ? 14 
HELX_P HELX_P36 36 ASN A 716 ? GLN A 730 ? ASN A 716 GLN A 730 1 ? 15 
HELX_P HELX_P37 37 MET B 14  ? LYS B 24  ? MET B 14  LYS B 24  1 ? 11 
HELX_P HELX_P38 38 ASP B 35  ? GLY B 46  ? ASP B 35  GLY B 46  1 ? 12 
HELX_P HELX_P39 39 THR B 53  ? LEU B 67  ? THR B 53  LEU B 67  1 ? 15 
HELX_P HELX_P40 40 THR B 68  ? HIS B 71  ? THR B 68  HIS B 71  5 ? 4  
HELX_P HELX_P41 41 PRO B 72  ? GLU B 89  ? PRO B 72  GLU B 89  1 ? 18 
HELX_P HELX_P42 42 VAL B 93  ? ASN B 103 ? VAL B 93  ASN B 103 1 ? 11 
HELX_P HELX_P43 43 ALA B 117 ? ASN B 127 ? ALA B 117 ASN B 127 1 ? 11 
HELX_P HELX_P44 44 ASN B 127 ? ILE B 135 ? ASN B 127 ILE B 135 1 ? 9  
HELX_P HELX_P45 45 ILE B 136 ? TYR B 143 ? ILE B 136 TYR B 143 5 ? 8  
HELX_P HELX_P46 46 ASN B 144 ? TYR B 155 ? ASN B 144 TYR B 155 1 ? 12 
HELX_P HELX_P47 47 ARG B 166 ? LYS B 180 ? ARG B 166 LYS B 180 1 ? 15 
HELX_P HELX_P48 48 ASP B 182 ? GLU B 195 ? ASP B 182 GLU B 195 1 ? 14 
HELX_P HELX_P49 49 ALA B 201 ? ALA B 208 ? ALA B 201 ALA B 208 1 ? 8  
HELX_P HELX_P50 50 SER B 227 ? SER B 244 ? SER B 227 SER B 244 1 ? 18 
HELX_P HELX_P51 51 GLY B 271 ? VAL B 286 ? GLY B 271 VAL B 286 1 ? 16 
HELX_P HELX_P52 52 ASP B 307 ? LEU B 312 ? ASP B 307 LEU B 312 1 ? 6  
HELX_P HELX_P53 53 PRO B 335 ? ASN B 345 ? PRO B 335 ASN B 345 1 ? 11 
HELX_P HELX_P54 54 GLY B 358 ? VAL B 362 ? GLY B 358 VAL B 362 5 ? 5  
HELX_P HELX_P55 55 TRP B 363 ? GLN B 377 ? TRP B 363 GLN B 377 1 ? 15 
HELX_P HELX_P56 56 ALA B 386 ? GLY B 401 ? ALA B 386 GLY B 401 1 ? 16 
HELX_P HELX_P57 57 LYS B 408 ? LYS B 414 ? LYS B 408 LYS B 414 1 ? 7  
HELX_P HELX_P58 58 GLN B 417 ? GLY B 421 ? GLN B 417 GLY B 421 5 ? 5  
HELX_P HELX_P59 59 ASN B 452 ? VAL B 455 ? ASN B 452 VAL B 455 5 ? 4  
HELX_P HELX_P60 60 ASP B 462 ? ASN B 484 ? ASP B 462 ASN B 484 1 ? 23 
HELX_P HELX_P61 61 VAL B 488 ? ARG B 499 ? VAL B 488 ARG B 499 1 ? 12 
HELX_P HELX_P62 62 GLY B 507 ? MET B 515 ? GLY B 507 MET B 515 1 ? 9  
HELX_P HELX_P63 63 SER B 521 ? GLY B 551 ? SER B 521 GLY B 551 1 ? 31 
HELX_P HELX_P64 64 PRO B 560 ? GLY B 564 ? PRO B 560 GLY B 564 5 ? 5  
HELX_P HELX_P65 65 LEU B 566 ? TRP B 571 ? LEU B 566 TRP B 571 1 ? 6  
HELX_P HELX_P66 66 ASP B 580 ? GLY B 592 ? ASP B 580 GLY B 592 1 ? 13 
HELX_P HELX_P67 67 THR B 604 ? GLY B 612 ? THR B 604 GLY B 612 1 ? 9  
HELX_P HELX_P68 68 ASN B 638 ? ARG B 648 ? ASN B 638 ARG B 648 1 ? 11 
HELX_P HELX_P69 69 HIS B 652 ? ALA B 661 ? HIS B 652 ALA B 661 1 ? 10 
HELX_P HELX_P70 70 PRO B 673 ? TYR B 680 ? PRO B 673 TYR B 680 1 ? 8  
HELX_P HELX_P71 71 SER B 687 ? ALA B 700 ? SER B 687 ALA B 700 1 ? 14 
HELX_P HELX_P72 72 ASN B 716 ? GLY B 731 ? ASN B 716 GLY B 731 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C MG . MG ? ? ? 1_555 D TTP . O2A ? ? A MG 801 A TTP 802 1_555 ? ? ? ? ? ? ? 1.907 ? 
metalc2 metalc ? ? C MG . MG ? ? ? 1_555 D TTP . O2B ? ? A MG 801 A TTP 802 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc3 metalc ? ? C MG . MG ? ? ? 1_555 D TTP . O3G ? ? A MG 801 A TTP 802 1_555 ? ? ? ? ? ? ? 2.474 ? 
metalc4 metalc ? ? H MG . MG ? ? ? 1_555 I TTP . O2A ? ? B MG 801 B TTP 802 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc5 metalc ? ? H MG . MG ? ? ? 1_555 I TTP . O3G ? ? B MG 801 B TTP 802 1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc6 metalc ? ? H MG . MG ? ? ? 1_555 I TTP . O2B ? ? B MG 801 B TTP 802 1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc7 metalc ? ? C MG . MG ? ? ? 1_555 M HOH . O   ? ? A MG 801 A HOH 921 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc8 metalc ? ? H MG . MG ? ? ? 1_555 N HOH . O   ? ? B MG 801 B HOH 919 1_555 ? ? ? ? ? ? ? 2.224 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 402 A . ? THR 402 A PRO 403 A ? PRO 403 A 1 7.19  
2 THR 402 B . ? THR 402 B PRO 403 B ? PRO 403 B 1 11.50 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 7 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 3 ? 
I ? 2 ? 
J ? 3 ? 
K ? 7 ? 
L ? 2 ? 
M ? 2 ? 
N ? 2 ? 
O ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
K 5 6 ? parallel      
K 6 7 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
O 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 158 ? ILE A 159 ? LYS A 158 ILE A 159 
A 2 LYS A 162 ? VAL A 163 ? LYS A 162 VAL A 163 
B 1 PHE A 198 ? HIS A 200 ? PHE A 198 HIS A 200 
B 2 LEU A 446 ? ALA A 450 ? LEU A 446 ALA A 450 
B 3 GLY A 502 ? GLN A 506 ? GLY A 502 GLN A 506 
C 1 ALA A 442 ? CYS A 444 ? ALA A 442 CYS A 444 
C 2 CYS A 218 ? SER A 222 ? CYS A 218 SER A 222 
C 3 GLY A 247 ? ALA A 251 ? GLY A 247 ALA A 251 
C 4 PHE A 297 ? LEU A 301 ? PHE A 297 LEU A 301 
C 5 LEU A 328 ? ILE A 334 ? LEU A 328 ILE A 334 
C 6 TYR A 404 ? TYR A 407 ? TYR A 404 TYR A 407 
C 7 THR A 734 ? MET A 736 ? THR A 734 MET A 736 
D 1 TYR A 261 ? ILE A 262 ? TYR A 261 ILE A 262 
D 2 GLY A 267 ? ASN A 268 ? GLY A 267 ASN A 268 
E 1 ASP A 347 ? LEU A 350 ? ASP A 347 LEU A 350 
E 2 LYS A 382 ? LYS A 385 ? LYS A 382 LYS A 385 
F 1 ILE A 624 ? VAL A 629 ? ILE A 624 VAL A 629 
F 2 GLY A 632 ? VAL A 637 ? GLY A 632 VAL A 637 
G 1 ILE A 710 ? HIS A 711 ? ILE A 710 HIS A 711 
G 2 LEU A 739 ? ARG A 740 ? LEU A 739 ARG A 740 
H 1 GLN B 10  ? ARG B 12  ? GLN B 10  ARG B 12  
H 2 HIS B 2   ? ILE B 4   ? HIS B 2   ILE B 4   
H 3 VAL B 51  ? THR B 52  ? VAL B 51  THR B 52  
I 1 LYS B 158 ? ILE B 159 ? LYS B 158 ILE B 159 
I 2 LYS B 162 ? VAL B 163 ? LYS B 162 VAL B 163 
J 1 PHE B 198 ? HIS B 200 ? PHE B 198 HIS B 200 
J 2 LEU B 446 ? ALA B 450 ? LEU B 446 ALA B 450 
J 3 GLY B 502 ? GLN B 506 ? GLY B 502 GLN B 506 
K 1 ALA B 442 ? CYS B 444 ? ALA B 442 CYS B 444 
K 2 CYS B 218 ? SER B 222 ? CYS B 218 SER B 222 
K 3 GLY B 247 ? ALA B 251 ? GLY B 247 ALA B 251 
K 4 PHE B 297 ? LEU B 301 ? PHE B 297 LEU B 301 
K 5 PHE B 329 ? ILE B 334 ? PHE B 329 ILE B 334 
K 6 TYR B 404 ? TYR B 407 ? TYR B 404 TYR B 407 
K 7 THR B 734 ? MET B 736 ? THR B 734 MET B 736 
L 1 TYR B 261 ? ILE B 262 ? TYR B 261 ILE B 262 
L 2 GLY B 267 ? ASN B 268 ? GLY B 267 ASN B 268 
M 1 ASP B 347 ? LEU B 350 ? ASP B 347 LEU B 350 
M 2 LYS B 382 ? LYS B 385 ? LYS B 382 LYS B 385 
N 1 ILE B 624 ? ARG B 627 ? ILE B 624 ARG B 627 
N 2 PHE B 634 ? VAL B 637 ? PHE B 634 VAL B 637 
O 1 ILE B 710 ? HIS B 711 ? ILE B 710 HIS B 711 
O 2 LEU B 739 ? ARG B 740 ? LEU B 739 ARG B 740 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 159 ? N ILE A 159 O LYS A 162 ? O LYS A 162 
B 1 2 N THR A 199 ? N THR A 199 O SER A 448 ? O SER A 448 
B 2 3 N ALA A 447 ? N ALA A 447 O GLY A 504 ? O GLY A 504 
C 1 2 O ALA A 442 ? O ALA A 442 N LEU A 220 ? N LEU A 220 
C 2 3 N LEU A 221 ? N LEU A 221 O GLY A 249 ? O GLY A 249 
C 3 4 N ILE A 248 ? N ILE A 248 O ALA A 298 ? O ALA A 298 
C 4 5 N ILE A 299 ? N ILE A 299 O PHE A 329 ? O PHE A 329 
C 5 6 N ILE A 334 ? N ILE A 334 O LEU A 406 ? O LEU A 406 
C 6 7 N MET A 405 ? N MET A 405 O MET A 736 ? O MET A 736 
D 1 2 N ILE A 262 ? N ILE A 262 O GLY A 267 ? O GLY A 267 
E 1 2 N LEU A 350 ? N LEU A 350 O LYS A 382 ? O LYS A 382 
F 1 2 N TYR A 625 ? N TYR A 625 O ILE A 636 ? O ILE A 636 
G 1 2 N ILE A 710 ? N ILE A 710 O ARG A 740 ? O ARG A 740 
H 1 2 O GLU B 11  ? O GLU B 11  N VAL B 3   ? N VAL B 3   
H 2 3 N ILE B 4   ? N ILE B 4   O VAL B 51  ? O VAL B 51  
I 1 2 N ILE B 159 ? N ILE B 159 O LYS B 162 ? O LYS B 162 
J 1 2 N THR B 199 ? N THR B 199 O SER B 448 ? O SER B 448 
J 2 3 N ALA B 447 ? N ALA B 447 O GLY B 504 ? O GLY B 504 
K 1 2 O CYS B 444 ? O CYS B 444 N CYS B 218 ? N CYS B 218 
K 2 3 N LEU B 221 ? N LEU B 221 O GLY B 249 ? O GLY B 249 
K 3 4 N VAL B 250 ? N VAL B 250 O TYR B 300 ? O TYR B 300 
K 4 5 N ILE B 299 ? N ILE B 299 O PHE B 329 ? O PHE B 329 
K 5 6 N ILE B 334 ? N ILE B 334 O LEU B 406 ? O LEU B 406 
K 6 7 N MET B 405 ? N MET B 405 O MET B 736 ? O MET B 736 
L 1 2 N ILE B 262 ? N ILE B 262 O GLY B 267 ? O GLY B 267 
M 1 2 N LEU B 350 ? N LEU B 350 O LYS B 382 ? O LYS B 382 
N 1 2 N TYR B 625 ? N TYR B 625 O ILE B 636 ? O ILE B 636 
O 1 2 N ILE B 710 ? N ILE B 710 O ARG B 740 ? O ARG B 740 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 801'  
AC2 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE TTP A 802' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 804' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 805' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE SO4 A 809' 
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG B 801'  
AC7 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE TTP B 802' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 B 803' 
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 806' 
BC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 B 807' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2  TTP D .   ? TTP A 802 . ? 1_555 ? 
2  AC1 2  HOH M .   ? HOH A 921 . ? 1_555 ? 
3  AC2 19 ASP A 226 ? ASP A 226 . ? 1_555 ? 
4  AC2 19 SER A 227 ? SER A 227 . ? 1_555 ? 
5  AC2 19 ILE A 228 ? ILE A 228 . ? 1_555 ? 
6  AC2 19 ILE A 231 ? ILE A 231 . ? 1_555 ? 
7  AC2 19 ARG A 256 ? ARG A 256 . ? 1_555 ? 
8  AC2 19 ILE A 262 ? ILE A 262 . ? 1_555 ? 
9  AC2 19 ALA A 263 ? ALA A 263 . ? 1_555 ? 
10 AC2 19 GLY A 264 ? GLY A 264 . ? 1_555 ? 
11 AC2 19 SER A 269 ? SER A 269 . ? 1_555 ? 
12 AC2 19 ASN A 270 ? ASN A 270 . ? 1_555 ? 
13 AC2 19 HOH M .   ? HOH A 793 . ? 1_555 ? 
14 AC2 19 MG  C .   ? MG  A 801 . ? 1_555 ? 
15 AC2 19 HOH M .   ? HOH A 921 . ? 1_555 ? 
16 AC2 19 LYS B 243 ? LYS B 243 . ? 1_555 ? 
17 AC2 19 TYR B 285 ? TYR B 285 . ? 1_555 ? 
18 AC2 19 VAL B 286 ? VAL B 286 . ? 1_555 ? 
19 AC2 19 ASP B 287 ? ASP B 287 . ? 1_555 ? 
20 AC2 19 GLN B 288 ? GLN B 288 . ? 1_555 ? 
21 AC2 19 GLY B 289 ? GLY B 289 . ? 1_555 ? 
22 AC3 5  ILE A 136 ? ILE A 136 . ? 1_555 ? 
23 AC3 5  TYR A 137 ? TYR A 137 . ? 1_555 ? 
24 AC3 5  ASP A 138 ? ASP A 138 . ? 1_555 ? 
25 AC3 5  HOH M .   ? HOH A 982 . ? 1_555 ? 
26 AC3 5  LYS B 382 ? LYS B 382 . ? 4_555 ? 
27 AC4 3  SER A 687 ? SER A 687 . ? 1_555 ? 
28 AC4 3  GLN A 688 ? GLN A 688 . ? 1_555 ? 
29 AC4 3  LYS A 689 ? LYS A 689 . ? 1_555 ? 
30 AC5 9  ALA A 201 ? ALA A 201 . ? 1_555 ? 
31 AC5 9  SER A 202 ? SER A 202 . ? 1_555 ? 
32 AC5 9  THR A 604 ? THR A 604 . ? 1_555 ? 
33 AC5 9  SER A 606 ? SER A 606 . ? 1_555 ? 
34 AC5 9  THR A 607 ? THR A 607 . ? 1_555 ? 
35 AC5 9  HOH M .   ? HOH A 826 . ? 1_555 ? 
36 AC5 9  HOH M .   ? HOH A 860 . ? 1_555 ? 
37 AC5 9  HOH M .   ? HOH A 892 . ? 1_555 ? 
38 AC5 9  HOH M .   ? HOH A 919 . ? 1_555 ? 
39 AC6 2  TTP I .   ? TTP B 802 . ? 1_555 ? 
40 AC6 2  HOH N .   ? HOH B 919 . ? 1_555 ? 
41 AC7 20 LYS A 243 ? LYS A 243 . ? 1_555 ? 
42 AC7 20 TYR A 285 ? TYR A 285 . ? 1_555 ? 
43 AC7 20 VAL A 286 ? VAL A 286 . ? 1_555 ? 
44 AC7 20 ASP A 287 ? ASP A 287 . ? 1_555 ? 
45 AC7 20 GLN A 288 ? GLN A 288 . ? 1_555 ? 
46 AC7 20 ASP B 226 ? ASP B 226 . ? 1_555 ? 
47 AC7 20 SER B 227 ? SER B 227 . ? 1_555 ? 
48 AC7 20 ILE B 228 ? ILE B 228 . ? 1_555 ? 
49 AC7 20 ILE B 231 ? ILE B 231 . ? 1_555 ? 
50 AC7 20 ILE B 255 ? ILE B 255 . ? 1_555 ? 
51 AC7 20 ARG B 256 ? ARG B 256 . ? 1_555 ? 
52 AC7 20 ILE B 262 ? ILE B 262 . ? 1_555 ? 
53 AC7 20 ALA B 263 ? ALA B 263 . ? 1_555 ? 
54 AC7 20 GLY B 264 ? GLY B 264 . ? 1_555 ? 
55 AC7 20 SER B 269 ? SER B 269 . ? 1_555 ? 
56 AC7 20 ASN B 270 ? ASN B 270 . ? 1_555 ? 
57 AC7 20 HOH N .   ? HOH B 793 . ? 1_555 ? 
58 AC7 20 MG  H .   ? MG  B 801 . ? 1_555 ? 
59 AC7 20 HOH N .   ? HOH B 805 . ? 1_555 ? 
60 AC7 20 HOH N .   ? HOH B 919 . ? 1_555 ? 
61 AC8 6  SER B 687 ? SER B 687 . ? 1_555 ? 
62 AC8 6  GLN B 688 ? GLN B 688 . ? 1_555 ? 
63 AC8 6  LYS B 689 ? LYS B 689 . ? 1_555 ? 
64 AC8 6  HOH N .   ? HOH B 873 . ? 4_445 ? 
65 AC8 6  HOH N .   ? HOH B 968 . ? 1_555 ? 
66 AC8 6  HOH N .   ? HOH B 969 . ? 1_555 ? 
67 AC9 4  LYS B 5   ? LYS B 5   . ? 1_555 ? 
68 AC9 4  ARG B 6   ? ARG B 6   . ? 1_555 ? 
69 AC9 4  THR B 53  ? THR B 53  . ? 1_555 ? 
70 AC9 4  HOH N .   ? HOH B 970 . ? 1_555 ? 
71 BC1 7  SER B 202 ? SER B 202 . ? 1_555 ? 
72 BC1 7  PRO B 603 ? PRO B 603 . ? 1_555 ? 
73 BC1 7  THR B 604 ? THR B 604 . ? 1_555 ? 
74 BC1 7  ALA B 605 ? ALA B 605 . ? 1_555 ? 
75 BC1 7  SER B 606 ? SER B 606 . ? 1_555 ? 
76 BC1 7  THR B 607 ? THR B 607 . ? 1_555 ? 
77 BC1 7  HOH N .   ? HOH B 956 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3HNC 
_atom_sites.fract_transf_matrix[1][1]   0.014497 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008764 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004560 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . MET A 1 14  ? -18.508 58.304  11.937  1.00 81.13 ? 14  MET A N     1 
ATOM   2     C  CA    . MET A 1 14  ? -19.697 57.847  11.155  1.00 81.69 ? 14  MET A CA    1 
ATOM   3     C  C     . MET A 1 14  ? -19.347 57.693  9.664   1.00 79.33 ? 14  MET A C     1 
ATOM   4     O  O     . MET A 1 14  ? -18.624 56.773  9.275   1.00 77.88 ? 14  MET A O     1 
ATOM   5     C  CB    . MET A 1 14  ? -20.865 58.829  11.362  1.00 83.51 ? 14  MET A CB    1 
ATOM   6     C  CG    . MET A 1 14  ? -22.244 58.315  10.923  1.00 84.78 ? 14  MET A CG    1 
ATOM   7     S  SD    . MET A 1 14  ? -23.603 59.380  11.472  1.00 88.28 ? 14  MET A SD    1 
ATOM   8     C  CE    . MET A 1 14  ? -23.359 60.833  10.436  1.00 87.95 ? 14  MET A CE    1 
ATOM   9     N  N     . PHE A 1 15  ? -19.872 58.605  8.850   1.00 79.06 ? 15  PHE A N     1 
ATOM   10    C  CA    . PHE A 1 15  ? -19.594 58.705  7.423   1.00 77.05 ? 15  PHE A CA    1 
ATOM   11    C  C     . PHE A 1 15  ? -18.125 59.089  7.232   1.00 75.23 ? 15  PHE A C     1 
ATOM   12    O  O     . PHE A 1 15  ? -17.473 58.639  6.288   1.00 73.49 ? 15  PHE A O     1 
ATOM   13    C  CB    . PHE A 1 15  ? -20.506 59.795  6.837   1.00 77.91 ? 15  PHE A CB    1 
ATOM   14    C  CG    . PHE A 1 15  ? -20.556 59.834  5.334   1.00 76.83 ? 15  PHE A CG    1 
ATOM   15    C  CD1   . PHE A 1 15  ? -21.562 59.162  4.641   1.00 77.26 ? 15  PHE A CD1   1 
ATOM   16    C  CD2   . PHE A 1 15  ? -19.628 60.582  4.609   1.00 75.34 ? 15  PHE A CD2   1 
ATOM   17    C  CE1   . PHE A 1 15  ? -21.627 59.207  3.246   1.00 76.23 ? 15  PHE A CE1   1 
ATOM   18    C  CE2   . PHE A 1 15  ? -19.683 60.634  3.216   1.00 74.29 ? 15  PHE A CE2   1 
ATOM   19    C  CZ    . PHE A 1 15  ? -20.686 59.945  2.532   1.00 74.72 ? 15  PHE A CZ    1 
ATOM   20    N  N     . ASP A 1 16  ? -17.617 59.902  8.159   1.00 75.47 ? 16  ASP A N     1 
ATOM   21    C  CA    . ASP A 1 16  ? -16.257 60.433  8.108   1.00 73.76 ? 16  ASP A CA    1 
ATOM   22    C  C     . ASP A 1 16  ? -15.185 59.359  8.318   1.00 72.15 ? 16  ASP A C     1 
ATOM   23    O  O     . ASP A 1 16  ? -14.200 59.319  7.576   1.00 70.67 ? 16  ASP A O     1 
ATOM   24    C  CB    . ASP A 1 16  ? -16.096 61.573  9.118   1.00 74.97 ? 16  ASP A CB    1 
ATOM   25    N  N     . LYS A 1 17  ? -15.382 58.488  9.309   1.00 72.30 ? 17  LYS A N     1 
ATOM   26    C  CA    . LYS A 1 17  ? -14.416 57.420  9.606   1.00 70.88 ? 17  LYS A CA    1 
ATOM   27    C  C     . LYS A 1 17  ? -14.258 56.399  8.465   1.00 69.11 ? 17  LYS A C     1 
ATOM   28    O  O     . LYS A 1 17  ? -13.166 55.849  8.255   1.00 67.64 ? 17  LYS A O     1 
ATOM   29    C  CB    . LYS A 1 17  ? -14.769 56.718  10.915  1.00 72.10 ? 17  LYS A CB    1 
ATOM   30    N  N     . ILE A 1 18  ? -15.349 56.148  7.741   1.00 68.84 ? 18  ILE A N     1 
ATOM   31    C  CA    . ILE A 1 18  ? -15.331 55.229  6.603   1.00 66.95 ? 18  ILE A CA    1 
ATOM   32    C  C     . ILE A 1 18  ? -14.691 55.897  5.383   1.00 65.04 ? 18  ILE A C     1 
ATOM   33    O  O     . ILE A 1 18  ? -13.836 55.299  4.733   1.00 63.27 ? 18  ILE A O     1 
ATOM   34    C  CB    . ILE A 1 18  ? -16.754 54.681  6.263   1.00 67.96 ? 18  ILE A CB    1 
ATOM   35    C  CG1   . ILE A 1 18  ? -17.412 54.018  7.490   1.00 70.12 ? 18  ILE A CG1   1 
ATOM   36    C  CG2   . ILE A 1 18  ? -16.713 53.722  5.067   1.00 66.53 ? 18  ILE A CG2   1 
ATOM   37    C  CD1   . ILE A 1 18  ? -16.618 52.863  8.128   1.00 70.50 ? 18  ILE A CD1   1 
ATOM   38    N  N     . THR A 1 19  ? -15.090 57.138  5.096   1.00 65.10 ? 19  THR A N     1 
ATOM   39    C  CA    . THR A 1 19  ? -14.537 57.897  3.966   1.00 63.77 ? 19  THR A CA    1 
ATOM   40    C  C     . THR A 1 19  ? -13.019 58.078  4.072   1.00 62.47 ? 19  THR A C     1 
ATOM   41    O  O     . THR A 1 19  ? -12.298 57.867  3.093   1.00 61.05 ? 19  THR A O     1 
ATOM   42    C  CB    . THR A 1 19  ? -15.231 59.268  3.777   1.00 64.77 ? 19  THR A CB    1 
ATOM   43    O  OG1   . THR A 1 19  ? -16.652 59.088  3.761   1.00 65.64 ? 19  THR A OG1   1 
ATOM   44    C  CG2   . THR A 1 19  ? -14.806 59.916  2.461   1.00 63.45 ? 19  THR A CG2   1 
ATOM   45    N  N     . SER A 1 20  ? -12.547 58.444  5.263   1.00 62.87 ? 20  SER A N     1 
ATOM   46    C  CA    . SER A 1 20  ? -11.122 58.656  5.514   1.00 61.92 ? 20  SER A CA    1 
ATOM   47    C  C     . SER A 1 20  ? -10.326 57.374  5.336   1.00 60.57 ? 20  SER A C     1 
ATOM   48    O  O     . SER A 1 20  ? -9.192  57.401  4.843   1.00 59.63 ? 20  SER A O     1 
ATOM   49    C  CB    . SER A 1 20  ? -10.893 59.209  6.920   1.00 63.16 ? 20  SER A CB    1 
ATOM   50    O  OG    . SER A 1 20  ? -11.180 58.227  7.904   1.00 64.62 ? 20  SER A OG    1 
ATOM   51    N  N     . ARG A 1 21  ? -10.927 56.254  5.733   1.00 60.58 ? 21  ARG A N     1 
ATOM   52    C  CA    . ARG A 1 21  ? -10.275 54.953  5.633   1.00 59.50 ? 21  ARG A CA    1 
ATOM   53    C  C     . ARG A 1 21  ? -10.091 54.537  4.171   1.00 57.33 ? 21  ARG A C     1 
ATOM   54    O  O     . ARG A 1 21  ? -9.075  53.942  3.812   1.00 56.03 ? 21  ARG A O     1 
ATOM   55    C  CB    . ARG A 1 21  ? -11.064 53.896  6.401   1.00 60.81 ? 21  ARG A CB    1 
ATOM   56    C  CG    . ARG A 1 21  ? -10.192 53.064  7.313   1.00 63.02 ? 21  ARG A CG    1 
ATOM   57    C  CD    . ARG A 1 21  ? -10.644 51.614  7.377   1.00 66.43 ? 21  ARG A CD    1 
ATOM   58    N  NE    . ARG A 1 21  ? -9.721  50.827  8.195   1.00 68.46 ? 21  ARG A NE    1 
ATOM   59    C  CZ    . ARG A 1 21  ? -9.655  49.499  8.205   1.00 69.07 ? 21  ARG A CZ    1 
ATOM   60    N  NH1   . ARG A 1 21  ? -10.461 48.778  7.436   1.00 68.93 ? 21  ARG A NH1   1 
ATOM   61    N  NH2   . ARG A 1 21  ? -8.772  48.892  8.990   1.00 69.69 ? 21  ARG A NH2   1 
ATOM   62    N  N     . ILE A 1 22  ? -11.082 54.865  3.344   1.00 56.69 ? 22  ILE A N     1 
ATOM   63    C  CA    . ILE A 1 22  ? -11.025 54.654  1.898   1.00 54.65 ? 22  ILE A CA    1 
ATOM   64    C  C     . ILE A 1 22  ? -9.978  55.580  1.291   1.00 53.37 ? 22  ILE A C     1 
ATOM   65    O  O     . ILE A 1 22  ? -9.150  55.132  0.486   1.00 52.07 ? 22  ILE A O     1 
ATOM   66    C  CB    . ILE A 1 22  ? -12.404 54.940  1.219   1.00 55.33 ? 22  ILE A CB    1 
ATOM   67    C  CG1   . ILE A 1 22  ? -13.546 54.140  1.878   1.00 56.75 ? 22  ILE A CG1   1 
ATOM   68    C  CG2   . ILE A 1 22  ? -12.343 54.721  -0.304  1.00 53.52 ? 22  ILE A CG2   1 
ATOM   69    C  CD1   . ILE A 1 22  ? -13.257 52.654  2.104   1.00 56.58 ? 22  ILE A CD1   1 
ATOM   70    N  N     . GLN A 1 23  ? -10.027 56.858  1.696   1.00 53.41 ? 23  GLN A N     1 
ATOM   71    C  CA    . GLN A 1 23  ? -9.132  57.922  1.217   1.00 52.35 ? 23  GLN A CA    1 
ATOM   72    C  C     . GLN A 1 23  ? -7.663  57.563  1.408   1.00 51.00 ? 23  GLN A C     1 
ATOM   73    O  O     . GLN A 1 23  ? -6.842  57.875  0.546   1.00 50.03 ? 23  GLN A O     1 
ATOM   74    C  CB    . GLN A 1 23  ? -9.462  59.268  1.902   1.00 53.69 ? 23  GLN A CB    1 
ATOM   75    C  CG    . GLN A 1 23  ? -8.607  60.493  1.478   1.00 53.80 ? 23  GLN A CG    1 
ATOM   76    C  CD    . GLN A 1 23  ? -8.727  60.840  -0.013  1.00 54.95 ? 23  GLN A CD    1 
ATOM   77    O  OE1   . GLN A 1 23  ? -7.740  60.788  -0.763  1.00 54.15 ? 23  GLN A OE1   1 
ATOM   78    N  NE2   . GLN A 1 23  ? -9.938  61.182  -0.447  1.00 55.61 ? 23  GLN A NE2   1 
ATOM   79    N  N     . LYS A 1 24  ? -7.354  56.888  2.520   1.00 50.78 ? 24  LYS A N     1 
ATOM   80    C  CA    . LYS A 1 24  ? -5.983  56.468  2.852   1.00 49.83 ? 24  LYS A CA    1 
ATOM   81    C  C     . LYS A 1 24  ? -5.346  55.549  1.803   1.00 48.47 ? 24  LYS A C     1 
ATOM   82    O  O     . LYS A 1 24  ? -4.124  55.439  1.738   1.00 48.03 ? 24  LYS A O     1 
ATOM   83    C  CB    . LYS A 1 24  ? -5.930  55.823  4.245   1.00 50.50 ? 24  LYS A CB    1 
ATOM   84    N  N     . LEU A 1 25  ? -6.171  54.903  0.979   1.00 47.72 ? 25  LEU A N     1 
ATOM   85    C  CA    . LEU A 1 25  ? -5.669  54.027  -0.083  1.00 46.15 ? 25  LEU A CA    1 
ATOM   86    C  C     . LEU A 1 25  ? -5.844  54.616  -1.492  1.00 45.06 ? 25  LEU A C     1 
ATOM   87    O  O     . LEU A 1 25  ? -5.693  53.897  -2.493  1.00 43.96 ? 25  LEU A O     1 
ATOM   88    C  CB    . LEU A 1 25  ? -6.320  52.637  0.004   1.00 46.42 ? 25  LEU A CB    1 
ATOM   89    C  CG    . LEU A 1 25  ? -6.166  51.864  1.319   1.00 47.91 ? 25  LEU A CG    1 
ATOM   90    C  CD1   . LEU A 1 25  ? -7.239  50.793  1.437   1.00 49.18 ? 25  LEU A CD1   1 
ATOM   91    C  CD2   . LEU A 1 25  ? -4.766  51.265  1.466   1.00 47.92 ? 25  LEU A CD2   1 
ATOM   92    N  N     . CYS A 1 26  ? -6.146  55.916  -1.565  1.00 44.64 ? 26  CYS A N     1 
ATOM   93    C  CA    . CYS A 1 26  ? -6.322  56.602  -2.853  1.00 43.39 ? 26  CYS A CA    1 
ATOM   94    C  C     . CYS A 1 26  ? -5.070  57.301  -3.358  1.00 42.53 ? 26  CYS A C     1 
ATOM   95    O  O     . CYS A 1 26  ? -5.132  58.023  -4.351  1.00 42.57 ? 26  CYS A O     1 
ATOM   96    C  CB    . CYS A 1 26  ? -7.464  57.617  -2.793  1.00 44.18 ? 26  CYS A CB    1 
ATOM   97    S  SG    . CYS A 1 26  ? -9.075  56.904  -2.572  1.00 43.99 ? 26  CYS A SG    1 
ATOM   98    N  N     . TYR A 1 27  ? -3.939  57.104  -2.690  1.00 42.16 ? 27  TYR A N     1 
ATOM   99    C  CA    . TYR A 1 27  ? -2.729  57.837  -3.064  1.00 41.96 ? 27  TYR A CA    1 
ATOM   100   C  C     . TYR A 1 27  ? -2.451  57.626  -4.544  1.00 41.19 ? 27  TYR A C     1 
ATOM   101   O  O     . TYR A 1 27  ? -2.545  56.507  -5.040  1.00 40.60 ? 27  TYR A O     1 
ATOM   102   C  CB    . TYR A 1 27  ? -1.518  57.429  -2.210  1.00 41.68 ? 27  TYR A CB    1 
ATOM   103   C  CG    . TYR A 1 27  ? -1.346  55.937  -2.055  1.00 40.99 ? 27  TYR A CG    1 
ATOM   104   C  CD1   . TYR A 1 27  ? -0.711  55.184  -3.048  1.00 39.85 ? 27  TYR A CD1   1 
ATOM   105   C  CD2   . TYR A 1 27  ? -1.815  55.277  -0.914  1.00 40.15 ? 27  TYR A CD2   1 
ATOM   106   C  CE1   . TYR A 1 27  ? -0.557  53.805  -2.914  1.00 40.19 ? 27  TYR A CE1   1 
ATOM   107   C  CE2   . TYR A 1 27  ? -1.669  53.908  -0.764  1.00 39.88 ? 27  TYR A CE2   1 
ATOM   108   C  CZ    . TYR A 1 27  ? -1.040  53.171  -1.768  1.00 41.42 ? 27  TYR A CZ    1 
ATOM   109   O  OH    . TYR A 1 27  ? -0.886  51.802  -1.640  1.00 41.30 ? 27  TYR A OH    1 
ATOM   110   N  N     . GLY A 1 28  ? -2.164  58.707  -5.262  1.00 41.13 ? 28  GLY A N     1 
ATOM   111   C  CA    . GLY A 1 28  ? -1.771  58.585  -6.658  1.00 40.60 ? 28  GLY A CA    1 
ATOM   112   C  C     . GLY A 1 28  ? -2.907  58.417  -7.649  1.00 41.00 ? 28  GLY A C     1 
ATOM   113   O  O     . GLY A 1 28  ? -2.667  58.450  -8.856  1.00 40.62 ? 28  GLY A O     1 
ATOM   114   N  N     . LEU A 1 29  ? -4.140  58.251  -7.154  1.00 41.53 ? 29  LEU A N     1 
ATOM   115   C  CA    . LEU A 1 29  ? -5.299  58.035  -8.029  1.00 41.56 ? 29  LEU A CA    1 
ATOM   116   C  C     . LEU A 1 29  ? -5.949  59.332  -8.528  1.00 42.41 ? 29  LEU A C     1 
ATOM   117   O  O     . LEU A 1 29  ? -5.753  60.395  -7.946  1.00 43.29 ? 29  LEU A O     1 
ATOM   118   C  CB    . LEU A 1 29  ? -6.330  57.120  -7.342  1.00 41.73 ? 29  LEU A CB    1 
ATOM   119   C  CG    . LEU A 1 29  ? -5.832  55.763  -6.820  1.00 40.71 ? 29  LEU A CG    1 
ATOM   120   C  CD1   . LEU A 1 29  ? -6.961  54.960  -6.223  1.00 39.13 ? 29  LEU A CD1   1 
ATOM   121   C  CD2   . LEU A 1 29  ? -5.094  54.953  -7.897  1.00 38.85 ? 29  LEU A CD2   1 
ATOM   122   N  N     . ASN A 1 30  ? -6.732  59.244  -9.602  1.00 42.84 ? 30  ASN A N     1 
ATOM   123   C  CA    . ASN A 1 30  ? -7.377  60.430  -10.168 1.00 43.78 ? 30  ASN A CA    1 
ATOM   124   C  C     . ASN A 1 30  ? -8.604  60.864  -9.364  1.00 45.25 ? 30  ASN A C     1 
ATOM   125   O  O     . ASN A 1 30  ? -9.694  60.295  -9.494  1.00 45.57 ? 30  ASN A O     1 
ATOM   126   C  CB    . ASN A 1 30  ? -7.734  60.204  -11.637 1.00 43.42 ? 30  ASN A CB    1 
ATOM   127   C  CG    . ASN A 1 30  ? -7.913  61.501  -12.406 1.00 44.09 ? 30  ASN A CG    1 
ATOM   128   O  OD1   . ASN A 1 30  ? -8.230  62.547  -11.836 1.00 45.66 ? 30  ASN A OD1   1 
ATOM   129   N  ND2   . ASN A 1 30  ? -7.714  61.435  -13.716 1.00 44.17 ? 30  ASN A ND2   1 
ATOM   130   N  N     . MET A 1 31  ? -8.419  61.894  -8.544  1.00 46.45 ? 31  MET A N     1 
ATOM   131   C  CA    . MET A 1 31  ? -9.455  62.329  -7.608  1.00 47.98 ? 31  MET A CA    1 
ATOM   132   C  C     . MET A 1 31  ? -10.586 63.129  -8.261  1.00 49.17 ? 31  MET A C     1 
ATOM   133   O  O     . MET A 1 31  ? -11.620 63.371  -7.626  1.00 50.25 ? 31  MET A O     1 
ATOM   134   C  CB    . MET A 1 31  ? -8.845  63.075  -6.416  1.00 48.53 ? 31  MET A CB    1 
ATOM   135   C  CG    . MET A 1 31  ? -7.814  62.259  -5.604  1.00 48.65 ? 31  MET A CG    1 
ATOM   136   S  SD    . MET A 1 31  ? -8.264  60.529  -5.269  1.00 51.57 ? 31  MET A SD    1 
ATOM   137   C  CE    . MET A 1 31  ? -9.621  60.717  -4.117  1.00 50.90 ? 31  MET A CE    1 
ATOM   138   N  N     . ASP A 1 32  ? -10.402 63.515  -9.527  1.00 49.04 ? 32  ASP A N     1 
ATOM   139   C  CA    . ASP A 1 32  ? -11.479 64.124  -10.311 1.00 50.19 ? 32  ASP A CA    1 
ATOM   140   C  C     . ASP A 1 32  ? -12.633 63.140  -10.493 1.00 49.90 ? 32  ASP A C     1 
ATOM   141   O  O     . ASP A 1 32  ? -13.779 63.549  -10.674 1.00 50.79 ? 32  ASP A O     1 
ATOM   142   C  CB    . ASP A 1 32  ? -10.991 64.558  -11.701 1.00 50.36 ? 32  ASP A CB    1 
ATOM   143   C  CG    . ASP A 1 32  ? -10.046 65.755  -11.665 1.00 52.62 ? 32  ASP A CG    1 
ATOM   144   O  OD1   . ASP A 1 32  ? -10.017 66.487  -10.651 1.00 55.31 ? 32  ASP A OD1   1 
ATOM   145   O  OD2   . ASP A 1 32  ? -9.333  65.971  -12.675 1.00 54.09 ? 32  ASP A OD2   1 
ATOM   146   N  N     . PHE A 1 33  ? -12.313 61.847  -10.449 1.00 48.63 ? 33  PHE A N     1 
ATOM   147   C  CA    . PHE A 1 33  ? -13.257 60.791  -10.803 1.00 48.55 ? 33  PHE A CA    1 
ATOM   148   C  C     . PHE A 1 33  ? -13.430 59.718  -9.733  1.00 48.43 ? 33  PHE A C     1 
ATOM   149   O  O     . PHE A 1 33  ? -14.481 59.099  -9.669  1.00 49.05 ? 33  PHE A O     1 
ATOM   150   C  CB    . PHE A 1 33  ? -12.891 60.173  -12.165 1.00 47.55 ? 33  PHE A CB    1 
ATOM   151   C  CG    . PHE A 1 33  ? -12.778 61.192  -13.272 1.00 47.26 ? 33  PHE A CG    1 
ATOM   152   C  CD1   . PHE A 1 33  ? -11.532 61.574  -13.762 1.00 46.43 ? 33  PHE A CD1   1 
ATOM   153   C  CD2   . PHE A 1 33  ? -13.913 61.798  -13.792 1.00 47.51 ? 33  PHE A CD2   1 
ATOM   154   C  CE1   . PHE A 1 33  ? -11.420 62.530  -14.771 1.00 46.21 ? 33  PHE A CE1   1 
ATOM   155   C  CE2   . PHE A 1 33  ? -13.809 62.761  -14.786 1.00 49.06 ? 33  PHE A CE2   1 
ATOM   156   C  CZ    . PHE A 1 33  ? -12.551 63.126  -15.274 1.00 47.62 ? 33  PHE A CZ    1 
ATOM   157   N  N     . VAL A 1 34  ? -12.408 59.498  -8.904  1.00 47.81 ? 34  VAL A N     1 
ATOM   158   C  CA    . VAL A 1 34  ? -12.541 58.625  -7.730  1.00 47.88 ? 34  VAL A CA    1 
ATOM   159   C  C     . VAL A 1 34  ? -13.088 59.447  -6.562  1.00 49.10 ? 34  VAL A C     1 
ATOM   160   O  O     . VAL A 1 34  ? -12.472 60.425  -6.144  1.00 49.43 ? 34  VAL A O     1 
ATOM   161   C  CB    . VAL A 1 34  ? -11.195 57.960  -7.335  1.00 46.77 ? 34  VAL A CB    1 
ATOM   162   C  CG1   . VAL A 1 34  ? -11.359 57.089  -6.108  1.00 46.72 ? 34  VAL A CG1   1 
ATOM   163   C  CG2   . VAL A 1 34  ? -10.633 57.129  -8.490  1.00 45.89 ? 34  VAL A CG2   1 
ATOM   164   N  N     . ASP A 1 35  ? -14.248 59.054  -6.046  1.00 50.08 ? 35  ASP A N     1 
ATOM   165   C  CA    . ASP A 1 35  ? -14.909 59.786  -4.954  1.00 51.52 ? 35  ASP A CA    1 
ATOM   166   C  C     . ASP A 1 35  ? -15.235 58.815  -3.807  1.00 51.82 ? 35  ASP A C     1 
ATOM   167   O  O     . ASP A 1 35  ? -16.209 58.078  -3.882  1.00 52.23 ? 35  ASP A O     1 
ATOM   168   C  CB    . ASP A 1 35  ? -16.164 60.507  -5.489  1.00 52.39 ? 35  ASP A CB    1 
ATOM   169   C  CG    . ASP A 1 35  ? -16.868 61.377  -4.438  1.00 54.77 ? 35  ASP A CG    1 
ATOM   170   O  OD1   . ASP A 1 35  ? -18.011 61.819  -4.715  1.00 55.81 ? 35  ASP A OD1   1 
ATOM   171   O  OD2   . ASP A 1 35  ? -16.299 61.637  -3.350  1.00 55.18 ? 35  ASP A OD2   1 
ATOM   172   N  N     . PRO A 1 36  ? -14.400 58.801  -2.748  1.00 51.95 ? 36  PRO A N     1 
ATOM   173   C  CA    . PRO A 1 36  ? -14.547 57.861  -1.624  1.00 52.49 ? 36  PRO A CA    1 
ATOM   174   C  C     . PRO A 1 36  ? -15.903 57.894  -0.904  1.00 54.59 ? 36  PRO A C     1 
ATOM   175   O  O     . PRO A 1 36  ? -16.339 56.866  -0.370  1.00 54.89 ? 36  PRO A O     1 
ATOM   176   C  CB    . PRO A 1 36  ? -13.422 58.280  -0.676  1.00 52.03 ? 36  PRO A CB    1 
ATOM   177   C  CG    . PRO A 1 36  ? -12.409 58.893  -1.570  1.00 50.98 ? 36  PRO A CG    1 
ATOM   178   C  CD    . PRO A 1 36  ? -13.224 59.669  -2.557  1.00 51.49 ? 36  PRO A CD    1 
ATOM   179   N  N     . ALA A 1 37  ? -16.560 59.052  -0.898  1.00 55.89 ? 37  ALA A N     1 
ATOM   180   C  CA    . ALA A 1 37  ? -17.888 59.181  -0.309  1.00 58.26 ? 37  ALA A CA    1 
ATOM   181   C  C     . ALA A 1 37  ? -18.929 58.345  -1.064  1.00 59.02 ? 37  ALA A C     1 
ATOM   182   O  O     . ALA A 1 37  ? -19.912 57.897  -0.467  1.00 60.32 ? 37  ALA A O     1 
ATOM   183   C  CB    . ALA A 1 37  ? -18.311 60.652  -0.245  1.00 59.26 ? 37  ALA A CB    1 
ATOM   184   N  N     . GLN A 1 38  ? -18.701 58.144  -2.366  1.00 58.52 ? 38  GLN A N     1 
ATOM   185   C  CA    . GLN A 1 38  ? -19.558 57.308  -3.221  1.00 59.24 ? 38  GLN A CA    1 
ATOM   186   C  C     . GLN A 1 38  ? -19.551 55.848  -2.755  1.00 59.06 ? 38  GLN A C     1 
ATOM   187   O  O     . GLN A 1 38  ? -20.568 55.149  -2.830  1.00 59.67 ? 38  GLN A O     1 
ATOM   188   C  CB    . GLN A 1 38  ? -19.084 57.362  -4.680  1.00 58.26 ? 38  GLN A CB    1 
ATOM   189   C  CG    . GLN A 1 38  ? -19.199 58.726  -5.350  1.00 60.17 ? 38  GLN A CG    1 
ATOM   190   C  CD    . GLN A 1 38  ? -20.514 58.917  -6.086  1.00 63.24 ? 38  GLN A CD    1 
ATOM   191   O  OE1   . GLN A 1 38  ? -21.364 59.701  -5.660  1.00 65.14 ? 38  GLN A OE1   1 
ATOM   192   N  NE2   . GLN A 1 38  ? -20.690 58.194  -7.195  1.00 62.74 ? 38  GLN A NE2   1 
ATOM   193   N  N     . ILE A 1 39  ? -18.386 55.396  -2.297  1.00 57.91 ? 39  ILE A N     1 
ATOM   194   C  CA    . ILE A 1 39  ? -18.237 54.069  -1.722  1.00 57.73 ? 39  ILE A CA    1 
ATOM   195   C  C     . ILE A 1 39  ? -18.883 54.016  -0.328  1.00 59.64 ? 39  ILE A C     1 
ATOM   196   O  O     . ILE A 1 39  ? -19.581 53.055  0.001   1.00 59.94 ? 39  ILE A O     1 
ATOM   197   C  CB    . ILE A 1 39  ? -16.749 53.661  -1.687  1.00 56.04 ? 39  ILE A CB    1 
ATOM   198   C  CG1   . ILE A 1 39  ? -16.238 53.453  -3.114  1.00 54.65 ? 39  ILE A CG1   1 
ATOM   199   C  CG2   . ILE A 1 39  ? -16.535 52.404  -0.865  1.00 55.62 ? 39  ILE A CG2   1 
ATOM   200   C  CD1   . ILE A 1 39  ? -14.796 53.846  -3.309  1.00 53.70 ? 39  ILE A CD1   1 
ATOM   201   N  N     . THR A 1 40  ? -18.670 55.070  0.461   1.00 60.80 ? 40  THR A N     1 
ATOM   202   C  CA    . THR A 1 40  ? -19.154 55.142  1.836   1.00 62.95 ? 40  THR A CA    1 
ATOM   203   C  C     . THR A 1 40  ? -20.671 54.993  1.931   1.00 65.33 ? 40  THR A C     1 
ATOM   204   O  O     . THR A 1 40  ? -21.165 54.308  2.825   1.00 66.10 ? 40  THR A O     1 
ATOM   205   C  CB    . THR A 1 40  ? -18.705 56.441  2.516   1.00 63.30 ? 40  THR A CB    1 
ATOM   206   O  OG1   . THR A 1 40  ? -17.277 56.530  2.468   1.00 61.77 ? 40  THR A OG1   1 
ATOM   207   C  CG2   . THR A 1 40  ? -19.147 56.478  3.973   1.00 65.28 ? 40  THR A CG2   1 
ATOM   208   N  N     . MET A 1 41  ? -21.391 55.620  1.001   1.00 66.69 ? 41  MET A N     1 
ATOM   209   C  CA    . MET A 1 41  ? -22.853 55.513  0.911   1.00 69.54 ? 41  MET A CA    1 
ATOM   210   C  C     . MET A 1 41  ? -23.360 54.070  0.868   1.00 69.40 ? 41  MET A C     1 
ATOM   211   O  O     . MET A 1 41  ? -24.400 53.751  1.452   1.00 71.00 ? 41  MET A O     1 
ATOM   212   C  CB    . MET A 1 41  ? -23.367 56.246  -0.327  1.00 69.57 ? 41  MET A CB    1 
ATOM   213   C  CG    . MET A 1 41  ? -23.431 57.755  -0.203  1.00 71.28 ? 41  MET A CG    1 
ATOM   214   S  SD    . MET A 1 41  ? -23.452 58.520  -1.841  1.00 71.97 ? 41  MET A SD    1 
ATOM   215   C  CE    . MET A 1 41  ? -25.107 58.101  -2.423  1.00 74.09 ? 41  MET A CE    1 
ATOM   216   N  N     . LYS A 1 42  ? -22.633 53.209  0.161   1.00 67.91 ? 42  LYS A N     1 
ATOM   217   C  CA    . LYS A 1 42  ? -23.012 51.806  0.042   1.00 67.93 ? 42  LYS A CA    1 
ATOM   218   C  C     . LYS A 1 42  ? -22.589 51.003  1.279   1.00 68.19 ? 42  LYS A C     1 
ATOM   219   O  O     . LYS A 1 42  ? -23.314 50.108  1.723   1.00 69.10 ? 42  LYS A O     1 
ATOM   220   C  CB    . LYS A 1 42  ? -22.438 51.210  -1.226  1.00 66.11 ? 42  LYS A CB    1 
ATOM   221   N  N     . VAL A 1 43  ? -21.424 51.344  1.829   1.00 67.49 ? 43  VAL A N     1 
ATOM   222   C  CA    . VAL A 1 43  ? -20.891 50.721  3.046   1.00 67.91 ? 43  VAL A CA    1 
ATOM   223   C  C     . VAL A 1 43  ? -21.734 51.081  4.277   1.00 70.32 ? 43  VAL A C     1 
ATOM   224   O  O     . VAL A 1 43  ? -22.053 50.214  5.093   1.00 71.37 ? 43  VAL A O     1 
ATOM   225   C  CB    . VAL A 1 43  ? -19.404 51.127  3.290   1.00 66.57 ? 43  VAL A CB    1 
ATOM   226   C  CG1   . VAL A 1 43  ? -18.911 50.669  4.662   1.00 66.87 ? 43  VAL A CG1   1 
ATOM   227   C  CG2   . VAL A 1 43  ? -18.507 50.579  2.193   1.00 64.31 ? 43  VAL A CG2   1 
ATOM   228   N  N     . ILE A 1 44  ? -22.086 52.360  4.394   1.00 71.33 ? 44  ILE A N     1 
ATOM   229   C  CA    . ILE A 1 44  ? -22.871 52.877  5.511   1.00 73.45 ? 44  ILE A CA    1 
ATOM   230   C  C     . ILE A 1 44  ? -24.112 52.032  5.796   1.00 75.35 ? 44  ILE A C     1 
ATOM   231   O  O     . ILE A 1 44  ? -24.450 51.804  6.959   1.00 76.59 ? 44  ILE A O     1 
ATOM   232   C  CB    . ILE A 1 44  ? -23.227 54.384  5.284   1.00 74.15 ? 44  ILE A CB    1 
ATOM   233   C  CG1   . ILE A 1 44  ? -22.209 55.299  5.985   1.00 74.11 ? 44  ILE A CG1   1 
ATOM   234   C  CG2   . ILE A 1 44  ? -24.674 54.721  5.678   1.00 76.16 ? 44  ILE A CG2   1 
ATOM   235   C  CD1   . ILE A 1 44  ? -22.169 55.208  7.517   1.00 75.93 ? 44  ILE A CD1   1 
ATOM   236   N  N     . GLN A 1 45  ? -24.762 51.547  4.737   1.00 75.61 ? 45  GLN A N     1 
ATOM   237   C  CA    . GLN A 1 45  ? -26.003 50.772  4.873   1.00 77.71 ? 45  GLN A CA    1 
ATOM   238   C  C     . GLN A 1 45  ? -25.784 49.271  5.135   1.00 77.53 ? 45  GLN A C     1 
ATOM   239   O  O     . GLN A 1 45  ? -26.744 48.502  5.233   1.00 78.70 ? 45  GLN A O     1 
ATOM   240   C  CB    . GLN A 1 45  ? -26.948 51.020  3.685   1.00 78.03 ? 45  GLN A CB    1 
ATOM   241   C  CG    . GLN A 1 45  ? -26.333 50.814  2.313   1.00 76.70 ? 45  GLN A CG    1 
ATOM   242   C  CD    . GLN A 1 45  ? -27.102 51.521  1.212   1.00 77.85 ? 45  GLN A CD    1 
ATOM   243   O  OE1   . GLN A 1 45  ? -27.662 50.881  0.318   1.00 78.29 ? 45  GLN A OE1   1 
ATOM   244   N  NE2   . GLN A 1 45  ? -27.136 52.848  1.273   1.00 78.22 ? 45  GLN A NE2   1 
ATOM   245   N  N     . GLY A 1 46  ? -24.516 48.873  5.253   1.00 76.32 ? 46  GLY A N     1 
ATOM   246   C  CA    . GLY A 1 46  ? -24.146 47.520  5.678   1.00 76.20 ? 46  GLY A CA    1 
ATOM   247   C  C     . GLY A 1 46  ? -23.762 47.451  7.153   1.00 77.13 ? 46  GLY A C     1 
ATOM   248   O  O     . GLY A 1 46  ? -23.209 46.450  7.612   1.00 76.90 ? 46  GLY A O     1 
ATOM   249   N  N     . LEU A 1 47  ? -24.055 48.518  7.891   1.00 78.15 ? 47  LEU A N     1 
ATOM   250   C  CA    . LEU A 1 47  ? -23.731 48.595  9.312   1.00 79.33 ? 47  LEU A CA    1 
ATOM   251   C  C     . LEU A 1 47  ? -24.736 47.861  10.200  1.00 81.27 ? 47  LEU A C     1 
ATOM   252   O  O     . LEU A 1 47  ? -25.936 47.822  9.909   1.00 82.55 ? 47  LEU A O     1 
ATOM   253   C  CB    . LEU A 1 47  ? -23.638 50.060  9.774   1.00 80.04 ? 47  LEU A CB    1 
ATOM   254   C  CG    . LEU A 1 47  ? -22.347 50.884  9.647   1.00 78.71 ? 47  LEU A CG    1 
ATOM   255   C  CD1   . LEU A 1 47  ? -22.585 52.297  10.190  1.00 80.05 ? 47  LEU A CD1   1 
ATOM   256   C  CD2   . LEU A 1 47  ? -21.168 50.237  10.366  1.00 77.61 ? 47  LEU A CD2   1 
ATOM   257   N  N     . TYR A 1 48  ? -24.224 47.286  11.287  1.00 81.61 ? 48  TYR A N     1 
ATOM   258   C  CA    . TYR A 1 48  ? -25.050 46.781  12.387  1.00 83.68 ? 48  TYR A CA    1 
ATOM   259   C  C     . TYR A 1 48  ? -24.224 46.544  13.653  1.00 83.94 ? 48  TYR A C     1 
ATOM   260   O  O     . TYR A 1 48  ? -22.989 46.483  13.590  1.00 82.28 ? 48  TYR A O     1 
ATOM   261   C  CB    . TYR A 1 48  ? -25.818 45.515  11.988  1.00 84.16 ? 48  TYR A CB    1 
ATOM   262   C  CG    . TYR A 1 48  ? -24.983 44.354  11.492  1.00 82.08 ? 48  TYR A CG    1 
ATOM   263   C  CD1   . TYR A 1 48  ? -24.727 44.187  10.133  1.00 80.61 ? 48  TYR A CD1   1 
ATOM   264   C  CD2   . TYR A 1 48  ? -24.487 43.398  12.378  1.00 82.06 ? 48  TYR A CD2   1 
ATOM   265   C  CE1   . TYR A 1 48  ? -23.971 43.105  9.666   1.00 79.33 ? 48  TYR A CE1   1 
ATOM   266   C  CE2   . TYR A 1 48  ? -23.734 42.311  11.926  1.00 80.94 ? 48  TYR A CE2   1 
ATOM   267   C  CZ    . TYR A 1 48  ? -23.480 42.171  10.570  1.00 79.75 ? 48  TYR A CZ    1 
ATOM   268   O  OH    . TYR A 1 48  ? -22.736 41.099  10.116  1.00 78.78 ? 48  TYR A OH    1 
ATOM   269   N  N     . SER A 1 49  ? -24.907 46.430  14.795  1.00 85.93 ? 49  SER A N     1 
ATOM   270   C  CA    . SER A 1 49  ? -24.245 46.076  16.049  1.00 86.45 ? 49  SER A CA    1 
ATOM   271   C  C     . SER A 1 49  ? -23.646 44.681  15.905  1.00 85.57 ? 49  SER A C     1 
ATOM   272   O  O     . SER A 1 49  ? -24.368 43.691  15.742  1.00 85.94 ? 49  SER A O     1 
ATOM   273   C  CB    . SER A 1 49  ? -25.209 46.143  17.234  1.00 89.07 ? 49  SER A CB    1 
ATOM   274   O  OG    . SER A 1 49  ? -25.643 47.470  17.466  1.00 89.90 ? 49  SER A OG    1 
ATOM   275   N  N     . GLY A 1 50  ? -22.316 44.628  15.925  1.00 84.18 ? 50  GLY A N     1 
ATOM   276   C  CA    . GLY A 1 50  ? -21.577 43.387  15.713  1.00 83.42 ? 50  GLY A CA    1 
ATOM   277   C  C     . GLY A 1 50  ? -20.894 43.271  14.358  1.00 81.36 ? 50  GLY A C     1 
ATOM   278   O  O     . GLY A 1 50  ? -20.412 42.194  14.001  1.00 80.52 ? 50  GLY A O     1 
ATOM   279   N  N     . VAL A 1 51  ? -20.849 44.364  13.596  1.00 80.72 ? 51  VAL A N     1 
ATOM   280   C  CA    . VAL A 1 51  ? -20.158 44.342  12.304  1.00 78.81 ? 51  VAL A CA    1 
ATOM   281   C  C     . VAL A 1 51  ? -18.670 44.666  12.464  1.00 77.61 ? 51  VAL A C     1 
ATOM   282   O  O     . VAL A 1 51  ? -18.298 45.660  13.098  1.00 77.94 ? 51  VAL A O     1 
ATOM   283   C  CB    . VAL A 1 51  ? -20.838 45.244  11.228  1.00 78.48 ? 51  VAL A CB    1 
ATOM   284   C  CG1   . VAL A 1 51  ? -20.445 46.711  11.392  1.00 78.19 ? 51  VAL A CG1   1 
ATOM   285   C  CG2   . VAL A 1 51  ? -20.507 44.741  9.816   1.00 76.59 ? 51  VAL A CG2   1 
ATOM   286   N  N     . THR A 1 52  ? -17.831 43.804  11.897  1.00 76.33 ? 52  THR A N     1 
ATOM   287   C  CA    . THR A 1 52  ? -16.385 43.989  11.938  1.00 75.20 ? 52  THR A CA    1 
ATOM   288   C  C     . THR A 1 52  ? -15.940 44.839  10.746  1.00 73.91 ? 52  THR A C     1 
ATOM   289   O  O     . THR A 1 52  ? -16.552 44.772  9.671   1.00 73.45 ? 52  THR A O     1 
ATOM   290   C  CB    . THR A 1 52  ? -15.628 42.631  11.937  1.00 74.47 ? 52  THR A CB    1 
ATOM   291   O  OG1   . THR A 1 52  ? -15.920 41.908  10.734  1.00 72.94 ? 52  THR A OG1   1 
ATOM   292   C  CG2   . THR A 1 52  ? -16.011 41.783  13.152  1.00 75.67 ? 52  THR A CG2   1 
ATOM   293   N  N     . THR A 1 53  ? -14.878 45.627  10.937  1.00 73.37 ? 53  THR A N     1 
ATOM   294   C  CA    . THR A 1 53  ? -14.347 46.493  9.867   1.00 71.97 ? 53  THR A CA    1 
ATOM   295   C  C     . THR A 1 53  ? -13.849 45.689  8.656   1.00 70.39 ? 53  THR A C     1 
ATOM   296   O  O     . THR A 1 53  ? -13.858 46.199  7.531   1.00 69.67 ? 53  THR A O     1 
ATOM   297   C  CB    . THR A 1 53  ? -13.234 47.483  10.358  1.00 71.61 ? 53  THR A CB    1 
ATOM   298   O  OG1   . THR A 1 53  ? -11.979 46.802  10.472  1.00 70.58 ? 53  THR A OG1   1 
ATOM   299   C  CG2   . THR A 1 53  ? -13.600 48.143  11.697  1.00 73.12 ? 53  THR A CG2   1 
ATOM   300   N  N     . VAL A 1 54  ? -13.430 44.443  8.895   1.00 70.02 ? 54  VAL A N     1 
ATOM   301   C  CA    . VAL A 1 54  ? -13.015 43.519  7.824   1.00 68.55 ? 54  VAL A CA    1 
ATOM   302   C  C     . VAL A 1 54  ? -14.178 43.160  6.880   1.00 68.61 ? 54  VAL A C     1 
ATOM   303   O  O     . VAL A 1 54  ? -13.978 43.015  5.668   1.00 67.47 ? 54  VAL A O     1 
ATOM   304   C  CB    . VAL A 1 54  ? -12.287 42.240  8.385   1.00 68.50 ? 54  VAL A CB    1 
ATOM   305   C  CG1   . VAL A 1 54  ? -13.053 41.610  9.548   1.00 70.25 ? 54  VAL A CG1   1 
ATOM   306   C  CG2   . VAL A 1 54  ? -12.019 41.204  7.284   1.00 67.18 ? 54  VAL A CG2   1 
ATOM   307   N  N     . GLU A 1 55  ? -15.381 43.022  7.439   1.00 69.99 ? 55  GLU A N     1 
ATOM   308   C  CA    . GLU A 1 55  ? -16.590 42.765  6.647   1.00 70.36 ? 55  GLU A CA    1 
ATOM   309   C  C     . GLU A 1 55  ? -16.963 44.002  5.829   1.00 69.53 ? 55  GLU A C     1 
ATOM   310   O  O     . GLU A 1 55  ? -17.355 43.897  4.665   1.00 68.65 ? 55  GLU A O     1 
ATOM   311   C  CB    . GLU A 1 55  ? -17.765 42.368  7.551   1.00 72.37 ? 55  GLU A CB    1 
ATOM   312   C  CG    . GLU A 1 55  ? -17.683 40.955  8.131   1.00 73.22 ? 55  GLU A CG    1 
ATOM   313   C  CD    . GLU A 1 55  ? -18.733 40.685  9.215   1.00 75.60 ? 55  GLU A CD    1 
ATOM   314   O  OE1   . GLU A 1 55  ? -19.237 41.648  9.854   1.00 77.15 ? 55  GLU A OE1   1 
ATOM   315   O  OE2   . GLU A 1 55  ? -19.050 39.492  9.429   1.00 77.24 ? 55  GLU A OE2   1 
ATOM   316   N  N     . LEU A 1 56  ? -16.839 45.168  6.459   1.00 69.59 ? 56  LEU A N     1 
ATOM   317   C  CA    . LEU A 1 56  ? -17.063 46.446  5.798   1.00 69.04 ? 56  LEU A CA    1 
ATOM   318   C  C     . LEU A 1 56  ? -16.002 46.696  4.727   1.00 67.12 ? 56  LEU A C     1 
ATOM   319   O  O     . LEU A 1 56  ? -16.253 47.395  3.743   1.00 66.79 ? 56  LEU A O     1 
ATOM   320   C  CB    . LEU A 1 56  ? -17.066 47.588  6.818   1.00 70.01 ? 56  LEU A CB    1 
ATOM   321   C  CG    . LEU A 1 56  ? -18.127 47.566  7.925   1.00 72.29 ? 56  LEU A CG    1 
ATOM   322   C  CD1   . LEU A 1 56  ? -17.848 48.665  8.946   1.00 73.45 ? 56  LEU A CD1   1 
ATOM   323   C  CD2   . LEU A 1 56  ? -19.551 47.694  7.369   1.00 73.44 ? 56  LEU A CD2   1 
ATOM   324   N  N     . ASP A 1 57  ? -14.823 46.110  4.915   1.00 65.70 ? 57  ASP A N     1 
ATOM   325   C  CA    . ASP A 1 57  ? -13.754 46.231  3.937   1.00 63.62 ? 57  ASP A CA    1 
ATOM   326   C  C     . ASP A 1 57  ? -14.036 45.510  2.630   1.00 61.98 ? 57  ASP A C     1 
ATOM   327   O  O     . ASP A 1 57  ? -13.665 46.010  1.573   1.00 61.10 ? 57  ASP A O     1 
ATOM   328   C  CB    . ASP A 1 57  ? -12.416 45.787  4.520   1.00 63.34 ? 57  ASP A CB    1 
ATOM   329   C  CG    . ASP A 1 57  ? -11.765 46.863  5.376   1.00 65.20 ? 57  ASP A CG    1 
ATOM   330   O  OD1   . ASP A 1 57  ? -12.265 48.018  5.399   1.00 66.21 ? 57  ASP A OD1   1 
ATOM   331   O  OD2   . ASP A 1 57  ? -10.747 46.551  6.034   1.00 66.89 ? 57  ASP A OD2   1 
ATOM   332   N  N     . THR A 1 58  ? -14.677 44.342  2.683   1.00 61.37 ? 58  THR A N     1 
ATOM   333   C  CA    . THR A 1 58  ? -15.038 43.661  1.432   1.00 59.74 ? 58  THR A CA    1 
ATOM   334   C  C     . THR A 1 58  ? -16.179 44.419  0.755   1.00 59.33 ? 58  THR A C     1 
ATOM   335   O  O     . THR A 1 58  ? -16.200 44.560  -0.470  1.00 58.63 ? 58  THR A O     1 
ATOM   336   C  CB    . THR A 1 58  ? -15.395 42.155  1.605   1.00 60.06 ? 58  THR A CB    1 
ATOM   337   O  OG1   . THR A 1 58  ? -16.373 42.005  2.633   1.00 61.73 ? 58  THR A OG1   1 
ATOM   338   C  CG2   . THR A 1 58  ? -14.160 41.333  1.963   1.00 59.82 ? 58  THR A CG2   1 
ATOM   339   N  N     . LEU A 1 59  ? -17.107 44.929  1.562   1.00 59.50 ? 59  LEU A N     1 
ATOM   340   C  CA    . LEU A 1 59  ? -18.218 45.725  1.050   1.00 58.90 ? 59  LEU A CA    1 
ATOM   341   C  C     . LEU A 1 59  ? -17.680 46.952  0.310   1.00 57.16 ? 59  LEU A C     1 
ATOM   342   O  O     . LEU A 1 59  ? -18.185 47.312  -0.757  1.00 57.00 ? 59  LEU A O     1 
ATOM   343   C  CB    . LEU A 1 59  ? -19.151 46.156  2.183   1.00 60.40 ? 59  LEU A CB    1 
ATOM   344   C  CG    . LEU A 1 59  ? -20.668 46.032  1.992   1.00 61.73 ? 59  LEU A CG    1 
ATOM   345   C  CD1   . LEU A 1 59  ? -21.382 46.683  3.159   1.00 63.12 ? 59  LEU A CD1   1 
ATOM   346   C  CD2   . LEU A 1 59  ? -21.182 46.609  0.669   1.00 60.81 ? 59  LEU A CD2   1 
ATOM   347   N  N     . ALA A 1 60  ? -16.654 47.578  0.885   1.00 55.22 ? 60  ALA A N     1 
ATOM   348   C  CA    . ALA A 1 60  ? -15.981 48.714  0.263   1.00 53.15 ? 60  ALA A CA    1 
ATOM   349   C  C     . ALA A 1 60  ? -15.215 48.337  -1.019  1.00 50.77 ? 60  ALA A C     1 
ATOM   350   O  O     . ALA A 1 60  ? -15.266 49.071  -1.999  1.00 50.30 ? 60  ALA A O     1 
ATOM   351   C  CB    . ALA A 1 60  ? -15.067 49.409  1.263   1.00 52.89 ? 60  ALA A CB    1 
ATOM   352   N  N     . ALA A 1 61  ? -14.526 47.199  -1.014  1.00 48.90 ? 61  ALA A N     1 
ATOM   353   C  CA    . ALA A 1 61  ? -13.808 46.735  -2.205  1.00 47.03 ? 61  ALA A CA    1 
ATOM   354   C  C     . ALA A 1 61  ? -14.750 46.325  -3.341  1.00 46.67 ? 61  ALA A C     1 
ATOM   355   O  O     . ALA A 1 61  ? -14.445 46.551  -4.507  1.00 45.66 ? 61  ALA A O     1 
ATOM   356   C  CB    . ALA A 1 61  ? -12.841 45.595  -1.857  1.00 45.99 ? 61  ALA A CB    1 
ATOM   357   N  N     . GLU A 1 62  ? -15.895 45.741  -2.987  1.00 47.43 ? 62  GLU A N     1 
ATOM   358   C  CA    . GLU A 1 62  ? -16.890 45.298  -3.957  1.00 47.69 ? 62  GLU A CA    1 
ATOM   359   C  C     . GLU A 1 62  ? -17.589 46.476  -4.604  1.00 47.01 ? 62  GLU A C     1 
ATOM   360   O  O     . GLU A 1 62  ? -17.822 46.482  -5.810  1.00 46.49 ? 62  GLU A O     1 
ATOM   361   C  CB    . GLU A 1 62  ? -17.935 44.394  -3.293  1.00 48.65 ? 62  GLU A CB    1 
ATOM   362   C  CG    . GLU A 1 62  ? -17.481 42.965  -3.116  1.00 49.70 ? 62  GLU A CG    1 
ATOM   363   C  CD    . GLU A 1 62  ? -18.524 42.062  -2.463  1.00 52.26 ? 62  GLU A CD    1 
ATOM   364   O  OE1   . GLU A 1 62  ? -19.453 42.566  -1.752  1.00 55.20 ? 62  GLU A OE1   1 
ATOM   365   O  OE2   . GLU A 1 62  ? -18.394 40.823  -2.669  1.00 55.48 ? 62  GLU A OE2   1 
ATOM   366   N  N     . THR A 1 63  ? -17.936 47.458  -3.779  1.00 47.19 ? 63  THR A N     1 
ATOM   367   C  CA    . THR A 1 63  ? -18.595 48.668  -4.232  1.00 46.71 ? 63  THR A CA    1 
ATOM   368   C  C     . THR A 1 63  ? -17.653 49.436  -5.139  1.00 45.02 ? 63  THR A C     1 
ATOM   369   O  O     . THR A 1 63  ? -18.043 49.839  -6.231  1.00 44.68 ? 63  THR A O     1 
ATOM   370   C  CB    . THR A 1 63  ? -19.005 49.544  -3.047  1.00 48.07 ? 63  THR A CB    1 
ATOM   371   O  OG1   . THR A 1 63  ? -19.862 48.790  -2.185  1.00 49.51 ? 63  THR A OG1   1 
ATOM   372   C  CG2   . THR A 1 63  ? -19.722 50.804  -3.519  1.00 48.06 ? 63  THR A CG2   1 
ATOM   373   N  N     . ALA A 1 64  ? -16.414 49.613  -4.690  1.00 43.65 ? 64  ALA A N     1 
ATOM   374   C  CA    . ALA A 1 64  ? -15.403 50.304  -5.479  1.00 42.73 ? 64  ALA A CA    1 
ATOM   375   C  C     . ALA A 1 64  ? -15.227 49.644  -6.847  1.00 42.03 ? 64  ALA A C     1 
ATOM   376   O  O     . ALA A 1 64  ? -15.052 50.340  -7.847  1.00 42.11 ? 64  ALA A O     1 
ATOM   377   C  CB    . ALA A 1 64  ? -14.066 50.371  -4.724  1.00 41.66 ? 64  ALA A CB    1 
ATOM   378   N  N     . ALA A 1 65  ? -15.288 48.311  -6.887  1.00 41.76 ? 65  ALA A N     1 
ATOM   379   C  CA    . ALA A 1 65  ? -15.126 47.550  -8.129  1.00 41.23 ? 65  ALA A CA    1 
ATOM   380   C  C     . ALA A 1 65  ? -16.300 47.699  -9.103  1.00 41.74 ? 65  ALA A C     1 
ATOM   381   O  O     . ALA A 1 65  ? -16.118 47.645  -10.318 1.00 41.33 ? 65  ALA A O     1 
ATOM   382   C  CB    . ALA A 1 65  ? -14.868 46.087  -7.820  1.00 41.03 ? 65  ALA A CB    1 
ATOM   383   N  N     . THR A 1 66  ? -17.499 47.872  -8.566  1.00 43.41 ? 66  THR A N     1 
ATOM   384   C  CA    . THR A 1 66  ? -18.698 48.155  -9.361  1.00 44.58 ? 66  THR A CA    1 
ATOM   385   C  C     . THR A 1 66  ? -18.589 49.540  -10.005 1.00 44.75 ? 66  THR A C     1 
ATOM   386   O  O     . THR A 1 66  ? -19.168 49.801  -11.062 1.00 45.02 ? 66  THR A O     1 
ATOM   387   C  CB    . THR A 1 66  ? -19.933 48.102  -8.458  1.00 46.14 ? 66  THR A CB    1 
ATOM   388   O  OG1   . THR A 1 66  ? -20.028 46.789  -7.897  1.00 47.15 ? 66  THR A OG1   1 
ATOM   389   C  CG2   . THR A 1 66  ? -21.226 48.407  -9.233  1.00 47.88 ? 66  THR A CG2   1 
ATOM   390   N  N     . LEU A 1 67  ? -17.827 50.415  -9.352  1.00 44.57 ? 67  LEU A N     1 
ATOM   391   C  CA    . LEU A 1 67  ? -17.653 51.795  -9.776  1.00 44.91 ? 67  LEU A CA    1 
ATOM   392   C  C     . LEU A 1 67  ? -16.512 51.921  -10.790 1.00 43.69 ? 67  LEU A C     1 
ATOM   393   O  O     . LEU A 1 67  ? -16.166 53.019  -11.197 1.00 43.75 ? 67  LEU A O     1 
ATOM   394   C  CB    . LEU A 1 67  ? -17.411 52.693  -8.553  1.00 45.15 ? 67  LEU A CB    1 
ATOM   395   C  CG    . LEU A 1 67  ? -18.462 53.684  -8.023  1.00 46.77 ? 67  LEU A CG    1 
ATOM   396   C  CD1   . LEU A 1 67  ? -19.900 53.464  -8.527  1.00 48.22 ? 67  LEU A CD1   1 
ATOM   397   C  CD2   . LEU A 1 67  ? -18.418 53.770  -6.505  1.00 46.50 ? 67  LEU A CD2   1 
ATOM   398   N  N     . THR A 1 68  ? -15.949 50.789  -11.204 1.00 42.94 ? 68  THR A N     1 
ATOM   399   C  CA    . THR A 1 68  ? -14.881 50.749  -12.205 1.00 42.16 ? 68  THR A CA    1 
ATOM   400   C  C     . THR A 1 68  ? -15.373 51.351  -13.509 1.00 42.09 ? 68  THR A C     1 
ATOM   401   O  O     . THR A 1 68  ? -14.606 51.928  -14.261 1.00 41.59 ? 68  THR A O     1 
ATOM   402   C  CB    . THR A 1 68  ? -14.403 49.290  -12.441 1.00 41.42 ? 68  THR A CB    1 
ATOM   403   O  OG1   . THR A 1 68  ? -13.951 48.745  -11.197 1.00 42.51 ? 68  THR A OG1   1 
ATOM   404   C  CG2   . THR A 1 68  ? -13.257 49.212  -13.454 1.00 40.12 ? 68  THR A CG2   1 
ATOM   405   N  N     . THR A 1 69  ? -16.674 51.229  -13.742 1.00 43.17 ? 69  THR A N     1 
ATOM   406   C  CA    . THR A 1 69  ? -17.321 51.745  -14.938 1.00 43.77 ? 69  THR A CA    1 
ATOM   407   C  C     . THR A 1 69  ? -17.402 53.288  -14.953 1.00 44.00 ? 69  THR A C     1 
ATOM   408   O  O     . THR A 1 69  ? -17.804 53.883  -15.954 1.00 44.64 ? 69  THR A O     1 
ATOM   409   C  CB    . THR A 1 69  ? -18.705 51.078  -15.130 1.00 44.76 ? 69  THR A CB    1 
ATOM   410   O  OG1   . THR A 1 69  ? -19.261 51.468  -16.385 1.00 47.46 ? 69  THR A OG1   1 
ATOM   411   C  CG2   . THR A 1 69  ? -19.675 51.462  -14.024 1.00 47.22 ? 69  THR A CG2   1 
ATOM   412   N  N     . LYS A 1 70  ? -17.009 53.923  -13.846 1.00 43.49 ? 70  LYS A N     1 
ATOM   413   C  CA    . LYS A 1 70  ? -16.898 55.380  -13.763 1.00 43.39 ? 70  LYS A CA    1 
ATOM   414   C  C     . LYS A 1 70  ? -15.465 55.863  -14.063 1.00 41.89 ? 70  LYS A C     1 
ATOM   415   O  O     . LYS A 1 70  ? -15.272 56.921  -14.656 1.00 41.84 ? 70  LYS A O     1 
ATOM   416   C  CB    . LYS A 1 70  ? -17.365 55.874  -12.387 1.00 44.41 ? 70  LYS A CB    1 
ATOM   417   N  N     . HIS A 1 71  ? -14.477 55.079  -13.631 1.00 40.37 ? 71  HIS A N     1 
ATOM   418   C  CA    . HIS A 1 71  ? -13.057 55.339  -13.872 1.00 38.81 ? 71  HIS A CA    1 
ATOM   419   C  C     . HIS A 1 71  ? -12.238 54.101  -13.499 1.00 37.67 ? 71  HIS A C     1 
ATOM   420   O  O     . HIS A 1 71  ? -12.536 53.455  -12.490 1.00 37.67 ? 71  HIS A O     1 
ATOM   421   C  CB    . HIS A 1 71  ? -12.558 56.545  -13.073 1.00 38.85 ? 71  HIS A CB    1 
ATOM   422   C  CG    . HIS A 1 71  ? -11.271 57.112  -13.590 1.00 38.06 ? 71  HIS A CG    1 
ATOM   423   N  ND1   . HIS A 1 71  ? -10.037 56.708  -13.127 1.00 37.89 ? 71  HIS A ND1   1 
ATOM   424   C  CD2   . HIS A 1 71  ? -11.027 58.036  -14.548 1.00 37.53 ? 71  HIS A CD2   1 
ATOM   425   C  CE1   . HIS A 1 71  ? -9.090  57.371  -13.762 1.00 36.71 ? 71  HIS A CE1   1 
ATOM   426   N  NE2   . HIS A 1 71  ? -9.664  58.178  -14.636 1.00 37.67 ? 71  HIS A NE2   1 
ATOM   427   N  N     . PRO A 1 72  ? -11.192 53.775  -14.293 1.00 36.66 ? 72  PRO A N     1 
ATOM   428   C  CA    . PRO A 1 72  ? -10.419 52.554  -13.997 1.00 35.77 ? 72  PRO A CA    1 
ATOM   429   C  C     . PRO A 1 72  ? -9.695  52.569  -12.645 1.00 35.47 ? 72  PRO A C     1 
ATOM   430   O  O     . PRO A 1 72  ? -9.392  51.500  -12.116 1.00 35.35 ? 72  PRO A O     1 
ATOM   431   C  CB    . PRO A 1 72  ? -9.414  52.452  -15.163 1.00 34.98 ? 72  PRO A CB    1 
ATOM   432   C  CG    . PRO A 1 72  ? -9.852  53.439  -16.180 1.00 35.53 ? 72  PRO A CG    1 
ATOM   433   C  CD    . PRO A 1 72  ? -10.672 54.481  -15.481 1.00 36.59 ? 72  PRO A CD    1 
ATOM   434   N  N     . ASP A 1 73  ? -9.451  53.747  -12.075 1.00 35.59 ? 73  ASP A N     1 
ATOM   435   C  CA    . ASP A 1 73  ? -8.773  53.836  -10.771 1.00 35.96 ? 73  ASP A CA    1 
ATOM   436   C  C     . ASP A 1 73  ? -9.606  53.272  -9.612  1.00 36.62 ? 73  ASP A C     1 
ATOM   437   O  O     . ASP A 1 73  ? -9.073  52.980  -8.525  1.00 36.95 ? 73  ASP A O     1 
ATOM   438   C  CB    . ASP A 1 73  ? -8.370  55.276  -10.446 1.00 36.16 ? 73  ASP A CB    1 
ATOM   439   C  CG    . ASP A 1 73  ? -7.147  55.742  -11.214 1.00 36.25 ? 73  ASP A CG    1 
ATOM   440   O  OD1   . ASP A 1 73  ? -6.590  54.959  -12.013 1.00 36.29 ? 73  ASP A OD1   1 
ATOM   441   O  OD2   . ASP A 1 73  ? -6.740  56.912  -11.007 1.00 37.22 ? 73  ASP A OD2   1 
ATOM   442   N  N     . TYR A 1 74  ? -10.908 53.137  -9.839  1.00 36.82 ? 74  TYR A N     1 
ATOM   443   C  CA    . TYR A 1 74  ? -11.778 52.463  -8.892  1.00 37.65 ? 74  TYR A CA    1 
ATOM   444   C  C     . TYR A 1 74  ? -11.404 50.983  -8.732  1.00 37.26 ? 74  TYR A C     1 
ATOM   445   O  O     . TYR A 1 74  ? -11.482 50.438  -7.628  1.00 37.56 ? 74  TYR A O     1 
ATOM   446   C  CB    . TYR A 1 74  ? -13.244 52.598  -9.313  1.00 38.13 ? 74  TYR A CB    1 
ATOM   447   C  CG    . TYR A 1 74  ? -13.931 53.845  -8.791  1.00 38.73 ? 74  TYR A CG    1 
ATOM   448   C  CD1   . TYR A 1 74  ? -14.410 54.815  -9.664  1.00 38.10 ? 74  TYR A CD1   1 
ATOM   449   C  CD2   . TYR A 1 74  ? -14.098 54.051  -7.419  1.00 39.18 ? 74  TYR A CD2   1 
ATOM   450   C  CE1   . TYR A 1 74  ? -15.053 55.954  -9.188  1.00 40.29 ? 74  TYR A CE1   1 
ATOM   451   C  CE2   . TYR A 1 74  ? -14.739 55.191  -6.927  1.00 40.75 ? 74  TYR A CE2   1 
ATOM   452   C  CZ    . TYR A 1 74  ? -15.218 56.140  -7.820  1.00 41.35 ? 74  TYR A CZ    1 
ATOM   453   O  OH    . TYR A 1 74  ? -15.860 57.275  -7.347  1.00 42.51 ? 74  TYR A OH    1 
ATOM   454   N  N     . ALA A 1 75  ? -11.012 50.341  -9.834  1.00 36.48 ? 75  ALA A N     1 
ATOM   455   C  CA    . ALA A 1 75  ? -10.539 48.954  -9.796  1.00 36.21 ? 75  ALA A CA    1 
ATOM   456   C  C     . ALA A 1 75  ? -9.206  48.829  -9.062  1.00 35.74 ? 75  ALA A C     1 
ATOM   457   O  O     . ALA A 1 75  ? -8.919  47.782  -8.483  1.00 35.94 ? 75  ALA A O     1 
ATOM   458   C  CB    . ALA A 1 75  ? -10.413 48.380  -11.208 1.00 35.60 ? 75  ALA A CB    1 
ATOM   459   N  N     . ILE A 1 76  ? -8.396  49.886  -9.100  1.00 35.59 ? 76  ILE A N     1 
ATOM   460   C  CA    . ILE A 1 76  ? -7.134  49.924  -8.353  1.00 35.70 ? 76  ILE A CA    1 
ATOM   461   C  C     . ILE A 1 76  ? -7.421  50.145  -6.871  1.00 36.47 ? 76  ILE A C     1 
ATOM   462   O  O     . ILE A 1 76  ? -6.850  49.479  -6.005  1.00 36.55 ? 76  ILE A O     1 
ATOM   463   C  CB    . ILE A 1 76  ? -6.160  51.007  -8.886  1.00 35.45 ? 76  ILE A CB    1 
ATOM   464   C  CG1   . ILE A 1 76  ? -5.799  50.727  -10.353 1.00 34.98 ? 76  ILE A CG1   1 
ATOM   465   C  CG2   . ILE A 1 76  ? -4.897  51.080  -8.018  1.00 34.98 ? 76  ILE A CG2   1 
ATOM   466   C  CD1   . ILE A 1 76  ? -4.957  51.843  -11.010 1.00 34.92 ? 76  ILE A CD1   1 
ATOM   467   N  N     . LEU A 1 77  ? -8.322  51.072  -6.577  1.00 36.97 ? 77  LEU A N     1 
ATOM   468   C  CA    . LEU A 1 77  ? -8.772  51.243  -5.209  1.00 37.42 ? 77  LEU A CA    1 
ATOM   469   C  C     . LEU A 1 77  ? -9.394  49.951  -4.640  1.00 37.52 ? 77  LEU A C     1 
ATOM   470   O  O     . LEU A 1 77  ? -9.164  49.600  -3.478  1.00 37.88 ? 77  LEU A O     1 
ATOM   471   C  CB    . LEU A 1 77  ? -9.774  52.395  -5.136  1.00 38.53 ? 77  LEU A CB    1 
ATOM   472   C  CG    . LEU A 1 77  ? -10.447 52.725  -3.805  1.00 38.79 ? 77  LEU A CG    1 
ATOM   473   C  CD1   . LEU A 1 77  ? -9.407  52.941  -2.710  1.00 38.83 ? 77  LEU A CD1   1 
ATOM   474   C  CD2   . LEU A 1 77  ? -11.293 53.967  -4.005  1.00 40.00 ? 77  LEU A CD2   1 
ATOM   475   N  N     . ALA A 1 78  ? -10.183 49.254  -5.452  1.00 36.86 ? 78  ALA A N     1 
ATOM   476   C  CA    . ALA A 1 78  ? -10.805 48.004  -5.017  1.00 37.14 ? 78  ALA A CA    1 
ATOM   477   C  C     . ALA A 1 78  ? -9.735  46.966  -4.647  1.00 36.74 ? 78  ALA A C     1 
ATOM   478   O  O     . ALA A 1 78  ? -9.834  46.302  -3.609  1.00 37.30 ? 78  ALA A O     1 
ATOM   479   C  CB    . ALA A 1 78  ? -11.731 47.478  -6.090  1.00 36.74 ? 78  ALA A CB    1 
ATOM   480   N  N     . ALA A 1 79  ? -8.702  46.868  -5.488  1.00 35.47 ? 79  ALA A N     1 
ATOM   481   C  CA    . ALA A 1 79  ? -7.576  45.978  -5.261  1.00 35.15 ? 79  ALA A CA    1 
ATOM   482   C  C     . ALA A 1 79  ? -6.805  46.345  -4.018  1.00 35.67 ? 79  ALA A C     1 
ATOM   483   O  O     . ALA A 1 79  ? -6.348  45.466  -3.304  1.00 36.28 ? 79  ALA A O     1 
ATOM   484   C  CB    . ALA A 1 79  ? -6.636  45.991  -6.455  1.00 33.98 ? 79  ALA A CB    1 
ATOM   485   N  N     . ARG A 1 80  ? -6.637  47.640  -3.770  1.00 36.18 ? 80  ARG A N     1 
ATOM   486   C  CA    . ARG A 1 80  ? -5.829  48.086  -2.636  1.00 36.74 ? 80  ARG A CA    1 
ATOM   487   C  C     . ARG A 1 80  ? -6.527  47.713  -1.348  1.00 37.32 ? 80  ARG A C     1 
ATOM   488   O  O     . ARG A 1 80  ? -5.872  47.317  -0.379  1.00 37.59 ? 80  ARG A O     1 
ATOM   489   C  CB    . ARG A 1 80  ? -5.488  49.590  -2.724  1.00 37.01 ? 80  ARG A CB    1 
ATOM   490   C  CG    . ARG A 1 80  ? -4.851  49.961  -4.088  1.00 37.87 ? 80  ARG A CG    1 
ATOM   491   C  CD    . ARG A 1 80  ? -3.568  50.775  -4.015  1.00 38.03 ? 80  ARG A CD    1 
ATOM   492   N  NE    . ARG A 1 80  ? -3.804  52.216  -3.993  1.00 39.54 ? 80  ARG A NE    1 
ATOM   493   C  CZ    . ARG A 1 80  ? -3.288  53.108  -4.845  1.00 37.92 ? 80  ARG A CZ    1 
ATOM   494   N  NH1   . ARG A 1 80  ? -2.484  52.754  -5.845  1.00 33.93 ? 80  ARG A NH1   1 
ATOM   495   N  NH2   . ARG A 1 80  ? -3.583  54.386  -4.675  1.00 38.44 ? 80  ARG A NH2   1 
ATOM   496   N  N     . ILE A 1 81  ? -7.861  47.785  -1.367  1.00 37.87 ? 81  ILE A N     1 
ATOM   497   C  CA    . ILE A 1 81  ? -8.676  47.425  -0.212  1.00 38.37 ? 81  ILE A CA    1 
ATOM   498   C  C     . ILE A 1 81  ? -8.630  45.915  0.035   1.00 38.85 ? 81  ILE A C     1 
ATOM   499   O  O     . ILE A 1 81  ? -8.366  45.477  1.155   1.00 39.50 ? 81  ILE A O     1 
ATOM   500   C  CB    . ILE A 1 81  ? -10.139 47.917  -0.349  1.00 39.33 ? 81  ILE A CB    1 
ATOM   501   C  CG1   . ILE A 1 81  ? -10.196 49.448  -0.482  1.00 38.83 ? 81  ILE A CG1   1 
ATOM   502   C  CG2   . ILE A 1 81  ? -10.961 47.467  0.844   1.00 39.15 ? 81  ILE A CG2   1 
ATOM   503   C  CD1   . ILE A 1 81  ? -11.504 49.981  -1.065  1.00 39.17 ? 81  ILE A CD1   1 
ATOM   504   N  N     . ALA A 1 82  ? -8.876  45.126  -1.008  1.00 38.38 ? 82  ALA A N     1 
ATOM   505   C  CA    . ALA A 1 82  ? -8.825  43.675  -0.885  1.00 38.99 ? 82  ALA A CA    1 
ATOM   506   C  C     . ALA A 1 82  ? -7.426  43.177  -0.463  1.00 38.74 ? 82  ALA A C     1 
ATOM   507   O  O     . ALA A 1 82  ? -7.316  42.291  0.397   1.00 38.78 ? 82  ALA A O     1 
ATOM   508   C  CB    . ALA A 1 82  ? -9.282  42.997  -2.180  1.00 38.71 ? 82  ALA A CB    1 
ATOM   509   N  N     . VAL A 1 83  ? -6.375  43.755  -1.043  1.00 38.20 ? 83  VAL A N     1 
ATOM   510   C  CA    . VAL A 1 83  ? -5.002  43.401  -0.656  1.00 38.61 ? 83  VAL A CA    1 
ATOM   511   C  C     . VAL A 1 83  ? -4.633  43.795  0.790   1.00 40.23 ? 83  VAL A C     1 
ATOM   512   O  O     . VAL A 1 83  ? -3.872  43.085  1.454   1.00 40.88 ? 83  VAL A O     1 
ATOM   513   C  CB    . VAL A 1 83  ? -3.969  43.919  -1.658  1.00 37.61 ? 83  VAL A CB    1 
ATOM   514   C  CG1   . VAL A 1 83  ? -2.555  43.526  -1.232  1.00 37.42 ? 83  VAL A CG1   1 
ATOM   515   C  CG2   . VAL A 1 83  ? -4.253  43.348  -3.035  1.00 36.28 ? 83  VAL A CG2   1 
ATOM   516   N  N     . SER A 1 84  ? -5.185  44.897  1.294   1.00 41.64 ? 84  SER A N     1 
ATOM   517   C  CA    . SER A 1 84  ? -4.961  45.271  2.695   1.00 43.21 ? 84  SER A CA    1 
ATOM   518   C  C     . SER A 1 84  ? -5.549  44.225  3.628   1.00 44.13 ? 84  SER A C     1 
ATOM   519   O  O     . SER A 1 84  ? -4.929  43.867  4.631   1.00 44.66 ? 84  SER A O     1 
ATOM   520   C  CB    . SER A 1 84  ? -5.548  46.647  3.022   1.00 43.98 ? 84  SER A CB    1 
ATOM   521   O  OG    . SER A 1 84  ? -5.025  47.638  2.154   1.00 44.75 ? 84  SER A OG    1 
ATOM   522   N  N     . ASN A 1 85  ? -6.746  43.747  3.300   1.00 44.62 ? 85  ASN A N     1 
ATOM   523   C  CA    . ASN A 1 85  ? -7.361  42.646  4.038   1.00 45.85 ? 85  ASN A CA    1 
ATOM   524   C  C     . ASN A 1 85  ? -6.491  41.388  3.992   1.00 44.84 ? 85  ASN A C     1 
ATOM   525   O  O     . ASN A 1 85  ? -6.310  40.721  5.013   1.00 45.55 ? 85  ASN A O     1 
ATOM   526   C  CB    . ASN A 1 85  ? -8.752  42.316  3.488   1.00 46.84 ? 85  ASN A CB    1 
ATOM   527   C  CG    . ASN A 1 85  ? -9.829  43.299  3.944   1.00 50.91 ? 85  ASN A CG    1 
ATOM   528   O  OD1   . ASN A 1 85  ? -10.835 43.493  3.242   1.00 53.27 ? 85  ASN A OD1   1 
ATOM   529   N  ND2   . ASN A 1 85  ? -9.640  43.907  5.126   1.00 53.15 ? 85  ASN A ND2   1 
ATOM   530   N  N     . LEU A 1 86  ? -5.952  41.077  2.810   1.00 42.94 ? 86  LEU A N     1 
ATOM   531   C  CA    . LEU A 1 86  ? -5.134  39.885  2.636   1.00 42.08 ? 86  LEU A CA    1 
ATOM   532   C  C     . LEU A 1 86  ? -3.848  39.974  3.445   1.00 41.95 ? 86  LEU A C     1 
ATOM   533   O  O     . LEU A 1 86  ? -3.419  38.996  4.039   1.00 41.84 ? 86  LEU A O     1 
ATOM   534   C  CB    . LEU A 1 86  ? -4.822  39.623  1.156   1.00 40.84 ? 86  LEU A CB    1 
ATOM   535   C  CG    . LEU A 1 86  ? -4.068  38.317  0.846   1.00 40.16 ? 86  LEU A CG    1 
ATOM   536   C  CD1   . LEU A 1 86  ? -4.881  37.104  1.273   1.00 40.67 ? 86  LEU A CD1   1 
ATOM   537   C  CD2   . LEU A 1 86  ? -3.694  38.211  -0.616  1.00 39.37 ? 86  LEU A CD2   1 
ATOM   538   N  N     . HIS A 1 87  ? -3.242  41.153  3.462   1.00 41.99 ? 87  HIS A N     1 
ATOM   539   C  CA    . HIS A 1 87  ? -2.020  41.366  4.228   1.00 42.69 ? 87  HIS A CA    1 
ATOM   540   C  C     . HIS A 1 87  ? -2.228  41.205  5.719   1.00 44.05 ? 87  HIS A C     1 
ATOM   541   O  O     . HIS A 1 87  ? -1.352  40.689  6.413   1.00 44.53 ? 87  HIS A O     1 
ATOM   542   C  CB    . HIS A 1 87  ? -1.423  42.729  3.914   1.00 42.11 ? 87  HIS A CB    1 
ATOM   543   C  CG    . HIS A 1 87  ? -0.603  42.734  2.669   1.00 41.09 ? 87  HIS A CG    1 
ATOM   544   N  ND1   . HIS A 1 87  ? 0.145   43.820  2.272   1.00 41.01 ? 87  HIS A ND1   1 
ATOM   545   C  CD2   . HIS A 1 87  ? -0.397  41.772  1.741   1.00 39.98 ? 87  HIS A CD2   1 
ATOM   546   C  CE1   . HIS A 1 87  ? 0.764   43.531  1.142   1.00 41.47 ? 87  HIS A CE1   1 
ATOM   547   N  NE2   . HIS A 1 87  ? 0.452   42.294  0.799   1.00 40.63 ? 87  HIS A NE2   1 
ATOM   548   N  N     . LYS A 1 88  ? -3.391  41.636  6.198   1.00 45.00 ? 88  LYS A N     1 
ATOM   549   C  CA    . LYS A 1 88  ? -3.747  41.497  7.603   1.00 46.55 ? 88  LYS A CA    1 
ATOM   550   C  C     . LYS A 1 88  ? -4.163  40.064  7.954   1.00 47.27 ? 88  LYS A C     1 
ATOM   551   O  O     . LYS A 1 88  ? -4.209  39.704  9.132   1.00 48.73 ? 88  LYS A O     1 
ATOM   552   C  CB    . LYS A 1 88  ? -4.846  42.503  7.982   1.00 47.32 ? 88  LYS A CB    1 
ATOM   553   N  N     . GLU A 1 89  ? -4.462  39.249  6.939   1.00 46.50 ? 89  GLU A N     1 
ATOM   554   C  CA    . GLU A 1 89  ? -4.878  37.858  7.158   1.00 46.77 ? 89  GLU A CA    1 
ATOM   555   C  C     . GLU A 1 89  ? -3.848  36.816  6.703   1.00 45.99 ? 89  GLU A C     1 
ATOM   556   O  O     . GLU A 1 89  ? -4.138  35.622  6.690   1.00 46.24 ? 89  GLU A O     1 
ATOM   557   C  CB    . GLU A 1 89  ? -6.247  37.594  6.512   1.00 46.94 ? 89  GLU A CB    1 
ATOM   558   N  N     . THR A 1 90  ? -2.652  37.272  6.328   1.00 45.19 ? 90  THR A N     1 
ATOM   559   C  CA    . THR A 1 90  ? -1.540  36.381  5.989   1.00 44.63 ? 90  THR A CA    1 
ATOM   560   C  C     . THR A 1 90  ? -0.268  36.755  6.755   1.00 45.21 ? 90  THR A C     1 
ATOM   561   O  O     . THR A 1 90  ? -0.127  37.882  7.219   1.00 45.46 ? 90  THR A O     1 
ATOM   562   C  CB    . THR A 1 90  ? -1.241  36.376  4.467   1.00 43.30 ? 90  THR A CB    1 
ATOM   563   O  OG1   . THR A 1 90  ? -1.061  37.716  3.999   1.00 42.28 ? 90  THR A OG1   1 
ATOM   564   C  CG2   . THR A 1 90  ? -2.372  35.719  3.691   1.00 42.77 ? 90  THR A CG2   1 
ATOM   565   N  N     . LYS A 1 91  ? 0.657   35.809  6.883   1.00 45.53 ? 91  LYS A N     1 
ATOM   566   C  CA    . LYS A 1 91  ? 1.955   36.091  7.498   1.00 46.19 ? 91  LYS A CA    1 
ATOM   567   C  C     . LYS A 1 91  ? 2.840   36.918  6.564   1.00 45.39 ? 91  LYS A C     1 
ATOM   568   O  O     . LYS A 1 91  ? 2.744   36.797  5.348   1.00 44.81 ? 91  LYS A O     1 
ATOM   569   C  CB    . LYS A 1 91  ? 2.660   34.794  7.915   1.00 46.67 ? 91  LYS A CB    1 
ATOM   570   C  CG    . LYS A 1 91  ? 2.035   34.098  9.117   1.00 47.15 ? 91  LYS A CG    1 
ATOM   571   C  CD    . LYS A 1 91  ? 2.662   32.746  9.344   1.00 47.65 ? 91  LYS A CD    1 
ATOM   572   C  CE    . LYS A 1 91  ? 1.972   31.997  10.469  1.00 50.21 ? 91  LYS A CE    1 
ATOM   573   N  NZ    . LYS A 1 91  ? 2.754   30.788  10.898  1.00 50.90 ? 91  LYS A NZ    1 
ATOM   574   N  N     . LYS A 1 92  ? 3.700   37.751  7.141   1.00 46.14 ? 92  LYS A N     1 
ATOM   575   C  CA    . LYS A 1 92  ? 4.505   38.700  6.365   1.00 45.96 ? 92  LYS A CA    1 
ATOM   576   C  C     . LYS A 1 92  ? 5.860   38.156  5.922   1.00 45.69 ? 92  LYS A C     1 
ATOM   577   O  O     . LYS A 1 92  ? 6.480   38.722  5.029   1.00 45.99 ? 92  LYS A O     1 
ATOM   578   C  CB    . LYS A 1 92  ? 4.696   40.026  7.140   1.00 46.40 ? 92  LYS A CB    1 
ATOM   579   N  N     . VAL A 1 93  ? 6.337   37.093  6.553   1.00 46.04 ? 93  VAL A N     1 
ATOM   580   C  CA    . VAL A 1 93  ? 7.639   36.540  6.189   1.00 45.56 ? 93  VAL A CA    1 
ATOM   581   C  C     . VAL A 1 93  ? 7.488   35.282  5.328   1.00 44.95 ? 93  VAL A C     1 
ATOM   582   O  O     . VAL A 1 93  ? 6.795   34.330  5.694   1.00 45.68 ? 93  VAL A O     1 
ATOM   583   C  CB    . VAL A 1 93  ? 8.653   36.444  7.413   1.00 46.84 ? 93  VAL A CB    1 
ATOM   584   C  CG1   . VAL A 1 93  ? 7.956   36.647  8.752   1.00 46.98 ? 93  VAL A CG1   1 
ATOM   585   C  CG2   . VAL A 1 93  ? 9.508   35.169  7.391   1.00 46.95 ? 93  VAL A CG2   1 
ATOM   586   N  N     . PHE A 1 94  ? 8.124   35.336  4.162   1.00 43.46 ? 94  PHE A N     1 
ATOM   587   C  CA    . PHE A 1 94  ? 8.095   34.307  3.142   1.00 42.31 ? 94  PHE A CA    1 
ATOM   588   C  C     . PHE A 1 94  ? 8.522   32.916  3.628   1.00 43.46 ? 94  PHE A C     1 
ATOM   589   O  O     . PHE A 1 94  ? 7.798   31.947  3.405   1.00 43.52 ? 94  PHE A O     1 
ATOM   590   C  CB    . PHE A 1 94  ? 8.949   34.785  1.969   1.00 41.29 ? 94  PHE A CB    1 
ATOM   591   C  CG    . PHE A 1 94  ? 9.210   33.749  0.921   1.00 39.80 ? 94  PHE A CG    1 
ATOM   592   C  CD1   . PHE A 1 94  ? 8.174   33.268  0.117   1.00 38.51 ? 94  PHE A CD1   1 
ATOM   593   C  CD2   . PHE A 1 94  ? 10.507  33.287  0.706   1.00 38.31 ? 94  PHE A CD2   1 
ATOM   594   C  CE1   . PHE A 1 94  ? 8.422   32.323  -0.881  1.00 38.00 ? 94  PHE A CE1   1 
ATOM   595   C  CE2   . PHE A 1 94  ? 10.775  32.340  -0.273  1.00 37.60 ? 94  PHE A CE2   1 
ATOM   596   C  CZ    . PHE A 1 94  ? 9.728   31.852  -1.074  1.00 39.25 ? 94  PHE A CZ    1 
ATOM   597   N  N     . SER A 1 95  ? 9.671   32.807  4.301   1.00 44.55 ? 95  SER A N     1 
ATOM   598   C  CA    . SER A 1 95  ? 10.134  31.499  4.776   1.00 45.51 ? 95  SER A CA    1 
ATOM   599   C  C     . SER A 1 95  ? 9.159   30.856  5.770   1.00 46.53 ? 95  SER A C     1 
ATOM   600   O  O     . SER A 1 95  ? 9.037   29.639  5.802   1.00 47.09 ? 95  SER A O     1 
ATOM   601   C  CB    . SER A 1 95  ? 11.564  31.550  5.326   1.00 46.23 ? 95  SER A CB    1 
ATOM   602   O  OG    . SER A 1 95  ? 11.651  32.226  6.565   1.00 47.26 ? 95  SER A OG    1 
ATOM   603   N  N     . ASP A 1 96  ? 8.451   31.679  6.546   1.00 46.96 ? 96  ASP A N     1 
ATOM   604   C  CA    . ASP A 1 96  ? 7.408   31.203  7.467   1.00 47.95 ? 96  ASP A CA    1 
ATOM   605   C  C     . ASP A 1 96  ? 6.197   30.606  6.756   1.00 47.13 ? 96  ASP A C     1 
ATOM   606   O  O     . ASP A 1 96  ? 5.642   29.606  7.202   1.00 48.16 ? 96  ASP A O     1 
ATOM   607   C  CB    . ASP A 1 96  ? 6.937   32.342  8.371   1.00 48.56 ? 96  ASP A CB    1 
ATOM   608   C  CG    . ASP A 1 96  ? 7.938   32.681  9.458   1.00 50.96 ? 96  ASP A CG    1 
ATOM   609   O  OD1   . ASP A 1 96  ? 9.004   32.022  9.533   1.00 51.74 ? 96  ASP A OD1   1 
ATOM   610   O  OD2   . ASP A 1 96  ? 7.645   33.608  10.251  1.00 52.80 ? 96  ASP A OD2   1 
ATOM   611   N  N     . VAL A 1 97  ? 5.787   31.237  5.662   1.00 45.73 ? 97  VAL A N     1 
ATOM   612   C  CA    . VAL A 1 97  ? 4.667   30.771  4.851   1.00 44.88 ? 97  VAL A CA    1 
ATOM   613   C  C     . VAL A 1 97  ? 5.028   29.470  4.124   1.00 44.75 ? 97  VAL A C     1 
ATOM   614   O  O     . VAL A 1 97  ? 4.198   28.560  4.045   1.00 44.89 ? 97  VAL A O     1 
ATOM   615   C  CB    . VAL A 1 97  ? 4.189   31.875  3.855   1.00 43.67 ? 97  VAL A CB    1 
ATOM   616   C  CG1   . VAL A 1 97  ? 3.247   31.312  2.793   1.00 43.06 ? 97  VAL A CG1   1 
ATOM   617   C  CG2   . VAL A 1 97  ? 3.516   33.002  4.607   1.00 43.18 ? 97  VAL A CG2   1 
ATOM   618   N  N     . MET A 1 98  ? 6.259   29.378  3.612   1.00 44.34 ? 98  MET A N     1 
ATOM   619   C  CA    . MET A 1 98  ? 6.728   28.155  2.957   1.00 44.51 ? 98  MET A CA    1 
ATOM   620   C  C     . MET A 1 98  ? 6.786   26.996  3.947   1.00 45.50 ? 98  MET A C     1 
ATOM   621   O  O     . MET A 1 98  ? 6.517   25.855  3.588   1.00 45.44 ? 98  MET A O     1 
ATOM   622   C  CB    . MET A 1 98  ? 8.113   28.341  2.332   1.00 44.54 ? 98  MET A CB    1 
ATOM   623   C  CG    . MET A 1 98  ? 8.218   29.379  1.249   1.00 45.03 ? 98  MET A CG    1 
ATOM   624   S  SD    . MET A 1 98  ? 7.390   28.954  -0.295  1.00 49.50 ? 98  MET A SD    1 
ATOM   625   C  CE    . MET A 1 98  ? 5.897   29.975  -0.186  1.00 46.68 ? 98  MET A CE    1 
ATOM   626   N  N     . GLU A 1 99  ? 7.153   27.294  5.190   1.00 46.56 ? 99  GLU A N     1 
ATOM   627   C  CA    . GLU A 1 99  ? 7.187   26.284  6.242   1.00 48.18 ? 99  GLU A CA    1 
ATOM   628   C  C     . GLU A 1 99  ? 5.805   25.763  6.572   1.00 48.69 ? 99  GLU A C     1 
ATOM   629   O  O     . GLU A 1 99  ? 5.625   24.558  6.721   1.00 49.49 ? 99  GLU A O     1 
ATOM   630   C  CB    . GLU A 1 99  ? 7.866   26.811  7.500   1.00 48.97 ? 99  GLU A CB    1 
ATOM   631   C  CG    . GLU A 1 99  ? 9.361   26.675  7.449   1.00 49.76 ? 99  GLU A CG    1 
ATOM   632   C  CD    . GLU A 1 99  ? 10.007  26.889  8.789   1.00 52.40 ? 99  GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1 99  ? 10.266  28.060  9.148   1.00 52.66 ? 99  GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1 99  ? 10.268  25.877  9.475   1.00 54.10 ? 99  GLU A OE2   1 
ATOM   635   N  N     . ASP A 1 100 ? 4.829   26.661  6.674   1.00 48.51 ? 100 ASP A N     1 
ATOM   636   C  CA    . ASP A 1 100 ? 3.470   26.239  6.970   1.00 49.34 ? 100 ASP A CA    1 
ATOM   637   C  C     . ASP A 1 100 ? 2.904   25.416  5.832   1.00 48.58 ? 100 ASP A C     1 
ATOM   638   O  O     . ASP A 1 100 ? 2.098   24.529  6.072   1.00 49.27 ? 100 ASP A O     1 
ATOM   639   C  CB    . ASP A 1 100 ? 2.560   27.436  7.242   1.00 49.81 ? 100 ASP A CB    1 
ATOM   640   C  CG    . ASP A 1 100 ? 2.969   28.216  8.474   1.00 51.20 ? 100 ASP A CG    1 
ATOM   641   O  OD1   . ASP A 1 100 ? 2.673   29.426  8.519   1.00 52.26 ? 100 ASP A OD1   1 
ATOM   642   O  OD2   . ASP A 1 100 ? 3.587   27.633  9.388   1.00 53.95 ? 100 ASP A OD2   1 
ATOM   643   N  N     . LEU A 1 101 ? 3.321   25.718  4.599   1.00 47.20 ? 101 LEU A N     1 
ATOM   644   C  CA    . LEU A 1 101 ? 2.873   24.970  3.425   1.00 46.56 ? 101 LEU A CA    1 
ATOM   645   C  C     . LEU A 1 101 ? 3.472   23.561  3.384   1.00 47.46 ? 101 LEU A C     1 
ATOM   646   O  O     . LEU A 1 101 ? 2.814   22.611  2.943   1.00 47.26 ? 101 LEU A O     1 
ATOM   647   C  CB    . LEU A 1 101 ? 3.211   25.712  2.129   1.00 44.80 ? 101 LEU A CB    1 
ATOM   648   C  CG    . LEU A 1 101 ? 2.407   26.967  1.783   1.00 44.10 ? 101 LEU A CG    1 
ATOM   649   C  CD1   . LEU A 1 101 ? 3.052   27.688  0.637   1.00 42.07 ? 101 LEU A CD1   1 
ATOM   650   C  CD2   . LEU A 1 101 ? 0.963   26.643  1.462   1.00 44.00 ? 101 LEU A CD2   1 
ATOM   651   N  N     . TYR A 1 102 ? 4.726   23.436  3.817   1.00 48.20 ? 102 TYR A N     1 
ATOM   652   C  CA    . TYR A 1 102 ? 5.368   22.136  3.892   1.00 49.33 ? 102 TYR A CA    1 
ATOM   653   C  C     . TYR A 1 102 ? 4.818   21.272  5.028   1.00 51.22 ? 102 TYR A C     1 
ATOM   654   O  O     . TYR A 1 102 ? 4.588   20.077  4.839   1.00 51.66 ? 102 TYR A O     1 
ATOM   655   C  CB    . TYR A 1 102 ? 6.887   22.257  4.026   1.00 49.40 ? 102 TYR A CB    1 
ATOM   656   C  CG    . TYR A 1 102 ? 7.571   20.903  4.050   1.00 49.99 ? 102 TYR A CG    1 
ATOM   657   C  CD1   . TYR A 1 102 ? 7.726   20.173  2.876   1.00 48.81 ? 102 TYR A CD1   1 
ATOM   658   C  CD2   . TYR A 1 102 ? 8.038   20.344  5.245   1.00 50.69 ? 102 TYR A CD2   1 
ATOM   659   C  CE1   . TYR A 1 102 ? 8.324   18.931  2.878   1.00 49.63 ? 102 TYR A CE1   1 
ATOM   660   C  CE2   . TYR A 1 102 ? 8.647   19.093  5.257   1.00 51.31 ? 102 TYR A CE2   1 
ATOM   661   C  CZ    . TYR A 1 102 ? 8.789   18.397  4.061   1.00 51.49 ? 102 TYR A CZ    1 
ATOM   662   O  OH    . TYR A 1 102 ? 9.386   17.156  4.020   1.00 52.42 ? 102 TYR A OH    1 
ATOM   663   N  N     . ASN A 1 103 ? 4.617   21.878  6.199   1.00 52.47 ? 103 ASN A N     1 
ATOM   664   C  CA    . ASN A 1 103 ? 4.228   21.142  7.401   1.00 54.54 ? 103 ASN A CA    1 
ATOM   665   C  C     . ASN A 1 103 ? 2.768   20.726  7.429   1.00 55.36 ? 103 ASN A C     1 
ATOM   666   O  O     . ASN A 1 103 ? 2.314   20.087  8.386   1.00 56.85 ? 103 ASN A O     1 
ATOM   667   C  CB    . ASN A 1 103 ? 4.563   21.954  8.651   1.00 55.29 ? 103 ASN A CB    1 
ATOM   668   C  CG    . ASN A 1 103 ? 6.051   22.121  8.847   1.00 55.90 ? 103 ASN A CG    1 
ATOM   669   O  OD1   . ASN A 1 103 ? 6.843   21.258  8.458   1.00 56.26 ? 103 ASN A OD1   1 
ATOM   670   N  ND2   . ASN A 1 103 ? 6.445   23.236  9.452   1.00 55.40 ? 103 ASN A ND2   1 
ATOM   671   N  N     . TYR A 1 104 ? 2.045   21.074  6.371   1.00 54.83 ? 104 TYR A N     1 
ATOM   672   C  CA    . TYR A 1 104 ? 0.619   20.836  6.295   1.00 55.70 ? 104 TYR A CA    1 
ATOM   673   C  C     . TYR A 1 104 ? 0.248   19.371  6.546   1.00 57.45 ? 104 TYR A C     1 
ATOM   674   O  O     . TYR A 1 104 ? 0.709   18.472  5.841   1.00 57.13 ? 104 TYR A O     1 
ATOM   675   C  CB    . TYR A 1 104 ? 0.078   21.321  4.949   1.00 53.93 ? 104 TYR A CB    1 
ATOM   676   C  CG    . TYR A 1 104 ? -1.379  21.007  4.775   1.00 54.58 ? 104 TYR A CG    1 
ATOM   677   C  CD1   . TYR A 1 104 ? -2.356  21.686  5.509   1.00 54.78 ? 104 TYR A CD1   1 
ATOM   678   C  CD2   . TYR A 1 104 ? -1.790  20.010  3.896   1.00 54.19 ? 104 TYR A CD2   1 
ATOM   679   C  CE1   . TYR A 1 104 ? -3.702  21.380  5.360   1.00 54.96 ? 104 TYR A CE1   1 
ATOM   680   C  CE2   . TYR A 1 104 ? -3.128  19.701  3.744   1.00 54.81 ? 104 TYR A CE2   1 
ATOM   681   C  CZ    . TYR A 1 104 ? -4.073  20.387  4.476   1.00 55.00 ? 104 TYR A CZ    1 
ATOM   682   O  OH    . TYR A 1 104 ? -5.392  20.066  4.309   1.00 56.74 ? 104 TYR A OH    1 
ATOM   683   N  N     . ILE A 1 105 ? -0.573  19.144  7.570   1.00 59.89 ? 105 ILE A N     1 
ATOM   684   C  CA    . ILE A 1 105 ? -1.104  17.813  7.872   1.00 62.04 ? 105 ILE A CA    1 
ATOM   685   C  C     . ILE A 1 105 ? -2.581  17.775  7.506   1.00 62.82 ? 105 ILE A C     1 
ATOM   686   O  O     . ILE A 1 105 ? -3.409  18.404  8.177   1.00 63.73 ? 105 ILE A O     1 
ATOM   687   C  CB    . ILE A 1 105 ? -0.966  17.430  9.383   1.00 63.88 ? 105 ILE A CB    1 
ATOM   688   C  CG1   . ILE A 1 105 ? 0.437   17.733  9.941   1.00 64.51 ? 105 ILE A CG1   1 
ATOM   689   C  CG2   . ILE A 1 105 ? -1.386  15.970  9.622   1.00 64.47 ? 105 ILE A CG2   1 
ATOM   690   C  CD1   . ILE A 1 105 ? 1.563   16.847  9.413   1.00 65.70 ? 105 ILE A CD1   1 
ATOM   691   N  N     . ASN A 1 106 ? -2.905  17.037  6.448   1.00 63.16 ? 106 ASN A N     1 
ATOM   692   C  CA    . ASN A 1 106 ? -4.291  16.825  6.024   1.00 64.20 ? 106 ASN A CA    1 
ATOM   693   C  C     . ASN A 1 106 ? -5.110  16.114  7.117   1.00 66.21 ? 106 ASN A C     1 
ATOM   694   O  O     . ASN A 1 106 ? -4.829  14.964  7.447   1.00 67.22 ? 106 ASN A O     1 
ATOM   695   C  CB    . ASN A 1 106 ? -4.318  16.077  4.675   1.00 63.61 ? 106 ASN A CB    1 
ATOM   696   C  CG    . ASN A 1 106 ? -5.619  15.313  4.424   1.00 65.00 ? 106 ASN A CG    1 
ATOM   697   O  OD1   . ASN A 1 106 ? -6.667  15.606  5.005   1.00 67.29 ? 106 ASN A OD1   1 
ATOM   698   N  ND2   . ASN A 1 106 ? -5.546  14.320  3.546   1.00 64.97 ? 106 ASN A ND2   1 
ATOM   699   N  N     . PRO A 1 107 ? -6.124  16.806  7.681   1.00 67.23 ? 107 PRO A N     1 
ATOM   700   C  CA    . PRO A 1 107 ? -6.846  16.304  8.861   1.00 69.35 ? 107 PRO A CA    1 
ATOM   701   C  C     . PRO A 1 107 ? -7.867  15.197  8.567   1.00 70.54 ? 107 PRO A C     1 
ATOM   702   O  O     . PRO A 1 107 ? -8.374  14.572  9.506   1.00 72.01 ? 107 PRO A O     1 
ATOM   703   C  CB    . PRO A 1 107 ? -7.549  17.559  9.414   1.00 69.62 ? 107 PRO A CB    1 
ATOM   704   C  CG    . PRO A 1 107 ? -7.093  18.724  8.528   1.00 67.67 ? 107 PRO A CG    1 
ATOM   705   C  CD    . PRO A 1 107 ? -6.655  18.110  7.244   1.00 66.27 ? 107 PRO A CD    1 
ATOM   706   N  N     . HIS A 1 108 ? -8.153  14.954  7.283   1.00 69.76 ? 108 HIS A N     1 
ATOM   707   C  CA    . HIS A 1 108 ? -9.070  13.883  6.874   1.00 70.61 ? 108 HIS A CA    1 
ATOM   708   C  C     . HIS A 1 108 ? -8.466  12.483  7.080   1.00 71.54 ? 108 HIS A C     1 
ATOM   709   O  O     . HIS A 1 108 ? -9.159  11.556  7.514   1.00 73.01 ? 108 HIS A O     1 
ATOM   710   C  CB    . HIS A 1 108 ? -9.524  14.082  5.423   1.00 69.21 ? 108 HIS A CB    1 
ATOM   711   N  N     . ASN A 1 109 ? -7.176  12.338  6.769   1.00 70.78 ? 109 ASN A N     1 
ATOM   712   C  CA    . ASN A 1 109 ? -6.442  11.083  7.005   1.00 71.23 ? 109 ASN A CA    1 
ATOM   713   C  C     . ASN A 1 109 ? -5.334  11.196  8.066   1.00 71.37 ? 109 ASN A C     1 
ATOM   714   O  O     . ASN A 1 109 ? -4.903  10.192  8.628   1.00 72.44 ? 109 ASN A O     1 
ATOM   715   C  CB    . ASN A 1 109 ? -5.862  10.543  5.692   1.00 70.19 ? 109 ASN A CB    1 
ATOM   716   C  CG    . ASN A 1 109 ? -4.954  11.546  4.990   1.00 69.39 ? 109 ASN A CG    1 
ATOM   717   O  OD1   . ASN A 1 109 ? -4.666  12.624  5.516   1.00 70.64 ? 109 ASN A OD1   1 
ATOM   718   N  ND2   . ASN A 1 109 ? -4.501  11.194  3.794   1.00 68.33 ? 109 ASN A ND2   1 
ATOM   719   N  N     . GLY A 1 110 ? -4.878  12.420  8.331   1.00 70.16 ? 110 GLY A N     1 
ATOM   720   C  CA    . GLY A 1 110 ? -3.766  12.656  9.261   1.00 69.74 ? 110 GLY A CA    1 
ATOM   721   C  C     . GLY A 1 110 ? -2.397  12.601  8.595   1.00 68.02 ? 110 GLY A C     1 
ATOM   722   O  O     . GLY A 1 110 ? -1.371  12.773  9.253   1.00 68.42 ? 110 GLY A O     1 
ATOM   723   N  N     . LYS A 1 111 ? -2.377  12.359  7.288   1.00 65.88 ? 111 LYS A N     1 
ATOM   724   C  CA    . LYS A 1 111 ? -1.127  12.174  6.569   1.00 64.30 ? 111 LYS A CA    1 
ATOM   725   C  C     . LYS A 1 111 ? -0.490  13.515  6.214   1.00 62.43 ? 111 LYS A C     1 
ATOM   726   O  O     . LYS A 1 111 ? -1.152  14.420  5.685   1.00 61.30 ? 111 LYS A O     1 
ATOM   727   C  CB    . LYS A 1 111 ? -1.343  11.317  5.317   1.00 63.74 ? 111 LYS A CB    1 
ATOM   728   N  N     . HIS A 1 112 ? 0.798   13.636  6.528   1.00 61.57 ? 112 HIS A N     1 
ATOM   729   C  CA    . HIS A 1 112 ? 1.584   14.803  6.161   1.00 59.39 ? 112 HIS A CA    1 
ATOM   730   C  C     . HIS A 1 112 ? 1.575   14.977  4.647   1.00 57.38 ? 112 HIS A C     1 
ATOM   731   O  O     . HIS A 1 112 ? 1.960   14.065  3.909   1.00 57.29 ? 112 HIS A O     1 
ATOM   732   C  CB    . HIS A 1 112 ? 3.011   14.659  6.681   1.00 59.87 ? 112 HIS A CB    1 
ATOM   733   C  CG    . HIS A 1 112 ? 3.927   15.752  6.236   1.00 58.44 ? 112 HIS A CG    1 
ATOM   734   N  ND1   . HIS A 1 112 ? 5.111   15.504  5.577   1.00 57.82 ? 112 HIS A ND1   1 
ATOM   735   C  CD2   . HIS A 1 112 ? 3.825   17.097  6.339   1.00 57.53 ? 112 HIS A CD2   1 
ATOM   736   C  CE1   . HIS A 1 112 ? 5.706   16.651  5.304   1.00 57.66 ? 112 HIS A CE1   1 
ATOM   737   N  NE2   . HIS A 1 112 ? 4.944   17.633  5.752   1.00 57.56 ? 112 HIS A NE2   1 
ATOM   738   N  N     . SER A 1 113 ? 1.119   16.145  4.194   1.00 55.57 ? 113 SER A N     1 
ATOM   739   C  CA    . SER A 1 113 ? 0.898   16.399  2.773   1.00 53.51 ? 113 SER A CA    1 
ATOM   740   C  C     . SER A 1 113 ? 1.464   17.757  2.374   1.00 51.93 ? 113 SER A C     1 
ATOM   741   O  O     . SER A 1 113 ? 0.714   18.719  2.222   1.00 51.43 ? 113 SER A O     1 
ATOM   742   C  CB    . SER A 1 113 ? -0.599  16.340  2.437   1.00 53.35 ? 113 SER A CB    1 
ATOM   743   O  OG    . SER A 1 113 ? -1.239  15.242  3.060   1.00 54.26 ? 113 SER A OG    1 
ATOM   744   N  N     . PRO A 1 114 ? 2.790   17.837  2.178   1.00 51.29 ? 114 PRO A N     1 
ATOM   745   C  CA    . PRO A 1 114 ? 3.448   19.119  1.921   1.00 49.82 ? 114 PRO A CA    1 
ATOM   746   C  C     . PRO A 1 114 ? 2.928   19.804  0.656   1.00 48.01 ? 114 PRO A C     1 
ATOM   747   O  O     . PRO A 1 114 ? 2.751   19.157  -0.369  1.00 46.96 ? 114 PRO A O     1 
ATOM   748   C  CB    . PRO A 1 114 ? 4.917   18.726  1.741   1.00 49.97 ? 114 PRO A CB    1 
ATOM   749   C  CG    . PRO A 1 114 ? 4.890   17.273  1.368   1.00 50.87 ? 114 PRO A CG    1 
ATOM   750   C  CD    . PRO A 1 114 ? 3.747   16.713  2.148   1.00 51.91 ? 114 PRO A CD    1 
ATOM   751   N  N     . MET A 1 115 ? 2.684   21.105  0.735   1.00 47.37 ? 115 MET A N     1 
ATOM   752   C  CA    . MET A 1 115 ? 2.163   21.846  -0.413  1.00 46.33 ? 115 MET A CA    1 
ATOM   753   C  C     . MET A 1 115 ? 3.285   22.509  -1.193  1.00 45.14 ? 115 MET A C     1 
ATOM   754   O  O     . MET A 1 115 ? 3.056   23.058  -2.271  1.00 44.28 ? 115 MET A O     1 
ATOM   755   C  CB    . MET A 1 115 ? 1.104   22.856  0.021   1.00 46.05 ? 115 MET A CB    1 
ATOM   756   C  CG    . MET A 1 115 ? -0.175  22.192  0.511   1.00 47.06 ? 115 MET A CG    1 
ATOM   757   S  SD    . MET A 1 115 ? -1.276  23.381  1.281   1.00 48.32 ? 115 MET A SD    1 
ATOM   758   C  CE    . MET A 1 115 ? -1.938  24.179  -0.181  1.00 46.46 ? 115 MET A CE    1 
ATOM   759   N  N     . VAL A 1 116 ? 4.487   22.464  -0.620  1.00 45.13 ? 116 VAL A N     1 
ATOM   760   C  CA    . VAL A 1 116 ? 5.721   22.798  -1.326  1.00 44.24 ? 116 VAL A CA    1 
ATOM   761   C  C     . VAL A 1 116 ? 6.691   21.633  -1.174  1.00 44.62 ? 116 VAL A C     1 
ATOM   762   O  O     . VAL A 1 116 ? 6.548   20.838  -0.250  1.00 45.75 ? 116 VAL A O     1 
ATOM   763   C  CB    . VAL A 1 116 ? 6.379   24.120  -0.826  1.00 44.21 ? 116 VAL A CB    1 
ATOM   764   C  CG1   . VAL A 1 116 ? 5.483   25.308  -1.124  1.00 43.07 ? 116 VAL A CG1   1 
ATOM   765   C  CG2   . VAL A 1 116 ? 6.744   24.057  0.658   1.00 44.57 ? 116 VAL A CG2   1 
ATOM   766   N  N     . ALA A 1 117 ? 7.656   21.528  -2.086  1.00 43.92 ? 117 ALA A N     1 
ATOM   767   C  CA    . ALA A 1 117 ? 8.637   20.444  -2.061  1.00 44.42 ? 117 ALA A CA    1 
ATOM   768   C  C     . ALA A 1 117 ? 9.641   20.693  -0.959  1.00 45.45 ? 117 ALA A C     1 
ATOM   769   O  O     . ALA A 1 117 ? 9.942   21.843  -0.638  1.00 45.52 ? 117 ALA A O     1 
ATOM   770   C  CB    . ALA A 1 117 ? 9.344   20.328  -3.404  1.00 43.72 ? 117 ALA A CB    1 
ATOM   771   N  N     . LYS A 1 118 ? 10.149  19.614  -0.370  1.00 46.80 ? 118 LYS A N     1 
ATOM   772   C  CA    . LYS A 1 118 ? 11.186  19.702  0.658   1.00 47.63 ? 118 LYS A CA    1 
ATOM   773   C  C     . LYS A 1 118 ? 12.448  20.421  0.166   1.00 47.45 ? 118 LYS A C     1 
ATOM   774   O  O     . LYS A 1 118 ? 13.032  21.221  0.902   1.00 47.75 ? 118 LYS A O     1 
ATOM   775   C  CB    . LYS A 1 118 ? 11.545  18.312  1.183   1.00 48.69 ? 118 LYS A CB    1 
ATOM   776   C  CG    . LYS A 1 118 ? 12.289  18.350  2.507   1.00 50.39 ? 118 LYS A CG    1 
ATOM   777   C  CD    . LYS A 1 118 ? 12.581  16.956  3.054   1.00 51.73 ? 118 LYS A CD    1 
ATOM   778   C  CE    . LYS A 1 118 ? 13.184  17.047  4.446   1.00 53.18 ? 118 LYS A CE    1 
ATOM   779   N  NZ    . LYS A 1 118 ? 14.188  18.139  4.523   1.00 52.62 ? 118 LYS A NZ    1 
ATOM   780   N  N     . SER A 1 119 ? 12.853  20.141  -1.074  1.00 46.94 ? 119 SER A N     1 
ATOM   781   C  CA    . SER A 1 119 ? 14.087  20.697  -1.635  1.00 47.03 ? 119 SER A CA    1 
ATOM   782   C  C     . SER A 1 119 ? 13.966  22.208  -1.804  1.00 46.17 ? 119 SER A C     1 
ATOM   783   O  O     . SER A 1 119 ? 14.910  22.943  -1.510  1.00 46.59 ? 119 SER A O     1 
ATOM   784   C  CB    . SER A 1 119 ? 14.451  20.021  -2.961  1.00 46.72 ? 119 SER A CB    1 
ATOM   785   O  OG    . SER A 1 119 ? 13.444  20.238  -3.935  1.00 46.62 ? 119 SER A OG    1 
ATOM   786   N  N     . THR A 1 120 ? 12.791  22.667  -2.240  1.00 45.04 ? 120 THR A N     1 
ATOM   787   C  CA    . THR A 1 120 ? 12.480  24.099  -2.257  1.00 44.08 ? 120 THR A CA    1 
ATOM   788   C  C     . THR A 1 120 ? 12.511  24.727  -0.852  1.00 44.89 ? 120 THR A C     1 
ATOM   789   O  O     . THR A 1 120 ? 13.113  25.791  -0.674  1.00 45.10 ? 120 THR A O     1 
ATOM   790   C  CB    . THR A 1 120 ? 11.139  24.400  -2.983  1.00 42.97 ? 120 THR A CB    1 
ATOM   791   O  OG1   . THR A 1 120 ? 11.259  24.057  -4.368  1.00 41.78 ? 120 THR A OG1   1 
ATOM   792   C  CG2   . THR A 1 120 ? 10.784  25.874  -2.894  1.00 42.38 ? 120 THR A CG2   1 
ATOM   793   N  N     . LEU A 1 121 ? 11.893  24.086  0.144   1.00 45.51 ? 121 LEU A N     1 
ATOM   794   C  CA    . LEU A 1 121 ? 11.875  24.667  1.498   1.00 46.10 ? 121 LEU A CA    1 
ATOM   795   C  C     . LEU A 1 121 ? 13.293  24.792  2.026   1.00 47.10 ? 121 LEU A C     1 
ATOM   796   O  O     . LEU A 1 121 ? 13.650  25.811  2.619   1.00 47.44 ? 121 LEU A O     1 
ATOM   797   C  CB    . LEU A 1 121 ? 11.044  23.839  2.487   1.00 46.73 ? 121 LEU A CB    1 
ATOM   798   C  CG    . LEU A 1 121 ? 10.240  24.533  3.611   1.00 46.69 ? 121 LEU A CG    1 
ATOM   799   C  CD1   . LEU A 1 121 ? 10.157  23.636  4.815   1.00 48.00 ? 121 LEU A CD1   1 
ATOM   800   C  CD2   . LEU A 1 121 ? 10.741  25.885  4.056   1.00 44.63 ? 121 LEU A CD2   1 
ATOM   801   N  N     . ASP A 1 122 ? 14.095  23.754  1.802   1.00 47.96 ? 122 ASP A N     1 
ATOM   802   C  CA    . ASP A 1 122 ? 15.464  23.709  2.310   1.00 49.36 ? 122 ASP A CA    1 
ATOM   803   C  C     . ASP A 1 122 ? 16.322  24.786  1.689   1.00 48.91 ? 122 ASP A C     1 
ATOM   804   O  O     . ASP A 1 122 ? 17.152  25.377  2.371   1.00 49.51 ? 122 ASP A O     1 
ATOM   805   C  CB    . ASP A 1 122 ? 16.092  22.336  2.073   1.00 50.32 ? 122 ASP A CB    1 
ATOM   806   C  CG    . ASP A 1 122 ? 15.528  21.270  2.989   1.00 52.18 ? 122 ASP A CG    1 
ATOM   807   O  OD1   . ASP A 1 122 ? 14.779  21.605  3.939   1.00 52.84 ? 122 ASP A OD1   1 
ATOM   808   O  OD2   . ASP A 1 122 ? 15.842  20.082  2.759   1.00 55.17 ? 122 ASP A OD2   1 
ATOM   809   N  N     . ILE A 1 123 ? 16.120  25.037  0.395   1.00 48.20 ? 123 ILE A N     1 
ATOM   810   C  CA    . ILE A 1 123 ? 16.787  26.150  -0.282  1.00 48.13 ? 123 ILE A CA    1 
ATOM   811   C  C     . ILE A 1 123 ? 16.337  27.467  0.342   1.00 47.97 ? 123 ILE A C     1 
ATOM   812   O  O     . ILE A 1 123 ? 17.169  28.310  0.678   1.00 49.17 ? 123 ILE A O     1 
ATOM   813   C  CB    . ILE A 1 123 ? 16.565  26.145  -1.823  1.00 47.24 ? 123 ILE A CB    1 
ATOM   814   C  CG1   . ILE A 1 123 ? 17.340  24.987  -2.453  1.00 47.76 ? 123 ILE A CG1   1 
ATOM   815   C  CG2   . ILE A 1 123 ? 17.028  27.476  -2.432  1.00 46.22 ? 123 ILE A CG2   1 
ATOM   816   C  CD1   . ILE A 1 123 ? 16.775  24.479  -3.751  1.00 47.34 ? 123 ILE A CD1   1 
ATOM   817   N  N     . VAL A 1 124 ? 15.033  27.628  0.541   1.00 47.26 ? 124 VAL A N     1 
ATOM   818   C  CA    . VAL A 1 124 ? 14.518  28.834  1.186   1.00 47.00 ? 124 VAL A CA    1 
ATOM   819   C  C     . VAL A 1 124 ? 15.115  29.048  2.577   1.00 48.47 ? 124 VAL A C     1 
ATOM   820   O  O     . VAL A 1 124 ? 15.635  30.123  2.854   1.00 48.91 ? 124 VAL A O     1 
ATOM   821   C  CB    . VAL A 1 124 ? 12.976  28.860  1.257   1.00 46.51 ? 124 VAL A CB    1 
ATOM   822   C  CG1   . VAL A 1 124 ? 12.501  29.957  2.213   1.00 46.28 ? 124 VAL A CG1   1 
ATOM   823   C  CG2   . VAL A 1 124 ? 12.367  29.053  -0.151  1.00 44.94 ? 124 VAL A CG2   1 
ATOM   824   N  N     . LEU A 1 125 ? 15.053  28.031  3.438   1.00 49.43 ? 125 LEU A N     1 
ATOM   825   C  CA    . LEU A 1 125 ? 15.536  28.159  4.816   1.00 50.66 ? 125 LEU A CA    1 
ATOM   826   C  C     . LEU A 1 125 ? 17.029  28.433  4.904   1.00 51.34 ? 125 LEU A C     1 
ATOM   827   O  O     . LEU A 1 125 ? 17.463  29.217  5.727   1.00 52.11 ? 125 LEU A O     1 
ATOM   828   C  CB    . LEU A 1 125 ? 15.195  26.920  5.642   1.00 51.53 ? 125 LEU A CB    1 
ATOM   829   C  CG    . LEU A 1 125 ? 13.721  26.687  5.970   1.00 51.72 ? 125 LEU A CG    1 
ATOM   830   C  CD1   . LEU A 1 125 ? 13.555  25.392  6.764   1.00 51.84 ? 125 LEU A CD1   1 
ATOM   831   C  CD2   . LEU A 1 125 ? 13.118  27.873  6.716   1.00 51.86 ? 125 LEU A CD2   1 
ATOM   832   N  N     . ALA A 1 126 ? 17.804  27.780  4.048   1.00 51.69 ? 126 ALA A N     1 
ATOM   833   C  CA    . ALA A 1 126 ? 19.244  27.992  3.977   1.00 52.58 ? 126 ALA A CA    1 
ATOM   834   C  C     . ALA A 1 126 ? 19.593  29.393  3.468   1.00 52.11 ? 126 ALA A C     1 
ATOM   835   O  O     . ALA A 1 126 ? 20.723  29.841  3.614   1.00 52.44 ? 126 ALA A O     1 
ATOM   836   C  CB    . ALA A 1 126 ? 19.880  26.934  3.081   1.00 52.86 ? 126 ALA A CB    1 
ATOM   837   N  N     . ASN A 1 127 ? 18.622  30.076  2.863   1.00 51.15 ? 127 ASN A N     1 
ATOM   838   C  CA    . ASN A 1 127 ? 18.864  31.389  2.266   1.00 50.78 ? 127 ASN A CA    1 
ATOM   839   C  C     . ASN A 1 127 ? 17.806  32.403  2.646   1.00 50.47 ? 127 ASN A C     1 
ATOM   840   O  O     . ASN A 1 127 ? 17.557  33.351  1.902   1.00 49.31 ? 127 ASN A O     1 
ATOM   841   C  CB    . ASN A 1 127 ? 18.944  31.272  0.739   1.00 49.45 ? 127 ASN A CB    1 
ATOM   842   C  CG    . ASN A 1 127 ? 20.150  30.491  0.285   1.00 50.12 ? 127 ASN A CG    1 
ATOM   843   O  OD1   . ASN A 1 127 ? 20.039  29.331  -0.092  1.00 50.21 ? 127 ASN A OD1   1 
ATOM   844   N  ND2   . ASN A 1 127 ? 21.318  31.113  0.346   1.00 50.08 ? 127 ASN A ND2   1 
ATOM   845   N  N     . LYS A 1 128 ? 17.198  32.206  3.812   1.00 51.78 ? 128 LYS A N     1 
ATOM   846   C  CA    . LYS A 1 128 ? 16.007  32.963  4.177   1.00 52.12 ? 128 LYS A CA    1 
ATOM   847   C  C     . LYS A 1 128 ? 16.263  34.444  4.428   1.00 52.47 ? 128 LYS A C     1 
ATOM   848   O  O     . LYS A 1 128 ? 15.400  35.273  4.138   1.00 52.03 ? 128 LYS A O     1 
ATOM   849   C  CB    . LYS A 1 128 ? 15.222  32.300  5.321   1.00 52.85 ? 128 LYS A CB    1 
ATOM   850   C  CG    . LYS A 1 128 ? 15.901  32.227  6.666   1.00 55.00 ? 128 LYS A CG    1 
ATOM   851   C  CD    . LYS A 1 128 ? 14.854  31.960  7.731   1.00 57.16 ? 128 LYS A CD    1 
ATOM   852   C  CE    . LYS A 1 128 ? 15.474  31.600  9.065   1.00 60.40 ? 128 LYS A CE    1 
ATOM   853   N  NZ    . LYS A 1 128 ? 14.430  31.578  10.134  1.00 61.71 ? 128 LYS A NZ    1 
ATOM   854   N  N     . ASP A 1 129 ? 17.446  34.779  4.932   1.00 53.60 ? 129 ASP A N     1 
ATOM   855   C  CA    . ASP A 1 129 ? 17.835  36.183  5.050   1.00 53.94 ? 129 ASP A CA    1 
ATOM   856   C  C     . ASP A 1 129 ? 17.703  36.936  3.718   1.00 52.42 ? 129 ASP A C     1 
ATOM   857   O  O     . ASP A 1 129 ? 16.946  37.902  3.617   1.00 51.92 ? 129 ASP A O     1 
ATOM   858   C  CB    . ASP A 1 129 ? 19.249  36.311  5.623   1.00 55.48 ? 129 ASP A CB    1 
ATOM   859   C  CG    . ASP A 1 129 ? 19.277  36.175  7.133   1.00 58.04 ? 129 ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1 129 ? 18.181  36.031  7.735   1.00 58.68 ? 129 ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1 129 ? 20.390  36.211  7.714   1.00 60.18 ? 129 ASP A OD2   1 
ATOM   862   N  N     . ARG A 1 130 ? 18.418  36.475  2.698   1.00 51.68 ? 130 ARG A N     1 
ATOM   863   C  CA    . ARG A 1 130 ? 18.404  37.135  1.403   1.00 50.42 ? 130 ARG A CA    1 
ATOM   864   C  C     . ARG A 1 130 ? 17.004  37.105  0.733   1.00 48.78 ? 130 ARG A C     1 
ATOM   865   O  O     . ARG A 1 130 ? 16.552  38.121  0.189   1.00 48.14 ? 130 ARG A O     1 
ATOM   866   C  CB    . ARG A 1 130 ? 19.507  36.553  0.511   1.00 50.95 ? 130 ARG A CB    1 
ATOM   867   C  CG    . ARG A 1 130 ? 19.839  37.370  -0.725  1.00 50.93 ? 130 ARG A CG    1 
ATOM   868   C  CD    . ARG A 1 130 ? 21.355  37.563  -0.862  1.00 54.91 ? 130 ARG A CD    1 
ATOM   869   N  NE    . ARG A 1 130 ? 22.029  36.575  -1.715  1.00 55.60 ? 130 ARG A NE    1 
ATOM   870   C  CZ    . ARG A 1 130 ? 22.142  36.668  -3.042  1.00 54.39 ? 130 ARG A CZ    1 
ATOM   871   N  NH1   . ARG A 1 130 ? 21.602  37.692  -3.703  1.00 52.87 ? 130 ARG A NH1   1 
ATOM   872   N  NH2   . ARG A 1 130 ? 22.783  35.721  -3.714  1.00 54.15 ? 130 ARG A NH2   1 
ATOM   873   N  N     . LEU A 1 131 ? 16.317  35.962  0.814   1.00 47.80 ? 131 LEU A N     1 
ATOM   874   C  CA    . LEU A 1 131 ? 14.998  35.783  0.186   1.00 46.18 ? 131 LEU A CA    1 
ATOM   875   C  C     . LEU A 1 131 ? 13.845  36.548  0.852   1.00 45.83 ? 131 LEU A C     1 
ATOM   876   O  O     . LEU A 1 131 ? 13.064  37.190  0.155   1.00 45.12 ? 131 LEU A O     1 
ATOM   877   C  CB    . LEU A 1 131 ? 14.637  34.299  0.064   1.00 46.11 ? 131 LEU A CB    1 
ATOM   878   C  CG    . LEU A 1 131 ? 15.431  33.479  -0.953  1.00 46.27 ? 131 LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1 131 ? 15.066  32.012  -0.846  1.00 46.18 ? 131 LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1 131 ? 15.211  33.990  -2.378  1.00 45.06 ? 131 LEU A CD2   1 
ATOM   881   N  N     . ASN A 1 132 ? 13.722  36.455  2.177   1.00 46.29 ? 132 ASN A N     1 
ATOM   882   C  CA    . ASN A 1 132 ? 12.698  37.196  2.918   1.00 46.48 ? 132 ASN A CA    1 
ATOM   883   C  C     . ASN A 1 132 ? 12.780  38.705  2.700   1.00 46.22 ? 132 ASN A C     1 
ATOM   884   O  O     . ASN A 1 132 ? 11.754  39.382  2.589   1.00 45.65 ? 132 ASN A O     1 
ATOM   885   C  CB    . ASN A 1 132 ? 12.768  36.918  4.431   1.00 47.50 ? 132 ASN A CB    1 
ATOM   886   C  CG    . ASN A 1 132 ? 12.200  35.552  4.826   1.00 47.76 ? 132 ASN A CG    1 
ATOM   887   O  OD1   . ASN A 1 132 ? 11.456  34.917  4.076   1.00 47.26 ? 132 ASN A OD1   1 
ATOM   888   N  ND2   . ASN A 1 132 ? 12.547  35.105  6.025   1.00 47.83 ? 132 ASN A ND2   1 
ATOM   889   N  N     . SER A 1 133 ? 14.005  39.219  2.631   1.00 46.65 ? 133 SER A N     1 
ATOM   890   C  CA    . SER A 1 133 ? 14.233  40.665  2.617   1.00 46.47 ? 133 SER A CA    1 
ATOM   891   C  C     . SER A 1 133 ? 14.171  41.274  1.222   1.00 44.98 ? 133 SER A C     1 
ATOM   892   O  O     . SER A 1 133 ? 13.903  42.473  1.081   1.00 44.85 ? 133 SER A O     1 
ATOM   893   C  CB    . SER A 1 133 ? 15.550  41.025  3.325   1.00 47.61 ? 133 SER A CB    1 
ATOM   894   O  OG    . SER A 1 133 ? 16.679  40.565  2.604   1.00 48.70 ? 133 SER A OG    1 
ATOM   895   N  N     . ALA A 1 134 ? 14.385  40.448  0.196   1.00 43.78 ? 134 ALA A N     1 
ATOM   896   C  CA    . ALA A 1 134 ? 14.365  40.919  -1.196  1.00 41.98 ? 134 ALA A CA    1 
ATOM   897   C  C     . ALA A 1 134 ? 12.945  41.231  -1.677  1.00 40.64 ? 134 ALA A C     1 
ATOM   898   O  O     . ALA A 1 134 ? 12.740  41.945  -2.666  1.00 39.82 ? 134 ALA A O     1 
ATOM   899   C  CB    . ALA A 1 134 ? 15.016  39.903  -2.105  1.00 41.71 ? 134 ALA A CB    1 
ATOM   900   N  N     . ILE A 1 135 ? 11.965  40.702  -0.965  1.00 40.10 ? 135 ILE A N     1 
ATOM   901   C  CA    . ILE A 1 135 ? 10.585  40.838  -1.390  1.00 38.96 ? 135 ILE A CA    1 
ATOM   902   C  C     . ILE A 1 135 ? 10.046  42.224  -1.051  1.00 38.62 ? 135 ILE A C     1 
ATOM   903   O  O     . ILE A 1 135 ? 10.353  42.781  0.008   1.00 38.71 ? 135 ILE A O     1 
ATOM   904   C  CB    . ILE A 1 135 ? 9.707   39.726  -0.791  1.00 39.10 ? 135 ILE A CB    1 
ATOM   905   C  CG1   . ILE A 1 135 ? 10.105  38.375  -1.399  1.00 38.92 ? 135 ILE A CG1   1 
ATOM   906   C  CG2   . ILE A 1 135 ? 8.249   40.031  -1.015  1.00 37.51 ? 135 ILE A CG2   1 
ATOM   907   C  CD1   . ILE A 1 135 ? 9.490   37.187  -0.714  1.00 40.84 ? 135 ILE A CD1   1 
ATOM   908   N  N     . ILE A 1 136 ? 9.267   42.770  -1.988  1.00 37.48 ? 136 ILE A N     1 
ATOM   909   C  CA    . ILE A 1 136 ? 8.630   44.062  -1.834  1.00 37.07 ? 136 ILE A CA    1 
ATOM   910   C  C     . ILE A 1 136 ? 7.117   43.856  -1.813  1.00 37.04 ? 136 ILE A C     1 
ATOM   911   O  O     . ILE A 1 136 ? 6.479   43.671  -2.844  1.00 36.47 ? 136 ILE A O     1 
ATOM   912   C  CB    . ILE A 1 136 ? 9.090   45.059  -2.933  1.00 36.72 ? 136 ILE A CB    1 
ATOM   913   C  CG1   . ILE A 1 136 ? 10.620  45.252  -2.865  1.00 37.26 ? 136 ILE A CG1   1 
ATOM   914   C  CG2   . ILE A 1 136 ? 8.366   46.402  -2.786  1.00 35.89 ? 136 ILE A CG2   1 
ATOM   915   C  CD1   . ILE A 1 136 ? 11.220  46.158  -3.941  1.00 36.73 ? 136 ILE A CD1   1 
ATOM   916   N  N     . TYR A 1 137 ? 6.547   43.877  -0.617  1.00 37.96 ? 137 TYR A N     1 
ATOM   917   C  CA    . TYR A 1 137 ? 5.140   43.581  -0.454  1.00 38.54 ? 137 TYR A CA    1 
ATOM   918   C  C     . TYR A 1 137 ? 4.206   44.636  -1.040  1.00 38.62 ? 137 TYR A C     1 
ATOM   919   O  O     . TYR A 1 137 ? 3.061   44.327  -1.338  1.00 38.48 ? 137 TYR A O     1 
ATOM   920   C  CB    . TYR A 1 137 ? 4.816   43.252  1.007   1.00 39.36 ? 137 TYR A CB    1 
ATOM   921   C  CG    . TYR A 1 137 ? 5.402   41.920  1.396   1.00 40.24 ? 137 TYR A CG    1 
ATOM   922   C  CD1   . TYR A 1 137 ? 6.474   41.844  2.288   1.00 40.29 ? 137 TYR A CD1   1 
ATOM   923   C  CD2   . TYR A 1 137 ? 4.926   40.730  0.825   1.00 39.16 ? 137 TYR A CD2   1 
ATOM   924   C  CE1   . TYR A 1 137 ? 7.034   40.623  2.626   1.00 40.36 ? 137 TYR A CE1   1 
ATOM   925   C  CE2   . TYR A 1 137 ? 5.480   39.504  1.161   1.00 39.19 ? 137 TYR A CE2   1 
ATOM   926   C  CZ    . TYR A 1 137 ? 6.535   39.461  2.058   1.00 40.25 ? 137 TYR A CZ    1 
ATOM   927   O  OH    . TYR A 1 137 ? 7.098   38.257  2.403   1.00 41.50 ? 137 TYR A OH    1 
ATOM   928   N  N     . ASP A 1 138 ? 4.701   45.860  -1.228  1.00 39.13 ? 138 ASP A N     1 
ATOM   929   C  CA    . ASP A 1 138 ? 3.929   46.898  -1.910  1.00 39.62 ? 138 ASP A CA    1 
ATOM   930   C  C     . ASP A 1 138 ? 3.590   46.496  -3.356  1.00 38.66 ? 138 ASP A C     1 
ATOM   931   O  O     . ASP A 1 138 ? 2.639   47.016  -3.935  1.00 38.72 ? 138 ASP A O     1 
ATOM   932   C  CB    . ASP A 1 138 ? 4.657   48.248  -1.883  1.00 39.98 ? 138 ASP A CB    1 
ATOM   933   C  CG    . ASP A 1 138 ? 3.874   49.354  -2.605  1.00 42.31 ? 138 ASP A CG    1 
ATOM   934   O  OD1   . ASP A 1 138 ? 2.722   49.659  -2.205  1.00 45.21 ? 138 ASP A OD1   1 
ATOM   935   O  OD2   . ASP A 1 138 ? 4.413   49.926  -3.578  1.00 44.39 ? 138 ASP A OD2   1 
ATOM   936   N  N     . ARG A 1 139 ? 4.359   45.570  -3.929  1.00 38.23 ? 139 ARG A N     1 
ATOM   937   C  CA    . ARG A 1 139 ? 4.058   45.041  -5.271  1.00 37.61 ? 139 ARG A CA    1 
ATOM   938   C  C     . ARG A 1 139 ? 2.748   44.236  -5.338  1.00 37.79 ? 139 ARG A C     1 
ATOM   939   O  O     . ARG A 1 139 ? 2.187   44.072  -6.409  1.00 37.74 ? 139 ARG A O     1 
ATOM   940   C  CB    . ARG A 1 139 ? 5.241   44.253  -5.837  1.00 36.84 ? 139 ARG A CB    1 
ATOM   941   C  CG    . ARG A 1 139 ? 6.415   45.138  -6.221  1.00 36.83 ? 139 ARG A CG    1 
ATOM   942   C  CD    . ARG A 1 139 ? 7.695   44.358  -6.465  1.00 36.73 ? 139 ARG A CD    1 
ATOM   943   N  NE    . ARG A 1 139 ? 8.806   45.257  -6.776  1.00 38.76 ? 139 ARG A NE    1 
ATOM   944   C  CZ    . ARG A 1 139 ? 10.069  44.885  -6.975  1.00 38.65 ? 139 ARG A CZ    1 
ATOM   945   N  NH1   . ARG A 1 139 ? 10.428  43.614  -6.918  1.00 37.60 ? 139 ARG A NH1   1 
ATOM   946   N  NH2   . ARG A 1 139 ? 10.986  45.804  -7.232  1.00 40.33 ? 139 ARG A NH2   1 
ATOM   947   N  N     . ASP A 1 140 ? 2.256   43.758  -4.195  1.00 38.85 ? 140 ASP A N     1 
ATOM   948   C  CA    . ASP A 1 140 ? 0.940   43.103  -4.117  1.00 39.58 ? 140 ASP A CA    1 
ATOM   949   C  C     . ASP A 1 140 ? -0.202  44.005  -4.572  1.00 39.92 ? 140 ASP A C     1 
ATOM   950   O  O     . ASP A 1 140 ? -1.239  43.514  -5.000  1.00 39.99 ? 140 ASP A O     1 
ATOM   951   C  CB    . ASP A 1 140 ? 0.649   42.643  -2.690  1.00 40.18 ? 140 ASP A CB    1 
ATOM   952   C  CG    . ASP A 1 140 ? 1.344   41.355  -2.330  1.00 41.54 ? 140 ASP A CG    1 
ATOM   953   O  OD1   . ASP A 1 140 ? 1.214   40.932  -1.158  1.00 43.70 ? 140 ASP A OD1   1 
ATOM   954   O  OD2   . ASP A 1 140 ? 2.019   40.751  -3.198  1.00 41.95 ? 140 ASP A OD2   1 
ATOM   955   N  N     . PHE A 1 141 ? -0.010  45.320  -4.443  1.00 40.82 ? 141 PHE A N     1 
ATOM   956   C  CA    . PHE A 1 141 ? -1.015  46.318  -4.805  1.00 41.63 ? 141 PHE A CA    1 
ATOM   957   C  C     . PHE A 1 141 ? -0.945  46.705  -6.291  1.00 41.81 ? 141 PHE A C     1 
ATOM   958   O  O     . PHE A 1 141 ? -1.648  47.618  -6.735  1.00 42.21 ? 141 PHE A O     1 
ATOM   959   C  CB    . PHE A 1 141 ? -0.849  47.582  -3.944  1.00 42.01 ? 141 PHE A CB    1 
ATOM   960   C  CG    . PHE A 1 141 ? -0.985  47.348  -2.458  1.00 42.46 ? 141 PHE A CG    1 
ATOM   961   C  CD1   . PHE A 1 141 ? -2.237  47.173  -1.872  1.00 43.43 ? 141 PHE A CD1   1 
ATOM   962   C  CD2   . PHE A 1 141 ? 0.136   47.330  -1.640  1.00 43.55 ? 141 PHE A CD2   1 
ATOM   963   C  CE1   . PHE A 1 141 ? -2.372  46.971  -0.488  1.00 43.81 ? 141 PHE A CE1   1 
ATOM   964   C  CE2   . PHE A 1 141 ? 0.014   47.119  -0.248  1.00 44.84 ? 141 PHE A CE2   1 
ATOM   965   C  CZ    . PHE A 1 141 ? -1.249  46.940  0.324   1.00 43.95 ? 141 PHE A CZ    1 
ATOM   966   N  N     . SER A 1 142 ? -0.107  46.019  -7.064  1.00 41.65 ? 142 SER A N     1 
ATOM   967   C  CA    . SER A 1 142 ? 0.099   46.413  -8.450  1.00 41.85 ? 142 SER A CA    1 
ATOM   968   C  C     . SER A 1 142 ? -0.884  45.770  -9.442  1.00 41.44 ? 142 SER A C     1 
ATOM   969   O  O     . SER A 1 142 ? -0.843  46.068  -10.630 1.00 41.98 ? 142 SER A O     1 
ATOM   970   C  CB    . SER A 1 142 ? 1.561   46.196  -8.870  1.00 41.67 ? 142 SER A CB    1 
ATOM   971   O  OG    . SER A 1 142 ? 1.918   44.827  -8.773  1.00 43.06 ? 142 SER A OG    1 
ATOM   972   N  N     . TYR A 1 143 ? -1.760  44.895  -8.953  1.00 41.34 ? 143 TYR A N     1 
ATOM   973   C  CA    . TYR A 1 143 ? -2.809  44.268  -9.775  1.00 40.81 ? 143 TYR A CA    1 
ATOM   974   C  C     . TYR A 1 143 ? -4.094  45.027  -9.539  1.00 40.67 ? 143 TYR A C     1 
ATOM   975   O  O     . TYR A 1 143 ? -4.314  45.516  -8.439  1.00 41.58 ? 143 TYR A O     1 
ATOM   976   C  CB    . TYR A 1 143 ? -3.011  42.781  -9.387  1.00 41.15 ? 143 TYR A CB    1 
ATOM   977   C  CG    . TYR A 1 143 ? -1.723  41.987  -9.386  1.00 41.21 ? 143 TYR A CG    1 
ATOM   978   C  CD1   . TYR A 1 143 ? -0.941  41.891  -8.232  1.00 41.94 ? 143 TYR A CD1   1 
ATOM   979   C  CD2   . TYR A 1 143 ? -1.256  41.379  -10.552 1.00 40.43 ? 143 TYR A CD2   1 
ATOM   980   C  CE1   . TYR A 1 143 ? 0.267   41.195  -8.240  1.00 41.59 ? 143 TYR A CE1   1 
ATOM   981   C  CE2   . TYR A 1 143 ? -0.054  40.683  -10.571 1.00 40.15 ? 143 TYR A CE2   1 
ATOM   982   C  CZ    . TYR A 1 143 ? 0.701   40.594  -9.414  1.00 41.06 ? 143 TYR A CZ    1 
ATOM   983   O  OH    . TYR A 1 143 ? 1.897   39.903  -9.432  1.00 41.37 ? 143 TYR A OH    1 
ATOM   984   N  N     . ASN A 1 144 ? -4.941  45.147  -10.553 1.00 39.75 ? 144 ASN A N     1 
ATOM   985   C  CA    . ASN A 1 144 ? -6.270  45.693  -10.312 1.00 39.72 ? 144 ASN A CA    1 
ATOM   986   C  C     . ASN A 1 144 ? -7.158  44.623  -9.661  1.00 39.47 ? 144 ASN A C     1 
ATOM   987   O  O     . ASN A 1 144 ? -6.743  43.471  -9.522  1.00 38.86 ? 144 ASN A O     1 
ATOM   988   C  CB    . ASN A 1 144 ? -6.891  46.294  -11.589 1.00 39.81 ? 144 ASN A CB    1 
ATOM   989   C  CG    . ASN A 1 144 ? -7.420  45.239  -12.557 1.00 40.46 ? 144 ASN A CG    1 
ATOM   990   O  OD1   . ASN A 1 144 ? -7.903  44.182  -12.160 1.00 41.38 ? 144 ASN A OD1   1 
ATOM   991   N  ND2   . ASN A 1 144 ? -7.340  45.541  -13.842 1.00 42.11 ? 144 ASN A ND2   1 
ATOM   992   N  N     . TYR A 1 145 ? -8.373  45.007  -9.280  1.00 39.27 ? 145 TYR A N     1 
ATOM   993   C  CA    . TYR A 1 145 ? -9.285  44.124  -8.569  1.00 39.22 ? 145 TYR A CA    1 
ATOM   994   C  C     . TYR A 1 145 ? -9.507  42.774  -9.249  1.00 38.47 ? 145 TYR A C     1 
ATOM   995   O  O     . TYR A 1 145 ? -9.471  41.727  -8.602  1.00 38.57 ? 145 TYR A O     1 
ATOM   996   C  CB    . TYR A 1 145 ? -10.633 44.805  -8.400  1.00 39.96 ? 145 TYR A CB    1 
ATOM   997   C  CG    . TYR A 1 145 ? -11.592 44.038  -7.528  1.00 40.96 ? 145 TYR A CG    1 
ATOM   998   C  CD1   . TYR A 1 145 ? -11.389 43.952  -6.148  1.00 41.56 ? 145 TYR A CD1   1 
ATOM   999   C  CD2   . TYR A 1 145 ? -12.716 43.407  -8.072  1.00 40.97 ? 145 TYR A CD2   1 
ATOM   1000  C  CE1   . TYR A 1 145 ? -12.286 43.265  -5.331  1.00 42.06 ? 145 TYR A CE1   1 
ATOM   1001  C  CE2   . TYR A 1 145 ? -13.617 42.712  -7.256  1.00 40.44 ? 145 TYR A CE2   1 
ATOM   1002  C  CZ    . TYR A 1 145 ? -13.386 42.648  -5.894  1.00 41.37 ? 145 TYR A CZ    1 
ATOM   1003  O  OH    . TYR A 1 145 ? -14.254 41.972  -5.079  1.00 43.87 ? 145 TYR A OH    1 
ATOM   1004  N  N     . PHE A 1 146 ? -9.745  42.813  -10.552 1.00 37.32 ? 146 PHE A N     1 
ATOM   1005  C  CA    . PHE A 1 146 ? -10.085 41.623  -11.314 1.00 36.67 ? 146 PHE A CA    1 
ATOM   1006  C  C     . PHE A 1 146 ? -8.885  40.705  -11.491 1.00 35.79 ? 146 PHE A C     1 
ATOM   1007  O  O     . PHE A 1 146 ? -9.024  39.482  -11.409 1.00 35.40 ? 146 PHE A O     1 
ATOM   1008  C  CB    . PHE A 1 146 ? -10.712 42.048  -12.641 1.00 36.33 ? 146 PHE A CB    1 
ATOM   1009  C  CG    . PHE A 1 146 ? -11.771 43.084  -12.462 1.00 37.05 ? 146 PHE A CG    1 
ATOM   1010  C  CD1   . PHE A 1 146 ? -13.058 42.717  -12.061 1.00 37.47 ? 146 PHE A CD1   1 
ATOM   1011  C  CD2   . PHE A 1 146 ? -11.475 44.436  -12.611 1.00 35.89 ? 146 PHE A CD2   1 
ATOM   1012  C  CE1   . PHE A 1 146 ? -14.039 43.679  -11.853 1.00 37.12 ? 146 PHE A CE1   1 
ATOM   1013  C  CE2   . PHE A 1 146 ? -12.448 45.398  -12.399 1.00 36.63 ? 146 PHE A CE2   1 
ATOM   1014  C  CZ    . PHE A 1 146 ? -13.734 45.019  -12.026 1.00 37.38 ? 146 PHE A CZ    1 
ATOM   1015  N  N     . GLY A 1 147 ? -7.709  41.306  -11.683 1.00 35.01 ? 147 GLY A N     1 
ATOM   1016  C  CA    . GLY A 1 147 ? -6.446  40.563  -11.760 1.00 34.51 ? 147 GLY A CA    1 
ATOM   1017  C  C     . GLY A 1 147 ? -6.061  39.921  -10.439 1.00 34.66 ? 147 GLY A C     1 
ATOM   1018  O  O     . GLY A 1 147 ? -5.547  38.807  -10.404 1.00 34.65 ? 147 GLY A O     1 
ATOM   1019  N  N     . PHE A 1 148 ? -6.326  40.621  -9.343  1.00 35.33 ? 148 PHE A N     1 
ATOM   1020  C  CA    . PHE A 1 148 ? -6.073  40.072  -8.028  1.00 35.56 ? 148 PHE A CA    1 
ATOM   1021  C  C     . PHE A 1 148 ? -7.057  38.955  -7.686  1.00 36.29 ? 148 PHE A C     1 
ATOM   1022  O  O     . PHE A 1 148 ? -6.684  37.978  -7.038  1.00 36.19 ? 148 PHE A O     1 
ATOM   1023  C  CB    . PHE A 1 148 ? -6.105  41.158  -6.954  1.00 35.93 ? 148 PHE A CB    1 
ATOM   1024  C  CG    . PHE A 1 148 ? -6.218  40.610  -5.554  1.00 36.88 ? 148 PHE A CG    1 
ATOM   1025  C  CD1   . PHE A 1 148 ? -5.091  40.125  -4.890  1.00 35.94 ? 148 PHE A CD1   1 
ATOM   1026  C  CD2   . PHE A 1 148 ? -7.457  40.537  -4.922  1.00 36.48 ? 148 PHE A CD2   1 
ATOM   1027  C  CE1   . PHE A 1 148 ? -5.190  39.586  -3.610  1.00 36.56 ? 148 PHE A CE1   1 
ATOM   1028  C  CE2   . PHE A 1 148 ? -7.570  40.003  -3.634  1.00 37.80 ? 148 PHE A CE2   1 
ATOM   1029  C  CZ    . PHE A 1 148 ? -6.432  39.530  -2.978  1.00 37.67 ? 148 PHE A CZ    1 
ATOM   1030  N  N     . LYS A 1 149 ? -8.314  39.098  -8.102  1.00 37.15 ? 149 LYS A N     1 
ATOM   1031  C  CA    . LYS A 1 149 ? -9.319  38.061  -7.814  1.00 38.12 ? 149 LYS A CA    1 
ATOM   1032  C  C     . LYS A 1 149 ? -9.066  36.765  -8.592  1.00 37.62 ? 149 LYS A C     1 
ATOM   1033  O  O     . LYS A 1 149 ? -9.353  35.671  -8.103  1.00 37.81 ? 149 LYS A O     1 
ATOM   1034  C  CB    . LYS A 1 149 ? -10.735 38.572  -8.022  1.00 38.61 ? 149 LYS A CB    1 
ATOM   1035  C  CG    . LYS A 1 149 ? -11.509 38.672  -6.722  1.00 41.29 ? 149 LYS A CG    1 
ATOM   1036  C  CD    . LYS A 1 149 ? -11.096 39.854  -5.866  1.00 42.89 ? 149 LYS A CD    1 
ATOM   1037  C  CE    . LYS A 1 149 ? -11.259 39.550  -4.372  1.00 44.30 ? 149 LYS A CE    1 
ATOM   1038  N  NZ    . LYS A 1 149 ? -12.534 38.863  -4.079  1.00 44.62 ? 149 LYS A NZ    1 
ATOM   1039  N  N     . THR A 1 150 ? -8.519  36.905  -9.793  1.00 37.03 ? 150 THR A N     1 
ATOM   1040  C  CA    . THR A 1 150 ? -8.007  35.768  -10.547 1.00 37.16 ? 150 THR A CA    1 
ATOM   1041  C  C     . THR A 1 150 ? -6.869  35.074  -9.777  1.00 37.07 ? 150 THR A C     1 
ATOM   1042  O  O     . THR A 1 150 ? -6.897  33.863  -9.598  1.00 37.02 ? 150 THR A O     1 
ATOM   1043  C  CB    . THR A 1 150 ? -7.557  36.197  -11.973 1.00 36.46 ? 150 THR A CB    1 
ATOM   1044  O  OG1   . THR A 1 150 ? -8.705  36.657  -12.695 1.00 36.95 ? 150 THR A OG1   1 
ATOM   1045  C  CG2   . THR A 1 150 ? -6.935  35.030  -12.736 1.00 35.47 ? 150 THR A CG2   1 
ATOM   1046  N  N     . LEU A 1 151 ? -5.888  35.851  -9.316  1.00 37.24 ? 151 LEU A N     1 
ATOM   1047  C  CA    . LEU A 1 151 ? -4.819  35.317  -8.476  1.00 37.84 ? 151 LEU A CA    1 
ATOM   1048  C  C     . LEU A 1 151 ? -5.335  34.599  -7.235  1.00 39.37 ? 151 LEU A C     1 
ATOM   1049  O  O     . LEU A 1 151 ? -4.876  33.507  -6.922  1.00 39.68 ? 151 LEU A O     1 
ATOM   1050  C  CB    . LEU A 1 151 ? -3.872  36.427  -8.033  1.00 37.66 ? 151 LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1 151 ? -2.743  36.853  -8.970  1.00 36.80 ? 151 LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1 151 ? -1.907  37.915  -8.282  1.00 36.06 ? 151 LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1 151 ? -1.890  35.664  -9.356  1.00 34.85 ? 151 LEU A CD2   1 
ATOM   1054  N  N     . GLU A 1 152 ? -6.278  35.221  -6.533  1.00 40.48 ? 152 GLU A N     1 
ATOM   1055  C  CA    . GLU A 1 152 ? -6.728  34.738  -5.235  1.00 42.82 ? 152 GLU A CA    1 
ATOM   1056  C  C     . GLU A 1 152 ? -7.459  33.398  -5.349  1.00 43.26 ? 152 GLU A C     1 
ATOM   1057  O  O     . GLU A 1 152 ? -7.351  32.537  -4.470  1.00 43.79 ? 152 GLU A O     1 
ATOM   1058  C  CB    . GLU A 1 152 ? -7.617  35.798  -4.565  1.00 43.37 ? 152 GLU A CB    1 
ATOM   1059  C  CG    . GLU A 1 152 ? -8.157  35.413  -3.202  1.00 45.68 ? 152 GLU A CG    1 
ATOM   1060  C  CD    . GLU A 1 152 ? -9.041  36.493  -2.597  1.00 47.24 ? 152 GLU A CD    1 
ATOM   1061  O  OE1   . GLU A 1 152 ? -8.523  37.256  -1.753  1.00 50.52 ? 152 GLU A OE1   1 
ATOM   1062  O  OE2   . GLU A 1 152 ? -10.240 36.591  -2.972  1.00 49.33 ? 152 GLU A OE2   1 
ATOM   1063  N  N     . ARG A 1 153 ? -8.168  33.209  -6.454  1.00 43.35 ? 153 ARG A N     1 
ATOM   1064  C  CA    . ARG A 1 153 ? -8.963  32.010  -6.645  1.00 44.46 ? 153 ARG A CA    1 
ATOM   1065  C  C     . ARG A 1 153 ? -8.181  30.736  -7.036  1.00 43.62 ? 153 ARG A C     1 
ATOM   1066  O  O     . ARG A 1 153 ? -8.542  29.652  -6.588  1.00 44.36 ? 153 ARG A O     1 
ATOM   1067  C  CB    . ARG A 1 153 ? -10.125 32.305  -7.593  1.00 44.89 ? 153 ARG A CB    1 
ATOM   1068  C  CG    . ARG A 1 153 ? -9.954  31.885  -9.018  1.00 47.58 ? 153 ARG A CG    1 
ATOM   1069  C  CD    . ARG A 1 153 ? -10.906 30.744  -9.356  1.00 52.85 ? 153 ARG A CD    1 
ATOM   1070  N  NE    . ARG A 1 153 ? -12.259 31.215  -9.670  1.00 56.62 ? 153 ARG A NE    1 
ATOM   1071  C  CZ    . ARG A 1 153 ? -13.233 31.391  -8.775  1.00 59.55 ? 153 ARG A CZ    1 
ATOM   1072  N  NH1   . ARG A 1 153 ? -13.017 31.143  -7.481  1.00 60.57 ? 153 ARG A NH1   1 
ATOM   1073  N  NH2   . ARG A 1 153 ? -14.429 31.822  -9.174  1.00 60.67 ? 153 ARG A NH2   1 
ATOM   1074  N  N     . SER A 1 154 ? -7.121  30.866  -7.834  1.00 42.23 ? 154 SER A N     1 
ATOM   1075  C  CA    . SER A 1 154 ? -6.368  29.692  -8.319  1.00 41.68 ? 154 SER A CA    1 
ATOM   1076  C  C     . SER A 1 154 ? -4.854  29.719  -8.063  1.00 40.66 ? 154 SER A C     1 
ATOM   1077  O  O     . SER A 1 154 ? -4.207  28.679  -8.086  1.00 40.77 ? 154 SER A O     1 
ATOM   1078  C  CB    . SER A 1 154 ? -6.566  29.495  -9.822  1.00 40.69 ? 154 SER A CB    1 
ATOM   1079  O  OG    . SER A 1 154 ? -7.877  29.808  -10.214 1.00 42.25 ? 154 SER A OG    1 
ATOM   1080  N  N     . TYR A 1 155 ? -4.281  30.892  -7.851  1.00 39.54 ? 155 TYR A N     1 
ATOM   1081  C  CA    . TYR A 1 155 ? -2.834  30.996  -7.903  1.00 38.74 ? 155 TYR A CA    1 
ATOM   1082  C  C     . TYR A 1 155 ? -2.159  31.062  -6.527  1.00 39.12 ? 155 TYR A C     1 
ATOM   1083  O  O     . TYR A 1 155 ? -0.976  30.792  -6.409  1.00 38.91 ? 155 TYR A O     1 
ATOM   1084  C  CB    . TYR A 1 155 ? -2.409  32.158  -8.822  1.00 38.14 ? 155 TYR A CB    1 
ATOM   1085  C  CG    . TYR A 1 155 ? -2.745  31.938  -10.284 1.00 37.13 ? 155 TYR A CG    1 
ATOM   1086  C  CD1   . TYR A 1 155 ? -4.057  32.069  -10.744 1.00 37.32 ? 155 TYR A CD1   1 
ATOM   1087  C  CD2   . TYR A 1 155 ? -1.755  31.603  -11.210 1.00 36.93 ? 155 TYR A CD2   1 
ATOM   1088  C  CE1   . TYR A 1 155 ? -4.384  31.849  -12.070 1.00 36.51 ? 155 TYR A CE1   1 
ATOM   1089  C  CE2   . TYR A 1 155 ? -2.065  31.402  -12.557 1.00 35.94 ? 155 TYR A CE2   1 
ATOM   1090  C  CZ    . TYR A 1 155 ? -3.388  31.515  -12.974 1.00 37.63 ? 155 TYR A CZ    1 
ATOM   1091  O  OH    . TYR A 1 155 ? -3.736  31.313  -14.297 1.00 38.61 ? 155 TYR A OH    1 
ATOM   1092  N  N     . LEU A 1 156 ? -2.912  31.394  -5.490  1.00 40.11 ? 156 LEU A N     1 
ATOM   1093  C  CA    . LEU A 1 156 ? -2.334  31.523  -4.150  1.00 40.95 ? 156 LEU A CA    1 
ATOM   1094  C  C     . LEU A 1 156 ? -2.698  30.304  -3.324  1.00 42.27 ? 156 LEU A C     1 
ATOM   1095  O  O     . LEU A 1 156 ? -3.881  30.001  -3.147  1.00 42.96 ? 156 LEU A O     1 
ATOM   1096  C  CB    . LEU A 1 156 ? -2.808  32.810  -3.463  1.00 40.85 ? 156 LEU A CB    1 
ATOM   1097  C  CG    . LEU A 1 156 ? -2.677  34.149  -4.214  1.00 39.97 ? 156 LEU A CG    1 
ATOM   1098  C  CD1   . LEU A 1 156 ? -3.143  35.311  -3.335  1.00 38.18 ? 156 LEU A CD1   1 
ATOM   1099  C  CD2   . LEU A 1 156 ? -1.249  34.385  -4.723  1.00 38.12 ? 156 LEU A CD2   1 
ATOM   1100  N  N     . LEU A 1 157 ? -1.682  29.598  -2.833  1.00 43.03 ? 157 LEU A N     1 
ATOM   1101  C  CA    . LEU A 1 157 ? -1.905  28.372  -2.070  1.00 44.61 ? 157 LEU A CA    1 
ATOM   1102  C  C     . LEU A 1 157 ? -2.745  28.628  -0.830  1.00 46.27 ? 157 LEU A C     1 
ATOM   1103  O  O     . LEU A 1 157 ? -2.527  29.618  -0.116  1.00 46.35 ? 157 LEU A O     1 
ATOM   1104  C  CB    . LEU A 1 157 ? -0.583  27.684  -1.710  1.00 44.68 ? 157 LEU A CB    1 
ATOM   1105  C  CG    . LEU A 1 157 ? 0.154   26.999  -2.867  1.00 44.05 ? 157 LEU A CG    1 
ATOM   1106  C  CD1   . LEU A 1 157 ? 1.473   26.381  -2.395  1.00 43.36 ? 157 LEU A CD1   1 
ATOM   1107  C  CD2   . LEU A 1 157 ? -0.736  25.951  -3.560  1.00 43.22 ? 157 LEU A CD2   1 
ATOM   1108  N  N     . LYS A 1 158 ? -3.708  27.732  -0.595  1.00 47.86 ? 158 LYS A N     1 
ATOM   1109  C  CA    . LYS A 1 158 ? -4.695  27.878  0.475   1.00 49.76 ? 158 LYS A CA    1 
ATOM   1110  C  C     . LYS A 1 158 ? -4.603  26.755  1.495   1.00 50.95 ? 158 LYS A C     1 
ATOM   1111  O  O     . LYS A 1 158 ? -4.521  25.585  1.132   1.00 51.35 ? 158 LYS A O     1 
ATOM   1112  C  CB    . LYS A 1 158 ? -6.111  27.914  -0.122  1.00 50.05 ? 158 LYS A CB    1 
ATOM   1113  C  CG    . LYS A 1 158 ? -6.457  29.222  -0.855  1.00 50.28 ? 158 LYS A CG    1 
ATOM   1114  C  CD    . LYS A 1 158 ? -7.702  29.122  -1.742  1.00 50.03 ? 158 LYS A CD    1 
ATOM   1115  C  CE    . LYS A 1 158 ? -8.992  29.203  -0.931  1.00 55.29 ? 158 LYS A CE    1 
ATOM   1116  N  NZ    . LYS A 1 158 ? -10.221 29.418  -1.776  1.00 56.70 ? 158 LYS A NZ    1 
ATOM   1117  N  N     . ILE A 1 159 ? -4.632  27.109  2.774   1.00 52.26 ? 159 ILE A N     1 
ATOM   1118  C  CA    . ILE A 1 159 ? -4.716  26.116  3.852   1.00 53.61 ? 159 ILE A CA    1 
ATOM   1119  C  C     . ILE A 1 159 ? -6.102  26.143  4.523   1.00 54.89 ? 159 ILE A C     1 
ATOM   1120  O  O     . ILE A 1 159 ? -6.470  27.144  5.139   1.00 55.20 ? 159 ILE A O     1 
ATOM   1121  C  CB    . ILE A 1 159 ? -3.575  26.309  4.887   1.00 54.16 ? 159 ILE A CB    1 
ATOM   1122  C  CG1   . ILE A 1 159 ? -2.229  25.946  4.243   1.00 52.83 ? 159 ILE A CG1   1 
ATOM   1123  C  CG2   . ILE A 1 159 ? -3.835  25.489  6.166   1.00 54.95 ? 159 ILE A CG2   1 
ATOM   1124  C  CD1   . ILE A 1 159 ? -1.026  26.313  5.068   1.00 53.42 ? 159 ILE A CD1   1 
ATOM   1125  N  N     . ASN A 1 160 ? -6.849  25.040  4.392   1.00 55.56 ? 160 ASN A N     1 
ATOM   1126  C  CA    . ASN A 1 160 ? -8.243  24.920  4.876   1.00 56.77 ? 160 ASN A CA    1 
ATOM   1127  C  C     . ASN A 1 160 ? -9.134  26.109  4.480   1.00 56.69 ? 160 ASN A C     1 
ATOM   1128  O  O     . ASN A 1 160 ? -9.801  26.722  5.321   1.00 57.58 ? 160 ASN A O     1 
ATOM   1129  C  CB    . ASN A 1 160 ? -8.301  24.633  6.394   1.00 58.29 ? 160 ASN A CB    1 
ATOM   1130  C  CG    . ASN A 1 160 ? -9.726  24.267  6.901   1.00 59.73 ? 160 ASN A CG    1 
ATOM   1131  O  OD1   . ASN A 1 160 ? -10.071 24.557  8.051   1.00 59.71 ? 160 ASN A OD1   1 
ATOM   1132  N  ND2   . ASN A 1 160 ? -10.537 23.631  6.049   1.00 58.72 ? 160 ASN A ND2   1 
ATOM   1133  N  N     . GLY A 1 161 ? -9.121  26.431  3.186   1.00 55.66 ? 161 GLY A N     1 
ATOM   1134  C  CA    . GLY A 1 161 ? -9.987  27.466  2.623   1.00 55.20 ? 161 GLY A CA    1 
ATOM   1135  C  C     . GLY A 1 161 ? -9.551  28.883  2.938   1.00 54.69 ? 161 GLY A C     1 
ATOM   1136  O  O     . GLY A 1 161 ? -10.308 29.835  2.727   1.00 55.03 ? 161 GLY A O     1 
ATOM   1137  N  N     . LYS A 1 162 ? -8.332  29.026  3.446   1.00 53.79 ? 162 LYS A N     1 
ATOM   1138  C  CA    . LYS A 1 162 ? -7.811  30.336  3.791   1.00 53.11 ? 162 LYS A CA    1 
ATOM   1139  C  C     . LYS A 1 162 ? -6.485  30.563  3.087   1.00 50.76 ? 162 LYS A C     1 
ATOM   1140  O  O     . LYS A 1 162 ? -5.551  29.778  3.253   1.00 50.63 ? 162 LYS A O     1 
ATOM   1141  C  CB    . LYS A 1 162 ? -7.659  30.476  5.313   1.00 54.29 ? 162 LYS A CB    1 
ATOM   1142  C  CG    . LYS A 1 162 ? -7.523  31.915  5.791   1.00 54.88 ? 162 LYS A CG    1 
ATOM   1143  C  CD    . LYS A 1 162 ? -7.113  32.001  7.258   1.00 56.69 ? 162 LYS A CD    1 
ATOM   1144  C  CE    . LYS A 1 162 ? -6.675  33.424  7.608   1.00 58.23 ? 162 LYS A CE    1 
ATOM   1145  N  NZ    . LYS A 1 162 ? -6.340  33.575  9.055   1.00 60.88 ? 162 LYS A NZ    1 
ATOM   1146  N  N     . VAL A 1 163 ? -6.415  31.632  2.295   1.00 48.95 ? 163 VAL A N     1 
ATOM   1147  C  CA    . VAL A 1 163 ? -5.195  31.983  1.563   1.00 46.93 ? 163 VAL A CA    1 
ATOM   1148  C  C     . VAL A 1 163 ? -3.993  32.142  2.508   1.00 46.86 ? 163 VAL A C     1 
ATOM   1149  O  O     . VAL A 1 163 ? -4.028  32.927  3.462   1.00 47.28 ? 163 VAL A O     1 
ATOM   1150  C  CB    . VAL A 1 163 ? -5.380  33.252  0.688   1.00 46.11 ? 163 VAL A CB    1 
ATOM   1151  C  CG1   . VAL A 1 163 ? -4.059  33.684  0.064   1.00 44.14 ? 163 VAL A CG1   1 
ATOM   1152  C  CG2   . VAL A 1 163 ? -6.419  33.003  -0.417  1.00 45.90 ? 163 VAL A CG2   1 
ATOM   1153  N  N     . ALA A 1 164 ? -2.943  31.371  2.234   1.00 46.13 ? 164 ALA A N     1 
ATOM   1154  C  CA    . ALA A 1 164 ? -1.694  31.435  2.989   1.00 46.03 ? 164 ALA A CA    1 
ATOM   1155  C  C     . ALA A 1 164 ? -0.629  32.231  2.241   1.00 44.79 ? 164 ALA A C     1 
ATOM   1156  O  O     . ALA A 1 164 ? 0.245   32.835  2.858   1.00 45.52 ? 164 ALA A O     1 
ATOM   1157  C  CB    . ALA A 1 164 ? -1.186  30.025  3.308   1.00 46.11 ? 164 ALA A CB    1 
ATOM   1158  N  N     . GLU A 1 165 ? -0.706  32.236  0.917   1.00 43.60 ? 165 GLU A N     1 
ATOM   1159  C  CA    . GLU A 1 165 ? 0.299   32.904  0.091   1.00 42.57 ? 165 GLU A CA    1 
ATOM   1160  C  C     . GLU A 1 165 ? -0.126  34.301  -0.369  1.00 41.67 ? 165 GLU A C     1 
ATOM   1161  O  O     . GLU A 1 165 ? -1.197  34.474  -0.952  1.00 41.60 ? 165 GLU A O     1 
ATOM   1162  C  CB    . GLU A 1 165 ? 0.604   32.069  -1.156  1.00 42.02 ? 165 GLU A CB    1 
ATOM   1163  C  CG    . GLU A 1 165 ? 1.471   30.846  -0.969  1.00 42.88 ? 165 GLU A CG    1 
ATOM   1164  C  CD    . GLU A 1 165 ? 2.070   30.388  -2.296  1.00 44.62 ? 165 GLU A CD    1 
ATOM   1165  O  OE1   . GLU A 1 165 ? 1.291   30.290  -3.286  1.00 43.92 ? 165 GLU A OE1   1 
ATOM   1166  O  OE2   . GLU A 1 165 ? 3.311   30.135  -2.351  1.00 43.33 ? 165 GLU A OE2   1 
ATOM   1167  N  N     . ARG A 1 166 ? 0.729   35.291  -0.134  1.00 40.90 ? 166 ARG A N     1 
ATOM   1168  C  CA    . ARG A 1 166 ? 0.595   36.587  -0.798  1.00 39.21 ? 166 ARG A CA    1 
ATOM   1169  C  C     . ARG A 1 166 ? 1.114   36.419  -2.228  1.00 38.06 ? 166 ARG A C     1 
ATOM   1170  O  O     . ARG A 1 166 ? 1.871   35.485  -2.497  1.00 37.85 ? 166 ARG A O     1 
ATOM   1171  C  CB    . ARG A 1 166 ? 1.396   37.656  -0.059  1.00 39.69 ? 166 ARG A CB    1 
ATOM   1172  C  CG    . ARG A 1 166 ? 0.899   37.964  1.350   1.00 39.97 ? 166 ARG A CG    1 
ATOM   1173  C  CD    . ARG A 1 166 ? 1.821   38.952  2.053   1.00 39.69 ? 166 ARG A CD    1 
ATOM   1174  N  NE    . ARG A 1 166 ? 1.369   39.253  3.412   1.00 39.39 ? 166 ARG A NE    1 
ATOM   1175  C  CZ    . ARG A 1 166 ? 1.790   40.294  4.131   1.00 39.66 ? 166 ARG A CZ    1 
ATOM   1176  N  NH1   . ARG A 1 166 ? 2.675   41.134  3.615   1.00 39.13 ? 166 ARG A NH1   1 
ATOM   1177  N  NH2   . ARG A 1 166 ? 1.324   40.506  5.362   1.00 39.65 ? 166 ARG A NH2   1 
ATOM   1178  N  N     . PRO A 1 167 ? 0.679   37.283  -3.164  1.00 37.29 ? 167 PRO A N     1 
ATOM   1179  C  CA    . PRO A 1 167 ? 1.229   37.222  -4.527  1.00 36.28 ? 167 PRO A CA    1 
ATOM   1180  C  C     . PRO A 1 167 ? 2.752   37.254  -4.586  1.00 35.89 ? 167 PRO A C     1 
ATOM   1181  O  O     . PRO A 1 167 ? 3.349   36.624  -5.463  1.00 35.93 ? 167 PRO A O     1 
ATOM   1182  C  CB    . PRO A 1 167 ? 0.620   38.451  -5.205  1.00 36.00 ? 167 PRO A CB    1 
ATOM   1183  C  CG    . PRO A 1 167 ? -0.715  38.616  -4.497  1.00 36.91 ? 167 PRO A CG    1 
ATOM   1184  C  CD    . PRO A 1 167 ? -0.387  38.300  -3.049  1.00 37.39 ? 167 PRO A CD    1 
ATOM   1185  N  N     . GLN A 1 168 ? 3.373   37.976  -3.660  1.00 35.95 ? 168 GLN A N     1 
ATOM   1186  C  CA    . GLN A 1 168 ? 4.834   38.036  -3.585  1.00 35.49 ? 168 GLN A CA    1 
ATOM   1187  C  C     . GLN A 1 168 ? 5.410   36.681  -3.186  1.00 35.43 ? 168 GLN A C     1 
ATOM   1188  O  O     . GLN A 1 168 ? 6.404   36.235  -3.766  1.00 35.16 ? 168 GLN A O     1 
ATOM   1189  C  CB    . GLN A 1 168 ? 5.310   39.146  -2.626  1.00 35.78 ? 168 GLN A CB    1 
ATOM   1190  C  CG    . GLN A 1 168 ? 4.981   40.567  -3.088  1.00 35.72 ? 168 GLN A CG    1 
ATOM   1191  C  CD    . GLN A 1 168 ? 5.096   40.747  -4.598  1.00 35.43 ? 168 GLN A CD    1 
ATOM   1192  O  OE1   . GLN A 1 168 ? 6.195   40.784  -5.151  1.00 36.72 ? 168 GLN A OE1   1 
ATOM   1193  N  NE2   . GLN A 1 168 ? 3.960   40.858  -5.268  1.00 34.08 ? 168 GLN A NE2   1 
ATOM   1194  N  N     . HIS A 1 169 ? 4.777   36.035  -2.207  1.00 35.28 ? 169 HIS A N     1 
ATOM   1195  C  CA    . HIS A 1 169 ? 5.170   34.703  -1.776  1.00 35.49 ? 169 HIS A CA    1 
ATOM   1196  C  C     . HIS A 1 169 ? 5.081   33.717  -2.931  1.00 35.18 ? 169 HIS A C     1 
ATOM   1197  O  O     . HIS A 1 169 ? 6.016   32.952  -3.169  1.00 35.41 ? 169 HIS A O     1 
ATOM   1198  C  CB    . HIS A 1 169 ? 4.296   34.215  -0.620  1.00 36.08 ? 169 HIS A CB    1 
ATOM   1199  C  CG    . HIS A 1 169 ? 4.417   35.034  0.625   1.00 35.98 ? 169 HIS A CG    1 
ATOM   1200  N  ND1   . HIS A 1 169 ? 3.347   35.285  1.455   1.00 36.18 ? 169 HIS A ND1   1 
ATOM   1201  C  CD2   . HIS A 1 169 ? 5.481   35.658  1.184   1.00 34.83 ? 169 HIS A CD2   1 
ATOM   1202  C  CE1   . HIS A 1 169 ? 3.748   36.018  2.478   1.00 36.88 ? 169 HIS A CE1   1 
ATOM   1203  N  NE2   . HIS A 1 169 ? 5.040   36.261  2.334   1.00 36.18 ? 169 HIS A NE2   1 
ATOM   1204  N  N     . MET A 1 170 ? 3.965   33.744  -3.653  1.00 34.87 ? 170 MET A N     1 
ATOM   1205  C  CA    . MET A 1 170 ? 3.810   32.903  -4.826  1.00 35.06 ? 170 MET A CA    1 
ATOM   1206  C  C     . MET A 1 170 ? 4.948   33.133  -5.838  1.00 34.72 ? 170 MET A C     1 
ATOM   1207  O  O     . MET A 1 170 ? 5.569   32.188  -6.293  1.00 35.05 ? 170 MET A O     1 
ATOM   1208  C  CB    . MET A 1 170 ? 2.436   33.127  -5.465  1.00 34.80 ? 170 MET A CB    1 
ATOM   1209  C  CG    . MET A 1 170 ? 2.117   32.193  -6.631  1.00 35.69 ? 170 MET A CG    1 
ATOM   1210  S  SD    . MET A 1 170 ? 2.733   32.823  -8.211  1.00 38.74 ? 170 MET A SD    1 
ATOM   1211  C  CE    . MET A 1 170 ? 1.403   33.953  -8.658  1.00 37.46 ? 170 MET A CE    1 
ATOM   1212  N  N     . LEU A 1 171 ? 5.223   34.391  -6.166  1.00 34.87 ? 171 LEU A N     1 
ATOM   1213  C  CA    . LEU A 1 171 ? 6.225   34.746  -7.185  1.00 34.54 ? 171 LEU A CA    1 
ATOM   1214  C  C     . LEU A 1 171 ? 7.643   34.388  -6.760  1.00 34.63 ? 171 LEU A C     1 
ATOM   1215  O  O     . LEU A 1 171 ? 8.474   34.032  -7.589  1.00 33.83 ? 171 LEU A O     1 
ATOM   1216  C  CB    . LEU A 1 171 ? 6.138   36.240  -7.511  1.00 34.34 ? 171 LEU A CB    1 
ATOM   1217  C  CG    . LEU A 1 171 ? 5.422   36.854  -8.725  1.00 34.72 ? 171 LEU A CG    1 
ATOM   1218  C  CD1   . LEU A 1 171 ? 4.454   35.937  -9.504  1.00 33.05 ? 171 LEU A CD1   1 
ATOM   1219  C  CD2   . LEU A 1 171 ? 4.748   38.159  -8.293  1.00 33.98 ? 171 LEU A CD2   1 
ATOM   1220  N  N     . MET A 1 172 ? 7.927   34.485  -5.467  1.00 35.59 ? 172 MET A N     1 
ATOM   1221  C  CA    . MET A 1 172 ? 9.243   34.074  -4.982  1.00 36.17 ? 172 MET A CA    1 
ATOM   1222  C  C     . MET A 1 172 ? 9.345   32.544  -4.942  1.00 36.59 ? 172 MET A C     1 
ATOM   1223  O  O     . MET A 1 172 ? 10.412  31.995  -5.224  1.00 36.88 ? 172 MET A O     1 
ATOM   1224  C  CB    . MET A 1 172 ? 9.593   34.721  -3.641  1.00 36.51 ? 172 MET A CB    1 
ATOM   1225  C  CG    . MET A 1 172 ? 11.031  34.419  -3.165  1.00 37.98 ? 172 MET A CG    1 
ATOM   1226  S  SD    . MET A 1 172 ? 12.377  34.959  -4.272  1.00 37.25 ? 172 MET A SD    1 
ATOM   1227  C  CE    . MET A 1 172 ? 12.667  36.647  -3.712  1.00 34.31 ? 172 MET A CE    1 
ATOM   1228  N  N     . ARG A 1 173 ? 8.239   31.862  -4.621  1.00 36.57 ? 173 ARG A N     1 
ATOM   1229  C  CA    . ARG A 1 173 ? 8.206   30.392  -4.679  1.00 37.04 ? 173 ARG A CA    1 
ATOM   1230  C  C     . ARG A 1 173 ? 8.533   29.880  -6.089  1.00 36.41 ? 173 ARG A C     1 
ATOM   1231  O  O     . ARG A 1 173 ? 9.320   28.946  -6.249  1.00 36.74 ? 173 ARG A O     1 
ATOM   1232  C  CB    . ARG A 1 173 ? 6.859   29.820  -4.202  1.00 37.25 ? 173 ARG A CB    1 
ATOM   1233  C  CG    . ARG A 1 173 ? 6.638   28.350  -4.623  1.00 37.49 ? 173 ARG A CG    1 
ATOM   1234  C  CD    . ARG A 1 173 ? 5.363   27.736  -4.081  1.00 38.46 ? 173 ARG A CD    1 
ATOM   1235  N  NE    . ARG A 1 173 ? 4.154   28.498  -4.414  1.00 40.53 ? 173 ARG A NE    1 
ATOM   1236  C  CZ    . ARG A 1 173 ? 3.419   28.330  -5.514  1.00 40.41 ? 173 ARG A CZ    1 
ATOM   1237  N  NH1   . ARG A 1 173 ? 3.767   27.439  -6.439  1.00 40.52 ? 173 ARG A NH1   1 
ATOM   1238  N  NH2   . ARG A 1 173 ? 2.331   29.069  -5.695  1.00 40.60 ? 173 ARG A NH2   1 
ATOM   1239  N  N     . VAL A 1 174 ? 7.917   30.494  -7.096  1.00 35.21 ? 174 VAL A N     1 
ATOM   1240  C  CA    . VAL A 1 174 ? 8.171   30.150  -8.489  1.00 34.78 ? 174 VAL A CA    1 
ATOM   1241  C  C     . VAL A 1 174 ? 9.636   30.368  -8.856  1.00 35.31 ? 174 VAL A C     1 
ATOM   1242  O  O     . VAL A 1 174 ? 10.242  29.524  -9.516  1.00 35.51 ? 174 VAL A O     1 
ATOM   1243  C  CB    . VAL A 1 174 ? 7.235   30.932  -9.443  1.00 33.94 ? 174 VAL A CB    1 
ATOM   1244  C  CG1   . VAL A 1 174 ? 7.577   30.683  -10.892 1.00 32.41 ? 174 VAL A CG1   1 
ATOM   1245  C  CG2   . VAL A 1 174 ? 5.770   30.556  -9.173  1.00 33.95 ? 174 VAL A CG2   1 
ATOM   1246  N  N     . SER A 1 175 ? 10.200  31.488  -8.396  1.00 35.91 ? 175 SER A N     1 
ATOM   1247  C  CA    . SER A 1 175 ? 11.556  31.917  -8.748  1.00 36.24 ? 175 SER A CA    1 
ATOM   1248  C  C     . SER A 1 175 ? 12.625  30.975  -8.203  1.00 37.76 ? 175 SER A C     1 
ATOM   1249  O  O     . SER A 1 175 ? 13.587  30.650  -8.908  1.00 38.12 ? 175 SER A O     1 
ATOM   1250  C  CB    . SER A 1 175 ? 11.807  33.337  -8.249  1.00 35.99 ? 175 SER A CB    1 
ATOM   1251  O  OG    . SER A 1 175 ? 10.833  34.227  -8.755  1.00 35.56 ? 175 SER A OG    1 
ATOM   1252  N  N     . VAL A 1 176 ? 12.465  30.553  -6.947  1.00 38.83 ? 176 VAL A N     1 
ATOM   1253  C  CA    . VAL A 1 176 ? 13.343  29.531  -6.365  1.00 40.11 ? 176 VAL A CA    1 
ATOM   1254  C  C     . VAL A 1 176 ? 12.997  28.134  -6.918  1.00 39.98 ? 176 VAL A C     1 
ATOM   1255  O  O     . VAL A 1 176 ? 13.873  27.281  -7.069  1.00 40.59 ? 176 VAL A O     1 
ATOM   1256  C  CB    . VAL A 1 176 ? 13.365  29.558  -4.804  1.00 40.81 ? 176 VAL A CB    1 
ATOM   1257  C  CG1   . VAL A 1 176 ? 13.944  30.855  -4.301  1.00 40.37 ? 176 VAL A CG1   1 
ATOM   1258  C  CG2   . VAL A 1 176 ? 11.980  29.383  -4.243  1.00 42.34 ? 176 VAL A CG2   1 
ATOM   1259  N  N     . GLY A 1 177 ? 11.727  27.924  -7.247  1.00 39.04 ? 177 GLY A N     1 
ATOM   1260  C  CA    . GLY A 1 177 ? 11.309  26.738  -7.985  1.00 39.08 ? 177 GLY A CA    1 
ATOM   1261  C  C     . GLY A 1 177 ? 12.094  26.537  -9.270  1.00 39.29 ? 177 GLY A C     1 
ATOM   1262  O  O     . GLY A 1 177 ? 12.513  25.420  -9.570  1.00 39.82 ? 177 GLY A O     1 
ATOM   1263  N  N     . ILE A 1 178 ? 12.298  27.615  -10.027 1.00 39.11 ? 178 ILE A N     1 
ATOM   1264  C  CA    . ILE A 1 178 ? 13.048  27.560  -11.284 1.00 39.34 ? 178 ILE A CA    1 
ATOM   1265  C  C     . ILE A 1 178 ? 14.562  27.548  -11.051 1.00 40.59 ? 178 ILE A C     1 
ATOM   1266  O  O     . ILE A 1 178 ? 15.279  26.730  -11.627 1.00 41.11 ? 178 ILE A O     1 
ATOM   1267  C  CB    . ILE A 1 178 ? 12.678  28.737  -12.223 1.00 38.39 ? 178 ILE A CB    1 
ATOM   1268  C  CG1   . ILE A 1 178 ? 11.250  28.581  -12.738 1.00 38.11 ? 178 ILE A CG1   1 
ATOM   1269  C  CG2   . ILE A 1 178 ? 13.641  28.824  -13.414 1.00 38.66 ? 178 ILE A CG2   1 
ATOM   1270  C  CD1   . ILE A 1 178 ? 10.521  29.886  -12.937 1.00 36.47 ? 178 ILE A CD1   1 
ATOM   1271  N  N     . HIS A 1 179 ? 15.044  28.452  -10.204 1.00 41.49 ? 179 HIS A N     1 
ATOM   1272  C  CA    . HIS A 1 179 ? 16.476  28.729  -10.117 1.00 42.73 ? 179 HIS A CA    1 
ATOM   1273  C  C     . HIS A 1 179 ? 17.180  27.994  -9.002  1.00 44.22 ? 179 HIS A C     1 
ATOM   1274  O  O     . HIS A 1 179 ? 18.405  27.887  -9.009  1.00 45.54 ? 179 HIS A O     1 
ATOM   1275  C  CB    . HIS A 1 179 ? 16.716  30.235  -10.020 1.00 42.07 ? 179 HIS A CB    1 
ATOM   1276  C  CG    . HIS A 1 179 ? 16.290  30.971  -11.246 1.00 42.23 ? 179 HIS A CG    1 
ATOM   1277  N  ND1   . HIS A 1 179 ? 17.026  30.956  -12.412 1.00 42.73 ? 179 HIS A ND1   1 
ATOM   1278  C  CD2   . HIS A 1 179 ? 15.177  31.696  -11.511 1.00 40.99 ? 179 HIS A CD2   1 
ATOM   1279  C  CE1   . HIS A 1 179 ? 16.399  31.665  -13.333 1.00 42.22 ? 179 HIS A CE1   1 
ATOM   1280  N  NE2   . HIS A 1 179 ? 15.273  32.121  -12.813 1.00 41.26 ? 179 HIS A NE2   1 
ATOM   1281  N  N     . LYS A 1 180 ? 16.402  27.517  -8.037  1.00 45.04 ? 180 LYS A N     1 
ATOM   1282  C  CA    . LYS A 1 180 ? 16.902  26.678  -6.943  1.00 46.93 ? 180 LYS A CA    1 
ATOM   1283  C  C     . LYS A 1 180 ? 18.076  27.306  -6.169  1.00 47.98 ? 180 LYS A C     1 
ATOM   1284  O  O     . LYS A 1 180 ? 17.879  28.325  -5.500  1.00 48.29 ? 180 LYS A O     1 
ATOM   1285  C  CB    . LYS A 1 180 ? 17.172  25.249  -7.448  1.00 47.35 ? 180 LYS A CB    1 
ATOM   1286  C  CG    . LYS A 1 180 ? 15.943  24.652  -8.162  1.00 46.78 ? 180 LYS A CG    1 
ATOM   1287  C  CD    . LYS A 1 180 ? 16.171  23.237  -8.627  1.00 48.26 ? 180 LYS A CD    1 
ATOM   1288  C  CE    . LYS A 1 180 ? 14.888  22.644  -9.208  1.00 50.79 ? 180 LYS A CE    1 
ATOM   1289  N  NZ    . LYS A 1 180 ? 13.692  22.697  -8.287  1.00 51.46 ? 180 LYS A NZ    1 
ATOM   1290  N  N     . GLU A 1 181 ? 19.278  26.741  -6.265  1.00 48.82 ? 181 GLU A N     1 
ATOM   1291  C  CA    . GLU A 1 181 ? 20.414  27.237  -5.477  1.00 50.04 ? 181 GLU A CA    1 
ATOM   1292  C  C     . GLU A 1 181 ? 20.994  28.549  -6.015  1.00 49.69 ? 181 GLU A C     1 
ATOM   1293  O  O     . GLU A 1 181 ? 21.740  29.233  -5.320  1.00 50.61 ? 181 GLU A O     1 
ATOM   1294  C  CB    . GLU A 1 181 ? 21.518  26.158  -5.339  1.00 51.15 ? 181 GLU A CB    1 
ATOM   1295  N  N     . ASP A 1 182 ? 20.645  28.891  -7.252  1.00 48.75 ? 182 ASP A N     1 
ATOM   1296  C  CA    . ASP A 1 182 ? 21.080  30.139  -7.862  1.00 48.17 ? 182 ASP A CA    1 
ATOM   1297  C  C     . ASP A 1 182 ? 20.226  31.280  -7.324  1.00 46.91 ? 182 ASP A C     1 
ATOM   1298  O  O     . ASP A 1 182 ? 19.209  31.640  -7.926  1.00 45.49 ? 182 ASP A O     1 
ATOM   1299  C  CB    . ASP A 1 182 ? 20.957  30.040  -9.383  1.00 48.02 ? 182 ASP A CB    1 
ATOM   1300  C  CG    . ASP A 1 182 ? 21.753  31.111  -10.119 1.00 49.08 ? 182 ASP A CG    1 
ATOM   1301  O  OD1   . ASP A 1 182 ? 22.064  30.887  -11.309 1.00 51.54 ? 182 ASP A OD1   1 
ATOM   1302  O  OD2   . ASP A 1 182 ? 22.055  32.175  -9.536  1.00 49.78 ? 182 ASP A OD2   1 
ATOM   1303  N  N     . ILE A 1 183 ? 20.636  31.837  -6.184  1.00 47.05 ? 183 ILE A N     1 
ATOM   1304  C  CA    . ILE A 1 183 ? 19.844  32.865  -5.501  1.00 46.12 ? 183 ILE A CA    1 
ATOM   1305  C  C     . ILE A 1 183 ? 19.810  34.169  -6.291  1.00 45.32 ? 183 ILE A C     1 
ATOM   1306  O  O     . ILE A 1 183 ? 18.769  34.832  -6.344  1.00 44.80 ? 183 ILE A O     1 
ATOM   1307  C  CB    . ILE A 1 183 ? 20.321  33.123  -4.041  1.00 47.21 ? 183 ILE A CB    1 
ATOM   1308  C  CG1   . ILE A 1 183 ? 20.449  31.811  -3.254  1.00 47.56 ? 183 ILE A CG1   1 
ATOM   1309  C  CG2   . ILE A 1 183 ? 19.390  34.110  -3.322  1.00 46.56 ? 183 ILE A CG2   1 
ATOM   1310  C  CD1   . ILE A 1 183 ? 19.178  30.985  -3.181  1.00 46.98 ? 183 ILE A CD1   1 
ATOM   1311  N  N     . ASP A 1 184 ? 20.935  34.513  -6.921  1.00 45.27 ? 184 ASP A N     1 
ATOM   1312  C  CA    . ASP A 1 184 ? 21.046  35.729  -7.737  1.00 44.48 ? 184 ASP A CA    1 
ATOM   1313  C  C     . ASP A 1 184 ? 20.040  35.724  -8.876  1.00 42.69 ? 184 ASP A C     1 
ATOM   1314  O  O     . ASP A 1 184 ? 19.365  36.730  -9.126  1.00 42.26 ? 184 ASP A O     1 
ATOM   1315  C  CB    . ASP A 1 184 ? 22.467  35.901  -8.283  1.00 45.37 ? 184 ASP A CB    1 
ATOM   1316  C  CG    . ASP A 1 184 ? 23.456  36.356  -7.213  1.00 49.14 ? 184 ASP A CG    1 
ATOM   1317  O  OD1   . ASP A 1 184 ? 23.004  36.865  -6.152  1.00 50.99 ? 184 ASP A OD1   1 
ATOM   1318  O  OD2   . ASP A 1 184 ? 24.689  36.202  -7.424  1.00 51.53 ? 184 ASP A OD2   1 
ATOM   1319  N  N     . ALA A 1 185 ? 19.942  34.581  -9.550  1.00 41.67 ? 185 ALA A N     1 
ATOM   1320  C  CA    . ALA A 1 185 ? 19.003  34.384  -10.640 1.00 40.02 ? 185 ALA A CA    1 
ATOM   1321  C  C     . ALA A 1 185 ? 17.570  34.323  -10.115 1.00 38.89 ? 185 ALA A C     1 
ATOM   1322  O  O     . ALA A 1 185 ? 16.655  34.779  -10.780 1.00 38.07 ? 185 ALA A O     1 
ATOM   1323  C  CB    . ALA A 1 185 ? 19.348  33.119  -11.423 1.00 39.78 ? 185 ALA A CB    1 
ATOM   1324  N  N     . ALA A 1 186 ? 17.380  33.764  -8.921  1.00 39.27 ? 186 ALA A N     1 
ATOM   1325  C  CA    . ALA A 1 186 ? 16.051  33.725  -8.303  1.00 38.67 ? 186 ALA A CA    1 
ATOM   1326  C  C     . ALA A 1 186 ? 15.521  35.139  -8.077  1.00 38.35 ? 186 ALA A C     1 
ATOM   1327  O  O     . ALA A 1 186 ? 14.398  35.452  -8.469  1.00 37.86 ? 186 ALA A O     1 
ATOM   1328  C  CB    . ALA A 1 186 ? 16.073  32.929  -6.997  1.00 38.80 ? 186 ALA A CB    1 
ATOM   1329  N  N     . ILE A 1 187 ? 16.343  35.996  -7.479  1.00 39.31 ? 187 ILE A N     1 
ATOM   1330  C  CA    . ILE A 1 187 ? 15.930  37.366  -7.163  1.00 39.40 ? 187 ILE A CA    1 
ATOM   1331  C  C     . ILE A 1 187 ? 15.731  38.200  -8.418  1.00 38.78 ? 187 ILE A C     1 
ATOM   1332  O  O     . ILE A 1 187 ? 14.754  38.938  -8.512  1.00 38.26 ? 187 ILE A O     1 
ATOM   1333  C  CB    . ILE A 1 187 ? 16.897  38.058  -6.177  1.00 40.35 ? 187 ILE A CB    1 
ATOM   1334  C  CG1   . ILE A 1 187 ? 16.860  37.340  -4.825  1.00 40.31 ? 187 ILE A CG1   1 
ATOM   1335  C  CG2   . ILE A 1 187 ? 16.525  39.536  -5.998  1.00 40.53 ? 187 ILE A CG2   1 
ATOM   1336  C  CD1   . ILE A 1 187 ? 17.925  37.771  -3.883  1.00 41.18 ? 187 ILE A CD1   1 
ATOM   1337  N  N     . GLU A 1 188 ? 16.637  38.064  -9.387  1.00 39.20 ? 188 GLU A N     1 
ATOM   1338  C  CA    . GLU A 1 188 ? 16.484  38.741  -10.679 1.00 38.83 ? 188 GLU A CA    1 
ATOM   1339  C  C     . GLU A 1 188 ? 15.139  38.382  -11.320 1.00 37.14 ? 188 GLU A C     1 
ATOM   1340  O  O     . GLU A 1 188 ? 14.426  39.259  -11.810 1.00 36.76 ? 188 GLU A O     1 
ATOM   1341  C  CB    . GLU A 1 188 ? 17.651  38.421  -11.623 1.00 39.08 ? 188 GLU A CB    1 
ATOM   1342  C  CG    . GLU A 1 188 ? 17.534  39.117  -12.986 1.00 39.80 ? 188 GLU A CG    1 
ATOM   1343  C  CD    . GLU A 1 188 ? 18.455  38.534  -14.058 1.00 41.47 ? 188 GLU A CD    1 
ATOM   1344  O  OE1   . GLU A 1 188 ? 18.540  37.281  -14.181 1.00 44.26 ? 188 GLU A OE1   1 
ATOM   1345  O  OE2   . GLU A 1 188 ? 19.079  39.336  -14.800 1.00 43.34 ? 188 GLU A OE2   1 
ATOM   1346  N  N     . THR A 1 189 ? 14.783  37.099  -11.283 1.00 36.41 ? 189 THR A N     1 
ATOM   1347  C  CA    . THR A 1 189 ? 13.485  36.640  -11.800 1.00 35.13 ? 189 THR A CA    1 
ATOM   1348  C  C     . THR A 1 189 ? 12.295  37.129  -10.962 1.00 34.98 ? 189 THR A C     1 
ATOM   1349  O  O     . THR A 1 189 ? 11.262  37.527  -11.516 1.00 34.98 ? 189 THR A O     1 
ATOM   1350  C  CB    . THR A 1 189 ? 13.452  35.097  -11.957 1.00 35.23 ? 189 THR A CB    1 
ATOM   1351  O  OG1   . THR A 1 189 ? 14.257  34.717  -13.081 1.00 33.82 ? 189 THR A OG1   1 
ATOM   1352  C  CG2   . THR A 1 189 ? 12.017  34.573  -12.149 1.00 33.02 ? 189 THR A CG2   1 
ATOM   1353  N  N     . TYR A 1 190 ? 12.434  37.091  -9.637  1.00 35.31 ? 190 TYR A N     1 
ATOM   1354  C  CA    . TYR A 1 190 ? 11.402  37.634  -8.741  1.00 35.04 ? 190 TYR A CA    1 
ATOM   1355  C  C     . TYR A 1 190 ? 11.100  39.090  -9.070  1.00 34.64 ? 190 TYR A C     1 
ATOM   1356  O  O     . TYR A 1 190 ? 9.937   39.477  -9.147  1.00 34.19 ? 190 TYR A O     1 
ATOM   1357  C  CB    . TYR A 1 190 ? 11.773  37.502  -7.249  1.00 35.43 ? 190 TYR A CB    1 
ATOM   1358  C  CG    . TYR A 1 190 ? 10.933  38.411  -6.393  1.00 34.90 ? 190 TYR A CG    1 
ATOM   1359  C  CD1   . TYR A 1 190 ? 9.621   38.071  -6.076  1.00 34.16 ? 190 TYR A CD1   1 
ATOM   1360  C  CD2   . TYR A 1 190 ? 11.424  39.649  -5.955  1.00 35.50 ? 190 TYR A CD2   1 
ATOM   1361  C  CE1   . TYR A 1 190 ? 8.823   38.915  -5.324  1.00 34.92 ? 190 TYR A CE1   1 
ATOM   1362  C  CE2   . TYR A 1 190 ? 10.627  40.507  -5.199  1.00 35.55 ? 190 TYR A CE2   1 
ATOM   1363  C  CZ    . TYR A 1 190 ? 9.326   40.128  -4.886  1.00 35.68 ? 190 TYR A CZ    1 
ATOM   1364  O  OH    . TYR A 1 190 ? 8.508   40.953  -4.144  1.00 36.12 ? 190 TYR A OH    1 
ATOM   1365  N  N     . ASN A 1 191 ? 12.147  39.892  -9.263  1.00 35.51 ? 191 ASN A N     1 
ATOM   1366  C  CA    . ASN A 1 191 ? 11.978  41.319  -9.609  1.00 35.83 ? 191 ASN A CA    1 
ATOM   1367  C  C     . ASN A 1 191 ? 11.263  41.559  -10.933 1.00 35.41 ? 191 ASN A C     1 
ATOM   1368  O  O     . ASN A 1 191 ? 10.353  42.365  -10.996 1.00 35.90 ? 191 ASN A O     1 
ATOM   1369  C  CB    . ASN A 1 191 ? 13.308  42.054  -9.584  1.00 36.13 ? 191 ASN A CB    1 
ATOM   1370  C  CG    . ASN A 1 191 ? 13.792  42.296  -8.191  1.00 37.31 ? 191 ASN A CG    1 
ATOM   1371  O  OD1   . ASN A 1 191 ? 12.996  42.519  -7.283  1.00 39.35 ? 191 ASN A OD1   1 
ATOM   1372  N  ND2   . ASN A 1 191 ? 15.098  42.239  -7.998  1.00 37.70 ? 191 ASN A ND2   1 
ATOM   1373  N  N     . LEU A 1 192 ? 11.673  40.846  -11.977 1.00 35.30 ? 192 LEU A N     1 
ATOM   1374  C  CA    . LEU A 1 192 ? 11.044  40.942  -13.284 1.00 34.70 ? 192 LEU A CA    1 
ATOM   1375  C  C     . LEU A 1 192 ? 9.586   40.490  -13.243 1.00 34.35 ? 192 LEU A C     1 
ATOM   1376  O  O     . LEU A 1 192 ? 8.741   41.057  -13.922 1.00 34.33 ? 192 LEU A O     1 
ATOM   1377  C  CB    . LEU A 1 192 ? 11.829  40.107  -14.298 1.00 34.62 ? 192 LEU A CB    1 
ATOM   1378  C  CG    . LEU A 1 192 ? 12.967  40.660  -15.184 1.00 35.63 ? 192 LEU A CG    1 
ATOM   1379  C  CD1   . LEU A 1 192 ? 13.366  42.124  -14.934 1.00 35.69 ? 192 LEU A CD1   1 
ATOM   1380  C  CD2   . LEU A 1 192 ? 14.180  39.742  -15.124 1.00 34.72 ? 192 LEU A CD2   1 
ATOM   1381  N  N     . LEU A 1 193 ? 9.288   39.466  -12.446 1.00 34.65 ? 193 LEU A N     1 
ATOM   1382  C  CA    . LEU A 1 193 ? 7.909   38.945  -12.364 1.00 33.95 ? 193 LEU A CA    1 
ATOM   1383  C  C     . LEU A 1 193 ? 7.023   39.858  -11.527 1.00 34.04 ? 193 LEU A C     1 
ATOM   1384  O  O     . LEU A 1 193 ? 5.913   40.175  -11.933 1.00 33.90 ? 193 LEU A O     1 
ATOM   1385  C  CB    . LEU A 1 193 ? 7.871   37.516  -11.787 1.00 33.67 ? 193 LEU A CB    1 
ATOM   1386  C  CG    . LEU A 1 193 ? 8.357   36.304  -12.587 1.00 32.57 ? 193 LEU A CG    1 
ATOM   1387  C  CD1   . LEU A 1 193 ? 8.387   35.073  -11.680 1.00 31.00 ? 193 LEU A CD1   1 
ATOM   1388  C  CD2   . LEU A 1 193 ? 7.507   36.046  -13.831 1.00 31.31 ? 193 LEU A CD2   1 
ATOM   1389  N  N     . SER A 1 194 ? 7.516   40.270  -10.356 1.00 35.07 ? 194 SER A N     1 
ATOM   1390  C  CA    . SER A 1 194 ? 6.753   41.150  -9.466  1.00 35.57 ? 194 SER A CA    1 
ATOM   1391  C  C     . SER A 1 194 ? 6.555   42.548  -10.035 1.00 36.11 ? 194 SER A C     1 
ATOM   1392  O  O     . SER A 1 194 ? 5.545   43.180  -9.739  1.00 36.64 ? 194 SER A O     1 
ATOM   1393  C  CB    . SER A 1 194 ? 7.353   41.198  -8.062  1.00 35.90 ? 194 SER A CB    1 
ATOM   1394  O  OG    . SER A 1 194 ? 8.622   41.793  -8.063  1.00 35.93 ? 194 SER A OG    1 
ATOM   1395  N  N     . GLU A 1 195 ? 7.495   43.019  -10.862 1.00 36.56 ? 195 GLU A N     1 
ATOM   1396  C  CA    . GLU A 1 195 ? 7.304   44.265  -11.614 1.00 37.48 ? 195 GLU A CA    1 
ATOM   1397  C  C     . GLU A 1 195 ? 6.530   44.077  -12.932 1.00 37.09 ? 195 GLU A C     1 
ATOM   1398  O  O     . GLU A 1 195 ? 6.225   45.049  -13.612 1.00 37.01 ? 195 GLU A O     1 
ATOM   1399  C  CB    . GLU A 1 195 ? 8.629   44.952  -11.893 1.00 37.93 ? 195 GLU A CB    1 
ATOM   1400  C  CG    . GLU A 1 195 ? 9.246   45.636  -10.694 1.00 41.87 ? 195 GLU A CG    1 
ATOM   1401  C  CD    . GLU A 1 195 ? 10.514  46.397  -11.053 1.00 47.52 ? 195 GLU A CD    1 
ATOM   1402  O  OE1   . GLU A 1 195 ? 11.379  46.538  -10.167 1.00 49.98 ? 195 GLU A OE1   1 
ATOM   1403  O  OE2   . GLU A 1 195 ? 10.658  46.851  -12.219 1.00 49.55 ? 195 GLU A OE2   1 
ATOM   1404  N  N     . ARG A 1 196 ? 6.232   42.823  -13.280 1.00 37.02 ? 196 ARG A N     1 
ATOM   1405  C  CA    . ARG A 1 196 ? 5.296   42.471  -14.355 1.00 37.02 ? 196 ARG A CA    1 
ATOM   1406  C  C     . ARG A 1 196 ? 5.842   42.695  -15.769 1.00 36.27 ? 196 ARG A C     1 
ATOM   1407  O  O     . ARG A 1 196 ? 5.093   42.939  -16.711 1.00 35.84 ? 196 ARG A O     1 
ATOM   1408  C  CB    . ARG A 1 196 ? 3.931   43.148  -14.140 1.00 37.13 ? 196 ARG A CB    1 
ATOM   1409  C  CG    . ARG A 1 196 ? 3.270   42.747  -12.807 1.00 38.62 ? 196 ARG A CG    1 
ATOM   1410  C  CD    . ARG A 1 196 ? 2.139   43.670  -12.396 1.00 39.59 ? 196 ARG A CD    1 
ATOM   1411  N  NE    . ARG A 1 196 ? 2.511   45.083  -12.514 1.00 45.04 ? 196 ARG A NE    1 
ATOM   1412  C  CZ    . ARG A 1 196 ? 1.920   45.935  -13.351 1.00 46.58 ? 196 ARG A CZ    1 
ATOM   1413  N  NH1   . ARG A 1 196 ? 0.921   45.520  -14.133 1.00 46.93 ? 196 ARG A NH1   1 
ATOM   1414  N  NH2   . ARG A 1 196 ? 2.320   47.197  -13.408 1.00 46.97 ? 196 ARG A NH2   1 
ATOM   1415  N  N     . TRP A 1 197 ? 7.161   42.595  -15.910 1.00 35.91 ? 197 TRP A N     1 
ATOM   1416  C  CA    . TRP A 1 197 ? 7.797   42.717  -17.215 1.00 34.93 ? 197 TRP A CA    1 
ATOM   1417  C  C     . TRP A 1 197 ? 7.433   41.527  -18.092 1.00 34.16 ? 197 TRP A C     1 
ATOM   1418  O  O     . TRP A 1 197 ? 7.309   41.636  -19.320 1.00 33.81 ? 197 TRP A O     1 
ATOM   1419  C  CB    . TRP A 1 197 ? 9.305   42.850  -17.043 1.00 35.37 ? 197 TRP A CB    1 
ATOM   1420  C  CG    . TRP A 1 197 ? 9.667   44.147  -16.397 1.00 35.39 ? 197 TRP A CG    1 
ATOM   1421  C  CD1   . TRP A 1 197 ? 9.908   44.357  -15.083 1.00 35.27 ? 197 TRP A CD1   1 
ATOM   1422  C  CD2   . TRP A 1 197 ? 9.789   45.424  -17.039 1.00 35.53 ? 197 TRP A CD2   1 
ATOM   1423  N  NE1   . TRP A 1 197 ? 10.187  45.680  -14.855 1.00 35.54 ? 197 TRP A NE1   1 
ATOM   1424  C  CE2   . TRP A 1 197 ? 10.118  46.360  -16.040 1.00 35.79 ? 197 TRP A CE2   1 
ATOM   1425  C  CE3   . TRP A 1 197 ? 9.661   45.864  -18.364 1.00 36.26 ? 197 TRP A CE3   1 
ATOM   1426  C  CZ2   . TRP A 1 197 ? 10.332  47.715  -16.320 1.00 35.98 ? 197 TRP A CZ2   1 
ATOM   1427  C  CZ3   . TRP A 1 197 ? 9.866   47.219  -18.644 1.00 36.15 ? 197 TRP A CZ3   1 
ATOM   1428  C  CH2   . TRP A 1 197 ? 10.198  48.124  -17.623 1.00 36.09 ? 197 TRP A CH2   1 
ATOM   1429  N  N     . PHE A 1 198 ? 7.249   40.388  -17.438 1.00 33.70 ? 198 PHE A N     1 
ATOM   1430  C  CA    . PHE A 1 198 ? 6.768   39.179  -18.085 1.00 33.06 ? 198 PHE A CA    1 
ATOM   1431  C  C     . PHE A 1 198 ? 6.059   38.306  -17.073 1.00 32.96 ? 198 PHE A C     1 
ATOM   1432  O  O     . PHE A 1 198 ? 6.035   38.611  -15.872 1.00 32.34 ? 198 PHE A O     1 
ATOM   1433  C  CB    . PHE A 1 198 ? 7.925   38.419  -18.743 1.00 32.91 ? 198 PHE A CB    1 
ATOM   1434  C  CG    . PHE A 1 198 ? 8.699   37.528  -17.807 1.00 33.79 ? 198 PHE A CG    1 
ATOM   1435  C  CD1   . PHE A 1 198 ? 9.597   38.061  -16.886 1.00 33.16 ? 198 PHE A CD1   1 
ATOM   1436  C  CD2   . PHE A 1 198 ? 8.554   36.129  -17.871 1.00 33.98 ? 198 PHE A CD2   1 
ATOM   1437  C  CE1   . PHE A 1 198 ? 10.324  37.215  -16.027 1.00 32.88 ? 198 PHE A CE1   1 
ATOM   1438  C  CE2   . PHE A 1 198 ? 9.278   35.288  -17.014 1.00 32.35 ? 198 PHE A CE2   1 
ATOM   1439  C  CZ    . PHE A 1 198 ? 10.160  35.835  -16.099 1.00 32.45 ? 198 PHE A CZ    1 
ATOM   1440  N  N     . THR A 1 199 ? 5.486   37.213  -17.573 1.00 33.22 ? 199 THR A N     1 
ATOM   1441  C  CA    . THR A 1 199 ? 4.965   36.149  -16.724 1.00 33.11 ? 199 THR A CA    1 
ATOM   1442  C  C     . THR A 1 199 ? 5.293   34.779  -17.299 1.00 33.33 ? 199 THR A C     1 
ATOM   1443  O  O     . THR A 1 199 ? 5.443   34.613  -18.526 1.00 33.61 ? 199 THR A O     1 
ATOM   1444  C  CB    . THR A 1 199 ? 3.432   36.285  -16.496 1.00 33.19 ? 199 THR A CB    1 
ATOM   1445  O  OG1   . THR A 1 199 ? 2.999   35.293  -15.556 1.00 34.09 ? 199 THR A OG1   1 
ATOM   1446  C  CG2   . THR A 1 199 ? 2.663   36.121  -17.797 1.00 32.42 ? 199 THR A CG2   1 
ATOM   1447  N  N     . HIS A 1 200 ? 5.420   33.800  -16.406 1.00 33.20 ? 200 HIS A N     1 
ATOM   1448  C  CA    . HIS A 1 200 ? 5.490   32.410  -16.814 1.00 33.12 ? 200 HIS A CA    1 
ATOM   1449  C  C     . HIS A 1 200 ? 4.067   31.927  -17.047 1.00 32.72 ? 200 HIS A C     1 
ATOM   1450  O  O     . HIS A 1 200 ? 3.103   32.543  -16.572 1.00 32.95 ? 200 HIS A O     1 
ATOM   1451  C  CB    . HIS A 1 200 ? 6.214   31.567  -15.764 1.00 33.55 ? 200 HIS A CB    1 
ATOM   1452  C  CG    . HIS A 1 200 ? 7.701   31.605  -15.899 1.00 34.31 ? 200 HIS A CG    1 
ATOM   1453  N  ND1   . HIS A 1 200 ? 8.370   30.948  -16.911 1.00 35.05 ? 200 HIS A ND1   1 
ATOM   1454  C  CD2   . HIS A 1 200 ? 8.649   32.247  -15.177 1.00 35.96 ? 200 HIS A CD2   1 
ATOM   1455  C  CE1   . HIS A 1 200 ? 9.668   31.185  -16.804 1.00 35.98 ? 200 HIS A CE1   1 
ATOM   1456  N  NE2   . HIS A 1 200 ? 9.865   31.969  -15.760 1.00 35.55 ? 200 HIS A NE2   1 
ATOM   1457  N  N     . ALA A 1 201 ? 3.936   30.859  -17.819 1.00 32.43 ? 201 ALA A N     1 
ATOM   1458  C  CA    . ALA A 1 201 ? 2.648   30.231  -18.078 1.00 31.86 ? 201 ALA A CA    1 
ATOM   1459  C  C     . ALA A 1 201 ? 2.020   29.712  -16.773 1.00 31.97 ? 201 ALA A C     1 
ATOM   1460  O  O     . ALA A 1 201 ? 2.723   29.424  -15.794 1.00 31.81 ? 201 ALA A O     1 
ATOM   1461  C  CB    . ALA A 1 201 ? 2.824   29.092  -19.076 1.00 32.05 ? 201 ALA A CB    1 
ATOM   1462  N  N     . SER A 1 202 ? 0.696   29.595  -16.778 1.00 31.79 ? 202 SER A N     1 
ATOM   1463  C  CA    . SER A 1 202 ? -0.071  29.159  -15.605 1.00 32.45 ? 202 SER A CA    1 
ATOM   1464  C  C     . SER A 1 202 ? 0.464   27.916  -14.892 1.00 33.17 ? 202 SER A C     1 
ATOM   1465  O  O     . SER A 1 202 ? 0.582   27.936  -13.662 1.00 33.58 ? 202 SER A O     1 
ATOM   1466  C  CB    . SER A 1 202 ? -1.541  28.958  -15.963 1.00 32.07 ? 202 SER A CB    1 
ATOM   1467  O  OG    . SER A 1 202 ? -2.150  30.205  -16.205 1.00 32.73 ? 202 SER A OG    1 
ATOM   1468  N  N     . PRO A 1 203 ? 0.761   26.822  -15.650 1.00 33.56 ? 203 PRO A N     1 
ATOM   1469  C  CA    . PRO A 1 203 ? 1.252   25.594  -15.004 1.00 33.52 ? 203 PRO A CA    1 
ATOM   1470  C  C     . PRO A 1 203 ? 2.517   25.825  -14.168 1.00 33.40 ? 203 PRO A C     1 
ATOM   1471  O  O     . PRO A 1 203 ? 2.655   25.249  -13.086 1.00 33.94 ? 203 PRO A O     1 
ATOM   1472  C  CB    . PRO A 1 203 ? 1.540   24.664  -16.185 1.00 33.54 ? 203 PRO A CB    1 
ATOM   1473  C  CG    . PRO A 1 203 ? 0.709   25.189  -17.311 1.00 33.79 ? 203 PRO A CG    1 
ATOM   1474  C  CD    . PRO A 1 203 ? 0.632   26.655  -17.117 1.00 32.97 ? 203 PRO A CD    1 
ATOM   1475  N  N     . THR A 1 204 ? 3.414   26.673  -14.662 1.00 32.57 ? 204 THR A N     1 
ATOM   1476  C  CA    . THR A 1 204 ? 4.624   27.060  -13.932 1.00 32.72 ? 204 THR A CA    1 
ATOM   1477  C  C     . THR A 1 204 ? 4.266   27.825  -12.655 1.00 32.96 ? 204 THR A C     1 
ATOM   1478  O  O     . THR A 1 204 ? 4.852   27.583  -11.597 1.00 33.77 ? 204 THR A O     1 
ATOM   1479  C  CB    . THR A 1 204 ? 5.534   27.944  -14.810 1.00 32.34 ? 204 THR A CB    1 
ATOM   1480  O  OG1   . THR A 1 204 ? 5.827   27.249  -16.029 1.00 33.13 ? 204 THR A OG1   1 
ATOM   1481  C  CG2   . THR A 1 204 ? 6.815   28.301  -14.097 1.00 31.42 ? 204 THR A CG2   1 
ATOM   1482  N  N     . LEU A 1 205 ? 3.304   28.741  -12.755 1.00 32.22 ? 205 LEU A N     1 
ATOM   1483  C  CA    . LEU A 1 205 ? 2.856   29.500  -11.591 1.00 32.30 ? 205 LEU A CA    1 
ATOM   1484  C  C     . LEU A 1 205 ? 2.164   28.610  -10.565 1.00 33.17 ? 205 LEU A C     1 
ATOM   1485  O  O     . LEU A 1 205 ? 2.347   28.808  -9.364  1.00 33.37 ? 205 LEU A O     1 
ATOM   1486  C  CB    . LEU A 1 205 ? 1.960   30.683  -11.991 1.00 31.58 ? 205 LEU A CB    1 
ATOM   1487  C  CG    . LEU A 1 205 ? 2.532   31.716  -12.970 1.00 30.40 ? 205 LEU A CG    1 
ATOM   1488  C  CD1   . LEU A 1 205 ? 1.491   32.766  -13.322 1.00 28.97 ? 205 LEU A CD1   1 
ATOM   1489  C  CD2   . LEU A 1 205 ? 3.804   32.375  -12.444 1.00 29.25 ? 205 LEU A CD2   1 
ATOM   1490  N  N     . PHE A 1 206 ? 1.386   27.625  -11.031 1.00 33.78 ? 206 PHE A N     1 
ATOM   1491  C  CA    . PHE A 1 206 ? 0.764   26.649  -10.114 1.00 35.18 ? 206 PHE A CA    1 
ATOM   1492  C  C     . PHE A 1 206 ? 1.818   25.759  -9.466  1.00 35.55 ? 206 PHE A C     1 
ATOM   1493  O  O     . PHE A 1 206 ? 1.836   25.592  -8.247  1.00 36.64 ? 206 PHE A O     1 
ATOM   1494  C  CB    . PHE A 1 206 ? -0.245  25.719  -10.812 1.00 35.22 ? 206 PHE A CB    1 
ATOM   1495  C  CG    . PHE A 1 206 ? -1.408  26.419  -11.442 1.00 35.85 ? 206 PHE A CG    1 
ATOM   1496  C  CD1   . PHE A 1 206 ? -1.915  25.970  -12.657 1.00 36.51 ? 206 PHE A CD1   1 
ATOM   1497  C  CD2   . PHE A 1 206 ? -2.005  27.514  -10.831 1.00 36.19 ? 206 PHE A CD2   1 
ATOM   1498  C  CE1   . PHE A 1 206 ? -3.000  26.605  -13.258 1.00 35.97 ? 206 PHE A CE1   1 
ATOM   1499  C  CE2   . PHE A 1 206 ? -3.082  28.153  -11.428 1.00 36.73 ? 206 PHE A CE2   1 
ATOM   1500  C  CZ    . PHE A 1 206 ? -3.584  27.690  -12.642 1.00 35.61 ? 206 PHE A CZ    1 
ATOM   1501  N  N     . ASN A 1 207 ? 2.702   25.201  -10.290 1.00 35.23 ? 207 ASN A N     1 
ATOM   1502  C  CA    . ASN A 1 207 ? 3.450   24.004  -9.902  1.00 35.58 ? 207 ASN A CA    1 
ATOM   1503  C  C     . ASN A 1 207 ? 4.906   24.173  -9.490  1.00 36.09 ? 207 ASN A C     1 
ATOM   1504  O  O     . ASN A 1 207 ? 5.473   23.255  -8.898  1.00 37.11 ? 207 ASN A O     1 
ATOM   1505  C  CB    . ASN A 1 207 ? 3.319   22.932  -10.992 1.00 34.83 ? 207 ASN A CB    1 
ATOM   1506  C  CG    . ASN A 1 207 ? 1.866   22.542  -11.244 1.00 34.37 ? 207 ASN A CG    1 
ATOM   1507  O  OD1   . ASN A 1 207 ? 1.100   22.347  -10.302 1.00 32.21 ? 207 ASN A OD1   1 
ATOM   1508  N  ND2   . ASN A 1 207 ? 1.476   22.454  -12.518 1.00 31.95 ? 207 ASN A ND2   1 
ATOM   1509  N  N     . ALA A 1 208 ? 5.513   25.320  -9.785  1.00 35.79 ? 208 ALA A N     1 
ATOM   1510  C  CA    . ALA A 1 208 ? 6.928   25.502  -9.471  1.00 36.90 ? 208 ALA A CA    1 
ATOM   1511  C  C     . ALA A 1 208 ? 7.166   25.492  -7.961  1.00 38.05 ? 208 ALA A C     1 
ATOM   1512  O  O     . ALA A 1 208 ? 6.382   26.046  -7.194  1.00 38.55 ? 208 ALA A O     1 
ATOM   1513  C  CB    . ALA A 1 208 ? 7.472   26.769  -10.111 1.00 36.13 ? 208 ALA A CB    1 
ATOM   1514  N  N     . GLY A 1 209 ? 8.233   24.829  -7.535  1.00 39.47 ? 209 GLY A N     1 
ATOM   1515  C  CA    . GLY A 1 209 ? 8.516   24.674  -6.112  1.00 40.95 ? 209 GLY A CA    1 
ATOM   1516  C  C     . GLY A 1 209 ? 7.639   23.673  -5.371  1.00 42.04 ? 209 GLY A C     1 
ATOM   1517  O  O     . GLY A 1 209 ? 7.789   23.509  -4.169  1.00 42.88 ? 209 GLY A O     1 
ATOM   1518  N  N     . THR A 1 210 ? 6.724   23.005  -6.072  1.00 42.21 ? 210 THR A N     1 
ATOM   1519  C  CA    . THR A 1 210 ? 5.887   21.980  -5.449  1.00 43.81 ? 210 THR A CA    1 
ATOM   1520  C  C     . THR A 1 210 ? 6.404   20.570  -5.755  1.00 45.09 ? 210 THR A C     1 
ATOM   1521  O  O     . THR A 1 210 ? 7.375   20.406  -6.507  1.00 44.90 ? 210 THR A O     1 
ATOM   1522  C  CB    . THR A 1 210 ? 4.380   22.086  -5.862  1.00 43.28 ? 210 THR A CB    1 
ATOM   1523  O  OG1   . THR A 1 210 ? 4.205   21.601  -7.198  1.00 43.08 ? 210 THR A OG1   1 
ATOM   1524  C  CG2   . THR A 1 210 ? 3.862   23.518  -5.756  1.00 42.18 ? 210 THR A CG2   1 
ATOM   1525  N  N     . ASN A 1 211 ? 5.743   19.570  -5.165  1.00 46.61 ? 211 ASN A N     1 
ATOM   1526  C  CA    . ASN A 1 211 ? 6.068   18.152  -5.359  1.00 48.21 ? 211 ASN A CA    1 
ATOM   1527  C  C     . ASN A 1 211 ? 5.898   17.614  -6.782  1.00 47.90 ? 211 ASN A C     1 
ATOM   1528  O  O     . ASN A 1 211 ? 6.713   16.810  -7.230  1.00 48.67 ? 211 ASN A O     1 
ATOM   1529  C  CB    . ASN A 1 211 ? 5.268   17.274  -4.395  1.00 49.16 ? 211 ASN A CB    1 
ATOM   1530  C  CG    . ASN A 1 211 ? 5.924   17.157  -3.036  1.00 52.17 ? 211 ASN A CG    1 
ATOM   1531  O  OD1   . ASN A 1 211 ? 5.245   17.213  -2.003  1.00 55.48 ? 211 ASN A OD1   1 
ATOM   1532  N  ND2   . ASN A 1 211 ? 7.255   17.001  -3.020  1.00 51.93 ? 211 ASN A ND2   1 
ATOM   1533  N  N     . ARG A 1 212 ? 4.845   18.026  -7.485  1.00 47.05 ? 212 ARG A N     1 
ATOM   1534  C  CA    . ARG A 1 212 ? 4.694   17.614  -8.881  1.00 46.57 ? 212 ARG A CA    1 
ATOM   1535  C  C     . ARG A 1 212 ? 4.879   18.810  -9.815  1.00 45.11 ? 212 ARG A C     1 
ATOM   1536  O  O     . ARG A 1 212 ? 3.897   19.423  -10.234 1.00 45.18 ? 212 ARG A O     1 
ATOM   1537  C  CB    . ARG A 1 212 ? 3.340   16.922  -9.115  1.00 46.94 ? 212 ARG A CB    1 
ATOM   1538  N  N     . PRO A 1 213 ? 6.143   19.162  -10.123 1.00 44.33 ? 213 PRO A N     1 
ATOM   1539  C  CA    . PRO A 1 213 ? 6.383   20.352  -10.930 1.00 42.96 ? 213 PRO A CA    1 
ATOM   1540  C  C     . PRO A 1 213 ? 6.176   20.104  -12.428 1.00 42.29 ? 213 PRO A C     1 
ATOM   1541  O  O     . PRO A 1 213 ? 7.143   20.056  -13.209 1.00 42.01 ? 213 PRO A O     1 
ATOM   1542  C  CB    . PRO A 1 213 ? 7.839   20.709  -10.603 1.00 43.07 ? 213 PRO A CB    1 
ATOM   1543  C  CG    . PRO A 1 213 ? 8.471   19.430  -10.200 1.00 43.90 ? 213 PRO A CG    1 
ATOM   1544  C  CD    . PRO A 1 213 ? 7.400   18.489  -9.738  1.00 44.90 ? 213 PRO A CD    1 
ATOM   1545  N  N     . GLN A 1 214 ? 4.919   19.922  -12.817 1.00 41.83 ? 214 GLN A N     1 
ATOM   1546  C  CA    . GLN A 1 214 ? 4.571   19.881  -14.224 1.00 41.54 ? 214 GLN A CA    1 
ATOM   1547  C  C     . GLN A 1 214 ? 4.395   21.335  -14.642 1.00 40.34 ? 214 GLN A C     1 
ATOM   1548  O  O     . GLN A 1 214 ? 3.361   21.952  -14.371 1.00 39.52 ? 214 GLN A O     1 
ATOM   1549  C  CB    . GLN A 1 214 ? 3.292   19.066  -14.463 1.00 42.11 ? 214 GLN A CB    1 
ATOM   1550  C  CG    . GLN A 1 214 ? 3.262   18.298  -15.821 1.00 43.98 ? 214 GLN A CG    1 
ATOM   1551  C  CD    . GLN A 1 214 ? 3.709   19.127  -17.035 1.00 46.16 ? 214 GLN A CD    1 
ATOM   1552  O  OE1   . GLN A 1 214 ? 4.709   18.800  -17.694 1.00 47.83 ? 214 GLN A OE1   1 
ATOM   1553  N  NE2   . GLN A 1 214 ? 2.971   20.200  -17.331 1.00 45.81 ? 214 GLN A NE2   1 
ATOM   1554  N  N     . LEU A 1 215 ? 5.392   21.881  -15.301 1.00 39.83 ? 215 LEU A N     1 
ATOM   1555  C  CA    . LEU A 1 215 ? 5.474   23.293  -15.553 1.00 39.23 ? 215 LEU A CA    1 
ATOM   1556  C  C     . LEU A 1 215 ? 5.104   23.662  -16.968 1.00 39.09 ? 215 LEU A C     1 
ATOM   1557  O  O     . LEU A 1 215 ? 5.021   24.793  -17.307 1.00 38.12 ? 215 LEU A O     1 
ATOM   1558  C  CB    . LEU A 1 215 ? 6.880   23.765  -15.253 1.00 39.05 ? 215 LEU A CB    1 
ATOM   1559  C  CG    . LEU A 1 215 ? 7.467   23.377  -13.922 1.00 39.54 ? 215 LEU A CG    1 
ATOM   1560  C  CD1   . LEU A 1 215 ? 8.840   23.881  -13.799 1.00 38.24 ? 215 LEU A CD1   1 
ATOM   1561  C  CD2   . LEU A 1 215 ? 6.631   23.896  -12.820 1.00 38.61 ? 215 LEU A CD2   1 
ATOM   1562  N  N     . SER A 1 216 ? 4.867   22.650  -17.765 1.00 40.31 ? 216 SER A N     1 
ATOM   1563  C  CA    . SER A 1 216 ? 4.598   22.770  -19.157 1.00 41.33 ? 216 SER A CA    1 
ATOM   1564  C  C     . SER A 1 216 ? 3.138   22.799  -19.490 1.00 41.76 ? 216 SER A C     1 
ATOM   1565  O  O     . SER A 1 216 ? 2.348   22.166  -18.860 1.00 41.72 ? 216 SER A O     1 
ATOM   1566  C  CB    . SER A 1 216 ? 5.229   21.613  -19.866 1.00 41.79 ? 216 SER A CB    1 
ATOM   1567  O  OG    . SER A 1 216 ? 6.595   21.674  -19.677 1.00 44.35 ? 216 SER A OG    1 
ATOM   1568  N  N     . SER A 1 217 ? 2.816   23.540  -20.526 1.00 42.15 ? 217 SER A N     1 
ATOM   1569  C  CA    . SER A 1 217 ? 1.451   23.783  -20.920 1.00 43.01 ? 217 SER A CA    1 
ATOM   1570  C  C     . SER A 1 217 ? 0.911   22.821  -21.933 1.00 43.48 ? 217 SER A C     1 
ATOM   1571  O  O     . SER A 1 217 ? -0.185  22.367  -21.830 1.00 44.66 ? 217 SER A O     1 
ATOM   1572  C  CB    . SER A 1 217 ? 1.334   25.175  -21.483 1.00 42.59 ? 217 SER A CB    1 
ATOM   1573  O  OG    . SER A 1 217 ? 2.184   26.038  -20.814 1.00 42.95 ? 217 SER A OG    1 
ATOM   1574  N  N     . CYS A 1 218 ? 1.702   22.522  -22.926 0.50 43.42 ? 218 CYS A N     1 
ATOM   1575  C  CA    . CYS A 1 218 ? 1.198   21.865  -24.089 0.00 12.65 ? 218 CYS A CA    1 
ATOM   1576  C  C     . CYS A 1 218 ? 1.892   20.541  -24.334 0.50 33.87 ? 218 CYS A C     1 
ATOM   1577  O  O     . CYS A 1 218 ? 2.973   20.340  -23.895 0.50 33.35 ? 218 CYS A O     1 
ATOM   1578  C  CB    . CYS A 1 218 ? 1.286   22.841  -25.306 0.00 12.38 ? 218 CYS A CB    1 
ATOM   1579  S  SG    . CYS A 1 218 ? 2.937   23.216  -26.024 0.00 12.42 ? 218 CYS A SG    1 
ATOM   1580  N  N     . PHE A 1 219 ? 1.219   19.644  -25.022 1.00 35.11 ? 219 PHE A N     1 
ATOM   1581  C  CA    . PHE A 1 219 ? 1.789   18.407  -25.499 1.00 36.19 ? 219 PHE A CA    1 
ATOM   1582  C  C     . PHE A 1 219 ? 1.276   18.104  -26.885 1.00 36.55 ? 219 PHE A C     1 
ATOM   1583  O  O     . PHE A 1 219 ? 0.170   18.377  -27.179 1.00 36.87 ? 219 PHE A O     1 
ATOM   1584  C  CB    . PHE A 1 219 ? 1.480   17.267  -24.548 1.00 36.44 ? 219 PHE A CB    1 
ATOM   1585  C  CG    . PHE A 1 219 ? 2.187   17.372  -23.266 1.00 37.67 ? 219 PHE A CG    1 
ATOM   1586  C  CD1   . PHE A 1 219 ? 1.633   18.028  -22.217 1.00 38.08 ? 219 PHE A CD1   1 
ATOM   1587  C  CD2   . PHE A 1 219 ? 3.428   16.851  -23.110 1.00 37.72 ? 219 PHE A CD2   1 
ATOM   1588  C  CE1   . PHE A 1 219 ? 2.301   18.137  -21.057 1.00 38.24 ? 219 PHE A CE1   1 
ATOM   1589  C  CE2   . PHE A 1 219 ? 4.069   16.970  -21.948 1.00 38.89 ? 219 PHE A CE2   1 
ATOM   1590  C  CZ    . PHE A 1 219 ? 3.506   17.612  -20.928 1.00 38.01 ? 219 PHE A CZ    1 
ATOM   1591  N  N     . LEU A 1 220 ? 2.107   17.556  -27.742 1.00 36.84 ? 220 LEU A N     1 
ATOM   1592  C  CA    . LEU A 1 220 ? 1.626   17.064  -29.001 1.00 37.55 ? 220 LEU A CA    1 
ATOM   1593  C  C     . LEU A 1 220 ? 2.060   15.656  -29.249 1.00 38.11 ? 220 LEU A C     1 
ATOM   1594  O  O     . LEU A 1 220 ? 3.109   15.264  -28.869 1.00 38.13 ? 220 LEU A O     1 
ATOM   1595  C  CB    . LEU A 1 220 ? 1.945   17.966  -30.185 1.00 37.28 ? 220 LEU A CB    1 
ATOM   1596  C  CG    . LEU A 1 220 ? 2.827   19.189  -30.233 1.00 37.71 ? 220 LEU A CG    1 
ATOM   1597  C  CD1   . LEU A 1 220 ? 2.726   19.769  -31.563 1.00 37.91 ? 220 LEU A CD1   1 
ATOM   1598  C  CD2   . LEU A 1 220 ? 2.500   20.191  -29.239 1.00 36.90 ? 220 LEU A CD2   1 
ATOM   1599  N  N     . LEU A 1 221 ? 1.188   14.898  -29.873 1.00 39.02 ? 221 LEU A N     1 
ATOM   1600  C  CA    . LEU A 1 221 ? 1.394   13.464  -30.121 1.00 40.47 ? 221 LEU A CA    1 
ATOM   1601  C  C     . LEU A 1 221 ? 0.993   13.078  -31.540 1.00 41.22 ? 221 LEU A C     1 
ATOM   1602  O  O     . LEU A 1 221 ? 0.065   13.651  -32.111 1.00 40.91 ? 221 LEU A O     1 
ATOM   1603  C  CB    . LEU A 1 221 ? 0.562   12.609  -29.156 1.00 40.38 ? 221 LEU A CB    1 
ATOM   1604  C  CG    . LEU A 1 221 ? 0.533   12.868  -27.655 1.00 40.51 ? 221 LEU A CG    1 
ATOM   1605  C  CD1   . LEU A 1 221 ? -0.357  14.054  -27.317 1.00 39.82 ? 221 LEU A CD1   1 
ATOM   1606  C  CD2   . LEU A 1 221 ? 0.028   11.638  -26.947 1.00 41.24 ? 221 LEU A CD2   1 
ATOM   1607  N  N     . SER A 1 222 ? 1.692   12.082  -32.074 1.00 43.01 ? 222 SER A N     1 
ATOM   1608  C  CA    . SER A 1 222 ? 1.379   11.461  -33.360 1.00 44.81 ? 222 SER A CA    1 
ATOM   1609  C  C     . SER A 1 222 ? 0.797   10.104  -33.079 1.00 46.10 ? 222 SER A C     1 
ATOM   1610  O  O     . SER A 1 222 ? 1.300   9.381   -32.221 1.00 46.70 ? 222 SER A O     1 
ATOM   1611  C  CB    . SER A 1 222 ? 2.640   11.270  -34.206 1.00 45.11 ? 222 SER A CB    1 
ATOM   1612  O  OG    . SER A 1 222 ? 2.961   12.464  -34.885 1.00 45.65 ? 222 SER A OG    1 
ATOM   1613  N  N     . MET A 1 223 ? -0.264  9.754   -33.796 1.00 47.25 ? 223 MET A N     1 
ATOM   1614  C  CA    . MET A 1 223 ? -0.848  8.430   -33.651 1.00 48.78 ? 223 MET A CA    1 
ATOM   1615  C  C     . MET A 1 223 ? 0.205   7.392   -34.037 1.00 50.11 ? 223 MET A C     1 
ATOM   1616  O  O     . MET A 1 223 ? 0.792   7.451   -35.137 1.00 50.37 ? 223 MET A O     1 
ATOM   1617  C  CB    . MET A 1 223 ? -2.099  8.286   -34.510 1.00 48.85 ? 223 MET A CB    1 
ATOM   1618  C  CG    . MET A 1 223 ? -2.951  7.137   -34.112 1.00 50.59 ? 223 MET A CG    1 
ATOM   1619  S  SD    . MET A 1 223 ? -3.847  7.446   -32.591 1.00 51.90 ? 223 MET A SD    1 
ATOM   1620  C  CE    . MET A 1 223 ? -5.368  8.091   -33.218 1.00 51.28 ? 223 MET A CE    1 
ATOM   1621  N  N     . LYS A 1 224 ? 0.441   6.459   -33.115 1.00 51.02 ? 224 LYS A N     1 
ATOM   1622  C  CA    . LYS A 1 224 ? 1.511   5.468   -33.236 1.00 52.31 ? 224 LYS A CA    1 
ATOM   1623  C  C     . LYS A 1 224 ? 1.353   4.582   -34.481 1.00 52.76 ? 224 LYS A C     1 
ATOM   1624  O  O     . LYS A 1 224 ? 1.788   4.957   -35.577 1.00 53.15 ? 224 LYS A O     1 
ATOM   1625  C  CB    . LYS A 1 224 ? 1.588   4.628   -31.954 1.00 52.95 ? 224 LYS A CB    1 
ATOM   1626  C  CG    . LYS A 1 224 ? 2.103   5.412   -30.755 1.00 54.33 ? 224 LYS A CG    1 
ATOM   1627  C  CD    . LYS A 1 224 ? 2.173   4.538   -29.524 1.00 57.04 ? 224 LYS A CD    1 
ATOM   1628  C  CE    . LYS A 1 224 ? 2.931   5.241   -28.421 1.00 57.62 ? 224 LYS A CE    1 
ATOM   1629  N  NZ    . LYS A 1 224 ? 3.477   4.243   -27.455 1.00 59.85 ? 224 LYS A NZ    1 
ATOM   1630  N  N     . ASP A 1 225 ? 0.725   3.422   -34.296 1.00 52.63 ? 225 ASP A N     1 
ATOM   1631  C  CA    . ASP A 1 225 ? 0.394   2.506   -35.380 1.00 52.59 ? 225 ASP A CA    1 
ATOM   1632  C  C     . ASP A 1 225 ? -1.095  2.606   -35.723 1.00 50.85 ? 225 ASP A C     1 
ATOM   1633  O  O     . ASP A 1 225 ? -1.899  3.072   -34.909 1.00 50.06 ? 225 ASP A O     1 
ATOM   1634  C  CB    . ASP A 1 225 ? 0.747   1.064   -34.969 1.00 54.08 ? 225 ASP A CB    1 
ATOM   1635  C  CG    . ASP A 1 225 ? 0.769   0.092   -36.157 1.00 57.85 ? 225 ASP A CG    1 
ATOM   1636  O  OD1   . ASP A 1 225 ? 0.558   0.528   -37.325 1.00 60.25 ? 225 ASP A OD1   1 
ATOM   1637  O  OD2   . ASP A 1 225 ? 1.004   -1.120  -35.922 1.00 61.49 ? 225 ASP A OD2   1 
ATOM   1638  N  N     . ASP A 1 226 ? -1.442  2.179   -36.937 1.00 49.53 ? 226 ASP A N     1 
ATOM   1639  C  CA    . ASP A 1 226 ? -2.829  2.028   -37.352 1.00 47.78 ? 226 ASP A CA    1 
ATOM   1640  C  C     . ASP A 1 226 ? -3.322  0.628   -36.952 1.00 47.75 ? 226 ASP A C     1 
ATOM   1641  O  O     . ASP A 1 226 ? -3.387  -0.297  -37.764 1.00 48.88 ? 226 ASP A O     1 
ATOM   1642  C  CB    . ASP A 1 226 ? -2.962  2.292   -38.856 1.00 47.93 ? 226 ASP A CB    1 
ATOM   1643  C  CG    . ASP A 1 226 ? -4.333  1.948   -39.397 1.00 47.72 ? 226 ASP A CG    1 
ATOM   1644  O  OD1   . ASP A 1 226 ? -4.412  1.392   -40.507 1.00 48.47 ? 226 ASP A OD1   1 
ATOM   1645  O  OD2   . ASP A 1 226 ? -5.331  2.206   -38.706 1.00 47.15 ? 226 ASP A OD2   1 
ATOM   1646  N  N     . SER A 1 227 ? -3.643  0.487   -35.672 1.00 46.23 ? 227 SER A N     1 
ATOM   1647  C  CA    . SER A 1 227 ? -4.045  -0.779  -35.078 1.00 45.58 ? 227 SER A CA    1 
ATOM   1648  C  C     . SER A 1 227 ? -4.688  -0.493  -33.735 1.00 44.66 ? 227 SER A C     1 
ATOM   1649  O  O     . SER A 1 227 ? -4.556  0.607   -33.216 1.00 43.67 ? 227 SER A O     1 
ATOM   1650  C  CB    . SER A 1 227 ? -2.837  -1.711  -34.897 1.00 45.90 ? 227 SER A CB    1 
ATOM   1651  O  OG    . SER A 1 227 ? -1.861  -1.172  -34.018 1.00 44.92 ? 227 SER A OG    1 
ATOM   1652  N  N     . ILE A 1 228 ? -5.376  -1.487  -33.177 1.00 45.04 ? 228 ILE A N     1 
ATOM   1653  C  CA    . ILE A 1 228 ? -5.951  -1.390  -31.838 1.00 44.35 ? 228 ILE A CA    1 
ATOM   1654  C  C     . ILE A 1 228 ? -4.861  -1.116  -30.797 1.00 44.12 ? 228 ILE A C     1 
ATOM   1655  O  O     . ILE A 1 228 ? -5.001  -0.214  -29.977 1.00 42.85 ? 228 ILE A O     1 
ATOM   1656  C  CB    . ILE A 1 228 ? -6.793  -2.644  -31.479 1.00 45.17 ? 228 ILE A CB    1 
ATOM   1657  C  CG1   . ILE A 1 228 ? -8.059  -2.708  -32.354 1.00 45.24 ? 228 ILE A CG1   1 
ATOM   1658  C  CG2   . ILE A 1 228 ? -7.160  -2.668  -29.982 1.00 44.69 ? 228 ILE A CG2   1 
ATOM   1659  C  CD1   . ILE A 1 228 ? -8.862  -1.403  -32.420 1.00 44.01 ? 228 ILE A CD1   1 
ATOM   1660  N  N     . GLU A 1 229 ? -3.778  -1.885  -30.864 1.00 44.96 ? 229 GLU A N     1 
ATOM   1661  C  CA    . GLU A 1 229 ? -2.606  -1.699  -30.007 1.00 45.63 ? 229 GLU A CA    1 
ATOM   1662  C  C     . GLU A 1 229 ? -2.154  -0.236  -29.983 1.00 44.19 ? 229 GLU A C     1 
ATOM   1663  O  O     . GLU A 1 229 ? -2.032  0.366   -28.912 1.00 43.54 ? 229 GLU A O     1 
ATOM   1664  C  CB    . GLU A 1 229 ? -1.471  -2.617  -30.493 1.00 46.73 ? 229 GLU A CB    1 
ATOM   1665  C  CG    . GLU A 1 229 ? -0.076  -2.301  -29.945 1.00 50.34 ? 229 GLU A CG    1 
ATOM   1666  C  CD    . GLU A 1 229 ? 0.322   -3.178  -28.757 1.00 56.27 ? 229 GLU A CD    1 
ATOM   1667  O  OE1   . GLU A 1 229 ? -0.026  -4.386  -28.744 1.00 58.76 ? 229 GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A 1 229 ? 1.001   -2.658  -27.840 1.00 57.88 ? 229 GLU A OE2   1 
ATOM   1669  N  N     . GLY A 1 230 ? -1.936  0.331   -31.173 1.00 43.47 ? 230 GLY A N     1 
ATOM   1670  C  CA    . GLY A 1 230 ? -1.427  1.690   -31.303 1.00 42.04 ? 230 GLY A CA    1 
ATOM   1671  C  C     . GLY A 1 230 ? -2.411  2.743   -30.832 1.00 40.99 ? 230 GLY A C     1 
ATOM   1672  O  O     . GLY A 1 230 ? -2.028  3.694   -30.149 1.00 40.22 ? 230 GLY A O     1 
ATOM   1673  N  N     . ILE A 1 231 ? -3.679  2.564   -31.205 1.00 40.89 ? 231 ILE A N     1 
ATOM   1674  C  CA    . ILE A 1 231 ? -4.758  3.495   -30.867 1.00 40.09 ? 231 ILE A CA    1 
ATOM   1675  C  C     . ILE A 1 231 ? -4.932  3.604   -29.355 1.00 39.88 ? 231 ILE A C     1 
ATOM   1676  O  O     . ILE A 1 231 ? -5.156  4.698   -28.833 1.00 39.45 ? 231 ILE A O     1 
ATOM   1677  C  CB    . ILE A 1 231 ? -6.090  3.085   -31.559 1.00 40.53 ? 231 ILE A CB    1 
ATOM   1678  C  CG1   . ILE A 1 231 ? -6.064  3.510   -33.026 1.00 40.58 ? 231 ILE A CG1   1 
ATOM   1679  C  CG2   . ILE A 1 231 ? -7.303  3.687   -30.860 1.00 39.96 ? 231 ILE A CG2   1 
ATOM   1680  C  CD1   . ILE A 1 231 ? -6.953  2.675   -33.928 1.00 39.86 ? 231 ILE A CD1   1 
ATOM   1681  N  N     . TYR A 1 232 ? -4.788  2.471   -28.672 1.00 40.30 ? 232 TYR A N     1 
ATOM   1682  C  CA    . TYR A 1 232 ? -4.975  2.376   -27.227 1.00 40.37 ? 232 TYR A CA    1 
ATOM   1683  C  C     . TYR A 1 232 ? -3.719  2.666   -26.405 1.00 40.90 ? 232 TYR A C     1 
ATOM   1684  O  O     . TYR A 1 232 ? -3.817  3.062   -25.240 1.00 40.50 ? 232 TYR A O     1 
ATOM   1685  C  CB    . TYR A 1 232 ? -5.606  1.028   -26.854 1.00 40.36 ? 232 TYR A CB    1 
ATOM   1686  C  CG    . TYR A 1 232 ? -7.094  1.091   -27.006 1.00 39.58 ? 232 TYR A CG    1 
ATOM   1687  C  CD1   . TYR A 1 232 ? -7.689  0.891   -28.250 1.00 38.22 ? 232 TYR A CD1   1 
ATOM   1688  C  CD2   . TYR A 1 232 ? -7.912  1.421   -25.922 1.00 38.89 ? 232 TYR A CD2   1 
ATOM   1689  C  CE1   . TYR A 1 232 ? -9.044  0.989   -28.416 1.00 37.99 ? 232 TYR A CE1   1 
ATOM   1690  C  CE2   . TYR A 1 232 ? -9.290  1.517   -26.075 1.00 38.62 ? 232 TYR A CE2   1 
ATOM   1691  C  CZ    . TYR A 1 232 ? -9.843  1.304   -27.324 1.00 39.46 ? 232 TYR A CZ    1 
ATOM   1692  O  OH    . TYR A 1 232 ? -11.197 1.395   -27.498 1.00 40.31 ? 232 TYR A OH    1 
ATOM   1693  N  N     . ASP A 1 233 ? -2.546  2.481   -27.010 1.00 41.84 ? 233 ASP A N     1 
ATOM   1694  C  CA    . ASP A 1 233 ? -1.315  2.977   -26.401 1.00 42.24 ? 233 ASP A CA    1 
ATOM   1695  C  C     . ASP A 1 233 ? -1.319  4.498   -26.376 1.00 40.86 ? 233 ASP A C     1 
ATOM   1696  O  O     . ASP A 1 233 ? -1.032  5.102   -25.343 1.00 40.35 ? 233 ASP A O     1 
ATOM   1697  C  CB    . ASP A 1 233 ? -0.075  2.444   -27.116 1.00 43.15 ? 233 ASP A CB    1 
ATOM   1698  C  CG    . ASP A 1 233 ? 0.435   1.155   -26.500 1.00 47.06 ? 233 ASP A CG    1 
ATOM   1699  O  OD1   . ASP A 1 233 ? 0.623   0.155   -27.243 1.00 50.33 ? 233 ASP A OD1   1 
ATOM   1700  O  OD2   . ASP A 1 233 ? 0.627   1.132   -25.258 1.00 50.65 ? 233 ASP A OD2   1 
ATOM   1701  N  N     . THR A 1 234 ? -1.682  5.104   -27.506 1.00 40.19 ? 234 THR A N     1 
ATOM   1702  C  CA    . THR A 1 234 ? -1.733  6.559   -27.641 1.00 39.06 ? 234 THR A CA    1 
ATOM   1703  C  C     . THR A 1 234 ? -2.794  7.130   -26.696 1.00 39.34 ? 234 THR A C     1 
ATOM   1704  O  O     . THR A 1 234 ? -2.581  8.177   -26.065 1.00 38.87 ? 234 THR A O     1 
ATOM   1705  C  CB    . THR A 1 234 ? -2.026  6.967   -29.112 1.00 39.07 ? 234 THR A CB    1 
ATOM   1706  O  OG1   . THR A 1 234 ? -1.085  6.323   -29.983 1.00 37.92 ? 234 THR A OG1   1 
ATOM   1707  C  CG2   . THR A 1 234 ? -1.964  8.486   -29.313 1.00 37.24 ? 234 THR A CG2   1 
ATOM   1708  N  N     . LEU A 1 235 ? -3.924  6.434   -26.598 1.00 39.80 ? 235 LEU A N     1 
ATOM   1709  C  CA    . LEU A 1 235 ? -4.986  6.801   -25.670 1.00 40.36 ? 235 LEU A CA    1 
ATOM   1710  C  C     . LEU A 1 235 ? -4.504  6.849   -24.225 1.00 41.00 ? 235 LEU A C     1 
ATOM   1711  O  O     . LEU A 1 235 ? -4.794  7.810   -23.497 1.00 40.62 ? 235 LEU A O     1 
ATOM   1712  C  CB    . LEU A 1 235 ? -6.171  5.841   -25.790 1.00 41.06 ? 235 LEU A CB    1 
ATOM   1713  C  CG    . LEU A 1 235 ? -7.385  6.210   -24.942 1.00 40.72 ? 235 LEU A CG    1 
ATOM   1714  C  CD1   . LEU A 1 235 ? -7.984  7.526   -25.413 1.00 39.92 ? 235 LEU A CD1   1 
ATOM   1715  C  CD2   . LEU A 1 235 ? -8.400  5.104   -24.997 1.00 41.41 ? 235 LEU A CD2   1 
ATOM   1716  N  N     . LYS A 1 236 ? -3.777  5.810   -23.818 1.00 42.21 ? 236 LYS A N     1 
ATOM   1717  C  CA    . LYS A 1 236 ? -3.137  5.779   -22.519 1.00 42.80 ? 236 LYS A CA    1 
ATOM   1718  C  C     . LYS A 1 236 ? -2.222  6.983   -22.368 1.00 42.78 ? 236 LYS A C     1 
ATOM   1719  O  O     . LYS A 1 236 ? -2.253  7.633   -21.319 1.00 43.43 ? 236 LYS A O     1 
ATOM   1720  C  CB    . LYS A 1 236 ? -2.351  4.482   -22.316 1.00 43.60 ? 236 LYS A CB    1 
ATOM   1721  C  CG    . LYS A 1 236 ? -1.716  4.360   -20.935 1.00 43.84 ? 236 LYS A CG    1 
ATOM   1722  C  CD    . LYS A 1 236 ? -0.961  3.070   -20.772 1.00 45.67 ? 236 LYS A CD    1 
ATOM   1723  C  CE    . LYS A 1 236 ? 0.149   3.215   -19.746 1.00 46.85 ? 236 LYS A CE    1 
ATOM   1724  N  NZ    . LYS A 1 236 ? 0.842   1.913   -19.526 1.00 48.27 ? 236 LYS A NZ    1 
ATOM   1725  N  N     . GLN A 1 237 ? -1.430  7.297   -23.405 1.00 42.58 ? 237 GLN A N     1 
ATOM   1726  C  CA    . GLN A 1 237 ? -0.544  8.479   -23.365 1.00 42.24 ? 237 GLN A CA    1 
ATOM   1727  C  C     . GLN A 1 237 ? -1.340  9.725   -23.004 1.00 40.76 ? 237 GLN A C     1 
ATOM   1728  O  O     . GLN A 1 237 ? -0.960  10.463  -22.093 1.00 40.60 ? 237 GLN A O     1 
ATOM   1729  C  CB    . GLN A 1 237 ? 0.167   8.744   -24.700 1.00 42.25 ? 237 GLN A CB    1 
ATOM   1730  C  CG    . GLN A 1 237 ? 0.992   7.614   -25.267 1.00 46.10 ? 237 GLN A CG    1 
ATOM   1731  C  CD    . GLN A 1 237 ? 2.374   7.545   -24.673 1.00 50.68 ? 237 GLN A CD    1 
ATOM   1732  O  OE1   . GLN A 1 237 ? 3.359   7.933   -25.321 1.00 51.27 ? 237 GLN A OE1   1 
ATOM   1733  N  NE2   . GLN A 1 237 ? 2.466   7.054   -23.423 1.00 51.10 ? 237 GLN A NE2   1 
ATOM   1734  N  N     . CYS A 1 238 ? -2.437  9.938   -23.736 1.00 39.79 ? 238 CYS A N     1 
ATOM   1735  C  CA    . CYS A 1 238 ? -3.310  11.102  -23.575 1.00 38.49 ? 238 CYS A CA    1 
ATOM   1736  C  C     . CYS A 1 238 ? -3.942  11.179  -22.193 1.00 38.03 ? 238 CYS A C     1 
ATOM   1737  O  O     . CYS A 1 238 ? -4.067  12.262  -21.642 1.00 37.47 ? 238 CYS A O     1 
ATOM   1738  C  CB    . CYS A 1 238 ? -4.406  11.104  -24.637 1.00 38.72 ? 238 CYS A CB    1 
ATOM   1739  S  SG    . CYS A 1 238 ? -3.801  11.299  -26.304 1.00 40.26 ? 238 CYS A SG    1 
ATOM   1740  N  N     . ALA A 1 239 ? -4.334  10.035  -21.641 1.00 38.05 ? 239 ALA A N     1 
ATOM   1741  C  CA    . ALA A 1 239 ? -4.863  9.982   -20.291 1.00 38.29 ? 239 ALA A CA    1 
ATOM   1742  C  C     . ALA A 1 239 ? -3.784  10.379  -19.278 1.00 38.40 ? 239 ALA A C     1 
ATOM   1743  O  O     . ALA A 1 239 ? -4.054  11.127  -18.339 1.00 37.94 ? 239 ALA A O     1 
ATOM   1744  C  CB    . ALA A 1 239 ? -5.400  8.603   -19.990 1.00 38.62 ? 239 ALA A CB    1 
ATOM   1745  N  N     . LEU A 1 240 ? -2.565  9.886   -19.479 1.00 38.54 ? 240 LEU A N     1 
ATOM   1746  C  CA    . LEU A 1 240 ? -1.461  10.204  -18.573 1.00 39.23 ? 240 LEU A CA    1 
ATOM   1747  C  C     . LEU A 1 240 ? -1.065  11.679  -18.640 1.00 39.29 ? 240 LEU A C     1 
ATOM   1748  O  O     . LEU A 1 240 ? -0.869  12.323  -17.602 1.00 39.52 ? 240 LEU A O     1 
ATOM   1749  C  CB    . LEU A 1 240 ? -0.263  9.287   -18.821 1.00 38.88 ? 240 LEU A CB    1 
ATOM   1750  C  CG    . LEU A 1 240 ? -0.481  7.827   -18.411 1.00 39.16 ? 240 LEU A CG    1 
ATOM   1751  C  CD1   . LEU A 1 240 ? 0.608   6.930   -18.975 1.00 39.47 ? 240 LEU A CD1   1 
ATOM   1752  C  CD2   . LEU A 1 240 ? -0.586  7.674   -16.885 1.00 38.49 ? 240 LEU A CD2   1 
ATOM   1753  N  N     . ILE A 1 241 ? -0.985  12.220  -19.851 1.00 39.62 ? 241 ILE A N     1 
ATOM   1754  C  CA    . ILE A 1 241 ? -0.722  13.648  -20.034 1.00 40.07 ? 241 ILE A CA    1 
ATOM   1755  C  C     . ILE A 1 241 ? -1.837  14.496  -19.418 1.00 40.96 ? 241 ILE A C     1 
ATOM   1756  O  O     . ILE A 1 241 ? -1.560  15.467  -18.709 1.00 41.18 ? 241 ILE A O     1 
ATOM   1757  C  CB    . ILE A 1 241 ? -0.530  14.002  -21.523 1.00 39.43 ? 241 ILE A CB    1 
ATOM   1758  C  CG1   . ILE A 1 241 ? 0.816   13.471  -22.017 1.00 39.32 ? 241 ILE A CG1   1 
ATOM   1759  C  CG2   . ILE A 1 241 ? -0.625  15.501  -21.729 1.00 38.83 ? 241 ILE A CG2   1 
ATOM   1760  C  CD1   . ILE A 1 241 ? 0.902   13.285  -23.511 1.00 40.83 ? 241 ILE A CD1   1 
ATOM   1761  N  N     . SER A 1 242 ? -3.083  14.091  -19.663 1.00 42.15 ? 242 SER A N     1 
ATOM   1762  C  CA    . SER A 1 242 ? -4.280  14.802  -19.228 1.00 43.29 ? 242 SER A CA    1 
ATOM   1763  C  C     . SER A 1 242 ? -4.417  14.788  -17.704 1.00 44.93 ? 242 SER A C     1 
ATOM   1764  O  O     . SER A 1 242 ? -5.129  15.605  -17.110 1.00 44.95 ? 242 SER A O     1 
ATOM   1765  C  CB    . SER A 1 242 ? -5.493  14.159  -19.893 1.00 43.33 ? 242 SER A CB    1 
ATOM   1766  O  OG    . SER A 1 242 ? -6.659  14.922  -19.721 1.00 44.39 ? 242 SER A OG    1 
ATOM   1767  N  N     . LYS A 1 243 ? -3.712  13.851  -17.080 1.00 47.05 ? 243 LYS A N     1 
ATOM   1768  C  CA    . LYS A 1 243 ? -3.573  13.775  -15.632 1.00 49.02 ? 243 LYS A CA    1 
ATOM   1769  C  C     . LYS A 1 243 ? -2.800  14.993  -15.116 1.00 49.49 ? 243 LYS A C     1 
ATOM   1770  O  O     . LYS A 1 243 ? -3.040  15.471  -14.008 1.00 50.22 ? 243 LYS A O     1 
ATOM   1771  C  CB    . LYS A 1 243 ? -2.824  12.491  -15.274 1.00 49.76 ? 243 LYS A CB    1 
ATOM   1772  C  CG    . LYS A 1 243 ? -3.059  11.968  -13.889 1.00 50.64 ? 243 LYS A CG    1 
ATOM   1773  C  CD    . LYS A 1 243 ? -2.554  10.542  -13.772 1.00 51.84 ? 243 LYS A CD    1 
ATOM   1774  C  CE    . LYS A 1 243 ? -1.273  10.452  -12.958 1.00 52.70 ? 243 LYS A CE    1 
ATOM   1775  N  NZ    . LYS A 1 243 ? -1.531  10.933  -11.573 1.00 53.11 ? 243 LYS A NZ    1 
ATOM   1776  N  N     . SER A 1 244 ? -1.874  15.484  -15.932 1.00 49.82 ? 244 SER A N     1 
ATOM   1777  C  CA    . SER A 1 244 ? -1.033  16.621  -15.575 1.00 50.66 ? 244 SER A CA    1 
ATOM   1778  C  C     . SER A 1 244 ? -1.556  17.943  -16.168 1.00 50.76 ? 244 SER A C     1 
ATOM   1779  O  O     . SER A 1 244 ? -0.789  18.873  -16.410 1.00 50.28 ? 244 SER A O     1 
ATOM   1780  C  CB    . SER A 1 244 ? 0.412   16.352  -16.016 1.00 50.53 ? 244 SER A CB    1 
ATOM   1781  N  N     . ALA A 1 245 ? -2.870  17.998  -16.406 1.00 52.06 ? 245 ALA A N     1 
ATOM   1782  C  CA    . ALA A 1 245 ? -3.598  19.203  -16.876 1.00 52.26 ? 245 ALA A CA    1 
ATOM   1783  C  C     . ALA A 1 245 ? -3.138  19.830  -18.208 1.00 51.88 ? 245 ALA A C     1 
ATOM   1784  O  O     . ALA A 1 245 ? -3.711  20.838  -18.656 1.00 52.26 ? 245 ALA A O     1 
ATOM   1785  C  CB    . ALA A 1 245 ? -3.688  20.279  -15.753 1.00 52.22 ? 245 ALA A CB    1 
ATOM   1786  N  N     . GLY A 1 246 ? -2.124  19.254  -18.842 1.00 51.40 ? 246 GLY A N     1 
ATOM   1787  C  CA    . GLY A 1 246 ? -1.643  19.800  -20.110 1.00 50.84 ? 246 GLY A CA    1 
ATOM   1788  C  C     . GLY A 1 246 ? -2.650  19.642  -21.243 1.00 50.16 ? 246 GLY A C     1 
ATOM   1789  O  O     . GLY A 1 246 ? -3.394  18.659  -21.278 1.00 51.17 ? 246 GLY A O     1 
ATOM   1790  N  N     . GLY A 1 247 ? -2.676  20.605  -22.163 1.00 48.65 ? 247 GLY A N     1 
ATOM   1791  C  CA    . GLY A 1 247 ? -3.503  20.494  -23.374 1.00 47.33 ? 247 GLY A CA    1 
ATOM   1792  C  C     . GLY A 1 247 ? -2.823  19.546  -24.352 1.00 46.34 ? 247 GLY A C     1 
ATOM   1793  O  O     . GLY A 1 247 ? -1.644  19.199  -24.163 1.00 46.56 ? 247 GLY A O     1 
ATOM   1794  N  N     . ILE A 1 248 ? -3.545  19.126  -25.392 1.00 44.79 ? 248 ILE A N     1 
ATOM   1795  C  CA    . ILE A 1 248 ? -3.035  18.115  -26.318 1.00 43.44 ? 248 ILE A CA    1 
ATOM   1796  C  C     . ILE A 1 248 ? -3.390  18.340  -27.802 1.00 42.41 ? 248 ILE A C     1 
ATOM   1797  O  O     . ILE A 1 248 ? -4.540  18.592  -28.147 1.00 42.15 ? 248 ILE A O     1 
ATOM   1798  C  CB    . ILE A 1 248 ? -3.498  16.694  -25.894 1.00 44.21 ? 248 ILE A CB    1 
ATOM   1799  C  CG1   . ILE A 1 248 ? -2.919  16.311  -24.526 1.00 44.16 ? 248 ILE A CG1   1 
ATOM   1800  C  CG2   . ILE A 1 248 ? -3.079  15.681  -26.917 1.00 44.21 ? 248 ILE A CG2   1 
ATOM   1801  C  CD1   . ILE A 1 248 ? -3.567  15.101  -23.869 1.00 44.41 ? 248 ILE A CD1   1 
ATOM   1802  N  N     . GLY A 1 249 ? -2.387  18.234  -28.672 1.00 41.22 ? 249 GLY A N     1 
ATOM   1803  C  CA    . GLY A 1 249 ? -2.619  18.127  -30.112 1.00 39.74 ? 249 GLY A CA    1 
ATOM   1804  C  C     . GLY A 1 249 ? -2.308  16.712  -30.555 1.00 39.42 ? 249 GLY A C     1 
ATOM   1805  O  O     . GLY A 1 249 ? -1.231  16.196  -30.236 1.00 39.92 ? 249 GLY A O     1 
ATOM   1806  N  N     . VAL A 1 250 ? -3.238  16.082  -31.274 1.00 38.49 ? 250 VAL A N     1 
ATOM   1807  C  CA    . VAL A 1 250 ? -3.091  14.688  -31.749 1.00 38.20 ? 250 VAL A CA    1 
ATOM   1808  C  C     . VAL A 1 250 ? -3.274  14.549  -33.277 1.00 37.99 ? 250 VAL A C     1 
ATOM   1809  O  O     . VAL A 1 250 ? -4.343  14.868  -33.827 1.00 37.40 ? 250 VAL A O     1 
ATOM   1810  C  CB    . VAL A 1 250 ? -4.086  13.693  -31.042 1.00 38.55 ? 250 VAL A CB    1 
ATOM   1811  C  CG1   . VAL A 1 250 ? -3.634  12.248  -31.230 1.00 39.25 ? 250 VAL A CG1   1 
ATOM   1812  C  CG2   . VAL A 1 250 ? -4.217  13.981  -29.567 1.00 37.74 ? 250 VAL A CG2   1 
ATOM   1813  N  N     . ALA A 1 251 ? -2.228  14.075  -33.952 1.00 37.57 ? 251 ALA A N     1 
ATOM   1814  C  CA    . ALA A 1 251 ? -2.326  13.722  -35.367 1.00 37.60 ? 251 ALA A CA    1 
ATOM   1815  C  C     . ALA A 1 251 ? -2.953  12.333  -35.505 1.00 38.08 ? 251 ALA A C     1 
ATOM   1816  O  O     . ALA A 1 251 ? -2.546  11.384  -34.830 1.00 38.51 ? 251 ALA A O     1 
ATOM   1817  C  CB    . ALA A 1 251 ? -0.967  13.767  -36.041 1.00 37.35 ? 251 ALA A CB    1 
ATOM   1818  N  N     . VAL A 1 252 ? -3.909  12.223  -36.420 1.00 37.87 ? 252 VAL A N     1 
ATOM   1819  C  CA    . VAL A 1 252 ? -4.801  11.077  -36.502 1.00 37.97 ? 252 VAL A CA    1 
ATOM   1820  C  C     . VAL A 1 252 ? -4.898  10.490  -37.938 1.00 38.65 ? 252 VAL A C     1 
ATOM   1821  O  O     . VAL A 1 252 ? -5.523  9.455   -38.162 1.00 38.92 ? 252 VAL A O     1 
ATOM   1822  C  CB    . VAL A 1 252 ? -6.182  11.530  -35.907 1.00 37.86 ? 252 VAL A CB    1 
ATOM   1823  C  CG1   . VAL A 1 252 ? -7.349  11.124  -36.736 1.00 37.89 ? 252 VAL A CG1   1 
ATOM   1824  C  CG2   . VAL A 1 252 ? -6.318  11.096  -34.451 1.00 37.06 ? 252 VAL A CG2   1 
ATOM   1825  N  N     . SER A 1 253 ? -4.237  11.140  -38.896 1.00 38.89 ? 253 SER A N     1 
ATOM   1826  C  CA    . SER A 1 253 ? -4.411  10.848  -40.327 1.00 39.70 ? 253 SER A CA    1 
ATOM   1827  C  C     . SER A 1 253 ? -3.994  9.454   -40.781 1.00 41.09 ? 253 SER A C     1 
ATOM   1828  O  O     . SER A 1 253 ? -4.429  9.002   -41.833 1.00 42.18 ? 253 SER A O     1 
ATOM   1829  C  CB    . SER A 1 253 ? -3.693  11.892  -41.174 1.00 39.33 ? 253 SER A CB    1 
ATOM   1830  O  OG    . SER A 1 253 ? -4.427  13.095  -41.198 1.00 38.49 ? 253 SER A OG    1 
ATOM   1831  N  N     . CYS A 1 254 ? -3.162  8.778   -39.991 1.00 41.79 ? 254 CYS A N     1 
ATOM   1832  C  CA    . CYS A 1 254 ? -2.690  7.437   -40.327 1.00 43.35 ? 254 CYS A CA    1 
ATOM   1833  C  C     . CYS A 1 254 ? -3.711  6.327   -40.034 1.00 43.49 ? 254 CYS A C     1 
ATOM   1834  O  O     . CYS A 1 254 ? -3.500  5.183   -40.432 1.00 44.75 ? 254 CYS A O     1 
ATOM   1835  C  CB    . CYS A 1 254 ? -1.355  7.143   -39.621 1.00 43.65 ? 254 CYS A CB    1 
ATOM   1836  S  SG    . CYS A 1 254 ? -1.507  6.675   -37.866 1.00 47.45 ? 254 CYS A SG    1 
ATOM   1837  N  N     . ILE A 1 255 ? -4.807  6.663   -39.354 1.00 42.82 ? 255 ILE A N     1 
ATOM   1838  C  CA    . ILE A 1 255 ? -5.838  5.684   -38.988 1.00 43.14 ? 255 ILE A CA    1 
ATOM   1839  C  C     . ILE A 1 255 ? -6.755  5.414   -40.177 1.00 43.67 ? 255 ILE A C     1 
ATOM   1840  O  O     . ILE A 1 255 ? -7.286  6.347   -40.767 1.00 43.60 ? 255 ILE A O     1 
ATOM   1841  C  CB    . ILE A 1 255 ? -6.666  6.157   -37.750 1.00 42.71 ? 255 ILE A CB    1 
ATOM   1842  C  CG1   . ILE A 1 255 ? -5.756  6.371   -36.529 1.00 42.29 ? 255 ILE A CG1   1 
ATOM   1843  C  CG2   . ILE A 1 255 ? -7.804  5.188   -37.425 1.00 43.66 ? 255 ILE A CG2   1 
ATOM   1844  C  CD1   . ILE A 1 255 ? -4.836  5.207   -36.214 1.00 42.95 ? 255 ILE A CD1   1 
ATOM   1845  N  N     . ARG A 1 256 ? -6.933  4.138   -40.523 1.00 44.26 ? 256 ARG A N     1 
ATOM   1846  C  CA    . ARG A 1 256 ? -7.655  3.759   -41.747 1.00 44.99 ? 256 ARG A CA    1 
ATOM   1847  C  C     . ARG A 1 256 ? -9.138  4.127   -41.693 1.00 45.12 ? 256 ARG A C     1 
ATOM   1848  O  O     . ARG A 1 256 ? -9.765  4.106   -40.630 1.00 44.94 ? 256 ARG A O     1 
ATOM   1849  C  CB    . ARG A 1 256 ? -7.420  2.281   -42.133 1.00 45.77 ? 256 ARG A CB    1 
ATOM   1850  C  CG    . ARG A 1 256 ? -8.183  1.236   -41.325 1.00 46.23 ? 256 ARG A CG    1 
ATOM   1851  C  CD    . ARG A 1 256 ? -7.783  -0.187  -41.725 1.00 46.40 ? 256 ARG A CD    1 
ATOM   1852  N  NE    . ARG A 1 256 ? -6.467  -0.526  -41.189 1.00 44.09 ? 256 ARG A NE    1 
ATOM   1853  C  CZ    . ARG A 1 256 ? -5.938  -1.744  -41.182 1.00 44.66 ? 256 ARG A CZ    1 
ATOM   1854  N  NH1   . ARG A 1 256 ? -4.735  -1.936  -40.656 1.00 42.59 ? 256 ARG A NH1   1 
ATOM   1855  N  NH2   . ARG A 1 256 ? -6.611  -2.771  -41.690 1.00 45.62 ? 256 ARG A NH2   1 
ATOM   1856  N  N     . ALA A 1 257 ? -9.682  4.466   -42.854 1.00 45.60 ? 257 ALA A N     1 
ATOM   1857  C  CA    . ALA A 1 257 ? -10.991 5.091   -42.930 1.00 45.94 ? 257 ALA A CA    1 
ATOM   1858  C  C     . ALA A 1 257 ? -12.134 4.087   -42.785 1.00 46.87 ? 257 ALA A C     1 
ATOM   1859  O  O     . ALA A 1 257 ? -11.924 2.879   -42.846 1.00 47.60 ? 257 ALA A O     1 
ATOM   1860  C  CB    . ALA A 1 257 ? -11.116 5.881   -44.213 1.00 45.73 ? 257 ALA A CB    1 
ATOM   1861  N  N     . THR A 1 258 ? -13.343 4.607   -42.597 1.00 47.29 ? 258 THR A N     1 
ATOM   1862  C  CA    . THR A 1 258 ? -14.543 3.783   -42.443 1.00 48.58 ? 258 THR A CA    1 
ATOM   1863  C  C     . THR A 1 258 ? -14.673 2.818   -43.625 1.00 49.44 ? 258 THR A C     1 
ATOM   1864  O  O     . THR A 1 258 ? -14.490 3.207   -44.778 1.00 49.88 ? 258 THR A O     1 
ATOM   1865  C  CB    . THR A 1 258 ? -15.810 4.668   -42.311 1.00 48.59 ? 258 THR A CB    1 
ATOM   1866  O  OG1   . THR A 1 258 ? -15.491 5.837   -41.558 1.00 48.48 ? 258 THR A OG1   1 
ATOM   1867  C  CG2   . THR A 1 258 ? -16.926 3.937   -41.600 1.00 50.11 ? 258 THR A CG2   1 
ATOM   1868  N  N     . GLY A 1 259 ? -14.947 1.556   -43.321 1.00 50.11 ? 259 GLY A N     1 
ATOM   1869  C  CA    . GLY A 1 259 ? -15.202 0.543   -44.346 1.00 51.23 ? 259 GLY A CA    1 
ATOM   1870  C  C     . GLY A 1 259 ? -13.985 -0.186  -44.902 1.00 51.20 ? 259 GLY A C     1 
ATOM   1871  O  O     . GLY A 1 259 ? -14.144 -1.126  -45.689 1.00 52.15 ? 259 GLY A O     1 
ATOM   1872  N  N     . SER A 1 260 ? -12.785 0.257   -44.514 1.00 50.03 ? 260 SER A N     1 
ATOM   1873  C  CA    . SER A 1 260 ? -11.529 -0.386  -44.912 1.00 50.01 ? 260 SER A CA    1 
ATOM   1874  C  C     . SER A 1 260 ? -11.412 -1.741  -44.257 1.00 50.66 ? 260 SER A C     1 
ATOM   1875  O  O     . SER A 1 260 ? -11.767 -1.905  -43.094 1.00 50.20 ? 260 SER A O     1 
ATOM   1876  C  CB    . SER A 1 260 ? -10.310 0.452   -44.519 1.00 48.78 ? 260 SER A CB    1 
ATOM   1877  O  OG    . SER A 1 260 ? -10.377 1.757   -45.065 1.00 48.84 ? 260 SER A OG    1 
ATOM   1878  N  N     . TYR A 1 261 ? -10.896 -2.697  -45.024 1.00 51.75 ? 261 TYR A N     1 
ATOM   1879  C  CA    . TYR A 1 261 ? -10.758 -4.077  -44.605 1.00 52.66 ? 261 TYR A CA    1 
ATOM   1880  C  C     . TYR A 1 261 ? -9.784  -4.240  -43.428 1.00 52.05 ? 261 TYR A C     1 
ATOM   1881  O  O     . TYR A 1 261 ? -8.705  -3.635  -43.409 1.00 50.97 ? 261 TYR A O     1 
ATOM   1882  C  CB    . TYR A 1 261 ? -10.319 -4.918  -45.813 1.00 53.96 ? 261 TYR A CB    1 
ATOM   1883  C  CG    . TYR A 1 261 ? -10.297 -6.410  -45.575 1.00 55.55 ? 261 TYR A CG    1 
ATOM   1884  C  CD1   . TYR A 1 261 ? -9.094  -7.120  -45.594 1.00 56.66 ? 261 TYR A CD1   1 
ATOM   1885  C  CD2   . TYR A 1 261 ? -11.477 -7.119  -45.330 1.00 56.74 ? 261 TYR A CD2   1 
ATOM   1886  C  CE1   . TYR A 1 261 ? -9.064  -8.503  -45.375 1.00 57.50 ? 261 TYR A CE1   1 
ATOM   1887  C  CE2   . TYR A 1 261 ? -11.458 -8.499  -45.110 1.00 58.09 ? 261 TYR A CE2   1 
ATOM   1888  C  CZ    . TYR A 1 261 ? -10.247 -9.182  -45.131 1.00 57.95 ? 261 TYR A CZ    1 
ATOM   1889  O  OH    . TYR A 1 261 ? -10.219 -10.546 -44.916 1.00 58.94 ? 261 TYR A OH    1 
ATOM   1890  N  N     . ILE A 1 262 ? -10.205 -5.023  -42.436 1.00 52.35 ? 262 ILE A N     1 
ATOM   1891  C  CA    . ILE A 1 262 ? -9.328  -5.500  -41.371 1.00 52.51 ? 262 ILE A CA    1 
ATOM   1892  C  C     . ILE A 1 262 ? -8.931  -6.921  -41.737 1.00 53.99 ? 262 ILE A C     1 
ATOM   1893  O  O     . ILE A 1 262 ? -9.801  -7.780  -41.915 1.00 55.18 ? 262 ILE A O     1 
ATOM   1894  C  CB    . ILE A 1 262 ? -10.040 -5.586  -39.989 1.00 52.39 ? 262 ILE A CB    1 
ATOM   1895  C  CG1   . ILE A 1 262 ? -11.012 -4.419  -39.736 1.00 52.01 ? 262 ILE A CG1   1 
ATOM   1896  C  CG2   . ILE A 1 262 ? -9.016  -5.800  -38.858 1.00 51.64 ? 262 ILE A CG2   1 
ATOM   1897  C  CD1   . ILE A 1 262 ? -10.381 -3.102  -39.530 1.00 50.53 ? 262 ILE A CD1   1 
ATOM   1898  N  N     . ALA A 1 263 ? -7.629  -7.179  -41.842 1.00 54.34 ? 263 ALA A N     1 
ATOM   1899  C  CA    . ALA A 1 263 ? -7.155  -8.508  -42.249 1.00 55.61 ? 263 ALA A CA    1 
ATOM   1900  C  C     . ALA A 1 263 ? -7.307  -9.556  -41.151 1.00 56.29 ? 263 ALA A C     1 
ATOM   1901  O  O     . ALA A 1 263 ? -7.795  -10.654 -41.407 1.00 57.84 ? 263 ALA A O     1 
ATOM   1902  C  CB    . ALA A 1 263 ? -5.715  -8.446  -42.741 1.00 55.54 ? 263 ALA A CB    1 
ATOM   1903  N  N     . GLY A 1 264 ? -6.894  -9.217  -39.935 1.00 55.85 ? 264 GLY A N     1 
ATOM   1904  C  CA    . GLY A 1 264 ? -6.908  -10.164 -38.816 1.00 56.53 ? 264 GLY A CA    1 
ATOM   1905  C  C     . GLY A 1 264 ? -8.274  -10.621 -38.325 1.00 57.18 ? 264 GLY A C     1 
ATOM   1906  O  O     . GLY A 1 264 ? -8.379  -11.684 -37.716 1.00 58.37 ? 264 GLY A O     1 
ATOM   1907  N  N     . THR A 1 265 ? -9.316  -9.829  -38.584 1.00 56.88 ? 265 THR A N     1 
ATOM   1908  C  CA    . THR A 1 265 ? -10.684 -10.148 -38.135 1.00 57.48 ? 265 THR A CA    1 
ATOM   1909  C  C     . THR A 1 265 ? -11.661 -10.340 -39.291 1.00 58.42 ? 265 THR A C     1 
ATOM   1910  O  O     . THR A 1 265 ? -12.824 -10.683 -39.065 1.00 59.23 ? 265 THR A O     1 
ATOM   1911  C  CB    . THR A 1 265 ? -11.290 -9.065  -37.177 1.00 56.65 ? 265 THR A CB    1 
ATOM   1912  O  OG1   . THR A 1 265 ? -11.721 -7.924  -37.931 1.00 55.22 ? 265 THR A OG1   1 
ATOM   1913  C  CG2   . THR A 1 265 ? -10.293 -8.637  -36.092 1.00 55.48 ? 265 THR A CG2   1 
ATOM   1914  N  N     . ASN A 1 266 ? -11.194 -10.108 -40.519 1.00 58.38 ? 266 ASN A N     1 
ATOM   1915  C  CA    . ASN A 1 266 ? -12.026 -10.223 -41.726 1.00 59.11 ? 266 ASN A CA    1 
ATOM   1916  C  C     . ASN A 1 266 ? -13.238 -9.285  -41.673 1.00 58.53 ? 266 ASN A C     1 
ATOM   1917  O  O     . ASN A 1 266 ? -14.306 -9.580  -42.214 1.00 59.54 ? 266 ASN A O     1 
ATOM   1918  C  CB    . ASN A 1 266 ? -12.442 -11.688 -41.966 1.00 60.79 ? 266 ASN A CB    1 
ATOM   1919  C  CG    . ASN A 1 266 ? -13.066 -11.911 -43.336 1.00 62.57 ? 266 ASN A CG    1 
ATOM   1920  O  OD1   . ASN A 1 266 ? -12.535 -11.475 -44.361 1.00 63.98 ? 266 ASN A OD1   1 
ATOM   1921  N  ND2   . ASN A 1 266 ? -14.200 -12.595 -43.358 1.00 64.33 ? 266 ASN A ND2   1 
ATOM   1922  N  N     . GLY A 1 267 ? -13.053 -8.147  -41.015 1.00 57.09 ? 267 GLY A N     1 
ATOM   1923  C  CA    . GLY A 1 267 ? -14.121 -7.172  -40.828 1.00 56.33 ? 267 GLY A CA    1 
ATOM   1924  C  C     . GLY A 1 267 ? -13.789 -5.865  -41.497 1.00 55.01 ? 267 GLY A C     1 
ATOM   1925  O  O     . GLY A 1 267 ? -12.859 -5.788  -42.295 1.00 54.76 ? 267 GLY A O     1 
ATOM   1926  N  N     . ASN A 1 268 ? -14.556 -4.831  -41.177 1.00 54.60 ? 268 ASN A N     1 
ATOM   1927  C  CA    . ASN A 1 268 ? -14.379 -3.526  -41.808 1.00 53.88 ? 268 ASN A CA    1 
ATOM   1928  C  C     . ASN A 1 268 ? -14.304 -2.383  -40.801 1.00 53.10 ? 268 ASN A C     1 
ATOM   1929  O  O     . ASN A 1 268 ? -15.207 -2.189  -39.992 1.00 53.34 ? 268 ASN A O     1 
ATOM   1930  C  CB    . ASN A 1 268 ? -15.475 -3.279  -42.849 1.00 54.46 ? 268 ASN A CB    1 
ATOM   1931  C  CG    . ASN A 1 268 ? -15.423 -4.276  -43.995 1.00 55.24 ? 268 ASN A CG    1 
ATOM   1932  O  OD1   . ASN A 1 268 ? -15.581 -5.477  -43.795 1.00 55.80 ? 268 ASN A OD1   1 
ATOM   1933  N  ND2   . ASN A 1 268 ? -15.195 -3.781  -45.198 1.00 55.85 ? 268 ASN A ND2   1 
ATOM   1934  N  N     . SER A 1 269 ? -13.218 -1.624  -40.866 1.00 52.45 ? 269 SER A N     1 
ATOM   1935  C  CA    . SER A 1 269 ? -12.951 -0.565  -39.901 1.00 51.60 ? 269 SER A CA    1 
ATOM   1936  C  C     . SER A 1 269 ? -14.102 0.415   -39.751 1.00 51.71 ? 269 SER A C     1 
ATOM   1937  O  O     . SER A 1 269 ? -14.786 0.766   -40.723 1.00 52.01 ? 269 SER A O     1 
ATOM   1938  C  CB    . SER A 1 269 ? -11.682 0.188   -40.267 1.00 50.46 ? 269 SER A CB    1 
ATOM   1939  O  OG    . SER A 1 269 ? -11.585 1.372   -39.505 1.00 50.75 ? 269 SER A OG    1 
ATOM   1940  N  N     . ASN A 1 270 ? -14.290 0.858   -38.515 1.00 51.36 ? 270 ASN A N     1 
ATOM   1941  C  CA    . ASN A 1 270 ? -15.343 1.803   -38.179 1.00 51.38 ? 270 ASN A CA    1 
ATOM   1942  C  C     . ASN A 1 270 ? -14.944 3.249   -38.462 1.00 50.36 ? 270 ASN A C     1 
ATOM   1943  O  O     . ASN A 1 270 ? -15.776 4.150   -38.376 1.00 50.41 ? 270 ASN A O     1 
ATOM   1944  C  CB    . ASN A 1 270 ? -15.749 1.620   -36.714 1.00 51.60 ? 270 ASN A CB    1 
ATOM   1945  C  CG    . ASN A 1 270 ? -16.356 0.261   -36.448 1.00 52.21 ? 270 ASN A CG    1 
ATOM   1946  O  OD1   . ASN A 1 270 ? -17.216 -0.205  -37.199 1.00 51.23 ? 270 ASN A OD1   1 
ATOM   1947  N  ND2   . ASN A 1 270 ? -15.908 -0.387  -35.378 1.00 52.45 ? 270 ASN A ND2   1 
ATOM   1948  N  N     . GLY A 1 271 ? -13.680 3.461   -38.820 1.00 49.49 ? 271 GLY A N     1 
ATOM   1949  C  CA    . GLY A 1 271 ? -13.206 4.789   -39.197 1.00 48.47 ? 271 GLY A CA    1 
ATOM   1950  C  C     . GLY A 1 271 ? -12.952 5.663   -37.990 1.00 47.62 ? 271 GLY A C     1 
ATOM   1951  O  O     . GLY A 1 271 ? -12.854 5.170   -36.866 1.00 47.65 ? 271 GLY A O     1 
ATOM   1952  N  N     . LEU A 1 272 ? -12.871 6.967   -38.222 1.00 47.12 ? 272 LEU A N     1 
ATOM   1953  C  CA    . LEU A 1 272 ? -12.415 7.911   -37.209 1.00 46.61 ? 272 LEU A CA    1 
ATOM   1954  C  C     . LEU A 1 272 ? -13.406 8.216   -36.080 1.00 46.83 ? 272 LEU A C     1 
ATOM   1955  O  O     . LEU A 1 272 ? -13.008 8.310   -34.919 1.00 46.48 ? 272 LEU A O     1 
ATOM   1956  C  CB    . LEU A 1 272 ? -11.948 9.209   -37.869 1.00 45.97 ? 272 LEU A CB    1 
ATOM   1957  C  CG    . LEU A 1 272 ? -10.554 9.167   -38.496 1.00 46.45 ? 272 LEU A CG    1 
ATOM   1958  C  CD1   . LEU A 1 272 ? -10.102 10.560  -38.907 1.00 45.59 ? 272 LEU A CD1   1 
ATOM   1959  C  CD2   . LEU A 1 272 ? -9.558  8.559   -37.526 1.00 46.91 ? 272 LEU A CD2   1 
ATOM   1960  N  N     . VAL A 1 273 ? -14.683 8.355   -36.432 1.00 47.58 ? 273 VAL A N     1 
ATOM   1961  C  CA    . VAL A 1 273 ? -15.734 8.795   -35.508 1.00 47.58 ? 273 VAL A CA    1 
ATOM   1962  C  C     . VAL A 1 273 ? -15.856 7.976   -34.215 1.00 47.86 ? 273 VAL A C     1 
ATOM   1963  O  O     . VAL A 1 273 ? -15.692 8.534   -33.126 1.00 47.62 ? 273 VAL A O     1 
ATOM   1964  C  CB    . VAL A 1 273 ? -17.097 8.927   -36.232 1.00 48.53 ? 273 VAL A CB    1 
ATOM   1965  C  CG1   . VAL A 1 273 ? -18.245 9.123   -35.229 1.00 49.17 ? 273 VAL A CG1   1 
ATOM   1966  C  CG2   . VAL A 1 273 ? -17.040 10.078  -37.243 1.00 48.23 ? 273 VAL A CG2   1 
ATOM   1967  N  N     . PRO A 1 274 ? -16.142 6.659   -34.313 1.00 48.69 ? 274 PRO A N     1 
ATOM   1968  C  CA    . PRO A 1 274 ? -16.241 5.925   -33.048 1.00 48.89 ? 274 PRO A CA    1 
ATOM   1969  C  C     . PRO A 1 274 ? -14.915 5.812   -32.297 1.00 48.10 ? 274 PRO A C     1 
ATOM   1970  O  O     . PRO A 1 274 ? -14.914 5.478   -31.112 1.00 47.91 ? 274 PRO A O     1 
ATOM   1971  C  CB    . PRO A 1 274 ? -16.752 4.539   -33.468 1.00 49.77 ? 274 PRO A CB    1 
ATOM   1972  C  CG    . PRO A 1 274 ? -16.410 4.414   -34.901 1.00 49.91 ? 274 PRO A CG    1 
ATOM   1973  C  CD    . PRO A 1 274 ? -16.419 5.795   -35.479 1.00 49.58 ? 274 PRO A CD    1 
ATOM   1974  N  N     . MET A 1 275 ? -13.802 6.083   -32.978 1.00 47.67 ? 275 MET A N     1 
ATOM   1975  C  CA    . MET A 1 275 ? -12.504 6.092   -32.318 1.00 47.59 ? 275 MET A CA    1 
ATOM   1976  C  C     . MET A 1 275 ? -12.386 7.375   -31.510 1.00 46.80 ? 275 MET A C     1 
ATOM   1977  O  O     . MET A 1 275 ? -11.921 7.370   -30.356 1.00 46.52 ? 275 MET A O     1 
ATOM   1978  C  CB    . MET A 1 275 ? -11.355 6.009   -33.326 1.00 46.99 ? 275 MET A CB    1 
ATOM   1979  C  CG    . MET A 1 275 ? -9.985  5.876   -32.651 1.00 46.69 ? 275 MET A CG    1 
ATOM   1980  S  SD    . MET A 1 275 ? -8.608  6.650   -33.534 1.00 47.52 ? 275 MET A SD    1 
ATOM   1981  C  CE    . MET A 1 275 ? -8.950  8.378   -33.292 1.00 45.26 ? 275 MET A CE    1 
ATOM   1982  N  N     . LEU A 1 276 ? -12.811 8.470   -32.138 1.00 46.41 ? 276 LEU A N     1 
ATOM   1983  C  CA    . LEU A 1 276 ? -12.817 9.785   -31.516 1.00 45.90 ? 276 LEU A CA    1 
ATOM   1984  C  C     . LEU A 1 276 ? -13.760 9.874   -30.311 1.00 46.37 ? 276 LEU A C     1 
ATOM   1985  O  O     . LEU A 1 276 ? -13.521 10.665  -29.400 1.00 46.22 ? 276 LEU A O     1 
ATOM   1986  C  CB    . LEU A 1 276 ? -13.128 10.871  -32.553 1.00 45.28 ? 276 LEU A CB    1 
ATOM   1987  C  CG    . LEU A 1 276 ? -11.932 11.666  -33.102 1.00 44.91 ? 276 LEU A CG    1 
ATOM   1988  C  CD1   . LEU A 1 276 ? -10.578 10.995  -32.870 1.00 43.65 ? 276 LEU A CD1   1 
ATOM   1989  C  CD2   . LEU A 1 276 ? -12.095 12.047  -34.572 1.00 44.23 ? 276 LEU A CD2   1 
ATOM   1990  N  N     . ARG A 1 277 ? -14.810 9.057   -30.296 1.00 47.09 ? 277 ARG A N     1 
ATOM   1991  C  CA    . ARG A 1 277 ? -15.714 9.028   -29.154 1.00 47.91 ? 277 ARG A CA    1 
ATOM   1992  C  C     . ARG A 1 277 ? -15.042 8.467   -27.905 1.00 47.08 ? 277 ARG A C     1 
ATOM   1993  O  O     . ARG A 1 277 ? -15.353 8.886   -26.792 1.00 47.05 ? 277 ARG A O     1 
ATOM   1994  C  CB    . ARG A 1 277 ? -17.001 8.267   -29.481 1.00 49.64 ? 277 ARG A CB    1 
ATOM   1995  C  CG    . ARG A 1 277 ? -17.858 8.980   -30.528 1.00 52.96 ? 277 ARG A CG    1 
ATOM   1996  C  CD    . ARG A 1 277 ? -19.320 8.523   -30.497 1.00 59.15 ? 277 ARG A CD    1 
ATOM   1997  N  NE    . ARG A 1 277 ? -19.995 8.967   -29.274 1.00 62.21 ? 277 ARG A NE    1 
ATOM   1998  C  CZ    . ARG A 1 277 ? -20.666 8.175   -28.442 1.00 64.36 ? 277 ARG A CZ    1 
ATOM   1999  N  NH1   . ARG A 1 277 ? -20.796 6.875   -28.699 1.00 64.97 ? 277 ARG A NH1   1 
ATOM   2000  N  NH2   . ARG A 1 277 ? -21.227 8.695   -27.354 1.00 65.19 ? 277 ARG A NH2   1 
ATOM   2001  N  N     . VAL A 1 278 ? -14.113 7.532   -28.093 1.00 46.23 ? 278 VAL A N     1 
ATOM   2002  C  CA    . VAL A 1 278 ? -13.340 6.977   -26.977 1.00 45.35 ? 278 VAL A CA    1 
ATOM   2003  C  C     . VAL A 1 278 ? -12.411 8.046   -26.379 1.00 44.01 ? 278 VAL A C     1 
ATOM   2004  O  O     . VAL A 1 278 ? -12.261 8.129   -25.156 1.00 44.32 ? 278 VAL A O     1 
ATOM   2005  C  CB    . VAL A 1 278 ? -12.549 5.690   -27.393 1.00 45.52 ? 278 VAL A CB    1 
ATOM   2006  C  CG1   . VAL A 1 278 ? -11.745 5.150   -26.243 1.00 44.58 ? 278 VAL A CG1   1 
ATOM   2007  C  CG2   . VAL A 1 278 ? -13.501 4.608   -27.887 1.00 45.95 ? 278 VAL A CG2   1 
ATOM   2008  N  N     . TYR A 1 279 ? -11.811 8.863   -27.247 1.00 42.62 ? 279 TYR A N     1 
ATOM   2009  C  CA    . TYR A 1 279 ? -10.937 9.973   -26.845 1.00 41.19 ? 279 TYR A CA    1 
ATOM   2010  C  C     . TYR A 1 279 ? -11.735 11.098  -26.195 1.00 40.88 ? 279 TYR A C     1 
ATOM   2011  O  O     . TYR A 1 279 ? -11.358 11.611  -25.146 1.00 40.59 ? 279 TYR A O     1 
ATOM   2012  C  CB    . TYR A 1 279 ? -10.148 10.509  -28.051 1.00 40.24 ? 279 TYR A CB    1 
ATOM   2013  C  CG    . TYR A 1 279 ? -8.936  9.669   -28.400 1.00 40.45 ? 279 TYR A CG    1 
ATOM   2014  C  CD1   . TYR A 1 279 ? -7.639  10.135  -28.146 1.00 38.79 ? 279 TYR A CD1   1 
ATOM   2015  C  CD2   . TYR A 1 279 ? -9.084  8.397   -28.967 1.00 40.49 ? 279 TYR A CD2   1 
ATOM   2016  C  CE1   . TYR A 1 279 ? -6.523  9.355   -28.451 1.00 38.25 ? 279 TYR A CE1   1 
ATOM   2017  C  CE2   . TYR A 1 279 ? -7.981  7.618   -29.284 1.00 40.97 ? 279 TYR A CE2   1 
ATOM   2018  C  CZ    . TYR A 1 279 ? -6.700  8.099   -29.019 1.00 40.14 ? 279 TYR A CZ    1 
ATOM   2019  O  OH    . TYR A 1 279 ? -5.612  7.309   -29.324 1.00 40.30 ? 279 TYR A OH    1 
ATOM   2020  N  N     . ASN A 1 280 ? -12.832 11.486  -26.835 1.00 41.09 ? 280 ASN A N     1 
ATOM   2021  C  CA    . ASN A 1 280 ? -13.812 12.384  -26.237 1.00 41.30 ? 280 ASN A CA    1 
ATOM   2022  C  C     . ASN A 1 280 ? -14.128 12.017  -24.778 1.00 41.77 ? 280 ASN A C     1 
ATOM   2023  O  O     . ASN A 1 280 ? -13.998 12.857  -23.880 1.00 41.32 ? 280 ASN A O     1 
ATOM   2024  C  CB    . ASN A 1 280 ? -15.099 12.382  -27.066 1.00 42.08 ? 280 ASN A CB    1 
ATOM   2025  C  CG    . ASN A 1 280 ? -16.087 13.415  -26.594 1.00 42.03 ? 280 ASN A CG    1 
ATOM   2026  O  OD1   . ASN A 1 280 ? -15.944 14.580  -26.897 1.00 43.46 ? 280 ASN A OD1   1 
ATOM   2027  N  ND2   . ASN A 1 280 ? -17.086 12.992  -25.840 1.00 42.72 ? 280 ASN A ND2   1 
ATOM   2028  N  N     . ASN A 1 281 ? -14.532 10.762  -24.564 1.00 42.47 ? 281 ASN A N     1 
ATOM   2029  C  CA    . ASN A 1 281 ? -14.810 10.213  -23.233 1.00 43.35 ? 281 ASN A CA    1 
ATOM   2030  C  C     . ASN A 1 281 ? -13.630 10.271  -22.282 1.00 42.94 ? 281 ASN A C     1 
ATOM   2031  O  O     . ASN A 1 281 ? -13.804 10.499  -21.087 1.00 42.87 ? 281 ASN A O     1 
ATOM   2032  C  CB    . ASN A 1 281 ? -15.227 8.756   -23.340 1.00 44.33 ? 281 ASN A CB    1 
ATOM   2033  C  CG    . ASN A 1 281 ? -16.603 8.583   -23.920 1.00 46.10 ? 281 ASN A CG    1 
ATOM   2034  O  OD1   . ASN A 1 281 ? -17.454 9.470   -23.833 1.00 46.95 ? 281 ASN A OD1   1 
ATOM   2035  N  ND2   . ASN A 1 281 ? -16.834 7.426   -24.518 1.00 46.93 ? 281 ASN A ND2   1 
ATOM   2036  N  N     . THR A 1 282 ? -12.437 10.015  -22.813 1.00 42.46 ? 282 THR A N     1 
ATOM   2037  C  CA    . THR A 1 282 ? -11.223 10.057  -22.022 1.00 42.51 ? 282 THR A CA    1 
ATOM   2038  C  C     . THR A 1 282 ? -10.953 11.493  -21.588 1.00 42.39 ? 282 THR A C     1 
ATOM   2039  O  O     . THR A 1 282 ? -10.542 11.736  -20.448 1.00 42.47 ? 282 THR A O     1 
ATOM   2040  C  CB    . THR A 1 282 ? -10.036 9.455   -22.807 1.00 42.00 ? 282 THR A CB    1 
ATOM   2041  O  OG1   . THR A 1 282 ? -10.268 8.055   -22.985 1.00 43.38 ? 282 THR A OG1   1 
ATOM   2042  C  CG2   . THR A 1 282 ? -8.712  9.646   -22.071 1.00 41.34 ? 282 THR A CG2   1 
ATOM   2043  N  N     . ALA A 1 283 ? -11.201 12.443  -22.488 1.00 42.72 ? 283 ALA A N     1 
ATOM   2044  C  CA    . ALA A 1 283 ? -11.028 13.864  -22.169 1.00 43.04 ? 283 ALA A CA    1 
ATOM   2045  C  C     . ALA A 1 283 ? -11.988 14.298  -21.057 1.00 44.21 ? 283 ALA A C     1 
ATOM   2046  O  O     . ALA A 1 283 ? -11.589 15.003  -20.126 1.00 44.31 ? 283 ALA A O     1 
ATOM   2047  C  CB    . ALA A 1 283 ? -11.203 14.717  -23.407 1.00 42.39 ? 283 ALA A CB    1 
ATOM   2048  N  N     . ARG A 1 284 ? -13.237 13.847  -21.141 1.00 45.63 ? 284 ARG A N     1 
ATOM   2049  C  CA    . ARG A 1 284 ? -14.215 14.132  -20.110 1.00 47.73 ? 284 ARG A CA    1 
ATOM   2050  C  C     . ARG A 1 284 ? -13.788 13.508  -18.778 1.00 47.82 ? 284 ARG A C     1 
ATOM   2051  O  O     . ARG A 1 284 ? -13.853 14.156  -17.738 1.00 48.05 ? 284 ARG A O     1 
ATOM   2052  C  CB    . ARG A 1 284 ? -15.614 13.645  -20.524 1.00 48.49 ? 284 ARG A CB    1 
ATOM   2053  C  CG    . ARG A 1 284 ? -16.759 14.484  -19.940 1.00 50.95 ? 284 ARG A CG    1 
ATOM   2054  C  CD    . ARG A 1 284 ? -18.149 13.836  -20.155 1.00 53.31 ? 284 ARG A CD    1 
ATOM   2055  N  NE    . ARG A 1 284 ? -18.643 13.929  -21.534 1.00 58.34 ? 284 ARG A NE    1 
ATOM   2056  C  CZ    . ARG A 1 284 ? -19.357 14.947  -22.025 1.00 60.56 ? 284 ARG A CZ    1 
ATOM   2057  N  NH1   . ARG A 1 284 ? -19.676 15.991  -21.262 1.00 61.51 ? 284 ARG A NH1   1 
ATOM   2058  N  NH2   . ARG A 1 284 ? -19.756 14.926  -23.292 1.00 61.83 ? 284 ARG A NH2   1 
ATOM   2059  N  N     . TYR A 1 285 ? -13.315 12.265  -18.826 1.00 48.18 ? 285 TYR A N     1 
ATOM   2060  C  CA    . TYR A 1 285 ? -13.041 11.481  -17.621 1.00 48.92 ? 285 TYR A CA    1 
ATOM   2061  C  C     . TYR A 1 285 ? -11.838 11.964  -16.808 1.00 49.00 ? 285 TYR A C     1 
ATOM   2062  O  O     . TYR A 1 285 ? -11.922 12.085  -15.596 1.00 49.40 ? 285 TYR A O     1 
ATOM   2063  C  CB    . TYR A 1 285 ? -12.929 9.983   -17.965 1.00 48.81 ? 285 TYR A CB    1 
ATOM   2064  C  CG    . TYR A 1 285 ? -12.450 9.088   -16.834 1.00 48.55 ? 285 TYR A CG    1 
ATOM   2065  C  CD1   . TYR A 1 285 ? -11.283 8.337   -16.969 1.00 47.27 ? 285 TYR A CD1   1 
ATOM   2066  C  CD2   . TYR A 1 285 ? -13.161 8.988   -15.636 1.00 48.50 ? 285 TYR A CD2   1 
ATOM   2067  C  CE1   . TYR A 1 285 ? -10.838 7.516   -15.952 1.00 47.65 ? 285 TYR A CE1   1 
ATOM   2068  C  CE2   . TYR A 1 285 ? -12.717 8.169   -14.604 1.00 48.72 ? 285 TYR A CE2   1 
ATOM   2069  C  CZ    . TYR A 1 285 ? -11.554 7.437   -14.769 1.00 48.81 ? 285 TYR A CZ    1 
ATOM   2070  O  OH    . TYR A 1 285 ? -11.099 6.620   -13.759 1.00 49.48 ? 285 TYR A OH    1 
ATOM   2071  N  N     . VAL A 1 286 ? -10.724 12.245  -17.462 1.00 49.37 ? 286 VAL A N     1 
ATOM   2072  C  CA    . VAL A 1 286 ? -9.567  12.741  -16.726 1.00 50.43 ? 286 VAL A CA    1 
ATOM   2073  C  C     . VAL A 1 286 ? -9.386  14.259  -16.913 1.00 51.08 ? 286 VAL A C     1 
ATOM   2074  O  O     . VAL A 1 286 ? -8.746  14.717  -17.863 1.00 50.46 ? 286 VAL A O     1 
ATOM   2075  C  CB    . VAL A 1 286 ? -8.274  11.817  -16.907 1.00 50.04 ? 286 VAL A CB    1 
ATOM   2076  C  CG1   . VAL A 1 286 ? -8.286  11.050  -18.217 1.00 49.52 ? 286 VAL A CG1   1 
ATOM   2077  C  CG2   . VAL A 1 286 ? -6.970  12.565  -16.696 1.00 49.06 ? 286 VAL A CG2   1 
ATOM   2078  N  N     . ASP A 1 287 ? -10.014 15.019  -16.009 1.00 53.09 ? 287 ASP A N     1 
ATOM   2079  C  CA    . ASP A 1 287 ? -9.939  16.484  -15.984 1.00 54.37 ? 287 ASP A CA    1 
ATOM   2080  C  C     . ASP A 1 287 ? -8.666  16.917  -15.272 1.00 55.00 ? 287 ASP A C     1 
ATOM   2081  O  O     . ASP A 1 287 ? -7.711  17.401  -15.899 1.00 54.99 ? 287 ASP A O     1 
ATOM   2082  C  CB    . ASP A 1 287 ? -11.118 17.089  -15.221 1.00 54.80 ? 287 ASP A CB    1 
ATOM   2083  C  CG    . ASP A 1 287 ? -12.390 16.287  -15.368 1.00 57.03 ? 287 ASP A CG    1 
ATOM   2084  O  OD1   . ASP A 1 287 ? -13.102 16.481  -16.385 1.00 58.33 ? 287 ASP A OD1   1 
ATOM   2085  O  OD2   . ASP A 1 287 ? -12.690 15.484  -14.450 1.00 58.00 ? 287 ASP A OD2   1 
ATOM   2086  N  N     . GLN A 1 288 ? -8.696  16.740  -13.952 1.00 56.52 ? 288 GLN A N     1 
ATOM   2087  C  CA    . GLN A 1 288 ? -7.609  17.030  -13.010 1.00 57.21 ? 288 GLN A CA    1 
ATOM   2088  C  C     . GLN A 1 288 ? -6.222  17.172  -13.629 1.00 56.46 ? 288 GLN A C     1 
ATOM   2089  O  O     . GLN A 1 288 ? -5.820  18.265  -14.034 1.00 56.16 ? 288 GLN A O     1 
ATOM   2090  C  CB    . GLN A 1 288 ? -7.593  15.942  -11.925 1.00 58.40 ? 288 GLN A CB    1 
ATOM   2091  C  CG    . GLN A 1 288 ? -8.688  16.075  -10.837 1.00 60.95 ? 288 GLN A CG    1 
ATOM   2092  C  CD    . GLN A 1 288 ? -10.115 15.798  -11.325 1.00 64.57 ? 288 GLN A CD    1 
ATOM   2093  O  OE1   . GLN A 1 288 ? -10.344 15.464  -12.491 1.00 65.93 ? 288 GLN A OE1   1 
ATOM   2094  N  NE2   . GLN A 1 288 ? -11.085 15.943  -10.421 1.00 66.24 ? 288 GLN A NE2   1 
ATOM   2095  N  N     . GLY A 1 295 ? -10.451 17.918  -19.812 1.00 63.58 ? 295 GLY A N     1 
ATOM   2096  C  CA    . GLY A 1 295 ? -9.221  17.635  -20.546 1.00 59.61 ? 295 GLY A CA    1 
ATOM   2097  C  C     . GLY A 1 295 ? -9.423  17.937  -22.016 1.00 56.91 ? 295 GLY A C     1 
ATOM   2098  O  O     . GLY A 1 295 ? -10.363 17.434  -22.619 1.00 58.39 ? 295 GLY A O     1 
ATOM   2099  N  N     . ALA A 1 296 ? -8.545  18.742  -22.605 1.00 53.64 ? 296 ALA A N     1 
ATOM   2100  C  CA    . ALA A 1 296 ? -8.800  19.284  -23.935 1.00 51.53 ? 296 ALA A CA    1 
ATOM   2101  C  C     . ALA A 1 296 ? -7.846  18.746  -25.010 1.00 48.05 ? 296 ALA A C     1 
ATOM   2102  O  O     . ALA A 1 296 ? -6.660  19.101  -25.025 1.00 46.83 ? 296 ALA A O     1 
ATOM   2103  C  CB    . ALA A 1 296 ? -8.756  20.795  -23.879 1.00 52.18 ? 296 ALA A CB    1 
ATOM   2104  N  N     . PHE A 1 297 ? -8.365  17.885  -25.893 1.00 46.60 ? 297 PHE A N     1 
ATOM   2105  C  CA    . PHE A 1 297 ? -7.586  17.331  -27.005 1.00 43.20 ? 297 PHE A CA    1 
ATOM   2106  C  C     . PHE A 1 297 ? -7.989  17.976  -28.327 1.00 41.91 ? 297 PHE A C     1 
ATOM   2107  O  O     . PHE A 1 297 ? -9.177  18.039  -28.656 1.00 43.34 ? 297 PHE A O     1 
ATOM   2108  C  CB    . PHE A 1 297 ? -7.783  15.814  -27.181 1.00 43.32 ? 297 PHE A CB    1 
ATOM   2109  C  CG    . PHE A 1 297 ? -7.654  14.989  -25.922 1.00 45.13 ? 297 PHE A CG    1 
ATOM   2110  C  CD1   . PHE A 1 297 ? -8.264  13.746  -25.860 1.00 45.80 ? 297 PHE A CD1   1 
ATOM   2111  C  CD2   . PHE A 1 297 ? -6.925  15.429  -24.820 1.00 46.24 ? 297 PHE A CD2   1 
ATOM   2112  C  CE1   . PHE A 1 297 ? -8.165  12.956  -24.732 1.00 49.34 ? 297 PHE A CE1   1 
ATOM   2113  C  CE2   . PHE A 1 297 ? -6.827  14.643  -23.676 1.00 49.30 ? 297 PHE A CE2   1 
ATOM   2114  C  CZ    . PHE A 1 297 ? -7.445  13.400  -23.632 1.00 50.57 ? 297 PHE A CZ    1 
ATOM   2115  N  N     . ALA A 1 298 ? -6.999  18.426  -29.092 1.00 39.50 ? 298 ALA A N     1 
ATOM   2116  C  CA    . ALA A 1 298 ? -7.228  18.885  -30.451 1.00 38.27 ? 298 ALA A CA    1 
ATOM   2117  C  C     . ALA A 1 298 ? -6.814  17.796  -31.452 1.00 36.77 ? 298 ALA A C     1 
ATOM   2118  O  O     . ALA A 1 298 ? -5.713  17.233  -31.362 1.00 35.87 ? 298 ALA A O     1 
ATOM   2119  C  CB    . ALA A 1 298 ? -6.487  20.174  -30.710 1.00 37.62 ? 298 ALA A CB    1 
ATOM   2120  N  N     . ILE A 1 299 ? -7.709  17.500  -32.393 1.00 36.44 ? 299 ILE A N     1 
ATOM   2121  C  CA    . ILE A 1 299 ? -7.534  16.397  -33.334 1.00 35.66 ? 299 ILE A CA    1 
ATOM   2122  C  C     . ILE A 1 299 ? -7.185  16.964  -34.706 1.00 34.62 ? 299 ILE A C     1 
ATOM   2123  O  O     . ILE A 1 299 ? -7.935  17.758  -35.265 1.00 36.01 ? 299 ILE A O     1 
ATOM   2124  C  CB    . ILE A 1 299 ? -8.818  15.514  -33.427 1.00 36.81 ? 299 ILE A CB    1 
ATOM   2125  C  CG1   . ILE A 1 299 ? -9.335  15.122  -32.032 1.00 39.13 ? 299 ILE A CG1   1 
ATOM   2126  C  CG2   . ILE A 1 299 ? -8.594  14.293  -34.311 1.00 36.45 ? 299 ILE A CG2   1 
ATOM   2127  C  CD1   . ILE A 1 299 ? -8.356  14.314  -31.161 1.00 38.15 ? 299 ILE A CD1   1 
ATOM   2128  N  N     . TYR A 1 300 ? -6.037  16.570  -35.235 1.00 33.54 ? 300 TYR A N     1 
ATOM   2129  C  CA    . TYR A 1 300 ? -5.558  17.096  -36.513 1.00 32.87 ? 300 TYR A CA    1 
ATOM   2130  C  C     . TYR A 1 300 ? -5.735  16.064  -37.608 1.00 32.30 ? 300 TYR A C     1 
ATOM   2131  O  O     . TYR A 1 300 ? -5.237  14.951  -37.498 1.00 32.46 ? 300 TYR A O     1 
ATOM   2132  C  CB    . TYR A 1 300 ? -4.088  17.510  -36.412 1.00 32.22 ? 300 TYR A CB    1 
ATOM   2133  C  CG    . TYR A 1 300 ? -3.889  18.821  -35.699 1.00 32.77 ? 300 TYR A CG    1 
ATOM   2134  C  CD1   . TYR A 1 300 ? -3.957  18.905  -34.305 1.00 32.32 ? 300 TYR A CD1   1 
ATOM   2135  C  CD2   . TYR A 1 300 ? -3.646  19.994  -36.423 1.00 33.36 ? 300 TYR A CD2   1 
ATOM   2136  C  CE1   . TYR A 1 300 ? -3.783  20.124  -33.658 1.00 31.54 ? 300 TYR A CE1   1 
ATOM   2137  C  CE2   . TYR A 1 300 ? -3.472  21.204  -35.784 1.00 31.94 ? 300 TYR A CE2   1 
ATOM   2138  C  CZ    . TYR A 1 300 ? -3.538  21.263  -34.411 1.00 33.26 ? 300 TYR A CZ    1 
ATOM   2139  O  OH    . TYR A 1 300 ? -3.357  22.480  -33.796 1.00 34.96 ? 300 TYR A OH    1 
ATOM   2140  N  N     . LEU A 1 301 ? -6.475  16.440  -38.644 1.00 32.53 ? 301 LEU A N     1 
ATOM   2141  C  CA    . LEU A 1 301 ? -6.722  15.580  -39.786 1.00 32.56 ? 301 LEU A CA    1 
ATOM   2142  C  C     . LEU A 1 301 ? -6.262  16.284  -41.070 1.00 32.68 ? 301 LEU A C     1 
ATOM   2143  O  O     . LEU A 1 301 ? -6.491  17.480  -41.237 1.00 32.95 ? 301 LEU A O     1 
ATOM   2144  C  CB    . LEU A 1 301 ? -8.211  15.280  -39.900 1.00 33.37 ? 301 LEU A CB    1 
ATOM   2145  C  CG    . LEU A 1 301 ? -8.712  13.873  -40.278 1.00 34.83 ? 301 LEU A CG    1 
ATOM   2146  C  CD1   . LEU A 1 301 ? -9.839  13.964  -41.283 1.00 34.01 ? 301 LEU A CD1   1 
ATOM   2147  C  CD2   . LEU A 1 301 ? -7.639  12.905  -40.772 1.00 32.70 ? 301 LEU A CD2   1 
ATOM   2148  N  N     . GLU A 1 302 ? -5.629  15.527  -41.968 1.00 32.81 ? 302 GLU A N     1 
ATOM   2149  C  CA    . GLU A 1 302 ? -5.287  16.005  -43.314 1.00 33.90 ? 302 GLU A CA    1 
ATOM   2150  C  C     . GLU A 1 302 ? -6.453  15.761  -44.292 1.00 34.76 ? 302 GLU A C     1 
ATOM   2151  O  O     . GLU A 1 302 ? -6.978  14.643  -44.375 1.00 35.07 ? 302 GLU A O     1 
ATOM   2152  C  CB    . GLU A 1 302 ? -3.981  15.361  -43.824 1.00 33.63 ? 302 GLU A CB    1 
ATOM   2153  C  CG    . GLU A 1 302 ? -2.809  15.464  -42.846 1.00 33.37 ? 302 GLU A CG    1 
ATOM   2154  C  CD    . GLU A 1 302 ? -1.439  15.212  -43.476 1.00 36.15 ? 302 GLU A CD    1 
ATOM   2155  O  OE1   . GLU A 1 302 ? -1.331  15.213  -44.734 1.00 37.05 ? 302 GLU A OE1   1 
ATOM   2156  O  OE2   . GLU A 1 302 ? -0.459  15.024  -42.700 1.00 35.80 ? 302 GLU A OE2   1 
ATOM   2157  N  N     . PRO A 1 303 ? -6.869  16.816  -45.026 1.00 36.04 ? 303 PRO A N     1 
ATOM   2158  C  CA    . PRO A 1 303 ? -8.065  16.788  -45.895 1.00 37.28 ? 303 PRO A CA    1 
ATOM   2159  C  C     . PRO A 1 303 ? -8.123  15.730  -47.010 1.00 37.63 ? 303 PRO A C     1 
ATOM   2160  O  O     . PRO A 1 303 ? -9.159  15.621  -47.680 1.00 39.49 ? 303 PRO A O     1 
ATOM   2161  C  CB    . PRO A 1 303 ? -8.138  18.215  -46.465 1.00 38.36 ? 303 PRO A CB    1 
ATOM   2162  C  CG    . PRO A 1 303 ? -6.804  18.809  -46.232 1.00 37.81 ? 303 PRO A CG    1 
ATOM   2163  C  CD    . PRO A 1 303 ? -6.228  18.145  -45.023 1.00 36.42 ? 303 PRO A CD    1 
ATOM   2164  N  N     . TRP A 1 304 ? -7.062  14.948  -47.209 1.00 36.79 ? 304 TRP A N     1 
ATOM   2165  C  CA    . TRP A 1 304 ? -7.135  13.825  -48.175 1.00 36.86 ? 304 TRP A CA    1 
ATOM   2166  C  C     . TRP A 1 304 ? -7.765  12.579  -47.570 1.00 36.50 ? 304 TRP A C     1 
ATOM   2167  O  O     . TRP A 1 304 ? -8.105  11.639  -48.289 1.00 37.77 ? 304 TRP A O     1 
ATOM   2168  C  CB    . TRP A 1 304 ? -5.764  13.476  -48.769 1.00 37.28 ? 304 TRP A CB    1 
ATOM   2169  C  CG    . TRP A 1 304 ? -4.695  13.307  -47.743 1.00 36.90 ? 304 TRP A CG    1 
ATOM   2170  C  CD1   . TRP A 1 304 ? -3.720  14.212  -47.424 1.00 37.39 ? 304 TRP A CD1   1 
ATOM   2171  C  CD2   . TRP A 1 304 ? -4.509  12.185  -46.867 1.00 36.25 ? 304 TRP A CD2   1 
ATOM   2172  N  NE1   . TRP A 1 304 ? -2.926  13.712  -46.416 1.00 38.57 ? 304 TRP A NE1   1 
ATOM   2173  C  CE2   . TRP A 1 304 ? -3.391  12.473  -46.052 1.00 36.79 ? 304 TRP A CE2   1 
ATOM   2174  C  CE3   . TRP A 1 304 ? -5.174  10.959  -46.698 1.00 37.38 ? 304 TRP A CE3   1 
ATOM   2175  C  CZ2   . TRP A 1 304 ? -2.917  11.581  -45.082 1.00 36.82 ? 304 TRP A CZ2   1 
ATOM   2176  C  CZ3   . TRP A 1 304 ? -4.705  10.067  -45.723 1.00 37.92 ? 304 TRP A CZ3   1 
ATOM   2177  C  CH2   . TRP A 1 304 ? -3.582  10.385  -44.934 1.00 37.45 ? 304 TRP A CH2   1 
ATOM   2178  N  N     . HIS A 1 305 ? -7.910  12.572  -46.246 1.00 35.66 ? 305 HIS A N     1 
ATOM   2179  C  CA    . HIS A 1 305 ? -8.447  11.423  -45.520 1.00 35.40 ? 305 HIS A CA    1 
ATOM   2180  C  C     . HIS A 1 305 ? -9.914  11.204  -45.840 1.00 36.80 ? 305 HIS A C     1 
ATOM   2181  O  O     . HIS A 1 305 ? -10.703 12.133  -45.808 1.00 37.14 ? 305 HIS A O     1 
ATOM   2182  C  CB    . HIS A 1 305 ? -8.286  11.618  -44.021 1.00 34.81 ? 305 HIS A CB    1 
ATOM   2183  C  CG    . HIS A 1 305 ? -8.430  10.353  -43.237 1.00 34.76 ? 305 HIS A CG    1 
ATOM   2184  N  ND1   . HIS A 1 305 ? -9.658  9.815   -42.915 1.00 35.30 ? 305 HIS A ND1   1 
ATOM   2185  C  CD2   . HIS A 1 305 ? -7.502  9.499   -42.747 1.00 33.46 ? 305 HIS A CD2   1 
ATOM   2186  C  CE1   . HIS A 1 305 ? -9.476  8.693   -42.240 1.00 36.58 ? 305 HIS A CE1   1 
ATOM   2187  N  NE2   . HIS A 1 305 ? -8.178  8.481   -42.123 1.00 34.67 ? 305 HIS A NE2   1 
ATOM   2188  N  N     . LEU A 1 306 ? -10.276 9.960   -46.125 1.00 38.13 ? 306 LEU A N     1 
ATOM   2189  C  CA    . LEU A 1 306 ? -11.611 9.637   -46.602 1.00 40.04 ? 306 LEU A CA    1 
ATOM   2190  C  C     . LEU A 1 306 ? -12.724 9.980   -45.597 1.00 41.46 ? 306 LEU A C     1 
ATOM   2191  O  O     . LEU A 1 306 ? -13.875 10.183  -45.995 1.00 43.61 ? 306 LEU A O     1 
ATOM   2192  C  CB    . LEU A 1 306 ? -11.676 8.165   -47.024 1.00 41.23 ? 306 LEU A CB    1 
ATOM   2193  C  CG    . LEU A 1 306 ? -13.029 7.598   -47.461 1.00 43.62 ? 306 LEU A CG    1 
ATOM   2194  C  CD1   . LEU A 1 306 ? -13.440 8.096   -48.848 1.00 43.34 ? 306 LEU A CD1   1 
ATOM   2195  C  CD2   . LEU A 1 306 ? -12.993 6.083   -47.409 1.00 44.38 ? 306 LEU A CD2   1 
ATOM   2196  N  N     . ASP A 1 307 ? -12.384 10.051  -44.309 1.00 40.84 ? 307 ASP A N     1 
ATOM   2197  C  CA    . ASP A 1 307 ? -13.375 10.360  -43.265 1.00 42.62 ? 307 ASP A CA    1 
ATOM   2198  C  C     . ASP A 1 307 ? -13.534 11.861  -43.006 1.00 42.36 ? 307 ASP A C     1 
ATOM   2199  O  O     . ASP A 1 307 ? -14.247 12.263  -42.085 1.00 44.09 ? 307 ASP A O     1 
ATOM   2200  C  CB    . ASP A 1 307 ? -13.055 9.621   -41.960 1.00 42.48 ? 307 ASP A CB    1 
ATOM   2201  C  CG    . ASP A 1 307 ? -13.456 8.158   -41.999 1.00 45.23 ? 307 ASP A CG    1 
ATOM   2202  O  OD1   . ASP A 1 307 ? -14.469 7.816   -42.654 1.00 48.05 ? 307 ASP A OD1   1 
ATOM   2203  O  OD2   . ASP A 1 307 ? -12.762 7.340   -41.363 1.00 45.65 ? 307 ASP A OD2   1 
ATOM   2204  N  N     . ILE A 1 308 ? -12.896 12.676  -43.843 1.00 41.01 ? 308 ILE A N     1 
ATOM   2205  C  CA    . ILE A 1 308 ? -12.892 14.135  -43.686 1.00 41.35 ? 308 ILE A CA    1 
ATOM   2206  C  C     . ILE A 1 308 ? -14.287 14.800  -43.530 1.00 44.49 ? 308 ILE A C     1 
ATOM   2207  O  O     . ILE A 1 308 ? -14.450 15.702  -42.701 1.00 45.38 ? 308 ILE A O     1 
ATOM   2208  C  CB    . ILE A 1 308 ? -12.054 14.823  -44.815 1.00 40.26 ? 308 ILE A CB    1 
ATOM   2209  C  CG1   . ILE A 1 308 ? -11.790 16.302  -44.500 1.00 40.62 ? 308 ILE A CG1   1 
ATOM   2210  C  CG2   . ILE A 1 308 ? -12.710 14.651  -46.191 1.00 41.16 ? 308 ILE A CG2   1 
ATOM   2211  C  CD1   . ILE A 1 308 ? -10.976 16.540  -43.233 1.00 39.15 ? 308 ILE A CD1   1 
ATOM   2212  N  N     . PHE A 1 309 ? -15.275 14.367  -44.310 1.00 46.36 ? 309 PHE A N     1 
ATOM   2213  C  CA    . PHE A 1 309 ? -16.614 14.965  -44.241 1.00 50.34 ? 309 PHE A CA    1 
ATOM   2214  C  C     . PHE A 1 309 ? -17.353 14.649  -42.935 1.00 52.78 ? 309 PHE A C     1 
ATOM   2215  O  O     . PHE A 1 309 ? -18.129 15.471  -42.440 1.00 55.42 ? 309 PHE A O     1 
ATOM   2216  C  CB    . PHE A 1 309 ? -17.480 14.535  -45.429 1.00 52.27 ? 309 PHE A CB    1 
ATOM   2217  C  CG    . PHE A 1 309 ? -17.218 15.306  -46.693 1.00 51.87 ? 309 PHE A CG    1 
ATOM   2218  C  CD1   . PHE A 1 309 ? -16.376 14.793  -47.675 1.00 49.55 ? 309 PHE A CD1   1 
ATOM   2219  C  CD2   . PHE A 1 309 ? -17.839 16.529  -46.921 1.00 54.17 ? 309 PHE A CD2   1 
ATOM   2220  C  CE1   . PHE A 1 309 ? -16.145 15.503  -48.864 1.00 49.96 ? 309 PHE A CE1   1 
ATOM   2221  C  CE2   . PHE A 1 309 ? -17.617 17.236  -48.104 1.00 54.06 ? 309 PHE A CE2   1 
ATOM   2222  C  CZ    . PHE A 1 309 ? -16.761 16.724  -49.072 1.00 51.94 ? 309 PHE A CZ    1 
ATOM   2223  N  N     . GLU A 1 310 ? -17.126 13.450  -42.401 1.00 52.67 ? 310 GLU A N     1 
ATOM   2224  C  CA    . GLU A 1 310 ? -17.753 13.018  -41.149 1.00 55.61 ? 310 GLU A CA    1 
ATOM   2225  C  C     . GLU A 1 310 ? -17.023 13.622  -39.952 1.00 53.95 ? 310 GLU A C     1 
ATOM   2226  O  O     . GLU A 1 310 ? -17.601 13.766  -38.875 1.00 56.23 ? 310 GLU A O     1 
ATOM   2227  C  CB    . GLU A 1 310 ? -17.784 11.486  -41.050 1.00 56.28 ? 310 GLU A CB    1 
ATOM   2228  C  CG    . GLU A 1 310 ? -18.746 10.792  -42.027 1.00 60.46 ? 310 GLU A CG    1 
ATOM   2229  C  CD    . GLU A 1 310 ? -18.324 10.885  -43.510 1.00 60.53 ? 310 GLU A CD    1 
ATOM   2230  O  OE1   . GLU A 1 310 ? -17.114 11.063  -43.805 1.00 56.34 ? 310 GLU A OE1   1 
ATOM   2231  O  OE2   . GLU A 1 310 ? -19.224 10.767  -44.383 1.00 64.24 ? 310 GLU A OE2   1 
ATOM   2232  N  N     . PHE A 1 311 ? -15.751 13.963  -40.161 1.00 50.59 ? 311 PHE A N     1 
ATOM   2233  C  CA    . PHE A 1 311 ? -14.932 14.710  -39.208 1.00 49.40 ? 311 PHE A CA    1 
ATOM   2234  C  C     . PHE A 1 311 ? -15.455 16.143  -39.078 1.00 51.44 ? 311 PHE A C     1 
ATOM   2235  O  O     . PHE A 1 311 ? -15.582 16.665  -37.977 1.00 52.53 ? 311 PHE A O     1 
ATOM   2236  C  CB    . PHE A 1 311 ? -13.483 14.702  -39.693 1.00 45.93 ? 311 PHE A CB    1 
ATOM   2237  C  CG    . PHE A 1 311 ? -12.502 15.388  -38.768 1.00 45.10 ? 311 PHE A CG    1 
ATOM   2238  C  CD1   . PHE A 1 311 ? -12.021 14.742  -37.626 1.00 44.63 ? 311 PHE A CD1   1 
ATOM   2239  C  CD2   . PHE A 1 311 ? -12.019 16.660  -39.068 1.00 44.23 ? 311 PHE A CD2   1 
ATOM   2240  C  CE1   . PHE A 1 311 ? -11.095 15.361  -36.792 1.00 42.91 ? 311 PHE A CE1   1 
ATOM   2241  C  CE2   . PHE A 1 311 ? -11.093 17.287  -38.233 1.00 43.16 ? 311 PHE A CE2   1 
ATOM   2242  C  CZ    . PHE A 1 311 ? -10.624 16.636  -37.102 1.00 41.94 ? 311 PHE A CZ    1 
ATOM   2243  N  N     . LEU A 1 312 ? -15.785 16.752  -40.214 1.00 52.78 ? 312 LEU A N     1 
ATOM   2244  C  CA    . LEU A 1 312 ? -16.393 18.080  -40.274 1.00 55.98 ? 312 LEU A CA    1 
ATOM   2245  C  C     . LEU A 1 312 ? -17.853 18.079  -39.787 1.00 61.53 ? 312 LEU A C     1 
ATOM   2246  O  O     . LEU A 1 312 ? -18.716 18.734  -40.386 1.00 65.29 ? 312 LEU A O     1 
ATOM   2247  C  CB    . LEU A 1 312 ? -16.320 18.611  -41.712 1.00 55.74 ? 312 LEU A CB    1 
ATOM   2248  C  CG    . LEU A 1 312 ? -15.156 19.478  -42.222 1.00 53.67 ? 312 LEU A CG    1 
ATOM   2249  C  CD1   . LEU A 1 312 ? -13.849 19.340  -41.434 1.00 49.65 ? 312 LEU A CD1   1 
ATOM   2250  C  CD2   . LEU A 1 312 ? -14.921 19.216  -43.707 1.00 52.78 ? 312 LEU A CD2   1 
ATOM   2251  N  N     . ASP A 1 313 ? -18.127 17.350  -38.704 1.00 62.95 ? 313 ASP A N     1 
ATOM   2252  C  CA    . ASP A 1 313 ? -19.494 17.182  -38.193 1.00 68.42 ? 313 ASP A CA    1 
ATOM   2253  C  C     . ASP A 1 313 ? -19.554 16.794  -36.722 1.00 69.57 ? 313 ASP A C     1 
ATOM   2254  O  O     . ASP A 1 313 ? -20.585 16.963  -36.074 1.00 74.24 ? 313 ASP A O     1 
ATOM   2255  C  CB    . ASP A 1 313 ? -20.245 16.141  -39.020 1.00 70.33 ? 313 ASP A CB    1 
ATOM   2256  C  CG    . ASP A 1 313 ? -21.036 16.759  -40.154 1.00 74.10 ? 313 ASP A CG    1 
ATOM   2257  O  OD1   . ASP A 1 313 ? -21.754 17.747  -39.904 1.00 78.48 ? 313 ASP A OD1   1 
ATOM   2258  O  OD2   . ASP A 1 313 ? -20.952 16.251  -41.291 1.00 74.24 ? 313 ASP A OD2   1 
ATOM   2259  N  N     . LEU A 1 314 ? -18.444 16.276  -36.204 1.00 66.14 ? 314 LEU A N     1 
ATOM   2260  C  CA    . LEU A 1 314 ? -18.368 15.817  -34.821 1.00 67.33 ? 314 LEU A CA    1 
ATOM   2261  C  C     . LEU A 1 314 ? -18.692 16.902  -33.792 1.00 70.04 ? 314 LEU A C     1 
ATOM   2262  O  O     . LEU A 1 314 ? -19.451 16.655  -32.850 1.00 74.24 ? 314 LEU A O     1 
ATOM   2263  C  CB    . LEU A 1 314 ? -17.002 15.193  -34.542 1.00 63.20 ? 314 LEU A CB    1 
ATOM   2264  C  CG    . LEU A 1 314 ? -16.815 13.753  -35.014 1.00 62.61 ? 314 LEU A CG    1 
ATOM   2265  C  CD1   . LEU A 1 314 ? -15.330 13.433  -35.115 1.00 59.05 ? 314 LEU A CD1   1 
ATOM   2266  C  CD2   . LEU A 1 314 ? -17.525 12.779  -34.075 1.00 66.66 ? 314 LEU A CD2   1 
ATOM   2267  N  N     . LYS A 1 315 ? -18.138 18.100  -33.982 1.00 68.32 ? 315 LYS A N     1 
ATOM   2268  C  CA    . LYS A 1 315 ? -18.448 19.245  -33.123 1.00 70.93 ? 315 LYS A CA    1 
ATOM   2269  C  C     . LYS A 1 315 ? -19.878 19.783  -33.334 1.00 76.63 ? 315 LYS A C     1 
ATOM   2270  O  O     . LYS A 1 315 ? -20.446 20.420  -32.436 1.00 80.42 ? 315 LYS A O     1 
ATOM   2271  C  CB    . LYS A 1 315 ? -17.417 20.350  -33.311 1.00 68.06 ? 315 LYS A CB    1 
ATOM   2272  N  N     . LYS A 1 316 ? -20.447 19.517  -34.512 1.00 77.29 ? 316 LYS A N     1 
ATOM   2273  C  CA    . LYS A 1 316 ? -21.802 19.965  -34.859 1.00 83.11 ? 316 LYS A CA    1 
ATOM   2274  C  C     . LYS A 1 316 ? -22.878 19.229  -34.059 1.00 87.90 ? 316 LYS A C     1 
ATOM   2275  O  O     . LYS A 1 316 ? -23.134 19.549  -32.899 1.00 90.43 ? 316 LYS A O     1 
ATOM   2276  C  CB    . LYS A 1 316 ? -22.051 19.804  -36.362 1.00 82.68 ? 316 LYS A CB    1 
ATOM   2277  N  N     . ARG A 1 326 ? -16.808 16.124  -29.173 1.00 58.58 ? 326 ARG A N     1 
ATOM   2278  C  CA    . ARG A 1 326 ? -17.575 17.190  -28.517 1.00 58.80 ? 326 ARG A CA    1 
ATOM   2279  C  C     . ARG A 1 326 ? -16.840 17.889  -27.359 1.00 57.30 ? 326 ARG A C     1 
ATOM   2280  O  O     . ARG A 1 326 ? -17.108 19.052  -27.067 1.00 57.37 ? 326 ARG A O     1 
ATOM   2281  C  CB    . ARG A 1 326 ? -18.933 16.662  -28.061 1.00 60.81 ? 326 ARG A CB    1 
ATOM   2282  C  CG    . ARG A 1 326 ? -19.864 16.205  -29.198 1.00 63.41 ? 326 ARG A CG    1 
ATOM   2283  C  CD    . ARG A 1 326 ? -20.664 17.381  -29.774 1.00 66.71 ? 326 ARG A CD    1 
ATOM   2284  N  NE    . ARG A 1 326 ? -21.951 16.981  -30.358 1.00 69.37 ? 326 ARG A NE    1 
ATOM   2285  C  CZ    . ARG A 1 326 ? -23.101 16.918  -29.682 1.00 71.87 ? 326 ARG A CZ    1 
ATOM   2286  N  NH1   . ARG A 1 326 ? -23.137 17.216  -28.388 1.00 72.51 ? 326 ARG A NH1   1 
ATOM   2287  N  NH2   . ARG A 1 326 ? -24.222 16.552  -30.295 1.00 73.04 ? 326 ARG A NH2   1 
ATOM   2288  N  N     . ASP A 1 327 ? -15.936 17.168  -26.696 1.00 56.10 ? 327 ASP A N     1 
ATOM   2289  C  CA    . ASP A 1 327 ? -14.927 17.738  -25.780 1.00 54.06 ? 327 ASP A CA    1 
ATOM   2290  C  C     . ASP A 1 327 ? -13.589 17.775  -26.506 1.00 51.95 ? 327 ASP A C     1 
ATOM   2291  O  O     . ASP A 1 327 ? -12.509 17.920  -25.910 1.00 51.19 ? 327 ASP A O     1 
ATOM   2292  C  CB    . ASP A 1 327 ? -14.786 16.866  -24.537 1.00 54.76 ? 327 ASP A CB    1 
ATOM   2293  C  CG    . ASP A 1 327 ? -15.838 17.167  -23.501 1.00 57.41 ? 327 ASP A CG    1 
ATOM   2294  O  OD1   . ASP A 1 327 ? -15.440 17.748  -22.457 1.00 57.32 ? 327 ASP A OD1   1 
ATOM   2295  O  OD2   . ASP A 1 327 ? -17.046 16.849  -23.742 1.00 58.96 ? 327 ASP A OD2   1 
ATOM   2296  N  N     . LEU A 1 328 ? -13.680 17.582  -27.810 1.00 50.50 ? 328 LEU A N     1 
ATOM   2297  C  CA    . LEU A 1 328 ? -12.528 17.558  -28.663 1.00 48.63 ? 328 LEU A CA    1 
ATOM   2298  C  C     . LEU A 1 328 ? -12.591 18.808  -29.486 1.00 47.64 ? 328 LEU A C     1 
ATOM   2299  O  O     . LEU A 1 328 ? -13.662 19.382  -29.687 1.00 47.88 ? 328 LEU A O     1 
ATOM   2300  C  CB    . LEU A 1 328 ? -12.550 16.317  -29.557 1.00 48.65 ? 328 LEU A CB    1 
ATOM   2301  C  CG    . LEU A 1 328 ? -12.585 14.960  -28.852 1.00 47.56 ? 328 LEU A CG    1 
ATOM   2302  C  CD1   . LEU A 1 328 ? -12.786 13.869  -29.879 1.00 47.11 ? 328 LEU A CD1   1 
ATOM   2303  C  CD2   . LEU A 1 328 ? -11.316 14.712  -28.032 1.00 44.70 ? 328 LEU A CD2   1 
ATOM   2304  N  N     . PHE A 1 329 ? -11.426 19.252  -29.916 1.00 46.45 ? 329 PHE A N     1 
ATOM   2305  C  CA    . PHE A 1 329 ? -11.313 20.417  -30.755 1.00 45.70 ? 329 PHE A CA    1 
ATOM   2306  C  C     . PHE A 1 329 ? -10.731 19.911  -32.064 1.00 44.99 ? 329 PHE A C     1 
ATOM   2307  O  O     . PHE A 1 329 ? -9.987  18.934  -32.083 1.00 44.99 ? 329 PHE A O     1 
ATOM   2308  C  CB    . PHE A 1 329 ? -10.432 21.467  -30.077 1.00 45.44 ? 329 PHE A CB    1 
ATOM   2309  C  CG    . PHE A 1 329 ? -10.994 21.969  -28.775 1.00 46.45 ? 329 PHE A CG    1 
ATOM   2310  C  CD1   . PHE A 1 329 ? -11.736 23.150  -28.730 1.00 47.60 ? 329 PHE A CD1   1 
ATOM   2311  C  CD2   . PHE A 1 329 ? -10.808 21.245  -27.591 1.00 48.42 ? 329 PHE A CD2   1 
ATOM   2312  C  CE1   . PHE A 1 329 ? -12.276 23.618  -27.527 1.00 48.03 ? 329 PHE A CE1   1 
ATOM   2313  C  CE2   . PHE A 1 329 ? -11.353 21.698  -26.373 1.00 49.65 ? 329 PHE A CE2   1 
ATOM   2314  C  CZ    . PHE A 1 329 ? -12.087 22.892  -26.343 1.00 48.59 ? 329 PHE A CZ    1 
ATOM   2315  N  N     . PHE A 1 330 ? -11.107 20.538  -33.165 1.00 44.26 ? 330 PHE A N     1 
ATOM   2316  C  CA    . PHE A 1 330 ? -10.773 19.990  -34.461 1.00 43.37 ? 330 PHE A CA    1 
ATOM   2317  C  C     . PHE A 1 330 ? -9.954  20.957  -35.294 1.00 42.12 ? 330 PHE A C     1 
ATOM   2318  O  O     . PHE A 1 330 ? -10.107 22.181  -35.211 1.00 41.65 ? 330 PHE A O     1 
ATOM   2319  C  CB    . PHE A 1 330 ? -12.039 19.500  -35.168 1.00 44.52 ? 330 PHE A CB    1 
ATOM   2320  C  CG    . PHE A 1 330 ? -12.831 18.510  -34.343 1.00 46.14 ? 330 PHE A CG    1 
ATOM   2321  C  CD1   . PHE A 1 330 ? -12.568 17.147  -34.424 1.00 46.42 ? 330 PHE A CD1   1 
ATOM   2322  C  CD2   . PHE A 1 330 ? -13.814 18.949  -33.448 1.00 47.59 ? 330 PHE A CD2   1 
ATOM   2323  C  CE1   . PHE A 1 330 ? -13.280 16.230  -33.660 1.00 46.66 ? 330 PHE A CE1   1 
ATOM   2324  C  CE2   . PHE A 1 330 ? -14.530 18.041  -32.675 1.00 47.63 ? 330 PHE A CE2   1 
ATOM   2325  C  CZ    . PHE A 1 330 ? -14.256 16.677  -32.783 1.00 47.87 ? 330 PHE A CZ    1 
ATOM   2326  N  N     . ALA A 1 331 ? -9.042  20.390  -36.068 1.00 40.78 ? 331 ALA A N     1 
ATOM   2327  C  CA    . ALA A 1 331 ? -8.093  21.174  -36.813 1.00 39.30 ? 331 ALA A CA    1 
ATOM   2328  C  C     . ALA A 1 331 ? -7.753  20.441  -38.093 1.00 39.16 ? 331 ALA A C     1 
ATOM   2329  O  O     . ALA A 1 331 ? -7.776  19.213  -38.145 1.00 39.44 ? 331 ALA A O     1 
ATOM   2330  C  CB    . ALA A 1 331 ? -6.852  21.404  -35.976 1.00 38.25 ? 331 ALA A CB    1 
ATOM   2331  N  N     . LEU A 1 332 ? -7.463  21.202  -39.134 1.00 38.67 ? 332 LEU A N     1 
ATOM   2332  C  CA    . LEU A 1 332 ? -6.977  20.622  -40.362 1.00 38.85 ? 332 LEU A CA    1 
ATOM   2333  C  C     . LEU A 1 332 ? -5.506  20.925  -40.531 1.00 38.31 ? 332 LEU A C     1 
ATOM   2334  O  O     . LEU A 1 332 ? -5.049  22.035  -40.246 1.00 38.35 ? 332 LEU A O     1 
ATOM   2335  C  CB    . LEU A 1 332 ? -7.761  21.154  -41.551 1.00 39.40 ? 332 LEU A CB    1 
ATOM   2336  C  CG    . LEU A 1 332 ? -9.272  20.942  -41.541 1.00 39.56 ? 332 LEU A CG    1 
ATOM   2337  C  CD1   . LEU A 1 332 ? -9.838  21.438  -42.847 1.00 38.10 ? 332 LEU A CD1   1 
ATOM   2338  C  CD2   . LEU A 1 332 ? -9.655  19.485  -41.276 1.00 39.20 ? 332 LEU A CD2   1 
ATOM   2339  N  N     . TRP A 1 333 ? -4.770  19.920  -40.982 1.00 38.14 ? 333 TRP A N     1 
ATOM   2340  C  CA    . TRP A 1 333 ? -3.361  20.043  -41.311 1.00 37.26 ? 333 TRP A CA    1 
ATOM   2341  C  C     . TRP A 1 333 ? -3.337  20.016  -42.837 1.00 37.96 ? 333 TRP A C     1 
ATOM   2342  O  O     . TRP A 1 333 ? -3.374  18.948  -43.442 1.00 38.65 ? 333 TRP A O     1 
ATOM   2343  C  CB    . TRP A 1 333 ? -2.624  18.853  -40.692 1.00 36.65 ? 333 TRP A CB    1 
ATOM   2344  C  CG    . TRP A 1 333 ? -1.123  18.959  -40.553 1.00 36.56 ? 333 TRP A CG    1 
ATOM   2345  C  CD1   . TRP A 1 333 ? -0.200  18.124  -41.114 1.00 37.23 ? 333 TRP A CD1   1 
ATOM   2346  C  CD2   . TRP A 1 333 ? -0.377  19.919  -39.786 1.00 34.45 ? 333 TRP A CD2   1 
ATOM   2347  N  NE1   . TRP A 1 333 ? 1.070   18.500  -40.751 1.00 36.39 ? 333 TRP A NE1   1 
ATOM   2348  C  CE2   . TRP A 1 333 ? 0.993   19.601  -39.941 1.00 35.17 ? 333 TRP A CE2   1 
ATOM   2349  C  CE3   . TRP A 1 333 ? -0.732  21.012  -38.983 1.00 34.19 ? 333 TRP A CE3   1 
ATOM   2350  C  CZ2   . TRP A 1 333 ? 2.018   20.341  -39.328 1.00 34.43 ? 333 TRP A CZ2   1 
ATOM   2351  C  CZ3   . TRP A 1 333 ? 0.280   21.750  -38.374 1.00 34.88 ? 333 TRP A CZ3   1 
ATOM   2352  C  CH2   . TRP A 1 333 ? 1.646   21.403  -38.545 1.00 35.53 ? 333 TRP A CH2   1 
ATOM   2353  N  N     . ILE A 1 334 ? -3.311  21.203  -43.451 1.00 38.07 ? 334 ILE A N     1 
ATOM   2354  C  CA    . ILE A 1 334 ? -3.624  21.372  -44.880 1.00 38.54 ? 334 ILE A CA    1 
ATOM   2355  C  C     . ILE A 1 334 ? -2.399  21.483  -45.802 1.00 38.81 ? 334 ILE A C     1 
ATOM   2356  O  O     . ILE A 1 334 ? -1.545  22.349  -45.601 1.00 38.65 ? 334 ILE A O     1 
ATOM   2357  C  CB    . ILE A 1 334 ? -4.568  22.593  -45.111 1.00 38.76 ? 334 ILE A CB    1 
ATOM   2358  C  CG1   . ILE A 1 334 ? -5.841  22.458  -44.259 1.00 38.60 ? 334 ILE A CG1   1 
ATOM   2359  C  CG2   . ILE A 1 334 ? -4.950  22.730  -46.598 1.00 39.28 ? 334 ILE A CG2   1 
ATOM   2360  C  CD1   . ILE A 1 334 ? -6.615  23.733  -44.115 1.00 37.51 ? 334 ILE A CD1   1 
ATOM   2361  N  N     . PRO A 1 335 ? -2.309  20.606  -46.819 1.00 39.28 ? 335 PRO A N     1 
ATOM   2362  C  CA    . PRO A 1 335 ? -1.259  20.767  -47.825 1.00 39.39 ? 335 PRO A CA    1 
ATOM   2363  C  C     . PRO A 1 335 ? -1.608  21.870  -48.823 1.00 39.94 ? 335 PRO A C     1 
ATOM   2364  O  O     . PRO A 1 335 ? -2.779  22.225  -48.971 1.00 40.52 ? 335 PRO A O     1 
ATOM   2365  C  CB    . PRO A 1 335 ? -1.233  19.409  -48.518 1.00 39.60 ? 335 PRO A CB    1 
ATOM   2366  C  CG    . PRO A 1 335 ? -2.622  18.914  -48.409 1.00 40.31 ? 335 PRO A CG    1 
ATOM   2367  C  CD    . PRO A 1 335 ? -3.142  19.415  -47.079 1.00 39.94 ? 335 PRO A CD    1 
ATOM   2368  N  N     . ASP A 1 336 ? -0.592  22.405  -49.493 1.00 40.05 ? 336 ASP A N     1 
ATOM   2369  C  CA    . ASP A 1 336 ? -0.769  23.436  -50.512 1.00 40.40 ? 336 ASP A CA    1 
ATOM   2370  C  C     . ASP A 1 336 ? -1.585  22.891  -51.676 1.00 41.17 ? 336 ASP A C     1 
ATOM   2371  O  O     . ASP A 1 336 ? -2.377  23.615  -52.296 1.00 41.54 ? 336 ASP A O     1 
ATOM   2372  C  CB    . ASP A 1 336 ? 0.598   23.942  -51.000 1.00 40.48 ? 336 ASP A CB    1 
ATOM   2373  C  CG    . ASP A 1 336 ? 1.382   24.689  -49.910 1.00 40.25 ? 336 ASP A CG    1 
ATOM   2374  O  OD1   . ASP A 1 336 ? 0.789   25.128  -48.903 1.00 39.30 ? 336 ASP A OD1   1 
ATOM   2375  O  OD2   . ASP A 1 336 ? 2.605   24.856  -50.064 1.00 41.58 ? 336 ASP A OD2   1 
ATOM   2376  N  N     . LEU A 1 337 ? -1.392  21.602  -51.951 1.00 41.36 ? 337 LEU A N     1 
ATOM   2377  C  CA    . LEU A 1 337 ? -2.062  20.926  -53.048 1.00 42.20 ? 337 LEU A CA    1 
ATOM   2378  C  C     . LEU A 1 337 ? -3.584  21.027  -52.945 1.00 42.42 ? 337 LEU A C     1 
ATOM   2379  O  O     . LEU A 1 337 ? -4.259  21.263  -53.947 1.00 43.31 ? 337 LEU A O     1 
ATOM   2380  C  CB    . LEU A 1 337 ? -1.593  19.475  -53.125 1.00 42.65 ? 337 LEU A CB    1 
ATOM   2381  C  CG    . LEU A 1 337 ? -1.607  18.675  -54.445 1.00 44.04 ? 337 LEU A CG    1 
ATOM   2382  C  CD1   . LEU A 1 337 ? -2.653  17.589  -54.378 1.00 45.27 ? 337 LEU A CD1   1 
ATOM   2383  C  CD2   . LEU A 1 337 ? -1.767  19.532  -55.714 1.00 43.69 ? 337 LEU A CD2   1 
ATOM   2384  N  N     . PHE A 1 338 ? -4.129  20.875  -51.741 1.00 41.58 ? 338 PHE A N     1 
ATOM   2385  C  CA    . PHE A 1 338 ? -5.572  21.046  -51.558 1.00 41.72 ? 338 PHE A CA    1 
ATOM   2386  C  C     . PHE A 1 338 ? -5.991  22.488  -51.869 1.00 41.94 ? 338 PHE A C     1 
ATOM   2387  O  O     . PHE A 1 338 ? -6.965  22.714  -52.578 1.00 42.50 ? 338 PHE A O     1 
ATOM   2388  C  CB    . PHE A 1 338 ? -6.021  20.625  -50.152 1.00 40.40 ? 338 PHE A CB    1 
ATOM   2389  C  CG    . PHE A 1 338 ? -7.475  20.895  -49.873 1.00 40.12 ? 338 PHE A CG    1 
ATOM   2390  C  CD1   . PHE A 1 338 ? -8.476  20.248  -50.603 1.00 41.15 ? 338 PHE A CD1   1 
ATOM   2391  C  CD2   . PHE A 1 338 ? -7.849  21.792  -48.873 1.00 38.27 ? 338 PHE A CD2   1 
ATOM   2392  C  CE1   . PHE A 1 338 ? -9.830  20.498  -50.340 1.00 41.82 ? 338 PHE A CE1   1 
ATOM   2393  C  CE2   . PHE A 1 338 ? -9.184  22.042  -48.594 1.00 37.74 ? 338 PHE A CE2   1 
ATOM   2394  C  CZ    . PHE A 1 338 ? -10.187 21.396  -49.328 1.00 40.05 ? 338 PHE A CZ    1 
ATOM   2395  N  N     . MET A 1 339 ? -5.237  23.454  -51.356 1.00 41.27 ? 339 MET A N     1 
ATOM   2396  C  CA    . MET A 1 339 ? -5.528  24.858  -51.629 1.00 42.00 ? 339 MET A CA    1 
ATOM   2397  C  C     . MET A 1 339 ? -5.455  25.204  -53.122 1.00 43.51 ? 339 MET A C     1 
ATOM   2398  O  O     . MET A 1 339 ? -6.306  25.945  -53.624 1.00 43.99 ? 339 MET A O     1 
ATOM   2399  C  CB    . MET A 1 339 ? -4.629  25.779  -50.802 1.00 40.80 ? 339 MET A CB    1 
ATOM   2400  C  CG    . MET A 1 339 ? -4.802  25.604  -49.296 1.00 40.74 ? 339 MET A CG    1 
ATOM   2401  S  SD    . MET A 1 339 ? -6.435  26.090  -48.715 1.00 42.38 ? 339 MET A SD    1 
ATOM   2402  C  CE    . MET A 1 339 ? -6.247  27.879  -48.644 1.00 40.93 ? 339 MET A CE    1 
ATOM   2403  N  N     . LYS A 1 340 ? -4.452  24.663  -53.823 1.00 44.10 ? 340 LYS A N     1 
ATOM   2404  C  CA    . LYS A 1 340 ? -4.336  24.854  -55.270 1.00 45.78 ? 340 LYS A CA    1 
ATOM   2405  C  C     . LYS A 1 340 ? -5.509  24.256  -56.047 1.00 46.82 ? 340 LYS A C     1 
ATOM   2406  O  O     . LYS A 1 340 ? -5.992  24.866  -57.002 1.00 48.10 ? 340 LYS A O     1 
ATOM   2407  C  CB    . LYS A 1 340 ? -2.993  24.336  -55.802 1.00 45.92 ? 340 LYS A CB    1 
ATOM   2408  C  CG    . LYS A 1 340 ? -1.853  25.319  -55.596 1.00 47.51 ? 340 LYS A CG    1 
ATOM   2409  C  CD    . LYS A 1 340 ? -0.506  24.649  -55.338 1.00 49.82 ? 340 LYS A CD    1 
ATOM   2410  C  CE    . LYS A 1 340 ? 0.469   25.664  -54.723 1.00 52.34 ? 340 LYS A CE    1 
ATOM   2411  N  NZ    . LYS A 1 340 ? 1.882   25.169  -54.600 1.00 53.74 ? 340 LYS A NZ    1 
ATOM   2412  N  N     . ARG A 1 341 ? -5.960  23.072  -55.630 1.00 46.69 ? 341 ARG A N     1 
ATOM   2413  C  CA    . ARG A 1 341 ? -7.050  22.355  -56.302 1.00 47.74 ? 341 ARG A CA    1 
ATOM   2414  C  C     . ARG A 1 341 ? -8.383  23.085  -56.120 1.00 48.47 ? 341 ARG A C     1 
ATOM   2415  O  O     . ARG A 1 341 ? -9.235  23.075  -57.012 1.00 49.42 ? 341 ARG A O     1 
ATOM   2416  C  CB    . ARG A 1 341 ? -7.166  20.912  -55.785 1.00 47.36 ? 341 ARG A CB    1 
ATOM   2417  C  CG    . ARG A 1 341 ? -5.956  20.006  -56.057 1.00 46.49 ? 341 ARG A CG    1 
ATOM   2418  C  CD    . ARG A 1 341 ? -6.148  19.148  -57.284 1.00 46.91 ? 341 ARG A CD    1 
ATOM   2419  N  NE    . ARG A 1 341 ? -5.001  18.285  -57.587 1.00 46.68 ? 341 ARG A NE    1 
ATOM   2420  C  CZ    . ARG A 1 341 ? -4.998  16.949  -57.499 1.00 46.17 ? 341 ARG A CZ    1 
ATOM   2421  N  NH1   . ARG A 1 341 ? -6.085  16.285  -57.109 1.00 43.85 ? 341 ARG A NH1   1 
ATOM   2422  N  NH2   . ARG A 1 341 ? -3.902  16.268  -57.821 1.00 44.25 ? 341 ARG A NH2   1 
ATOM   2423  N  N     . VAL A 1 342 ? -8.543  23.719  -54.961 1.00 47.93 ? 342 VAL A N     1 
ATOM   2424  C  CA    . VAL A 1 342 ? -9.746  24.478  -54.646 1.00 48.87 ? 342 VAL A CA    1 
ATOM   2425  C  C     . VAL A 1 342 ? -9.873  25.717  -55.538 1.00 50.22 ? 342 VAL A C     1 
ATOM   2426  O  O     . VAL A 1 342 ? -10.901 25.905  -56.190 1.00 51.40 ? 342 VAL A O     1 
ATOM   2427  C  CB    . VAL A 1 342 ? -9.808  24.857  -53.133 1.00 47.71 ? 342 VAL A CB    1 
ATOM   2428  C  CG1   . VAL A 1 342 ? -10.910 25.888  -52.860 1.00 48.23 ? 342 VAL A CG1   1 
ATOM   2429  C  CG2   . VAL A 1 342 ? -10.025 23.609  -52.274 1.00 46.66 ? 342 VAL A CG2   1 
ATOM   2430  N  N     . GLU A 1 343 ? -8.831  26.549  -55.583 1.00 50.35 ? 343 GLU A N     1 
ATOM   2431  C  CA    . GLU A 1 343 ? -8.913  27.802  -56.342 1.00 51.91 ? 343 GLU A CA    1 
ATOM   2432  C  C     . GLU A 1 343 ? -8.977  27.580  -57.846 1.00 53.08 ? 343 GLU A C     1 
ATOM   2433  O  O     . GLU A 1 343 ? -9.542  28.401  -58.559 1.00 54.26 ? 343 GLU A O     1 
ATOM   2434  C  CB    . GLU A 1 343 ? -7.794  28.785  -55.979 1.00 51.44 ? 343 GLU A CB    1 
ATOM   2435  C  CG    . GLU A 1 343 ? -6.408  28.196  -56.024 1.00 53.97 ? 343 GLU A CG    1 
ATOM   2436  C  CD    . GLU A 1 343 ? -5.305  29.238  -56.185 1.00 57.35 ? 343 GLU A CD    1 
ATOM   2437  O  OE1   . GLU A 1 343 ? -5.466  30.408  -55.749 1.00 57.51 ? 343 GLU A OE1   1 
ATOM   2438  O  OE2   . GLU A 1 343 ? -4.259  28.863  -56.757 1.00 59.03 ? 343 GLU A OE2   1 
ATOM   2439  N  N     . THR A 1 344 ? -8.420  26.466  -58.317 1.00 53.08 ? 344 THR A N     1 
ATOM   2440  C  CA    . THR A 1 344 ? -8.474  26.112  -59.737 1.00 54.26 ? 344 THR A CA    1 
ATOM   2441  C  C     . THR A 1 344 ? -9.695  25.252  -60.102 1.00 54.95 ? 344 THR A C     1 
ATOM   2442  O  O     . THR A 1 344 ? -9.787  24.755  -61.218 1.00 56.04 ? 344 THR A O     1 
ATOM   2443  C  CB    . THR A 1 344 ? -7.180  25.395  -60.187 1.00 54.25 ? 344 THR A CB    1 
ATOM   2444  O  OG1   . THR A 1 344 ? -6.992  24.216  -59.396 1.00 53.68 ? 344 THR A OG1   1 
ATOM   2445  C  CG2   . THR A 1 344 ? -5.960  26.315  -60.035 1.00 53.41 ? 344 THR A CG2   1 
ATOM   2446  N  N     . ASN A 1 345 ? -10.617 25.067  -59.153 1.00 54.39 ? 345 ASN A N     1 
ATOM   2447  C  CA    . ASN A 1 345 ? -11.877 24.336  -59.376 1.00 55.10 ? 345 ASN A CA    1 
ATOM   2448  C  C     . ASN A 1 345 ? -11.688 22.891  -59.847 1.00 55.21 ? 345 ASN A C     1 
ATOM   2449  O  O     . ASN A 1 345 ? -12.435 22.398  -60.690 1.00 56.59 ? 345 ASN A O     1 
ATOM   2450  C  CB    . ASN A 1 345 ? -12.790 25.113  -60.344 1.00 56.85 ? 345 ASN A CB    1 
ATOM   2451  C  CG    . ASN A 1 345 ? -14.242 24.620  -60.330 1.00 58.49 ? 345 ASN A CG    1 
ATOM   2452  O  OD1   . ASN A 1 345 ? -14.658 23.865  -59.443 1.00 58.65 ? 345 ASN A OD1   1 
ATOM   2453  N  ND2   . ASN A 1 345 ? -15.018 25.055  -61.321 1.00 59.69 ? 345 ASN A ND2   1 
ATOM   2454  N  N     . GLN A 1 346 ? -10.699 22.209  -59.281 1.00 53.80 ? 346 GLN A N     1 
ATOM   2455  C  CA    . GLN A 1 346 ? -10.368 20.845  -59.689 1.00 53.90 ? 346 GLN A CA    1 
ATOM   2456  C  C     . GLN A 1 346 ? -10.912 19.768  -58.740 1.00 52.90 ? 346 GLN A C     1 
ATOM   2457  O  O     . GLN A 1 346 ? -11.471 20.070  -57.677 1.00 52.10 ? 346 GLN A O     1 
ATOM   2458  C  CB    . GLN A 1 346 ? -8.853  20.691  -59.800 1.00 53.39 ? 346 GLN A CB    1 
ATOM   2459  C  CG    . GLN A 1 346 ? -8.223  21.465  -60.929 1.00 55.84 ? 346 GLN A CG    1 
ATOM   2460  C  CD    . GLN A 1 346 ? -6.723  21.270  -60.973 1.00 57.04 ? 346 GLN A CD    1 
ATOM   2461  O  OE1   . GLN A 1 346 ? -6.130  20.807  -60.008 1.00 57.00 ? 346 GLN A OE1   1 
ATOM   2462  N  NE2   . GLN A 1 346 ? -6.102  21.620  -62.096 1.00 58.96 ? 346 GLN A NE2   1 
ATOM   2463  N  N     . ASP A 1 347 ? -10.726 18.511  -59.135 1.00 52.59 ? 347 ASP A N     1 
ATOM   2464  C  CA    . ASP A 1 347 ? -11.082 17.368  -58.302 1.00 51.70 ? 347 ASP A CA    1 
ATOM   2465  C  C     . ASP A 1 347 ? -10.060 17.064  -57.207 1.00 49.45 ? 347 ASP A C     1 
ATOM   2466  O  O     . ASP A 1 347 ? -8.862  17.338  -57.345 1.00 48.76 ? 347 ASP A O     1 
ATOM   2467  C  CB    . ASP A 1 347 ? -11.286 16.126  -59.161 1.00 53.12 ? 347 ASP A CB    1 
ATOM   2468  C  CG    . ASP A 1 347 ? -12.553 16.188  -59.968 1.00 55.95 ? 347 ASP A CG    1 
ATOM   2469  O  OD1   . ASP A 1 347 ? -13.320 17.164  -59.809 1.00 58.03 ? 347 ASP A OD1   1 
ATOM   2470  O  OD2   . ASP A 1 347 ? -12.786 15.258  -60.764 1.00 58.83 ? 347 ASP A OD2   1 
ATOM   2471  N  N     . TRP A 1 348 ? -10.558 16.487  -56.119 1.00 47.72 ? 348 TRP A N     1 
ATOM   2472  C  CA    . TRP A 1 348 ? -9.733  16.136  -54.980 1.00 45.54 ? 348 TRP A CA    1 
ATOM   2473  C  C     . TRP A 1 348 ? -10.005 14.680  -54.687 1.00 45.60 ? 348 TRP A C     1 
ATOM   2474  O  O     . TRP A 1 348 ? -11.156 14.240  -54.719 1.00 46.28 ? 348 TRP A O     1 
ATOM   2475  C  CB    . TRP A 1 348 ? -10.086 17.028  -53.789 1.00 43.84 ? 348 TRP A CB    1 
ATOM   2476  C  CG    . TRP A 1 348 ? -9.349  16.750  -52.530 1.00 41.65 ? 348 TRP A CG    1 
ATOM   2477  C  CD1   . TRP A 1 348 ? -9.881  16.290  -51.366 1.00 40.77 ? 348 TRP A CD1   1 
ATOM   2478  C  CD2   . TRP A 1 348 ? -7.949  16.949  -52.282 1.00 40.53 ? 348 TRP A CD2   1 
ATOM   2479  N  NE1   . TRP A 1 348 ? -8.904  16.179  -50.404 1.00 39.80 ? 348 TRP A NE1   1 
ATOM   2480  C  CE2   . TRP A 1 348 ? -7.707  16.577  -50.938 1.00 39.04 ? 348 TRP A CE2   1 
ATOM   2481  C  CE3   . TRP A 1 348 ? -6.875  17.402  -53.064 1.00 39.66 ? 348 TRP A CE3   1 
ATOM   2482  C  CZ2   . TRP A 1 348 ? -6.435  16.634  -50.356 1.00 37.92 ? 348 TRP A CZ2   1 
ATOM   2483  C  CZ3   . TRP A 1 348 ? -5.608  17.462  -52.485 1.00 39.69 ? 348 TRP A CZ3   1 
ATOM   2484  C  CH2   . TRP A 1 348 ? -5.400  17.072  -51.140 1.00 38.89 ? 348 TRP A CH2   1 
ATOM   2485  N  N     . SER A 1 349 ? -8.934  13.936  -54.439 1.00 44.99 ? 349 SER A N     1 
ATOM   2486  C  CA    . SER A 1 349 ? -9.019  12.502  -54.210 1.00 45.21 ? 349 SER A CA    1 
ATOM   2487  C  C     . SER A 1 349 ? -8.969  12.177  -52.727 1.00 44.05 ? 349 SER A C     1 
ATOM   2488  O  O     . SER A 1 349 ? -8.009  12.527  -52.035 1.00 43.04 ? 349 SER A O     1 
ATOM   2489  C  CB    . SER A 1 349 ? -7.881  11.785  -54.942 1.00 45.61 ? 349 SER A CB    1 
ATOM   2490  O  OG    . SER A 1 349 ? -8.087  11.787  -56.343 1.00 46.54 ? 349 SER A OG    1 
ATOM   2491  N  N     . LEU A 1 350 ? -10.011 11.506  -52.250 1.00 44.51 ? 350 LEU A N     1 
ATOM   2492  C  CA    . LEU A 1 350 ? -10.071 11.040  -50.864 1.00 43.98 ? 350 LEU A CA    1 
ATOM   2493  C  C     . LEU A 1 350 ? -9.457  9.648   -50.749 1.00 44.13 ? 350 LEU A C     1 
ATOM   2494  O  O     . LEU A 1 350 ? -9.705  8.773   -51.580 1.00 44.88 ? 350 LEU A O     1 
ATOM   2495  C  CB    . LEU A 1 350 ? -11.506 11.083  -50.321 1.00 44.27 ? 350 LEU A CB    1 
ATOM   2496  C  CG    . LEU A 1 350 ? -12.107 12.495  -50.203 1.00 44.41 ? 350 LEU A CG    1 
ATOM   2497  C  CD1   . LEU A 1 350 ? -13.515 12.463  -49.618 1.00 45.68 ? 350 LEU A CD1   1 
ATOM   2498  C  CD2   . LEU A 1 350 ? -11.216 13.434  -49.387 1.00 42.45 ? 350 LEU A CD2   1 
ATOM   2499  N  N     . MET A 1 351 ? -8.625  9.468   -49.728 1.00 43.26 ? 351 MET A N     1 
ATOM   2500  C  CA    . MET A 1 351 ? -7.834  8.256   -49.600 1.00 43.59 ? 351 MET A CA    1 
ATOM   2501  C  C     . MET A 1 351 ? -7.859  7.677   -48.192 1.00 43.15 ? 351 MET A C     1 
ATOM   2502  O  O     . MET A 1 351 ? -7.993  8.401   -47.204 1.00 41.82 ? 351 MET A O     1 
ATOM   2503  C  CB    . MET A 1 351 ? -6.389  8.521   -50.033 1.00 43.08 ? 351 MET A CB    1 
ATOM   2504  C  CG    . MET A 1 351 ? -6.217  8.820   -51.524 1.00 43.70 ? 351 MET A CG    1 
ATOM   2505  S  SD    . MET A 1 351 ? -4.547  9.384   -51.894 1.00 43.71 ? 351 MET A SD    1 
ATOM   2506  C  CE    . MET A 1 351 ? -4.613  9.591   -53.677 1.00 43.66 ? 351 MET A CE    1 
ATOM   2507  N  N     . CYS A 1 352 ? -7.749  6.355   -48.120 1.00 44.28 ? 352 CYS A N     1 
ATOM   2508  C  CA    . CYS A 1 352 ? -7.556  5.658   -46.856 1.00 44.45 ? 352 CYS A CA    1 
ATOM   2509  C  C     . CYS A 1 352 ? -6.060  5.388   -46.703 1.00 44.26 ? 352 CYS A C     1 
ATOM   2510  O  O     . CYS A 1 352 ? -5.448  4.808   -47.601 1.00 44.59 ? 352 CYS A O     1 
ATOM   2511  C  CB    . CYS A 1 352 ? -8.356  4.354   -46.827 1.00 45.35 ? 352 CYS A CB    1 
ATOM   2512  S  SG    . CYS A 1 352 ? -7.917  3.283   -45.460 1.00 44.94 ? 352 CYS A SG    1 
ATOM   2513  N  N     . PRO A 1 353 ? -5.466  5.819   -45.570 1.00 43.78 ? 353 PRO A N     1 
ATOM   2514  C  CA    . PRO A 1 353 ? -4.013  5.712   -45.325 1.00 43.87 ? 353 PRO A CA    1 
ATOM   2515  C  C     . PRO A 1 353 ? -3.462  4.281   -45.301 1.00 45.08 ? 353 PRO A C     1 
ATOM   2516  O  O     . PRO A 1 353 ? -2.246  4.096   -45.360 1.00 45.32 ? 353 PRO A O     1 
ATOM   2517  C  CB    . PRO A 1 353 ? -3.835  6.369   -43.949 1.00 42.71 ? 353 PRO A CB    1 
ATOM   2518  C  CG    . PRO A 1 353 ? -5.173  6.274   -43.309 1.00 42.87 ? 353 PRO A CG    1 
ATOM   2519  C  CD    . PRO A 1 353 ? -6.162  6.437   -44.428 1.00 43.21 ? 353 PRO A CD    1 
ATOM   2520  N  N     . ASN A 1 354 ? -4.342  3.288   -45.201 1.00 46.46 ? 354 ASN A N     1 
ATOM   2521  C  CA    . ASN A 1 354 ? -3.935  1.884   -45.237 1.00 47.96 ? 354 ASN A CA    1 
ATOM   2522  C  C     . ASN A 1 354 ? -3.716  1.405   -46.685 1.00 49.35 ? 354 ASN A C     1 
ATOM   2523  O  O     . ASN A 1 354 ? -2.836  0.582   -46.964 1.00 49.46 ? 354 ASN A O     1 
ATOM   2524  C  CB    . ASN A 1 354 ? -4.975  1.023   -44.524 1.00 48.62 ? 354 ASN A CB    1 
ATOM   2525  C  CG    . ASN A 1 354 ? -4.637  -0.456  -44.549 1.00 50.35 ? 354 ASN A CG    1 
ATOM   2526  O  OD1   . ASN A 1 354 ? -3.533  -0.861  -44.187 1.00 50.53 ? 354 ASN A OD1   1 
ATOM   2527  N  ND2   . ASN A 1 354 ? -5.604  -1.276  -44.963 1.00 52.54 ? 354 ASN A ND2   1 
ATOM   2528  N  N     . GLU A 1 355 ? -4.535  1.933   -47.592 1.00 49.96 ? 355 GLU A N     1 
ATOM   2529  C  CA    . GLU A 1 355 ? -4.372  1.726   -49.019 1.00 51.15 ? 355 GLU A CA    1 
ATOM   2530  C  C     . GLU A 1 355 ? -3.271  2.647   -49.561 1.00 50.10 ? 355 GLU A C     1 
ATOM   2531  O  O     . GLU A 1 355 ? -2.521  2.261   -50.463 1.00 50.97 ? 355 GLU A O     1 
ATOM   2532  C  CB    . GLU A 1 355 ? -5.701  1.983   -49.735 1.00 51.68 ? 355 GLU A CB    1 
ATOM   2533  C  CG    . GLU A 1 355 ? -5.656  1.781   -51.249 1.00 54.00 ? 355 GLU A CG    1 
ATOM   2534  C  CD    . GLU A 1 355 ? -7.022  1.938   -51.912 1.00 55.15 ? 355 GLU A CD    1 
ATOM   2535  O  OE1   . GLU A 1 355 ? -7.178  1.453   -53.061 1.00 57.77 ? 355 GLU A OE1   1 
ATOM   2536  O  OE2   . GLU A 1 355 ? -7.933  2.537   -51.286 1.00 56.59 ? 355 GLU A OE2   1 
ATOM   2537  N  N     . CYS A 1 356 ? -3.159  3.847   -48.995 1.00 48.37 ? 356 CYS A N     1 
ATOM   2538  C  CA    . CYS A 1 356 ? -2.188  4.832   -49.467 1.00 47.14 ? 356 CYS A CA    1 
ATOM   2539  C  C     . CYS A 1 356 ? -1.258  5.303   -48.340 1.00 45.76 ? 356 CYS A C     1 
ATOM   2540  O  O     . CYS A 1 356 ? -1.434  6.398   -47.814 1.00 44.52 ? 356 CYS A O     1 
ATOM   2541  C  CB    . CYS A 1 356 ? -2.916  6.020   -50.105 1.00 46.87 ? 356 CYS A CB    1 
ATOM   2542  S  SG    . CYS A 1 356 ? -4.035  5.571   -51.457 1.00 48.33 ? 356 CYS A SG    1 
ATOM   2543  N  N     . PRO A 1 357 ? -0.256  4.478   -47.975 1.00 46.00 ? 357 PRO A N     1 
ATOM   2544  C  CA    . PRO A 1 357 ? 0.567   4.794   -46.804 1.00 45.26 ? 357 PRO A CA    1 
ATOM   2545  C  C     . PRO A 1 357 ? 1.570   5.920   -47.030 1.00 44.98 ? 357 PRO A C     1 
ATOM   2546  O  O     . PRO A 1 357 ? 2.041   6.123   -48.157 1.00 45.49 ? 357 PRO A O     1 
ATOM   2547  C  CB    . PRO A 1 357 ? 1.312   3.480   -46.533 1.00 45.79 ? 357 PRO A CB    1 
ATOM   2548  C  CG    . PRO A 1 357 ? 1.417   2.826   -47.867 1.00 46.64 ? 357 PRO A CG    1 
ATOM   2549  C  CD    . PRO A 1 357 ? 0.165   3.215   -48.619 1.00 47.05 ? 357 PRO A CD    1 
ATOM   2550  N  N     . GLY A 1 358 ? 1.866   6.649   -45.955 1.00 44.22 ? 358 GLY A N     1 
ATOM   2551  C  CA    . GLY A 1 358 ? 2.997   7.570   -45.903 1.00 44.08 ? 358 GLY A CA    1 
ATOM   2552  C  C     . GLY A 1 358 ? 2.716   9.023   -46.232 1.00 43.63 ? 358 GLY A C     1 
ATOM   2553  O  O     . GLY A 1 358 ? 3.614   9.858   -46.153 1.00 43.41 ? 358 GLY A O     1 
ATOM   2554  N  N     . LEU A 1 359 ? 1.476   9.324   -46.607 1.00 43.76 ? 359 LEU A N     1 
ATOM   2555  C  CA    . LEU A 1 359 ? 1.076   10.683  -46.960 1.00 43.27 ? 359 LEU A CA    1 
ATOM   2556  C  C     . LEU A 1 359 ? 1.374   11.726  -45.873 1.00 42.74 ? 359 LEU A C     1 
ATOM   2557  O  O     . LEU A 1 359 ? 1.673   12.875  -46.183 1.00 42.54 ? 359 LEU A O     1 
ATOM   2558  C  CB    . LEU A 1 359 ? -0.401  10.712  -47.356 1.00 43.26 ? 359 LEU A CB    1 
ATOM   2559  C  CG    . LEU A 1 359 ? -0.839  10.709  -48.834 1.00 43.00 ? 359 LEU A CG    1 
ATOM   2560  C  CD1   . LEU A 1 359 ? 0.262   10.370  -49.806 1.00 41.33 ? 359 LEU A CD1   1 
ATOM   2561  C  CD2   . LEU A 1 359 ? -2.081  9.848   -49.058 1.00 41.84 ? 359 LEU A CD2   1 
ATOM   2562  N  N     . ASP A 1 360 ? 1.314   11.321  -44.610 1.00 42.75 ? 360 ASP A N     1 
ATOM   2563  C  CA    . ASP A 1 360 ? 1.588   12.232  -43.498 1.00 42.27 ? 360 ASP A CA    1 
ATOM   2564  C  C     . ASP A 1 360 ? 3.075   12.331  -43.105 1.00 42.31 ? 360 ASP A C     1 
ATOM   2565  O  O     . ASP A 1 360 ? 3.454   13.220  -42.338 1.00 41.86 ? 360 ASP A O     1 
ATOM   2566  C  CB    . ASP A 1 360 ? 0.711   11.895  -42.274 1.00 42.03 ? 360 ASP A CB    1 
ATOM   2567  C  CG    . ASP A 1 360 ? 0.899   10.461  -41.765 1.00 42.86 ? 360 ASP A CG    1 
ATOM   2568  O  OD1   . ASP A 1 360 ? 0.600   10.231  -40.576 1.00 42.79 ? 360 ASP A OD1   1 
ATOM   2569  O  OD2   . ASP A 1 360 ? 1.321   9.562   -42.530 1.00 43.56 ? 360 ASP A OD2   1 
ATOM   2570  N  N     . GLU A 1 361 ? 3.905   11.438  -43.640 1.00 43.00 ? 361 GLU A N     1 
ATOM   2571  C  CA    . GLU A 1 361 ? 5.331   11.391  -43.306 1.00 43.51 ? 361 GLU A CA    1 
ATOM   2572  C  C     . GLU A 1 361 ? 6.125   12.267  -44.262 1.00 43.10 ? 361 GLU A C     1 
ATOM   2573  O  O     . GLU A 1 361 ? 7.351   12.345  -44.203 1.00 42.77 ? 361 GLU A O     1 
ATOM   2574  C  CB    . GLU A 1 361 ? 5.846   9.956   -43.380 1.00 44.56 ? 361 GLU A CB    1 
ATOM   2575  C  CG    . GLU A 1 361 ? 5.173   8.982   -42.415 1.00 48.34 ? 361 GLU A CG    1 
ATOM   2576  C  CD    . GLU A 1 361 ? 5.830   8.964   -41.043 1.00 52.48 ? 361 GLU A CD    1 
ATOM   2577  O  OE1   . GLU A 1 361 ? 7.004   9.398   -40.931 1.00 55.12 ? 361 GLU A OE1   1 
ATOM   2578  O  OE2   . GLU A 1 361 ? 5.180   8.510   -40.076 1.00 53.11 ? 361 GLU A OE2   1 
ATOM   2579  N  N     . VAL A 1 362 ? 5.405   12.962  -45.127 1.00 43.04 ? 362 VAL A N     1 
ATOM   2580  C  CA    . VAL A 1 362 ? 6.012   13.616  -46.258 1.00 43.20 ? 362 VAL A CA    1 
ATOM   2581  C  C     . VAL A 1 362 ? 5.257   14.945  -46.482 1.00 42.92 ? 362 VAL A C     1 
ATOM   2582  O  O     . VAL A 1 362 ? 4.054   15.038  -46.203 1.00 42.24 ? 362 VAL A O     1 
ATOM   2583  C  CB    . VAL A 1 362 ? 5.988   12.601  -47.449 1.00 44.31 ? 362 VAL A CB    1 
ATOM   2584  C  CG1   . VAL A 1 362 ? 4.838   12.835  -48.410 1.00 44.58 ? 362 VAL A CG1   1 
ATOM   2585  C  CG2   . VAL A 1 362 ? 7.335   12.489  -48.142 1.00 44.84 ? 362 VAL A CG2   1 
ATOM   2586  N  N     . TRP A 1 363 ? 5.975   15.984  -46.912 1.00 42.81 ? 363 TRP A N     1 
ATOM   2587  C  CA    . TRP A 1 363 ? 5.370   17.289  -47.181 1.00 42.49 ? 363 TRP A CA    1 
ATOM   2588  C  C     . TRP A 1 363 ? 5.918   17.873  -48.476 1.00 43.60 ? 363 TRP A C     1 
ATOM   2589  O  O     . TRP A 1 363 ? 6.822   17.290  -49.080 1.00 44.44 ? 363 TRP A O     1 
ATOM   2590  C  CB    . TRP A 1 363 ? 5.576   18.255  -45.999 1.00 41.58 ? 363 TRP A CB    1 
ATOM   2591  C  CG    . TRP A 1 363 ? 7.013   18.590  -45.690 1.00 41.20 ? 363 TRP A CG    1 
ATOM   2592  C  CD1   . TRP A 1 363 ? 7.838   17.942  -44.808 1.00 40.49 ? 363 TRP A CD1   1 
ATOM   2593  C  CD2   . TRP A 1 363 ? 7.794   19.659  -46.256 1.00 41.12 ? 363 TRP A CD2   1 
ATOM   2594  N  NE1   . TRP A 1 363 ? 9.080   18.540  -44.791 1.00 40.35 ? 363 TRP A NE1   1 
ATOM   2595  C  CE2   . TRP A 1 363 ? 9.079   19.594  -45.670 1.00 40.74 ? 363 TRP A CE2   1 
ATOM   2596  C  CE3   . TRP A 1 363 ? 7.528   20.670  -47.191 1.00 41.91 ? 363 TRP A CE3   1 
ATOM   2597  C  CZ2   . TRP A 1 363 ? 10.094  20.494  -45.995 1.00 41.19 ? 363 TRP A CZ2   1 
ATOM   2598  C  CZ3   . TRP A 1 363 ? 8.543   21.562  -47.522 1.00 41.85 ? 363 TRP A CZ3   1 
ATOM   2599  C  CH2   . TRP A 1 363 ? 9.810   21.465  -46.921 1.00 42.04 ? 363 TRP A CH2   1 
ATOM   2600  N  N     . GLY A 1 364 ? 5.353   19.005  -48.908 1.00 43.95 ? 364 GLY A N     1 
ATOM   2601  C  CA    . GLY A 1 364 ? 5.817   19.735  -50.096 1.00 44.92 ? 364 GLY A CA    1 
ATOM   2602  C  C     . GLY A 1 364 ? 5.769   18.933  -51.387 1.00 46.43 ? 364 GLY A C     1 
ATOM   2603  O  O     . GLY A 1 364 ? 4.785   18.227  -51.661 1.00 46.74 ? 364 GLY A O     1 
ATOM   2604  N  N     . GLU A 1 365 ? 6.838   19.032  -52.179 1.00 47.48 ? 365 GLU A N     1 
ATOM   2605  C  CA    . GLU A 1 365 ? 6.927   18.321  -53.459 1.00 48.68 ? 365 GLU A CA    1 
ATOM   2606  C  C     . GLU A 1 365 ? 6.891   16.806  -53.278 1.00 48.89 ? 365 GLU A C     1 
ATOM   2607  O  O     . GLU A 1 365 ? 6.292   16.096  -54.090 1.00 49.62 ? 365 GLU A O     1 
ATOM   2608  C  CB    . GLU A 1 365 ? 8.178   18.746  -54.233 1.00 49.78 ? 365 GLU A CB    1 
ATOM   2609  N  N     . GLU A 1 366 ? 7.525   16.322  -52.211 1.00 48.21 ? 366 GLU A N     1 
ATOM   2610  C  CA    . GLU A 1 366 ? 7.525   14.898  -51.880 1.00 48.78 ? 366 GLU A CA    1 
ATOM   2611  C  C     . GLU A 1 366 ? 6.114   14.352  -51.640 1.00 47.41 ? 366 GLU A C     1 
ATOM   2612  O  O     . GLU A 1 366 ? 5.826   13.218  -52.022 1.00 47.98 ? 366 GLU A O     1 
ATOM   2613  C  CB    . GLU A 1 366 ? 8.433   14.610  -50.668 1.00 48.25 ? 366 GLU A CB    1 
ATOM   2614  C  CG    . GLU A 1 366 ? 9.917   14.448  -51.000 1.00 50.80 ? 366 GLU A CG    1 
ATOM   2615  C  CD    . GLU A 1 366 ? 10.803  14.118  -49.774 1.00 50.95 ? 366 GLU A CD    1 
ATOM   2616  O  OE1   . GLU A 1 366 ? 10.300  13.541  -48.782 1.00 52.12 ? 366 GLU A OE1   1 
ATOM   2617  O  OE2   . GLU A 1 366 ? 12.024  14.425  -49.813 1.00 55.11 ? 366 GLU A OE2   1 
ATOM   2618  N  N     . PHE A 1 367 ? 5.251   15.147  -51.003 1.00 45.94 ? 367 PHE A N     1 
ATOM   2619  C  CA    . PHE A 1 367 ? 3.848   14.763  -50.802 1.00 45.30 ? 367 PHE A CA    1 
ATOM   2620  C  C     . PHE A 1 367 ? 3.091   14.797  -52.120 1.00 46.11 ? 367 PHE A C     1 
ATOM   2621  O  O     . PHE A 1 367 ? 2.372   13.854  -52.459 1.00 46.71 ? 367 PHE A O     1 
ATOM   2622  C  CB    . PHE A 1 367 ? 3.140   15.667  -49.772 1.00 44.09 ? 367 PHE A CB    1 
ATOM   2623  C  CG    . PHE A 1 367 ? 1.625   15.597  -49.834 1.00 43.98 ? 367 PHE A CG    1 
ATOM   2624  C  CD1   . PHE A 1 367 ? 0.900   16.480  -50.641 1.00 43.79 ? 367 PHE A CD1   1 
ATOM   2625  C  CD2   . PHE A 1 367 ? 0.923   14.643  -49.094 1.00 43.50 ? 367 PHE A CD2   1 
ATOM   2626  C  CE1   . PHE A 1 367 ? -0.503  16.404  -50.718 1.00 44.20 ? 367 PHE A CE1   1 
ATOM   2627  C  CE2   . PHE A 1 367 ? -0.481  14.573  -49.153 1.00 42.80 ? 367 PHE A CE2   1 
ATOM   2628  C  CZ    . PHE A 1 367 ? -1.191  15.449  -49.973 1.00 43.05 ? 367 PHE A CZ    1 
ATOM   2629  N  N     . GLU A 1 368 ? 3.257   15.898  -52.849 1.00 46.08 ? 368 GLU A N     1 
ATOM   2630  C  CA    . GLU A 1 368 ? 2.548   16.122  -54.105 1.00 46.83 ? 368 GLU A CA    1 
ATOM   2631  C  C     . GLU A 1 368 ? 2.869   15.037  -55.129 1.00 47.40 ? 368 GLU A C     1 
ATOM   2632  O  O     . GLU A 1 368 ? 1.986   14.626  -55.884 1.00 48.29 ? 368 GLU A O     1 
ATOM   2633  C  CB    . GLU A 1 368 ? 2.835   17.534  -54.648 1.00 46.92 ? 368 GLU A CB    1 
ATOM   2634  C  CG    . GLU A 1 368 ? 2.473   18.661  -53.643 1.00 46.13 ? 368 GLU A CG    1 
ATOM   2635  C  CD    . GLU A 1 368 ? 2.244   20.034  -54.285 1.00 47.49 ? 368 GLU A CD    1 
ATOM   2636  O  OE1   . GLU A 1 368 ? 1.978   20.998  -53.527 1.00 47.51 ? 368 GLU A OE1   1 
ATOM   2637  O  OE2   . GLU A 1 368 ? 2.318   20.163  -55.538 1.00 50.21 ? 368 GLU A OE2   1 
ATOM   2638  N  N     . LYS A 1 369 ? 4.117   14.560  -55.135 1.00 46.97 ? 369 LYS A N     1 
ATOM   2639  C  CA    . LYS A 1 369 ? 4.518   13.467  -56.020 1.00 47.53 ? 369 LYS A CA    1 
ATOM   2640  C  C     . LYS A 1 369 ? 3.914   12.135  -55.575 1.00 47.16 ? 369 LYS A C     1 
ATOM   2641  O  O     . LYS A 1 369 ? 3.376   11.397  -56.396 1.00 47.99 ? 369 LYS A O     1 
ATOM   2642  C  CB    . LYS A 1 369 ? 6.043   13.372  -56.132 1.00 48.01 ? 369 LYS A CB    1 
ATOM   2643  N  N     . LEU A 1 370 ? 3.983   11.840  -54.278 1.00 45.99 ? 370 LEU A N     1 
ATOM   2644  C  CA    . LEU A 1 370 ? 3.362   10.625  -53.728 1.00 45.63 ? 370 LEU A CA    1 
ATOM   2645  C  C     . LEU A 1 370 ? 1.842   10.609  -53.914 1.00 45.99 ? 370 LEU A C     1 
ATOM   2646  O  O     . LEU A 1 370 ? 1.272   9.613   -54.367 1.00 46.55 ? 370 LEU A O     1 
ATOM   2647  C  CB    . LEU A 1 370 ? 3.710   10.449  -52.248 1.00 44.50 ? 370 LEU A CB    1 
ATOM   2648  C  CG    . LEU A 1 370 ? 3.216   9.165   -51.570 1.00 44.27 ? 370 LEU A CG    1 
ATOM   2649  C  CD1   . LEU A 1 370 ? 3.785   7.930   -52.262 1.00 44.70 ? 370 LEU A CD1   1 
ATOM   2650  C  CD2   . LEU A 1 370 ? 3.561   9.157   -50.089 1.00 42.85 ? 370 LEU A CD2   1 
ATOM   2651  N  N     . TYR A 1 371 ? 1.198   11.717  -53.562 1.00 45.62 ? 371 TYR A N     1 
ATOM   2652  C  CA    . TYR A 1 371 ? -0.246  11.858  -53.716 1.00 46.44 ? 371 TYR A CA    1 
ATOM   2653  C  C     . TYR A 1 371 ? -0.699  11.602  -55.163 1.00 48.13 ? 371 TYR A C     1 
ATOM   2654  O  O     . TYR A 1 371 ? -1.641  10.844  -55.396 1.00 48.40 ? 371 TYR A O     1 
ATOM   2655  C  CB    . TYR A 1 371 ? -0.695  13.244  -53.231 1.00 45.39 ? 371 TYR A CB    1 
ATOM   2656  C  CG    . TYR A 1 371 ? -2.191  13.458  -53.264 1.00 45.65 ? 371 TYR A CG    1 
ATOM   2657  C  CD1   . TYR A 1 371 ? -3.005  12.998  -52.223 1.00 45.08 ? 371 TYR A CD1   1 
ATOM   2658  C  CD2   . TYR A 1 371 ? -2.796  14.118  -54.332 1.00 45.74 ? 371 TYR A CD2   1 
ATOM   2659  C  CE1   . TYR A 1 371 ? -4.376  13.190  -52.247 1.00 44.81 ? 371 TYR A CE1   1 
ATOM   2660  C  CE2   . TYR A 1 371 ? -4.165  14.317  -54.365 1.00 46.16 ? 371 TYR A CE2   1 
ATOM   2661  C  CZ    . TYR A 1 371 ? -4.949  13.852  -53.321 1.00 46.37 ? 371 TYR A CZ    1 
ATOM   2662  O  OH    . TYR A 1 371 ? -6.310  14.048  -53.354 1.00 46.92 ? 371 TYR A OH    1 
ATOM   2663  N  N     . ALA A 1 372 ? -0.013  12.228  -56.122 1.00 49.48 ? 372 ALA A N     1 
ATOM   2664  C  CA    . ALA A 1 372 ? -0.355  12.112  -57.543 1.00 51.52 ? 372 ALA A CA    1 
ATOM   2665  C  C     . ALA A 1 372 ? -0.077  10.717  -58.061 1.00 52.90 ? 372 ALA A C     1 
ATOM   2666  O  O     . ALA A 1 372 ? -0.816  10.203  -58.907 1.00 54.38 ? 372 ALA A O     1 
ATOM   2667  C  CB    . ALA A 1 372 ? 0.408   13.133  -58.361 1.00 52.13 ? 372 ALA A CB    1 
ATOM   2668  N  N     . SER A 1 373 ? 0.997   10.114  -57.556 1.00 53.13 ? 373 SER A N     1 
ATOM   2669  C  CA    . SER A 1 373 ? 1.327   8.718   -57.854 1.00 54.29 ? 373 SER A CA    1 
ATOM   2670  C  C     . SER A 1 373 ? 0.199   7.764   -57.448 1.00 54.39 ? 373 SER A C     1 
ATOM   2671  O  O     . SER A 1 373 ? -0.137  6.863   -58.201 1.00 55.50 ? 373 SER A O     1 
ATOM   2672  C  CB    . SER A 1 373 ? 2.635   8.316   -57.172 1.00 53.84 ? 373 SER A CB    1 
ATOM   2673  O  OG    . SER A 1 373 ? 2.912   6.945   -57.384 1.00 55.89 ? 373 SER A OG    1 
ATOM   2674  N  N     . TYR A 1 374 ? -0.383  7.963   -56.267 1.00 53.59 ? 374 TYR A N     1 
ATOM   2675  C  CA    . TYR A 1 374 ? -1.527  7.151   -55.847 1.00 54.07 ? 374 TYR A CA    1 
ATOM   2676  C  C     . TYR A 1 374 ? -2.757  7.461   -56.689 1.00 54.92 ? 374 TYR A C     1 
ATOM   2677  O  O     . TYR A 1 374 ? -3.565  6.577   -56.944 1.00 55.86 ? 374 TYR A O     1 
ATOM   2678  C  CB    . TYR A 1 374 ? -1.871  7.356   -54.370 1.00 52.93 ? 374 TYR A CB    1 
ATOM   2679  C  CG    . TYR A 1 374 ? -0.885  6.805   -53.360 1.00 52.62 ? 374 TYR A CG    1 
ATOM   2680  C  CD1   . TYR A 1 374 ? -0.586  7.527   -52.201 1.00 52.31 ? 374 TYR A CD1   1 
ATOM   2681  C  CD2   . TYR A 1 374 ? -0.269  5.567   -53.539 1.00 53.30 ? 374 TYR A CD2   1 
ATOM   2682  C  CE1   . TYR A 1 374 ? 0.304   7.033   -51.246 1.00 51.41 ? 374 TYR A CE1   1 
ATOM   2683  C  CE2   . TYR A 1 374 ? 0.634   5.066   -52.588 1.00 53.68 ? 374 TYR A CE2   1 
ATOM   2684  C  CZ    . TYR A 1 374 ? 0.908   5.808   -51.445 1.00 52.21 ? 374 TYR A CZ    1 
ATOM   2685  O  OH    . TYR A 1 374 ? 1.791   5.341   -50.498 1.00 51.75 ? 374 TYR A OH    1 
ATOM   2686  N  N     . GLU A 1 375 ? -2.906  8.716   -57.107 1.00 54.98 ? 375 GLU A N     1 
ATOM   2687  C  CA    . GLU A 1 375 ? -4.014  9.081   -57.985 1.00 56.53 ? 375 GLU A CA    1 
ATOM   2688  C  C     . GLU A 1 375 ? -3.914  8.345   -59.315 1.00 57.97 ? 375 GLU A C     1 
ATOM   2689  O  O     . GLU A 1 375 ? -4.874  7.698   -59.733 1.00 59.16 ? 375 GLU A O     1 
ATOM   2690  C  CB    . GLU A 1 375 ? -4.088  10.592  -58.209 1.00 56.25 ? 375 GLU A CB    1 
ATOM   2691  C  CG    . GLU A 1 375 ? -4.838  11.355  -57.118 1.00 55.69 ? 375 GLU A CG    1 
ATOM   2692  C  CD    . GLU A 1 375 ? -4.965  12.837  -57.430 1.00 55.77 ? 375 GLU A CD    1 
ATOM   2693  O  OE1   . GLU A 1 375 ? -5.959  13.477  -57.012 1.00 56.45 ? 375 GLU A OE1   1 
ATOM   2694  O  OE2   . GLU A 1 375 ? -4.063  13.370  -58.102 1.00 58.40 ? 375 GLU A OE2   1 
ATOM   2695  N  N     . LYS A 1 376 ? -2.750  8.429   -59.960 1.00 58.12 ? 376 LYS A N     1 
ATOM   2696  C  CA    . LYS A 1 376 ? -2.499  7.723   -61.216 1.00 59.55 ? 376 LYS A CA    1 
ATOM   2697  C  C     . LYS A 1 376 ? -2.561  6.196   -61.073 1.00 60.01 ? 376 LYS A C     1 
ATOM   2698  O  O     . LYS A 1 376 ? -2.953  5.499   -62.016 1.00 61.30 ? 376 LYS A O     1 
ATOM   2699  C  CB    . LYS A 1 376 ? -1.165  8.154   -61.820 1.00 59.95 ? 376 LYS A CB    1 
ATOM   2700  N  N     . GLN A 1 377 ? -2.192  5.685   -59.898 1.00 58.87 ? 377 GLN A N     1 
ATOM   2701  C  CA    . GLN A 1 377 ? -2.248  4.243   -59.609 1.00 59.16 ? 377 GLN A CA    1 
ATOM   2702  C  C     . GLN A 1 377 ? -3.672  3.717   -59.389 1.00 59.71 ? 377 GLN A C     1 
ATOM   2703  O  O     . GLN A 1 377 ? -3.879  2.506   -59.256 1.00 60.16 ? 377 GLN A O     1 
ATOM   2704  C  CB    . GLN A 1 377 ? -1.394  3.900   -58.393 1.00 58.12 ? 377 GLN A CB    1 
ATOM   2705  C  CG    . GLN A 1 377 ? 0.096   3.892   -58.637 1.00 57.23 ? 377 GLN A CG    1 
ATOM   2706  C  CD    . GLN A 1 377 ? 0.838   3.261   -57.490 1.00 56.84 ? 377 GLN A CD    1 
ATOM   2707  O  OE1   . GLN A 1 377 ? 0.567   2.119   -57.127 1.00 57.50 ? 377 GLN A OE1   1 
ATOM   2708  N  NE2   . GLN A 1 377 ? 1.783   3.995   -56.907 1.00 56.06 ? 377 GLN A NE2   1 
ATOM   2709  N  N     . GLY A 1 378 ? -4.641  4.633   -59.346 1.00 59.46 ? 378 GLY A N     1 
ATOM   2710  C  CA    . GLY A 1 378 ? -6.054  4.285   -59.218 1.00 59.80 ? 378 GLY A CA    1 
ATOM   2711  C  C     . GLY A 1 378 ? -6.504  4.049   -57.784 1.00 58.85 ? 378 GLY A C     1 
ATOM   2712  O  O     . GLY A 1 378 ? -7.691  3.844   -57.528 1.00 59.21 ? 378 GLY A O     1 
ATOM   2713  N  N     . ARG A 1 379 ? -5.564  4.082   -56.845 1.00 57.39 ? 379 ARG A N     1 
ATOM   2714  C  CA    . ARG A 1 379 ? -5.885  3.797   -55.452 1.00 56.52 ? 379 ARG A CA    1 
ATOM   2715  C  C     . ARG A 1 379 ? -6.425  5.029   -54.734 1.00 55.23 ? 379 ARG A C     1 
ATOM   2716  O  O     . ARG A 1 379 ? -5.738  5.701   -53.965 1.00 54.18 ? 379 ARG A O     1 
ATOM   2717  C  CB    . ARG A 1 379 ? -4.714  3.118   -54.719 1.00 56.23 ? 379 ARG A CB    1 
ATOM   2718  C  CG    . ARG A 1 379 ? -3.344  3.388   -55.309 1.00 56.49 ? 379 ARG A CG    1 
ATOM   2719  C  CD    . ARG A 1 379 ? -2.406  2.201   -55.135 1.00 57.49 ? 379 ARG A CD    1 
ATOM   2720  N  NE    . ARG A 1 379 ? -1.885  2.096   -53.774 1.00 56.95 ? 379 ARG A NE    1 
ATOM   2721  C  CZ    . ARG A 1 379 ? -0.632  1.764   -53.468 1.00 57.70 ? 379 ARG A CZ    1 
ATOM   2722  N  NH1   . ARG A 1 379 ? 0.252   1.513   -54.429 1.00 57.95 ? 379 ARG A NH1   1 
ATOM   2723  N  NH2   . ARG A 1 379 ? -0.254  1.699   -52.196 1.00 56.44 ? 379 ARG A NH2   1 
ATOM   2724  N  N     . VAL A 1 380 ? -7.684  5.316   -55.025 1.00 55.30 ? 380 VAL A N     1 
ATOM   2725  C  CA    . VAL A 1 380 ? -8.385  6.469   -54.502 1.00 54.00 ? 380 VAL A CA    1 
ATOM   2726  C  C     . VAL A 1 380 ? -9.742  5.924   -54.133 1.00 54.51 ? 380 VAL A C     1 
ATOM   2727  O  O     . VAL A 1 380 ? -10.401 5.285   -54.955 1.00 55.48 ? 380 VAL A O     1 
ATOM   2728  C  CB    . VAL A 1 380 ? -8.518  7.576   -55.588 1.00 54.34 ? 380 VAL A CB    1 
ATOM   2729  C  CG1   . VAL A 1 380 ? -9.597  8.593   -55.235 1.00 53.75 ? 380 VAL A CG1   1 
ATOM   2730  C  CG2   . VAL A 1 380 ? -7.177  8.265   -55.810 1.00 53.39 ? 380 VAL A CG2   1 
ATOM   2731  N  N     . ARG A 1 381 ? -10.167 6.163   -52.899 1.00 53.56 ? 381 ARG A N     1 
ATOM   2732  C  CA    . ARG A 1 381 ? -11.441 5.615   -52.454 1.00 54.14 ? 381 ARG A CA    1 
ATOM   2733  C  C     . ARG A 1 381 ? -12.664 6.430   -52.907 1.00 54.27 ? 381 ARG A C     1 
ATOM   2734  O  O     . ARG A 1 381 ? -13.718 5.863   -53.182 1.00 55.13 ? 381 ARG A O     1 
ATOM   2735  C  CB    . ARG A 1 381 ? -11.443 5.389   -50.945 1.00 53.25 ? 381 ARG A CB    1 
ATOM   2736  C  CG    . ARG A 1 381 ? -12.569 4.474   -50.524 1.00 56.46 ? 381 ARG A CG    1 
ATOM   2737  C  CD    . ARG A 1 381 ? -12.154 3.009   -50.471 1.00 58.04 ? 381 ARG A CD    1 
ATOM   2738  N  NE    . ARG A 1 381 ? -11.674 2.681   -49.132 1.00 58.76 ? 381 ARG A NE    1 
ATOM   2739  C  CZ    . ARG A 1 381 ? -12.454 2.568   -48.057 1.00 58.54 ? 381 ARG A CZ    1 
ATOM   2740  N  NH1   . ARG A 1 381 ? -13.768 2.749   -48.141 1.00 58.91 ? 381 ARG A NH1   1 
ATOM   2741  N  NH2   . ARG A 1 381 ? -11.915 2.276   -46.889 1.00 58.37 ? 381 ARG A NH2   1 
ATOM   2742  N  N     . LYS A 1 382 ? -12.522 7.754   -52.977 1.00 53.45 ? 382 LYS A N     1 
ATOM   2743  C  CA    . LYS A 1 382 ? -13.584 8.623   -53.482 1.00 53.94 ? 382 LYS A CA    1 
ATOM   2744  C  C     . LYS A 1 382 ? -12.988 9.873   -54.104 1.00 53.08 ? 382 LYS A C     1 
ATOM   2745  O  O     . LYS A 1 382 ? -11.963 10.366  -53.647 1.00 51.62 ? 382 LYS A O     1 
ATOM   2746  C  CB    . LYS A 1 382 ? -14.550 9.023   -52.365 1.00 53.99 ? 382 LYS A CB    1 
ATOM   2747  C  CG    . LYS A 1 382 ? -15.864 9.612   -52.869 1.00 56.30 ? 382 LYS A CG    1 
ATOM   2748  C  CD    . LYS A 1 382 ? -16.540 10.474  -51.811 1.00 58.79 ? 382 LYS A CD    1 
ATOM   2749  C  CE    . LYS A 1 382 ? -17.458 9.666   -50.885 1.00 61.34 ? 382 LYS A CE    1 
ATOM   2750  N  NZ    . LYS A 1 382 ? -18.681 9.145   -51.589 1.00 63.46 ? 382 LYS A NZ    1 
ATOM   2751  N  N     . VAL A 1 383 ? -13.632 10.383  -55.151 1.00 53.63 ? 383 VAL A N     1 
ATOM   2752  C  CA    . VAL A 1 383 ? -13.211 11.644  -55.756 1.00 52.99 ? 383 VAL A CA    1 
ATOM   2753  C  C     . VAL A 1 383 ? -14.344 12.657  -55.730 1.00 52.96 ? 383 VAL A C     1 
ATOM   2754  O  O     . VAL A 1 383 ? -15.452 12.373  -56.184 1.00 54.31 ? 383 VAL A O     1 
ATOM   2755  C  CB    . VAL A 1 383 ? -12.598 11.456  -57.185 1.00 53.84 ? 383 VAL A CB    1 
ATOM   2756  C  CG1   . VAL A 1 383 ? -13.254 10.318  -57.919 1.00 55.84 ? 383 VAL A CG1   1 
ATOM   2757  C  CG2   . VAL A 1 383 ? -12.653 12.760  -57.998 1.00 54.05 ? 383 VAL A CG2   1 
ATOM   2758  N  N     . VAL A 1 384 ? -14.057 13.825  -55.164 1.00 51.48 ? 384 VAL A N     1 
ATOM   2759  C  CA    . VAL A 1 384 ? -15.032 14.904  -55.035 1.00 51.43 ? 384 VAL A CA    1 
ATOM   2760  C  C     . VAL A 1 384 ? -14.489 16.172  -55.673 1.00 51.48 ? 384 VAL A C     1 
ATOM   2761  O  O     . VAL A 1 384 ? -13.299 16.270  -55.953 1.00 51.00 ? 384 VAL A O     1 
ATOM   2762  C  CB    . VAL A 1 384 ? -15.378 15.217  -53.543 1.00 50.42 ? 384 VAL A CB    1 
ATOM   2763  C  CG1   . VAL A 1 384 ? -16.040 14.023  -52.862 1.00 50.39 ? 384 VAL A CG1   1 
ATOM   2764  C  CG2   . VAL A 1 384 ? -14.136 15.705  -52.758 1.00 47.81 ? 384 VAL A CG2   1 
ATOM   2765  N  N     . LYS A 1 385 ? -15.363 17.147  -55.892 1.00 52.33 ? 385 LYS A N     1 
ATOM   2766  C  CA    . LYS A 1 385 ? -14.923 18.472  -56.285 1.00 52.43 ? 385 LYS A CA    1 
ATOM   2767  C  C     . LYS A 1 385 ? -14.238 19.121  -55.076 1.00 50.77 ? 385 LYS A C     1 
ATOM   2768  O  O     . LYS A 1 385 ? -14.795 19.133  -53.973 1.00 50.32 ? 385 LYS A O     1 
ATOM   2769  C  CB    . LYS A 1 385 ? -16.113 19.306  -56.782 1.00 53.62 ? 385 LYS A CB    1 
ATOM   2770  N  N     . ALA A 1 386 ? -13.020 19.628  -55.268 1.00 50.21 ? 386 ALA A N     1 
ATOM   2771  C  CA    . ALA A 1 386 ? -12.258 20.250  -54.170 1.00 48.87 ? 386 ALA A CA    1 
ATOM   2772  C  C     . ALA A 1 386 ? -13.061 21.362  -53.489 1.00 48.94 ? 386 ALA A C     1 
ATOM   2773  O  O     . ALA A 1 386 ? -12.884 21.643  -52.298 1.00 47.89 ? 386 ALA A O     1 
ATOM   2774  C  CB    . ALA A 1 386 ? -10.931 20.793  -54.674 1.00 48.00 ? 386 ALA A CB    1 
ATOM   2775  N  N     . GLN A 1 387 ? -13.936 21.983  -54.271 1.00 50.41 ? 387 GLN A N     1 
ATOM   2776  C  CA    . GLN A 1 387 ? -14.792 23.067  -53.833 1.00 51.31 ? 387 GLN A CA    1 
ATOM   2777  C  C     . GLN A 1 387 ? -15.849 22.558  -52.844 1.00 51.45 ? 387 GLN A C     1 
ATOM   2778  O  O     . GLN A 1 387 ? -16.157 23.230  -51.853 1.00 50.56 ? 387 GLN A O     1 
ATOM   2779  C  CB    . GLN A 1 387 ? -15.455 23.695  -55.057 1.00 53.18 ? 387 GLN A CB    1 
ATOM   2780  C  CG    . GLN A 1 387 ? -15.919 25.129  -54.869 1.00 55.90 ? 387 GLN A CG    1 
ATOM   2781  C  CD    . GLN A 1 387 ? -14.863 26.155  -55.235 1.00 58.21 ? 387 GLN A CD    1 
ATOM   2782  O  OE1   . GLN A 1 387 ? -14.061 25.949  -56.153 1.00 59.88 ? 387 GLN A OE1   1 
ATOM   2783  N  NE2   . GLN A 1 387 ? -14.867 27.281  -54.523 1.00 58.22 ? 387 GLN A NE2   1 
ATOM   2784  N  N     . GLN A 1 388 ? -16.392 21.372  -53.128 1.00 52.48 ? 388 GLN A N     1 
ATOM   2785  C  CA    . GLN A 1 388 ? -17.361 20.689  -52.268 1.00 53.32 ? 388 GLN A CA    1 
ATOM   2786  C  C     . GLN A 1 388 ? -16.807 20.467  -50.857 1.00 51.39 ? 388 GLN A C     1 
ATOM   2787  O  O     . GLN A 1 388 ? -17.487 20.758  -49.869 1.00 51.26 ? 388 GLN A O     1 
ATOM   2788  C  CB    . GLN A 1 388 ? -17.754 19.351  -52.902 1.00 54.29 ? 388 GLN A CB    1 
ATOM   2789  C  CG    . GLN A 1 388 ? -18.824 18.549  -52.170 1.00 55.76 ? 388 GLN A CG    1 
ATOM   2790  C  CD    . GLN A 1 388 ? -18.946 17.124  -52.713 1.00 57.67 ? 388 GLN A CD    1 
ATOM   2791  O  OE1   . GLN A 1 388 ? -18.840 16.880  -53.934 1.00 61.09 ? 388 GLN A OE1   1 
ATOM   2792  N  NE2   . GLN A 1 388 ? -19.166 16.170  -51.808 1.00 59.65 ? 388 GLN A NE2   1 
ATOM   2793  N  N     . LEU A 1 389 ? -15.579 19.951  -50.774 1.00 50.10 ? 389 LEU A N     1 
ATOM   2794  C  CA    . LEU A 1 389 ? -14.885 19.801  -49.495 1.00 48.46 ? 389 LEU A CA    1 
ATOM   2795  C  C     . LEU A 1 389 ? -14.643 21.169  -48.886 1.00 47.42 ? 389 LEU A C     1 
ATOM   2796  O  O     . LEU A 1 389 ? -14.833 21.353  -47.688 1.00 46.65 ? 389 LEU A O     1 
ATOM   2797  C  CB    . LEU A 1 389 ? -13.541 19.066  -49.650 1.00 47.68 ? 389 LEU A CB    1 
ATOM   2798  C  CG    . LEU A 1 389 ? -13.011 18.203  -48.483 1.00 47.14 ? 389 LEU A CG    1 
ATOM   2799  C  CD1   . LEU A 1 389 ? -11.502 18.033  -48.553 1.00 45.71 ? 389 LEU A CD1   1 
ATOM   2800  C  CD2   . LEU A 1 389 ? -13.409 18.666  -47.077 1.00 45.91 ? 389 LEU A CD2   1 
ATOM   2801  N  N     . TRP A 1 390 ? -14.228 22.121  -49.718 1.00 47.60 ? 390 TRP A N     1 
ATOM   2802  C  CA    . TRP A 1 390 ? -13.947 23.473  -49.257 1.00 47.32 ? 390 TRP A CA    1 
ATOM   2803  C  C     . TRP A 1 390 ? -15.138 24.096  -48.534 1.00 47.86 ? 390 TRP A C     1 
ATOM   2804  O  O     . TRP A 1 390 ? -14.979 24.651  -47.438 1.00 47.03 ? 390 TRP A O     1 
ATOM   2805  C  CB    . TRP A 1 390 ? -13.480 24.389  -50.399 1.00 47.53 ? 390 TRP A CB    1 
ATOM   2806  C  CG    . TRP A 1 390 ? -13.220 25.781  -49.902 1.00 46.78 ? 390 TRP A CG    1 
ATOM   2807  C  CD1   . TRP A 1 390 ? -14.017 26.879  -50.071 1.00 47.28 ? 390 TRP A CD1   1 
ATOM   2808  C  CD2   . TRP A 1 390 ? -12.114 26.207  -49.100 1.00 45.68 ? 390 TRP A CD2   1 
ATOM   2809  N  NE1   . TRP A 1 390 ? -13.461 27.970  -49.447 1.00 46.36 ? 390 TRP A NE1   1 
ATOM   2810  C  CE2   . TRP A 1 390 ? -12.293 27.586  -48.840 1.00 45.70 ? 390 TRP A CE2   1 
ATOM   2811  C  CE3   . TRP A 1 390 ? -10.974 25.561  -48.589 1.00 45.09 ? 390 TRP A CE3   1 
ATOM   2812  C  CZ2   . TRP A 1 390 ? -11.376 28.333  -48.083 1.00 43.92 ? 390 TRP A CZ2   1 
ATOM   2813  C  CZ3   . TRP A 1 390 ? -10.060 26.310  -47.840 1.00 43.40 ? 390 TRP A CZ3   1 
ATOM   2814  C  CH2   . TRP A 1 390 ? -10.273 27.679  -47.595 1.00 43.07 ? 390 TRP A CH2   1 
ATOM   2815  N  N     . TYR A 1 391 ? -16.319 23.992  -49.141 1.00 49.78 ? 391 TYR A N     1 
ATOM   2816  C  CA    . TYR A 1 391 ? -17.532 24.569  -48.557 1.00 51.11 ? 391 TYR A CA    1 
ATOM   2817  C  C     . TYR A 1 391 ? -18.032 23.848  -47.324 1.00 50.49 ? 391 TYR A C     1 
ATOM   2818  O  O     . TYR A 1 391 ? -18.610 24.475  -46.438 1.00 50.43 ? 391 TYR A O     1 
ATOM   2819  C  CB    . TYR A 1 391 ? -18.634 24.788  -49.604 1.00 53.49 ? 391 TYR A CB    1 
ATOM   2820  C  CG    . TYR A 1 391 ? -18.334 26.044  -50.367 1.00 55.43 ? 391 TYR A CG    1 
ATOM   2821  C  CD1   . TYR A 1 391 ? -17.905 25.996  -51.694 1.00 56.88 ? 391 TYR A CD1   1 
ATOM   2822  C  CD2   . TYR A 1 391 ? -18.393 27.291  -49.730 1.00 56.22 ? 391 TYR A CD2   1 
ATOM   2823  C  CE1   . TYR A 1 391 ? -17.590 27.162  -52.386 1.00 57.37 ? 391 TYR A CE1   1 
ATOM   2824  C  CE2   . TYR A 1 391 ? -18.070 28.456  -50.406 1.00 57.08 ? 391 TYR A CE2   1 
ATOM   2825  C  CZ    . TYR A 1 391 ? -17.673 28.384  -51.735 1.00 57.20 ? 391 TYR A CZ    1 
ATOM   2826  O  OH    . TYR A 1 391 ? -17.355 29.543  -52.404 1.00 58.33 ? 391 TYR A OH    1 
ATOM   2827  N  N     . ALA A 1 392 ? -17.779 22.544  -47.262 1.00 50.08 ? 392 ALA A N     1 
ATOM   2828  C  CA    . ALA A 1 392 ? -18.054 21.773  -46.060 1.00 49.53 ? 392 ALA A CA    1 
ATOM   2829  C  C     . ALA A 1 392 ? -17.204 22.285  -44.900 1.00 47.94 ? 392 ALA A C     1 
ATOM   2830  O  O     . ALA A 1 392 ? -17.650 22.272  -43.753 1.00 47.83 ? 392 ALA A O     1 
ATOM   2831  C  CB    . ALA A 1 392 ? -17.810 20.304  -46.299 1.00 49.57 ? 392 ALA A CB    1 
ATOM   2832  N  N     . ILE A 1 393 ? -16.003 22.763  -45.213 1.00 46.99 ? 393 ILE A N     1 
ATOM   2833  C  CA    . ILE A 1 393 ? -15.094 23.324  -44.205 1.00 45.84 ? 393 ILE A CA    1 
ATOM   2834  C  C     . ILE A 1 393 ? -15.604 24.683  -43.725 1.00 46.04 ? 393 ILE A C     1 
ATOM   2835  O  O     . ILE A 1 393 ? -15.579 24.971  -42.529 1.00 45.59 ? 393 ILE A O     1 
ATOM   2836  C  CB    . ILE A 1 393 ? -13.639 23.487  -44.741 1.00 44.95 ? 393 ILE A CB    1 
ATOM   2837  C  CG1   . ILE A 1 393 ? -13.046 22.142  -45.179 1.00 44.72 ? 393 ILE A CG1   1 
ATOM   2838  C  CG2   . ILE A 1 393 ? -12.744 24.176  -43.692 1.00 44.11 ? 393 ILE A CG2   1 
ATOM   2839  C  CD1   . ILE A 1 393 ? -11.723 22.262  -45.950 1.00 44.08 ? 393 ILE A CD1   1 
ATOM   2840  N  N     . ILE A 1 394 ? -16.054 25.505  -44.675 1.00 46.85 ? 394 ILE A N     1 
ATOM   2841  C  CA    . ILE A 1 394 ? -16.589 26.834  -44.398 1.00 46.96 ? 394 ILE A CA    1 
ATOM   2842  C  C     . ILE A 1 394 ? -17.837 26.726  -43.523 1.00 47.31 ? 394 ILE A C     1 
ATOM   2843  O  O     . ILE A 1 394 ? -17.908 27.346  -42.468 1.00 47.21 ? 394 ILE A O     1 
ATOM   2844  C  CB    . ILE A 1 394 ? -16.936 27.612  -45.715 1.00 48.06 ? 394 ILE A CB    1 
ATOM   2845  C  CG1   . ILE A 1 394 ? -15.686 27.910  -46.555 1.00 47.34 ? 394 ILE A CG1   1 
ATOM   2846  C  CG2   . ILE A 1 394 ? -17.689 28.892  -45.406 1.00 48.37 ? 394 ILE A CG2   1 
ATOM   2847  C  CD1   . ILE A 1 394 ? -14.601 28.717  -45.837 1.00 45.94 ? 394 ILE A CD1   1 
ATOM   2848  N  N     . GLU A 1 395 ? -18.807 25.930  -43.961 1.00 47.84 ? 395 GLU A N     1 
ATOM   2849  C  CA    . GLU A 1 395 ? -20.046 25.724  -43.204 1.00 48.54 ? 395 GLU A CA    1 
ATOM   2850  C  C     . GLU A 1 395 ? -19.801 25.263  -41.759 1.00 47.10 ? 395 GLU A C     1 
ATOM   2851  O  O     . GLU A 1 395 ? -20.495 25.693  -40.832 1.00 47.30 ? 395 GLU A O     1 
ATOM   2852  C  CB    . GLU A 1 395 ? -20.966 24.735  -43.930 1.00 49.68 ? 395 GLU A CB    1 
ATOM   2853  C  CG    . GLU A 1 395 ? -21.480 25.246  -45.271 1.00 51.80 ? 395 GLU A CG    1 
ATOM   2854  C  CD    . GLU A 1 395 ? -21.731 24.129  -46.289 1.00 54.03 ? 395 GLU A CD    1 
ATOM   2855  O  OE1   . GLU A 1 395 ? -22.152 23.014  -45.887 1.00 54.78 ? 395 GLU A OE1   1 
ATOM   2856  O  OE2   . GLU A 1 395 ? -21.503 24.375  -47.497 1.00 54.21 ? 395 GLU A OE2   1 
ATOM   2857  N  N     . SER A 1 396 ? -18.813 24.392  -41.575 1.00 45.52 ? 396 SER A N     1 
ATOM   2858  C  CA    . SER A 1 396 ? -18.457 23.921  -40.242 1.00 44.39 ? 396 SER A CA    1 
ATOM   2859  C  C     . SER A 1 396 ? -17.913 25.050  -39.355 1.00 42.85 ? 396 SER A C     1 
ATOM   2860  O  O     . SER A 1 396 ? -18.232 25.121  -38.167 1.00 42.40 ? 396 SER A O     1 
ATOM   2861  C  CB    . SER A 1 396 ? -17.455 22.772  -40.330 1.00 43.48 ? 396 SER A CB    1 
ATOM   2862  O  OG    . SER A 1 396 ? -16.991 22.441  -39.041 1.00 43.49 ? 396 SER A OG    1 
ATOM   2863  N  N     . GLN A 1 397 ? -17.104 25.927  -39.949 1.00 42.14 ? 397 GLN A N     1 
ATOM   2864  C  CA    . GLN A 1 397 ? -16.506 27.073  -39.249 1.00 40.99 ? 397 GLN A CA    1 
ATOM   2865  C  C     . GLN A 1 397 ? -17.513 28.161  -38.905 1.00 42.06 ? 397 GLN A C     1 
ATOM   2866  O  O     . GLN A 1 397 ? -17.458 28.748  -37.827 1.00 41.62 ? 397 GLN A O     1 
ATOM   2867  C  CB    . GLN A 1 397 ? -15.365 27.651  -40.068 1.00 40.12 ? 397 GLN A CB    1 
ATOM   2868  C  CG    . GLN A 1 397 ? -14.166 26.727  -40.132 1.00 37.81 ? 397 GLN A CG    1 
ATOM   2869  C  CD    . GLN A 1 397 ? -13.152 27.133  -41.172 1.00 37.06 ? 397 GLN A CD    1 
ATOM   2870  O  OE1   . GLN A 1 397 ? -13.451 27.877  -42.114 1.00 36.33 ? 397 GLN A OE1   1 
ATOM   2871  N  NE2   . GLN A 1 397 ? -11.933 26.639  -41.013 1.00 37.16 ? 397 GLN A NE2   1 
ATOM   2872  N  N     . THR A 1 398 ? -18.443 28.428  -39.815 1.00 43.62 ? 398 THR A N     1 
ATOM   2873  C  CA    . THR A 1 398 ? -19.480 29.407  -39.539 1.00 44.87 ? 398 THR A CA    1 
ATOM   2874  C  C     . THR A 1 398 ? -20.435 28.916  -38.443 1.00 45.51 ? 398 THR A C     1 
ATOM   2875  O  O     . THR A 1 398 ? -20.962 29.719  -37.685 1.00 45.92 ? 398 THR A O     1 
ATOM   2876  C  CB    . THR A 1 398 ? -20.242 29.840  -40.821 1.00 46.15 ? 398 THR A CB    1 
ATOM   2877  O  OG1   . THR A 1 398 ? -20.943 28.723  -41.376 1.00 47.73 ? 398 THR A OG1   1 
ATOM   2878  C  CG2   . THR A 1 398 ? -19.268 30.386  -41.850 1.00 45.08 ? 398 THR A CG2   1 
ATOM   2879  N  N     . GLU A 1 399 ? -20.618 27.603  -38.337 1.00 46.12 ? 399 GLU A N     1 
ATOM   2880  C  CA    . GLU A 1 399 ? -21.462 27.026  -37.282 1.00 47.47 ? 399 GLU A CA    1 
ATOM   2881  C  C     . GLU A 1 399 ? -20.774 26.829  -35.917 1.00 46.24 ? 399 GLU A C     1 
ATOM   2882  O  O     . GLU A 1 399 ? -21.439 26.931  -34.882 1.00 46.58 ? 399 GLU A O     1 
ATOM   2883  C  CB    . GLU A 1 399 ? -22.086 25.699  -37.732 1.00 48.25 ? 399 GLU A CB    1 
ATOM   2884  C  CG    . GLU A 1 399 ? -23.055 25.098  -36.690 1.00 50.07 ? 399 GLU A CG    1 
ATOM   2885  C  CD    . GLU A 1 399 ? -23.430 23.647  -36.967 1.00 51.35 ? 399 GLU A CD    1 
ATOM   2886  O  OE1   . GLU A 1 399 ? -22.523 22.831  -37.240 1.00 52.08 ? 399 GLU A OE1   1 
ATOM   2887  O  OE2   . GLU A 1 399 ? -24.640 23.325  -36.897 1.00 55.52 ? 399 GLU A OE2   1 
ATOM   2888  N  N     . THR A 1 400 ? -19.470 26.544  -35.912 1.00 44.89 ? 400 THR A N     1 
ATOM   2889  C  CA    . THR A 1 400 ? -18.763 26.173  -34.671 1.00 44.15 ? 400 THR A CA    1 
ATOM   2890  C  C     . THR A 1 400 ? -17.488 26.960  -34.387 1.00 42.86 ? 400 THR A C     1 
ATOM   2891  O  O     . THR A 1 400 ? -16.966 26.902  -33.283 1.00 42.75 ? 400 THR A O     1 
ATOM   2892  C  CB    . THR A 1 400 ? -18.382 24.668  -34.656 1.00 44.36 ? 400 THR A CB    1 
ATOM   2893  O  OG1   . THR A 1 400 ? -17.425 24.398  -35.696 1.00 43.21 ? 400 THR A OG1   1 
ATOM   2894  C  CG2   . THR A 1 400 ? -19.619 23.785  -34.855 1.00 45.51 ? 400 THR A CG2   1 
ATOM   2895  N  N     . GLY A 1 401 ? -16.976 27.673  -35.385 1.00 42.52 ? 401 GLY A N     1 
ATOM   2896  C  CA    . GLY A 1 401 ? -15.726 28.415  -35.251 1.00 41.32 ? 401 GLY A CA    1 
ATOM   2897  C  C     . GLY A 1 401 ? -14.524 27.597  -35.673 1.00 40.84 ? 401 GLY A C     1 
ATOM   2898  O  O     . GLY A 1 401 ? -13.429 28.124  -35.810 1.00 39.99 ? 401 GLY A O     1 
ATOM   2899  N  N     . THR A 1 402 ? -14.747 26.301  -35.882 1.00 41.55 ? 402 THR A N     1 
ATOM   2900  C  CA    . THR A 1 402 ? -13.692 25.318  -36.156 1.00 40.99 ? 402 THR A CA    1 
ATOM   2901  C  C     . THR A 1 402 ? -14.097 24.523  -37.399 1.00 41.38 ? 402 THR A C     1 
ATOM   2902  O  O     . THR A 1 402 ? -15.269 24.542  -37.767 1.00 42.11 ? 402 THR A O     1 
ATOM   2903  C  CB    . THR A 1 402 ? -13.496 24.329  -34.948 1.00 41.40 ? 402 THR A CB    1 
ATOM   2904  O  OG1   . THR A 1 402 ? -14.707 23.572  -34.716 1.00 42.94 ? 402 THR A OG1   1 
ATOM   2905  C  CG2   . THR A 1 402 ? -13.057 25.069  -33.669 1.00 39.21 ? 402 THR A CG2   1 
ATOM   2906  N  N     . PRO A 1 403 ? -13.155 23.780  -38.029 1.00 40.87 ? 403 PRO A N     1 
ATOM   2907  C  CA    . PRO A 1 403 ? -11.769 23.476  -37.640 1.00 39.71 ? 403 PRO A CA    1 
ATOM   2908  C  C     . PRO A 1 403 ? -10.770 24.630  -37.735 1.00 38.87 ? 403 PRO A C     1 
ATOM   2909  O  O     . PRO A 1 403 ? -10.919 25.520  -38.575 1.00 38.96 ? 403 PRO A O     1 
ATOM   2910  C  CB    . PRO A 1 403 ? -11.367 22.379  -38.633 1.00 39.82 ? 403 PRO A CB    1 
ATOM   2911  C  CG    . PRO A 1 403 ? -12.171 22.686  -39.856 1.00 41.25 ? 403 PRO A CG    1 
ATOM   2912  C  CD    . PRO A 1 403 ? -13.513 23.113  -39.301 1.00 41.44 ? 403 PRO A CD    1 
ATOM   2913  N  N     . TYR A 1 404 ? -9.746  24.591  -36.887 1.00 38.04 ? 404 TYR A N     1 
ATOM   2914  C  CA    . TYR A 1 404 ? -8.593  25.469  -37.057 1.00 37.85 ? 404 TYR A CA    1 
ATOM   2915  C  C     . TYR A 1 404 ? -7.989  25.186  -38.424 1.00 37.93 ? 404 TYR A C     1 
ATOM   2916  O  O     . TYR A 1 404 ? -8.144  24.092  -38.957 1.00 38.20 ? 404 TYR A O     1 
ATOM   2917  C  CB    . TYR A 1 404 ? -7.509  25.231  -36.001 1.00 37.31 ? 404 TYR A CB    1 
ATOM   2918  C  CG    . TYR A 1 404 ? -7.942  25.002  -34.559 1.00 38.04 ? 404 TYR A CG    1 
ATOM   2919  C  CD1   . TYR A 1 404 ? -9.102  25.578  -34.022 1.00 37.79 ? 404 TYR A CD1   1 
ATOM   2920  C  CD2   . TYR A 1 404 ? -7.140  24.230  -33.713 1.00 38.33 ? 404 TYR A CD2   1 
ATOM   2921  C  CE1   . TYR A 1 404 ? -9.455  25.360  -32.690 1.00 38.89 ? 404 TYR A CE1   1 
ATOM   2922  C  CE2   . TYR A 1 404 ? -7.474  24.013  -32.389 1.00 38.08 ? 404 TYR A CE2   1 
ATOM   2923  C  CZ    . TYR A 1 404 ? -8.622  24.580  -31.883 1.00 39.27 ? 404 TYR A CZ    1 
ATOM   2924  O  OH    . TYR A 1 404 ? -8.920  24.335  -30.568 1.00 40.77 ? 404 TYR A OH    1 
ATOM   2925  N  N     . MET A 1 405 ? -7.311  26.175  -38.991 1.00 38.25 ? 405 MET A N     1 
ATOM   2926  C  CA    . MET A 1 405 ? -6.666  26.020  -40.289 1.00 39.04 ? 405 MET A CA    1 
ATOM   2927  C  C     . MET A 1 405 ? -5.152  26.129  -40.141 1.00 38.53 ? 405 MET A C     1 
ATOM   2928  O  O     . MET A 1 405 ? -4.620  27.197  -39.826 1.00 38.30 ? 405 MET A O     1 
ATOM   2929  C  CB    . MET A 1 405 ? -7.187  27.054  -41.294 1.00 39.58 ? 405 MET A CB    1 
ATOM   2930  C  CG    . MET A 1 405 ? -8.691  27.008  -41.518 1.00 41.11 ? 405 MET A CG    1 
ATOM   2931  S  SD    . MET A 1 405 ? -9.237  25.748  -42.692 1.00 43.51 ? 405 MET A SD    1 
ATOM   2932  C  CE    . MET A 1 405 ? -8.934  26.552  -44.272 1.00 41.95 ? 405 MET A CE    1 
ATOM   2933  N  N     . LEU A 1 406 ? -4.472  25.009  -40.357 1.00 38.59 ? 406 LEU A N     1 
ATOM   2934  C  CA    . LEU A 1 406 ? -3.019  24.982  -40.385 1.00 38.26 ? 406 LEU A CA    1 
ATOM   2935  C  C     . LEU A 1 406 ? -2.493  24.574  -41.741 1.00 38.78 ? 406 LEU A C     1 
ATOM   2936  O  O     . LEU A 1 406 ? -3.017  23.651  -42.377 1.00 39.35 ? 406 LEU A O     1 
ATOM   2937  C  CB    . LEU A 1 406 ? -2.468  24.083  -39.292 1.00 37.91 ? 406 LEU A CB    1 
ATOM   2938  C  CG    . LEU A 1 406 ? -2.590  24.832  -37.967 1.00 38.84 ? 406 LEU A CG    1 
ATOM   2939  C  CD1   . LEU A 1 406 ? -3.893  24.467  -37.219 1.00 39.18 ? 406 LEU A CD1   1 
ATOM   2940  C  CD2   . LEU A 1 406 ? -1.376  24.622  -37.108 1.00 39.21 ? 406 LEU A CD2   1 
ATOM   2941  N  N     . TYR A 1 407 ? -1.471  25.297  -42.191 1.00 38.58 ? 407 TYR A N     1 
ATOM   2942  C  CA    . TYR A 1 407 ? -0.851  25.026  -43.477 1.00 38.87 ? 407 TYR A CA    1 
ATOM   2943  C  C     . TYR A 1 407 ? 0.411   24.201  -43.272 1.00 38.78 ? 407 TYR A C     1 
ATOM   2944  O  O     . TYR A 1 407 ? 1.468   24.707  -42.861 1.00 38.33 ? 407 TYR A O     1 
ATOM   2945  C  CB    . TYR A 1 407 ? -0.679  26.313  -44.304 1.00 38.92 ? 407 TYR A CB    1 
ATOM   2946  C  CG    . TYR A 1 407 ? -2.030  26.949  -44.543 1.00 39.51 ? 407 TYR A CG    1 
ATOM   2947  C  CD1   . TYR A 1 407 ? -2.358  28.188  -43.988 1.00 39.50 ? 407 TYR A CD1   1 
ATOM   2948  C  CD2   . TYR A 1 407 ? -3.023  26.261  -45.254 1.00 40.28 ? 407 TYR A CD2   1 
ATOM   2949  C  CE1   . TYR A 1 407 ? -3.622  28.746  -44.180 1.00 39.23 ? 407 TYR A CE1   1 
ATOM   2950  C  CE2   . TYR A 1 407 ? -4.287  26.808  -45.440 1.00 40.24 ? 407 TYR A CE2   1 
ATOM   2951  C  CZ    . TYR A 1 407 ? -4.579  28.049  -44.903 1.00 39.47 ? 407 TYR A CZ    1 
ATOM   2952  O  OH    . TYR A 1 407 ? -5.832  28.582  -45.095 1.00 39.45 ? 407 TYR A OH    1 
ATOM   2953  N  N     . LYS A 1 408 ? 0.239   22.908  -43.542 1.00 39.09 ? 408 LYS A N     1 
ATOM   2954  C  CA    . LYS A 1 408 ? 1.215   21.854  -43.282 1.00 39.00 ? 408 LYS A CA    1 
ATOM   2955  C  C     . LYS A 1 408 ? 2.553   22.107  -43.964 1.00 39.52 ? 408 LYS A C     1 
ATOM   2956  O  O     . LYS A 1 408 ? 3.606   21.831  -43.399 1.00 39.59 ? 408 LYS A O     1 
ATOM   2957  C  CB    . LYS A 1 408 ? 0.617   20.520  -43.741 1.00 39.36 ? 408 LYS A CB    1 
ATOM   2958  C  CG    . LYS A 1 408 ? 1.597   19.393  -43.949 1.00 39.18 ? 408 LYS A CG    1 
ATOM   2959  C  CD    . LYS A 1 408 ? 0.913   18.245  -44.668 1.00 38.93 ? 408 LYS A CD    1 
ATOM   2960  C  CE    . LYS A 1 408 ? 1.838   17.054  -44.875 1.00 38.35 ? 408 LYS A CE    1 
ATOM   2961  N  NZ    . LYS A 1 408 ? 1.258   16.060  -45.823 1.00 36.35 ? 408 LYS A NZ    1 
ATOM   2962  N  N     . ASP A 1 409 ? 2.505   22.633  -45.182 1.00 39.99 ? 409 ASP A N     1 
ATOM   2963  C  CA    . ASP A 1 409 ? 3.718   22.857  -45.951 1.00 40.00 ? 409 ASP A CA    1 
ATOM   2964  C  C     . ASP A 1 409 ? 4.464   24.098  -45.490 1.00 39.71 ? 409 ASP A C     1 
ATOM   2965  O  O     . ASP A 1 409 ? 5.695   24.085  -45.460 1.00 39.86 ? 409 ASP A O     1 
ATOM   2966  C  CB    . ASP A 1 409 ? 3.414   22.882  -47.450 1.00 40.63 ? 409 ASP A CB    1 
ATOM   2967  C  CG    . ASP A 1 409 ? 2.829   21.557  -47.947 1.00 41.37 ? 409 ASP A CG    1 
ATOM   2968  O  OD1   . ASP A 1 409 ? 3.229   20.479  -47.452 1.00 41.29 ? 409 ASP A OD1   1 
ATOM   2969  O  OD2   . ASP A 1 409 ? 1.965   21.584  -48.839 1.00 42.95 ? 409 ASP A OD2   1 
ATOM   2970  N  N     . SER A 1 410 ? 3.731   25.154  -45.115 1.00 39.35 ? 410 SER A N     1 
ATOM   2971  C  CA    . SER A 1 410 ? 4.336   26.355  -44.502 1.00 39.06 ? 410 SER A CA    1 
ATOM   2972  C  C     . SER A 1 410 ? 5.012   26.031  -43.162 1.00 38.51 ? 410 SER A C     1 
ATOM   2973  O  O     . SER A 1 410 ? 6.161   26.416  -42.940 1.00 38.36 ? 410 SER A O     1 
ATOM   2974  C  CB    . SER A 1 410 ? 3.295   27.457  -44.299 1.00 38.70 ? 410 SER A CB    1 
ATOM   2975  O  OG    . SER A 1 410 ? 2.690   27.821  -45.527 1.00 40.56 ? 410 SER A OG    1 
ATOM   2976  N  N     . CYS A 1 411 ? 4.285   25.324  -42.289 1.00 37.99 ? 411 CYS A N     1 
ATOM   2977  C  CA    . CYS A 1 411 ? 4.802   24.823  -41.013 1.00 37.78 ? 411 CYS A CA    1 
ATOM   2978  C  C     . CYS A 1 411 ? 6.100   24.050  -41.196 1.00 38.38 ? 411 CYS A C     1 
ATOM   2979  O  O     . CYS A 1 411 ? 7.083   24.300  -40.490 1.00 38.44 ? 411 CYS A O     1 
ATOM   2980  C  CB    . CYS A 1 411 ? 3.778   23.907  -40.340 1.00 37.46 ? 411 CYS A CB    1 
ATOM   2981  S  SG    . CYS A 1 411 ? 2.316   24.739  -39.699 1.00 37.74 ? 411 CYS A SG    1 
ATOM   2982  N  N     . ASN A 1 412 ? 6.106   23.122  -42.152 1.00 38.58 ? 412 ASN A N     1 
ATOM   2983  C  CA    . ASN A 1 412 ? 7.285   22.297  -42.406 1.00 39.19 ? 412 ASN A CA    1 
ATOM   2984  C  C     . ASN A 1 412 ? 8.450   23.038  -43.093 1.00 39.69 ? 412 ASN A C     1 
ATOM   2985  O  O     . ASN A 1 412 ? 9.578   22.991  -42.619 1.00 39.54 ? 412 ASN A O     1 
ATOM   2986  C  CB    . ASN A 1 412 ? 6.887   21.028  -43.163 1.00 39.28 ? 412 ASN A CB    1 
ATOM   2987  C  CG    . ASN A 1 412 ? 6.354   19.948  -42.236 1.00 39.41 ? 412 ASN A CG    1 
ATOM   2988  O  OD1   . ASN A 1 412 ? 7.127   19.216  -41.625 1.00 39.74 ? 412 ASN A OD1   1 
ATOM   2989  N  ND2   . ASN A 1 412 ? 5.029   19.857  -42.112 1.00 37.99 ? 412 ASN A ND2   1 
ATOM   2990  N  N     . ARG A 1 413 ? 8.154   23.730  -44.190 1.00 40.34 ? 413 ARG A N     1 
ATOM   2991  C  CA    . ARG A 1 413 ? 9.146   24.476  -44.966 1.00 41.50 ? 413 ARG A CA    1 
ATOM   2992  C  C     . ARG A 1 413 ? 9.928   25.466  -44.107 1.00 40.79 ? 413 ARG A C     1 
ATOM   2993  O  O     . ARG A 1 413 ? 11.121  25.669  -44.323 1.00 41.42 ? 413 ARG A O     1 
ATOM   2994  C  CB    . ARG A 1 413 ? 8.465   25.220  -46.126 1.00 41.51 ? 413 ARG A CB    1 
ATOM   2995  C  CG    . ARG A 1 413 ? 9.421   25.805  -47.157 1.00 44.24 ? 413 ARG A CG    1 
ATOM   2996  C  CD    . ARG A 1 413 ? 8.678   26.464  -48.326 1.00 44.85 ? 413 ARG A CD    1 
ATOM   2997  N  NE    . ARG A 1 413 ? 7.886   25.496  -49.091 1.00 49.03 ? 413 ARG A NE    1 
ATOM   2998  C  CZ    . ARG A 1 413 ? 6.551   25.451  -49.116 1.00 49.72 ? 413 ARG A CZ    1 
ATOM   2999  N  NH1   . ARG A 1 413 ? 5.834   26.332  -48.423 1.00 48.49 ? 413 ARG A NH1   1 
ATOM   3000  N  NH2   . ARG A 1 413 ? 5.929   24.523  -49.845 1.00 49.53 ? 413 ARG A NH2   1 
ATOM   3001  N  N     . LYS A 1 414 ? 9.251   26.076  -43.135 1.00 39.78 ? 414 LYS A N     1 
ATOM   3002  C  CA    . LYS A 1 414 ? 9.838   27.150  -42.348 1.00 38.96 ? 414 LYS A CA    1 
ATOM   3003  C  C     . LYS A 1 414 ? 10.081  26.756  -40.895 1.00 38.43 ? 414 LYS A C     1 
ATOM   3004  O  O     . LYS A 1 414 ? 10.000  27.592  -39.986 1.00 38.75 ? 414 LYS A O     1 
ATOM   3005  C  CB    . LYS A 1 414 ? 8.975   28.416  -42.453 1.00 38.80 ? 414 LYS A CB    1 
ATOM   3006  C  CG    . LYS A 1 414 ? 8.906   28.966  -43.877 1.00 38.99 ? 414 LYS A CG    1 
ATOM   3007  C  CD    . LYS A 1 414 ? 8.318   30.366  -43.974 1.00 39.25 ? 414 LYS A CD    1 
ATOM   3008  C  CE    . LYS A 1 414 ? 6.815   30.383  -43.701 1.00 38.50 ? 414 LYS A CE    1 
ATOM   3009  N  NZ    . LYS A 1 414 ? 6.103   31.325  -44.608 1.00 38.35 ? 414 LYS A NZ    1 
ATOM   3010  N  N     . SER A 1 415 ? 10.388  25.483  -40.677 1.00 38.03 ? 415 SER A N     1 
ATOM   3011  C  CA    . SER A 1 415 ? 10.635  24.981  -39.340 1.00 37.51 ? 415 SER A CA    1 
ATOM   3012  C  C     . SER A 1 415 ? 12.109  24.636  -39.154 1.00 37.99 ? 415 SER A C     1 
ATOM   3013  O  O     . SER A 1 415 ? 12.726  24.041  -40.044 1.00 38.81 ? 415 SER A O     1 
ATOM   3014  C  CB    . SER A 1 415 ? 9.771   23.756  -39.071 1.00 37.15 ? 415 SER A CB    1 
ATOM   3015  O  OG    . SER A 1 415 ? 10.037  23.221  -37.787 1.00 37.37 ? 415 SER A OG    1 
ATOM   3016  N  N     . ASN A 1 416 ? 12.672  25.019  -38.007 1.00 37.52 ? 416 ASN A N     1 
ATOM   3017  C  CA    . ASN A 1 416 ? 14.066  24.674  -37.691 1.00 37.96 ? 416 ASN A CA    1 
ATOM   3018  C  C     . ASN A 1 416 ? 14.212  23.217  -37.282 1.00 38.38 ? 416 ASN A C     1 
ATOM   3019  O  O     . ASN A 1 416 ? 15.327  22.702  -37.196 1.00 39.14 ? 416 ASN A O     1 
ATOM   3020  C  CB    . ASN A 1 416 ? 14.655  25.560  -36.592 1.00 37.44 ? 416 ASN A CB    1 
ATOM   3021  C  CG    . ASN A 1 416 ? 16.169  25.381  -36.459 1.00 37.55 ? 416 ASN A CG    1 
ATOM   3022  O  OD1   . ASN A 1 416 ? 16.881  25.424  -37.456 1.00 36.28 ? 416 ASN A OD1   1 
ATOM   3023  N  ND2   . ASN A 1 416 ? 16.657  25.161  -35.236 1.00 35.10 ? 416 ASN A ND2   1 
ATOM   3024  N  N     . GLN A 1 417 ? 13.082  22.562  -37.030 1.00 37.89 ? 417 GLN A N     1 
ATOM   3025  C  CA    . GLN A 1 417 ? 13.076  21.149  -36.670 1.00 38.37 ? 417 GLN A CA    1 
ATOM   3026  C  C     . GLN A 1 417 ? 12.892  20.220  -37.889 1.00 38.97 ? 417 GLN A C     1 
ATOM   3027  O  O     . GLN A 1 417 ? 12.761  19.015  -37.735 1.00 39.18 ? 417 GLN A O     1 
ATOM   3028  C  CB    . GLN A 1 417 ? 11.985  20.879  -35.622 1.00 37.56 ? 417 GLN A CB    1 
ATOM   3029  C  CG    . GLN A 1 417 ? 12.369  21.258  -34.206 1.00 37.17 ? 417 GLN A CG    1 
ATOM   3030  C  CD    . GLN A 1 417 ? 11.396  20.712  -33.165 1.00 36.88 ? 417 GLN A CD    1 
ATOM   3031  O  OE1   . GLN A 1 417 ? 10.333  20.193  -33.509 1.00 36.87 ? 417 GLN A OE1   1 
ATOM   3032  N  NE2   . GLN A 1 417 ? 11.764  20.823  -31.887 1.00 34.27 ? 417 GLN A NE2   1 
ATOM   3033  N  N     . GLN A 1 418 ? 12.891  20.783  -39.095 1.00 39.60 ? 418 GLN A N     1 
ATOM   3034  C  CA    . GLN A 1 418 ? 12.585  20.011  -40.306 1.00 40.21 ? 418 GLN A CA    1 
ATOM   3035  C  C     . GLN A 1 418 ? 13.643  18.965  -40.639 1.00 41.23 ? 418 GLN A C     1 
ATOM   3036  O  O     . GLN A 1 418 ? 13.407  18.099  -41.482 1.00 41.92 ? 418 GLN A O     1 
ATOM   3037  C  CB    . GLN A 1 418 ? 12.356  20.932  -41.517 1.00 40.53 ? 418 GLN A CB    1 
ATOM   3038  C  CG    . GLN A 1 418 ? 13.611  21.604  -42.060 1.00 40.30 ? 418 GLN A CG    1 
ATOM   3039  C  CD    . GLN A 1 418 ? 13.324  22.497  -43.239 1.00 41.09 ? 418 GLN A CD    1 
ATOM   3040  O  OE1   . GLN A 1 418 ? 12.923  23.654  -43.078 1.00 40.01 ? 418 GLN A OE1   1 
ATOM   3041  N  NE2   . GLN A 1 418 ? 13.544  21.973  -44.442 1.00 41.92 ? 418 GLN A NE2   1 
ATOM   3042  N  N     . ASN A 1 419 ? 14.810  19.056  -39.998 1.00 41.66 ? 419 ASN A N     1 
ATOM   3043  C  CA    . ASN A 1 419 ? 15.839  18.018  -40.141 1.00 42.73 ? 419 ASN A CA    1 
ATOM   3044  C  C     . ASN A 1 419 ? 15.465  16.728  -39.405 1.00 42.68 ? 419 ASN A C     1 
ATOM   3045  O  O     . ASN A 1 419 ? 16.106  15.700  -39.597 1.00 43.72 ? 419 ASN A O     1 
ATOM   3046  C  CB    . ASN A 1 419 ? 17.220  18.520  -39.675 1.00 43.30 ? 419 ASN A CB    1 
ATOM   3047  C  CG    . ASN A 1 419 ? 17.256  18.884  -38.182 1.00 43.30 ? 419 ASN A CG    1 
ATOM   3048  O  OD1   . ASN A 1 419 ? 16.304  19.450  -37.645 1.00 42.48 ? 419 ASN A OD1   1 
ATOM   3049  N  ND2   . ASN A 1 419 ? 18.371  18.575  -37.520 1.00 43.76 ? 419 ASN A ND2   1 
ATOM   3050  N  N     . LEU A 1 420 ? 14.430  16.791  -38.565 1.00 41.76 ? 420 LEU A N     1 
ATOM   3051  C  CA    . LEU A 1 420 ? 13.970  15.628  -37.799 1.00 41.60 ? 420 LEU A CA    1 
ATOM   3052  C  C     . LEU A 1 420 ? 12.998  14.747  -38.578 1.00 41.26 ? 420 LEU A C     1 
ATOM   3053  O  O     . LEU A 1 420 ? 12.769  13.598  -38.211 1.00 41.23 ? 420 LEU A O     1 
ATOM   3054  C  CB    . LEU A 1 420 ? 13.305  16.078  -36.497 1.00 40.88 ? 420 LEU A CB    1 
ATOM   3055  C  CG    . LEU A 1 420 ? 14.150  16.894  -35.515 1.00 41.63 ? 420 LEU A CG    1 
ATOM   3056  C  CD1   . LEU A 1 420 ? 13.320  17.278  -34.286 1.00 40.25 ? 420 LEU A CD1   1 
ATOM   3057  C  CD2   . LEU A 1 420 ? 15.438  16.144  -35.115 1.00 42.81 ? 420 LEU A CD2   1 
ATOM   3058  N  N     . GLY A 1 421 ? 12.433  15.298  -39.651 1.00 41.10 ? 421 GLY A N     1 
ATOM   3059  C  CA    . GLY A 1 421 ? 11.354  14.647  -40.398 1.00 40.73 ? 421 GLY A CA    1 
ATOM   3060  C  C     . GLY A 1 421 ? 10.120  15.530  -40.421 1.00 39.83 ? 421 GLY A C     1 
ATOM   3061  O  O     . GLY A 1 421 ? 10.137  16.635  -39.891 1.00 39.18 ? 421 GLY A O     1 
ATOM   3062  N  N     . THR A 1 422 ? 9.048   15.041  -41.038 1.00 39.89 ? 422 THR A N     1 
ATOM   3063  C  CA    . THR A 1 422 ? 7.826   15.821  -41.223 1.00 39.11 ? 422 THR A CA    1 
ATOM   3064  C  C     . THR A 1 422 ? 7.105   16.047  -39.896 1.00 38.34 ? 422 THR A C     1 
ATOM   3065  O  O     . THR A 1 422 ? 6.975   15.128  -39.098 1.00 38.85 ? 422 THR A O     1 
ATOM   3066  C  CB    . THR A 1 422 ? 6.879   15.118  -42.215 1.00 39.69 ? 422 THR A CB    1 
ATOM   3067  O  OG1   . THR A 1 422 ? 7.542   14.965  -43.478 1.00 40.49 ? 422 THR A OG1   1 
ATOM   3068  C  CG2   . THR A 1 422 ? 5.584   15.911  -42.416 1.00 38.78 ? 422 THR A CG2   1 
ATOM   3069  N  N     . ILE A 1 423 ? 6.657   17.280  -39.675 1.00 37.61 ? 423 ILE A N     1 
ATOM   3070  C  CA    . ILE A 1 423 ? 5.843   17.645  -38.521 1.00 36.77 ? 423 ILE A CA    1 
ATOM   3071  C  C     . ILE A 1 423 ? 4.368   17.393  -38.853 1.00 37.05 ? 423 ILE A C     1 
ATOM   3072  O  O     . ILE A 1 423 ? 3.854   17.877  -39.870 1.00 37.15 ? 423 ILE A O     1 
ATOM   3073  C  CB    . ILE A 1 423 ? 6.113   19.109  -38.092 1.00 36.05 ? 423 ILE A CB    1 
ATOM   3074  C  CG1   . ILE A 1 423 ? 7.570   19.243  -37.616 1.00 36.84 ? 423 ILE A CG1   1 
ATOM   3075  C  CG2   . ILE A 1 423 ? 5.149   19.547  -37.008 1.00 35.09 ? 423 ILE A CG2   1 
ATOM   3076  C  CD1   . ILE A 1 423 ? 8.126   20.646  -37.636 1.00 37.19 ? 423 ILE A CD1   1 
ATOM   3077  N  N     . LYS A 1 424 ? 3.698   16.635  -37.986 1.00 37.03 ? 424 LYS A N     1 
ATOM   3078  C  CA    . LYS A 1 424 ? 2.411   16.035  -38.310 1.00 37.40 ? 424 LYS A CA    1 
ATOM   3079  C  C     . LYS A 1 424 ? 1.208   16.804  -37.773 1.00 37.37 ? 424 LYS A C     1 
ATOM   3080  O  O     . LYS A 1 424 ? 0.077   16.588  -38.221 1.00 37.33 ? 424 LYS A O     1 
ATOM   3081  C  CB    . LYS A 1 424 ? 2.366   14.582  -37.825 1.00 37.42 ? 424 LYS A CB    1 
ATOM   3082  C  CG    . LYS A 1 424 ? 3.309   13.644  -38.536 1.00 38.57 ? 424 LYS A CG    1 
ATOM   3083  C  CD    . LYS A 1 424 ? 3.063   12.214  -38.083 1.00 41.23 ? 424 LYS A CD    1 
ATOM   3084  C  CE    . LYS A 1 424 ? 4.061   11.262  -38.712 1.00 44.50 ? 424 LYS A CE    1 
ATOM   3085  N  NZ    . LYS A 1 424 ? 3.673   9.817   -38.517 1.00 46.37 ? 424 LYS A NZ    1 
ATOM   3086  N  N     . CYS A 1 425 ? 1.449   17.689  -36.809 1.00 37.55 ? 425 CYS A N     1 
ATOM   3087  C  CA    . CYS A 1 425 ? 0.378   18.498  -36.231 1.00 37.78 ? 425 CYS A CA    1 
ATOM   3088  C  C     . CYS A 1 425 ? 0.909   19.704  -35.467 1.00 37.40 ? 425 CYS A C     1 
ATOM   3089  O  O     . CYS A 1 425 ? 2.114   19.901  -35.354 1.00 37.21 ? 425 CYS A O     1 
ATOM   3090  C  CB    . CYS A 1 425 ? -0.509  17.639  -35.314 1.00 37.96 ? 425 CYS A CB    1 
ATOM   3091  S  SG    . CYS A 1 425 ? 0.318   17.016  -33.810 1.00 39.53 ? 425 CYS A SG    1 
ATOM   3092  N  N     . SER A 1 426 ? -0.019  20.510  -34.954 1.00 37.79 ? 426 SER A N     1 
ATOM   3093  C  CA    . SER A 1 426 ? 0.273   21.573  -33.996 1.00 37.52 ? 426 SER A CA    1 
ATOM   3094  C  C     . SER A 1 426 ? -0.368  21.202  -32.637 1.00 37.61 ? 426 SER A C     1 
ATOM   3095  O  O     . SER A 1 426 ? -0.719  20.041  -32.414 1.00 37.71 ? 426 SER A O     1 
ATOM   3096  C  CB    . SER A 1 426 ? -0.247  22.908  -34.547 1.00 37.43 ? 426 SER A CB    1 
ATOM   3097  O  OG    . SER A 1 426 ? 0.006   23.987  -33.666 1.00 37.61 ? 426 SER A OG    1 
ATOM   3098  N  N     . ASN A 1 427 ? -0.518  22.172  -31.737 1.00 37.50 ? 427 ASN A N     1 
ATOM   3099  C  CA    . ASN A 1 427 ? -1.102  21.907  -30.418 1.00 37.74 ? 427 ASN A CA    1 
ATOM   3100  C  C     . ASN A 1 427 ? -2.574  22.303  -30.324 1.00 37.95 ? 427 ASN A C     1 
ATOM   3101  O  O     . ASN A 1 427 ? -3.240  22.515  -31.334 1.00 38.34 ? 427 ASN A O     1 
ATOM   3102  C  CB    . ASN A 1 427 ? -0.296  22.609  -29.314 1.00 37.36 ? 427 ASN A CB    1 
ATOM   3103  C  CG    . ASN A 1 427 ? -0.289  24.117  -29.463 1.00 37.84 ? 427 ASN A CG    1 
ATOM   3104  O  OD1   . ASN A 1 427 ? -0.156  24.651  -30.573 1.00 37.86 ? 427 ASN A OD1   1 
ATOM   3105  N  ND2   . ASN A 1 427 ? -0.423  24.816  -28.345 1.00 36.64 ? 427 ASN A ND2   1 
ATOM   3106  N  N     . LEU A 1 428 ? -3.067  22.402  -29.095 1.00 38.24 ? 428 LEU A N     1 
ATOM   3107  C  CA    . LEU A 1 428 ? -4.446  22.782  -28.819 1.00 38.31 ? 428 LEU A CA    1 
ATOM   3108  C  C     . LEU A 1 428 ? -4.750  24.197  -29.286 1.00 38.36 ? 428 LEU A C     1 
ATOM   3109  O  O     . LEU A 1 428 ? -5.857  24.474  -29.735 1.00 38.94 ? 428 LEU A O     1 
ATOM   3110  C  CB    . LEU A 1 428 ? -4.728  22.646  -27.321 1.00 38.33 ? 428 LEU A CB    1 
ATOM   3111  C  CG    . LEU A 1 428 ? -6.115  23.038  -26.811 1.00 39.19 ? 428 LEU A CG    1 
ATOM   3112  C  CD1   . LEU A 1 428 ? -7.191  22.074  -27.310 1.00 37.86 ? 428 LEU A CD1   1 
ATOM   3113  C  CD2   . LEU A 1 428 ? -6.122  23.156  -25.284 1.00 38.65 ? 428 LEU A CD2   1 
ATOM   3114  N  N     . CYS A 1 429 ? -3.756  25.081  -29.199 1.00 38.41 ? 429 CYS A N     1 
ATOM   3115  C  CA    . CYS A 1 429 ? -3.954  26.512  -29.468 1.00 38.46 ? 429 CYS A CA    1 
ATOM   3116  C  C     . CYS A 1 429 ? -3.247  27.007  -30.716 1.00 37.94 ? 429 CYS A C     1 
ATOM   3117  O  O     . CYS A 1 429 ? -3.225  28.198  -30.993 1.00 37.77 ? 429 CYS A O     1 
ATOM   3118  C  CB    . CYS A 1 429 ? -3.565  27.339  -28.246 1.00 38.41 ? 429 CYS A CB    1 
ATOM   3119  S  SG    . CYS A 1 429 ? -4.601  26.884  -26.850 1.00 40.72 ? 429 CYS A SG    1 
ATOM   3120  N  N     . THR A 1 430 ? -2.687  26.067  -31.467 1.00 37.87 ? 430 THR A N     1 
ATOM   3121  C  CA    . THR A 1 430 ? -2.184  26.300  -32.820 1.00 38.00 ? 430 THR A CA    1 
ATOM   3122  C  C     . THR A 1 430 ? -0.956  27.196  -32.918 1.00 37.94 ? 430 THR A C     1 
ATOM   3123  O  O     . THR A 1 430 ? -0.645  27.666  -34.000 1.00 38.68 ? 430 THR A O     1 
ATOM   3124  C  CB    . THR A 1 430 ? -3.285  26.839  -33.794 1.00 38.44 ? 430 THR A CB    1 
ATOM   3125  O  OG1   . THR A 1 430 ? -3.530  28.228  -33.535 1.00 37.35 ? 430 THR A OG1   1 
ATOM   3126  C  CG2   . THR A 1 430 ? -4.575  26.058  -33.666 1.00 37.77 ? 430 THR A CG2   1 
ATOM   3127  N  N     . GLU A 1 431 ? -0.267  27.452  -31.811 1.00 37.72 ? 431 GLU A N     1 
ATOM   3128  C  CA    . GLU A 1 431 ? 0.948   28.264  -31.873 1.00 37.86 ? 431 GLU A CA    1 
ATOM   3129  C  C     . GLU A 1 431 ? 2.206   27.399  -31.966 1.00 37.26 ? 431 GLU A C     1 
ATOM   3130  O  O     . GLU A 1 431 ? 3.236   27.858  -32.443 1.00 37.23 ? 431 GLU A O     1 
ATOM   3131  C  CB    . GLU A 1 431 ? 1.024   29.284  -30.714 1.00 38.01 ? 431 GLU A CB    1 
ATOM   3132  C  CG    . GLU A 1 431 ? 1.559   28.773  -29.368 1.00 40.11 ? 431 GLU A CG    1 
ATOM   3133  C  CD    . GLU A 1 431 ? 0.513   28.050  -28.539 1.00 43.23 ? 431 GLU A CD    1 
ATOM   3134  O  OE1   . GLU A 1 431 ? 0.807   27.697  -27.367 1.00 45.22 ? 431 GLU A OE1   1 
ATOM   3135  O  OE2   . GLU A 1 431 ? -0.605  27.829  -29.049 1.00 44.35 ? 431 GLU A OE2   1 
ATOM   3136  N  N     . ILE A 1 432 ? 2.101   26.140  -31.540 1.00 36.95 ? 432 ILE A N     1 
ATOM   3137  C  CA    . ILE A 1 432 ? 3.256   25.244  -31.461 1.00 36.69 ? 432 ILE A CA    1 
ATOM   3138  C  C     . ILE A 1 432 ? 3.409   24.347  -32.688 1.00 37.18 ? 432 ILE A C     1 
ATOM   3139  O  O     . ILE A 1 432 ? 2.515   23.589  -33.032 1.00 37.54 ? 432 ILE A O     1 
ATOM   3140  C  CB    . ILE A 1 432 ? 3.215   24.375  -30.174 1.00 36.80 ? 432 ILE A CB    1 
ATOM   3141  C  CG1   . ILE A 1 432 ? 3.089   25.248  -28.910 1.00 35.87 ? 432 ILE A CG1   1 
ATOM   3142  C  CG2   . ILE A 1 432 ? 4.439   23.458  -30.096 1.00 36.60 ? 432 ILE A CG2   1 
ATOM   3143  C  CD1   . ILE A 1 432 ? 4.323   26.122  -28.607 1.00 36.51 ? 432 ILE A CD1   1 
ATOM   3144  N  N     . VAL A 1 433 ? 4.561   24.445  -33.341 1.00 37.50 ? 433 VAL A N     1 
ATOM   3145  C  CA    . VAL A 1 433 ? 4.907   23.578  -34.459 1.00 37.85 ? 433 VAL A CA    1 
ATOM   3146  C  C     . VAL A 1 433 ? 6.177   22.806  -34.081 1.00 37.90 ? 433 VAL A C     1 
ATOM   3147  O  O     . VAL A 1 433 ? 7.291   23.321  -34.197 1.00 38.60 ? 433 VAL A O     1 
ATOM   3148  C  CB    . VAL A 1 433 ? 5.095   24.389  -35.781 1.00 38.24 ? 433 VAL A CB    1 
ATOM   3149  C  CG1   . VAL A 1 433 ? 5.407   23.458  -36.953 1.00 39.11 ? 433 VAL A CG1   1 
ATOM   3150  C  CG2   . VAL A 1 433 ? 3.839   25.217  -36.094 1.00 38.12 ? 433 VAL A CG2   1 
ATOM   3151  N  N     . GLU A 1 434 ? 5.991   21.573  -33.617 1.00 37.75 ? 434 GLU A N     1 
ATOM   3152  C  CA    . GLU A 1 434 ? 7.078   20.720  -33.129 1.00 37.40 ? 434 GLU A CA    1 
ATOM   3153  C  C     . GLU A 1 434 ? 6.897   19.283  -33.598 1.00 37.60 ? 434 GLU A C     1 
ATOM   3154  O  O     . GLU A 1 434 ? 5.766   18.805  -33.773 1.00 37.15 ? 434 GLU A O     1 
ATOM   3155  C  CB    . GLU A 1 434 ? 7.153   20.748  -31.595 1.00 37.30 ? 434 GLU A CB    1 
ATOM   3156  C  CG    . GLU A 1 434 ? 7.927   21.917  -31.023 1.00 37.14 ? 434 GLU A CG    1 
ATOM   3157  C  CD    . GLU A 1 434 ? 7.634   22.175  -29.546 1.00 37.13 ? 434 GLU A CD    1 
ATOM   3158  O  OE1   . GLU A 1 434 ? 7.521   21.207  -28.762 1.00 37.81 ? 434 GLU A OE1   1 
ATOM   3159  O  OE2   . GLU A 1 434 ? 7.537   23.363  -29.162 1.00 37.25 ? 434 GLU A OE2   1 
ATOM   3160  N  N     . TYR A 1 435 ? 8.031   18.606  -33.774 1.00 37.74 ? 435 TYR A N     1 
ATOM   3161  C  CA    . TYR A 1 435 ? 8.099   17.233  -34.266 1.00 37.98 ? 435 TYR A CA    1 
ATOM   3162  C  C     . TYR A 1 435 ? 7.580   16.228  -33.240 1.00 38.41 ? 435 TYR A C     1 
ATOM   3163  O  O     . TYR A 1 435 ? 7.812   16.383  -32.039 1.00 38.31 ? 435 TYR A O     1 
ATOM   3164  C  CB    . TYR A 1 435 ? 9.550   16.890  -34.621 1.00 38.14 ? 435 TYR A CB    1 
ATOM   3165  C  CG    . TYR A 1 435 ? 9.751   15.494  -35.143 1.00 38.01 ? 435 TYR A CG    1 
ATOM   3166  C  CD1   . TYR A 1 435 ? 9.343   15.153  -36.432 1.00 38.56 ? 435 TYR A CD1   1 
ATOM   3167  C  CD2   . TYR A 1 435 ? 10.359  14.513  -34.361 1.00 38.56 ? 435 TYR A CD2   1 
ATOM   3168  C  CE1   . TYR A 1 435 ? 9.525   13.870  -36.934 1.00 38.95 ? 435 TYR A CE1   1 
ATOM   3169  C  CE2   . TYR A 1 435 ? 10.551  13.215  -34.853 1.00 39.40 ? 435 TYR A CE2   1 
ATOM   3170  C  CZ    . TYR A 1 435 ? 10.128  12.909  -36.147 1.00 40.00 ? 435 TYR A CZ    1 
ATOM   3171  O  OH    . TYR A 1 435 ? 10.304  11.645  -36.666 1.00 41.61 ? 435 TYR A OH    1 
ATOM   3172  N  N     . THR A 1 436 ? 6.877   15.211  -33.737 1.00 38.83 ? 436 THR A N     1 
ATOM   3173  C  CA    . THR A 1 436 ? 6.405   14.082  -32.943 1.00 39.69 ? 436 THR A CA    1 
ATOM   3174  C  C     . THR A 1 436 ? 6.679   12.782  -33.706 1.00 40.51 ? 436 THR A C     1 
ATOM   3175  O  O     . THR A 1 436 ? 6.806   12.798  -34.930 1.00 40.71 ? 436 THR A O     1 
ATOM   3176  C  CB    . THR A 1 436 ? 4.891   14.181  -32.630 1.00 39.45 ? 436 THR A CB    1 
ATOM   3177  O  OG1   . THR A 1 436 ? 4.152   14.240  -33.852 1.00 39.86 ? 436 THR A OG1   1 
ATOM   3178  C  CG2   . THR A 1 436 ? 4.586   15.419  -31.815 1.00 38.49 ? 436 THR A CG2   1 
ATOM   3179  N  N     . SER A 1 437 ? 6.798   11.675  -32.971 1.00 41.33 ? 437 SER A N     1 
ATOM   3180  C  CA    . SER A 1 437 ? 6.960   10.330  -33.536 1.00 42.59 ? 437 SER A CA    1 
ATOM   3181  C  C     . SER A 1 437 ? 6.575   9.307   -32.471 1.00 43.63 ? 437 SER A C     1 
ATOM   3182  O  O     . SER A 1 437 ? 6.207   9.688   -31.361 1.00 43.53 ? 437 SER A O     1 
ATOM   3183  C  CB    . SER A 1 437 ? 8.402   10.088  -34.012 1.00 42.75 ? 437 SER A CB    1 
ATOM   3184  O  OG    . SER A 1 437 ? 9.314   10.019  -32.933 1.00 42.90 ? 437 SER A OG    1 
ATOM   3185  N  N     . LYS A 1 438 ? 6.653   8.020   -32.816 1.00 44.93 ? 438 LYS A N     1 
ATOM   3186  C  CA    . LYS A 1 438 ? 6.474   6.924   -31.860 1.00 46.19 ? 438 LYS A CA    1 
ATOM   3187  C  C     . LYS A 1 438 ? 7.217   7.168   -30.547 1.00 46.11 ? 438 LYS A C     1 
ATOM   3188  O  O     . LYS A 1 438 ? 6.680   6.901   -29.466 1.00 46.12 ? 438 LYS A O     1 
ATOM   3189  C  CB    . LYS A 1 438 ? 6.981   5.606   -32.456 1.00 47.64 ? 438 LYS A CB    1 
ATOM   3190  C  CG    . LYS A 1 438 ? 5.920   4.706   -33.079 1.00 50.11 ? 438 LYS A CG    1 
ATOM   3191  C  CD    . LYS A 1 438 ? 6.328   3.229   -32.935 1.00 53.82 ? 438 LYS A CD    1 
ATOM   3192  C  CE    . LYS A 1 438 ? 5.332   2.291   -33.615 1.00 55.60 ? 438 LYS A CE    1 
ATOM   3193  N  NZ    . LYS A 1 438 ? 5.583   2.182   -35.086 1.00 56.52 ? 438 LYS A NZ    1 
ATOM   3194  N  N     . ASP A 1 439 ? 8.442   7.685   -30.664 1.00 45.92 ? 439 ASP A N     1 
ATOM   3195  C  CA    . ASP A 1 439 ? 9.389   7.790   -29.553 1.00 46.41 ? 439 ASP A CA    1 
ATOM   3196  C  C     . ASP A 1 439 ? 9.399   9.154   -28.838 1.00 45.40 ? 439 ASP A C     1 
ATOM   3197  O  O     . ASP A 1 439 ? 10.094  9.329   -27.833 1.00 45.53 ? 439 ASP A O     1 
ATOM   3198  C  CB    . ASP A 1 439 ? 10.800  7.485   -30.060 1.00 47.31 ? 439 ASP A CB    1 
ATOM   3199  C  CG    . ASP A 1 439 ? 10.928  6.078   -30.648 1.00 50.08 ? 439 ASP A CG    1 
ATOM   3200  O  OD1   . ASP A 1 439 ? 11.510  5.943   -31.751 1.00 52.17 ? 439 ASP A OD1   1 
ATOM   3201  O  OD2   . ASP A 1 439 ? 10.451  5.109   -30.014 1.00 51.58 ? 439 ASP A OD2   1 
ATOM   3202  N  N     . GLU A 1 440 ? 8.629   10.108  -29.357 1.00 43.90 ? 440 GLU A N     1 
ATOM   3203  C  CA    . GLU A 1 440 ? 8.717   11.490  -28.922 1.00 42.46 ? 440 GLU A CA    1 
ATOM   3204  C  C     . GLU A 1 440 ? 7.357   12.162  -28.914 1.00 41.25 ? 440 GLU A C     1 
ATOM   3205  O  O     . GLU A 1 440 ? 6.660   12.220  -29.935 1.00 40.87 ? 440 GLU A O     1 
ATOM   3206  C  CB    . GLU A 1 440 ? 9.639   12.279  -29.855 1.00 42.40 ? 440 GLU A CB    1 
ATOM   3207  C  CG    . GLU A 1 440 ? 11.127  12.035  -29.661 1.00 43.20 ? 440 GLU A CG    1 
ATOM   3208  C  CD    . GLU A 1 440 ? 11.958  12.739  -30.713 1.00 43.62 ? 440 GLU A CD    1 
ATOM   3209  O  OE1   . GLU A 1 440 ? 11.780  13.961  -30.915 1.00 44.63 ? 440 GLU A OE1   1 
ATOM   3210  O  OE2   . GLU A 1 440 ? 12.795  12.071  -31.348 1.00 46.43 ? 440 GLU A OE2   1 
ATOM   3211  N  N     . VAL A 1 441 ? 6.982   12.658  -27.760 1.00 40.28 ? 441 VAL A N     1 
ATOM   3212  C  CA    . VAL A 1 441 ? 5.876   13.551  -27.648 1.00 38.23 ? 441 VAL A CA    1 
ATOM   3213  C  C     . VAL A 1 441 ? 6.423   14.912  -27.333 1.00 37.47 ? 441 VAL A C     1 
ATOM   3214  O  O     . VAL A 1 441 ? 7.233   15.074  -26.475 1.00 37.52 ? 441 VAL A O     1 
ATOM   3215  C  CB    . VAL A 1 441 ? 4.795   13.083  -26.658 1.00 38.64 ? 441 VAL A CB    1 
ATOM   3216  C  CG1   . VAL A 1 441 ? 4.787   11.659  -26.503 1.00 38.24 ? 441 VAL A CG1   1 
ATOM   3217  C  CG2   . VAL A 1 441 ? 4.871   13.762  -25.395 1.00 37.17 ? 441 VAL A CG2   1 
ATOM   3218  N  N     . ALA A 1 442 ? 5.995   15.888  -28.087 1.00 36.49 ? 442 ALA A N     1 
ATOM   3219  C  CA    . ALA A 1 442 ? 6.502   17.212  -27.929 1.00 35.74 ? 442 ALA A CA    1 
ATOM   3220  C  C     . ALA A 1 442 ? 5.824   17.942  -26.806 1.00 35.47 ? 442 ALA A C     1 
ATOM   3221  O  O     . ALA A 1 442 ? 4.686   17.740  -26.522 1.00 35.32 ? 442 ALA A O     1 
ATOM   3222  C  CB    . ALA A 1 442 ? 6.365   17.942  -29.174 1.00 35.36 ? 442 ALA A CB    1 
ATOM   3223  N  N     . VAL A 1 443 ? 6.564   18.796  -26.154 1.00 34.99 ? 443 VAL A N     1 
ATOM   3224  C  CA    . VAL A 1 443 ? 6.019   19.565  -25.087 1.00 34.85 ? 443 VAL A CA    1 
ATOM   3225  C  C     . VAL A 1 443 ? 6.402   20.998  -25.278 1.00 34.49 ? 443 VAL A C     1 
ATOM   3226  O  O     . VAL A 1 443 ? 7.450   21.284  -25.718 1.00 34.96 ? 443 VAL A O     1 
ATOM   3227  C  CB    . VAL A 1 443 ? 6.493   19.019  -23.707 1.00 35.27 ? 443 VAL A CB    1 
ATOM   3228  C  CG1   . VAL A 1 443 ? 7.575   18.069  -23.836 1.00 34.98 ? 443 VAL A CG1   1 
ATOM   3229  C  CG2   . VAL A 1 443 ? 6.814   20.073  -22.758 1.00 34.69 ? 443 VAL A CG2   1 
ATOM   3230  N  N     . CYS A 1 444 ? 5.571   21.944  -24.945 0.50 34.01 ? 444 CYS A N     1 
ATOM   3231  C  CA    . CYS A 1 444 ? 6.206   23.226  -24.822 0.00 11.69 ? 444 CYS A CA    1 
ATOM   3232  C  C     . CYS A 1 444 ? 6.063   23.966  -23.557 0.50 34.12 ? 444 CYS A C     1 
ATOM   3233  O  O     . CYS A 1 444 ? 5.166   23.774  -22.787 0.50 33.76 ? 444 CYS A O     1 
ATOM   3234  C  CB    . CYS A 1 444 ? 6.144   24.137  -26.047 0.00 11.33 ? 444 CYS A CB    1 
ATOM   3235  S  SG    . CYS A 1 444 ? 7.817   24.774  -26.554 0.00 11.46 ? 444 CYS A SG    1 
ATOM   3236  N  N     . ASN A 1 445 ? 7.044   24.819  -23.415 1.00 34.42 ? 445 ASN A N     1 
ATOM   3237  C  CA    . ASN A 1 445 ? 7.441   25.475  -22.241 1.00 34.78 ? 445 ASN A CA    1 
ATOM   3238  C  C     . ASN A 1 445 ? 7.339   26.921  -22.581 1.00 34.28 ? 445 ASN A C     1 
ATOM   3239  O  O     . ASN A 1 445 ? 8.015   27.396  -23.426 1.00 34.39 ? 445 ASN A O     1 
ATOM   3240  C  CB    . ASN A 1 445 ? 8.867   25.057  -22.007 1.00 35.30 ? 445 ASN A CB    1 
ATOM   3241  C  CG    . ASN A 1 445 ? 9.121   23.639  -22.460 1.00 37.74 ? 445 ASN A CG    1 
ATOM   3242  O  OD1   . ASN A 1 445 ? 8.661   22.710  -21.843 1.00 39.60 ? 445 ASN A OD1   1 
ATOM   3243  N  ND2   . ASN A 1 445 ? 9.844   23.474  -23.530 1.00 35.74 ? 445 ASN A ND2   1 
ATOM   3244  N  N     . LEU A 1 446 ? 6.454   27.606  -21.906 1.00 33.78 ? 446 LEU A N     1 
ATOM   3245  C  CA    . LEU A 1 446 ? 5.965   28.871  -22.344 1.00 33.21 ? 446 LEU A CA    1 
ATOM   3246  C  C     . LEU A 1 446 ? 5.998   29.985  -21.336 1.00 33.40 ? 446 LEU A C     1 
ATOM   3247  O  O     . LEU A 1 446 ? 5.860   29.774  -20.174 1.00 33.00 ? 446 LEU A O     1 
ATOM   3248  C  CB    . LEU A 1 446 ? 4.537   28.706  -22.822 1.00 32.97 ? 446 LEU A CB    1 
ATOM   3249  C  CG    . LEU A 1 446 ? 4.173   27.594  -23.766 1.00 32.89 ? 446 LEU A CG    1 
ATOM   3250  C  CD1   . LEU A 1 446 ? 2.718   27.679  -24.042 1.00 31.80 ? 446 LEU A CD1   1 
ATOM   3251  C  CD2   . LEU A 1 446 ? 4.930   27.698  -25.001 1.00 31.01 ? 446 LEU A CD2   1 
ATOM   3252  N  N     . ALA A 1 447 ? 6.182   31.184  -21.853 1.00 33.07 ? 447 ALA A N     1 
ATOM   3253  C  CA    . ALA A 1 447 ? 6.116   32.431  -21.130 1.00 33.36 ? 447 ALA A CA    1 
ATOM   3254  C  C     . ALA A 1 447 ? 5.691   33.554  -22.055 1.00 33.51 ? 447 ALA A C     1 
ATOM   3255  O  O     . ALA A 1 447 ? 5.721   33.401  -23.227 1.00 33.43 ? 447 ALA A O     1 
ATOM   3256  C  CB    . ALA A 1 447 ? 7.424   32.738  -20.515 1.00 33.34 ? 447 ALA A CB    1 
ATOM   3257  N  N     . SER A 1 448 ? 5.284   34.683  -21.504 1.00 34.20 ? 448 SER A N     1 
ATOM   3258  C  CA    . SER A 1 448 ? 4.949   35.864  -22.320 1.00 34.28 ? 448 SER A CA    1 
ATOM   3259  C  C     . SER A 1 448 ? 5.474   37.196  -21.771 1.00 34.65 ? 448 SER A C     1 
ATOM   3260  O  O     . SER A 1 448 ? 5.452   37.450  -20.556 1.00 35.09 ? 448 SER A O     1 
ATOM   3261  C  CB    . SER A 1 448 ? 3.437   35.951  -22.603 1.00 34.03 ? 448 SER A CB    1 
ATOM   3262  O  OG    . SER A 1 448 ? 2.670   36.060  -21.411 1.00 34.56 ? 448 SER A OG    1 
ATOM   3263  N  N     . LEU A 1 449 ? 5.943   38.032  -22.693 1.00 34.31 ? 449 LEU A N     1 
ATOM   3264  C  CA    . LEU A 1 449 ? 6.386   39.378  -22.391 1.00 34.22 ? 449 LEU A CA    1 
ATOM   3265  C  C     . LEU A 1 449 ? 5.201   40.326  -22.370 1.00 33.90 ? 449 LEU A C     1 
ATOM   3266  O  O     . LEU A 1 449 ? 4.363   40.279  -23.280 1.00 34.14 ? 449 LEU A O     1 
ATOM   3267  C  CB    . LEU A 1 449 ? 7.374   39.852  -23.459 1.00 34.67 ? 449 LEU A CB    1 
ATOM   3268  C  CG    . LEU A 1 449 ? 8.839   39.372  -23.513 1.00 35.07 ? 449 LEU A CG    1 
ATOM   3269  C  CD1   . LEU A 1 449 ? 9.425   39.058  -22.151 1.00 34.60 ? 449 LEU A CD1   1 
ATOM   3270  C  CD2   . LEU A 1 449 ? 8.985   38.200  -24.426 1.00 34.41 ? 449 LEU A CD2   1 
ATOM   3271  N  N     . ALA A 1 450 ? 5.126   41.187  -21.350 1.00 33.44 ? 450 ALA A N     1 
ATOM   3272  C  CA    . ALA A 1 450 ? 4.053   42.191  -21.273 1.00 33.31 ? 450 ALA A CA    1 
ATOM   3273  C  C     . ALA A 1 450 ? 4.439   43.461  -22.055 1.00 33.31 ? 450 ALA A C     1 
ATOM   3274  O  O     . ALA A 1 450 ? 5.124   44.341  -21.530 1.00 33.63 ? 450 ALA A O     1 
ATOM   3275  C  CB    . ALA A 1 450 ? 3.705   42.507  -19.807 1.00 32.96 ? 450 ALA A CB    1 
ATOM   3276  N  N     . LEU A 1 451 ? 3.987   43.543  -23.304 1.00 33.19 ? 451 LEU A N     1 
ATOM   3277  C  CA    . LEU A 1 451 ? 4.482   44.539  -24.269 1.00 33.84 ? 451 LEU A CA    1 
ATOM   3278  C  C     . LEU A 1 451 ? 4.130   45.974  -23.921 1.00 34.64 ? 451 LEU A C     1 
ATOM   3279  O  O     . LEU A 1 451 ? 4.752   46.911  -24.411 1.00 34.96 ? 451 LEU A O     1 
ATOM   3280  C  CB    . LEU A 1 451 ? 3.992   44.216  -25.696 1.00 33.29 ? 451 LEU A CB    1 
ATOM   3281  C  CG    . LEU A 1 451 ? 4.455   42.900  -26.331 1.00 32.49 ? 451 LEU A CG    1 
ATOM   3282  C  CD1   . LEU A 1 451 ? 3.863   42.745  -27.725 1.00 31.86 ? 451 LEU A CD1   1 
ATOM   3283  C  CD2   . LEU A 1 451 ? 5.990   42.778  -26.382 1.00 31.28 ? 451 LEU A CD2   1 
ATOM   3284  N  N     . ASN A 1 452 ? 3.124   46.139  -23.076 1.00 35.48 ? 452 ASN A N     1 
ATOM   3285  C  CA    . ASN A 1 452 ? 2.706   47.455  -22.604 1.00 36.92 ? 452 ASN A CA    1 
ATOM   3286  C  C     . ASN A 1 452 ? 3.756   48.066  -21.679 1.00 37.30 ? 452 ASN A C     1 
ATOM   3287  O  O     . ASN A 1 452 ? 3.906   49.275  -21.620 1.00 38.04 ? 452 ASN A O     1 
ATOM   3288  C  CB    . ASN A 1 452 ? 1.362   47.336  -21.877 1.00 37.02 ? 452 ASN A CB    1 
ATOM   3289  C  CG    . ASN A 1 452 ? 1.362   46.216  -20.857 1.00 38.12 ? 452 ASN A CG    1 
ATOM   3290  O  OD1   . ASN A 1 452 ? 1.502   45.049  -21.208 1.00 38.12 ? 452 ASN A OD1   1 
ATOM   3291  N  ND2   . ASN A 1 452 ? 1.234   46.570  -19.578 1.00 40.40 ? 452 ASN A ND2   1 
ATOM   3292  N  N     . MET A 1 453 ? 4.485   47.215  -20.965 1.00 37.65 ? 453 MET A N     1 
ATOM   3293  C  CA    . MET A 1 453 ? 5.512   47.656  -20.019 1.00 38.32 ? 453 MET A CA    1 
ATOM   3294  C  C     . MET A 1 453 ? 6.652   48.396  -20.681 1.00 38.86 ? 453 MET A C     1 
ATOM   3295  O  O     . MET A 1 453 ? 7.338   49.176  -20.025 1.00 40.01 ? 453 MET A O     1 
ATOM   3296  C  CB    . MET A 1 453 ? 6.096   46.462  -19.250 1.00 38.04 ? 453 MET A CB    1 
ATOM   3297  C  CG    . MET A 1 453 ? 5.121   45.735  -18.375 1.00 38.36 ? 453 MET A CG    1 
ATOM   3298  S  SD    . MET A 1 453 ? 4.326   46.856  -17.204 1.00 42.50 ? 453 MET A SD    1 
ATOM   3299  C  CE    . MET A 1 453 ? 5.694   47.302  -16.123 1.00 40.08 ? 453 MET A CE    1 
ATOM   3300  N  N     . TYR A 1 454 ? 6.869   48.143  -21.967 1.00 38.83 ? 454 TYR A N     1 
ATOM   3301  C  CA    . TYR A 1 454 ? 8.073   48.636  -22.653 1.00 39.54 ? 454 TYR A CA    1 
ATOM   3302  C  C     . TYR A 1 454 ? 7.878   49.970  -23.374 1.00 41.08 ? 454 TYR A C     1 
ATOM   3303  O  O     . TYR A 1 454 ? 8.813   50.497  -23.998 1.00 41.52 ? 454 TYR A O     1 
ATOM   3304  C  CB    . TYR A 1 454 ? 8.652   47.551  -23.578 1.00 38.35 ? 454 TYR A CB    1 
ATOM   3305  C  CG    . TYR A 1 454 ? 8.916   46.266  -22.828 1.00 37.28 ? 454 TYR A CG    1 
ATOM   3306  C  CD1   . TYR A 1 454 ? 7.885   45.356  -22.587 1.00 35.45 ? 454 TYR A CD1   1 
ATOM   3307  C  CD2   . TYR A 1 454 ? 10.176  45.987  -22.301 1.00 37.11 ? 454 TYR A CD2   1 
ATOM   3308  C  CE1   . TYR A 1 454 ? 8.102   44.201  -21.866 1.00 34.95 ? 454 TYR A CE1   1 
ATOM   3309  C  CE2   . TYR A 1 454 ? 10.405  44.818  -21.578 1.00 36.52 ? 454 TYR A CE2   1 
ATOM   3310  C  CZ    . TYR A 1 454 ? 9.358   43.938  -21.362 1.00 35.95 ? 454 TYR A CZ    1 
ATOM   3311  O  OH    . TYR A 1 454 ? 9.564   42.778  -20.665 1.00 35.83 ? 454 TYR A OH    1 
ATOM   3312  N  N     . VAL A 1 455 ? 6.667   50.521  -23.289 1.00 42.53 ? 455 VAL A N     1 
ATOM   3313  C  CA    . VAL A 1 455 ? 6.464   51.884  -23.772 1.00 44.59 ? 455 VAL A CA    1 
ATOM   3314  C  C     . VAL A 1 455 ? 6.806   52.904  -22.704 1.00 46.34 ? 455 VAL A C     1 
ATOM   3315  O  O     . VAL A 1 455 ? 6.383   52.834  -21.543 1.00 46.25 ? 455 VAL A O     1 
ATOM   3316  C  CB    . VAL A 1 455 ? 5.110   52.170  -24.526 1.00 44.40 ? 455 VAL A CB    1 
ATOM   3317  C  CG1   . VAL A 1 455 ? 4.078   51.088  -24.296 1.00 43.77 ? 455 VAL A CG1   1 
ATOM   3318  C  CG2   . VAL A 1 455 ? 4.590   53.593  -24.243 1.00 43.58 ? 455 VAL A CG2   1 
ATOM   3319  N  N     . THR A 1 456 ? 7.612   53.841  -23.161 1.00 48.54 ? 456 THR A N     1 
ATOM   3320  C  CA    . THR A 1 456 ? 8.269   54.826  -22.351 1.00 50.73 ? 456 THR A CA    1 
ATOM   3321  C  C     . THR A 1 456 ? 7.329   55.996  -22.057 1.00 52.51 ? 456 THR A C     1 
ATOM   3322  O  O     . THR A 1 456 ? 6.355   56.214  -22.789 1.00 52.89 ? 456 THR A O     1 
ATOM   3323  C  CB    . THR A 1 456 ? 9.540   55.234  -23.111 1.00 51.01 ? 456 THR A CB    1 
ATOM   3324  O  OG1   . THR A 1 456 ? 10.689  54.784  -22.392 1.00 51.00 ? 456 THR A OG1   1 
ATOM   3325  C  CG2   . THR A 1 456 ? 9.607   56.682  -23.339 1.00 51.77 ? 456 THR A CG2   1 
ATOM   3326  N  N     . SER A 1 457 ? 7.608   56.723  -20.974 1.00 54.58 ? 457 SER A N     1 
ATOM   3327  C  CA    . SER A 1 457 ? 6.860   57.944  -20.615 1.00 56.58 ? 457 SER A CA    1 
ATOM   3328  C  C     . SER A 1 457 ? 6.871   59.037  -21.699 1.00 57.87 ? 457 SER A C     1 
ATOM   3329  O  O     . SER A 1 457 ? 6.012   59.927  -21.695 1.00 58.64 ? 457 SER A O     1 
ATOM   3330  C  CB    . SER A 1 457 ? 7.406   58.526  -19.313 1.00 57.38 ? 457 SER A CB    1 
ATOM   3331  O  OG    . SER A 1 457 ? 8.775   58.872  -19.465 1.00 59.27 ? 457 SER A OG    1 
ATOM   3332  N  N     . GLU A 1 458 ? 7.847   58.967  -22.608 1.00 58.57 ? 458 GLU A N     1 
ATOM   3333  C  CA    . GLU A 1 458 ? 7.965   59.900  -23.732 1.00 59.61 ? 458 GLU A CA    1 
ATOM   3334  C  C     . GLU A 1 458 ? 7.327   59.322  -24.999 1.00 58.89 ? 458 GLU A C     1 
ATOM   3335  O  O     . GLU A 1 458 ? 7.659   59.744  -26.110 1.00 59.77 ? 458 GLU A O     1 
ATOM   3336  C  CB    . GLU A 1 458 ? 9.441   60.234  -24.034 1.00 60.79 ? 458 GLU A CB    1 
ATOM   3337  C  CG    . GLU A 1 458 ? 10.474  59.959  -22.915 1.00 62.38 ? 458 GLU A CG    1 
ATOM   3338  C  CD    . GLU A 1 458 ? 11.753  59.268  -23.445 1.00 64.80 ? 458 GLU A CD    1 
ATOM   3339  O  OE1   . GLU A 1 458 ? 12.197  59.578  -24.582 1.00 65.83 ? 458 GLU A OE1   1 
ATOM   3340  O  OE2   . GLU A 1 458 ? 12.308  58.401  -22.724 1.00 64.24 ? 458 GLU A OE2   1 
ATOM   3341  N  N     . HIS A 1 459 ? 6.415   58.364  -24.840 1.00 57.63 ? 459 HIS A N     1 
ATOM   3342  C  CA    . HIS A 1 459 ? 5.792   57.673  -25.985 1.00 56.72 ? 459 HIS A CA    1 
ATOM   3343  C  C     . HIS A 1 459 ? 6.811   57.186  -27.026 1.00 55.77 ? 459 HIS A C     1 
ATOM   3344  O  O     . HIS A 1 459 ? 6.613   57.372  -28.237 1.00 56.13 ? 459 HIS A O     1 
ATOM   3345  C  CB    . HIS A 1 459 ? 4.727   58.545  -26.675 1.00 57.85 ? 459 HIS A CB    1 
ATOM   3346  C  CG    . HIS A 1 459 ? 3.484   58.749  -25.868 1.00 59.46 ? 459 HIS A CG    1 
ATOM   3347  N  ND1   . HIS A 1 459 ? 2.604   59.781  -26.113 1.00 62.32 ? 459 HIS A ND1   1 
ATOM   3348  C  CD2   . HIS A 1 459 ? 2.978   58.067  -24.813 1.00 60.84 ? 459 HIS A CD2   1 
ATOM   3349  C  CE1   . HIS A 1 459 ? 1.603   59.720  -25.251 1.00 62.83 ? 459 HIS A CE1   1 
ATOM   3350  N  NE2   . HIS A 1 459 ? 1.807   58.689  -24.450 1.00 62.37 ? 459 HIS A NE2   1 
ATOM   3351  N  N     . THR A 1 460 ? 7.908   56.600  -26.539 1.00 53.92 ? 460 THR A N     1 
ATOM   3352  C  CA    . THR A 1 460 ? 8.835   55.829  -27.370 1.00 51.99 ? 460 THR A CA    1 
ATOM   3353  C  C     . THR A 1 460 ? 8.844   54.386  -26.868 1.00 49.78 ? 460 THR A C     1 
ATOM   3354  O  O     . THR A 1 460 ? 8.270   54.083  -25.808 1.00 49.21 ? 460 THR A O     1 
ATOM   3355  C  CB    . THR A 1 460 ? 10.269  56.384  -27.321 1.00 52.91 ? 460 THR A CB    1 
ATOM   3356  O  OG1   . THR A 1 460 ? 10.797  56.217  -26.003 1.00 52.66 ? 460 THR A OG1   1 
ATOM   3357  C  CG2   . THR A 1 460 ? 10.302  57.859  -27.701 1.00 54.03 ? 460 THR A CG2   1 
ATOM   3358  N  N     . TYR A 1 461 ? 9.493   53.499  -27.619 1.00 47.71 ? 461 TYR A N     1 
ATOM   3359  C  CA    . TYR A 1 461 ? 9.502   52.089  -27.274 1.00 45.07 ? 461 TYR A CA    1 
ATOM   3360  C  C     . TYR A 1 461 ? 10.883  51.574  -26.893 1.00 44.52 ? 461 TYR A C     1 
ATOM   3361  O  O     . TYR A 1 461 ? 11.834  51.667  -27.679 1.00 45.25 ? 461 TYR A O     1 
ATOM   3362  C  CB    . TYR A 1 461 ? 8.890   51.237  -28.391 1.00 44.29 ? 461 TYR A CB    1 
ATOM   3363  C  CG    . TYR A 1 461 ? 8.349   49.934  -27.856 1.00 42.78 ? 461 TYR A CG    1 
ATOM   3364  C  CD1   . TYR A 1 461 ? 7.044   49.848  -27.371 1.00 41.17 ? 461 TYR A CD1   1 
ATOM   3365  C  CD2   . TYR A 1 461 ? 9.162   48.796  -27.779 1.00 41.58 ? 461 TYR A CD2   1 
ATOM   3366  C  CE1   . TYR A 1 461 ? 6.555   48.654  -26.846 1.00 41.15 ? 461 TYR A CE1   1 
ATOM   3367  C  CE2   . TYR A 1 461 ? 8.677   47.598  -27.266 1.00 40.92 ? 461 TYR A CE2   1 
ATOM   3368  C  CZ    . TYR A 1 461 ? 7.379   47.535  -26.800 1.00 40.74 ? 461 TYR A CZ    1 
ATOM   3369  O  OH    . TYR A 1 461 ? 6.905   46.355  -26.287 1.00 39.96 ? 461 TYR A OH    1 
ATOM   3370  N  N     . ASP A 1 462 ? 10.985  51.016  -25.689 1.00 43.16 ? 462 ASP A N     1 
ATOM   3371  C  CA    . ASP A 1 462 ? 12.267  50.526  -25.175 1.00 42.44 ? 462 ASP A CA    1 
ATOM   3372  C  C     . ASP A 1 462 ? 12.607  49.121  -25.678 1.00 41.54 ? 462 ASP A C     1 
ATOM   3373  O  O     . ASP A 1 462 ? 12.450  48.137  -24.947 1.00 40.93 ? 462 ASP A O     1 
ATOM   3374  C  CB    . ASP A 1 462 ? 12.280  50.559  -23.647 1.00 42.35 ? 462 ASP A CB    1 
ATOM   3375  C  CG    . ASP A 1 462 ? 13.692  50.576  -23.063 1.00 43.14 ? 462 ASP A CG    1 
ATOM   3376  O  OD1   . ASP A 1 462 ? 13.810  50.954  -21.883 1.00 42.94 ? 462 ASP A OD1   1 
ATOM   3377  O  OD2   . ASP A 1 462 ? 14.679  50.207  -23.755 1.00 43.32 ? 462 ASP A OD2   1 
ATOM   3378  N  N     . PHE A 1 463 ? 13.075  49.037  -26.926 1.00 41.35 ? 463 PHE A N     1 
ATOM   3379  C  CA    . PHE A 1 463 ? 13.539  47.769  -27.503 1.00 40.55 ? 463 PHE A CA    1 
ATOM   3380  C  C     . PHE A 1 463 ? 14.717  47.174  -26.718 1.00 40.31 ? 463 PHE A C     1 
ATOM   3381  O  O     . PHE A 1 463 ? 14.764  45.959  -26.520 1.00 40.08 ? 463 PHE A O     1 
ATOM   3382  C  CB    . PHE A 1 463 ? 13.905  47.917  -28.986 1.00 40.74 ? 463 PHE A CB    1 
ATOM   3383  C  CG    . PHE A 1 463 ? 12.809  48.516  -29.827 1.00 41.75 ? 463 PHE A CG    1 
ATOM   3384  C  CD1   . PHE A 1 463 ? 12.951  49.793  -30.373 1.00 42.37 ? 463 PHE A CD1   1 
ATOM   3385  C  CD2   . PHE A 1 463 ? 11.622  47.811  -30.069 1.00 41.19 ? 463 PHE A CD2   1 
ATOM   3386  C  CE1   . PHE A 1 463 ? 11.937  50.361  -31.150 1.00 42.04 ? 463 PHE A CE1   1 
ATOM   3387  C  CE2   . PHE A 1 463 ? 10.605  48.373  -30.848 1.00 40.65 ? 463 PHE A CE2   1 
ATOM   3388  C  CZ    . PHE A 1 463 ? 10.764  49.649  -31.389 1.00 40.92 ? 463 PHE A CZ    1 
ATOM   3389  N  N     . LYS A 1 464 ? 15.653  48.010  -26.263 1.00 40.24 ? 464 LYS A N     1 
ATOM   3390  C  CA    . LYS A 1 464 ? 16.812  47.489  -25.517 1.00 40.16 ? 464 LYS A CA    1 
ATOM   3391  C  C     . LYS A 1 464 ? 16.343  46.690  -24.301 1.00 38.94 ? 464 LYS A C     1 
ATOM   3392  O  O     . LYS A 1 464 ? 16.828  45.592  -24.045 1.00 38.62 ? 464 LYS A O     1 
ATOM   3393  C  CB    . LYS A 1 464 ? 17.792  48.606  -25.114 1.00 40.68 ? 464 LYS A CB    1 
ATOM   3394  N  N     . LYS A 1 465 ? 15.364  47.230  -23.582 1.00 38.32 ? 465 LYS A N     1 
ATOM   3395  C  CA    . LYS A 1 465 ? 14.864  46.582  -22.373 1.00 37.64 ? 465 LYS A CA    1 
ATOM   3396  C  C     . LYS A 1 465 ? 14.060  45.323  -22.680 1.00 36.62 ? 465 LYS A C     1 
ATOM   3397  O  O     . LYS A 1 465 ? 14.095  44.371  -21.912 1.00 36.01 ? 465 LYS A O     1 
ATOM   3398  C  CB    . LYS A 1 465 ? 14.054  47.566  -21.533 1.00 37.50 ? 465 LYS A CB    1 
ATOM   3399  C  CG    . LYS A 1 465 ? 13.439  46.987  -20.283 1.00 37.72 ? 465 LYS A CG    1 
ATOM   3400  C  CD    . LYS A 1 465 ? 14.467  46.686  -19.220 1.00 39.78 ? 465 LYS A CD    1 
ATOM   3401  C  CE    . LYS A 1 465 ? 13.777  46.136  -17.993 1.00 41.08 ? 465 LYS A CE    1 
ATOM   3402  N  NZ    . LYS A 1 465 ? 14.542  46.424  -16.772 1.00 44.70 ? 465 LYS A NZ    1 
ATOM   3403  N  N     . LEU A 1 466 ? 13.356  45.316  -23.810 1.00 36.46 ? 466 LEU A N     1 
ATOM   3404  C  CA    . LEU A 1 466 ? 12.605  44.143  -24.239 1.00 35.84 ? 466 LEU A CA    1 
ATOM   3405  C  C     . LEU A 1 466 ? 13.545  42.980  -24.549 1.00 36.28 ? 466 LEU A C     1 
ATOM   3406  O  O     . LEU A 1 466 ? 13.285  41.837  -24.159 1.00 35.54 ? 466 LEU A O     1 
ATOM   3407  C  CB    . LEU A 1 466 ? 11.712  44.469  -25.444 1.00 35.64 ? 466 LEU A CB    1 
ATOM   3408  C  CG    . LEU A 1 466 ? 10.879  43.346  -26.084 1.00 34.86 ? 466 LEU A CG    1 
ATOM   3409  C  CD1   . LEU A 1 466 ? 9.807   42.783  -25.122 1.00 33.12 ? 466 LEU A CD1   1 
ATOM   3410  C  CD2   . LEU A 1 466 ? 10.238  43.861  -27.355 1.00 34.37 ? 466 LEU A CD2   1 
ATOM   3411  N  N     . ALA A 1 467 ? 14.634  43.284  -25.252 1.00 37.45 ? 467 ALA A N     1 
ATOM   3412  C  CA    . ALA A 1 467 ? 15.677  42.298  -25.541 1.00 38.11 ? 467 ALA A CA    1 
ATOM   3413  C  C     . ALA A 1 467 ? 16.256  41.728  -24.253 1.00 38.73 ? 467 ALA A C     1 
ATOM   3414  O  O     . ALA A 1 467 ? 16.429  40.514  -24.147 1.00 39.11 ? 467 ALA A O     1 
ATOM   3415  C  CB    . ALA A 1 467 ? 16.770  42.912  -26.390 1.00 38.65 ? 467 ALA A CB    1 
ATOM   3416  N  N     . GLU A 1 468 ? 16.535  42.602  -23.284 1.00 39.45 ? 468 GLU A N     1 
ATOM   3417  C  CA    . GLU A 1 468 ? 17.121  42.218  -21.996 1.00 40.91 ? 468 GLU A CA    1 
ATOM   3418  C  C     . GLU A 1 468 ? 16.281  41.190  -21.268 1.00 39.61 ? 468 GLU A C     1 
ATOM   3419  O  O     . GLU A 1 468 ? 16.801  40.166  -20.830 1.00 40.22 ? 468 GLU A O     1 
ATOM   3420  C  CB    . GLU A 1 468 ? 17.229  43.426  -21.065 1.00 41.43 ? 468 GLU A CB    1 
ATOM   3421  C  CG    . GLU A 1 468 ? 18.485  44.257  -21.175 1.00 44.24 ? 468 GLU A CG    1 
ATOM   3422  C  CD    . GLU A 1 468 ? 18.457  45.436  -20.199 1.00 45.59 ? 468 GLU A CD    1 
ATOM   3423  O  OE1   . GLU A 1 468 ? 18.086  45.226  -19.013 1.00 48.50 ? 468 GLU A OE1   1 
ATOM   3424  O  OE2   . GLU A 1 468 ? 18.798  46.570  -20.621 1.00 49.63 ? 468 GLU A OE2   1 
ATOM   3425  N  N     . VAL A 1 469 ? 14.989  41.492  -21.119 1.00 38.18 ? 469 VAL A N     1 
ATOM   3426  C  CA    . VAL A 1 469 ? 14.059  40.636  -20.396 1.00 36.65 ? 469 VAL A CA    1 
ATOM   3427  C  C     . VAL A 1 469 ? 13.896  39.301  -21.111 1.00 36.14 ? 469 VAL A C     1 
ATOM   3428  O  O     . VAL A 1 469 ? 13.938  38.244  -20.468 1.00 36.13 ? 469 VAL A O     1 
ATOM   3429  C  CB    . VAL A 1 469 ? 12.682  41.313  -20.180 1.00 36.27 ? 469 VAL A CB    1 
ATOM   3430  C  CG1   . VAL A 1 469 ? 11.741  40.384  -19.376 1.00 35.07 ? 469 VAL A CG1   1 
ATOM   3431  C  CG2   . VAL A 1 469 ? 12.852  42.653  -19.468 1.00 34.93 ? 469 VAL A CG2   1 
ATOM   3432  N  N     . THR A 1 470 ? 13.746  39.358  -22.435 1.00 35.37 ? 470 THR A N     1 
ATOM   3433  C  CA    . THR A 1 470 ? 13.730  38.164  -23.289 1.00 34.90 ? 470 THR A CA    1 
ATOM   3434  C  C     . THR A 1 470 ? 14.906  37.221  -23.020 1.00 35.05 ? 470 THR A C     1 
ATOM   3435  O  O     . THR A 1 470 ? 14.722  36.006  -22.965 1.00 34.55 ? 470 THR A O     1 
ATOM   3436  C  CB    . THR A 1 470 ? 13.727  38.536  -24.796 1.00 34.90 ? 470 THR A CB    1 
ATOM   3437  O  OG1   . THR A 1 470 ? 12.721  39.514  -25.039 1.00 34.49 ? 470 THR A OG1   1 
ATOM   3438  C  CG2   . THR A 1 470 ? 13.449  37.314  -25.660 1.00 34.46 ? 470 THR A CG2   1 
ATOM   3439  N  N     . LYS A 1 471 ? 16.110  37.777  -22.869 1.00 35.73 ? 471 LYS A N     1 
ATOM   3440  C  CA    . LYS A 1 471 ? 17.285  36.956  -22.553 1.00 36.14 ? 471 LYS A CA    1 
ATOM   3441  C  C     . LYS A 1 471 ? 17.075  36.186  -21.245 1.00 35.64 ? 471 LYS A C     1 
ATOM   3442  O  O     . LYS A 1 471 ? 17.411  35.013  -21.153 1.00 35.71 ? 471 LYS A O     1 
ATOM   3443  C  CB    . LYS A 1 471 ? 18.573  37.790  -22.520 1.00 37.05 ? 471 LYS A CB    1 
ATOM   3444  C  CG    . LYS A 1 471 ? 19.062  38.252  -23.884 1.00 37.47 ? 471 LYS A CG    1 
ATOM   3445  C  CD    . LYS A 1 471 ? 20.481  38.855  -23.830 1.00 39.09 ? 471 LYS A CD    1 
ATOM   3446  C  CE    . LYS A 1 471 ? 21.569  37.769  -23.888 1.00 42.65 ? 471 LYS A CE    1 
ATOM   3447  N  NZ    . LYS A 1 471 ? 22.980  38.293  -23.941 1.00 43.30 ? 471 LYS A NZ    1 
ATOM   3448  N  N     . VAL A 1 472 ? 16.475  36.836  -20.253 1.00 35.53 ? 472 VAL A N     1 
ATOM   3449  C  CA    . VAL A 1 472 ? 16.155  36.185  -18.972 1.00 35.21 ? 472 VAL A CA    1 
ATOM   3450  C  C     . VAL A 1 472 ? 15.116  35.087  -19.138 1.00 34.55 ? 472 VAL A C     1 
ATOM   3451  O  O     . VAL A 1 472 ? 15.211  34.038  -18.504 1.00 35.01 ? 472 VAL A O     1 
ATOM   3452  C  CB    . VAL A 1 472 ? 15.626  37.194  -17.935 1.00 35.13 ? 472 VAL A CB    1 
ATOM   3453  C  CG1   . VAL A 1 472 ? 15.079  36.467  -16.697 1.00 34.85 ? 472 VAL A CG1   1 
ATOM   3454  C  CG2   . VAL A 1 472 ? 16.721  38.179  -17.559 1.00 35.44 ? 472 VAL A CG2   1 
ATOM   3455  N  N     . VAL A 1 473 ? 14.123  35.339  -19.989 1.00 33.71 ? 473 VAL A N     1 
ATOM   3456  C  CA    . VAL A 1 473 ? 13.028  34.404  -20.192 1.00 32.63 ? 473 VAL A CA    1 
ATOM   3457  C  C     . VAL A 1 473 ? 13.549  33.128  -20.849 1.00 32.58 ? 473 VAL A C     1 
ATOM   3458  O  O     . VAL A 1 473 ? 13.196  32.029  -20.427 1.00 32.49 ? 473 VAL A O     1 
ATOM   3459  C  CB    . VAL A 1 473 ? 11.869  35.030  -21.013 1.00 32.33 ? 473 VAL A CB    1 
ATOM   3460  C  CG1   . VAL A 1 473 ? 10.759  34.019  -21.226 1.00 31.73 ? 473 VAL A CG1   1 
ATOM   3461  C  CG2   . VAL A 1 473 ? 11.300  36.259  -20.304 1.00 32.67 ? 473 VAL A CG2   1 
ATOM   3462  N  N     . VAL A 1 474 ? 14.400  33.277  -21.863 1.00 32.60 ? 474 VAL A N     1 
ATOM   3463  C  CA    . VAL A 1 474 ? 15.046  32.136  -22.503 1.00 32.99 ? 474 VAL A CA    1 
ATOM   3464  C  C     . VAL A 1 474 ? 15.746  31.270  -21.460 1.00 34.05 ? 474 VAL A C     1 
ATOM   3465  O  O     . VAL A 1 474 ? 15.532  30.066  -21.422 1.00 34.35 ? 474 VAL A O     1 
ATOM   3466  C  CB    . VAL A 1 474 ? 16.048  32.570  -23.606 1.00 33.72 ? 474 VAL A CB    1 
ATOM   3467  C  CG1   . VAL A 1 474 ? 16.956  31.400  -24.037 1.00 33.26 ? 474 VAL A CG1   1 
ATOM   3468  C  CG2   . VAL A 1 474 ? 15.299  33.112  -24.807 1.00 32.91 ? 474 VAL A CG2   1 
ATOM   3469  N  N     . ARG A 1 475 ? 16.561  31.886  -20.605 1.00 34.61 ? 475 ARG A N     1 
ATOM   3470  C  CA    . ARG A 1 475 ? 17.280  31.141  -19.574 1.00 35.75 ? 475 ARG A CA    1 
ATOM   3471  C  C     . ARG A 1 475 ? 16.347  30.461  -18.554 1.00 35.53 ? 475 ARG A C     1 
ATOM   3472  O  O     . ARG A 1 475 ? 16.616  29.338  -18.115 1.00 35.61 ? 475 ARG A O     1 
ATOM   3473  C  CB    . ARG A 1 475 ? 18.293  32.040  -18.869 1.00 36.56 ? 475 ARG A CB    1 
ATOM   3474  C  CG    . ARG A 1 475 ? 19.479  32.436  -19.742 1.00 37.73 ? 475 ARG A CG    1 
ATOM   3475  C  CD    . ARG A 1 475 ? 20.439  33.315  -18.954 1.00 39.58 ? 475 ARG A CD    1 
ATOM   3476  N  NE    . ARG A 1 475 ? 21.614  33.706  -19.732 1.00 43.02 ? 475 ARG A NE    1 
ATOM   3477  C  CZ    . ARG A 1 475 ? 22.731  32.987  -19.847 1.00 42.58 ? 475 ARG A CZ    1 
ATOM   3478  N  NH1   . ARG A 1 475 ? 22.842  31.807  -19.244 1.00 42.48 ? 475 ARG A NH1   1 
ATOM   3479  N  NH2   . ARG A 1 475 ? 23.738  33.455  -20.574 1.00 42.06 ? 475 ARG A NH2   1 
ATOM   3480  N  N     . ASN A 1 476 ? 15.262  31.140  -18.184 1.00 34.97 ? 476 ASN A N     1 
ATOM   3481  C  CA    . ASN A 1 476 ? 14.253  30.543  -17.312 1.00 35.15 ? 476 ASN A CA    1 
ATOM   3482  C  C     . ASN A 1 476 ? 13.594  29.323  -17.923 1.00 34.99 ? 476 ASN A C     1 
ATOM   3483  O  O     . ASN A 1 476 ? 13.402  28.312  -17.248 1.00 35.24 ? 476 ASN A O     1 
ATOM   3484  C  CB    . ASN A 1 476 ? 13.190  31.569  -16.916 1.00 34.77 ? 476 ASN A CB    1 
ATOM   3485  C  CG    . ASN A 1 476 ? 13.695  32.539  -15.870 1.00 35.65 ? 476 ASN A CG    1 
ATOM   3486  O  OD1   . ASN A 1 476 ? 14.898  32.589  -15.591 1.00 37.75 ? 476 ASN A OD1   1 
ATOM   3487  N  ND2   . ASN A 1 476 ? 12.793  33.309  -15.287 1.00 34.80 ? 476 ASN A ND2   1 
ATOM   3488  N  N     . LEU A 1 477 ? 13.268  29.412  -19.206 1.00 34.65 ? 477 LEU A N     1 
ATOM   3489  C  CA    . LEU A 1 477 ? 12.580  28.326  -19.880 1.00 34.83 ? 477 LEU A CA    1 
ATOM   3490  C  C     . LEU A 1 477 ? 13.491  27.107  -20.129 1.00 35.98 ? 477 LEU A C     1 
ATOM   3491  O  O     . LEU A 1 477 ? 13.027  25.964  -20.079 1.00 36.07 ? 477 LEU A O     1 
ATOM   3492  C  CB    . LEU A 1 477 ? 11.893  28.826  -21.160 1.00 33.97 ? 477 LEU A CB    1 
ATOM   3493  C  CG    . LEU A 1 477 ? 10.719  29.792  -20.984 1.00 32.45 ? 477 LEU A CG    1 
ATOM   3494  C  CD1   . LEU A 1 477 ? 10.146  30.159  -22.339 1.00 33.19 ? 477 LEU A CD1   1 
ATOM   3495  C  CD2   . LEU A 1 477 ? 9.619   29.230  -20.102 1.00 32.16 ? 477 LEU A CD2   1 
ATOM   3496  N  N     . ASN A 1 478 ? 14.778  27.359  -20.370 1.00 36.87 ? 478 ASN A N     1 
ATOM   3497  C  CA    . ASN A 1 478 ? 15.791  26.301  -20.421 1.00 38.28 ? 478 ASN A CA    1 
ATOM   3498  C  C     . ASN A 1 478 ? 15.982  25.550  -19.123 1.00 38.65 ? 478 ASN A C     1 
ATOM   3499  O  O     . ASN A 1 478 ? 16.176  24.346  -19.133 1.00 39.46 ? 478 ASN A O     1 
ATOM   3500  C  CB    . ASN A 1 478 ? 17.148  26.866  -20.815 1.00 39.16 ? 478 ASN A CB    1 
ATOM   3501  C  CG    . ASN A 1 478 ? 17.437  26.666  -22.247 1.00 40.66 ? 478 ASN A CG    1 
ATOM   3502  O  OD1   . ASN A 1 478 ? 17.230  27.577  -23.061 1.00 43.58 ? 478 ASN A OD1   1 
ATOM   3503  N  ND2   . ASN A 1 478 ? 17.871  25.459  -22.599 1.00 38.46 ? 478 ASN A ND2   1 
ATOM   3504  N  N     . LYS A 1 479 ? 15.996  26.278  -18.013 1.00 38.70 ? 479 LYS A N     1 
ATOM   3505  C  CA    . LYS A 1 479 ? 16.015  25.652  -16.705 1.00 39.07 ? 479 LYS A CA    1 
ATOM   3506  C  C     . LYS A 1 479 ? 14.774  24.794  -16.510 1.00 38.72 ? 479 LYS A C     1 
ATOM   3507  O  O     . LYS A 1 479 ? 14.878  23.663  -16.040 1.00 39.00 ? 479 LYS A O     1 
ATOM   3508  C  CB    . LYS A 1 479 ? 16.160  26.697  -15.602 1.00 39.15 ? 479 LYS A CB    1 
ATOM   3509  C  CG    . LYS A 1 479 ? 17.626  26.973  -15.261 1.00 40.94 ? 479 LYS A CG    1 
ATOM   3510  C  CD    . LYS A 1 479 ? 17.795  28.254  -14.481 1.00 42.48 ? 479 LYS A CD    1 
ATOM   3511  C  CE    . LYS A 1 479 ? 19.260  28.574  -14.260 1.00 43.59 ? 479 LYS A CE    1 
ATOM   3512  N  NZ    . LYS A 1 479 ? 19.433  29.671  -13.267 1.00 43.42 ? 479 LYS A NZ    1 
ATOM   3513  N  N     . ILE A 1 480 ? 13.616  25.314  -16.923 1.00 37.90 ? 480 ILE A N     1 
ATOM   3514  C  CA    . ILE A 1 480 ? 12.362  24.582  -16.809 1.00 37.85 ? 480 ILE A CA    1 
ATOM   3515  C  C     . ILE A 1 480 ? 12.403  23.225  -17.514 1.00 38.38 ? 480 ILE A C     1 
ATOM   3516  O  O     . ILE A 1 480 ? 11.917  22.237  -16.957 1.00 39.06 ? 480 ILE A O     1 
ATOM   3517  C  CB    . ILE A 1 480 ? 11.147  25.446  -17.249 1.00 37.46 ? 480 ILE A CB    1 
ATOM   3518  C  CG1   . ILE A 1 480 ? 10.768  26.398  -16.108 1.00 37.17 ? 480 ILE A CG1   1 
ATOM   3519  C  CG2   . ILE A 1 480 ? 9.960   24.581  -17.664 1.00 35.73 ? 480 ILE A CG2   1 
ATOM   3520  C  CD1   . ILE A 1 480 ? 9.937   27.581  -16.539 1.00 38.92 ? 480 ILE A CD1   1 
ATOM   3521  N  N     . ILE A 1 481 ? 13.023  23.169  -18.696 1.00 38.27 ? 481 ILE A N     1 
ATOM   3522  C  CA    . ILE A 1 481 ? 13.180  21.921  -19.449 1.00 38.64 ? 481 ILE A CA    1 
ATOM   3523  C  C     . ILE A 1 481 ? 13.817  20.816  -18.610 1.00 40.30 ? 481 ILE A C     1 
ATOM   3524  O  O     . ILE A 1 481 ? 13.387  19.667  -18.679 1.00 40.37 ? 481 ILE A O     1 
ATOM   3525  C  CB    . ILE A 1 481 ? 14.008  22.132  -20.746 1.00 38.89 ? 481 ILE A CB    1 
ATOM   3526  C  CG1   . ILE A 1 481 ? 13.166  22.827  -21.821 1.00 38.01 ? 481 ILE A CG1   1 
ATOM   3527  C  CG2   . ILE A 1 481 ? 14.591  20.798  -21.275 1.00 38.64 ? 481 ILE A CG2   1 
ATOM   3528  C  CD1   . ILE A 1 481 ? 14.008  23.395  -22.959 1.00 38.54 ? 481 ILE A CD1   1 
ATOM   3529  N  N     . ASP A 1 482 ? 14.823  21.173  -17.808 1.00 41.53 ? 482 ASP A N     1 
ATOM   3530  C  CA    . ASP A 1 482 ? 15.598  20.200  -17.033 1.00 43.12 ? 482 ASP A CA    1 
ATOM   3531  C  C     . ASP A 1 482 ? 14.982  19.776  -15.711 1.00 43.98 ? 482 ASP A C     1 
ATOM   3532  O  O     . ASP A 1 482 ? 15.256  18.676  -15.227 1.00 45.16 ? 482 ASP A O     1 
ATOM   3533  C  CB    . ASP A 1 482 ? 17.016  20.727  -16.802 1.00 44.28 ? 482 ASP A CB    1 
ATOM   3534  C  CG    . ASP A 1 482 ? 17.754  20.973  -18.106 1.00 44.86 ? 482 ASP A CG    1 
ATOM   3535  O  OD1   . ASP A 1 482 ? 18.530  21.950  -18.191 1.00 45.47 ? 482 ASP A OD1   1 
ATOM   3536  O  OD2   . ASP A 1 482 ? 17.525  20.191  -19.054 1.00 44.35 ? 482 ASP A OD2   1 
ATOM   3537  N  N     . ILE A 1 483 ? 14.147  20.638  -15.137 1.00 43.79 ? 483 ILE A N     1 
ATOM   3538  C  CA    . ILE A 1 483 ? 13.527  20.373  -13.839 1.00 44.45 ? 483 ILE A CA    1 
ATOM   3539  C  C     . ILE A 1 483 ? 12.077  19.873  -13.946 1.00 43.97 ? 483 ILE A C     1 
ATOM   3540  O  O     . ILE A 1 483 ? 11.485  19.451  -12.952 1.00 44.64 ? 483 ILE A O     1 
ATOM   3541  C  CB    . ILE A 1 483 ? 13.597  21.621  -12.910 1.00 44.85 ? 483 ILE A CB    1 
ATOM   3542  C  CG1   . ILE A 1 483 ? 12.668  22.728  -13.403 1.00 44.23 ? 483 ILE A CG1   1 
ATOM   3543  C  CG2   . ILE A 1 483 ? 15.043  22.130  -12.777 1.00 45.69 ? 483 ILE A CG2   1 
ATOM   3544  C  CD1   . ILE A 1 483 ? 12.607  23.913  -12.485 1.00 46.55 ? 483 ILE A CD1   1 
ATOM   3545  N  N     . ASN A 1 484 ? 11.520  19.921  -15.152 1.00 43.08 ? 484 ASN A N     1 
ATOM   3546  C  CA    . ASN A 1 484 ? 10.137  19.527  -15.409 1.00 42.69 ? 484 ASN A CA    1 
ATOM   3547  C  C     . ASN A 1 484 ? 9.799   18.083  -14.989 1.00 43.43 ? 484 ASN A C     1 
ATOM   3548  O  O     . ASN A 1 484 ? 10.584  17.153  -15.219 1.00 43.84 ? 484 ASN A O     1 
ATOM   3549  C  CB    . ASN A 1 484 ? 9.831   19.718  -16.902 1.00 41.95 ? 484 ASN A CB    1 
ATOM   3550  C  CG    . ASN A 1 484 ? 8.364   20.003  -17.184 1.00 42.38 ? 484 ASN A CG    1 
ATOM   3551  O  OD1   . ASN A 1 484 ? 7.579   20.291  -16.290 1.00 42.83 ? 484 ASN A OD1   1 
ATOM   3552  N  ND2   . ASN A 1 484 ? 7.996   19.937  -18.454 1.00 44.91 ? 484 ASN A ND2   1 
ATOM   3553  N  N     . TYR A 1 485 ? 8.635   17.915  -14.358 1.00 43.43 ? 485 TYR A N     1 
ATOM   3554  C  CA    . TYR A 1 485 ? 8.023   16.603  -14.179 1.00 43.75 ? 485 TYR A CA    1 
ATOM   3555  C  C     . TYR A 1 485 ? 7.309   16.256  -15.479 1.00 42.61 ? 485 TYR A C     1 
ATOM   3556  O  O     . TYR A 1 485 ? 6.378   16.954  -15.888 1.00 42.49 ? 485 TYR A O     1 
ATOM   3557  C  CB    . TYR A 1 485 ? 7.028   16.616  -13.010 1.00 45.06 ? 485 TYR A CB    1 
ATOM   3558  C  CG    . TYR A 1 485 ? 6.168   15.375  -12.925 1.00 46.90 ? 485 TYR A CG    1 
ATOM   3559  C  CD1   . TYR A 1 485 ? 6.456   14.363  -12.014 1.00 48.67 ? 485 TYR A CD1   1 
ATOM   3560  C  CD2   . TYR A 1 485 ? 5.056   15.213  -13.767 1.00 48.45 ? 485 TYR A CD2   1 
ATOM   3561  C  CE1   . TYR A 1 485 ? 5.657   13.209  -11.944 1.00 50.67 ? 485 TYR A CE1   1 
ATOM   3562  C  CE2   . TYR A 1 485 ? 4.261   14.071  -13.713 1.00 49.25 ? 485 TYR A CE2   1 
ATOM   3563  C  CZ    . TYR A 1 485 ? 4.565   13.074  -12.804 1.00 50.23 ? 485 TYR A CZ    1 
ATOM   3564  O  OH    . TYR A 1 485 ? 3.762   11.956  -12.758 1.00 51.01 ? 485 TYR A OH    1 
ATOM   3565  N  N     . TYR A 1 486 ? 7.755   15.193  -16.135 1.00 42.07 ? 486 TYR A N     1 
ATOM   3566  C  CA    . TYR A 1 486 ? 7.172   14.757  -17.398 1.00 40.91 ? 486 TYR A CA    1 
ATOM   3567  C  C     . TYR A 1 486 ? 6.192   13.609  -17.186 1.00 41.25 ? 486 TYR A C     1 
ATOM   3568  O  O     . TYR A 1 486 ? 6.519   12.643  -16.500 1.00 42.31 ? 486 TYR A O     1 
ATOM   3569  C  CB    . TYR A 1 486 ? 8.272   14.335  -18.370 1.00 40.69 ? 486 TYR A CB    1 
ATOM   3570  C  CG    . TYR A 1 486 ? 9.146   15.482  -18.796 1.00 39.58 ? 486 TYR A CG    1 
ATOM   3571  C  CD1   . TYR A 1 486 ? 8.748   16.336  -19.826 1.00 37.45 ? 486 TYR A CD1   1 
ATOM   3572  C  CD2   . TYR A 1 486 ? 10.370  15.722  -18.170 1.00 39.96 ? 486 TYR A CD2   1 
ATOM   3573  C  CE1   . TYR A 1 486 ? 9.545   17.392  -20.219 1.00 37.46 ? 486 TYR A CE1   1 
ATOM   3574  C  CE2   . TYR A 1 486 ? 11.180  16.783  -18.560 1.00 38.75 ? 486 TYR A CE2   1 
ATOM   3575  C  CZ    . TYR A 1 486 ? 10.758  17.610  -19.579 1.00 38.16 ? 486 TYR A CZ    1 
ATOM   3576  O  OH    . TYR A 1 486 ? 11.545  18.658  -19.970 1.00 38.63 ? 486 TYR A OH    1 
ATOM   3577  N  N     . PRO A 1 487 ? 4.989   13.702  -17.789 1.00 40.60 ? 487 PRO A N     1 
ATOM   3578  C  CA    . PRO A 1 487 ? 3.967   12.674  -17.523 1.00 40.94 ? 487 PRO A CA    1 
ATOM   3579  C  C     . PRO A 1 487 ? 4.271   11.340  -18.214 1.00 41.35 ? 487 PRO A C     1 
ATOM   3580  O  O     . PRO A 1 487 ? 3.894   10.292  -17.700 1.00 42.48 ? 487 PRO A O     1 
ATOM   3581  C  CB    . PRO A 1 487 ? 2.673   13.301  -18.052 1.00 40.24 ? 487 PRO A CB    1 
ATOM   3582  C  CG    . PRO A 1 487 ? 3.131   14.317  -19.091 1.00 39.85 ? 487 PRO A CG    1 
ATOM   3583  C  CD    . PRO A 1 487 ? 4.537   14.734  -18.747 1.00 39.27 ? 487 PRO A CD    1 
ATOM   3584  N  N     . VAL A 1 488 ? 4.961   11.386  -19.354 1.00 40.85 ? 488 VAL A N     1 
ATOM   3585  C  CA    . VAL A 1 488 ? 5.422   10.183  -20.054 1.00 41.04 ? 488 VAL A CA    1 
ATOM   3586  C  C     . VAL A 1 488 ? 6.895   10.312  -20.497 1.00 41.24 ? 488 VAL A C     1 
ATOM   3587  O  O     . VAL A 1 488 ? 7.344   11.407  -20.849 1.00 40.61 ? 488 VAL A O     1 
ATOM   3588  C  CB    . VAL A 1 488 ? 4.518   9.845   -21.282 1.00 40.89 ? 488 VAL A CB    1 
ATOM   3589  C  CG1   . VAL A 1 488 ? 3.071   9.500   -20.838 1.00 40.59 ? 488 VAL A CG1   1 
ATOM   3590  C  CG2   . VAL A 1 488 ? 4.538   10.971  -22.324 1.00 39.32 ? 488 VAL A CG2   1 
ATOM   3591  N  N     . PRO A 1 489 ? 7.656   9.198   -20.476 1.00 42.08 ? 489 PRO A N     1 
ATOM   3592  C  CA    . PRO A 1 489 ? 9.067   9.243   -20.896 1.00 41.99 ? 489 PRO A CA    1 
ATOM   3593  C  C     . PRO A 1 489 ? 9.322   9.835   -22.292 1.00 41.22 ? 489 PRO A C     1 
ATOM   3594  O  O     . PRO A 1 489 ? 10.368  10.461  -22.509 1.00 41.08 ? 489 PRO A O     1 
ATOM   3595  C  CB    . PRO A 1 489 ? 9.515   7.779   -20.829 1.00 43.38 ? 489 PRO A CB    1 
ATOM   3596  C  CG    . PRO A 1 489 ? 8.259   6.964   -20.616 1.00 43.77 ? 489 PRO A CG    1 
ATOM   3597  C  CD    . PRO A 1 489 ? 7.255   7.860   -20.003 1.00 42.81 ? 489 PRO A CD    1 
ATOM   3598  N  N     . GLU A 1 490 ? 8.380   9.659   -23.216 1.00 40.60 ? 490 GLU A N     1 
ATOM   3599  C  CA    . GLU A 1 490 ? 8.522   10.177  -24.582 1.00 39.78 ? 490 GLU A CA    1 
ATOM   3600  C  C     . GLU A 1 490 ? 8.539   11.719  -24.643 1.00 38.82 ? 490 GLU A C     1 
ATOM   3601  O  O     . GLU A 1 490 ? 9.160   12.302  -25.544 1.00 38.17 ? 490 GLU A O     1 
ATOM   3602  C  CB    . GLU A 1 490 ? 7.398   9.647   -25.480 1.00 39.92 ? 490 GLU A CB    1 
ATOM   3603  C  CG    . GLU A 1 490 ? 7.454   8.145   -25.803 1.00 41.95 ? 490 GLU A CG    1 
ATOM   3604  C  CD    . GLU A 1 490 ? 6.810   7.259   -24.737 1.00 45.34 ? 490 GLU A CD    1 
ATOM   3605  O  OE1   . GLU A 1 490 ? 6.154   7.790   -23.810 1.00 46.55 ? 490 GLU A OE1   1 
ATOM   3606  O  OE2   . GLU A 1 490 ? 6.959   6.017   -24.829 1.00 47.12 ? 490 GLU A OE2   1 
ATOM   3607  N  N     . ALA A 1 491 ? 7.832   12.363  -23.706 1.00 37.98 ? 491 ALA A N     1 
ATOM   3608  C  CA    . ALA A 1 491 ? 7.827   13.820  -23.578 1.00 37.18 ? 491 ALA A CA    1 
ATOM   3609  C  C     . ALA A 1 491 ? 9.179   14.331  -23.068 1.00 37.49 ? 491 ALA A C     1 
ATOM   3610  O  O     . ALA A 1 491 ? 9.697   15.337  -23.549 1.00 36.25 ? 491 ALA A O     1 
ATOM   3611  C  CB    . ALA A 1 491 ? 6.703   14.277  -22.659 1.00 36.66 ? 491 ALA A CB    1 
ATOM   3612  N  N     . CYS A 1 492 ? 9.741   13.614  -22.102 1.00 38.83 ? 492 CYS A N     1 
ATOM   3613  C  CA    . CYS A 1 492 ? 11.057  13.924  -21.566 1.00 39.71 ? 492 CYS A CA    1 
ATOM   3614  C  C     . CYS A 1 492 ? 12.131  13.843  -22.655 1.00 39.97 ? 492 CYS A C     1 
ATOM   3615  O  O     . CYS A 1 492 ? 12.950  14.747  -22.808 1.00 39.50 ? 492 CYS A O     1 
ATOM   3616  C  CB    . CYS A 1 492 ? 11.375  12.966  -20.423 1.00 40.59 ? 492 CYS A CB    1 
ATOM   3617  S  SG    . CYS A 1 492 ? 12.921  13.320  -19.605 1.00 42.56 ? 492 CYS A SG    1 
ATOM   3618  N  N     . LEU A 1 493 ? 12.092  12.760  -23.426 1.00 41.08 ? 493 LEU A N     1 
ATOM   3619  C  CA    . LEU A 1 493 ? 13.070  12.480  -24.474 1.00 41.85 ? 493 LEU A CA    1 
ATOM   3620  C  C     . LEU A 1 493 ? 13.059  13.607  -25.494 1.00 41.14 ? 493 LEU A C     1 
ATOM   3621  O  O     . LEU A 1 493 ? 14.101  14.166  -25.839 1.00 41.73 ? 493 LEU A O     1 
ATOM   3622  C  CB    . LEU A 1 493 ? 12.722  11.156  -25.159 1.00 42.30 ? 493 LEU A CB    1 
ATOM   3623  C  CG    . LEU A 1 493 ? 13.770  10.188  -25.726 1.00 45.32 ? 493 LEU A CG    1 
ATOM   3624  C  CD1   . LEU A 1 493 ? 13.281  9.654   -27.078 1.00 45.19 ? 493 LEU A CD1   1 
ATOM   3625  C  CD2   . LEU A 1 493 ? 15.203  10.763  -25.856 1.00 46.03 ? 493 LEU A CD2   1 
ATOM   3626  N  N     . SER A 1 494 ? 11.860  13.943  -25.954 1.00 40.31 ? 494 SER A N     1 
ATOM   3627  C  CA    . SER A 1 494 ? 11.639  14.979  -26.944 1.00 39.58 ? 494 SER A CA    1 
ATOM   3628  C  C     . SER A 1 494 ? 12.227  16.325  -26.511 1.00 39.33 ? 494 SER A C     1 
ATOM   3629  O  O     . SER A 1 494 ? 12.978  16.959  -27.267 1.00 39.24 ? 494 SER A O     1 
ATOM   3630  C  CB    . SER A 1 494 ? 10.136  15.091  -27.216 1.00 38.88 ? 494 SER A CB    1 
ATOM   3631  O  OG    . SER A 1 494 ? 9.788   16.349  -27.753 1.00 38.61 ? 494 SER A OG    1 
ATOM   3632  N  N     . ASN A 1 495 ? 11.913  16.735  -25.285 1.00 39.45 ? 495 ASN A N     1 
ATOM   3633  C  CA    . ASN A 1 495 ? 12.325  18.043  -24.771 1.00 39.58 ? 495 ASN A CA    1 
ATOM   3634  C  C     . ASN A 1 495 ? 13.829  18.172  -24.539 1.00 40.44 ? 495 ASN A C     1 
ATOM   3635  O  O     . ASN A 1 495 ? 14.387  19.259  -24.685 1.00 40.30 ? 495 ASN A O     1 
ATOM   3636  C  CB    . ASN A 1 495 ? 11.572  18.384  -23.482 1.00 39.49 ? 495 ASN A CB    1 
ATOM   3637  C  CG    . ASN A 1 495 ? 10.838  19.708  -23.574 1.00 39.08 ? 495 ASN A CG    1 
ATOM   3638  O  OD1   . ASN A 1 495 ? 10.506  20.166  -24.665 1.00 39.41 ? 495 ASN A OD1   1 
ATOM   3639  N  ND2   . ASN A 1 495 ? 10.567  20.321  -22.427 1.00 39.34 ? 495 ASN A ND2   1 
ATOM   3640  N  N     . LYS A 1 496 ? 14.469  17.063  -24.181 1.00 41.44 ? 496 LYS A N     1 
ATOM   3641  C  CA    . LYS A 1 496 ? 15.900  17.039  -23.898 1.00 42.70 ? 496 LYS A CA    1 
ATOM   3642  C  C     . LYS A 1 496 ? 16.731  16.915  -25.181 1.00 42.64 ? 496 LYS A C     1 
ATOM   3643  O  O     . LYS A 1 496 ? 17.866  17.376  -25.227 1.00 43.12 ? 496 LYS A O     1 
ATOM   3644  C  CB    . LYS A 1 496 ? 16.244  15.900  -22.928 1.00 44.21 ? 496 LYS A CB    1 
ATOM   3645  C  CG    . LYS A 1 496 ? 15.571  16.006  -21.558 1.00 46.21 ? 496 LYS A CG    1 
ATOM   3646  C  CD    . LYS A 1 496 ? 16.485  16.578  -20.492 1.00 50.40 ? 496 LYS A CD    1 
ATOM   3647  C  CE    . LYS A 1 496 ? 15.854  16.402  -19.101 1.00 53.01 ? 496 LYS A CE    1 
ATOM   3648  N  NZ    . LYS A 1 496 ? 16.786  16.761  -17.980 1.00 55.57 ? 496 LYS A NZ    1 
ATOM   3649  N  N     . ARG A 1 497 ? 16.166  16.294  -26.212 1.00 41.97 ? 497 ARG A N     1 
ATOM   3650  C  CA    . ARG A 1 497 ? 16.825  16.229  -27.518 1.00 42.22 ? 497 ARG A CA    1 
ATOM   3651  C  C     . ARG A 1 497 ? 16.866  17.567  -28.268 1.00 41.11 ? 497 ARG A C     1 
ATOM   3652  O  O     . ARG A 1 497 ? 17.902  17.938  -28.808 1.00 41.63 ? 497 ARG A O     1 
ATOM   3653  C  CB    . ARG A 1 497 ? 16.171  15.178  -28.414 1.00 42.19 ? 497 ARG A CB    1 
ATOM   3654  C  CG    . ARG A 1 497 ? 16.759  13.797  -28.292 1.00 43.94 ? 497 ARG A CG    1 
ATOM   3655  C  CD    . ARG A 1 497 ? 16.029  12.851  -29.221 1.00 44.87 ? 497 ARG A CD    1 
ATOM   3656  N  NE    . ARG A 1 497 ? 16.495  11.480  -29.056 1.00 47.56 ? 497 ARG A NE    1 
ATOM   3657  C  CZ    . ARG A 1 497 ? 15.881  10.407  -29.553 1.00 48.47 ? 497 ARG A CZ    1 
ATOM   3658  N  NH1   . ARG A 1 497 ? 14.761  10.533  -30.257 1.00 45.93 ? 497 ARG A NH1   1 
ATOM   3659  N  NH2   . ARG A 1 497 ? 16.395  9.201   -29.345 1.00 50.50 ? 497 ARG A NH2   1 
ATOM   3660  N  N     . HIS A 1 498 ? 15.734  18.269  -28.315 1.00 39.65 ? 498 HIS A N     1 
ATOM   3661  C  CA    . HIS A 1 498 ? 15.590  19.434  -29.189 1.00 38.27 ? 498 HIS A CA    1 
ATOM   3662  C  C     . HIS A 1 498 ? 15.470  20.760  -28.419 1.00 37.58 ? 498 HIS A C     1 
ATOM   3663  O  O     . HIS A 1 498 ? 15.716  21.832  -28.981 1.00 37.50 ? 498 HIS A O     1 
ATOM   3664  C  CB    . HIS A 1 498 ? 14.408  19.222  -30.150 1.00 37.51 ? 498 HIS A CB    1 
ATOM   3665  C  CG    . HIS A 1 498 ? 14.282  17.813  -30.641 1.00 37.59 ? 498 HIS A CG    1 
ATOM   3666  N  ND1   . HIS A 1 498 ? 15.258  17.195  -31.396 1.00 38.74 ? 498 HIS A ND1   1 
ATOM   3667  C  CD2   . HIS A 1 498 ? 13.304  16.893  -30.473 1.00 37.61 ? 498 HIS A CD2   1 
ATOM   3668  C  CE1   . HIS A 1 498 ? 14.885  15.959  -31.677 1.00 37.84 ? 498 HIS A CE1   1 
ATOM   3669  N  NE2   . HIS A 1 498 ? 13.701  15.750  -31.132 1.00 37.73 ? 498 HIS A NE2   1 
ATOM   3670  N  N     . ARG A 1 499 ? 15.109  20.680  -27.137 1.00 36.80 ? 499 ARG A N     1 
ATOM   3671  C  CA    . ARG A 1 499 ? 14.934  21.863  -26.278 1.00 36.20 ? 499 ARG A CA    1 
ATOM   3672  C  C     . ARG A 1 499 ? 14.131  22.986  -26.923 1.00 35.30 ? 499 ARG A C     1 
ATOM   3673  O  O     . ARG A 1 499 ? 14.609  24.116  -26.969 1.00 35.35 ? 499 ARG A O     1 
ATOM   3674  C  CB    . ARG A 1 499 ? 16.283  22.453  -25.860 1.00 37.00 ? 499 ARG A CB    1 
ATOM   3675  C  CG    . ARG A 1 499 ? 17.279  21.482  -25.300 1.00 37.61 ? 499 ARG A CG    1 
ATOM   3676  C  CD    . ARG A 1 499 ? 18.294  22.202  -24.436 1.00 37.94 ? 499 ARG A CD    1 
ATOM   3677  N  NE    . ARG A 1 499 ? 18.474  21.340  -23.305 1.00 39.60 ? 499 ARG A NE    1 
ATOM   3678  C  CZ    . ARG A 1 499 ? 18.209  21.624  -22.043 1.00 36.41 ? 499 ARG A CZ    1 
ATOM   3679  N  NH1   . ARG A 1 499 ? 17.830  22.828  -21.656 1.00 32.13 ? 499 ARG A NH1   1 
ATOM   3680  N  NH2   . ARG A 1 499 ? 18.388  20.659  -21.160 1.00 37.49 ? 499 ARG A NH2   1 
ATOM   3681  N  N     . PRO A 1 500 ? 12.905  22.701  -27.401 1.00 34.48 ? 500 PRO A N     1 
ATOM   3682  C  CA    . PRO A 1 500 ? 12.187  23.839  -27.956 1.00 33.75 ? 500 PRO A CA    1 
ATOM   3683  C  C     . PRO A 1 500 ? 11.636  24.695  -26.825 1.00 33.37 ? 500 PRO A C     1 
ATOM   3684  O  O     . PRO A 1 500 ? 11.371  24.181  -25.743 1.00 33.33 ? 500 PRO A O     1 
ATOM   3685  C  CB    . PRO A 1 500 ? 11.032  23.181  -28.720 1.00 33.64 ? 500 PRO A CB    1 
ATOM   3686  C  CG    . PRO A 1 500 ? 10.783  21.902  -27.989 1.00 33.62 ? 500 PRO A CG    1 
ATOM   3687  C  CD    . PRO A 1 500 ? 12.106  21.460  -27.426 1.00 33.70 ? 500 PRO A CD    1 
ATOM   3688  N  N     . ILE A 1 501 ? 11.484  25.992  -27.060 1.00 33.60 ? 501 ILE A N     1 
ATOM   3689  C  CA    . ILE A 1 501 ? 10.726  26.843  -26.138 1.00 33.38 ? 501 ILE A CA    1 
ATOM   3690  C  C     . ILE A 1 501 ? 9.739   27.723  -26.908 1.00 33.04 ? 501 ILE A C     1 
ATOM   3691  O  O     . ILE A 1 501 ? 9.812   27.837  -28.138 1.00 32.66 ? 501 ILE A O     1 
ATOM   3692  C  CB    . ILE A 1 501 ? 11.628  27.695  -25.182 1.00 33.61 ? 501 ILE A CB    1 
ATOM   3693  C  CG1   . ILE A 1 501 ? 12.484  28.698  -25.953 1.00 34.03 ? 501 ILE A CG1   1 
ATOM   3694  C  CG2   . ILE A 1 501 ? 12.499  26.799  -24.281 1.00 33.69 ? 501 ILE A CG2   1 
ATOM   3695  C  CD1   . ILE A 1 501 ? 13.152  29.737  -25.041 1.00 34.60 ? 501 ILE A CD1   1 
ATOM   3696  N  N     . GLY A 1 502 ? 8.802   28.321  -26.182 1.00 32.50 ? 502 GLY A N     1 
ATOM   3697  C  CA    . GLY A 1 502 ? 7.843   29.187  -26.805 1.00 32.22 ? 502 GLY A CA    1 
ATOM   3698  C  C     . GLY A 1 502 ? 7.682   30.440  -25.995 1.00 32.19 ? 502 GLY A C     1 
ATOM   3699  O  O     . GLY A 1 502 ? 7.030   30.427  -24.958 1.00 32.54 ? 502 GLY A O     1 
ATOM   3700  N  N     . ILE A 1 503 ? 8.279   31.526  -26.463 1.00 32.13 ? 503 ILE A N     1 
ATOM   3701  C  CA    . ILE A 1 503 ? 8.095   32.818  -25.817 1.00 32.35 ? 503 ILE A CA    1 
ATOM   3702  C  C     . ILE A 1 503 ? 7.047   33.569  -26.608 1.00 32.54 ? 503 ILE A C     1 
ATOM   3703  O  O     . ILE A 1 503 ? 7.145   33.682  -27.840 1.00 33.03 ? 503 ILE A O     1 
ATOM   3704  C  CB    . ILE A 1 503 ? 9.412   33.619  -25.720 1.00 33.04 ? 503 ILE A CB    1 
ATOM   3705  C  CG1   . ILE A 1 503 ? 10.433  32.840  -24.871 1.00 33.40 ? 503 ILE A CG1   1 
ATOM   3706  C  CG2   . ILE A 1 503 ? 9.163   35.009  -25.140 1.00 31.56 ? 503 ILE A CG2   1 
ATOM   3707  C  CD1   . ILE A 1 503 ? 11.846  33.399  -24.897 1.00 33.42 ? 503 ILE A CD1   1 
ATOM   3708  N  N     . GLY A 1 504 ? 6.013   34.022  -25.898 1.00 32.20 ? 504 GLY A N     1 
ATOM   3709  C  CA    . GLY A 1 504 ? 4.919   34.769  -26.497 1.00 31.15 ? 504 GLY A CA    1 
ATOM   3710  C  C     . GLY A 1 504 ? 4.828   36.162  -25.912 1.00 31.31 ? 504 GLY A C     1 
ATOM   3711  O  O     . GLY A 1 504 ? 5.778   36.646  -25.265 1.00 30.81 ? 504 GLY A O     1 
ATOM   3712  N  N     . VAL A 1 505 ? 3.678   36.801  -26.135 1.00 31.05 ? 505 VAL A N     1 
ATOM   3713  C  CA    . VAL A 1 505 ? 3.458   38.180  -25.730 1.00 31.21 ? 505 VAL A CA    1 
ATOM   3714  C  C     . VAL A 1 505 ? 2.028   38.378  -25.210 1.00 31.58 ? 505 VAL A C     1 
ATOM   3715  O  O     . VAL A 1 505 ? 1.155   37.528  -25.405 1.00 31.64 ? 505 VAL A O     1 
ATOM   3716  C  CB    . VAL A 1 505 ? 3.693   39.176  -26.915 1.00 31.52 ? 505 VAL A CB    1 
ATOM   3717  C  CG1   . VAL A 1 505 ? 5.080   39.019  -27.527 1.00 30.71 ? 505 VAL A CG1   1 
ATOM   3718  C  CG2   . VAL A 1 505 ? 2.599   39.025  -27.992 1.00 30.87 ? 505 VAL A CG2   1 
ATOM   3719  N  N     . GLN A 1 506 ? 1.807   39.505  -24.546 1.00 31.76 ? 506 GLN A N     1 
ATOM   3720  C  CA    . GLN A 1 506 ? 0.462   40.010  -24.258 1.00 32.50 ? 506 GLN A CA    1 
ATOM   3721  C  C     . GLN A 1 506 ? 0.473   41.536  -24.278 1.00 32.80 ? 506 GLN A C     1 
ATOM   3722  O  O     . GLN A 1 506 ? 1.536   42.163  -24.232 1.00 33.34 ? 506 GLN A O     1 
ATOM   3723  C  CB    . GLN A 1 506 ? -0.044  39.513  -22.905 1.00 32.79 ? 506 GLN A CB    1 
ATOM   3724  C  CG    . GLN A 1 506 ? 0.943   39.674  -21.756 1.00 33.53 ? 506 GLN A CG    1 
ATOM   3725  C  CD    . GLN A 1 506 ? 0.408   39.049  -20.504 1.00 37.36 ? 506 GLN A CD    1 
ATOM   3726  O  OE1   . GLN A 1 506 ? -0.356  39.675  -19.756 1.00 38.20 ? 506 GLN A OE1   1 
ATOM   3727  N  NE2   . GLN A 1 506 ? 0.787   37.790  -20.265 1.00 37.74 ? 506 GLN A NE2   1 
ATOM   3728  N  N     . GLY A 1 507 ? -0.708  42.128  -24.364 1.00 33.21 ? 507 GLY A N     1 
ATOM   3729  C  CA    . GLY A 1 507 ? -0.841  43.582  -24.339 1.00 33.72 ? 507 GLY A CA    1 
ATOM   3730  C  C     . GLY A 1 507 ? -0.285  44.318  -25.538 1.00 33.88 ? 507 GLY A C     1 
ATOM   3731  O  O     . GLY A 1 507 ? 0.054   45.490  -25.435 1.00 34.31 ? 507 GLY A O     1 
ATOM   3732  N  N     . LEU A 1 508 ? -0.191  43.643  -26.678 1.00 34.21 ? 508 LEU A N     1 
ATOM   3733  C  CA    . LEU A 1 508 ? 0.191   44.306  -27.926 1.00 34.89 ? 508 LEU A CA    1 
ATOM   3734  C  C     . LEU A 1 508 ? -0.794  45.439  -28.260 1.00 35.59 ? 508 LEU A C     1 
ATOM   3735  O  O     . LEU A 1 508 ? -0.368  46.534  -28.629 1.00 36.36 ? 508 LEU A O     1 
ATOM   3736  C  CB    . LEU A 1 508 ? 0.279   43.281  -29.057 1.00 34.89 ? 508 LEU A CB    1 
ATOM   3737  C  CG    . LEU A 1 508 ? 0.818   43.504  -30.488 1.00 35.23 ? 508 LEU A CG    1 
ATOM   3738  C  CD1   . LEU A 1 508 ? -0.296  43.813  -31.465 1.00 35.98 ? 508 LEU A CD1   1 
ATOM   3739  C  CD2   . LEU A 1 508 ? 1.994   44.469  -30.612 1.00 35.98 ? 508 LEU A CD2   1 
ATOM   3740  N  N     . ALA A 1 509 ? -2.098  45.183  -28.093 1.00 35.51 ? 509 ALA A N     1 
ATOM   3741  C  CA    . ALA A 1 509 ? -3.124  46.202  -28.316 1.00 35.98 ? 509 ALA A CA    1 
ATOM   3742  C  C     . ALA A 1 509 ? -2.904  47.392  -27.401 1.00 36.05 ? 509 ALA A C     1 
ATOM   3743  O  O     . ALA A 1 509 ? -3.051  48.535  -27.830 1.00 36.79 ? 509 ALA A O     1 
ATOM   3744  C  CB    . ALA A 1 509 ? -4.525  45.634  -28.113 1.00 35.95 ? 509 ALA A CB    1 
ATOM   3745  N  N     . ASP A 1 510 ? -2.536  47.111  -26.151 1.00 35.39 ? 510 ASP A N     1 
ATOM   3746  C  CA    . ASP A 1 510 ? -2.223  48.144  -25.161 1.00 35.58 ? 510 ASP A CA    1 
ATOM   3747  C  C     . ASP A 1 510 ? -0.973  48.950  -25.505 1.00 35.57 ? 510 ASP A C     1 
ATOM   3748  O  O     . ASP A 1 510 ? -0.913  50.144  -25.202 1.00 36.37 ? 510 ASP A O     1 
ATOM   3749  C  CB    . ASP A 1 510 ? -2.101  47.544  -23.753 1.00 35.10 ? 510 ASP A CB    1 
ATOM   3750  C  CG    . ASP A 1 510 ? -3.342  46.750  -23.348 1.00 35.30 ? 510 ASP A CG    1 
ATOM   3751  O  OD1   . ASP A 1 510 ? -4.288  47.338  -22.770 1.00 35.15 ? 510 ASP A OD1   1 
ATOM   3752  O  OD2   . ASP A 1 510 ? -3.385  45.543  -23.643 1.00 34.36 ? 510 ASP A OD2   1 
ATOM   3753  N  N     . ALA A 1 511 ? 0.014   48.315  -26.134 1.00 34.78 ? 511 ALA A N     1 
ATOM   3754  C  CA    . ALA A 1 511 ? 1.255   49.010  -26.501 1.00 34.68 ? 511 ALA A CA    1 
ATOM   3755  C  C     . ALA A 1 511 ? 0.986   50.021  -27.603 1.00 35.34 ? 511 ALA A C     1 
ATOM   3756  O  O     . ALA A 1 511 ? 1.520   51.134  -27.576 1.00 35.78 ? 511 ALA A O     1 
ATOM   3757  C  CB    . ALA A 1 511 ? 2.335   48.029  -26.921 1.00 34.27 ? 511 ALA A CB    1 
ATOM   3758  N  N     . PHE A 1 512 ? 0.126   49.641  -28.552 1.00 35.04 ? 512 PHE A N     1 
ATOM   3759  C  CA    . PHE A 1 512 ? -0.289  50.542  -29.617 1.00 35.05 ? 512 PHE A CA    1 
ATOM   3760  C  C     . PHE A 1 512 ? -1.043  51.721  -29.043 1.00 35.70 ? 512 PHE A C     1 
ATOM   3761  O  O     . PHE A 1 512 ? -0.736  52.874  -29.355 1.00 35.93 ? 512 PHE A O     1 
ATOM   3762  C  CB    . PHE A 1 512 ? -1.152  49.819  -30.659 1.00 34.94 ? 512 PHE A CB    1 
ATOM   3763  C  CG    . PHE A 1 512 ? -0.389  48.840  -31.512 1.00 33.99 ? 512 PHE A CG    1 
ATOM   3764  C  CD1   . PHE A 1 512 ? 1.003   48.886  -31.591 1.00 33.06 ? 512 PHE A CD1   1 
ATOM   3765  C  CD2   . PHE A 1 512 ? -1.067  47.880  -32.251 1.00 33.64 ? 512 PHE A CD2   1 
ATOM   3766  C  CE1   . PHE A 1 512 ? 1.698   47.987  -32.378 1.00 33.36 ? 512 PHE A CE1   1 
ATOM   3767  C  CE2   . PHE A 1 512 ? -0.377  46.972  -33.038 1.00 33.44 ? 512 PHE A CE2   1 
ATOM   3768  C  CZ    . PHE A 1 512 ? 1.003   47.026  -33.106 1.00 33.28 ? 512 PHE A CZ    1 
ATOM   3769  N  N     . ILE A 1 513 ? -2.025  51.427  -28.193 1.00 35.65 ? 513 ILE A N     1 
ATOM   3770  C  CA    . ILE A 1 513 ? -2.812  52.476  -27.560 1.00 36.30 ? 513 ILE A CA    1 
ATOM   3771  C  C     . ILE A 1 513 ? -1.924  53.426  -26.735 1.00 36.95 ? 513 ILE A C     1 
ATOM   3772  O  O     . ILE A 1 513 ? -2.017  54.650  -26.894 1.00 37.87 ? 513 ILE A O     1 
ATOM   3773  C  CB    . ILE A 1 513 ? -3.983  51.914  -26.729 1.00 35.95 ? 513 ILE A CB    1 
ATOM   3774  C  CG1   . ILE A 1 513 ? -5.016  51.258  -27.654 1.00 36.12 ? 513 ILE A CG1   1 
ATOM   3775  C  CG2   . ILE A 1 513 ? -4.635  53.028  -25.922 1.00 35.92 ? 513 ILE A CG2   1 
ATOM   3776  C  CD1   . ILE A 1 513 ? -5.985  50.307  -26.933 1.00 37.07 ? 513 ILE A CD1   1 
ATOM   3777  N  N     . LEU A 1 514 ? -1.050  52.876  -25.893 1.00 36.32 ? 514 LEU A N     1 
ATOM   3778  C  CA    . LEU A 1 514 ? -0.135  53.717  -25.114 1.00 37.04 ? 514 LEU A CA    1 
ATOM   3779  C  C     . LEU A 1 514 ? 0.767   54.597  -25.984 1.00 37.76 ? 514 LEU A C     1 
ATOM   3780  O  O     . LEU A 1 514 ? 1.170   55.668  -25.535 1.00 38.30 ? 514 LEU A O     1 
ATOM   3781  C  CB    . LEU A 1 514 ? 0.717   52.893  -24.126 1.00 36.49 ? 514 LEU A CB    1 
ATOM   3782  C  CG    . LEU A 1 514 ? 0.026   52.244  -22.922 1.00 36.03 ? 514 LEU A CG    1 
ATOM   3783  C  CD1   . LEU A 1 514 ? 0.979   51.300  -22.225 1.00 34.55 ? 514 LEU A CD1   1 
ATOM   3784  C  CD2   . LEU A 1 514 ? -0.538  53.280  -21.937 1.00 34.98 ? 514 LEU A CD2   1 
ATOM   3785  N  N     . MET A 1 515 ? 1.072   54.148  -27.208 1.00 37.93 ? 515 MET A N     1 
ATOM   3786  C  CA    . MET A 1 515 ? 1.905   54.912  -28.158 1.00 38.73 ? 515 MET A CA    1 
ATOM   3787  C  C     . MET A 1 515 ? 1.034   55.840  -29.001 1.00 39.60 ? 515 MET A C     1 
ATOM   3788  O  O     . MET A 1 515 ? 1.541   56.585  -29.849 1.00 40.09 ? 515 MET A O     1 
ATOM   3789  C  CB    . MET A 1 515 ? 2.668   53.982  -29.109 1.00 38.56 ? 515 MET A CB    1 
ATOM   3790  C  CG    . MET A 1 515 ? 3.748   53.090  -28.492 1.00 38.68 ? 515 MET A CG    1 
ATOM   3791  S  SD    . MET A 1 515 ? 5.304   53.909  -28.087 1.00 42.04 ? 515 MET A SD    1 
ATOM   3792  C  CE    . MET A 1 515 ? 6.044   54.141  -29.696 1.00 40.56 ? 515 MET A CE    1 
ATOM   3793  N  N     . ARG A 1 516 ? -0.279  55.772  -28.772 1.00 39.79 ? 516 ARG A N     1 
ATOM   3794  C  CA    . ARG A 1 516 ? -1.287  56.540  -29.530 1.00 40.60 ? 516 ARG A CA    1 
ATOM   3795  C  C     . ARG A 1 516 ? -1.437  56.082  -30.982 1.00 40.57 ? 516 ARG A C     1 
ATOM   3796  O  O     . ARG A 1 516 ? -1.775  56.880  -31.866 1.00 41.29 ? 516 ARG A O     1 
ATOM   3797  C  CB    . ARG A 1 516 ? -0.993  58.042  -29.452 1.00 41.99 ? 516 ARG A CB    1 
ATOM   3798  C  CG    . ARG A 1 516 ? -0.960  58.598  -28.036 1.00 43.45 ? 516 ARG A CG    1 
ATOM   3799  C  CD    . ARG A 1 516 ? -2.350  59.055  -27.633 1.00 46.96 ? 516 ARG A CD    1 
ATOM   3800  N  NE    . ARG A 1 516 ? -2.983  58.191  -26.640 1.00 46.81 ? 516 ARG A NE    1 
ATOM   3801  C  CZ    . ARG A 1 516 ? -4.268  58.276  -26.285 1.00 47.56 ? 516 ARG A CZ    1 
ATOM   3802  N  NH1   . ARG A 1 516 ? -5.084  59.152  -26.859 1.00 46.08 ? 516 ARG A NH1   1 
ATOM   3803  N  NH2   . ARG A 1 516 ? -4.746  57.458  -25.362 1.00 48.31 ? 516 ARG A NH2   1 
ATOM   3804  N  N     . TYR A 1 517 ? -1.215  54.789  -31.213 1.00 40.02 ? 517 TYR A N     1 
ATOM   3805  C  CA    . TYR A 1 517 ? -1.215  54.215  -32.561 1.00 40.59 ? 517 TYR A CA    1 
ATOM   3806  C  C     . TYR A 1 517 ? -2.469  53.393  -32.845 1.00 40.55 ? 517 TYR A C     1 
ATOM   3807  O  O     . TYR A 1 517 ? -2.720  52.401  -32.162 1.00 39.76 ? 517 TYR A O     1 
ATOM   3808  C  CB    . TYR A 1 517 ? -0.002  53.296  -32.772 1.00 39.84 ? 517 TYR A CB    1 
ATOM   3809  C  CG    . TYR A 1 517 ? 1.370   53.944  -32.772 1.00 40.31 ? 517 TYR A CG    1 
ATOM   3810  C  CD1   . TYR A 1 517 ? 1.536   55.326  -32.932 1.00 40.61 ? 517 TYR A CD1   1 
ATOM   3811  C  CD2   . TYR A 1 517 ? 2.517   53.151  -32.654 1.00 39.54 ? 517 TYR A CD2   1 
ATOM   3812  C  CE1   . TYR A 1 517 ? 2.815   55.905  -32.941 1.00 41.45 ? 517 TYR A CE1   1 
ATOM   3813  C  CE2   . TYR A 1 517 ? 3.796   53.712  -32.667 1.00 39.65 ? 517 TYR A CE2   1 
ATOM   3814  C  CZ    . TYR A 1 517 ? 3.942   55.083  -32.812 1.00 41.25 ? 517 TYR A CZ    1 
ATOM   3815  O  OH    . TYR A 1 517 ? 5.217   55.617  -32.833 1.00 42.06 ? 517 TYR A OH    1 
ATOM   3816  N  N     . PRO A 1 518 ? -3.255  53.788  -33.866 1.00 41.65 ? 518 PRO A N     1 
ATOM   3817  C  CA    . PRO A 1 518 ? -4.319  52.885  -34.308 1.00 41.53 ? 518 PRO A CA    1 
ATOM   3818  C  C     . PRO A 1 518 ? -3.725  51.549  -34.742 1.00 41.07 ? 518 PRO A C     1 
ATOM   3819  O  O     . PRO A 1 518 ? -2.634  51.523  -35.322 1.00 41.18 ? 518 PRO A O     1 
ATOM   3820  C  CB    . PRO A 1 518 ? -4.929  53.619  -35.508 1.00 42.66 ? 518 PRO A CB    1 
ATOM   3821  C  CG    . PRO A 1 518 ? -4.610  55.070  -35.273 1.00 43.18 ? 518 PRO A CG    1 
ATOM   3822  C  CD    . PRO A 1 518 ? -3.247  55.051  -34.633 1.00 42.78 ? 518 PRO A CD    1 
ATOM   3823  N  N     . PHE A 1 519 ? -4.436  50.456  -34.461 1.00 40.41 ? 519 PHE A N     1 
ATOM   3824  C  CA    . PHE A 1 519 ? -3.949  49.114  -34.760 1.00 39.79 ? 519 PHE A CA    1 
ATOM   3825  C  C     . PHE A 1 519 ? -3.417  48.932  -36.192 1.00 40.50 ? 519 PHE A C     1 
ATOM   3826  O  O     . PHE A 1 519 ? -2.399  48.259  -36.395 1.00 39.92 ? 519 PHE A O     1 
ATOM   3827  C  CB    . PHE A 1 519 ? -5.041  48.075  -34.482 1.00 39.82 ? 519 PHE A CB    1 
ATOM   3828  C  CG    . PHE A 1 519 ? -4.502  46.691  -34.216 1.00 39.27 ? 519 PHE A CG    1 
ATOM   3829  C  CD1   . PHE A 1 519 ? -4.251  45.809  -35.270 1.00 38.67 ? 519 PHE A CD1   1 
ATOM   3830  C  CD2   . PHE A 1 519 ? -4.232  46.279  -32.908 1.00 38.42 ? 519 PHE A CD2   1 
ATOM   3831  C  CE1   . PHE A 1 519 ? -3.746  44.537  -35.023 1.00 38.87 ? 519 PHE A CE1   1 
ATOM   3832  C  CE2   . PHE A 1 519 ? -3.726  45.016  -32.649 1.00 38.55 ? 519 PHE A CE2   1 
ATOM   3833  C  CZ    . PHE A 1 519 ? -3.482  44.138  -33.705 1.00 39.03 ? 519 PHE A CZ    1 
ATOM   3834  N  N     . GLU A 1 520 ? -4.103  49.536  -37.166 1.00 41.37 ? 520 GLU A N     1 
ATOM   3835  C  CA    . GLU A 1 520 ? -3.808  49.341  -38.586 1.00 42.23 ? 520 GLU A CA    1 
ATOM   3836  C  C     . GLU A 1 520 ? -2.877  50.411  -39.173 1.00 42.63 ? 520 GLU A C     1 
ATOM   3837  O  O     . GLU A 1 520 ? -2.495  50.318  -40.341 1.00 42.81 ? 520 GLU A O     1 
ATOM   3838  C  CB    . GLU A 1 520 ? -5.102  49.350  -39.404 1.00 43.39 ? 520 GLU A CB    1 
ATOM   3839  C  CG    . GLU A 1 520 ? -6.165  48.354  -38.980 1.00 44.11 ? 520 GLU A CG    1 
ATOM   3840  C  CD    . GLU A 1 520 ? -7.551  48.792  -39.430 1.00 47.06 ? 520 GLU A CD    1 
ATOM   3841  O  OE1   . GLU A 1 520 ? -7.990  48.360  -40.527 1.00 48.07 ? 520 GLU A OE1   1 
ATOM   3842  O  OE2   . GLU A 1 520 ? -8.184  49.596  -38.702 1.00 47.43 ? 520 GLU A OE2   1 
ATOM   3843  N  N     . SER A 1 521 ? -2.538  51.424  -38.376 1.00 42.36 ? 521 SER A N     1 
ATOM   3844  C  CA    . SER A 1 521 ? -1.662  52.518  -38.823 1.00 42.77 ? 521 SER A CA    1 
ATOM   3845  C  C     . SER A 1 521 ? -0.275  52.018  -39.253 1.00 42.35 ? 521 SER A C     1 
ATOM   3846  O  O     . SER A 1 521 ? 0.167   50.957  -38.821 1.00 41.37 ? 521 SER A O     1 
ATOM   3847  C  CB    . SER A 1 521 ? -1.506  53.568  -37.714 1.00 42.68 ? 521 SER A CB    1 
ATOM   3848  O  OG    . SER A 1 521 ? -0.721  53.057  -36.644 1.00 40.93 ? 521 SER A OG    1 
ATOM   3849  N  N     . ALA A 1 522 ? 0.388   52.795  -40.105 1.00 43.33 ? 522 ALA A N     1 
ATOM   3850  C  CA    . ALA A 1 522 ? 1.757   52.527  -40.546 1.00 43.43 ? 522 ALA A CA    1 
ATOM   3851  C  C     . ALA A 1 522 ? 2.745   52.499  -39.372 1.00 42.86 ? 522 ALA A C     1 
ATOM   3852  O  O     . ALA A 1 522 ? 3.693   51.713  -39.376 1.00 42.29 ? 522 ALA A O     1 
ATOM   3853  C  CB    . ALA A 1 522 ? 2.186   53.571  -41.587 1.00 44.77 ? 522 ALA A CB    1 
ATOM   3854  N  N     . GLU A 1 523 ? 2.507   53.350  -38.372 1.00 42.89 ? 523 GLU A N     1 
ATOM   3855  C  CA    . GLU A 1 523 ? 3.310   53.380  -37.146 1.00 42.62 ? 523 GLU A CA    1 
ATOM   3856  C  C     . GLU A 1 523 ? 3.161   52.085  -36.343 1.00 41.35 ? 523 GLU A C     1 
ATOM   3857  O  O     . GLU A 1 523 ? 4.132   51.594  -35.772 1.00 40.80 ? 523 GLU A O     1 
ATOM   3858  C  CB    . GLU A 1 523 ? 2.923   54.576  -36.260 1.00 42.94 ? 523 GLU A CB    1 
ATOM   3859  C  CG    . GLU A 1 523 ? 3.264   55.952  -36.824 1.00 45.18 ? 523 GLU A CG    1 
ATOM   3860  C  CD    . GLU A 1 523 ? 2.205   56.473  -37.786 1.00 48.04 ? 523 GLU A CD    1 
ATOM   3861  O  OE1   . GLU A 1 523 ? 2.415   57.553  -38.373 1.00 49.50 ? 523 GLU A OE1   1 
ATOM   3862  O  OE2   . GLU A 1 523 ? 1.161   55.802  -37.961 1.00 48.35 ? 523 GLU A OE2   1 
ATOM   3863  N  N     . ALA A 1 524 ? 1.940   51.555  -36.288 1.00 40.99 ? 524 ALA A N     1 
ATOM   3864  C  CA    . ALA A 1 524 ? 1.667   50.290  -35.610 1.00 40.10 ? 524 ALA A CA    1 
ATOM   3865  C  C     . ALA A 1 524 ? 2.258   49.127  -36.392 1.00 40.15 ? 524 ALA A C     1 
ATOM   3866  O  O     . ALA A 1 524 ? 2.865   48.234  -35.802 1.00 39.69 ? 524 ALA A O     1 
ATOM   3867  C  CB    . ALA A 1 524 ? 0.173   50.088  -35.402 1.00 39.91 ? 524 ALA A CB    1 
ATOM   3868  N  N     . GLN A 1 525 ? 2.102   49.148  -37.714 1.00 40.82 ? 525 GLN A N     1 
ATOM   3869  C  CA    . GLN A 1 525 ? 2.660   48.097  -38.560 1.00 41.55 ? 525 GLN A CA    1 
ATOM   3870  C  C     . GLN A 1 525 ? 4.180   47.965  -38.434 1.00 41.23 ? 525 GLN A C     1 
ATOM   3871  O  O     . GLN A 1 525 ? 4.690   46.849  -38.384 1.00 41.12 ? 525 GLN A O     1 
ATOM   3872  C  CB    . GLN A 1 525 ? 2.225   48.257  -40.018 1.00 42.23 ? 525 GLN A CB    1 
ATOM   3873  C  CG    . GLN A 1 525 ? 0.742   47.932  -40.235 1.00 43.26 ? 525 GLN A CG    1 
ATOM   3874  C  CD    . GLN A 1 525 ? 0.321   48.058  -41.685 1.00 44.98 ? 525 GLN A CD    1 
ATOM   3875  O  OE1   . GLN A 1 525 ? 1.099   47.776  -42.604 1.00 47.50 ? 525 GLN A OE1   1 
ATOM   3876  N  NE2   . GLN A 1 525 ? -0.916  48.499  -41.901 1.00 47.07 ? 525 GLN A NE2   1 
ATOM   3877  N  N     . LEU A 1 526 ? 4.883   49.093  -38.354 1.00 41.73 ? 526 LEU A N     1 
ATOM   3878  C  CA    . LEU A 1 526 ? 6.333   49.103  -38.159 1.00 41.87 ? 526 LEU A CA    1 
ATOM   3879  C  C     . LEU A 1 526 ? 6.744   48.689  -36.737 1.00 41.23 ? 526 LEU A C     1 
ATOM   3880  O  O     . LEU A 1 526 ? 7.651   47.872  -36.573 1.00 41.09 ? 526 LEU A O     1 
ATOM   3881  C  CB    . LEU A 1 526 ? 6.944   50.474  -38.517 1.00 43.20 ? 526 LEU A CB    1 
ATOM   3882  C  CG    . LEU A 1 526 ? 8.474   50.657  -38.414 1.00 43.45 ? 526 LEU A CG    1 
ATOM   3883  C  CD1   . LEU A 1 526 ? 9.241   49.789  -39.415 1.00 42.04 ? 526 LEU A CD1   1 
ATOM   3884  C  CD2   . LEU A 1 526 ? 8.869   52.133  -38.559 1.00 43.96 ? 526 LEU A CD2   1 
ATOM   3885  N  N     . LEU A 1 527 ? 6.086   49.239  -35.716 1.00 40.71 ? 527 LEU A N     1 
ATOM   3886  C  CA    . LEU A 1 527 ? 6.401   48.856  -34.337 1.00 39.68 ? 527 LEU A CA    1 
ATOM   3887  C  C     . LEU A 1 527 ? 6.177   47.357  -34.161 1.00 39.18 ? 527 LEU A C     1 
ATOM   3888  O  O     . LEU A 1 527 ? 6.988   46.673  -33.528 1.00 39.25 ? 527 LEU A O     1 
ATOM   3889  C  CB    . LEU A 1 527 ? 5.585   49.666  -33.321 1.00 39.53 ? 527 LEU A CB    1 
ATOM   3890  C  CG    . LEU A 1 527 ? 5.793   49.360  -31.830 1.00 38.63 ? 527 LEU A CG    1 
ATOM   3891  C  CD1   . LEU A 1 527 ? 7.171   49.835  -31.325 1.00 38.33 ? 527 LEU A CD1   1 
ATOM   3892  C  CD2   . LEU A 1 527 ? 4.675   49.963  -30.990 1.00 37.99 ? 527 LEU A CD2   1 
ATOM   3893  N  N     . ASN A 1 528 ? 5.086   46.851  -34.739 1.00 38.93 ? 528 ASN A N     1 
ATOM   3894  C  CA    . ASN A 1 528 ? 4.831   45.405  -34.802 1.00 38.41 ? 528 ASN A CA    1 
ATOM   3895  C  C     . ASN A 1 528 ? 6.036   44.598  -35.351 1.00 38.38 ? 528 ASN A C     1 
ATOM   3896  O  O     . ASN A 1 528 ? 6.499   43.674  -34.704 1.00 38.07 ? 528 ASN A O     1 
ATOM   3897  C  CB    . ASN A 1 528 ? 3.540   45.101  -35.580 1.00 37.81 ? 528 ASN A CB    1 
ATOM   3898  C  CG    . ASN A 1 528 ? 3.258   43.618  -35.677 1.00 37.13 ? 528 ASN A CG    1 
ATOM   3899  O  OD1   . ASN A 1 528 ? 2.892   42.977  -34.690 1.00 36.80 ? 528 ASN A OD1   1 
ATOM   3900  N  ND2   . ASN A 1 528 ? 3.431   43.059  -36.867 1.00 35.69 ? 528 ASN A ND2   1 
ATOM   3901  N  N     . LYS A 1 529 ? 6.559   44.962  -36.520 1.00 39.37 ? 529 LYS A N     1 
ATOM   3902  C  CA    . LYS A 1 529 ? 7.798   44.329  -37.020 1.00 39.77 ? 529 LYS A CA    1 
ATOM   3903  C  C     . LYS A 1 529 ? 8.950   44.432  -36.007 1.00 39.34 ? 529 LYS A C     1 
ATOM   3904  O  O     . LYS A 1 529 ? 9.615   43.442  -35.704 1.00 39.05 ? 529 LYS A O     1 
ATOM   3905  C  CB    . LYS A 1 529 ? 8.258   44.978  -38.314 1.00 40.43 ? 529 LYS A CB    1 
ATOM   3906  C  CG    . LYS A 1 529 ? 7.383   44.758  -39.521 1.00 42.43 ? 529 LYS A CG    1 
ATOM   3907  C  CD    . LYS A 1 529 ? 8.131   45.306  -40.735 1.00 45.92 ? 529 LYS A CD    1 
ATOM   3908  C  CE    . LYS A 1 529 ? 7.219   45.577  -41.905 1.00 48.75 ? 529 LYS A CE    1 
ATOM   3909  N  NZ    . LYS A 1 529 ? 7.820   46.621  -42.797 1.00 49.15 ? 529 LYS A NZ    1 
ATOM   3910  N  N     . GLN A 1 530 ? 9.161   45.643  -35.495 1.00 39.32 ? 530 GLN A N     1 
ATOM   3911  C  CA    . GLN A 1 530 ? 10.291  45.975  -34.633 1.00 39.10 ? 530 GLN A CA    1 
ATOM   3912  C  C     . GLN A 1 530 ? 10.272  45.238  -33.311 1.00 37.78 ? 530 GLN A C     1 
ATOM   3913  O  O     . GLN A 1 530 ? 11.308  44.750  -32.883 1.00 37.69 ? 530 GLN A O     1 
ATOM   3914  C  CB    . GLN A 1 530 ? 10.341  47.480  -34.368 1.00 39.62 ? 530 GLN A CB    1 
ATOM   3915  C  CG    . GLN A 1 530 ? 10.622  48.320  -35.597 1.00 41.25 ? 530 GLN A CG    1 
ATOM   3916  C  CD    . GLN A 1 530 ? 10.604  49.820  -35.318 1.00 41.72 ? 530 GLN A CD    1 
ATOM   3917  O  OE1   . GLN A 1 530 ? 9.689   50.350  -34.672 1.00 41.75 ? 530 GLN A OE1   1 
ATOM   3918  N  NE2   . GLN A 1 530 ? 11.614  50.506  -35.812 1.00 42.03 ? 530 GLN A NE2   1 
ATOM   3919  N  N     . ILE A 1 531 ? 9.102   45.186  -32.668 1.00 36.92 ? 531 ILE A N     1 
ATOM   3920  C  CA    . ILE A 1 531 ? 8.890   44.427  -31.429 1.00 35.86 ? 531 ILE A CA    1 
ATOM   3921  C  C     . ILE A 1 531 ? 9.316   42.965  -31.599 1.00 35.15 ? 531 ILE A C     1 
ATOM   3922  O  O     . ILE A 1 531 ? 10.061  42.426  -30.781 1.00 34.33 ? 531 ILE A O     1 
ATOM   3923  C  CB    . ILE A 1 531 ? 7.396   44.490  -30.960 1.00 35.88 ? 531 ILE A CB    1 
ATOM   3924  C  CG1   . ILE A 1 531 ? 7.081   45.838  -30.292 1.00 36.33 ? 531 ILE A CG1   1 
ATOM   3925  C  CG2   . ILE A 1 531 ? 7.040   43.310  -30.026 1.00 34.77 ? 531 ILE A CG2   1 
ATOM   3926  C  CD1   . ILE A 1 531 ? 5.593   46.022  -29.892 1.00 35.24 ? 531 ILE A CD1   1 
ATOM   3927  N  N     . PHE A 1 532 ? 8.851   42.335  -32.676 1.00 34.96 ? 532 PHE A N     1 
ATOM   3928  C  CA    . PHE A 1 532 ? 9.149   40.916  -32.910 1.00 34.44 ? 532 PHE A CA    1 
ATOM   3929  C  C     . PHE A 1 532 ? 10.575  40.627  -33.422 1.00 34.41 ? 532 PHE A C     1 
ATOM   3930  O  O     . PHE A 1 532 ? 11.180  39.633  -33.022 1.00 33.58 ? 532 PHE A O     1 
ATOM   3931  C  CB    . PHE A 1 532 ? 8.020   40.247  -33.701 1.00 33.78 ? 532 PHE A CB    1 
ATOM   3932  C  CG    . PHE A 1 532 ? 6.737   40.139  -32.899 1.00 34.88 ? 532 PHE A CG    1 
ATOM   3933  C  CD1   . PHE A 1 532 ? 6.517   39.055  -32.057 1.00 33.62 ? 532 PHE A CD1   1 
ATOM   3934  C  CD2   . PHE A 1 532 ? 5.777   41.156  -32.940 1.00 35.54 ? 532 PHE A CD2   1 
ATOM   3935  C  CE1   . PHE A 1 532 ? 5.357   38.971  -31.292 1.00 35.24 ? 532 PHE A CE1   1 
ATOM   3936  C  CE2   . PHE A 1 532 ? 4.613   41.081  -32.170 1.00 35.58 ? 532 PHE A CE2   1 
ATOM   3937  C  CZ    . PHE A 1 532 ? 4.403   39.994  -31.344 1.00 33.97 ? 532 PHE A CZ    1 
ATOM   3938  N  N     . GLU A 1 533 ? 11.125  41.517  -34.248 1.00 35.14 ? 533 GLU A N     1 
ATOM   3939  C  CA    . GLU A 1 533 ? 12.564  41.473  -34.573 1.00 36.19 ? 533 GLU A CA    1 
ATOM   3940  C  C     . GLU A 1 533 ? 13.362  41.429  -33.271 1.00 36.03 ? 533 GLU A C     1 
ATOM   3941  O  O     . GLU A 1 533 ? 14.315  40.653  -33.147 1.00 36.80 ? 533 GLU A O     1 
ATOM   3942  C  CB    . GLU A 1 533 ? 13.010  42.680  -35.428 1.00 36.82 ? 533 GLU A CB    1 
ATOM   3943  C  CG    . GLU A 1 533 ? 12.411  42.724  -36.852 1.00 37.81 ? 533 GLU A CG    1 
ATOM   3944  C  CD    . GLU A 1 533 ? 12.972  43.837  -37.754 1.00 39.56 ? 533 GLU A CD    1 
ATOM   3945  O  OE1   . GLU A 1 533 ? 13.603  44.803  -37.250 1.00 41.27 ? 533 GLU A OE1   1 
ATOM   3946  O  OE2   . GLU A 1 533 ? 12.772  43.744  -38.991 1.00 40.69 ? 533 GLU A OE2   1 
ATOM   3947  N  N     . THR A 1 534 ? 12.934  42.234  -32.299 1.00 35.38 ? 534 THR A N     1 
ATOM   3948  C  CA    . THR A 1 534 ? 13.628  42.423  -31.027 1.00 35.56 ? 534 THR A CA    1 
ATOM   3949  C  C     . THR A 1 534 ? 13.561  41.179  -30.146 1.00 34.91 ? 534 THR A C     1 
ATOM   3950  O  O     . THR A 1 534 ? 14.562  40.768  -29.561 1.00 35.09 ? 534 THR A O     1 
ATOM   3951  C  CB    . THR A 1 534 ? 13.051  43.659  -30.260 1.00 35.80 ? 534 THR A CB    1 
ATOM   3952  O  OG1   . THR A 1 534 ? 13.239  44.844  -31.054 1.00 36.43 ? 534 THR A OG1   1 
ATOM   3953  C  CG2   . THR A 1 534 ? 13.727  43.841  -28.885 1.00 35.74 ? 534 THR A CG2   1 
ATOM   3954  N  N     . ILE A 1 535 ? 12.369  40.597  -30.047 1.00 33.95 ? 535 ILE A N     1 
ATOM   3955  C  CA    . ILE A 1 535 ? 12.166  39.371  -29.278 1.00 33.15 ? 535 ILE A CA    1 
ATOM   3956  C  C     . ILE A 1 535 ? 12.986  38.205  -29.841 1.00 33.01 ? 535 ILE A C     1 
ATOM   3957  O  O     . ILE A 1 535 ? 13.666  37.519  -29.097 1.00 33.65 ? 535 ILE A O     1 
ATOM   3958  C  CB    . ILE A 1 535 ? 10.673  39.001  -29.189 1.00 32.02 ? 535 ILE A CB    1 
ATOM   3959  C  CG1   . ILE A 1 535 ? 9.922   40.085  -28.415 1.00 31.44 ? 535 ILE A CG1   1 
ATOM   3960  C  CG2   . ILE A 1 535 ? 10.495  37.621  -28.545 1.00 30.91 ? 535 ILE A CG2   1 
ATOM   3961  C  CD1   . ILE A 1 535 ? 8.401   39.957  -28.467 1.00 29.55 ? 535 ILE A CD1   1 
ATOM   3962  N  N     . TYR A 1 536 ? 12.932  38.007  -31.150 1.00 33.13 ? 536 TYR A N     1 
ATOM   3963  C  CA    . TYR A 1 536 ? 13.724  36.981  -31.823 1.00 33.55 ? 536 TYR A CA    1 
ATOM   3964  C  C     . TYR A 1 536 ? 15.219  37.217  -31.598 1.00 34.46 ? 536 TYR A C     1 
ATOM   3965  O  O     . TYR A 1 536 ? 15.954  36.294  -31.222 1.00 34.89 ? 536 TYR A O     1 
ATOM   3966  C  CB    . TYR A 1 536 ? 13.368  36.971  -33.309 1.00 33.82 ? 536 TYR A CB    1 
ATOM   3967  C  CG    . TYR A 1 536 ? 13.872  35.799  -34.127 1.00 33.82 ? 536 TYR A CG    1 
ATOM   3968  C  CD1   . TYR A 1 536 ? 13.648  34.492  -33.727 1.00 35.19 ? 536 TYR A CD1   1 
ATOM   3969  C  CD2   . TYR A 1 536 ? 14.526  36.011  -35.340 1.00 35.16 ? 536 TYR A CD2   1 
ATOM   3970  C  CE1   . TYR A 1 536 ? 14.094  33.426  -34.495 1.00 36.37 ? 536 TYR A CE1   1 
ATOM   3971  C  CE2   . TYR A 1 536 ? 14.985  34.959  -36.113 1.00 34.81 ? 536 TYR A CE2   1 
ATOM   3972  C  CZ    . TYR A 1 536 ? 14.760  33.670  -35.691 1.00 35.65 ? 536 TYR A CZ    1 
ATOM   3973  O  OH    . TYR A 1 536 ? 15.201  32.614  -36.453 1.00 36.19 ? 536 TYR A OH    1 
ATOM   3974  N  N     . TYR A 1 537 ? 15.657  38.463  -31.775 1.00 34.95 ? 537 TYR A N     1 
ATOM   3975  C  CA    . TYR A 1 537 ? 17.066  38.809  -31.602 1.00 35.58 ? 537 TYR A CA    1 
ATOM   3976  C  C     . TYR A 1 537 ? 17.590  38.514  -30.199 1.00 36.03 ? 537 TYR A C     1 
ATOM   3977  O  O     . TYR A 1 537 ? 18.664  37.924  -30.051 1.00 36.83 ? 537 TYR A O     1 
ATOM   3978  C  CB    . TYR A 1 537 ? 17.326  40.282  -31.944 1.00 35.71 ? 537 TYR A CB    1 
ATOM   3979  C  CG    . TYR A 1 537 ? 18.793  40.585  -32.166 1.00 36.25 ? 537 TYR A CG    1 
ATOM   3980  C  CD1   . TYR A 1 537 ? 19.627  40.915  -31.095 1.00 35.99 ? 537 TYR A CD1   1 
ATOM   3981  C  CD2   . TYR A 1 537 ? 19.352  40.520  -33.440 1.00 35.77 ? 537 TYR A CD2   1 
ATOM   3982  C  CE1   . TYR A 1 537 ? 20.969  41.194  -31.287 1.00 36.21 ? 537 TYR A CE1   1 
ATOM   3983  C  CE2   . TYR A 1 537 ? 20.691  40.796  -33.640 1.00 37.61 ? 537 TYR A CE2   1 
ATOM   3984  C  CZ    . TYR A 1 537 ? 21.499  41.129  -32.556 1.00 38.20 ? 537 TYR A CZ    1 
ATOM   3985  O  OH    . TYR A 1 537 ? 22.841  41.403  -32.743 1.00 38.59 ? 537 TYR A OH    1 
ATOM   3986  N  N     . GLY A 1 538 ? 16.855  38.954  -29.180 1.00 35.48 ? 538 GLY A N     1 
ATOM   3987  C  CA    . GLY A 1 538 ? 17.257  38.740  -27.796 1.00 36.07 ? 538 GLY A CA    1 
ATOM   3988  C  C     . GLY A 1 538 ? 17.225  37.261  -27.441 1.00 36.45 ? 538 GLY A C     1 
ATOM   3989  O  O     . GLY A 1 538 ? 18.166  36.732  -26.838 1.00 37.07 ? 538 GLY A O     1 
ATOM   3990  N  N     . ALA A 1 539 ? 16.143  36.589  -27.825 1.00 36.01 ? 539 ALA A N     1 
ATOM   3991  C  CA    . ALA A 1 539 ? 16.029  35.143  -27.632 1.00 36.11 ? 539 ALA A CA    1 
ATOM   3992  C  C     . ALA A 1 539 ? 17.222  34.371  -28.245 1.00 36.75 ? 539 ALA A C     1 
ATOM   3993  O  O     . ALA A 1 539 ? 17.883  33.603  -27.543 1.00 37.32 ? 539 ALA A O     1 
ATOM   3994  C  CB    . ALA A 1 539 ? 14.677  34.626  -28.164 1.00 35.05 ? 539 ALA A CB    1 
ATOM   3995  N  N     . LEU A 1 540 ? 17.515  34.606  -29.525 1.00 37.01 ? 540 LEU A N     1 
ATOM   3996  C  CA    . LEU A 1 540 ? 18.641  33.940  -30.208 1.00 37.99 ? 540 LEU A CA    1 
ATOM   3997  C  C     . LEU A 1 540 ? 19.978  34.239  -29.541 1.00 38.75 ? 540 LEU A C     1 
ATOM   3998  O  O     . LEU A 1 540 ? 20.849  33.382  -29.464 1.00 39.12 ? 540 LEU A O     1 
ATOM   3999  C  CB    . LEU A 1 540 ? 18.723  34.362  -31.682 1.00 38.39 ? 540 LEU A CB    1 
ATOM   4000  C  CG    . LEU A 1 540 ? 17.764  33.799  -32.737 1.00 38.51 ? 540 LEU A CG    1 
ATOM   4001  C  CD1   . LEU A 1 540 ? 17.860  34.632  -34.011 1.00 38.16 ? 540 LEU A CD1   1 
ATOM   4002  C  CD2   . LEU A 1 540 ? 18.036  32.322  -33.037 1.00 38.72 ? 540 LEU A CD2   1 
ATOM   4003  N  N     . GLU A 1 541 ? 20.130  35.470  -29.070 1.00 39.29 ? 541 GLU A N     1 
ATOM   4004  C  CA    . GLU A 1 541 ? 21.345  35.898  -28.408 1.00 40.80 ? 541 GLU A CA    1 
ATOM   4005  C  C     . GLU A 1 541 ? 21.549  35.168  -27.070 1.00 39.99 ? 541 GLU A C     1 
ATOM   4006  O  O     . GLU A 1 541 ? 22.674  34.767  -26.749 1.00 40.98 ? 541 GLU A O     1 
ATOM   4007  C  CB    . GLU A 1 541 ? 21.364  37.421  -28.248 1.00 40.54 ? 541 GLU A CB    1 
ATOM   4008  C  CG    . GLU A 1 541 ? 22.760  37.980  -28.019 1.00 44.05 ? 541 GLU A CG    1 
ATOM   4009  C  CD    . GLU A 1 541 ? 22.767  39.443  -27.599 1.00 45.54 ? 541 GLU A CD    1 
ATOM   4010  O  OE1   . GLU A 1 541 ? 23.414  40.256  -28.299 1.00 49.87 ? 541 GLU A OE1   1 
ATOM   4011  O  OE2   . GLU A 1 541 ? 22.134  39.787  -26.566 1.00 50.02 ? 541 GLU A OE2   1 
ATOM   4012  N  N     . ALA A 1 542 ? 20.471  34.974  -26.307 1.00 38.73 ? 542 ALA A N     1 
ATOM   4013  C  CA    . ALA A 1 542 ? 20.552  34.223  -25.046 1.00 38.32 ? 542 ALA A CA    1 
ATOM   4014  C  C     . ALA A 1 542 ? 20.754  32.739  -25.309 1.00 38.12 ? 542 ALA A C     1 
ATOM   4015  O  O     . ALA A 1 542 ? 21.586  32.093  -24.668 1.00 38.70 ? 542 ALA A O     1 
ATOM   4016  C  CB    . ALA A 1 542 ? 19.324  34.447  -24.189 1.00 37.40 ? 542 ALA A CB    1 
ATOM   4017  N  N     . SER A 1 543 ? 20.013  32.207  -26.273 1.00 37.33 ? 543 SER A N     1 
ATOM   4018  C  CA    . SER A 1 543 ? 20.149  30.810  -26.647 1.00 37.71 ? 543 SER A CA    1 
ATOM   4019  C  C     . SER A 1 543 ? 21.566  30.497  -27.130 1.00 39.29 ? 543 SER A C     1 
ATOM   4020  O  O     . SER A 1 543 ? 22.091  29.418  -26.852 1.00 40.05 ? 543 SER A O     1 
ATOM   4021  C  CB    . SER A 1 543 ? 19.135  30.443  -27.713 1.00 36.89 ? 543 SER A CB    1 
ATOM   4022  O  OG    . SER A 1 543 ? 19.136  29.050  -27.911 1.00 37.28 ? 543 SER A OG    1 
ATOM   4023  N  N     . CYS A 1 544 ? 22.171  31.445  -27.845 1.00 40.07 ? 544 CYS A N     1 
ATOM   4024  C  CA    . CYS A 1 544 ? 23.551  31.329  -28.311 1.00 41.37 ? 544 CYS A CA    1 
ATOM   4025  C  C     . CYS A 1 544 ? 24.571  31.366  -27.156 1.00 42.17 ? 544 CYS A C     1 
ATOM   4026  O  O     . CYS A 1 544 ? 25.538  30.603  -27.157 1.00 43.10 ? 544 CYS A O     1 
ATOM   4027  C  CB    . CYS A 1 544 ? 23.856  32.418  -29.345 1.00 41.58 ? 544 CYS A CB    1 
ATOM   4028  S  SG    . CYS A 1 544 ? 25.500  32.313  -30.073 1.00 44.29 ? 544 CYS A SG    1 
ATOM   4029  N  N     . ASP A 1 545 ? 24.353  32.257  -26.190 1.00 41.88 ? 545 ASP A N     1 
ATOM   4030  C  CA    . ASP A 1 545 ? 25.163  32.311  -24.971 1.00 43.00 ? 545 ASP A CA    1 
ATOM   4031  C  C     . ASP A 1 545 ? 25.095  30.987  -24.194 1.00 43.03 ? 545 ASP A C     1 
ATOM   4032  O  O     . ASP A 1 545 ? 26.115  30.489  -23.699 1.00 44.12 ? 545 ASP A O     1 
ATOM   4033  C  CB    . ASP A 1 545 ? 24.709  33.470  -24.073 1.00 42.80 ? 545 ASP A CB    1 
ATOM   4034  C  CG    . ASP A 1 545 ? 25.068  34.831  -24.641 1.00 44.81 ? 545 ASP A CG    1 
ATOM   4035  O  OD1   . ASP A 1 545 ? 25.981  34.912  -25.497 1.00 49.15 ? 545 ASP A OD1   1 
ATOM   4036  O  OD2   . ASP A 1 545 ? 24.450  35.833  -24.226 1.00 45.07 ? 545 ASP A OD2   1 
ATOM   4037  N  N     . LEU A 1 546 ? 23.889  30.424  -24.094 1.00 41.85 ? 546 LEU A N     1 
ATOM   4038  C  CA    . LEU A 1 546 ? 23.693  29.126  -23.464 1.00 41.43 ? 546 LEU A CA    1 
ATOM   4039  C  C     . LEU A 1 546 ? 24.413  28.006  -24.195 1.00 42.18 ? 546 LEU A C     1 
ATOM   4040  O  O     . LEU A 1 546 ? 24.993  27.132  -23.553 1.00 42.85 ? 546 LEU A O     1 
ATOM   4041  C  CB    . LEU A 1 546 ? 22.209  28.806  -23.333 1.00 40.20 ? 546 LEU A CB    1 
ATOM   4042  C  CG    . LEU A 1 546 ? 21.519  29.365  -22.089 1.00 38.49 ? 546 LEU A CG    1 
ATOM   4043  C  CD1   . LEU A 1 546 ? 20.038  29.365  -22.325 1.00 36.38 ? 546 LEU A CD1   1 
ATOM   4044  C  CD2   . LEU A 1 546 ? 21.880  28.552  -20.855 1.00 37.77 ? 546 LEU A CD2   1 
ATOM   4045  N  N     . ALA A 1 547 ? 24.388  28.041  -25.527 1.00 42.25 ? 547 ALA A N     1 
ATOM   4046  C  CA    . ALA A 1 547 ? 25.086  27.040  -26.344 1.00 43.71 ? 547 ALA A CA    1 
ATOM   4047  C  C     . ALA A 1 547 ? 26.588  27.102  -26.121 1.00 45.38 ? 547 ALA A C     1 
ATOM   4048  O  O     . ALA A 1 547 ? 27.256  26.082  -26.141 1.00 46.31 ? 547 ALA A O     1 
ATOM   4049  C  CB    . ALA A 1 547 ? 24.768  27.214  -27.815 1.00 43.18 ? 547 ALA A CB    1 
ATOM   4050  N  N     . LYS A 1 548 ? 27.102  28.279  -25.864 1.00 46.56 ? 548 LYS A N     1 
ATOM   4051  C  CA    . LYS A 1 548 ? 28.484  28.458  -25.525 1.00 48.87 ? 548 LYS A CA    1 
ATOM   4052  C  C     . LYS A 1 548 ? 28.820  27.916  -24.154 1.00 49.36 ? 548 LYS A C     1 
ATOM   4053  O  O     . LYS A 1 548 ? 29.839  27.339  -23.988 1.00 50.48 ? 548 LYS A O     1 
ATOM   4054  C  CB    . LYS A 1 548 ? 28.832  29.926  -25.630 1.00 49.38 ? 548 LYS A CB    1 
ATOM   4055  C  CG    . LYS A 1 548 ? 30.088  30.345  -24.999 1.00 51.51 ? 548 LYS A CG    1 
ATOM   4056  C  CD    . LYS A 1 548 ? 30.193  31.793  -25.179 1.00 54.77 ? 548 LYS A CD    1 
ATOM   4057  C  CE    . LYS A 1 548 ? 31.470  32.363  -24.658 1.00 59.12 ? 548 LYS A CE    1 
ATOM   4058  N  NZ    . LYS A 1 548 ? 31.259  33.764  -24.208 1.00 60.63 ? 548 LYS A NZ    1 
ATOM   4059  N  N     . GLU A 1 549 ? 27.946  28.090  -23.186 1.00 48.79 ? 549 GLU A N     1 
ATOM   4060  C  CA    . GLU A 1 549 ? 28.192  27.624  -21.812 1.00 49.82 ? 549 GLU A CA    1 
ATOM   4061  C  C     . GLU A 1 549 ? 27.951  26.128  -21.650 1.00 49.32 ? 549 GLU A C     1 
ATOM   4062  O  O     . GLU A 1 549 ? 28.529  25.495  -20.776 1.00 50.29 ? 549 GLU A O     1 
ATOM   4063  C  CB    . GLU A 1 549 ? 27.297  28.360  -20.800 1.00 49.03 ? 549 GLU A CB    1 
ATOM   4064  C  CG    . GLU A 1 549 ? 27.460  29.885  -20.719 1.00 50.04 ? 549 GLU A CG    1 
ATOM   4065  C  CD    . GLU A 1 549 ? 26.192  30.590  -20.207 1.00 49.21 ? 549 GLU A CD    1 
ATOM   4066  O  OE1   . GLU A 1 549 ? 25.398  29.967  -19.462 1.00 49.74 ? 549 GLU A OE1   1 
ATOM   4067  O  OE2   . GLU A 1 549 ? 25.988  31.776  -20.553 1.00 51.27 ? 549 GLU A OE2   1 
ATOM   4068  N  N     . GLN A 1 550 ? 27.129  25.560  -22.501 1.00 48.40 ? 550 GLN A N     1 
ATOM   4069  C  CA    . GLN A 1 550 ? 26.607  24.246  -22.266 1.00 47.94 ? 550 GLN A CA    1 
ATOM   4070  C  C     . GLN A 1 550 ? 26.544  23.350  -23.486 1.00 47.70 ? 550 GLN A C     1 
ATOM   4071  O  O     . GLN A 1 550 ? 26.137  22.220  -23.396 1.00 47.86 ? 550 GLN A O     1 
ATOM   4072  C  CB    . GLN A 1 550 ? 25.242  24.392  -21.616 1.00 22.25 ? 550 GLN A CB    1 
ATOM   4073  C  CG    . GLN A 1 550 ? 25.349  24.852  -20.185 1.00 22.61 ? 550 GLN A CG    1 
ATOM   4074  C  CD    . GLN A 1 550 ? 24.143  25.634  -19.662 1.00 21.49 ? 550 GLN A CD    1 
ATOM   4075  O  OE1   . GLN A 1 550 ? 23.001  25.278  -19.927 1.00 20.51 ? 550 GLN A OE1   1 
ATOM   4076  N  NE2   . GLN A 1 550 ? 24.405  26.695  -18.880 1.00 21.74 ? 550 GLN A NE2   1 
ATOM   4077  N  N     . GLY A 1 551 ? 26.967  23.866  -24.620 1.00 47.45 ? 551 GLY A N     1 
ATOM   4078  C  CA    . GLY A 1 551 ? 26.915  23.152  -25.897 1.00 47.07 ? 551 GLY A CA    1 
ATOM   4079  C  C     . GLY A 1 551 ? 25.535  23.222  -26.540 1.00 45.81 ? 551 GLY A C     1 
ATOM   4080  O  O     . GLY A 1 551 ? 24.527  23.293  -25.839 1.00 44.39 ? 551 GLY A O     1 
ATOM   4081  N  N     . PRO A 1 552 ? 25.476  23.178  -27.888 1.00 45.82 ? 552 PRO A N     1 
ATOM   4082  C  CA    . PRO A 1 552 ? 24.208  23.211  -28.624 1.00 44.43 ? 552 PRO A CA    1 
ATOM   4083  C  C     . PRO A 1 552 ? 23.337  22.001  -28.289 1.00 44.43 ? 552 PRO A C     1 
ATOM   4084  O  O     . PRO A 1 552 ? 23.819  21.045  -27.678 1.00 45.14 ? 552 PRO A O     1 
ATOM   4085  C  CB    . PRO A 1 552 ? 24.651  23.122  -30.090 1.00 45.03 ? 552 PRO A CB    1 
ATOM   4086  C  CG    . PRO A 1 552 ? 26.078  23.526  -30.102 1.00 45.80 ? 552 PRO A CG    1 
ATOM   4087  C  CD    . PRO A 1 552 ? 26.635  23.072  -28.792 1.00 46.49 ? 552 PRO A CD    1 
ATOM   4088  N  N     . TYR A 1 553 ? 22.069  22.028  -28.690 1.00 43.58 ? 553 TYR A N     1 
ATOM   4089  C  CA    . TYR A 1 553 ? 21.184  20.902  -28.425 1.00 43.66 ? 553 TYR A CA    1 
ATOM   4090  C  C     . TYR A 1 553 ? 21.564  19.730  -29.335 1.00 44.90 ? 553 TYR A C     1 
ATOM   4091  O  O     . TYR A 1 553 ? 22.143  19.936  -30.406 1.00 45.15 ? 553 TYR A O     1 
ATOM   4092  C  CB    . TYR A 1 553 ? 19.708  21.301  -28.566 1.00 42.45 ? 553 TYR A CB    1 
ATOM   4093  C  CG    . TYR A 1 553 ? 19.325  21.830  -29.925 1.00 41.22 ? 553 TYR A CG    1 
ATOM   4094  C  CD1   . TYR A 1 553 ? 18.722  21.002  -30.866 1.00 40.30 ? 553 TYR A CD1   1 
ATOM   4095  C  CD2   . TYR A 1 553 ? 19.561  23.162  -30.270 1.00 40.77 ? 553 TYR A CD2   1 
ATOM   4096  C  CE1   . TYR A 1 553 ? 18.353  21.487  -32.122 1.00 40.16 ? 553 TYR A CE1   1 
ATOM   4097  C  CE2   . TYR A 1 553 ? 19.209  23.658  -31.529 1.00 40.43 ? 553 TYR A CE2   1 
ATOM   4098  C  CZ    . TYR A 1 553 ? 18.606  22.812  -32.449 1.00 40.63 ? 553 TYR A CZ    1 
ATOM   4099  O  OH    . TYR A 1 553 ? 18.247  23.286  -33.697 1.00 41.38 ? 553 TYR A OH    1 
ATOM   4100  N  N     . GLU A 1 554 ? 21.239  18.515  -28.894 1.00 45.67 ? 554 GLU A N     1 
ATOM   4101  C  CA    . GLU A 1 554 ? 21.718  17.265  -29.502 1.00 47.89 ? 554 GLU A CA    1 
ATOM   4102  C  C     . GLU A 1 554 ? 21.522  17.169  -31.010 1.00 47.13 ? 554 GLU A C     1 
ATOM   4103  O  O     . GLU A 1 554 ? 22.326  16.575  -31.729 1.00 48.40 ? 554 GLU A O     1 
ATOM   4104  C  CB    . GLU A 1 554 ? 21.034  16.073  -28.821 1.00 47.93 ? 554 GLU A CB    1 
ATOM   4105  C  CG    . GLU A 1 554 ? 21.250  14.720  -29.498 1.00 49.62 ? 554 GLU A CG    1 
ATOM   4106  C  CD    . GLU A 1 554 ? 20.639  13.574  -28.707 1.00 51.42 ? 554 GLU A CD    1 
ATOM   4107  O  OE1   . GLU A 1 554 ? 20.117  13.831  -27.594 1.00 54.42 ? 554 GLU A OE1   1 
ATOM   4108  O  OE2   . GLU A 1 554 ? 20.686  12.413  -29.191 1.00 56.32 ? 554 GLU A OE2   1 
ATOM   4109  N  N     . THR A 1 555 ? 20.460  17.794  -31.472 1.00 46.02 ? 555 THR A N     1 
ATOM   4110  C  CA    . THR A 1 555 ? 19.917  17.562  -32.788 1.00 45.71 ? 555 THR A CA    1 
ATOM   4111  C  C     . THR A 1 555 ? 20.178  18.784  -33.701 1.00 45.56 ? 555 THR A C     1 
ATOM   4112  O  O     . THR A 1 555 ? 19.663  18.878  -34.825 1.00 45.21 ? 555 THR A O     1 
ATOM   4113  C  CB    . THR A 1 555 ? 18.415  17.211  -32.594 1.00 44.56 ? 555 THR A CB    1 
ATOM   4114  O  OG1   . THR A 1 555 ? 18.089  16.007  -33.290 1.00 44.73 ? 555 THR A OG1   1 
ATOM   4115  C  CG2   . THR A 1 555 ? 17.490  18.356  -32.965 1.00 43.76 ? 555 THR A CG2   1 
ATOM   4116  N  N     . TYR A 1 556 ? 21.014  19.696  -33.202 1.00 45.83 ? 556 TYR A N     1 
ATOM   4117  C  CA    . TYR A 1 556 ? 21.283  20.988  -33.843 1.00 46.18 ? 556 TYR A CA    1 
ATOM   4118  C  C     . TYR A 1 556 ? 21.901  20.905  -35.232 1.00 47.32 ? 556 TYR A C     1 
ATOM   4119  O  O     . TYR A 1 556 ? 21.545  21.683  -36.117 1.00 46.98 ? 556 TYR A O     1 
ATOM   4120  C  CB    . TYR A 1 556 ? 22.164  21.859  -32.937 1.00 46.33 ? 556 TYR A CB    1 
ATOM   4121  C  CG    . TYR A 1 556 ? 22.660  23.139  -33.574 1.00 46.33 ? 556 TYR A CG    1 
ATOM   4122  C  CD1   . TYR A 1 556 ? 24.015  23.311  -33.895 1.00 46.88 ? 556 TYR A CD1   1 
ATOM   4123  C  CD2   . TYR A 1 556 ? 21.775  24.179  -33.860 1.00 45.33 ? 556 TYR A CD2   1 
ATOM   4124  C  CE1   . TYR A 1 556 ? 24.468  24.493  -34.478 1.00 46.71 ? 556 TYR A CE1   1 
ATOM   4125  C  CE2   . TYR A 1 556 ? 22.214  25.353  -34.446 1.00 45.52 ? 556 TYR A CE2   1 
ATOM   4126  C  CZ    . TYR A 1 556 ? 23.555  25.506  -34.755 1.00 47.22 ? 556 TYR A CZ    1 
ATOM   4127  O  OH    . TYR A 1 556 ? 23.960  26.684  -35.330 1.00 47.83 ? 556 TYR A OH    1 
ATOM   4128  N  N     . GLU A 1 557 ? 22.832  19.979  -35.416 1.00 48.86 ? 557 GLU A N     1 
ATOM   4129  C  CA    . GLU A 1 557 ? 23.593  19.924  -36.659 1.00 50.77 ? 557 GLU A CA    1 
ATOM   4130  C  C     . GLU A 1 557 ? 22.721  19.386  -37.797 1.00 50.26 ? 557 GLU A C     1 
ATOM   4131  O  O     . GLU A 1 557 ? 22.090  18.336  -37.666 1.00 50.23 ? 557 GLU A O     1 
ATOM   4132  C  CB    . GLU A 1 557 ? 24.881  19.110  -36.476 1.00 52.01 ? 557 GLU A CB    1 
ATOM   4133  C  CG    . GLU A 1 557 ? 26.058  19.622  -37.285 1.00 55.85 ? 557 GLU A CG    1 
ATOM   4134  C  CD    . GLU A 1 557 ? 26.422  21.080  -36.974 1.00 58.90 ? 557 GLU A CD    1 
ATOM   4135  O  OE1   . GLU A 1 557 ? 27.012  21.357  -35.899 1.00 59.52 ? 557 GLU A OE1   1 
ATOM   4136  O  OE2   . GLU A 1 557 ? 26.121  21.949  -37.824 1.00 60.05 ? 557 GLU A OE2   1 
ATOM   4137  N  N     . GLY A 1 558 ? 22.625  20.131  -38.874 1.00 50.03 ? 558 GLY A N     1 
ATOM   4138  C  CA    . GLY A 1 558 ? 21.755  19.756  -39.947 1.00 49.48 ? 558 GLY A CA    1 
ATOM   4139  C  C     . GLY A 1 558 ? 20.552  20.645  -40.068 1.00 48.35 ? 558 GLY A C     1 
ATOM   4140  O  O     . GLY A 1 558 ? 19.948  20.725  -41.108 1.00 48.36 ? 558 GLY A O     1 
ATOM   4141  N  N     . SER A 1 559 ? 20.226  21.312  -38.979 1.00 47.06 ? 559 SER A N     1 
ATOM   4142  C  CA    . SER A 1 559 ? 19.099  22.201  -38.899 1.00 45.51 ? 559 SER A CA    1 
ATOM   4143  C  C     . SER A 1 559 ? 19.346  23.437  -39.706 1.00 45.56 ? 559 SER A C     1 
ATOM   4144  O  O     . SER A 1 559 ? 20.455  23.776  -39.978 1.00 46.39 ? 559 SER A O     1 
ATOM   4145  C  CB    . SER A 1 559 ? 18.847  22.575  -37.451 1.00 44.74 ? 559 SER A CB    1 
ATOM   4146  O  OG    . SER A 1 559 ? 19.711  23.584  -37.024 1.00 45.03 ? 559 SER A OG    1 
ATOM   4147  N  N     . PRO A 1 560 ? 18.288  24.105  -40.091 1.00 44.50 ? 560 PRO A N     1 
ATOM   4148  C  CA    . PRO A 1 560 ? 18.396  25.322  -40.866 1.00 44.87 ? 560 PRO A CA    1 
ATOM   4149  C  C     . PRO A 1 560 ? 19.198  26.416  -40.211 1.00 44.87 ? 560 PRO A C     1 
ATOM   4150  O  O     . PRO A 1 560 ? 19.885  27.108  -40.912 1.00 45.83 ? 560 PRO A O     1 
ATOM   4151  C  CB    . PRO A 1 560 ? 16.956  25.717  -41.037 1.00 43.97 ? 560 PRO A CB    1 
ATOM   4152  C  CG    . PRO A 1 560 ? 16.273  24.436  -41.107 1.00 44.00 ? 560 PRO A CG    1 
ATOM   4153  C  CD    . PRO A 1 560 ? 17.035  23.426  -40.370 1.00 43.89 ? 560 PRO A CD    1 
ATOM   4154  N  N     . VAL A 1 561 ? 19.157  26.560  -38.905 1.00 44.01 ? 561 VAL A N     1 
ATOM   4155  C  CA    . VAL A 1 561 ? 20.003  27.559  -38.313 1.00 44.28 ? 561 VAL A CA    1 
ATOM   4156  C  C     . VAL A 1 561 ? 21.482  27.187  -38.226 1.00 45.31 ? 561 VAL A C     1 
ATOM   4157  O  O     . VAL A 1 561 ? 22.306  28.057  -38.099 1.00 45.80 ? 561 VAL A O     1 
ATOM   4158  C  CB    . VAL A 1 561 ? 19.477  28.153  -37.003 1.00 43.37 ? 561 VAL A CB    1 
ATOM   4159  C  CG1   . VAL A 1 561 ? 18.076  27.811  -36.754 1.00 43.16 ? 561 VAL A CG1   1 
ATOM   4160  C  CG2   . VAL A 1 561 ? 20.347  27.847  -35.887 1.00 43.39 ? 561 VAL A CG2   1 
ATOM   4161  N  N     . SER A 1 562 ? 21.815  25.911  -38.324 1.00 45.28 ? 562 SER A N     1 
ATOM   4162  C  CA    . SER A 1 562 ? 23.211  25.510  -38.371 1.00 46.02 ? 562 SER A CA    1 
ATOM   4163  C  C     . SER A 1 562 ? 23.823  25.807  -39.724 1.00 46.94 ? 562 SER A C     1 
ATOM   4164  O  O     . SER A 1 562 ? 25.016  25.876  -39.867 1.00 47.79 ? 562 SER A O     1 
ATOM   4165  C  CB    . SER A 1 562 ? 23.395  24.058  -37.984 1.00 46.13 ? 562 SER A CB    1 
ATOM   4166  O  OG    . SER A 1 562 ? 23.047  23.200  -39.009 1.00 45.98 ? 562 SER A OG    1 
ATOM   4167  N  N     . LYS A 1 563 ? 22.976  26.042  -40.701 1.00 46.53 ? 563 LYS A N     1 
ATOM   4168  C  CA    . LYS A 1 563 ? 23.415  26.437  -41.995 1.00 47.49 ? 563 LYS A CA    1 
ATOM   4169  C  C     . LYS A 1 563 ? 23.281  27.909  -42.186 1.00 46.83 ? 563 LYS A C     1 
ATOM   4170  O  O     . LYS A 1 563 ? 23.332  28.379  -43.280 1.00 47.52 ? 563 LYS A O     1 
ATOM   4171  C  CB    . LYS A 1 563 ? 22.597  25.749  -43.057 1.00 47.72 ? 563 LYS A CB    1 
ATOM   4172  C  CG    . LYS A 1 563 ? 22.354  24.315  -42.844 1.00 48.93 ? 563 LYS A CG    1 
ATOM   4173  C  CD    . LYS A 1 563 ? 21.649  23.772  -44.034 1.00 51.62 ? 563 LYS A CD    1 
ATOM   4174  C  CE    . LYS A 1 563 ? 21.154  22.393  -43.823 1.00 52.68 ? 563 LYS A CE    1 
ATOM   4175  N  NZ    . LYS A 1 563 ? 20.089  22.096  -44.781 1.00 53.57 ? 563 LYS A NZ    1 
ATOM   4176  N  N     . GLY A 1 564 ? 23.097  28.636  -41.109 1.00 45.72 ? 564 GLY A N     1 
ATOM   4177  C  CA    . GLY A 1 564 ? 23.005  30.072  -41.177 1.00 45.21 ? 564 GLY A CA    1 
ATOM   4178  C  C     . GLY A 1 564 ? 21.710  30.653  -41.674 1.00 44.17 ? 564 GLY A C     1 
ATOM   4179  O  O     . GLY A 1 564 ? 21.659  31.782  -42.070 1.00 44.69 ? 564 GLY A O     1 
ATOM   4180  N  N     . ILE A 1 565 ? 20.664  29.862  -41.653 1.00 42.59 ? 565 ILE A N     1 
ATOM   4181  C  CA    . ILE A 1 565 ? 19.337  30.309  -42.068 1.00 41.19 ? 565 ILE A CA    1 
ATOM   4182  C  C     . ILE A 1 565 ? 18.486  30.530  -40.824 1.00 39.91 ? 565 ILE A C     1 
ATOM   4183  O  O     . ILE A 1 565 ? 18.179  29.584  -40.095 1.00 38.78 ? 565 ILE A O     1 
ATOM   4184  C  CB    . ILE A 1 565 ? 18.659  29.292  -43.030 1.00 41.40 ? 565 ILE A CB    1 
ATOM   4185  C  CG1   . ILE A 1 565 ? 19.467  29.164  -44.333 1.00 42.55 ? 565 ILE A CG1   1 
ATOM   4186  C  CG2   . ILE A 1 565 ? 17.213  29.686  -43.329 1.00 39.34 ? 565 ILE A CG2   1 
ATOM   4187  C  CD1   . ILE A 1 565 ? 19.168  27.895  -45.124 1.00 42.96 ? 565 ILE A CD1   1 
ATOM   4188  N  N     . LEU A 1 566 ? 18.148  31.788  -40.558 1.00 39.56 ? 566 LEU A N     1 
ATOM   4189  C  CA    . LEU A 1 566 ? 17.248  32.114  -39.450 1.00 38.64 ? 566 LEU A CA    1 
ATOM   4190  C  C     . LEU A 1 566 ? 15.862  32.206  -40.038 1.00 38.23 ? 566 LEU A C     1 
ATOM   4191  O  O     . LEU A 1 566 ? 15.726  32.137  -41.252 1.00 38.65 ? 566 LEU A O     1 
ATOM   4192  C  CB    . LEU A 1 566 ? 17.661  33.410  -38.740 1.00 38.34 ? 566 LEU A CB    1 
ATOM   4193  C  CG    . LEU A 1 566 ? 19.077  33.457  -38.147 1.00 38.35 ? 566 LEU A CG    1 
ATOM   4194  C  CD1   . LEU A 1 566 ? 19.314  34.817  -37.507 1.00 37.18 ? 566 LEU A CD1   1 
ATOM   4195  C  CD2   . LEU A 1 566 ? 19.349  32.312  -37.138 1.00 36.55 ? 566 LEU A CD2   1 
ATOM   4196  N  N     . GLN A 1 567 ? 14.846  32.371  -39.190 1.00 37.89 ? 567 GLN A N     1 
ATOM   4197  C  CA    . GLN A 1 567 ? 13.446  32.244  -39.608 1.00 37.86 ? 567 GLN A CA    1 
ATOM   4198  C  C     . GLN A 1 567 ? 13.063  33.216  -40.729 1.00 38.69 ? 567 GLN A C     1 
ATOM   4199  O  O     . GLN A 1 567 ? 12.426  32.828  -41.713 1.00 39.33 ? 567 GLN A O     1 
ATOM   4200  C  CB    . GLN A 1 567 ? 12.501  32.368  -38.395 1.00 37.29 ? 567 GLN A CB    1 
ATOM   4201  C  CG    . GLN A 1 567 ? 10.996  32.355  -38.729 1.00 36.31 ? 567 GLN A CG    1 
ATOM   4202  C  CD    . GLN A 1 567 ? 10.443  30.959  -39.032 1.00 36.92 ? 567 GLN A CD    1 
ATOM   4203  O  OE1   . GLN A 1 567 ? 9.299   30.822  -39.435 1.00 37.80 ? 567 GLN A OE1   1 
ATOM   4204  N  NE2   . GLN A 1 567 ? 11.252  29.927  -38.827 1.00 37.11 ? 567 GLN A NE2   1 
ATOM   4205  N  N     . TYR A 1 568 ? 13.473  34.470  -40.592 1.00 39.25 ? 568 TYR A N     1 
ATOM   4206  C  CA    . TYR A 1 568 ? 13.141  35.493  -41.581 1.00 39.88 ? 568 TYR A CA    1 
ATOM   4207  C  C     . TYR A 1 568 ? 13.745  35.229  -42.970 1.00 41.57 ? 568 TYR A C     1 
ATOM   4208  O  O     . TYR A 1 568 ? 13.168  35.658  -43.982 1.00 42.19 ? 568 TYR A O     1 
ATOM   4209  C  CB    . TYR A 1 568 ? 13.522  36.882  -41.066 1.00 39.76 ? 568 TYR A CB    1 
ATOM   4210  C  CG    . TYR A 1 568 ? 14.999  37.054  -40.769 1.00 40.12 ? 568 TYR A CG    1 
ATOM   4211  C  CD1   . TYR A 1 568 ? 15.477  37.014  -39.463 1.00 39.67 ? 568 TYR A CD1   1 
ATOM   4212  C  CD2   . TYR A 1 568 ? 15.915  37.263  -41.798 1.00 40.45 ? 568 TYR A CD2   1 
ATOM   4213  C  CE1   . TYR A 1 568 ? 16.832  37.181  -39.193 1.00 39.86 ? 568 TYR A CE1   1 
ATOM   4214  C  CE2   . TYR A 1 568 ? 17.259  37.423  -41.541 1.00 41.70 ? 568 TYR A CE2   1 
ATOM   4215  C  CZ    . TYR A 1 568 ? 17.709  37.386  -40.239 1.00 41.03 ? 568 TYR A CZ    1 
ATOM   4216  O  OH    . TYR A 1 568 ? 19.046  37.550  -40.001 1.00 42.53 ? 568 TYR A OH    1 
ATOM   4217  N  N     . ASP A 1 569 ? 14.897  34.544  -43.023 1.00 42.27 ? 569 ASP A N     1 
ATOM   4218  C  CA    . ASP A 1 569 ? 15.478  34.106  -44.304 1.00 43.56 ? 569 ASP A CA    1 
ATOM   4219  C  C     . ASP A 1 569 ? 14.522  33.156  -45.024 1.00 43.86 ? 569 ASP A C     1 
ATOM   4220  O  O     . ASP A 1 569 ? 14.411  33.183  -46.248 1.00 44.17 ? 569 ASP A O     1 
ATOM   4221  C  CB    . ASP A 1 569 ? 16.821  33.398  -44.099 1.00 43.92 ? 569 ASP A CB    1 
ATOM   4222  C  CG    . ASP A 1 569 ? 17.919  34.334  -43.641 1.00 44.79 ? 569 ASP A CG    1 
ATOM   4223  O  OD1   . ASP A 1 569 ? 18.589  34.001  -42.640 1.00 44.95 ? 569 ASP A OD1   1 
ATOM   4224  O  OD2   . ASP A 1 569 ? 18.109  35.401  -44.268 1.00 45.05 ? 569 ASP A OD2   1 
ATOM   4225  N  N     . MET A 1 570 ? 13.830  32.328  -44.240 1.00 43.76 ? 570 MET A N     1 
ATOM   4226  C  CA    . MET A 1 570 ? 12.867  31.367  -44.756 1.00 44.42 ? 570 MET A CA    1 
ATOM   4227  C  C     . MET A 1 570 ? 11.607  32.029  -45.332 1.00 44.18 ? 570 MET A C     1 
ATOM   4228  O  O     . MET A 1 570 ? 10.880  31.411  -46.116 1.00 44.57 ? 570 MET A O     1 
ATOM   4229  C  CB    . MET A 1 570 ? 12.494  30.364  -43.666 1.00 43.49 ? 570 MET A CB    1 
ATOM   4230  C  CG    . MET A 1 570 ? 13.611  29.424  -43.269 1.00 44.08 ? 570 MET A CG    1 
ATOM   4231  S  SD    . MET A 1 570 ? 13.204  28.402  -41.839 1.00 44.84 ? 570 MET A SD    1 
ATOM   4232  C  CE    . MET A 1 570 ? 13.771  26.831  -42.456 1.00 44.09 ? 570 MET A CE    1 
ATOM   4233  N  N     . TRP A 1 571 ? 11.358  33.279  -44.941 1.00 43.97 ? 571 TRP A N     1 
ATOM   4234  C  CA    . TRP A 1 571 ? 10.212  34.046  -45.438 1.00 43.89 ? 571 TRP A CA    1 
ATOM   4235  C  C     . TRP A 1 571 ? 10.628  35.004  -46.546 1.00 45.05 ? 571 TRP A C     1 
ATOM   4236  O  O     . TRP A 1 571 ? 9.782   35.666  -47.146 1.00 45.41 ? 571 TRP A O     1 
ATOM   4237  C  CB    . TRP A 1 571 ? 9.581   34.869  -44.308 1.00 42.74 ? 571 TRP A CB    1 
ATOM   4238  C  CG    . TRP A 1 571 ? 8.808   34.099  -43.275 1.00 41.57 ? 571 TRP A CG    1 
ATOM   4239  C  CD1   . TRP A 1 571 ? 9.316   33.261  -42.323 1.00 40.86 ? 571 TRP A CD1   1 
ATOM   4240  C  CD2   . TRP A 1 571 ? 7.390   34.141  -43.058 1.00 40.89 ? 571 TRP A CD2   1 
ATOM   4241  N  NE1   . TRP A 1 571 ? 8.305   32.767  -41.537 1.00 39.81 ? 571 TRP A NE1   1 
ATOM   4242  C  CE2   . TRP A 1 571 ? 7.112   33.290  -41.964 1.00 40.09 ? 571 TRP A CE2   1 
ATOM   4243  C  CE3   . TRP A 1 571 ? 6.329   34.816  -43.680 1.00 40.24 ? 571 TRP A CE3   1 
ATOM   4244  C  CZ2   . TRP A 1 571 ? 5.809   33.086  -41.477 1.00 39.54 ? 571 TRP A CZ2   1 
ATOM   4245  C  CZ3   . TRP A 1 571 ? 5.035   34.617  -43.199 1.00 40.90 ? 571 TRP A CZ3   1 
ATOM   4246  C  CH2   . TRP A 1 571 ? 4.788   33.755  -42.101 1.00 40.07 ? 571 TRP A CH2   1 
ATOM   4247  N  N     . ASN A 1 572 ? 11.936  35.084  -46.792 1.00 46.15 ? 572 ASN A N     1 
ATOM   4248  C  CA    . ASN A 1 572 ? 12.532  36.036  -47.735 1.00 47.39 ? 572 ASN A CA    1 
ATOM   4249  C  C     . ASN A 1 572 ? 12.369  37.484  -47.306 1.00 47.14 ? 572 ASN A C     1 
ATOM   4250  O  O     . ASN A 1 572 ? 12.137  38.375  -48.130 1.00 48.15 ? 572 ASN A O     1 
ATOM   4251  C  CB    . ASN A 1 572 ? 12.004  35.813  -49.156 1.00 48.35 ? 572 ASN A CB    1 
ATOM   4252  C  CG    . ASN A 1 572 ? 12.629  34.619  -49.806 1.00 50.16 ? 572 ASN A CG    1 
ATOM   4253  O  OD1   . ASN A 1 572 ? 12.051  33.539  -49.815 1.00 52.00 ? 572 ASN A OD1   1 
ATOM   4254  N  ND2   . ASN A 1 572 ? 13.839  34.790  -50.326 1.00 53.22 ? 572 ASN A ND2   1 
ATOM   4255  N  N     . VAL A 1 573 ? 12.496  37.707  -46.004 1.00 46.10 ? 573 VAL A N     1 
ATOM   4256  C  CA    . VAL A 1 573 ? 12.357  39.034  -45.415 1.00 45.37 ? 573 VAL A CA    1 
ATOM   4257  C  C     . VAL A 1 573 ? 13.722  39.534  -44.990 1.00 45.73 ? 573 VAL A C     1 
ATOM   4258  O  O     . VAL A 1 573 ? 14.549  38.776  -44.469 1.00 45.68 ? 573 VAL A O     1 
ATOM   4259  C  CB    . VAL A 1 573 ? 11.373  39.028  -44.205 1.00 44.00 ? 573 VAL A CB    1 
ATOM   4260  C  CG1   . VAL A 1 573 ? 11.523  40.288  -43.341 1.00 43.58 ? 573 VAL A CG1   1 
ATOM   4261  C  CG2   . VAL A 1 573 ? 9.953   38.912  -44.696 1.00 43.87 ? 573 VAL A CG2   1 
ATOM   4262  N  N     . THR A 1 574 ? 13.955  40.814  -45.237 1.00 46.35 ? 574 THR A N     1 
ATOM   4263  C  CA    . THR A 1 574 ? 15.128  41.487  -44.721 1.00 46.88 ? 574 THR A CA    1 
ATOM   4264  C  C     . THR A 1 574 ? 14.680  42.324  -43.527 1.00 46.24 ? 574 THR A C     1 
ATOM   4265  O  O     . THR A 1 574 ? 13.804  43.188  -43.670 1.00 46.23 ? 574 THR A O     1 
ATOM   4266  C  CB    . THR A 1 574 ? 15.792  42.369  -45.801 1.00 48.37 ? 574 THR A CB    1 
ATOM   4267  O  OG1   . THR A 1 574 ? 16.110  41.556  -46.938 1.00 48.56 ? 574 THR A OG1   1 
ATOM   4268  C  CG2   . THR A 1 574 ? 17.061  43.036  -45.262 1.00 48.68 ? 574 THR A CG2   1 
ATOM   4269  N  N     . PRO A 1 575 ? 15.285  42.079  -42.348 1.00 45.57 ? 575 PRO A N     1 
ATOM   4270  C  CA    . PRO A 1 575 ? 14.892  42.823  -41.165 1.00 44.88 ? 575 PRO A CA    1 
ATOM   4271  C  C     . PRO A 1 575 ? 15.198  44.306  -41.336 1.00 45.91 ? 575 PRO A C     1 
ATOM   4272  O  O     . PRO A 1 575 ? 15.996  44.676  -42.214 1.00 46.72 ? 575 PRO A O     1 
ATOM   4273  C  CB    . PRO A 1 575 ? 15.770  42.218  -40.057 1.00 44.38 ? 575 PRO A CB    1 
ATOM   4274  C  CG    . PRO A 1 575 ? 16.202  40.892  -40.579 1.00 44.30 ? 575 PRO A CG    1 
ATOM   4275  C  CD    . PRO A 1 575 ? 16.375  41.131  -42.050 1.00 45.87 ? 575 PRO A CD    1 
ATOM   4276  N  N     . THR A 1 576 ? 14.551  45.140  -40.517 1.00 45.51 ? 576 THR A N     1 
ATOM   4277  C  CA    . THR A 1 576 ? 14.864  46.572  -40.447 1.00 46.35 ? 576 THR A CA    1 
ATOM   4278  C  C     . THR A 1 576 ? 16.296  46.741  -39.920 1.00 47.05 ? 576 THR A C     1 
ATOM   4279  O  O     . THR A 1 576 ? 16.949  45.757  -39.557 1.00 46.63 ? 576 THR A O     1 
ATOM   4280  C  CB    . THR A 1 576 ? 13.834  47.371  -39.558 1.00 45.95 ? 576 THR A CB    1 
ATOM   4281  O  OG1   . THR A 1 576 ? 14.123  47.198  -38.163 1.00 45.38 ? 576 THR A OG1   1 
ATOM   4282  C  CG2   . THR A 1 576 ? 12.385  46.938  -39.836 1.00 44.26 ? 576 THR A CG2   1 
ATOM   4283  N  N     . ASP A 1 577 ? 16.785  47.978  -39.879 1.00 48.22 ? 577 ASP A N     1 
ATOM   4284  C  CA    . ASP A 1 577 ? 18.157  48.249  -39.435 1.00 49.06 ? 577 ASP A CA    1 
ATOM   4285  C  C     . ASP A 1 577 ? 18.308  48.312  -37.904 1.00 48.28 ? 577 ASP A C     1 
ATOM   4286  O  O     . ASP A 1 577 ? 19.399  48.552  -37.399 1.00 49.20 ? 577 ASP A O     1 
ATOM   4287  C  CB    . ASP A 1 577 ? 18.694  49.542  -40.098 1.00 50.61 ? 577 ASP A CB    1 
ATOM   4288  N  N     . LEU A 1 578 ? 17.219  48.080  -37.176 1.00 46.81 ? 578 LEU A N     1 
ATOM   4289  C  CA    . LEU A 1 578 ? 17.205  48.184  -35.707 1.00 46.04 ? 578 LEU A CA    1 
ATOM   4290  C  C     . LEU A 1 578 ? 18.256  47.319  -34.989 1.00 45.87 ? 578 LEU A C     1 
ATOM   4291  O  O     . LEU A 1 578 ? 18.912  47.784  -34.058 1.00 46.02 ? 578 LEU A O     1 
ATOM   4292  C  CB    . LEU A 1 578 ? 15.795  47.891  -35.160 1.00 44.62 ? 578 LEU A CB    1 
ATOM   4293  C  CG    . LEU A 1 578 ? 15.521  47.988  -33.651 1.00 44.30 ? 578 LEU A CG    1 
ATOM   4294  C  CD1   . LEU A 1 578 ? 15.756  49.407  -33.120 1.00 44.21 ? 578 LEU A CD1   1 
ATOM   4295  C  CD2   . LEU A 1 578 ? 14.105  47.511  -33.322 1.00 42.94 ? 578 LEU A CD2   1 
ATOM   4296  N  N     . TRP A 1 579 ? 18.403  46.070  -35.428 1.00 45.50 ? 579 TRP A N     1 
ATOM   4297  C  CA    . TRP A 1 579 ? 19.323  45.121  -34.807 1.00 45.40 ? 579 TRP A CA    1 
ATOM   4298  C  C     . TRP A 1 579 ? 20.354  44.616  -35.794 1.00 46.61 ? 579 TRP A C     1 
ATOM   4299  O  O     . TRP A 1 579 ? 20.056  44.449  -36.984 1.00 46.67 ? 579 TRP A O     1 
ATOM   4300  C  CB    . TRP A 1 579 ? 18.560  43.934  -34.205 1.00 44.28 ? 579 TRP A CB    1 
ATOM   4301  C  CG    . TRP A 1 579 ? 17.742  44.308  -33.008 1.00 43.21 ? 579 TRP A CG    1 
ATOM   4302  C  CD1   . TRP A 1 579 ? 16.383  44.425  -32.949 1.00 42.26 ? 579 TRP A CD1   1 
ATOM   4303  C  CD2   . TRP A 1 579 ? 18.235  44.639  -31.700 1.00 42.75 ? 579 TRP A CD2   1 
ATOM   4304  N  NE1   . TRP A 1 579 ? 15.999  44.809  -31.683 1.00 42.19 ? 579 TRP A NE1   1 
ATOM   4305  C  CE2   . TRP A 1 579 ? 17.115  44.944  -30.897 1.00 41.69 ? 579 TRP A CE2   1 
ATOM   4306  C  CE3   . TRP A 1 579 ? 19.518  44.712  -31.134 1.00 44.56 ? 579 TRP A CE3   1 
ATOM   4307  C  CZ2   . TRP A 1 579 ? 17.231  45.310  -29.548 1.00 42.13 ? 579 TRP A CZ2   1 
ATOM   4308  C  CZ3   . TRP A 1 579 ? 19.635  45.077  -29.787 1.00 44.75 ? 579 TRP A CZ3   1 
ATOM   4309  C  CH2   . TRP A 1 579 ? 18.492  45.372  -29.011 1.00 43.31 ? 579 TRP A CH2   1 
ATOM   4310  N  N     . ASP A 1 580 ? 21.562  44.365  -35.279 1.00 47.29 ? 580 ASP A N     1 
ATOM   4311  C  CA    . ASP A 1 580 ? 22.702  43.900  -36.068 1.00 48.10 ? 580 ASP A CA    1 
ATOM   4312  C  C     . ASP A 1 580 ? 22.686  42.378  -36.229 1.00 47.29 ? 580 ASP A C     1 
ATOM   4313  O  O     . ASP A 1 580 ? 23.297  41.652  -35.436 1.00 47.38 ? 580 ASP A O     1 
ATOM   4314  C  CB    . ASP A 1 580 ? 23.999  44.338  -35.380 1.00 49.49 ? 580 ASP A CB    1 
ATOM   4315  C  CG    . ASP A 1 580 ? 25.235  44.130  -36.248 1.00 52.06 ? 580 ASP A CG    1 
ATOM   4316  O  OD1   . ASP A 1 580 ? 25.201  43.318  -37.206 1.00 53.42 ? 580 ASP A OD1   1 
ATOM   4317  O  OD2   . ASP A 1 580 ? 26.257  44.792  -35.963 1.00 55.10 ? 580 ASP A OD2   1 
ATOM   4318  N  N     . TRP A 1 581 ? 21.995  41.902  -37.262 1.00 46.65 ? 581 TRP A N     1 
ATOM   4319  C  CA    . TRP A 1 581 ? 21.861  40.463  -37.515 1.00 45.87 ? 581 TRP A CA    1 
ATOM   4320  C  C     . TRP A 1 581 ? 23.148  39.805  -38.035 1.00 46.87 ? 581 TRP A C     1 
ATOM   4321  O  O     . TRP A 1 581 ? 23.338  38.601  -37.853 1.00 46.65 ? 581 TRP A O     1 
ATOM   4322  C  CB    . TRP A 1 581 ? 20.674  40.179  -38.448 1.00 45.08 ? 581 TRP A CB    1 
ATOM   4323  C  CG    . TRP A 1 581 ? 19.357  40.609  -37.848 1.00 44.14 ? 581 TRP A CG    1 
ATOM   4324  C  CD1   . TRP A 1 581 ? 18.737  41.811  -38.021 1.00 43.92 ? 581 TRP A CD1   1 
ATOM   4325  C  CD2   . TRP A 1 581 ? 18.521  39.849  -36.956 1.00 42.05 ? 581 TRP A CD2   1 
ATOM   4326  N  NE1   . TRP A 1 581 ? 17.569  41.853  -37.293 1.00 42.82 ? 581 TRP A NE1   1 
ATOM   4327  C  CE2   . TRP A 1 581 ? 17.409  40.664  -36.632 1.00 41.89 ? 581 TRP A CE2   1 
ATOM   4328  C  CE3   . TRP A 1 581 ? 18.600  38.559  -36.405 1.00 41.71 ? 581 TRP A CE3   1 
ATOM   4329  C  CZ2   . TRP A 1 581 ? 16.367  40.229  -35.783 1.00 40.64 ? 581 TRP A CZ2   1 
ATOM   4330  C  CZ3   . TRP A 1 581 ? 17.561  38.125  -35.544 1.00 41.33 ? 581 TRP A CZ3   1 
ATOM   4331  C  CH2   . TRP A 1 581 ? 16.465  38.967  -35.245 1.00 40.17 ? 581 TRP A CH2   1 
ATOM   4332  N  N     . LYS A 1 582 ? 24.022  40.586  -38.670 1.00 48.12 ? 582 LYS A N     1 
ATOM   4333  C  CA    . LYS A 1 582 ? 25.302  40.069  -39.164 1.00 49.46 ? 582 LYS A CA    1 
ATOM   4334  C  C     . LYS A 1 582 ? 26.167  39.604  -38.007 1.00 49.50 ? 582 LYS A C     1 
ATOM   4335  O  O     . LYS A 1 582 ? 26.682  38.490  -38.033 1.00 49.55 ? 582 LYS A O     1 
ATOM   4336  C  CB    . LYS A 1 582 ? 26.050  41.105  -40.016 1.00 50.75 ? 582 LYS A CB    1 
ATOM   4337  N  N     . VAL A 1 583 ? 26.299  40.446  -36.985 1.00 49.63 ? 583 VAL A N     1 
ATOM   4338  C  CA    . VAL A 1 583 ? 27.074  40.086  -35.791 1.00 50.34 ? 583 VAL A CA    1 
ATOM   4339  C  C     . VAL A 1 583 ? 26.481  38.875  -35.052 1.00 49.01 ? 583 VAL A C     1 
ATOM   4340  O  O     . VAL A 1 583 ? 27.227  37.985  -34.627 1.00 49.59 ? 583 VAL A O     1 
ATOM   4341  C  CB    . VAL A 1 583 ? 27.287  41.303  -34.842 1.00 50.98 ? 583 VAL A CB    1 
ATOM   4342  C  CG1   . VAL A 1 583 ? 27.559  40.866  -33.388 1.00 50.92 ? 583 VAL A CG1   1 
ATOM   4343  C  CG2   . VAL A 1 583 ? 28.420  42.179  -35.359 1.00 52.55 ? 583 VAL A CG2   1 
ATOM   4344  N  N     . LEU A 1 584 ? 25.157  38.824  -34.929 1.00 47.19 ? 584 LEU A N     1 
ATOM   4345  C  CA    . LEU A 1 584 ? 24.508  37.688  -34.267 1.00 46.27 ? 584 LEU A CA    1 
ATOM   4346  C  C     . LEU A 1 584 ? 24.708  36.362  -35.010 1.00 46.45 ? 584 LEU A C     1 
ATOM   4347  O  O     . LEU A 1 584 ? 24.999  35.344  -34.390 1.00 46.52 ? 584 LEU A O     1 
ATOM   4348  C  CB    . LEU A 1 584 ? 23.017  37.954  -34.018 1.00 44.75 ? 584 LEU A CB    1 
ATOM   4349  C  CG    . LEU A 1 584 ? 22.202  36.819  -33.399 1.00 43.09 ? 584 LEU A CG    1 
ATOM   4350  C  CD1   . LEU A 1 584 ? 22.640  36.542  -31.966 1.00 42.95 ? 584 LEU A CD1   1 
ATOM   4351  C  CD2   . LEU A 1 584 ? 20.733  37.145  -33.453 1.00 42.58 ? 584 LEU A CD2   1 
ATOM   4352  N  N     . LYS A 1 585 ? 24.542  36.377  -36.329 1.00 46.99 ? 585 LYS A N     1 
ATOM   4353  C  CA    . LYS A 1 585 ? 24.805  35.198  -37.154 1.00 47.54 ? 585 LYS A CA    1 
ATOM   4354  C  C     . LYS A 1 585 ? 26.245  34.681  -36.999 1.00 48.81 ? 585 LYS A C     1 
ATOM   4355  O  O     . LYS A 1 585 ? 26.483  33.480  -37.054 1.00 49.01 ? 585 LYS A O     1 
ATOM   4356  C  CB    . LYS A 1 585 ? 24.489  35.487  -38.620 1.00 47.71 ? 585 LYS A CB    1 
ATOM   4357  C  CG    . LYS A 1 585 ? 23.018  35.364  -38.960 1.00 47.36 ? 585 LYS A CG    1 
ATOM   4358  C  CD    . LYS A 1 585 ? 22.776  35.435  -40.465 1.00 48.34 ? 585 LYS A CD    1 
ATOM   4359  C  CE    . LYS A 1 585 ? 21.417  34.838  -40.821 1.00 47.48 ? 585 LYS A CE    1 
ATOM   4360  N  NZ    . LYS A 1 585 ? 20.980  35.211  -42.194 1.00 46.74 ? 585 LYS A NZ    1 
ATOM   4361  N  N     . GLU A 1 586 ? 27.191  35.593  -36.793 1.00 49.96 ? 586 GLU A N     1 
ATOM   4362  C  CA    . GLU A 1 586 ? 28.591  35.233  -36.528 1.00 51.61 ? 586 GLU A CA    1 
ATOM   4363  C  C     . GLU A 1 586 ? 28.724  34.479  -35.211 1.00 50.85 ? 586 GLU A C     1 
ATOM   4364  O  O     . GLU A 1 586 ? 29.465  33.500  -35.117 1.00 51.50 ? 586 GLU A O     1 
ATOM   4365  C  CB    . GLU A 1 586 ? 29.483  36.478  -36.514 1.00 52.53 ? 586 GLU A CB    1 
ATOM   4366  C  CG    . GLU A 1 586 ? 29.676  37.116  -37.882 1.00 54.30 ? 586 GLU A CG    1 
ATOM   4367  C  CD    . GLU A 1 586 ? 30.486  38.405  -37.839 1.00 56.13 ? 586 GLU A CD    1 
ATOM   4368  O  OE1   . GLU A 1 586 ? 30.215  39.275  -36.982 1.00 58.15 ? 586 GLU A OE1   1 
ATOM   4369  O  OE2   . GLU A 1 586 ? 31.394  38.557  -38.682 1.00 59.11 ? 586 GLU A OE2   1 
ATOM   4370  N  N     . LYS A 1 587 ? 27.989  34.928  -34.198 1.00 49.70 ? 587 LYS A N     1 
ATOM   4371  C  CA    . LYS A 1 587 ? 28.002  34.256  -32.908 1.00 49.19 ? 587 LYS A CA    1 
ATOM   4372  C  C     . LYS A 1 587 ? 27.386  32.860  -32.996 1.00 48.01 ? 587 LYS A C     1 
ATOM   4373  O  O     . LYS A 1 587 ? 27.955  31.906  -32.469 1.00 48.38 ? 587 LYS A O     1 
ATOM   4374  C  CB    . LYS A 1 587 ? 27.297  35.092  -31.847 1.00 48.64 ? 587 LYS A CB    1 
ATOM   4375  C  CG    . LYS A 1 587 ? 28.007  36.377  -31.504 1.00 50.45 ? 587 LYS A CG    1 
ATOM   4376  C  CD    . LYS A 1 587 ? 27.377  36.987  -30.271 1.00 52.62 ? 587 LYS A CD    1 
ATOM   4377  C  CE    . LYS A 1 587 ? 27.563  38.495  -30.225 1.00 54.20 ? 587 LYS A CE    1 
ATOM   4378  N  NZ    . LYS A 1 587 ? 26.494  39.093  -29.370 1.00 55.18 ? 587 LYS A NZ    1 
ATOM   4379  N  N     . ILE A 1 588 ? 26.241  32.744  -33.672 1.00 46.45 ? 588 ILE A N     1 
ATOM   4380  C  CA    . ILE A 1 588 ? 25.578  31.449  -33.863 1.00 45.23 ? 588 ILE A CA    1 
ATOM   4381  C  C     . ILE A 1 588 ? 26.443  30.500  -34.693 1.00 45.93 ? 588 ILE A C     1 
ATOM   4382  O  O     . ILE A 1 588 ? 26.604  29.332  -34.344 1.00 45.99 ? 588 ILE A O     1 
ATOM   4383  C  CB    . ILE A 1 588 ? 24.171  31.596  -34.504 1.00 44.37 ? 588 ILE A CB    1 
ATOM   4384  C  CG1   . ILE A 1 588 ? 23.301  32.534  -33.661 1.00 42.75 ? 588 ILE A CG1   1 
ATOM   4385  C  CG2   . ILE A 1 588 ? 23.520  30.214  -34.706 1.00 42.82 ? 588 ILE A CG2   1 
ATOM   4386  C  CD1   . ILE A 1 588 ? 22.007  32.952  -34.325 1.00 42.38 ? 588 ILE A CD1   1 
ATOM   4387  N  N     . ALA A 1 589 ? 27.020  31.010  -35.777 1.00 46.30 ? 589 ALA A N     1 
ATOM   4388  C  CA    . ALA A 1 589 ? 27.912  30.208  -36.607 1.00 46.92 ? 589 ALA A CA    1 
ATOM   4389  C  C     . ALA A 1 589 ? 29.070  29.601  -35.801 1.00 48.01 ? 589 ALA A C     1 
ATOM   4390  O  O     . ALA A 1 589 ? 29.529  28.502  -36.117 1.00 48.64 ? 589 ALA A O     1 
ATOM   4391  C  CB    . ALA A 1 589 ? 28.433  31.025  -37.783 1.00 47.57 ? 589 ALA A CB    1 
ATOM   4392  N  N     . LYS A 1 590 ? 29.523  30.304  -34.759 1.00 48.22 ? 590 LYS A N     1 
ATOM   4393  C  CA    . LYS A 1 590 ? 30.657  29.842  -33.943 1.00 49.39 ? 590 LYS A CA    1 
ATOM   4394  C  C     . LYS A 1 590 ? 30.256  28.926  -32.782 1.00 48.76 ? 590 LYS A C     1 
ATOM   4395  O  O     . LYS A 1 590 ? 30.971  27.968  -32.486 1.00 49.22 ? 590 LYS A O     1 
ATOM   4396  C  CB    . LYS A 1 590 ? 31.504  31.034  -33.431 1.00 50.21 ? 590 LYS A CB    1 
ATOM   4397  N  N     . TYR A 1 591 ? 29.115  29.214  -32.144 1.00 47.51 ? 591 TYR A N     1 
ATOM   4398  C  CA    . TYR A 1 591 ? 28.673  28.479  -30.944 1.00 46.94 ? 591 TYR A CA    1 
ATOM   4399  C  C     . TYR A 1 591 ? 27.385  27.694  -31.137 1.00 45.57 ? 591 TYR A C     1 
ATOM   4400  O  O     . TYR A 1 591 ? 27.130  26.716  -30.423 1.00 45.47 ? 591 TYR A O     1 
ATOM   4401  C  CB    . TYR A 1 591 ? 28.476  29.427  -29.757 1.00 46.89 ? 591 TYR A CB    1 
ATOM   4402  C  CG    . TYR A 1 591 ? 29.679  30.257  -29.408 1.00 48.31 ? 591 TYR A CG    1 
ATOM   4403  C  CD1   . TYR A 1 591 ? 29.673  31.637  -29.605 1.00 48.21 ? 591 TYR A CD1   1 
ATOM   4404  C  CD2   . TYR A 1 591 ? 30.830  29.666  -28.884 1.00 50.84 ? 591 TYR A CD2   1 
ATOM   4405  C  CE1   . TYR A 1 591 ? 30.779  32.413  -29.284 1.00 49.88 ? 591 TYR A CE1   1 
ATOM   4406  C  CE2   . TYR A 1 591 ? 31.951  30.434  -28.567 1.00 51.82 ? 591 TYR A CE2   1 
ATOM   4407  C  CZ    . TYR A 1 591 ? 31.914  31.805  -28.768 1.00 51.35 ? 591 TYR A CZ    1 
ATOM   4408  O  OH    . TYR A 1 591 ? 33.012  32.568  -28.450 1.00 53.86 ? 591 TYR A OH    1 
ATOM   4409  N  N     . GLY A 1 592 ? 26.561  28.133  -32.079 1.00 44.48 ? 592 GLY A N     1 
ATOM   4410  C  CA    . GLY A 1 592 ? 25.262  27.504  -32.295 1.00 42.89 ? 592 GLY A CA    1 
ATOM   4411  C  C     . GLY A 1 592 ? 24.291  27.968  -31.234 1.00 41.44 ? 592 GLY A C     1 
ATOM   4412  O  O     . GLY A 1 592 ? 24.527  28.972  -30.563 1.00 41.75 ? 592 GLY A O     1 
ATOM   4413  N  N     . ILE A 1 593 ? 23.194  27.243  -31.082 1.00 40.18 ? 593 ILE A N     1 
ATOM   4414  C  CA    . ILE A 1 593 ? 22.164  27.632  -30.128 1.00 38.93 ? 593 ILE A CA    1 
ATOM   4415  C  C     . ILE A 1 593 ? 21.722  26.452  -29.267 1.00 38.23 ? 593 ILE A C     1 
ATOM   4416  O  O     . ILE A 1 593 ? 21.834  25.302  -29.682 1.00 38.19 ? 593 ILE A O     1 
ATOM   4417  C  CB    . ILE A 1 593 ? 20.953  28.329  -30.815 1.00 38.28 ? 593 ILE A CB    1 
ATOM   4418  C  CG1   . ILE A 1 593 ? 20.479  27.545  -32.048 1.00 37.81 ? 593 ILE A CG1   1 
ATOM   4419  C  CG2   . ILE A 1 593 ? 21.314  29.780  -31.202 1.00 38.83 ? 593 ILE A CG2   1 
ATOM   4420  C  CD1   . ILE A 1 593 ? 19.077  27.914  -32.494 1.00 36.82 ? 593 ILE A CD1   1 
ATOM   4421  N  N     . ARG A 1 594 ? 21.252  26.764  -28.064 1.00 37.34 ? 594 ARG A N     1 
ATOM   4422  C  CA    . ARG A 1 594 ? 20.795  25.791  -27.082 1.00 37.08 ? 594 ARG A CA    1 
ATOM   4423  C  C     . ARG A 1 594 ? 19.358  25.284  -27.309 1.00 36.13 ? 594 ARG A C     1 
ATOM   4424  O  O     . ARG A 1 594 ? 18.956  24.248  -26.750 1.00 35.90 ? 594 ARG A O     1 
ATOM   4425  C  CB    . ARG A 1 594 ? 20.881  26.424  -25.686 1.00 37.14 ? 594 ARG A CB    1 
ATOM   4426  C  CG    . ARG A 1 594 ? 20.758  25.452  -24.524 1.00 36.71 ? 594 ARG A CG    1 
ATOM   4427  C  CD    . ARG A 1 594 ? 21.910  24.432  -24.483 1.00 36.61 ? 594 ARG A CD    1 
ATOM   4428  N  NE    . ARG A 1 594 ? 21.621  23.398  -23.496 1.00 36.71 ? 594 ARG A NE    1 
ATOM   4429  C  CZ    . ARG A 1 594 ? 22.041  22.138  -23.553 1.00 37.31 ? 594 ARG A CZ    1 
ATOM   4430  N  NH1   . ARG A 1 594 ? 22.806  21.718  -24.554 1.00 38.48 ? 594 ARG A NH1   1 
ATOM   4431  N  NH2   . ARG A 1 594 ? 21.678  21.284  -22.601 1.00 35.61 ? 594 ARG A NH2   1 
ATOM   4432  N  N     . ASN A 1 595 ? 18.580  26.015  -28.104 1.00 35.22 ? 595 ASN A N     1 
ATOM   4433  C  CA    . ASN A 1 595 ? 17.162  25.700  -28.274 1.00 34.29 ? 595 ASN A CA    1 
ATOM   4434  C  C     . ASN A 1 595 ? 16.753  25.709  -29.733 1.00 34.46 ? 595 ASN A C     1 
ATOM   4435  O  O     . ASN A 1 595 ? 17.052  26.665  -30.462 1.00 34.71 ? 595 ASN A O     1 
ATOM   4436  C  CB    . ASN A 1 595 ? 16.298  26.680  -27.482 1.00 33.16 ? 595 ASN A CB    1 
ATOM   4437  C  CG    . ASN A 1 595 ? 16.765  26.844  -26.050 1.00 33.32 ? 595 ASN A CG    1 
ATOM   4438  O  OD1   . ASN A 1 595 ? 16.542  25.973  -25.196 1.00 33.89 ? 595 ASN A OD1   1 
ATOM   4439  N  ND2   . ASN A 1 595 ? 17.409  27.968  -25.773 1.00 30.38 ? 595 ASN A ND2   1 
ATOM   4440  N  N     . SER A 1 596 ? 16.074  24.645  -30.152 1.00 34.44 ? 596 SER A N     1 
ATOM   4441  C  CA    . SER A 1 596 ? 15.731  24.441  -31.559 1.00 34.89 ? 596 SER A CA    1 
ATOM   4442  C  C     . SER A 1 596 ? 14.678  25.415  -32.042 1.00 34.67 ? 596 SER A C     1 
ATOM   4443  O  O     . SER A 1 596 ? 14.622  25.724  -33.239 1.00 34.53 ? 596 SER A O     1 
ATOM   4444  C  CB    . SER A 1 596 ? 15.254  23.004  -31.812 1.00 34.91 ? 596 SER A CB    1 
ATOM   4445  O  OG    . SER A 1 596 ? 14.143  22.658  -30.998 1.00 35.29 ? 596 SER A OG    1 
ATOM   4446  N  N     . LEU A 1 597 ? 13.841  25.871  -31.101 1.00 34.32 ? 597 LEU A N     1 
ATOM   4447  C  CA    . LEU A 1 597 ? 12.746  26.789  -31.373 1.00 33.99 ? 597 LEU A CA    1 
ATOM   4448  C  C     . LEU A 1 597 ? 12.550  27.704  -30.166 1.00 34.19 ? 597 LEU A C     1 
ATOM   4449  O  O     . LEU A 1 597 ? 12.804  27.295  -29.024 1.00 34.94 ? 597 LEU A O     1 
ATOM   4450  C  CB    . LEU A 1 597 ? 11.463  26.011  -31.685 1.00 34.01 ? 597 LEU A CB    1 
ATOM   4451  C  CG    . LEU A 1 597 ? 11.453  25.095  -32.930 1.00 34.38 ? 597 LEU A CG    1 
ATOM   4452  C  CD1   . LEU A 1 597 ? 10.190  24.255  -32.936 1.00 34.66 ? 597 LEU A CD1   1 
ATOM   4453  C  CD2   . LEU A 1 597 ? 11.589  25.875  -34.237 1.00 32.14 ? 597 LEU A CD2   1 
ATOM   4454  N  N     . LEU A 1 598 ? 12.095  28.932  -30.414 1.00 33.62 ? 598 LEU A N     1 
ATOM   4455  C  CA    . LEU A 1 598 ? 12.124  29.984  -29.405 1.00 33.42 ? 598 LEU A CA    1 
ATOM   4456  C  C     . LEU A 1 598 ? 10.820  30.725  -29.150 1.00 33.19 ? 598 LEU A C     1 
ATOM   4457  O  O     . LEU A 1 598 ? 10.509  31.030  -28.006 1.00 33.23 ? 598 LEU A O     1 
ATOM   4458  C  CB    . LEU A 1 598 ? 13.214  31.001  -29.748 1.00 33.84 ? 598 LEU A CB    1 
ATOM   4459  C  CG    . LEU A 1 598 ? 14.636  30.444  -29.621 1.00 34.78 ? 598 LEU A CG    1 
ATOM   4460  C  CD1   . LEU A 1 598 ? 15.607  31.220  -30.499 1.00 34.55 ? 598 LEU A CD1   1 
ATOM   4461  C  CD2   . LEU A 1 598 ? 15.091  30.429  -28.160 1.00 33.98 ? 598 LEU A CD2   1 
ATOM   4462  N  N     . ILE A 1 599 ? 10.072  31.013  -30.212 1.00 33.36 ? 599 ILE A N     1 
ATOM   4463  C  CA    . ILE A 1 599 ? 9.003   32.000  -30.186 1.00 33.24 ? 599 ILE A CA    1 
ATOM   4464  C  C     . ILE A 1 599 ? 7.705   31.366  -30.650 1.00 33.69 ? 599 ILE A C     1 
ATOM   4465  O  O     . ILE A 1 599 ? 7.669   30.707  -31.689 1.00 33.54 ? 599 ILE A O     1 
ATOM   4466  C  CB    . ILE A 1 599 ? 9.326   33.222  -31.121 1.00 33.37 ? 599 ILE A CB    1 
ATOM   4467  C  CG1   . ILE A 1 599 ? 10.778  33.709  -30.954 1.00 33.70 ? 599 ILE A CG1   1 
ATOM   4468  C  CG2   . ILE A 1 599 ? 8.322   34.368  -30.905 1.00 32.82 ? 599 ILE A CG2   1 
ATOM   4469  C  CD1   . ILE A 1 599 ? 11.100  34.311  -29.575 1.00 31.87 ? 599 ILE A CD1   1 
ATOM   4470  N  N     . ALA A 1 600 ? 6.640   31.580  -29.884 1.00 34.57 ? 600 ALA A N     1 
ATOM   4471  C  CA    . ALA A 1 600 ? 5.323   31.018  -30.200 1.00 35.48 ? 600 ALA A CA    1 
ATOM   4472  C  C     . ALA A 1 600 ? 4.215   31.775  -29.467 1.00 35.93 ? 600 ALA A C     1 
ATOM   4473  O  O     . ALA A 1 600 ? 3.774   31.348  -28.398 1.00 36.25 ? 600 ALA A O     1 
ATOM   4474  C  CB    . ALA A 1 600 ? 5.283   29.525  -29.844 1.00 35.62 ? 600 ALA A CB    1 
ATOM   4475  N  N     . PRO A 1 601 ? 3.789   32.930  -30.010 1.00 36.47 ? 601 PRO A N     1 
ATOM   4476  C  CA    . PRO A 1 601 ? 2.697   33.674  -29.371 1.00 36.95 ? 601 PRO A CA    1 
ATOM   4477  C  C     . PRO A 1 601 ? 1.398   32.881  -29.164 1.00 37.26 ? 601 PRO A C     1 
ATOM   4478  O  O     . PRO A 1 601 ? 0.638   32.637  -30.107 1.00 37.37 ? 601 PRO A O     1 
ATOM   4479  C  CB    . PRO A 1 601 ? 2.507   34.881  -30.300 1.00 37.40 ? 601 PRO A CB    1 
ATOM   4480  C  CG    . PRO A 1 601 ? 3.884   35.062  -30.928 1.00 37.17 ? 601 PRO A CG    1 
ATOM   4481  C  CD    . PRO A 1 601 ? 4.336   33.653  -31.172 1.00 36.50 ? 601 PRO A CD    1 
ATOM   4482  N  N     . MET A 1 602 ? 1.195   32.488  -27.912 1.00 37.88 ? 602 MET A N     1 
ATOM   4483  C  CA    . MET A 1 602 ? 0.038   31.731  -27.427 1.00 38.67 ? 602 MET A CA    1 
ATOM   4484  C  C     . MET A 1 602 ? -1.065  32.669  -26.932 1.00 39.59 ? 602 MET A C     1 
ATOM   4485  O  O     . MET A 1 602 ? -0.804  33.845  -26.696 1.00 39.25 ? 602 MET A O     1 
ATOM   4486  C  CB    . MET A 1 602 ? 0.467   30.805  -26.275 1.00 38.72 ? 602 MET A CB    1 
ATOM   4487  C  CG    . MET A 1 602 ? 0.805   31.506  -24.941 1.00 37.98 ? 602 MET A CG    1 
ATOM   4488  S  SD    . MET A 1 602 ? 2.242   32.618  -25.000 1.00 39.93 ? 602 MET A SD    1 
ATOM   4489  C  CE    . MET A 1 602 ? 3.583   31.445  -25.121 1.00 36.50 ? 602 MET A CE    1 
ATOM   4490  N  N     . PRO A 1 603 ? -2.295  32.143  -26.754 1.00 40.73 ? 603 PRO A N     1 
ATOM   4491  C  CA    . PRO A 1 603 ? -3.455  32.938  -26.347 1.00 41.92 ? 603 PRO A CA    1 
ATOM   4492  C  C     . PRO A 1 603 ? -3.352  33.681  -25.014 1.00 43.17 ? 603 PRO A C     1 
ATOM   4493  O  O     . PRO A 1 603 ? -4.010  34.699  -24.866 1.00 44.62 ? 603 PRO A O     1 
ATOM   4494  C  CB    . PRO A 1 603 ? -4.590  31.904  -26.280 1.00 42.16 ? 603 PRO A CB    1 
ATOM   4495  C  CG    . PRO A 1 603 ? -4.153  30.810  -27.169 1.00 41.71 ? 603 PRO A CG    1 
ATOM   4496  C  CD    . PRO A 1 603 ? -2.668  30.734  -26.974 1.00 40.83 ? 603 PRO A CD    1 
ATOM   4497  N  N     . THR A 1 604 ? -2.577  33.193  -24.052 1.00 43.79 ? 604 THR A N     1 
ATOM   4498  C  CA    . THR A 1 604 ? -2.409  33.886  -22.751 1.00 44.96 ? 604 THR A CA    1 
ATOM   4499  C  C     . THR A 1 604 ? -3.713  34.284  -22.037 1.00 45.63 ? 604 THR A C     1 
ATOM   4500  O  O     . THR A 1 604 ? -3.771  35.343  -21.401 1.00 45.92 ? 604 THR A O     1 
ATOM   4501  C  CB    . THR A 1 604 ? -1.518  35.194  -22.839 1.00 45.18 ? 604 THR A CB    1 
ATOM   4502  O  OG1   . THR A 1 604 ? -2.247  36.256  -23.493 1.00 44.91 ? 604 THR A OG1   1 
ATOM   4503  C  CG2   . THR A 1 604 ? -0.178  34.938  -23.529 1.00 44.71 ? 604 THR A CG2   1 
ATOM   4504  N  N     . ALA A 1 605 ? -4.746  33.452  -22.119 1.00 46.15 ? 605 ALA A N     1 
ATOM   4505  C  CA    . ALA A 1 605 ? -6.053  33.849  -21.580 1.00 46.80 ? 605 ALA A CA    1 
ATOM   4506  C  C     . ALA A 1 605 ? -5.977  34.238  -20.099 1.00 46.96 ? 605 ALA A C     1 
ATOM   4507  O  O     . ALA A 1 605 ? -6.328  35.361  -19.734 1.00 47.60 ? 605 ALA A O     1 
ATOM   4508  C  CB    . ALA A 1 605 ? -7.101  32.769  -21.817 1.00 47.28 ? 605 ALA A CB    1 
ATOM   4509  N  N     . SER A 1 606 ? -5.465  33.335  -19.269 1.00 46.57 ? 606 SER A N     1 
ATOM   4510  C  CA    . SER A 1 606 ? -5.479  33.521  -17.819 1.00 46.71 ? 606 SER A CA    1 
ATOM   4511  C  C     . SER A 1 606 ? -4.438  34.487  -17.268 1.00 45.64 ? 606 SER A C     1 
ATOM   4512  O  O     . SER A 1 606 ? -4.743  35.282  -16.384 1.00 46.28 ? 606 SER A O     1 
ATOM   4513  C  CB    . SER A 1 606 ? -5.398  32.165  -17.096 1.00 47.58 ? 606 SER A CB    1 
ATOM   4514  O  OG    . SER A 1 606 ? -4.747  31.183  -17.901 1.00 49.19 ? 606 SER A OG    1 
ATOM   4515  N  N     . THR A 1 607 ? -3.215  34.437  -17.773 1.00 44.30 ? 607 THR A N     1 
ATOM   4516  C  CA    . THR A 1 607 ? -2.181  35.330  -17.255 1.00 43.28 ? 607 THR A CA    1 
ATOM   4517  C  C     . THR A 1 607 ? -2.379  36.783  -17.709 1.00 42.89 ? 607 THR A C     1 
ATOM   4518  O  O     . THR A 1 607 ? -1.969  37.710  -17.005 1.00 43.26 ? 607 THR A O     1 
ATOM   4519  C  CB    . THR A 1 607 ? -0.739  34.834  -17.561 1.00 42.96 ? 607 THR A CB    1 
ATOM   4520  O  OG1   . THR A 1 607 ? -0.569  34.664  -18.969 1.00 41.95 ? 607 THR A OG1   1 
ATOM   4521  C  CG2   . THR A 1 607 ? -0.432  33.517  -16.837 1.00 42.30 ? 607 THR A CG2   1 
ATOM   4522  N  N     . ALA A 1 608 ? -3.009  36.984  -18.868 1.00 41.71 ? 608 ALA A N     1 
ATOM   4523  C  CA    . ALA A 1 608 ? -3.345  38.336  -19.331 1.00 40.89 ? 608 ALA A CA    1 
ATOM   4524  C  C     . ALA A 1 608 ? -4.405  38.950  -18.446 1.00 41.04 ? 608 ALA A C     1 
ATOM   4525  O  O     . ALA A 1 608 ? -4.347  40.144  -18.157 1.00 41.26 ? 608 ALA A O     1 
ATOM   4526  C  CB    . ALA A 1 608 ? -3.800  38.341  -20.790 1.00 40.46 ? 608 ALA A CB    1 
ATOM   4527  N  N     . GLN A 1 609 ? -5.375  38.137  -18.019 1.00 40.95 ? 609 GLN A N     1 
ATOM   4528  C  CA    . GLN A 1 609 ? -6.402  38.599  -17.084 1.00 41.55 ? 609 GLN A CA    1 
ATOM   4529  C  C     . GLN A 1 609 ? -5.798  39.011  -15.741 1.00 41.45 ? 609 GLN A C     1 
ATOM   4530  O  O     . GLN A 1 609 ? -6.274  39.943  -15.115 1.00 42.36 ? 609 GLN A O     1 
ATOM   4531  C  CB    . GLN A 1 609 ? -7.512  37.538  -16.894 1.00 41.80 ? 609 GLN A CB    1 
ATOM   4532  N  N     . ILE A 1 610 ? -4.743  38.319  -15.315 1.00 41.40 ? 610 ILE A N     1 
ATOM   4533  C  CA    . ILE A 1 610 ? -4.003  38.672  -14.104 1.00 41.52 ? 610 ILE A CA    1 
ATOM   4534  C  C     . ILE A 1 610 ? -3.322  40.035  -14.246 1.00 41.76 ? 610 ILE A C     1 
ATOM   4535  O  O     . ILE A 1 610 ? -3.448  40.895  -13.362 1.00 42.13 ? 610 ILE A O     1 
ATOM   4536  C  CB    . ILE A 1 610 ? -2.958  37.593  -13.737 1.00 41.43 ? 610 ILE A CB    1 
ATOM   4537  C  CG1   . ILE A 1 610 ? -3.657  36.351  -13.188 1.00 41.52 ? 610 ILE A CG1   1 
ATOM   4538  C  CG2   . ILE A 1 610 ? -1.952  38.121  -12.689 1.00 42.01 ? 610 ILE A CG2   1 
ATOM   4539  C  CD1   . ILE A 1 610 ? -2.743  35.165  -13.040 1.00 41.51 ? 610 ILE A CD1   1 
ATOM   4540  N  N     . LEU A 1 611 ? -2.611  40.232  -15.355 1.00 41.31 ? 611 LEU A N     1 
ATOM   4541  C  CA    . LEU A 1 611 ? -1.813  41.449  -15.553 1.00 41.58 ? 611 LEU A CA    1 
ATOM   4542  C  C     . LEU A 1 611 ? -2.602  42.651  -16.077 1.00 41.94 ? 611 LEU A C     1 
ATOM   4543  O  O     . LEU A 1 611 ? -2.071  43.758  -16.151 1.00 42.16 ? 611 LEU A O     1 
ATOM   4544  C  CB    . LEU A 1 611 ? -0.609  41.170  -16.452 1.00 41.09 ? 611 LEU A CB    1 
ATOM   4545  C  CG    . LEU A 1 611 ? 0.356   40.069  -16.003 1.00 41.47 ? 611 LEU A CG    1 
ATOM   4546  C  CD1   . LEU A 1 611 ? 1.536   39.985  -16.967 1.00 42.25 ? 611 LEU A CD1   1 
ATOM   4547  C  CD2   . LEU A 1 611 ? 0.839   40.306  -14.586 1.00 41.92 ? 611 LEU A CD2   1 
ATOM   4548  N  N     . GLY A 1 612 ? -3.863  42.429  -16.430 1.00 42.15 ? 612 GLY A N     1 
ATOM   4549  C  CA    . GLY A 1 612 ? -4.733  43.501  -16.903 1.00 42.87 ? 612 GLY A CA    1 
ATOM   4550  C  C     . GLY A 1 612 ? -4.433  43.958  -18.321 1.00 42.87 ? 612 GLY A C     1 
ATOM   4551  O  O     . GLY A 1 612 ? -4.772  45.083  -18.692 1.00 43.08 ? 612 GLY A O     1 
ATOM   4552  N  N     . ASN A 1 613 ? -3.793  43.086  -19.105 1.00 42.27 ? 613 ASN A N     1 
ATOM   4553  C  CA    . ASN A 1 613 ? -3.526  43.345  -20.523 1.00 42.08 ? 613 ASN A CA    1 
ATOM   4554  C  C     . ASN A 1 613 ? -4.520  42.622  -21.433 1.00 41.89 ? 613 ASN A C     1 
ATOM   4555  O  O     . ASN A 1 613 ? -5.100  41.597  -21.059 1.00 41.55 ? 613 ASN A O     1 
ATOM   4556  C  CB    . ASN A 1 613 ? -2.107  42.896  -20.896 1.00 41.54 ? 613 ASN A CB    1 
ATOM   4557  C  CG    . ASN A 1 613 ? -1.048  43.511  -20.012 1.00 42.08 ? 613 ASN A CG    1 
ATOM   4558  O  OD1   . ASN A 1 613 ? -1.099  44.704  -19.705 1.00 44.34 ? 613 ASN A OD1   1 
ATOM   4559  N  ND2   . ASN A 1 613 ? -0.072  42.705  -19.601 1.00 40.82 ? 613 ASN A ND2   1 
ATOM   4560  N  N     . ASN A 1 614 ? -4.713  43.158  -22.634 1.00 42.03 ? 614 ASN A N     1 
ATOM   4561  C  CA    . ASN A 1 614 ? -5.411  42.409  -23.666 1.00 42.19 ? 614 ASN A CA    1 
ATOM   4562  C  C     . ASN A 1 614 ? -4.545  41.225  -24.094 1.00 41.93 ? 614 ASN A C     1 
ATOM   4563  O  O     . ASN A 1 614 ? -3.307  41.316  -24.097 1.00 41.27 ? 614 ASN A O     1 
ATOM   4564  C  CB    . ASN A 1 614 ? -5.762  43.290  -24.859 1.00 42.18 ? 614 ASN A CB    1 
ATOM   4565  C  CG    . ASN A 1 614 ? -7.059  42.864  -25.514 1.00 42.84 ? 614 ASN A CG    1 
ATOM   4566  O  OD1   . ASN A 1 614 ? -8.129  42.939  -24.891 1.00 43.39 ? 614 ASN A OD1   1 
ATOM   4567  N  ND2   . ASN A 1 614 ? -6.980  42.398  -26.764 1.00 40.71 ? 614 ASN A ND2   1 
ATOM   4568  N  N     . GLU A 1 615 ? -5.186  40.103  -24.409 1.00 42.33 ? 615 GLU A N     1 
ATOM   4569  C  CA    . GLU A 1 615 ? -4.435  38.886  -24.725 1.00 42.26 ? 615 GLU A CA    1 
ATOM   4570  C  C     . GLU A 1 615 ? -3.657  38.998  -26.013 1.00 41.21 ? 615 GLU A C     1 
ATOM   4571  O  O     . GLU A 1 615 ? -4.141  39.554  -27.003 1.00 41.47 ? 615 GLU A O     1 
ATOM   4572  C  CB    . GLU A 1 615 ? -5.303  37.624  -24.751 1.00 42.71 ? 615 GLU A CB    1 
ATOM   4573  C  CG    . GLU A 1 615 ? -6.732  37.832  -25.120 1.00 47.22 ? 615 GLU A CG    1 
ATOM   4574  C  CD    . GLU A 1 615 ? -7.588  38.168  -23.906 1.00 52.29 ? 615 GLU A CD    1 
ATOM   4575  O  OE1   . GLU A 1 615 ? -7.621  37.338  -22.959 1.00 54.58 ? 615 GLU A OE1   1 
ATOM   4576  O  OE2   . GLU A 1 615 ? -8.220  39.255  -23.907 1.00 52.79 ? 615 GLU A OE2   1 
ATOM   4577  N  N     . SER A 1 616 ? -2.423  38.507  -25.941 1.00 39.99 ? 616 SER A N     1 
ATOM   4578  C  CA    . SER A 1 616 ? -1.637  38.120  -27.085 1.00 39.36 ? 616 SER A CA    1 
ATOM   4579  C  C     . SER A 1 616 ? -1.412  39.268  -28.063 1.00 39.25 ? 616 SER A C     1 
ATOM   4580  O  O     . SER A 1 616 ? -1.056  40.378  -27.665 1.00 39.29 ? 616 SER A O     1 
ATOM   4581  C  CB    . SER A 1 616 ? -2.303  36.915  -27.773 1.00 39.18 ? 616 SER A CB    1 
ATOM   4582  O  OG    . SER A 1 616 ? -1.430  36.318  -28.716 1.00 40.90 ? 616 SER A OG    1 
ATOM   4583  N  N     . ILE A 1 617 ? -1.622  38.979  -29.345 1.00 39.03 ? 617 ILE A N     1 
ATOM   4584  C  CA    . ILE A 1 617 ? -1.412  39.924  -30.420 1.00 38.86 ? 617 ILE A CA    1 
ATOM   4585  C  C     . ILE A 1 617 ? -2.732  40.530  -30.903 1.00 39.11 ? 617 ILE A C     1 
ATOM   4586  O  O     . ILE A 1 617 ? -2.747  41.308  -31.857 1.00 39.45 ? 617 ILE A O     1 
ATOM   4587  C  CB    . ILE A 1 617 ? -0.652  39.259  -31.604 1.00 39.24 ? 617 ILE A CB    1 
ATOM   4588  C  CG1   . ILE A 1 617 ? -1.118  37.812  -31.829 1.00 40.15 ? 617 ILE A CG1   1 
ATOM   4589  C  CG2   . ILE A 1 617 ? 0.839   39.231  -31.328 1.00 37.89 ? 617 ILE A CG2   1 
ATOM   4590  C  CD1   . ILE A 1 617 ? -2.290  37.632  -32.758 1.00 40.35 ? 617 ILE A CD1   1 
ATOM   4591  N  N     . GLU A 1 618 ? -3.840  40.199  -30.239 1.00 38.53 ? 618 GLU A N     1 
ATOM   4592  C  CA    . GLU A 1 618 ? -5.136  40.617  -30.762 1.00 39.04 ? 618 GLU A CA    1 
ATOM   4593  C  C     . GLU A 1 618 ? -5.650  42.007  -30.306 1.00 37.98 ? 618 GLU A C     1 
ATOM   4594  O  O     . GLU A 1 618 ? -5.355  42.462  -29.191 1.00 37.31 ? 618 GLU A O     1 
ATOM   4595  C  CB    . GLU A 1 618 ? -6.197  39.495  -30.665 1.00 39.16 ? 618 GLU A CB    1 
ATOM   4596  C  CG    . GLU A 1 618 ? -6.784  39.156  -29.313 1.00 40.39 ? 618 GLU A CG    1 
ATOM   4597  C  CD    . GLU A 1 618 ? -8.057  38.271  -29.439 1.00 41.85 ? 618 GLU A CD    1 
ATOM   4598  O  OE1   . GLU A 1 618 ? -8.260  37.636  -30.503 1.00 43.78 ? 618 GLU A OE1   1 
ATOM   4599  O  OE2   . GLU A 1 618 ? -8.860  38.216  -28.470 1.00 45.22 ? 618 GLU A OE2   1 
ATOM   4600  N  N     . PRO A 1 619 ? -6.387  42.701  -31.199 1.00 37.49 ? 619 PRO A N     1 
ATOM   4601  C  CA    . PRO A 1 619 ? -7.010  43.976  -30.815 1.00 37.26 ? 619 PRO A CA    1 
ATOM   4602  C  C     . PRO A 1 619 ? -8.051  43.795  -29.708 1.00 37.02 ? 619 PRO A C     1 
ATOM   4603  O  O     . PRO A 1 619 ? -8.456  42.658  -29.402 1.00 36.22 ? 619 PRO A O     1 
ATOM   4604  C  CB    . PRO A 1 619 ? -7.698  44.436  -32.105 1.00 37.58 ? 619 PRO A CB    1 
ATOM   4605  C  CG    . PRO A 1 619 ? -7.048  43.664  -33.205 1.00 37.67 ? 619 PRO A CG    1 
ATOM   4606  C  CD    . PRO A 1 619 ? -6.664  42.357  -32.608 1.00 37.27 ? 619 PRO A CD    1 
ATOM   4607  N  N     . TYR A 1 620 ? -8.462  44.904  -29.100 1.00 37.11 ? 620 TYR A N     1 
ATOM   4608  C  CA    . TYR A 1 620 ? -9.615  44.878  -28.221 1.00 37.82 ? 620 TYR A CA    1 
ATOM   4609  C  C     . TYR A 1 620 ? -10.824 44.439  -29.034 1.00 38.45 ? 620 TYR A C     1 
ATOM   4610  O  O     . TYR A 1 620 ? -11.089 44.988  -30.100 1.00 39.29 ? 620 TYR A O     1 
ATOM   4611  C  CB    . TYR A 1 620 ? -9.832  46.246  -27.573 1.00 38.24 ? 620 TYR A CB    1 
ATOM   4612  C  CG    . TYR A 1 620 ? -9.009  46.448  -26.314 1.00 37.79 ? 620 TYR A CG    1 
ATOM   4613  C  CD1   . TYR A 1 620 ? -9.588  46.277  -25.052 1.00 37.74 ? 620 TYR A CD1   1 
ATOM   4614  C  CD2   . TYR A 1 620 ? -7.656  46.797  -26.379 1.00 36.25 ? 620 TYR A CD2   1 
ATOM   4615  C  CE1   . TYR A 1 620 ? -8.849  46.454  -23.881 1.00 36.33 ? 620 TYR A CE1   1 
ATOM   4616  C  CE2   . TYR A 1 620 ? -6.905  46.972  -25.214 1.00 36.72 ? 620 TYR A CE2   1 
ATOM   4617  C  CZ    . TYR A 1 620 ? -7.519  46.804  -23.964 1.00 36.52 ? 620 TYR A CZ    1 
ATOM   4618  O  OH    . TYR A 1 620 ? -6.806  46.981  -22.798 1.00 36.53 ? 620 TYR A OH    1 
ATOM   4619  N  N     . THR A 1 621 ? -11.515 43.405  -28.569 1.00 38.53 ? 621 THR A N     1 
ATOM   4620  C  CA    . THR A 1 621 ? -12.646 42.871  -29.322 1.00 39.81 ? 621 THR A CA    1 
ATOM   4621  C  C     . THR A 1 621 ? -13.903 43.713  -29.062 1.00 40.83 ? 621 THR A C     1 
ATOM   4622  O  O     . THR A 1 621 ? -14.856 43.716  -29.856 1.00 41.71 ? 621 THR A O     1 
ATOM   4623  C  CB    . THR A 1 621 ? -12.894 41.347  -29.049 1.00 39.68 ? 621 THR A CB    1 
ATOM   4624  O  OG1   . THR A 1 621 ? -13.547 41.168  -27.789 1.00 40.80 ? 621 THR A OG1   1 
ATOM   4625  C  CG2   . THR A 1 621 ? -11.575 40.566  -29.049 1.00 38.89 ? 621 THR A CG2   1 
ATOM   4626  N  N     . SER A 1 622 ? -13.875 44.433  -27.946 1.00 40.54 ? 622 SER A N     1 
ATOM   4627  C  CA    . SER A 1 622 ? -14.939 45.341  -27.561 1.00 41.55 ? 622 SER A CA    1 
ATOM   4628  C  C     . SER A 1 622 ? -14.370 46.403  -26.629 1.00 41.14 ? 622 SER A C     1 
ATOM   4629  O  O     . SER A 1 622 ? -13.381 46.156  -25.937 1.00 40.79 ? 622 SER A O     1 
ATOM   4630  C  CB    . SER A 1 622 ? -16.054 44.583  -26.850 1.00 41.82 ? 622 SER A CB    1 
ATOM   4631  O  OG    . SER A 1 622 ? -17.050 45.484  -26.415 1.00 44.21 ? 622 SER A OG    1 
ATOM   4632  N  N     . ASN A 1 623 ? -14.986 47.580  -26.615 1.00 41.54 ? 623 ASN A N     1 
ATOM   4633  C  CA    . ASN A 1 623 ? -14.619 48.608  -25.654 1.00 41.42 ? 623 ASN A CA    1 
ATOM   4634  C  C     . ASN A 1 623 ? -15.350 48.477  -24.318 1.00 42.07 ? 623 ASN A C     1 
ATOM   4635  O  O     . ASN A 1 623 ? -14.908 49.038  -23.307 1.00 41.77 ? 623 ASN A O     1 
ATOM   4636  C  CB    . ASN A 1 623 ? -14.778 49.999  -26.259 1.00 41.84 ? 623 ASN A CB    1 
ATOM   4637  C  CG    . ASN A 1 623 ? -13.710 50.298  -27.292 1.00 41.23 ? 623 ASN A CG    1 
ATOM   4638  O  OD1   . ASN A 1 623 ? -12.502 50.178  -27.021 1.00 38.99 ? 623 ASN A OD1   1 
ATOM   4639  N  ND2   . ASN A 1 623 ? -14.144 50.664  -28.493 1.00 40.72 ? 623 ASN A ND2   1 
ATOM   4640  N  N     . ILE A 1 624 ? -16.451 47.724  -24.310 1.00 42.71 ? 624 ILE A N     1 
ATOM   4641  C  CA    . ILE A 1 624 ? -17.117 47.354  -23.055 1.00 43.75 ? 624 ILE A CA    1 
ATOM   4642  C  C     . ILE A 1 624 ? -17.405 45.852  -22.959 1.00 43.83 ? 624 ILE A C     1 
ATOM   4643  O  O     . ILE A 1 624 ? -17.928 45.236  -23.886 1.00 44.17 ? 624 ILE A O     1 
ATOM   4644  C  CB    . ILE A 1 624 ? -18.378 48.211  -22.757 1.00 44.87 ? 624 ILE A CB    1 
ATOM   4645  C  CG1   . ILE A 1 624 ? -18.801 48.036  -21.291 1.00 45.87 ? 624 ILE A CG1   1 
ATOM   4646  C  CG2   . ILE A 1 624 ? -19.509 47.878  -23.744 1.00 46.48 ? 624 ILE A CG2   1 
ATOM   4647  C  CD1   . ILE A 1 624 ? -19.716 49.128  -20.742 1.00 46.57 ? 624 ILE A CD1   1 
ATOM   4648  N  N     . TYR A 1 625 ? -17.023 45.269  -21.829 1.00 44.07 ? 625 TYR A N     1 
ATOM   4649  C  CA    . TYR A 1 625 ? -17.133 43.837  -21.602 1.00 44.64 ? 625 TYR A CA    1 
ATOM   4650  C  C     . TYR A 1 625 ? -17.416 43.618  -20.126 1.00 45.36 ? 625 TYR A C     1 
ATOM   4651  O  O     . TYR A 1 625 ? -17.264 44.536  -19.323 1.00 46.02 ? 625 TYR A O     1 
ATOM   4652  C  CB    . TYR A 1 625 ? -15.855 43.112  -22.053 1.00 43.73 ? 625 TYR A CB    1 
ATOM   4653  C  CG    . TYR A 1 625 ? -14.578 43.871  -21.753 1.00 43.69 ? 625 TYR A CG    1 
ATOM   4654  C  CD1   . TYR A 1 625 ? -13.834 43.603  -20.597 1.00 44.16 ? 625 TYR A CD1   1 
ATOM   4655  C  CD2   . TYR A 1 625 ? -14.118 44.874  -22.621 1.00 43.88 ? 625 TYR A CD2   1 
ATOM   4656  C  CE1   . TYR A 1 625 ? -12.657 44.315  -20.317 1.00 44.09 ? 625 TYR A CE1   1 
ATOM   4657  C  CE2   . TYR A 1 625 ? -12.958 45.594  -22.350 1.00 43.76 ? 625 TYR A CE2   1 
ATOM   4658  C  CZ    . TYR A 1 625 ? -12.227 45.308  -21.202 1.00 43.87 ? 625 TYR A CZ    1 
ATOM   4659  O  OH    . TYR A 1 625 ? -11.068 46.015  -20.948 1.00 43.81 ? 625 TYR A OH    1 
ATOM   4660  N  N     . THR A 1 626 ? -17.859 42.417  -19.771 1.00 45.95 ? 626 THR A N     1 
ATOM   4661  C  CA    . THR A 1 626 ? -18.171 42.097  -18.382 1.00 46.55 ? 626 THR A CA    1 
ATOM   4662  C  C     . THR A 1 626 ? -17.239 41.015  -17.847 1.00 45.59 ? 626 THR A C     1 
ATOM   4663  O  O     . THR A 1 626 ? -16.813 40.128  -18.589 1.00 45.22 ? 626 THR A O     1 
ATOM   4664  C  CB    . THR A 1 626 ? -19.591 41.559  -18.236 1.00 48.07 ? 626 THR A CB    1 
ATOM   4665  O  OG1   . THR A 1 626 ? -19.695 40.355  -19.006 1.00 49.25 ? 626 THR A OG1   1 
ATOM   4666  C  CG2   . THR A 1 626 ? -20.634 42.588  -18.689 1.00 48.18 ? 626 THR A CG2   1 
ATOM   4667  N  N     . ARG A 1 627 ? -16.928 41.101  -16.559 1.00 45.27 ? 627 ARG A N     1 
ATOM   4668  C  CA    . ARG A 1 627 ? -16.209 40.043  -15.859 1.00 44.45 ? 627 ARG A CA    1 
ATOM   4669  C  C     . ARG A 1 627 ? -17.056 39.573  -14.684 1.00 45.11 ? 627 ARG A C     1 
ATOM   4670  O  O     . ARG A 1 627 ? -17.683 40.385  -14.001 1.00 45.22 ? 627 ARG A O     1 
ATOM   4671  C  CB    . ARG A 1 627 ? -14.826 40.532  -15.376 1.00 43.51 ? 627 ARG A CB    1 
ATOM   4672  N  N     . ARG A 1 628 ? -17.093 38.258  -14.474 1.00 45.16 ? 628 ARG A N     1 
ATOM   4673  C  CA    . ARG A 1 628 ? -17.715 37.692  -13.277 1.00 46.11 ? 628 ARG A CA    1 
ATOM   4674  C  C     . ARG A 1 628 ? -16.654 37.363  -12.228 1.00 45.60 ? 628 ARG A C     1 
ATOM   4675  O  O     . ARG A 1 628 ? -15.594 36.808  -12.537 1.00 44.16 ? 628 ARG A O     1 
ATOM   4676  C  CB    . ARG A 1 628 ? -18.553 36.451  -13.614 1.00 46.81 ? 628 ARG A CB    1 
ATOM   4677  N  N     . VAL A 1 629 ? -16.946 37.746  -10.992 1.00 46.38 ? 629 VAL A N     1 
ATOM   4678  C  CA    . VAL A 1 629 ? -16.149 37.361  -9.834  1.00 46.34 ? 629 VAL A CA    1 
ATOM   4679  C  C     . VAL A 1 629 ? -17.118 36.700  -8.847  1.00 47.75 ? 629 VAL A C     1 
ATOM   4680  O  O     . VAL A 1 629 ? -17.866 37.385  -8.136  1.00 48.61 ? 629 VAL A O     1 
ATOM   4681  C  CB    . VAL A 1 629 ? -15.389 38.582  -9.230  1.00 46.06 ? 629 VAL A CB    1 
ATOM   4682  C  CG1   . VAL A 1 629 ? -14.859 38.285  -7.830  1.00 45.81 ? 629 VAL A CG1   1 
ATOM   4683  C  CG2   . VAL A 1 629 ? -14.252 38.999  -10.156 1.00 44.67 ? 629 VAL A CG2   1 
ATOM   4684  N  N     . LEU A 1 630 ? -17.115 35.365  -8.851  1.00 47.97 ? 630 LEU A N     1 
ATOM   4685  C  CA    . LEU A 1 630 ? -18.043 34.544  -8.065  1.00 49.45 ? 630 LEU A CA    1 
ATOM   4686  C  C     . LEU A 1 630 ? -19.515 34.927  -8.306  1.00 50.71 ? 630 LEU A C     1 
ATOM   4687  O  O     . LEU A 1 630 ? -20.020 34.733  -9.410  1.00 50.96 ? 630 LEU A O     1 
ATOM   4688  C  CB    . LEU A 1 630 ? -17.668 34.544  -6.571  1.00 50.12 ? 630 LEU A CB    1 
ATOM   4689  C  CG    . LEU A 1 630 ? -16.284 33.989  -6.204  1.00 49.44 ? 630 LEU A CG    1 
ATOM   4690  C  CD1   . LEU A 1 630 ? -15.889 34.441  -4.798  1.00 49.99 ? 630 LEU A CD1   1 
ATOM   4691  C  CD2   . LEU A 1 630 ? -16.214 32.462  -6.341  1.00 48.63 ? 630 LEU A CD2   1 
ATOM   4692  N  N     . SER A 1 631 ? -20.195 35.467  -7.295  1.00 51.77 ? 631 SER A N     1 
ATOM   4693  C  CA    . SER A 1 631 ? -21.595 35.882  -7.451  1.00 53.04 ? 631 SER A CA    1 
ATOM   4694  C  C     . SER A 1 631 ? -21.768 37.333  -7.953  1.00 52.69 ? 631 SER A C     1 
ATOM   4695  O  O     . SER A 1 631 ? -22.884 37.871  -7.955  1.00 53.77 ? 631 SER A O     1 
ATOM   4696  C  CB    . SER A 1 631 ? -22.374 35.679  -6.142  1.00 54.65 ? 631 SER A CB    1 
ATOM   4697  O  OG    . SER A 1 631 ? -21.951 36.575  -5.125  1.00 54.80 ? 631 SER A OG    1 
ATOM   4698  N  N     . GLY A 1 632 ? -20.673 37.957  -8.375  1.00 50.99 ? 632 GLY A N     1 
ATOM   4699  C  CA    . GLY A 1 632 ? -20.716 39.346  -8.819  1.00 50.42 ? 632 GLY A CA    1 
ATOM   4700  C  C     . GLY A 1 632 ? -20.409 39.511  -10.291 1.00 49.07 ? 632 GLY A C     1 
ATOM   4701  O  O     . GLY A 1 632 ? -19.488 38.867  -10.822 1.00 48.10 ? 632 GLY A O     1 
ATOM   4702  N  N     . GLU A 1 633 ? -21.181 40.373  -10.953 1.00 48.85 ? 633 GLU A N     1 
ATOM   4703  C  CA    . GLU A 1 633 ? -20.885 40.761  -12.333 1.00 47.45 ? 633 GLU A CA    1 
ATOM   4704  C  C     . GLU A 1 633 ? -20.448 42.221  -12.359 1.00 46.58 ? 633 GLU A C     1 
ATOM   4705  O  O     . GLU A 1 633 ? -20.977 43.039  -11.599 1.00 47.44 ? 633 GLU A O     1 
ATOM   4706  C  CB    . GLU A 1 633 ? -22.086 40.531  -13.233 1.00 48.36 ? 633 GLU A CB    1 
ATOM   4707  N  N     . PHE A 1 634 ? -19.470 42.530  -13.216 1.00 44.49 ? 634 PHE A N     1 
ATOM   4708  C  CA    . PHE A 1 634 ? -18.895 43.877  -13.334 1.00 43.59 ? 634 PHE A CA    1 
ATOM   4709  C  C     . PHE A 1 634 ? -18.742 44.287  -14.799 1.00 43.32 ? 634 PHE A C     1 
ATOM   4710  O  O     . PHE A 1 634 ? -18.181 43.540  -15.608 1.00 42.56 ? 634 PHE A O     1 
ATOM   4711  C  CB    . PHE A 1 634 ? -17.533 43.959  -12.624 1.00 42.17 ? 634 PHE A CB    1 
ATOM   4712  C  CG    . PHE A 1 634 ? -17.577 43.537  -11.183 1.00 42.23 ? 634 PHE A CG    1 
ATOM   4713  C  CD1   . PHE A 1 634 ? -17.458 42.193  -10.829 1.00 40.61 ? 634 PHE A CD1   1 
ATOM   4714  C  CD2   . PHE A 1 634 ? -17.762 44.475  -10.176 1.00 41.63 ? 634 PHE A CD2   1 
ATOM   4715  C  CE1   . PHE A 1 634 ? -17.522 41.798  -9.499  1.00 40.38 ? 634 PHE A CE1   1 
ATOM   4716  C  CE2   . PHE A 1 634 ? -17.813 44.088  -8.840  1.00 41.80 ? 634 PHE A CE2   1 
ATOM   4717  C  CZ    . PHE A 1 634 ? -17.692 42.747  -8.501  1.00 41.95 ? 634 PHE A CZ    1 
ATOM   4718  N  N     . GLN A 1 635 ? -19.253 45.472  -15.128 1.00 43.98 ? 635 GLN A N     1 
ATOM   4719  C  CA    . GLN A 1 635 ? -19.091 46.069  -16.447 1.00 43.79 ? 635 GLN A CA    1 
ATOM   4720  C  C     . GLN A 1 635 ? -17.739 46.746  -16.480 1.00 42.44 ? 635 GLN A C     1 
ATOM   4721  O  O     . GLN A 1 635 ? -17.407 47.524  -15.584 1.00 42.56 ? 635 GLN A O     1 
ATOM   4722  C  CB    . GLN A 1 635 ? -20.173 47.117  -16.709 1.00 44.87 ? 635 GLN A CB    1 
ATOM   4723  C  CG    . GLN A 1 635 ? -21.541 46.552  -17.082 1.00 47.03 ? 635 GLN A CG    1 
ATOM   4724  C  CD    . GLN A 1 635 ? -22.611 47.629  -17.230 1.00 48.67 ? 635 GLN A CD    1 
ATOM   4725  O  OE1   . GLN A 1 635 ? -22.604 48.647  -16.524 1.00 51.38 ? 635 GLN A OE1   1 
ATOM   4726  N  NE2   . GLN A 1 635 ? -23.546 47.404  -18.147 1.00 51.19 ? 635 GLN A NE2   1 
ATOM   4727  N  N     . ILE A 1 636 ? -16.950 46.443  -17.502 1.00 41.06 ? 636 ILE A N     1 
ATOM   4728  C  CA    . ILE A 1 636 ? -15.633 47.047  -17.628 1.00 40.29 ? 636 ILE A CA    1 
ATOM   4729  C  C     . ILE A 1 636 ? -15.476 47.688  -19.000 1.00 39.93 ? 636 ILE A C     1 
ATOM   4730  O  O     . ILE A 1 636 ? -15.680 47.035  -20.027 1.00 39.53 ? 636 ILE A O     1 
ATOM   4731  C  CB    . ILE A 1 636 ? -14.499 46.019  -17.362 1.00 39.39 ? 636 ILE A CB    1 
ATOM   4732  C  CG1   . ILE A 1 636 ? -14.533 45.553  -15.903 1.00 39.88 ? 636 ILE A CG1   1 
ATOM   4733  C  CG2   . ILE A 1 636 ? -13.132 46.617  -17.692 1.00 39.11 ? 636 ILE A CG2   1 
ATOM   4734  C  CD1   . ILE A 1 636 ? -13.953 44.168  -15.680 1.00 41.20 ? 636 ILE A CD1   1 
ATOM   4735  N  N     . VAL A 1 637 ? -15.128 48.974  -19.007 1.00 39.85 ? 637 VAL A N     1 
ATOM   4736  C  CA    . VAL A 1 637 ? -14.780 49.651  -20.251 1.00 39.44 ? 637 VAL A CA    1 
ATOM   4737  C  C     . VAL A 1 637 ? -13.260 49.655  -20.473 1.00 38.26 ? 637 VAL A C     1 
ATOM   4738  O  O     . VAL A 1 637 ? -12.482 49.716  -19.513 1.00 38.05 ? 637 VAL A O     1 
ATOM   4739  C  CB    . VAL A 1 637 ? -15.495 51.033  -20.403 1.00 40.53 ? 637 VAL A CB    1 
ATOM   4740  C  CG1   . VAL A 1 637 ? -16.093 51.505  -19.077 1.00 42.45 ? 637 VAL A CG1   1 
ATOM   4741  C  CG2   . VAL A 1 637 ? -14.624 52.090  -21.083 1.00 39.61 ? 637 VAL A CG2   1 
ATOM   4742  N  N     . ASN A 1 638 ? -12.855 49.521  -21.739 1.00 37.39 ? 638 ASN A N     1 
ATOM   4743  C  CA    . ASN A 1 638 ? -11.465 49.684  -22.151 1.00 36.18 ? 638 ASN A CA    1 
ATOM   4744  C  C     . ASN A 1 638 ? -10.862 50.843  -21.348 1.00 36.47 ? 638 ASN A C     1 
ATOM   4745  O  O     . ASN A 1 638 ? -11.317 51.997  -21.483 1.00 37.33 ? 638 ASN A O     1 
ATOM   4746  C  CB    . ASN A 1 638 ? -11.423 49.963  -23.654 1.00 36.30 ? 638 ASN A CB    1 
ATOM   4747  C  CG    . ASN A 1 638 ? -10.020 50.174  -24.189 1.00 35.30 ? 638 ASN A CG    1 
ATOM   4748  O  OD1   . ASN A 1 638 ? -9.127  50.643  -23.488 1.00 37.37 ? 638 ASN A OD1   1 
ATOM   4749  N  ND2   . ASN A 1 638 ? -9.833  49.855  -25.451 1.00 34.31 ? 638 ASN A ND2   1 
ATOM   4750  N  N     . PRO A 1 639 ? -9.878  50.538  -20.476 1.00 35.48 ? 639 PRO A N     1 
ATOM   4751  C  CA    . PRO A 1 639 ? -9.407  51.515  -19.484 1.00 35.43 ? 639 PRO A CA    1 
ATOM   4752  C  C     . PRO A 1 639 ? -8.769  52.742  -20.118 1.00 35.77 ? 639 PRO A C     1 
ATOM   4753  O  O     . PRO A 1 639 ? -8.926  53.860  -19.613 1.00 36.31 ? 639 PRO A O     1 
ATOM   4754  C  CB    . PRO A 1 639 ? -8.410  50.720  -18.626 1.00 35.06 ? 639 PRO A CB    1 
ATOM   4755  C  CG    . PRO A 1 639 ? -8.050  49.504  -19.430 1.00 34.35 ? 639 PRO A CG    1 
ATOM   4756  C  CD    . PRO A 1 639 ? -9.184  49.239  -20.379 1.00 34.84 ? 639 PRO A CD    1 
ATOM   4757  N  N     . HIS A 1 640 ? -8.079  52.540  -21.236 1.00 35.76 ? 640 HIS A N     1 
ATOM   4758  C  CA    . HIS A 1 640 ? -7.500  53.646  -21.996 1.00 35.99 ? 640 HIS A CA    1 
ATOM   4759  C  C     . HIS A 1 640 ? -8.604  54.559  -22.507 1.00 36.85 ? 640 HIS A C     1 
ATOM   4760  O  O     . HIS A 1 640 ? -8.525  55.784  -22.364 1.00 38.09 ? 640 HIS A O     1 
ATOM   4761  C  CB    . HIS A 1 640 ? -6.677  53.123  -23.166 1.00 35.64 ? 640 HIS A CB    1 
ATOM   4762  C  CG    . HIS A 1 640 ? -5.686  52.067  -22.784 1.00 35.85 ? 640 HIS A CG    1 
ATOM   4763  N  ND1   . HIS A 1 640 ? -4.510  52.352  -22.121 1.00 37.48 ? 640 HIS A ND1   1 
ATOM   4764  C  CD2   . HIS A 1 640 ? -5.693  50.728  -22.978 1.00 35.64 ? 640 HIS A CD2   1 
ATOM   4765  C  CE1   . HIS A 1 640 ? -3.840  51.232  -21.915 1.00 36.05 ? 640 HIS A CE1   1 
ATOM   4766  N  NE2   . HIS A 1 640 ? -4.537  50.231  -22.424 1.00 35.71 ? 640 HIS A NE2   1 
ATOM   4767  N  N     . LEU A 1 641 ? -9.636  53.959  -23.091 1.00 36.47 ? 641 LEU A N     1 
ATOM   4768  C  CA    . LEU A 1 641 ? -10.761 54.712  -23.609 1.00 37.05 ? 641 LEU A CA    1 
ATOM   4769  C  C     . LEU A 1 641 ? -11.432 55.500  -22.486 1.00 37.57 ? 641 LEU A C     1 
ATOM   4770  O  O     . LEU A 1 641 ? -11.677 56.700  -22.632 1.00 38.47 ? 641 LEU A O     1 
ATOM   4771  C  CB    . LEU A 1 641 ? -11.778 53.786  -24.288 1.00 37.10 ? 641 LEU A CB    1 
ATOM   4772  C  CG    . LEU A 1 641 ? -13.073 54.429  -24.802 1.00 38.65 ? 641 LEU A CG    1 
ATOM   4773  C  CD1   . LEU A 1 641 ? -12.810 55.393  -25.962 1.00 38.85 ? 641 LEU A CD1   1 
ATOM   4774  C  CD2   . LEU A 1 641 ? -14.116 53.380  -25.199 1.00 38.12 ? 641 LEU A CD2   1 
ATOM   4775  N  N     . LEU A 1 642 ? -11.713 54.834  -21.369 1.00 36.83 ? 642 LEU A N     1 
ATOM   4776  C  CA    . LEU A 1 642 ? -12.420 55.481  -20.265 1.00 37.50 ? 642 LEU A CA    1 
ATOM   4777  C  C     . LEU A 1 642 ? -11.634 56.682  -19.716 1.00 37.86 ? 642 LEU A C     1 
ATOM   4778  O  O     . LEU A 1 642 ? -12.229 57.682  -19.305 1.00 38.20 ? 642 LEU A O     1 
ATOM   4779  C  CB    . LEU A 1 642 ? -12.752 54.467  -19.162 1.00 37.14 ? 642 LEU A CB    1 
ATOM   4780  C  CG    . LEU A 1 642 ? -13.605 54.906  -17.959 1.00 38.33 ? 642 LEU A CG    1 
ATOM   4781  C  CD1   . LEU A 1 642 ? -14.859 55.664  -18.375 1.00 39.48 ? 642 LEU A CD1   1 
ATOM   4782  C  CD2   . LEU A 1 642 ? -13.977 53.703  -17.112 1.00 38.02 ? 642 LEU A CD2   1 
ATOM   4783  N  N     . LYS A 1 643 ? -10.303 56.573  -19.725 1.00 37.36 ? 643 LYS A N     1 
ATOM   4784  C  CA    . LYS A 1 643 ? -9.434  57.683  -19.350 1.00 38.17 ? 643 LYS A CA    1 
ATOM   4785  C  C     . LYS A 1 643 ? -9.530  58.845  -20.333 1.00 38.88 ? 643 LYS A C     1 
ATOM   4786  O  O     . LYS A 1 643 ? -9.637  59.999  -19.911 1.00 39.27 ? 643 LYS A O     1 
ATOM   4787  C  CB    . LYS A 1 643 ? -7.986  57.223  -19.174 1.00 37.20 ? 643 LYS A CB    1 
ATOM   4788  C  CG    . LYS A 1 643 ? -7.719  56.693  -17.773 1.00 38.95 ? 643 LYS A CG    1 
ATOM   4789  C  CD    . LYS A 1 643 ? -6.461  55.840  -17.692 1.00 40.83 ? 643 LYS A CD    1 
ATOM   4790  C  CE    . LYS A 1 643 ? -6.134  55.489  -16.241 1.00 42.71 ? 643 LYS A CE    1 
ATOM   4791  N  NZ    . LYS A 1 643 ? -5.476  54.145  -16.125 1.00 43.39 ? 643 LYS A NZ    1 
ATOM   4792  N  N     . ASP A 1 644 ? -9.499  58.534  -21.629 1.00 39.12 ? 644 ASP A N     1 
ATOM   4793  C  CA    . ASP A 1 644 ? -9.652  59.539  -22.680 1.00 40.44 ? 644 ASP A CA    1 
ATOM   4794  C  C     . ASP A 1 644 ? -11.007 60.244  -22.619 1.00 41.91 ? 644 ASP A C     1 
ATOM   4795  O  O     . ASP A 1 644 ? -11.075 61.468  -22.776 1.00 42.83 ? 644 ASP A O     1 
ATOM   4796  C  CB    . ASP A 1 644 ? -9.439  58.928  -24.070 1.00 40.36 ? 644 ASP A CB    1 
ATOM   4797  C  CG    . ASP A 1 644 ? -7.963  58.773  -24.430 1.00 40.63 ? 644 ASP A CG    1 
ATOM   4798  O  OD1   . ASP A 1 644 ? -7.165  59.697  -24.148 1.00 42.77 ? 644 ASP A OD1   1 
ATOM   4799  O  OD2   . ASP A 1 644 ? -7.598  57.726  -25.011 1.00 39.97 ? 644 ASP A OD2   1 
ATOM   4800  N  N     . LEU A 1 645 ? -12.073 59.483  -22.372 1.00 42.20 ? 645 LEU A N     1 
ATOM   4801  C  CA    . LEU A 1 645 ? -13.432 60.040  -22.376 1.00 43.99 ? 645 LEU A CA    1 
ATOM   4802  C  C     . LEU A 1 645 ? -13.770 60.859  -21.138 1.00 45.16 ? 645 LEU A C     1 
ATOM   4803  O  O     . LEU A 1 645 ? -14.378 61.933  -21.253 1.00 45.88 ? 645 LEU A O     1 
ATOM   4804  C  CB    . LEU A 1 645 ? -14.481 58.949  -22.574 1.00 44.00 ? 645 LEU A CB    1 
ATOM   4805  C  CG    . LEU A 1 645 ? -14.410 58.127  -23.860 1.00 43.86 ? 645 LEU A CG    1 
ATOM   4806  C  CD1   . LEU A 1 645 ? -15.537 57.103  -23.847 1.00 44.63 ? 645 LEU A CD1   1 
ATOM   4807  C  CD2   . LEU A 1 645 ? -14.456 59.005  -25.115 1.00 43.39 ? 645 LEU A CD2   1 
ATOM   4808  N  N     . THR A 1 646 ? -13.390 60.350  -19.961 1.00 45.20 ? 646 THR A N     1 
ATOM   4809  C  CA    . THR A 1 646 ? -13.596 61.084  -18.701 1.00 46.50 ? 646 THR A CA    1 
ATOM   4810  C  C     . THR A 1 646 ? -12.825 62.412  -18.692 1.00 47.36 ? 646 THR A C     1 
ATOM   4811  O  O     . THR A 1 646 ? -13.385 63.454  -18.367 1.00 48.29 ? 646 THR A O     1 
ATOM   4812  C  CB    . THR A 1 646 ? -13.228 60.243  -17.448 1.00 45.78 ? 646 THR A CB    1 
ATOM   4813  O  OG1   . THR A 1 646 ? -11.900 59.715  -17.583 1.00 44.26 ? 646 THR A OG1   1 
ATOM   4814  C  CG2   . THR A 1 646 ? -14.213 59.108  -17.255 1.00 45.82 ? 646 THR A CG2   1 
ATOM   4815  N  N     . GLU A 1 647 ? -11.552 62.357  -19.078 1.00 47.43 ? 647 GLU A N     1 
ATOM   4816  C  CA    . GLU A 1 647 ? -10.690 63.539  -19.186 1.00 49.32 ? 647 GLU A CA    1 
ATOM   4817  C  C     . GLU A 1 647 ? -11.248 64.631  -20.118 1.00 49.91 ? 647 GLU A C     1 
ATOM   4818  O  O     . GLU A 1 647 ? -10.981 65.808  -19.917 1.00 51.13 ? 647 GLU A O     1 
ATOM   4819  C  CB    . GLU A 1 647 ? -9.265  63.100  -19.567 1.00 48.10 ? 647 GLU A CB    1 
ATOM   4820  C  CG    . GLU A 1 647 ? -8.484  63.983  -20.547 1.00 50.85 ? 647 GLU A CG    1 
ATOM   4821  C  CD    . GLU A 1 647 ? -7.278  63.257  -21.180 1.00 50.74 ? 647 GLU A CD    1 
ATOM   4822  O  OE1   . GLU A 1 647 ? -6.620  63.855  -22.072 1.00 54.77 ? 647 GLU A OE1   1 
ATOM   4823  O  OE2   . GLU A 1 647 ? -6.991  62.092  -20.798 1.00 52.50 ? 647 GLU A OE2   1 
ATOM   4824  N  N     . ARG A 1 648 ? -12.039 64.245  -21.112 1.00 49.98 ? 648 ARG A N     1 
ATOM   4825  C  CA    . ARG A 1 648 ? -12.658 65.210  -22.021 1.00 51.36 ? 648 ARG A CA    1 
ATOM   4826  C  C     . ARG A 1 648 ? -14.085 65.598  -21.622 1.00 52.51 ? 648 ARG A C     1 
ATOM   4827  O  O     . ARG A 1 648 ? -14.786 66.269  -22.386 1.00 53.58 ? 648 ARG A O     1 
ATOM   4828  C  CB    . ARG A 1 648 ? -12.623 64.688  -23.461 1.00 51.02 ? 648 ARG A CB    1 
ATOM   4829  C  CG    . ARG A 1 648 ? -11.234 64.730  -24.065 1.00 51.33 ? 648 ARG A CG    1 
ATOM   4830  C  CD    . ARG A 1 648 ? -11.032 63.679  -25.124 1.00 53.10 ? 648 ARG A CD    1 
ATOM   4831  N  NE    . ARG A 1 648 ? -9.695  63.088  -24.988 1.00 55.42 ? 648 ARG A NE    1 
ATOM   4832  C  CZ    . ARG A 1 648 ? -8.712  63.233  -25.867 1.00 55.70 ? 648 ARG A CZ    1 
ATOM   4833  N  NH1   . ARG A 1 648 ? -8.907  63.930  -26.978 1.00 58.63 ? 648 ARG A NH1   1 
ATOM   4834  N  NH2   . ARG A 1 648 ? -7.541  62.662  -25.645 1.00 56.58 ? 648 ARG A NH2   1 
ATOM   4835  N  N     . GLY A 1 649 ? -14.513 65.179  -20.430 1.00 52.22 ? 649 GLY A N     1 
ATOM   4836  C  CA    . GLY A 1 649 ? -15.864 65.473  -19.947 1.00 53.29 ? 649 GLY A CA    1 
ATOM   4837  C  C     . GLY A 1 649 ? -16.944 64.894  -20.843 1.00 53.68 ? 649 GLY A C     1 
ATOM   4838  O  O     . GLY A 1 649 ? -18.029 65.470  -20.974 1.00 54.84 ? 649 GLY A O     1 
ATOM   4839  N  N     . LEU A 1 650 ? -16.634 63.746  -21.450 1.00 52.74 ? 650 LEU A N     1 
ATOM   4840  C  CA    . LEU A 1 650 ? -17.538 63.043  -22.365 1.00 53.12 ? 650 LEU A CA    1 
ATOM   4841  C  C     . LEU A 1 650 ? -18.301 61.884  -21.713 1.00 52.99 ? 650 LEU A C     1 
ATOM   4842  O  O     . LEU A 1 650 ? -19.385 61.520  -22.166 1.00 53.95 ? 650 LEU A O     1 
ATOM   4843  C  CB    . LEU A 1 650 ? -16.775 62.560  -23.607 1.00 52.03 ? 650 LEU A CB    1 
ATOM   4844  C  CG    . LEU A 1 650 ? -16.301 63.678  -24.548 1.00 53.29 ? 650 LEU A CG    1 
ATOM   4845  C  CD1   . LEU A 1 650 ? -15.270 63.188  -25.557 1.00 52.40 ? 650 LEU A CD1   1 
ATOM   4846  C  CD2   . LEU A 1 650 ? -17.477 64.342  -25.262 1.00 55.07 ? 650 LEU A CD2   1 
ATOM   4847  N  N     . TRP A 1 651 ? -17.753 61.331  -20.635 1.00 52.19 ? 651 TRP A N     1 
ATOM   4848  C  CA    . TRP A 1 651 ? -18.322 60.142  -20.006 1.00 51.78 ? 651 TRP A CA    1 
ATOM   4849  C  C     . TRP A 1 651 ? -19.544 60.398  -19.133 1.00 53.26 ? 651 TRP A C     1 
ATOM   4850  O  O     . TRP A 1 651 ? -19.492 61.185  -18.186 1.00 54.20 ? 651 TRP A O     1 
ATOM   4851  C  CB    . TRP A 1 651 ? -17.261 59.424  -19.183 1.00 50.25 ? 651 TRP A CB    1 
ATOM   4852  C  CG    . TRP A 1 651 ? -17.687 58.075  -18.742 1.00 49.58 ? 651 TRP A CG    1 
ATOM   4853  C  CD1   . TRP A 1 651 ? -17.935 57.665  -17.460 1.00 48.50 ? 651 TRP A CD1   1 
ATOM   4854  C  CD2   . TRP A 1 651 ? -17.930 56.939  -19.586 1.00 48.69 ? 651 TRP A CD2   1 
ATOM   4855  N  NE1   . TRP A 1 651 ? -18.305 56.341  -17.456 1.00 48.24 ? 651 TRP A NE1   1 
ATOM   4856  C  CE2   . TRP A 1 651 ? -18.315 55.872  -18.745 1.00 47.81 ? 651 TRP A CE2   1 
ATOM   4857  C  CE3   . TRP A 1 651 ? -17.854 56.720  -20.971 1.00 47.95 ? 651 TRP A CE3   1 
ATOM   4858  C  CZ2   . TRP A 1 651 ? -18.629 54.603  -19.241 1.00 48.10 ? 651 TRP A CZ2   1 
ATOM   4859  C  CZ3   . TRP A 1 651 ? -18.157 55.454  -21.464 1.00 47.92 ? 651 TRP A CZ3   1 
ATOM   4860  C  CH2   . TRP A 1 651 ? -18.537 54.411  -20.597 1.00 47.57 ? 651 TRP A CH2   1 
ATOM   4861  N  N     . HIS A 1 652 ? -20.636 59.718  -19.468 1.00 54.05 ? 652 HIS A N     1 
ATOM   4862  C  CA    . HIS A 1 652 ? -21.858 59.676  -18.654 1.00 55.35 ? 652 HIS A CA    1 
ATOM   4863  C  C     . HIS A 1 652 ? -22.633 58.390  -18.961 1.00 55.61 ? 652 HIS A C     1 
ATOM   4864  O  O     . HIS A 1 652 ? -22.231 57.605  -19.827 1.00 54.63 ? 652 HIS A O     1 
ATOM   4865  C  CB    . HIS A 1 652 ? -22.726 60.935  -18.837 1.00 56.71 ? 652 HIS A CB    1 
ATOM   4866  C  CG    . HIS A 1 652 ? -23.124 61.207  -20.254 1.00 57.05 ? 652 HIS A CG    1 
ATOM   4867  N  ND1   . HIS A 1 652 ? -22.211 61.516  -21.239 1.00 56.07 ? 652 HIS A ND1   1 
ATOM   4868  C  CD2   . HIS A 1 652 ? -24.341 61.242  -20.848 1.00 58.53 ? 652 HIS A CD2   1 
ATOM   4869  C  CE1   . HIS A 1 652 ? -22.845 61.711  -22.382 1.00 56.73 ? 652 HIS A CE1   1 
ATOM   4870  N  NE2   . HIS A 1 652 ? -24.138 61.549  -22.172 1.00 58.29 ? 652 HIS A NE2   1 
ATOM   4871  N  N     . GLU A 1 653 ? -23.735 58.169  -18.250 1.00 57.02 ? 653 GLU A N     1 
ATOM   4872  C  CA    . GLU A 1 653 ? -24.413 56.876  -18.296 1.00 57.45 ? 653 GLU A CA    1 
ATOM   4873  C  C     . GLU A 1 653 ? -25.107 56.553  -19.632 1.00 57.57 ? 653 GLU A C     1 
ATOM   4874  O  O     . GLU A 1 653 ? -25.066 55.403  -20.088 1.00 56.61 ? 653 GLU A O     1 
ATOM   4875  C  CB    . GLU A 1 653 ? -25.386 56.736  -17.131 1.00 58.94 ? 653 GLU A CB    1 
ATOM   4876  C  CG    . GLU A 1 653 ? -25.212 55.427  -16.385 1.00 60.06 ? 653 GLU A CG    1 
ATOM   4877  C  CD    . GLU A 1 653 ? -26.518 54.673  -16.225 1.00 64.33 ? 653 GLU A CD    1 
ATOM   4878  O  OE1   . GLU A 1 653 ? -26.542 53.467  -16.580 1.00 65.08 ? 653 GLU A OE1   1 
ATOM   4879  O  OE2   . GLU A 1 653 ? -27.516 55.286  -15.761 1.00 66.41 ? 653 GLU A OE2   1 
ATOM   4880  N  N     . GLU A 1 654 ? -25.732 57.555  -20.252 1.00 58.50 ? 654 GLU A N     1 
ATOM   4881  C  CA    . GLU A 1 654 ? -26.354 57.381  -21.576 1.00 58.98 ? 654 GLU A CA    1 
ATOM   4882  C  C     . GLU A 1 654 ? -25.292 57.150  -22.662 1.00 57.61 ? 654 GLU A C     1 
ATOM   4883  O  O     . GLU A 1 654 ? -25.581 56.597  -23.726 1.00 57.46 ? 654 GLU A O     1 
ATOM   4884  C  CB    . GLU A 1 654 ? -27.257 58.573  -21.926 1.00 60.71 ? 654 GLU A CB    1 
ATOM   4885  N  N     . MET A 1 655 ? -24.062 57.561  -22.361 1.00 56.40 ? 655 MET A N     1 
ATOM   4886  C  CA    . MET A 1 655 ? -22.915 57.369  -23.234 1.00 55.01 ? 655 MET A CA    1 
ATOM   4887  C  C     . MET A 1 655 ? -22.467 55.908  -23.214 1.00 53.37 ? 655 MET A C     1 
ATOM   4888  O  O     . MET A 1 655 ? -22.245 55.294  -24.264 1.00 52.49 ? 655 MET A O     1 
ATOM   4889  C  CB    . MET A 1 655 ? -21.794 58.284  -22.758 1.00 55.15 ? 655 MET A CB    1 
ATOM   4890  C  CG    . MET A 1 655 ? -20.425 57.961  -23.272 1.00 54.65 ? 655 MET A CG    1 
ATOM   4891  S  SD    . MET A 1 655 ? -20.274 58.423  -24.997 1.00 59.22 ? 655 MET A SD    1 
ATOM   4892  C  CE    . MET A 1 655 ? -18.550 58.899  -24.951 1.00 55.10 ? 655 MET A CE    1 
ATOM   4893  N  N     . LYS A 1 656 ? -22.325 55.379  -21.998 1.00 52.36 ? 656 LYS A N     1 
ATOM   4894  C  CA    . LYS A 1 656 ? -22.043 53.974  -21.734 1.00 50.78 ? 656 LYS A CA    1 
ATOM   4895  C  C     . LYS A 1 656 ? -23.076 53.070  -22.419 1.00 50.76 ? 656 LYS A C     1 
ATOM   4896  O  O     . LYS A 1 656 ? -22.721 52.128  -23.126 1.00 50.02 ? 656 LYS A O     1 
ATOM   4897  C  CB    . LYS A 1 656 ? -22.037 53.765  -20.214 1.00 50.94 ? 656 LYS A CB    1 
ATOM   4898  C  CG    . LYS A 1 656 ? -21.566 52.407  -19.713 1.00 50.85 ? 656 LYS A CG    1 
ATOM   4899  C  CD    . LYS A 1 656 ? -22.752 51.558  -19.291 1.00 54.01 ? 656 LYS A CD    1 
ATOM   4900  C  CE    . LYS A 1 656 ? -23.342 51.983  -17.954 1.00 56.69 ? 656 LYS A CE    1 
ATOM   4901  N  NZ    . LYS A 1 656 ? -22.481 51.535  -16.821 1.00 58.48 ? 656 LYS A NZ    1 
ATOM   4902  N  N     . ASN A 1 657 ? -24.349 53.385  -22.225 1.00 51.68 ? 657 ASN A N     1 
ATOM   4903  C  CA    . ASN A 1 657 ? -25.451 52.624  -22.808 1.00 52.07 ? 657 ASN A CA    1 
ATOM   4904  C  C     . ASN A 1 657 ? -25.536 52.715  -24.335 1.00 52.03 ? 657 ASN A C     1 
ATOM   4905  O  O     . ASN A 1 657 ? -25.969 51.764  -25.003 1.00 51.82 ? 657 ASN A O     1 
ATOM   4906  C  CB    . ASN A 1 657 ? -26.775 53.032  -22.154 1.00 53.50 ? 657 ASN A CB    1 
ATOM   4907  C  CG    . ASN A 1 657 ? -26.831 52.657  -20.680 1.00 53.33 ? 657 ASN A CG    1 
ATOM   4908  O  OD1   . ASN A 1 657 ? -26.209 51.681  -20.251 1.00 52.04 ? 657 ASN A OD1   1 
ATOM   4909  N  ND2   . ASN A 1 657 ? -27.579 53.426  -19.899 1.00 54.33 ? 657 ASN A ND2   1 
ATOM   4910  N  N     . GLN A 1 658 ? -25.112 53.852  -24.881 1.00 51.92 ? 658 GLN A N     1 
ATOM   4911  C  CA    . GLN A 1 658 ? -25.004 54.005  -26.331 1.00 51.98 ? 658 GLN A CA    1 
ATOM   4912  C  C     . GLN A 1 658 ? -23.953 53.048  -26.916 1.00 50.12 ? 658 GLN A C     1 
ATOM   4913  O  O     . GLN A 1 658 ? -24.196 52.404  -27.932 1.00 49.74 ? 658 GLN A O     1 
ATOM   4914  C  CB    . GLN A 1 658 ? -24.711 55.457  -26.706 1.00 52.56 ? 658 GLN A CB    1 
ATOM   4915  N  N     . ILE A 1 659 ? -22.812 52.937  -26.241 1.00 49.02 ? 659 ILE A N     1 
ATOM   4916  C  CA    . ILE A 1 659 ? -21.706 52.071  -26.678 1.00 47.93 ? 659 ILE A CA    1 
ATOM   4917  C  C     . ILE A 1 659 ? -22.061 50.581  -26.535 1.00 47.83 ? 659 ILE A C     1 
ATOM   4918  O  O     . ILE A 1 659 ? -21.706 49.766  -27.388 1.00 47.22 ? 659 ILE A O     1 
ATOM   4919  C  CB    . ILE A 1 659 ? -20.394 52.419  -25.923 1.00 46.80 ? 659 ILE A CB    1 
ATOM   4920  C  CG1   . ILE A 1 659 ? -20.031 53.894  -26.147 1.00 47.39 ? 659 ILE A CG1   1 
ATOM   4921  C  CG2   . ILE A 1 659 ? -19.235 51.492  -26.334 1.00 44.97 ? 659 ILE A CG2   1 
ATOM   4922  C  CD1   . ILE A 1 659 ? -18.949 54.427  -25.204 1.00 46.86 ? 659 ILE A CD1   1 
ATOM   4923  N  N     . ILE A 1 660 ? -22.774 50.245  -25.459 1.00 48.78 ? 660 ILE A N     1 
ATOM   4924  C  CA    . ILE A 1 660 ? -23.311 48.904  -25.247 1.00 48.98 ? 660 ILE A CA    1 
ATOM   4925  C  C     . ILE A 1 660 ? -24.295 48.549  -26.352 1.00 50.23 ? 660 ILE A C     1 
ATOM   4926  O  O     . ILE A 1 660 ? -24.309 47.420  -26.832 1.00 50.17 ? 660 ILE A O     1 
ATOM   4927  C  CB    . ILE A 1 660 ? -24.002 48.776  -23.872 1.00 49.68 ? 660 ILE A CB    1 
ATOM   4928  C  CG1   . ILE A 1 660 ? -22.961 48.773  -22.751 1.00 48.41 ? 660 ILE A CG1   1 
ATOM   4929  C  CG2   . ILE A 1 660 ? -24.870 47.503  -23.795 1.00 50.15 ? 660 ILE A CG2   1 
ATOM   4930  C  CD1   . ILE A 1 660 ? -23.565 48.880  -21.358 1.00 49.13 ? 660 ILE A CD1   1 
ATOM   4931  N  N     . ALA A 1 661 ? -25.107 49.518  -26.759 1.00 52.22 ? 661 ALA A N     1 
ATOM   4932  C  CA    . ALA A 1 661 ? -26.058 49.319  -27.854 1.00 53.84 ? 661 ALA A CA    1 
ATOM   4933  C  C     . ALA A 1 661 ? -25.356 49.132  -29.199 1.00 53.52 ? 661 ALA A C     1 
ATOM   4934  O  O     . ALA A 1 661 ? -25.945 48.611  -30.147 1.00 54.67 ? 661 ALA A O     1 
ATOM   4935  C  CB    . ALA A 1 661 ? -27.061 50.477  -27.923 1.00 55.45 ? 661 ALA A CB    1 
ATOM   4936  N  N     . CYS A 1 662 ? -24.095 49.542  -29.283 1.00 52.47 ? 662 CYS A N     1 
ATOM   4937  C  CA    . CYS A 1 662 ? -23.360 49.426  -30.538 1.00 52.13 ? 662 CYS A CA    1 
ATOM   4938  C  C     . CYS A 1 662 ? -22.369 48.280  -30.515 1.00 50.32 ? 662 CYS A C     1 
ATOM   4939  O  O     . CYS A 1 662 ? -21.337 48.339  -31.177 1.00 49.55 ? 662 CYS A O     1 
ATOM   4940  C  CB    . CYS A 1 662 ? -22.653 50.737  -30.862 1.00 52.12 ? 662 CYS A CB    1 
ATOM   4941  S  SG    . CYS A 1 662 ? -23.799 52.045  -31.229 1.00 55.12 ? 662 CYS A SG    1 
ATOM   4942  N  N     . ASN A 1 663 ? -22.702 47.234  -29.761 1.00 50.00 ? 663 ASN A N     1 
ATOM   4943  C  CA    . ASN A 1 663 ? -21.813 46.091  -29.556 1.00 48.70 ? 663 ASN A CA    1 
ATOM   4944  C  C     . ASN A 1 663 ? -20.395 46.529  -29.192 1.00 47.36 ? 663 ASN A C     1 
ATOM   4945  O  O     . ASN A 1 663 ? -19.422 46.064  -29.786 1.00 46.61 ? 663 ASN A O     1 
ATOM   4946  C  CB    . ASN A 1 663 ? -21.803 45.174  -30.783 1.00 48.77 ? 663 ASN A CB    1 
ATOM   4947  C  CG    . ASN A 1 663 ? -23.182 44.617  -31.110 1.00 50.77 ? 663 ASN A CG    1 
ATOM   4948  O  OD1   . ASN A 1 663 ? -23.912 44.163  -30.226 1.00 51.82 ? 663 ASN A OD1   1 
ATOM   4949  N  ND2   . ASN A 1 663 ? -23.542 44.652  -32.388 1.00 51.33 ? 663 ASN A ND2   1 
ATOM   4950  N  N     . GLY A 1 664 ? -20.296 47.456  -28.240 1.00 47.00 ? 664 GLY A N     1 
ATOM   4951  C  CA    . GLY A 1 664 ? -19.007 47.904  -27.725 1.00 45.63 ? 664 GLY A CA    1 
ATOM   4952  C  C     . GLY A 1 664 ? -18.211 48.804  -28.652 1.00 45.10 ? 664 GLY A C     1 
ATOM   4953  O  O     . GLY A 1 664 ? -17.027 49.034  -28.422 1.00 43.93 ? 664 GLY A O     1 
ATOM   4954  N  N     . SER A 1 665 ? -18.861 49.319  -29.693 1.00 45.78 ? 665 SER A N     1 
ATOM   4955  C  CA    . SER A 1 665 ? -18.214 50.235  -30.642 1.00 45.50 ? 665 SER A CA    1 
ATOM   4956  C  C     . SER A 1 665 ? -18.452 51.698  -30.275 1.00 45.96 ? 665 SER A C     1 
ATOM   4957  O  O     . SER A 1 665 ? -19.437 52.023  -29.611 1.00 47.08 ? 665 SER A O     1 
ATOM   4958  C  CB    . SER A 1 665 ? -18.707 49.968  -32.068 1.00 46.07 ? 665 SER A CB    1 
ATOM   4959  O  OG    . SER A 1 665 ? -18.418 51.061  -32.921 1.00 46.26 ? 665 SER A OG    1 
ATOM   4960  N  N     . ILE A 1 666 ? -17.546 52.571  -30.714 1.00 45.43 ? 666 ILE A N     1 
ATOM   4961  C  CA    . ILE A 1 666 ? -17.695 54.022  -30.519 1.00 46.02 ? 666 ILE A CA    1 
ATOM   4962  C  C     . ILE A 1 666 ? -17.737 54.799  -31.841 1.00 46.79 ? 666 ILE A C     1 
ATOM   4963  O  O     . ILE A 1 666 ? -17.771 56.030  -31.836 1.00 47.39 ? 666 ILE A O     1 
ATOM   4964  C  CB    . ILE A 1 666 ? -16.577 54.630  -29.615 1.00 45.35 ? 666 ILE A CB    1 
ATOM   4965  C  CG1   . ILE A 1 666 ? -15.195 54.498  -30.276 1.00 43.99 ? 666 ILE A CG1   1 
ATOM   4966  C  CG2   . ILE A 1 666 ? -16.611 54.015  -28.208 1.00 45.18 ? 666 ILE A CG2   1 
ATOM   4967  C  CD1   . ILE A 1 666 ? -14.132 55.452  -29.710 1.00 43.90 ? 666 ILE A CD1   1 
ATOM   4968  N  N     . GLN A 1 667 ? -17.739 54.084  -32.964 1.00 46.65 ? 667 GLN A N     1 
ATOM   4969  C  CA    . GLN A 1 667 ? -17.680 54.731  -34.278 1.00 47.80 ? 667 GLN A CA    1 
ATOM   4970  C  C     . GLN A 1 667 ? -18.883 55.633  -34.570 1.00 49.70 ? 667 GLN A C     1 
ATOM   4971  O  O     . GLN A 1 667 ? -18.750 56.620  -35.280 1.00 50.49 ? 667 GLN A O     1 
ATOM   4972  C  CB    . GLN A 1 667 ? -17.498 53.710  -35.410 1.00 47.48 ? 667 GLN A CB    1 
ATOM   4973  C  CG    . GLN A 1 667 ? -16.252 52.838  -35.296 1.00 45.48 ? 667 GLN A CG    1 
ATOM   4974  C  CD    . GLN A 1 667 ? -14.978 53.629  -35.104 1.00 45.22 ? 667 GLN A CD    1 
ATOM   4975  O  OE1   . GLN A 1 667 ? -14.573 54.398  -35.981 1.00 46.67 ? 667 GLN A OE1   1 
ATOM   4976  N  NE2   . GLN A 1 667 ? -14.327 53.435  -33.956 1.00 41.89 ? 667 GLN A NE2   1 
ATOM   4977  N  N     . SER A 1 668 ? -20.044 55.303  -34.013 1.00 50.65 ? 668 SER A N     1 
ATOM   4978  C  CA    . SER A 1 668 ? -21.253 56.075  -34.304 1.00 53.15 ? 668 SER A CA    1 
ATOM   4979  C  C     . SER A 1 668 ? -21.616 57.153  -33.256 1.00 54.00 ? 668 SER A C     1 
ATOM   4980  O  O     . SER A 1 668 ? -22.679 57.768  -33.357 1.00 55.70 ? 668 SER A O     1 
ATOM   4981  C  CB    . SER A 1 668 ? -22.436 55.139  -34.556 1.00 53.84 ? 668 SER A CB    1 
ATOM   4982  O  OG    . SER A 1 668 ? -22.721 54.368  -33.403 1.00 53.39 ? 668 SER A OG    1 
ATOM   4983  N  N     . ILE A 1 669 ? -20.735 57.390  -32.280 1.00 52.98 ? 669 ILE A N     1 
ATOM   4984  C  CA    . ILE A 1 669 ? -20.972 58.423  -31.258 1.00 53.79 ? 669 ILE A CA    1 
ATOM   4985  C  C     . ILE A 1 669 ? -20.472 59.800  -31.732 1.00 54.80 ? 669 ILE A C     1 
ATOM   4986  O  O     . ILE A 1 669 ? -19.265 60.010  -31.880 1.00 53.87 ? 669 ILE A O     1 
ATOM   4987  C  CB    . ILE A 1 669 ? -20.324 58.081  -29.869 1.00 52.72 ? 669 ILE A CB    1 
ATOM   4988  C  CG1   . ILE A 1 669 ? -20.514 56.599  -29.470 1.00 50.80 ? 669 ILE A CG1   1 
ATOM   4989  C  CG2   . ILE A 1 669 ? -20.825 59.058  -28.785 1.00 53.21 ? 669 ILE A CG2   1 
ATOM   4990  C  CD1   . ILE A 1 669 ? -21.946 56.185  -29.161 1.00 52.40 ? 669 ILE A CD1   1 
ATOM   4991  N  N     . PRO A 1 670 ? -21.404 60.743  -31.972 1.00 56.67 ? 670 PRO A N     1 
ATOM   4992  C  CA    . PRO A 1 670 ? -21.047 62.034  -32.578 1.00 57.84 ? 670 PRO A CA    1 
ATOM   4993  C  C     . PRO A 1 670 ? -20.082 62.901  -31.763 1.00 57.43 ? 670 PRO A C     1 
ATOM   4994  O  O     . PRO A 1 670 ? -19.264 63.612  -32.354 1.00 57.45 ? 670 PRO A O     1 
ATOM   4995  C  CB    . PRO A 1 670 ? -22.402 62.744  -32.733 1.00 59.51 ? 670 PRO A CB    1 
ATOM   4996  C  CG    . PRO A 1 670 ? -23.416 61.651  -32.666 1.00 59.80 ? 670 PRO A CG    1 
ATOM   4997  C  CD    . PRO A 1 670 ? -22.852 60.647  -31.714 1.00 57.76 ? 670 PRO A CD    1 
ATOM   4998  N  N     . GLU A 1 671 ? -20.167 62.846  -30.436 1.00 57.16 ? 671 GLU A N     1 
ATOM   4999  C  CA    . GLU A 1 671 ? -19.379 63.754  -29.591 1.00 57.33 ? 671 GLU A CA    1 
ATOM   5000  C  C     . GLU A 1 671 ? -17.929 63.318  -29.372 1.00 55.45 ? 671 GLU A C     1 
ATOM   5001  O  O     . GLU A 1 671 ? -17.184 63.966  -28.630 1.00 55.45 ? 671 GLU A O     1 
ATOM   5002  C  CB    . GLU A 1 671 ? -20.074 64.032  -28.247 1.00 57.97 ? 671 GLU A CB    1 
ATOM   5003  C  CG    . GLU A 1 671 ? -20.533 62.801  -27.467 1.00 58.83 ? 671 GLU A CG    1 
ATOM   5004  C  CD    . GLU A 1 671 ? -21.987 62.410  -27.753 1.00 62.98 ? 671 GLU A CD    1 
ATOM   5005  O  OE1   . GLU A 1 671 ? -22.460 61.424  -27.145 1.00 63.61 ? 671 GLU A OE1   1 
ATOM   5006  O  OE2   . GLU A 1 671 ? -22.665 63.079  -28.576 1.00 64.92 ? 671 GLU A OE2   1 
ATOM   5007  N  N     . ILE A 1 672 ? -17.531 62.229  -30.023 1.00 54.14 ? 672 ILE A N     1 
ATOM   5008  C  CA    . ILE A 1 672 ? -16.201 61.653  -29.819 1.00 52.42 ? 672 ILE A CA    1 
ATOM   5009  C  C     . ILE A 1 672 ? -15.284 62.015  -30.989 1.00 52.51 ? 672 ILE A C     1 
ATOM   5010  O  O     . ILE A 1 672 ? -15.657 61.835  -32.146 1.00 53.04 ? 672 ILE A O     1 
ATOM   5011  C  CB    . ILE A 1 672 ? -16.267 60.116  -29.566 1.00 51.13 ? 672 ILE A CB    1 
ATOM   5012  C  CG1   . ILE A 1 672 ? -17.089 59.818  -28.299 1.00 50.80 ? 672 ILE A CG1   1 
ATOM   5013  C  CG2   . ILE A 1 672 ? -14.846 59.485  -29.487 1.00 49.45 ? 672 ILE A CG2   1 
ATOM   5014  C  CD1   . ILE A 1 672 ? -17.124 58.336  -27.891 1.00 50.02 ? 672 ILE A CD1   1 
ATOM   5015  N  N     . PRO A 1 673 ? -14.099 62.576  -30.685 1.00 52.15 ? 673 PRO A N     1 
ATOM   5016  C  CA    . PRO A 1 673 ? -13.131 62.967  -31.715 1.00 52.36 ? 673 PRO A CA    1 
ATOM   5017  C  C     . PRO A 1 673 ? -12.689 61.791  -32.584 1.00 51.51 ? 673 PRO A C     1 
ATOM   5018  O  O     . PRO A 1 673 ? -12.458 60.692  -32.067 1.00 50.54 ? 673 PRO A O     1 
ATOM   5019  C  CB    . PRO A 1 673 ? -11.941 63.491  -30.896 1.00 51.79 ? 673 PRO A CB    1 
ATOM   5020  C  CG    . PRO A 1 673 ? -12.544 63.910  -29.597 1.00 52.06 ? 673 PRO A CG    1 
ATOM   5021  C  CD    . PRO A 1 673 ? -13.615 62.902  -29.331 1.00 51.40 ? 673 PRO A CD    1 
ATOM   5022  N  N     . ASP A 1 674 ? -12.555 62.032  -33.887 1.00 51.95 ? 674 ASP A N     1 
ATOM   5023  C  CA    . ASP A 1 674 ? -12.129 61.002  -34.833 1.00 51.19 ? 674 ASP A CA    1 
ATOM   5024  C  C     . ASP A 1 674 ? -10.806 60.339  -34.460 1.00 49.38 ? 674 ASP A C     1 
ATOM   5025  O  O     . ASP A 1 674 ? -10.627 59.143  -34.705 1.00 48.23 ? 674 ASP A O     1 
ATOM   5026  C  CB    . ASP A 1 674 ? -12.088 61.556  -36.257 1.00 52.57 ? 674 ASP A CB    1 
ATOM   5027  C  CG    . ASP A 1 674 ? -13.475 61.937  -36.770 1.00 55.09 ? 674 ASP A CG    1 
ATOM   5028  O  OD1   . ASP A 1 674 ? -14.419 61.128  -36.601 1.00 54.79 ? 674 ASP A OD1   1 
ATOM   5029  O  OD2   . ASP A 1 674 ? -13.621 63.048  -37.341 1.00 58.35 ? 674 ASP A OD2   1 
ATOM   5030  N  N     . ASP A 1 675 ? -9.900  61.116  -33.864 1.00 48.88 ? 675 ASP A N     1 
ATOM   5031  C  CA    . ASP A 1 675 ? -8.635  60.608  -33.315 1.00 47.43 ? 675 ASP A CA    1 
ATOM   5032  C  C     . ASP A 1 675 ? -8.891  59.403  -32.414 1.00 45.81 ? 675 ASP A C     1 
ATOM   5033  O  O     . ASP A 1 675 ? -8.310  58.326  -32.603 1.00 44.82 ? 675 ASP A O     1 
ATOM   5034  C  CB    . ASP A 1 675 ? -7.897  61.728  -32.523 1.00 48.00 ? 675 ASP A CB    1 
ATOM   5035  N  N     . LEU A 1 676 ? -9.790  59.594  -31.453 1.00 45.40 ? 676 LEU A N     1 
ATOM   5036  C  CA    . LEU A 1 676 ? -10.157 58.549  -30.499 1.00 43.87 ? 676 LEU A CA    1 
ATOM   5037  C  C     . LEU A 1 676 ? -10.901 57.382  -31.141 1.00 43.21 ? 676 LEU A C     1 
ATOM   5038  O  O     . LEU A 1 676 ? -10.648 56.233  -30.790 1.00 42.00 ? 676 LEU A O     1 
ATOM   5039  C  CB    . LEU A 1 676 ? -10.955 59.134  -29.330 1.00 44.12 ? 676 LEU A CB    1 
ATOM   5040  C  CG    . LEU A 1 676 ? -10.191 60.095  -28.420 1.00 43.75 ? 676 LEU A CG    1 
ATOM   5041  C  CD1   . LEU A 1 676 ? -11.011 60.374  -27.176 1.00 43.65 ? 676 LEU A CD1   1 
ATOM   5042  C  CD2   . LEU A 1 676 ? -8.800  59.553  -28.048 1.00 41.75 ? 676 LEU A CD2   1 
ATOM   5043  N  N     . LYS A 1 677 ? -11.800 57.682  -32.080 1.00 43.99 ? 677 LYS A N     1 
ATOM   5044  C  CA    . LYS A 1 677 ? -12.507 56.649  -32.858 1.00 43.81 ? 677 LYS A CA    1 
ATOM   5045  C  C     . LYS A 1 677 ? -11.545 55.745  -33.636 1.00 43.11 ? 677 LYS A C     1 
ATOM   5046  O  O     . LYS A 1 677 ? -11.745 54.536  -33.725 1.00 42.49 ? 677 LYS A O     1 
ATOM   5047  C  CB    . LYS A 1 677 ? -13.525 57.285  -33.818 1.00 45.03 ? 677 LYS A CB    1 
ATOM   5048  C  CG    . LYS A 1 677 ? -14.657 58.025  -33.122 1.00 45.33 ? 677 LYS A CG    1 
ATOM   5049  C  CD    . LYS A 1 677 ? -15.701 58.506  -34.098 1.00 46.63 ? 677 LYS A CD    1 
ATOM   5050  C  CE    . LYS A 1 677 ? -16.920 58.982  -33.352 1.00 48.13 ? 677 LYS A CE    1 
ATOM   5051  N  NZ    . LYS A 1 677 ? -18.015 59.454  -34.244 1.00 49.23 ? 677 LYS A NZ    1 
ATOM   5052  N  N     . GLN A 1 678 ? -10.495 56.338  -34.189 1.00 43.44 ? 678 GLN A N     1 
ATOM   5053  C  CA    . GLN A 1 678 ? -9.485  55.589  -34.930 1.00 43.38 ? 678 GLN A CA    1 
ATOM   5054  C  C     . GLN A 1 678 ? -8.670  54.660  -34.022 1.00 41.76 ? 678 GLN A C     1 
ATOM   5055  O  O     . GLN A 1 678 ? -8.276  53.573  -34.434 1.00 41.40 ? 678 GLN A O     1 
ATOM   5056  C  CB    . GLN A 1 678 ? -8.561  56.565  -35.654 1.00 44.38 ? 678 GLN A CB    1 
ATOM   5057  C  CG    . GLN A 1 678 ? -7.818  55.983  -36.822 1.00 47.03 ? 678 GLN A CG    1 
ATOM   5058  C  CD    . GLN A 1 678 ? -8.619  56.038  -38.096 1.00 52.21 ? 678 GLN A CD    1 
ATOM   5059  O  OE1   . GLN A 1 678 ? -9.757  55.559  -38.157 1.00 54.47 ? 678 GLN A OE1   1 
ATOM   5060  N  NE2   . GLN A 1 678 ? -8.031  56.627  -39.136 1.00 55.09 ? 678 GLN A NE2   1 
ATOM   5061  N  N     . LEU A 1 679 ? -8.447  55.090  -32.783 1.00 41.00 ? 679 LEU A N     1 
ATOM   5062  C  CA    . LEU A 1 679 ? -7.580  54.394  -31.842 1.00 39.53 ? 679 LEU A CA    1 
ATOM   5063  C  C     . LEU A 1 679 ? -8.311  53.223  -31.186 1.00 39.03 ? 679 LEU A C     1 
ATOM   5064  O  O     . LEU A 1 679 ? -7.705  52.192  -30.858 1.00 38.15 ? 679 LEU A O     1 
ATOM   5065  C  CB    . LEU A 1 679 ? -7.127  55.365  -30.747 1.00 39.52 ? 679 LEU A CB    1 
ATOM   5066  C  CG    . LEU A 1 679 ? -5.670  55.587  -30.319 1.00 39.08 ? 679 LEU A CG    1 
ATOM   5067  C  CD1   . LEU A 1 679 ? -5.656  56.086  -28.877 1.00 39.26 ? 679 LEU A CD1   1 
ATOM   5068  C  CD2   . LEU A 1 679 ? -4.800  54.369  -30.448 1.00 37.12 ? 679 LEU A CD2   1 
ATOM   5069  N  N     . TYR A 1 680 ? -9.613  53.396  -30.982 1.00 39.31 ? 680 TYR A N     1 
ATOM   5070  C  CA    . TYR A 1 680 ? -10.416 52.406  -30.285 1.00 38.69 ? 680 TYR A CA    1 
ATOM   5071  C  C     . TYR A 1 680 ? -11.435 51.728  -31.216 1.00 39.70 ? 680 TYR A C     1 
ATOM   5072  O  O     . TYR A 1 680 ? -12.580 51.455  -30.827 1.00 39.98 ? 680 TYR A O     1 
ATOM   5073  C  CB    . TYR A 1 680 ? -11.078 53.040  -29.054 1.00 38.64 ? 680 TYR A CB    1 
ATOM   5074  C  CG    . TYR A 1 680 ? -10.087 53.685  -28.089 1.00 37.83 ? 680 TYR A CG    1 
ATOM   5075  C  CD1   . TYR A 1 680 ? -10.049 55.067  -27.910 1.00 37.81 ? 680 TYR A CD1   1 
ATOM   5076  C  CD2   . TYR A 1 680 ? -9.178  52.916  -27.378 1.00 35.79 ? 680 TYR A CD2   1 
ATOM   5077  C  CE1   . TYR A 1 680 ? -9.150  55.654  -27.034 1.00 36.23 ? 680 TYR A CE1   1 
ATOM   5078  C  CE2   . TYR A 1 680 ? -8.271  53.496  -26.507 1.00 35.88 ? 680 TYR A CE2   1 
ATOM   5079  C  CZ    . TYR A 1 680 ? -8.264  54.861  -26.334 1.00 36.64 ? 680 TYR A CZ    1 
ATOM   5080  O  OH    . TYR A 1 680 ? -7.355  55.423  -25.459 1.00 36.33 ? 680 TYR A OH    1 
ATOM   5081  N  N     . LYS A 1 681 ? -11.007 51.455  -32.450 1.00 39.87 ? 681 LYS A N     1 
ATOM   5082  C  CA    . LYS A 1 681 ? -11.735 50.536  -33.312 1.00 40.54 ? 681 LYS A CA    1 
ATOM   5083  C  C     . LYS A 1 681 ? -11.707 49.174  -32.634 1.00 39.83 ? 681 LYS A C     1 
ATOM   5084  O  O     . LYS A 1 681 ? -10.692 48.791  -32.021 1.00 38.75 ? 681 LYS A O     1 
ATOM   5085  C  CB    . LYS A 1 681 ? -11.086 50.432  -34.692 1.00 40.89 ? 681 LYS A CB    1 
ATOM   5086  C  CG    . LYS A 1 681 ? -11.073 51.722  -35.477 1.00 43.36 ? 681 LYS A CG    1 
ATOM   5087  C  CD    . LYS A 1 681 ? -10.301 51.580  -36.774 1.00 45.93 ? 681 LYS A CD    1 
ATOM   5088  C  CE    . LYS A 1 681 ? -11.231 51.447  -37.961 1.00 48.21 ? 681 LYS A CE    1 
ATOM   5089  N  NZ    . LYS A 1 681 ? -10.603 52.024  -39.185 1.00 51.47 ? 681 LYS A NZ    1 
ATOM   5090  N  N     . THR A 1 682 ? -12.825 48.457  -32.709 1.00 40.09 ? 682 THR A N     1 
ATOM   5091  C  CA    . THR A 1 682 ? -12.852 47.092  -32.213 1.00 39.46 ? 682 THR A CA    1 
ATOM   5092  C  C     . THR A 1 682 ? -12.300 46.175  -33.304 1.00 39.44 ? 682 THR A C     1 
ATOM   5093  O  O     . THR A 1 682 ? -12.139 46.583  -34.461 1.00 39.69 ? 682 THR A O     1 
ATOM   5094  C  CB    . THR A 1 682 ? -14.265 46.638  -31.798 1.00 39.97 ? 682 THR A CB    1 
ATOM   5095  O  OG1   . THR A 1 682 ? -15.071 46.450  -32.965 1.00 40.83 ? 682 THR A OG1   1 
ATOM   5096  C  CG2   . THR A 1 682 ? -14.925 47.657  -30.856 1.00 40.18 ? 682 THR A CG2   1 
ATOM   5097  N  N     . VAL A 1 683 ? -12.009 44.936  -32.928 1.00 39.07 ? 683 VAL A N     1 
ATOM   5098  C  CA    . VAL A 1 683 ? -11.539 43.932  -33.883 1.00 39.03 ? 683 VAL A CA    1 
ATOM   5099  C  C     . VAL A 1 683 ? -12.515 43.718  -35.062 1.00 39.93 ? 683 VAL A C     1 
ATOM   5100  O  O     . VAL A 1 683 ? -12.099 43.355  -36.157 1.00 40.15 ? 683 VAL A O     1 
ATOM   5101  C  CB    . VAL A 1 683 ? -11.207 42.612  -33.149 1.00 38.64 ? 683 VAL A CB    1 
ATOM   5102  C  CG1   . VAL A 1 683 ? -12.487 41.891  -32.686 1.00 38.18 ? 683 VAL A CG1   1 
ATOM   5103  C  CG2   . VAL A 1 683 ? -10.311 41.728  -34.008 1.00 38.27 ? 683 VAL A CG2   1 
ATOM   5104  N  N     . TRP A 1 684 ? -13.801 43.959  -34.831 1.00 40.46 ? 684 TRP A N     1 
ATOM   5105  C  CA    . TRP A 1 684 ? -14.818 43.857  -35.876 1.00 41.78 ? 684 TRP A CA    1 
ATOM   5106  C  C     . TRP A 1 684 ? -14.740 45.012  -36.875 1.00 42.83 ? 684 TRP A C     1 
ATOM   5107  O  O     . TRP A 1 684 ? -15.224 44.905  -38.004 1.00 43.82 ? 684 TRP A O     1 
ATOM   5108  C  CB    . TRP A 1 684 ? -16.215 43.818  -35.250 1.00 42.28 ? 684 TRP A CB    1 
ATOM   5109  C  CG    . TRP A 1 684 ? -16.323 42.822  -34.122 1.00 41.99 ? 684 TRP A CG    1 
ATOM   5110  C  CD1   . TRP A 1 684 ? -16.194 43.079  -32.788 1.00 40.86 ? 684 TRP A CD1   1 
ATOM   5111  C  CD2   . TRP A 1 684 ? -16.561 41.413  -34.236 1.00 41.70 ? 684 TRP A CD2   1 
ATOM   5112  N  NE1   . TRP A 1 684 ? -16.339 41.924  -32.068 1.00 39.95 ? 684 TRP A NE1   1 
ATOM   5113  C  CE2   . TRP A 1 684 ? -16.561 40.884  -32.929 1.00 39.99 ? 684 TRP A CE2   1 
ATOM   5114  C  CE3   . TRP A 1 684 ? -16.768 40.545  -35.318 1.00 42.17 ? 684 TRP A CE3   1 
ATOM   5115  C  CZ2   . TRP A 1 684 ? -16.782 39.525  -32.666 1.00 40.35 ? 684 TRP A CZ2   1 
ATOM   5116  C  CZ3   . TRP A 1 684 ? -16.979 39.185  -35.054 1.00 41.25 ? 684 TRP A CZ3   1 
ATOM   5117  C  CH2   . TRP A 1 684 ? -16.991 38.695  -33.739 1.00 40.54 ? 684 TRP A CH2   1 
ATOM   5118  N  N     . GLU A 1 685 ? -14.139 46.120  -36.450 1.00 42.74 ? 685 GLU A N     1 
ATOM   5119  C  CA    . GLU A 1 685 ? -14.000 47.292  -37.297 1.00 43.50 ? 685 GLU A CA    1 
ATOM   5120  C  C     . GLU A 1 685 ? -12.630 47.345  -37.973 1.00 43.04 ? 685 GLU A C     1 
ATOM   5121  O  O     . GLU A 1 685 ? -12.396 48.148  -38.866 1.00 43.98 ? 685 GLU A O     1 
ATOM   5122  C  CB    . GLU A 1 685 ? -14.271 48.545  -36.474 1.00 43.77 ? 685 GLU A CB    1 
ATOM   5123  C  CG    . GLU A 1 685 ? -15.720 48.613  -36.053 1.00 45.26 ? 685 GLU A CG    1 
ATOM   5124  C  CD    . GLU A 1 685 ? -15.965 49.455  -34.822 1.00 45.56 ? 685 GLU A CD    1 
ATOM   5125  O  OE1   . GLU A 1 685 ? -15.056 49.582  -33.961 1.00 42.92 ? 685 GLU A OE1   1 
ATOM   5126  O  OE2   . GLU A 1 685 ? -17.096 49.986  -34.728 1.00 47.26 ? 685 GLU A OE2   1 
ATOM   5127  N  N     . ILE A 1 686 ? -11.732 46.473  -37.542 1.00 42.15 ? 686 ILE A N     1 
ATOM   5128  C  CA    . ILE A 1 686 ? -10.392 46.398  -38.106 1.00 41.86 ? 686 ILE A CA    1 
ATOM   5129  C  C     . ILE A 1 686 ? -10.375 45.396  -39.264 1.00 42.24 ? 686 ILE A C     1 
ATOM   5130  O  O     . ILE A 1 686 ? -10.914 44.287  -39.158 1.00 42.12 ? 686 ILE A O     1 
ATOM   5131  C  CB    . ILE A 1 686 ? -9.367  46.025  -37.004 1.00 40.45 ? 686 ILE A CB    1 
ATOM   5132  C  CG1   . ILE A 1 686 ? -9.200  47.198  -36.034 1.00 39.65 ? 686 ILE A CG1   1 
ATOM   5133  C  CG2   . ILE A 1 686 ? -8.039  45.587  -37.602 1.00 39.37 ? 686 ILE A CG2   1 
ATOM   5134  C  CD1   . ILE A 1 686 ? -8.601  46.819  -34.698 1.00 37.10 ? 686 ILE A CD1   1 
ATOM   5135  N  N     . SER A 1 687 ? -9.768  45.803  -40.372 1.00 42.86 ? 687 SER A N     1 
ATOM   5136  C  CA    . SER A 1 687 ? -9.619  44.941  -41.540 1.00 43.07 ? 687 SER A CA    1 
ATOM   5137  C  C     . SER A 1 687 ? -8.923  43.637  -41.153 1.00 42.09 ? 687 SER A C     1 
ATOM   5138  O  O     . SER A 1 687 ? -7.843  43.655  -40.534 1.00 41.74 ? 687 SER A O     1 
ATOM   5139  C  CB    . SER A 1 687 ? -8.847  45.684  -42.631 1.00 43.71 ? 687 SER A CB    1 
ATOM   5140  O  OG    . SER A 1 687 ? -8.166  44.794  -43.484 1.00 43.23 ? 687 SER A OG    1 
ATOM   5141  N  N     . GLN A 1 688 ? -9.560  42.512  -41.483 1.00 41.99 ? 688 GLN A N     1 
ATOM   5142  C  CA    . GLN A 1 688 ? -9.020  41.187  -41.145 1.00 41.16 ? 688 GLN A CA    1 
ATOM   5143  C  C     . GLN A 1 688 ? -7.831  40.792  -42.019 1.00 40.81 ? 688 GLN A C     1 
ATOM   5144  O  O     . GLN A 1 688 ? -6.986  40.029  -41.586 1.00 40.14 ? 688 GLN A O     1 
ATOM   5145  C  CB    . GLN A 1 688 ? -10.109 40.103  -41.147 1.00 41.30 ? 688 GLN A CB    1 
ATOM   5146  C  CG    . GLN A 1 688 ? -11.196 40.281  -40.073 1.00 41.28 ? 688 GLN A CG    1 
ATOM   5147  C  CD    . GLN A 1 688 ? -10.635 40.468  -38.656 1.00 41.59 ? 688 GLN A CD    1 
ATOM   5148  O  OE1   . GLN A 1 688 ? -10.170 39.509  -38.017 1.00 40.67 ? 688 GLN A OE1   1 
ATOM   5149  N  NE2   . GLN A 1 688 ? -10.686 41.709  -38.156 1.00 39.80 ? 688 GLN A NE2   1 
ATOM   5150  N  N     . LYS A 1 689 ? -7.758  41.333  -43.232 1.00 41.86 ? 689 LYS A N     1 
ATOM   5151  C  CA    . LYS A 1 689 ? -6.590  41.158  -44.094 1.00 42.26 ? 689 LYS A CA    1 
ATOM   5152  C  C     . LYS A 1 689 ? -5.377  41.878  -43.530 1.00 41.65 ? 689 LYS A C     1 
ATOM   5153  O  O     . LYS A 1 689 ? -4.245  41.398  -43.660 1.00 41.37 ? 689 LYS A O     1 
ATOM   5154  C  CB    . LYS A 1 689 ? -6.869  41.629  -45.527 1.00 43.46 ? 689 LYS A CB    1 
ATOM   5155  C  CG    . LYS A 1 689 ? -7.437  40.535  -46.421 1.00 45.51 ? 689 LYS A CG    1 
ATOM   5156  C  CD    . LYS A 1 689 ? -8.579  41.060  -47.284 1.00 50.08 ? 689 LYS A CD    1 
ATOM   5157  C  CE    . LYS A 1 689 ? -9.280  39.942  -48.042 1.00 51.54 ? 689 LYS A CE    1 
ATOM   5158  N  NZ    . LYS A 1 689 ? -8.667  39.756  -49.390 1.00 54.55 ? 689 LYS A NZ    1 
ATOM   5159  N  N     . THR A 1 690 ? -5.618  43.030  -42.912 1.00 41.49 ? 690 THR A N     1 
ATOM   5160  C  CA    . THR A 1 690 ? -4.571  43.778  -42.224 1.00 40.81 ? 690 THR A CA    1 
ATOM   5161  C  C     . THR A 1 690 ? -4.024  42.965  -41.044 1.00 39.95 ? 690 THR A C     1 
ATOM   5162  O  O     . THR A 1 690 ? -2.809  42.863  -40.859 1.00 39.54 ? 690 THR A O     1 
ATOM   5163  C  CB    . THR A 1 690 ? -5.096  45.151  -41.760 1.00 41.19 ? 690 THR A CB    1 
ATOM   5164  O  OG1   . THR A 1 690 ? -5.520  45.897  -42.901 1.00 40.65 ? 690 THR A OG1   1 
ATOM   5165  C  CG2   . THR A 1 690 ? -4.025  45.940  -41.004 1.00 40.47 ? 690 THR A CG2   1 
ATOM   5166  N  N     . VAL A 1 691 ? -4.933  42.376  -40.271 1.00 39.92 ? 691 VAL A N     1 
ATOM   5167  C  CA    . VAL A 1 691 ? -4.583  41.482  -39.171 1.00 39.25 ? 691 VAL A CA    1 
ATOM   5168  C  C     . VAL A 1 691 ? -3.730  40.315  -39.681 1.00 39.34 ? 691 VAL A C     1 
ATOM   5169  O  O     . VAL A 1 691 ? -2.713  39.975  -39.073 1.00 38.99 ? 691 VAL A O     1 
ATOM   5170  C  CB    . VAL A 1 691 ? -5.859  40.975  -38.437 1.00 39.27 ? 691 VAL A CB    1 
ATOM   5171  C  CG1   . VAL A 1 691 ? -5.534  39.873  -37.427 1.00 38.46 ? 691 VAL A CG1   1 
ATOM   5172  C  CG2   . VAL A 1 691 ? -6.560  42.130  -37.740 1.00 39.27 ? 691 VAL A CG2   1 
ATOM   5173  N  N     . LEU A 1 692 ? -4.142  39.718  -40.798 1.00 39.88 ? 692 LEU A N     1 
ATOM   5174  C  CA    . LEU A 1 692 ? -3.409  38.616  -41.416 1.00 40.00 ? 692 LEU A CA    1 
ATOM   5175  C  C     . LEU A 1 692 ? -2.016  39.039  -41.901 1.00 40.32 ? 692 LEU A C     1 
ATOM   5176  O  O     . LEU A 1 692 ? -1.041  38.282  -41.776 1.00 39.77 ? 692 LEU A O     1 
ATOM   5177  C  CB    . LEU A 1 692 ? -4.219  38.058  -42.588 1.00 40.65 ? 692 LEU A CB    1 
ATOM   5178  C  CG    . LEU A 1 692 ? -5.104  36.808  -42.480 1.00 41.03 ? 692 LEU A CG    1 
ATOM   5179  C  CD1   . LEU A 1 692 ? -5.327  36.329  -41.063 1.00 41.35 ? 692 LEU A CD1   1 
ATOM   5180  C  CD2   . LEU A 1 692 ? -6.445  36.997  -43.215 1.00 40.80 ? 692 LEU A CD2   1 
ATOM   5181  N  N     . LYS A 1 693 ? -1.936  40.248  -42.455 1.00 41.30 ? 693 LYS A N     1 
ATOM   5182  C  CA    . LYS A 1 693 ? -0.700  40.784  -43.018 1.00 42.08 ? 693 LYS A CA    1 
ATOM   5183  C  C     . LYS A 1 693 ? 0.282   41.137  -41.892 1.00 41.27 ? 693 LYS A C     1 
ATOM   5184  O  O     . LYS A 1 693 ? 1.478   40.865  -41.983 1.00 41.00 ? 693 LYS A O     1 
ATOM   5185  C  CB    . LYS A 1 693 ? -1.010  41.989  -43.912 1.00 43.22 ? 693 LYS A CB    1 
ATOM   5186  C  CG    . LYS A 1 693 ? 0.040   42.286  -44.973 1.00 45.68 ? 693 LYS A CG    1 
ATOM   5187  C  CD    . LYS A 1 693 ? 0.740   43.614  -44.710 1.00 49.58 ? 693 LYS A CD    1 
ATOM   5188  C  CE    . LYS A 1 693 ? 0.219   44.734  -45.621 1.00 52.29 ? 693 LYS A CE    1 
ATOM   5189  N  NZ    . LYS A 1 693 ? 0.639   46.114  -45.157 1.00 52.19 ? 693 LYS A NZ    1 
ATOM   5190  N  N     . MET A 1 694 ? -0.240  41.720  -40.819 1.00 40.73 ? 694 MET A N     1 
ATOM   5191  C  CA    . MET A 1 694 ? 0.571   42.008  -39.646 1.00 39.98 ? 694 MET A CA    1 
ATOM   5192  C  C     . MET A 1 694 ? 1.069   40.731  -38.972 1.00 39.19 ? 694 MET A C     1 
ATOM   5193  O  O     . MET A 1 694 ? 2.198   40.696  -38.472 1.00 39.07 ? 694 MET A O     1 
ATOM   5194  C  CB    . MET A 1 694 ? -0.201  42.888  -38.671 1.00 40.03 ? 694 MET A CB    1 
ATOM   5195  C  CG    . MET A 1 694 ? -0.331  44.330  -39.143 1.00 40.09 ? 694 MET A CG    1 
ATOM   5196  S  SD    . MET A 1 694 ? -1.511  45.269  -38.159 1.00 40.22 ? 694 MET A SD    1 
ATOM   5197  C  CE    . MET A 1 694 ? -0.559  45.547  -36.652 1.00 38.74 ? 694 MET A CE    1 
ATOM   5198  N  N     . ALA A 1 695 ? 0.234   39.688  -38.980 1.00 38.52 ? 695 ALA A N     1 
ATOM   5199  C  CA    . ALA A 1 695 ? 0.636   38.347  -38.537 1.00 37.76 ? 695 ALA A CA    1 
ATOM   5200  C  C     . ALA A 1 695 ? 1.764   37.787  -39.405 1.00 38.14 ? 695 ALA A C     1 
ATOM   5201  O  O     . ALA A 1 695 ? 2.718   37.200  -38.890 1.00 37.87 ? 695 ALA A O     1 
ATOM   5202  C  CB    . ALA A 1 695 ? -0.546  37.401  -38.548 1.00 37.20 ? 695 ALA A CB    1 
ATOM   5203  N  N     . ALA A 1 696 ? 1.642   37.964  -40.721 1.00 38.86 ? 696 ALA A N     1 
ATOM   5204  C  CA    . ALA A 1 696 ? 2.660   37.507  -41.660 1.00 39.31 ? 696 ALA A CA    1 
ATOM   5205  C  C     . ALA A 1 696 ? 3.996   38.222  -41.435 1.00 39.62 ? 696 ALA A C     1 
ATOM   5206  O  O     . ALA A 1 696 ? 5.053   37.591  -41.480 1.00 39.64 ? 696 ALA A O     1 
ATOM   5207  C  CB    . ALA A 1 696 ? 2.187   37.691  -43.091 1.00 39.95 ? 696 ALA A CB    1 
ATOM   5208  N  N     . GLU A 1 697 ? 3.937   39.526  -41.164 1.00 39.97 ? 697 GLU A N     1 
ATOM   5209  C  CA    . GLU A 1 697 ? 5.141   40.351  -41.051 1.00 40.59 ? 697 GLU A CA    1 
ATOM   5210  C  C     . GLU A 1 697 ? 5.946   40.084  -39.760 1.00 39.52 ? 697 GLU A C     1 
ATOM   5211  O  O     . GLU A 1 697 ? 7.180   39.988  -39.800 1.00 39.40 ? 697 GLU A O     1 
ATOM   5212  C  CB    . GLU A 1 697 ? 4.804   41.840  -41.256 1.00 40.83 ? 697 GLU A CB    1 
ATOM   5213  C  CG    . GLU A 1 697 ? 4.367   42.146  -42.689 1.00 42.53 ? 697 GLU A CG    1 
ATOM   5214  C  CD    . GLU A 1 697 ? 3.963   43.594  -42.943 1.00 44.44 ? 697 GLU A CD    1 
ATOM   5215  O  OE1   . GLU A 1 697 ? 3.575   44.319  -41.995 1.00 47.06 ? 697 GLU A OE1   1 
ATOM   5216  O  OE2   . GLU A 1 697 ? 4.019   44.011  -44.122 1.00 47.63 ? 697 GLU A OE2   1 
ATOM   5217  N  N     . ARG A 1 698 ? 5.244   39.946  -38.638 1.00 38.43 ? 698 ARG A N     1 
ATOM   5218  C  CA    . ARG A 1 698 ? 5.865   39.525  -37.378 1.00 37.81 ? 698 ARG A CA    1 
ATOM   5219  C  C     . ARG A 1 698 ? 6.218   38.045  -37.429 1.00 37.46 ? 698 ARG A C     1 
ATOM   5220  O  O     . ARG A 1 698 ? 7.106   37.594  -36.706 1.00 37.30 ? 698 ARG A O     1 
ATOM   5221  C  CB    . ARG A 1 698 ? 4.958   39.819  -36.162 1.00 37.32 ? 698 ARG A CB    1 
ATOM   5222  C  CG    . ARG A 1 698 ? 3.770   38.882  -35.977 1.00 36.08 ? 698 ARG A CG    1 
ATOM   5223  C  CD    . ARG A 1 698 ? 3.046   39.125  -34.637 1.00 36.26 ? 698 ARG A CD    1 
ATOM   5224  N  NE    . ARG A 1 698 ? 2.200   40.312  -34.701 1.00 35.46 ? 698 ARG A NE    1 
ATOM   5225  C  CZ    . ARG A 1 698 ? 0.915   40.303  -35.049 1.00 34.15 ? 698 ARG A CZ    1 
ATOM   5226  N  NH1   . ARG A 1 698 ? 0.302   39.165  -35.327 1.00 31.92 ? 698 ARG A NH1   1 
ATOM   5227  N  NH2   . ARG A 1 698 ? 0.234   41.439  -35.099 1.00 34.83 ? 698 ARG A NH2   1 
ATOM   5228  N  N     . GLY A 1 699 ? 5.529   37.306  -38.301 1.00 37.52 ? 699 GLY A N     1 
ATOM   5229  C  CA    . GLY A 1 699 ? 5.687   35.853  -38.424 1.00 37.06 ? 699 GLY A CA    1 
ATOM   5230  C  C     . GLY A 1 699 ? 7.037   35.430  -38.963 1.00 37.51 ? 699 GLY A C     1 
ATOM   5231  O  O     . GLY A 1 699 ? 7.485   34.312  -38.716 1.00 37.44 ? 699 GLY A O     1 
ATOM   5232  N  N     . ALA A 1 700 ? 7.683   36.326  -39.708 1.00 38.25 ? 700 ALA A N     1 
ATOM   5233  C  CA    . ALA A 1 700 ? 9.031   36.094  -40.248 1.00 38.46 ? 700 ALA A CA    1 
ATOM   5234  C  C     . ALA A 1 700 ? 10.073  36.057  -39.129 1.00 38.02 ? 700 ALA A C     1 
ATOM   5235  O  O     . ALA A 1 700 ? 11.211  35.632  -39.337 1.00 37.76 ? 700 ALA A O     1 
ATOM   5236  C  CB    . ALA A 1 700 ? 9.386   37.180  -41.278 1.00 39.10 ? 700 ALA A CB    1 
ATOM   5237  N  N     . PHE A 1 701 ? 9.668   36.510  -37.943 1.00 37.38 ? 701 PHE A N     1 
ATOM   5238  C  CA    . PHE A 1 701 ? 10.555  36.548  -36.772 1.00 37.38 ? 701 PHE A CA    1 
ATOM   5239  C  C     . PHE A 1 701 ? 9.969   35.666  -35.692 1.00 36.88 ? 701 PHE A C     1 
ATOM   5240  O  O     . PHE A 1 701 ? 10.411  35.675  -34.545 1.00 36.79 ? 701 PHE A O     1 
ATOM   5241  C  CB    . PHE A 1 701 ? 10.785  38.001  -36.318 1.00 37.07 ? 701 PHE A CB    1 
ATOM   5242  C  CG    . PHE A 1 701 ? 11.387  38.860  -37.409 1.00 38.18 ? 701 PHE A CG    1 
ATOM   5243  C  CD1   . PHE A 1 701 ? 10.569  39.486  -38.358 1.00 37.67 ? 701 PHE A CD1   1 
ATOM   5244  C  CD2   . PHE A 1 701 ? 12.768  38.980  -37.531 1.00 37.93 ? 701 PHE A CD2   1 
ATOM   5245  C  CE1   . PHE A 1 701 ? 11.116  40.234  -39.392 1.00 38.97 ? 701 PHE A CE1   1 
ATOM   5246  C  CE2   . PHE A 1 701 ? 13.333  39.729  -38.562 1.00 39.82 ? 701 PHE A CE2   1 
ATOM   5247  C  CZ    . PHE A 1 701 ? 12.503  40.361  -39.500 1.00 40.55 ? 701 PHE A CZ    1 
ATOM   5248  N  N     . ILE A 1 702 ? 8.964   34.887  -36.087 1.00 37.03 ? 702 ILE A N     1 
ATOM   5249  C  CA    . ILE A 1 702 ? 8.368   33.894  -35.195 1.00 36.85 ? 702 ILE A CA    1 
ATOM   5250  C  C     . ILE A 1 702 ? 8.777   32.490  -35.613 1.00 37.41 ? 702 ILE A C     1 
ATOM   5251  O  O     . ILE A 1 702 ? 8.536   32.044  -36.741 1.00 37.73 ? 702 ILE A O     1 
ATOM   5252  C  CB    . ILE A 1 702 ? 6.844   34.069  -35.039 1.00 36.17 ? 702 ILE A CB    1 
ATOM   5253  C  CG1   . ILE A 1 702 ? 6.564   35.360  -34.262 1.00 35.63 ? 702 ILE A CG1   1 
ATOM   5254  C  CG2   . ILE A 1 702 ? 6.227   32.863  -34.331 1.00 35.22 ? 702 ILE A CG2   1 
ATOM   5255  C  CD1   . ILE A 1 702 ? 5.129   35.872  -34.363 1.00 35.87 ? 702 ILE A CD1   1 
ATOM   5256  N  N     . ASP A 1 703 ? 9.423   31.833  -34.661 1.00 37.66 ? 703 ASP A N     1 
ATOM   5257  C  CA    . ASP A 1 703 ? 10.034  30.525  -34.792 1.00 38.66 ? 703 ASP A CA    1 
ATOM   5258  C  C     . ASP A 1 703 ? 9.026   29.419  -35.034 1.00 38.06 ? 703 ASP A C     1 
ATOM   5259  O  O     . ASP A 1 703 ? 9.265   28.507  -35.820 1.00 38.24 ? 703 ASP A O     1 
ATOM   5260  C  CB    . ASP A 1 703 ? 10.725  30.209  -33.461 1.00 39.04 ? 703 ASP A CB    1 
ATOM   5261  C  CG    . ASP A 1 703 ? 12.119  29.798  -33.650 1.00 42.23 ? 703 ASP A CG    1 
ATOM   5262  O  OD1   . ASP A 1 703 ? 12.430  29.286  -34.750 1.00 47.46 ? 703 ASP A OD1   1 
ATOM   5263  O  OD2   . ASP A 1 703 ? 12.918  30.015  -32.730 1.00 45.92 ? 703 ASP A OD2   1 
ATOM   5264  N  N     . GLN A 1 704 ? 7.924   29.480  -34.293 1.00 37.12 ? 704 GLN A N     1 
ATOM   5265  C  CA    . GLN A 1 704 ? 6.869   28.502  -34.408 1.00 36.68 ? 704 GLN A CA    1 
ATOM   5266  C  C     . GLN A 1 704 ? 5.718   29.180  -35.153 1.00 36.72 ? 704 GLN A C     1 
ATOM   5267  O  O     . GLN A 1 704 ? 5.925   29.678  -36.259 1.00 37.21 ? 704 GLN A O     1 
ATOM   5268  C  CB    . GLN A 1 704 ? 6.470   27.985  -33.022 1.00 36.03 ? 704 GLN A CB    1 
ATOM   5269  C  CG    . GLN A 1 704 ? 7.668   27.617  -32.156 1.00 35.35 ? 704 GLN A CG    1 
ATOM   5270  C  CD    . GLN A 1 704 ? 7.452   26.375  -31.320 1.00 35.27 ? 704 GLN A CD    1 
ATOM   5271  O  OE1   . GLN A 1 704 ? 6.760   25.438  -31.735 1.00 34.81 ? 704 GLN A OE1   1 
ATOM   5272  N  NE2   . GLN A 1 704 ? 8.056   26.352  -30.131 1.00 35.30 ? 704 GLN A NE2   1 
ATOM   5273  N  N     . SER A 1 705 ? 4.528   29.218  -34.555 1.00 35.95 ? 705 SER A N     1 
ATOM   5274  C  CA    . SER A 1 705 ? 3.392   29.917  -35.145 1.00 35.71 ? 705 SER A CA    1 
ATOM   5275  C  C     . SER A 1 705 ? 2.759   30.850  -34.109 1.00 35.39 ? 705 SER A C     1 
ATOM   5276  O  O     . SER A 1 705 ? 3.372   31.149  -33.089 1.00 34.92 ? 705 SER A O     1 
ATOM   5277  C  CB    . SER A 1 705 ? 2.371   28.910  -35.683 1.00 35.89 ? 705 SER A CB    1 
ATOM   5278  O  OG    . SER A 1 705 ? 1.454   29.550  -36.546 1.00 36.19 ? 705 SER A OG    1 
ATOM   5279  N  N     . GLN A 1 706 ? 1.544   31.318  -34.382 1.00 35.70 ? 706 GLN A N     1 
ATOM   5280  C  CA    . GLN A 1 706 ? 0.825   32.213  -33.472 1.00 36.07 ? 706 GLN A CA    1 
ATOM   5281  C  C     . GLN A 1 706 ? -0.655  31.906  -33.472 1.00 36.10 ? 706 GLN A C     1 
ATOM   5282  O  O     . GLN A 1 706 ? -1.222  31.586  -34.516 1.00 35.98 ? 706 GLN A O     1 
ATOM   5283  C  CB    . GLN A 1 706 ? 1.072   33.696  -33.808 1.00 35.83 ? 706 GLN A CB    1 
ATOM   5284  C  CG    . GLN A 1 706 ? 1.032   34.028  -35.276 1.00 37.32 ? 706 GLN A CG    1 
ATOM   5285  C  CD    . GLN A 1 706 ? 1.503   35.439  -35.606 1.00 37.68 ? 706 GLN A CD    1 
ATOM   5286  O  OE1   . GLN A 1 706 ? 1.106   36.403  -34.955 1.00 38.76 ? 706 GLN A OE1   1 
ATOM   5287  N  NE2   . GLN A 1 706 ? 2.335   35.563  -36.645 1.00 36.73 ? 706 GLN A NE2   1 
ATOM   5288  N  N     . SER A 1 707 ? -1.269  31.992  -32.290 1.00 36.53 ? 707 SER A N     1 
ATOM   5289  C  CA    . SER A 1 707 ? -2.699  31.711  -32.124 1.00 37.12 ? 707 SER A CA    1 
ATOM   5290  C  C     . SER A 1 707 ? -3.488  32.867  -32.699 1.00 37.79 ? 707 SER A C     1 
ATOM   5291  O  O     . SER A 1 707 ? -3.580  33.924  -32.081 1.00 38.87 ? 707 SER A O     1 
ATOM   5292  C  CB    . SER A 1 707 ? -3.053  31.523  -30.646 1.00 37.06 ? 707 SER A CB    1 
ATOM   5293  O  OG    . SER A 1 707 ? -2.230  30.542  -30.044 1.00 36.30 ? 707 SER A OG    1 
ATOM   5294  N  N     . LEU A 1 708 ? -4.056  32.669  -33.881 1.00 38.09 ? 708 LEU A N     1 
ATOM   5295  C  CA    . LEU A 1 708 ? -4.620  33.773  -34.650 1.00 38.36 ? 708 LEU A CA    1 
ATOM   5296  C  C     . LEU A 1 708 ? -6.120  33.593  -34.892 1.00 38.66 ? 708 LEU A C     1 
ATOM   5297  O  O     . LEU A 1 708 ? -6.533  32.763  -35.703 1.00 38.55 ? 708 LEU A O     1 
ATOM   5298  C  CB    . LEU A 1 708 ? -3.902  33.861  -35.996 1.00 38.66 ? 708 LEU A CB    1 
ATOM   5299  C  CG    . LEU A 1 708 ? -3.535  35.204  -36.648 1.00 40.16 ? 708 LEU A CG    1 
ATOM   5300  C  CD1   . LEU A 1 708 ? -3.790  35.103  -38.160 1.00 40.11 ? 708 LEU A CD1   1 
ATOM   5301  C  CD2   . LEU A 1 708 ? -4.248  36.418  -36.052 1.00 39.39 ? 708 LEU A CD2   1 
ATOM   5302  N  N     . ASN A 1 709 ? -6.933  34.379  -34.197 1.00 38.80 ? 709 ASN A N     1 
ATOM   5303  C  CA    . ASN A 1 709 ? -8.373  34.356  -34.407 1.00 39.25 ? 709 ASN A CA    1 
ATOM   5304  C  C     . ASN A 1 709 ? -8.784  35.292  -35.514 1.00 39.81 ? 709 ASN A C     1 
ATOM   5305  O  O     . ASN A 1 709 ? -8.205  36.374  -35.660 1.00 39.82 ? 709 ASN A O     1 
ATOM   5306  C  CB    . ASN A 1 709 ? -9.117  34.733  -33.126 1.00 39.43 ? 709 ASN A CB    1 
ATOM   5307  C  CG    . ASN A 1 709 ? -8.931  33.711  -32.023 1.00 39.48 ? 709 ASN A CG    1 
ATOM   5308  O  OD1   . ASN A 1 709 ? -9.067  32.508  -32.248 1.00 40.83 ? 709 ASN A OD1   1 
ATOM   5309  N  ND2   . ASN A 1 709 ? -8.623  34.184  -30.824 1.00 37.67 ? 709 ASN A ND2   1 
ATOM   5310  N  N     . ILE A 1 710 ? -9.782  34.866  -36.291 1.00 40.64 ? 710 ILE A N     1 
ATOM   5311  C  CA    . ILE A 1 710 ? -10.426 35.711  -37.302 1.00 41.42 ? 710 ILE A CA    1 
ATOM   5312  C  C     . ILE A 1 710 ? -11.817 36.151  -36.839 1.00 42.10 ? 710 ILE A C     1 
ATOM   5313  O  O     . ILE A 1 710 ? -12.591 35.353  -36.308 1.00 41.66 ? 710 ILE A O     1 
ATOM   5314  C  CB    . ILE A 1 710 ? -10.500 35.005  -38.676 1.00 42.01 ? 710 ILE A CB    1 
ATOM   5315  C  CG1   . ILE A 1 710 ? -9.093  34.682  -39.201 1.00 42.61 ? 710 ILE A CG1   1 
ATOM   5316  C  CG2   . ILE A 1 710 ? -11.293 35.828  -39.700 1.00 42.74 ? 710 ILE A CG2   1 
ATOM   5317  C  CD1   . ILE A 1 710 ? -8.050  35.796  -38.993 1.00 45.21 ? 710 ILE A CD1   1 
ATOM   5318  N  N     . HIS A 1 711 ? -12.119 37.432  -37.055 1.00 42.93 ? 711 HIS A N     1 
ATOM   5319  C  CA    . HIS A 1 711 ? -13.342 38.044  -36.569 1.00 43.82 ? 711 HIS A CA    1 
ATOM   5320  C  C     . HIS A 1 711 ? -14.105 38.662  -37.719 1.00 45.55 ? 711 HIS A C     1 
ATOM   5321  O  O     . HIS A 1 711 ? -13.713 39.720  -38.206 1.00 45.93 ? 711 HIS A O     1 
ATOM   5322  C  CB    . HIS A 1 711 ? -13.010 39.156  -35.582 1.00 43.13 ? 711 HIS A CB    1 
ATOM   5323  C  CG    . HIS A 1 711 ? -12.549 38.677  -34.243 1.00 42.01 ? 711 HIS A CG    1 
ATOM   5324  N  ND1   . HIS A 1 711 ? -11.220 38.441  -33.952 1.00 39.14 ? 711 HIS A ND1   1 
ATOM   5325  C  CD2   . HIS A 1 711 ? -13.235 38.432  -33.100 1.00 41.19 ? 711 HIS A CD2   1 
ATOM   5326  C  CE1   . HIS A 1 711 ? -11.111 38.058  -32.693 1.00 38.30 ? 711 HIS A CE1   1 
ATOM   5327  N  NE2   . HIS A 1 711 ? -12.317 38.046  -32.152 1.00 39.02 ? 711 HIS A NE2   1 
ATOM   5328  N  N     . ILE A 1 712 ? -15.191 38.019  -38.144 1.00 46.90 ? 712 ILE A N     1 
ATOM   5329  C  CA    . ILE A 1 712 ? -16.029 38.556  -39.218 1.00 49.23 ? 712 ILE A CA    1 
ATOM   5330  C  C     . ILE A 1 712 ? -17.467 38.684  -38.724 1.00 51.30 ? 712 ILE A C     1 
ATOM   5331  O  O     . ILE A 1 712 ? -18.126 37.679  -38.442 1.00 51.66 ? 712 ILE A O     1 
ATOM   5332  C  CB    . ILE A 1 712 ? -15.990 37.689  -40.502 1.00 49.39 ? 712 ILE A CB    1 
ATOM   5333  C  CG1   . ILE A 1 712 ? -14.555 37.548  -41.024 1.00 47.79 ? 712 ILE A CG1   1 
ATOM   5334  C  CG2   . ILE A 1 712 ? -16.875 38.311  -41.583 1.00 50.77 ? 712 ILE A CG2   1 
ATOM   5335  C  CD1   . ILE A 1 712 ? -14.359 36.409  -41.997 1.00 46.31 ? 712 ILE A CD1   1 
ATOM   5336  N  N     . ALA A 1 713 ? -17.937 39.925  -38.619 1.00 53.17 ? 713 ALA A N     1 
ATOM   5337  C  CA    . ALA A 1 713 ? -19.237 40.225  -38.018 1.00 55.36 ? 713 ALA A CA    1 
ATOM   5338  C  C     . ALA A 1 713 ? -20.403 39.645  -38.818 1.00 57.39 ? 713 ALA A C     1 
ATOM   5339  O  O     . ALA A 1 713 ? -21.154 38.814  -38.299 1.00 57.73 ? 713 ALA A O     1 
ATOM   5340  C  CB    . ALA A 1 713 ? -19.403 41.735  -37.827 1.00 56.04 ? 713 ALA A CB    1 
ATOM   5341  N  N     . GLU A 1 714 ? -20.543 40.082  -40.072 1.00 59.17 ? 714 GLU A N     1 
ATOM   5342  C  CA    . GLU A 1 714 ? -21.578 39.560  -40.976 1.00 61.32 ? 714 GLU A CA    1 
ATOM   5343  C  C     . GLU A 1 714 ? -20.926 38.666  -42.036 1.00 61.53 ? 714 GLU A C     1 
ATOM   5344  O  O     . GLU A 1 714 ? -20.515 39.150  -43.106 1.00 61.98 ? 714 GLU A O     1 
ATOM   5345  C  CB    . GLU A 1 714 ? -22.382 40.704  -41.619 1.00 62.79 ? 714 GLU A CB    1 
ATOM   5346  N  N     . PRO A 1 715 ? -20.834 37.352  -41.737 1.00 61.25 ? 715 PRO A N     1 
ATOM   5347  C  CA    . PRO A 1 715 ? -19.991 36.429  -42.487 1.00 60.89 ? 715 PRO A CA    1 
ATOM   5348  C  C     . PRO A 1 715 ? -20.714 35.771  -43.658 1.00 62.06 ? 715 PRO A C     1 
ATOM   5349  O  O     . PRO A 1 715 ? -21.626 34.960  -43.461 1.00 62.97 ? 715 PRO A O     1 
ATOM   5350  C  CB    . PRO A 1 715 ? -19.635 35.377  -41.442 1.00 59.92 ? 715 PRO A CB    1 
ATOM   5351  C  CG    . PRO A 1 715 ? -20.878 35.310  -40.571 1.00 60.76 ? 715 PRO A CG    1 
ATOM   5352  C  CD    . PRO A 1 715 ? -21.566 36.658  -40.658 1.00 61.34 ? 715 PRO A CD    1 
ATOM   5353  N  N     . ASN A 1 716 ? -20.321 36.136  -44.868 1.00 62.09 ? 716 ASN A N     1 
ATOM   5354  C  CA    . ASN A 1 716 ? -20.747 35.378  -46.020 1.00 62.83 ? 716 ASN A CA    1 
ATOM   5355  C  C     . ASN A 1 716 ? -19.615 34.403  -46.336 1.00 61.30 ? 716 ASN A C     1 
ATOM   5356  O  O     . ASN A 1 716 ? -18.493 34.584  -45.844 1.00 59.96 ? 716 ASN A O     1 
ATOM   5357  C  CB    . ASN A 1 716 ? -21.164 36.298  -47.187 1.00 64.38 ? 716 ASN A CB    1 
ATOM   5358  C  CG    . ASN A 1 716 ? -20.096 36.443  -48.252 1.00 64.97 ? 716 ASN A CG    1 
ATOM   5359  O  OD1   . ASN A 1 716 ? -19.030 36.994  -48.004 1.00 63.85 ? 716 ASN A OD1   1 
ATOM   5360  N  ND2   . ASN A 1 716 ? -20.394 35.960  -49.463 1.00 67.90 ? 716 ASN A ND2   1 
ATOM   5361  N  N     . TYR A 1 717 ? -19.899 33.360  -47.114 1.00 61.12 ? 717 TYR A N     1 
ATOM   5362  C  CA    . TYR A 1 717 ? -18.880 32.337  -47.381 1.00 59.55 ? 717 TYR A CA    1 
ATOM   5363  C  C     . TYR A 1 717 ? -17.728 32.875  -48.238 1.00 58.55 ? 717 TYR A C     1 
ATOM   5364  O  O     . TYR A 1 717 ? -16.576 32.449  -48.081 1.00 57.34 ? 717 TYR A O     1 
ATOM   5365  C  CB    . TYR A 1 717 ? -19.491 31.054  -47.968 1.00 60.37 ? 717 TYR A CB    1 
ATOM   5366  C  CG    . TYR A 1 717 ? -20.452 30.321  -47.032 1.00 60.63 ? 717 TYR A CG    1 
ATOM   5367  C  CD1   . TYR A 1 717 ? -20.453 30.558  -45.649 1.00 60.13 ? 717 TYR A CD1   1 
ATOM   5368  C  CD2   . TYR A 1 717 ? -21.336 29.367  -47.527 1.00 61.99 ? 717 TYR A CD2   1 
ATOM   5369  C  CE1   . TYR A 1 717 ? -21.326 29.880  -44.800 1.00 60.65 ? 717 TYR A CE1   1 
ATOM   5370  C  CE2   . TYR A 1 717 ? -22.214 28.682  -46.687 1.00 63.05 ? 717 TYR A CE2   1 
ATOM   5371  C  CZ    . TYR A 1 717 ? -22.207 28.944  -45.326 1.00 62.02 ? 717 TYR A CZ    1 
ATOM   5372  O  OH    . TYR A 1 717 ? -23.083 28.267  -44.500 1.00 62.09 ? 717 TYR A OH    1 
ATOM   5373  N  N     . GLY A 1 718 ? -18.045 33.829  -49.111 1.00 58.58 ? 718 GLY A N     1 
ATOM   5374  C  CA    . GLY A 1 718 ? -17.044 34.502  -49.939 1.00 57.57 ? 718 GLY A CA    1 
ATOM   5375  C  C     . GLY A 1 718 ? -16.020 35.293  -49.146 1.00 55.57 ? 718 GLY A C     1 
ATOM   5376  O  O     . GLY A 1 718 ? -14.837 35.283  -49.474 1.00 54.90 ? 718 GLY A O     1 
ATOM   5377  N  N     . LYS A 1 719 ? -16.478 35.979  -48.100 1.00 54.58 ? 719 LYS A N     1 
ATOM   5378  C  CA    . LYS A 1 719 ? -15.600 36.784  -47.258 1.00 52.97 ? 719 LYS A CA    1 
ATOM   5379  C  C     . LYS A 1 719 ? -14.598 35.897  -46.514 1.00 51.25 ? 719 LYS A C     1 
ATOM   5380  O  O     . LYS A 1 719 ? -13.409 36.216  -46.446 1.00 50.37 ? 719 LYS A O     1 
ATOM   5381  C  CB    . LYS A 1 719 ? -16.413 37.635  -46.280 1.00 52.93 ? 719 LYS A CB    1 
ATOM   5382  N  N     . LEU A 1 720 ? -15.090 34.772  -45.994 1.00 50.43 ? 720 LEU A N     1 
ATOM   5383  C  CA    . LEU A 1 720 ? -14.281 33.810  -45.260 1.00 48.89 ? 720 LEU A CA    1 
ATOM   5384  C  C     . LEU A 1 720 ? -13.266 33.109  -46.162 1.00 48.04 ? 720 LEU A C     1 
ATOM   5385  O  O     . LEU A 1 720 ? -12.099 32.918  -45.782 1.00 47.11 ? 720 LEU A O     1 
ATOM   5386  C  CB    . LEU A 1 720 ? -15.185 32.773  -44.609 1.00 49.04 ? 720 LEU A CB    1 
ATOM   5387  C  CG    . LEU A 1 720 ? -14.964 32.392  -43.148 1.00 49.26 ? 720 LEU A CG    1 
ATOM   5388  C  CD1   . LEU A 1 720 ? -15.617 31.038  -42.936 1.00 51.77 ? 720 LEU A CD1   1 
ATOM   5389  C  CD2   . LEU A 1 720 ? -13.494 32.350  -42.723 1.00 47.84 ? 720 LEU A CD2   1 
ATOM   5390  N  N     . THR A 1 721 ? -13.725 32.735  -47.352 1.00 48.26 ? 721 THR A N     1 
ATOM   5391  C  CA    . THR A 1 721 ? -12.906 32.079  -48.360 1.00 47.76 ? 721 THR A CA    1 
ATOM   5392  C  C     . THR A 1 721 ? -11.739 32.957  -48.758 1.00 47.31 ? 721 THR A C     1 
ATOM   5393  O  O     . THR A 1 721 ? -10.613 32.474  -48.890 1.00 46.92 ? 721 THR A O     1 
ATOM   5394  C  CB    . THR A 1 721 ? -13.744 31.704  -49.600 1.00 49.09 ? 721 THR A CB    1 
ATOM   5395  O  OG1   . THR A 1 721 ? -14.679 30.686  -49.230 1.00 49.70 ? 721 THR A OG1   1 
ATOM   5396  C  CG2   . THR A 1 721 ? -12.873 31.192  -50.750 1.00 48.36 ? 721 THR A CG2   1 
ATOM   5397  N  N     . SER A 1 722 ? -12.001 34.249  -48.928 1.00 47.38 ? 722 SER A N     1 
ATOM   5398  C  CA    . SER A 1 722 ? -10.946 35.166  -49.321 1.00 47.05 ? 722 SER A CA    1 
ATOM   5399  C  C     . SER A 1 722 ? -10.000 35.482  -48.164 1.00 45.23 ? 722 SER A C     1 
ATOM   5400  O  O     . SER A 1 722 ? -8.865  35.886  -48.408 1.00 45.21 ? 722 SER A O     1 
ATOM   5401  C  CB    . SER A 1 722 ? -11.516 36.435  -49.954 1.00 48.29 ? 722 SER A CB    1 
ATOM   5402  O  OG    . SER A 1 722 ? -12.043 37.293  -48.970 1.00 50.08 ? 722 SER A OG    1 
ATOM   5403  N  N     . MET A 1 723 ? -10.452 35.288  -46.920 1.00 43.81 ? 723 MET A N     1 
ATOM   5404  C  CA    . MET A 1 723 ? -9.566  35.436  -45.753 1.00 42.22 ? 723 MET A CA    1 
ATOM   5405  C  C     . MET A 1 723 ? -8.618  34.233  -45.557 1.00 41.20 ? 723 MET A C     1 
ATOM   5406  O  O     . MET A 1 723 ? -7.425  34.425  -45.304 1.00 40.60 ? 723 MET A O     1 
ATOM   5407  C  CB    . MET A 1 723 ? -10.396 35.653  -44.497 1.00 18.96 ? 723 MET A CB    1 
ATOM   5408  N  N     . HIS A 1 724 ? -9.138  33.005  -45.686 1.00 40.88 ? 724 HIS A N     1 
ATOM   5409  C  CA    . HIS A 1 724 ? -8.292  31.798  -45.704 1.00 39.80 ? 724 HIS A CA    1 
ATOM   5410  C  C     . HIS A 1 724 ? -7.227  31.864  -46.799 1.00 39.92 ? 724 HIS A C     1 
ATOM   5411  O  O     . HIS A 1 724 ? -6.055  31.635  -46.536 1.00 38.67 ? 724 HIS A O     1 
ATOM   5412  C  CB    . HIS A 1 724 ? -9.109  30.521  -45.913 1.00 40.10 ? 724 HIS A CB    1 
ATOM   5413  C  CG    . HIS A 1 724 ? -9.969  30.140  -44.752 1.00 39.55 ? 724 HIS A CG    1 
ATOM   5414  N  ND1   . HIS A 1 724 ? -9.522  30.162  -43.448 1.00 37.31 ? 724 HIS A ND1   1 
ATOM   5415  C  CD2   . HIS A 1 724 ? -11.249 29.699  -44.704 1.00 40.18 ? 724 HIS A CD2   1 
ATOM   5416  C  CE1   . HIS A 1 724 ? -10.495 29.771  -42.646 1.00 38.02 ? 724 HIS A CE1   1 
ATOM   5417  N  NE2   . HIS A 1 724 ? -11.552 29.475  -43.384 1.00 40.27 ? 724 HIS A NE2   1 
ATOM   5418  N  N     . PHE A 1 725 ? -7.643  32.183  -48.023 1.00 40.95 ? 725 PHE A N     1 
ATOM   5419  C  CA    . PHE A 1 725 ? -6.708  32.245  -49.152 1.00 41.69 ? 725 PHE A CA    1 
ATOM   5420  C  C     . PHE A 1 725 ? -5.677  33.373  -49.059 1.00 41.77 ? 725 PHE A C     1 
ATOM   5421  O  O     . PHE A 1 725 ? -4.517  33.192  -49.442 1.00 41.94 ? 725 PHE A O     1 
ATOM   5422  C  CB    . PHE A 1 725 ? -7.446  32.220  -50.500 1.00 42.69 ? 725 PHE A CB    1 
ATOM   5423  C  CG    . PHE A 1 725 ? -7.771  30.829  -50.960 1.00 42.88 ? 725 PHE A CG    1 
ATOM   5424  C  CD1   . PHE A 1 725 ? -8.940  30.201  -50.547 1.00 42.91 ? 725 PHE A CD1   1 
ATOM   5425  C  CD2   . PHE A 1 725 ? -6.875  30.121  -51.763 1.00 42.33 ? 725 PHE A CD2   1 
ATOM   5426  C  CE1   . PHE A 1 725 ? -9.226  28.888  -50.944 1.00 43.45 ? 725 PHE A CE1   1 
ATOM   5427  C  CE2   . PHE A 1 725 ? -7.148  28.820  -52.165 1.00 42.84 ? 725 PHE A CE2   1 
ATOM   5428  C  CZ    . PHE A 1 725 ? -8.325  28.199  -51.757 1.00 43.19 ? 725 PHE A CZ    1 
ATOM   5429  N  N     . TYR A 1 726 ? -6.080  34.520  -48.523 1.00 41.89 ? 726 TYR A N     1 
ATOM   5430  C  CA    . TYR A 1 726 ? -5.131  35.606  -48.305 1.00 41.83 ? 726 TYR A CA    1 
ATOM   5431  C  C     . TYR A 1 726 ? -4.071  35.211  -47.262 1.00 40.90 ? 726 TYR A C     1 
ATOM   5432  O  O     . TYR A 1 726 ? -2.872  35.392  -47.492 1.00 41.07 ? 726 TYR A O     1 
ATOM   5433  C  CB    . TYR A 1 726 ? -5.865  36.885  -47.905 1.00 42.27 ? 726 TYR A CB    1 
ATOM   5434  C  CG    . TYR A 1 726 ? -4.965  38.081  -47.704 1.00 42.06 ? 726 TYR A CG    1 
ATOM   5435  C  CD1   . TYR A 1 726 ? -4.593  38.888  -48.784 1.00 42.93 ? 726 TYR A CD1   1 
ATOM   5436  C  CD2   . TYR A 1 726 ? -4.487  38.410  -46.430 1.00 40.96 ? 726 TYR A CD2   1 
ATOM   5437  C  CE1   . TYR A 1 726 ? -3.756  39.998  -48.604 1.00 43.47 ? 726 TYR A CE1   1 
ATOM   5438  C  CE2   . TYR A 1 726 ? -3.654  39.512  -46.235 1.00 41.70 ? 726 TYR A CE2   1 
ATOM   5439  C  CZ    . TYR A 1 726 ? -3.295  40.301  -47.324 1.00 43.05 ? 726 TYR A CZ    1 
ATOM   5440  O  OH    . TYR A 1 726 ? -2.477  41.389  -47.132 1.00 43.67 ? 726 TYR A OH    1 
ATOM   5441  N  N     . GLY A 1 727 ? -4.521  34.659  -46.133 1.00 40.11 ? 727 GLY A N     1 
ATOM   5442  C  CA    . GLY A 1 727 ? -3.624  34.194  -45.070 1.00 39.28 ? 727 GLY A CA    1 
ATOM   5443  C  C     . GLY A 1 727 ? -2.694  33.081  -45.526 1.00 39.35 ? 727 GLY A C     1 
ATOM   5444  O  O     . GLY A 1 727 ? -1.507  33.062  -45.165 1.00 38.78 ? 727 GLY A O     1 
ATOM   5445  N  N     . TRP A 1 728 ? -3.237  32.162  -46.327 1.00 39.67 ? 728 TRP A N     1 
ATOM   5446  C  CA    . TRP A 1 728 ? -2.457  31.091  -46.936 1.00 40.02 ? 728 TRP A CA    1 
ATOM   5447  C  C     . TRP A 1 728 ? -1.338  31.653  -47.828 1.00 40.83 ? 728 TRP A C     1 
ATOM   5448  O  O     . TRP A 1 728 ? -0.165  31.303  -47.672 1.00 40.44 ? 728 TRP A O     1 
ATOM   5449  C  CB    . TRP A 1 728 ? -3.366  30.128  -47.728 1.00 40.18 ? 728 TRP A CB    1 
ATOM   5450  C  CG    . TRP A 1 728 ? -2.597  29.117  -48.547 1.00 40.53 ? 728 TRP A CG    1 
ATOM   5451  C  CD1   . TRP A 1 728 ? -1.697  28.191  -48.077 1.00 39.31 ? 728 TRP A CD1   1 
ATOM   5452  C  CD2   . TRP A 1 728 ? -2.644  28.942  -49.968 1.00 41.00 ? 728 TRP A CD2   1 
ATOM   5453  N  NE1   . TRP A 1 728 ? -1.195  27.454  -49.115 1.00 40.15 ? 728 TRP A NE1   1 
ATOM   5454  C  CE2   . TRP A 1 728 ? -1.754  27.891  -50.288 1.00 41.05 ? 728 TRP A CE2   1 
ATOM   5455  C  CE3   . TRP A 1 728 ? -3.365  29.558  -51.005 1.00 42.41 ? 728 TRP A CE3   1 
ATOM   5456  C  CZ2   . TRP A 1 728 ? -1.559  27.446  -51.600 1.00 41.86 ? 728 TRP A CZ2   1 
ATOM   5457  C  CZ3   . TRP A 1 728 ? -3.167  29.114  -52.314 1.00 42.44 ? 728 TRP A CZ3   1 
ATOM   5458  C  CH2   . TRP A 1 728 ? -2.272  28.072  -52.597 1.00 42.33 ? 728 TRP A CH2   1 
ATOM   5459  N  N     . LYS A 1 729 ? -1.714  32.534  -48.751 1.00 42.01 ? 729 LYS A N     1 
ATOM   5460  C  CA    . LYS A 1 729 ? -0.775  33.142  -49.684 1.00 42.73 ? 729 LYS A CA    1 
ATOM   5461  C  C     . LYS A 1 729 ? 0.259   34.042  -49.004 1.00 42.31 ? 729 LYS A C     1 
ATOM   5462  O  O     . LYS A 1 729 ? 1.360   34.212  -49.526 1.00 42.53 ? 729 LYS A O     1 
ATOM   5463  C  CB    . LYS A 1 729 ? -1.530  33.908  -50.766 1.00 43.91 ? 729 LYS A CB    1 
ATOM   5464  C  CG    . LYS A 1 729 ? -2.037  33.025  -51.900 1.00 45.83 ? 729 LYS A CG    1 
ATOM   5465  C  CD    . LYS A 1 729 ? -3.212  33.672  -52.615 1.00 48.08 ? 729 LYS A CD    1 
ATOM   5466  C  CE    . LYS A 1 729 ? -3.226  33.346  -54.099 1.00 51.32 ? 729 LYS A CE    1 
ATOM   5467  N  NZ    . LYS A 1 729 ? -2.983  31.899  -54.383 1.00 52.96 ? 729 LYS A NZ    1 
ATOM   5468  N  N     . GLN A 1 730 ? -0.094  34.611  -47.850 1.00 41.50 ? 730 GLN A N     1 
ATOM   5469  C  CA    . GLN A 1 730 ? 0.849   35.404  -47.038 1.00 41.31 ? 730 GLN A CA    1 
ATOM   5470  C  C     . GLN A 1 730 ? 1.966   34.581  -46.379 1.00 40.39 ? 730 GLN A C     1 
ATOM   5471  O  O     . GLN A 1 730 ? 2.925   35.150  -45.852 1.00 39.84 ? 730 GLN A O     1 
ATOM   5472  C  CB    . GLN A 1 730 ? 0.108   36.185  -45.947 1.00 41.17 ? 730 GLN A CB    1 
ATOM   5473  C  CG    . GLN A 1 730 ? -0.693  37.358  -46.455 1.00 43.01 ? 730 GLN A CG    1 
ATOM   5474  C  CD    . GLN A 1 730 ? 0.183   38.463  -46.966 1.00 44.94 ? 730 GLN A CD    1 
ATOM   5475  O  OE1   . GLN A 1 730 ? 0.121   38.824  -48.136 1.00 46.43 ? 730 GLN A OE1   1 
ATOM   5476  N  NE2   . GLN A 1 730 ? 1.012   39.010  -46.091 1.00 45.77 ? 730 GLN A NE2   1 
ATOM   5477  N  N     . GLY A 1 731 ? 1.822   33.254  -46.395 1.00 39.94 ? 731 GLY A N     1 
ATOM   5478  C  CA    . GLY A 1 731 ? 2.846   32.344  -45.887 1.00 39.15 ? 731 GLY A CA    1 
ATOM   5479  C  C     . GLY A 1 731 ? 2.625   31.921  -44.452 1.00 38.17 ? 731 GLY A C     1 
ATOM   5480  O  O     . GLY A 1 731 ? 3.519   31.347  -43.816 1.00 37.88 ? 731 GLY A O     1 
ATOM   5481  N  N     . LEU A 1 732 ? 1.425   32.200  -43.945 1.00 37.82 ? 732 LEU A N     1 
ATOM   5482  C  CA    . LEU A 1 732 ? 1.060   31.911  -42.560 1.00 36.37 ? 732 LEU A CA    1 
ATOM   5483  C  C     . LEU A 1 732 ? 1.019   30.421  -42.270 1.00 35.86 ? 732 LEU A C     1 
ATOM   5484  O  O     . LEU A 1 732 ? 0.462   29.644  -43.055 1.00 36.28 ? 732 LEU A O     1 
ATOM   5485  C  CB    . LEU A 1 732 ? -0.291  32.540  -42.219 1.00 36.57 ? 732 LEU A CB    1 
ATOM   5486  C  CG    . LEU A 1 732 ? -0.367  34.042  -41.929 1.00 36.52 ? 732 LEU A CG    1 
ATOM   5487  C  CD1   . LEU A 1 732 ? -1.775  34.361  -41.504 1.00 34.96 ? 732 LEU A CD1   1 
ATOM   5488  C  CD2   . LEU A 1 732 ? 0.617   34.456  -40.826 1.00 36.51 ? 732 LEU A CD2   1 
ATOM   5489  N  N     . LYS A 1 733 ? 1.627   30.040  -41.145 1.00 34.91 ? 733 LYS A N     1 
ATOM   5490  C  CA    . LYS A 1 733 ? 1.608   28.659  -40.649 1.00 34.20 ? 733 LYS A CA    1 
ATOM   5491  C  C     . LYS A 1 733 ? 0.243   28.286  -40.083 1.00 33.86 ? 733 LYS A C     1 
ATOM   5492  O  O     . LYS A 1 733 ? -0.298  27.228  -40.399 1.00 33.78 ? 733 LYS A O     1 
ATOM   5493  C  CB    . LYS A 1 733 ? 2.700   28.453  -39.599 1.00 33.71 ? 733 LYS A CB    1 
ATOM   5494  C  CG    . LYS A 1 733 ? 4.112   28.636  -40.158 1.00 33.17 ? 733 LYS A CG    1 
ATOM   5495  C  CD    . LYS A 1 733 ? 5.150   28.481  -39.085 1.00 31.20 ? 733 LYS A CD    1 
ATOM   5496  C  CE    . LYS A 1 733 ? 6.500   28.965  -39.572 1.00 31.42 ? 733 LYS A CE    1 
ATOM   5497  N  NZ    . LYS A 1 733 ? 7.531   28.913  -38.493 1.00 28.70 ? 733 LYS A NZ    1 
ATOM   5498  N  N     . THR A 1 734 ? -0.299  29.164  -39.239 1.00 33.77 ? 734 THR A N     1 
ATOM   5499  C  CA    . THR A 1 734 ? -1.683  29.068  -38.774 1.00 33.69 ? 734 THR A CA    1 
ATOM   5500  C  C     . THR A 1 734 ? -2.508  30.128  -39.479 1.00 34.26 ? 734 THR A C     1 
ATOM   5501  O  O     . THR A 1 734 ? -2.360  31.313  -39.196 1.00 33.74 ? 734 THR A O     1 
ATOM   5502  C  CB    . THR A 1 734 ? -1.805  29.320  -37.273 1.00 33.13 ? 734 THR A CB    1 
ATOM   5503  O  OG1   . THR A 1 734 ? -0.903  28.468  -36.568 1.00 31.96 ? 734 THR A OG1   1 
ATOM   5504  C  CG2   . THR A 1 734 ? -3.262  29.062  -36.792 1.00 33.37 ? 734 THR A CG2   1 
ATOM   5505  N  N     . GLY A 1 735 ? -3.360  29.699  -40.405 1.00 34.95 ? 735 GLY A N     1 
ATOM   5506  C  CA    . GLY A 1 735 ? -4.247  30.613  -41.110 1.00 35.64 ? 735 GLY A CA    1 
ATOM   5507  C  C     . GLY A 1 735 ? -5.376  31.090  -40.217 1.00 36.35 ? 735 GLY A C     1 
ATOM   5508  O  O     . GLY A 1 735 ? -5.830  32.231  -40.326 1.00 36.82 ? 735 GLY A O     1 
ATOM   5509  N  N     . MET A 1 736 ? -5.829  30.217  -39.321 1.00 36.54 ? 736 MET A N     1 
ATOM   5510  C  CA    . MET A 1 736 ? -6.901  30.553  -38.401 1.00 37.04 ? 736 MET A CA    1 
ATOM   5511  C  C     . MET A 1 736 ? -6.930  29.615  -37.198 1.00 37.07 ? 736 MET A C     1 
ATOM   5512  O  O     . MET A 1 736 ? -6.891  28.391  -37.357 1.00 37.24 ? 736 MET A O     1 
ATOM   5513  C  CB    . MET A 1 736 ? -8.255  30.504  -39.112 1.00 37.48 ? 736 MET A CB    1 
ATOM   5514  C  CG    . MET A 1 736 ? -9.383  31.047  -38.279 1.00 37.65 ? 736 MET A CG    1 
ATOM   5515  S  SD    . MET A 1 736 ? -10.980 30.777  -39.034 1.00 40.09 ? 736 MET A SD    1 
ATOM   5516  C  CE    . MET A 1 736 ? -11.316 29.065  -38.600 1.00 38.52 ? 736 MET A CE    1 
ATOM   5517  N  N     . TYR A 1 737 ? -6.983  30.208  -36.005 1.00 36.85 ? 737 TYR A N     1 
ATOM   5518  C  CA    . TYR A 1 737 ? -7.358  29.513  -34.781 1.00 37.23 ? 737 TYR A CA    1 
ATOM   5519  C  C     . TYR A 1 737 ? -8.893  29.398  -34.765 1.00 38.43 ? 737 TYR A C     1 
ATOM   5520  O  O     . TYR A 1 737 ? -9.434  28.471  -35.366 1.00 39.57 ? 737 TYR A O     1 
ATOM   5521  C  CB    . TYR A 1 737 ? -6.785  30.266  -33.574 1.00 36.53 ? 737 TYR A CB    1 
ATOM   5522  C  CG    . TYR A 1 737 ? -6.960  29.627  -32.217 1.00 36.54 ? 737 TYR A CG    1 
ATOM   5523  C  CD1   . TYR A 1 737 ? -7.199  28.263  -32.077 1.00 36.45 ? 737 TYR A CD1   1 
ATOM   5524  C  CD2   . TYR A 1 737 ? -6.850  30.399  -31.058 1.00 36.62 ? 737 TYR A CD2   1 
ATOM   5525  C  CE1   . TYR A 1 737 ? -7.353  27.696  -30.822 1.00 36.54 ? 737 TYR A CE1   1 
ATOM   5526  C  CE2   . TYR A 1 737 ? -6.993  29.838  -29.805 1.00 35.23 ? 737 TYR A CE2   1 
ATOM   5527  C  CZ    . TYR A 1 737 ? -7.238  28.490  -29.691 1.00 35.97 ? 737 TYR A CZ    1 
ATOM   5528  O  OH    . TYR A 1 737 ? -7.385  27.941  -28.442 1.00 36.28 ? 737 TYR A OH    1 
ATOM   5529  N  N     . TYR A 1 738 ? -9.591  30.341  -34.130 1.00 39.15 ? 738 TYR A N     1 
ATOM   5530  C  CA    . TYR A 1 738 ? -11.069 30.366  -34.116 1.00 40.31 ? 738 TYR A CA    1 
ATOM   5531  C  C     . TYR A 1 738 ? -11.636 31.428  -35.050 1.00 40.82 ? 738 TYR A C     1 
ATOM   5532  O  O     . TYR A 1 738 ? -11.074 32.510  -35.168 1.00 40.30 ? 738 TYR A O     1 
ATOM   5533  C  CB    . TYR A 1 738 ? -11.597 30.675  -32.718 1.00 40.80 ? 738 TYR A CB    1 
ATOM   5534  C  CG    . TYR A 1 738 ? -11.733 29.497  -31.800 1.00 41.61 ? 738 TYR A CG    1 
ATOM   5535  C  CD1   . TYR A 1 738 ? -10.690 29.126  -30.948 1.00 41.83 ? 738 TYR A CD1   1 
ATOM   5536  C  CD2   . TYR A 1 738 ? -12.922 28.765  -31.754 1.00 43.69 ? 738 TYR A CD2   1 
ATOM   5537  C  CE1   . TYR A 1 738 ? -10.818 28.038  -30.086 1.00 41.77 ? 738 TYR A CE1   1 
ATOM   5538  C  CE2   . TYR A 1 738 ? -13.062 27.676  -30.899 1.00 43.68 ? 738 TYR A CE2   1 
ATOM   5539  C  CZ    . TYR A 1 738 ? -12.005 27.321  -30.071 1.00 42.97 ? 738 TYR A CZ    1 
ATOM   5540  O  OH    . TYR A 1 738 ? -12.154 26.252  -29.223 1.00 44.19 ? 738 TYR A OH    1 
ATOM   5541  N  N     . LEU A 1 739 ? -12.745 31.108  -35.712 1.00 41.86 ? 739 LEU A N     1 
ATOM   5542  C  CA    . LEU A 1 739 ? -13.560 32.102  -36.399 1.00 42.99 ? 739 LEU A CA    1 
ATOM   5543  C  C     . LEU A 1 739 ? -14.585 32.613  -35.390 1.00 44.06 ? 739 LEU A C     1 
ATOM   5544  O  O     . LEU A 1 739 ? -15.296 31.817  -34.773 1.00 43.77 ? 739 LEU A O     1 
ATOM   5545  C  CB    . LEU A 1 739 ? -14.303 31.469  -37.578 1.00 43.54 ? 739 LEU A CB    1 
ATOM   5546  C  CG    . LEU A 1 739 ? -14.767 32.238  -38.830 1.00 44.71 ? 739 LEU A CG    1 
ATOM   5547  C  CD1   . LEU A 1 739 ? -16.164 31.760  -39.223 1.00 45.94 ? 739 LEU A CD1   1 
ATOM   5548  C  CD2   . LEU A 1 739 ? -14.749 33.771  -38.732 1.00 44.09 ? 739 LEU A CD2   1 
ATOM   5549  N  N     . ARG A 1 740 ? -14.649 33.929  -35.204 1.00 45.29 ? 740 ARG A N     1 
ATOM   5550  C  CA    . ARG A 1 740 ? -15.732 34.525  -34.421 1.00 47.57 ? 740 ARG A CA    1 
ATOM   5551  C  C     . ARG A 1 740 ? -16.654 35.303  -35.340 1.00 49.18 ? 740 ARG A C     1 
ATOM   5552  O  O     . ARG A 1 740 ? -16.199 36.041  -36.215 1.00 49.00 ? 740 ARG A O     1 
ATOM   5553  C  CB    . ARG A 1 740 ? -15.207 35.441  -33.319 1.00 47.12 ? 740 ARG A CB    1 
ATOM   5554  C  CG    . ARG A 1 740 ? -13.866 35.052  -32.763 1.00 47.58 ? 740 ARG A CG    1 
ATOM   5555  C  CD    . ARG A 1 740 ? -13.990 34.143  -31.582 1.00 50.29 ? 740 ARG A CD    1 
ATOM   5556  N  NE    . ARG A 1 740 ? -12.854 34.346  -30.699 1.00 51.68 ? 740 ARG A NE    1 
ATOM   5557  C  CZ    . ARG A 1 740 ? -12.475 33.508  -29.741 1.00 53.36 ? 740 ARG A CZ    1 
ATOM   5558  N  NH1   . ARG A 1 740 ? -13.131 32.367  -29.525 1.00 53.88 ? 740 ARG A NH1   1 
ATOM   5559  N  NH2   . ARG A 1 740 ? -11.420 33.820  -29.001 1.00 53.98 ? 740 ARG A NH2   1 
ATOM   5560  N  N     . THR A 1 741 ? -17.952 35.129  -35.119 1.00 51.58 ? 741 THR A N     1 
ATOM   5561  C  CA    . THR A 1 741 ? -18.990 35.684  -35.987 1.00 54.32 ? 741 THR A CA    1 
ATOM   5562  C  C     . THR A 1 741 ? -19.937 36.625  -35.226 1.00 55.95 ? 741 THR A C     1 
ATOM   5563  O  O     . THR A 1 741 ? -20.660 37.427  -35.838 1.00 57.13 ? 741 THR A O     1 
ATOM   5564  C  CB    . THR A 1 741 ? -19.741 34.547  -36.721 1.00 54.98 ? 741 THR A CB    1 
ATOM   5565  O  OG1   . THR A 1 741 ? -19.083 34.288  -37.965 1.00 55.54 ? 741 THR A OG1   1 
ATOM   5566  C  CG2   . THR A 1 741 ? -21.211 34.896  -36.993 1.00 57.54 ? 741 THR A CG2   1 
ATOM   5567  N  N     . ARG A 1 742 ? -19.924 36.519  -33.897 1.00 56.65 ? 742 ARG A N     1 
ATOM   5568  C  CA    . ARG A 1 742 ? -20.615 37.481  -33.031 1.00 58.37 ? 742 ARG A CA    1 
ATOM   5569  C  C     . ARG A 1 742 ? -20.443 37.173  -31.542 1.00 58.20 ? 742 ARG A C     1 
ATOM   5570  O  O     . ARG A 1 742 ? -20.874 37.950  -30.683 1.00 58.88 ? 742 ARG A O     1 
ATOM   5571  C  CB    . ARG A 1 742 ? -22.104 37.591  -33.390 1.00 60.18 ? 742 ARG A CB    1 
ATOM   5572  C  CG    . ARG A 1 742 ? -22.653 39.026  -33.342 1.00 62.61 ? 742 ARG A CG    1 
ATOM   5573  C  CD    . ARG A 1 742 ? -21.649 40.054  -33.897 1.00 62.90 ? 742 ARG A CD    1 
ATOM   5574  N  NE    . ARG A 1 742 ? -20.806 40.632  -32.847 1.00 61.73 ? 742 ARG A NE    1 
ATOM   5575  C  CZ    . ARG A 1 742 ? -20.213 41.822  -32.928 1.00 62.15 ? 742 ARG A CZ    1 
ATOM   5576  N  NH1   . ARG A 1 742 ? -20.361 42.582  -34.007 1.00 62.54 ? 742 ARG A NH1   1 
ATOM   5577  N  NH2   . ARG A 1 742 ? -19.475 42.267  -31.920 1.00 62.07 ? 742 ARG A NH2   1 
ATOM   5578  N  N     . MET B 1 1   ? -45.045 -25.840 -67.374 1.00 76.82 ? 1   MET B N     1 
ATOM   5579  C  CA    . MET B 1 1   ? -44.025 -25.297 -66.438 1.00 75.75 ? 1   MET B CA    1 
ATOM   5580  C  C     . MET B 1 1   ? -42.713 -26.073 -66.497 1.00 74.26 ? 1   MET B C     1 
ATOM   5581  O  O     . MET B 1 1   ? -42.710 -27.307 -66.576 1.00 73.91 ? 1   MET B O     1 
ATOM   5582  C  CB    . MET B 1 1   ? -44.557 -25.292 -65.005 1.00 74.85 ? 1   MET B CB    1 
ATOM   5583  C  CG    . MET B 1 1   ? -45.044 -23.938 -64.530 1.00 75.65 ? 1   MET B CG    1 
ATOM   5584  S  SD    . MET B 1 1   ? -45.727 -23.937 -62.856 1.00 74.92 ? 1   MET B SD    1 
ATOM   5585  C  CE    . MET B 1 1   ? -44.696 -25.109 -61.977 1.00 73.36 ? 1   MET B CE    1 
ATOM   5586  N  N     . HIS B 1 2   ? -41.607 -25.333 -66.438 1.00 73.40 ? 2   HIS B N     1 
ATOM   5587  C  CA    . HIS B 1 2   ? -40.271 -25.897 -66.580 1.00 72.13 ? 2   HIS B CA    1 
ATOM   5588  C  C     . HIS B 1 2   ? -39.341 -25.451 -65.460 1.00 70.28 ? 2   HIS B C     1 
ATOM   5589  O  O     . HIS B 1 2   ? -39.328 -24.283 -65.079 1.00 70.07 ? 2   HIS B O     1 
ATOM   5590  C  CB    . HIS B 1 2   ? -39.660 -25.498 -67.923 1.00 73.37 ? 2   HIS B CB    1 
ATOM   5591  C  CG    . HIS B 1 2   ? -40.418 -26.002 -69.112 1.00 75.68 ? 2   HIS B CG    1 
ATOM   5592  N  ND1   . HIS B 1 2   ? -40.231 -27.263 -69.637 1.00 76.20 ? 2   HIS B ND1   1 
ATOM   5593  C  CD2   . HIS B 1 2   ? -41.358 -25.409 -69.887 1.00 77.86 ? 2   HIS B CD2   1 
ATOM   5594  C  CE1   . HIS B 1 2   ? -41.026 -27.428 -70.679 1.00 78.13 ? 2   HIS B CE1   1 
ATOM   5595  N  NE2   . HIS B 1 2   ? -41.721 -26.317 -70.852 1.00 79.40 ? 2   HIS B NE2   1 
ATOM   5596  N  N     . VAL B 1 3   ? -38.569 -26.396 -64.934 1.00 68.72 ? 3   VAL B N     1 
ATOM   5597  C  CA    . VAL B 1 3   ? -37.450 -26.062 -64.060 1.00 67.22 ? 3   VAL B CA    1 
ATOM   5598  C  C     . VAL B 1 3   ? -36.185 -25.985 -64.908 1.00 67.36 ? 3   VAL B C     1 
ATOM   5599  O  O     . VAL B 1 3   ? -36.070 -26.654 -65.944 1.00 67.79 ? 3   VAL B O     1 
ATOM   5600  C  CB    . VAL B 1 3   ? -37.215 -27.099 -62.936 1.00 65.62 ? 3   VAL B CB    1 
ATOM   5601  C  CG1   . VAL B 1 3   ? -36.779 -26.391 -61.664 1.00 64.65 ? 3   VAL B CG1   1 
ATOM   5602  C  CG2   . VAL B 1 3   ? -38.454 -27.929 -62.673 1.00 65.70 ? 3   VAL B CG2   1 
ATOM   5603  N  N     . ILE B 1 4   ? -35.245 -25.154 -64.471 1.00 66.73 ? 4   ILE B N     1 
ATOM   5604  C  CA    . ILE B 1 4   ? -33.924 -25.121 -65.075 1.00 66.81 ? 4   ILE B CA    1 
ATOM   5605  C  C     . ILE B 1 4   ? -33.008 -25.961 -64.193 1.00 65.10 ? 4   ILE B C     1 
ATOM   5606  O  O     . ILE B 1 4   ? -32.727 -25.591 -63.048 1.00 64.16 ? 4   ILE B O     1 
ATOM   5607  C  CB    . ILE B 1 4   ? -33.394 -23.665 -65.260 1.00 67.56 ? 4   ILE B CB    1 
ATOM   5608  C  CG1   . ILE B 1 4   ? -34.378 -22.813 -66.091 1.00 68.72 ? 4   ILE B CG1   1 
ATOM   5609  C  CG2   . ILE B 1 4   ? -31.990 -23.660 -65.878 1.00 67.80 ? 4   ILE B CG2   1 
ATOM   5610  C  CD1   . ILE B 1 4   ? -34.665 -23.324 -67.492 1.00 70.16 ? 4   ILE B CD1   1 
ATOM   5611  N  N     . LYS B 1 5   ? -32.577 -27.105 -64.725 1.00 64.87 ? 5   LYS B N     1 
ATOM   5612  C  CA    . LYS B 1 5   ? -31.692 -28.022 -64.002 1.00 63.66 ? 5   LYS B CA    1 
ATOM   5613  C  C     . LYS B 1 5   ? -30.293 -27.418 -63.839 1.00 63.37 ? 5   LYS B C     1 
ATOM   5614  O  O     . LYS B 1 5   ? -29.955 -26.441 -64.514 1.00 64.16 ? 5   LYS B O     1 
ATOM   5615  C  CB    . LYS B 1 5   ? -31.617 -29.380 -64.709 1.00 63.93 ? 5   LYS B CB    1 
ATOM   5616  C  CG    . LYS B 1 5   ? -32.923 -30.157 -64.752 1.00 64.13 ? 5   LYS B CG    1 
ATOM   5617  C  CD    . LYS B 1 5   ? -32.682 -31.659 -64.943 1.00 65.12 ? 5   LYS B CD    1 
ATOM   5618  C  CE    . LYS B 1 5   ? -32.727 -32.091 -66.411 1.00 66.81 ? 5   LYS B CE    1 
ATOM   5619  N  NZ    . LYS B 1 5   ? -31.431 -31.892 -67.118 1.00 67.75 ? 5   LYS B NZ    1 
ATOM   5620  N  N     . ARG B 1 6   ? -29.492 -27.984 -62.936 1.00 62.22 ? 6   ARG B N     1 
ATOM   5621  C  CA    . ARG B 1 6   ? -28.118 -27.502 -62.703 1.00 62.26 ? 6   ARG B CA    1 
ATOM   5622  C  C     . ARG B 1 6   ? -27.290 -27.420 -63.995 1.00 63.55 ? 6   ARG B C     1 
ATOM   5623  O  O     . ARG B 1 6   ? -26.541 -26.461 -64.205 1.00 63.90 ? 6   ARG B O     1 
ATOM   5624  C  CB    . ARG B 1 6   ? -27.404 -28.364 -61.665 1.00 60.64 ? 6   ARG B CB    1 
ATOM   5625  C  CG    . ARG B 1 6   ? -27.983 -28.217 -60.289 1.00 60.18 ? 6   ARG B CG    1 
ATOM   5626  C  CD    . ARG B 1 6   ? -27.641 -29.398 -59.393 1.00 59.98 ? 6   ARG B CD    1 
ATOM   5627  N  NE    . ARG B 1 6   ? -28.685 -29.618 -58.393 1.00 59.31 ? 6   ARG B NE    1 
ATOM   5628  C  CZ    . ARG B 1 6   ? -28.845 -28.883 -57.296 1.00 59.39 ? 6   ARG B CZ    1 
ATOM   5629  N  NH1   . ARG B 1 6   ? -28.020 -27.871 -57.036 1.00 58.90 ? 6   ARG B NH1   1 
ATOM   5630  N  NH2   . ARG B 1 6   ? -29.835 -29.161 -56.455 1.00 58.51 ? 6   ARG B NH2   1 
ATOM   5631  N  N     . ASP B 1 7   ? -27.456 -28.418 -64.859 1.00 64.22 ? 7   ASP B N     1 
ATOM   5632  C  CA    . ASP B 1 7   ? -26.775 -28.451 -66.146 1.00 65.94 ? 7   ASP B CA    1 
ATOM   5633  C  C     . ASP B 1 7   ? -27.341 -27.417 -67.135 1.00 67.38 ? 7   ASP B C     1 
ATOM   5634  O  O     . ASP B 1 7   ? -26.980 -27.405 -68.319 1.00 68.61 ? 7   ASP B O     1 
ATOM   5635  C  CB    . ASP B 1 7   ? -26.816 -29.876 -66.725 1.00 66.31 ? 7   ASP B CB    1 
ATOM   5636  C  CG    . ASP B 1 7   ? -28.229 -30.335 -67.105 1.00 67.45 ? 7   ASP B CG    1 
ATOM   5637  O  OD1   . ASP B 1 7   ? -29.220 -29.663 -66.743 1.00 68.13 ? 7   ASP B OD1   1 
ATOM   5638  O  OD2   . ASP B 1 7   ? -28.345 -31.383 -67.776 1.00 68.06 ? 7   ASP B OD2   1 
ATOM   5639  N  N     . GLY B 1 8   ? -28.228 -26.558 -66.635 1.00 67.27 ? 8   GLY B N     1 
ATOM   5640  C  CA    . GLY B 1 8   ? -28.892 -25.545 -67.449 1.00 68.96 ? 8   GLY B CA    1 
ATOM   5641  C  C     . GLY B 1 8   ? -29.990 -26.057 -68.368 1.00 70.24 ? 8   GLY B C     1 
ATOM   5642  O  O     . GLY B 1 8   ? -30.578 -25.276 -69.122 1.00 71.59 ? 8   GLY B O     1 
ATOM   5643  N  N     . ARG B 1 9   ? -30.271 -27.359 -68.319 1.00 70.17 ? 9   ARG B N     1 
ATOM   5644  C  CA    . ARG B 1 9   ? -31.310 -27.962 -69.176 1.00 71.57 ? 9   ARG B CA    1 
ATOM   5645  C  C     . ARG B 1 9   ? -32.718 -27.803 -68.604 1.00 71.35 ? 9   ARG B C     1 
ATOM   5646  O  O     . ARG B 1 9   ? -32.923 -27.820 -67.384 1.00 69.91 ? 9   ARG B O     1 
ATOM   5647  C  CB    . ARG B 1 9   ? -31.030 -29.442 -69.455 1.00 71.37 ? 9   ARG B CB    1 
ATOM   5648  C  CG    . ARG B 1 9   ? -29.835 -29.690 -70.338 1.00 73.30 ? 9   ARG B CG    1 
ATOM   5649  C  CD    . ARG B 1 9   ? -29.672 -31.163 -70.656 1.00 75.45 ? 9   ARG B CD    1 
ATOM   5650  N  NE    . ARG B 1 9   ? -28.317 -31.439 -71.129 1.00 77.90 ? 9   ARG B NE    1 
ATOM   5651  C  CZ    . ARG B 1 9   ? -27.964 -32.482 -71.876 1.00 79.71 ? 9   ARG B CZ    1 
ATOM   5652  N  NH1   . ARG B 1 9   ? -28.862 -33.386 -72.265 1.00 80.12 ? 9   ARG B NH1   1 
ATOM   5653  N  NH2   . ARG B 1 9   ? -26.699 -32.612 -72.248 1.00 80.31 ? 9   ARG B NH2   1 
ATOM   5654  N  N     . GLN B 1 10  ? -33.677 -27.662 -69.513 1.00 72.82 ? 10  GLN B N     1 
ATOM   5655  C  CA    . GLN B 1 10  ? -35.066 -27.413 -69.175 1.00 73.31 ? 10  GLN B CA    1 
ATOM   5656  C  C     . GLN B 1 10  ? -35.812 -28.722 -68.935 1.00 73.15 ? 10  GLN B C     1 
ATOM   5657  O  O     . GLN B 1 10  ? -35.799 -29.616 -69.789 1.00 74.04 ? 10  GLN B O     1 
ATOM   5658  C  CB    . GLN B 1 10  ? -35.723 -26.639 -70.314 1.00 75.07 ? 10  GLN B CB    1 
ATOM   5659  C  CG    . GLN B 1 10  ? -36.721 -25.600 -69.865 1.00 75.53 ? 10  GLN B CG    1 
ATOM   5660  C  CD    . GLN B 1 10  ? -36.841 -24.452 -70.845 1.00 77.23 ? 10  GLN B CD    1 
ATOM   5661  O  OE1   . GLN B 1 10  ? -37.842 -24.324 -71.550 1.00 77.81 ? 10  GLN B OE1   1 
ATOM   5662  N  NE2   . GLN B 1 10  ? -35.812 -23.609 -70.898 1.00 77.30 ? 10  GLN B NE2   1 
ATOM   5663  N  N     . GLU B 1 11  ? -36.469 -28.820 -67.778 1.00 72.28 ? 11  GLU B N     1 
ATOM   5664  C  CA    . GLU B 1 11  ? -37.220 -30.016 -67.391 1.00 72.14 ? 11  GLU B CA    1 
ATOM   5665  C  C     . GLU B 1 11  ? -38.662 -29.686 -66.988 1.00 72.19 ? 11  GLU B C     1 
ATOM   5666  O  O     . GLU B 1 11  ? -38.906 -28.710 -66.279 1.00 71.88 ? 11  GLU B O     1 
ATOM   5667  C  CB    . GLU B 1 11  ? -36.513 -30.719 -66.232 1.00 70.57 ? 11  GLU B CB    1 
ATOM   5668  C  CG    . GLU B 1 11  ? -36.799 -32.207 -66.126 1.00 70.96 ? 11  GLU B CG    1 
ATOM   5669  C  CD    . GLU B 1 11  ? -36.000 -32.872 -65.018 1.00 69.59 ? 11  GLU B CD    1 
ATOM   5670  O  OE1   . GLU B 1 11  ? -35.312 -33.880 -65.299 1.00 70.75 ? 11  GLU B OE1   1 
ATOM   5671  O  OE2   . GLU B 1 11  ? -36.046 -32.382 -63.867 1.00 69.98 ? 11  GLU B OE2   1 
ATOM   5672  N  N     . ARG B 1 12  ? -39.605 -30.516 -67.437 1.00 72.67 ? 12  ARG B N     1 
ATOM   5673  C  CA    . ARG B 1 12  ? -41.023 -30.388 -67.082 1.00 72.91 ? 12  ARG B CA    1 
ATOM   5674  C  C     . ARG B 1 12  ? -41.220 -30.564 -65.579 1.00 71.07 ? 12  ARG B C     1 
ATOM   5675  O  O     . ARG B 1 12  ? -40.706 -31.520 -64.998 1.00 70.07 ? 12  ARG B O     1 
ATOM   5676  C  CB    . ARG B 1 12  ? -41.846 -31.458 -67.806 1.00 74.00 ? 12  ARG B CB    1 
ATOM   5677  C  CG    . ARG B 1 12  ? -43.183 -30.981 -68.325 1.00 76.40 ? 12  ARG B CG    1 
ATOM   5678  C  CD    . ARG B 1 12  ? -43.147 -30.924 -69.842 1.00 79.76 ? 12  ARG B CD    1 
ATOM   5679  N  NE    . ARG B 1 12  ? -43.884 -29.790 -70.391 1.00 81.98 ? 12  ARG B NE    1 
ATOM   5680  C  CZ    . ARG B 1 12  ? -43.821 -29.409 -71.664 1.00 84.49 ? 12  ARG B CZ    1 
ATOM   5681  N  NH1   . ARG B 1 12  ? -44.523 -28.363 -72.083 1.00 86.51 ? 12  ARG B NH1   1 
ATOM   5682  N  NH2   . ARG B 1 12  ? -43.056 -30.073 -72.524 1.00 84.96 ? 12  ARG B NH2   1 
ATOM   5683  N  N     . VAL B 1 13  ? -41.953 -29.646 -64.952 1.00 70.63 ? 13  VAL B N     1 
ATOM   5684  C  CA    . VAL B 1 13  ? -42.293 -29.774 -63.529 1.00 68.99 ? 13  VAL B CA    1 
ATOM   5685  C  C     . VAL B 1 13  ? -43.321 -30.903 -63.353 1.00 68.87 ? 13  VAL B C     1 
ATOM   5686  O  O     . VAL B 1 13  ? -44.431 -30.830 -63.891 1.00 69.93 ? 13  VAL B O     1 
ATOM   5687  C  CB    . VAL B 1 13  ? -42.835 -28.447 -62.932 1.00 69.33 ? 13  VAL B CB    1 
ATOM   5688  C  CG1   . VAL B 1 13  ? -43.114 -28.590 -61.439 1.00 67.94 ? 13  VAL B CG1   1 
ATOM   5689  C  CG2   . VAL B 1 13  ? -41.862 -27.306 -63.175 1.00 69.56 ? 13  VAL B CG2   1 
ATOM   5690  N  N     . MET B 1 14  ? -42.935 -31.949 -62.619 1.00 67.11 ? 14  MET B N     1 
ATOM   5691  C  CA    . MET B 1 14  ? -43.784 -33.127 -62.434 1.00 66.83 ? 14  MET B CA    1 
ATOM   5692  C  C     . MET B 1 14  ? -43.974 -33.471 -60.968 1.00 65.09 ? 14  MET B C     1 
ATOM   5693  O  O     . MET B 1 14  ? -42.998 -33.608 -60.216 1.00 63.50 ? 14  MET B O     1 
ATOM   5694  C  CB    . MET B 1 14  ? -43.213 -34.334 -63.175 1.00 66.84 ? 14  MET B CB    1 
ATOM   5695  C  CG    . MET B 1 14  ? -43.255 -34.203 -64.683 1.00 68.76 ? 14  MET B CG    1 
ATOM   5696  S  SD    . MET B 1 14  ? -42.299 -35.484 -65.512 1.00 69.18 ? 14  MET B SD    1 
ATOM   5697  C  CE    . MET B 1 14  ? -40.634 -35.151 -64.907 1.00 67.42 ? 14  MET B CE    1 
ATOM   5698  N  N     . PHE B 1 15  ? -45.242 -33.617 -60.579 1.00 64.92 ? 15  PHE B N     1 
ATOM   5699  C  CA    . PHE B 1 15  ? -45.626 -33.945 -59.203 1.00 63.37 ? 15  PHE B CA    1 
ATOM   5700  C  C     . PHE B 1 15  ? -44.893 -35.180 -58.681 1.00 62.05 ? 15  PHE B C     1 
ATOM   5701  O  O     . PHE B 1 15  ? -44.316 -35.150 -57.597 1.00 60.61 ? 15  PHE B O     1 
ATOM   5702  C  CB    . PHE B 1 15  ? -47.145 -34.153 -59.112 1.00 64.33 ? 15  PHE B CB    1 
ATOM   5703  C  CG    . PHE B 1 15  ? -47.679 -34.183 -57.706 1.00 62.97 ? 15  PHE B CG    1 
ATOM   5704  C  CD1   . PHE B 1 15  ? -48.149 -33.020 -57.105 1.00 62.46 ? 15  PHE B CD1   1 
ATOM   5705  C  CD2   . PHE B 1 15  ? -47.726 -35.374 -56.989 1.00 61.91 ? 15  PHE B CD2   1 
ATOM   5706  C  CE1   . PHE B 1 15  ? -48.649 -33.042 -55.809 1.00 62.10 ? 15  PHE B CE1   1 
ATOM   5707  C  CE2   . PHE B 1 15  ? -48.225 -35.407 -55.691 1.00 61.32 ? 15  PHE B CE2   1 
ATOM   5708  C  CZ    . PHE B 1 15  ? -48.687 -34.239 -55.100 1.00 61.78 ? 15  PHE B CZ    1 
ATOM   5709  N  N     . ASP B 1 16  ? -44.914 -36.248 -59.475 1.00 62.47 ? 16  ASP B N     1 
ATOM   5710  C  CA    . ASP B 1 16  ? -44.339 -37.532 -59.100 1.00 61.78 ? 16  ASP B CA    1 
ATOM   5711  C  C     . ASP B 1 16  ? -42.833 -37.495 -58.858 1.00 60.44 ? 16  ASP B C     1 
ATOM   5712  O  O     . ASP B 1 16  ? -42.353 -38.128 -57.922 1.00 59.50 ? 16  ASP B O     1 
ATOM   5713  C  CB    . ASP B 1 16  ? -44.682 -38.599 -60.142 1.00 62.82 ? 16  ASP B CB    1 
ATOM   5714  C  CG    . ASP B 1 16  ? -46.142 -39.035 -60.080 1.00 64.71 ? 16  ASP B CG    1 
ATOM   5715  O  OD1   . ASP B 1 16  ? -46.755 -38.984 -58.986 1.00 64.08 ? 16  ASP B OD1   1 
ATOM   5716  O  OD2   . ASP B 1 16  ? -46.678 -39.440 -61.138 1.00 66.82 ? 16  ASP B OD2   1 
ATOM   5717  N  N     . LYS B 1 17  ? -42.097 -36.758 -59.691 1.00 60.52 ? 17  LYS B N     1 
ATOM   5718  C  CA    . LYS B 1 17  ? -40.634 -36.709 -59.581 1.00 59.45 ? 17  LYS B CA    1 
ATOM   5719  C  C     . LYS B 1 17  ? -40.185 -35.873 -58.393 1.00 58.08 ? 17  LYS B C     1 
ATOM   5720  O  O     . LYS B 1 17  ? -39.266 -36.258 -57.671 1.00 57.54 ? 17  LYS B O     1 
ATOM   5721  C  CB    . LYS B 1 17  ? -40.001 -36.202 -60.872 1.00 60.16 ? 17  LYS B CB    1 
ATOM   5722  N  N     . ILE B 1 18  ? -40.832 -34.730 -58.188 1.00 58.19 ? 18  ILE B N     1 
ATOM   5723  C  CA    . ILE B 1 18  ? -40.554 -33.886 -57.023 1.00 57.02 ? 18  ILE B CA    1 
ATOM   5724  C  C     . ILE B 1 18  ? -40.845 -34.665 -55.744 1.00 56.44 ? 18  ILE B C     1 
ATOM   5725  O  O     . ILE B 1 18  ? -39.996 -34.734 -54.863 1.00 55.18 ? 18  ILE B O     1 
ATOM   5726  C  CB    . ILE B 1 18  ? -41.344 -32.555 -57.067 1.00 57.39 ? 18  ILE B CB    1 
ATOM   5727  C  CG1   . ILE B 1 18  ? -40.876 -31.715 -58.261 1.00 58.12 ? 18  ILE B CG1   1 
ATOM   5728  C  CG2   . ILE B 1 18  ? -41.189 -31.781 -55.764 1.00 55.91 ? 18  ILE B CG2   1 
ATOM   5729  C  CD1   . ILE B 1 18  ? -41.859 -30.643 -58.707 1.00 59.12 ? 18  ILE B CD1   1 
ATOM   5730  N  N     . THR B 1 19  ? -42.033 -35.267 -55.669 1.00 57.58 ? 19  THR B N     1 
ATOM   5731  C  CA    . THR B 1 19  ? -42.417 -36.151 -54.563 1.00 57.60 ? 19  THR B CA    1 
ATOM   5732  C  C     . THR B 1 19  ? -41.395 -37.270 -54.384 1.00 57.31 ? 19  THR B C     1 
ATOM   5733  O  O     . THR B 1 19  ? -40.985 -37.579 -53.257 1.00 56.13 ? 19  THR B O     1 
ATOM   5734  C  CB    . THR B 1 19  ? -43.809 -36.781 -54.801 1.00 58.73 ? 19  THR B CB    1 
ATOM   5735  O  OG1   . THR B 1 19  ? -44.729 -35.768 -55.213 1.00 59.82 ? 19  THR B OG1   1 
ATOM   5736  C  CG2   . THR B 1 19  ? -44.331 -37.443 -53.537 1.00 58.11 ? 19  THR B CG2   1 
ATOM   5737  N  N     . SER B 1 20  ? -40.997 -37.857 -55.512 1.00 58.51 ? 20  SER B N     1 
ATOM   5738  C  CA    . SER B 1 20  ? -40.021 -38.944 -55.564 1.00 58.99 ? 20  SER B CA    1 
ATOM   5739  C  C     . SER B 1 20  ? -38.696 -38.571 -54.895 1.00 57.95 ? 20  SER B C     1 
ATOM   5740  O  O     . SER B 1 20  ? -38.187 -39.329 -54.070 1.00 57.48 ? 20  SER B O     1 
ATOM   5741  C  CB    . SER B 1 20  ? -39.790 -39.376 -57.020 1.00 59.98 ? 20  SER B CB    1 
ATOM   5742  O  OG    . SER B 1 20  ? -39.063 -40.584 -57.095 1.00 60.71 ? 20  SER B OG    1 
ATOM   5743  N  N     . ARG B 1 21  ? -38.155 -37.401 -55.235 1.00 58.18 ? 21  ARG B N     1 
ATOM   5744  C  CA    . ARG B 1 21  ? -36.896 -36.937 -54.651 1.00 57.61 ? 21  ARG B CA    1 
ATOM   5745  C  C     . ARG B 1 21  ? -37.011 -36.764 -53.139 1.00 57.19 ? 21  ARG B C     1 
ATOM   5746  O  O     . ARG B 1 21  ? -36.090 -37.126 -52.394 1.00 56.37 ? 21  ARG B O     1 
ATOM   5747  C  CB    . ARG B 1 21  ? -36.444 -35.645 -55.303 1.00 57.83 ? 21  ARG B CB    1 
ATOM   5748  N  N     . ILE B 1 22  ? -38.145 -36.221 -52.691 1.00 58.00 ? 22  ILE B N     1 
ATOM   5749  C  CA    . ILE B 1 22  ? -38.401 -36.012 -51.266 1.00 57.62 ? 22  ILE B CA    1 
ATOM   5750  C  C     . ILE B 1 22  ? -38.494 -37.358 -50.556 1.00 57.81 ? 22  ILE B C     1 
ATOM   5751  O  O     . ILE B 1 22  ? -37.964 -37.518 -49.459 1.00 56.54 ? 22  ILE B O     1 
ATOM   5752  C  CB    . ILE B 1 22  ? -39.688 -35.160 -51.010 1.00 58.30 ? 22  ILE B CB    1 
ATOM   5753  C  CG1   . ILE B 1 22  ? -39.678 -33.860 -51.825 1.00 58.79 ? 22  ILE B CG1   1 
ATOM   5754  C  CG2   . ILE B 1 22  ? -39.879 -34.858 -49.519 1.00 57.07 ? 22  ILE B CG2   1 
ATOM   5755  C  CD1   . ILE B 1 22  ? -38.374 -33.070 -51.771 1.00 59.21 ? 22  ILE B CD1   1 
ATOM   5756  N  N     . GLN B 1 23  ? -39.147 -38.323 -51.209 1.00 59.50 ? 23  GLN B N     1 
ATOM   5757  C  CA    . GLN B 1 23  ? -39.309 -39.682 -50.679 1.00 60.22 ? 23  GLN B CA    1 
ATOM   5758  C  C     . GLN B 1 23  ? -37.977 -40.356 -50.321 1.00 59.57 ? 23  GLN B C     1 
ATOM   5759  O  O     . GLN B 1 23  ? -37.867 -40.992 -49.281 1.00 58.92 ? 23  GLN B O     1 
ATOM   5760  C  CB    . GLN B 1 23  ? -40.089 -40.555 -51.672 1.00 61.41 ? 23  GLN B CB    1 
ATOM   5761  C  CG    . GLN B 1 23  ? -40.326 -41.994 -51.210 1.00 62.82 ? 23  GLN B CG    1 
ATOM   5762  C  CD    . GLN B 1 23  ? -41.146 -42.070 -49.930 1.00 65.12 ? 23  GLN B CD    1 
ATOM   5763  O  OE1   . GLN B 1 23  ? -42.243 -41.514 -49.848 1.00 67.00 ? 23  GLN B OE1   1 
ATOM   5764  N  NE2   . GLN B 1 23  ? -40.616 -42.762 -48.921 1.00 64.83 ? 23  GLN B NE2   1 
ATOM   5765  N  N     . LYS B 1 24  ? -36.982 -40.210 -51.192 1.00 60.11 ? 24  LYS B N     1 
ATOM   5766  C  CA    . LYS B 1 24  ? -35.686 -40.859 -51.018 1.00 60.27 ? 24  LYS B CA    1 
ATOM   5767  C  C     . LYS B 1 24  ? -34.923 -40.365 -49.782 1.00 59.47 ? 24  LYS B C     1 
ATOM   5768  O  O     . LYS B 1 24  ? -33.967 -41.009 -49.340 1.00 59.27 ? 24  LYS B O     1 
ATOM   5769  C  CB    . LYS B 1 24  ? -34.837 -40.700 -52.287 1.00 60.73 ? 24  LYS B CB    1 
ATOM   5770  N  N     . LEU B 1 25  ? -35.357 -39.231 -49.229 1.00 59.38 ? 25  LEU B N     1 
ATOM   5771  C  CA    . LEU B 1 25  ? -34.735 -38.631 -48.041 1.00 58.36 ? 25  LEU B CA    1 
ATOM   5772  C  C     . LEU B 1 25  ? -35.526 -38.899 -46.749 1.00 58.57 ? 25  LEU B C     1 
ATOM   5773  O  O     . LEU B 1 25  ? -35.270 -38.274 -45.707 1.00 57.54 ? 25  LEU B O     1 
ATOM   5774  C  CB    . LEU B 1 25  ? -34.560 -37.120 -48.243 1.00 57.73 ? 25  LEU B CB    1 
ATOM   5775  C  CG    . LEU B 1 25  ? -33.873 -36.599 -49.508 1.00 57.78 ? 25  LEU B CG    1 
ATOM   5776  C  CD1   . LEU B 1 25  ? -34.038 -35.088 -49.620 1.00 56.72 ? 25  LEU B CD1   1 
ATOM   5777  C  CD2   . LEU B 1 25  ? -32.397 -36.986 -49.545 1.00 57.04 ? 25  LEU B CD2   1 
ATOM   5778  N  N     . CYS B 1 26  ? -36.471 -39.837 -46.817 1.00 59.80 ? 26  CYS B N     1 
ATOM   5779  C  CA    . CYS B 1 26  ? -37.376 -40.114 -45.696 1.00 60.67 ? 26  CYS B CA    1 
ATOM   5780  C  C     . CYS B 1 26  ? -37.000 -41.323 -44.830 1.00 60.98 ? 26  CYS B C     1 
ATOM   5781  O  O     . CYS B 1 26  ? -37.786 -41.725 -43.967 1.00 61.30 ? 26  CYS B O     1 
ATOM   5782  C  CB    . CYS B 1 26  ? -38.819 -40.264 -46.194 1.00 61.83 ? 26  CYS B CB    1 
ATOM   5783  S  SG    . CYS B 1 26  ? -39.677 -38.707 -46.490 1.00 61.75 ? 26  CYS B SG    1 
ATOM   5784  N  N     . TYR B 1 27  ? -35.815 -41.897 -45.059 1.00 61.34 ? 27  TYR B N     1 
ATOM   5785  C  CA    . TYR B 1 27  ? -35.331 -43.055 -44.287 1.00 61.84 ? 27  TYR B CA    1 
ATOM   5786  C  C     . TYR B 1 27  ? -35.312 -42.790 -42.787 1.00 61.05 ? 27  TYR B C     1 
ATOM   5787  O  O     . TYR B 1 27  ? -34.680 -41.842 -42.319 1.00 60.30 ? 27  TYR B O     1 
ATOM   5788  C  CB    . TYR B 1 27  ? -33.942 -43.520 -44.761 1.00 62.33 ? 27  TYR B CB    1 
ATOM   5789  C  CG    . TYR B 1 27  ? -33.006 -42.405 -45.198 1.00 62.92 ? 27  TYR B CG    1 
ATOM   5790  C  CD1   . TYR B 1 27  ? -32.122 -41.799 -44.291 1.00 62.69 ? 27  TYR B CD1   1 
ATOM   5791  C  CD2   . TYR B 1 27  ? -32.999 -41.960 -46.524 1.00 64.16 ? 27  TYR B CD2   1 
ATOM   5792  C  CE1   . TYR B 1 27  ? -31.255 -40.766 -44.704 1.00 62.51 ? 27  TYR B CE1   1 
ATOM   5793  C  CE2   . TYR B 1 27  ? -32.146 -40.938 -46.941 1.00 64.14 ? 27  TYR B CE2   1 
ATOM   5794  C  CZ    . TYR B 1 27  ? -31.281 -40.345 -46.032 1.00 62.73 ? 27  TYR B CZ    1 
ATOM   5795  O  OH    . TYR B 1 27  ? -30.451 -39.339 -46.475 1.00 61.99 ? 27  TYR B OH    1 
ATOM   5796  N  N     . GLY B 1 28  ? -36.028 -43.624 -42.041 1.00 61.34 ? 28  GLY B N     1 
ATOM   5797  C  CA    . GLY B 1 28  ? -36.076 -43.510 -40.586 1.00 60.41 ? 28  GLY B CA    1 
ATOM   5798  C  C     . GLY B 1 28  ? -37.093 -42.509 -40.068 1.00 60.27 ? 28  GLY B C     1 
ATOM   5799  O  O     . GLY B 1 28  ? -37.159 -42.260 -38.861 1.00 59.77 ? 28  GLY B O     1 
ATOM   5800  N  N     . LEU B 1 29  ? -37.888 -41.932 -40.969 1.00 60.53 ? 29  LEU B N     1 
ATOM   5801  C  CA    . LEU B 1 29  ? -38.864 -40.913 -40.571 1.00 60.41 ? 29  LEU B CA    1 
ATOM   5802  C  C     . LEU B 1 29  ? -40.265 -41.502 -40.429 1.00 61.27 ? 29  LEU B C     1 
ATOM   5803  O  O     . LEU B 1 29  ? -40.586 -42.507 -41.058 1.00 62.09 ? 29  LEU B O     1 
ATOM   5804  C  CB    . LEU B 1 29  ? -38.850 -39.702 -41.524 1.00 60.30 ? 29  LEU B CB    1 
ATOM   5805  C  CG    . LEU B 1 29  ? -37.542 -38.904 -41.694 1.00 59.53 ? 29  LEU B CG    1 
ATOM   5806  C  CD1   . LEU B 1 29  ? -37.740 -37.720 -42.640 1.00 59.19 ? 29  LEU B CD1   1 
ATOM   5807  C  CD2   . LEU B 1 29  ? -36.962 -38.429 -40.359 1.00 58.72 ? 29  LEU B CD2   1 
ATOM   5808  N  N     . ASN B 1 30  ? -41.080 -40.875 -39.584 1.00 61.20 ? 30  ASN B N     1 
ATOM   5809  C  CA    . ASN B 1 30  ? -42.423 -41.355 -39.279 1.00 62.13 ? 30  ASN B CA    1 
ATOM   5810  C  C     . ASN B 1 30  ? -43.379 -41.079 -40.431 1.00 63.10 ? 30  ASN B C     1 
ATOM   5811  O  O     . ASN B 1 30  ? -43.933 -39.985 -40.539 1.00 63.18 ? 30  ASN B O     1 
ATOM   5812  C  CB    . ASN B 1 30  ? -42.934 -40.713 -37.981 1.00 61.86 ? 30  ASN B CB    1 
ATOM   5813  C  CG    . ASN B 1 30  ? -44.188 -41.391 -37.430 1.00 63.01 ? 30  ASN B CG    1 
ATOM   5814  O  OD1   . ASN B 1 30  ? -44.975 -41.987 -38.168 1.00 65.22 ? 30  ASN B OD1   1 
ATOM   5815  N  ND2   . ASN B 1 30  ? -44.385 -41.279 -36.124 1.00 62.49 ? 30  ASN B ND2   1 
ATOM   5816  N  N     . MET B 1 31  ? -43.579 -42.089 -41.274 1.00 63.91 ? 31  MET B N     1 
ATOM   5817  C  CA    . MET B 1 31  ? -44.371 -41.942 -42.497 1.00 65.02 ? 31  MET B CA    1 
ATOM   5818  C  C     . MET B 1 31  ? -45.887 -41.958 -42.259 1.00 66.22 ? 31  MET B C     1 
ATOM   5819  O  O     . MET B 1 31  ? -46.666 -41.687 -43.175 1.00 67.13 ? 31  MET B O     1 
ATOM   5820  C  CB    . MET B 1 31  ? -43.961 -42.985 -43.545 1.00 65.63 ? 31  MET B CB    1 
ATOM   5821  C  CG    . MET B 1 31  ? -42.458 -43.014 -43.865 1.00 64.87 ? 31  MET B CG    1 
ATOM   5822  S  SD    . MET B 1 31  ? -41.694 -41.410 -44.224 1.00 65.10 ? 31  MET B SD    1 
ATOM   5823  C  CE    . MET B 1 31  ? -42.618 -40.934 -45.689 1.00 64.96 ? 31  MET B CE    1 
ATOM   5824  N  N     . ASP B 1 32  ? -46.290 -42.268 -41.027 1.00 66.26 ? 32  ASP B N     1 
ATOM   5825  C  CA    . ASP B 1 32  ? -47.684 -42.134 -40.602 1.00 67.03 ? 32  ASP B CA    1 
ATOM   5826  C  C     . ASP B 1 32  ? -48.100 -40.663 -40.570 1.00 66.36 ? 32  ASP B C     1 
ATOM   5827  O  O     . ASP B 1 32  ? -49.286 -40.348 -40.701 1.00 67.83 ? 32  ASP B O     1 
ATOM   5828  C  CB    . ASP B 1 32  ? -47.901 -42.763 -39.212 1.00 67.55 ? 32  ASP B CB    1 
ATOM   5829  C  CG    . ASP B 1 32  ? -47.756 -44.285 -39.213 1.00 68.44 ? 32  ASP B CG    1 
ATOM   5830  O  OD1   . ASP B 1 32  ? -48.308 -44.940 -40.125 1.00 70.05 ? 32  ASP B OD1   1 
ATOM   5831  O  OD2   . ASP B 1 32  ? -47.107 -44.827 -38.289 1.00 67.81 ? 32  ASP B OD2   1 
ATOM   5832  N  N     . PHE B 1 33  ? -47.126 -39.769 -40.399 1.00 64.33 ? 33  PHE B N     1 
ATOM   5833  C  CA    . PHE B 1 33  ? -47.403 -38.331 -40.310 1.00 63.53 ? 33  PHE B CA    1 
ATOM   5834  C  C     . PHE B 1 33  ? -46.666 -37.478 -41.350 1.00 62.50 ? 33  PHE B C     1 
ATOM   5835  O  O     . PHE B 1 33  ? -47.206 -36.472 -41.818 1.00 62.79 ? 33  PHE B O     1 
ATOM   5836  C  CB    . PHE B 1 33  ? -47.154 -37.824 -38.884 1.00 62.67 ? 33  PHE B CB    1 
ATOM   5837  C  CG    . PHE B 1 33  ? -47.874 -38.621 -37.841 1.00 63.35 ? 33  PHE B CG    1 
ATOM   5838  C  CD1   . PHE B 1 33  ? -47.192 -39.566 -37.081 1.00 62.66 ? 33  PHE B CD1   1 
ATOM   5839  C  CD2   . PHE B 1 33  ? -49.247 -38.464 -37.650 1.00 64.86 ? 33  PHE B CD2   1 
ATOM   5840  C  CE1   . PHE B 1 33  ? -47.858 -40.327 -36.135 1.00 62.94 ? 33  PHE B CE1   1 
ATOM   5841  C  CE2   . PHE B 1 33  ? -49.925 -39.218 -36.700 1.00 65.01 ? 33  PHE B CE2   1 
ATOM   5842  C  CZ    . PHE B 1 33  ? -49.230 -40.152 -35.943 1.00 64.76 ? 33  PHE B CZ    1 
ATOM   5843  N  N     . VAL B 1 34  ? -45.445 -37.884 -41.700 1.00 61.03 ? 34  VAL B N     1 
ATOM   5844  C  CA    . VAL B 1 34  ? -44.675 -37.251 -42.776 1.00 60.07 ? 34  VAL B CA    1 
ATOM   5845  C  C     . VAL B 1 34  ? -45.130 -37.765 -44.148 1.00 60.97 ? 34  VAL B C     1 
ATOM   5846  O  O     . VAL B 1 34  ? -45.044 -38.958 -44.437 1.00 61.20 ? 34  VAL B O     1 
ATOM   5847  C  CB    . VAL B 1 34  ? -43.148 -37.473 -42.603 1.00 58.86 ? 34  VAL B CB    1 
ATOM   5848  C  CG1   . VAL B 1 34  ? -42.373 -36.967 -43.826 1.00 58.41 ? 34  VAL B CG1   1 
ATOM   5849  C  CG2   . VAL B 1 34  ? -42.648 -36.791 -41.338 1.00 57.50 ? 34  VAL B CG2   1 
ATOM   5850  N  N     . ASP B 1 35  ? -45.607 -36.844 -44.982 1.00 61.33 ? 35  ASP B N     1 
ATOM   5851  C  CA    . ASP B 1 35  ? -46.098 -37.155 -46.323 1.00 62.32 ? 35  ASP B CA    1 
ATOM   5852  C  C     . ASP B 1 35  ? -45.354 -36.290 -47.347 1.00 61.55 ? 35  ASP B C     1 
ATOM   5853  O  O     . ASP B 1 35  ? -45.597 -35.090 -47.430 1.00 61.59 ? 35  ASP B O     1 
ATOM   5854  C  CB    . ASP B 1 35  ? -47.610 -36.888 -46.395 1.00 63.87 ? 35  ASP B CB    1 
ATOM   5855  C  CG    . ASP B 1 35  ? -48.309 -37.714 -47.461 1.00 66.29 ? 35  ASP B CG    1 
ATOM   5856  O  OD1   . ASP B 1 35  ? -49.323 -38.367 -47.127 1.00 69.20 ? 35  ASP B OD1   1 
ATOM   5857  O  OD2   . ASP B 1 35  ? -47.865 -37.711 -48.629 1.00 66.83 ? 35  ASP B OD2   1 
ATOM   5858  N  N     . PRO B 1 36  ? -44.430 -36.897 -48.118 1.00 61.03 ? 36  PRO B N     1 
ATOM   5859  C  CA    . PRO B 1 36  ? -43.697 -36.198 -49.187 1.00 60.72 ? 36  PRO B CA    1 
ATOM   5860  C  C     . PRO B 1 36  ? -44.597 -35.392 -50.142 1.00 61.48 ? 36  PRO B C     1 
ATOM   5861  O  O     . PRO B 1 36  ? -44.290 -34.239 -50.442 1.00 61.35 ? 36  PRO B O     1 
ATOM   5862  C  CB    . PRO B 1 36  ? -43.008 -37.341 -49.940 1.00 60.84 ? 36  PRO B CB    1 
ATOM   5863  C  CG    . PRO B 1 36  ? -42.810 -38.385 -48.900 1.00 60.53 ? 36  PRO B CG    1 
ATOM   5864  C  CD    . PRO B 1 36  ? -44.013 -38.307 -48.007 1.00 60.81 ? 36  PRO B CD    1 
ATOM   5865  N  N     . ALA B 1 37  ? -45.698 -35.991 -50.591 1.00 62.11 ? 37  ALA B N     1 
ATOM   5866  C  CA    . ALA B 1 37  ? -46.647 -35.335 -51.498 1.00 63.01 ? 37  ALA B CA    1 
ATOM   5867  C  C     . ALA B 1 37  ? -47.276 -34.056 -50.934 1.00 62.89 ? 37  ALA B C     1 
ATOM   5868  O  O     . ALA B 1 37  ? -47.744 -33.213 -51.696 1.00 63.45 ? 37  ALA B O     1 
ATOM   5869  C  CB    . ALA B 1 37  ? -47.731 -36.316 -51.928 1.00 64.20 ? 37  ALA B CB    1 
ATOM   5870  N  N     . GLN B 1 38  ? -47.286 -33.924 -49.606 1.00 62.10 ? 38  GLN B N     1 
ATOM   5871  C  CA    . GLN B 1 38  ? -47.756 -32.705 -48.928 1.00 62.08 ? 38  GLN B CA    1 
ATOM   5872  C  C     . GLN B 1 38  ? -46.909 -31.477 -49.249 1.00 61.05 ? 38  GLN B C     1 
ATOM   5873  O  O     . GLN B 1 38  ? -47.437 -30.375 -49.429 1.00 61.73 ? 38  GLN B O     1 
ATOM   5874  C  CB    . GLN B 1 38  ? -47.810 -32.899 -47.405 1.00 61.39 ? 38  GLN B CB    1 
ATOM   5875  C  CG    . GLN B 1 38  ? -49.206 -33.128 -46.868 1.00 63.56 ? 38  GLN B CG    1 
ATOM   5876  C  CD    . GLN B 1 38  ? -50.218 -32.144 -47.449 1.00 65.86 ? 38  GLN B CD    1 
ATOM   5877  O  OE1   . GLN B 1 38  ? -50.140 -30.930 -47.214 1.00 65.68 ? 38  GLN B OE1   1 
ATOM   5878  N  NE2   . GLN B 1 38  ? -51.170 -32.668 -48.217 1.00 66.20 ? 38  GLN B NE2   1 
ATOM   5879  N  N     . ILE B 1 39  ? -45.597 -31.689 -49.299 1.00 59.39 ? 39  ILE B N     1 
ATOM   5880  C  CA    . ILE B 1 39  ? -44.624 -30.654 -49.633 1.00 58.35 ? 39  ILE B CA    1 
ATOM   5881  C  C     . ILE B 1 39  ? -44.736 -30.276 -51.114 1.00 59.27 ? 39  ILE B C     1 
ATOM   5882  O  O     . ILE B 1 39  ? -44.870 -29.103 -51.453 1.00 59.41 ? 39  ILE B O     1 
ATOM   5883  C  CB    . ILE B 1 39  ? -43.187 -31.126 -49.291 1.00 56.69 ? 39  ILE B CB    1 
ATOM   5884  C  CG1   . ILE B 1 39  ? -43.038 -31.301 -47.774 1.00 54.91 ? 39  ILE B CG1   1 
ATOM   5885  C  CG2   . ILE B 1 39  ? -42.142 -30.163 -49.858 1.00 56.08 ? 39  ILE B CG2   1 
ATOM   5886  C  CD1   . ILE B 1 39  ? -41.973 -32.303 -47.359 1.00 51.21 ? 39  ILE B CD1   1 
ATOM   5887  N  N     . THR B 1 40  ? -44.693 -31.287 -51.977 1.00 59.90 ? 40  THR B N     1 
ATOM   5888  C  CA    . THR B 1 40  ? -44.821 -31.124 -53.418 1.00 61.41 ? 40  THR B CA    1 
ATOM   5889  C  C     . THR B 1 40  ? -46.036 -30.266 -53.767 1.00 63.36 ? 40  THR B C     1 
ATOM   5890  O  O     . THR B 1 40  ? -45.990 -29.455 -54.686 1.00 64.30 ? 40  THR B O     1 
ATOM   5891  C  CB    . THR B 1 40  ? -44.979 -32.501 -54.084 1.00 61.92 ? 40  THR B CB    1 
ATOM   5892  O  OG1   . THR B 1 40  ? -43.985 -33.399 -53.573 1.00 59.68 ? 40  THR B OG1   1 
ATOM   5893  C  CG2   . THR B 1 40  ? -44.875 -32.399 -55.614 1.00 62.85 ? 40  THR B CG2   1 
ATOM   5894  N  N     . MET B 1 41  ? -47.106 -30.457 -53.003 1.00 64.37 ? 41  MET B N     1 
ATOM   5895  C  CA    . MET B 1 41  ? -48.393 -29.793 -53.184 1.00 66.68 ? 41  MET B CA    1 
ATOM   5896  C  C     . MET B 1 41  ? -48.311 -28.284 -52.965 1.00 66.40 ? 41  MET B C     1 
ATOM   5897  O  O     . MET B 1 41  ? -48.843 -27.501 -53.756 1.00 67.61 ? 41  MET B O     1 
ATOM   5898  C  CB    . MET B 1 41  ? -49.365 -30.377 -52.169 1.00 66.89 ? 41  MET B CB    1 
ATOM   5899  C  CG    . MET B 1 41  ? -50.715 -30.719 -52.700 1.00 69.15 ? 41  MET B CG    1 
ATOM   5900  S  SD    . MET B 1 41  ? -51.602 -31.692 -51.461 1.00 70.61 ? 41  MET B SD    1 
ATOM   5901  C  CE    . MET B 1 41  ? -50.993 -33.352 -51.796 1.00 69.53 ? 41  MET B CE    1 
ATOM   5902  N  N     . LYS B 1 42  ? -47.655 -27.890 -51.877 1.00 64.99 ? 42  LYS B N     1 
ATOM   5903  C  CA    . LYS B 1 42  ? -47.488 -26.483 -51.531 1.00 64.83 ? 42  LYS B CA    1 
ATOM   5904  C  C     . LYS B 1 42  ? -46.425 -25.795 -52.400 1.00 64.56 ? 42  LYS B C     1 
ATOM   5905  O  O     . LYS B 1 42  ? -46.537 -24.604 -52.690 1.00 65.37 ? 42  LYS B O     1 
ATOM   5906  C  CB    . LYS B 1 42  ? -47.169 -26.333 -50.039 1.00 63.30 ? 42  LYS B CB    1 
ATOM   5907  N  N     . VAL B 1 43  ? -45.408 -26.551 -52.815 1.00 63.70 ? 43  VAL B N     1 
ATOM   5908  C  CA    . VAL B 1 43  ? -44.332 -26.042 -53.677 1.00 63.49 ? 43  VAL B CA    1 
ATOM   5909  C  C     . VAL B 1 43  ? -44.862 -25.691 -55.075 1.00 65.38 ? 43  VAL B C     1 
ATOM   5910  O  O     . VAL B 1 43  ? -44.651 -24.578 -55.561 1.00 65.48 ? 43  VAL B O     1 
ATOM   5911  C  CB    . VAL B 1 43  ? -43.140 -27.048 -53.762 1.00 62.04 ? 43  VAL B CB    1 
ATOM   5912  C  CG1   . VAL B 1 43  ? -42.196 -26.720 -54.915 1.00 61.74 ? 43  VAL B CG1   1 
ATOM   5913  C  CG2   . VAL B 1 43  ? -42.383 -27.078 -52.450 1.00 60.64 ? 43  VAL B CG2   1 
ATOM   5914  N  N     . ILE B 1 44  ? -45.556 -26.639 -55.702 1.00 66.71 ? 44  ILE B N     1 
ATOM   5915  C  CA    . ILE B 1 44  ? -46.107 -26.448 -57.045 1.00 69.39 ? 44  ILE B CA    1 
ATOM   5916  C  C     . ILE B 1 44  ? -47.103 -25.279 -57.117 1.00 71.41 ? 44  ILE B C     1 
ATOM   5917  O  O     . ILE B 1 44  ? -47.260 -24.667 -58.175 1.00 72.76 ? 44  ILE B O     1 
ATOM   5918  C  CB    . ILE B 1 44  ? -46.761 -27.741 -57.595 1.00 69.87 ? 44  ILE B CB    1 
ATOM   5919  C  CG1   . ILE B 1 44  ? -45.699 -28.774 -57.978 1.00 69.23 ? 44  ILE B CG1   1 
ATOM   5920  C  CG2   . ILE B 1 44  ? -47.606 -27.433 -58.810 1.00 72.37 ? 44  ILE B CG2   1 
ATOM   5921  C  CD1   . ILE B 1 44  ? -46.248 -29.988 -58.745 1.00 69.76 ? 44  ILE B CD1   1 
ATOM   5922  N  N     . GLN B 1 45  ? -47.762 -24.978 -55.994 1.00 72.23 ? 45  GLN B N     1 
ATOM   5923  C  CA    . GLN B 1 45  ? -48.727 -23.873 -55.907 1.00 74.48 ? 45  GLN B CA    1 
ATOM   5924  C  C     . GLN B 1 45  ? -48.124 -22.545 -56.368 1.00 75.03 ? 45  GLN B C     1 
ATOM   5925  O  O     . GLN B 1 45  ? -48.477 -22.030 -57.437 1.00 76.77 ? 45  GLN B O     1 
ATOM   5926  C  CB    . GLN B 1 45  ? -49.288 -23.744 -54.480 1.00 74.02 ? 45  GLN B CB    1 
ATOM   5927  C  CG    . GLN B 1 45  ? -50.653 -24.420 -54.256 1.00 75.59 ? 45  GLN B CG    1 
ATOM   5928  C  CD    . GLN B 1 45  ? -50.949 -24.691 -52.778 1.00 74.58 ? 45  GLN B CD    1 
ATOM   5929  O  OE1   . GLN B 1 45  ? -50.758 -23.825 -51.919 1.00 75.11 ? 45  GLN B OE1   1 
ATOM   5930  N  NE2   . GLN B 1 45  ? -51.417 -25.900 -52.481 1.00 74.38 ? 45  GLN B NE2   1 
ATOM   5931  N  N     . GLY B 1 46  ? -47.218 -22.003 -55.557 1.00 74.09 ? 46  GLY B N     1 
ATOM   5932  C  CA    . GLY B 1 46  ? -46.503 -20.774 -55.891 1.00 74.62 ? 46  GLY B CA    1 
ATOM   5933  C  C     . GLY B 1 46  ? -45.178 -21.110 -56.548 1.00 73.99 ? 46  GLY B C     1 
ATOM   5934  O  O     . GLY B 1 46  ? -44.133 -21.161 -55.881 1.00 71.94 ? 46  GLY B O     1 
ATOM   5935  N  N     . LEU B 1 47  ? -45.239 -21.341 -57.862 1.00 75.03 ? 47  LEU B N     1 
ATOM   5936  C  CA    . LEU B 1 47  ? -44.106 -21.825 -58.641 1.00 74.62 ? 47  LEU B CA    1 
ATOM   5937  C  C     . LEU B 1 47  ? -44.264 -21.350 -60.080 1.00 76.53 ? 47  LEU B C     1 
ATOM   5938  O  O     . LEU B 1 47  ? -45.232 -21.720 -60.752 1.00 77.95 ? 47  LEU B O     1 
ATOM   5939  C  CB    . LEU B 1 47  ? -44.080 -23.361 -58.590 1.00 73.78 ? 47  LEU B CB    1 
ATOM   5940  C  CG    . LEU B 1 47  ? -42.801 -24.208 -58.483 1.00 71.88 ? 47  LEU B CG    1 
ATOM   5941  C  CD1   . LEU B 1 47  ? -42.116 -24.343 -59.815 1.00 71.67 ? 47  LEU B CD1   1 
ATOM   5942  C  CD2   . LEU B 1 47  ? -41.835 -23.684 -57.420 1.00 70.40 ? 47  LEU B CD2   1 
ATOM   5943  N  N     . TYR B 1 48  ? -43.334 -20.517 -60.549 1.00 76.84 ? 48  TYR B N     1 
ATOM   5944  C  CA    . TYR B 1 48  ? -43.372 -20.014 -61.935 1.00 78.65 ? 48  TYR B CA    1 
ATOM   5945  C  C     . TYR B 1 48  ? -42.239 -20.608 -62.766 1.00 77.96 ? 48  TYR B C     1 
ATOM   5946  O  O     . TYR B 1 48  ? -41.137 -20.810 -62.253 1.00 76.95 ? 48  TYR B O     1 
ATOM   5947  C  CB    . TYR B 1 48  ? -43.296 -18.481 -61.967 1.00 80.01 ? 48  TYR B CB    1 
ATOM   5948  C  CG    . TYR B 1 48  ? -44.385 -17.774 -61.178 1.00 81.19 ? 48  TYR B CG    1 
ATOM   5949  C  CD1   . TYR B 1 48  ? -44.229 -17.523 -59.806 1.00 80.22 ? 48  TYR B CD1   1 
ATOM   5950  C  CD2   . TYR B 1 48  ? -45.567 -17.347 -61.805 1.00 83.16 ? 48  TYR B CD2   1 
ATOM   5951  C  CE1   . TYR B 1 48  ? -45.222 -16.878 -59.075 1.00 81.02 ? 48  TYR B CE1   1 
ATOM   5952  C  CE2   . TYR B 1 48  ? -46.567 -16.697 -61.084 1.00 83.80 ? 48  TYR B CE2   1 
ATOM   5953  C  CZ    . TYR B 1 48  ? -46.386 -16.467 -59.720 1.00 82.83 ? 48  TYR B CZ    1 
ATOM   5954  O  OH    . TYR B 1 48  ? -47.366 -15.829 -58.995 1.00 83.61 ? 48  TYR B OH    1 
ATOM   5955  N  N     . SER B 1 49  ? -42.502 -20.885 -64.041 1.00 78.63 ? 49  SER B N     1 
ATOM   5956  C  CA    . SER B 1 49  ? -41.489 -21.495 -64.909 1.00 78.14 ? 49  SER B CA    1 
ATOM   5957  C  C     . SER B 1 49  ? -40.340 -20.534 -65.233 1.00 77.88 ? 49  SER B C     1 
ATOM   5958  O  O     . SER B 1 49  ? -40.566 -19.416 -65.699 1.00 79.33 ? 49  SER B O     1 
ATOM   5959  C  CB    . SER B 1 49  ? -42.112 -22.067 -66.189 1.00 79.46 ? 49  SER B CB    1 
ATOM   5960  O  OG    . SER B 1 49  ? -42.582 -21.050 -67.046 1.00 81.81 ? 49  SER B OG    1 
ATOM   5961  N  N     . GLY B 1 50  ? -39.114 -20.997 -64.986 1.00 76.08 ? 50  GLY B N     1 
ATOM   5962  C  CA    . GLY B 1 50  ? -37.903 -20.171 -65.059 1.00 75.00 ? 50  GLY B CA    1 
ATOM   5963  C  C     . GLY B 1 50  ? -37.130 -20.334 -63.763 1.00 72.51 ? 50  GLY B C     1 
ATOM   5964  O  O     . GLY B 1 50  ? -36.005 -19.839 -63.609 1.00 71.95 ? 50  GLY B O     1 
ATOM   5965  N  N     . VAL B 1 51  ? -37.769 -21.027 -62.824 1.00 70.83 ? 51  VAL B N     1 
ATOM   5966  C  CA    . VAL B 1 51  ? -37.191 -21.371 -61.530 1.00 68.33 ? 51  VAL B CA    1 
ATOM   5967  C  C     . VAL B 1 51  ? -36.076 -22.398 -61.753 1.00 67.01 ? 51  VAL B C     1 
ATOM   5968  O  O     . VAL B 1 51  ? -36.178 -23.249 -62.638 1.00 67.24 ? 51  VAL B O     1 
ATOM   5969  C  CB    . VAL B 1 51  ? -38.302 -21.921 -60.567 1.00 67.79 ? 51  VAL B CB    1 
ATOM   5970  C  CG1   . VAL B 1 51  ? -38.941 -23.206 -61.126 1.00 67.80 ? 51  VAL B CG1   1 
ATOM   5971  C  CG2   . VAL B 1 51  ? -37.784 -22.133 -59.141 1.00 65.48 ? 51  VAL B CG2   1 
ATOM   5972  N  N     . THR B 1 52  ? -35.001 -22.289 -60.980 1.00 65.36 ? 52  THR B N     1 
ATOM   5973  C  CA    . THR B 1 52  ? -33.927 -23.280 -61.031 1.00 64.32 ? 52  THR B CA    1 
ATOM   5974  C  C     . THR B 1 52  ? -34.188 -24.374 -59.996 1.00 62.97 ? 52  THR B C     1 
ATOM   5975  O  O     . THR B 1 52  ? -34.931 -24.150 -59.035 1.00 62.26 ? 52  THR B O     1 
ATOM   5976  C  CB    . THR B 1 52  ? -32.531 -22.645 -60.800 1.00 63.91 ? 52  THR B CB    1 
ATOM   5977  O  OG1   . THR B 1 52  ? -32.470 -22.044 -59.497 1.00 62.52 ? 52  THR B OG1   1 
ATOM   5978  C  CG2   . THR B 1 52  ? -32.230 -21.595 -61.869 1.00 65.23 ? 52  THR B CG2   1 
ATOM   5979  N  N     . THR B 1 53  ? -33.588 -25.551 -60.190 1.00 62.53 ? 53  THR B N     1 
ATOM   5980  C  CA    . THR B 1 53  ? -33.715 -26.639 -59.212 1.00 61.44 ? 53  THR B CA    1 
ATOM   5981  C  C     . THR B 1 53  ? -33.165 -26.255 -57.840 1.00 60.03 ? 53  THR B C     1 
ATOM   5982  O  O     . THR B 1 53  ? -33.691 -26.695 -56.822 1.00 59.31 ? 53  THR B O     1 
ATOM   5983  C  CB    . THR B 1 53  ? -33.099 -27.992 -59.685 1.00 61.36 ? 53  THR B CB    1 
ATOM   5984  O  OG1   . THR B 1 53  ? -31.835 -27.768 -60.316 1.00 62.24 ? 53  THR B OG1   1 
ATOM   5985  C  CG2   . THR B 1 53  ? -34.027 -28.704 -60.662 1.00 62.25 ? 53  THR B CG2   1 
ATOM   5986  N  N     . VAL B 1 54  ? -32.131 -25.418 -57.805 1.00 59.84 ? 54  VAL B N     1 
ATOM   5987  C  CA    . VAL B 1 54  ? -31.621 -24.921 -56.519 1.00 58.65 ? 54  VAL B CA    1 
ATOM   5988  C  C     . VAL B 1 54  ? -32.680 -24.060 -55.807 1.00 58.49 ? 54  VAL B C     1 
ATOM   5989  O  O     . VAL B 1 54  ? -32.851 -24.156 -54.587 1.00 57.47 ? 54  VAL B O     1 
ATOM   5990  C  CB    . VAL B 1 54  ? -30.210 -24.227 -56.629 1.00 58.41 ? 54  VAL B CB    1 
ATOM   5991  C  CG1   . VAL B 1 54  ? -30.110 -23.335 -57.851 1.00 60.83 ? 54  VAL B CG1   1 
ATOM   5992  C  CG2   . VAL B 1 54  ? -29.865 -23.452 -55.364 1.00 57.44 ? 54  VAL B CG2   1 
ATOM   5993  N  N     . GLU B 1 55  ? -33.402 -23.250 -56.579 1.00 59.66 ? 55  GLU B N     1 
ATOM   5994  C  CA    . GLU B 1 55  ? -34.523 -22.471 -56.050 1.00 59.91 ? 55  GLU B CA    1 
ATOM   5995  C  C     . GLU B 1 55  ? -35.665 -23.395 -55.605 1.00 59.27 ? 55  GLU B C     1 
ATOM   5996  O  O     . GLU B 1 55  ? -36.212 -23.230 -54.509 1.00 58.86 ? 55  GLU B O     1 
ATOM   5997  C  CB    . GLU B 1 55  ? -35.016 -21.452 -57.082 1.00 61.38 ? 55  GLU B CB    1 
ATOM   5998  C  CG    . GLU B 1 55  ? -34.148 -20.211 -57.202 1.00 61.95 ? 55  GLU B CG    1 
ATOM   5999  C  CD    . GLU B 1 55  ? -34.477 -19.362 -58.428 1.00 64.24 ? 55  GLU B CD    1 
ATOM   6000  O  OE1   . GLU B 1 55  ? -33.729 -18.392 -58.684 1.00 66.29 ? 55  GLU B OE1   1 
ATOM   6001  O  OE2   . GLU B 1 55  ? -35.469 -19.647 -59.140 1.00 65.28 ? 55  GLU B OE2   1 
ATOM   6002  N  N     . LEU B 1 56  ? -35.993 -24.372 -56.450 1.00 59.14 ? 56  LEU B N     1 
ATOM   6003  C  CA    . LEU B 1 56  ? -36.996 -25.389 -56.151 1.00 58.52 ? 56  LEU B CA    1 
ATOM   6004  C  C     . LEU B 1 56  ? -36.682 -26.105 -54.841 1.00 56.77 ? 56  LEU B C     1 
ATOM   6005  O  O     . LEU B 1 56  ? -37.556 -26.240 -53.983 1.00 56.27 ? 56  LEU B O     1 
ATOM   6006  C  CB    . LEU B 1 56  ? -37.065 -26.403 -57.297 1.00 59.40 ? 56  LEU B CB    1 
ATOM   6007  C  CG    . LEU B 1 56  ? -38.271 -27.315 -57.579 1.00 60.21 ? 56  LEU B CG    1 
ATOM   6008  C  CD1   . LEU B 1 56  ? -38.542 -28.286 -56.446 1.00 60.42 ? 56  LEU B CD1   1 
ATOM   6009  C  CD2   . LEU B 1 56  ? -39.523 -26.516 -57.931 1.00 62.26 ? 56  LEU B CD2   1 
ATOM   6010  N  N     . ASP B 1 57  ? -35.435 -26.556 -54.696 1.00 55.75 ? 57  ASP B N     1 
ATOM   6011  C  CA    . ASP B 1 57  ? -34.980 -27.256 -53.492 1.00 54.46 ? 57  ASP B CA    1 
ATOM   6012  C  C     . ASP B 1 57  ? -35.123 -26.379 -52.258 1.00 53.37 ? 57  ASP B C     1 
ATOM   6013  O  O     . ASP B 1 57  ? -35.583 -26.844 -51.215 1.00 52.59 ? 57  ASP B O     1 
ATOM   6014  C  CB    . ASP B 1 57  ? -33.523 -27.712 -53.635 1.00 54.25 ? 57  ASP B CB    1 
ATOM   6015  C  CG    . ASP B 1 57  ? -33.368 -28.952 -54.522 1.00 55.99 ? 57  ASP B CG    1 
ATOM   6016  O  OD1   . ASP B 1 57  ? -34.242 -29.212 -55.374 1.00 57.15 ? 57  ASP B OD1   1 
ATOM   6017  O  OD2   . ASP B 1 57  ? -32.353 -29.673 -54.365 1.00 58.06 ? 57  ASP B OD2   1 
ATOM   6018  N  N     . THR B 1 58  ? -34.734 -25.111 -52.395 1.00 53.40 ? 58  THR B N     1 
ATOM   6019  C  CA    . THR B 1 58  ? -34.802 -24.129 -51.311 1.00 52.86 ? 58  THR B CA    1 
ATOM   6020  C  C     . THR B 1 58  ? -36.244 -23.943 -50.860 1.00 52.79 ? 58  THR B C     1 
ATOM   6021  O  O     . THR B 1 58  ? -36.532 -23.932 -49.664 1.00 52.30 ? 58  THR B O     1 
ATOM   6022  C  CB    . THR B 1 58  ? -34.204 -22.761 -51.738 1.00 53.60 ? 58  THR B CB    1 
ATOM   6023  O  OG1   . THR B 1 58  ? -32.853 -22.942 -52.190 1.00 53.57 ? 58  THR B OG1   1 
ATOM   6024  C  CG2   . THR B 1 58  ? -34.220 -21.767 -50.575 1.00 53.26 ? 58  THR B CG2   1 
ATOM   6025  N  N     . LEU B 1 59  ? -37.137 -23.810 -51.834 1.00 53.67 ? 59  LEU B N     1 
ATOM   6026  C  CA    . LEU B 1 59  ? -38.568 -23.691 -51.595 1.00 53.93 ? 59  LEU B CA    1 
ATOM   6027  C  C     . LEU B 1 59  ? -39.098 -24.927 -50.866 1.00 52.55 ? 59  LEU B C     1 
ATOM   6028  O  O     . LEU B 1 59  ? -39.810 -24.809 -49.869 1.00 52.28 ? 59  LEU B O     1 
ATOM   6029  C  CB    . LEU B 1 59  ? -39.298 -23.529 -52.933 1.00 55.63 ? 59  LEU B CB    1 
ATOM   6030  C  CG    . LEU B 1 59  ? -40.466 -22.553 -53.096 1.00 58.61 ? 59  LEU B CG    1 
ATOM   6031  C  CD1   . LEU B 1 59  ? -41.429 -22.549 -51.891 1.00 59.54 ? 59  LEU B CD1   1 
ATOM   6032  C  CD2   . LEU B 1 59  ? -39.938 -21.143 -53.384 1.00 60.05 ? 59  LEU B CD2   1 
ATOM   6033  N  N     . ALA B 1 60  ? -38.744 -26.106 -51.372 1.00 51.63 ? 60  ALA B N     1 
ATOM   6034  C  CA    . ALA B 1 60  ? -39.172 -27.373 -50.785 1.00 50.75 ? 60  ALA B CA    1 
ATOM   6035  C  C     . ALA B 1 60  ? -38.666 -27.560 -49.347 1.00 49.39 ? 60  ALA B C     1 
ATOM   6036  O  O     . ALA B 1 60  ? -39.404 -28.052 -48.486 1.00 48.92 ? 60  ALA B O     1 
ATOM   6037  C  CB    . ALA B 1 60  ? -38.756 -28.539 -51.672 1.00 50.55 ? 60  ALA B CB    1 
ATOM   6038  N  N     . ALA B 1 61  ? -37.421 -27.156 -49.088 1.00 48.60 ? 61  ALA B N     1 
ATOM   6039  C  CA    . ALA B 1 61  ? -36.873 -27.186 -47.726 1.00 47.78 ? 61  ALA B CA    1 
ATOM   6040  C  C     . ALA B 1 61  ? -37.611 -26.214 -46.796 1.00 47.78 ? 61  ALA B C     1 
ATOM   6041  O  O     . ALA B 1 61  ? -37.948 -26.570 -45.669 1.00 47.13 ? 61  ALA B O     1 
ATOM   6042  C  CB    . ALA B 1 61  ? -35.370 -26.903 -47.734 1.00 46.98 ? 61  ALA B CB    1 
ATOM   6043  N  N     . GLU B 1 62  ? -37.877 -25.003 -47.283 1.00 48.70 ? 62  GLU B N     1 
ATOM   6044  C  CA    . GLU B 1 62  ? -38.592 -23.998 -46.505 1.00 49.55 ? 62  GLU B CA    1 
ATOM   6045  C  C     . GLU B 1 62  ? -40.049 -24.398 -46.250 1.00 50.66 ? 62  GLU B C     1 
ATOM   6046  O  O     . GLU B 1 62  ? -40.618 -24.049 -45.217 1.00 50.67 ? 62  GLU B O     1 
ATOM   6047  C  CB    . GLU B 1 62  ? -38.516 -22.638 -47.187 1.00 50.55 ? 62  GLU B CB    1 
ATOM   6048  N  N     . THR B 1 63  ? -40.637 -25.136 -47.192 1.00 51.84 ? 63  THR B N     1 
ATOM   6049  C  CA    . THR B 1 63  ? -42.004 -25.635 -47.062 1.00 52.87 ? 63  THR B CA    1 
ATOM   6050  C  C     . THR B 1 63  ? -42.091 -26.793 -46.062 1.00 52.48 ? 63  THR B C     1 
ATOM   6051  O  O     . THR B 1 63  ? -42.955 -26.792 -45.180 1.00 52.66 ? 63  THR B O     1 
ATOM   6052  C  CB    . THR B 1 63  ? -42.580 -26.049 -48.433 1.00 54.10 ? 63  THR B CB    1 
ATOM   6053  O  OG1   . THR B 1 63  ? -42.589 -24.908 -49.301 1.00 54.86 ? 63  THR B OG1   1 
ATOM   6054  C  CG2   . THR B 1 63  ? -44.003 -26.603 -48.296 1.00 54.18 ? 63  THR B CG2   1 
ATOM   6055  N  N     . ALA B 1 64  ? -41.194 -27.767 -46.201 1.00 52.19 ? 64  ALA B N     1 
ATOM   6056  C  CA    . ALA B 1 64  ? -41.067 -28.863 -45.231 1.00 52.12 ? 64  ALA B CA    1 
ATOM   6057  C  C     . ALA B 1 64  ? -40.964 -28.364 -43.788 1.00 51.74 ? 64  ALA B C     1 
ATOM   6058  O  O     . ALA B 1 64  ? -41.513 -28.987 -42.875 1.00 51.89 ? 64  ALA B O     1 
ATOM   6059  C  CB    . ALA B 1 64  ? -39.873 -29.750 -45.573 1.00 51.07 ? 64  ALA B CB    1 
ATOM   6060  N  N     . ALA B 1 65  ? -40.277 -27.233 -43.601 1.00 51.91 ? 65  ALA B N     1 
ATOM   6061  C  CA    . ALA B 1 65  ? -40.029 -26.657 -42.274 1.00 51.37 ? 65  ALA B CA    1 
ATOM   6062  C  C     . ALA B 1 65  ? -41.226 -25.912 -41.683 1.00 52.58 ? 65  ALA B C     1 
ATOM   6063  O  O     . ALA B 1 65  ? -41.293 -25.726 -40.469 1.00 52.30 ? 65  ALA B O     1 
ATOM   6064  C  CB    . ALA B 1 65  ? -38.814 -25.760 -42.303 1.00 50.41 ? 65  ALA B CB    1 
ATOM   6065  N  N     . THR B 1 66  ? -42.162 -25.467 -42.516 1.00 54.39 ? 66  THR B N     1 
ATOM   6066  C  CA    . THR B 1 66  ? -43.401 -24.898 -41.973 1.00 56.00 ? 66  THR B CA    1 
ATOM   6067  C  C     . THR B 1 66  ? -44.356 -26.007 -41.533 1.00 56.57 ? 66  THR B C     1 
ATOM   6068  O  O     . THR B 1 66  ? -45.309 -25.759 -40.789 1.00 57.68 ? 66  THR B O     1 
ATOM   6069  C  CB    . THR B 1 66  ? -44.117 -23.913 -42.935 1.00 57.15 ? 66  THR B CB    1 
ATOM   6070  O  OG1   . THR B 1 66  ? -44.272 -24.515 -44.224 1.00 59.11 ? 66  THR B OG1   1 
ATOM   6071  C  CG2   . THR B 1 66  ? -43.323 -22.628 -43.077 1.00 57.17 ? 66  THR B CG2   1 
ATOM   6072  N  N     . LEU B 1 67  ? -44.082 -27.229 -41.986 1.00 56.38 ? 67  LEU B N     1 
ATOM   6073  C  CA    . LEU B 1 67  ? -44.873 -28.404 -41.615 1.00 56.60 ? 67  LEU B CA    1 
ATOM   6074  C  C     . LEU B 1 67  ? -44.317 -29.107 -40.359 1.00 55.48 ? 67  LEU B C     1 
ATOM   6075  O  O     . LEU B 1 67  ? -44.775 -30.189 -39.987 1.00 55.36 ? 67  LEU B O     1 
ATOM   6076  C  CB    . LEU B 1 67  ? -44.998 -29.364 -42.810 1.00 57.15 ? 67  LEU B CB    1 
ATOM   6077  C  CG    . LEU B 1 67  ? -46.212 -29.271 -43.762 1.00 58.93 ? 67  LEU B CG    1 
ATOM   6078  C  CD1   . LEU B 1 67  ? -46.747 -27.856 -43.947 1.00 60.05 ? 67  LEU B CD1   1 
ATOM   6079  C  CD2   . LEU B 1 67  ? -45.880 -29.895 -45.113 1.00 58.83 ? 67  LEU B CD2   1 
ATOM   6080  N  N     . THR B 1 68  ? -43.344 -28.468 -39.706 1.00 54.49 ? 68  THR B N     1 
ATOM   6081  C  CA    . THR B 1 68  ? -42.823 -28.920 -38.411 1.00 53.83 ? 68  THR B CA    1 
ATOM   6082  C  C     . THR B 1 68  ? -43.933 -28.964 -37.369 1.00 54.46 ? 68  THR B C     1 
ATOM   6083  O  O     . THR B 1 68  ? -43.931 -29.819 -36.477 1.00 54.16 ? 68  THR B O     1 
ATOM   6084  C  CB    . THR B 1 68  ? -41.706 -27.997 -37.879 1.00 52.73 ? 68  THR B CB    1 
ATOM   6085  O  OG1   . THR B 1 68  ? -40.686 -27.870 -38.873 1.00 53.66 ? 68  THR B OG1   1 
ATOM   6086  C  CG2   . THR B 1 68  ? -41.079 -28.574 -36.626 1.00 51.41 ? 68  THR B CG2   1 
ATOM   6087  N  N     . THR B 1 69  ? -44.884 -28.045 -37.499 1.00 55.38 ? 69  THR B N     1 
ATOM   6088  C  CA    . THR B 1 69  ? -46.024 -27.987 -36.596 1.00 56.23 ? 69  THR B CA    1 
ATOM   6089  C  C     . THR B 1 69  ? -47.065 -29.086 -36.868 1.00 57.01 ? 69  THR B C     1 
ATOM   6090  O  O     . THR B 1 69  ? -48.058 -29.190 -36.150 1.00 58.06 ? 69  THR B O     1 
ATOM   6091  C  CB    . THR B 1 69  ? -46.672 -26.581 -36.597 1.00 57.11 ? 69  THR B CB    1 
ATOM   6092  O  OG1   . THR B 1 69  ? -47.046 -26.222 -37.931 1.00 58.63 ? 69  THR B OG1   1 
ATOM   6093  C  CG2   . THR B 1 69  ? -45.691 -25.559 -36.080 1.00 55.81 ? 69  THR B CG2   1 
ATOM   6094  N  N     . LYS B 1 70  ? -46.830 -29.910 -37.891 1.00 56.71 ? 70  LYS B N     1 
ATOM   6095  C  CA    . LYS B 1 70  ? -47.653 -31.101 -38.138 1.00 57.29 ? 70  LYS B CA    1 
ATOM   6096  C  C     . LYS B 1 70  ? -46.968 -32.358 -37.581 1.00 56.23 ? 70  LYS B C     1 
ATOM   6097  O  O     . LYS B 1 70  ? -47.617 -33.241 -37.026 1.00 56.72 ? 70  LYS B O     1 
ATOM   6098  C  CB    . LYS B 1 70  ? -47.962 -31.252 -39.633 1.00 58.07 ? 70  LYS B CB    1 
ATOM   6099  N  N     . HIS B 1 71  ? -45.650 -32.426 -37.743 1.00 54.87 ? 71  HIS B N     1 
ATOM   6100  C  CA    . HIS B 1 71  ? -44.818 -33.457 -37.119 1.00 53.73 ? 71  HIS B CA    1 
ATOM   6101  C  C     . HIS B 1 71  ? -43.368 -32.999 -37.157 1.00 52.10 ? 71  HIS B C     1 
ATOM   6102  O  O     . HIS B 1 71  ? -42.927 -32.462 -38.178 1.00 52.01 ? 71  HIS B O     1 
ATOM   6103  C  CB    . HIS B 1 71  ? -44.959 -34.806 -37.831 1.00 54.38 ? 71  HIS B CB    1 
ATOM   6104  C  CG    . HIS B 1 71  ? -44.423 -35.959 -37.040 1.00 53.90 ? 71  HIS B CG    1 
ATOM   6105  N  ND1   . HIS B 1 71  ? -43.079 -36.262 -36.984 1.00 52.47 ? 71  HIS B ND1   1 
ATOM   6106  C  CD2   . HIS B 1 71  ? -45.048 -36.875 -36.262 1.00 54.03 ? 71  HIS B CD2   1 
ATOM   6107  C  CE1   . HIS B 1 71  ? -42.899 -37.318 -36.212 1.00 52.08 ? 71  HIS B CE1   1 
ATOM   6108  N  NE2   . HIS B 1 71  ? -44.077 -37.710 -35.762 1.00 53.68 ? 71  HIS B NE2   1 
ATOM   6109  N  N     . PRO B 1 72  ? -42.617 -33.208 -36.054 1.00 50.91 ? 72  PRO B N     1 
ATOM   6110  C  CA    . PRO B 1 72  ? -41.229 -32.722 -35.992 1.00 49.28 ? 72  PRO B CA    1 
ATOM   6111  C  C     . PRO B 1 72  ? -40.280 -33.336 -37.024 1.00 48.61 ? 72  PRO B C     1 
ATOM   6112  O  O     . PRO B 1 72  ? -39.268 -32.723 -37.344 1.00 47.88 ? 72  PRO B O     1 
ATOM   6113  C  CB    . PRO B 1 72  ? -40.783 -33.078 -34.566 1.00 48.49 ? 72  PRO B CB    1 
ATOM   6114  C  CG    . PRO B 1 72  ? -41.701 -34.152 -34.133 1.00 49.64 ? 72  PRO B CG    1 
ATOM   6115  C  CD    . PRO B 1 72  ? -43.013 -33.883 -34.804 1.00 51.06 ? 72  PRO B CD    1 
ATOM   6116  N  N     . ASP B 1 73  ? -40.603 -34.520 -37.544 1.00 49.05 ? 73  ASP B N     1 
ATOM   6117  C  CA    . ASP B 1 73  ? -39.755 -35.188 -38.544 1.00 48.90 ? 73  ASP B CA    1 
ATOM   6118  C  C     . ASP B 1 73  ? -39.681 -34.395 -39.856 1.00 48.98 ? 73  ASP B C     1 
ATOM   6119  O  O     . ASP B 1 73  ? -38.712 -34.525 -40.613 1.00 48.59 ? 73  ASP B O     1 
ATOM   6120  C  CB    . ASP B 1 73  ? -40.235 -36.624 -38.805 1.00 50.05 ? 73  ASP B CB    1 
ATOM   6121  C  CG    . ASP B 1 73  ? -39.741 -37.628 -37.758 1.00 50.27 ? 73  ASP B CG    1 
ATOM   6122  O  OD1   . ASP B 1 73  ? -39.973 -38.839 -37.954 1.00 52.19 ? 73  ASP B OD1   1 
ATOM   6123  O  OD2   . ASP B 1 73  ? -39.128 -37.228 -36.748 1.00 50.03 ? 73  ASP B OD2   1 
ATOM   6124  N  N     . TYR B 1 74  ? -40.707 -33.578 -40.107 1.00 49.19 ? 74  TYR B N     1 
ATOM   6125  C  CA    . TYR B 1 74  ? -40.701 -32.597 -41.195 1.00 49.37 ? 74  TYR B CA    1 
ATOM   6126  C  C     . TYR B 1 74  ? -39.517 -31.615 -41.137 1.00 48.73 ? 74  TYR B C     1 
ATOM   6127  O  O     . TYR B 1 74  ? -38.993 -31.214 -42.184 1.00 48.90 ? 74  TYR B O     1 
ATOM   6128  C  CB    . TYR B 1 74  ? -42.005 -31.801 -41.206 1.00 49.99 ? 74  TYR B CB    1 
ATOM   6129  C  CG    . TYR B 1 74  ? -43.139 -32.433 -41.980 1.00 50.76 ? 74  TYR B CG    1 
ATOM   6130  C  CD1   . TYR B 1 74  ? -44.303 -32.855 -41.332 1.00 51.00 ? 74  TYR B CD1   1 
ATOM   6131  C  CD2   . TYR B 1 74  ? -43.059 -32.593 -43.367 1.00 51.21 ? 74  TYR B CD2   1 
ATOM   6132  C  CE1   . TYR B 1 74  ? -45.360 -33.417 -42.046 1.00 52.22 ? 74  TYR B CE1   1 
ATOM   6133  C  CE2   . TYR B 1 74  ? -44.110 -33.163 -44.096 1.00 51.96 ? 74  TYR B CE2   1 
ATOM   6134  C  CZ    . TYR B 1 74  ? -45.255 -33.571 -43.427 1.00 53.08 ? 74  TYR B CZ    1 
ATOM   6135  O  OH    . TYR B 1 74  ? -46.292 -34.129 -44.142 1.00 54.31 ? 74  TYR B OH    1 
ATOM   6136  N  N     . ALA B 1 75  ? -39.105 -31.221 -39.928 1.00 47.49 ? 75  ALA B N     1 
ATOM   6137  C  CA    . ALA B 1 75  ? -37.959 -30.318 -39.782 1.00 46.67 ? 75  ALA B CA    1 
ATOM   6138  C  C     . ALA B 1 75  ? -36.659 -31.019 -40.163 1.00 46.11 ? 75  ALA B C     1 
ATOM   6139  O  O     . ALA B 1 75  ? -35.763 -30.403 -40.748 1.00 46.03 ? 75  ALA B O     1 
ATOM   6140  C  CB    . ALA B 1 75  ? -37.878 -29.753 -38.373 1.00 45.77 ? 75  ALA B CB    1 
ATOM   6141  N  N     . ILE B 1 76  ? -36.564 -32.305 -39.826 1.00 46.14 ? 76  ILE B N     1 
ATOM   6142  C  CA    . ILE B 1 76  ? -35.425 -33.144 -40.220 1.00 45.54 ? 76  ILE B CA    1 
ATOM   6143  C  C     . ILE B 1 76  ? -35.401 -33.283 -41.745 1.00 45.97 ? 76  ILE B C     1 
ATOM   6144  O  O     . ILE B 1 76  ? -34.362 -33.061 -42.373 1.00 45.92 ? 76  ILE B O     1 
ATOM   6145  C  CB    . ILE B 1 76  ? -35.474 -34.552 -39.558 1.00 45.42 ? 76  ILE B CB    1 
ATOM   6146  C  CG1   . ILE B 1 76  ? -35.481 -34.449 -38.024 1.00 44.94 ? 76  ILE B CG1   1 
ATOM   6147  C  CG2   . ILE B 1 76  ? -34.343 -35.450 -40.090 1.00 44.71 ? 76  ILE B CG2   1 
ATOM   6148  C  CD1   . ILE B 1 76  ? -34.142 -34.080 -37.396 1.00 46.27 ? 76  ILE B CD1   1 
ATOM   6149  N  N     . LEU B 1 77  ? -36.550 -33.625 -42.328 1.00 46.44 ? 77  LEU B N     1 
ATOM   6150  C  CA    . LEU B 1 77  ? -36.688 -33.718 -43.786 1.00 47.17 ? 77  LEU B CA    1 
ATOM   6151  C  C     . LEU B 1 77  ? -36.302 -32.427 -44.512 1.00 47.13 ? 77  LEU B C     1 
ATOM   6152  O  O     . LEU B 1 77  ? -35.631 -32.476 -45.547 1.00 47.59 ? 77  LEU B O     1 
ATOM   6153  C  CB    . LEU B 1 77  ? -38.105 -34.163 -44.182 1.00 48.07 ? 77  LEU B CB    1 
ATOM   6154  C  CG    . LEU B 1 77  ? -38.421 -34.415 -45.664 1.00 49.08 ? 77  LEU B CG    1 
ATOM   6155  C  CD1   . LEU B 1 77  ? -37.408 -35.338 -46.355 1.00 48.11 ? 77  LEU B CD1   1 
ATOM   6156  C  CD2   . LEU B 1 77  ? -39.841 -34.955 -45.820 1.00 49.88 ? 77  LEU B CD2   1 
ATOM   6157  N  N     . ALA B 1 78  ? -36.726 -31.284 -43.975 1.00 46.83 ? 78  ALA B N     1 
ATOM   6158  C  CA    . ALA B 1 78  ? -36.329 -29.985 -44.516 1.00 47.31 ? 78  ALA B CA    1 
ATOM   6159  C  C     . ALA B 1 78  ? -34.797 -29.818 -44.576 1.00 46.94 ? 78  ALA B C     1 
ATOM   6160  O  O     . ALA B 1 78  ? -34.261 -29.333 -45.574 1.00 47.30 ? 78  ALA B O     1 
ATOM   6161  C  CB    . ALA B 1 78  ? -36.964 -28.860 -43.717 1.00 47.09 ? 78  ALA B CB    1 
ATOM   6162  N  N     . ALA B 1 79  ? -34.104 -30.224 -43.509 1.00 46.37 ? 79  ALA B N     1 
ATOM   6163  C  CA    . ALA B 1 79  ? -32.635 -30.182 -43.475 1.00 46.16 ? 79  ALA B CA    1 
ATOM   6164  C  C     . ALA B 1 79  ? -32.039 -31.153 -44.483 1.00 46.56 ? 79  ALA B C     1 
ATOM   6165  O  O     . ALA B 1 79  ? -31.088 -30.805 -45.181 1.00 46.46 ? 79  ALA B O     1 
ATOM   6166  C  CB    . ALA B 1 79  ? -32.104 -30.482 -42.081 1.00 45.09 ? 79  ALA B CB    1 
ATOM   6167  N  N     . ARG B 1 80  ? -32.609 -32.361 -44.541 1.00 46.95 ? 80  ARG B N     1 
ATOM   6168  C  CA    . ARG B 1 80  ? -32.247 -33.382 -45.541 1.00 47.85 ? 80  ARG B CA    1 
ATOM   6169  C  C     . ARG B 1 80  ? -32.311 -32.849 -46.987 1.00 48.33 ? 80  ARG B C     1 
ATOM   6170  O  O     . ARG B 1 80  ? -31.400 -33.097 -47.775 1.00 48.56 ? 80  ARG B O     1 
ATOM   6171  C  CB    . ARG B 1 80  ? -33.109 -34.652 -45.376 1.00 48.31 ? 80  ARG B CB    1 
ATOM   6172  C  CG    . ARG B 1 80  ? -32.973 -35.340 -44.023 1.00 48.26 ? 80  ARG B CG    1 
ATOM   6173  C  CD    . ARG B 1 80  ? -32.261 -36.681 -44.101 1.00 50.96 ? 80  ARG B CD    1 
ATOM   6174  N  NE    . ARG B 1 80  ? -33.184 -37.807 -43.943 1.00 53.57 ? 80  ARG B NE    1 
ATOM   6175  C  CZ    . ARG B 1 80  ? -33.412 -38.463 -42.803 1.00 53.80 ? 80  ARG B CZ    1 
ATOM   6176  N  NH1   . ARG B 1 80  ? -32.777 -38.142 -41.682 1.00 52.87 ? 80  ARG B NH1   1 
ATOM   6177  N  NH2   . ARG B 1 80  ? -34.286 -39.458 -42.787 1.00 55.35 ? 80  ARG B NH2   1 
ATOM   6178  N  N     . ILE B 1 81  ? -33.368 -32.105 -47.320 1.00 48.81 ? 81  ILE B N     1 
ATOM   6179  C  CA    . ILE B 1 81  ? -33.486 -31.449 -48.640 1.00 49.56 ? 81  ILE B CA    1 
ATOM   6180  C  C     . ILE B 1 81  ? -32.407 -30.372 -48.856 1.00 49.33 ? 81  ILE B C     1 
ATOM   6181  O  O     . ILE B 1 81  ? -31.753 -30.330 -49.909 1.00 49.58 ? 81  ILE B O     1 
ATOM   6182  C  CB    . ILE B 1 81  ? -34.889 -30.822 -48.852 1.00 50.41 ? 81  ILE B CB    1 
ATOM   6183  C  CG1   . ILE B 1 81  ? -35.971 -31.910 -48.878 1.00 50.88 ? 81  ILE B CG1   1 
ATOM   6184  C  CG2   . ILE B 1 81  ? -34.916 -29.960 -50.127 1.00 51.02 ? 81  ILE B CG2   1 
ATOM   6185  C  CD1   . ILE B 1 81  ? -37.386 -31.380 -48.709 1.00 51.30 ? 81  ILE B CD1   1 
ATOM   6186  N  N     . ALA B 1 82  ? -32.234 -29.503 -47.858 1.00 48.59 ? 82  ALA B N     1 
ATOM   6187  C  CA    . ALA B 1 82  ? -31.204 -28.462 -47.907 1.00 48.42 ? 82  ALA B CA    1 
ATOM   6188  C  C     . ALA B 1 82  ? -29.794 -29.051 -48.099 1.00 47.98 ? 82  ALA B C     1 
ATOM   6189  O  O     . ALA B 1 82  ? -29.039 -28.603 -48.964 1.00 47.96 ? 82  ALA B O     1 
ATOM   6190  C  CB    . ALA B 1 82  ? -31.271 -27.586 -46.656 1.00 47.49 ? 82  ALA B CB    1 
ATOM   6191  N  N     . VAL B 1 83  ? -29.469 -30.071 -47.304 1.00 47.47 ? 83  VAL B N     1 
ATOM   6192  C  CA    . VAL B 1 83  ? -28.152 -30.722 -47.340 1.00 47.66 ? 83  VAL B CA    1 
ATOM   6193  C  C     . VAL B 1 83  ? -27.927 -31.441 -48.673 1.00 48.75 ? 83  VAL B C     1 
ATOM   6194  O  O     . VAL B 1 83  ? -26.829 -31.392 -49.244 1.00 48.79 ? 83  VAL B O     1 
ATOM   6195  C  CB    . VAL B 1 83  ? -27.964 -31.690 -46.151 1.00 46.62 ? 83  VAL B CB    1 
ATOM   6196  C  CG1   . VAL B 1 83  ? -26.737 -32.542 -46.340 1.00 47.80 ? 83  VAL B CG1   1 
ATOM   6197  C  CG2   . VAL B 1 83  ? -27.846 -30.923 -44.861 1.00 46.14 ? 83  VAL B CG2   1 
ATOM   6198  N  N     . SER B 1 84  ? -28.980 -32.096 -49.158 1.00 49.54 ? 84  SER B N     1 
ATOM   6199  C  CA    . SER B 1 84  ? -28.973 -32.727 -50.468 1.00 50.84 ? 84  SER B CA    1 
ATOM   6200  C  C     . SER B 1 84  ? -28.518 -31.703 -51.502 1.00 51.50 ? 84  SER B C     1 
ATOM   6201  O  O     . SER B 1 84  ? -27.647 -31.988 -52.321 1.00 51.92 ? 84  SER B O     1 
ATOM   6202  C  CB    . SER B 1 84  ? -30.368 -33.266 -50.803 1.00 51.57 ? 84  SER B CB    1 
ATOM   6203  O  OG    . SER B 1 84  ? -30.406 -33.837 -52.097 1.00 53.50 ? 84  SER B OG    1 
ATOM   6204  N  N     . ASN B 1 85  ? -29.091 -30.501 -51.429 1.00 51.74 ? 85  ASN B N     1 
ATOM   6205  C  CA    . ASN B 1 85  ? -28.700 -29.399 -52.306 1.00 52.46 ? 85  ASN B CA    1 
ATOM   6206  C  C     . ASN B 1 85  ? -27.271 -28.947 -52.050 1.00 51.91 ? 85  ASN B C     1 
ATOM   6207  O  O     . ASN B 1 85  ? -26.512 -28.728 -52.991 1.00 52.88 ? 85  ASN B O     1 
ATOM   6208  C  CB    . ASN B 1 85  ? -29.665 -28.215 -52.178 1.00 52.73 ? 85  ASN B CB    1 
ATOM   6209  C  CG    . ASN B 1 85  ? -29.362 -27.107 -53.166 1.00 53.87 ? 85  ASN B CG    1 
ATOM   6210  O  OD1   . ASN B 1 85  ? -29.476 -27.294 -54.378 1.00 54.68 ? 85  ASN B OD1   1 
ATOM   6211  N  ND2   . ASN B 1 85  ? -28.972 -25.942 -52.653 1.00 54.10 ? 85  ASN B ND2   1 
ATOM   6212  N  N     . LEU B 1 86  ? -26.905 -28.823 -50.777 1.00 51.02 ? 86  LEU B N     1 
ATOM   6213  C  CA    . LEU B 1 86  ? -25.549 -28.438 -50.399 1.00 50.45 ? 86  LEU B CA    1 
ATOM   6214  C  C     . LEU B 1 86  ? -24.503 -29.415 -50.924 1.00 50.77 ? 86  LEU B C     1 
ATOM   6215  O  O     . LEU B 1 86  ? -23.450 -28.990 -51.383 1.00 51.25 ? 86  LEU B O     1 
ATOM   6216  C  CB    . LEU B 1 86  ? -25.412 -28.280 -48.886 1.00 49.42 ? 86  LEU B CB    1 
ATOM   6217  C  CG    . LEU B 1 86  ? -24.010 -27.906 -48.385 1.00 48.89 ? 86  LEU B CG    1 
ATOM   6218  C  CD1   . LEU B 1 86  ? -23.547 -26.550 -48.937 1.00 47.67 ? 86  LEU B CD1   1 
ATOM   6219  C  CD2   . LEU B 1 86  ? -23.966 -27.933 -46.865 1.00 47.62 ? 86  LEU B CD2   1 
ATOM   6220  N  N     . HIS B 1 87  ? -24.792 -30.715 -50.871 1.00 50.74 ? 87  HIS B N     1 
ATOM   6221  C  CA    . HIS B 1 87  ? -23.878 -31.710 -51.441 1.00 51.14 ? 87  HIS B CA    1 
ATOM   6222  C  C     . HIS B 1 87  ? -23.675 -31.538 -52.948 1.00 52.39 ? 87  HIS B C     1 
ATOM   6223  O  O     . HIS B 1 87  ? -22.556 -31.669 -53.444 1.00 52.69 ? 87  HIS B O     1 
ATOM   6224  C  CB    . HIS B 1 87  ? -24.314 -33.135 -51.109 1.00 50.74 ? 87  HIS B CB    1 
ATOM   6225  C  CG    . HIS B 1 87  ? -24.140 -33.493 -49.668 1.00 50.64 ? 87  HIS B CG    1 
ATOM   6226  N  ND1   . HIS B 1 87  ? -24.631 -34.661 -49.127 1.00 50.71 ? 87  HIS B ND1   1 
ATOM   6227  C  CD2   . HIS B 1 87  ? -23.556 -32.821 -48.646 1.00 50.07 ? 87  HIS B CD2   1 
ATOM   6228  C  CE1   . HIS B 1 87  ? -24.334 -34.706 -47.841 1.00 49.67 ? 87  HIS B CE1   1 
ATOM   6229  N  NE2   . HIS B 1 87  ? -23.687 -33.599 -47.524 1.00 49.86 ? 87  HIS B NE2   1 
ATOM   6230  N  N     . LYS B 1 88  ? -24.752 -31.230 -53.667 1.00 53.18 ? 88  LYS B N     1 
ATOM   6231  C  CA    . LYS B 1 88  ? -24.672 -30.999 -55.108 1.00 54.66 ? 88  LYS B CA    1 
ATOM   6232  C  C     . LYS B 1 88  ? -23.876 -29.727 -55.418 1.00 55.32 ? 88  LYS B C     1 
ATOM   6233  O  O     . LYS B 1 88  ? -23.303 -29.600 -56.488 1.00 56.12 ? 88  LYS B O     1 
ATOM   6234  C  CB    . LYS B 1 88  ? -26.077 -30.943 -55.731 1.00 55.26 ? 88  LYS B CB    1 
ATOM   6235  N  N     . GLU B 1 89  ? -23.819 -28.806 -54.459 1.00 55.25 ? 89  GLU B N     1 
ATOM   6236  C  CA    . GLU B 1 89  ? -23.119 -27.531 -54.648 1.00 56.21 ? 89  GLU B CA    1 
ATOM   6237  C  C     . GLU B 1 89  ? -21.724 -27.500 -54.006 1.00 55.61 ? 89  GLU B C     1 
ATOM   6238  O  O     . GLU B 1 89  ? -21.091 -26.450 -53.945 1.00 56.01 ? 89  GLU B O     1 
ATOM   6239  C  CB    . GLU B 1 89  ? -23.991 -26.361 -54.147 1.00 56.06 ? 89  GLU B CB    1 
ATOM   6240  C  CG    . GLU B 1 89  ? -25.325 -26.181 -54.907 1.00 58.17 ? 89  GLU B CG    1 
ATOM   6241  C  CD    . GLU B 1 89  ? -25.139 -25.838 -56.395 1.00 61.75 ? 89  GLU B CD    1 
ATOM   6242  O  OE1   . GLU B 1 89  ? -24.639 -24.729 -56.697 1.00 63.84 ? 89  GLU B OE1   1 
ATOM   6243  O  OE2   . GLU B 1 89  ? -25.501 -26.669 -57.265 1.00 62.73 ? 89  GLU B OE2   1 
ATOM   6244  N  N     . THR B 1 90  ? -21.238 -28.655 -53.562 1.00 55.14 ? 90  THR B N     1 
ATOM   6245  C  CA    . THR B 1 90  ? -19.973 -28.745 -52.825 1.00 54.99 ? 90  THR B CA    1 
ATOM   6246  C  C     . THR B 1 90  ? -19.056 -29.827 -53.402 1.00 55.34 ? 90  THR B C     1 
ATOM   6247  O  O     . THR B 1 90  ? -19.528 -30.764 -54.043 1.00 55.31 ? 90  THR B O     1 
ATOM   6248  C  CB    . THR B 1 90  ? -20.239 -29.053 -51.328 1.00 53.54 ? 90  THR B CB    1 
ATOM   6249  O  OG1   . THR B 1 90  ? -21.035 -28.012 -50.762 1.00 54.35 ? 90  THR B OG1   1 
ATOM   6250  C  CG2   . THR B 1 90  ? -18.955 -29.108 -50.547 1.00 54.55 ? 90  THR B CG2   1 
ATOM   6251  N  N     . LYS B 1 91  ? -17.749 -29.701 -53.161 1.00 55.60 ? 91  LYS B N     1 
ATOM   6252  C  CA    . LYS B 1 91  ? -16.806 -30.778 -53.490 1.00 56.20 ? 91  LYS B CA    1 
ATOM   6253  C  C     . LYS B 1 91  ? -16.920 -31.918 -52.474 1.00 55.30 ? 91  LYS B C     1 
ATOM   6254  O  O     . LYS B 1 91  ? -17.153 -31.678 -51.290 1.00 53.96 ? 91  LYS B O     1 
ATOM   6255  C  CB    . LYS B 1 91  ? -15.364 -30.264 -53.571 1.00 56.82 ? 91  LYS B CB    1 
ATOM   6256  C  CG    . LYS B 1 91  ? -15.093 -29.381 -54.770 1.00 58.09 ? 91  LYS B CG    1 
ATOM   6257  C  CD    . LYS B 1 91  ? -13.617 -29.131 -54.938 1.00 59.80 ? 91  LYS B CD    1 
ATOM   6258  C  CE    . LYS B 1 91  ? -13.358 -28.301 -56.184 1.00 62.19 ? 91  LYS B CE    1 
ATOM   6259  N  NZ    . LYS B 1 91  ? -11.904 -28.212 -56.510 1.00 63.11 ? 91  LYS B NZ    1 
ATOM   6260  N  N     . LYS B 1 92  ? -16.755 -33.153 -52.948 1.00 55.81 ? 92  LYS B N     1 
ATOM   6261  C  CA    . LYS B 1 92  ? -16.953 -34.335 -52.105 1.00 55.40 ? 92  LYS B CA    1 
ATOM   6262  C  C     . LYS B 1 92  ? -15.767 -34.722 -51.214 1.00 55.17 ? 92  LYS B C     1 
ATOM   6263  O  O     . LYS B 1 92  ? -15.978 -35.264 -50.137 1.00 55.00 ? 92  LYS B O     1 
ATOM   6264  C  CB    . LYS B 1 92  ? -17.410 -35.534 -52.941 1.00 56.17 ? 92  LYS B CB    1 
ATOM   6265  N  N     . VAL B 1 93  ? -14.535 -34.460 -51.644 1.00 55.73 ? 93  VAL B N     1 
ATOM   6266  C  CA    . VAL B 1 93  ? -13.367 -34.882 -50.857 1.00 55.41 ? 93  VAL B CA    1 
ATOM   6267  C  C     . VAL B 1 93  ? -12.830 -33.792 -49.925 1.00 54.85 ? 93  VAL B C     1 
ATOM   6268  O  O     . VAL B 1 93  ? -12.630 -32.646 -50.336 1.00 55.21 ? 93  VAL B O     1 
ATOM   6269  C  CB    . VAL B 1 93  ? -12.256 -35.606 -51.718 1.00 56.91 ? 93  VAL B CB    1 
ATOM   6270  C  CG1   . VAL B 1 93  ? -12.303 -35.200 -53.188 1.00 58.28 ? 93  VAL B CG1   1 
ATOM   6271  C  CG2   . VAL B 1 93  ? -10.859 -35.434 -51.131 1.00 56.63 ? 93  VAL B CG2   1 
ATOM   6272  N  N     . PHE B 1 94  ? -12.636 -34.171 -48.659 1.00 53.66 ? 94  PHE B N     1 
ATOM   6273  C  CA    . PHE B 1 94  ? -12.199 -33.273 -47.589 1.00 52.68 ? 94  PHE B CA    1 
ATOM   6274  C  C     . PHE B 1 94  ? -10.901 -32.526 -47.884 1.00 53.53 ? 94  PHE B C     1 
ATOM   6275  O  O     . PHE B 1 94  ? -10.855 -31.303 -47.762 1.00 53.35 ? 94  PHE B O     1 
ATOM   6276  C  CB    . PHE B 1 94  ? -12.079 -34.054 -46.272 1.00 51.53 ? 94  PHE B CB    1 
ATOM   6277  C  CG    . PHE B 1 94  ? -11.373 -33.310 -45.161 1.00 50.28 ? 94  PHE B CG    1 
ATOM   6278  C  CD1   . PHE B 1 94  ? -11.960 -32.200 -44.552 1.00 49.56 ? 94  PHE B CD1   1 
ATOM   6279  C  CD2   . PHE B 1 94  ? -10.136 -33.748 -44.698 1.00 49.88 ? 94  PHE B CD2   1 
ATOM   6280  C  CE1   . PHE B 1 94  ? -11.312 -31.521 -43.515 1.00 49.05 ? 94  PHE B CE1   1 
ATOM   6281  C  CE2   . PHE B 1 94  ? -9.480  -33.078 -43.663 1.00 49.59 ? 94  PHE B CE2   1 
ATOM   6282  C  CZ    . PHE B 1 94  ? -10.070 -31.960 -43.068 1.00 49.16 ? 94  PHE B CZ    1 
ATOM   6283  N  N     . SER B 1 95  ? -9.854  -33.259 -48.248 1.00 54.58 ? 95  SER B N     1 
ATOM   6284  C  CA    . SER B 1 95  ? -8.542  -32.655 -48.504 1.00 56.00 ? 95  SER B CA    1 
ATOM   6285  C  C     . SER B 1 95  ? -8.589  -31.650 -49.664 1.00 57.21 ? 95  SER B C     1 
ATOM   6286  O  O     . SER B 1 95  ? -7.819  -30.685 -49.677 1.00 57.84 ? 95  SER B O     1 
ATOM   6287  C  CB    . SER B 1 95  ? -7.472  -33.725 -48.754 1.00 56.63 ? 95  SER B CB    1 
ATOM   6288  O  OG    . SER B 1 95  ? -7.772  -34.491 -49.909 1.00 57.34 ? 95  SER B OG    1 
ATOM   6289  N  N     . ASP B 1 96  ? -9.502  -31.881 -50.613 1.00 57.60 ? 96  ASP B N     1 
ATOM   6290  C  CA    . ASP B 1 96  ? -9.748  -30.963 -51.729 1.00 58.72 ? 96  ASP B CA    1 
ATOM   6291  C  C     . ASP B 1 96  ? -10.221 -29.597 -51.261 1.00 58.11 ? 96  ASP B C     1 
ATOM   6292  O  O     . ASP B 1 96  ? -9.674  -28.575 -51.678 1.00 58.86 ? 96  ASP B O     1 
ATOM   6293  C  CB    . ASP B 1 96  ? -10.778 -31.542 -52.702 1.00 58.98 ? 96  ASP B CB    1 
ATOM   6294  C  CG    . ASP B 1 96  ? -10.143 -32.316 -53.843 1.00 61.13 ? 96  ASP B CG    1 
ATOM   6295  O  OD1   . ASP B 1 96  ? -8.921  -32.598 -53.780 1.00 61.17 ? 96  ASP B OD1   1 
ATOM   6296  O  OD2   . ASP B 1 96  ? -10.881 -32.646 -54.806 1.00 62.51 ? 96  ASP B OD2   1 
ATOM   6297  N  N     . VAL B 1 97  ? -11.244 -29.592 -50.407 1.00 56.89 ? 97  VAL B N     1 
ATOM   6298  C  CA    . VAL B 1 97  ? -11.781 -28.357 -49.831 1.00 56.44 ? 97  VAL B CA    1 
ATOM   6299  C  C     . VAL B 1 97  ? -10.706 -27.613 -49.015 1.00 56.59 ? 97  VAL B C     1 
ATOM   6300  O  O     . VAL B 1 97  ? -10.557 -26.398 -49.147 1.00 57.22 ? 97  VAL B O     1 
ATOM   6301  C  CB    . VAL B 1 97  ? -13.058 -28.614 -48.984 1.00 54.99 ? 97  VAL B CB    1 
ATOM   6302  C  CG1   . VAL B 1 97  ? -13.729 -27.307 -48.608 1.00 54.31 ? 97  VAL B CG1   1 
ATOM   6303  C  CG2   . VAL B 1 97  ? -14.041 -29.485 -49.758 1.00 55.25 ? 97  VAL B CG2   1 
ATOM   6304  N  N     . MET B 1 98  ? -9.943  -28.349 -48.209 1.00 56.25 ? 98  MET B N     1 
ATOM   6305  C  CA    . MET B 1 98  ? -8.845  -27.772 -47.437 1.00 56.29 ? 98  MET B CA    1 
ATOM   6306  C  C     . MET B 1 98  ? -7.813  -27.066 -48.316 1.00 57.85 ? 98  MET B C     1 
ATOM   6307  O  O     . MET B 1 98  ? -7.226  -26.071 -47.898 1.00 58.19 ? 98  MET B O     1 
ATOM   6308  C  CB    . MET B 1 98  ? -8.159  -28.839 -46.588 1.00 55.77 ? 98  MET B CB    1 
ATOM   6309  C  CG    . MET B 1 98  ? -9.035  -29.447 -45.517 1.00 54.69 ? 98  MET B CG    1 
ATOM   6310  S  SD    . MET B 1 98  ? -9.693  -28.213 -44.379 1.00 54.37 ? 98  MET B SD    1 
ATOM   6311  C  CE    . MET B 1 98  ? -11.445 -28.204 -44.825 1.00 53.72 ? 98  MET B CE    1 
ATOM   6312  N  N     . GLU B 1 99  ? -7.589  -27.585 -49.522 1.00 58.99 ? 99  GLU B N     1 
ATOM   6313  C  CA    . GLU B 1 99  ? -6.684  -26.951 -50.481 1.00 60.51 ? 99  GLU B CA    1 
ATOM   6314  C  C     . GLU B 1 99  ? -7.299  -25.671 -51.049 1.00 60.70 ? 99  GLU B C     1 
ATOM   6315  O  O     . GLU B 1 99  ? -6.633  -24.641 -51.114 1.00 61.16 ? 99  GLU B O     1 
ATOM   6316  C  CB    . GLU B 1 99  ? -6.313  -27.917 -51.607 1.00 61.47 ? 99  GLU B CB    1 
ATOM   6317  C  CG    . GLU B 1 99  ? -5.454  -29.084 -51.162 1.00 61.81 ? 99  GLU B CG    1 
ATOM   6318  C  CD    . GLU B 1 99  ? -4.895  -29.886 -52.328 1.00 63.88 ? 99  GLU B CD    1 
ATOM   6319  O  OE1   . GLU B 1 99  ? -5.468  -30.958 -52.644 1.00 64.23 ? 99  GLU B OE1   1 
ATOM   6320  O  OE2   . GLU B 1 99  ? -3.884  -29.443 -52.927 1.00 65.97 ? 99  GLU B OE2   1 
ATOM   6321  N  N     . ASP B 1 100 ? -8.570  -25.753 -51.449 1.00 60.48 ? 100 ASP B N     1 
ATOM   6322  C  CA    . ASP B 1 100 ? -9.352  -24.604 -51.918 1.00 60.84 ? 100 ASP B CA    1 
ATOM   6323  C  C     . ASP B 1 100 ? -9.412  -23.478 -50.883 1.00 60.32 ? 100 ASP B C     1 
ATOM   6324  O  O     . ASP B 1 100 ? -9.290  -22.300 -51.233 1.00 61.18 ? 100 ASP B O     1 
ATOM   6325  C  CB    . ASP B 1 100 ? -10.779 -25.033 -52.272 1.00 60.28 ? 100 ASP B CB    1 
ATOM   6326  C  CG    . ASP B 1 100 ? -10.850 -25.902 -53.518 1.00 61.67 ? 100 ASP B CG    1 
ATOM   6327  O  OD1   . ASP B 1 100 ? -11.981 -26.302 -53.873 1.00 61.85 ? 100 ASP B OD1   1 
ATOM   6328  O  OD2   . ASP B 1 100 ? -9.800  -26.191 -54.144 1.00 62.93 ? 100 ASP B OD2   1 
ATOM   6329  N  N     . LEU B 1 101 ? -9.609  -23.845 -49.618 1.00 58.96 ? 101 LEU B N     1 
ATOM   6330  C  CA    . LEU B 1 101 ? -9.620  -22.873 -48.527 1.00 58.44 ? 101 LEU B CA    1 
ATOM   6331  C  C     . LEU B 1 101 ? -8.248  -22.233 -48.335 1.00 59.47 ? 101 LEU B C     1 
ATOM   6332  O  O     . LEU B 1 101 ? -8.151  -21.016 -48.181 1.00 59.77 ? 101 LEU B O     1 
ATOM   6333  C  CB    . LEU B 1 101 ? -10.115 -23.506 -47.218 1.00 56.62 ? 101 LEU B CB    1 
ATOM   6334  C  CG    . LEU B 1 101 ? -11.561 -24.027 -47.159 1.00 55.61 ? 101 LEU B CG    1 
ATOM   6335  C  CD1   . LEU B 1 101 ? -11.811 -24.759 -45.848 1.00 54.06 ? 101 LEU B CD1   1 
ATOM   6336  C  CD2   . LEU B 1 101 ? -12.600 -22.920 -47.355 1.00 54.53 ? 101 LEU B CD2   1 
ATOM   6337  N  N     . TYR B 1 102 ? -7.194  -23.046 -48.361 1.00 60.38 ? 102 TYR B N     1 
ATOM   6338  C  CA    . TYR B 1 102 ? -5.836  -22.531 -48.227 1.00 62.17 ? 102 TYR B CA    1 
ATOM   6339  C  C     . TYR B 1 102 ? -5.394  -21.669 -49.408 1.00 64.64 ? 102 TYR B C     1 
ATOM   6340  O  O     . TYR B 1 102 ? -4.712  -20.662 -49.219 1.00 65.35 ? 102 TYR B O     1 
ATOM   6341  C  CB    . TYR B 1 102 ? -4.823  -23.655 -48.011 1.00 62.22 ? 102 TYR B CB    1 
ATOM   6342  C  CG    . TYR B 1 102 ? -3.419  -23.126 -47.804 1.00 63.24 ? 102 TYR B CG    1 
ATOM   6343  C  CD1   . TYR B 1 102 ? -2.993  -22.719 -46.542 1.00 62.70 ? 102 TYR B CD1   1 
ATOM   6344  C  CD2   . TYR B 1 102 ? -2.527  -23.003 -48.877 1.00 64.50 ? 102 TYR B CD2   1 
ATOM   6345  C  CE1   . TYR B 1 102 ? -1.710  -22.210 -46.342 1.00 63.86 ? 102 TYR B CE1   1 
ATOM   6346  C  CE2   . TYR B 1 102 ? -1.240  -22.497 -48.690 1.00 65.58 ? 102 TYR B CE2   1 
ATOM   6347  C  CZ    . TYR B 1 102 ? -0.840  -22.107 -47.416 1.00 65.30 ? 102 TYR B CZ    1 
ATOM   6348  O  OH    . TYR B 1 102 ? 0.422   -21.609 -47.207 1.00 66.48 ? 102 TYR B OH    1 
ATOM   6349  N  N     . ASN B 1 103 ? -5.768  -22.072 -50.620 1.00 66.53 ? 103 ASN B N     1 
ATOM   6350  C  CA    . ASN B 1 103 ? -5.316  -21.384 -51.827 1.00 69.56 ? 103 ASN B CA    1 
ATOM   6351  C  C     . ASN B 1 103 ? -6.099  -20.108 -52.149 1.00 70.89 ? 103 ASN B C     1 
ATOM   6352  O  O     . ASN B 1 103 ? -5.846  -19.464 -53.171 1.00 72.44 ? 103 ASN B O     1 
ATOM   6353  C  CB    . ASN B 1 103 ? -5.317  -22.335 -53.031 1.00 70.23 ? 103 ASN B CB    1 
ATOM   6354  C  CG    . ASN B 1 103 ? -4.328  -23.484 -52.877 1.00 70.24 ? 103 ASN B CG    1 
ATOM   6355  O  OD1   . ASN B 1 103 ? -3.242  -23.324 -52.315 1.00 69.39 ? 103 ASN B OD1   1 
ATOM   6356  N  ND2   . ASN B 1 103 ? -4.706  -24.655 -53.386 1.00 69.88 ? 103 ASN B ND2   1 
ATOM   6357  N  N     . TYR B 1 104 ? -7.025  -19.738 -51.265 1.00 71.02 ? 104 TYR B N     1 
ATOM   6358  C  CA    . TYR B 1 104 ? -7.910  -18.591 -51.487 1.00 72.58 ? 104 TYR B CA    1 
ATOM   6359  C  C     . TYR B 1 104 ? -7.174  -17.261 -51.671 1.00 74.61 ? 104 TYR B C     1 
ATOM   6360  O  O     . TYR B 1 104 ? -6.279  -16.911 -50.896 1.00 74.40 ? 104 TYR B O     1 
ATOM   6361  C  CB    . TYR B 1 104 ? -8.949  -18.481 -50.370 1.00 71.21 ? 104 TYR B CB    1 
ATOM   6362  C  CG    . TYR B 1 104 ? -9.888  -17.307 -50.514 1.00 72.02 ? 104 TYR B CG    1 
ATOM   6363  C  CD1   . TYR B 1 104 ? -10.838 -17.269 -51.537 1.00 73.04 ? 104 TYR B CD1   1 
ATOM   6364  C  CD2   . TYR B 1 104 ? -9.833  -16.236 -49.624 1.00 72.57 ? 104 TYR B CD2   1 
ATOM   6365  C  CE1   . TYR B 1 104 ? -11.704 -16.190 -51.676 1.00 73.78 ? 104 TYR B CE1   1 
ATOM   6366  C  CE2   . TYR B 1 104 ? -10.697 -15.150 -49.750 1.00 73.32 ? 104 TYR B CE2   1 
ATOM   6367  C  CZ    . TYR B 1 104 ? -11.630 -15.133 -50.780 1.00 73.46 ? 104 TYR B CZ    1 
ATOM   6368  O  OH    . TYR B 1 104 ? -12.486 -14.060 -50.911 1.00 73.31 ? 104 TYR B OH    1 
ATOM   6369  N  N     . ILE B 1 105 ? -7.563  -16.547 -52.725 1.00 77.02 ? 105 ILE B N     1 
ATOM   6370  C  CA    . ILE B 1 105 ? -7.025  -15.227 -53.058 1.00 79.56 ? 105 ILE B CA    1 
ATOM   6371  C  C     . ILE B 1 105 ? -8.190  -14.229 -53.036 1.00 80.09 ? 105 ILE B C     1 
ATOM   6372  O  O     . ILE B 1 105 ? -9.157  -14.383 -53.797 1.00 80.33 ? 105 ILE B O     1 
ATOM   6373  C  CB    . ILE B 1 105 ? -6.358  -15.208 -54.476 1.00 81.54 ? 105 ILE B CB    1 
ATOM   6374  C  CG1   . ILE B 1 105 ? -5.486  -16.454 -54.731 1.00 81.92 ? 105 ILE B CG1   1 
ATOM   6375  C  CG2   . ILE B 1 105 ? -5.578  -13.916 -54.705 1.00 83.45 ? 105 ILE B CG2   1 
ATOM   6376  C  CD1   . ILE B 1 105 ? -4.053  -16.387 -54.201 1.00 82.26 ? 105 ILE B CD1   1 
ATOM   6377  N  N     . ASN B 1 106 ? -8.108  -13.226 -52.157 1.00 80.62 ? 106 ASN B N     1 
ATOM   6378  C  CA    . ASN B 1 106 ? -9.130  -12.176 -52.066 1.00 81.20 ? 106 ASN B CA    1 
ATOM   6379  C  C     . ASN B 1 106 ? -9.217  -11.428 -53.398 1.00 83.63 ? 106 ASN B C     1 
ATOM   6380  O  O     . ASN B 1 106 ? -8.190  -11.001 -53.934 1.00 85.16 ? 106 ASN B O     1 
ATOM   6381  C  CB    . ASN B 1 106 ? -8.825  -11.220 -50.919 1.00 80.89 ? 106 ASN B CB    1 
ATOM   6382  N  N     . PRO B 1 107 ? -10.439 -11.288 -53.947 1.00 84.14 ? 107 PRO B N     1 
ATOM   6383  C  CA    . PRO B 1 107 ? -10.610 -10.788 -55.324 1.00 86.27 ? 107 PRO B CA    1 
ATOM   6384  C  C     . PRO B 1 107 ? -10.342 -9.285  -55.501 1.00 88.10 ? 107 PRO B C     1 
ATOM   6385  O  O     . PRO B 1 107 ? -9.732  -8.879  -56.496 1.00 89.87 ? 107 PRO B O     1 
ATOM   6386  C  CB    . PRO B 1 107 ? -12.068 -11.132 -55.649 1.00 85.69 ? 107 PRO B CB    1 
ATOM   6387  C  CG    . PRO B 1 107 ? -12.753 -11.206 -54.321 1.00 83.83 ? 107 PRO B CG    1 
ATOM   6388  C  CD    . PRO B 1 107 ? -11.727 -11.591 -53.294 1.00 82.60 ? 107 PRO B CD    1 
ATOM   6389  N  N     . HIS B 1 108 ? -10.787 -8.477  -54.540 1.00 87.74 ? 108 HIS B N     1 
ATOM   6390  C  CA    . HIS B 1 108 ? -10.588 -7.025  -54.583 1.00 89.34 ? 108 HIS B CA    1 
ATOM   6391  C  C     . HIS B 1 108 ? -9.296  -6.556  -53.889 1.00 89.41 ? 108 HIS B C     1 
ATOM   6392  O  O     . HIS B 1 108 ? -9.039  -5.350  -53.795 1.00 90.68 ? 108 HIS B O     1 
ATOM   6393  C  CB    . HIS B 1 108 ? -11.819 -6.287  -54.028 1.00 89.02 ? 108 HIS B CB    1 
ATOM   6394  C  CG    . HIS B 1 108 ? -12.620 -7.085  -53.046 1.00 87.64 ? 108 HIS B CG    1 
ATOM   6395  N  ND1   . HIS B 1 108 ? -12.240 -7.249  -51.730 1.00 87.10 ? 108 HIS B ND1   1 
ATOM   6396  C  CD2   . HIS B 1 108 ? -13.787 -7.760  -53.187 1.00 87.39 ? 108 HIS B CD2   1 
ATOM   6397  C  CE1   . HIS B 1 108 ? -13.136 -7.993  -51.104 1.00 85.52 ? 108 HIS B CE1   1 
ATOM   6398  N  NE2   . HIS B 1 108 ? -14.085 -8.314  -51.965 1.00 85.53 ? 108 HIS B NE2   1 
ATOM   6399  N  N     . ASN B 1 109 ? -8.494  -7.510  -53.416 1.00 88.10 ? 109 ASN B N     1 
ATOM   6400  C  CA    . ASN B 1 109 ? -7.184  -7.225  -52.816 1.00 87.87 ? 109 ASN B CA    1 
ATOM   6401  C  C     . ASN B 1 109 ? -6.053  -7.882  -53.614 1.00 88.55 ? 109 ASN B C     1 
ATOM   6402  O  O     . ASN B 1 109 ? -4.935  -7.361  -53.665 1.00 89.69 ? 109 ASN B O     1 
ATOM   6403  C  CB    . ASN B 1 109 ? -7.150  -7.680  -51.356 1.00 85.99 ? 109 ASN B CB    1 
ATOM   6404  N  N     . GLY B 1 110 ? -6.358  -9.022  -54.236 1.00 87.63 ? 110 GLY B N     1 
ATOM   6405  C  CA    . GLY B 1 110 ? -5.381  -9.800  -55.004 1.00 87.87 ? 110 GLY B CA    1 
ATOM   6406  C  C     . GLY B 1 110 ? -4.437  -10.617 -54.136 1.00 86.50 ? 110 GLY B C     1 
ATOM   6407  O  O     . GLY B 1 110 ? -3.594  -11.353 -54.653 1.00 87.11 ? 110 GLY B O     1 
ATOM   6408  N  N     . LYS B 1 111 ? -4.596  -10.496 -52.817 1.00 84.53 ? 111 LYS B N     1 
ATOM   6409  C  CA    . LYS B 1 111 ? -3.680  -11.094 -51.844 1.00 83.22 ? 111 LYS B CA    1 
ATOM   6410  C  C     . LYS B 1 111 ? -4.057  -12.527 -51.465 1.00 81.15 ? 111 LYS B C     1 
ATOM   6411  O  O     . LYS B 1 111 ? -5.234  -12.840 -51.252 1.00 79.88 ? 111 LYS B O     1 
ATOM   6412  C  CB    . LYS B 1 111 ? -3.585  -10.213 -50.589 1.00 82.50 ? 111 LYS B CB    1 
ATOM   6413  N  N     . HIS B 1 112 ? -3.041  -13.387 -51.393 1.00 80.73 ? 112 HIS B N     1 
ATOM   6414  C  CA    . HIS B 1 112 ? -3.190  -14.759 -50.915 1.00 78.63 ? 112 HIS B CA    1 
ATOM   6415  C  C     . HIS B 1 112 ? -3.592  -14.735 -49.445 1.00 76.38 ? 112 HIS B C     1 
ATOM   6416  O  O     . HIS B 1 112 ? -2.810  -14.331 -48.578 1.00 76.35 ? 112 HIS B O     1 
ATOM   6417  C  CB    . HIS B 1 112 ? -1.887  -15.544 -51.125 1.00 79.58 ? 112 HIS B CB    1 
ATOM   6418  C  CG    . HIS B 1 112 ? -1.930  -16.955 -50.620 1.00 78.34 ? 112 HIS B CG    1 
ATOM   6419  N  ND1   . HIS B 1 112 ? -0.851  -17.555 -50.005 1.00 78.25 ? 112 HIS B ND1   1 
ATOM   6420  C  CD2   . HIS B 1 112 ? -2.917  -17.882 -50.635 1.00 77.33 ? 112 HIS B CD2   1 
ATOM   6421  C  CE1   . HIS B 1 112 ? -1.171  -18.791 -49.666 1.00 77.22 ? 112 HIS B CE1   1 
ATOM   6422  N  NE2   . HIS B 1 112 ? -2.420  -19.014 -50.036 1.00 76.80 ? 112 HIS B NE2   1 
ATOM   6423  N  N     . SER B 1 113 ? -4.828  -15.152 -49.181 1.00 74.22 ? 113 SER B N     1 
ATOM   6424  C  CA    . SER B 1 113 ? -5.402  -15.080 -47.839 1.00 71.74 ? 113 SER B CA    1 
ATOM   6425  C  C     . SER B 1 113 ? -5.926  -16.453 -47.383 1.00 69.44 ? 113 SER B C     1 
ATOM   6426  O  O     . SER B 1 113 ? -7.146  -16.678 -47.346 1.00 68.35 ? 113 SER B O     1 
ATOM   6427  C  CB    . SER B 1 113 ? -6.515  -14.024 -47.802 1.00 71.78 ? 113 SER B CB    1 
ATOM   6428  O  OG    . SER B 1 113 ? -6.160  -12.873 -48.561 1.00 73.76 ? 113 SER B OG    1 
ATOM   6429  N  N     . PRO B 1 114 ? -5.003  -17.373 -47.022 1.00 68.40 ? 114 PRO B N     1 
ATOM   6430  C  CA    . PRO B 1 114 ? -5.400  -18.729 -46.650 1.00 66.65 ? 114 PRO B CA    1 
ATOM   6431  C  C     . PRO B 1 114 ? -6.483  -18.715 -45.578 1.00 64.42 ? 114 PRO B C     1 
ATOM   6432  O  O     . PRO B 1 114 ? -6.409  -17.926 -44.636 1.00 63.81 ? 114 PRO B O     1 
ATOM   6433  C  CB    . PRO B 1 114 ? -4.106  -19.343 -46.095 1.00 66.91 ? 114 PRO B CB    1 
ATOM   6434  C  CG    . PRO B 1 114 ? -3.158  -18.193 -45.902 1.00 67.99 ? 114 PRO B CG    1 
ATOM   6435  C  CD    . PRO B 1 114 ? -3.544  -17.188 -46.918 1.00 69.20 ? 114 PRO B CD    1 
ATOM   6436  N  N     . MET B 1 115 ? -7.493  -19.563 -45.750 1.00 62.93 ? 115 MET B N     1 
ATOM   6437  C  CA    . MET B 1 115 ? -8.593  -19.670 -44.795 1.00 60.65 ? 115 MET B CA    1 
ATOM   6438  C  C     . MET B 1 115 ? -8.340  -20.799 -43.790 1.00 59.22 ? 115 MET B C     1 
ATOM   6439  O  O     . MET B 1 115 ? -9.042  -20.912 -42.791 1.00 58.42 ? 115 MET B O     1 
ATOM   6440  C  CB    . MET B 1 115 ? -9.931  -19.856 -45.523 1.00 60.43 ? 115 MET B CB    1 
ATOM   6441  C  CG    . MET B 1 115 ? -10.314 -18.693 -46.438 1.00 61.09 ? 115 MET B CG    1 
ATOM   6442  S  SD    . MET B 1 115 ? -11.967 -18.814 -47.172 1.00 61.40 ? 115 MET B SD    1 
ATOM   6443  C  CE    . MET B 1 115 ? -13.001 -18.396 -45.771 1.00 59.93 ? 115 MET B CE    1 
ATOM   6444  N  N     . VAL B 1 116 ? -7.342  -21.634 -44.067 1.00 59.13 ? 116 VAL B N     1 
ATOM   6445  C  CA    . VAL B 1 116 ? -6.838  -22.620 -43.107 1.00 57.86 ? 116 VAL B CA    1 
ATOM   6446  C  C     . VAL B 1 116 ? -5.322  -22.462 -42.967 1.00 58.71 ? 116 VAL B C     1 
ATOM   6447  O  O     . VAL B 1 116 ? -4.671  -21.918 -43.866 1.00 59.91 ? 116 VAL B O     1 
ATOM   6448  C  CB    . VAL B 1 116 ? -7.215  -24.085 -43.487 1.00 57.54 ? 116 VAL B CB    1 
ATOM   6449  C  CG1   . VAL B 1 116 ? -8.715  -24.226 -43.663 1.00 56.51 ? 116 VAL B CG1   1 
ATOM   6450  C  CG2   . VAL B 1 116 ? -6.494  -24.553 -44.736 1.00 58.43 ? 116 VAL B CG2   1 
ATOM   6451  N  N     . ALA B 1 117 ? -4.772  -22.912 -41.838 1.00 58.00 ? 117 ALA B N     1 
ATOM   6452  C  CA    . ALA B 1 117 ? -3.327  -22.835 -41.580 1.00 58.82 ? 117 ALA B CA    1 
ATOM   6453  C  C     . ALA B 1 117 ? -2.538  -23.803 -42.473 1.00 60.08 ? 117 ALA B C     1 
ATOM   6454  O  O     . ALA B 1 117 ? -3.037  -24.877 -42.809 1.00 59.69 ? 117 ALA B O     1 
ATOM   6455  C  CB    . ALA B 1 117 ? -3.042  -23.114 -40.113 1.00 57.71 ? 117 ALA B CB    1 
ATOM   6456  N  N     . LYS B 1 118 ? -1.316  -23.424 -42.861 1.00 61.58 ? 118 LYS B N     1 
ATOM   6457  C  CA    . LYS B 1 118 ? -0.469  -24.304 -43.681 1.00 62.95 ? 118 LYS B CA    1 
ATOM   6458  C  C     . LYS B 1 118 ? -0.157  -25.629 -42.981 1.00 62.72 ? 118 LYS B C     1 
ATOM   6459  O  O     . LYS B 1 118 ? -0.187  -26.690 -43.610 1.00 63.33 ? 118 LYS B O     1 
ATOM   6460  C  CB    . LYS B 1 118 ? 0.829   -23.597 -44.119 1.00 64.54 ? 118 LYS B CB    1 
ATOM   6461  N  N     . SER B 1 119 ? 0.121   -25.562 -41.679 1.00 62.11 ? 119 SER B N     1 
ATOM   6462  C  CA    . SER B 1 119 ? 0.481   -26.748 -40.896 1.00 61.83 ? 119 SER B CA    1 
ATOM   6463  C  C     . SER B 1 119 ? -0.672  -27.749 -40.770 1.00 60.47 ? 119 SER B C     1 
ATOM   6464  O  O     . SER B 1 119 ? -0.435  -28.952 -40.626 1.00 60.91 ? 119 SER B O     1 
ATOM   6465  C  CB    . SER B 1 119 ? 1.025   -26.355 -39.514 1.00 61.38 ? 119 SER B CB    1 
ATOM   6466  O  OG    . SER B 1 119 ? 0.115   -25.525 -38.818 1.00 60.52 ? 119 SER B OG    1 
ATOM   6467  N  N     . THR B 1 120 ? -1.908  -27.250 -40.835 1.00 59.00 ? 120 THR B N     1 
ATOM   6468  C  CA    . THR B 1 120 ? -3.100  -28.105 -40.884 1.00 57.68 ? 120 THR B CA    1 
ATOM   6469  C  C     . THR B 1 120 ? -3.211  -28.784 -42.257 1.00 58.23 ? 120 THR B C     1 
ATOM   6470  O  O     . THR B 1 120 ? -3.341  -30.008 -42.350 1.00 58.04 ? 120 THR B O     1 
ATOM   6471  C  CB    . THR B 1 120 ? -4.381  -27.306 -40.548 1.00 56.55 ? 120 THR B CB    1 
ATOM   6472  O  OG1   . THR B 1 120 ? -4.276  -26.787 -39.214 1.00 56.07 ? 120 THR B OG1   1 
ATOM   6473  C  CG2   . THR B 1 120 ? -5.636  -28.183 -40.657 1.00 55.71 ? 120 THR B CG2   1 
ATOM   6474  N  N     . LEU B 1 121 ? -3.142  -27.979 -43.315 1.00 58.62 ? 121 LEU B N     1 
ATOM   6475  C  CA    . LEU B 1 121 ? -3.117  -28.487 -44.677 1.00 59.50 ? 121 LEU B CA    1 
ATOM   6476  C  C     . LEU B 1 121 ? -2.062  -29.586 -44.825 1.00 60.12 ? 121 LEU B C     1 
ATOM   6477  O  O     . LEU B 1 121 ? -2.356  -30.657 -45.355 1.00 60.13 ? 121 LEU B O     1 
ATOM   6478  C  CB    . LEU B 1 121 ? -2.828  -27.353 -45.674 1.00 60.69 ? 121 LEU B CB    1 
ATOM   6479  C  CG    . LEU B 1 121 ? -3.556  -27.304 -47.029 1.00 61.14 ? 121 LEU B CG    1 
ATOM   6480  C  CD1   . LEU B 1 121 ? -2.575  -26.907 -48.130 1.00 62.16 ? 121 LEU B CD1   1 
ATOM   6481  C  CD2   . LEU B 1 121 ? -4.273  -28.608 -47.401 1.00 59.64 ? 121 LEU B CD2   1 
ATOM   6482  N  N     . ASP B 1 122 ? -0.849  -29.315 -44.338 1.00 60.55 ? 122 ASP B N     1 
ATOM   6483  C  CA    . ASP B 1 122 ? 0.272   -30.253 -44.429 1.00 61.43 ? 122 ASP B CA    1 
ATOM   6484  C  C     . ASP B 1 122 ? -0.046  -31.604 -43.797 1.00 60.39 ? 122 ASP B C     1 
ATOM   6485  O  O     . ASP B 1 122 ? 0.173   -32.648 -44.415 1.00 61.10 ? 122 ASP B O     1 
ATOM   6486  C  CB    . ASP B 1 122 ? 1.529   -29.659 -43.790 1.00 62.28 ? 122 ASP B CB    1 
ATOM   6487  C  CG    . ASP B 1 122 ? 2.203   -28.603 -44.669 1.00 64.68 ? 122 ASP B CG    1 
ATOM   6488  O  OD1   . ASP B 1 122 ? 1.863   -28.486 -45.872 1.00 65.59 ? 122 ASP B OD1   1 
ATOM   6489  O  OD2   . ASP B 1 122 ? 3.096   -27.891 -44.145 1.00 66.07 ? 122 ASP B OD2   1 
ATOM   6490  N  N     . ILE B 1 123 ? -0.567  -31.571 -42.571 1.00 58.69 ? 123 ILE B N     1 
ATOM   6491  C  CA    . ILE B 1 123 ? -1.009  -32.779 -41.873 1.00 57.53 ? 123 ILE B CA    1 
ATOM   6492  C  C     . ILE B 1 123 ? -2.112  -33.491 -42.663 1.00 56.81 ? 123 ILE B C     1 
ATOM   6493  O  O     . ILE B 1 123 ? -2.069  -34.711 -42.839 1.00 57.03 ? 123 ILE B O     1 
ATOM   6494  C  CB    . ILE B 1 123 ? -1.465  -32.463 -40.421 1.00 56.39 ? 123 ILE B CB    1 
ATOM   6495  C  CG1   . ILE B 1 123 ? -0.235  -32.207 -39.538 1.00 57.19 ? 123 ILE B CG1   1 
ATOM   6496  C  CG2   . ILE B 1 123 ? -2.291  -33.611 -39.844 1.00 55.01 ? 123 ILE B CG2   1 
ATOM   6497  C  CD1   . ILE B 1 123 ? -0.497  -31.326 -38.339 1.00 55.51 ? 123 ILE B CD1   1 
ATOM   6498  N  N     . VAL B 1 124 ? -3.077  -32.720 -43.158 1.00 55.78 ? 124 VAL B N     1 
ATOM   6499  C  CA    . VAL B 1 124 ? -4.165  -33.275 -43.957 1.00 55.34 ? 124 VAL B CA    1 
ATOM   6500  C  C     . VAL B 1 124 ? -3.645  -33.980 -45.219 1.00 56.79 ? 124 VAL B C     1 
ATOM   6501  O  O     . VAL B 1 124 ? -4.009  -35.124 -45.473 1.00 56.79 ? 124 VAL B O     1 
ATOM   6502  C  CB    . VAL B 1 124 ? -5.252  -32.215 -44.290 1.00 54.64 ? 124 VAL B CB    1 
ATOM   6503  C  CG1   . VAL B 1 124 ? -6.217  -32.736 -45.346 1.00 54.06 ? 124 VAL B CG1   1 
ATOM   6504  C  CG2   . VAL B 1 124 ? -6.018  -31.817 -43.022 1.00 53.13 ? 124 VAL B CG2   1 
ATOM   6505  N  N     . LEU B 1 125 ? -2.781  -33.301 -45.978 1.00 57.97 ? 125 LEU B N     1 
ATOM   6506  C  CA    . LEU B 1 125 ? -2.198  -33.852 -47.208 1.00 59.53 ? 125 LEU B CA    1 
ATOM   6507  C  C     . LEU B 1 125 ? -1.312  -35.082 -46.969 1.00 60.34 ? 125 LEU B C     1 
ATOM   6508  O  O     . LEU B 1 125 ? -1.298  -36.009 -47.787 1.00 61.35 ? 125 LEU B O     1 
ATOM   6509  C  CB    . LEU B 1 125 ? -1.424  -32.776 -47.987 1.00 60.70 ? 125 LEU B CB    1 
ATOM   6510  C  CG    . LEU B 1 125 ? -2.184  -31.625 -48.670 1.00 60.89 ? 125 LEU B CG    1 
ATOM   6511  C  CD1   . LEU B 1 125 ? -1.196  -30.622 -49.268 1.00 62.57 ? 125 LEU B CD1   1 
ATOM   6512  C  CD2   . LEU B 1 125 ? -3.166  -32.112 -49.742 1.00 60.37 ? 125 LEU B CD2   1 
ATOM   6513  N  N     . ALA B 1 126 ? -0.584  -35.090 -45.852 1.00 59.96 ? 126 ALA B N     1 
ATOM   6514  C  CA    . ALA B 1 126 ? 0.234   -36.243 -45.472 1.00 60.60 ? 126 ALA B CA    1 
ATOM   6515  C  C     . ALA B 1 126 ? -0.614  -37.462 -45.120 1.00 59.85 ? 126 ALA B C     1 
ATOM   6516  O  O     . ALA B 1 126 ? -0.131  -38.588 -45.174 1.00 60.77 ? 126 ALA B O     1 
ATOM   6517  C  CB    . ALA B 1 126 ? 1.168   -35.889 -44.310 1.00 60.40 ? 126 ALA B CB    1 
ATOM   6518  N  N     . ASN B 1 127 ? -1.874  -37.224 -44.758 1.00 58.73 ? 127 ASN B N     1 
ATOM   6519  C  CA    . ASN B 1 127 ? -2.792  -38.279 -44.316 1.00 57.92 ? 127 ASN B CA    1 
ATOM   6520  C  C     . ASN B 1 127 ? -4.129  -38.244 -45.073 1.00 57.55 ? 127 ASN B C     1 
ATOM   6521  O  O     . ASN B 1 127 ? -5.176  -38.578 -44.516 1.00 56.30 ? 127 ASN B O     1 
ATOM   6522  C  CB    . ASN B 1 127 ? -3.028  -38.191 -42.799 1.00 56.47 ? 127 ASN B CB    1 
ATOM   6523  C  CG    . ASN B 1 127 ? -1.731  -38.203 -41.991 1.00 57.06 ? 127 ASN B CG    1 
ATOM   6524  O  OD1   . ASN B 1 127 ? -1.287  -39.251 -41.519 1.00 57.26 ? 127 ASN B OD1   1 
ATOM   6525  N  ND2   . ASN B 1 127 ? -1.125  -37.032 -41.822 1.00 56.42 ? 127 ASN B ND2   1 
ATOM   6526  N  N     . LYS B 1 128 ? -4.067  -37.823 -46.339 1.00 58.59 ? 128 LYS B N     1 
ATOM   6527  C  CA    . LYS B 1 128 ? -5.213  -37.740 -47.255 1.00 58.66 ? 128 LYS B CA    1 
ATOM   6528  C  C     . LYS B 1 128 ? -6.164  -38.924 -47.153 1.00 58.12 ? 128 LYS B C     1 
ATOM   6529  O  O     . LYS B 1 128 ? -7.346  -38.758 -46.848 1.00 56.65 ? 128 LYS B O     1 
ATOM   6530  C  CB    . LYS B 1 128 ? -4.711  -37.695 -48.707 1.00 60.31 ? 128 LYS B CB    1 
ATOM   6531  C  CG    . LYS B 1 128 ? -4.637  -36.327 -49.359 1.00 61.26 ? 128 LYS B CG    1 
ATOM   6532  C  CD    . LYS B 1 128 ? -4.107  -36.470 -50.785 1.00 62.58 ? 128 LYS B CD    1 
ATOM   6533  C  CE    . LYS B 1 128 ? -4.514  -35.296 -51.663 1.00 64.25 ? 128 LYS B CE    1 
ATOM   6534  N  NZ    . LYS B 1 128 ? -4.449  -35.629 -53.125 1.00 65.79 ? 128 LYS B NZ    1 
ATOM   6535  N  N     . ASP B 1 129 ? -5.620  -40.110 -47.435 1.00 59.16 ? 129 ASP B N     1 
ATOM   6536  C  CA    . ASP B 1 129 ? -6.400  -41.330 -47.651 1.00 59.22 ? 129 ASP B CA    1 
ATOM   6537  C  C     . ASP B 1 129 ? -7.235  -41.718 -46.436 1.00 57.70 ? 129 ASP B C     1 
ATOM   6538  O  O     . ASP B 1 129 ? -8.454  -41.845 -46.532 1.00 57.43 ? 129 ASP B O     1 
ATOM   6539  C  CB    . ASP B 1 129 ? -5.478  -42.486 -48.084 1.00 60.87 ? 129 ASP B CB    1 
ATOM   6540  N  N     . ARG B 1 130 ? -6.572  -41.884 -45.299 1.00 57.01 ? 130 ARG B N     1 
ATOM   6541  C  CA    . ARG B 1 130 ? -7.221  -42.212 -44.032 1.00 55.58 ? 130 ARG B CA    1 
ATOM   6542  C  C     . ARG B 1 130 ? -8.275  -41.168 -43.641 1.00 53.88 ? 130 ARG B C     1 
ATOM   6543  O  O     . ARG B 1 130 ? -9.379  -41.528 -43.237 1.00 52.91 ? 130 ARG B O     1 
ATOM   6544  C  CB    . ARG B 1 130 ? -6.149  -42.334 -42.945 1.00 55.80 ? 130 ARG B CB    1 
ATOM   6545  C  CG    . ARG B 1 130 ? -6.509  -43.187 -41.753 1.00 55.74 ? 130 ARG B CG    1 
ATOM   6546  C  CD    . ARG B 1 130 ? -5.230  -43.587 -41.002 1.00 57.40 ? 130 ARG B CD    1 
ATOM   6547  N  NE    . ARG B 1 130 ? -5.360  -43.581 -39.536 1.00 57.20 ? 130 ARG B NE    1 
ATOM   6548  C  CZ    . ARG B 1 130 ? -6.419  -44.004 -38.846 1.00 56.35 ? 130 ARG B CZ    1 
ATOM   6549  N  NH1   . ARG B 1 130 ? -7.483  -44.512 -39.462 1.00 57.56 ? 130 ARG B NH1   1 
ATOM   6550  N  NH2   . ARG B 1 130 ? -6.406  -43.942 -37.525 1.00 55.27 ? 130 ARG B NH2   1 
ATOM   6551  N  N     . LEU B 1 131 ? -7.932  -39.886 -43.792 1.00 53.36 ? 131 LEU B N     1 
ATOM   6552  C  CA    . LEU B 1 131 ? -8.801  -38.768 -43.394 1.00 52.06 ? 131 LEU B CA    1 
ATOM   6553  C  C     . LEU B 1 131 ? -10.041 -38.598 -44.281 1.00 51.83 ? 131 LEU B C     1 
ATOM   6554  O  O     . LEU B 1 131 ? -11.159 -38.388 -43.772 1.00 50.72 ? 131 LEU B O     1 
ATOM   6555  C  CB    . LEU B 1 131 ? -8.018  -37.447 -43.323 1.00 51.81 ? 131 LEU B CB    1 
ATOM   6556  C  CG    . LEU B 1 131 ? -7.060  -37.223 -42.143 1.00 51.75 ? 131 LEU B CG    1 
ATOM   6557  C  CD1   . LEU B 1 131 ? -6.271  -35.933 -42.316 1.00 51.64 ? 131 LEU B CD1   1 
ATOM   6558  C  CD2   . LEU B 1 131 ? -7.804  -37.204 -40.825 1.00 50.56 ? 131 LEU B CD2   1 
ATOM   6559  N  N     . ASN B 1 132 ? -9.835  -38.688 -45.596 1.00 52.27 ? 132 ASN B N     1 
ATOM   6560  C  CA    . ASN B 1 132 ? -10.910 -38.508 -46.568 1.00 52.07 ? 132 ASN B CA    1 
ATOM   6561  C  C     . ASN B 1 132 ? -11.965 -39.598 -46.489 1.00 51.69 ? 132 ASN B C     1 
ATOM   6562  O  O     . ASN B 1 132 ? -13.145 -39.337 -46.701 1.00 51.14 ? 132 ASN B O     1 
ATOM   6563  C  CB    . ASN B 1 132 ? -10.355 -38.439 -47.994 1.00 53.12 ? 132 ASN B CB    1 
ATOM   6564  C  CG    . ASN B 1 132 ? -9.658  -37.121 -48.291 1.00 53.53 ? 132 ASN B CG    1 
ATOM   6565  O  OD1   . ASN B 1 132 ? -10.033 -36.068 -47.770 1.00 51.19 ? 132 ASN B OD1   1 
ATOM   6566  N  ND2   . ASN B 1 132 ? -8.636  -37.174 -49.146 1.00 55.02 ? 132 ASN B ND2   1 
ATOM   6567  N  N     . SER B 1 133 ? -11.529 -40.815 -46.181 1.00 52.09 ? 133 SER B N     1 
ATOM   6568  C  CA    . SER B 1 133 ? -12.420 -41.964 -46.182 1.00 52.19 ? 133 SER B CA    1 
ATOM   6569  C  C     . SER B 1 133 ? -13.015 -42.260 -44.806 1.00 50.88 ? 133 SER B C     1 
ATOM   6570  O  O     . SER B 1 133 ? -13.921 -43.090 -44.696 1.00 50.96 ? 133 SER B O     1 
ATOM   6571  C  CB    . SER B 1 133 ? -11.722 -43.196 -46.770 1.00 53.48 ? 133 SER B CB    1 
ATOM   6572  O  OG    . SER B 1 133 ? -10.545 -43.491 -46.048 1.00 54.85 ? 133 SER B OG    1 
ATOM   6573  N  N     . ALA B 1 134 ? -12.522 -41.570 -43.774 1.00 49.78 ? 134 ALA B N     1 
ATOM   6574  C  CA    . ALA B 1 134 ? -13.074 -41.673 -42.416 1.00 48.51 ? 134 ALA B CA    1 
ATOM   6575  C  C     . ALA B 1 134 ? -14.385 -40.909 -42.309 1.00 47.54 ? 134 ALA B C     1 
ATOM   6576  O  O     . ALA B 1 134 ? -15.189 -41.161 -41.415 1.00 46.89 ? 134 ALA B O     1 
ATOM   6577  C  CB    . ALA B 1 134 ? -12.078 -41.148 -41.376 1.00 48.08 ? 134 ALA B CB    1 
ATOM   6578  N  N     . ILE B 1 135 ? -14.591 -39.981 -43.234 1.00 47.57 ? 135 ILE B N     1 
ATOM   6579  C  CA    . ILE B 1 135 ? -15.749 -39.094 -43.210 1.00 46.84 ? 135 ILE B CA    1 
ATOM   6580  C  C     . ILE B 1 135 ? -17.039 -39.773 -43.684 1.00 46.87 ? 135 ILE B C     1 
ATOM   6581  O  O     . ILE B 1 135 ? -17.074 -40.384 -44.753 1.00 47.49 ? 135 ILE B O     1 
ATOM   6582  C  CB    . ILE B 1 135 ? -15.458 -37.813 -44.021 1.00 46.90 ? 135 ILE B CB    1 
ATOM   6583  C  CG1   . ILE B 1 135 ? -14.449 -36.954 -43.256 1.00 46.45 ? 135 ILE B CG1   1 
ATOM   6584  C  CG2   . ILE B 1 135 ? -16.724 -37.025 -44.259 1.00 46.42 ? 135 ILE B CG2   1 
ATOM   6585  C  CD1   . ILE B 1 135 ? -13.608 -36.083 -44.117 1.00 46.78 ? 135 ILE B CD1   1 
ATOM   6586  N  N     . ILE B 1 136 ? -18.090 -39.656 -42.875 1.00 46.13 ? 136 ILE B N     1 
ATOM   6587  C  CA    . ILE B 1 136 ? -19.395 -40.222 -43.217 1.00 46.61 ? 136 ILE B CA    1 
ATOM   6588  C  C     . ILE B 1 136 ? -20.379 -39.109 -43.569 1.00 46.53 ? 136 ILE B C     1 
ATOM   6589  O  O     . ILE B 1 136 ? -20.905 -38.435 -42.687 1.00 45.96 ? 136 ILE B O     1 
ATOM   6590  C  CB    . ILE B 1 136 ? -19.954 -41.101 -42.074 1.00 46.09 ? 136 ILE B CB    1 
ATOM   6591  C  CG1   . ILE B 1 136 ? -18.860 -42.025 -41.498 1.00 46.33 ? 136 ILE B CG1   1 
ATOM   6592  C  CG2   . ILE B 1 136 ? -21.221 -41.841 -42.527 1.00 46.35 ? 136 ILE B CG2   1 
ATOM   6593  C  CD1   . ILE B 1 136 ? -18.325 -43.107 -42.454 1.00 47.45 ? 136 ILE B CD1   1 
ATOM   6594  N  N     . TYR B 1 137 ? -20.621 -38.929 -44.866 1.00 47.62 ? 137 TYR B N     1 
ATOM   6595  C  CA    . TYR B 1 137 ? -21.426 -37.816 -45.363 1.00 47.87 ? 137 TYR B CA    1 
ATOM   6596  C  C     . TYR B 1 137 ? -22.919 -37.966 -45.081 1.00 48.26 ? 137 TYR B C     1 
ATOM   6597  O  O     . TYR B 1 137 ? -23.664 -36.979 -45.124 1.00 48.23 ? 137 TYR B O     1 
ATOM   6598  C  CB    . TYR B 1 137 ? -21.140 -37.553 -46.849 1.00 48.54 ? 137 TYR B CB    1 
ATOM   6599  C  CG    . TYR B 1 137 ? -19.753 -36.978 -47.061 1.00 48.73 ? 137 TYR B CG    1 
ATOM   6600  C  CD1   . TYR B 1 137 ? -18.747 -37.728 -47.683 1.00 48.66 ? 137 TYR B CD1   1 
ATOM   6601  C  CD2   . TYR B 1 137 ? -19.433 -35.695 -46.597 1.00 48.00 ? 137 TYR B CD2   1 
ATOM   6602  C  CE1   . TYR B 1 137 ? -17.461 -37.209 -47.856 1.00 49.07 ? 137 TYR B CE1   1 
ATOM   6603  C  CE2   . TYR B 1 137 ? -18.155 -35.162 -46.762 1.00 48.17 ? 137 TYR B CE2   1 
ATOM   6604  C  CZ    . TYR B 1 137 ? -17.171 -35.924 -47.388 1.00 49.65 ? 137 TYR B CZ    1 
ATOM   6605  O  OH    . TYR B 1 137 ? -15.903 -35.404 -47.544 1.00 49.67 ? 137 TYR B OH    1 
ATOM   6606  N  N     . ASP B 1 138 ? -23.347 -39.190 -44.773 1.00 48.86 ? 138 ASP B N     1 
ATOM   6607  C  CA    . ASP B 1 138 ? -24.725 -39.441 -44.350 1.00 49.41 ? 138 ASP B CA    1 
ATOM   6608  C  C     . ASP B 1 138 ? -25.019 -38.780 -43.004 1.00 48.48 ? 138 ASP B C     1 
ATOM   6609  O  O     . ASP B 1 138 ? -26.183 -38.619 -42.620 1.00 48.36 ? 138 ASP B O     1 
ATOM   6610  C  CB    . ASP B 1 138 ? -25.012 -40.942 -44.276 1.00 50.19 ? 138 ASP B CB    1 
ATOM   6611  C  CG    . ASP B 1 138 ? -25.180 -41.576 -45.649 1.00 53.38 ? 138 ASP B CG    1 
ATOM   6612  O  OD1   . ASP B 1 138 ? -25.080 -42.824 -45.749 1.00 56.46 ? 138 ASP B OD1   1 
ATOM   6613  O  OD2   . ASP B 1 138 ? -25.412 -40.838 -46.635 1.00 55.90 ? 138 ASP B OD2   1 
ATOM   6614  N  N     . ARG B 1 139 ? -23.960 -38.397 -42.293 1.00 47.76 ? 139 ARG B N     1 
ATOM   6615  C  CA    . ARG B 1 139 ? -24.107 -37.708 -41.013 1.00 46.86 ? 139 ARG B CA    1 
ATOM   6616  C  C     . ARG B 1 139 ? -24.558 -36.259 -41.185 1.00 46.53 ? 139 ARG B C     1 
ATOM   6617  O  O     . ARG B 1 139 ? -25.110 -35.672 -40.264 1.00 45.59 ? 139 ARG B O     1 
ATOM   6618  C  CB    . ARG B 1 139 ? -22.828 -37.815 -40.189 1.00 46.18 ? 139 ARG B CB    1 
ATOM   6619  C  CG    . ARG B 1 139 ? -22.689 -39.171 -39.522 1.00 46.11 ? 139 ARG B CG    1 
ATOM   6620  C  CD    . ARG B 1 139 ? -21.272 -39.441 -39.042 1.00 44.88 ? 139 ARG B CD    1 
ATOM   6621  N  NE    . ARG B 1 139 ? -21.125 -40.821 -38.592 1.00 44.20 ? 139 ARG B NE    1 
ATOM   6622  C  CZ    . ARG B 1 139 ? -20.002 -41.364 -38.125 1.00 42.77 ? 139 ARG B CZ    1 
ATOM   6623  N  NH1   . ARG B 1 139 ? -18.884 -40.658 -38.030 1.00 41.94 ? 139 ARG B NH1   1 
ATOM   6624  N  NH2   . ARG B 1 139 ? -20.001 -42.633 -37.753 1.00 42.77 ? 139 ARG B NH2   1 
ATOM   6625  N  N     . ASP B 1 140 ? -24.345 -35.705 -42.377 1.00 47.41 ? 140 ASP B N     1 
ATOM   6626  C  CA    . ASP B 1 140 ? -24.847 -34.375 -42.736 1.00 47.86 ? 140 ASP B CA    1 
ATOM   6627  C  C     . ASP B 1 140 ? -26.369 -34.309 -42.693 1.00 48.14 ? 140 ASP B C     1 
ATOM   6628  O  O     . ASP B 1 140 ? -26.938 -33.229 -42.531 1.00 48.26 ? 140 ASP B O     1 
ATOM   6629  C  CB    . ASP B 1 140 ? -24.392 -33.985 -44.145 1.00 48.65 ? 140 ASP B CB    1 
ATOM   6630  C  CG    . ASP B 1 140 ? -22.967 -33.477 -44.188 1.00 49.85 ? 140 ASP B CG    1 
ATOM   6631  O  OD1   . ASP B 1 140 ? -22.417 -33.368 -45.313 1.00 50.81 ? 140 ASP B OD1   1 
ATOM   6632  O  OD2   . ASP B 1 140 ? -22.395 -33.186 -43.109 1.00 50.06 ? 140 ASP B OD2   1 
ATOM   6633  N  N     . PHE B 1 141 ? -27.012 -35.465 -42.842 1.00 48.52 ? 141 PHE B N     1 
ATOM   6634  C  CA    . PHE B 1 141 ? -28.463 -35.557 -42.887 1.00 49.27 ? 141 PHE B CA    1 
ATOM   6635  C  C     . PHE B 1 141 ? -29.092 -35.764 -41.511 1.00 49.21 ? 141 PHE B C     1 
ATOM   6636  O  O     . PHE B 1 141 ? -30.307 -35.978 -41.413 1.00 49.83 ? 141 PHE B O     1 
ATOM   6637  C  CB    . PHE B 1 141 ? -28.897 -36.682 -43.836 1.00 49.92 ? 141 PHE B CB    1 
ATOM   6638  C  CG    . PHE B 1 141 ? -28.482 -36.465 -45.260 1.00 50.76 ? 141 PHE B CG    1 
ATOM   6639  C  CD1   . PHE B 1 141 ? -29.279 -35.713 -46.125 1.00 51.71 ? 141 PHE B CD1   1 
ATOM   6640  C  CD2   . PHE B 1 141 ? -27.288 -37.001 -45.740 1.00 51.35 ? 141 PHE B CD2   1 
ATOM   6641  C  CE1   . PHE B 1 141 ? -28.900 -35.499 -47.454 1.00 52.26 ? 141 PHE B CE1   1 
ATOM   6642  C  CE2   . PHE B 1 141 ? -26.897 -36.798 -47.061 1.00 52.45 ? 141 PHE B CE2   1 
ATOM   6643  C  CZ    . PHE B 1 141 ? -27.707 -36.044 -47.926 1.00 52.90 ? 141 PHE B CZ    1 
ATOM   6644  N  N     . SER B 1 142 ? -28.283 -35.684 -40.454 1.00 48.82 ? 142 SER B N     1 
ATOM   6645  C  CA    . SER B 1 142 ? -28.775 -35.922 -39.096 1.00 48.84 ? 142 SER B CA    1 
ATOM   6646  C  C     . SER B 1 142 ? -29.369 -34.686 -38.410 1.00 48.53 ? 142 SER B C     1 
ATOM   6647  O  O     . SER B 1 142 ? -30.066 -34.809 -37.399 1.00 48.56 ? 142 SER B O     1 
ATOM   6648  C  CB    . SER B 1 142 ? -27.696 -36.573 -38.229 1.00 48.57 ? 142 SER B CB    1 
ATOM   6649  O  OG    . SER B 1 142 ? -26.582 -35.710 -38.062 1.00 49.46 ? 142 SER B OG    1 
ATOM   6650  N  N     . TYR B 1 143 ? -29.115 -33.508 -38.980 1.00 48.52 ? 143 TYR B N     1 
ATOM   6651  C  CA    . TYR B 1 143 ? -29.627 -32.236 -38.464 1.00 48.08 ? 143 TYR B CA    1 
ATOM   6652  C  C     . TYR B 1 143 ? -31.106 -31.965 -38.781 1.00 48.82 ? 143 TYR B C     1 
ATOM   6653  O  O     . TYR B 1 143 ? -31.701 -32.612 -39.661 1.00 49.41 ? 143 TYR B O     1 
ATOM   6654  C  CB    . TYR B 1 143 ? -28.785 -31.085 -39.018 1.00 48.23 ? 143 TYR B CB    1 
ATOM   6655  C  CG    . TYR B 1 143 ? -27.305 -31.211 -38.724 1.00 48.06 ? 143 TYR B CG    1 
ATOM   6656  C  CD1   . TYR B 1 143 ? -26.425 -31.716 -39.688 1.00 48.55 ? 143 TYR B CD1   1 
ATOM   6657  C  CD2   . TYR B 1 143 ? -26.785 -30.839 -37.477 1.00 47.22 ? 143 TYR B CD2   1 
ATOM   6658  C  CE1   . TYR B 1 143 ? -25.061 -31.846 -39.421 1.00 48.02 ? 143 TYR B CE1   1 
ATOM   6659  C  CE2   . TYR B 1 143 ? -25.427 -30.959 -37.200 1.00 46.85 ? 143 TYR B CE2   1 
ATOM   6660  C  CZ    . TYR B 1 143 ? -24.569 -31.462 -38.178 1.00 47.45 ? 143 TYR B CZ    1 
ATOM   6661  O  OH    . TYR B 1 143 ? -23.219 -31.584 -37.915 1.00 47.15 ? 143 TYR B OH    1 
ATOM   6662  N  N     . ASN B 1 144 ? -31.693 -31.015 -38.046 1.00 48.32 ? 144 ASN B N     1 
ATOM   6663  C  CA    . ASN B 1 144 ? -32.973 -30.414 -38.425 1.00 49.02 ? 144 ASN B CA    1 
ATOM   6664  C  C     . ASN B 1 144 ? -32.721 -29.073 -39.136 1.00 49.35 ? 144 ASN B C     1 
ATOM   6665  O  O     . ASN B 1 144 ? -31.602 -28.549 -39.095 1.00 49.07 ? 144 ASN B O     1 
ATOM   6666  C  CB    . ASN B 1 144 ? -33.933 -30.278 -37.222 1.00 48.60 ? 144 ASN B CB    1 
ATOM   6667  C  CG    . ASN B 1 144 ? -33.509 -29.194 -36.226 1.00 47.90 ? 144 ASN B CG    1 
ATOM   6668  O  OD1   . ASN B 1 144 ? -33.107 -28.088 -36.603 1.00 47.71 ? 144 ASN B OD1   1 
ATOM   6669  N  ND2   . ASN B 1 144 ? -33.620 -29.507 -34.943 1.00 46.93 ? 144 ASN B ND2   1 
ATOM   6670  N  N     . TYR B 1 145 ? -33.750 -28.530 -39.780 1.00 50.16 ? 145 TYR B N     1 
ATOM   6671  C  CA    . TYR B 1 145 ? -33.624 -27.312 -40.596 1.00 50.93 ? 145 TYR B CA    1 
ATOM   6672  C  C     . TYR B 1 145 ? -32.918 -26.151 -39.889 1.00 50.20 ? 145 TYR B C     1 
ATOM   6673  O  O     . TYR B 1 145 ? -32.000 -25.544 -40.441 1.00 50.09 ? 145 TYR B O     1 
ATOM   6674  C  CB    . TYR B 1 145 ? -35.011 -26.868 -41.079 1.00 52.20 ? 145 TYR B CB    1 
ATOM   6675  C  CG    . TYR B 1 145 ? -35.029 -25.728 -42.082 1.00 53.13 ? 145 TYR B CG    1 
ATOM   6676  C  CD1   . TYR B 1 145 ? -34.651 -25.931 -43.415 1.00 54.39 ? 145 TYR B CD1   1 
ATOM   6677  C  CD2   . TYR B 1 145 ? -35.465 -24.458 -41.708 1.00 53.47 ? 145 TYR B CD2   1 
ATOM   6678  C  CE1   . TYR B 1 145 ? -34.685 -24.885 -44.346 1.00 55.40 ? 145 TYR B CE1   1 
ATOM   6679  C  CE2   . TYR B 1 145 ? -35.508 -23.408 -42.627 1.00 54.72 ? 145 TYR B CE2   1 
ATOM   6680  C  CZ    . TYR B 1 145 ? -35.119 -23.628 -43.942 1.00 55.36 ? 145 TYR B CZ    1 
ATOM   6681  O  OH    . TYR B 1 145 ? -35.158 -22.588 -44.844 1.00 55.60 ? 145 TYR B OH    1 
ATOM   6682  N  N     . PHE B 1 146 ? -33.352 -25.863 -38.666 1.00 49.72 ? 146 PHE B N     1 
ATOM   6683  C  CA    . PHE B 1 146 ? -32.902 -24.693 -37.919 1.00 49.31 ? 146 PHE B CA    1 
ATOM   6684  C  C     . PHE B 1 146 ? -31.467 -24.845 -37.422 1.00 48.23 ? 146 PHE B C     1 
ATOM   6685  O  O     . PHE B 1 146 ? -30.725 -23.863 -37.335 1.00 48.03 ? 146 PHE B O     1 
ATOM   6686  C  CB    . PHE B 1 146 ? -33.876 -24.409 -36.772 1.00 49.57 ? 146 PHE B CB    1 
ATOM   6687  C  CG    . PHE B 1 146 ? -35.319 -24.556 -37.172 1.00 51.37 ? 146 PHE B CG    1 
ATOM   6688  C  CD1   . PHE B 1 146 ? -35.977 -23.528 -37.849 1.00 53.66 ? 146 PHE B CD1   1 
ATOM   6689  C  CD2   . PHE B 1 146 ? -36.013 -25.737 -36.911 1.00 51.96 ? 146 PHE B CD2   1 
ATOM   6690  C  CE1   . PHE B 1 146 ? -37.325 -23.666 -38.246 1.00 54.43 ? 146 PHE B CE1   1 
ATOM   6691  C  CE2   . PHE B 1 146 ? -37.353 -25.885 -37.299 1.00 53.61 ? 146 PHE B CE2   1 
ATOM   6692  C  CZ    . PHE B 1 146 ? -38.011 -24.844 -37.966 1.00 54.10 ? 146 PHE B CZ    1 
ATOM   6693  N  N     . GLY B 1 147 ? -31.071 -26.077 -37.124 1.00 47.51 ? 147 GLY B N     1 
ATOM   6694  C  CA    . GLY B 1 147 ? -29.672 -26.373 -36.841 1.00 46.70 ? 147 GLY B CA    1 
ATOM   6695  C  C     . GLY B 1 147 ? -28.803 -26.165 -38.068 1.00 47.05 ? 147 GLY B C     1 
ATOM   6696  O  O     . GLY B 1 147 ? -27.714 -25.584 -37.979 1.00 46.48 ? 147 GLY B O     1 
ATOM   6697  N  N     . PHE B 1 148 ? -29.289 -26.634 -39.220 1.00 47.85 ? 148 PHE B N     1 
ATOM   6698  C  CA    . PHE B 1 148 ? -28.537 -26.516 -40.464 1.00 48.11 ? 148 PHE B CA    1 
ATOM   6699  C  C     . PHE B 1 148 ? -28.328 -25.056 -40.841 1.00 48.47 ? 148 PHE B C     1 
ATOM   6700  O  O     . PHE B 1 148 ? -27.228 -24.654 -41.245 1.00 48.22 ? 148 PHE B O     1 
ATOM   6701  C  CB    . PHE B 1 148 ? -29.210 -27.272 -41.614 1.00 49.02 ? 148 PHE B CB    1 
ATOM   6702  C  CG    . PHE B 1 148 ? -28.492 -27.116 -42.943 1.00 49.62 ? 148 PHE B CG    1 
ATOM   6703  C  CD1   . PHE B 1 148 ? -27.257 -27.727 -43.161 1.00 49.82 ? 148 PHE B CD1   1 
ATOM   6704  C  CD2   . PHE B 1 148 ? -29.038 -26.342 -43.954 1.00 49.93 ? 148 PHE B CD2   1 
ATOM   6705  C  CE1   . PHE B 1 148 ? -26.585 -27.572 -44.372 1.00 51.18 ? 148 PHE B CE1   1 
ATOM   6706  C  CE2   . PHE B 1 148 ? -28.375 -26.185 -45.170 1.00 51.64 ? 148 PHE B CE2   1 
ATOM   6707  C  CZ    . PHE B 1 148 ? -27.150 -26.803 -45.380 1.00 51.39 ? 148 PHE B CZ    1 
ATOM   6708  N  N     . LYS B 1 149 ? -29.387 -24.266 -40.702 1.00 48.86 ? 149 LYS B N     1 
ATOM   6709  C  CA    . LYS B 1 149 ? -29.327 -22.854 -41.066 1.00 49.60 ? 149 LYS B CA    1 
ATOM   6710  C  C     . LYS B 1 149 ? -28.345 -22.060 -40.199 1.00 48.99 ? 149 LYS B C     1 
ATOM   6711  O  O     . LYS B 1 149 ? -27.663 -21.170 -40.714 1.00 49.55 ? 149 LYS B O     1 
ATOM   6712  C  CB    . LYS B 1 149 ? -30.724 -22.226 -41.074 1.00 50.18 ? 149 LYS B CB    1 
ATOM   6713  C  CG    . LYS B 1 149 ? -31.238 -21.895 -42.466 1.00 52.02 ? 149 LYS B CG    1 
ATOM   6714  C  CD    . LYS B 1 149 ? -31.406 -23.127 -43.336 1.00 52.62 ? 149 LYS B CD    1 
ATOM   6715  C  CE    . LYS B 1 149 ? -30.970 -22.849 -44.768 1.00 54.38 ? 149 LYS B CE    1 
ATOM   6716  N  NZ    . LYS B 1 149 ? -31.551 -21.607 -45.361 1.00 55.87 ? 149 LYS B NZ    1 
ATOM   6717  N  N     . THR B 1 150 ? -28.272 -22.390 -38.903 1.00 47.79 ? 150 THR B N     1 
ATOM   6718  C  CA    . THR B 1 150 ? -27.266 -21.812 -38.003 1.00 47.02 ? 150 THR B CA    1 
ATOM   6719  C  C     . THR B 1 150 ? -25.845 -22.151 -38.473 1.00 46.86 ? 150 THR B C     1 
ATOM   6720  O  O     . THR B 1 150 ? -24.993 -21.265 -38.559 1.00 47.18 ? 150 THR B O     1 
ATOM   6721  C  CB    . THR B 1 150 ? -27.477 -22.249 -36.527 1.00 46.28 ? 150 THR B CB    1 
ATOM   6722  O  OG1   . THR B 1 150 ? -28.759 -21.791 -36.069 1.00 46.79 ? 150 THR B OG1   1 
ATOM   6723  C  CG2   . THR B 1 150 ? -26.392 -21.670 -35.623 1.00 45.01 ? 150 THR B CG2   1 
ATOM   6724  N  N     . LEU B 1 151 ? -25.607 -23.422 -38.795 1.00 46.72 ? 151 LEU B N     1 
ATOM   6725  C  CA    . LEU B 1 151 ? -24.331 -23.865 -39.369 1.00 46.77 ? 151 LEU B CA    1 
ATOM   6726  C  C     . LEU B 1 151 ? -24.014 -23.131 -40.663 1.00 47.91 ? 151 LEU B C     1 
ATOM   6727  O  O     . LEU B 1 151 ? -22.884 -22.686 -40.868 1.00 48.16 ? 151 LEU B O     1 
ATOM   6728  C  CB    . LEU B 1 151 ? -24.351 -25.365 -39.666 1.00 46.70 ? 151 LEU B CB    1 
ATOM   6729  C  CG    . LEU B 1 151 ? -24.168 -26.425 -38.585 1.00 45.40 ? 151 LEU B CG    1 
ATOM   6730  C  CD1   . LEU B 1 151 ? -24.276 -27.774 -39.245 1.00 45.50 ? 151 LEU B CD1   1 
ATOM   6731  C  CD2   . LEU B 1 151 ? -22.839 -26.295 -37.881 1.00 44.06 ? 151 LEU B CD2   1 
ATOM   6732  N  N     . GLU B 1 152 ? -25.020 -23.009 -41.526 1.00 48.88 ? 152 GLU B N     1 
ATOM   6733  C  CA    . GLU B 1 152 ? -24.840 -22.432 -42.853 1.00 50.45 ? 152 GLU B CA    1 
ATOM   6734  C  C     . GLU B 1 152 ? -24.501 -20.938 -42.820 1.00 50.68 ? 152 GLU B C     1 
ATOM   6735  O  O     . GLU B 1 152 ? -23.660 -20.471 -43.601 1.00 51.50 ? 152 GLU B O     1 
ATOM   6736  C  CB    . GLU B 1 152 ? -26.078 -22.682 -43.719 1.00 51.35 ? 152 GLU B CB    1 
ATOM   6737  C  CG    . GLU B 1 152 ? -25.900 -22.284 -45.171 1.00 54.14 ? 152 GLU B CG    1 
ATOM   6738  C  CD    . GLU B 1 152 ? -27.204 -22.270 -45.938 1.00 57.97 ? 152 GLU B CD    1 
ATOM   6739  O  OE1   . GLU B 1 152 ? -27.309 -23.044 -46.917 1.00 59.76 ? 152 GLU B OE1   1 
ATOM   6740  O  OE2   . GLU B 1 152 ? -28.119 -21.492 -45.566 1.00 59.05 ? 152 GLU B OE2   1 
ATOM   6741  N  N     . ARG B 1 153 ? -25.147 -20.201 -41.920 1.00 49.98 ? 153 ARG B N     1 
ATOM   6742  C  CA    . ARG B 1 153 ? -24.898 -18.767 -41.786 1.00 50.27 ? 153 ARG B CA    1 
ATOM   6743  C  C     . ARG B 1 153 ? -23.483 -18.441 -41.285 1.00 49.70 ? 153 ARG B C     1 
ATOM   6744  O  O     . ARG B 1 153 ? -22.856 -17.511 -41.787 1.00 50.21 ? 153 ARG B O     1 
ATOM   6745  C  CB    . ARG B 1 153 ? -25.967 -18.099 -40.891 1.00 50.02 ? 153 ARG B CB    1 
ATOM   6746  N  N     . SER B 1 154 ? -22.970 -19.211 -40.324 1.00 48.59 ? 154 SER B N     1 
ATOM   6747  C  CA    . SER B 1 154 ? -21.728 -18.809 -39.644 1.00 48.14 ? 154 SER B CA    1 
ATOM   6748  C  C     . SER B 1 154 ? -20.570 -19.812 -39.613 1.00 47.72 ? 154 SER B C     1 
ATOM   6749  O  O     . SER B 1 154 ? -19.419 -19.408 -39.483 1.00 47.61 ? 154 SER B O     1 
ATOM   6750  C  CB    . SER B 1 154 ? -22.039 -18.354 -38.216 1.00 47.23 ? 154 SER B CB    1 
ATOM   6751  O  OG    . SER B 1 154 ? -23.176 -17.513 -38.189 1.00 47.51 ? 154 SER B OG    1 
ATOM   6752  N  N     . TYR B 1 155 ? -20.869 -21.103 -39.737 1.00 47.46 ? 155 TYR B N     1 
ATOM   6753  C  CA    . TYR B 1 155 ? -19.910 -22.149 -39.368 1.00 46.97 ? 155 TYR B CA    1 
ATOM   6754  C  C     . TYR B 1 155 ? -19.244 -22.887 -40.529 1.00 47.75 ? 155 TYR B C     1 
ATOM   6755  O  O     . TYR B 1 155 ? -18.208 -23.538 -40.347 1.00 47.58 ? 155 TYR B O     1 
ATOM   6756  C  CB    . TYR B 1 155 ? -20.576 -23.167 -38.442 1.00 46.02 ? 155 TYR B CB    1 
ATOM   6757  C  CG    . TYR B 1 155 ? -20.979 -22.610 -37.102 1.00 45.09 ? 155 TYR B CG    1 
ATOM   6758  C  CD1   . TYR B 1 155 ? -22.178 -21.902 -36.946 1.00 45.18 ? 155 TYR B CD1   1 
ATOM   6759  C  CD2   . TYR B 1 155 ? -20.177 -22.806 -35.982 1.00 44.66 ? 155 TYR B CD2   1 
ATOM   6760  C  CE1   . TYR B 1 155 ? -22.558 -21.391 -35.709 1.00 44.74 ? 155 TYR B CE1   1 
ATOM   6761  C  CE2   . TYR B 1 155 ? -20.548 -22.300 -34.731 1.00 44.39 ? 155 TYR B CE2   1 
ATOM   6762  C  CZ    . TYR B 1 155 ? -21.737 -21.594 -34.607 1.00 44.23 ? 155 TYR B CZ    1 
ATOM   6763  O  OH    . TYR B 1 155 ? -22.099 -21.090 -33.386 1.00 43.34 ? 155 TYR B OH    1 
ATOM   6764  N  N     . LEU B 1 156 ? -19.838 -22.812 -41.712 1.00 48.42 ? 156 LEU B N     1 
ATOM   6765  C  CA    . LEU B 1 156 ? -19.235 -23.458 -42.874 1.00 49.10 ? 156 LEU B CA    1 
ATOM   6766  C  C     . LEU B 1 156 ? -18.459 -22.422 -43.674 1.00 50.34 ? 156 LEU B C     1 
ATOM   6767  O  O     . LEU B 1 156 ? -19.030 -21.445 -44.163 1.00 51.00 ? 156 LEU B O     1 
ATOM   6768  C  CB    . LEU B 1 156 ? -20.301 -24.156 -43.724 1.00 48.96 ? 156 LEU B CB    1 
ATOM   6769  C  CG    . LEU B 1 156 ? -21.291 -25.048 -42.972 1.00 47.16 ? 156 LEU B CG    1 
ATOM   6770  C  CD1   . LEU B 1 156 ? -22.335 -25.587 -43.922 1.00 45.79 ? 156 LEU B CD1   1 
ATOM   6771  C  CD2   . LEU B 1 156 ? -20.573 -26.192 -42.224 1.00 46.24 ? 156 LEU B CD2   1 
ATOM   6772  N  N     . LEU B 1 157 ? -17.152 -22.623 -43.774 1.00 51.13 ? 157 LEU B N     1 
ATOM   6773  C  CA    . LEU B 1 157 ? -16.282 -21.654 -44.430 1.00 52.71 ? 157 LEU B CA    1 
ATOM   6774  C  C     . LEU B 1 157 ? -16.708 -21.427 -45.871 1.00 54.33 ? 157 LEU B C     1 
ATOM   6775  O  O     . LEU B 1 157 ? -16.931 -22.384 -46.623 1.00 54.75 ? 157 LEU B O     1 
ATOM   6776  C  CB    . LEU B 1 157 ? -14.816 -22.080 -44.348 1.00 52.83 ? 157 LEU B CB    1 
ATOM   6777  C  CG    . LEU B 1 157 ? -14.115 -21.840 -43.009 1.00 52.28 ? 157 LEU B CG    1 
ATOM   6778  C  CD1   . LEU B 1 157 ? -12.688 -22.370 -43.053 1.00 52.62 ? 157 LEU B CD1   1 
ATOM   6779  C  CD2   . LEU B 1 157 ? -14.133 -20.350 -42.624 1.00 51.89 ? 157 LEU B CD2   1 
ATOM   6780  N  N     . LYS B 1 158 ? -16.856 -20.153 -46.230 1.00 55.53 ? 158 LYS B N     1 
ATOM   6781  C  CA    . LYS B 1 158 ? -17.353 -19.758 -47.543 1.00 56.84 ? 158 LYS B CA    1 
ATOM   6782  C  C     . LYS B 1 158 ? -16.222 -19.269 -48.417 1.00 58.38 ? 158 LYS B C     1 
ATOM   6783  O  O     . LYS B 1 158 ? -15.357 -18.531 -47.952 1.00 58.69 ? 158 LYS B O     1 
ATOM   6784  C  CB    . LYS B 1 158 ? -18.401 -18.649 -47.414 1.00 57.02 ? 158 LYS B CB    1 
ATOM   6785  C  CG    . LYS B 1 158 ? -19.769 -19.123 -46.968 1.00 56.31 ? 158 LYS B CG    1 
ATOM   6786  C  CD    . LYS B 1 158 ? -20.681 -17.960 -46.664 1.00 57.16 ? 158 LYS B CD    1 
ATOM   6787  C  CE    . LYS B 1 158 ? -22.053 -18.436 -46.204 1.00 57.06 ? 158 LYS B CE    1 
ATOM   6788  N  NZ    . LYS B 1 158 ? -22.884 -17.322 -45.652 1.00 57.66 ? 158 LYS B NZ    1 
ATOM   6789  N  N     . ILE B 1 159 ? -16.233 -19.702 -49.678 1.00 59.62 ? 159 ILE B N     1 
ATOM   6790  C  CA    . ILE B 1 159 ? -15.384 -19.137 -50.720 1.00 61.32 ? 159 ILE B CA    1 
ATOM   6791  C  C     . ILE B 1 159 ? -16.241 -18.131 -51.496 1.00 62.47 ? 159 ILE B C     1 
ATOM   6792  O  O     . ILE B 1 159 ? -17.269 -18.502 -52.070 1.00 62.91 ? 159 ILE B O     1 
ATOM   6793  C  CB    . ILE B 1 159 ? -14.838 -20.245 -51.677 1.00 61.95 ? 159 ILE B CB    1 
ATOM   6794  C  CG1   . ILE B 1 159 ? -13.825 -21.160 -50.967 1.00 61.12 ? 159 ILE B CG1   1 
ATOM   6795  C  CG2   . ILE B 1 159 ? -14.255 -19.641 -52.967 1.00 63.85 ? 159 ILE B CG2   1 
ATOM   6796  C  CD1   . ILE B 1 159 ? -12.423 -20.580 -50.797 1.00 61.81 ? 159 ILE B CD1   1 
ATOM   6797  N  N     . ASN B 1 160 ? -15.825 -16.862 -51.491 1.00 63.30 ? 160 ASN B N     1 
ATOM   6798  C  CA    . ASN B 1 160 ? -16.551 -15.768 -52.155 1.00 64.54 ? 160 ASN B CA    1 
ATOM   6799  C  C     . ASN B 1 160 ? -18.075 -15.799 -52.004 1.00 63.97 ? 160 ASN B C     1 
ATOM   6800  O  O     . ASN B 1 160 ? -18.811 -15.759 -53.002 1.00 64.90 ? 160 ASN B O     1 
ATOM   6801  C  CB    . ASN B 1 160 ? -16.175 -15.683 -53.639 1.00 66.27 ? 160 ASN B CB    1 
ATOM   6802  C  CG    . ASN B 1 160 ? -14.784 -15.129 -53.853 1.00 68.05 ? 160 ASN B CG    1 
ATOM   6803  O  OD1   . ASN B 1 160 ? -14.307 -14.290 -53.083 1.00 68.92 ? 160 ASN B OD1   1 
ATOM   6804  N  ND2   . ASN B 1 160 ? -14.121 -15.594 -54.906 1.00 69.29 ? 160 ASN B ND2   1 
ATOM   6805  N  N     . GLY B 1 161 ? -18.537 -15.877 -50.759 1.00 62.23 ? 161 GLY B N     1 
ATOM   6806  C  CA    . GLY B 1 161 ? -19.970 -15.889 -50.468 1.00 61.64 ? 161 GLY B CA    1 
ATOM   6807  C  C     . GLY B 1 161 ? -20.686 -17.200 -50.753 1.00 60.92 ? 161 GLY B C     1 
ATOM   6808  O  O     . GLY B 1 161 ? -21.892 -17.312 -50.512 1.00 60.48 ? 161 GLY B O     1 
ATOM   6809  N  N     . LYS B 1 162 ? -19.951 -18.186 -51.271 1.00 60.65 ? 162 LYS B N     1 
ATOM   6810  C  CA    . LYS B 1 162 ? -20.494 -19.522 -51.518 1.00 59.84 ? 162 LYS B CA    1 
ATOM   6811  C  C     . LYS B 1 162 ? -19.903 -20.545 -50.548 1.00 58.17 ? 162 LYS B C     1 
ATOM   6812  O  O     . LYS B 1 162 ? -18.680 -20.653 -50.420 1.00 58.22 ? 162 LYS B O     1 
ATOM   6813  C  CB    . LYS B 1 162 ? -20.243 -19.945 -52.969 1.00 61.15 ? 162 LYS B CB    1 
ATOM   6814  C  CG    . LYS B 1 162 ? -20.796 -21.322 -53.318 1.00 61.73 ? 162 LYS B CG    1 
ATOM   6815  C  CD    . LYS B 1 162 ? -20.776 -21.578 -54.819 1.00 63.82 ? 162 LYS B CD    1 
ATOM   6816  C  CE    . LYS B 1 162 ? -21.180 -23.013 -55.130 1.00 64.12 ? 162 LYS B CE    1 
ATOM   6817  N  NZ    . LYS B 1 162 ? -21.826 -23.124 -56.477 1.00 66.01 ? 162 LYS B NZ    1 
ATOM   6818  N  N     . VAL B 1 163 ? -20.781 -21.288 -49.870 1.00 56.65 ? 163 VAL B N     1 
ATOM   6819  C  CA    . VAL B 1 163 ? -20.371 -22.325 -48.913 1.00 54.88 ? 163 VAL B CA    1 
ATOM   6820  C  C     . VAL B 1 163 ? -19.523 -23.413 -49.583 1.00 54.80 ? 163 VAL B C     1 
ATOM   6821  O  O     . VAL B 1 163 ? -19.942 -24.033 -50.572 1.00 55.65 ? 163 VAL B O     1 
ATOM   6822  C  CB    . VAL B 1 163 ? -21.593 -22.962 -48.181 1.00 54.16 ? 163 VAL B CB    1 
ATOM   6823  C  CG1   . VAL B 1 163 ? -21.162 -24.153 -47.333 1.00 52.96 ? 163 VAL B CG1   1 
ATOM   6824  C  CG2   . VAL B 1 163 ? -22.307 -21.928 -47.310 1.00 53.27 ? 163 VAL B CG2   1 
ATOM   6825  N  N     . ALA B 1 164 ? -18.323 -23.619 -49.049 1.00 53.61 ? 164 ALA B N     1 
ATOM   6826  C  CA    . ALA B 1 164 ? -17.397 -24.602 -49.588 1.00 53.22 ? 164 ALA B CA    1 
ATOM   6827  C  C     . ALA B 1 164 ? -17.305 -25.848 -48.700 1.00 51.96 ? 164 ALA B C     1 
ATOM   6828  O  O     . ALA B 1 164 ? -16.982 -26.938 -49.183 1.00 52.42 ? 164 ALA B O     1 
ATOM   6829  C  CB    . ALA B 1 164 ? -16.029 -23.979 -49.788 1.00 53.72 ? 164 ALA B CB    1 
ATOM   6830  N  N     . GLU B 1 165 ? -17.592 -25.690 -47.410 1.00 50.10 ? 165 GLU B N     1 
ATOM   6831  C  CA    . GLU B 1 165 ? -17.492 -26.793 -46.463 1.00 48.67 ? 165 GLU B CA    1 
ATOM   6832  C  C     . GLU B 1 165 ? -18.823 -27.461 -46.192 1.00 47.64 ? 165 GLU B C     1 
ATOM   6833  O  O     . GLU B 1 165 ? -19.802 -26.805 -45.825 1.00 47.13 ? 165 GLU B O     1 
ATOM   6834  C  CB    . GLU B 1 165 ? -16.945 -26.307 -45.125 1.00 47.97 ? 165 GLU B CB    1 
ATOM   6835  C  CG    . GLU B 1 165 ? -15.469 -26.034 -45.089 1.00 49.99 ? 165 GLU B CG    1 
ATOM   6836  C  CD    . GLU B 1 165 ? -14.988 -25.762 -43.677 1.00 51.59 ? 165 GLU B CD    1 
ATOM   6837  O  OE1   . GLU B 1 165 ? -15.680 -25.017 -42.945 1.00 52.33 ? 165 GLU B OE1   1 
ATOM   6838  O  OE2   . GLU B 1 165 ? -13.921 -26.301 -43.298 1.00 52.92 ? 165 GLU B OE2   1 
ATOM   6839  N  N     . ARG B 1 166 ? -18.844 -28.777 -46.358 1.00 47.12 ? 166 ARG B N     1 
ATOM   6840  C  CA    . ARG B 1 166 ? -19.898 -29.604 -45.796 1.00 45.96 ? 166 ARG B CA    1 
ATOM   6841  C  C     . ARG B 1 166 ? -19.715 -29.643 -44.271 1.00 44.91 ? 166 ARG B C     1 
ATOM   6842  O  O     . ARG B 1 166 ? -18.585 -29.492 -43.785 1.00 44.50 ? 166 ARG B O     1 
ATOM   6843  C  CB    . ARG B 1 166 ? -19.834 -31.010 -46.392 1.00 46.17 ? 166 ARG B CB    1 
ATOM   6844  C  CG    . ARG B 1 166 ? -20.134 -31.036 -47.876 1.00 46.52 ? 166 ARG B CG    1 
ATOM   6845  C  CD    . ARG B 1 166 ? -20.116 -32.429 -48.451 1.00 45.82 ? 166 ARG B CD    1 
ATOM   6846  N  NE    . ARG B 1 166 ? -20.498 -32.404 -49.857 1.00 47.26 ? 166 ARG B NE    1 
ATOM   6847  C  CZ    . ARG B 1 166 ? -20.526 -33.464 -50.658 1.00 48.52 ? 166 ARG B CZ    1 
ATOM   6848  N  NH1   . ARG B 1 166 ? -20.187 -34.667 -50.205 1.00 49.57 ? 166 ARG B NH1   1 
ATOM   6849  N  NH2   . ARG B 1 166 ? -20.894 -33.321 -51.925 1.00 49.19 ? 166 ARG B NH2   1 
ATOM   6850  N  N     . PRO B 1 167 ? -20.822 -29.802 -43.509 1.00 44.08 ? 167 PRO B N     1 
ATOM   6851  C  CA    . PRO B 1 167 ? -20.707 -29.988 -42.063 1.00 43.17 ? 167 PRO B CA    1 
ATOM   6852  C  C     . PRO B 1 167 ? -19.616 -30.985 -41.660 1.00 43.28 ? 167 PRO B C     1 
ATOM   6853  O  O     . PRO B 1 167 ? -18.893 -30.732 -40.686 1.00 43.07 ? 167 PRO B O     1 
ATOM   6854  C  CB    . PRO B 1 167 ? -22.092 -30.499 -41.662 1.00 42.94 ? 167 PRO B CB    1 
ATOM   6855  C  CG    . PRO B 1 167 ? -23.019 -29.854 -42.650 1.00 43.90 ? 167 PRO B CG    1 
ATOM   6856  C  CD    . PRO B 1 167 ? -22.233 -29.754 -43.946 1.00 44.53 ? 167 PRO B CD    1 
ATOM   6857  N  N     . GLN B 1 168 ? -19.482 -32.089 -42.404 1.00 43.49 ? 168 GLN B N     1 
ATOM   6858  C  CA    . GLN B 1 168 ? -18.459 -33.100 -42.102 1.00 43.14 ? 168 GLN B CA    1 
ATOM   6859  C  C     . GLN B 1 168 ? -17.033 -32.580 -42.312 1.00 43.29 ? 168 GLN B C     1 
ATOM   6860  O  O     . GLN B 1 168 ? -16.114 -32.969 -41.583 1.00 43.05 ? 168 GLN B O     1 
ATOM   6861  C  CB    . GLN B 1 168 ? -18.683 -34.385 -42.909 1.00 43.70 ? 168 GLN B CB    1 
ATOM   6862  C  CG    . GLN B 1 168 ? -20.011 -35.084 -42.668 1.00 43.52 ? 168 GLN B CG    1 
ATOM   6863  C  CD    . GLN B 1 168 ? -20.332 -35.249 -41.202 1.00 43.45 ? 168 GLN B CD    1 
ATOM   6864  O  OE1   . GLN B 1 168 ? -19.765 -36.099 -40.513 1.00 42.95 ? 168 GLN B OE1   1 
ATOM   6865  N  NE2   . GLN B 1 168 ? -21.255 -34.435 -40.714 1.00 43.43 ? 168 GLN B NE2   1 
ATOM   6866  N  N     . HIS B 1 169 ? -16.862 -31.707 -43.306 1.00 43.59 ? 169 HIS B N     1 
ATOM   6867  C  CA    . HIS B 1 169 ? -15.569 -31.071 -43.595 1.00 43.85 ? 169 HIS B CA    1 
ATOM   6868  C  C     . HIS B 1 169 ? -15.133 -30.163 -42.450 1.00 42.90 ? 169 HIS B C     1 
ATOM   6869  O  O     . HIS B 1 169 ? -13.967 -30.168 -42.038 1.00 42.94 ? 169 HIS B O     1 
ATOM   6870  C  CB    . HIS B 1 169 ? -15.630 -30.259 -44.899 1.00 44.38 ? 169 HIS B CB    1 
ATOM   6871  C  CG    . HIS B 1 169 ? -15.870 -31.084 -46.128 1.00 45.61 ? 169 HIS B CG    1 
ATOM   6872  N  ND1   . HIS B 1 169 ? -16.567 -30.608 -47.217 1.00 45.16 ? 169 HIS B ND1   1 
ATOM   6873  C  CD2   . HIS B 1 169 ? -15.505 -32.351 -46.441 1.00 46.09 ? 169 HIS B CD2   1 
ATOM   6874  C  CE1   . HIS B 1 169 ? -16.619 -31.542 -48.149 1.00 45.45 ? 169 HIS B CE1   1 
ATOM   6875  N  NE2   . HIS B 1 169 ? -15.982 -32.610 -47.703 1.00 46.09 ? 169 HIS B NE2   1 
ATOM   6876  N  N     . MET B 1 170 ? -16.083 -29.379 -41.955 1.00 42.25 ? 170 MET B N     1 
ATOM   6877  C  CA    . MET B 1 170 ? -15.867 -28.499 -40.822 1.00 41.76 ? 170 MET B CA    1 
ATOM   6878  C  C     . MET B 1 170 ? -15.436 -29.296 -39.584 1.00 40.84 ? 170 MET B C     1 
ATOM   6879  O  O     . MET B 1 170 ? -14.526 -28.887 -38.863 1.00 40.60 ? 170 MET B O     1 
ATOM   6880  C  CB    . MET B 1 170 ? -17.136 -27.682 -40.555 1.00 41.52 ? 170 MET B CB    1 
ATOM   6881  C  CG    . MET B 1 170 ? -17.027 -26.659 -39.431 1.00 42.42 ? 170 MET B CG    1 
ATOM   6882  S  SD    . MET B 1 170 ? -17.524 -27.315 -37.822 1.00 45.12 ? 170 MET B SD    1 
ATOM   6883  C  CE    . MET B 1 170 ? -19.315 -27.228 -37.976 1.00 43.75 ? 170 MET B CE    1 
ATOM   6884  N  N     . LEU B 1 171 ? -16.083 -30.438 -39.365 1.00 40.45 ? 171 LEU B N     1 
ATOM   6885  C  CA    . LEU B 1 171 ? -15.857 -31.259 -38.183 1.00 39.83 ? 171 LEU B CA    1 
ATOM   6886  C  C     . LEU B 1 171 ? -14.479 -31.921 -38.225 1.00 40.42 ? 171 LEU B C     1 
ATOM   6887  O  O     . LEU B 1 171 ? -13.768 -31.993 -37.211 1.00 40.00 ? 171 LEU B O     1 
ATOM   6888  C  CB    . LEU B 1 171 ? -16.978 -32.293 -38.059 1.00 39.61 ? 171 LEU B CB    1 
ATOM   6889  C  CG    . LEU B 1 171 ? -18.165 -32.098 -37.093 1.00 38.92 ? 171 LEU B CG    1 
ATOM   6890  C  CD1   . LEU B 1 171 ? -18.280 -30.701 -36.439 1.00 36.93 ? 171 LEU B CD1   1 
ATOM   6891  C  CD2   . LEU B 1 171 ? -19.465 -32.491 -37.760 1.00 38.15 ? 171 LEU B CD2   1 
ATOM   6892  N  N     . MET B 1 172 ? -14.090 -32.380 -39.410 1.00 41.36 ? 172 MET B N     1 
ATOM   6893  C  CA    . MET B 1 172 ? -12.770 -32.966 -39.576 1.00 42.14 ? 172 MET B CA    1 
ATOM   6894  C  C     . MET B 1 172 ? -11.690 -31.891 -39.453 1.00 42.48 ? 172 MET B C     1 
ATOM   6895  O  O     . MET B 1 172 ? -10.616 -32.157 -38.910 1.00 42.28 ? 172 MET B O     1 
ATOM   6896  C  CB    . MET B 1 172 ? -12.640 -33.733 -40.897 1.00 43.10 ? 172 MET B CB    1 
ATOM   6897  C  CG    . MET B 1 172 ? -11.372 -34.591 -40.975 1.00 43.27 ? 172 MET B CG    1 
ATOM   6898  S  SD    . MET B 1 172 ? -11.156 -35.740 -39.581 1.00 42.64 ? 172 MET B SD    1 
ATOM   6899  C  CE    . MET B 1 172 ? -12.035 -37.168 -40.218 1.00 41.75 ? 172 MET B CE    1 
ATOM   6900  N  N     . ARG B 1 173 ? -11.991 -30.682 -39.939 1.00 42.54 ? 173 ARG B N     1 
ATOM   6901  C  CA    . ARG B 1 173 ? -11.073 -29.553 -39.802 1.00 43.12 ? 173 ARG B CA    1 
ATOM   6902  C  C     . ARG B 1 173 ? -10.793 -29.267 -38.327 1.00 41.91 ? 173 ARG B C     1 
ATOM   6903  O  O     . ARG B 1 173 ? -9.630  -29.189 -37.908 1.00 41.65 ? 173 ARG B O     1 
ATOM   6904  C  CB    . ARG B 1 173 ? -11.601 -28.303 -40.523 1.00 43.47 ? 173 ARG B CB    1 
ATOM   6905  C  CG    . ARG B 1 173 ? -10.680 -27.077 -40.379 1.00 45.04 ? 173 ARG B CG    1 
ATOM   6906  C  CD    . ARG B 1 173 ? -11.085 -25.887 -41.243 1.00 45.33 ? 173 ARG B CD    1 
ATOM   6907  N  NE    . ARG B 1 173 ? -12.506 -25.546 -41.138 1.00 47.92 ? 173 ARG B NE    1 
ATOM   6908  C  CZ    . ARG B 1 173 ? -13.066 -24.841 -40.155 1.00 47.67 ? 173 ARG B CZ    1 
ATOM   6909  N  NH1   . ARG B 1 173 ? -12.342 -24.384 -39.134 1.00 47.35 ? 173 ARG B NH1   1 
ATOM   6910  N  NH2   . ARG B 1 173 ? -14.373 -24.601 -40.195 1.00 47.40 ? 173 ARG B NH2   1 
ATOM   6911  N  N     . VAL B 1 174 ? -11.865 -29.132 -37.548 1.00 40.87 ? 174 VAL B N     1 
ATOM   6912  C  CA    . VAL B 1 174 ? -11.757 -28.953 -36.108 1.00 40.06 ? 174 VAL B CA    1 
ATOM   6913  C  C     . VAL B 1 174 ? -10.893 -30.058 -35.489 1.00 40.29 ? 174 VAL B C     1 
ATOM   6914  O  O     . VAL B 1 174 ? -9.972  -29.766 -34.713 1.00 40.36 ? 174 VAL B O     1 
ATOM   6915  C  CB    . VAL B 1 174 ? -13.153 -28.937 -35.418 1.00 39.29 ? 174 VAL B CB    1 
ATOM   6916  C  CG1   . VAL B 1 174 ? -13.004 -28.942 -33.906 1.00 37.98 ? 174 VAL B CG1   1 
ATOM   6917  C  CG2   . VAL B 1 174 ? -13.974 -27.738 -35.868 1.00 39.09 ? 174 VAL B CG2   1 
ATOM   6918  N  N     . SER B 1 175 ? -11.198 -31.314 -35.843 1.00 40.31 ? 175 SER B N     1 
ATOM   6919  C  CA    . SER B 1 175 ? -10.509 -32.499 -35.300 1.00 40.30 ? 175 SER B CA    1 
ATOM   6920  C  C     . SER B 1 175 ? -8.999  -32.521 -35.567 1.00 41.56 ? 175 SER B C     1 
ATOM   6921  O  O     . SER B 1 175 ? -8.203  -32.826 -34.671 1.00 41.63 ? 175 SER B O     1 
ATOM   6922  C  CB    . SER B 1 175 ? -11.148 -33.779 -35.841 1.00 40.16 ? 175 SER B CB    1 
ATOM   6923  O  OG    . SER B 1 175 ? -12.528 -33.837 -35.528 1.00 38.99 ? 175 SER B OG    1 
ATOM   6924  N  N     . VAL B 1 176 ? -8.617  -32.219 -36.806 1.00 42.58 ? 176 VAL B N     1 
ATOM   6925  C  CA    . VAL B 1 176 ? -7.213  -32.117 -37.175 1.00 43.93 ? 176 VAL B CA    1 
ATOM   6926  C  C     . VAL B 1 176 ? -6.607  -30.870 -36.517 1.00 44.16 ? 176 VAL B C     1 
ATOM   6927  O  O     . VAL B 1 176 ? -5.456  -30.893 -36.058 1.00 44.66 ? 176 VAL B O     1 
ATOM   6928  C  CB    . VAL B 1 176 ? -7.023  -32.084 -38.717 1.00 44.93 ? 176 VAL B CB    1 
ATOM   6929  C  CG1   . VAL B 1 176 ? -5.541  -31.882 -39.078 1.00 46.13 ? 176 VAL B CG1   1 
ATOM   6930  C  CG2   . VAL B 1 176 ? -7.559  -33.369 -39.351 1.00 44.08 ? 176 VAL B CG2   1 
ATOM   6931  N  N     . GLY B 1 177 ? -7.405  -29.802 -36.453 1.00 43.77 ? 177 GLY B N     1 
ATOM   6932  C  CA    . GLY B 1 177 ? -7.021  -28.559 -35.782 1.00 43.93 ? 177 GLY B CA    1 
ATOM   6933  C  C     . GLY B 1 177 ? -6.637  -28.741 -34.322 1.00 43.83 ? 177 GLY B C     1 
ATOM   6934  O  O     . GLY B 1 177 ? -5.744  -28.038 -33.810 1.00 43.97 ? 177 GLY B O     1 
ATOM   6935  N  N     . ILE B 1 178 ? -7.304  -29.691 -33.660 1.00 43.05 ? 178 ILE B N     1 
ATOM   6936  C  CA    . ILE B 1 178 ? -7.039  -30.020 -32.255 1.00 42.50 ? 178 ILE B CA    1 
ATOM   6937  C  C     . ILE B 1 178 ? -5.914  -31.039 -32.082 1.00 43.26 ? 178 ILE B C     1 
ATOM   6938  O  O     . ILE B 1 178 ? -5.071  -30.869 -31.203 1.00 43.49 ? 178 ILE B O     1 
ATOM   6939  C  CB    . ILE B 1 178 ? -8.326  -30.502 -31.518 1.00 41.35 ? 178 ILE B CB    1 
ATOM   6940  C  CG1   . ILE B 1 178 ? -9.303  -29.336 -31.356 1.00 41.10 ? 178 ILE B CG1   1 
ATOM   6941  C  CG2   . ILE B 1 178 ? -8.001  -31.092 -30.145 1.00 40.21 ? 178 ILE B CG2   1 
ATOM   6942  C  CD1   . ILE B 1 178 ? -10.755 -29.757 -31.114 1.00 41.92 ? 178 ILE B CD1   1 
ATOM   6943  N  N     . HIS B 1 179 ? -5.899  -32.081 -32.916 1.00 43.93 ? 179 HIS B N     1 
ATOM   6944  C  CA    . HIS B 1 179 ? -5.025  -33.251 -32.699 1.00 44.81 ? 179 HIS B CA    1 
ATOM   6945  C  C     . HIS B 1 179 ? -3.764  -33.358 -33.586 1.00 46.82 ? 179 HIS B C     1 
ATOM   6946  O  O     . HIS B 1 179 ? -2.896  -34.209 -33.340 1.00 47.16 ? 179 HIS B O     1 
ATOM   6947  C  CB    . HIS B 1 179 ? -5.847  -34.544 -32.776 1.00 44.18 ? 179 HIS B CB    1 
ATOM   6948  C  CG    . HIS B 1 179 ? -6.937  -34.617 -31.755 1.00 42.22 ? 179 HIS B CG    1 
ATOM   6949  N  ND1   . HIS B 1 179 ? -6.689  -34.850 -30.421 1.00 40.77 ? 179 HIS B ND1   1 
ATOM   6950  C  CD2   . HIS B 1 179 ? -8.277  -34.469 -31.868 1.00 40.50 ? 179 HIS B CD2   1 
ATOM   6951  C  CE1   . HIS B 1 179 ? -7.827  -34.841 -29.754 1.00 39.38 ? 179 HIS B CE1   1 
ATOM   6952  N  NE2   . HIS B 1 179 ? -8.807  -34.617 -30.609 1.00 39.19 ? 179 HIS B NE2   1 
ATOM   6953  N  N     . LYS B 1 180 ? -3.714  -32.525 -34.621 1.00 48.10 ? 180 LYS B N     1 
ATOM   6954  C  CA    . LYS B 1 180 ? -2.648  -32.575 -35.610 1.00 50.43 ? 180 LYS B CA    1 
ATOM   6955  C  C     . LYS B 1 180 ? -2.172  -34.008 -35.888 1.00 51.55 ? 180 LYS B C     1 
ATOM   6956  O  O     . LYS B 1 180 ? -2.970  -34.845 -36.313 1.00 51.65 ? 180 LYS B O     1 
ATOM   6957  C  CB    . LYS B 1 180 ? -1.495  -31.638 -35.240 1.00 26.41 ? 180 LYS B CB    1 
ATOM   6958  C  CG    . LYS B 1 180 ? -1.502  -30.330 -36.038 1.00 26.67 ? 180 LYS B CG    1 
ATOM   6959  C  CD    . LYS B 1 180 ? -1.131  -29.138 -35.169 1.00 26.33 ? 180 LYS B CD    1 
ATOM   6960  C  CE    . LYS B 1 180 ? -2.338  -28.259 -34.844 1.00 25.13 ? 180 LYS B CE    1 
ATOM   6961  N  NZ    . LYS B 1 180 ? -2.066  -27.361 -33.698 1.00 24.63 ? 180 LYS B NZ    1 
ATOM   6962  N  N     . GLU B 1 181 ? -0.892  -34.301 -35.675 1.00 52.68 ? 181 GLU B N     1 
ATOM   6963  C  CA    . GLU B 1 181 ? -0.357  -35.559 -36.204 1.00 54.06 ? 181 GLU B CA    1 
ATOM   6964  C  C     . GLU B 1 181 ? -1.010  -36.817 -35.609 1.00 53.64 ? 181 GLU B C     1 
ATOM   6965  O  O     . GLU B 1 181 ? -0.898  -37.908 -36.182 1.00 54.40 ? 181 GLU B O     1 
ATOM   6966  C  CB    . GLU B 1 181 ? 1.196   -35.604 -36.066 1.00 55.07 ? 181 GLU B CB    1 
ATOM   6967  N  N     . ASP B 1 182 ? -1.700  -36.669 -34.478 1.00 52.60 ? 182 ASP B N     1 
ATOM   6968  C  CA    . ASP B 1 182 ? -2.401  -37.808 -33.875 1.00 52.40 ? 182 ASP B CA    1 
ATOM   6969  C  C     . ASP B 1 182 ? -3.715  -38.101 -34.593 1.00 51.48 ? 182 ASP B C     1 
ATOM   6970  O  O     . ASP B 1 182 ? -4.800  -37.791 -34.091 1.00 50.38 ? 182 ASP B O     1 
ATOM   6971  C  CB    . ASP B 1 182 ? -2.627  -37.620 -32.371 1.00 51.84 ? 182 ASP B CB    1 
ATOM   6972  C  CG    . ASP B 1 182 ? -2.946  -38.936 -31.661 1.00 53.36 ? 182 ASP B CG    1 
ATOM   6973  O  OD1   . ASP B 1 182 ? -2.720  -39.007 -30.432 1.00 55.72 ? 182 ASP B OD1   1 
ATOM   6974  O  OD2   . ASP B 1 182 ? -3.418  -39.897 -32.320 1.00 53.27 ? 182 ASP B OD2   1 
ATOM   6975  N  N     . ILE B 1 183 ? -3.580  -38.719 -35.764 1.00 52.12 ? 183 ILE B N     1 
ATOM   6976  C  CA    . ILE B 1 183 ? -4.686  -39.056 -36.652 1.00 51.59 ? 183 ILE B CA    1 
ATOM   6977  C  C     . ILE B 1 183 ? -5.695  -40.020 -36.009 1.00 50.90 ? 183 ILE B C     1 
ATOM   6978  O  O     . ILE B 1 183 ? -6.892  -39.942 -36.304 1.00 50.31 ? 183 ILE B O     1 
ATOM   6979  C  CB    . ILE B 1 183 ? -4.154  -39.584 -38.036 1.00 52.96 ? 183 ILE B CB    1 
ATOM   6980  C  CG1   . ILE B 1 183 ? -3.155  -38.587 -38.648 1.00 53.37 ? 183 ILE B CG1   1 
ATOM   6981  C  CG2   . ILE B 1 183 ? -5.298  -39.869 -39.031 1.00 52.59 ? 183 ILE B CG2   1 
ATOM   6982  C  CD1   . ILE B 1 183 ? -3.656  -37.122 -38.740 1.00 50.73 ? 183 ILE B CD1   1 
ATOM   6983  N  N     . ASP B 1 184 ? -5.208  -40.912 -35.140 1.00 50.87 ? 184 ASP B N     1 
ATOM   6984  C  CA    . ASP B 1 184 ? -6.064  -41.790 -34.337 1.00 50.24 ? 184 ASP B CA    1 
ATOM   6985  C  C     . ASP B 1 184 ? -7.018  -40.951 -33.476 1.00 48.25 ? 184 ASP B C     1 
ATOM   6986  O  O     . ASP B 1 184 ? -8.228  -41.165 -33.488 1.00 47.64 ? 184 ASP B O     1 
ATOM   6987  C  CB    . ASP B 1 184 ? -5.224  -42.690 -33.421 1.00 51.29 ? 184 ASP B CB    1 
ATOM   6988  C  CG    . ASP B 1 184 ? -4.493  -43.797 -34.172 1.00 54.40 ? 184 ASP B CG    1 
ATOM   6989  O  OD1   . ASP B 1 184 ? -5.125  -44.519 -34.985 1.00 56.04 ? 184 ASP B OD1   1 
ATOM   6990  O  OD2   . ASP B 1 184 ? -3.277  -43.958 -33.927 1.00 56.52 ? 184 ASP B OD2   1 
ATOM   6991  N  N     . ALA B 1 185 ? -6.459  -39.998 -32.737 1.00 47.17 ? 185 ALA B N     1 
ATOM   6992  C  CA    . ALA B 1 185 ? -7.248  -39.115 -31.880 1.00 45.41 ? 185 ALA B CA    1 
ATOM   6993  C  C     . ALA B 1 185 ? -8.179  -38.190 -32.674 1.00 44.34 ? 185 ALA B C     1 
ATOM   6994  O  O     . ALA B 1 185 ? -9.303  -37.950 -32.251 1.00 43.81 ? 185 ALA B O     1 
ATOM   6995  C  CB    . ALA B 1 185 ? -6.348  -38.317 -30.952 1.00 44.99 ? 185 ALA B CB    1 
ATOM   6996  N  N     . ALA B 1 186 ? -7.714  -37.686 -33.814 1.00 44.25 ? 186 ALA B N     1 
ATOM   6997  C  CA    . ALA B 1 186 ? -8.532  -36.841 -34.692 1.00 43.51 ? 186 ALA B CA    1 
ATOM   6998  C  C     . ALA B 1 186 ? -9.790  -37.559 -35.184 1.00 43.11 ? 186 ALA B C     1 
ATOM   6999  O  O     . ALA B 1 186 ? -10.889 -36.975 -35.213 1.00 42.20 ? 186 ALA B O     1 
ATOM   7000  C  CB    . ALA B 1 186 ? -7.710  -36.362 -35.879 1.00 44.70 ? 186 ALA B CB    1 
ATOM   7001  N  N     . ILE B 1 187 ? -9.625  -38.825 -35.561 1.00 43.29 ? 187 ILE B N     1 
ATOM   7002  C  CA    . ILE B 1 187 ? -10.735 -39.621 -36.080 1.00 43.14 ? 187 ILE B CA    1 
ATOM   7003  C  C     . ILE B 1 187 ? -11.719 -39.988 -34.958 1.00 42.62 ? 187 ILE B C     1 
ATOM   7004  O  O     . ILE B 1 187 ? -12.941 -40.015 -35.180 1.00 42.05 ? 187 ILE B O     1 
ATOM   7005  C  CB    . ILE B 1 187 ? -10.234 -40.833 -36.927 1.00 43.89 ? 187 ILE B CB    1 
ATOM   7006  C  CG1   . ILE B 1 187 ? -9.751  -40.338 -38.296 1.00 44.09 ? 187 ILE B CG1   1 
ATOM   7007  C  CG2   . ILE B 1 187 ? -11.317 -41.891 -37.098 1.00 43.36 ? 187 ILE B CG2   1 
ATOM   7008  C  CD1   . ILE B 1 187 ? -8.798  -41.282 -39.020 1.00 44.99 ? 187 ILE B CD1   1 
ATOM   7009  N  N     . GLU B 1 188 ? -11.190 -40.222 -33.758 1.00 42.50 ? 188 GLU B N     1 
ATOM   7010  C  CA    . GLU B 1 188 ? -12.031 -40.474 -32.590 1.00 42.69 ? 188 GLU B CA    1 
ATOM   7011  C  C     . GLU B 1 188 ? -12.880 -39.254 -32.259 1.00 41.11 ? 188 GLU B C     1 
ATOM   7012  O  O     . GLU B 1 188 ? -14.082 -39.384 -32.013 1.00 41.28 ? 188 GLU B O     1 
ATOM   7013  C  CB    . GLU B 1 188 ? -11.199 -40.893 -31.373 1.00 42.74 ? 188 GLU B CB    1 
ATOM   7014  C  CG    . GLU B 1 188 ? -12.005 -41.007 -30.056 1.00 43.18 ? 188 GLU B CG    1 
ATOM   7015  C  CD    . GLU B 1 188 ? -11.107 -41.275 -28.849 1.00 44.28 ? 188 GLU B CD    1 
ATOM   7016  O  OE1   . GLU B 1 188 ? -10.299 -40.386 -28.484 1.00 46.62 ? 188 GLU B OE1   1 
ATOM   7017  O  OE2   . GLU B 1 188 ? -11.205 -42.379 -28.266 1.00 47.55 ? 188 GLU B OE2   1 
ATOM   7018  N  N     . THR B 1 189 ? -12.258 -38.078 -32.268 1.00 40.24 ? 189 THR B N     1 
ATOM   7019  C  CA    . THR B 1 189 ? -12.982 -36.814 -32.085 1.00 39.08 ? 189 THR B CA    1 
ATOM   7020  C  C     . THR B 1 189 ? -13.972 -36.527 -33.224 1.00 38.99 ? 189 THR B C     1 
ATOM   7021  O  O     . THR B 1 189 ? -15.089 -36.105 -32.955 1.00 38.68 ? 189 THR B O     1 
ATOM   7022  C  CB    . THR B 1 189 ? -12.021 -35.622 -31.857 1.00 39.01 ? 189 THR B CB    1 
ATOM   7023  O  OG1   . THR B 1 189 ? -11.567 -35.647 -30.502 1.00 38.20 ? 189 THR B OG1   1 
ATOM   7024  C  CG2   . THR B 1 189 ? -12.700 -34.268 -32.133 1.00 37.06 ? 189 THR B CG2   1 
ATOM   7025  N  N     . TYR B 1 190 ? -13.575 -36.760 -34.478 1.00 39.55 ? 190 TYR B N     1 
ATOM   7026  C  CA    . TYR B 1 190 ? -14.491 -36.535 -35.597 1.00 39.51 ? 190 TYR B CA    1 
ATOM   7027  C  C     . TYR B 1 190 ? -15.755 -37.392 -35.485 1.00 39.56 ? 190 TYR B C     1 
ATOM   7028  O  O     . TYR B 1 190 ? -16.854 -36.913 -35.747 1.00 39.12 ? 190 TYR B O     1 
ATOM   7029  C  CB    . TYR B 1 190 ? -13.828 -36.755 -36.967 1.00 40.29 ? 190 TYR B CB    1 
ATOM   7030  C  CG    . TYR B 1 190 ? -14.867 -37.016 -38.043 1.00 40.07 ? 190 TYR B CG    1 
ATOM   7031  C  CD1   . TYR B 1 190 ? -15.607 -35.961 -38.594 1.00 39.99 ? 190 TYR B CD1   1 
ATOM   7032  C  CD2   . TYR B 1 190 ? -15.160 -38.315 -38.458 1.00 39.23 ? 190 TYR B CD2   1 
ATOM   7033  C  CE1   . TYR B 1 190 ? -16.593 -36.192 -39.552 1.00 38.91 ? 190 TYR B CE1   1 
ATOM   7034  C  CE2   . TYR B 1 190 ? -16.146 -38.555 -39.406 1.00 40.41 ? 190 TYR B CE2   1 
ATOM   7035  C  CZ    . TYR B 1 190 ? -16.856 -37.481 -39.953 1.00 40.15 ? 190 TYR B CZ    1 
ATOM   7036  O  OH    . TYR B 1 190 ? -17.831 -37.705 -40.900 1.00 41.10 ? 190 TYR B OH    1 
ATOM   7037  N  N     . ASN B 1 191 ? -15.579 -38.656 -35.115 1.00 40.46 ? 191 ASN B N     1 
ATOM   7038  C  CA    . ASN B 1 191 ? -16.695 -39.590 -34.936 1.00 41.13 ? 191 ASN B CA    1 
ATOM   7039  C  C     . ASN B 1 191 ? -17.658 -39.158 -33.829 1.00 40.66 ? 191 ASN B C     1 
ATOM   7040  O  O     . ASN B 1 191 ? -18.882 -39.242 -33.980 1.00 40.74 ? 191 ASN B O     1 
ATOM   7041  C  CB    . ASN B 1 191 ? -16.175 -41.005 -34.652 1.00 41.61 ? 191 ASN B CB    1 
ATOM   7042  C  CG    . ASN B 1 191 ? -15.666 -41.702 -35.901 1.00 42.07 ? 191 ASN B CG    1 
ATOM   7043  O  OD1   . ASN B 1 191 ? -16.282 -41.636 -36.962 1.00 40.92 ? 191 ASN B OD1   1 
ATOM   7044  N  ND2   . ASN B 1 191 ? -14.536 -42.380 -35.774 1.00 42.73 ? 191 ASN B ND2   1 
ATOM   7045  N  N     . LEU B 1 192 ? -17.086 -38.701 -32.725 1.00 40.42 ? 192 LEU B N     1 
ATOM   7046  C  CA    . LEU B 1 192 ? -17.849 -38.236 -31.587 1.00 40.15 ? 192 LEU B CA    1 
ATOM   7047  C  C     . LEU B 1 192 ? -18.621 -36.957 -31.913 1.00 39.81 ? 192 LEU B C     1 
ATOM   7048  O  O     . LEU B 1 192 ? -19.788 -36.808 -31.508 1.00 39.27 ? 192 LEU B O     1 
ATOM   7049  C  CB    . LEU B 1 192 ? -16.909 -38.033 -30.392 1.00 40.17 ? 192 LEU B CB    1 
ATOM   7050  C  CG    . LEU B 1 192 ? -16.902 -39.032 -29.216 1.00 41.20 ? 192 LEU B CG    1 
ATOM   7051  C  CD1   . LEU B 1 192 ? -17.702 -40.317 -29.448 1.00 41.17 ? 192 LEU B CD1   1 
ATOM   7052  C  CD2   . LEU B 1 192 ? -15.476 -39.335 -28.746 1.00 41.81 ? 192 LEU B CD2   1 
ATOM   7053  N  N     . LEU B 1 193 ? -17.981 -36.046 -32.652 1.00 39.58 ? 193 LEU B N     1 
ATOM   7054  C  CA    . LEU B 1 193 ? -18.625 -34.786 -33.035 1.00 39.49 ? 193 LEU B CA    1 
ATOM   7055  C  C     . LEU B 1 193 ? -19.741 -34.981 -34.057 1.00 40.19 ? 193 LEU B C     1 
ATOM   7056  O  O     . LEU B 1 193 ? -20.826 -34.407 -33.921 1.00 40.13 ? 193 LEU B O     1 
ATOM   7057  C  CB    . LEU B 1 193 ? -17.598 -33.799 -33.595 1.00 39.65 ? 193 LEU B CB    1 
ATOM   7058  C  CG    . LEU B 1 193 ? -16.605 -33.145 -32.632 1.00 38.44 ? 193 LEU B CG    1 
ATOM   7059  C  CD1   . LEU B 1 193 ? -15.614 -32.333 -33.442 1.00 36.93 ? 193 LEU B CD1   1 
ATOM   7060  C  CD2   . LEU B 1 193 ? -17.337 -32.285 -31.577 1.00 35.33 ? 193 LEU B CD2   1 
ATOM   7061  N  N     . SER B 1 194 ? -19.459 -35.795 -35.075 1.00 40.96 ? 194 SER B N     1 
ATOM   7062  C  CA    . SER B 1 194 ? -20.367 -36.014 -36.189 1.00 41.69 ? 194 SER B CA    1 
ATOM   7063  C  C     . SER B 1 194 ? -21.552 -36.893 -35.801 1.00 42.42 ? 194 SER B C     1 
ATOM   7064  O  O     . SER B 1 194 ? -22.603 -36.831 -36.440 1.00 42.69 ? 194 SER B O     1 
ATOM   7065  C  CB    . SER B 1 194 ? -19.616 -36.625 -37.373 1.00 42.36 ? 194 SER B CB    1 
ATOM   7066  O  OG    . SER B 1 194 ? -19.061 -37.880 -37.025 1.00 41.69 ? 194 SER B OG    1 
ATOM   7067  N  N     . GLU B 1 195 ? -21.374 -37.717 -34.767 1.00 42.76 ? 195 GLU B N     1 
ATOM   7068  C  CA    . GLU B 1 195 ? -22.474 -38.503 -34.219 1.00 43.73 ? 195 GLU B CA    1 
ATOM   7069  C  C     . GLU B 1 195 ? -23.194 -37.762 -33.083 1.00 42.77 ? 195 GLU B C     1 
ATOM   7070  O  O     . GLU B 1 195 ? -24.144 -38.285 -32.495 1.00 42.60 ? 195 GLU B O     1 
ATOM   7071  C  CB    . GLU B 1 195 ? -22.000 -39.894 -33.789 1.00 44.23 ? 195 GLU B CB    1 
ATOM   7072  C  CG    . GLU B 1 195 ? -21.956 -40.921 -34.937 1.00 46.25 ? 195 GLU B CG    1 
ATOM   7073  C  CD    . GLU B 1 195 ? -21.109 -42.170 -34.615 1.00 47.89 ? 195 GLU B CD    1 
ATOM   7074  O  OE1   . GLU B 1 195 ? -21.332 -43.215 -35.270 1.00 51.71 ? 195 GLU B OE1   1 
ATOM   7075  O  OE2   . GLU B 1 195 ? -20.218 -42.114 -33.727 1.00 50.24 ? 195 GLU B OE2   1 
ATOM   7076  N  N     . ARG B 1 196 ? -22.725 -36.545 -32.791 1.00 42.16 ? 196 ARG B N     1 
ATOM   7077  C  CA    . ARG B 1 196 ? -23.456 -35.561 -31.976 1.00 42.02 ? 196 ARG B CA    1 
ATOM   7078  C  C     . ARG B 1 196 ? -23.473 -35.851 -30.461 1.00 40.76 ? 196 ARG B C     1 
ATOM   7079  O  O     . ARG B 1 196 ? -24.397 -35.447 -29.752 1.00 40.26 ? 196 ARG B O     1 
ATOM   7080  C  CB    . ARG B 1 196 ? -24.882 -35.345 -32.544 1.00 42.08 ? 196 ARG B CB    1 
ATOM   7081  C  CG    . ARG B 1 196 ? -24.915 -34.460 -33.804 1.00 43.50 ? 196 ARG B CG    1 
ATOM   7082  C  CD    . ARG B 1 196 ? -26.100 -34.729 -34.775 1.00 45.51 ? 196 ARG B CD    1 
ATOM   7083  N  NE    . ARG B 1 196 ? -27.384 -34.953 -34.109 1.00 49.02 ? 196 ARG B NE    1 
ATOM   7084  C  CZ    . ARG B 1 196 ? -27.927 -36.154 -33.920 1.00 51.73 ? 196 ARG B CZ    1 
ATOM   7085  N  NH1   . ARG B 1 196 ? -27.307 -37.247 -34.362 1.00 53.84 ? 196 ARG B NH1   1 
ATOM   7086  N  NH2   . ARG B 1 196 ? -29.090 -36.270 -33.288 1.00 52.43 ? 196 ARG B NH2   1 
ATOM   7087  N  N     . TRP B 1 197 ? -22.441 -36.543 -29.981 1.00 40.11 ? 197 TRP B N     1 
ATOM   7088  C  CA    . TRP B 1 197 ? -22.327 -36.918 -28.570 1.00 39.47 ? 197 TRP B CA    1 
ATOM   7089  C  C     . TRP B 1 197 ? -21.957 -35.714 -27.703 1.00 38.66 ? 197 TRP B C     1 
ATOM   7090  O  O     . TRP B 1 197 ? -22.352 -35.628 -26.537 1.00 37.91 ? 197 TRP B O     1 
ATOM   7091  C  CB    . TRP B 1 197 ? -21.297 -38.040 -28.394 1.00 39.64 ? 197 TRP B CB    1 
ATOM   7092  C  CG    . TRP B 1 197 ? -21.732 -39.347 -29.002 1.00 40.56 ? 197 TRP B CG    1 
ATOM   7093  C  CD1   . TRP B 1 197 ? -21.384 -39.841 -30.232 1.00 41.09 ? 197 TRP B CD1   1 
ATOM   7094  C  CD2   . TRP B 1 197 ? -22.608 -40.314 -28.414 1.00 40.58 ? 197 TRP B CD2   1 
ATOM   7095  N  NE1   . TRP B 1 197 ? -21.981 -41.061 -30.439 1.00 41.97 ? 197 TRP B NE1   1 
ATOM   7096  C  CE2   . TRP B 1 197 ? -22.743 -41.375 -29.344 1.00 41.68 ? 197 TRP B CE2   1 
ATOM   7097  C  CE3   . TRP B 1 197 ? -23.295 -40.389 -27.192 1.00 39.87 ? 197 TRP B CE3   1 
ATOM   7098  C  CZ2   . TRP B 1 197 ? -23.539 -42.493 -29.093 1.00 41.65 ? 197 TRP B CZ2   1 
ATOM   7099  C  CZ3   . TRP B 1 197 ? -24.079 -41.504 -26.936 1.00 41.06 ? 197 TRP B CZ3   1 
ATOM   7100  C  CH2   . TRP B 1 197 ? -24.198 -42.543 -27.886 1.00 41.89 ? 197 TRP B CH2   1 
ATOM   7101  N  N     . PHE B 1 198 ? -21.198 -34.797 -28.300 1.00 38.10 ? 198 PHE B N     1 
ATOM   7102  C  CA    . PHE B 1 198 ? -20.793 -33.544 -27.668 1.00 37.53 ? 198 PHE B CA    1 
ATOM   7103  C  C     . PHE B 1 198 ? -20.466 -32.521 -28.761 1.00 37.84 ? 198 PHE B C     1 
ATOM   7104  O  O     . PHE B 1 198 ? -20.448 -32.852 -29.944 1.00 38.58 ? 198 PHE B O     1 
ATOM   7105  C  CB    . PHE B 1 198 ? -19.585 -33.755 -26.720 1.00 36.58 ? 198 PHE B CB    1 
ATOM   7106  C  CG    . PHE B 1 198 ? -18.226 -33.734 -27.405 1.00 35.80 ? 198 PHE B CG    1 
ATOM   7107  C  CD1   . PHE B 1 198 ? -17.743 -34.856 -28.071 1.00 36.46 ? 198 PHE B CD1   1 
ATOM   7108  C  CD2   . PHE B 1 198 ? -17.421 -32.596 -27.352 1.00 34.44 ? 198 PHE B CD2   1 
ATOM   7109  C  CE1   . PHE B 1 198 ? -16.471 -34.840 -28.691 1.00 36.99 ? 198 PHE B CE1   1 
ATOM   7110  C  CE2   . PHE B 1 198 ? -16.160 -32.562 -27.960 1.00 34.71 ? 198 PHE B CE2   1 
ATOM   7111  C  CZ    . PHE B 1 198 ? -15.680 -33.693 -28.632 1.00 36.43 ? 198 PHE B CZ    1 
ATOM   7112  N  N     . THR B 1 199 ? -20.219 -31.283 -28.366 1.00 37.69 ? 199 THR B N     1 
ATOM   7113  C  CA    . THR B 1 199 ? -19.708 -30.291 -29.301 1.00 38.27 ? 199 THR B CA    1 
ATOM   7114  C  C     . THR B 1 199 ? -18.696 -29.374 -28.622 1.00 38.02 ? 199 THR B C     1 
ATOM   7115  O  O     . THR B 1 199 ? -18.786 -29.112 -27.412 1.00 37.61 ? 199 THR B O     1 
ATOM   7116  C  CB    . THR B 1 199 ? -20.846 -29.464 -29.977 1.00 38.47 ? 199 THR B CB    1 
ATOM   7117  O  OG1   . THR B 1 199 ? -20.273 -28.520 -30.893 1.00 39.93 ? 199 THR B OG1   1 
ATOM   7118  C  CG2   . THR B 1 199 ? -21.677 -28.722 -28.949 1.00 37.62 ? 199 THR B CG2   1 
ATOM   7119  N  N     . HIS B 1 200 ? -17.723 -28.916 -29.405 1.00 38.09 ? 200 HIS B N     1 
ATOM   7120  C  CA    . HIS B 1 200 ? -16.828 -27.865 -28.964 1.00 37.86 ? 200 HIS B CA    1 
ATOM   7121  C  C     . HIS B 1 200 ? -17.567 -26.531 -29.052 1.00 37.45 ? 200 HIS B C     1 
ATOM   7122  O  O     . HIS B 1 200 ? -18.565 -26.418 -29.760 1.00 37.20 ? 200 HIS B O     1 
ATOM   7123  C  CB    . HIS B 1 200 ? -15.542 -27.862 -29.791 1.00 38.41 ? 200 HIS B CB    1 
ATOM   7124  C  CG    . HIS B 1 200 ? -14.526 -28.855 -29.314 1.00 39.17 ? 200 HIS B CG    1 
ATOM   7125  N  ND1   . HIS B 1 200 ? -13.753 -28.646 -28.189 1.00 37.85 ? 200 HIS B ND1   1 
ATOM   7126  C  CD2   . HIS B 1 200 ? -14.178 -30.075 -29.790 1.00 39.37 ? 200 HIS B CD2   1 
ATOM   7127  C  CE1   . HIS B 1 200 ? -12.968 -29.691 -27.999 1.00 38.25 ? 200 HIS B CE1   1 
ATOM   7128  N  NE2   . HIS B 1 200 ? -13.205 -30.572 -28.955 1.00 38.88 ? 200 HIS B NE2   1 
ATOM   7129  N  N     . ALA B 1 201 ? -17.095 -25.539 -28.305 1.00 37.21 ? 201 ALA B N     1 
ATOM   7130  C  CA    . ALA B 1 201 ? -17.718 -24.221 -28.301 1.00 36.96 ? 201 ALA B CA    1 
ATOM   7131  C  C     . ALA B 1 201 ? -17.494 -23.514 -29.644 1.00 37.56 ? 201 ALA B C     1 
ATOM   7132  O  O     . ALA B 1 201 ? -16.515 -23.800 -30.344 1.00 38.02 ? 201 ALA B O     1 
ATOM   7133  C  CB    . ALA B 1 201 ? -17.165 -23.397 -27.165 1.00 36.67 ? 201 ALA B CB    1 
ATOM   7134  N  N     . SER B 1 202 ? -18.395 -22.591 -29.988 1.00 37.41 ? 202 SER B N     1 
ATOM   7135  C  CA    . SER B 1 202 ? -18.317 -21.833 -31.250 1.00 37.70 ? 202 SER B CA    1 
ATOM   7136  C  C     . SER B 1 202 ? -16.913 -21.366 -31.648 1.00 37.89 ? 202 SER B C     1 
ATOM   7137  O  O     . SER B 1 202 ? -16.489 -21.628 -32.778 1.00 38.46 ? 202 SER B O     1 
ATOM   7138  C  CB    . SER B 1 202 ? -19.303 -20.669 -31.259 1.00 37.66 ? 202 SER B CB    1 
ATOM   7139  O  OG    . SER B 1 202 ? -20.627 -21.157 -31.222 1.00 38.38 ? 202 SER B OG    1 
ATOM   7140  N  N     . PRO B 1 203 ? -16.192 -20.652 -30.742 1.00 37.80 ? 203 PRO B N     1 
ATOM   7141  C  CA    . PRO B 1 203 ? -14.789 -20.251 -31.021 1.00 37.65 ? 203 PRO B CA    1 
ATOM   7142  C  C     . PRO B 1 203 ? -13.937 -21.360 -31.636 1.00 37.68 ? 203 PRO B C     1 
ATOM   7143  O  O     . PRO B 1 203 ? -13.215 -21.109 -32.604 1.00 38.40 ? 203 PRO B O     1 
ATOM   7144  C  CB    . PRO B 1 203 ? -14.240 -19.899 -29.637 1.00 37.11 ? 203 PRO B CB    1 
ATOM   7145  C  CG    . PRO B 1 203 ? -15.437 -19.466 -28.852 1.00 36.84 ? 203 PRO B CG    1 
ATOM   7146  C  CD    . PRO B 1 203 ? -16.654 -20.144 -29.427 1.00 36.96 ? 203 PRO B CD    1 
ATOM   7147  N  N     . THR B 1 204 ? -14.023 -22.567 -31.075 1.00 36.93 ? 204 THR B N     1 
ATOM   7148  C  CA    . THR B 1 204 ? -13.266 -23.708 -31.577 1.00 37.50 ? 204 THR B CA    1 
ATOM   7149  C  C     . THR B 1 204 ? -13.788 -24.158 -32.931 1.00 38.03 ? 204 THR B C     1 
ATOM   7150  O  O     . THR B 1 204 ? -13.003 -24.398 -33.844 1.00 38.90 ? 204 THR B O     1 
ATOM   7151  C  CB    . THR B 1 204 ? -13.275 -24.891 -30.585 1.00 37.13 ? 204 THR B CB    1 
ATOM   7152  O  OG1   . THR B 1 204 ? -12.743 -24.459 -29.330 1.00 38.09 ? 204 THR B OG1   1 
ATOM   7153  C  CG2   . THR B 1 204 ? -12.436 -26.042 -31.098 1.00 36.33 ? 204 THR B CG2   1 
ATOM   7154  N  N     . LEU B 1 205 ? -15.108 -24.269 -33.064 1.00 37.87 ? 205 LEU B N     1 
ATOM   7155  C  CA    . LEU B 1 205 ? -15.705 -24.643 -34.337 1.00 38.75 ? 205 LEU B CA    1 
ATOM   7156  C  C     . LEU B 1 205 ? -15.294 -23.668 -35.446 1.00 40.05 ? 205 LEU B C     1 
ATOM   7157  O  O     . LEU B 1 205 ? -14.932 -24.100 -36.542 1.00 40.86 ? 205 LEU B O     1 
ATOM   7158  C  CB    . LEU B 1 205 ? -17.228 -24.750 -34.223 1.00 38.56 ? 205 LEU B CB    1 
ATOM   7159  C  CG    . LEU B 1 205 ? -17.807 -25.712 -33.170 1.00 38.39 ? 205 LEU B CG    1 
ATOM   7160  C  CD1   . LEU B 1 205 ? -19.328 -25.645 -33.124 1.00 38.50 ? 205 LEU B CD1   1 
ATOM   7161  C  CD2   . LEU B 1 205 ? -17.340 -27.158 -33.380 1.00 38.67 ? 205 LEU B CD2   1 
ATOM   7162  N  N     . PHE B 1 206 ? -15.325 -22.363 -35.145 1.00 40.34 ? 206 PHE B N     1 
ATOM   7163  C  CA    . PHE B 1 206 ? -14.944 -21.317 -36.097 1.00 41.39 ? 206 PHE B CA    1 
ATOM   7164  C  C     . PHE B 1 206 ? -13.495 -21.451 -36.570 1.00 42.64 ? 206 PHE B C     1 
ATOM   7165  O  O     . PHE B 1 206 ? -13.247 -21.509 -37.778 1.00 43.23 ? 206 PHE B O     1 
ATOM   7166  C  CB    . PHE B 1 206 ? -15.116 -19.913 -35.496 1.00 41.10 ? 206 PHE B CB    1 
ATOM   7167  C  CG    . PHE B 1 206 ? -16.535 -19.489 -35.293 1.00 41.39 ? 206 PHE B CG    1 
ATOM   7168  C  CD1   . PHE B 1 206 ? -16.852 -18.592 -34.285 1.00 41.12 ? 206 PHE B CD1   1 
ATOM   7169  C  CD2   . PHE B 1 206 ? -17.563 -19.975 -36.100 1.00 41.76 ? 206 PHE B CD2   1 
ATOM   7170  C  CE1   . PHE B 1 206 ? -18.170 -18.178 -34.079 1.00 40.43 ? 206 PHE B CE1   1 
ATOM   7171  C  CE2   . PHE B 1 206 ? -18.877 -19.567 -35.898 1.00 41.25 ? 206 PHE B CE2   1 
ATOM   7172  C  CZ    . PHE B 1 206 ? -19.180 -18.672 -34.883 1.00 40.83 ? 206 PHE B CZ    1 
ATOM   7173  N  N     . ASN B 1 207 ? -12.558 -21.523 -35.613 1.00 42.54 ? 207 ASN B N     1 
ATOM   7174  C  CA    . ASN B 1 207 ? -11.156 -21.204 -35.875 1.00 43.74 ? 207 ASN B CA    1 
ATOM   7175  C  C     . ASN B 1 207 ? -10.144 -22.341 -35.750 1.00 44.21 ? 207 ASN B C     1 
ATOM   7176  O  O     . ASN B 1 207 ? -8.958  -22.140 -36.038 1.00 44.54 ? 207 ASN B O     1 
ATOM   7177  C  CB    . ASN B 1 207 ? -10.711 -20.031 -34.993 1.00 43.90 ? 207 ASN B CB    1 
ATOM   7178  C  CG    . ASN B 1 207 ? -11.735 -18.911 -34.943 1.00 43.93 ? 207 ASN B CG    1 
ATOM   7179  O  OD1   . ASN B 1 207 ? -12.310 -18.635 -33.890 1.00 44.45 ? 207 ASN B OD1   1 
ATOM   7180  N  ND2   . ASN B 1 207 ? -11.971 -18.264 -36.077 1.00 44.16 ? 207 ASN B ND2   1 
ATOM   7181  N  N     . ALA B 1 208 ? -10.592 -23.520 -35.318 1.00 44.20 ? 208 ALA B N     1 
ATOM   7182  C  CA    . ALA B 1 208 ? -9.713  -24.693 -35.273 1.00 45.01 ? 208 ALA B CA    1 
ATOM   7183  C  C     . ALA B 1 208 ? -9.118  -24.960 -36.652 1.00 46.89 ? 208 ALA B C     1 
ATOM   7184  O  O     . ALA B 1 208 ? -9.823  -24.913 -37.673 1.00 47.17 ? 208 ALA B O     1 
ATOM   7185  C  CB    . ALA B 1 208 ? -10.447 -25.902 -34.769 1.00 44.20 ? 208 ALA B CB    1 
ATOM   7186  N  N     . GLY B 1 209 ? -7.811  -25.202 -36.674 1.00 48.13 ? 209 GLY B N     1 
ATOM   7187  C  CA    . GLY B 1 209 ? -7.085  -25.430 -37.917 1.00 50.38 ? 209 GLY B CA    1 
ATOM   7188  C  C     . GLY B 1 209 ? -6.948  -24.211 -38.813 1.00 52.13 ? 209 GLY B C     1 
ATOM   7189  O  O     . GLY B 1 209 ? -6.667  -24.351 -40.011 1.00 53.14 ? 209 GLY B O     1 
ATOM   7190  N  N     . THR B 1 210 ? -7.159  -23.020 -38.244 1.00 52.32 ? 210 THR B N     1 
ATOM   7191  C  CA    . THR B 1 210 ? -6.881  -21.771 -38.952 1.00 53.68 ? 210 THR B CA    1 
ATOM   7192  C  C     . THR B 1 210 ? -5.652  -21.099 -38.346 1.00 54.67 ? 210 THR B C     1 
ATOM   7193  O  O     . THR B 1 210 ? -5.120  -21.558 -37.328 1.00 54.09 ? 210 THR B O     1 
ATOM   7194  C  CB    . THR B 1 210 ? -8.082  -20.777 -38.952 1.00 53.23 ? 210 THR B CB    1 
ATOM   7195  O  OG1   . THR B 1 210 ? -8.374  -20.359 -37.615 1.00 52.64 ? 210 THR B OG1   1 
ATOM   7196  C  CG2   . THR B 1 210 ? -9.327  -21.392 -39.581 1.00 52.43 ? 210 THR B CG2   1 
ATOM   7197  N  N     . ASN B 1 211 ? -5.206  -20.022 -38.996 1.00 56.39 ? 211 ASN B N     1 
ATOM   7198  C  CA    . ASN B 1 211 ? -4.049  -19.235 -38.561 1.00 57.51 ? 211 ASN B CA    1 
ATOM   7199  C  C     . ASN B 1 211 ? -4.357  -18.370 -37.337 1.00 56.65 ? 211 ASN B C     1 
ATOM   7200  O  O     . ASN B 1 211 ? -5.453  -17.801 -37.227 1.00 55.61 ? 211 ASN B O     1 
ATOM   7201  C  CB    . ASN B 1 211 ? -3.555  -18.362 -39.709 1.00 59.14 ? 211 ASN B CB    1 
ATOM   7202  C  CG    . ASN B 1 211 ? -2.056  -18.133 -39.661 1.00 61.89 ? 211 ASN B CG    1 
ATOM   7203  O  OD1   . ASN B 1 211 ? -1.551  -17.377 -38.825 1.00 62.96 ? 211 ASN B OD1   1 
ATOM   7204  N  ND2   . ASN B 1 211 ? -1.333  -18.783 -40.571 1.00 63.42 ? 211 ASN B ND2   1 
ATOM   7205  N  N     . ARG B 1 212 ? -3.375  -18.270 -36.434 1.00 57.01 ? 212 ARG B N     1 
ATOM   7206  C  CA    . ARG B 1 212 ? -3.546  -17.641 -35.113 1.00 56.37 ? 212 ARG B CA    1 
ATOM   7207  C  C     . ARG B 1 212 ? -4.900  -18.053 -34.495 1.00 55.04 ? 212 ARG B C     1 
ATOM   7208  O  O     . ARG B 1 212 ? -5.785  -17.206 -34.302 1.00 54.72 ? 212 ARG B O     1 
ATOM   7209  C  CB    . ARG B 1 212 ? -3.434  -16.110 -35.193 1.00 57.09 ? 212 ARG B CB    1 
ATOM   7210  C  CG    . ARG B 1 212 ? -2.330  -15.574 -36.105 1.00 60.21 ? 212 ARG B CG    1 
ATOM   7211  C  CD    . ARG B 1 212 ? -1.890  -14.178 -35.682 1.00 62.84 ? 212 ARG B CD    1 
ATOM   7212  N  NE    . ARG B 1 212 ? -0.697  -13.759 -36.414 1.00 67.06 ? 212 ARG B NE    1 
ATOM   7213  C  CZ    . ARG B 1 212 ? 0.222   -12.902 -35.965 1.00 68.31 ? 212 ARG B CZ    1 
ATOM   7214  N  NH1   . ARG B 1 212 ? 0.119   -12.351 -34.757 1.00 67.09 ? 212 ARG B NH1   1 
ATOM   7215  N  NH2   . ARG B 1 212 ? 1.261   -12.603 -36.736 1.00 69.92 ? 212 ARG B NH2   1 
ATOM   7216  N  N     . PRO B 1 213 ? -5.066  -19.357 -34.190 1.00 54.18 ? 213 PRO B N     1 
ATOM   7217  C  CA    . PRO B 1 213 ? -6.391  -19.863 -33.830 1.00 52.92 ? 213 PRO B CA    1 
ATOM   7218  C  C     . PRO B 1 213 ? -6.903  -19.371 -32.474 1.00 51.77 ? 213 PRO B C     1 
ATOM   7219  O  O     . PRO B 1 213 ? -6.253  -19.577 -31.452 1.00 51.19 ? 213 PRO B O     1 
ATOM   7220  C  CB    . PRO B 1 213 ? -6.197  -21.383 -33.817 1.00 52.72 ? 213 PRO B CB    1 
ATOM   7221  C  CG    . PRO B 1 213 ? -4.751  -21.574 -33.523 1.00 53.54 ? 213 PRO B CG    1 
ATOM   7222  C  CD    . PRO B 1 213 ? -4.038  -20.414 -34.151 1.00 54.39 ? 213 PRO B CD    1 
ATOM   7223  N  N     . GLN B 1 214 ? -8.066  -18.721 -32.503 1.00 51.44 ? 214 GLN B N     1 
ATOM   7224  C  CA    . GLN B 1 214 ? -8.796  -18.283 -31.312 1.00 50.71 ? 214 GLN B CA    1 
ATOM   7225  C  C     . GLN B 1 214 ? -9.783  -19.362 -30.876 1.00 49.26 ? 214 GLN B C     1 
ATOM   7226  O  O     . GLN B 1 214 ? -10.944 -19.353 -31.279 1.00 48.83 ? 214 GLN B O     1 
ATOM   7227  C  CB    . GLN B 1 214 ? -9.547  -16.977 -31.608 1.00 51.34 ? 214 GLN B CB    1 
ATOM   7228  C  CG    . GLN B 1 214 ? -8.639  -15.765 -31.828 1.00 53.47 ? 214 GLN B CG    1 
ATOM   7229  C  CD    . GLN B 1 214 ? -7.862  -15.392 -30.576 1.00 55.17 ? 214 GLN B CD    1 
ATOM   7230  O  OE1   . GLN B 1 214 ? -8.402  -15.432 -29.459 1.00 55.04 ? 214 GLN B OE1   1 
ATOM   7231  N  NE2   . GLN B 1 214 ? -6.589  -15.029 -30.750 1.00 56.30 ? 214 GLN B NE2   1 
ATOM   7232  N  N     . LEU B 1 215 ? -9.315  -20.290 -30.049 1.00 48.49 ? 215 LEU B N     1 
ATOM   7233  C  CA    . LEU B 1 215 ? -10.094 -21.483 -29.729 1.00 47.80 ? 215 LEU B CA    1 
ATOM   7234  C  C     . LEU B 1 215 ? -10.896 -21.321 -28.446 1.00 47.30 ? 215 LEU B C     1 
ATOM   7235  O  O     . LEU B 1 215 ? -11.933 -21.963 -28.237 1.00 46.66 ? 215 LEU B O     1 
ATOM   7236  C  CB    . LEU B 1 215 ? -9.179  -22.709 -29.667 1.00 47.56 ? 215 LEU B CB    1 
ATOM   7237  C  CG    . LEU B 1 215 ? -8.392  -22.946 -30.957 1.00 47.54 ? 215 LEU B CG    1 
ATOM   7238  C  CD1   . LEU B 1 215 ? -7.445  -24.127 -30.813 1.00 48.35 ? 215 LEU B CD1   1 
ATOM   7239  C  CD2   . LEU B 1 215 ? -9.325  -23.136 -32.139 1.00 46.39 ? 215 LEU B CD2   1 
ATOM   7240  N  N     . SER B 1 216 ? -10.392 -20.456 -27.587 1.00 47.52 ? 216 SER B N     1 
ATOM   7241  C  CA    . SER B 1 216 ? -11.101 -20.058 -26.400 1.00 47.60 ? 216 SER B CA    1 
ATOM   7242  C  C     . SER B 1 216 ? -11.359 -18.578 -26.579 1.00 47.80 ? 216 SER B C     1 
ATOM   7243  O  O     . SER B 1 216 ? -10.458 -17.833 -27.002 1.00 48.33 ? 216 SER B O     1 
ATOM   7244  C  CB    . SER B 1 216 ? -10.231 -20.300 -25.179 1.00 47.47 ? 216 SER B CB    1 
ATOM   7245  O  OG    . SER B 1 216 ? -8.957  -19.694 -25.364 1.00 50.02 ? 216 SER B OG    1 
ATOM   7246  N  N     . SER B 1 217 ? -12.584 -18.150 -26.298 1.00 47.31 ? 217 SER B N     1 
ATOM   7247  C  CA    . SER B 1 217 ? -12.898 -16.744 -26.481 1.00 48.03 ? 217 SER B CA    1 
ATOM   7248  C  C     . SER B 1 217 ? -13.731 -16.126 -25.348 1.00 47.54 ? 217 SER B C     1 
ATOM   7249  O  O     . SER B 1 217 ? -14.518 -15.199 -25.582 1.00 48.11 ? 217 SER B O     1 
ATOM   7250  C  CB    . SER B 1 217 ? -13.512 -16.501 -27.869 1.00 48.85 ? 217 SER B CB    1 
ATOM   7251  O  OG    . SER B 1 217 ? -14.925 -16.428 -27.813 1.00 49.92 ? 217 SER B OG    1 
ATOM   7252  N  N     . CYS B 1 218 ? -13.565 -16.650 -24.130 1.00 46.49 ? 218 CYS B N     1 
ATOM   7253  C  CA    . CYS B 1 218 ? -14.031 -15.964 -22.926 1.00 45.82 ? 218 CYS B CA    1 
ATOM   7254  C  C     . CYS B 1 218 ? -12.918 -15.763 -21.926 1.00 44.08 ? 218 CYS B C     1 
ATOM   7255  O  O     . CYS B 1 218 ? -12.078 -16.641 -21.727 1.00 43.87 ? 218 CYS B O     1 
ATOM   7256  C  CB    . CYS B 1 218 ? -15.228 -16.649 -22.283 1.00 45.53 ? 218 CYS B CB    1 
ATOM   7257  S  SG    . CYS B 1 218 ? -16.702 -15.590 -22.345 1.00 51.72 ? 218 CYS B SG    1 
ATOM   7258  N  N     . PHE B 1 219 ? -12.923 -14.588 -21.310 1.00 42.57 ? 219 PHE B N     1 
ATOM   7259  C  CA    . PHE B 1 219 ? -11.811 -14.120 -20.500 1.00 41.23 ? 219 PHE B CA    1 
ATOM   7260  C  C     . PHE B 1 219 ? -12.294 -13.456 -19.215 1.00 40.43 ? 219 PHE B C     1 
ATOM   7261  O  O     . PHE B 1 219 ? -13.444 -13.033 -19.120 1.00 40.24 ? 219 PHE B O     1 
ATOM   7262  C  CB    . PHE B 1 219 ? -10.949 -13.137 -21.311 1.00 41.67 ? 219 PHE B CB    1 
ATOM   7263  C  CG    . PHE B 1 219 ? -10.306 -13.746 -22.534 1.00 41.08 ? 219 PHE B CG    1 
ATOM   7264  C  CD1   . PHE B 1 219 ? -10.977 -13.765 -23.756 1.00 40.36 ? 219 PHE B CD1   1 
ATOM   7265  C  CD2   . PHE B 1 219 ? -9.026  -14.294 -22.466 1.00 41.49 ? 219 PHE B CD2   1 
ATOM   7266  C  CE1   . PHE B 1 219 ? -10.389 -14.325 -24.898 1.00 40.93 ? 219 PHE B CE1   1 
ATOM   7267  C  CE2   . PHE B 1 219 ? -8.421  -14.859 -23.605 1.00 42.08 ? 219 PHE B CE2   1 
ATOM   7268  C  CZ    . PHE B 1 219 ? -9.114  -14.872 -24.825 1.00 41.65 ? 219 PHE B CZ    1 
ATOM   7269  N  N     . LEU B 1 220 ? -11.420 -13.396 -18.216 1.00 39.96 ? 220 LEU B N     1 
ATOM   7270  C  CA    . LEU B 1 220 ? -11.687 -12.601 -17.017 1.00 39.46 ? 220 LEU B CA    1 
ATOM   7271  C  C     . LEU B 1 220 ? -10.484 -11.773 -16.544 1.00 40.07 ? 220 LEU B C     1 
ATOM   7272  O  O     . LEU B 1 220 ? -9.338  -12.218 -16.629 1.00 39.98 ? 220 LEU B O     1 
ATOM   7273  C  CB    . LEU B 1 220 ? -12.361 -13.410 -15.883 1.00 38.54 ? 220 LEU B CB    1 
ATOM   7274  C  CG    . LEU B 1 220 ? -12.392 -14.913 -15.591 1.00 37.44 ? 220 LEU B CG    1 
ATOM   7275  C  CD1   . LEU B 1 220 ? -13.332 -15.159 -14.434 1.00 36.04 ? 220 LEU B CD1   1 
ATOM   7276  C  CD2   . LEU B 1 220 ? -12.811 -15.785 -16.763 1.00 37.62 ? 220 LEU B CD2   1 
ATOM   7277  N  N     . LEU B 1 221 ? -10.764 -10.553 -16.085 1.00 40.68 ? 221 LEU B N     1 
ATOM   7278  C  CA    . LEU B 1 221 ? -9.721  -9.569  -15.735 1.00 41.96 ? 221 LEU B CA    1 
ATOM   7279  C  C     . LEU B 1 221 ? -10.066 -8.894  -14.422 1.00 41.58 ? 221 LEU B C     1 
ATOM   7280  O  O     . LEU B 1 221 ? -11.228 -8.675  -14.134 1.00 40.91 ? 221 LEU B O     1 
ATOM   7281  C  CB    . LEU B 1 221 ? -9.595  -8.460  -16.802 1.00 42.76 ? 221 LEU B CB    1 
ATOM   7282  C  CG    . LEU B 1 221 ? -9.130  -8.712  -18.233 1.00 44.11 ? 221 LEU B CG    1 
ATOM   7283  C  CD1   . LEU B 1 221 ? -10.270 -9.158  -19.101 1.00 44.62 ? 221 LEU B CD1   1 
ATOM   7284  C  CD2   . LEU B 1 221 ? -8.557  -7.459  -18.806 1.00 45.22 ? 221 LEU B CD2   1 
ATOM   7285  N  N     . SER B 1 222 ? -9.045  -8.555  -13.645 1.00 42.40 ? 222 SER B N     1 
ATOM   7286  C  CA    . SER B 1 222 ? -9.194  -7.668  -12.491 1.00 43.51 ? 222 SER B CA    1 
ATOM   7287  C  C     . SER B 1 222 ? -8.527  -6.347  -12.804 1.00 44.88 ? 222 SER B C     1 
ATOM   7288  O  O     . SER B 1 222 ? -7.442  -6.327  -13.388 1.00 45.82 ? 222 SER B O     1 
ATOM   7289  C  CB    . SER B 1 222 ? -8.521  -8.262  -11.257 1.00 43.08 ? 222 SER B CB    1 
ATOM   7290  O  OG    . SER B 1 222 ? -9.358  -9.213  -10.638 1.00 42.87 ? 222 SER B OG    1 
ATOM   7291  N  N     . MET B 1 223 ? -9.156  -5.247  -12.412 1.00 45.92 ? 223 MET B N     1 
ATOM   7292  C  CA    . MET B 1 223 ? -8.525  -3.945  -12.574 1.00 47.65 ? 223 MET B CA    1 
ATOM   7293  C  C     . MET B 1 223 ? -7.145  -3.960  -11.893 1.00 48.76 ? 223 MET B C     1 
ATOM   7294  O  O     . MET B 1 223 ? -7.016  -4.392  -10.726 1.00 48.03 ? 223 MET B O     1 
ATOM   7295  C  CB    . MET B 1 223 ? -9.398  -2.843  -12.000 1.00 47.73 ? 223 MET B CB    1 
ATOM   7296  C  CG    . MET B 1 223 ? -9.313  -1.555  -12.793 1.00 49.52 ? 223 MET B CG    1 
ATOM   7297  S  SD    . MET B 1 223 ? -10.516 -1.581  -14.122 1.00 50.56 ? 223 MET B SD    1 
ATOM   7298  C  CE    . MET B 1 223 ? -10.233 -0.028  -14.900 1.00 51.42 ? 223 MET B CE    1 
ATOM   7299  N  N     . LYS B 1 224 ? -6.124  -3.508  -12.634 1.00 50.24 ? 224 LYS B N     1 
ATOM   7300  C  CA    . LYS B 1 224 ? -4.726  -3.603  -12.191 1.00 51.20 ? 224 LYS B CA    1 
ATOM   7301  C  C     . LYS B 1 224 ? -4.523  -2.910  -10.838 1.00 51.44 ? 224 LYS B C     1 
ATOM   7302  O  O     . LYS B 1 224 ? -4.555  -3.572  -9.779  1.00 51.22 ? 224 LYS B O     1 
ATOM   7303  C  CB    . LYS B 1 224 ? -3.761  -3.108  -13.275 1.00 52.47 ? 224 LYS B CB    1 
ATOM   7304  C  CG    . LYS B 1 224 ? -3.747  -4.015  -14.512 1.00 52.86 ? 224 LYS B CG    1 
ATOM   7305  C  CD    . LYS B 1 224 ? -2.468  -3.880  -15.314 1.00 55.28 ? 224 LYS B CD    1 
ATOM   7306  C  CE    . LYS B 1 224 ? -2.497  -4.805  -16.537 1.00 56.00 ? 224 LYS B CE    1 
ATOM   7307  N  NZ    . LYS B 1 224 ? -1.120  -5.112  -17.033 1.00 56.91 ? 224 LYS B NZ    1 
ATOM   7308  N  N     . ASP B 1 225 ? -4.340  -1.594  -10.858 1.00 51.82 ? 225 ASP B N     1 
ATOM   7309  C  CA    . ASP B 1 225 ? -4.552  -0.827  -9.644  1.00 51.02 ? 225 ASP B CA    1 
ATOM   7310  C  C     . ASP B 1 225 ? -5.406  0.396   -9.877  1.00 50.48 ? 225 ASP B C     1 
ATOM   7311  O  O     . ASP B 1 225 ? -5.927  0.620   -10.973 1.00 50.94 ? 225 ASP B O     1 
ATOM   7312  C  CB    . ASP B 1 225 ? -3.249  -0.476  -8.919  1.00 52.68 ? 225 ASP B CB    1 
ATOM   7313  C  CG    . ASP B 1 225 ? -2.135  -0.099  -9.859  1.00 54.77 ? 225 ASP B CG    1 
ATOM   7314  O  OD1   . ASP B 1 225 ? -1.516  -1.022  -10.430 1.00 56.09 ? 225 ASP B OD1   1 
ATOM   7315  O  OD2   . ASP B 1 225 ? -1.858  1.110   -9.991  1.00 57.94 ? 225 ASP B OD2   1 
ATOM   7316  N  N     . ASP B 1 226 ? -5.554  1.162   -8.806  1.00 49.05 ? 226 ASP B N     1 
ATOM   7317  C  CA    . ASP B 1 226 ? -6.414  2.315   -8.737  1.00 47.91 ? 226 ASP B CA    1 
ATOM   7318  C  C     . ASP B 1 226 ? -5.672  3.571   -9.236  1.00 48.38 ? 226 ASP B C     1 
ATOM   7319  O  O     . ASP B 1 226 ? -5.349  4.487   -8.464  1.00 48.39 ? 226 ASP B O     1 
ATOM   7320  C  CB    . ASP B 1 226 ? -6.870  2.447   -7.285  1.00 47.47 ? 226 ASP B CB    1 
ATOM   7321  C  CG    . ASP B 1 226 ? -7.806  3.601   -7.063  1.00 47.92 ? 226 ASP B CG    1 
ATOM   7322  O  OD1   . ASP B 1 226 ? -7.688  4.217   -5.989  1.00 48.62 ? 226 ASP B OD1   1 
ATOM   7323  O  OD2   . ASP B 1 226 ? -8.648  3.890   -7.939  1.00 47.68 ? 226 ASP B OD2   1 
ATOM   7324  N  N     . SER B 1 227 ? -5.392  3.587   -10.538 1.00 47.57 ? 227 SER B N     1 
ATOM   7325  C  CA    . SER B 1 227 ? -4.688  4.701   -11.168 1.00 48.08 ? 227 SER B CA    1 
ATOM   7326  C  C     . SER B 1 227 ? -5.055  4.818   -12.646 1.00 47.78 ? 227 SER B C     1 
ATOM   7327  O  O     . SER B 1 227 ? -5.457  3.832   -13.264 1.00 46.96 ? 227 SER B O     1 
ATOM   7328  C  CB    . SER B 1 227 ? -3.175  4.548   -10.998 1.00 48.30 ? 227 SER B CB    1 
ATOM   7329  O  OG    . SER B 1 227 ? -2.676  3.497   -11.796 1.00 48.21 ? 227 SER B OG    1 
ATOM   7330  N  N     . ILE B 1 228 ? -4.926  6.024   -13.198 1.00 48.33 ? 228 ILE B N     1 
ATOM   7331  C  CA    . ILE B 1 228 ? -5.128  6.251   -14.633 1.00 48.71 ? 228 ILE B CA    1 
ATOM   7332  C  C     . ILE B 1 228 ? -4.289  5.264   -15.470 1.00 48.81 ? 228 ILE B C     1 
ATOM   7333  O  O     . ILE B 1 228 ? -4.786  4.703   -16.450 1.00 48.58 ? 228 ILE B O     1 
ATOM   7334  C  CB    . ILE B 1 228 ? -4.867  7.739   -15.037 1.00 50.25 ? 228 ILE B CB    1 
ATOM   7335  C  CG1   . ILE B 1 228 ? -5.944  8.673   -14.461 1.00 49.61 ? 228 ILE B CG1   1 
ATOM   7336  C  CG2   . ILE B 1 228 ? -4.748  7.907   -16.561 1.00 51.05 ? 228 ILE B CG2   1 
ATOM   7337  C  CD1   . ILE B 1 228 ? -7.384  8.415   -14.939 1.00 48.47 ? 228 ILE B CD1   1 
ATOM   7338  N  N     . GLU B 1 229 ? -3.038  5.036   -15.065 1.00 49.13 ? 229 GLU B N     1 
ATOM   7339  C  CA    . GLU B 1 229 ? -2.183  4.030   -15.703 1.00 49.33 ? 229 GLU B CA    1 
ATOM   7340  C  C     . GLU B 1 229 ? -2.763  2.613   -15.643 1.00 47.18 ? 229 GLU B C     1 
ATOM   7341  O  O     . GLU B 1 229 ? -2.780  1.904   -16.650 1.00 47.18 ? 229 GLU B O     1 
ATOM   7342  C  CB    . GLU B 1 229 ? -0.773  4.050   -15.106 1.00 50.36 ? 229 GLU B CB    1 
ATOM   7343  C  CG    . GLU B 1 229 ? 0.240   3.254   -15.925 1.00 53.51 ? 229 GLU B CG    1 
ATOM   7344  C  CD    . GLU B 1 229 ? 1.675   3.627   -15.609 1.00 59.40 ? 229 GLU B CD    1 
ATOM   7345  O  OE1   . GLU B 1 229 ? 2.091   3.461   -14.437 1.00 60.83 ? 229 GLU B OE1   1 
ATOM   7346  O  OE2   . GLU B 1 229 ? 2.392   4.088   -16.534 1.00 62.66 ? 229 GLU B OE2   1 
ATOM   7347  N  N     . GLY B 1 230 ? -3.237  2.202   -14.468 1.00 45.45 ? 230 GLY B N     1 
ATOM   7348  C  CA    . GLY B 1 230 ? -3.854  0.888   -14.314 1.00 43.12 ? 230 GLY B CA    1 
ATOM   7349  C  C     . GLY B 1 230 ? -5.149  0.755   -15.103 1.00 42.20 ? 230 GLY B C     1 
ATOM   7350  O  O     . GLY B 1 230 ? -5.369  -0.243  -15.801 1.00 41.52 ? 230 GLY B O     1 
ATOM   7351  N  N     . ILE B 1 231 ? -6.005  1.767   -14.990 1.00 41.97 ? 231 ILE B N     1 
ATOM   7352  C  CA    . ILE B 1 231 ? -7.298  1.785   -15.679 1.00 41.66 ? 231 ILE B CA    1 
ATOM   7353  C  C     . ILE B 1 231 ? -7.131  1.678   -17.203 1.00 41.90 ? 231 ILE B C     1 
ATOM   7354  O  O     . ILE B 1 231 ? -7.808  0.876   -17.849 1.00 41.15 ? 231 ILE B O     1 
ATOM   7355  C  CB    . ILE B 1 231 ? -8.121  3.048   -15.293 1.00 42.52 ? 231 ILE B CB    1 
ATOM   7356  C  CG1   . ILE B 1 231 ? -8.609  2.941   -13.845 1.00 41.88 ? 231 ILE B CG1   1 
ATOM   7357  C  CG2   . ILE B 1 231 ? -9.307  3.272   -16.243 1.00 42.62 ? 231 ILE B CG2   1 
ATOM   7358  C  CD1   . ILE B 1 231 ? -8.909  4.291   -13.209 1.00 41.25 ? 231 ILE B CD1   1 
ATOM   7359  N  N     . TYR B 1 232 ? -6.211  2.468   -17.753 1.00 42.80 ? 232 TYR B N     1 
ATOM   7360  C  CA    . TYR B 1 232 ? -5.943  2.472   -19.190 1.00 43.47 ? 232 TYR B CA    1 
ATOM   7361  C  C     . TYR B 1 232 ? -5.092  1.301   -19.710 1.00 43.60 ? 232 TYR B C     1 
ATOM   7362  O  O     . TYR B 1 232 ? -5.165  0.978   -20.893 1.00 44.17 ? 232 TYR B O     1 
ATOM   7363  C  CB    . TYR B 1 232 ? -5.441  3.853   -19.660 1.00 44.58 ? 232 TYR B CB    1 
ATOM   7364  C  CG    . TYR B 1 232 ? -6.600  4.818   -19.782 1.00 44.12 ? 232 TYR B CG    1 
ATOM   7365  C  CD1   . TYR B 1 232 ? -7.175  5.392   -18.642 1.00 42.57 ? 232 TYR B CD1   1 
ATOM   7366  C  CD2   . TYR B 1 232 ? -7.172  5.102   -21.022 1.00 43.54 ? 232 TYR B CD2   1 
ATOM   7367  C  CE1   . TYR B 1 232 ? -8.256  6.241   -18.733 1.00 42.71 ? 232 TYR B CE1   1 
ATOM   7368  C  CE2   . TYR B 1 232 ? -8.269  5.957   -21.126 1.00 44.19 ? 232 TYR B CE2   1 
ATOM   7369  C  CZ    . TYR B 1 232 ? -8.804  6.524   -19.976 1.00 44.72 ? 232 TYR B CZ    1 
ATOM   7370  O  OH    . TYR B 1 232 ? -9.886  7.376   -20.059 1.00 45.25 ? 232 TYR B OH    1 
ATOM   7371  N  N     . ASP B 1 233 ? -4.316  0.662   -18.831 1.00 43.48 ? 233 ASP B N     1 
ATOM   7372  C  CA    . ASP B 1 233 ? -3.638  -0.603  -19.163 1.00 43.57 ? 233 ASP B CA    1 
ATOM   7373  C  C     . ASP B 1 233 ? -4.640  -1.728  -19.341 1.00 41.79 ? 233 ASP B C     1 
ATOM   7374  O  O     . ASP B 1 233 ? -4.515  -2.546  -20.245 1.00 42.14 ? 233 ASP B O     1 
ATOM   7375  C  CB    . ASP B 1 233 ? -2.621  -1.006  -18.085 1.00 43.51 ? 233 ASP B CB    1 
ATOM   7376  C  CG    . ASP B 1 233 ? -1.230  -0.502  -18.378 1.00 48.44 ? 233 ASP B CG    1 
ATOM   7377  O  OD1   . ASP B 1 233 ? -0.496  -0.190  -17.402 1.00 51.71 ? 233 ASP B OD1   1 
ATOM   7378  O  OD2   . ASP B 1 233 ? -0.868  -0.398  -19.582 1.00 52.02 ? 233 ASP B OD2   1 
ATOM   7379  N  N     . THR B 1 234 ? -5.623  -1.773  -18.450 1.00 40.82 ? 234 THR B N     1 
ATOM   7380  C  CA    . THR B 1 234 ? -6.690  -2.760  -18.499 1.00 39.09 ? 234 THR B CA    1 
ATOM   7381  C  C     . THR B 1 234 ? -7.584  -2.500  -19.709 1.00 39.37 ? 234 THR B C     1 
ATOM   7382  O  O     . THR B 1 234 ? -8.037  -3.438  -20.359 1.00 39.38 ? 234 THR B O     1 
ATOM   7383  C  CB    . THR B 1 234 ? -7.497  -2.732  -17.189 1.00 38.20 ? 234 THR B CB    1 
ATOM   7384  O  OG1   . THR B 1 234 ? -6.603  -2.930  -16.090 1.00 37.62 ? 234 THR B OG1   1 
ATOM   7385  C  CG2   . THR B 1 234 ? -8.579  -3.810  -17.160 1.00 36.98 ? 234 THR B CG2   1 
ATOM   7386  N  N     . LEU B 1 235 ? -7.815  -1.228  -20.023 1.00 40.19 ? 235 LEU B N     1 
ATOM   7387  C  CA    . LEU B 1 235 ? -8.655  -0.865  -21.166 1.00 40.60 ? 235 LEU B CA    1 
ATOM   7388  C  C     . LEU B 1 235 ? -8.060  -1.388  -22.473 1.00 41.28 ? 235 LEU B C     1 
ATOM   7389  O  O     . LEU B 1 235 ? -8.772  -1.959  -23.305 1.00 41.04 ? 235 LEU B O     1 
ATOM   7390  C  CB    . LEU B 1 235 ? -8.863  0.649   -21.235 1.00 41.46 ? 235 LEU B CB    1 
ATOM   7391  C  CG    . LEU B 1 235 ? -9.817  1.157   -22.318 1.00 41.19 ? 235 LEU B CG    1 
ATOM   7392  C  CD1   . LEU B 1 235 ? -11.272 0.817   -21.986 1.00 38.81 ? 235 LEU B CD1   1 
ATOM   7393  C  CD2   . LEU B 1 235 ? -9.631  2.649   -22.484 1.00 39.92 ? 235 LEU B CD2   1 
ATOM   7394  N  N     . LYS B 1 236 ? -6.753  -1.203  -22.631 1.00 42.25 ? 236 LYS B N     1 
ATOM   7395  C  CA    . LYS B 1 236 ? -6.033  -1.754  -23.762 1.00 43.55 ? 236 LYS B CA    1 
ATOM   7396  C  C     . LYS B 1 236 ? -6.219  -3.275  -23.819 1.00 42.78 ? 236 LYS B C     1 
ATOM   7397  O  O     . LYS B 1 236 ? -6.525  -3.824  -24.881 1.00 43.00 ? 236 LYS B O     1 
ATOM   7398  C  CB    . LYS B 1 236 ? -4.553  -1.376  -23.681 1.00 44.62 ? 236 LYS B CB    1 
ATOM   7399  C  CG    . LYS B 1 236 ? -3.714  -1.846  -24.844 1.00 45.69 ? 236 LYS B CG    1 
ATOM   7400  C  CD    . LYS B 1 236 ? -2.315  -1.304  -24.700 1.00 49.03 ? 236 LYS B CD    1 
ATOM   7401  C  CE    . LYS B 1 236 ? -1.307  -2.191  -25.386 1.00 51.19 ? 236 LYS B CE    1 
ATOM   7402  N  NZ    . LYS B 1 236 ? 0.044   -1.569  -25.327 1.00 54.71 ? 236 LYS B NZ    1 
ATOM   7403  N  N     . GLN B 1 237 ? -6.062  -3.943  -22.679 1.00 41.97 ? 237 GLN B N     1 
ATOM   7404  C  CA    . GLN B 1 237 ? -6.263  -5.382  -22.609 1.00 41.55 ? 237 GLN B CA    1 
ATOM   7405  C  C     . GLN B 1 237 ? -7.626  -5.761  -23.150 1.00 41.05 ? 237 GLN B C     1 
ATOM   7406  O  O     . GLN B 1 237 ? -7.711  -6.548  -24.091 1.00 41.65 ? 237 GLN B O     1 
ATOM   7407  C  CB    . GLN B 1 237 ? -6.115  -5.896  -21.183 1.00 40.62 ? 237 GLN B CB    1 
ATOM   7408  C  CG    . GLN B 1 237 ? -4.682  -6.058  -20.742 1.00 42.77 ? 237 GLN B CG    1 
ATOM   7409  C  CD    . GLN B 1 237 ? -4.568  -6.773  -19.406 1.00 44.60 ? 237 GLN B CD    1 
ATOM   7410  O  OE1   . GLN B 1 237 ? -5.386  -6.565  -18.487 1.00 44.62 ? 237 GLN B OE1   1 
ATOM   7411  N  NE2   . GLN B 1 237 ? -3.552  -7.624  -19.285 1.00 44.11 ? 237 GLN B NE2   1 
ATOM   7412  N  N     . CYS B 1 238 ? -8.680  -5.185  -22.571 1.00 40.45 ? 238 CYS B N     1 
ATOM   7413  C  CA    . CYS B 1 238 ? -10.054 -5.423  -23.025 1.00 40.17 ? 238 CYS B CA    1 
ATOM   7414  C  C     . CYS B 1 238 ? -10.269 -5.119  -24.491 1.00 40.90 ? 238 CYS B C     1 
ATOM   7415  O  O     . CYS B 1 238 ? -11.036 -5.798  -25.143 1.00 40.80 ? 238 CYS B O     1 
ATOM   7416  C  CB    . CYS B 1 238 ? -11.053 -4.609  -22.208 1.00 39.83 ? 238 CYS B CB    1 
ATOM   7417  S  SG    . CYS B 1 238 ? -11.083 -5.112  -20.520 1.00 39.35 ? 238 CYS B SG    1 
ATOM   7418  N  N     . ALA B 1 239 ? -9.613  -4.082  -24.996 1.00 42.21 ? 239 ALA B N     1 
ATOM   7419  C  CA    . ALA B 1 239 ? -9.710  -3.748  -26.402 1.00 43.30 ? 239 ALA B CA    1 
ATOM   7420  C  C     . ALA B 1 239 ? -9.098  -4.867  -27.242 1.00 43.47 ? 239 ALA B C     1 
ATOM   7421  O  O     . ALA B 1 239 ? -9.704  -5.315  -28.215 1.00 43.38 ? 239 ALA B O     1 
ATOM   7422  C  CB    . ALA B 1 239 ? -9.032  -2.426  -26.681 1.00 44.50 ? 239 ALA B CB    1 
ATOM   7423  N  N     . LEU B 1 240 ? -7.911  -5.323  -26.837 1.00 43.58 ? 240 LEU B N     1 
ATOM   7424  C  CA    . LEU B 1 240 ? -7.170  -6.378  -27.543 1.00 43.65 ? 240 LEU B CA    1 
ATOM   7425  C  C     . LEU B 1 240 ? -7.898  -7.728  -27.517 1.00 42.42 ? 240 LEU B C     1 
ATOM   7426  O  O     . LEU B 1 240 ? -8.000  -8.407  -28.547 1.00 42.57 ? 240 LEU B O     1 
ATOM   7427  C  CB    . LEU B 1 240 ? -5.741  -6.505  -26.996 1.00 43.70 ? 240 LEU B CB    1 
ATOM   7428  C  CG    . LEU B 1 240 ? -4.760  -5.416  -27.454 1.00 45.49 ? 240 LEU B CG    1 
ATOM   7429  C  CD1   . LEU B 1 240 ? -3.483  -5.431  -26.622 1.00 46.04 ? 240 LEU B CD1   1 
ATOM   7430  C  CD2   . LEU B 1 240 ? -4.412  -5.540  -28.940 1.00 46.18 ? 240 LEU B CD2   1 
ATOM   7431  N  N     . ILE B 1 241 ? -8.413  -8.095  -26.348 1.00 41.03 ? 241 ILE B N     1 
ATOM   7432  C  CA    . ILE B 1 241 ? -9.265  -9.268  -26.207 1.00 39.78 ? 241 ILE B CA    1 
ATOM   7433  C  C     . ILE B 1 241 ? -10.509 -9.141  -27.102 1.00 40.22 ? 241 ILE B C     1 
ATOM   7434  O  O     . ILE B 1 241 ? -10.838 -10.057 -27.858 1.00 39.92 ? 241 ILE B O     1 
ATOM   7435  C  CB    . ILE B 1 241 ? -9.656  -9.507  -24.716 1.00 38.76 ? 241 ILE B CB    1 
ATOM   7436  C  CG1   . ILE B 1 241 ? -8.441  -9.988  -23.914 1.00 38.33 ? 241 ILE B CG1   1 
ATOM   7437  C  CG2   . ILE B 1 241 ? -10.797 -10.509 -24.601 1.00 37.82 ? 241 ILE B CG2   1 
ATOM   7438  C  CD1   . ILE B 1 241 ? -8.555  -9.811  -22.403 1.00 37.06 ? 241 ILE B CD1   1 
ATOM   7439  N  N     . SER B 1 242 ? -11.183 -7.996  -27.032 1.00 41.08 ? 242 SER B N     1 
ATOM   7440  C  CA    . SER B 1 242 ? -12.406 -7.773  -27.810 1.00 41.77 ? 242 SER B CA    1 
ATOM   7441  C  C     . SER B 1 242 ? -12.179 -7.833  -29.333 1.00 43.12 ? 242 SER B C     1 
ATOM   7442  O  O     . SER B 1 242 ? -13.086 -8.182  -30.086 1.00 43.17 ? 242 SER B O     1 
ATOM   7443  C  CB    . SER B 1 242 ? -13.069 -6.455  -27.399 1.00 41.96 ? 242 SER B CB    1 
ATOM   7444  O  OG    . SER B 1 242 ? -14.266 -6.235  -28.125 1.00 42.90 ? 242 SER B OG    1 
ATOM   7445  N  N     . LYS B 1 243 ? -10.966 -7.492  -29.768 1.00 44.48 ? 243 LYS B N     1 
ATOM   7446  C  CA    . LYS B 1 243 ? -10.568 -7.574  -31.172 1.00 46.24 ? 243 LYS B CA    1 
ATOM   7447  C  C     . LYS B 1 243 ? -10.524 -9.025  -31.642 1.00 46.08 ? 243 LYS B C     1 
ATOM   7448  O  O     . LYS B 1 243 ? -10.833 -9.320  -32.795 1.00 46.70 ? 243 LYS B O     1 
ATOM   7449  C  CB    . LYS B 1 243 ? -9.213  -6.882  -31.385 1.00 47.33 ? 243 LYS B CB    1 
ATOM   7450  C  CG    . LYS B 1 243 ? -8.394  -7.413  -32.546 1.00 48.75 ? 243 LYS B CG    1 
ATOM   7451  C  CD    . LYS B 1 243 ? -7.280  -6.455  -32.927 1.00 52.79 ? 243 LYS B CD    1 
ATOM   7452  C  CE    . LYS B 1 243 ? -6.062  -7.192  -33.486 1.00 54.22 ? 243 LYS B CE    1 
ATOM   7453  N  NZ    . LYS B 1 243 ? -6.432  -8.213  -34.517 1.00 55.73 ? 243 LYS B NZ    1 
ATOM   7454  N  N     . SER B 1 244 ? -10.148 -9.919  -30.728 1.00 45.77 ? 244 SER B N     1 
ATOM   7455  C  CA    . SER B 1 244 ? -10.159 -11.355 -30.961 1.00 45.71 ? 244 SER B CA    1 
ATOM   7456  C  C     . SER B 1 244 ? -11.536 -11.964 -30.702 1.00 45.29 ? 244 SER B C     1 
ATOM   7457  O  O     . SER B 1 244 ? -11.663 -13.177 -30.618 1.00 44.94 ? 244 SER B O     1 
ATOM   7458  C  CB    . SER B 1 244 ? -9.140  -12.031 -30.053 1.00 45.20 ? 244 SER B CB    1 
ATOM   7459  O  OG    . SER B 1 244 ? -7.858  -11.468 -30.235 1.00 47.54 ? 244 SER B OG    1 
ATOM   7460  N  N     . ALA B 1 245 ? -12.562 -11.122 -30.577 1.00 45.92 ? 245 ALA B N     1 
ATOM   7461  C  CA    . ALA B 1 245 ? -13.938 -11.572 -30.326 1.00 45.53 ? 245 ALA B CA    1 
ATOM   7462  C  C     . ALA B 1 245 ? -14.085 -12.289 -28.981 1.00 44.47 ? 245 ALA B C     1 
ATOM   7463  O  O     . ALA B 1 245 ? -14.854 -13.241 -28.845 1.00 44.25 ? 245 ALA B O     1 
ATOM   7464  C  CB    . ALA B 1 245 ? -14.441 -12.457 -31.484 1.00 45.59 ? 245 ALA B CB    1 
ATOM   7465  N  N     . GLY B 1 246 ? -13.326 -11.839 -27.992 1.00 44.55 ? 246 GLY B N     1 
ATOM   7466  C  CA    . GLY B 1 246 ? -13.412 -12.401 -26.655 1.00 43.18 ? 246 GLY B CA    1 
ATOM   7467  C  C     . GLY B 1 246 ? -14.456 -11.670 -25.838 1.00 42.81 ? 246 GLY B C     1 
ATOM   7468  O  O     . GLY B 1 246 ? -14.504 -10.439 -25.864 1.00 43.68 ? 246 GLY B O     1 
ATOM   7469  N  N     . GLY B 1 247 ? -15.315 -12.429 -25.150 1.00 41.60 ? 247 GLY B N     1 
ATOM   7470  C  CA    . GLY B 1 247 ? -16.193 -11.892 -24.106 1.00 40.72 ? 247 GLY B CA    1 
ATOM   7471  C  C     . GLY B 1 247 ? -15.386 -11.735 -22.823 1.00 40.15 ? 247 GLY B C     1 
ATOM   7472  O  O     . GLY B 1 247 ? -14.398 -12.440 -22.633 1.00 40.06 ? 247 GLY B O     1 
ATOM   7473  N  N     . ILE B 1 248 ? -15.792 -10.816 -21.944 1.00 39.69 ? 248 ILE B N     1 
ATOM   7474  C  CA    . ILE B 1 248 ? -14.992 -10.499 -20.755 1.00 38.83 ? 248 ILE B CA    1 
ATOM   7475  C  C     . ILE B 1 248 ? -15.809 -10.261 -19.488 1.00 37.74 ? 248 ILE B C     1 
ATOM   7476  O  O     . ILE B 1 248 ? -16.860 -9.659  -19.535 1.00 38.16 ? 248 ILE B O     1 
ATOM   7477  C  CB    . ILE B 1 248 ? -14.089 -9.244  -20.971 1.00 39.75 ? 248 ILE B CB    1 
ATOM   7478  C  CG1   . ILE B 1 248 ? -13.288 -9.343  -22.267 1.00 40.13 ? 248 ILE B CG1   1 
ATOM   7479  C  CG2   . ILE B 1 248 ? -13.133 -9.102  -19.827 1.00 39.78 ? 248 ILE B CG2   1 
ATOM   7480  C  CD1   . ILE B 1 248 ? -12.622 -8.063  -22.689 1.00 41.14 ? 248 ILE B CD1   1 
ATOM   7481  N  N     . GLY B 1 249 ? -15.299 -10.743 -18.359 1.00 36.68 ? 249 GLY B N     1 
ATOM   7482  C  CA    . GLY B 1 249 ? -15.771 -10.336 -17.038 1.00 35.39 ? 249 GLY B CA    1 
ATOM   7483  C  C     . GLY B 1 249 ? -14.657 -9.536  -16.388 1.00 35.18 ? 249 GLY B C     1 
ATOM   7484  O  O     . GLY B 1 249 ? -13.513 -9.995  -16.356 1.00 34.90 ? 249 GLY B O     1 
ATOM   7485  N  N     . VAL B 1 250 ? -14.990 -8.340  -15.895 1.00 35.09 ? 250 VAL B N     1 
ATOM   7486  C  CA    . VAL B 1 250 ? -14.014 -7.397  -15.316 1.00 35.22 ? 250 VAL B CA    1 
ATOM   7487  C  C     . VAL B 1 250 ? -14.396 -7.010  -13.890 1.00 34.84 ? 250 VAL B C     1 
ATOM   7488  O  O     . VAL B 1 250 ? -15.522 -6.571  -13.645 1.00 34.64 ? 250 VAL B O     1 
ATOM   7489  C  CB    . VAL B 1 250 ? -13.903 -6.077  -16.136 1.00 36.15 ? 250 VAL B CB    1 
ATOM   7490  C  CG1   . VAL B 1 250 ? -12.617 -5.328  -15.781 1.00 36.69 ? 250 VAL B CG1   1 
ATOM   7491  C  CG2   . VAL B 1 250 ? -13.945 -6.349  -17.629 1.00 37.23 ? 250 VAL B CG2   1 
ATOM   7492  N  N     . ALA B 1 251 ? -13.458 -7.167  -12.958 1.00 34.75 ? 251 ALA B N     1 
ATOM   7493  C  CA    . ALA B 1 251 ? -13.655 -6.730  -11.572 1.00 34.87 ? 251 ALA B CA    1 
ATOM   7494  C  C     . ALA B 1 251 ? -13.128 -5.308  -11.388 1.00 35.64 ? 251 ALA B C     1 
ATOM   7495  O  O     . ALA B 1 251 ? -11.974 -5.021  -11.707 1.00 36.14 ? 251 ALA B O     1 
ATOM   7496  C  CB    . ALA B 1 251 ? -12.969 -7.674  -10.604 1.00 34.15 ? 251 ALA B CB    1 
ATOM   7497  N  N     . VAL B 1 252 ? -13.964 -4.457  -10.808 1.00 35.76 ? 252 VAL B N     1 
ATOM   7498  C  CA    . VAL B 1 252 ? -13.790 -3.023  -10.834 1.00 37.03 ? 252 VAL B CA    1 
ATOM   7499  C  C     . VAL B 1 252 ? -13.783 -2.379  -9.423  1.00 37.62 ? 252 VAL B C     1 
ATOM   7500  O  O     . VAL B 1 252 ? -13.663 -1.158  -9.275  1.00 38.10 ? 252 VAL B O     1 
ATOM   7501  C  CB    . VAL B 1 252 ? -14.873 -2.449  -11.820 1.00 37.68 ? 252 VAL B CB    1 
ATOM   7502  C  CG1   . VAL B 1 252 ? -15.892 -1.551  -11.167 1.00 37.11 ? 252 VAL B CG1   1 
ATOM   7503  C  CG2   . VAL B 1 252 ? -14.230 -1.877  -13.079 1.00 39.00 ? 252 VAL B CG2   1 
ATOM   7504  N  N     . SER B 1 253 ? -13.868 -3.215  -8.388  1.00 37.46 ? 253 SER B N     1 
ATOM   7505  C  CA    . SER B 1 253 ? -14.104 -2.737  -7.016  1.00 37.86 ? 253 SER B CA    1 
ATOM   7506  C  C     . SER B 1 253 ? -12.920 -2.035  -6.368  1.00 38.42 ? 253 SER B C     1 
ATOM   7507  O  O     . SER B 1 253 ? -13.082 -1.377  -5.351  1.00 38.80 ? 253 SER B O     1 
ATOM   7508  C  CB    . SER B 1 253 ? -14.556 -3.882  -6.115  1.00 36.83 ? 253 SER B CB    1 
ATOM   7509  O  OG    . SER B 1 253 ? -15.906 -4.227  -6.369  1.00 37.98 ? 253 SER B OG    1 
ATOM   7510  N  N     . CYS B 1 254 ? -11.734 -2.174  -6.948  1.00 38.75 ? 254 CYS B N     1 
ATOM   7511  C  CA    . CYS B 1 254 ? -10.541 -1.568  -6.379  1.00 39.58 ? 254 CYS B CA    1 
ATOM   7512  C  C     . CYS B 1 254 ? -10.431 -0.080  -6.739  1.00 40.31 ? 254 CYS B C     1 
ATOM   7513  O  O     . CYS B 1 254 ? -9.561  0.629   -6.216  1.00 40.98 ? 254 CYS B O     1 
ATOM   7514  C  CB    . CYS B 1 254 ? -9.294  -2.337  -6.831  1.00 39.71 ? 254 CYS B CB    1 
ATOM   7515  S  SG    . CYS B 1 254 ? -8.642  -1.818  -8.449  1.00 43.74 ? 254 CYS B SG    1 
ATOM   7516  N  N     . ILE B 1 255 ? -11.327 0.387   -7.613  1.00 40.15 ? 255 ILE B N     1 
ATOM   7517  C  CA    . ILE B 1 255 ? -11.317 1.769   -8.112  1.00 40.88 ? 255 ILE B CA    1 
ATOM   7518  C  C     . ILE B 1 255 ? -12.073 2.742   -7.190  1.00 41.45 ? 255 ILE B C     1 
ATOM   7519  O  O     . ILE B 1 255 ? -13.230 2.484   -6.835  1.00 41.39 ? 255 ILE B O     1 
ATOM   7520  C  CB    . ILE B 1 255 ? -11.883 1.844   -9.574  1.00 41.06 ? 255 ILE B CB    1 
ATOM   7521  C  CG1   . ILE B 1 255 ? -11.105 0.911   -10.523 1.00 41.22 ? 255 ILE B CG1   1 
ATOM   7522  C  CG2   . ILE B 1 255 ? -11.936 3.288   -10.095 1.00 41.42 ? 255 ILE B CG2   1 
ATOM   7523  C  CD1   . ILE B 1 255 ? -9.602  1.246   -10.707 1.00 42.91 ? 255 ILE B CD1   1 
ATOM   7524  N  N     . ARG B 1 256 ? -11.413 3.850   -6.833  1.00 41.86 ? 256 ARG B N     1 
ATOM   7525  C  CA    . ARG B 1 256 ? -11.949 4.897   -5.957  1.00 42.52 ? 256 ARG B CA    1 
ATOM   7526  C  C     . ARG B 1 256 ? -13.360 5.347   -6.290  1.00 43.00 ? 256 ARG B C     1 
ATOM   7527  O  O     . ARG B 1 256 ? -13.709 5.536   -7.467  1.00 43.17 ? 256 ARG B O     1 
ATOM   7528  C  CB    . ARG B 1 256 ? -11.121 6.167   -6.091  1.00 44.16 ? 256 ARG B CB    1 
ATOM   7529  C  CG    . ARG B 1 256 ? -9.978  6.329   -5.197  1.00 44.49 ? 256 ARG B CG    1 
ATOM   7530  C  CD    . ARG B 1 256 ? -8.890  6.812   -6.078  1.00 44.32 ? 256 ARG B CD    1 
ATOM   7531  N  NE    . ARG B 1 256 ? -7.994  7.751   -5.448  1.00 45.51 ? 256 ARG B NE    1 
ATOM   7532  C  CZ    . ARG B 1 256 ? -6.689  7.569   -5.303  1.00 45.32 ? 256 ARG B CZ    1 
ATOM   7533  N  NH1   . ARG B 1 256 ? -6.094  6.455   -5.729  1.00 42.07 ? 256 ARG B NH1   1 
ATOM   7534  N  NH2   . ARG B 1 256 ? -5.983  8.532   -4.734  1.00 45.86 ? 256 ARG B NH2   1 
ATOM   7535  N  N     . ALA B 1 257 ? -14.128 5.624   -5.240  1.00 42.82 ? 257 ALA B N     1 
ATOM   7536  C  CA    . ALA B 1 257 ? -15.481 6.110   -5.399  1.00 43.37 ? 257 ALA B CA    1 
ATOM   7537  C  C     . ALA B 1 257 ? -15.486 7.586   -5.806  1.00 45.20 ? 257 ALA B C     1 
ATOM   7538  O  O     . ALA B 1 257 ? -14.468 8.284   -5.709  1.00 46.20 ? 257 ALA B O     1 
ATOM   7539  C  CB    . ALA B 1 257 ? -16.265 5.886   -4.123  1.00 42.49 ? 257 ALA B CB    1 
ATOM   7540  N  N     . THR B 1 258 ? -16.638 8.050   -6.274  1.00 45.91 ? 258 THR B N     1 
ATOM   7541  C  CA    . THR B 1 258 ? -16.838 9.439   -6.594  1.00 47.48 ? 258 THR B CA    1 
ATOM   7542  C  C     . THR B 1 258 ? -16.612 10.284  -5.345  1.00 48.46 ? 258 THR B C     1 
ATOM   7543  O  O     . THR B 1 258 ? -17.018 9.896   -4.241  1.00 47.72 ? 258 THR B O     1 
ATOM   7544  C  CB    . THR B 1 258 ? -18.259 9.666   -7.117  1.00 48.10 ? 258 THR B CB    1 
ATOM   7545  O  OG1   . THR B 1 258 ? -18.609 8.593   -7.996  1.00 46.89 ? 258 THR B OG1   1 
ATOM   7546  C  CG2   . THR B 1 258 ? -18.355 10.995  -7.867  1.00 49.78 ? 258 THR B CG2   1 
ATOM   7547  N  N     . GLY B 1 259 ? -15.945 11.424  -5.532  1.00 49.68 ? 259 GLY B N     1 
ATOM   7548  C  CA    . GLY B 1 259 ? -15.629 12.334  -4.446  1.00 50.95 ? 259 GLY B CA    1 
ATOM   7549  C  C     . GLY B 1 259 ? -14.352 12.004  -3.693  1.00 50.96 ? 259 GLY B C     1 
ATOM   7550  O  O     . GLY B 1 259 ? -13.918 12.779  -2.851  1.00 51.85 ? 259 GLY B O     1 
ATOM   7551  N  N     . SER B 1 260 ? -13.750 10.853  -3.974  1.00 50.58 ? 260 SER B N     1 
ATOM   7552  C  CA    . SER B 1 260 ? -12.534 10.456  -3.271  1.00 50.77 ? 260 SER B CA    1 
ATOM   7553  C  C     . SER B 1 260 ? -11.366 11.306  -3.697  1.00 52.60 ? 260 SER B C     1 
ATOM   7554  O  O     . SER B 1 260 ? -11.196 11.619  -4.879  1.00 53.06 ? 260 SER B O     1 
ATOM   7555  C  CB    . SER B 1 260 ? -12.206 8.986   -3.485  1.00 49.20 ? 260 SER B CB    1 
ATOM   7556  O  OG    . SER B 1 260 ? -13.059 8.185   -2.696  1.00 48.92 ? 260 SER B OG    1 
ATOM   7557  N  N     . TYR B 1 261 ? -10.570 11.677  -2.704  1.00 53.82 ? 261 TYR B N     1 
ATOM   7558  C  CA    . TYR B 1 261 ? -9.398  12.499  -2.901  1.00 56.12 ? 261 TYR B CA    1 
ATOM   7559  C  C     . TYR B 1 261 ? -8.371  11.849  -3.828  1.00 56.03 ? 261 TYR B C     1 
ATOM   7560  O  O     . TYR B 1 261 ? -8.150  10.642  -3.780  1.00 55.09 ? 261 TYR B O     1 
ATOM   7561  C  CB    . TYR B 1 261 ? -8.764  12.812  -1.543  1.00 56.77 ? 261 TYR B CB    1 
ATOM   7562  C  CG    . TYR B 1 261 ? -7.745  13.913  -1.607  1.00 59.38 ? 261 TYR B CG    1 
ATOM   7563  C  CD1   . TYR B 1 261 ? -6.430  13.691  -1.201  1.00 60.23 ? 261 TYR B CD1   1 
ATOM   7564  C  CD2   . TYR B 1 261 ? -8.090  15.180  -2.100  1.00 61.39 ? 261 TYR B CD2   1 
ATOM   7565  C  CE1   . TYR B 1 261 ? -5.485  14.706  -1.266  1.00 62.14 ? 261 TYR B CE1   1 
ATOM   7566  C  CE2   . TYR B 1 261 ? -7.153  16.198  -2.173  1.00 63.24 ? 261 TYR B CE2   1 
ATOM   7567  C  CZ    . TYR B 1 261 ? -5.854  15.952  -1.756  1.00 63.25 ? 261 TYR B CZ    1 
ATOM   7568  O  OH    . TYR B 1 261 ? -4.920  16.953  -1.823  1.00 64.82 ? 261 TYR B OH    1 
ATOM   7569  N  N     . ILE B 1 262 ? -7.773  12.668  -4.683  1.00 57.68 ? 262 ILE B N     1 
ATOM   7570  C  CA    . ILE B 1 262 ? -6.648  12.272  -5.518  1.00 58.32 ? 262 ILE B CA    1 
ATOM   7571  C  C     . ILE B 1 262 ? -5.466  13.115  -5.034  1.00 60.13 ? 262 ILE B C     1 
ATOM   7572  O  O     . ILE B 1 262 ? -5.410  14.320  -5.285  1.00 61.56 ? 262 ILE B O     1 
ATOM   7573  C  CB    . ILE B 1 262 ? -6.931  12.533  -7.032  1.00 58.93 ? 262 ILE B CB    1 
ATOM   7574  C  CG1   . ILE B 1 262 ? -8.290  11.965  -7.444  1.00 57.79 ? 262 ILE B CG1   1 
ATOM   7575  C  CG2   . ILE B 1 262 ? -5.837  11.948  -7.909  1.00 58.32 ? 262 ILE B CG2   1 
ATOM   7576  C  CD1   . ILE B 1 262 ? -8.785  12.473  -8.776  1.00 58.88 ? 262 ILE B CD1   1 
ATOM   7577  N  N     . ALA B 1 263 ? -4.540  12.485  -4.317  1.00 60.34 ? 263 ALA B N     1 
ATOM   7578  C  CA    . ALA B 1 263 ? -3.422  13.206  -3.690  1.00 62.18 ? 263 ALA B CA    1 
ATOM   7579  C  C     . ALA B 1 263 ? -2.478  13.838  -4.706  1.00 64.36 ? 263 ALA B C     1 
ATOM   7580  O  O     . ALA B 1 263 ? -1.876  14.883  -4.441  1.00 66.01 ? 263 ALA B O     1 
ATOM   7581  C  CB    . ALA B 1 263 ? -2.650  12.290  -2.742  1.00 61.14 ? 263 ALA B CB    1 
ATOM   7582  N  N     . GLY B 1 264 ? -2.355  13.203  -5.868  1.00 64.72 ? 264 GLY B N     1 
ATOM   7583  C  CA    . GLY B 1 264 ? -1.513  13.716  -6.936  1.00 66.90 ? 264 GLY B CA    1 
ATOM   7584  C  C     . GLY B 1 264 ? -1.969  15.063  -7.464  1.00 68.97 ? 264 GLY B C     1 
ATOM   7585  O  O     . GLY B 1 264 ? -1.197  16.031  -7.456  1.00 70.80 ? 264 GLY B O     1 
ATOM   7586  N  N     . THR B 1 265 ? -3.226  15.127  -7.907  1.00 68.83 ? 265 THR B N     1 
ATOM   7587  C  CA    . THR B 1 265 ? -3.746  16.298  -8.626  1.00 70.62 ? 265 THR B CA    1 
ATOM   7588  C  C     . THR B 1 265 ? -4.533  17.270  -7.734  1.00 71.10 ? 265 THR B C     1 
ATOM   7589  O  O     . THR B 1 265 ? -5.052  18.286  -8.220  1.00 72.51 ? 265 THR B O     1 
ATOM   7590  C  CB    . THR B 1 265 ? -4.631  15.883  -9.839  1.00 70.43 ? 265 THR B CB    1 
ATOM   7591  O  OG1   . THR B 1 265 ? -5.839  15.271  -9.370  1.00 69.47 ? 265 THR B OG1   1 
ATOM   7592  C  CG2   . THR B 1 265 ? -3.894  14.906  -10.762 1.00 70.24 ? 265 THR B CG2   1 
ATOM   7593  N  N     . ASN B 1 266 ? -4.620  16.958  -6.439  1.00 69.93 ? 266 ASN B N     1 
ATOM   7594  C  CA    . ASN B 1 266 ? -5.368  17.776  -5.473  1.00 70.03 ? 266 ASN B CA    1 
ATOM   7595  C  C     . ASN B 1 266 ? -6.841  17.943  -5.871  1.00 69.68 ? 266 ASN B C     1 
ATOM   7596  O  O     . ASN B 1 266 ? -7.519  18.886  -5.446  1.00 70.58 ? 266 ASN B O     1 
ATOM   7597  C  CB    . ASN B 1 266 ? -4.690  19.143  -5.276  1.00 71.95 ? 266 ASN B CB    1 
ATOM   7598  C  CG    . ASN B 1 266 ? -5.050  19.794  -3.948  1.00 72.33 ? 266 ASN B CG    1 
ATOM   7599  O  OD1   . ASN B 1 266 ? -4.989  19.158  -2.894  1.00 70.23 ? 266 ASN B OD1   1 
ATOM   7600  N  ND2   . ASN B 1 266 ? -5.421  21.075  -3.993  1.00 73.82 ? 266 ASN B ND2   1 
ATOM   7601  N  N     . GLY B 1 267 ? -7.320  17.018  -6.700  1.00 68.33 ? 267 GLY B N     1 
ATOM   7602  C  CA    . GLY B 1 267 ? -8.710  17.004  -7.143  1.00 67.71 ? 267 GLY B CA    1 
ATOM   7603  C  C     . GLY B 1 267 ? -9.457  15.811  -6.575  1.00 65.36 ? 267 GLY B C     1 
ATOM   7604  O  O     . GLY B 1 267 ? -8.945  15.091  -5.715  1.00 64.25 ? 267 GLY B O     1 
ATOM   7605  N  N     . ASN B 1 268 ? -10.674 15.603  -7.061  1.00 64.49 ? 268 ASN B N     1 
ATOM   7606  C  CA    . ASN B 1 268 ? -11.517 14.524  -6.575  1.00 62.41 ? 268 ASN B CA    1 
ATOM   7607  C  C     . ASN B 1 268 ? -11.919 13.596  -7.710  1.00 61.24 ? 268 ASN B C     1 
ATOM   7608  O  O     . ASN B 1 268 ? -12.104 14.038  -8.848  1.00 62.54 ? 268 ASN B O     1 
ATOM   7609  C  CB    . ASN B 1 268 ? -12.753 15.087  -5.875  1.00 62.81 ? 268 ASN B CB    1 
ATOM   7610  C  CG    . ASN B 1 268 ? -12.397 15.977  -4.688  1.00 64.43 ? 268 ASN B CG    1 
ATOM   7611  O  OD1   . ASN B 1 268 ? -11.793 15.520  -3.714  1.00 64.16 ? 268 ASN B OD1   1 
ATOM   7612  N  ND2   . ASN B 1 268 ? -12.778 17.251  -4.764  1.00 65.76 ? 268 ASN B ND2   1 
ATOM   7613  N  N     . SER B 1 269 ? -12.044 12.310  -7.398  1.00 58.66 ? 269 SER B N     1 
ATOM   7614  C  CA    . SER B 1 269 ? -12.368 11.310  -8.399  1.00 56.88 ? 269 SER B CA    1 
ATOM   7615  C  C     . SER B 1 269 ? -13.777 11.450  -8.945  1.00 56.38 ? 269 SER B C     1 
ATOM   7616  O  O     . SER B 1 269 ? -14.698 11.881  -8.251  1.00 55.89 ? 269 SER B O     1 
ATOM   7617  C  CB    . SER B 1 269 ? -12.176 9.904   -7.848  1.00 55.14 ? 269 SER B CB    1 
ATOM   7618  O  OG    . SER B 1 269 ? -12.626 8.959   -8.797  1.00 55.02 ? 269 SER B OG    1 
ATOM   7619  N  N     . ASN B 1 270 ? -13.921 11.060  -10.207 1.00 56.12 ? 270 ASN B N     1 
ATOM   7620  C  CA    . ASN B 1 270 ? -15.210 11.023  -10.883 1.00 55.67 ? 270 ASN B CA    1 
ATOM   7621  C  C     . ASN B 1 270 ? -15.961 9.719   -10.572 1.00 53.60 ? 270 ASN B C     1 
ATOM   7622  O  O     . ASN B 1 270 ? -17.169 9.611   -10.803 1.00 53.68 ? 270 ASN B O     1 
ATOM   7623  C  CB    . ASN B 1 270 ? -15.003 11.216  -12.386 1.00 56.47 ? 270 ASN B CB    1 
ATOM   7624  C  CG    . ASN B 1 270 ? -14.333 12.543  -12.712 1.00 58.91 ? 270 ASN B CG    1 
ATOM   7625  O  OD1   . ASN B 1 270 ? -14.711 13.589  -12.183 1.00 59.93 ? 270 ASN B OD1   1 
ATOM   7626  N  ND2   . ASN B 1 270 ? -13.329 12.506  -13.576 1.00 59.67 ? 270 ASN B ND2   1 
ATOM   7627  N  N     . GLY B 1 271 ? -15.240 8.745   -10.019 1.00 51.33 ? 271 GLY B N     1 
ATOM   7628  C  CA    . GLY B 1 271 ? -15.829 7.471   -9.652  1.00 49.06 ? 271 GLY B CA    1 
ATOM   7629  C  C     . GLY B 1 271 ? -16.023 6.547   -10.833 1.00 48.00 ? 271 GLY B C     1 
ATOM   7630  O  O     . GLY B 1 271 ? -15.478 6.778   -11.916 1.00 48.85 ? 271 GLY B O     1 
ATOM   7631  N  N     . LEU B 1 272 ? -16.821 5.510   -10.622 1.00 46.44 ? 272 LEU B N     1 
ATOM   7632  C  CA    . LEU B 1 272 ? -16.943 4.418   -11.574 1.00 45.23 ? 272 LEU B CA    1 
ATOM   7633  C  C     . LEU B 1 272 ? -17.666 4.777   -12.856 1.00 45.45 ? 272 LEU B C     1 
ATOM   7634  O  O     . LEU B 1 272 ? -17.278 4.313   -13.929 1.00 45.64 ? 272 LEU B O     1 
ATOM   7635  C  CB    . LEU B 1 272 ? -17.624 3.209   -10.931 1.00 44.25 ? 272 LEU B CB    1 
ATOM   7636  C  CG    . LEU B 1 272 ? -16.827 2.415   -9.904  1.00 43.58 ? 272 LEU B CG    1 
ATOM   7637  C  CD1   . LEU B 1 272 ? -17.628 1.211   -9.490  1.00 44.19 ? 272 LEU B CD1   1 
ATOM   7638  C  CD2   . LEU B 1 272 ? -15.489 1.984   -10.446 1.00 43.98 ? 272 LEU B CD2   1 
ATOM   7639  N  N     . VAL B 1 273 ? -18.712 5.590   -12.746 1.00 45.50 ? 273 VAL B N     1 
ATOM   7640  C  CA    . VAL B 1 273 ? -19.603 5.841   -13.878 1.00 45.39 ? 273 VAL B CA    1 
ATOM   7641  C  C     . VAL B 1 273 ? -18.871 6.404   -15.102 1.00 46.00 ? 273 VAL B C     1 
ATOM   7642  O  O     . VAL B 1 273 ? -18.896 5.777   -16.160 1.00 45.98 ? 273 VAL B O     1 
ATOM   7643  C  CB    . VAL B 1 273 ? -20.869 6.649   -13.464 1.00 46.38 ? 273 VAL B CB    1 
ATOM   7644  C  CG1   . VAL B 1 273 ? -21.615 7.202   -14.679 1.00 46.98 ? 273 VAL B CG1   1 
ATOM   7645  C  CG2   . VAL B 1 273 ? -21.783 5.761   -12.617 1.00 45.42 ? 273 VAL B CG2   1 
ATOM   7646  N  N     . PRO B 1 274 ? -18.195 7.564   -14.962 1.00 46.37 ? 274 PRO B N     1 
ATOM   7647  C  CA    . PRO B 1 274 ? -17.471 8.110   -16.105 1.00 47.22 ? 274 PRO B CA    1 
ATOM   7648  C  C     . PRO B 1 274 ? -16.413 7.164   -16.677 1.00 46.41 ? 274 PRO B C     1 
ATOM   7649  O  O     . PRO B 1 274 ? -16.144 7.198   -17.883 1.00 47.00 ? 274 PRO B O     1 
ATOM   7650  C  CB    . PRO B 1 274 ? -16.801 9.363   -15.528 1.00 48.39 ? 274 PRO B CB    1 
ATOM   7651  C  CG    . PRO B 1 274 ? -17.629 9.728   -14.368 1.00 48.10 ? 274 PRO B CG    1 
ATOM   7652  C  CD    . PRO B 1 274 ? -18.060 8.435   -13.781 1.00 46.79 ? 274 PRO B CD    1 
ATOM   7653  N  N     . MET B 1 275 ? -15.815 6.337   -15.825 1.00 44.93 ? 275 MET B N     1 
ATOM   7654  C  CA    . MET B 1 275 ? -14.797 5.404   -16.279 1.00 44.71 ? 275 MET B CA    1 
ATOM   7655  C  C     . MET B 1 275 ? -15.430 4.279   -17.097 1.00 43.07 ? 275 MET B C     1 
ATOM   7656  O  O     . MET B 1 275 ? -14.894 3.855   -18.120 1.00 43.11 ? 275 MET B O     1 
ATOM   7657  C  CB    . MET B 1 275 ? -14.042 4.825   -15.090 1.00 43.39 ? 275 MET B CB    1 
ATOM   7658  C  CG    . MET B 1 275 ? -12.882 3.944   -15.485 1.00 43.32 ? 275 MET B CG    1 
ATOM   7659  S  SD    . MET B 1 275 ? -12.663 2.609   -14.303 1.00 44.62 ? 275 MET B SD    1 
ATOM   7660  C  CE    . MET B 1 275 ? -13.798 1.417   -14.993 1.00 42.56 ? 275 MET B CE    1 
ATOM   7661  N  N     . LEU B 1 276 ? -16.570 3.793   -16.618 1.00 41.70 ? 276 LEU B N     1 
ATOM   7662  C  CA    . LEU B 1 276 ? -17.308 2.739   -17.282 1.00 40.33 ? 276 LEU B CA    1 
ATOM   7663  C  C     . LEU B 1 276 ? -17.875 3.192   -18.629 1.00 40.93 ? 276 LEU B C     1 
ATOM   7664  O  O     . LEU B 1 276 ? -18.133 2.374   -19.493 1.00 40.62 ? 276 LEU B O     1 
ATOM   7665  C  CB    . LEU B 1 276 ? -18.415 2.239   -16.365 1.00 39.52 ? 276 LEU B CB    1 
ATOM   7666  C  CG    . LEU B 1 276 ? -18.250 0.934   -15.583 1.00 37.62 ? 276 LEU B CG    1 
ATOM   7667  C  CD1   . LEU B 1 276 ? -16.839 0.352   -15.580 1.00 36.69 ? 276 LEU B CD1   1 
ATOM   7668  C  CD2   . LEU B 1 276 ? -18.781 1.107   -14.170 1.00 38.38 ? 276 LEU B CD2   1 
ATOM   7669  N  N     . ARG B 1 277 ? -18.048 4.496   -18.797 1.00 41.89 ? 277 ARG B N     1 
ATOM   7670  C  CA    . ARG B 1 277 ? -18.434 5.071   -20.081 1.00 43.26 ? 277 ARG B CA    1 
ATOM   7671  C  C     . ARG B 1 277 ? -17.338 4.906   -21.130 1.00 43.30 ? 277 ARG B C     1 
ATOM   7672  O  O     . ARG B 1 277 ? -17.632 4.719   -22.309 1.00 43.91 ? 277 ARG B O     1 
ATOM   7673  C  CB    . ARG B 1 277 ? -18.792 6.545   -19.923 1.00 44.65 ? 277 ARG B CB    1 
ATOM   7674  C  CG    . ARG B 1 277 ? -20.170 6.774   -19.322 1.00 46.61 ? 277 ARG B CG    1 
ATOM   7675  C  CD    . ARG B 1 277 ? -20.878 7.916   -20.041 1.00 51.75 ? 277 ARG B CD    1 
ATOM   7676  N  NE    . ARG B 1 277 ? -21.229 7.562   -21.415 1.00 55.57 ? 277 ARG B NE    1 
ATOM   7677  C  CZ    . ARG B 1 277 ? -21.399 8.437   -22.408 1.00 59.49 ? 277 ARG B CZ    1 
ATOM   7678  N  NH1   . ARG B 1 277 ? -21.239 9.746   -22.202 1.00 61.31 ? 277 ARG B NH1   1 
ATOM   7679  N  NH2   . ARG B 1 277 ? -21.723 7.998   -23.622 1.00 60.00 ? 277 ARG B NH2   1 
ATOM   7680  N  N     . VAL B 1 278 ? -16.080 4.980   -20.696 1.00 42.78 ? 278 VAL B N     1 
ATOM   7681  C  CA    . VAL B 1 278 ? -14.935 4.760   -21.575 1.00 42.85 ? 278 VAL B CA    1 
ATOM   7682  C  C     . VAL B 1 278 ? -14.907 3.302   -22.027 1.00 41.77 ? 278 VAL B C     1 
ATOM   7683  O  O     . VAL B 1 278 ? -14.661 3.019   -23.196 1.00 42.11 ? 278 VAL B O     1 
ATOM   7684  C  CB    . VAL B 1 278 ? -13.594 5.136   -20.892 1.00 43.00 ? 278 VAL B CB    1 
ATOM   7685  C  CG1   . VAL B 1 278 ? -12.430 4.877   -21.822 1.00 43.25 ? 278 VAL B CG1   1 
ATOM   7686  C  CG2   . VAL B 1 278 ? -13.596 6.602   -20.465 1.00 44.07 ? 278 VAL B CG2   1 
ATOM   7687  N  N     . TYR B 1 279 ? -15.173 2.390   -21.091 1.00 40.62 ? 279 TYR B N     1 
ATOM   7688  C  CA    . TYR B 1 279 ? -15.249 0.955   -21.372 1.00 39.45 ? 279 TYR B CA    1 
ATOM   7689  C  C     . TYR B 1 279 ? -16.447 0.614   -22.268 1.00 39.63 ? 279 TYR B C     1 
ATOM   7690  O  O     . TYR B 1 279 ? -16.347 -0.251  -23.143 1.00 39.49 ? 279 TYR B O     1 
ATOM   7691  C  CB    . TYR B 1 279 ? -15.293 0.154   -20.064 1.00 38.17 ? 279 TYR B CB    1 
ATOM   7692  C  CG    . TYR B 1 279 ? -13.928 -0.064  -19.453 1.00 38.51 ? 279 TYR B CG    1 
ATOM   7693  C  CD1   . TYR B 1 279 ? -13.324 -1.318  -19.474 1.00 38.00 ? 279 TYR B CD1   1 
ATOM   7694  C  CD2   . TYR B 1 279 ? -13.232 0.989   -18.858 1.00 39.51 ? 279 TYR B CD2   1 
ATOM   7695  C  CE1   . TYR B 1 279 ? -12.049 -1.512  -18.920 1.00 38.10 ? 279 TYR B CE1   1 
ATOM   7696  C  CE2   . TYR B 1 279 ? -11.970 0.803   -18.308 1.00 38.81 ? 279 TYR B CE2   1 
ATOM   7697  C  CZ    . TYR B 1 279 ? -11.384 -0.444  -18.347 1.00 38.39 ? 279 TYR B CZ    1 
ATOM   7698  O  OH    . TYR B 1 279 ? -10.126 -0.616  -17.806 1.00 38.71 ? 279 TYR B OH    1 
ATOM   7699  N  N     . ASN B 1 280 ? -17.570 1.298   -22.038 1.00 39.74 ? 280 ASN B N     1 
ATOM   7700  C  CA    . ASN B 1 280 ? -18.772 1.129   -22.832 1.00 39.62 ? 280 ASN B CA    1 
ATOM   7701  C  C     . ASN B 1 280 ? -18.483 1.461   -24.277 1.00 41.03 ? 280 ASN B C     1 
ATOM   7702  O  O     . ASN B 1 280 ? -18.763 0.667   -25.178 1.00 40.51 ? 280 ASN B O     1 
ATOM   7703  C  CB    . ASN B 1 280 ? -19.877 2.051   -22.333 1.00 40.41 ? 280 ASN B CB    1 
ATOM   7704  C  CG    . ASN B 1 280 ? -21.206 1.780   -23.013 1.00 39.92 ? 280 ASN B CG    1 
ATOM   7705  O  OD1   . ASN B 1 280 ? -21.927 0.869   -22.631 1.00 39.09 ? 280 ASN B OD1   1 
ATOM   7706  N  ND2   . ASN B 1 280 ? -21.524 2.560   -24.032 1.00 41.10 ? 280 ASN B ND2   1 
ATOM   7707  N  N     . ASN B 1 281 ? -17.913 2.644   -24.487 1.00 42.40 ? 281 ASN B N     1 
ATOM   7708  C  CA    . ASN B 1 281 ? -17.592 3.093   -25.823 1.00 44.00 ? 281 ASN B CA    1 
ATOM   7709  C  C     . ASN B 1 281 ? -16.431 2.336   -26.480 1.00 43.76 ? 281 ASN B C     1 
ATOM   7710  O  O     . ASN B 1 281 ? -16.359 2.265   -27.704 1.00 44.76 ? 281 ASN B O     1 
ATOM   7711  C  CB    . ASN B 1 281 ? -17.458 4.610   -25.859 1.00 45.79 ? 281 ASN B CB    1 
ATOM   7712  C  CG    . ASN B 1 281 ? -18.802 5.314   -25.589 1.00 48.02 ? 281 ASN B CG    1 
ATOM   7713  O  OD1   . ASN B 1 281 ? -18.837 6.429   -25.090 1.00 51.63 ? 281 ASN B OD1   1 
ATOM   7714  N  ND2   . ASN B 1 281 ? -19.907 4.647   -25.909 1.00 49.20 ? 281 ASN B ND2   1 
ATOM   7715  N  N     . THR B 1 282 ? -15.559 1.740   -25.672 1.00 42.93 ? 282 THR B N     1 
ATOM   7716  C  CA    . THR B 1 282 ? -14.553 0.815   -26.183 1.00 42.88 ? 282 THR B CA    1 
ATOM   7717  C  C     . THR B 1 282 ? -15.238 -0.461  -26.687 1.00 42.66 ? 282 THR B C     1 
ATOM   7718  O  O     . THR B 1 282 ? -14.847 -1.004  -27.713 1.00 43.44 ? 282 THR B O     1 
ATOM   7719  C  CB    . THR B 1 282 ? -13.445 0.493   -25.128 1.00 41.88 ? 282 THR B CB    1 
ATOM   7720  O  OG1   . THR B 1 282 ? -12.542 1.597   -25.041 1.00 42.45 ? 282 THR B OG1   1 
ATOM   7721  C  CG2   . THR B 1 282 ? -12.636 -0.736  -25.524 1.00 40.79 ? 282 THR B CG2   1 
ATOM   7722  N  N     . ALA B 1 283 ? -16.268 -0.923  -25.977 1.00 42.20 ? 283 ALA B N     1 
ATOM   7723  C  CA    . ALA B 1 283 ? -17.053 -2.080  -26.416 1.00 41.83 ? 283 ALA B CA    1 
ATOM   7724  C  C     . ALA B 1 283 ? -17.781 -1.841  -27.748 1.00 43.27 ? 283 ALA B C     1 
ATOM   7725  O  O     . ALA B 1 283 ? -17.854 -2.737  -28.588 1.00 43.22 ? 283 ALA B O     1 
ATOM   7726  C  CB    . ALA B 1 283 ? -18.026 -2.497  -25.342 1.00 40.76 ? 283 ALA B CB    1 
ATOM   7727  N  N     . ARG B 1 284 ? -18.307 -0.635  -27.940 1.00 44.87 ? 284 ARG B N     1 
ATOM   7728  C  CA    . ARG B 1 284 ? -18.983 -0.264  -29.188 1.00 46.81 ? 284 ARG B CA    1 
ATOM   7729  C  C     . ARG B 1 284 ? -18.018 -0.133  -30.361 1.00 47.82 ? 284 ARG B C     1 
ATOM   7730  O  O     . ARG B 1 284 ? -18.337 -0.552  -31.472 1.00 48.00 ? 284 ARG B O     1 
ATOM   7731  C  CB    . ARG B 1 284 ? -19.780 1.033   -29.017 1.00 47.61 ? 284 ARG B CB    1 
ATOM   7732  C  CG    . ARG B 1 284 ? -20.808 0.962   -27.901 1.00 47.87 ? 284 ARG B CG    1 
ATOM   7733  C  CD    . ARG B 1 284 ? -21.695 2.199   -27.844 1.00 49.73 ? 284 ARG B CD    1 
ATOM   7734  N  NE    . ARG B 1 284 ? -22.705 2.200   -28.899 1.00 52.76 ? 284 ARG B NE    1 
ATOM   7735  C  CZ    . ARG B 1 284 ? -22.966 3.248   -29.672 1.00 56.36 ? 284 ARG B CZ    1 
ATOM   7736  N  NH1   . ARG B 1 284 ? -22.310 4.394   -29.483 1.00 57.81 ? 284 ARG B NH1   1 
ATOM   7737  N  NH2   . ARG B 1 284 ? -23.891 3.161   -30.624 1.00 57.29 ? 284 ARG B NH2   1 
ATOM   7738  N  N     . TYR B 1 285 ? -16.841 0.439   -30.096 1.00 48.87 ? 285 TYR B N     1 
ATOM   7739  C  CA    . TYR B 1 285 ? -15.825 0.687   -31.117 1.00 50.17 ? 285 TYR B CA    1 
ATOM   7740  C  C     . TYR B 1 285 ? -15.133 -0.590  -31.591 1.00 50.57 ? 285 TYR B C     1 
ATOM   7741  O  O     . TYR B 1 285 ? -15.057 -0.843  -32.792 1.00 50.87 ? 285 TYR B O     1 
ATOM   7742  C  CB    . TYR B 1 285 ? -14.795 1.707   -30.615 1.00 50.32 ? 285 TYR B CB    1 
ATOM   7743  C  CG    . TYR B 1 285 ? -13.587 1.904   -31.516 1.00 49.92 ? 285 TYR B CG    1 
ATOM   7744  C  CD1   . TYR B 1 285 ? -12.297 1.696   -31.032 1.00 48.36 ? 285 TYR B CD1   1 
ATOM   7745  C  CD2   . TYR B 1 285 ? -13.736 2.312   -32.845 1.00 50.74 ? 285 TYR B CD2   1 
ATOM   7746  C  CE1   . TYR B 1 285 ? -11.183 1.876   -31.847 1.00 49.97 ? 285 TYR B CE1   1 
ATOM   7747  C  CE2   . TYR B 1 285 ? -12.633 2.496   -33.672 1.00 51.41 ? 285 TYR B CE2   1 
ATOM   7748  C  CZ    . TYR B 1 285 ? -11.359 2.272   -33.170 1.00 51.71 ? 285 TYR B CZ    1 
ATOM   7749  O  OH    . TYR B 1 285 ? -10.267 2.454   -33.985 1.00 52.78 ? 285 TYR B OH    1 
ATOM   7750  N  N     . VAL B 1 286 ? -14.615 -1.386  -30.660 1.00 51.03 ? 286 VAL B N     1 
ATOM   7751  C  CA    . VAL B 1 286 ? -13.917 -2.610  -31.063 1.00 52.35 ? 286 VAL B CA    1 
ATOM   7752  C  C     . VAL B 1 286 ? -14.857 -3.819  -31.064 1.00 52.55 ? 286 VAL B C     1 
ATOM   7753  O  O     . VAL B 1 286 ? -14.875 -4.635  -30.142 1.00 51.38 ? 286 VAL B O     1 
ATOM   7754  C  CB    . VAL B 1 286 ? -12.488 -2.791  -30.400 1.00 51.86 ? 286 VAL B CB    1 
ATOM   7755  C  CG1   . VAL B 1 286 ? -12.465 -2.356  -28.953 1.00 52.11 ? 286 VAL B CG1   1 
ATOM   7756  C  CG2   . VAL B 1 286 ? -11.947 -4.203  -30.580 1.00 50.28 ? 286 VAL B CG2   1 
ATOM   7757  N  N     . ASP B 1 287 ? -15.649 -3.873  -32.136 1.00 55.09 ? 287 ASP B N     1 
ATOM   7758  C  CA    . ASP B 1 287 ? -16.659 -4.899  -32.386 1.00 56.60 ? 287 ASP B CA    1 
ATOM   7759  C  C     . ASP B 1 287 ? -16.308 -5.757  -33.617 1.00 58.32 ? 287 ASP B C     1 
ATOM   7760  O  O     . ASP B 1 287 ? -17.193 -6.198  -34.360 1.00 58.53 ? 287 ASP B O     1 
ATOM   7761  C  CB    . ASP B 1 287 ? -18.038 -4.241  -32.564 1.00 56.86 ? 287 ASP B CB    1 
ATOM   7762  C  CG    . ASP B 1 287 ? -18.095 -3.256  -33.736 1.00 58.90 ? 287 ASP B CG    1 
ATOM   7763  O  OD1   . ASP B 1 287 ? -19.187 -2.704  -33.982 1.00 59.47 ? 287 ASP B OD1   1 
ATOM   7764  O  OD2   . ASP B 1 287 ? -17.068 -3.018  -34.409 1.00 60.51 ? 287 ASP B OD2   1 
ATOM   7765  N  N     . GLN B 1 288 ? -15.006 -5.975  -33.815 1.00 60.57 ? 288 GLN B N     1 
ATOM   7766  C  CA    . GLN B 1 288 ? -14.445 -6.642  -35.008 1.00 62.62 ? 288 GLN B CA    1 
ATOM   7767  C  C     . GLN B 1 288 ? -14.643 -5.903  -36.340 1.00 64.91 ? 288 GLN B C     1 
ATOM   7768  O  O     . GLN B 1 288 ? -14.260 -6.416  -37.391 1.00 65.90 ? 288 GLN B O     1 
ATOM   7769  C  CB    . GLN B 1 288 ? -14.941 -8.079  -35.126 1.00 61.92 ? 288 GLN B CB    1 
ATOM   7770  C  CG    . GLN B 1 288 ? -14.310 -9.042  -34.148 1.00 61.72 ? 288 GLN B CG    1 
ATOM   7771  C  CD    . GLN B 1 288 ? -14.881 -10.426 -34.318 1.00 63.22 ? 288 GLN B CD    1 
ATOM   7772  O  OE1   . GLN B 1 288 ? -15.675 -10.876 -33.490 1.00 64.17 ? 288 GLN B OE1   1 
ATOM   7773  N  NE2   . GLN B 1 288 ? -14.515 -11.100 -35.412 1.00 62.61 ? 288 GLN B NE2   1 
ATOM   7774  N  N     . GLY B 1 289 ? -15.231 -4.710  -36.298 1.00 66.61 ? 289 GLY B N     1 
ATOM   7775  C  CA    . GLY B 1 289 ? -15.419 -3.899  -37.497 1.00 69.27 ? 289 GLY B CA    1 
ATOM   7776  C  C     . GLY B 1 289 ? -16.736 -4.120  -38.220 1.00 70.51 ? 289 GLY B C     1 
ATOM   7777  O  O     . GLY B 1 289 ? -16.941 -5.164  -38.849 1.00 69.98 ? 289 GLY B O     1 
ATOM   7778  N  N     . GLY B 1 290 ? -17.619 -3.122  -38.130 1.00 72.29 ? 290 GLY B N     1 
ATOM   7779  C  CA    . GLY B 1 290 ? -18.915 -3.109  -38.834 1.00 74.04 ? 290 GLY B CA    1 
ATOM   7780  C  C     . GLY B 1 290 ? -20.018 -3.938  -38.190 1.00 73.73 ? 290 GLY B C     1 
ATOM   7781  O  O     . GLY B 1 290 ? -21.153 -3.969  -38.691 1.00 74.30 ? 290 GLY B O     1 
ATOM   7782  N  N     . ASN B 1 291 ? -19.679 -4.586  -37.070 1.00 73.04 ? 291 ASN B N     1 
ATOM   7783  C  CA    . ASN B 1 291 ? -20.512 -5.605  -36.409 1.00 72.31 ? 291 ASN B CA    1 
ATOM   7784  C  C     . ASN B 1 291 ? -20.591 -6.910  -37.209 1.00 72.04 ? 291 ASN B C     1 
ATOM   7785  O  O     . ASN B 1 291 ? -19.568 -7.553  -37.480 1.00 71.65 ? 291 ASN B O     1 
ATOM   7786  C  CB    . ASN B 1 291 ? -21.914 -5.072  -36.064 1.00 72.75 ? 291 ASN B CB    1 
ATOM   7787  C  CG    . ASN B 1 291 ? -22.070 -4.741  -34.584 1.00 72.83 ? 291 ASN B CG    1 
ATOM   7788  O  OD1   . ASN B 1 291 ? -21.916 -5.609  -33.721 1.00 72.43 ? 291 ASN B OD1   1 
ATOM   7789  N  ND2   . ASN B 1 291 ? -22.396 -3.485  -34.288 1.00 74.15 ? 291 ASN B ND2   1 
ATOM   7790  N  N     . PRO B 1 294 ? -21.178 -5.207  -30.916 1.00 58.13 ? 294 PRO B N     1 
ATOM   7791  C  CA    . PRO B 1 294 ? -20.318 -4.552  -29.931 1.00 57.16 ? 294 PRO B CA    1 
ATOM   7792  C  C     . PRO B 1 294 ? -19.709 -5.562  -28.975 1.00 54.94 ? 294 PRO B C     1 
ATOM   7793  O  O     . PRO B 1 294 ? -20.417 -6.450  -28.492 1.00 54.09 ? 294 PRO B O     1 
ATOM   7794  C  CB    . PRO B 1 294 ? -21.279 -3.614  -29.170 1.00 57.41 ? 294 PRO B CB    1 
ATOM   7795  C  CG    . PRO B 1 294 ? -22.618 -3.722  -29.861 1.00 58.39 ? 294 PRO B CG    1 
ATOM   7796  C  CD    . PRO B 1 294 ? -22.606 -5.025  -30.605 1.00 58.56 ? 294 PRO B CD    1 
ATOM   7797  N  N     . GLY B 1 295 ? -18.406 -5.436  -28.710 1.00 54.06 ? 295 GLY B N     1 
ATOM   7798  C  CA    . GLY B 1 295 ? -17.727 -6.303  -27.735 1.00 51.19 ? 295 GLY B CA    1 
ATOM   7799  C  C     . GLY B 1 295 ? -18.530 -6.391  -26.449 1.00 49.28 ? 295 GLY B C     1 
ATOM   7800  O  O     . GLY B 1 295 ? -19.282 -5.464  -26.118 1.00 49.72 ? 295 GLY B O     1 
ATOM   7801  N  N     . ALA B 1 296 ? -18.385 -7.493  -25.716 1.00 46.98 ? 296 ALA B N     1 
ATOM   7802  C  CA    . ALA B 1 296 ? -19.215 -7.708  -24.532 1.00 44.80 ? 296 ALA B CA    1 
ATOM   7803  C  C     . ALA B 1 296 ? -18.397 -7.809  -23.247 1.00 43.09 ? 296 ALA B C     1 
ATOM   7804  O  O     . ALA B 1 296 ? -17.613 -8.753  -23.065 1.00 42.56 ? 296 ALA B O     1 
ATOM   7805  C  CB    . ALA B 1 296 ? -20.088 -8.932  -24.722 1.00 44.23 ? 296 ALA B CB    1 
ATOM   7806  N  N     . PHE B 1 297 ? -18.569 -6.819  -22.371 1.00 41.87 ? 297 PHE B N     1 
ATOM   7807  C  CA    . PHE B 1 297 ? -17.884 -6.786  -21.080 1.00 39.99 ? 297 PHE B CA    1 
ATOM   7808  C  C     . PHE B 1 297 ? -18.915 -6.846  -19.958 1.00 38.84 ? 297 PHE B C     1 
ATOM   7809  O  O     . PHE B 1 297 ? -19.863 -6.060  -19.940 1.00 39.23 ? 297 PHE B O     1 
ATOM   7810  C  CB    . PHE B 1 297 ? -17.047 -5.509  -20.902 1.00 40.65 ? 297 PHE B CB    1 
ATOM   7811  C  CG    . PHE B 1 297 ? -16.178 -5.137  -22.083 1.00 41.73 ? 297 PHE B CG    1 
ATOM   7812  C  CD1   . PHE B 1 297 ? -15.818 -3.810  -22.280 1.00 42.41 ? 297 PHE B CD1   1 
ATOM   7813  C  CD2   . PHE B 1 297 ? -15.699 -6.095  -22.979 1.00 42.94 ? 297 PHE B CD2   1 
ATOM   7814  C  CE1   . PHE B 1 297 ? -15.013 -3.429  -23.352 1.00 44.48 ? 297 PHE B CE1   1 
ATOM   7815  C  CE2   . PHE B 1 297 ? -14.895 -5.723  -24.065 1.00 45.15 ? 297 PHE B CE2   1 
ATOM   7816  C  CZ    . PHE B 1 297 ? -14.546 -4.386  -24.248 1.00 44.67 ? 297 PHE B CZ    1 
ATOM   7817  N  N     . ALA B 1 298 ? -18.735 -7.784  -19.034 1.00 37.08 ? 298 ALA B N     1 
ATOM   7818  C  CA    . ALA B 1 298 ? -19.527 -7.836  -17.809 1.00 36.00 ? 298 ALA B CA    1 
ATOM   7819  C  C     . ALA B 1 298 ? -18.724 -7.220  -16.667 1.00 35.43 ? 298 ALA B C     1 
ATOM   7820  O  O     . ALA B 1 298 ? -17.618 -7.676  -16.351 1.00 35.20 ? 298 ALA B O     1 
ATOM   7821  C  CB    . ALA B 1 298 ? -19.921 -9.267  -17.483 1.00 35.20 ? 298 ALA B CB    1 
ATOM   7822  N  N     . ILE B 1 299 ? -19.269 -6.165  -16.068 1.00 35.45 ? 299 ILE B N     1 
ATOM   7823  C  CA    . ILE B 1 299 ? -18.584 -5.440  -14.993 1.00 35.02 ? 299 ILE B CA    1 
ATOM   7824  C  C     . ILE B 1 299 ? -19.018 -5.965  -13.631 1.00 33.92 ? 299 ILE B C     1 
ATOM   7825  O  O     . ILE B 1 299 ? -20.212 -6.028  -13.349 1.00 34.10 ? 299 ILE B O     1 
ATOM   7826  C  CB    . ILE B 1 299 ? -18.873 -3.930  -15.078 1.00 36.07 ? 299 ILE B CB    1 
ATOM   7827  C  CG1   . ILE B 1 299 ? -18.598 -3.390  -16.498 1.00 36.95 ? 299 ILE B CG1   1 
ATOM   7828  C  CG2   . ILE B 1 299 ? -18.138 -3.152  -13.958 1.00 36.01 ? 299 ILE B CG2   1 
ATOM   7829  C  CD1   . ILE B 1 299 ? -17.195 -3.618  -17.042 1.00 36.32 ? 299 ILE B CD1   1 
ATOM   7830  N  N     . TYR B 1 300 ? -18.047 -6.338  -12.799 1.00 33.04 ? 300 TYR B N     1 
ATOM   7831  C  CA    . TYR B 1 300 ? -18.313 -6.902  -11.461 1.00 32.24 ? 300 TYR B CA    1 
ATOM   7832  C  C     . TYR B 1 300 ? -17.993 -5.895  -10.355 1.00 32.64 ? 300 TYR B C     1 
ATOM   7833  O  O     . TYR B 1 300 ? -16.892 -5.333  -10.312 1.00 32.48 ? 300 TYR B O     1 
ATOM   7834  C  CB    . TYR B 1 300 ? -17.550 -8.228  -11.240 1.00 31.17 ? 300 TYR B CB    1 
ATOM   7835  C  CG    . TYR B 1 300 ? -18.155 -9.417  -11.980 1.00 30.44 ? 300 TYR B CG    1 
ATOM   7836  C  CD1   . TYR B 1 300 ? -18.018 -9.544  -13.363 1.00 30.27 ? 300 TYR B CD1   1 
ATOM   7837  C  CD2   . TYR B 1 300 ? -18.868 -10.408 -11.296 1.00 28.95 ? 300 TYR B CD2   1 
ATOM   7838  C  CE1   . TYR B 1 300 ? -18.582 -10.618 -14.059 1.00 30.31 ? 300 TYR B CE1   1 
ATOM   7839  C  CE2   . TYR B 1 300 ? -19.431 -11.483 -11.976 1.00 29.38 ? 300 TYR B CE2   1 
ATOM   7840  C  CZ    . TYR B 1 300 ? -19.289 -11.587 -13.365 1.00 30.65 ? 300 TYR B CZ    1 
ATOM   7841  O  OH    . TYR B 1 300 ? -19.842 -12.652 -14.065 1.00 29.52 ? 300 TYR B OH    1 
ATOM   7842  N  N     . LEU B 1 301 ? -18.972 -5.669  -9.479  1.00 32.51 ? 301 LEU B N     1 
ATOM   7843  C  CA    . LEU B 1 301 ? -18.849 -4.713  -8.387  1.00 33.47 ? 301 LEU B CA    1 
ATOM   7844  C  C     . LEU B 1 301 ? -19.335 -5.343  -7.075  1.00 33.44 ? 301 LEU B C     1 
ATOM   7845  O  O     . LEU B 1 301 ? -20.404 -5.956  -7.026  1.00 33.44 ? 301 LEU B O     1 
ATOM   7846  C  CB    . LEU B 1 301 ? -19.677 -3.460  -8.675  1.00 34.00 ? 301 LEU B CB    1 
ATOM   7847  C  CG    . LEU B 1 301 ? -19.176 -2.046  -8.328  1.00 36.14 ? 301 LEU B CG    1 
ATOM   7848  C  CD1   . LEU B 1 301 ? -20.316 -1.176  -7.831  1.00 35.82 ? 301 LEU B CD1   1 
ATOM   7849  C  CD2   . LEU B 1 301 ? -18.039 -2.018  -7.337  1.00 35.59 ? 301 LEU B CD2   1 
ATOM   7850  N  N     . GLU B 1 302 ? -18.555 -5.173  -6.016  1.00 33.55 ? 302 GLU B N     1 
ATOM   7851  C  CA    . GLU B 1 302 ? -18.961 -5.629  -4.693  1.00 34.30 ? 302 GLU B CA    1 
ATOM   7852  C  C     . GLU B 1 302 ? -19.864 -4.568  -4.047  1.00 34.27 ? 302 GLU B C     1 
ATOM   7853  O  O     . GLU B 1 302 ? -19.599 -3.377  -4.179  1.00 35.19 ? 302 GLU B O     1 
ATOM   7854  C  CB    . GLU B 1 302 ? -17.730 -5.953  -3.831  1.00 34.13 ? 302 GLU B CB    1 
ATOM   7855  C  CG    . GLU B 1 302 ? -16.743 -6.886  -4.551  1.00 34.94 ? 302 GLU B CG    1 
ATOM   7856  C  CD    . GLU B 1 302 ? -15.788 -7.654  -3.628  1.00 35.65 ? 302 GLU B CD    1 
ATOM   7857  O  OE1   . GLU B 1 302 ? -16.054 -7.749  -2.397  1.00 37.58 ? 302 GLU B OE1   1 
ATOM   7858  O  OE2   . GLU B 1 302 ? -14.772 -8.182  -4.160  1.00 36.43 ? 302 GLU B OE2   1 
ATOM   7859  N  N     . PRO B 1 303 ? -20.962 -4.993  -3.388  1.00 33.85 ? 303 PRO B N     1 
ATOM   7860  C  CA    . PRO B 1 303 ? -21.946 -4.044  -2.845  1.00 34.32 ? 303 PRO B CA    1 
ATOM   7861  C  C     . PRO B 1 303 ? -21.520 -3.143  -1.661  1.00 35.00 ? 303 PRO B C     1 
ATOM   7862  O  O     . PRO B 1 303 ? -22.326 -2.299  -1.224  1.00 36.08 ? 303 PRO B O     1 
ATOM   7863  C  CB    . PRO B 1 303 ? -23.117 -4.951  -2.451  1.00 34.32 ? 303 PRO B CB    1 
ATOM   7864  C  CG    . PRO B 1 303 ? -22.497 -6.279  -2.206  1.00 32.86 ? 303 PRO B CG    1 
ATOM   7865  C  CD    . PRO B 1 303 ? -21.377 -6.390  -3.178  1.00 32.77 ? 303 PRO B CD    1 
ATOM   7866  N  N     . TRP B 1 304 ? -20.296 -3.295  -1.146  1.00 34.23 ? 304 TRP B N     1 
ATOM   7867  C  CA    . TRP B 1 304 ? -19.775 -2.334  -0.150  1.00 34.53 ? 304 TRP B CA    1 
ATOM   7868  C  C     . TRP B 1 304 ? -19.273 -1.057  -0.823  1.00 35.19 ? 304 TRP B C     1 
ATOM   7869  O  O     . TRP B 1 304 ? -19.044 -0.052  -0.154  1.00 36.22 ? 304 TRP B O     1 
ATOM   7870  C  CB    . TRP B 1 304 ? -18.668 -2.936  0.744   1.00 33.99 ? 304 TRP B CB    1 
ATOM   7871  C  CG    . TRP B 1 304 ? -17.572 -3.614  -0.035  1.00 32.87 ? 304 TRP B CG    1 
ATOM   7872  C  CD1   . TRP B 1 304 ? -17.414 -4.950  -0.212  1.00 31.89 ? 304 TRP B CD1   1 
ATOM   7873  C  CD2   . TRP B 1 304 ? -16.509 -2.983  -0.768  1.00 32.29 ? 304 TRP B CD2   1 
ATOM   7874  N  NE1   . TRP B 1 304 ? -16.311 -5.204  -0.994  1.00 31.99 ? 304 TRP B NE1   1 
ATOM   7875  C  CE2   . TRP B 1 304 ? -15.743 -4.013  -1.362  1.00 32.02 ? 304 TRP B CE2   1 
ATOM   7876  C  CE3   . TRP B 1 304 ? -16.123 -1.649  -0.974  1.00 32.63 ? 304 TRP B CE3   1 
ATOM   7877  C  CZ2   . TRP B 1 304 ? -14.611 -3.753  -2.156  1.00 32.32 ? 304 TRP B CZ2   1 
ATOM   7878  C  CZ3   . TRP B 1 304 ? -15.000 -1.389  -1.771  1.00 33.67 ? 304 TRP B CZ3   1 
ATOM   7879  C  CH2   . TRP B 1 304 ? -14.259 -2.438  -2.349  1.00 33.12 ? 304 TRP B CH2   1 
ATOM   7880  N  N     . HIS B 1 305 ? -19.091 -1.095  -2.142  1.00 35.02 ? 305 HIS B N     1 
ATOM   7881  C  CA    . HIS B 1 305 ? -18.549 0.048   -2.868  1.00 35.54 ? 305 HIS B CA    1 
ATOM   7882  C  C     . HIS B 1 305 ? -19.537 1.212   -2.901  1.00 36.85 ? 305 HIS B C     1 
ATOM   7883  O  O     . HIS B 1 305 ? -20.709 1.018   -3.180  1.00 37.18 ? 305 HIS B O     1 
ATOM   7884  C  CB    . HIS B 1 305 ? -18.148 -0.366  -4.276  1.00 34.65 ? 305 HIS B CB    1 
ATOM   7885  C  CG    . HIS B 1 305 ? -17.266 0.626   -4.974  1.00 34.53 ? 305 HIS B CG    1 
ATOM   7886  N  ND1   . HIS B 1 305 ? -17.701 1.880   -5.349  1.00 35.18 ? 305 HIS B ND1   1 
ATOM   7887  C  CD2   . HIS B 1 305 ? -15.979 0.539   -5.381  1.00 33.60 ? 305 HIS B CD2   1 
ATOM   7888  C  CE1   . HIS B 1 305 ? -16.719 2.524   -5.954  1.00 35.99 ? 305 HIS B CE1   1 
ATOM   7889  N  NE2   . HIS B 1 305 ? -15.665 1.729   -5.994  1.00 35.34 ? 305 HIS B NE2   1 
ATOM   7890  N  N     . LEU B 1 306 ? -19.042 2.420   -2.620  1.00 38.22 ? 306 LEU B N     1 
ATOM   7891  C  CA    . LEU B 1 306 ? -19.859 3.634   -2.487  1.00 38.92 ? 306 LEU B CA    1 
ATOM   7892  C  C     . LEU B 1 306 ? -20.639 4.017   -3.750  1.00 39.54 ? 306 LEU B C     1 
ATOM   7893  O  O     . LEU B 1 306 ? -21.666 4.707   -3.675  1.00 40.48 ? 306 LEU B O     1 
ATOM   7894  C  CB    . LEU B 1 306 ? -18.980 4.807   -2.035  1.00 39.54 ? 306 LEU B CB    1 
ATOM   7895  C  CG    . LEU B 1 306 ? -19.626 6.180   -1.771  1.00 40.43 ? 306 LEU B CG    1 
ATOM   7896  C  CD1   . LEU B 1 306 ? -20.491 6.185   -0.534  1.00 39.45 ? 306 LEU B CD1   1 
ATOM   7897  C  CD2   . LEU B 1 306 ? -18.571 7.258   -1.665  1.00 41.46 ? 306 LEU B CD2   1 
ATOM   7898  N  N     . ASP B 1 307 ? -20.151 3.575   -4.903  1.00 39.02 ? 307 ASP B N     1 
ATOM   7899  C  CA    . ASP B 1 307 ? -20.762 3.925   -6.180  1.00 39.44 ? 307 ASP B CA    1 
ATOM   7900  C  C     . ASP B 1 307 ? -21.789 2.874   -6.619  1.00 39.17 ? 307 ASP B C     1 
ATOM   7901  O  O     . ASP B 1 307 ? -22.247 2.894   -7.761  1.00 39.55 ? 307 ASP B O     1 
ATOM   7902  C  CB    . ASP B 1 307 ? -19.682 4.088   -7.263  1.00 39.33 ? 307 ASP B CB    1 
ATOM   7903  C  CG    . ASP B 1 307 ? -18.975 5.441   -7.219  1.00 39.78 ? 307 ASP B CG    1 
ATOM   7904  O  OD1   . ASP B 1 307 ? -19.498 6.414   -6.631  1.00 39.40 ? 307 ASP B OD1   1 
ATOM   7905  O  OD2   . ASP B 1 307 ? -17.875 5.531   -7.812  1.00 40.50 ? 307 ASP B OD2   1 
ATOM   7906  N  N     . ILE B 1 308 ? -22.151 1.972   -5.705  1.00 38.78 ? 308 ILE B N     1 
ATOM   7907  C  CA    . ILE B 1 308 ? -23.078 0.865   -5.989  1.00 38.53 ? 308 ILE B CA    1 
ATOM   7908  C  C     . ILE B 1 308 ? -24.442 1.325   -6.552  1.00 39.69 ? 308 ILE B C     1 
ATOM   7909  O  O     . ILE B 1 308 ? -24.895 0.800   -7.564  1.00 39.95 ? 308 ILE B O     1 
ATOM   7910  C  CB    . ILE B 1 308 ? -23.248 -0.101  -4.749  1.00 37.63 ? 308 ILE B CB    1 
ATOM   7911  C  CG1   . ILE B 1 308 ? -24.163 -1.288  -5.077  1.00 37.54 ? 308 ILE B CG1   1 
ATOM   7912  C  CG2   . ILE B 1 308 ? -23.760 0.642   -3.519  1.00 38.02 ? 308 ILE B CG2   1 
ATOM   7913  C  CD1   . ILE B 1 308 ? -23.510 -2.371  -5.973  1.00 36.82 ? 308 ILE B CD1   1 
ATOM   7914  N  N     . PHE B 1 309 ? -25.078 2.308   -5.913  1.00 40.79 ? 309 PHE B N     1 
ATOM   7915  C  CA    . PHE B 1 309 ? -26.388 2.796   -6.360  1.00 41.86 ? 309 PHE B CA    1 
ATOM   7916  C  C     . PHE B 1 309 ? -26.378 3.316   -7.800  1.00 43.14 ? 309 PHE B C     1 
ATOM   7917  O  O     . PHE B 1 309 ? -27.304 3.036   -8.568  1.00 43.81 ? 309 PHE B O     1 
ATOM   7918  C  CB    . PHE B 1 309 ? -26.946 3.859   -5.400  1.00 42.17 ? 309 PHE B CB    1 
ATOM   7919  C  CG    . PHE B 1 309 ? -27.520 3.290   -4.126  1.00 40.66 ? 309 PHE B CG    1 
ATOM   7920  C  CD1   . PHE B 1 309 ? -26.748 3.219   -2.973  1.00 38.55 ? 309 PHE B CD1   1 
ATOM   7921  C  CD2   . PHE B 1 309 ? -28.835 2.828   -4.083  1.00 40.09 ? 309 PHE B CD2   1 
ATOM   7922  C  CE1   . PHE B 1 309 ? -27.269 2.703   -1.788  1.00 38.41 ? 309 PHE B CE1   1 
ATOM   7923  C  CE2   . PHE B 1 309 ? -29.375 2.297   -2.904  1.00 39.82 ? 309 PHE B CE2   1 
ATOM   7924  C  CZ    . PHE B 1 309 ? -28.584 2.233   -1.750  1.00 40.00 ? 309 PHE B CZ    1 
ATOM   7925  N  N     . GLU B 1 310 ? -25.334 4.057   -8.168  1.00 44.17 ? 310 GLU B N     1 
ATOM   7926  C  CA    . GLU B 1 310 ? -25.212 4.593   -9.531  1.00 45.87 ? 310 GLU B CA    1 
ATOM   7927  C  C     . GLU B 1 310 ? -24.883 3.484   -10.516 1.00 45.13 ? 310 GLU B C     1 
ATOM   7928  O  O     . GLU B 1 310 ? -25.299 3.519   -11.668 1.00 45.89 ? 310 GLU B O     1 
ATOM   7929  C  CB    . GLU B 1 310 ? -24.160 5.705   -9.607  1.00 46.63 ? 310 GLU B CB    1 
ATOM   7930  C  CG    . GLU B 1 310 ? -24.604 7.031   -8.985  1.00 50.03 ? 310 GLU B CG    1 
ATOM   7931  C  CD    . GLU B 1 310 ? -24.857 6.922   -7.475  1.00 53.23 ? 310 GLU B CD    1 
ATOM   7932  O  OE1   . GLU B 1 310 ? -23.908 6.521   -6.743  1.00 52.63 ? 310 GLU B OE1   1 
ATOM   7933  O  OE2   . GLU B 1 310 ? -26.001 7.223   -7.032  1.00 53.49 ? 310 GLU B OE2   1 
ATOM   7934  N  N     . PHE B 1 311 ? -24.150 2.487   -10.037 1.00 44.23 ? 311 PHE B N     1 
ATOM   7935  C  CA    . PHE B 1 311 ? -23.816 1.310   -10.823 1.00 43.74 ? 311 PHE B CA    1 
ATOM   7936  C  C     . PHE B 1 311 ? -25.104 0.590   -11.213 1.00 44.42 ? 311 PHE B C     1 
ATOM   7937  O  O     . PHE B 1 311 ? -25.305 0.222   -12.375 1.00 44.54 ? 311 PHE B O     1 
ATOM   7938  C  CB    . PHE B 1 311 ? -22.899 0.414   -9.993  1.00 41.94 ? 311 PHE B CB    1 
ATOM   7939  C  CG    . PHE B 1 311 ? -22.574 -0.902  -10.627 1.00 40.73 ? 311 PHE B CG    1 
ATOM   7940  C  CD1   . PHE B 1 311 ? -21.537 -1.007  -11.566 1.00 40.76 ? 311 PHE B CD1   1 
ATOM   7941  C  CD2   . PHE B 1 311 ? -23.260 -2.052  -10.253 1.00 39.05 ? 311 PHE B CD2   1 
ATOM   7942  C  CE1   . PHE B 1 311 ? -21.212 -2.237  -12.137 1.00 37.60 ? 311 PHE B CE1   1 
ATOM   7943  C  CE2   . PHE B 1 311 ? -22.946 -3.290  -10.830 1.00 37.78 ? 311 PHE B CE2   1 
ATOM   7944  C  CZ    . PHE B 1 311 ? -21.919 -3.376  -11.771 1.00 37.91 ? 311 PHE B CZ    1 
ATOM   7945  N  N     . LEU B 1 312 ? -25.980 0.433   -10.227 1.00 45.23 ? 312 LEU B N     1 
ATOM   7946  C  CA    . LEU B 1 312 ? -27.262 -0.234  -10.379 1.00 46.46 ? 312 LEU B CA    1 
ATOM   7947  C  C     . LEU B 1 312 ? -28.188 0.441   -11.409 1.00 48.97 ? 312 LEU B C     1 
ATOM   7948  O  O     . LEU B 1 312 ? -29.234 -0.105  -11.750 1.00 49.60 ? 312 LEU B O     1 
ATOM   7949  C  CB    . LEU B 1 312 ? -27.935 -0.344  -9.000  1.00 45.85 ? 312 LEU B CB    1 
ATOM   7950  C  CG    . LEU B 1 312 ? -27.873 -1.650  -8.169  1.00 45.09 ? 312 LEU B CG    1 
ATOM   7951  C  CD1   . LEU B 1 312 ? -26.939 -2.748  -8.698  1.00 41.65 ? 312 LEU B CD1   1 
ATOM   7952  C  CD2   . LEU B 1 312 ? -27.599 -1.401  -6.690  1.00 43.66 ? 312 LEU B CD2   1 
ATOM   7953  N  N     . ASP B 1 313 ? -27.784 1.614   -11.905 1.00 51.25 ? 313 ASP B N     1 
ATOM   7954  C  CA    . ASP B 1 313 ? -28.595 2.434   -12.829 1.00 53.75 ? 313 ASP B CA    1 
ATOM   7955  C  C     . ASP B 1 313 ? -28.077 2.463   -14.265 1.00 54.51 ? 313 ASP B C     1 
ATOM   7956  O  O     . ASP B 1 313 ? -28.834 2.755   -15.191 1.00 55.66 ? 313 ASP B O     1 
ATOM   7957  C  CB    . ASP B 1 313 ? -28.702 3.876   -12.318 1.00 55.03 ? 313 ASP B CB    1 
ATOM   7958  C  CG    . ASP B 1 313 ? -29.724 4.029   -11.203 1.00 57.04 ? 313 ASP B CG    1 
ATOM   7959  O  OD1   . ASP B 1 313 ? -30.394 3.027   -10.863 1.00 58.73 ? 313 ASP B OD1   1 
ATOM   7960  O  OD2   . ASP B 1 313 ? -29.860 5.150   -10.662 1.00 58.21 ? 313 ASP B OD2   1 
ATOM   7961  N  N     . LEU B 1 314 ? -26.792 2.152   -14.437 1.00 54.32 ? 314 LEU B N     1 
ATOM   7962  C  CA    . LEU B 1 314 ? -26.095 2.282   -15.719 1.00 55.51 ? 314 LEU B CA    1 
ATOM   7963  C  C     . LEU B 1 314 ? -26.757 1.607   -16.928 1.00 56.60 ? 314 LEU B C     1 
ATOM   7964  O  O     . LEU B 1 314 ? -26.461 1.946   -18.071 1.00 57.31 ? 314 LEU B O     1 
ATOM   7965  C  CB    . LEU B 1 314 ? -24.653 1.792   -15.581 1.00 54.32 ? 314 LEU B CB    1 
ATOM   7966  C  CG    . LEU B 1 314 ? -23.643 2.703   -14.878 1.00 54.20 ? 314 LEU B CG    1 
ATOM   7967  C  CD1   . LEU B 1 314 ? -22.318 1.972   -14.724 1.00 52.76 ? 314 LEU B CD1   1 
ATOM   7968  C  CD2   . LEU B 1 314 ? -23.442 4.012   -15.632 1.00 55.62 ? 314 LEU B CD2   1 
ATOM   7969  N  N     . LYS B 1 315 ? -27.658 0.667   -16.659 1.00 57.11 ? 315 LYS B N     1 
ATOM   7970  C  CA    . LYS B 1 315 ? -28.271 -0.161  -17.686 1.00 58.32 ? 315 LYS B CA    1 
ATOM   7971  C  C     . LYS B 1 315 ? -29.747 0.217   -17.923 1.00 60.36 ? 315 LYS B C     1 
ATOM   7972  O  O     . LYS B 1 315 ? -30.363 -0.242  -18.892 1.00 61.19 ? 315 LYS B O     1 
ATOM   7973  C  CB    . LYS B 1 315 ? -28.118 -1.638  -17.296 1.00 56.76 ? 315 LYS B CB    1 
ATOM   7974  C  CG    . LYS B 1 315 ? -28.533 -2.658  -18.357 1.00 57.67 ? 315 LYS B CG    1 
ATOM   7975  C  CD    . LYS B 1 315 ? -27.467 -2.911  -19.424 1.00 56.91 ? 315 LYS B CD    1 
ATOM   7976  C  CE    . LYS B 1 315 ? -27.912 -4.026  -20.352 1.00 55.57 ? 315 LYS B CE    1 
ATOM   7977  N  NZ    . LYS B 1 315 ? -26.949 -4.241  -21.452 1.00 56.59 ? 315 LYS B NZ    1 
ATOM   7978  N  N     . LYS B 1 316 ? -30.303 1.055   -17.045 1.00 61.58 ? 316 LYS B N     1 
ATOM   7979  C  CA    . LYS B 1 316 ? -31.664 1.565   -17.218 1.00 63.89 ? 316 LYS B CA    1 
ATOM   7980  C  C     . LYS B 1 316 ? -31.822 2.273   -18.566 1.00 65.92 ? 316 LYS B C     1 
ATOM   7981  O  O     . LYS B 1 316 ? -30.991 3.096   -18.945 1.00 66.26 ? 316 LYS B O     1 
ATOM   7982  C  CB    . LYS B 1 316 ? -32.050 2.507   -16.075 1.00 64.35 ? 316 LYS B CB    1 
ATOM   7983  C  CG    . LYS B 1 316 ? -32.912 1.871   -14.993 1.00 64.84 ? 316 LYS B CG    1 
ATOM   7984  C  CD    . LYS B 1 316 ? -32.110 1.460   -13.760 1.00 64.63 ? 316 LYS B CD    1 
ATOM   7985  C  CE    . LYS B 1 316 ? -33.039 0.962   -12.651 1.00 64.77 ? 316 LYS B CE    1 
ATOM   7986  N  NZ    . LYS B 1 316 ? -32.561 1.332   -11.293 1.00 63.46 ? 316 LYS B NZ    1 
ATOM   7987  N  N     . ASN B 1 317 ? -32.883 1.934   -19.291 1.00 67.74 ? 317 ASN B N     1 
ATOM   7988  C  CA    . ASN B 1 317 ? -33.126 2.522   -20.607 1.00 70.20 ? 317 ASN B CA    1 
ATOM   7989  C  C     . ASN B 1 317 ? -33.636 3.965   -20.492 1.00 72.67 ? 317 ASN B C     1 
ATOM   7990  O  O     . ASN B 1 317 ? -33.393 4.784   -21.379 1.00 74.08 ? 317 ASN B O     1 
ATOM   7991  C  CB    . ASN B 1 317 ? -34.081 1.651   -21.429 1.00 70.85 ? 317 ASN B CB    1 
ATOM   7992  N  N     . THR B 1 318 ? -34.335 4.265   -19.397 1.00 73.55 ? 318 THR B N     1 
ATOM   7993  C  CA    . THR B 1 318 ? -34.681 5.647   -19.033 1.00 75.64 ? 318 THR B CA    1 
ATOM   7994  C  C     . THR B 1 318 ? -33.522 6.209   -18.200 1.00 74.83 ? 318 THR B C     1 
ATOM   7995  O  O     . THR B 1 318 ? -33.084 5.561   -17.240 1.00 73.14 ? 318 THR B O     1 
ATOM   7996  C  CB    . THR B 1 318 ? -36.009 5.727   -18.207 1.00 76.76 ? 318 THR B CB    1 
ATOM   7997  O  OG1   . THR B 1 318 ? -35.724 5.992   -16.823 1.00 75.78 ? 318 THR B OG1   1 
ATOM   7998  C  CG2   . THR B 1 318 ? -36.838 4.427   -18.334 1.00 76.27 ? 318 THR B CG2   1 
ATOM   7999  N  N     . GLY B 1 319 ? -33.023 7.397   -18.553 1.00 76.01 ? 319 GLY B N     1 
ATOM   8000  C  CA    . GLY B 1 319 ? -31.854 7.943   -17.854 1.00 75.27 ? 319 GLY B CA    1 
ATOM   8001  C  C     . GLY B 1 319 ? -31.346 9.322   -18.216 1.00 76.72 ? 319 GLY B C     1 
ATOM   8002  O  O     . GLY B 1 319 ? -32.094 10.296  -18.152 1.00 78.77 ? 319 GLY B O     1 
ATOM   8003  N  N     . LYS B 1 320 ? -30.060 9.402   -18.572 1.00 76.09 ? 320 LYS B N     1 
ATOM   8004  C  CA    . LYS B 1 320 ? -29.383 10.683  -18.823 1.00 77.30 ? 320 LYS B CA    1 
ATOM   8005  C  C     . LYS B 1 320 ? -28.122 10.589  -19.704 1.00 76.84 ? 320 LYS B C     1 
ATOM   8006  O  O     . LYS B 1 320 ? -27.287 11.495  -19.691 1.00 77.60 ? 320 LYS B O     1 
ATOM   8007  C  CB    . LYS B 1 320 ? -29.060 11.387  -17.491 1.00 77.06 ? 320 LYS B CB    1 
ATOM   8008  N  N     . GLU B 1 321 ? -27.994 9.501   -20.463 1.00 75.80 ? 321 GLU B N     1 
ATOM   8009  C  CA    . GLU B 1 321 ? -26.907 9.311   -21.450 1.00 75.30 ? 321 GLU B CA    1 
ATOM   8010  C  C     . GLU B 1 321 ? -25.476 9.303   -20.882 1.00 73.63 ? 321 GLU B C     1 
ATOM   8011  O  O     . GLU B 1 321 ? -24.759 8.307   -21.025 1.00 72.32 ? 321 GLU B O     1 
ATOM   8012  C  CB    . GLU B 1 321 ? -27.037 10.304  -22.623 1.00 77.69 ? 321 GLU B CB    1 
ATOM   8013  N  N     . GLU B 1 322 ? -25.069 10.407  -20.252 1.00 73.47 ? 322 GLU B N     1 
ATOM   8014  C  CA    . GLU B 1 322 ? -23.745 10.518  -19.631 1.00 71.74 ? 322 GLU B CA    1 
ATOM   8015  C  C     . GLU B 1 322 ? -23.646 9.725   -18.322 1.00 69.36 ? 322 GLU B C     1 
ATOM   8016  O  O     . GLU B 1 322 ? -22.547 9.494   -17.802 1.00 68.22 ? 322 GLU B O     1 
ATOM   8017  C  CB    . GLU B 1 322 ? -23.382 11.978  -19.402 1.00 73.30 ? 322 GLU B CB    1 
ATOM   8018  N  N     . GLN B 1 323 ? -24.797 9.317   -17.790 1.00 68.17 ? 323 GLN B N     1 
ATOM   8019  C  CA    . GLN B 1 323 ? -24.845 8.469   -16.604 1.00 65.66 ? 323 GLN B CA    1 
ATOM   8020  C  C     . GLN B 1 323 ? -25.292 7.053   -16.984 1.00 63.63 ? 323 GLN B C     1 
ATOM   8021  O  O     . GLN B 1 323 ? -25.751 6.294   -16.133 1.00 62.59 ? 323 GLN B O     1 
ATOM   8022  C  CB    . GLN B 1 323 ? -25.784 9.074   -15.558 1.00 66.35 ? 323 GLN B CB    1 
ATOM   8023  C  CG    . GLN B 1 323 ? -25.453 10.510  -15.179 1.00 69.21 ? 323 GLN B CG    1 
ATOM   8024  C  CD    . GLN B 1 323 ? -26.678 11.305  -14.757 1.00 73.00 ? 323 GLN B CD    1 
ATOM   8025  O  OE1   . GLN B 1 323 ? -27.740 10.737  -14.488 1.00 74.37 ? 323 GLN B OE1   1 
ATOM   8026  N  NE2   . GLN B 1 323 ? -26.538 12.629  -14.703 1.00 74.55 ? 323 GLN B NE2   1 
ATOM   8027  N  N     . ARG B 1 324 ? -25.157 6.714   -18.267 1.00 63.05 ? 324 ARG B N     1 
ATOM   8028  C  CA    . ARG B 1 324 ? -25.561 5.407   -18.797 1.00 61.24 ? 324 ARG B CA    1 
ATOM   8029  C  C     . ARG B 1 324 ? -24.436 4.704   -19.548 1.00 59.76 ? 324 ARG B C     1 
ATOM   8030  O  O     . ARG B 1 324 ? -23.632 5.341   -20.233 1.00 60.55 ? 324 ARG B O     1 
ATOM   8031  C  CB    . ARG B 1 324 ? -26.772 5.532   -19.734 1.00 62.68 ? 324 ARG B CB    1 
ATOM   8032  C  CG    . ARG B 1 324 ? -28.097 5.928   -19.077 1.00 63.74 ? 324 ARG B CG    1 
ATOM   8033  C  CD    . ARG B 1 324 ? -28.530 4.979   -17.962 1.00 62.06 ? 324 ARG B CD    1 
ATOM   8034  N  NE    . ARG B 1 324 ? -28.401 5.636   -16.665 1.00 62.67 ? 324 ARG B NE    1 
ATOM   8035  C  CZ    . ARG B 1 324 ? -29.423 6.024   -15.910 1.00 62.65 ? 324 ARG B CZ    1 
ATOM   8036  N  NH1   . ARG B 1 324 ? -30.667 5.793   -16.299 1.00 63.53 ? 324 ARG B NH1   1 
ATOM   8037  N  NH2   . ARG B 1 324 ? -29.197 6.624   -14.751 1.00 61.76 ? 324 ARG B NH2   1 
ATOM   8038  N  N     . ALA B 1 325 ? -24.403 3.380   -19.415 1.00 57.43 ? 325 ALA B N     1 
ATOM   8039  C  CA    . ALA B 1 325 ? -23.484 2.524   -20.162 1.00 55.67 ? 325 ALA B CA    1 
ATOM   8040  C  C     . ALA B 1 325 ? -24.223 1.258   -20.603 1.00 54.21 ? 325 ALA B C     1 
ATOM   8041  O  O     . ALA B 1 325 ? -23.951 0.152   -20.129 1.00 52.46 ? 325 ALA B O     1 
ATOM   8042  C  CB    . ALA B 1 325 ? -22.256 2.185   -19.321 1.00 54.34 ? 325 ALA B CB    1 
ATOM   8043  N  N     . ARG B 1 326 ? -25.151 1.431   -21.533 1.00 54.32 ? 326 ARG B N     1 
ATOM   8044  C  CA    . ARG B 1 326 ? -26.094 0.369   -21.855 1.00 53.34 ? 326 ARG B CA    1 
ATOM   8045  C  C     . ARG B 1 326 ? -25.550 -0.760  -22.743 1.00 52.17 ? 326 ARG B C     1 
ATOM   8046  O  O     . ARG B 1 326 ? -26.271 -1.716  -23.037 1.00 52.24 ? 326 ARG B O     1 
ATOM   8047  C  CB    . ARG B 1 326 ? -27.391 0.954   -22.423 1.00 55.07 ? 326 ARG B CB    1 
ATOM   8048  C  CG    . ARG B 1 326 ? -28.098 1.938   -21.483 1.00 55.39 ? 326 ARG B CG    1 
ATOM   8049  C  CD    . ARG B 1 326 ? -29.370 2.463   -22.134 1.00 57.04 ? 326 ARG B CD    1 
ATOM   8050  N  NE    . ARG B 1 326 ? -29.812 3.740   -21.582 1.00 57.33 ? 326 ARG B NE    1 
ATOM   8051  C  CZ    . ARG B 1 326 ? -29.574 4.923   -22.141 1.00 59.15 ? 326 ARG B CZ    1 
ATOM   8052  N  NH1   . ARG B 1 326 ? -28.879 5.011   -23.268 1.00 59.29 ? 326 ARG B NH1   1 
ATOM   8053  N  NH2   . ARG B 1 326 ? -30.032 6.026   -21.569 1.00 60.52 ? 326 ARG B NH2   1 
ATOM   8054  N  N     . ASP B 1 327 ? -24.283 -0.674  -23.141 1.00 51.03 ? 327 ASP B N     1 
ATOM   8055  C  CA    . ASP B 1 327 ? -23.651 -1.754  -23.915 1.00 49.35 ? 327 ASP B CA    1 
ATOM   8056  C  C     . ASP B 1 327 ? -22.813 -2.712  -23.060 1.00 46.60 ? 327 ASP B C     1 
ATOM   8057  O  O     . ASP B 1 327 ? -22.348 -3.742  -23.544 1.00 45.98 ? 327 ASP B O     1 
ATOM   8058  C  CB    . ASP B 1 327 ? -22.842 -1.180  -25.070 1.00 50.84 ? 327 ASP B CB    1 
ATOM   8059  C  CG    . ASP B 1 327 ? -23.684 -0.305  -25.973 1.00 53.31 ? 327 ASP B CG    1 
ATOM   8060  O  OD1   . ASP B 1 327 ? -24.534 -0.852  -26.700 1.00 55.39 ? 327 ASP B OD1   1 
ATOM   8061  O  OD2   . ASP B 1 327 ? -23.510 0.931   -25.946 1.00 55.10 ? 327 ASP B OD2   1 
ATOM   8062  N  N     . LEU B 1 328 ? -22.640 -2.364  -21.787 1.00 44.40 ? 328 LEU B N     1 
ATOM   8063  C  CA    . LEU B 1 328 ? -22.027 -3.244  -20.804 1.00 41.11 ? 328 LEU B CA    1 
ATOM   8064  C  C     . LEU B 1 328 ? -23.079 -4.104  -20.129 1.00 39.82 ? 328 LEU B C     1 
ATOM   8065  O  O     . LEU B 1 328 ? -24.277 -3.846  -20.240 1.00 40.13 ? 328 LEU B O     1 
ATOM   8066  C  CB    . LEU B 1 328 ? -21.267 -2.442  -19.741 1.00 40.33 ? 328 LEU B CB    1 
ATOM   8067  C  CG    . LEU B 1 328 ? -20.215 -1.428  -20.200 1.00 40.67 ? 328 LEU B CG    1 
ATOM   8068  C  CD1   . LEU B 1 328 ? -19.724 -0.618  -19.003 1.00 39.37 ? 328 LEU B CD1   1 
ATOM   8069  C  CD2   . LEU B 1 328 ? -19.044 -2.097  -20.961 1.00 39.25 ? 328 LEU B CD2   1 
ATOM   8070  N  N     . PHE B 1 329 ? -22.604 -5.130  -19.430 1.00 38.02 ? 329 PHE B N     1 
ATOM   8071  C  CA    . PHE B 1 329 ? -23.441 -6.037  -18.681 1.00 37.08 ? 329 PHE B CA    1 
ATOM   8072  C  C     . PHE B 1 329 ? -22.977 -5.949  -17.246 1.00 36.35 ? 329 PHE B C     1 
ATOM   8073  O  O     . PHE B 1 329 ? -21.808 -5.662  -16.990 1.00 35.77 ? 329 PHE B O     1 
ATOM   8074  C  CB    . PHE B 1 329 ? -23.309 -7.456  -19.233 1.00 36.82 ? 329 PHE B CB    1 
ATOM   8075  C  CG    . PHE B 1 329 ? -23.665 -7.568  -20.692 1.00 37.96 ? 329 PHE B CG    1 
ATOM   8076  C  CD1   . PHE B 1 329 ? -24.978 -7.838  -21.081 1.00 39.61 ? 329 PHE B CD1   1 
ATOM   8077  C  CD2   . PHE B 1 329 ? -22.695 -7.373  -21.678 1.00 38.63 ? 329 PHE B CD2   1 
ATOM   8078  C  CE1   . PHE B 1 329 ? -25.328 -7.926  -22.432 1.00 40.80 ? 329 PHE B CE1   1 
ATOM   8079  C  CE2   . PHE B 1 329 ? -23.026 -7.456  -23.039 1.00 40.33 ? 329 PHE B CE2   1 
ATOM   8080  C  CZ    . PHE B 1 329 ? -24.345 -7.732  -23.418 1.00 41.15 ? 329 PHE B CZ    1 
ATOM   8081  N  N     . PHE B 1 330 ? -23.888 -6.175  -16.307 1.00 36.04 ? 330 PHE B N     1 
ATOM   8082  C  CA    . PHE B 1 330 ? -23.614 -5.849  -14.911 1.00 35.56 ? 330 PHE B CA    1 
ATOM   8083  C  C     . PHE B 1 330 ? -23.827 -7.010  -13.966 1.00 34.93 ? 330 PHE B C     1 
ATOM   8084  O  O     . PHE B 1 330 ? -24.764 -7.788  -14.108 1.00 34.78 ? 330 PHE B O     1 
ATOM   8085  C  CB    . PHE B 1 330 ? -24.414 -4.610  -14.483 1.00 36.21 ? 330 PHE B CB    1 
ATOM   8086  C  CG    . PHE B 1 330 ? -24.070 -3.387  -15.280 1.00 37.83 ? 330 PHE B CG    1 
ATOM   8087  C  CD1   . PHE B 1 330 ? -22.949 -2.619  -14.953 1.00 37.00 ? 330 PHE B CD1   1 
ATOM   8088  C  CD2   . PHE B 1 330 ? -24.821 -3.035  -16.398 1.00 38.95 ? 330 PHE B CD2   1 
ATOM   8089  C  CE1   . PHE B 1 330 ? -22.602 -1.512  -15.701 1.00 37.56 ? 330 PHE B CE1   1 
ATOM   8090  C  CE2   . PHE B 1 330 ? -24.484 -1.921  -17.162 1.00 40.37 ? 330 PHE B CE2   1 
ATOM   8091  C  CZ    . PHE B 1 330 ? -23.369 -1.156  -16.811 1.00 40.18 ? 330 PHE B CZ    1 
ATOM   8092  N  N     . ALA B 1 331 ? -22.929 -7.124  -12.999 1.00 34.56 ? 331 ALA B N     1 
ATOM   8093  C  CA    . ALA B 1 331 ? -22.923 -8.252  -12.099 1.00 34.25 ? 331 ALA B CA    1 
ATOM   8094  C  C     . ALA B 1 331 ? -22.441 -7.798  -10.733 1.00 34.52 ? 331 ALA B C     1 
ATOM   8095  O  O     . ALA B 1 331 ? -21.583 -6.919  -10.628 1.00 35.33 ? 331 ALA B O     1 
ATOM   8096  C  CB    . ALA B 1 331 ? -22.034 -9.349  -12.645 1.00 33.37 ? 331 ALA B CB    1 
ATOM   8097  N  N     . LEU B 1 332 ? -23.019 -8.397  -9.698  1.00 34.47 ? 332 LEU B N     1 
ATOM   8098  C  CA    . LEU B 1 332 ? -22.627 -8.148  -8.331  1.00 34.45 ? 332 LEU B CA    1 
ATOM   8099  C  C     . LEU B 1 332 ? -21.820 -9.328  -7.836  1.00 34.06 ? 332 LEU B C     1 
ATOM   8100  O  O     . LEU B 1 332 ? -22.122 -10.475 -8.160  1.00 34.23 ? 332 LEU B O     1 
ATOM   8101  C  CB    . LEU B 1 332 ? -23.853 -7.939  -7.435  1.00 34.73 ? 332 LEU B CB    1 
ATOM   8102  C  CG    . LEU B 1 332 ? -24.742 -6.723  -7.698  1.00 34.96 ? 332 LEU B CG    1 
ATOM   8103  C  CD1   . LEU B 1 332 ? -25.799 -6.609  -6.636  1.00 36.20 ? 332 LEU B CD1   1 
ATOM   8104  C  CD2   . LEU B 1 332 ? -23.949 -5.443  -7.778  1.00 36.21 ? 332 LEU B CD2   1 
ATOM   8105  N  N     . TRP B 1 333 ? -20.788 -9.031  -7.054  1.00 33.75 ? 333 TRP B N     1 
ATOM   8106  C  CA    . TRP B 1 333 ? -19.906 -10.032 -6.491  1.00 32.87 ? 333 TRP B CA    1 
ATOM   8107  C  C     . TRP B 1 333 ? -20.078 -9.893  -4.976  1.00 33.51 ? 333 TRP B C     1 
ATOM   8108  O  O     . TRP B 1 333 ? -19.455 -9.038  -4.333  1.00 33.89 ? 333 TRP B O     1 
ATOM   8109  C  CB    . TRP B 1 333 ? -18.488 -9.740  -6.971  1.00 32.33 ? 333 TRP B CB    1 
ATOM   8110  C  CG    . TRP B 1 333 ? -17.465 -10.784 -6.683  1.00 32.55 ? 333 TRP B CG    1 
ATOM   8111  C  CD1   . TRP B 1 333 ? -16.399 -10.659 -5.850  1.00 31.51 ? 333 TRP B CD1   1 
ATOM   8112  C  CD2   . TRP B 1 333 ? -17.379 -12.102 -7.256  1.00 32.06 ? 333 TRP B CD2   1 
ATOM   8113  N  NE1   . TRP B 1 333 ? -15.659 -11.811 -5.852  1.00 31.89 ? 333 TRP B NE1   1 
ATOM   8114  C  CE2   . TRP B 1 333 ? -16.234 -12.718 -6.702  1.00 31.44 ? 333 TRP B CE2   1 
ATOM   8115  C  CE3   . TRP B 1 333 ? -18.157 -12.818 -8.179  1.00 31.14 ? 333 TRP B CE3   1 
ATOM   8116  C  CZ2   . TRP B 1 333 ? -15.844 -14.026 -7.029  1.00 30.71 ? 333 TRP B CZ2   1 
ATOM   8117  C  CZ3   . TRP B 1 333 ? -17.761 -14.122 -8.523  1.00 30.90 ? 333 TRP B CZ3   1 
ATOM   8118  C  CH2   . TRP B 1 333 ? -16.612 -14.711 -7.939  1.00 31.19 ? 333 TRP B CH2   1 
ATOM   8119  N  N     . ILE B 1 334 ? -20.953 -10.732 -4.420  1.00 33.75 ? 334 ILE B N     1 
ATOM   8120  C  CA    . ILE B 1 334 ? -21.627 -10.438 -3.141  1.00 34.11 ? 334 ILE B CA    1 
ATOM   8121  C  C     . ILE B 1 334 ? -21.080 -11.198 -1.931  1.00 34.16 ? 334 ILE B C     1 
ATOM   8122  O  O     . ILE B 1 334 ? -21.046 -12.429 -1.924  1.00 33.57 ? 334 ILE B O     1 
ATOM   8123  C  CB    . ILE B 1 334 ? -23.158 -10.685 -3.244  1.00 34.18 ? 334 ILE B CB    1 
ATOM   8124  C  CG1   . ILE B 1 334 ? -23.751 -9.933  -4.431  1.00 34.83 ? 334 ILE B CG1   1 
ATOM   8125  C  CG2   . ILE B 1 334 ? -23.891 -10.285 -1.953  1.00 35.33 ? 334 ILE B CG2   1 
ATOM   8126  C  CD1   . ILE B 1 334 ? -25.209 -10.332 -4.742  1.00 34.87 ? 334 ILE B CD1   1 
ATOM   8127  N  N     . PRO B 1 335 ? -20.670 -10.459 -0.887  1.00 34.93 ? 335 PRO B N     1 
ATOM   8128  C  CA    . PRO B 1 335 ? -20.292 -11.134 0.338   1.00 35.47 ? 335 PRO B CA    1 
ATOM   8129  C  C     . PRO B 1 335 ? -21.511 -11.609 1.137   1.00 36.63 ? 335 PRO B C     1 
ATOM   8130  O  O     . PRO B 1 335 ? -22.590 -10.995 1.079   1.00 36.95 ? 335 PRO B O     1 
ATOM   8131  C  CB    . PRO B 1 335 ? -19.511 -10.067 1.098   1.00 35.62 ? 335 PRO B CB    1 
ATOM   8132  C  CG    . PRO B 1 335 ? -20.065 -8.793  0.632   1.00 36.00 ? 335 PRO B CG    1 
ATOM   8133  C  CD    . PRO B 1 335 ? -20.510 -9.000  -0.786  1.00 35.28 ? 335 PRO B CD    1 
ATOM   8134  N  N     . ASP B 1 336 ? -21.323 -12.714 1.859   1.00 37.18 ? 336 ASP B N     1 
ATOM   8135  C  CA    . ASP B 1 336 ? -22.336 -13.255 2.764   1.00 37.99 ? 336 ASP B CA    1 
ATOM   8136  C  C     . ASP B 1 336 ? -22.823 -12.211 3.769   1.00 38.49 ? 336 ASP B C     1 
ATOM   8137  O  O     . ASP B 1 336 ? -24.012 -12.172 4.088   1.00 38.88 ? 336 ASP B O     1 
ATOM   8138  C  CB    . ASP B 1 336 ? -21.784 -14.478 3.520   1.00 38.28 ? 336 ASP B CB    1 
ATOM   8139  C  CG    . ASP B 1 336 ? -21.727 -15.734 2.659   1.00 38.38 ? 336 ASP B CG    1 
ATOM   8140  O  OD1   . ASP B 1 336 ? -22.122 -15.686 1.470   1.00 38.77 ? 336 ASP B OD1   1 
ATOM   8141  O  OD2   . ASP B 1 336 ? -21.293 -16.783 3.183   1.00 40.23 ? 336 ASP B OD2   1 
ATOM   8142  N  N     . LEU B 1 337 ? -21.892 -11.382 4.260   1.00 38.53 ? 337 LEU B N     1 
ATOM   8143  C  CA    . LEU B 1 337 ? -22.186 -10.328 5.242   1.00 39.03 ? 337 LEU B CA    1 
ATOM   8144  C  C     . LEU B 1 337 ? -23.321 -9.414  4.780   1.00 38.73 ? 337 LEU B C     1 
ATOM   8145  O  O     . LEU B 1 337 ? -24.193 -9.072  5.572   1.00 39.46 ? 337 LEU B O     1 
ATOM   8146  C  CB    . LEU B 1 337 ? -20.945 -9.481  5.531   1.00 39.24 ? 337 LEU B CB    1 
ATOM   8147  C  CG    . LEU B 1 337 ? -20.651 -8.978  6.959   1.00 41.34 ? 337 LEU B CG    1 
ATOM   8148  C  CD1   . LEU B 1 337 ? -19.854 -7.681  6.906   1.00 40.53 ? 337 LEU B CD1   1 
ATOM   8149  C  CD2   . LEU B 1 337 ? -21.873 -8.820  7.877   1.00 41.44 ? 337 LEU B CD2   1 
ATOM   8150  N  N     . PHE B 1 338 ? -23.306 -9.028  3.504   1.00 37.50 ? 338 PHE B N     1 
ATOM   8151  C  CA    . PHE B 1 338 ? -24.383 -8.218  2.942   1.00 37.72 ? 338 PHE B CA    1 
ATOM   8152  C  C     . PHE B 1 338 ? -25.750 -8.896  3.061   1.00 37.84 ? 338 PHE B C     1 
ATOM   8153  O  O     . PHE B 1 338 ? -26.718 -8.276  3.496   1.00 38.44 ? 338 PHE B O     1 
ATOM   8154  C  CB    . PHE B 1 338 ? -24.106 -7.827  1.478   1.00 36.97 ? 338 PHE B CB    1 
ATOM   8155  C  CG    . PHE B 1 338 ? -25.244 -7.082  0.835   1.00 37.66 ? 338 PHE B CG    1 
ATOM   8156  C  CD1   . PHE B 1 338 ? -25.635 -5.831  1.322   1.00 37.86 ? 338 PHE B CD1   1 
ATOM   8157  C  CD2   . PHE B 1 338 ? -25.951 -7.643  -0.231  1.00 37.51 ? 338 PHE B CD2   1 
ATOM   8158  C  CE1   . PHE B 1 338 ? -26.701 -5.146  0.753   1.00 38.93 ? 338 PHE B CE1   1 
ATOM   8159  C  CE2   . PHE B 1 338 ? -27.025 -6.957  -0.816  1.00 38.46 ? 338 PHE B CE2   1 
ATOM   8160  C  CZ    . PHE B 1 338 ? -27.399 -5.707  -0.325  1.00 38.51 ? 338 PHE B CZ    1 
ATOM   8161  N  N     . MET B 1 339 ? -25.806 -10.168 2.675   1.00 37.56 ? 339 MET B N     1 
ATOM   8162  C  CA    . MET B 1 339 ? -27.042 -10.948 2.670   1.00 37.82 ? 339 MET B CA    1 
ATOM   8163  C  C     . MET B 1 339 ? -27.540 -11.180 4.082   1.00 38.80 ? 339 MET B C     1 
ATOM   8164  O  O     . MET B 1 339 ? -28.751 -11.236 4.319   1.00 39.64 ? 339 MET B O     1 
ATOM   8165  C  CB    . MET B 1 339 ? -26.823 -12.283 1.963   1.00 37.24 ? 339 MET B CB    1 
ATOM   8166  C  CG    . MET B 1 339 ? -26.414 -12.166 0.489   1.00 36.50 ? 339 MET B CG    1 
ATOM   8167  S  SD    . MET B 1 339 ? -27.744 -11.549 -0.569  1.00 37.91 ? 339 MET B SD    1 
ATOM   8168  C  CE    . MET B 1 339 ? -28.828 -12.971 -0.674  1.00 38.62 ? 339 MET B CE    1 
ATOM   8169  N  N     . LYS B 1 340 ? -26.606 -11.296 5.022   1.00 38.70 ? 340 LYS B N     1 
ATOM   8170  C  CA    . LYS B 1 340 ? -26.955 -11.460 6.424   1.00 39.89 ? 340 LYS B CA    1 
ATOM   8171  C  C     . LYS B 1 340 ? -27.480 -10.158 7.053   1.00 40.95 ? 340 LYS B C     1 
ATOM   8172  O  O     . LYS B 1 340 ? -28.389 -10.200 7.892   1.00 42.71 ? 340 LYS B O     1 
ATOM   8173  C  CB    . LYS B 1 340 ? -25.772 -12.047 7.219   1.00 39.88 ? 340 LYS B CB    1 
ATOM   8174  N  N     . ARG B 1 341 ? -26.930 -9.010  6.645   1.00 40.44 ? 341 ARG B N     1 
ATOM   8175  C  CA    . ARG B 1 341 ? -27.421 -7.706  7.121   1.00 40.85 ? 341 ARG B CA    1 
ATOM   8176  C  C     . ARG B 1 341 ? -28.792 -7.388  6.532   1.00 41.19 ? 341 ARG B C     1 
ATOM   8177  O  O     . ARG B 1 341 ? -29.619 -6.773  7.198   1.00 42.87 ? 341 ARG B O     1 
ATOM   8178  C  CB    . ARG B 1 341 ? -26.442 -6.571  6.806   1.00 40.54 ? 341 ARG B CB    1 
ATOM   8179  C  CG    . ARG B 1 341 ? -25.016 -6.735  7.352   1.00 39.91 ? 341 ARG B CG    1 
ATOM   8180  C  CD    . ARG B 1 341 ? -24.739 -5.799  8.507   1.00 41.21 ? 341 ARG B CD    1 
ATOM   8181  N  NE    . ARG B 1 341 ? -23.378 -5.905  9.046   1.00 40.86 ? 341 ARG B NE    1 
ATOM   8182  C  CZ    . ARG B 1 341 ? -22.499 -4.902  9.126   1.00 41.07 ? 341 ARG B CZ    1 
ATOM   8183  N  NH1   . ARG B 1 341 ? -22.800 -3.676  8.690   1.00 40.63 ? 341 ARG B NH1   1 
ATOM   8184  N  NH2   . ARG B 1 341 ? -21.302 -5.126  9.649   1.00 39.41 ? 341 ARG B NH2   1 
ATOM   8185  N  N     . VAL B 1 342 ? -29.037 -7.807  5.292   1.00 40.38 ? 342 VAL B N     1 
ATOM   8186  C  CA    . VAL B 1 342 ? -30.341 -7.597  4.646   1.00 40.75 ? 342 VAL B CA    1 
ATOM   8187  C  C     . VAL B 1 342 ? -31.441 -8.302  5.429   1.00 42.30 ? 342 VAL B C     1 
ATOM   8188  O  O     . VAL B 1 342 ? -32.445 -7.684  5.796   1.00 43.41 ? 342 VAL B O     1 
ATOM   8189  C  CB    . VAL B 1 342 ? -30.378 -8.084  3.157   1.00 39.53 ? 342 VAL B CB    1 
ATOM   8190  C  CG1   . VAL B 1 342 ? -31.799 -8.086  2.621   1.00 38.96 ? 342 VAL B CG1   1 
ATOM   8191  C  CG2   . VAL B 1 342 ? -29.513 -7.208  2.283   1.00 38.70 ? 342 VAL B CG2   1 
ATOM   8192  N  N     . GLU B 1 343 ? -31.245 -9.590  5.696   1.00 42.19 ? 343 GLU B N     1 
ATOM   8193  C  CA    . GLU B 1 343 ? -32.307 -10.374 6.307   1.00 44.16 ? 343 GLU B CA    1 
ATOM   8194  C  C     . GLU B 1 343 ? -32.497 -10.079 7.802   1.00 44.92 ? 343 GLU B C     1 
ATOM   8195  O  O     . GLU B 1 343 ? -33.608 -10.236 8.315   1.00 46.03 ? 343 GLU B O     1 
ATOM   8196  C  CB    . GLU B 1 343 ? -32.168 -11.880 5.989   1.00 43.52 ? 343 GLU B CB    1 
ATOM   8197  C  CG    . GLU B 1 343 ? -31.246 -12.698 6.895   1.00 44.64 ? 343 GLU B CG    1 
ATOM   8198  C  CD    . GLU B 1 343 ? -31.111 -14.150 6.431   1.00 44.78 ? 343 GLU B CD    1 
ATOM   8199  O  OE1   . GLU B 1 343 ? -32.111 -14.739 5.960   1.00 45.95 ? 343 GLU B OE1   1 
ATOM   8200  O  OE2   . GLU B 1 343 ? -29.991 -14.702 6.528   1.00 48.03 ? 343 GLU B OE2   1 
ATOM   8201  N  N     . THR B 1 344 ? -31.426 -9.634  8.473   1.00 44.37 ? 344 THR B N     1 
ATOM   8202  C  CA    . THR B 1 344 ? -31.501 -9.169  9.869   1.00 45.62 ? 344 THR B CA    1 
ATOM   8203  C  C     . THR B 1 344 ? -31.841 -7.680  9.981   1.00 46.05 ? 344 THR B C     1 
ATOM   8204  O  O     . THR B 1 344 ? -31.997 -7.163  11.086  1.00 47.06 ? 344 THR B O     1 
ATOM   8205  C  CB    . THR B 1 344 ? -30.187 -9.422  10.644  1.00 45.34 ? 344 THR B CB    1 
ATOM   8206  O  OG1   . THR B 1 344 ? -29.084 -8.890  9.901   1.00 44.56 ? 344 THR B OG1   1 
ATOM   8207  C  CG2   . THR B 1 344 ? -29.969 -10.903 10.860  1.00 46.01 ? 344 THR B CG2   1 
ATOM   8208  N  N     . ASN B 1 345 ? -31.930 -6.994  8.837   1.00 45.15 ? 345 ASN B N     1 
ATOM   8209  C  CA    . ASN B 1 345 ? -32.379 -5.592  8.770   1.00 45.40 ? 345 ASN B CA    1 
ATOM   8210  C  C     . ASN B 1 345 ? -31.415 -4.645  9.486   1.00 45.65 ? 345 ASN B C     1 
ATOM   8211  O  O     . ASN B 1 345 ? -31.825 -3.751  10.214  1.00 46.30 ? 345 ASN B O     1 
ATOM   8212  C  CB    . ASN B 1 345 ? -33.828 -5.460  9.286   1.00 46.90 ? 345 ASN B CB    1 
ATOM   8213  C  CG    . ASN B 1 345 ? -34.457 -4.105  8.978   1.00 47.33 ? 345 ASN B CG    1 
ATOM   8214  O  OD1   . ASN B 1 345 ? -34.120 -3.452  7.992   1.00 46.18 ? 345 ASN B OD1   1 
ATOM   8215  N  ND2   . ASN B 1 345 ? -35.385 -3.684  9.828   1.00 47.62 ? 345 ASN B ND2   1 
ATOM   8216  N  N     . GLN B 1 346 ? -30.120 -4.857  9.261   1.00 44.77 ? 346 GLN B N     1 
ATOM   8217  C  CA    . GLN B 1 346 ? -29.082 -4.031  9.868   1.00 45.46 ? 346 GLN B CA    1 
ATOM   8218  C  C     . GLN B 1 346 ? -28.574 -2.962  8.898   1.00 44.23 ? 346 GLN B C     1 
ATOM   8219  O  O     . GLN B 1 346 ? -29.037 -2.868  7.757   1.00 43.76 ? 346 GLN B O     1 
ATOM   8220  C  CB    . GLN B 1 346 ? -27.913 -4.906  10.320  1.00 44.45 ? 346 GLN B CB    1 
ATOM   8221  C  CG    . GLN B 1 346 ? -28.059 -5.550  11.699  1.00 47.54 ? 346 GLN B CG    1 
ATOM   8222  C  CD    . GLN B 1 346 ? -26.868 -6.467  12.014  1.00 47.69 ? 346 GLN B CD    1 
ATOM   8223  O  OE1   . GLN B 1 346 ? -26.954 -7.689  11.870  1.00 48.95 ? 346 GLN B OE1   1 
ATOM   8224  N  NE2   . GLN B 1 346 ? -25.737 -5.868  12.403  1.00 50.95 ? 346 GLN B NE2   1 
ATOM   8225  N  N     . ASP B 1 347 ? -27.614 -2.168  9.360   1.00 43.77 ? 347 ASP B N     1 
ATOM   8226  C  CA    . ASP B 1 347 ? -26.994 -1.147  8.537   1.00 43.13 ? 347 ASP B CA    1 
ATOM   8227  C  C     . ASP B 1 347 ? -25.901 -1.749  7.657   1.00 41.58 ? 347 ASP B C     1 
ATOM   8228  O  O     . ASP B 1 347 ? -25.323 -2.782  7.996   1.00 41.09 ? 347 ASP B O     1 
ATOM   8229  C  CB    . ASP B 1 347 ? -26.421 -0.031  9.413   1.00 43.96 ? 347 ASP B CB    1 
ATOM   8230  C  CG    . ASP B 1 347 ? -27.506 0.808   10.081  1.00 46.16 ? 347 ASP B CG    1 
ATOM   8231  O  OD1   . ASP B 1 347 ? -28.695 0.676   9.715   1.00 46.94 ? 347 ASP B OD1   1 
ATOM   8232  O  OD2   . ASP B 1 347 ? -27.168 1.613   10.975  1.00 48.53 ? 347 ASP B OD2   1 
ATOM   8233  N  N     . TRP B 1 348 ? -25.643 -1.096  6.524   1.00 40.31 ? 348 TRP B N     1 
ATOM   8234  C  CA    . TRP B 1 348 ? -24.612 -1.489  5.587   1.00 38.74 ? 348 TRP B CA    1 
ATOM   8235  C  C     . TRP B 1 348 ? -23.751 -0.269  5.350   1.00 38.86 ? 348 TRP B C     1 
ATOM   8236  O  O     . TRP B 1 348 ? -24.266 0.834   5.170   1.00 39.26 ? 348 TRP B O     1 
ATOM   8237  C  CB    . TRP B 1 348 ? -25.242 -1.957  4.269   1.00 38.05 ? 348 TRP B CB    1 
ATOM   8238  C  CG    . TRP B 1 348 ? -24.259 -2.415  3.213   1.00 36.43 ? 348 TRP B CG    1 
ATOM   8239  C  CD1   . TRP B 1 348 ? -24.013 -1.820  2.010   1.00 35.78 ? 348 TRP B CD1   1 
ATOM   8240  C  CD2   . TRP B 1 348 ? -23.404 -3.566  3.271   1.00 35.42 ? 348 TRP B CD2   1 
ATOM   8241  N  NE1   . TRP B 1 348 ? -23.055 -2.528  1.312   1.00 34.58 ? 348 TRP B NE1   1 
ATOM   8242  C  CE2   . TRP B 1 348 ? -22.667 -3.603  2.066   1.00 35.06 ? 348 TRP B CE2   1 
ATOM   8243  C  CE3   . TRP B 1 348 ? -23.180 -4.565  4.228   1.00 36.53 ? 348 TRP B CE3   1 
ATOM   8244  C  CZ2   . TRP B 1 348 ? -21.727 -4.609  1.792   1.00 35.00 ? 348 TRP B CZ2   1 
ATOM   8245  C  CZ3   . TRP B 1 348 ? -22.241 -5.568  3.953   1.00 34.18 ? 348 TRP B CZ3   1 
ATOM   8246  C  CH2   . TRP B 1 348 ? -21.528 -5.575  2.752   1.00 34.13 ? 348 TRP B CH2   1 
ATOM   8247  N  N     . SER B 1 349 ? -22.437 -0.460  5.367   1.00 38.52 ? 349 SER B N     1 
ATOM   8248  C  CA    . SER B 1 349 ? -21.518 0.662   5.235   1.00 38.58 ? 349 SER B CA    1 
ATOM   8249  C  C     . SER B 1 349 ? -20.993 0.681   3.835   1.00 37.81 ? 349 SER B C     1 
ATOM   8250  O  O     . SER B 1 349 ? -20.569 -0.348  3.314   1.00 36.98 ? 349 SER B O     1 
ATOM   8251  C  CB    . SER B 1 349 ? -20.359 0.551   6.217   1.00 38.66 ? 349 SER B CB    1 
ATOM   8252  O  OG    . SER B 1 349 ? -20.797 0.752   7.546   1.00 39.93 ? 349 SER B OG    1 
ATOM   8253  N  N     . LEU B 1 350 ? -21.040 1.855   3.217   1.00 38.21 ? 350 LEU B N     1 
ATOM   8254  C  CA    . LEU B 1 350 ? -20.481 2.027   1.894   1.00 37.68 ? 350 LEU B CA    1 
ATOM   8255  C  C     . LEU B 1 350 ? -19.099 2.642   2.026   1.00 38.12 ? 350 LEU B C     1 
ATOM   8256  O  O     . LEU B 1 350 ? -18.894 3.609   2.769   1.00 38.77 ? 350 LEU B O     1 
ATOM   8257  C  CB    . LEU B 1 350 ? -21.403 2.867   1.008   1.00 38.27 ? 350 LEU B CB    1 
ATOM   8258  C  CG    . LEU B 1 350 ? -22.800 2.298   0.713   1.00 37.88 ? 350 LEU B CG    1 
ATOM   8259  C  CD1   . LEU B 1 350 ? -23.637 3.263   -0.145  1.00 37.63 ? 350 LEU B CD1   1 
ATOM   8260  C  CD2   . LEU B 1 350 ? -22.687 0.948   0.041   1.00 36.44 ? 350 LEU B CD2   1 
ATOM   8261  N  N     . MET B 1 351 ? -18.148 2.062   1.311   1.00 37.45 ? 351 MET B N     1 
ATOM   8262  C  CA    . MET B 1 351 ? -16.756 2.426   1.480   1.00 38.24 ? 351 MET B CA    1 
ATOM   8263  C  C     . MET B 1 351 ? -16.081 2.815   0.167   1.00 38.33 ? 351 MET B C     1 
ATOM   8264  O  O     . MET B 1 351 ? -16.510 2.413   -0.926  1.00 37.96 ? 351 MET B O     1 
ATOM   8265  C  CB    . MET B 1 351 ? -16.001 1.268   2.163   1.00 37.42 ? 351 MET B CB    1 
ATOM   8266  C  CG    . MET B 1 351 ? -16.420 1.031   3.609   1.00 37.76 ? 351 MET B CG    1 
ATOM   8267  S  SD    . MET B 1 351 ? -15.736 -0.469  4.332   1.00 38.21 ? 351 MET B SD    1 
ATOM   8268  C  CE    . MET B 1 351 ? -16.443 -0.412  5.975   1.00 37.78 ? 351 MET B CE    1 
ATOM   8269  N  N     . CYS B 1 352 ? -15.027 3.612   0.280   1.00 39.34 ? 352 CYS B N     1 
ATOM   8270  C  CA    . CYS B 1 352 ? -14.132 3.824   -0.843  1.00 39.47 ? 352 CYS B CA    1 
ATOM   8271  C  C     . CYS B 1 352 ? -12.929 2.885   -0.661  1.00 39.46 ? 352 CYS B C     1 
ATOM   8272  O  O     . CYS B 1 352 ? -12.327 2.866   0.412   1.00 39.60 ? 352 CYS B O     1 
ATOM   8273  C  CB    . CYS B 1 352 ? -13.706 5.281   -0.930  1.00 40.26 ? 352 CYS B CB    1 
ATOM   8274  S  SG    . CYS B 1 352 ? -12.466 5.565   -2.192  1.00 41.47 ? 352 CYS B SG    1 
ATOM   8275  N  N     . PRO B 1 353 ? -12.599 2.079   -1.696  1.00 39.14 ? 353 PRO B N     1 
ATOM   8276  C  CA    . PRO B 1 353 ? -11.492 1.112   -1.601  1.00 39.27 ? 353 PRO B CA    1 
ATOM   8277  C  C     . PRO B 1 353 ? -10.127 1.750   -1.309  1.00 40.59 ? 353 PRO B C     1 
ATOM   8278  O  O     . PRO B 1 353 ? -9.234  1.075   -0.814  1.00 40.62 ? 353 PRO B O     1 
ATOM   8279  C  CB    . PRO B 1 353 ? -11.477 0.459   -2.991  1.00 38.56 ? 353 PRO B CB    1 
ATOM   8280  C  CG    . PRO B 1 353 ? -12.167 1.445   -3.880  1.00 38.22 ? 353 PRO B CG    1 
ATOM   8281  C  CD    . PRO B 1 353 ? -13.239 2.029   -3.021  1.00 38.43 ? 353 PRO B CD    1 
ATOM   8282  N  N     . ASN B 1 354 ? -9.978  3.031   -1.632  1.00 42.09 ? 354 ASN B N     1 
ATOM   8283  C  CA    . ASN B 1 354 ? -8.768  3.787   -1.326  1.00 43.86 ? 354 ASN B CA    1 
ATOM   8284  C  C     . ASN B 1 354 ? -8.672  4.088   0.175   1.00 45.10 ? 354 ASN B C     1 
ATOM   8285  O  O     . ASN B 1 354 ? -7.573  4.111   0.740   1.00 45.98 ? 354 ASN B O     1 
ATOM   8286  C  CB    . ASN B 1 354 ? -8.734  5.086   -2.145  1.00 44.40 ? 354 ASN B CB    1 
ATOM   8287  C  CG    . ASN B 1 354 ? -7.405  5.845   -2.013  1.00 46.33 ? 354 ASN B CG    1 
ATOM   8288  O  OD1   . ASN B 1 354 ? -6.324  5.304   -2.278  1.00 46.66 ? 354 ASN B OD1   1 
ATOM   8289  N  ND2   . ASN B 1 354 ? -7.490  7.105   -1.613  1.00 45.43 ? 354 ASN B ND2   1 
ATOM   8290  N  N     . GLU B 1 355 ? -9.823  4.323   0.811   1.00 45.29 ? 355 GLU B N     1 
ATOM   8291  C  CA    . GLU B 1 355 ? -9.884  4.553   2.254   1.00 46.43 ? 355 GLU B CA    1 
ATOM   8292  C  C     . GLU B 1 355 ? -9.872  3.232   3.004   1.00 45.62 ? 355 GLU B C     1 
ATOM   8293  O  O     . GLU B 1 355 ? -9.439  3.153   4.157   1.00 46.33 ? 355 GLU B O     1 
ATOM   8294  C  CB    . GLU B 1 355 ? -11.156 5.309   2.627   1.00 46.70 ? 355 GLU B CB    1 
ATOM   8295  C  CG    . GLU B 1 355 ? -11.101 6.809   2.408   1.00 48.82 ? 355 GLU B CG    1 
ATOM   8296  C  CD    . GLU B 1 355 ? -12.473 7.461   2.558   1.00 49.20 ? 355 GLU B CD    1 
ATOM   8297  O  OE1   . GLU B 1 355 ? -13.153 7.194   3.588   1.00 49.58 ? 355 GLU B OE1   1 
ATOM   8298  O  OE2   . GLU B 1 355 ? -12.856 8.234   1.641   1.00 49.50 ? 355 GLU B OE2   1 
ATOM   8299  N  N     . CYS B 1 356 ? -10.368 2.201   2.333   1.00 44.29 ? 356 CYS B N     1 
ATOM   8300  C  CA    . CYS B 1 356 ? -10.558 0.903   2.925   1.00 43.53 ? 356 CYS B CA    1 
ATOM   8301  C  C     . CYS B 1 356 ? -10.004 -0.152  1.984   1.00 43.00 ? 356 CYS B C     1 
ATOM   8302  O  O     . CYS B 1 356 ? -10.767 -0.879  1.361   1.00 42.23 ? 356 CYS B O     1 
ATOM   8303  C  CB    . CYS B 1 356 ? -12.050 0.682   3.178   1.00 43.24 ? 356 CYS B CB    1 
ATOM   8304  S  SG    . CYS B 1 356 ? -12.766 1.963   4.228   1.00 43.53 ? 356 CYS B SG    1 
ATOM   8305  N  N     . PRO B 1 357 ? -8.664  -0.230  1.865   1.00 43.80 ? 357 PRO B N     1 
ATOM   8306  C  CA    . PRO B 1 357 ? -8.062  -1.113  0.869   1.00 43.58 ? 357 PRO B CA    1 
ATOM   8307  C  C     . PRO B 1 357 ? -8.176  -2.599  1.185   1.00 43.26 ? 357 PRO B C     1 
ATOM   8308  O  O     . PRO B 1 357 ? -8.284  -2.980  2.350   1.00 43.73 ? 357 PRO B O     1 
ATOM   8309  C  CB    . PRO B 1 357 ? -6.590  -0.688  0.871   1.00 44.35 ? 357 PRO B CB    1 
ATOM   8310  C  CG    . PRO B 1 357 ? -6.362  -0.151  2.222   1.00 45.21 ? 357 PRO B CG    1 
ATOM   8311  C  CD    . PRO B 1 357 ? -7.640  0.514   2.625   1.00 44.83 ? 357 PRO B CD    1 
ATOM   8312  N  N     . GLY B 1 358 ? -8.159  -3.415  0.135   1.00 42.71 ? 358 GLY B N     1 
ATOM   8313  C  CA    . GLY B 1 358 ? -8.009  -4.863  0.264   1.00 42.51 ? 358 GLY B CA    1 
ATOM   8314  C  C     . GLY B 1 358 ? -9.263  -5.666  0.542   1.00 41.90 ? 358 GLY B C     1 
ATOM   8315  O  O     . GLY B 1 358 ? -9.172  -6.858  0.832   1.00 42.02 ? 358 GLY B O     1 
ATOM   8316  N  N     . LEU B 1 359 ? -10.426 -5.019  0.467   1.00 41.70 ? 359 LEU B N     1 
ATOM   8317  C  CA    . LEU B 1 359 ? -11.715 -5.683  0.679   1.00 41.00 ? 359 LEU B CA    1 
ATOM   8318  C  C     . LEU B 1 359 ? -12.018 -6.706  -0.408  1.00 40.52 ? 359 LEU B C     1 
ATOM   8319  O  O     . LEU B 1 359 ? -12.687 -7.708  -0.146  1.00 40.20 ? 359 LEU B O     1 
ATOM   8320  C  CB    . LEU B 1 359 ? -12.842 -4.655  0.750   1.00 40.99 ? 359 LEU B CB    1 
ATOM   8321  C  CG    . LEU B 1 359 ? -13.514 -4.211  2.060   1.00 41.92 ? 359 LEU B CG    1 
ATOM   8322  C  CD1   . LEU B 1 359 ? -12.658 -4.398  3.305   1.00 41.00 ? 359 LEU B CD1   1 
ATOM   8323  C  CD2   . LEU B 1 359 ? -14.026 -2.774  1.941   1.00 41.49 ? 359 LEU B CD2   1 
ATOM   8324  N  N     . ASP B 1 360 ? -11.528 -6.461  -1.619  1.00 40.69 ? 360 ASP B N     1 
ATOM   8325  C  CA    . ASP B 1 360 ? -11.719 -7.403  -2.725  1.00 41.08 ? 360 ASP B CA    1 
ATOM   8326  C  C     . ASP B 1 360 ? -10.691 -8.563  -2.726  1.00 41.21 ? 360 ASP B C     1 
ATOM   8327  O  O     . ASP B 1 360 ? -10.856 -9.552  -3.446  1.00 40.53 ? 360 ASP B O     1 
ATOM   8328  C  CB    . ASP B 1 360 ? -11.708 -6.662  -4.072  1.00 41.34 ? 360 ASP B CB    1 
ATOM   8329  C  CG    . ASP B 1 360 ? -10.394 -5.938  -4.337  1.00 43.91 ? 360 ASP B CG    1 
ATOM   8330  O  OD1   . ASP B 1 360 ? -10.031 -5.771  -5.527  1.00 45.54 ? 360 ASP B OD1   1 
ATOM   8331  O  OD2   . ASP B 1 360 ? -9.716  -5.534  -3.357  1.00 47.23 ? 360 ASP B OD2   1 
ATOM   8332  N  N     . GLU B 1 361 ? -9.643  -8.426  -1.914  1.00 42.14 ? 361 GLU B N     1 
ATOM   8333  C  CA    . GLU B 1 361 ? -8.533  -9.389  -1.861  1.00 42.98 ? 361 GLU B CA    1 
ATOM   8334  C  C     . GLU B 1 361 ? -8.678  -10.405 -0.742  1.00 42.49 ? 361 GLU B C     1 
ATOM   8335  O  O     . GLU B 1 361 ? -7.725  -11.085 -0.375  1.00 43.26 ? 361 GLU B O     1 
ATOM   8336  C  CB    . GLU B 1 361 ? -7.205  -8.652  -1.701  1.00 43.78 ? 361 GLU B CB    1 
ATOM   8337  C  CG    . GLU B 1 361 ? -6.325  -8.774  -2.915  1.00 46.89 ? 361 GLU B CG    1 
ATOM   8338  C  CD    . GLU B 1 361 ? -5.758  -7.444  -3.362  1.00 51.00 ? 361 GLU B CD    1 
ATOM   8339  O  OE1   . GLU B 1 361 ? -5.385  -6.606  -2.499  1.00 52.18 ? 361 GLU B OE1   1 
ATOM   8340  O  OE2   . GLU B 1 361 ? -5.679  -7.250  -4.594  1.00 52.59 ? 361 GLU B OE2   1 
ATOM   8341  N  N     . VAL B 1 362 ? -9.895  -10.515 -0.233  1.00 41.60 ? 362 VAL B N     1 
ATOM   8342  C  CA    . VAL B 1 362 ? -10.163 -11.163 1.029   1.00 41.27 ? 362 VAL B CA    1 
ATOM   8343  C  C     . VAL B 1 362 ? -11.629 -11.612 0.985   1.00 40.45 ? 362 VAL B C     1 
ATOM   8344  O  O     . VAL B 1 362 ? -12.487 -10.871 0.498   1.00 39.61 ? 362 VAL B O     1 
ATOM   8345  C  CB    . VAL B 1 362 ? -9.838  -10.140 2.153   1.00 42.06 ? 362 VAL B CB    1 
ATOM   8346  C  CG1   . VAL B 1 362 ? -11.016 -9.775  2.976   1.00 41.13 ? 362 VAL B CG1   1 
ATOM   8347  C  CG2   . VAL B 1 362 ? -8.638  -10.572 2.989   1.00 43.16 ? 362 VAL B CG2   1 
ATOM   8348  N  N     . TRP B 1 363 ? -11.904 -12.833 1.445   1.00 40.25 ? 363 TRP B N     1 
ATOM   8349  C  CA    . TRP B 1 363 ? -13.279 -13.373 1.464   1.00 39.57 ? 363 TRP B CA    1 
ATOM   8350  C  C     . TRP B 1 363 ? -13.626 -13.984 2.809   1.00 40.27 ? 363 TRP B C     1 
ATOM   8351  O  O     . TRP B 1 363 ? -12.744 -14.192 3.645   1.00 40.50 ? 363 TRP B O     1 
ATOM   8352  C  CB    . TRP B 1 363 ? -13.506 -14.412 0.345   1.00 38.54 ? 363 TRP B CB    1 
ATOM   8353  C  CG    . TRP B 1 363 ? -12.662 -15.666 0.449   1.00 38.79 ? 363 TRP B CG    1 
ATOM   8354  C  CD1   . TRP B 1 363 ? -11.429 -15.875 -0.116  1.00 38.59 ? 363 TRP B CD1   1 
ATOM   8355  C  CD2   . TRP B 1 363 ? -12.991 -16.884 1.149   1.00 38.80 ? 363 TRP B CD2   1 
ATOM   8356  N  NE1   . TRP B 1 363 ? -10.973 -17.138 0.191   1.00 38.60 ? 363 TRP B NE1   1 
ATOM   8357  C  CE2   . TRP B 1 363 ? -11.908 -17.777 0.966   1.00 38.92 ? 363 TRP B CE2   1 
ATOM   8358  C  CE3   . TRP B 1 363 ? -14.093 -17.304 1.913   1.00 38.55 ? 363 TRP B CE3   1 
ATOM   8359  C  CZ2   . TRP B 1 363 ? -11.893 -19.064 1.524   1.00 39.22 ? 363 TRP B CZ2   1 
ATOM   8360  C  CZ3   . TRP B 1 363 ? -14.078 -18.584 2.468   1.00 38.80 ? 363 TRP B CZ3   1 
ATOM   8361  C  CH2   . TRP B 1 363 ? -12.980 -19.446 2.271   1.00 39.69 ? 363 TRP B CH2   1 
ATOM   8362  N  N     . GLY B 1 364 ? -14.916 -14.276 2.997   1.00 40.39 ? 364 GLY B N     1 
ATOM   8363  C  CA    . GLY B 1 364 ? -15.418 -14.987 4.179   1.00 41.37 ? 364 GLY B CA    1 
ATOM   8364  C  C     . GLY B 1 364 ? -15.126 -14.274 5.480   1.00 42.60 ? 364 GLY B C     1 
ATOM   8365  O  O     . GLY B 1 364 ? -15.250 -13.049 5.556   1.00 42.89 ? 364 GLY B O     1 
ATOM   8366  N  N     . GLU B 1 365 ? -14.731 -15.042 6.497   1.00 43.68 ? 365 GLU B N     1 
ATOM   8367  C  CA    . GLU B 1 365 ? -14.413 -14.512 7.829   1.00 45.33 ? 365 GLU B CA    1 
ATOM   8368  C  C     . GLU B 1 365 ? -13.336 -13.429 7.809   1.00 45.13 ? 365 GLU B C     1 
ATOM   8369  O  O     . GLU B 1 365 ? -13.435 -12.438 8.530   1.00 45.50 ? 365 GLU B O     1 
ATOM   8370  C  CB    . GLU B 1 365 ? -14.022 -15.645 8.788   1.00 46.72 ? 365 GLU B CB    1 
ATOM   8371  C  CG    . GLU B 1 365 ? -15.181 -16.144 9.663   1.00 50.99 ? 365 GLU B CG    1 
ATOM   8372  C  CD    . GLU B 1 365 ? -15.226 -17.669 9.801   1.00 56.18 ? 365 GLU B CD    1 
ATOM   8373  O  OE1   . GLU B 1 365 ? -14.367 -18.247 10.521  1.00 57.80 ? 365 GLU B OE1   1 
ATOM   8374  O  OE2   . GLU B 1 365 ? -16.138 -18.287 9.186   1.00 56.60 ? 365 GLU B OE2   1 
ATOM   8375  N  N     . GLU B 1 366 ? -12.320 -13.608 6.973   1.00 44.42 ? 366 GLU B N     1 
ATOM   8376  C  CA    . GLU B 1 366 ? -11.286 -12.597 6.812   1.00 44.86 ? 366 GLU B CA    1 
ATOM   8377  C  C     . GLU B 1 366 ? -11.872 -11.258 6.301   1.00 43.28 ? 366 GLU B C     1 
ATOM   8378  O  O     . GLU B 1 366 ? -11.534 -10.183 6.823   1.00 43.98 ? 366 GLU B O     1 
ATOM   8379  C  CB    . GLU B 1 366 ? -10.174 -13.120 5.897   1.00 44.41 ? 366 GLU B CB    1 
ATOM   8380  C  CG    . GLU B 1 366 ? -8.832  -12.457 6.144   1.00 47.13 ? 366 GLU B CG    1 
ATOM   8381  C  CD    . GLU B 1 366 ? -7.697  -13.094 5.347   1.00 48.03 ? 366 GLU B CD    1 
ATOM   8382  O  OE1   . GLU B 1 366 ? -6.674  -12.400 5.107   1.00 50.80 ? 366 GLU B OE1   1 
ATOM   8383  O  OE2   . GLU B 1 366 ? -7.825  -14.282 4.966   1.00 50.25 ? 366 GLU B OE2   1 
ATOM   8384  N  N     . PHE B 1 367 ? -12.770 -11.333 5.316   1.00 41.11 ? 367 PHE B N     1 
ATOM   8385  C  CA    . PHE B 1 367 ? -13.497 -10.150 4.851   1.00 39.85 ? 367 PHE B CA    1 
ATOM   8386  C  C     . PHE B 1 367 ? -14.304 -9.493  5.962   1.00 40.58 ? 367 PHE B C     1 
ATOM   8387  O  O     . PHE B 1 367 ? -14.208 -8.284  6.173   1.00 40.76 ? 367 PHE B O     1 
ATOM   8388  C  CB    . PHE B 1 367 ? -14.427 -10.461 3.666   1.00 37.91 ? 367 PHE B CB    1 
ATOM   8389  C  CG    . PHE B 1 367 ? -15.324 -9.313  3.308   1.00 36.60 ? 367 PHE B CG    1 
ATOM   8390  C  CD1   . PHE B 1 367 ? -16.598 -9.199  3.874   1.00 35.24 ? 367 PHE B CD1   1 
ATOM   8391  C  CD2   . PHE B 1 367 ? -14.879 -8.308  2.448   1.00 34.79 ? 367 PHE B CD2   1 
ATOM   8392  C  CE1   . PHE B 1 367 ? -17.425 -8.118  3.573   1.00 34.51 ? 367 PHE B CE1   1 
ATOM   8393  C  CE2   . PHE B 1 367 ? -15.698 -7.229  2.138   1.00 34.27 ? 367 PHE B CE2   1 
ATOM   8394  C  CZ    . PHE B 1 367 ? -16.980 -7.133  2.702   1.00 34.38 ? 367 PHE B CZ    1 
ATOM   8395  N  N     . GLU B 1 368 ? -15.115 -10.295 6.648   1.00 40.87 ? 368 GLU B N     1 
ATOM   8396  C  CA    . GLU B 1 368 ? -16.041 -9.780  7.651   1.00 42.25 ? 368 GLU B CA    1 
ATOM   8397  C  C     . GLU B 1 368 ? -15.270 -9.102  8.766   1.00 42.95 ? 368 GLU B C     1 
ATOM   8398  O  O     . GLU B 1 368 ? -15.703 -8.081  9.293   1.00 43.64 ? 368 GLU B O     1 
ATOM   8399  C  CB    . GLU B 1 368 ? -16.967 -10.892 8.162   1.00 42.35 ? 368 GLU B CB    1 
ATOM   8400  C  CG    . GLU B 1 368 ? -17.889 -11.435 7.043   1.00 42.79 ? 368 GLU B CG    1 
ATOM   8401  C  CD    . GLU B 1 368 ? -18.791 -12.588 7.465   1.00 43.35 ? 368 GLU B CD    1 
ATOM   8402  O  OE1   . GLU B 1 368 ? -19.200 -13.379 6.577   1.00 43.85 ? 368 GLU B OE1   1 
ATOM   8403  O  OE2   . GLU B 1 368 ? -19.105 -12.704 8.671   1.00 46.28 ? 368 GLU B OE2   1 
ATOM   8404  N  N     . LYS B 1 369 ? -14.094 -9.645  9.067   1.00 43.18 ? 369 LYS B N     1 
ATOM   8405  C  CA    . LYS B 1 369 ? -13.209 -9.083  10.070  1.00 44.01 ? 369 LYS B CA    1 
ATOM   8406  C  C     . LYS B 1 369 ? -12.575 -7.768  9.601   1.00 43.21 ? 369 LYS B C     1 
ATOM   8407  O  O     . LYS B 1 369 ? -12.564 -6.796  10.348  1.00 43.92 ? 369 LYS B O     1 
ATOM   8408  C  CB    . LYS B 1 369 ? -12.147 -10.113 10.471  1.00 45.07 ? 369 LYS B CB    1 
ATOM   8409  C  CG    . LYS B 1 369 ? -11.288 -9.704  11.663  1.00 48.92 ? 369 LYS B CG    1 
ATOM   8410  C  CD    . LYS B 1 369 ? -10.663 -10.931 12.356  1.00 53.57 ? 369 LYS B CD    1 
ATOM   8411  C  CE    . LYS B 1 369 ? -9.238  -11.204 11.854  1.00 55.63 ? 369 LYS B CE    1 
ATOM   8412  N  NZ    . LYS B 1 369 ? -8.251  -10.236 12.427  1.00 56.43 ? 369 LYS B NZ    1 
ATOM   8413  N  N     . LEU B 1 370 ? -12.055 -7.734  8.372   1.00 41.47 ? 370 LEU B N     1 
ATOM   8414  C  CA    . LEU B 1 370 ? -11.462 -6.515  7.837   1.00 40.74 ? 370 LEU B CA    1 
ATOM   8415  C  C     . LEU B 1 370 ? -12.508 -5.410  7.692   1.00 40.54 ? 370 LEU B C     1 
ATOM   8416  O  O     . LEU B 1 370 ? -12.264 -4.267  8.074   1.00 41.06 ? 370 LEU B O     1 
ATOM   8417  C  CB    . LEU B 1 370 ? -10.762 -6.772  6.493   1.00 40.44 ? 370 LEU B CB    1 
ATOM   8418  C  CG    . LEU B 1 370 ? -10.026 -5.595  5.829   1.00 40.16 ? 370 LEU B CG    1 
ATOM   8419  C  CD1   . LEU B 1 370 ? -8.857  -5.102  6.683   1.00 41.09 ? 370 LEU B CD1   1 
ATOM   8420  C  CD2   . LEU B 1 370 ? -9.545  -5.945  4.427   1.00 38.96 ? 370 LEU B CD2   1 
ATOM   8421  N  N     . TYR B 1 371 ? -13.672 -5.773  7.157   1.00 39.39 ? 371 TYR B N     1 
ATOM   8422  C  CA    . TYR B 1 371 ? -14.785 -4.850  6.973   1.00 39.26 ? 371 TYR B CA    1 
ATOM   8423  C  C     . TYR B 1 371 ? -15.300 -4.301  8.301   1.00 40.15 ? 371 TYR B C     1 
ATOM   8424  O  O     . TYR B 1 371 ? -15.597 -3.113  8.398   1.00 40.96 ? 371 TYR B O     1 
ATOM   8425  C  CB    . TYR B 1 371 ? -15.909 -5.552  6.205   1.00 38.52 ? 371 TYR B CB    1 
ATOM   8426  C  CG    . TYR B 1 371 ? -17.129 -4.710  5.883   1.00 38.15 ? 371 TYR B CG    1 
ATOM   8427  C  CD1   . TYR B 1 371 ? -17.156 -3.881  4.754   1.00 37.81 ? 371 TYR B CD1   1 
ATOM   8428  C  CD2   . TYR B 1 371 ? -18.272 -4.774  6.680   1.00 39.06 ? 371 TYR B CD2   1 
ATOM   8429  C  CE1   . TYR B 1 371 ? -18.282 -3.115  4.443   1.00 37.37 ? 371 TYR B CE1   1 
ATOM   8430  C  CE2   . TYR B 1 371 ? -19.408 -4.017  6.378   1.00 39.50 ? 371 TYR B CE2   1 
ATOM   8431  C  CZ    . TYR B 1 371 ? -19.401 -3.192  5.258   1.00 38.52 ? 371 TYR B CZ    1 
ATOM   8432  O  OH    . TYR B 1 371 ? -20.515 -2.456  4.956   1.00 38.90 ? 371 TYR B OH    1 
ATOM   8433  N  N     . ALA B 1 372 ? -15.404 -5.155  9.318   1.00 40.35 ? 372 ALA B N     1 
ATOM   8434  C  CA    . ALA B 1 372 ? -15.898 -4.715  10.629  1.00 41.67 ? 372 ALA B CA    1 
ATOM   8435  C  C     . ALA B 1 372 ? -14.951 -3.740  11.327  1.00 42.78 ? 372 ALA B C     1 
ATOM   8436  O  O     . ALA B 1 372 ? -15.414 -2.847  12.045  1.00 43.85 ? 372 ALA B O     1 
ATOM   8437  C  CB    . ALA B 1 372 ? -16.211 -5.904  11.541  1.00 41.68 ? 372 ALA B CB    1 
ATOM   8438  N  N     . SER B 1 373 ? -13.641 -3.894  11.129  1.00 42.88 ? 373 SER B N     1 
ATOM   8439  C  CA    . SER B 1 373 ? -12.695 -2.960  11.755  1.00 44.67 ? 373 SER B CA    1 
ATOM   8440  C  C     . SER B 1 373 ? -12.677 -1.601  11.055  1.00 44.25 ? 373 SER B C     1 
ATOM   8441  O  O     . SER B 1 373 ? -12.520 -0.569  11.718  1.00 45.52 ? 373 SER B O     1 
ATOM   8442  C  CB    . SER B 1 373 ? -11.280 -3.551  11.920  1.00 45.22 ? 373 SER B CB    1 
ATOM   8443  O  OG    . SER B 1 373 ? -10.515 -3.462  10.725  1.00 46.39 ? 373 SER B OG    1 
ATOM   8444  N  N     . TYR B 1 374 ? -12.863 -1.591  9.734   1.00 42.96 ? 374 TYR B N     1 
ATOM   8445  C  CA    . TYR B 1 374 ? -13.014 -0.330  9.004   1.00 42.54 ? 374 TYR B CA    1 
ATOM   8446  C  C     . TYR B 1 374 ? -14.234 0.439   9.497   1.00 42.94 ? 374 TYR B C     1 
ATOM   8447  O  O     . TYR B 1 374 ? -14.176 1.655   9.653   1.00 44.06 ? 374 TYR B O     1 
ATOM   8448  C  CB    . TYR B 1 374 ? -13.121 -0.550  7.496   1.00 41.18 ? 374 TYR B CB    1 
ATOM   8449  C  CG    . TYR B 1 374 ? -11.830 -0.906  6.787   1.00 40.71 ? 374 TYR B CG    1 
ATOM   8450  C  CD1   . TYR B 1 374 ? -11.861 -1.628  5.596   1.00 38.55 ? 374 TYR B CD1   1 
ATOM   8451  C  CD2   . TYR B 1 374 ? -10.584 -0.534  7.302   1.00 40.70 ? 374 TYR B CD2   1 
ATOM   8452  C  CE1   . TYR B 1 374 ? -10.700 -1.968  4.936   1.00 38.34 ? 374 TYR B CE1   1 
ATOM   8453  C  CE2   . TYR B 1 374 ? -9.412  -0.878  6.644   1.00 40.68 ? 374 TYR B CE2   1 
ATOM   8454  C  CZ    . TYR B 1 374 ? -9.481  -1.593  5.453   1.00 39.96 ? 374 TYR B CZ    1 
ATOM   8455  O  OH    . TYR B 1 374 ? -8.336  -1.951  4.770   1.00 39.97 ? 374 TYR B OH    1 
ATOM   8456  N  N     . GLU B 1 375 ? -15.330 -0.273  9.741   1.00 42.88 ? 375 GLU B N     1 
ATOM   8457  C  CA    . GLU B 1 375 ? -16.529 0.315   10.331  1.00 43.89 ? 375 GLU B CA    1 
ATOM   8458  C  C     . GLU B 1 375 ? -16.224 0.871   11.716  1.00 45.34 ? 375 GLU B C     1 
ATOM   8459  O  O     . GLU B 1 375 ? -16.584 2.010   12.013  1.00 46.35 ? 375 GLU B O     1 
ATOM   8460  C  CB    . GLU B 1 375 ? -17.668 -0.709  10.427  1.00 43.59 ? 375 GLU B CB    1 
ATOM   8461  C  CG    . GLU B 1 375 ? -18.376 -1.041  9.115   1.00 42.15 ? 375 GLU B CG    1 
ATOM   8462  C  CD    . GLU B 1 375 ? -19.551 -2.001  9.307   1.00 42.92 ? 375 GLU B CD    1 
ATOM   8463  O  OE1   . GLU B 1 375 ? -20.686 -1.638  8.925   1.00 44.00 ? 375 GLU B OE1   1 
ATOM   8464  O  OE2   . GLU B 1 375 ? -19.353 -3.121  9.840   1.00 43.35 ? 375 GLU B OE2   1 
ATOM   8465  N  N     . LYS B 1 376 ? -15.547 0.082   12.552  1.00 46.02 ? 376 LYS B N     1 
ATOM   8466  C  CA    . LYS B 1 376 ? -15.213 0.522   13.918  1.00 47.94 ? 376 LYS B CA    1 
ATOM   8467  C  C     . LYS B 1 376 ? -14.269 1.723   13.935  1.00 48.84 ? 376 LYS B C     1 
ATOM   8468  O  O     . LYS B 1 376 ? -14.385 2.597   14.803  1.00 49.94 ? 376 LYS B O     1 
ATOM   8469  C  CB    . LYS B 1 376 ? -14.646 -0.624  14.767  1.00 48.47 ? 376 LYS B CB    1 
ATOM   8470  N  N     . GLN B 1 377 ? -13.354 1.780   12.968  1.00 48.37 ? 377 GLN B N     1 
ATOM   8471  C  CA    . GLN B 1 377 ? -12.434 2.919   12.865  1.00 49.24 ? 377 GLN B CA    1 
ATOM   8472  C  C     . GLN B 1 377 ? -13.109 4.160   12.271  1.00 49.45 ? 377 GLN B C     1 
ATOM   8473  O  O     . GLN B 1 377 ? -12.461 5.186   12.084  1.00 50.23 ? 377 GLN B O     1 
ATOM   8474  C  CB    . GLN B 1 377 ? -11.194 2.544   12.047  1.00 48.66 ? 377 GLN B CB    1 
ATOM   8475  C  CG    . GLN B 1 377 ? -10.395 1.364   12.610  1.00 48.92 ? 377 GLN B CG    1 
ATOM   8476  C  CD    . GLN B 1 377 ? -9.453  0.749   11.587  1.00 48.42 ? 377 GLN B CD    1 
ATOM   8477  O  OE1   . GLN B 1 377 ? -8.669  1.452   10.951  1.00 48.88 ? 377 GLN B OE1   1 
ATOM   8478  N  NE2   . GLN B 1 377 ? -9.525  -0.575  11.428  1.00 48.20 ? 377 GLN B NE2   1 
ATOM   8479  N  N     . GLY B 1 378 ? -14.407 4.065   11.979  1.00 49.17 ? 378 GLY B N     1 
ATOM   8480  C  CA    . GLY B 1 378 ? -15.138 5.145   11.305  1.00 49.14 ? 378 GLY B CA    1 
ATOM   8481  C  C     . GLY B 1 378 ? -14.684 5.423   9.874   1.00 48.50 ? 378 GLY B C     1 
ATOM   8482  O  O     . GLY B 1 378 ? -14.918 6.511   9.350   1.00 48.83 ? 378 GLY B O     1 
ATOM   8483  N  N     . ARG B 1 379 ? -14.028 4.450   9.241   1.00 47.58 ? 379 ARG B N     1 
ATOM   8484  C  CA    . ARG B 1 379 ? -13.594 4.590   7.851   1.00 47.07 ? 379 ARG B CA    1 
ATOM   8485  C  C     . ARG B 1 379 ? -14.766 4.193   6.949   1.00 46.05 ? 379 ARG B C     1 
ATOM   8486  O  O     . ARG B 1 379 ? -14.721 3.163   6.272   1.00 45.12 ? 379 ARG B O     1 
ATOM   8487  C  CB    . ARG B 1 379 ? -12.395 3.681   7.542   1.00 46.58 ? 379 ARG B CB    1 
ATOM   8488  C  CG    . ARG B 1 379 ? -11.320 3.580   8.613   1.00 48.44 ? 379 ARG B CG    1 
ATOM   8489  C  CD    . ARG B 1 379 ? -10.044 4.304   8.232   1.00 50.56 ? 379 ARG B CD    1 
ATOM   8490  N  NE    . ARG B 1 379 ? -9.312  3.654   7.138   1.00 50.70 ? 379 ARG B NE    1 
ATOM   8491  C  CZ    . ARG B 1 379 ? -8.384  2.706   7.284   1.00 50.80 ? 379 ARG B CZ    1 
ATOM   8492  N  NH1   . ARG B 1 379 ? -8.055  2.255   8.486   1.00 51.17 ? 379 ARG B NH1   1 
ATOM   8493  N  NH2   . ARG B 1 379 ? -7.779  2.206   6.216   1.00 49.85 ? 379 ARG B NH2   1 
ATOM   8494  N  N     . VAL B 1 380 ? -15.826 4.996   6.967   1.00 46.03 ? 380 VAL B N     1 
ATOM   8495  C  CA    . VAL B 1 380 ? -17.007 4.741   6.140   1.00 45.14 ? 380 VAL B CA    1 
ATOM   8496  C  C     . VAL B 1 380 ? -17.544 6.044   5.563   1.00 45.42 ? 380 VAL B C     1 
ATOM   8497  O  O     . VAL B 1 380 ? -17.609 7.059   6.245   1.00 46.57 ? 380 VAL B O     1 
ATOM   8498  C  CB    . VAL B 1 380 ? -18.118 3.884   6.871   1.00 44.96 ? 380 VAL B CB    1 
ATOM   8499  C  CG1   . VAL B 1 380 ? -17.932 3.871   8.364   1.00 46.76 ? 380 VAL B CG1   1 
ATOM   8500  C  CG2   . VAL B 1 380 ? -19.525 4.345   6.516   1.00 45.13 ? 380 VAL B CG2   1 
ATOM   8501  N  N     . ARG B 1 381 ? -17.903 6.006   4.286   1.00 44.47 ? 381 ARG B N     1 
ATOM   8502  C  CA    . ARG B 1 381 ? -18.346 7.191   3.579   1.00 44.66 ? 381 ARG B CA    1 
ATOM   8503  C  C     . ARG B 1 381 ? -19.839 7.459   3.698   1.00 44.62 ? 381 ARG B C     1 
ATOM   8504  O  O     . ARG B 1 381 ? -20.261 8.615   3.691   1.00 45.59 ? 381 ARG B O     1 
ATOM   8505  C  CB    . ARG B 1 381 ? -17.946 7.091   2.115   1.00 44.14 ? 381 ARG B CB    1 
ATOM   8506  C  CG    . ARG B 1 381 ? -16.477 7.349   1.891   1.00 44.85 ? 381 ARG B CG    1 
ATOM   8507  C  CD    . ARG B 1 381 ? -16.189 8.848   1.819   1.00 45.83 ? 381 ARG B CD    1 
ATOM   8508  N  NE    . ARG B 1 381 ? -15.498 9.099   0.563   1.00 47.33 ? 381 ARG B NE    1 
ATOM   8509  C  CZ    . ARG B 1 381 ? -16.052 9.654   -0.506  1.00 48.91 ? 381 ARG B CZ    1 
ATOM   8510  N  NH1   . ARG B 1 381 ? -17.311 10.076  -0.492  1.00 49.05 ? 381 ARG B NH1   1 
ATOM   8511  N  NH2   . ARG B 1 381 ? -15.326 9.807   -1.597  1.00 51.47 ? 381 ARG B NH2   1 
ATOM   8512  N  N     . LYS B 1 382 ? -20.625 6.390   3.801   1.00 43.31 ? 382 LYS B N     1 
ATOM   8513  C  CA    . LYS B 1 382 ? -22.082 6.476   3.845   1.00 43.22 ? 382 LYS B CA    1 
ATOM   8514  C  C     . LYS B 1 382 ? -22.631 5.164   4.367   1.00 42.01 ? 382 LYS B C     1 
ATOM   8515  O  O     . LYS B 1 382 ? -22.207 4.097   3.938   1.00 40.73 ? 382 LYS B O     1 
ATOM   8516  C  CB    . LYS B 1 382 ? -22.648 6.734   2.447   1.00 43.23 ? 382 LYS B CB    1 
ATOM   8517  C  CG    . LYS B 1 382 ? -24.147 7.000   2.412   1.00 45.08 ? 382 LYS B CG    1 
ATOM   8518  C  CD    . LYS B 1 382 ? -24.659 7.076   0.983   1.00 46.98 ? 382 LYS B CD    1 
ATOM   8519  C  CE    . LYS B 1 382 ? -26.116 7.500   0.954   1.00 49.22 ? 382 LYS B CE    1 
ATOM   8520  N  NZ    . LYS B 1 382 ? -26.826 6.956   -0.235  1.00 50.57 ? 382 LYS B NZ    1 
ATOM   8521  N  N     . VAL B 1 383 ? -23.560 5.245   5.310   1.00 42.41 ? 383 VAL B N     1 
ATOM   8522  C  CA    . VAL B 1 383 ? -24.282 4.066   5.763   1.00 41.42 ? 383 VAL B CA    1 
ATOM   8523  C  C     . VAL B 1 383 ? -25.750 4.169   5.378   1.00 41.91 ? 383 VAL B C     1 
ATOM   8524  O  O     . VAL B 1 383 ? -26.359 5.224   5.506   1.00 43.06 ? 383 VAL B O     1 
ATOM   8525  C  CB    . VAL B 1 383 ? -24.017 3.682   7.287   1.00 42.02 ? 383 VAL B CB    1 
ATOM   8526  C  CG1   . VAL B 1 383 ? -22.977 4.585   7.953   1.00 41.66 ? 383 VAL B CG1   1 
ATOM   8527  C  CG2   . VAL B 1 383 ? -25.299 3.550   8.105   1.00 42.33 ? 383 VAL B CG2   1 
ATOM   8528  N  N     . VAL B 1 384 ? -26.281 3.074   4.847   1.00 41.18 ? 384 VAL B N     1 
ATOM   8529  C  CA    . VAL B 1 384 ? -27.689 2.955   4.478   1.00 41.78 ? 384 VAL B CA    1 
ATOM   8530  C  C     . VAL B 1 384 ? -28.221 1.743   5.215   1.00 41.67 ? 384 VAL B C     1 
ATOM   8531  O  O     . VAL B 1 384 ? -27.440 0.920   5.671   1.00 41.19 ? 384 VAL B O     1 
ATOM   8532  C  CB    . VAL B 1 384 ? -27.885 2.754   2.934   1.00 41.22 ? 384 VAL B CB    1 
ATOM   8533  C  CG1   . VAL B 1 384 ? -27.411 3.978   2.156   1.00 40.84 ? 384 VAL B CG1   1 
ATOM   8534  C  CG2   . VAL B 1 384 ? -27.169 1.485   2.432   1.00 39.70 ? 384 VAL B CG2   1 
ATOM   8535  N  N     . LYS B 1 385 ? -29.537 1.631   5.358   1.00 42.90 ? 385 LYS B N     1 
ATOM   8536  C  CA    . LYS B 1 385 ? -30.116 0.357   5.776   1.00 42.78 ? 385 LYS B CA    1 
ATOM   8537  C  C     . LYS B 1 385 ? -29.794 -0.651  4.664   1.00 41.72 ? 385 LYS B C     1 
ATOM   8538  O  O     . LYS B 1 385 ? -29.915 -0.318  3.474   1.00 41.75 ? 385 LYS B O     1 
ATOM   8539  C  CB    . LYS B 1 385 ? -31.611 0.488   5.995   1.00 43.95 ? 385 LYS B CB    1 
ATOM   8540  N  N     . ALA B 1 386 ? -29.333 -1.851  5.035   1.00 40.75 ? 386 ALA B N     1 
ATOM   8541  C  CA    . ALA B 1 386 ? -28.940 -2.868  4.044   1.00 39.21 ? 386 ALA B CA    1 
ATOM   8542  C  C     . ALA B 1 386 ? -30.072 -3.223  3.074   1.00 39.45 ? 386 ALA B C     1 
ATOM   8543  O  O     . ALA B 1 386 ? -29.811 -3.568  1.913   1.00 39.10 ? 386 ALA B O     1 
ATOM   8544  C  CB    . ALA B 1 386 ? -28.413 -4.112  4.724   1.00 38.11 ? 386 ALA B CB    1 
ATOM   8545  N  N     . GLN B 1 387 ? -31.313 -3.126  3.550   1.00 40.25 ? 387 GLN B N     1 
ATOM   8546  C  CA    . GLN B 1 387 ? -32.502 -3.430  2.741   1.00 41.04 ? 387 GLN B CA    1 
ATOM   8547  C  C     . GLN B 1 387 ? -32.765 -2.390  1.644   1.00 41.37 ? 387 GLN B C     1 
ATOM   8548  O  O     . GLN B 1 387 ? -33.357 -2.710  0.607   1.00 41.42 ? 387 GLN B O     1 
ATOM   8549  C  CB    . GLN B 1 387 ? -33.743 -3.616  3.630   1.00 42.15 ? 387 GLN B CB    1 
ATOM   8550  C  CG    . GLN B 1 387 ? -33.595 -4.774  4.616   1.00 42.59 ? 387 GLN B CG    1 
ATOM   8551  C  CD    . GLN B 1 387 ? -34.902 -5.247  5.246   1.00 44.04 ? 387 GLN B CD    1 
ATOM   8552  O  OE1   . GLN B 1 387 ? -35.867 -4.488  5.393   1.00 44.72 ? 387 GLN B OE1   1 
ATOM   8553  N  NE2   . GLN B 1 387 ? -34.929 -6.518  5.630   1.00 44.69 ? 387 GLN B NE2   1 
ATOM   8554  N  N     . GLN B 1 388 ? -32.330 -1.154  1.886   1.00 41.58 ? 388 GLN B N     1 
ATOM   8555  C  CA    . GLN B 1 388 ? -32.438 -0.074  0.909   1.00 42.14 ? 388 GLN B CA    1 
ATOM   8556  C  C     . GLN B 1 388 ? -31.607 -0.403  -0.334  1.00 40.87 ? 388 GLN B C     1 
ATOM   8557  O  O     . GLN B 1 388 ? -32.076 -0.217  -1.466  1.00 41.42 ? 388 GLN B O     1 
ATOM   8558  C  CB    . GLN B 1 388 ? -32.004 1.261   1.527   1.00 42.48 ? 388 GLN B CB    1 
ATOM   8559  C  CG    . GLN B 1 388 ? -32.223 2.469   0.634   1.00 43.60 ? 388 GLN B CG    1 
ATOM   8560  C  CD    . GLN B 1 388 ? -31.581 3.749   1.166   1.00 44.95 ? 388 GLN B CD    1 
ATOM   8561  O  OE1   . GLN B 1 388 ? -31.206 3.842   2.346   1.00 47.29 ? 388 GLN B OE1   1 
ATOM   8562  N  NE2   . GLN B 1 388 ? -31.469 4.751   0.297   1.00 44.27 ? 388 GLN B NE2   1 
ATOM   8563  N  N     . LEU B 1 389 ? -30.391 -0.902  -0.120  1.00 39.37 ? 389 LEU B N     1 
ATOM   8564  C  CA    . LEU B 1 389 ? -29.548 -1.362  -1.214  1.00 38.42 ? 389 LEU B CA    1 
ATOM   8565  C  C     . LEU B 1 389 ? -30.185 -2.602  -1.839  1.00 38.41 ? 389 LEU B C     1 
ATOM   8566  O  O     . LEU B 1 389 ? -30.179 -2.759  -3.066  1.00 38.24 ? 389 LEU B O     1 
ATOM   8567  C  CB    . LEU B 1 389 ? -28.146 -1.717  -0.722  1.00 37.29 ? 389 LEU B CB    1 
ATOM   8568  C  CG    . LEU B 1 389 ? -26.944 -1.462  -1.637  1.00 37.06 ? 389 LEU B CG    1 
ATOM   8569  C  CD1   . LEU B 1 389 ? -25.865 -2.496  -1.414  1.00 35.11 ? 389 LEU B CD1   1 
ATOM   8570  C  CD2   . LEU B 1 389 ? -27.307 -1.381  -3.114  1.00 36.52 ? 389 LEU B CD2   1 
ATOM   8571  N  N     . TRP B 1 390 ? -30.732 -3.479  -0.995  1.00 38.11 ? 390 TRP B N     1 
ATOM   8572  C  CA    . TRP B 1 390 ? -31.431 -4.647  -1.495  1.00 37.75 ? 390 TRP B CA    1 
ATOM   8573  C  C     . TRP B 1 390 ? -32.564 -4.272  -2.473  1.00 38.59 ? 390 TRP B C     1 
ATOM   8574  O  O     . TRP B 1 390 ? -32.688 -4.870  -3.552  1.00 37.96 ? 390 TRP B O     1 
ATOM   8575  C  CB    . TRP B 1 390 ? -31.971 -5.509  -0.348  1.00 38.18 ? 390 TRP B CB    1 
ATOM   8576  C  CG    . TRP B 1 390 ? -32.608 -6.758  -0.876  1.00 37.91 ? 390 TRP B CG    1 
ATOM   8577  C  CD1   . TRP B 1 390 ? -33.942 -7.052  -0.923  1.00 38.47 ? 390 TRP B CD1   1 
ATOM   8578  C  CD2   . TRP B 1 390 ? -31.929 -7.860  -1.481  1.00 35.98 ? 390 TRP B CD2   1 
ATOM   8579  N  NE1   . TRP B 1 390 ? -34.135 -8.278  -1.515  1.00 38.01 ? 390 TRP B NE1   1 
ATOM   8580  C  CE2   . TRP B 1 390 ? -32.915 -8.798  -1.863  1.00 36.53 ? 390 TRP B CE2   1 
ATOM   8581  C  CE3   . TRP B 1 390 ? -30.579 -8.146  -1.732  1.00 35.02 ? 390 TRP B CE3   1 
ATOM   8582  C  CZ2   . TRP B 1 390 ? -32.597 -10.005 -2.483  1.00 35.94 ? 390 TRP B CZ2   1 
ATOM   8583  C  CZ3   . TRP B 1 390 ? -30.257 -9.341  -2.361  1.00 34.69 ? 390 TRP B CZ3   1 
ATOM   8584  C  CH2   . TRP B 1 390 ? -31.265 -10.260 -2.726  1.00 35.59 ? 390 TRP B CH2   1 
ATOM   8585  N  N     . TYR B 1 391 ? -33.369 -3.280  -2.099  1.00 39.47 ? 391 TYR B N     1 
ATOM   8586  C  CA    . TYR B 1 391 ? -34.465 -2.817  -2.944  1.00 40.97 ? 391 TYR B CA    1 
ATOM   8587  C  C     . TYR B 1 391 ? -33.972 -2.249  -4.270  1.00 40.58 ? 391 TYR B C     1 
ATOM   8588  O  O     . TYR B 1 391 ? -34.629 -2.407  -5.295  1.00 41.17 ? 391 TYR B O     1 
ATOM   8589  C  CB    . TYR B 1 391 ? -35.308 -1.764  -2.218  1.00 42.85 ? 391 TYR B CB    1 
ATOM   8590  C  CG    . TYR B 1 391 ? -36.396 -2.302  -1.317  1.00 43.63 ? 391 TYR B CG    1 
ATOM   8591  C  CD1   . TYR B 1 391 ? -37.573 -1.583  -1.127  1.00 46.66 ? 391 TYR B CD1   1 
ATOM   8592  C  CD2   . TYR B 1 391 ? -36.253 -3.517  -0.649  1.00 43.56 ? 391 TYR B CD2   1 
ATOM   8593  C  CE1   . TYR B 1 391 ? -38.578 -2.051  -0.289  1.00 48.10 ? 391 TYR B CE1   1 
ATOM   8594  C  CE2   . TYR B 1 391 ? -37.257 -4.008  0.185   1.00 45.32 ? 391 TYR B CE2   1 
ATOM   8595  C  CZ    . TYR B 1 391 ? -38.418 -3.266  0.359   1.00 47.58 ? 391 TYR B CZ    1 
ATOM   8596  O  OH    . TYR B 1 391 ? -39.420 -3.730  1.180   1.00 49.58 ? 391 TYR B OH    1 
ATOM   8597  N  N     . ALA B 1 392 ? -32.822 -1.578  -4.243  1.00 39.79 ? 392 ALA B N     1 
ATOM   8598  C  CA    . ALA B 1 392 ? -32.240 -1.011  -5.450  1.00 39.31 ? 392 ALA B CA    1 
ATOM   8599  C  C     . ALA B 1 392 ? -31.830 -2.136  -6.396  1.00 38.53 ? 392 ALA B C     1 
ATOM   8600  O  O     . ALA B 1 392 ? -32.002 -2.032  -7.614  1.00 38.75 ? 392 ALA B O     1 
ATOM   8601  C  CB    . ALA B 1 392 ? -31.053 -0.139  -5.102  1.00 38.79 ? 392 ALA B CB    1 
ATOM   8602  N  N     . ILE B 1 393 ? -31.315 -3.217  -5.817  1.00 37.78 ? 393 ILE B N     1 
ATOM   8603  C  CA    . ILE B 1 393 ? -30.904 -4.392  -6.570  1.00 37.47 ? 393 ILE B CA    1 
ATOM   8604  C  C     . ILE B 1 393 ? -32.103 -5.006  -7.298  1.00 38.37 ? 393 ILE B C     1 
ATOM   8605  O  O     . ILE B 1 393 ? -32.043 -5.269  -8.499  1.00 38.40 ? 393 ILE B O     1 
ATOM   8606  C  CB    . ILE B 1 393 ? -30.190 -5.438  -5.652  1.00 36.42 ? 393 ILE B CB    1 
ATOM   8607  C  CG1   . ILE B 1 393 ? -28.837 -4.888  -5.166  1.00 36.24 ? 393 ILE B CG1   1 
ATOM   8608  C  CG2   . ILE B 1 393 ? -30.003 -6.793  -6.368  1.00 35.29 ? 393 ILE B CG2   1 
ATOM   8609  C  CD1   . ILE B 1 393 ? -28.162 -5.739  -4.077  1.00 35.07 ? 393 ILE B CD1   1 
ATOM   8610  N  N     . ILE B 1 394 ? -33.192 -5.214  -6.565  1.00 39.56 ? 394 ILE B N     1 
ATOM   8611  C  CA    . ILE B 1 394 ? -34.349 -5.912  -7.106  1.00 40.58 ? 394 ILE B CA    1 
ATOM   8612  C  C     . ILE B 1 394 ? -35.139 -5.022  -8.052  1.00 41.50 ? 394 ILE B C     1 
ATOM   8613  O  O     . ILE B 1 394 ? -35.748 -5.515  -8.995  1.00 42.03 ? 394 ILE B O     1 
ATOM   8614  C  CB    . ILE B 1 394 ? -35.233 -6.573  -5.998  1.00 41.14 ? 394 ILE B CB    1 
ATOM   8615  C  CG1   . ILE B 1 394 ? -35.621 -5.566  -4.921  1.00 43.16 ? 394 ILE B CG1   1 
ATOM   8616  C  CG2   . ILE B 1 394 ? -34.495 -7.735  -5.349  1.00 39.45 ? 394 ILE B CG2   1 
ATOM   8617  C  CD1   . ILE B 1 394 ? -36.275 -6.198  -3.689  1.00 43.70 ? 394 ILE B CD1   1 
ATOM   8618  N  N     . GLU B 1 395 ? -35.080 -3.712  -7.818  1.00 42.28 ? 395 GLU B N     1 
ATOM   8619  C  CA    . GLU B 1 395 ? -35.657 -2.724  -8.724  1.00 43.52 ? 395 GLU B CA    1 
ATOM   8620  C  C     . GLU B 1 395 ? -34.923 -2.736  -10.061 1.00 42.96 ? 395 GLU B C     1 
ATOM   8621  O  O     . GLU B 1 395 ? -35.549 -2.715  -11.121 1.00 43.75 ? 395 GLU B O     1 
ATOM   8622  C  CB    . GLU B 1 395 ? -35.624 -1.321  -8.098  1.00 44.58 ? 395 GLU B CB    1 
ATOM   8623  N  N     . SER B 1 396 ? -33.594 -2.788  -10.001 1.00 41.18 ? 396 SER B N     1 
ATOM   8624  C  CA    . SER B 1 396 ? -32.779 -2.888  -11.199 1.00 40.64 ? 396 SER B CA    1 
ATOM   8625  C  C     . SER B 1 396 ? -33.105 -4.145  -12.031 1.00 40.61 ? 396 SER B C     1 
ATOM   8626  O  O     . SER B 1 396 ? -33.193 -4.070  -13.263 1.00 40.77 ? 396 SER B O     1 
ATOM   8627  C  CB    . SER B 1 396 ? -31.292 -2.835  -10.829 1.00 39.15 ? 396 SER B CB    1 
ATOM   8628  O  OG    . SER B 1 396 ? -30.474 -3.061  -11.963 1.00 38.76 ? 396 SER B OG    1 
ATOM   8629  N  N     . GLN B 1 397 ? -33.287 -5.283  -11.349 1.00 39.90 ? 397 GLN B N     1 
ATOM   8630  C  CA    . GLN B 1 397 ? -33.590 -6.559  -12.000 1.00 39.79 ? 397 GLN B CA    1 
ATOM   8631  C  C     . GLN B 1 397 ? -34.988 -6.605  -12.624 1.00 41.66 ? 397 GLN B C     1 
ATOM   8632  O  O     . GLN B 1 397 ? -35.198 -7.265  -13.643 1.00 41.89 ? 397 GLN B O     1 
ATOM   8633  C  CB    . GLN B 1 397 ? -33.414 -7.710  -11.013 1.00 38.76 ? 397 GLN B CB    1 
ATOM   8634  C  CG    . GLN B 1 397 ? -31.980 -7.872  -10.531 1.00 37.70 ? 397 GLN B CG    1 
ATOM   8635  C  CD    . GLN B 1 397 ? -31.851 -8.781  -9.332  1.00 36.74 ? 397 GLN B CD    1 
ATOM   8636  O  OE1   . GLN B 1 397 ? -32.817 -9.036  -8.611  1.00 36.75 ? 397 GLN B OE1   1 
ATOM   8637  N  NE2   . GLN B 1 397 ? -30.648 -9.291  -9.120  1.00 34.98 ? 397 GLN B NE2   1 
ATOM   8638  N  N     . THR B 1 398 ? -35.934 -5.908  -12.003 1.00 42.96 ? 398 THR B N     1 
ATOM   8639  C  CA    . THR B 1 398 ? -37.306 -5.821  -12.495 1.00 45.02 ? 398 THR B CA    1 
ATOM   8640  C  C     . THR B 1 398 ? -37.338 -4.978  -13.778 1.00 46.16 ? 398 THR B C     1 
ATOM   8641  O  O     . THR B 1 398 ? -38.121 -5.247  -14.698 1.00 47.07 ? 398 THR B O     1 
ATOM   8642  C  CB    . THR B 1 398 ? -38.239 -5.209  -11.404 1.00 46.08 ? 398 THR B CB    1 
ATOM   8643  O  OG1   . THR B 1 398 ? -38.123 -5.982  -10.204 1.00 45.99 ? 398 THR B OG1   1 
ATOM   8644  C  CG2   . THR B 1 398 ? -39.697 -5.193  -11.839 1.00 47.68 ? 398 THR B CG2   1 
ATOM   8645  N  N     . GLU B 1 399 ? -36.466 -3.973  -13.831 1.00 46.04 ? 399 GLU B N     1 
ATOM   8646  C  CA    . GLU B 1 399 ? -36.382 -3.073  -14.974 1.00 46.89 ? 399 GLU B CA    1 
ATOM   8647  C  C     . GLU B 1 399 ? -35.555 -3.676  -16.115 1.00 45.97 ? 399 GLU B C     1 
ATOM   8648  O  O     . GLU B 1 399 ? -35.964 -3.616  -17.267 1.00 46.57 ? 399 GLU B O     1 
ATOM   8649  C  CB    . GLU B 1 399 ? -35.826 -1.711  -14.547 1.00 46.89 ? 399 GLU B CB    1 
ATOM   8650  N  N     . THR B 1 400 ? -34.416 -4.289  -15.785 1.00 44.49 ? 400 THR B N     1 
ATOM   8651  C  CA    . THR B 1 400 ? -33.445 -4.718  -16.802 1.00 43.48 ? 400 THR B CA    1 
ATOM   8652  C  C     . THR B 1 400 ? -33.131 -6.226  -16.838 1.00 42.42 ? 400 THR B C     1 
ATOM   8653  O  O     . THR B 1 400 ? -32.525 -6.706  -17.792 1.00 42.20 ? 400 THR B O     1 
ATOM   8654  C  CB    . THR B 1 400 ? -32.113 -3.906  -16.688 1.00 43.22 ? 400 THR B CB    1 
ATOM   8655  O  OG1   . THR B 1 400 ? -31.305 -4.401  -15.607 1.00 41.22 ? 400 THR B OG1   1 
ATOM   8656  C  CG2   . THR B 1 400 ? -32.386 -2.406  -16.485 1.00 44.31 ? 400 THR B CG2   1 
ATOM   8657  N  N     . GLY B 1 401 ? -33.530 -6.968  -15.807 1.00 42.06 ? 401 GLY B N     1 
ATOM   8658  C  CA    . GLY B 1 401 ? -33.190 -8.389  -15.701 1.00 41.21 ? 401 GLY B CA    1 
ATOM   8659  C  C     . GLY B 1 401 ? -31.838 -8.649  -15.041 1.00 40.22 ? 401 GLY B C     1 
ATOM   8660  O  O     . GLY B 1 401 ? -31.422 -9.806  -14.870 1.00 38.50 ? 401 GLY B O     1 
ATOM   8661  N  N     . THR B 1 402 ? -31.161 -7.563  -14.673 1.00 40.50 ? 402 THR B N     1 
ATOM   8662  C  CA    . THR B 1 402 ? -29.814 -7.607  -14.113 1.00 40.28 ? 402 THR B CA    1 
ATOM   8663  C  C     . THR B 1 402 ? -29.745 -6.611  -12.943 1.00 40.24 ? 402 THR B C     1 
ATOM   8664  O  O     . THR B 1 402 ? -30.634 -5.769  -12.810 1.00 41.71 ? 402 THR B O     1 
ATOM   8665  C  CB    . THR B 1 402 ? -28.722 -7.281  -15.201 1.00 40.73 ? 402 THR B CB    1 
ATOM   8666  O  OG1   . THR B 1 402 ? -28.828 -5.910  -15.627 1.00 42.93 ? 402 THR B OG1   1 
ATOM   8667  C  CG2   . THR B 1 402 ? -28.854 -8.202  -16.427 1.00 41.12 ? 402 THR B CG2   1 
ATOM   8668  N  N     . PRO B 1 403 ? -28.673 -6.649  -12.124 1.00 39.21 ? 403 PRO B N     1 
ATOM   8669  C  CA    . PRO B 1 403 ? -27.408 -7.367  -12.298 1.00 37.93 ? 403 PRO B CA    1 
ATOM   8670  C  C     . PRO B 1 403 ? -27.492 -8.863  -11.999 1.00 37.04 ? 403 PRO B C     1 
ATOM   8671  O  O     . PRO B 1 403 ? -28.417 -9.321  -11.306 1.00 36.62 ? 403 PRO B O     1 
ATOM   8672  C  CB    . PRO B 1 403 ? -26.482 -6.674  -11.294 1.00 37.91 ? 403 PRO B CB    1 
ATOM   8673  C  CG    . PRO B 1 403 ? -27.411 -6.239  -10.190 1.00 37.84 ? 403 PRO B CG    1 
ATOM   8674  C  CD    . PRO B 1 403 ? -28.695 -5.873  -10.864 1.00 39.04 ? 403 PRO B CD    1 
ATOM   8675  N  N     . TYR B 1 404 ? -26.533 -9.604  -12.552 1.00 36.24 ? 404 TYR B N     1 
ATOM   8676  C  CA    . TYR B 1 404 ? -26.340 -11.010 -12.222 1.00 35.51 ? 404 TYR B CA    1 
ATOM   8677  C  C     . TYR B 1 404 ? -25.980 -11.095 -10.732 1.00 35.30 ? 404 TYR B C     1 
ATOM   8678  O  O     . TYR B 1 404 ? -25.440 -10.126 -10.148 1.00 35.56 ? 404 TYR B O     1 
ATOM   8679  C  CB    . TYR B 1 404 ? -25.238 -11.649 -13.084 1.00 35.05 ? 404 TYR B CB    1 
ATOM   8680  C  CG    . TYR B 1 404 ? -25.234 -11.282 -14.572 1.00 35.94 ? 404 TYR B CG    1 
ATOM   8681  C  CD1   . TYR B 1 404 ? -26.423 -11.131 -15.288 1.00 36.62 ? 404 TYR B CD1   1 
ATOM   8682  C  CD2   . TYR B 1 404 ? -24.028 -11.121 -15.269 1.00 36.02 ? 404 TYR B CD2   1 
ATOM   8683  C  CE1   . TYR B 1 404 ? -26.418 -10.809 -16.644 1.00 37.56 ? 404 TYR B CE1   1 
ATOM   8684  C  CE2   . TYR B 1 404 ? -24.009 -10.798 -16.640 1.00 36.00 ? 404 TYR B CE2   1 
ATOM   8685  C  CZ    . TYR B 1 404 ? -25.207 -10.646 -17.320 1.00 37.59 ? 404 TYR B CZ    1 
ATOM   8686  O  OH    . TYR B 1 404 ? -25.218 -10.324 -18.672 1.00 37.72 ? 404 TYR B OH    1 
ATOM   8687  N  N     . MET B 1 405 ? -26.298 -12.234 -10.123 1.00 34.68 ? 405 MET B N     1 
ATOM   8688  C  CA    . MET B 1 405 ? -26.062 -12.449 -8.707  1.00 34.78 ? 405 MET B CA    1 
ATOM   8689  C  C     . MET B 1 405 ? -25.017 -13.533 -8.497  1.00 34.75 ? 405 MET B C     1 
ATOM   8690  O  O     . MET B 1 405 ? -25.252 -14.707 -8.808  1.00 35.39 ? 405 MET B O     1 
ATOM   8691  C  CB    . MET B 1 405 ? -27.368 -12.823 -7.997  1.00 35.05 ? 405 MET B CB    1 
ATOM   8692  C  CG    . MET B 1 405 ? -28.455 -11.761 -8.110  1.00 36.06 ? 405 MET B CG    1 
ATOM   8693  S  SD    . MET B 1 405 ? -28.091 -10.237 -7.182  1.00 38.49 ? 405 MET B SD    1 
ATOM   8694  C  CE    . MET B 1 405 ? -28.628 -10.739 -5.537  1.00 34.03 ? 405 MET B CE    1 
ATOM   8695  N  N     . LEU B 1 406 ? -23.863 -13.139 -7.969  1.00 34.52 ? 406 LEU B N     1 
ATOM   8696  C  CA    . LEU B 1 406 ? -22.803 -14.084 -7.656  1.00 34.03 ? 406 LEU B CA    1 
ATOM   8697  C  C     . LEU B 1 406 ? -22.436 -13.977 -6.193  1.00 34.19 ? 406 LEU B C     1 
ATOM   8698  O  O     . LEU B 1 406 ? -22.322 -12.880 -5.656  1.00 35.03 ? 406 LEU B O     1 
ATOM   8699  C  CB    . LEU B 1 406 ? -21.574 -13.859 -8.554  1.00 33.84 ? 406 LEU B CB    1 
ATOM   8700  C  CG    . LEU B 1 406 ? -21.845 -14.477 -9.935  1.00 34.54 ? 406 LEU B CG    1 
ATOM   8701  C  CD1   . LEU B 1 406 ? -22.272 -13.438 -10.964 1.00 35.92 ? 406 LEU B CD1   1 
ATOM   8702  C  CD2   . LEU B 1 406 ? -20.689 -15.296 -10.426 1.00 33.96 ? 406 LEU B CD2   1 
ATOM   8703  N  N     . TYR B 1 407 ? -22.265 -15.116 -5.542  1.00 33.71 ? 407 TYR B N     1 
ATOM   8704  C  CA    . TYR B 1 407 ? -21.912 -15.106 -4.145  1.00 34.09 ? 407 TYR B CA    1 
ATOM   8705  C  C     . TYR B 1 407 ? -20.425 -15.374 -3.962  1.00 34.06 ? 407 TYR B C     1 
ATOM   8706  O  O     . TYR B 1 407 ? -19.941 -16.511 -4.077  1.00 34.34 ? 407 TYR B O     1 
ATOM   8707  C  CB    . TYR B 1 407 ? -22.836 -16.028 -3.348  1.00 34.32 ? 407 TYR B CB    1 
ATOM   8708  C  CG    . TYR B 1 407 ? -24.263 -15.561 -3.482  1.00 34.90 ? 407 TYR B CG    1 
ATOM   8709  C  CD1   . TYR B 1 407 ? -25.179 -16.271 -4.246  1.00 35.26 ? 407 TYR B CD1   1 
ATOM   8710  C  CD2   . TYR B 1 407 ? -24.683 -14.370 -2.887  1.00 34.99 ? 407 TYR B CD2   1 
ATOM   8711  C  CE1   . TYR B 1 407 ? -26.492 -15.822 -4.396  1.00 36.16 ? 407 TYR B CE1   1 
ATOM   8712  C  CE2   . TYR B 1 407 ? -25.991 -13.913 -3.030  1.00 35.08 ? 407 TYR B CE2   1 
ATOM   8713  C  CZ    . TYR B 1 407 ? -26.884 -14.638 -3.786  1.00 35.84 ? 407 TYR B CZ    1 
ATOM   8714  O  OH    . TYR B 1 407 ? -28.172 -14.192 -3.926  1.00 36.40 ? 407 TYR B OH    1 
ATOM   8715  N  N     . LYS B 1 408 ? -19.716 -14.274 -3.729  1.00 33.69 ? 408 LYS B N     1 
ATOM   8716  C  CA    . LYS B 1 408 ? -18.267 -14.230 -3.597  1.00 33.52 ? 408 LYS B CA    1 
ATOM   8717  C  C     . LYS B 1 408 ? -17.686 -15.285 -2.629  1.00 33.88 ? 408 LYS B C     1 
ATOM   8718  O  O     . LYS B 1 408 ? -16.677 -15.921 -2.933  1.00 33.30 ? 408 LYS B O     1 
ATOM   8719  C  CB    . LYS B 1 408 ? -17.859 -12.804 -3.184  1.00 33.63 ? 408 LYS B CB    1 
ATOM   8720  C  CG    . LYS B 1 408 ? -16.450 -12.638 -2.702  1.00 33.25 ? 408 LYS B CG    1 
ATOM   8721  C  CD    . LYS B 1 408 ? -16.213 -11.218 -2.298  1.00 34.25 ? 408 LYS B CD    1 
ATOM   8722  C  CE    . LYS B 1 408 ? -14.863 -11.053 -1.647  1.00 35.03 ? 408 LYS B CE    1 
ATOM   8723  N  NZ    . LYS B 1 408 ? -14.718 -9.692  -1.062  1.00 35.55 ? 408 LYS B NZ    1 
ATOM   8724  N  N     . ASP B 1 409 ? -18.321 -15.463 -1.472  1.00 34.46 ? 409 ASP B N     1 
ATOM   8725  C  CA    . ASP B 1 409 ? -17.802 -16.393 -0.476  1.00 35.12 ? 409 ASP B CA    1 
ATOM   8726  C  C     . ASP B 1 409 ? -18.021 -17.833 -0.890  1.00 35.18 ? 409 ASP B C     1 
ATOM   8727  O  O     . ASP B 1 409 ? -17.120 -18.660 -0.740  1.00 35.81 ? 409 ASP B O     1 
ATOM   8728  C  CB    . ASP B 1 409 ? -18.374 -16.104 0.905   1.00 35.50 ? 409 ASP B CB    1 
ATOM   8729  C  CG    . ASP B 1 409 ? -18.057 -14.695 1.380   1.00 35.87 ? 409 ASP B CG    1 
ATOM   8730  O  OD1   . ASP B 1 409 ? -17.046 -14.112 0.918   1.00 35.51 ? 409 ASP B OD1   1 
ATOM   8731  O  OD2   . ASP B 1 409 ? -18.821 -14.166 2.216   1.00 36.51 ? 409 ASP B OD2   1 
ATOM   8732  N  N     . SER B 1 410 ? -19.202 -18.127 -1.430  1.00 34.97 ? 410 SER B N     1 
ATOM   8733  C  CA    . SER B 1 410 ? -19.476 -19.432 -2.020  1.00 34.79 ? 410 SER B CA    1 
ATOM   8734  C  C     . SER B 1 410 ? -18.442 -19.741 -3.110  1.00 34.35 ? 410 SER B C     1 
ATOM   8735  O  O     . SER B 1 410 ? -17.847 -20.813 -3.127  1.00 34.62 ? 410 SER B O     1 
ATOM   8736  C  CB    . SER B 1 410 ? -20.879 -19.457 -2.631  1.00 34.82 ? 410 SER B CB    1 
ATOM   8737  O  OG    . SER B 1 410 ? -21.879 -19.559 -1.634  1.00 36.11 ? 410 SER B OG    1 
ATOM   8738  N  N     . CYS B 1 411 ? -18.239 -18.794 -4.015  1.00 33.72 ? 411 CYS B N     1 
ATOM   8739  C  CA    . CYS B 1 411 ? -17.288 -18.960 -5.100  1.00 33.69 ? 411 CYS B CA    1 
ATOM   8740  C  C     . CYS B 1 411 ? -15.905 -19.308 -4.596  1.00 34.14 ? 411 CYS B C     1 
ATOM   8741  O  O     . CYS B 1 411 ? -15.303 -20.258 -5.081  1.00 34.55 ? 411 CYS B O     1 
ATOM   8742  C  CB    . CYS B 1 411 ? -17.252 -17.720 -5.980  1.00 33.36 ? 411 CYS B CB    1 
ATOM   8743  S  SG    . CYS B 1 411 ? -18.719 -17.590 -7.041  1.00 34.07 ? 411 CYS B SG    1 
ATOM   8744  N  N     . ASN B 1 412 ? -15.427 -18.561 -3.599  1.00 34.82 ? 412 ASN B N     1 
ATOM   8745  C  CA    . ASN B 1 412 ? -14.082 -18.734 -3.049  1.00 35.50 ? 412 ASN B CA    1 
ATOM   8746  C  C     . ASN B 1 412 ? -13.925 -19.931 -2.101  1.00 36.37 ? 412 ASN B C     1 
ATOM   8747  O  O     . ASN B 1 412 ? -12.928 -20.647 -2.188  1.00 37.20 ? 412 ASN B O     1 
ATOM   8748  C  CB    . ASN B 1 412 ? -13.618 -17.444 -2.363  1.00 35.85 ? 412 ASN B CB    1 
ATOM   8749  C  CG    . ASN B 1 412 ? -13.100 -16.410 -3.345  1.00 35.80 ? 412 ASN B CG    1 
ATOM   8750  O  OD1   . ASN B 1 412 ? -11.941 -16.473 -3.757  1.00 37.45 ? 412 ASN B OD1   1 
ATOM   8751  N  ND2   . ASN B 1 412 ? -13.948 -15.452 -3.720  1.00 32.28 ? 412 ASN B ND2   1 
ATOM   8752  N  N     . ARG B 1 413 ? -14.890 -20.136 -1.199  1.00 36.38 ? 413 ARG B N     1 
ATOM   8753  C  CA    . ARG B 1 413 ? -14.871 -21.260 -0.257  1.00 37.28 ? 413 ARG B CA    1 
ATOM   8754  C  C     . ARG B 1 413 ? -14.815 -22.616 -0.953  1.00 36.80 ? 413 ARG B C     1 
ATOM   8755  O  O     . ARG B 1 413 ? -14.267 -23.573 -0.407  1.00 37.40 ? 413 ARG B O     1 
ATOM   8756  C  CB    . ARG B 1 413 ? -16.101 -21.220 0.666   1.00 37.63 ? 413 ARG B CB    1 
ATOM   8757  C  CG    . ARG B 1 413 ? -16.093 -22.264 1.792   1.00 39.37 ? 413 ARG B CG    1 
ATOM   8758  C  CD    . ARG B 1 413 ? -17.276 -22.115 2.747   1.00 40.07 ? 413 ARG B CD    1 
ATOM   8759  N  NE    . ARG B 1 413 ? -17.290 -20.821 3.435   1.00 43.34 ? 413 ARG B NE    1 
ATOM   8760  C  CZ    . ARG B 1 413 ? -18.118 -19.816 3.151   1.00 44.38 ? 413 ARG B CZ    1 
ATOM   8761  N  NH1   . ARG B 1 413 ? -19.023 -19.941 2.179   1.00 44.36 ? 413 ARG B NH1   1 
ATOM   8762  N  NH2   . ARG B 1 413 ? -18.040 -18.678 3.840   1.00 43.70 ? 413 ARG B NH2   1 
ATOM   8763  N  N     . LYS B 1 414 ? -15.384 -22.693 -2.154  1.00 35.78 ? 414 LYS B N     1 
ATOM   8764  C  CA    . LYS B 1 414 ? -15.458 -23.951 -2.885  1.00 35.38 ? 414 LYS B CA    1 
ATOM   8765  C  C     . LYS B 1 414 ? -14.727 -23.932 -4.222  1.00 35.43 ? 414 LYS B C     1 
ATOM   8766  O  O     . LYS B 1 414 ? -15.147 -24.600 -5.179  1.00 35.49 ? 414 LYS B O     1 
ATOM   8767  C  CB    . LYS B 1 414 ? -16.906 -24.342 -3.105  1.00 34.94 ? 414 LYS B CB    1 
ATOM   8768  C  CG    . LYS B 1 414 ? -17.743 -24.374 -1.843  1.00 35.09 ? 414 LYS B CG    1 
ATOM   8769  C  CD    . LYS B 1 414 ? -19.137 -24.723 -2.261  1.00 35.72 ? 414 LYS B CD    1 
ATOM   8770  C  CE    . LYS B 1 414 ? -20.180 -24.000 -1.481  1.00 35.82 ? 414 LYS B CE    1 
ATOM   8771  N  NZ    . LYS B 1 414 ? -21.415 -23.968 -2.309  1.00 35.12 ? 414 LYS B NZ    1 
ATOM   8772  N  N     . SER B 1 415 ? -13.637 -23.171 -4.291  1.00 35.41 ? 415 SER B N     1 
ATOM   8773  C  CA    . SER B 1 415 ? -12.760 -23.214 -5.450  1.00 35.34 ? 415 SER B CA    1 
ATOM   8774  C  C     . SER B 1 415 ? -11.504 -24.040 -5.174  1.00 36.43 ? 415 SER B C     1 
ATOM   8775  O  O     . SER B 1 415 ? -10.830 -23.865 -4.149  1.00 37.17 ? 415 SER B O     1 
ATOM   8776  C  CB    . SER B 1 415 ? -12.361 -21.807 -5.889  1.00 35.26 ? 415 SER B CB    1 
ATOM   8777  O  OG    . SER B 1 415 ? -11.543 -21.846 -7.050  1.00 34.14 ? 415 SER B OG    1 
ATOM   8778  N  N     . ASN B 1 416 ? -11.188 -24.932 -6.102  1.00 36.47 ? 416 ASN B N     1 
ATOM   8779  C  CA    . ASN B 1 416 ? -9.910  -25.604 -6.089  1.00 37.25 ? 416 ASN B CA    1 
ATOM   8780  C  C     . ASN B 1 416 ? -8.750  -24.659 -6.452  1.00 37.98 ? 416 ASN B C     1 
ATOM   8781  O  O     . ASN B 1 416 ? -7.581  -25.009 -6.283  1.00 38.90 ? 416 ASN B O     1 
ATOM   8782  C  CB    . ASN B 1 416 ? -9.935  -26.823 -7.005  1.00 37.33 ? 416 ASN B CB    1 
ATOM   8783  C  CG    . ASN B 1 416 ? -8.705  -27.663 -6.852  1.00 37.55 ? 416 ASN B CG    1 
ATOM   8784  O  OD1   . ASN B 1 416 ? -8.257  -27.913 -5.730  1.00 38.53 ? 416 ASN B OD1   1 
ATOM   8785  N  ND2   . ASN B 1 416 ? -8.119  -28.072 -7.971  1.00 36.29 ? 416 ASN B ND2   1 
ATOM   8786  N  N     . GLN B 1 417 ? -9.082  -23.460 -6.941  1.00 37.99 ? 417 GLN B N     1 
ATOM   8787  C  CA    . GLN B 1 417 ? -8.098  -22.389 -7.179  1.00 38.60 ? 417 GLN B CA    1 
ATOM   8788  C  C     . GLN B 1 417 ? -7.895  -21.470 -5.962  1.00 39.09 ? 417 GLN B C     1 
ATOM   8789  O  O     . GLN B 1 417 ? -7.168  -20.483 -6.032  1.00 39.65 ? 417 GLN B O     1 
ATOM   8790  C  CB    . GLN B 1 417 ? -8.465  -21.579 -8.424  1.00 38.26 ? 417 GLN B CB    1 
ATOM   8791  C  CG    . GLN B 1 417 ? -8.050  -22.263 -9.729  1.00 38.78 ? 417 GLN B CG    1 
ATOM   8792  C  CD    . GLN B 1 417 ? -8.186  -21.359 -10.926 1.00 39.15 ? 417 GLN B CD    1 
ATOM   8793  O  OE1   . GLN B 1 417 ? -8.624  -20.219 -10.797 1.00 40.28 ? 417 GLN B OE1   1 
ATOM   8794  N  NE2   . GLN B 1 417 ? -7.820  -21.861 -12.106 1.00 37.99 ? 417 GLN B NE2   1 
ATOM   8795  N  N     . GLN B 1 418 ? -8.552  -21.828 -4.863  1.00 38.99 ? 418 GLN B N     1 
ATOM   8796  C  CA    . GLN B 1 418 ? -8.386  -21.258 -3.524  1.00 39.85 ? 418 GLN B CA    1 
ATOM   8797  C  C     . GLN B 1 418 ? -6.954  -20.906 -3.117  1.00 40.42 ? 418 GLN B C     1 
ATOM   8798  O  O     . GLN B 1 418 ? -6.722  -19.868 -2.500  1.00 40.94 ? 418 GLN B O     1 
ATOM   8799  C  CB    . GLN B 1 418 ? -8.881  -22.299 -2.531  1.00 40.41 ? 418 GLN B CB    1 
ATOM   8800  C  CG    . GLN B 1 418 ? -9.476  -21.769 -1.292  1.00 42.85 ? 418 GLN B CG    1 
ATOM   8801  C  CD    . GLN B 1 418 ? -10.331 -22.806 -0.612  1.00 45.46 ? 418 GLN B CD    1 
ATOM   8802  O  OE1   . GLN B 1 418 ? -11.183 -23.444 -1.243  1.00 46.75 ? 418 GLN B OE1   1 
ATOM   8803  N  NE2   . GLN B 1 418 ? -10.120 -22.980 0.678   1.00 47.15 ? 418 GLN B NE2   1 
ATOM   8804  N  N     . ASN B 1 419 ? -6.012  -21.787 -3.438  1.00 40.50 ? 419 ASN B N     1 
ATOM   8805  C  CA    . ASN B 1 419 ? -4.610  -21.627 -3.052  1.00 41.25 ? 419 ASN B CA    1 
ATOM   8806  C  C     . ASN B 1 419 ? -3.871  -20.482 -3.757  1.00 41.32 ? 419 ASN B C     1 
ATOM   8807  O  O     . ASN B 1 419 ? -2.751  -20.132 -3.360  1.00 42.35 ? 419 ASN B O     1 
ATOM   8808  C  CB    . ASN B 1 419 ? -3.842  -22.948 -3.245  1.00 41.69 ? 419 ASN B CB    1 
ATOM   8809  C  CG    . ASN B 1 419 ? -3.889  -23.473 -4.691  1.00 41.91 ? 419 ASN B CG    1 
ATOM   8810  O  OD1   . ASN B 1 419 ? -4.952  -23.540 -5.329  1.00 41.87 ? 419 ASN B OD1   1 
ATOM   8811  N  ND2   . ASN B 1 419 ? -2.737  -23.877 -5.195  1.00 42.81 ? 419 ASN B ND2   1 
ATOM   8812  N  N     . LEU B 1 420 ? -4.494  -19.909 -4.791  1.00 39.88 ? 420 LEU B N     1 
ATOM   8813  C  CA    . LEU B 1 420 ? -3.875  -18.855 -5.608  1.00 39.89 ? 420 LEU B CA    1 
ATOM   8814  C  C     . LEU B 1 420 ? -4.054  -17.455 -5.035  1.00 39.85 ? 420 LEU B C     1 
ATOM   8815  O  O     . LEU B 1 420 ? -3.265  -16.544 -5.343  1.00 39.78 ? 420 LEU B O     1 
ATOM   8816  C  CB    . LEU B 1 420 ? -4.426  -18.878 -7.037  1.00 39.06 ? 420 LEU B CB    1 
ATOM   8817  C  CG    . LEU B 1 420 ? -4.201  -20.116 -7.901  1.00 39.08 ? 420 LEU B CG    1 
ATOM   8818  C  CD1   . LEU B 1 420 ? -4.795  -19.905 -9.280  1.00 37.73 ? 420 LEU B CD1   1 
ATOM   8819  C  CD2   . LEU B 1 420 ? -2.723  -20.427 -7.986  1.00 39.91 ? 420 LEU B CD2   1 
ATOM   8820  N  N     . GLY B 1 421 ? -5.093  -17.307 -4.209  1.00 39.13 ? 421 GLY B N     1 
ATOM   8821  C  CA    . GLY B 1 421 ? -5.547  -16.030 -3.688  1.00 38.88 ? 421 GLY B CA    1 
ATOM   8822  C  C     . GLY B 1 421 ? -7.035  -15.877 -3.962  1.00 37.99 ? 421 GLY B C     1 
ATOM   8823  O  O     . GLY B 1 421 ? -7.650  -16.744 -4.587  1.00 37.30 ? 421 GLY B O     1 
ATOM   8824  N  N     . THR B 1 422 ? -7.612  -14.775 -3.484  1.00 37.88 ? 422 THR B N     1 
ATOM   8825  C  CA    . THR B 1 422 ? -9.040  -14.490 -3.662  1.00 37.06 ? 422 THR B CA    1 
ATOM   8826  C  C     . THR B 1 422 ? -9.443  -14.281 -5.132  1.00 36.50 ? 422 THR B C     1 
ATOM   8827  O  O     . THR B 1 422 ? -8.803  -13.534 -5.876  1.00 36.39 ? 422 THR B O     1 
ATOM   8828  C  CB    . THR B 1 422 ? -9.485  -13.278 -2.799  1.00 36.96 ? 422 THR B CB    1 
ATOM   8829  O  OG1   . THR B 1 422 ? -9.381  -13.622 -1.416  1.00 37.17 ? 422 THR B OG1   1 
ATOM   8830  C  CG2   . THR B 1 422 ? -10.927 -12.887 -3.096  1.00 36.21 ? 422 THR B CG2   1 
ATOM   8831  N  N     . ILE B 1 423 ? -10.506 -14.971 -5.530  1.00 35.99 ? 423 ILE B N     1 
ATOM   8832  C  CA    . ILE B 1 423 ? -11.117 -14.802 -6.851  1.00 35.73 ? 423 ILE B CA    1 
ATOM   8833  C  C     . ILE B 1 423 ? -12.058 -13.593 -6.810  1.00 36.11 ? 423 ILE B C     1 
ATOM   8834  O  O     . ILE B 1 423 ? -12.968 -13.514 -5.965  1.00 35.84 ? 423 ILE B O     1 
ATOM   8835  C  CB    . ILE B 1 423 ? -11.850 -16.089 -7.297  1.00 35.03 ? 423 ILE B CB    1 
ATOM   8836  C  CG1   . ILE B 1 423 ? -10.851 -17.260 -7.321  1.00 35.17 ? 423 ILE B CG1   1 
ATOM   8837  C  CG2   . ILE B 1 423 ? -12.531 -15.897 -8.653  1.00 33.92 ? 423 ILE B CG2   1 
ATOM   8838  C  CD1   . ILE B 1 423 ? -11.468 -18.614 -7.491  1.00 33.75 ? 423 ILE B CD1   1 
ATOM   8839  N  N     . LYS B 1 424 ? -11.817 -12.653 -7.723  1.00 36.54 ? 424 LYS B N     1 
ATOM   8840  C  CA    . LYS B 1 424 ? -12.433 -11.335 -7.655  1.00 36.79 ? 424 LYS B CA    1 
ATOM   8841  C  C     . LYS B 1 424 ? -13.674 -11.208 -8.517  1.00 36.56 ? 424 LYS B C     1 
ATOM   8842  O  O     . LYS B 1 424 ? -14.431 -10.242 -8.373  1.00 37.02 ? 424 LYS B O     1 
ATOM   8843  C  CB    . LYS B 1 424 ? -11.416 -10.257 -8.042  1.00 37.29 ? 424 LYS B CB    1 
ATOM   8844  C  CG    . LYS B 1 424 ? -10.216 -10.203 -7.125  1.00 38.59 ? 424 LYS B CG    1 
ATOM   8845  C  CD    . LYS B 1 424 ? -9.445  -8.929  -7.326  1.00 41.86 ? 424 LYS B CD    1 
ATOM   8846  C  CE    . LYS B 1 424 ? -8.185  -8.907  -6.480  1.00 44.17 ? 424 LYS B CE    1 
ATOM   8847  N  NZ    . LYS B 1 424 ? -7.495  -7.599  -6.607  1.00 45.37 ? 424 LYS B NZ    1 
ATOM   8848  N  N     . CYS B 1 425 ? -13.883 -12.162 -9.422  1.00 36.19 ? 425 CYS B N     1 
ATOM   8849  C  CA    . CYS B 1 425 ? -15.021 -12.080 -10.349 1.00 36.00 ? 425 CYS B CA    1 
ATOM   8850  C  C     . CYS B 1 425 ? -15.250 -13.346 -11.176 1.00 35.57 ? 425 CYS B C     1 
ATOM   8851  O  O     . CYS B 1 425 ? -14.435 -14.276 -11.166 1.00 35.46 ? 425 CYS B O     1 
ATOM   8852  C  CB    . CYS B 1 425 ? -14.860 -10.886 -11.300 1.00 36.63 ? 425 CYS B CB    1 
ATOM   8853  S  SG    . CYS B 1 425 ? -13.628 -11.176 -12.591 1.00 36.83 ? 425 CYS B SG    1 
ATOM   8854  N  N     . SER B 1 426 ? -16.373 -13.343 -11.892 1.00 35.30 ? 426 SER B N     1 
ATOM   8855  C  CA    . SER B 1 426 ? -16.751 -14.386 -12.844 1.00 34.96 ? 426 SER B CA    1 
ATOM   8856  C  C     . SER B 1 426 ? -16.668 -13.816 -14.272 1.00 34.92 ? 426 SER B C     1 
ATOM   8857  O  O     . SER B 1 426 ? -16.065 -12.752 -14.488 1.00 34.98 ? 426 SER B O     1 
ATOM   8858  C  CB    . SER B 1 426 ? -18.176 -14.867 -12.544 1.00 34.72 ? 426 SER B CB    1 
ATOM   8859  O  OG    . SER B 1 426 ? -18.490 -16.049 -13.257 1.00 35.33 ? 426 SER B OG    1 
ATOM   8860  N  N     . ASN B 1 427 ? -17.272 -14.511 -15.235 1.00 34.07 ? 427 ASN B N     1 
ATOM   8861  C  CA    . ASN B 1 427 ? -17.134 -14.134 -16.641 1.00 34.59 ? 427 ASN B CA    1 
ATOM   8862  C  C     . ASN B 1 427 ? -18.385 -13.466 -17.211 1.00 34.62 ? 427 ASN B C     1 
ATOM   8863  O  O     . ASN B 1 427 ? -19.315 -13.124 -16.473 1.00 34.59 ? 427 ASN B O     1 
ATOM   8864  C  CB    . ASN B 1 427 ? -16.744 -15.352 -17.487 1.00 34.38 ? 427 ASN B CB    1 
ATOM   8865  C  CG    . ASN B 1 427 ? -17.862 -16.364 -17.590 1.00 34.95 ? 427 ASN B CG    1 
ATOM   8866  O  OD1   . ASN B 1 427 ? -18.577 -16.620 -16.617 1.00 36.59 ? 427 ASN B OD1   1 
ATOM   8867  N  ND2   . ASN B 1 427 ? -18.017 -16.954 -18.761 1.00 35.69 ? 427 ASN B ND2   1 
ATOM   8868  N  N     . LEU B 1 428 ? -18.407 -13.291 -18.528 1.00 34.95 ? 428 LEU B N     1 
ATOM   8869  C  CA    . LEU B 1 428 ? -19.579 -12.740 -19.202 1.00 35.55 ? 428 LEU B CA    1 
ATOM   8870  C  C     . LEU B 1 428 ? -20.856 -13.489 -18.832 1.00 35.17 ? 428 LEU B C     1 
ATOM   8871  O  O     . LEU B 1 428 ? -21.887 -12.871 -18.597 1.00 35.06 ? 428 LEU B O     1 
ATOM   8872  C  CB    . LEU B 1 428 ? -19.391 -12.748 -20.717 1.00 35.65 ? 428 LEU B CB    1 
ATOM   8873  C  CG    . LEU B 1 428 ? -20.433 -11.982 -21.521 1.00 35.91 ? 428 LEU B CG    1 
ATOM   8874  C  CD1   . LEU B 1 428 ? -20.425 -10.505 -21.158 1.00 35.60 ? 428 LEU B CD1   1 
ATOM   8875  C  CD2   . LEU B 1 428 ? -20.156 -12.162 -23.002 1.00 36.99 ? 428 LEU B CD2   1 
ATOM   8876  N  N     . CYS B 1 429 ? -20.763 -14.815 -18.758 1.00 35.08 ? 429 CYS B N     1 
ATOM   8877  C  CA    . CYS B 1 429 ? -21.941 -15.658 -18.607 1.00 35.89 ? 429 CYS B CA    1 
ATOM   8878  C  C     . CYS B 1 429 ? -22.138 -16.279 -17.226 1.00 35.23 ? 429 CYS B C     1 
ATOM   8879  O  O     . CYS B 1 429 ? -23.059 -17.052 -17.029 1.00 35.42 ? 429 CYS B O     1 
ATOM   8880  C  CB    . CYS B 1 429 ? -21.938 -16.721 -19.697 1.00 36.18 ? 429 CYS B CB    1 
ATOM   8881  S  SG    . CYS B 1 429 ? -22.022 -15.965 -21.337 1.00 39.83 ? 429 CYS B SG    1 
ATOM   8882  N  N     . THR B 1 430 ? -21.271 -15.925 -16.280 1.00 35.27 ? 430 THR B N     1 
ATOM   8883  C  CA    . THR B 1 430 ? -21.432 -16.235 -14.846 1.00 35.19 ? 430 THR B CA    1 
ATOM   8884  C  C     . THR B 1 430 ? -21.218 -17.683 -14.442 1.00 35.30 ? 430 THR B C     1 
ATOM   8885  O  O     . THR B 1 430 ? -21.598 -18.065 -13.341 1.00 35.38 ? 430 THR B O     1 
ATOM   8886  C  CB    . THR B 1 430 ? -22.799 -15.741 -14.241 1.00 35.11 ? 430 THR B CB    1 
ATOM   8887  O  OG1   . THR B 1 430 ? -23.864 -16.575 -14.700 1.00 35.48 ? 430 THR B OG1   1 
ATOM   8888  C  CG2   . THR B 1 430 ? -23.100 -14.315 -14.612 1.00 35.20 ? 430 THR B CG2   1 
ATOM   8889  N  N     . GLU B 1 431 ? -20.600 -18.489 -15.308 1.00 36.10 ? 431 GLU B N     1 
ATOM   8890  C  CA    . GLU B 1 431 ? -20.354 -19.905 -14.995 1.00 35.96 ? 431 GLU B CA    1 
ATOM   8891  C  C     . GLU B 1 431 ? -18.896 -20.200 -14.609 1.00 35.78 ? 431 GLU B C     1 
ATOM   8892  O  O     . GLU B 1 431 ? -18.592 -21.268 -14.070 1.00 35.72 ? 431 GLU B O     1 
ATOM   8893  C  CB    . GLU B 1 431 ? -20.806 -20.802 -16.163 1.00 36.52 ? 431 GLU B CB    1 
ATOM   8894  C  CG    . GLU B 1 431 ? -19.750 -21.062 -17.240 1.00 38.45 ? 431 GLU B CG    1 
ATOM   8895  C  CD    . GLU B 1 431 ? -19.700 -20.002 -18.327 1.00 42.98 ? 431 GLU B CD    1 
ATOM   8896  O  OE1   . GLU B 1 431 ? -19.080 -20.271 -19.372 1.00 45.83 ? 431 GLU B OE1   1 
ATOM   8897  O  OE2   . GLU B 1 431 ? -20.274 -18.902 -18.168 1.00 45.39 ? 431 GLU B OE2   1 
ATOM   8898  N  N     . ILE B 1 432 ? -18.000 -19.260 -14.895 1.00 35.78 ? 432 ILE B N     1 
ATOM   8899  C  CA    . ILE B 1 432 ? -16.570 -19.464 -14.683 1.00 36.02 ? 432 ILE B CA    1 
ATOM   8900  C  C     . ILE B 1 432 ? -16.113 -18.766 -13.406 1.00 35.93 ? 432 ILE B C     1 
ATOM   8901  O  O     . ILE B 1 432 ? -16.429 -17.599 -13.188 1.00 36.83 ? 432 ILE B O     1 
ATOM   8902  C  CB    . ILE B 1 432 ? -15.739 -18.956 -15.896 1.00 36.62 ? 432 ILE B CB    1 
ATOM   8903  C  CG1   . ILE B 1 432 ? -16.089 -19.722 -17.181 1.00 36.90 ? 432 ILE B CG1   1 
ATOM   8904  C  CG2   . ILE B 1 432 ? -14.240 -19.007 -15.604 1.00 37.23 ? 432 ILE B CG2   1 
ATOM   8905  C  CD1   . ILE B 1 432 ? -15.782 -21.222 -17.152 1.00 36.22 ? 432 ILE B CD1   1 
ATOM   8906  N  N     . VAL B 1 433 ? -15.402 -19.489 -12.548 1.00 35.57 ? 433 VAL B N     1 
ATOM   8907  C  CA    . VAL B 1 433 ? -14.853 -18.913 -11.325 1.00 35.06 ? 433 VAL B CA    1 
ATOM   8908  C  C     . VAL B 1 433 ? -13.344 -19.183 -11.307 1.00 35.23 ? 433 VAL B C     1 
ATOM   8909  O  O     . VAL B 1 433 ? -12.884 -20.229 -10.846 1.00 35.36 ? 433 VAL B O     1 
ATOM   8910  C  CB    . VAL B 1 433 ? -15.529 -19.484 -10.066 1.00 35.01 ? 433 VAL B CB    1 
ATOM   8911  C  CG1   . VAL B 1 433 ? -15.018 -18.766 -8.826  1.00 35.08 ? 433 VAL B CG1   1 
ATOM   8912  C  CG2   . VAL B 1 433 ? -17.045 -19.350 -10.160 1.00 34.84 ? 433 VAL B CG2   1 
ATOM   8913  N  N     . GLU B 1 434 ? -12.583 -18.231 -11.830 1.00 34.78 ? 434 GLU B N     1 
ATOM   8914  C  CA    . GLU B 1 434 ? -11.167 -18.425 -12.045 1.00 34.89 ? 434 GLU B CA    1 
ATOM   8915  C  C     . GLU B 1 434 ? -10.398 -17.210 -11.548 1.00 35.09 ? 434 GLU B C     1 
ATOM   8916  O  O     . GLU B 1 434 ? -10.874 -16.070 -11.652 1.00 34.66 ? 434 GLU B O     1 
ATOM   8917  C  CB    . GLU B 1 434 ? -10.886 -18.689 -13.527 1.00 35.33 ? 434 GLU B CB    1 
ATOM   8918  C  CG    . GLU B 1 434 ? -11.096 -20.135 -13.965 1.00 35.55 ? 434 GLU B CG    1 
ATOM   8919  C  CD    . GLU B 1 434 ? -10.995 -20.339 -15.474 1.00 35.60 ? 434 GLU B CD    1 
ATOM   8920  O  OE1   . GLU B 1 434 ? -10.239 -19.587 -16.139 1.00 36.58 ? 434 GLU B OE1   1 
ATOM   8921  O  OE2   . GLU B 1 434 ? -11.665 -21.265 -15.994 1.00 33.74 ? 434 GLU B OE2   1 
ATOM   8922  N  N     . TYR B 1 435 ? -9.208  -17.471 -11.010 1.00 35.07 ? 435 TYR B N     1 
ATOM   8923  C  CA    . TYR B 1 435 ? -8.388  -16.453 -10.384 1.00 35.04 ? 435 TYR B CA    1 
ATOM   8924  C  C     . TYR B 1 435 ? -7.833  -15.454 -11.403 1.00 35.71 ? 435 TYR B C     1 
ATOM   8925  O  O     . TYR B 1 435 ? -7.438  -15.829 -12.504 1.00 36.13 ? 435 TYR B O     1 
ATOM   8926  C  CB    . TYR B 1 435 ? -7.251  -17.126 -9.607  1.00 35.45 ? 435 TYR B CB    1 
ATOM   8927  C  CG    . TYR B 1 435 ? -6.255  -16.178 -8.982  1.00 34.33 ? 435 TYR B CG    1 
ATOM   8928  C  CD1   . TYR B 1 435 ? -6.596  -15.414 -7.864  1.00 33.19 ? 435 TYR B CD1   1 
ATOM   8929  C  CD2   . TYR B 1 435 ? -4.971  -16.048 -9.510  1.00 34.68 ? 435 TYR B CD2   1 
ATOM   8930  C  CE1   . TYR B 1 435 ? -5.685  -14.534 -7.283  1.00 34.28 ? 435 TYR B CE1   1 
ATOM   8931  C  CE2   . TYR B 1 435 ? -4.044  -15.175 -8.941  1.00 35.17 ? 435 TYR B CE2   1 
ATOM   8932  C  CZ    . TYR B 1 435 ? -4.405  -14.428 -7.823  1.00 36.08 ? 435 TYR B CZ    1 
ATOM   8933  O  OH    . TYR B 1 435 ? -3.497  -13.566 -7.264  1.00 37.08 ? 435 TYR B OH    1 
ATOM   8934  N  N     . THR B 1 436 ? -7.833  -14.178 -11.031 1.00 35.86 ? 436 THR B N     1 
ATOM   8935  C  CA    . THR B 1 436 ? -7.211  -13.131 -11.840 1.00 36.65 ? 436 THR B CA    1 
ATOM   8936  C  C     . THR B 1 436 ? -6.312  -12.272 -10.957 1.00 37.34 ? 436 THR B C     1 
ATOM   8937  O  O     . THR B 1 436 ? -6.526  -12.187 -9.747  1.00 36.76 ? 436 THR B O     1 
ATOM   8938  C  CB    . THR B 1 436 ? -8.261  -12.214 -12.501 1.00 36.39 ? 436 THR B CB    1 
ATOM   8939  O  OG1   . THR B 1 436 ? -9.047  -11.585 -11.475 1.00 37.09 ? 436 THR B OG1   1 
ATOM   8940  C  CG2   . THR B 1 436 ? -9.165  -13.000 -13.426 1.00 34.63 ? 436 THR B CG2   1 
ATOM   8941  N  N     . SER B 1 437 ? -5.310  -11.649 -11.575 1.00 38.60 ? 437 SER B N     1 
ATOM   8942  C  CA    . SER B 1 437 ? -4.394  -10.724 -10.902 1.00 39.95 ? 437 SER B CA    1 
ATOM   8943  C  C     . SER B 1 437 ? -3.777  -9.770  -11.928 1.00 41.30 ? 437 SER B C     1 
ATOM   8944  O  O     . SER B 1 437 ? -4.163  -9.765  -13.095 1.00 41.06 ? 437 SER B O     1 
ATOM   8945  C  CB    . SER B 1 437 ? -3.287  -11.486 -10.161 1.00 40.36 ? 437 SER B CB    1 
ATOM   8946  O  OG    . SER B 1 437 ? -2.327  -12.010 -11.067 1.00 41.54 ? 437 SER B OG    1 
ATOM   8947  N  N     . LYS B 1 438 ? -2.812  -8.966  -11.493 1.00 43.14 ? 438 LYS B N     1 
ATOM   8948  C  CA    . LYS B 1 438 ? -2.107  -8.072  -12.407 1.00 44.84 ? 438 LYS B CA    1 
ATOM   8949  C  C     . LYS B 1 438 ? -1.450  -8.874  -13.530 1.00 45.79 ? 438 LYS B C     1 
ATOM   8950  O  O     . LYS B 1 438 ? -1.526  -8.493  -14.700 1.00 46.88 ? 438 LYS B O     1 
ATOM   8951  C  CB    . LYS B 1 438 ? -1.078  -7.211  -11.661 1.00 45.61 ? 438 LYS B CB    1 
ATOM   8952  N  N     . ASP B 1 439 ? -0.845  -10.003 -13.174 1.00 46.02 ? 439 ASP B N     1 
ATOM   8953  C  CA    . ASP B 1 439 ? -0.098  -10.812 -14.127 1.00 46.88 ? 439 ASP B CA    1 
ATOM   8954  C  C     . ASP B 1 439 ? -0.962  -11.833 -14.862 1.00 45.71 ? 439 ASP B C     1 
ATOM   8955  O  O     . ASP B 1 439 ? -0.479  -12.517 -15.763 1.00 46.50 ? 439 ASP B O     1 
ATOM   8956  C  CB    . ASP B 1 439 ? 1.056   -11.531 -13.414 1.00 47.72 ? 439 ASP B CB    1 
ATOM   8957  C  CG    . ASP B 1 439 ? 2.138   -10.574 -12.918 1.00 51.29 ? 439 ASP B CG    1 
ATOM   8958  O  OD1   . ASP B 1 439 ? 3.131   -11.062 -12.329 1.00 54.79 ? 439 ASP B OD1   1 
ATOM   8959  O  OD2   . ASP B 1 439 ? 2.016   -9.339  -13.110 1.00 52.88 ? 439 ASP B OD2   1 
ATOM   8960  N  N     . GLU B 1 440 ? -2.231  -11.950 -14.490 1.00 44.17 ? 440 GLU B N     1 
ATOM   8961  C  CA    . GLU B 1 440 ? -3.024  -13.084 -14.957 1.00 43.57 ? 440 GLU B CA    1 
ATOM   8962  C  C     . GLU B 1 440 ? -4.440  -12.765 -15.423 1.00 42.04 ? 440 GLU B C     1 
ATOM   8963  O  O     . GLU B 1 440 ? -5.299  -12.411 -14.620 1.00 41.40 ? 440 GLU B O     1 
ATOM   8964  C  CB    . GLU B 1 440 ? -3.059  -14.178 -13.876 1.00 43.02 ? 440 GLU B CB    1 
ATOM   8965  C  CG    . GLU B 1 440 ? -1.721  -14.913 -13.683 1.00 44.56 ? 440 GLU B CG    1 
ATOM   8966  C  CD    . GLU B 1 440 ? -1.819  -16.069 -12.697 1.00 44.43 ? 440 GLU B CD    1 
ATOM   8967  O  OE1   . GLU B 1 440 ? -2.871  -16.739 -12.659 1.00 44.73 ? 440 GLU B OE1   1 
ATOM   8968  O  OE2   . GLU B 1 440 ? -0.842  -16.316 -11.965 1.00 46.82 ? 440 GLU B OE2   1 
ATOM   8969  N  N     . VAL B 1 441 ? -4.686  -12.911 -16.721 1.00 42.11 ? 441 VAL B N     1 
ATOM   8970  C  CA    . VAL B 1 441 ? -6.070  -12.904 -17.216 1.00 41.08 ? 441 VAL B CA    1 
ATOM   8971  C  C     . VAL B 1 441 ? -6.563  -14.324 -17.518 1.00 40.68 ? 441 VAL B C     1 
ATOM   8972  O  O     . VAL B 1 441 ? -6.006  -15.045 -18.355 1.00 41.18 ? 441 VAL B O     1 
ATOM   8973  C  CB    . VAL B 1 441 ? -6.386  -11.816 -18.329 1.00 41.55 ? 441 VAL B CB    1 
ATOM   8974  C  CG1   . VAL B 1 441 ? -5.156  -11.066 -18.773 1.00 42.15 ? 441 VAL B CG1   1 
ATOM   8975  C  CG2   . VAL B 1 441 ? -7.208  -12.375 -19.510 1.00 40.83 ? 441 VAL B CG2   1 
ATOM   8976  N  N     . ALA B 1 442 ? -7.592  -14.721 -16.779 1.00 39.67 ? 442 ALA B N     1 
ATOM   8977  C  CA    . ALA B 1 442 ? -8.149  -16.056 -16.879 1.00 39.37 ? 442 ALA B CA    1 
ATOM   8978  C  C     . ALA B 1 442 ? -8.914  -16.269 -18.183 1.00 39.64 ? 442 ALA B C     1 
ATOM   8979  O  O     . ALA B 1 442 ? -9.506  -15.335 -18.739 1.00 39.17 ? 442 ALA B O     1 
ATOM   8980  C  CB    . ALA B 1 442 ? -9.036  -16.342 -15.678 1.00 38.84 ? 442 ALA B CB    1 
ATOM   8981  N  N     . VAL B 1 443 ? -8.875  -17.514 -18.654 1.00 39.98 ? 443 VAL B N     1 
ATOM   8982  C  CA    . VAL B 1 443 ? -9.438  -17.924 -19.932 1.00 40.56 ? 443 VAL B CA    1 
ATOM   8983  C  C     . VAL B 1 443 ? -10.418 -19.080 -19.699 1.00 40.57 ? 443 VAL B C     1 
ATOM   8984  O  O     . VAL B 1 443 ? -10.186 -19.945 -18.843 1.00 40.03 ? 443 VAL B O     1 
ATOM   8985  C  CB    . VAL B 1 443 ? -8.324  -18.405 -20.900 1.00 41.72 ? 443 VAL B CB    1 
ATOM   8986  C  CG1   . VAL B 1 443 ? -8.822  -18.461 -22.345 1.00 40.99 ? 443 VAL B CG1   1 
ATOM   8987  C  CG2   . VAL B 1 443 ? -7.080  -17.509 -20.802 1.00 42.90 ? 443 VAL B CG2   1 
ATOM   8988  N  N     . CYS B 1 444 ? -11.511 -19.077 -20.459 1.00 40.98 ? 444 CYS B N     1 
ATOM   8989  C  CA    . CYS B 1 444 ? -12.498 -20.155 -20.422 1.00 41.25 ? 444 CYS B CA    1 
ATOM   8990  C  C     . CYS B 1 444 ? -12.375 -21.025 -21.675 1.00 41.03 ? 444 CYS B C     1 
ATOM   8991  O  O     . CYS B 1 444 ? -12.651 -20.565 -22.782 1.00 41.63 ? 444 CYS B O     1 
ATOM   8992  C  CB    . CYS B 1 444 ? -13.918 -19.587 -20.323 1.00 41.29 ? 444 CYS B CB    1 
ATOM   8993  S  SG    . CYS B 1 444 ? -14.042 -17.984 -19.474 1.00 45.29 ? 444 CYS B SG    1 
ATOM   8994  N  N     . ASN B 1 445 ? -11.951 -22.273 -21.488 1.00 40.16 ? 445 ASN B N     1 
ATOM   8995  C  CA    . ASN B 1 445 ? -11.812 -23.245 -22.577 1.00 39.85 ? 445 ASN B CA    1 
ATOM   8996  C  C     . ASN B 1 445 ? -12.985 -24.236 -22.511 1.00 38.77 ? 445 ASN B C     1 
ATOM   8997  O  O     . ASN B 1 445 ? -13.061 -25.039 -21.580 1.00 38.29 ? 445 ASN B O     1 
ATOM   8998  C  CB    . ASN B 1 445 ? -10.474 -23.978 -22.439 1.00 40.28 ? 445 ASN B CB    1 
ATOM   8999  C  CG    . ASN B 1 445 ? -9.332  -23.048 -21.994 1.00 41.05 ? 445 ASN B CG    1 
ATOM   9000  O  OD1   . ASN B 1 445 ? -8.780  -22.285 -22.798 1.00 43.06 ? 445 ASN B OD1   1 
ATOM   9001  N  ND2   . ASN B 1 445 ? -8.971  -23.123 -20.720 1.00 38.24 ? 445 ASN B ND2   1 
ATOM   9002  N  N     . LEU B 1 446 ? -13.896 -24.179 -23.484 1.00 38.22 ? 446 LEU B N     1 
ATOM   9003  C  CA    . LEU B 1 446 ? -15.245 -24.735 -23.284 1.00 37.10 ? 446 LEU B CA    1 
ATOM   9004  C  C     . LEU B 1 446 ? -15.799 -25.727 -24.307 1.00 37.01 ? 446 LEU B C     1 
ATOM   9005  O  O     . LEU B 1 446 ? -15.557 -25.613 -25.500 1.00 37.66 ? 446 LEU B O     1 
ATOM   9006  C  CB    . LEU B 1 446 ? -16.260 -23.601 -23.142 1.00 36.86 ? 446 LEU B CB    1 
ATOM   9007  C  CG    . LEU B 1 446 ? -15.940 -22.420 -22.231 1.00 37.00 ? 446 LEU B CG    1 
ATOM   9008  C  CD1   . LEU B 1 446 ? -16.952 -21.308 -22.498 1.00 38.75 ? 446 LEU B CD1   1 
ATOM   9009  C  CD2   . LEU B 1 446 ? -15.914 -22.808 -20.747 1.00 35.79 ? 446 LEU B CD2   1 
ATOM   9010  N  N     . ALA B 1 447 ? -16.589 -26.676 -23.804 1.00 36.25 ? 447 ALA B N     1 
ATOM   9011  C  CA    . ALA B 1 447 ? -17.335 -27.640 -24.620 1.00 36.11 ? 447 ALA B CA    1 
ATOM   9012  C  C     . ALA B 1 447 ? -18.583 -28.087 -23.850 1.00 35.19 ? 447 ALA B C     1 
ATOM   9013  O  O     . ALA B 1 447 ? -18.670 -27.858 -22.646 1.00 34.79 ? 447 ALA B O     1 
ATOM   9014  C  CB    . ALA B 1 447 ? -16.460 -28.836 -24.969 1.00 36.22 ? 447 ALA B CB    1 
ATOM   9015  N  N     . SER B 1 448 ? -19.542 -28.701 -24.542 1.00 35.19 ? 448 SER B N     1 
ATOM   9016  C  CA    . SER B 1 448 ? -20.740 -29.244 -23.898 1.00 34.88 ? 448 SER B CA    1 
ATOM   9017  C  C     . SER B 1 448 ? -21.074 -30.661 -24.359 1.00 35.07 ? 448 SER B C     1 
ATOM   9018  O  O     . SER B 1 448 ? -20.936 -30.986 -25.539 1.00 35.65 ? 448 SER B O     1 
ATOM   9019  C  CB    . SER B 1 448 ? -21.964 -28.347 -24.131 1.00 34.80 ? 448 SER B CB    1 
ATOM   9020  O  OG    . SER B 1 448 ? -22.277 -28.242 -25.511 1.00 36.44 ? 448 SER B OG    1 
ATOM   9021  N  N     . LEU B 1 449 ? -21.507 -31.483 -23.403 1.00 34.35 ? 449 LEU B N     1 
ATOM   9022  C  CA    . LEU B 1 449 ? -22.038 -32.814 -23.660 1.00 34.69 ? 449 LEU B CA    1 
ATOM   9023  C  C     . LEU B 1 449 ? -23.524 -32.738 -24.031 1.00 34.43 ? 449 LEU B C     1 
ATOM   9024  O  O     . LEU B 1 449 ? -24.274 -32.001 -23.400 1.00 33.83 ? 449 LEU B O     1 
ATOM   9025  C  CB    . LEU B 1 449 ? -21.914 -33.683 -22.405 1.00 34.43 ? 449 LEU B CB    1 
ATOM   9026  C  CG    . LEU B 1 449 ? -20.631 -34.381 -21.948 1.00 35.05 ? 449 LEU B CG    1 
ATOM   9027  C  CD1   . LEU B 1 449 ? -19.554 -34.474 -23.028 1.00 35.16 ? 449 LEU B CD1   1 
ATOM   9028  C  CD2   . LEU B 1 449 ? -20.096 -33.773 -20.663 1.00 34.64 ? 449 LEU B CD2   1 
ATOM   9029  N  N     . ALA B 1 450 ? -23.944 -33.510 -25.031 1.00 34.44 ? 450 ALA B N     1 
ATOM   9030  C  CA    . ALA B 1 450 ? -25.358 -33.582 -25.391 1.00 34.69 ? 450 ALA B CA    1 
ATOM   9031  C  C     . ALA B 1 450 ? -26.059 -34.676 -24.581 1.00 34.52 ? 450 ALA B C     1 
ATOM   9032  O  O     . ALA B 1 450 ? -26.054 -35.841 -24.971 1.00 34.73 ? 450 ALA B O     1 
ATOM   9033  C  CB    . ALA B 1 450 ? -25.528 -33.810 -26.893 1.00 35.37 ? 450 ALA B CB    1 
ATOM   9034  N  N     . LEU B 1 451 ? -26.674 -34.275 -23.468 1.00 34.18 ? 451 LEU B N     1 
ATOM   9035  C  CA    . LEU B 1 451 ? -27.232 -35.191 -22.466 1.00 34.44 ? 451 LEU B CA    1 
ATOM   9036  C  C     . LEU B 1 451 ? -28.364 -36.112 -22.946 1.00 35.91 ? 451 LEU B C     1 
ATOM   9037  O  O     . LEU B 1 451 ? -28.569 -37.188 -22.381 1.00 36.40 ? 451 LEU B O     1 
ATOM   9038  C  CB    . LEU B 1 451 ? -27.689 -34.407 -21.235 1.00 33.31 ? 451 LEU B CB    1 
ATOM   9039  C  CG    . LEU B 1 451 ? -26.622 -33.726 -20.367 1.00 32.83 ? 451 LEU B CG    1 
ATOM   9040  C  CD1   . LEU B 1 451 ? -27.279 -33.085 -19.141 1.00 31.12 ? 451 LEU B CD1   1 
ATOM   9041  C  CD2   . LEU B 1 451 ? -25.499 -34.682 -19.936 1.00 30.59 ? 451 LEU B CD2   1 
ATOM   9042  N  N     . ASN B 1 452 ? -29.096 -35.689 -23.974 1.00 37.06 ? 452 ASN B N     1 
ATOM   9043  C  CA    . ASN B 1 452 ? -30.121 -36.521 -24.607 1.00 38.60 ? 452 ASN B CA    1 
ATOM   9044  C  C     . ASN B 1 452 ? -29.570 -37.768 -25.307 1.00 39.42 ? 452 ASN B C     1 
ATOM   9045  O  O     . ASN B 1 452 ? -30.293 -38.755 -25.452 1.00 39.73 ? 452 ASN B O     1 
ATOM   9046  C  CB    . ASN B 1 452 ? -30.881 -35.700 -25.641 1.00 39.19 ? 452 ASN B CB    1 
ATOM   9047  C  CG    . ASN B 1 452 ? -29.955 -34.967 -26.556 1.00 39.13 ? 452 ASN B CG    1 
ATOM   9048  O  OD1   . ASN B 1 452 ? -29.097 -34.208 -26.091 1.00 38.28 ? 452 ASN B OD1   1 
ATOM   9049  N  ND2   . ASN B 1 452 ? -30.088 -35.200 -27.867 1.00 39.29 ? 452 ASN B ND2   1 
ATOM   9050  N  N     . MET B 1 453 ? -28.309 -37.714 -25.745 1.00 39.33 ? 453 MET B N     1 
ATOM   9051  C  CA    . MET B 1 453 ? -27.705 -38.814 -26.519 1.00 40.62 ? 453 MET B CA    1 
ATOM   9052  C  C     . MET B 1 453 ? -27.415 -40.079 -25.707 1.00 41.10 ? 453 MET B C     1 
ATOM   9053  O  O     . MET B 1 453 ? -27.254 -41.152 -26.283 1.00 42.23 ? 453 MET B O     1 
ATOM   9054  C  CB    . MET B 1 453 ? -26.414 -38.364 -27.212 1.00 40.27 ? 453 MET B CB    1 
ATOM   9055  C  CG    . MET B 1 453 ? -26.609 -37.383 -28.358 1.00 41.52 ? 453 MET B CG    1 
ATOM   9056  S  SD    . MET B 1 453 ? -27.508 -38.078 -29.757 1.00 43.69 ? 453 MET B SD    1 
ATOM   9057  C  CE    . MET B 1 453 ? -26.382 -39.374 -30.281 1.00 43.96 ? 453 MET B CE    1 
ATOM   9058  N  N     . TYR B 1 454 ? -27.351 -39.949 -24.382 1.00 40.80 ? 454 TYR B N     1 
ATOM   9059  C  CA    . TYR B 1 454 ? -26.967 -41.052 -23.504 1.00 40.86 ? 454 TYR B CA    1 
ATOM   9060  C  C     . TYR B 1 454 ? -28.163 -41.861 -22.981 1.00 42.43 ? 454 TYR B C     1 
ATOM   9061  O  O     . TYR B 1 454 ? -27.976 -42.846 -22.278 1.00 42.98 ? 454 TYR B O     1 
ATOM   9062  C  CB    . TYR B 1 454 ? -26.028 -40.552 -22.383 1.00 39.22 ? 454 TYR B CB    1 
ATOM   9063  C  CG    . TYR B 1 454 ? -24.866 -39.771 -22.959 1.00 37.75 ? 454 TYR B CG    1 
ATOM   9064  C  CD1   . TYR B 1 454 ? -24.989 -38.412 -23.239 1.00 36.98 ? 454 TYR B CD1   1 
ATOM   9065  C  CD2   . TYR B 1 454 ? -23.668 -40.401 -23.291 1.00 37.53 ? 454 TYR B CD2   1 
ATOM   9066  C  CE1   . TYR B 1 454 ? -23.951 -37.697 -23.818 1.00 35.98 ? 454 TYR B CE1   1 
ATOM   9067  C  CE2   . TYR B 1 454 ? -22.621 -39.693 -23.875 1.00 37.12 ? 454 TYR B CE2   1 
ATOM   9068  C  CZ    . TYR B 1 454 ? -22.771 -38.339 -24.136 1.00 36.74 ? 454 TYR B CZ    1 
ATOM   9069  O  OH    . TYR B 1 454 ? -21.753 -37.616 -24.708 1.00 36.34 ? 454 TYR B OH    1 
ATOM   9070  N  N     . VAL B 1 455 ? -29.386 -41.481 -23.352 1.00 43.93 ? 455 VAL B N     1 
ATOM   9071  C  CA    . VAL B 1 455 ? -30.547 -42.339 -23.047 1.00 45.98 ? 455 VAL B CA    1 
ATOM   9072  C  C     . VAL B 1 455 ? -30.785 -43.412 -24.119 1.00 48.33 ? 455 VAL B C     1 
ATOM   9073  O  O     . VAL B 1 455 ? -30.713 -43.143 -25.324 1.00 48.83 ? 455 VAL B O     1 
ATOM   9074  C  CB    . VAL B 1 455 ? -31.851 -41.556 -22.624 1.00 46.01 ? 455 VAL B CB    1 
ATOM   9075  C  CG1   . VAL B 1 455 ? -31.781 -40.086 -22.971 1.00 44.93 ? 455 VAL B CG1   1 
ATOM   9076  C  CG2   . VAL B 1 455 ? -33.128 -42.217 -23.160 1.00 46.66 ? 455 VAL B CG2   1 
ATOM   9077  N  N     . THR B 1 456 ? -31.039 -44.636 -23.656 1.00 50.18 ? 456 THR B N     1 
ATOM   9078  C  CA    . THR B 1 456 ? -31.179 -45.798 -24.533 1.00 52.51 ? 456 THR B CA    1 
ATOM   9079  C  C     . THR B 1 456 ? -32.638 -46.046 -24.909 1.00 54.47 ? 456 THR B C     1 
ATOM   9080  O  O     . THR B 1 456 ? -33.548 -45.453 -24.316 1.00 54.93 ? 456 THR B O     1 
ATOM   9081  C  CB    . THR B 1 456 ? -30.635 -47.072 -23.855 1.00 52.83 ? 456 THR B CB    1 
ATOM   9082  O  OG1   . THR B 1 456 ? -31.475 -47.403 -22.744 1.00 53.89 ? 456 THR B OG1   1 
ATOM   9083  C  CG2   . THR B 1 456 ? -29.192 -46.879 -23.373 1.00 51.24 ? 456 THR B CG2   1 
ATOM   9084  N  N     . SER B 1 457 ? -32.855 -46.935 -25.880 1.00 56.56 ? 457 SER B N     1 
ATOM   9085  C  CA    . SER B 1 457 ? -34.205 -47.307 -26.335 1.00 58.87 ? 457 SER B CA    1 
ATOM   9086  C  C     . SER B 1 457 ? -35.084 -47.889 -25.215 1.00 59.83 ? 457 SER B C     1 
ATOM   9087  O  O     . SER B 1 457 ? -36.303 -48.015 -25.378 1.00 61.36 ? 457 SER B O     1 
ATOM   9088  C  CB    . SER B 1 457 ? -34.126 -48.318 -27.485 1.00 60.03 ? 457 SER B CB    1 
ATOM   9089  O  OG    . SER B 1 457 ? -33.020 -48.048 -28.332 1.00 60.21 ? 457 SER B OG    1 
ATOM   9090  N  N     . GLU B 1 458 ? -34.455 -48.234 -24.089 1.00 59.51 ? 458 GLU B N     1 
ATOM   9091  C  CA    . GLU B 1 458 ? -35.128 -48.875 -22.957 1.00 59.72 ? 458 GLU B CA    1 
ATOM   9092  C  C     . GLU B 1 458 ? -35.301 -47.935 -21.766 1.00 58.66 ? 458 GLU B C     1 
ATOM   9093  O  O     . GLU B 1 458 ? -35.514 -48.396 -20.639 1.00 58.92 ? 458 GLU B O     1 
ATOM   9094  C  CB    . GLU B 1 458 ? -34.367 -50.143 -22.533 1.00 60.24 ? 458 GLU B CB    1 
ATOM   9095  N  N     . HIS B 1 459 ? -35.213 -46.626 -22.023 1.00 57.18 ? 459 HIS B N     1 
ATOM   9096  C  CA    . HIS B 1 459 ? -35.381 -45.597 -20.991 1.00 55.71 ? 459 HIS B CA    1 
ATOM   9097  C  C     . HIS B 1 459 ? -34.443 -45.823 -19.803 1.00 54.16 ? 459 HIS B C     1 
ATOM   9098  O  O     . HIS B 1 459 ? -34.867 -45.796 -18.637 1.00 54.59 ? 459 HIS B O     1 
ATOM   9099  C  CB    . HIS B 1 459 ? -36.836 -45.508 -20.517 1.00 56.90 ? 459 HIS B CB    1 
ATOM   9100  C  CG    . HIS B 1 459 ? -37.829 -45.389 -21.630 1.00 59.70 ? 459 HIS B CG    1 
ATOM   9101  N  ND1   . HIS B 1 459 ? -38.170 -46.451 -22.443 1.00 62.85 ? 459 HIS B ND1   1 
ATOM   9102  C  CD2   . HIS B 1 459 ? -38.569 -44.338 -22.056 1.00 60.88 ? 459 HIS B CD2   1 
ATOM   9103  C  CE1   . HIS B 1 459 ? -39.068 -46.056 -23.328 1.00 63.96 ? 459 HIS B CE1   1 
ATOM   9104  N  NE2   . HIS B 1 459 ? -39.330 -44.779 -23.112 1.00 63.57 ? 459 HIS B NE2   1 
ATOM   9105  N  N     . THR B 1 460 ? -33.172 -46.066 -20.118 1.00 52.07 ? 460 THR B N     1 
ATOM   9106  C  CA    . THR B 1 460 ? -32.109 -46.182 -19.123 1.00 49.83 ? 460 THR B CA    1 
ATOM   9107  C  C     . THR B 1 460 ? -31.040 -45.155 -19.463 1.00 47.47 ? 460 THR B C     1 
ATOM   9108  O  O     . THR B 1 460 ? -30.903 -44.753 -20.614 1.00 47.63 ? 460 THR B O     1 
ATOM   9109  C  CB    . THR B 1 460 ? -31.466 -47.590 -19.114 1.00 50.68 ? 460 THR B CB    1 
ATOM   9110  O  OG1   . THR B 1 460 ? -30.754 -47.802 -20.341 1.00 51.10 ? 460 THR B OG1   1 
ATOM   9111  C  CG2   . THR B 1 460 ? -32.517 -48.689 -18.931 1.00 51.20 ? 460 THR B CG2   1 
ATOM   9112  N  N     . TYR B 1 461 ? -30.274 -44.724 -18.476 1.00 45.21 ? 461 TYR B N     1 
ATOM   9113  C  CA    . TYR B 1 461 ? -29.241 -43.757 -18.765 1.00 42.75 ? 461 TYR B CA    1 
ATOM   9114  C  C     . TYR B 1 461 ? -27.835 -44.393 -18.836 1.00 42.35 ? 461 TYR B C     1 
ATOM   9115  O  O     . TYR B 1 461 ? -27.365 -45.021 -17.878 1.00 41.96 ? 461 TYR B O     1 
ATOM   9116  C  CB    . TYR B 1 461 ? -29.305 -42.559 -17.803 1.00 41.38 ? 461 TYR B CB    1 
ATOM   9117  C  CG    . TYR B 1 461 ? -28.710 -41.322 -18.433 1.00 39.59 ? 461 TYR B CG    1 
ATOM   9118  C  CD1   . TYR B 1 461 ? -29.507 -40.421 -19.134 1.00 38.38 ? 461 TYR B CD1   1 
ATOM   9119  C  CD2   . TYR B 1 461 ? -27.338 -41.081 -18.371 1.00 37.21 ? 461 TYR B CD2   1 
ATOM   9120  C  CE1   . TYR B 1 461 ? -28.952 -39.303 -19.745 1.00 37.55 ? 461 TYR B CE1   1 
ATOM   9121  C  CE2   . TYR B 1 461 ? -26.777 -39.971 -18.972 1.00 37.20 ? 461 TYR B CE2   1 
ATOM   9122  C  CZ    . TYR B 1 461 ? -27.585 -39.089 -19.662 1.00 37.75 ? 461 TYR B CZ    1 
ATOM   9123  O  OH    . TYR B 1 461 ? -27.013 -37.995 -20.266 1.00 37.57 ? 461 TYR B OH    1 
ATOM   9124  N  N     . ASP B 1 462 ? -27.172 -44.222 -19.978 1.00 41.38 ? 462 ASP B N     1 
ATOM   9125  C  CA    . ASP B 1 462 ? -25.850 -44.800 -20.170 1.00 41.33 ? 462 ASP B CA    1 
ATOM   9126  C  C     . ASP B 1 462 ? -24.725 -43.980 -19.526 1.00 40.17 ? 462 ASP B C     1 
ATOM   9127  O  O     . ASP B 1 462 ? -23.989 -43.253 -20.202 1.00 39.33 ? 462 ASP B O     1 
ATOM   9128  C  CB    . ASP B 1 462 ? -25.558 -45.074 -21.650 1.00 41.73 ? 462 ASP B CB    1 
ATOM   9129  C  CG    . ASP B 1 462 ? -24.344 -45.970 -21.846 1.00 42.78 ? 462 ASP B CG    1 
ATOM   9130  O  OD1   . ASP B 1 462 ? -24.201 -46.542 -22.944 1.00 43.22 ? 462 ASP B OD1   1 
ATOM   9131  O  OD2   . ASP B 1 462 ? -23.523 -46.100 -20.904 1.00 44.41 ? 462 ASP B OD2   1 
ATOM   9132  N  N     . PHE B 1 463 ? -24.590 -44.147 -18.213 1.00 39.91 ? 463 PHE B N     1 
ATOM   9133  C  CA    . PHE B 1 463 ? -23.564 -43.466 -17.424 1.00 39.40 ? 463 PHE B CA    1 
ATOM   9134  C  C     . PHE B 1 463 ? -22.126 -43.767 -17.853 1.00 39.61 ? 463 PHE B C     1 
ATOM   9135  O  O     . PHE B 1 463 ? -21.290 -42.875 -17.828 1.00 39.45 ? 463 PHE B O     1 
ATOM   9136  C  CB    . PHE B 1 463 ? -23.767 -43.752 -15.937 1.00 39.19 ? 463 PHE B CB    1 
ATOM   9137  C  CG    . PHE B 1 463 ? -25.093 -43.263 -15.411 1.00 39.63 ? 463 PHE B CG    1 
ATOM   9138  C  CD1   . PHE B 1 463 ? -26.072 -44.163 -14.998 1.00 40.15 ? 463 PHE B CD1   1 
ATOM   9139  C  CD2   . PHE B 1 463 ? -25.378 -41.898 -15.359 1.00 37.91 ? 463 PHE B CD2   1 
ATOM   9140  C  CE1   . PHE B 1 463 ? -27.305 -43.712 -14.522 1.00 39.47 ? 463 PHE B CE1   1 
ATOM   9141  C  CE2   . PHE B 1 463 ? -26.604 -41.449 -14.895 1.00 38.61 ? 463 PHE B CE2   1 
ATOM   9142  C  CZ    . PHE B 1 463 ? -27.573 -42.361 -14.474 1.00 38.80 ? 463 PHE B CZ    1 
ATOM   9143  N  N     . LYS B 1 464 ? -21.844 -45.007 -18.250 1.00 40.75 ? 464 LYS B N     1 
ATOM   9144  C  CA    . LYS B 1 464 ? -20.504 -45.385 -18.722 1.00 41.17 ? 464 LYS B CA    1 
ATOM   9145  C  C     . LYS B 1 464 ? -20.106 -44.624 -19.985 1.00 40.53 ? 464 LYS B C     1 
ATOM   9146  O  O     . LYS B 1 464 ? -19.007 -44.086 -20.059 1.00 40.74 ? 464 LYS B O     1 
ATOM   9147  C  CB    . LYS B 1 464 ? -20.396 -46.894 -18.964 1.00 42.59 ? 464 LYS B CB    1 
ATOM   9148  C  CG    . LYS B 1 464 ? -20.378 -47.749 -17.688 1.00 43.96 ? 464 LYS B CG    1 
ATOM   9149  C  CD    . LYS B 1 464 ? -20.130 -49.214 -18.015 1.00 44.52 ? 464 LYS B CD    1 
ATOM   9150  C  CE    . LYS B 1 464 ? -20.097 -50.043 -16.739 1.00 49.08 ? 464 LYS B CE    1 
ATOM   9151  N  NZ    . LYS B 1 464 ? -21.469 -50.381 -16.203 1.00 50.71 ? 464 LYS B NZ    1 
ATOM   9152  N  N     . LYS B 1 465 ? -21.000 -44.584 -20.971 1.00 40.12 ? 465 LYS B N     1 
ATOM   9153  C  CA    . LYS B 1 465 ? -20.764 -43.818 -22.189 1.00 39.26 ? 465 LYS B CA    1 
ATOM   9154  C  C     . LYS B 1 465 ? -20.477 -42.344 -21.906 1.00 38.21 ? 465 LYS B C     1 
ATOM   9155  O  O     . LYS B 1 465 ? -19.540 -41.775 -22.466 1.00 38.25 ? 465 LYS B O     1 
ATOM   9156  C  CB    . LYS B 1 465 ? -21.942 -43.940 -23.158 1.00 39.19 ? 465 LYS B CB    1 
ATOM   9157  C  CG    . LYS B 1 465 ? -21.710 -43.255 -24.495 1.00 38.62 ? 465 LYS B CG    1 
ATOM   9158  C  CD    . LYS B 1 465 ? -20.572 -43.906 -25.264 1.00 38.27 ? 465 LYS B CD    1 
ATOM   9159  C  CE    . LYS B 1 465 ? -20.290 -43.187 -26.567 1.00 37.85 ? 465 LYS B CE    1 
ATOM   9160  N  NZ    . LYS B 1 465 ? -19.751 -44.117 -27.586 1.00 38.31 ? 465 LYS B NZ    1 
ATOM   9161  N  N     . LEU B 1 466 ? -21.286 -41.737 -21.041 1.00 37.22 ? 466 LEU B N     1 
ATOM   9162  C  CA    . LEU B 1 466 ? -21.102 -40.352 -20.655 1.00 36.15 ? 466 LEU B CA    1 
ATOM   9163  C  C     . LEU B 1 466 ? -19.718 -40.094 -20.033 1.00 36.44 ? 466 LEU B C     1 
ATOM   9164  O  O     . LEU B 1 466 ? -19.055 -39.093 -20.365 1.00 35.85 ? 466 LEU B O     1 
ATOM   9165  C  CB    . LEU B 1 466 ? -22.214 -39.928 -19.700 1.00 35.80 ? 466 LEU B CB    1 
ATOM   9166  C  CG    . LEU B 1 466 ? -22.254 -38.489 -19.179 1.00 34.40 ? 466 LEU B CG    1 
ATOM   9167  C  CD1   . LEU B 1 466 ? -22.382 -37.490 -20.313 1.00 34.41 ? 466 LEU B CD1   1 
ATOM   9168  C  CD2   . LEU B 1 466 ? -23.405 -38.348 -18.203 1.00 34.36 ? 466 LEU B CD2   1 
ATOM   9169  N  N     . ALA B 1 467 ? -19.286 -40.986 -19.140 1.00 36.39 ? 467 ALA B N     1 
ATOM   9170  C  CA    . ALA B 1 467 ? -17.951 -40.876 -18.568 1.00 36.63 ? 467 ALA B CA    1 
ATOM   9171  C  C     . ALA B 1 467 ? -16.880 -40.975 -19.663 1.00 37.32 ? 467 ALA B C     1 
ATOM   9172  O  O     . ALA B 1 467 ? -15.924 -40.208 -19.654 1.00 37.32 ? 467 ALA B O     1 
ATOM   9173  C  CB    . ALA B 1 467 ? -17.727 -41.937 -17.491 1.00 37.13 ? 467 ALA B CB    1 
ATOM   9174  N  N     . GLU B 1 468 ? -17.060 -41.898 -20.610 1.00 37.70 ? 468 GLU B N     1 
ATOM   9175  C  CA    . GLU B 1 468 ? -16.063 -42.136 -21.652 1.00 38.63 ? 468 GLU B CA    1 
ATOM   9176  C  C     . GLU B 1 468 ? -15.926 -40.988 -22.651 1.00 38.24 ? 468 GLU B C     1 
ATOM   9177  O  O     . GLU B 1 468 ? -14.808 -40.695 -23.094 1.00 39.41 ? 468 GLU B O     1 
ATOM   9178  C  CB    . GLU B 1 468 ? -16.312 -43.466 -22.397 1.00 39.73 ? 468 GLU B CB    1 
ATOM   9179  C  CG    . GLU B 1 468 ? -16.004 -44.738 -21.582 1.00 40.76 ? 468 GLU B CG    1 
ATOM   9180  C  CD    . GLU B 1 468 ? -14.600 -44.756 -20.951 1.00 41.72 ? 468 GLU B CD    1 
ATOM   9181  O  OE1   . GLU B 1 468 ? -13.606 -44.453 -21.647 1.00 41.45 ? 468 GLU B OE1   1 
ATOM   9182  O  OE2   . GLU B 1 468 ? -14.493 -45.090 -19.750 1.00 42.95 ? 468 GLU B OE2   1 
ATOM   9183  N  N     . VAL B 1 469 ? -17.052 -40.366 -23.015 1.00 36.86 ? 469 VAL B N     1 
ATOM   9184  C  CA    . VAL B 1 469 ? -17.064 -39.189 -23.889 1.00 35.72 ? 469 VAL B CA    1 
ATOM   9185  C  C     . VAL B 1 469 ? -16.434 -37.988 -23.184 1.00 35.29 ? 469 VAL B C     1 
ATOM   9186  O  O     . VAL B 1 469 ? -15.643 -37.259 -23.789 1.00 35.52 ? 469 VAL B O     1 
ATOM   9187  C  CB    . VAL B 1 469 ? -18.494 -38.809 -24.384 1.00 35.16 ? 469 VAL B CB    1 
ATOM   9188  C  CG1   . VAL B 1 469 ? -18.438 -37.540 -25.197 1.00 33.74 ? 469 VAL B CG1   1 
ATOM   9189  C  CG2   . VAL B 1 469 ? -19.102 -39.928 -25.231 1.00 34.98 ? 469 VAL B CG2   1 
ATOM   9190  N  N     . THR B 1 470 ? -16.773 -37.808 -21.907 1.00 34.59 ? 470 THR B N     1 
ATOM   9191  C  CA    . THR B 1 470 ? -16.214 -36.744 -21.071 1.00 34.38 ? 470 THR B CA    1 
ATOM   9192  C  C     . THR B 1 470 ? -14.694 -36.780 -21.046 1.00 35.25 ? 470 THR B C     1 
ATOM   9193  O  O     . THR B 1 470 ? -14.045 -35.732 -21.074 1.00 35.56 ? 470 THR B O     1 
ATOM   9194  C  CB    . THR B 1 470 ? -16.746 -36.820 -19.616 1.00 33.84 ? 470 THR B CB    1 
ATOM   9195  O  OG1   . THR B 1 470 ? -18.177 -36.733 -19.630 1.00 32.71 ? 470 THR B OG1   1 
ATOM   9196  C  CG2   . THR B 1 470 ? -16.177 -35.690 -18.740 1.00 33.20 ? 470 THR B CG2   1 
ATOM   9197  N  N     . LYS B 1 471 ? -14.136 -37.981 -21.000 1.00 36.23 ? 471 LYS B N     1 
ATOM   9198  C  CA    . LYS B 1 471 ? -12.693 -38.170 -20.966 1.00 37.33 ? 471 LYS B CA    1 
ATOM   9199  C  C     . LYS B 1 471 ? -12.012 -37.664 -22.234 1.00 37.43 ? 471 LYS B C     1 
ATOM   9200  O  O     . LYS B 1 471 ? -10.930 -37.086 -22.168 1.00 37.82 ? 471 LYS B O     1 
ATOM   9201  C  CB    . LYS B 1 471 ? -12.356 -39.644 -20.693 1.00 38.49 ? 471 LYS B CB    1 
ATOM   9202  C  CG    . LYS B 1 471 ? -12.490 -40.005 -19.222 1.00 39.81 ? 471 LYS B CG    1 
ATOM   9203  C  CD    . LYS B 1 471 ? -13.242 -41.289 -18.982 1.00 43.12 ? 471 LYS B CD    1 
ATOM   9204  C  CE    . LYS B 1 471 ? -12.322 -42.399 -18.542 1.00 46.82 ? 471 LYS B CE    1 
ATOM   9205  N  NZ    . LYS B 1 471 ? -13.110 -43.550 -18.013 1.00 48.48 ? 471 LYS B NZ    1 
ATOM   9206  N  N     . VAL B 1 472 ? -12.655 -37.881 -23.376 1.00 37.30 ? 472 VAL B N     1 
ATOM   9207  C  CA    . VAL B 1 472 ? -12.187 -37.352 -24.659 1.00 37.44 ? 472 VAL B CA    1 
ATOM   9208  C  C     . VAL B 1 472 ? -12.261 -35.822 -24.642 1.00 36.71 ? 472 VAL B C     1 
ATOM   9209  O  O     . VAL B 1 472 ? -11.316 -35.144 -25.051 1.00 37.22 ? 472 VAL B O     1 
ATOM   9210  C  CB    . VAL B 1 472 ? -13.018 -37.930 -25.848 1.00 38.07 ? 472 VAL B CB    1 
ATOM   9211  C  CG1   . VAL B 1 472 ? -12.724 -37.193 -27.153 1.00 38.71 ? 472 VAL B CG1   1 
ATOM   9212  C  CG2   . VAL B 1 472 ? -12.773 -39.431 -26.002 1.00 38.29 ? 472 VAL B CG2   1 
ATOM   9213  N  N     . VAL B 1 473 ? -13.377 -35.284 -24.144 1.00 35.61 ? 473 VAL B N     1 
ATOM   9214  C  CA    . VAL B 1 473 ? -13.568 -33.830 -24.063 1.00 34.51 ? 473 VAL B CA    1 
ATOM   9215  C  C     . VAL B 1 473 ? -12.465 -33.153 -23.239 1.00 34.37 ? 473 VAL B C     1 
ATOM   9216  O  O     . VAL B 1 473 ? -11.884 -32.164 -23.690 1.00 34.50 ? 473 VAL B O     1 
ATOM   9217  C  CB    . VAL B 1 473 ? -14.981 -33.445 -23.556 1.00 33.49 ? 473 VAL B CB    1 
ATOM   9218  C  CG1   . VAL B 1 473 ? -15.114 -31.937 -23.448 1.00 31.90 ? 473 VAL B CG1   1 
ATOM   9219  C  CG2   . VAL B 1 473 ? -16.046 -33.994 -24.500 1.00 33.55 ? 473 VAL B CG2   1 
ATOM   9220  N  N     . VAL B 1 474 ? -12.173 -33.703 -22.057 1.00 34.14 ? 474 VAL B N     1 
ATOM   9221  C  CA    . VAL B 1 474 ? -11.056 -33.247 -21.219 1.00 34.24 ? 474 VAL B CA    1 
ATOM   9222  C  C     . VAL B 1 474 ? -9.741  -33.222 -22.004 1.00 35.80 ? 474 VAL B C     1 
ATOM   9223  O  O     . VAL B 1 474 ? -8.995  -32.246 -21.942 1.00 36.24 ? 474 VAL B O     1 
ATOM   9224  C  CB    . VAL B 1 474 ? -10.877 -34.120 -19.960 1.00 33.95 ? 474 VAL B CB    1 
ATOM   9225  C  CG1   . VAL B 1 474 ? -9.563  -33.790 -19.248 1.00 33.48 ? 474 VAL B CG1   1 
ATOM   9226  C  CG2   . VAL B 1 474 ? -12.048 -33.950 -19.019 1.00 32.50 ? 474 VAL B CG2   1 
ATOM   9227  N  N     . ARG B 1 475 ? -9.471  -34.296 -22.740 1.00 36.96 ? 475 ARG B N     1 
ATOM   9228  C  CA    . ARG B 1 475 ? -8.231  -34.416 -23.485 1.00 38.83 ? 475 ARG B CA    1 
ATOM   9229  C  C     . ARG B 1 475 ? -8.156  -33.384 -24.599 1.00 39.44 ? 475 ARG B C     1 
ATOM   9230  O  O     . ARG B 1 475 ? -7.100  -32.779 -24.809 1.00 40.31 ? 475 ARG B O     1 
ATOM   9231  C  CB    . ARG B 1 475 ? -8.072  -35.835 -24.043 1.00 39.88 ? 475 ARG B CB    1 
ATOM   9232  C  CG    . ARG B 1 475 ? -7.703  -36.848 -22.973 1.00 40.65 ? 475 ARG B CG    1 
ATOM   9233  C  CD    . ARG B 1 475 ? -7.429  -38.223 -23.535 1.00 41.15 ? 475 ARG B CD    1 
ATOM   9234  N  NE    . ARG B 1 475 ? -6.907  -39.118 -22.502 1.00 44.04 ? 475 ARG B NE    1 
ATOM   9235  C  CZ    . ARG B 1 475 ? -5.609  -39.327 -22.248 1.00 45.61 ? 475 ARG B CZ    1 
ATOM   9236  N  NH1   . ARG B 1 475 ? -4.664  -38.693 -22.946 1.00 45.86 ? 475 ARG B NH1   1 
ATOM   9237  N  NH2   . ARG B 1 475 ? -5.250  -40.172 -21.283 1.00 44.75 ? 475 ARG B NH2   1 
ATOM   9238  N  N     . ASN B 1 476 ? -9.278  -33.194 -25.306 1.00 39.15 ? 476 ASN B N     1 
ATOM   9239  C  CA    . ASN B 1 476 ? -9.387  -32.198 -26.365 1.00 39.30 ? 476 ASN B CA    1 
ATOM   9240  C  C     . ASN B 1 476 ? -9.173  -30.776 -25.862 1.00 38.75 ? 476 ASN B C     1 
ATOM   9241  O  O     . ASN B 1 476 ? -8.386  -30.031 -26.431 1.00 39.61 ? 476 ASN B O     1 
ATOM   9242  C  CB    . ASN B 1 476 ? -10.747 -32.300 -27.058 1.00 39.30 ? 476 ASN B CB    1 
ATOM   9243  C  CG    . ASN B 1 476 ? -10.887 -33.556 -27.900 1.00 40.23 ? 476 ASN B CG    1 
ATOM   9244  O  OD1   . ASN B 1 476 ? -10.014 -34.425 -27.890 1.00 41.58 ? 476 ASN B OD1   1 
ATOM   9245  N  ND2   . ASN B 1 476 ? -11.992 -33.654 -28.640 1.00 39.36 ? 476 ASN B ND2   1 
ATOM   9246  N  N     . LEU B 1 477 ? -9.877  -30.402 -24.793 1.00 37.53 ? 477 LEU B N     1 
ATOM   9247  C  CA    . LEU B 1 477 ? -9.759  -29.057 -24.223 1.00 36.85 ? 477 LEU B CA    1 
ATOM   9248  C  C     . LEU B 1 477 ? -8.365  -28.797 -23.678 1.00 37.93 ? 477 LEU B C     1 
ATOM   9249  O  O     . LEU B 1 477 ? -7.871  -27.662 -23.727 1.00 38.46 ? 477 LEU B O     1 
ATOM   9250  C  CB    . LEU B 1 477 ? -10.821 -28.804 -23.146 1.00 35.17 ? 477 LEU B CB    1 
ATOM   9251  C  CG    . LEU B 1 477 ? -12.268 -28.680 -23.650 1.00 34.03 ? 477 LEU B CG    1 
ATOM   9252  C  CD1   . LEU B 1 477 ? -13.255 -28.565 -22.506 1.00 31.19 ? 477 LEU B CD1   1 
ATOM   9253  C  CD2   . LEU B 1 477 ? -12.428 -27.514 -24.625 1.00 32.77 ? 477 LEU B CD2   1 
ATOM   9254  N  N     . ASN B 1 478 ? -7.733  -29.854 -23.171 1.00 38.50 ? 478 ASN B N     1 
ATOM   9255  C  CA    . ASN B 1 478 ? -6.362  -29.773 -22.693 1.00 39.69 ? 478 ASN B CA    1 
ATOM   9256  C  C     . ASN B 1 478 ? -5.339  -29.557 -23.807 1.00 40.82 ? 478 ASN B C     1 
ATOM   9257  O  O     . ASN B 1 478 ? -4.313  -28.911 -23.594 1.00 41.79 ? 478 ASN B O     1 
ATOM   9258  C  CB    . ASN B 1 478 ? -6.001  -31.004 -21.868 1.00 40.17 ? 478 ASN B CB    1 
ATOM   9259  C  CG    . ASN B 1 478 ? -4.834  -30.752 -20.958 1.00 41.36 ? 478 ASN B CG    1 
ATOM   9260  O  OD1   . ASN B 1 478 ? -4.966  -30.096 -19.926 1.00 39.75 ? 478 ASN B OD1   1 
ATOM   9261  N  ND2   . ASN B 1 478 ? -3.667  -31.264 -21.342 1.00 45.41 ? 478 ASN B ND2   1 
ATOM   9262  N  N     . LYS B 1 479 ? -5.626  -30.088 -24.991 1.00 41.09 ? 479 LYS B N     1 
ATOM   9263  C  CA    . LYS B 1 479 ? -4.803  -29.820 -26.167 1.00 42.28 ? 479 LYS B CA    1 
ATOM   9264  C  C     . LYS B 1 479 ? -5.051  -28.414 -26.704 1.00 42.13 ? 479 LYS B C     1 
ATOM   9265  O  O     . LYS B 1 479 ? -4.145  -27.777 -27.230 1.00 43.29 ? 479 LYS B O     1 
ATOM   9266  C  CB    . LYS B 1 479 ? -5.065  -30.850 -27.263 1.00 42.93 ? 479 LYS B CB    1 
ATOM   9267  C  CG    . LYS B 1 479 ? -4.536  -32.232 -26.954 1.00 43.07 ? 479 LYS B CG    1 
ATOM   9268  C  CD    . LYS B 1 479 ? -4.615  -33.132 -28.173 1.00 43.61 ? 479 LYS B CD    1 
ATOM   9269  C  CE    . LYS B 1 479 ? -4.131  -34.530 -27.835 1.00 43.65 ? 479 LYS B CE    1 
ATOM   9270  N  NZ    . LYS B 1 479 ? -4.332  -35.499 -28.945 1.00 44.33 ? 479 LYS B NZ    1 
ATOM   9271  N  N     . ILE B 1 480 ? -6.284  -27.939 -26.567 1.00 41.03 ? 480 ILE B N     1 
ATOM   9272  C  CA    . ILE B 1 480 ? -6.655  -26.579 -26.967 1.00 40.78 ? 480 ILE B CA    1 
ATOM   9273  C  C     . ILE B 1 480 ? -5.885  -25.514 -26.175 1.00 40.86 ? 480 ILE B C     1 
ATOM   9274  O  O     . ILE B 1 480 ? -5.505  -24.481 -26.737 1.00 41.84 ? 480 ILE B O     1 
ATOM   9275  C  CB    . ILE B 1 480 ? -8.187  -26.378 -26.879 1.00 39.83 ? 480 ILE B CB    1 
ATOM   9276  C  CG1   . ILE B 1 480 ? -8.856  -26.983 -28.122 1.00 40.42 ? 480 ILE B CG1   1 
ATOM   9277  C  CG2   . ILE B 1 480 ? -8.569  -24.891 -26.668 1.00 39.15 ? 480 ILE B CG2   1 
ATOM   9278  C  CD1   . ILE B 1 480 ? -10.367 -27.172 -27.995 1.00 38.76 ? 480 ILE B CD1   1 
ATOM   9279  N  N     . ILE B 1 481 ? -5.631  -25.774 -24.891 1.00 40.03 ? 481 ILE B N     1 
ATOM   9280  C  CA    . ILE B 1 481 ? -4.831  -24.866 -24.056 1.00 39.94 ? 481 ILE B CA    1 
ATOM   9281  C  C     . ILE B 1 481 ? -3.452  -24.552 -24.672 1.00 42.04 ? 481 ILE B C     1 
ATOM   9282  O  O     . ILE B 1 481 ? -2.967  -23.421 -24.576 1.00 42.58 ? 481 ILE B O     1 
ATOM   9283  C  CB    . ILE B 1 481 ? -4.693  -25.397 -22.607 1.00 39.04 ? 481 ILE B CB    1 
ATOM   9284  C  CG1   . ILE B 1 481 ? -6.026  -25.235 -21.870 1.00 36.67 ? 481 ILE B CG1   1 
ATOM   9285  C  CG2   . ILE B 1 481 ? -3.551  -24.685 -21.848 1.00 38.74 ? 481 ILE B CG2   1 
ATOM   9286  C  CD1   . ILE B 1 481 ? -6.094  -25.955 -20.543 1.00 36.93 ? 481 ILE B CD1   1 
ATOM   9287  N  N     . ASP B 1 482 ? -2.852  -25.540 -25.328 1.00 43.02 ? 482 ASP B N     1 
ATOM   9288  C  CA    . ASP B 1 482 ? -1.527  -25.384 -25.920 1.00 45.39 ? 482 ASP B CA    1 
ATOM   9289  C  C     . ASP B 1 482 ? -1.524  -24.892 -27.364 1.00 46.75 ? 482 ASP B C     1 
ATOM   9290  O  O     . ASP B 1 482 ? -0.521  -24.347 -27.824 1.00 48.05 ? 482 ASP B O     1 
ATOM   9291  C  CB    . ASP B 1 482 ? -0.752  -26.698 -25.818 1.00 46.32 ? 482 ASP B CB    1 
ATOM   9292  C  CG    . ASP B 1 482 ? -0.560  -27.137 -24.386 1.00 46.64 ? 482 ASP B CG    1 
ATOM   9293  O  OD1   . ASP B 1 482 ? -0.827  -28.321 -24.074 1.00 47.62 ? 482 ASP B OD1   1 
ATOM   9294  O  OD2   . ASP B 1 482 ? -0.164  -26.284 -23.561 1.00 46.62 ? 482 ASP B OD2   1 
ATOM   9295  N  N     . ILE B 1 483 ? -2.633  -25.089 -28.076 1.00 46.79 ? 483 ILE B N     1 
ATOM   9296  C  CA    . ILE B 1 483 ? -2.734  -24.667 -29.480 1.00 48.37 ? 483 ILE B CA    1 
ATOM   9297  C  C     . ILE B 1 483 ? -3.221  -23.218 -29.598 1.00 47.76 ? 483 ILE B C     1 
ATOM   9298  O  O     . ILE B 1 483 ? -2.943  -22.533 -30.586 1.00 48.65 ? 483 ILE B O     1 
ATOM   9299  C  CB    . ILE B 1 483 ? -3.658  -25.622 -30.306 1.00 48.62 ? 483 ILE B CB    1 
ATOM   9300  C  CG1   . ILE B 1 483 ? -3.041  -27.015 -30.397 1.00 49.98 ? 483 ILE B CG1   1 
ATOM   9301  C  CG2   . ILE B 1 483 ? -3.891  -25.092 -31.726 1.00 49.71 ? 483 ILE B CG2   1 
ATOM   9302  C  CD1   . ILE B 1 483 ? -4.038  -28.067 -30.815 1.00 51.15 ? 483 ILE B CD1   1 
ATOM   9303  N  N     . ASN B 1 484 ? -3.941  -22.766 -28.576 1.00 46.39 ? 484 ASN B N     1 
ATOM   9304  C  CA    . ASN B 1 484 ? -4.624  -21.480 -28.595 1.00 45.98 ? 484 ASN B CA    1 
ATOM   9305  C  C     . ASN B 1 484 ? -3.687  -20.292 -28.798 1.00 47.13 ? 484 ASN B C     1 
ATOM   9306  O  O     . ASN B 1 484 ? -2.629  -20.214 -28.166 1.00 47.79 ? 484 ASN B O     1 
ATOM   9307  C  CB    . ASN B 1 484 ? -5.407  -21.309 -27.296 1.00 44.63 ? 484 ASN B CB    1 
ATOM   9308  C  CG    . ASN B 1 484 ? -6.421  -20.197 -27.372 1.00 44.74 ? 484 ASN B CG    1 
ATOM   9309  O  OD1   . ASN B 1 484 ? -7.383  -20.266 -28.132 1.00 45.64 ? 484 ASN B OD1   1 
ATOM   9310  N  ND2   . ASN B 1 484 ? -6.213  -19.162 -26.578 1.00 45.17 ? 484 ASN B ND2   1 
ATOM   9311  N  N     . TYR B 1 485 ? -4.069  -19.382 -29.692 1.00 47.56 ? 485 TYR B N     1 
ATOM   9312  C  CA    . TYR B 1 485 ? -3.367  -18.110 -29.835 1.00 48.63 ? 485 TYR B CA    1 
ATOM   9313  C  C     . TYR B 1 485 ? -3.992  -17.092 -28.894 1.00 47.03 ? 485 TYR B C     1 
ATOM   9314  O  O     . TYR B 1 485 ? -5.179  -16.781 -29.014 1.00 46.84 ? 485 TYR B O     1 
ATOM   9315  C  CB    . TYR B 1 485 ? -3.405  -17.598 -31.280 1.00 50.72 ? 485 TYR B CB    1 
ATOM   9316  C  CG    . TYR B 1 485 ? -2.343  -16.553 -31.550 1.00 53.08 ? 485 TYR B CG    1 
ATOM   9317  C  CD1   . TYR B 1 485 ? -1.104  -16.910 -32.100 1.00 55.17 ? 485 TYR B CD1   1 
ATOM   9318  C  CD2   . TYR B 1 485 ? -2.567  -15.208 -31.235 1.00 53.89 ? 485 TYR B CD2   1 
ATOM   9319  C  CE1   . TYR B 1 485 ? -0.120  -15.945 -32.338 1.00 57.13 ? 485 TYR B CE1   1 
ATOM   9320  C  CE2   . TYR B 1 485 ? -1.594  -14.238 -31.454 1.00 55.62 ? 485 TYR B CE2   1 
ATOM   9321  C  CZ    . TYR B 1 485 ? -0.375  -14.610 -32.008 1.00 57.27 ? 485 TYR B CZ    1 
ATOM   9322  O  OH    . TYR B 1 485 ? 0.580   -13.639 -32.226 1.00 58.93 ? 485 TYR B OH    1 
ATOM   9323  N  N     . TYR B 1 486 ? -3.192  -16.588 -27.958 1.00 46.12 ? 486 TYR B N     1 
ATOM   9324  C  CA    . TYR B 1 486 ? -3.674  -15.726 -26.879 1.00 44.28 ? 486 TYR B CA    1 
ATOM   9325  C  C     . TYR B 1 486 ? -3.590  -14.246 -27.260 1.00 45.17 ? 486 TYR B C     1 
ATOM   9326  O  O     . TYR B 1 486 ? -2.569  -13.803 -27.776 1.00 47.07 ? 486 TYR B O     1 
ATOM   9327  C  CB    . TYR B 1 486 ? -2.896  -16.016 -25.585 1.00 43.23 ? 486 TYR B CB    1 
ATOM   9328  C  CG    . TYR B 1 486 ? -3.176  -17.405 -25.048 1.00 41.37 ? 486 TYR B CG    1 
ATOM   9329  C  CD1   . TYR B 1 486 ? -4.311  -17.653 -24.275 1.00 38.64 ? 486 TYR B CD1   1 
ATOM   9330  C  CD2   . TYR B 1 486 ? -2.328  -18.476 -25.338 1.00 41.02 ? 486 TYR B CD2   1 
ATOM   9331  C  CE1   . TYR B 1 486 ? -4.594  -18.924 -23.800 1.00 37.32 ? 486 TYR B CE1   1 
ATOM   9332  C  CE2   . TYR B 1 486 ? -2.609  -19.761 -24.863 1.00 40.15 ? 486 TYR B CE2   1 
ATOM   9333  C  CZ    . TYR B 1 486 ? -3.744  -19.971 -24.094 1.00 38.22 ? 486 TYR B CZ    1 
ATOM   9334  O  OH    . TYR B 1 486 ? -4.034  -21.224 -23.615 1.00 38.07 ? 486 TYR B OH    1 
ATOM   9335  N  N     . PRO B 1 487 ? -4.671  -13.480 -27.028 1.00 44.26 ? 487 PRO B N     1 
ATOM   9336  C  CA    . PRO B 1 487 ? -4.674  -12.051 -27.409 1.00 45.10 ? 487 PRO B CA    1 
ATOM   9337  C  C     . PRO B 1 487 ? -3.761  -11.177 -26.535 1.00 45.29 ? 487 PRO B C     1 
ATOM   9338  O  O     . PRO B 1 487 ? -3.236  -10.162 -27.007 1.00 46.72 ? 487 PRO B O     1 
ATOM   9339  C  CB    . PRO B 1 487 ? -6.148  -11.636 -27.257 1.00 44.21 ? 487 PRO B CB    1 
ATOM   9340  C  CG    . PRO B 1 487 ? -6.755  -12.654 -26.350 1.00 42.23 ? 487 PRO B CG    1 
ATOM   9341  C  CD    . PRO B 1 487 ? -5.945  -13.912 -26.423 1.00 42.22 ? 487 PRO B CD    1 
ATOM   9342  N  N     . VAL B 1 488 ? -3.586  -11.573 -25.276 1.00 44.01 ? 488 VAL B N     1 
ATOM   9343  C  CA    . VAL B 1 488 ? -2.629  -10.931 -24.368 1.00 44.02 ? 488 VAL B CA    1 
ATOM   9344  C  C     . VAL B 1 488 ? -1.811  -12.005 -23.610 1.00 44.13 ? 488 VAL B C     1 
ATOM   9345  O  O     . VAL B 1 488 ? -2.308  -13.125 -23.386 1.00 43.05 ? 488 VAL B O     1 
ATOM   9346  C  CB    . VAL B 1 488 ? -3.321  -9.929  -23.385 1.00 43.07 ? 488 VAL B CB    1 
ATOM   9347  C  CG1   . VAL B 1 488 ? -3.942  -8.748  -24.145 1.00 42.89 ? 488 VAL B CG1   1 
ATOM   9348  C  CG2   . VAL B 1 488 ? -4.353  -10.625 -22.486 1.00 40.49 ? 488 VAL B CG2   1 
ATOM   9349  N  N     . PRO B 1 489 ? -0.562  -11.677 -23.216 1.00 44.98 ? 489 PRO B N     1 
ATOM   9350  C  CA    . PRO B 1 489 ? 0.330   -12.692 -22.646 1.00 45.26 ? 489 PRO B CA    1 
ATOM   9351  C  C     . PRO B 1 489 ? -0.060  -13.126 -21.238 1.00 43.95 ? 489 PRO B C     1 
ATOM   9352  O  O     . PRO B 1 489 ? 0.299   -14.228 -20.817 1.00 43.96 ? 489 PRO B O     1 
ATOM   9353  C  CB    . PRO B 1 489 ? 1.701   -11.997 -22.623 1.00 46.67 ? 489 PRO B CB    1 
ATOM   9354  C  CG    . PRO B 1 489 ? 1.527   -10.726 -23.394 1.00 47.95 ? 489 PRO B CG    1 
ATOM   9355  C  CD    . PRO B 1 489 ? 0.093   -10.360 -23.272 1.00 46.41 ? 489 PRO B CD    1 
ATOM   9356  N  N     . GLU B 1 490 ? -0.770  -12.256 -20.520 1.00 43.04 ? 490 GLU B N     1 
ATOM   9357  C  CA    . GLU B 1 490 ? -1.279  -12.558 -19.189 1.00 41.43 ? 490 GLU B CA    1 
ATOM   9358  C  C     . GLU B 1 490 ? -2.276  -13.690 -19.246 1.00 40.12 ? 490 GLU B C     1 
ATOM   9359  O  O     . GLU B 1 490 ? -2.446  -14.403 -18.265 1.00 39.52 ? 490 GLU B O     1 
ATOM   9360  C  CB    . GLU B 1 490 ? -1.957  -11.339 -18.568 1.00 40.70 ? 490 GLU B CB    1 
ATOM   9361  C  CG    . GLU B 1 490 ? -1.030  -10.203 -18.194 1.00 43.04 ? 490 GLU B CG    1 
ATOM   9362  C  CD    . GLU B 1 490 ? -0.862  -9.169  -19.304 1.00 45.90 ? 490 GLU B CD    1 
ATOM   9363  O  OE1   . GLU B 1 490 ? -1.371  -9.377  -20.432 1.00 46.88 ? 490 GLU B OE1   1 
ATOM   9364  O  OE2   . GLU B 1 490 ? -0.227  -8.128  -19.038 1.00 46.48 ? 490 GLU B OE2   1 
ATOM   9365  N  N     . ALA B 1 491 ? -2.956  -13.827 -20.387 1.00 40.24 ? 491 ALA B N     1 
ATOM   9366  C  CA    . ALA B 1 491 ? -3.930  -14.904 -20.618 1.00 39.21 ? 491 ALA B CA    1 
ATOM   9367  C  C     . ALA B 1 491 ? -3.209  -16.234 -20.809 1.00 39.98 ? 491 ALA B C     1 
ATOM   9368  O  O     . ALA B 1 491 ? -3.584  -17.249 -20.220 1.00 39.07 ? 491 ALA B O     1 
ATOM   9369  C  CB    . ALA B 1 491 ? -4.809  -14.587 -21.838 1.00 38.92 ? 491 ALA B CB    1 
ATOM   9370  N  N     . CYS B 1 492 ? -2.171  -16.207 -21.646 1.00 42.04 ? 492 CYS B N     1 
ATOM   9371  C  CA    . CYS B 1 492 ? -1.294  -17.343 -21.875 1.00 42.91 ? 492 CYS B CA    1 
ATOM   9372  C  C     . CYS B 1 492 ? -0.680  -17.834 -20.564 1.00 42.99 ? 492 CYS B C     1 
ATOM   9373  O  O     . CYS B 1 492 ? -0.723  -19.024 -20.273 1.00 42.67 ? 492 CYS B O     1 
ATOM   9374  C  CB    . CYS B 1 492 ? -0.196  -16.958 -22.867 1.00 44.69 ? 492 CYS B CB    1 
ATOM   9375  S  SG    . CYS B 1 492 ? 0.949   -18.307 -23.296 1.00 46.76 ? 492 CYS B SG    1 
ATOM   9376  N  N     . LEU B 1 493 ? -0.137  -16.910 -19.770 1.00 43.74 ? 493 LEU B N     1 
ATOM   9377  C  CA    . LEU B 1 493 ? 0.463   -17.237 -18.469 1.00 44.34 ? 493 LEU B CA    1 
ATOM   9378  C  C     . LEU B 1 493 ? -0.521  -17.996 -17.574 1.00 42.93 ? 493 LEU B C     1 
ATOM   9379  O  O     . LEU B 1 493 ? -0.207  -19.083 -17.064 1.00 43.11 ? 493 LEU B O     1 
ATOM   9380  C  CB    . LEU B 1 493 ? 0.912   -15.967 -17.748 1.00 45.04 ? 493 LEU B CB    1 
ATOM   9381  C  CG    . LEU B 1 493 ? 2.236   -15.981 -16.969 1.00 47.61 ? 493 LEU B CG    1 
ATOM   9382  C  CD1   . LEU B 1 493 ? 2.062   -15.190 -15.673 1.00 46.86 ? 493 LEU B CD1   1 
ATOM   9383  C  CD2   . LEU B 1 493 ? 2.760   -17.399 -16.670 1.00 48.37 ? 493 LEU B CD2   1 
ATOM   9384  N  N     . SER B 1 494 ? -1.710  -17.416 -17.417 1.00 41.15 ? 494 SER B N     1 
ATOM   9385  C  CA    . SER B 1 494 ? -2.778  -17.984 -16.619 1.00 39.68 ? 494 SER B CA    1 
ATOM   9386  C  C     . SER B 1 494 ? -3.186  -19.408 -17.027 1.00 39.40 ? 494 SER B C     1 
ATOM   9387  O  O     . SER B 1 494 ? -3.227  -20.298 -16.170 1.00 39.31 ? 494 SER B O     1 
ATOM   9388  C  CB    . SER B 1 494 ? -3.987  -17.053 -16.646 1.00 38.58 ? 494 SER B CB    1 
ATOM   9389  O  OG    . SER B 1 494 ? -5.167  -17.779 -16.382 1.00 37.81 ? 494 SER B OG    1 
ATOM   9390  N  N     . ASN B 1 495 ? -3.483  -19.617 -18.316 1.00 39.47 ? 495 ASN B N     1 
ATOM   9391  C  CA    . ASN B 1 495 ? -3.864  -20.947 -18.853 1.00 39.08 ? 495 ASN B CA    1 
ATOM   9392  C  C     . ASN B 1 495 ? -2.762  -22.006 -18.729 1.00 40.31 ? 495 ASN B C     1 
ATOM   9393  O  O     . ASN B 1 495 ? -3.038  -23.161 -18.431 1.00 40.15 ? 495 ASN B O     1 
ATOM   9394  C  CB    . ASN B 1 495 ? -4.330  -20.853 -20.324 1.00 38.81 ? 495 ASN B CB    1 
ATOM   9395  C  CG    . ASN B 1 495 ? -5.838  -21.137 -20.510 1.00 36.89 ? 495 ASN B CG    1 
ATOM   9396  O  OD1   . ASN B 1 495 ? -6.643  -21.013 -19.589 1.00 33.17 ? 495 ASN B OD1   1 
ATOM   9397  N  ND2   . ASN B 1 495 ? -6.211  -21.512 -21.727 1.00 36.57 ? 495 ASN B ND2   1 
ATOM   9398  N  N     . LYS B 1 496 ? -1.514  -21.613 -18.967 1.00 42.14 ? 496 LYS B N     1 
ATOM   9399  C  CA    . LYS B 1 496 ? -0.388  -22.543 -18.853 1.00 43.63 ? 496 LYS B CA    1 
ATOM   9400  C  C     . LYS B 1 496 ? -0.081  -22.914 -17.398 1.00 43.22 ? 496 LYS B C     1 
ATOM   9401  O  O     . LYS B 1 496 ? 0.328   -24.029 -17.132 1.00 43.84 ? 496 LYS B O     1 
ATOM   9402  C  CB    . LYS B 1 496 ? 0.874   -21.991 -19.543 1.00 45.87 ? 496 LYS B CB    1 
ATOM   9403  C  CG    . LYS B 1 496 ? 0.759   -21.732 -21.067 1.00 46.61 ? 496 LYS B CG    1 
ATOM   9404  C  CD    . LYS B 1 496 ? 0.205   -22.913 -21.839 1.00 47.44 ? 496 LYS B CD    1 
ATOM   9405  C  CE    . LYS B 1 496 ? -0.007  -22.551 -23.304 1.00 48.24 ? 496 LYS B CE    1 
ATOM   9406  N  NZ    . LYS B 1 496 ? 1.226   -22.693 -24.135 1.00 48.99 ? 496 LYS B NZ    1 
ATOM   9407  N  N     . ARG B 1 497 ? -0.292  -21.982 -16.471 1.00 42.64 ? 497 ARG B N     1 
ATOM   9408  C  CA    . ARG B 1 497 ? -0.081  -22.220 -15.032 1.00 42.63 ? 497 ARG B CA    1 
ATOM   9409  C  C     . ARG B 1 497 ? -1.110  -23.136 -14.371 1.00 41.53 ? 497 ARG B C     1 
ATOM   9410  O  O     . ARG B 1 497 ? -0.747  -24.083 -13.683 1.00 41.97 ? 497 ARG B O     1 
ATOM   9411  C  CB    . ARG B 1 497 ? -0.075  -20.901 -14.259 1.00 42.23 ? 497 ARG B CB    1 
ATOM   9412  C  CG    . ARG B 1 497 ? 1.275   -20.241 -14.147 1.00 44.14 ? 497 ARG B CG    1 
ATOM   9413  C  CD    . ARG B 1 497 ? 1.211   -19.049 -13.194 1.00 43.94 ? 497 ARG B CD    1 
ATOM   9414  N  NE    . ARG B 1 497 ? 2.504   -18.374 -13.140 1.00 46.93 ? 497 ARG B NE    1 
ATOM   9415  C  CZ    . ARG B 1 497 ? 2.701   -17.108 -12.767 1.00 47.78 ? 497 ARG B CZ    1 
ATOM   9416  N  NH1   . ARG B 1 497 ? 1.686   -16.330 -12.404 1.00 45.26 ? 497 ARG B NH1   1 
ATOM   9417  N  NH2   . ARG B 1 497 ? 3.932   -16.613 -12.771 1.00 50.43 ? 497 ARG B NH2   1 
ATOM   9418  N  N     . HIS B 1 498 ? -2.393  -22.828 -14.549 1.00 40.28 ? 498 HIS B N     1 
ATOM   9419  C  CA    . HIS B 1 498 ? -3.447  -23.515 -13.807 1.00 38.97 ? 498 HIS B CA    1 
ATOM   9420  C  C     . HIS B 1 498 ? -4.280  -24.435 -14.696 1.00 37.92 ? 498 HIS B C     1 
ATOM   9421  O  O     . HIS B 1 498 ? -5.028  -25.258 -14.193 1.00 37.21 ? 498 HIS B O     1 
ATOM   9422  C  CB    . HIS B 1 498 ? -4.351  -22.498 -13.095 1.00 38.10 ? 498 HIS B CB    1 
ATOM   9423  C  CG    . HIS B 1 498 ? -3.622  -21.281 -12.613 1.00 39.61 ? 498 HIS B CG    1 
ATOM   9424  N  ND1   . HIS B 1 498 ? -2.596  -21.340 -11.690 1.00 40.60 ? 498 HIS B ND1   1 
ATOM   9425  C  CD2   . HIS B 1 498 ? -3.765  -19.971 -12.935 1.00 39.53 ? 498 HIS B CD2   1 
ATOM   9426  C  CE1   . HIS B 1 498 ? -2.138  -20.120 -11.467 1.00 41.44 ? 498 HIS B CE1   1 
ATOM   9427  N  NE2   . HIS B 1 498 ? -2.831  -19.272 -12.210 1.00 40.71 ? 498 HIS B NE2   1 
ATOM   9428  N  N     . ARG B 1 499 ? -4.154  -24.287 -16.014 1.00 37.74 ? 499 ARG B N     1 
ATOM   9429  C  CA    . ARG B 1 499 ? -4.854  -25.162 -16.977 1.00 37.12 ? 499 ARG B CA    1 
ATOM   9430  C  C     . ARG B 1 499 ? -6.341  -25.436 -16.677 1.00 35.73 ? 499 ARG B C     1 
ATOM   9431  O  O     . ARG B 1 499 ? -6.773  -26.585 -16.712 1.00 35.34 ? 499 ARG B O     1 
ATOM   9432  C  CB    . ARG B 1 499 ? -4.115  -26.490 -17.105 1.00 37.78 ? 499 ARG B CB    1 
ATOM   9433  C  CG    . ARG B 1 499 ? -2.649  -26.336 -17.470 1.00 39.29 ? 499 ARG B CG    1 
ATOM   9434  C  CD    . ARG B 1 499 ? -2.134  -27.613 -18.063 1.00 39.58 ? 499 ARG B CD    1 
ATOM   9435  N  NE    . ARG B 1 499 ? -1.335  -27.312 -19.240 1.00 42.50 ? 499 ARG B NE    1 
ATOM   9436  C  CZ    . ARG B 1 499 ? -1.630  -27.668 -20.485 1.00 41.44 ? 499 ARG B CZ    1 
ATOM   9437  N  NH1   . ARG B 1 499 ? -2.707  -28.394 -20.776 1.00 37.74 ? 499 ARG B NH1   1 
ATOM   9438  N  NH2   . ARG B 1 499 ? -0.800  -27.312 -21.443 1.00 43.51 ? 499 ARG B NH2   1 
ATOM   9439  N  N     . PRO B 1 500 ? -7.138  -24.388 -16.401 1.00 34.88 ? 500 PRO B N     1 
ATOM   9440  C  CA    . PRO B 1 500 ? -8.545  -24.717 -16.164 1.00 34.41 ? 500 PRO B CA    1 
ATOM   9441  C  C     . PRO B 1 500 ? -9.266  -25.066 -17.471 1.00 34.41 ? 500 PRO B C     1 
ATOM   9442  O  O     . PRO B 1 500 ? -8.822  -24.666 -18.558 1.00 35.32 ? 500 PRO B O     1 
ATOM   9443  C  CB    . PRO B 1 500 ? -9.109  -23.431 -15.563 1.00 33.26 ? 500 PRO B CB    1 
ATOM   9444  C  CG    . PRO B 1 500 ? -8.254  -22.365 -16.145 1.00 34.30 ? 500 PRO B CG    1 
ATOM   9445  C  CD    . PRO B 1 500 ? -6.887  -22.940 -16.312 1.00 34.76 ? 500 PRO B CD    1 
ATOM   9446  N  N     . ILE B 1 501 ? -10.328 -25.850 -17.356 1.00 33.70 ? 501 ILE B N     1 
ATOM   9447  C  CA    . ILE B 1 501 ? -11.247 -26.086 -18.463 1.00 34.03 ? 501 ILE B CA    1 
ATOM   9448  C  C     . ILE B 1 501 ? -12.698 -26.047 -17.950 1.00 33.69 ? 501 ILE B C     1 
ATOM   9449  O  O     . ILE B 1 501 ? -12.964 -26.025 -16.738 1.00 32.98 ? 501 ILE B O     1 
ATOM   9450  C  CB    . ILE B 1 501 ? -10.950 -27.414 -19.249 1.00 34.68 ? 501 ILE B CB    1 
ATOM   9451  C  CG1   . ILE B 1 501 ? -11.065 -28.655 -18.360 1.00 34.34 ? 501 ILE B CG1   1 
ATOM   9452  C  CG2   . ILE B 1 501 ? -9.576  -27.375 -19.947 1.00 35.46 ? 501 ILE B CG2   1 
ATOM   9453  C  CD1   . ILE B 1 501 ? -11.114 -29.945 -19.160 1.00 35.13 ? 501 ILE B CD1   1 
ATOM   9454  N  N     . GLY B 1 502 ? -13.634 -26.030 -18.882 1.00 33.90 ? 502 GLY B N     1 
ATOM   9455  C  CA    . GLY B 1 502 ? -15.021 -25.841 -18.537 1.00 33.55 ? 502 GLY B CA    1 
ATOM   9456  C  C     . GLY B 1 502 ? -15.864 -26.703 -19.435 1.00 33.91 ? 502 GLY B C     1 
ATOM   9457  O  O     . GLY B 1 502 ? -16.142 -26.340 -20.573 1.00 34.25 ? 502 GLY B O     1 
ATOM   9458  N  N     . ILE B 1 503 ? -16.248 -27.860 -18.911 1.00 34.00 ? 503 ILE B N     1 
ATOM   9459  C  CA    . ILE B 1 503 ? -17.146 -28.759 -19.599 1.00 34.29 ? 503 ILE B CA    1 
ATOM   9460  C  C     . ILE B 1 503 ? -18.570 -28.509 -19.123 1.00 33.75 ? 503 ILE B C     1 
ATOM   9461  O  O     . ILE B 1 503 ? -18.838 -28.470 -17.920 1.00 33.42 ? 503 ILE B O     1 
ATOM   9462  C  CB    . ILE B 1 503 ? -16.741 -30.226 -19.371 1.00 35.03 ? 503 ILE B CB    1 
ATOM   9463  C  CG1   . ILE B 1 503 ? -15.308 -30.455 -19.883 1.00 35.47 ? 503 ILE B CG1   1 
ATOM   9464  C  CG2   . ILE B 1 503 ? -17.753 -31.179 -20.053 1.00 34.98 ? 503 ILE B CG2   1 
ATOM   9465  C  CD1   . ILE B 1 503 ? -14.737 -31.827 -19.566 1.00 35.24 ? 503 ILE B CD1   1 
ATOM   9466  N  N     . GLY B 1 504 ? -19.473 -28.321 -20.077 1.00 33.48 ? 504 GLY B N     1 
ATOM   9467  C  CA    . GLY B 1 504 ? -20.860 -28.033 -19.764 1.00 32.93 ? 504 GLY B CA    1 
ATOM   9468  C  C     . GLY B 1 504 ? -21.769 -29.007 -20.470 1.00 33.51 ? 504 GLY B C     1 
ATOM   9469  O  O     . GLY B 1 504 ? -21.327 -30.067 -20.922 1.00 34.08 ? 504 GLY B O     1 
ATOM   9470  N  N     . VAL B 1 505 ? -23.042 -28.652 -20.583 1.00 33.16 ? 505 VAL B N     1 
ATOM   9471  C  CA    . VAL B 1 505 ? -24.034 -29.600 -21.062 1.00 33.15 ? 505 VAL B CA    1 
ATOM   9472  C  C     . VAL B 1 505 ? -25.092 -28.913 -21.900 1.00 33.76 ? 505 VAL B C     1 
ATOM   9473  O  O     . VAL B 1 505 ? -25.226 -27.683 -21.871 1.00 33.82 ? 505 VAL B O     1 
ATOM   9474  C  CB    . VAL B 1 505 ? -24.758 -30.344 -19.899 1.00 32.68 ? 505 VAL B CB    1 
ATOM   9475  C  CG1   . VAL B 1 505 ? -23.762 -31.035 -18.971 1.00 32.96 ? 505 VAL B CG1   1 
ATOM   9476  C  CG2   . VAL B 1 505 ? -25.639 -29.401 -19.132 1.00 30.57 ? 505 VAL B CG2   1 
ATOM   9477  N  N     . GLN B 1 506 ? -25.834 -29.721 -22.643 1.00 33.76 ? 506 GLN B N     1 
ATOM   9478  C  CA    . GLN B 1 506 ? -27.051 -29.273 -23.278 1.00 35.13 ? 506 GLN B CA    1 
ATOM   9479  C  C     . GLN B 1 506 ? -28.053 -30.425 -23.310 1.00 35.73 ? 506 GLN B C     1 
ATOM   9480  O  O     . GLN B 1 506 ? -27.682 -31.584 -23.108 1.00 36.04 ? 506 GLN B O     1 
ATOM   9481  C  CB    . GLN B 1 506 ? -26.773 -28.726 -24.676 1.00 35.69 ? 506 GLN B CB    1 
ATOM   9482  C  CG    . GLN B 1 506 ? -26.080 -29.695 -25.605 1.00 36.59 ? 506 GLN B CG    1 
ATOM   9483  C  CD    . GLN B 1 506 ? -25.840 -29.091 -26.964 1.00 38.54 ? 506 GLN B CD    1 
ATOM   9484  O  OE1   . GLN B 1 506 ? -26.627 -29.291 -27.881 1.00 40.12 ? 506 GLN B OE1   1 
ATOM   9485  N  NE2   . GLN B 1 506 ? -24.760 -28.324 -27.098 1.00 39.51 ? 506 GLN B NE2   1 
ATOM   9486  N  N     . GLY B 1 507 ? -29.321 -30.104 -23.525 1.00 36.13 ? 507 GLY B N     1 
ATOM   9487  C  CA    . GLY B 1 507 ? -30.343 -31.133 -23.618 1.00 36.64 ? 507 GLY B CA    1 
ATOM   9488  C  C     . GLY B 1 507 ? -30.659 -31.831 -22.306 1.00 36.18 ? 507 GLY B C     1 
ATOM   9489  O  O     . GLY B 1 507 ? -31.049 -33.004 -22.296 1.00 36.68 ? 507 GLY B O     1 
ATOM   9490  N  N     . LEU B 1 508 ? -30.509 -31.126 -21.193 1.00 35.12 ? 508 LEU B N     1 
ATOM   9491  C  CA    . LEU B 1 508 ? -30.912 -31.707 -19.917 1.00 35.14 ? 508 LEU B CA    1 
ATOM   9492  C  C     . LEU B 1 508 ? -32.410 -32.002 -19.965 1.00 35.72 ? 508 LEU B C     1 
ATOM   9493  O  O     . LEU B 1 508 ? -32.840 -33.108 -19.630 1.00 36.28 ? 508 LEU B O     1 
ATOM   9494  C  CB    . LEU B 1 508 ? -30.569 -30.786 -18.740 1.00 34.65 ? 508 LEU B CB    1 
ATOM   9495  C  CG    . LEU B 1 508 ? -30.238 -31.335 -17.335 1.00 35.57 ? 508 LEU B CG    1 
ATOM   9496  C  CD1   . LEU B 1 508 ? -31.038 -30.584 -16.268 1.00 34.75 ? 508 LEU B CD1   1 
ATOM   9497  C  CD2   . LEU B 1 508 ? -30.421 -32.844 -17.170 1.00 35.12 ? 508 LEU B CD2   1 
ATOM   9498  N  N     . ALA B 1 509 ? -33.193 -31.018 -20.409 1.00 35.82 ? 509 ALA B N     1 
ATOM   9499  C  CA    . ALA B 1 509 ? -34.644 -31.162 -20.493 1.00 36.70 ? 509 ALA B CA    1 
ATOM   9500  C  C     . ALA B 1 509 ? -35.030 -32.327 -21.395 1.00 37.24 ? 509 ALA B C     1 
ATOM   9501  O  O     . ALA B 1 509 ? -35.931 -33.082 -21.068 1.00 38.21 ? 509 ALA B O     1 
ATOM   9502  C  CB    . ALA B 1 509 ? -35.305 -29.864 -20.964 1.00 36.83 ? 509 ALA B CB    1 
ATOM   9503  N  N     . ASP B 1 510 ? -34.329 -32.473 -22.514 1.00 37.43 ? 510 ASP B N     1 
ATOM   9504  C  CA    . ASP B 1 510 ? -34.563 -33.570 -23.466 1.00 38.35 ? 510 ASP B CA    1 
ATOM   9505  C  C     . ASP B 1 510 ? -34.293 -34.939 -22.850 1.00 37.72 ? 510 ASP B C     1 
ATOM   9506  O  O     . ASP B 1 510 ? -35.061 -35.872 -23.062 1.00 39.04 ? 510 ASP B O     1 
ATOM   9507  C  CB    . ASP B 1 510 ? -33.704 -33.377 -24.720 1.00 38.33 ? 510 ASP B CB    1 
ATOM   9508  C  CG    . ASP B 1 510 ? -33.923 -32.016 -25.372 1.00 40.02 ? 510 ASP B CG    1 
ATOM   9509  O  OD1   . ASP B 1 510 ? -34.973 -31.822 -26.033 1.00 40.87 ? 510 ASP B OD1   1 
ATOM   9510  O  OD2   . ASP B 1 510 ? -33.044 -31.137 -25.214 1.00 40.56 ? 510 ASP B OD2   1 
ATOM   9511  N  N     . ALA B 1 511 ? -33.205 -35.043 -22.088 1.00 36.43 ? 511 ALA B N     1 
ATOM   9512  C  CA    . ALA B 1 511 ? -32.850 -36.265 -21.371 1.00 36.15 ? 511 ALA B CA    1 
ATOM   9513  C  C     . ALA B 1 511 ? -33.904 -36.637 -20.317 1.00 36.73 ? 511 ALA B C     1 
ATOM   9514  O  O     . ALA B 1 511 ? -34.210 -37.817 -20.142 1.00 37.57 ? 511 ALA B O     1 
ATOM   9515  C  CB    . ALA B 1 511 ? -31.442 -36.152 -20.740 1.00 34.58 ? 511 ALA B CB    1 
ATOM   9516  N  N     . PHE B 1 512 ? -34.462 -35.648 -19.618 1.00 36.51 ? 512 PHE B N     1 
ATOM   9517  C  CA    . PHE B 1 512 ? -35.565 -35.928 -18.699 1.00 37.12 ? 512 PHE B CA    1 
ATOM   9518  C  C     . PHE B 1 512 ? -36.772 -36.458 -19.459 1.00 38.50 ? 512 PHE B C     1 
ATOM   9519  O  O     . PHE B 1 512 ? -37.350 -37.462 -19.079 1.00 39.07 ? 512 PHE B O     1 
ATOM   9520  C  CB    . PHE B 1 512 ? -35.966 -34.694 -17.902 1.00 36.85 ? 512 PHE B CB    1 
ATOM   9521  C  CG    . PHE B 1 512 ? -34.952 -34.263 -16.878 1.00 35.60 ? 512 PHE B CG    1 
ATOM   9522  C  CD1   . PHE B 1 512 ? -33.996 -35.153 -16.387 1.00 35.09 ? 512 PHE B CD1   1 
ATOM   9523  C  CD2   . PHE B 1 512 ? -34.982 -32.971 -16.371 1.00 33.98 ? 512 PHE B CD2   1 
ATOM   9524  C  CE1   . PHE B 1 512 ? -33.068 -34.737 -15.432 1.00 34.20 ? 512 PHE B CE1   1 
ATOM   9525  C  CE2   . PHE B 1 512 ? -34.069 -32.554 -15.412 1.00 32.59 ? 512 PHE B CE2   1 
ATOM   9526  C  CZ    . PHE B 1 512 ? -33.115 -33.435 -14.940 1.00 32.84 ? 512 PHE B CZ    1 
ATOM   9527  N  N     . ILE B 1 513 ? -37.135 -35.784 -20.543 1.00 39.48 ? 513 ILE B N     1 
ATOM   9528  C  CA    . ILE B 1 513 ? -38.320 -36.154 -21.329 1.00 41.21 ? 513 ILE B CA    1 
ATOM   9529  C  C     . ILE B 1 513 ? -38.172 -37.514 -22.017 1.00 42.40 ? 513 ILE B C     1 
ATOM   9530  O  O     . ILE B 1 513 ? -39.113 -38.303 -22.055 1.00 43.44 ? 513 ILE B O     1 
ATOM   9531  C  CB    . ILE B 1 513 ? -38.647 -35.082 -22.374 1.00 41.37 ? 513 ILE B CB    1 
ATOM   9532  C  CG1   . ILE B 1 513 ? -39.019 -33.769 -21.668 1.00 40.55 ? 513 ILE B CG1   1 
ATOM   9533  C  CG2   . ILE B 1 513 ? -39.750 -35.580 -23.306 1.00 42.42 ? 513 ILE B CG2   1 
ATOM   9534  C  CD1   . ILE B 1 513 ? -38.966 -32.535 -22.546 1.00 39.57 ? 513 ILE B CD1   1 
ATOM   9535  N  N     . LEU B 1 514 ? -36.986 -37.783 -22.556 1.00 42.46 ? 514 LEU B N     1 
ATOM   9536  C  CA    . LEU B 1 514 ? -36.721 -39.072 -23.184 1.00 43.55 ? 514 LEU B CA    1 
ATOM   9537  C  C     . LEU B 1 514 ? -36.848 -40.228 -22.188 1.00 44.16 ? 514 LEU B C     1 
ATOM   9538  O  O     . LEU B 1 514 ? -37.266 -41.329 -22.559 1.00 45.08 ? 514 LEU B O     1 
ATOM   9539  C  CB    . LEU B 1 514 ? -35.337 -39.070 -23.842 1.00 42.53 ? 514 LEU B CB    1 
ATOM   9540  C  CG    . LEU B 1 514 ? -35.233 -38.268 -25.139 1.00 42.74 ? 514 LEU B CG    1 
ATOM   9541  C  CD1   . LEU B 1 514 ? -33.779 -38.203 -25.602 1.00 42.29 ? 514 LEU B CD1   1 
ATOM   9542  C  CD2   . LEU B 1 514 ? -36.153 -38.820 -26.243 1.00 40.88 ? 514 LEU B CD2   1 
ATOM   9543  N  N     . MET B 1 515 ? -36.479 -39.962 -20.931 1.00 43.65 ? 515 MET B N     1 
ATOM   9544  C  CA    . MET B 1 515 ? -36.602 -40.923 -19.831 1.00 44.16 ? 515 MET B CA    1 
ATOM   9545  C  C     . MET B 1 515 ? -38.030 -40.964 -19.285 1.00 45.34 ? 515 MET B C     1 
ATOM   9546  O  O     . MET B 1 515 ? -38.370 -41.831 -18.471 1.00 45.94 ? 515 MET B O     1 
ATOM   9547  C  CB    . MET B 1 515 ? -35.636 -40.561 -18.697 1.00 43.26 ? 515 MET B CB    1 
ATOM   9548  C  CG    . MET B 1 515 ? -34.169 -40.650 -19.055 1.00 42.90 ? 515 MET B CG    1 
ATOM   9549  S  SD    . MET B 1 515 ? -33.635 -42.363 -19.153 1.00 46.88 ? 515 MET B SD    1 
ATOM   9550  C  CE    . MET B 1 515 ? -33.808 -42.857 -17.430 1.00 47.52 ? 515 MET B CE    1 
ATOM   9551  N  N     . ARG B 1 516 ? -38.844 -40.008 -19.733 1.00 45.67 ? 516 ARG B N     1 
ATOM   9552  C  CA    . ARG B 1 516 ? -40.240 -39.853 -19.328 1.00 46.85 ? 516 ARG B CA    1 
ATOM   9553  C  C     . ARG B 1 516 ? -40.382 -39.240 -17.936 1.00 46.29 ? 516 ARG B C     1 
ATOM   9554  O  O     . ARG B 1 516 ? -41.384 -39.467 -17.250 1.00 47.11 ? 516 ARG B O     1 
ATOM   9555  C  CB    . ARG B 1 516 ? -40.992 -41.187 -19.438 1.00 48.61 ? 516 ARG B CB    1 
ATOM   9556  C  CG    . ARG B 1 516 ? -40.902 -41.841 -20.816 1.00 49.84 ? 516 ARG B CG    1 
ATOM   9557  C  CD    . ARG B 1 516 ? -42.164 -41.581 -21.616 1.00 53.93 ? 516 ARG B CD    1 
ATOM   9558  N  NE    . ARG B 1 516 ? -42.013 -40.549 -22.637 1.00 54.53 ? 516 ARG B NE    1 
ATOM   9559  C  CZ    . ARG B 1 516 ? -43.027 -39.848 -23.148 1.00 55.98 ? 516 ARG B CZ    1 
ATOM   9560  N  NH1   . ARG B 1 516 ? -44.267 -40.026 -22.707 1.00 56.32 ? 516 ARG B NH1   1 
ATOM   9561  N  NH2   . ARG B 1 516 ? -42.794 -38.943 -24.087 1.00 56.35 ? 516 ARG B NH2   1 
ATOM   9562  N  N     . TYR B 1 517 ? -39.388 -38.446 -17.532 1.00 44.64 ? 517 TYR B N     1 
ATOM   9563  C  CA    . TYR B 1 517 ? -39.416 -37.785 -16.227 1.00 44.22 ? 517 TYR B CA    1 
ATOM   9564  C  C     . TYR B 1 517 ? -39.852 -36.325 -16.308 1.00 44.19 ? 517 TYR B C     1 
ATOM   9565  O  O     . TYR B 1 517 ? -39.286 -35.548 -17.082 1.00 43.92 ? 517 TYR B O     1 
ATOM   9566  C  CB    . TYR B 1 517 ? -38.056 -37.836 -15.527 1.00 43.01 ? 517 TYR B CB    1 
ATOM   9567  C  CG    . TYR B 1 517 ? -37.466 -39.211 -15.297 1.00 43.12 ? 517 TYR B CG    1 
ATOM   9568  C  CD1   . TYR B 1 517 ? -38.278 -40.359 -15.199 1.00 43.75 ? 517 TYR B CD1   1 
ATOM   9569  C  CD2   . TYR B 1 517 ? -36.088 -39.354 -15.130 1.00 40.75 ? 517 TYR B CD2   1 
ATOM   9570  C  CE1   . TYR B 1 517 ? -37.712 -41.620 -14.973 1.00 44.44 ? 517 TYR B CE1   1 
ATOM   9571  C  CE2   . TYR B 1 517 ? -35.519 -40.586 -14.899 1.00 41.72 ? 517 TYR B CE2   1 
ATOM   9572  C  CZ    . TYR B 1 517 ? -36.322 -41.716 -14.821 1.00 44.06 ? 517 TYR B CZ    1 
ATOM   9573  O  OH    . TYR B 1 517 ? -35.711 -42.929 -14.601 1.00 44.51 ? 517 TYR B OH    1 
ATOM   9574  N  N     . PRO B 1 518 ? -40.875 -35.948 -15.516 1.00 44.94 ? 518 PRO B N     1 
ATOM   9575  C  CA    . PRO B 1 518 ? -41.130 -34.526 -15.264 1.00 44.49 ? 518 PRO B CA    1 
ATOM   9576  C  C     . PRO B 1 518 ? -39.882 -33.878 -14.664 1.00 43.07 ? 518 PRO B C     1 
ATOM   9577  O  O     . PRO B 1 518 ? -39.139 -34.545 -13.940 1.00 42.05 ? 518 PRO B O     1 
ATOM   9578  C  CB    . PRO B 1 518 ? -42.252 -34.551 -14.229 1.00 45.49 ? 518 PRO B CB    1 
ATOM   9579  C  CG    . PRO B 1 518 ? -42.931 -35.889 -14.437 1.00 46.91 ? 518 PRO B CG    1 
ATOM   9580  C  CD    . PRO B 1 518 ? -41.858 -36.829 -14.847 1.00 45.80 ? 518 PRO B CD    1 
ATOM   9581  N  N     . PHE B 1 519 ? -39.670 -32.594 -14.960 1.00 42.50 ? 519 PHE B N     1 
ATOM   9582  C  CA    . PHE B 1 519 ? -38.495 -31.858 -14.506 1.00 41.09 ? 519 PHE B CA    1 
ATOM   9583  C  C     . PHE B 1 519 ? -38.355 -31.854 -12.983 1.00 41.39 ? 519 PHE B C     1 
ATOM   9584  O  O     . PHE B 1 519 ? -37.245 -31.949 -12.448 1.00 40.63 ? 519 PHE B O     1 
ATOM   9585  C  CB    . PHE B 1 519 ? -38.497 -30.414 -15.051 1.00 40.53 ? 519 PHE B CB    1 
ATOM   9586  C  CG    . PHE B 1 519 ? -37.112 -29.810 -15.177 1.00 38.11 ? 519 PHE B CG    1 
ATOM   9587  C  CD1   . PHE B 1 519 ? -36.523 -29.144 -14.103 1.00 36.68 ? 519 PHE B CD1   1 
ATOM   9588  C  CD2   . PHE B 1 519 ? -36.397 -29.926 -16.364 1.00 36.83 ? 519 PHE B CD2   1 
ATOM   9589  C  CE1   . PHE B 1 519 ? -35.235 -28.593 -14.212 1.00 35.79 ? 519 PHE B CE1   1 
ATOM   9590  C  CE2   . PHE B 1 519 ? -35.101 -29.395 -16.484 1.00 35.76 ? 519 PHE B CE2   1 
ATOM   9591  C  CZ    . PHE B 1 519 ? -34.520 -28.726 -15.410 1.00 34.89 ? 519 PHE B CZ    1 
ATOM   9592  N  N     . GLU B 1 520 ? -39.490 -31.768 -12.302 1.00 43.16 ? 520 GLU B N     1 
ATOM   9593  C  CA    . GLU B 1 520 ? -39.549 -31.658 -10.848 1.00 43.80 ? 520 GLU B CA    1 
ATOM   9594  C  C     . GLU B 1 520 ? -39.683 -32.996 -10.102 1.00 44.18 ? 520 GLU B C     1 
ATOM   9595  O  O     . GLU B 1 520 ? -39.739 -33.001 -8.872  1.00 44.67 ? 520 GLU B O     1 
ATOM   9596  C  CB    . GLU B 1 520 ? -40.721 -30.745 -10.457 1.00 45.24 ? 520 GLU B CB    1 
ATOM   9597  C  CG    . GLU B 1 520 ? -40.567 -29.289 -10.878 1.00 46.08 ? 520 GLU B CG    1 
ATOM   9598  C  CD    . GLU B 1 520 ? -41.902 -28.625 -11.188 1.00 49.52 ? 520 GLU B CD    1 
ATOM   9599  O  OE1   . GLU B 1 520 ? -42.230 -27.601 -10.542 1.00 51.12 ? 520 GLU B OE1   1 
ATOM   9600  O  OE2   . GLU B 1 520 ? -42.620 -29.125 -12.081 1.00 49.98 ? 520 GLU B OE2   1 
ATOM   9601  N  N     . SER B 1 521 ? -39.737 -34.120 -10.819 1.00 44.22 ? 521 SER B N     1 
ATOM   9602  C  CA    . SER B 1 521 ? -39.978 -35.422 -10.167 1.00 44.98 ? 521 SER B CA    1 
ATOM   9603  C  C     . SER B 1 521 ? -38.753 -35.953 -9.426  1.00 44.30 ? 521 SER B C     1 
ATOM   9604  O  O     . SER B 1 521 ? -37.620 -35.542 -9.716  1.00 43.12 ? 521 SER B O     1 
ATOM   9605  C  CB    . SER B 1 521 ? -40.496 -36.472 -11.165 1.00 45.54 ? 521 SER B CB    1 
ATOM   9606  O  OG    . SER B 1 521 ? -39.511 -36.836 -12.119 1.00 44.20 ? 521 SER B OG    1 
ATOM   9607  N  N     . ALA B 1 522 ? -38.997 -36.860 -8.472  1.00 45.07 ? 522 ALA B N     1 
ATOM   9608  C  CA    . ALA B 1 522 ? -37.940 -37.553 -7.720  1.00 44.57 ? 522 ALA B CA    1 
ATOM   9609  C  C     . ALA B 1 522 ? -36.949 -38.233 -8.659  1.00 43.86 ? 522 ALA B C     1 
ATOM   9610  O  O     . ALA B 1 522 ? -35.734 -38.243 -8.405  1.00 42.63 ? 522 ALA B O     1 
ATOM   9611  C  CB    . ALA B 1 522 ? -38.550 -38.576 -6.776  1.00 45.86 ? 522 ALA B CB    1 
ATOM   9612  N  N     . GLU B 1 523 ? -37.484 -38.779 -9.752  1.00 44.57 ? 523 GLU B N     1 
ATOM   9613  C  CA    . GLU B 1 523 ? -36.698 -39.487 -10.761 1.00 44.74 ? 523 GLU B CA    1 
ATOM   9614  C  C     . GLU B 1 523 ? -35.710 -38.569 -11.476 1.00 43.20 ? 523 GLU B C     1 
ATOM   9615  O  O     . GLU B 1 523 ? -34.544 -38.923 -11.631 1.00 42.17 ? 523 GLU B O     1 
ATOM   9616  C  CB    . GLU B 1 523 ? -37.614 -40.173 -11.777 1.00 46.02 ? 523 GLU B CB    1 
ATOM   9617  C  CG    . GLU B 1 523 ? -38.422 -41.348 -11.216 1.00 49.89 ? 523 GLU B CG    1 
ATOM   9618  C  CD    . GLU B 1 523 ? -39.756 -40.929 -10.598 1.00 54.03 ? 523 GLU B CD    1 
ATOM   9619  O  OE1   . GLU B 1 523 ? -40.495 -41.824 -10.127 1.00 57.04 ? 523 GLU B OE1   1 
ATOM   9620  O  OE2   . GLU B 1 523 ? -40.071 -39.716 -10.582 1.00 54.06 ? 523 GLU B OE2   1 
ATOM   9621  N  N     . ALA B 1 524 ? -36.185 -37.393 -11.892 1.00 43.19 ? 524 ALA B N     1 
ATOM   9622  C  CA    . ALA B 1 524 ? -35.344 -36.391 -12.543 1.00 42.30 ? 524 ALA B CA    1 
ATOM   9623  C  C     . ALA B 1 524 ? -34.328 -35.767 -11.591 1.00 41.76 ? 524 ALA B C     1 
ATOM   9624  O  O     . ALA B 1 524 ? -33.209 -35.477 -11.998 1.00 41.04 ? 524 ALA B O     1 
ATOM   9625  C  CB    . ALA B 1 524 ? -36.196 -35.312 -13.194 1.00 42.15 ? 524 ALA B CB    1 
ATOM   9626  N  N     . GLN B 1 525 ? -34.720 -35.555 -10.335 1.00 42.73 ? 525 GLN B N     1 
ATOM   9627  C  CA    . GLN B 1 525 ? -33.814 -34.990 -9.323  1.00 42.98 ? 525 GLN B CA    1 
ATOM   9628  C  C     . GLN B 1 525 ? -32.653 -35.935 -9.004  1.00 42.09 ? 525 GLN B C     1 
ATOM   9629  O  O     . GLN B 1 525 ? -31.529 -35.488 -8.781  1.00 41.55 ? 525 GLN B O     1 
ATOM   9630  C  CB    . GLN B 1 525 ? -34.571 -34.610 -8.039  1.00 43.75 ? 525 GLN B CB    1 
ATOM   9631  C  CG    . GLN B 1 525 ? -35.518 -33.388 -8.194  1.00 45.38 ? 525 GLN B CG    1 
ATOM   9632  C  CD    . GLN B 1 525 ? -36.267 -33.027 -6.906  1.00 46.70 ? 525 GLN B CD    1 
ATOM   9633  O  OE1   . GLN B 1 525 ? -37.503 -33.131 -6.832  1.00 49.76 ? 525 GLN B OE1   1 
ATOM   9634  N  NE2   . GLN B 1 525 ? -35.521 -32.599 -5.889  1.00 48.58 ? 525 GLN B NE2   1 
ATOM   9635  N  N     . LEU B 1 526 ? -32.930 -37.238 -8.992  1.00 42.35 ? 526 LEU B N     1 
ATOM   9636  C  CA    . LEU B 1 526 ? -31.888 -38.241 -8.797  1.00 41.59 ? 526 LEU B CA    1 
ATOM   9637  C  C     . LEU B 1 526 ? -31.051 -38.443 -10.070 1.00 40.34 ? 526 LEU B C     1 
ATOM   9638  O  O     . LEU B 1 526 ? -29.837 -38.604 -9.987  1.00 39.93 ? 526 LEU B O     1 
ATOM   9639  C  CB    . LEU B 1 526 ? -32.468 -39.577 -8.295  1.00 42.75 ? 526 LEU B CB    1 
ATOM   9640  C  CG    . LEU B 1 526 ? -31.498 -40.767 -8.326  1.00 43.03 ? 526 LEU B CG    1 
ATOM   9641  C  CD1   . LEU B 1 526 ? -30.372 -40.625 -7.280  1.00 41.84 ? 526 LEU B CD1   1 
ATOM   9642  C  CD2   . LEU B 1 526 ? -32.247 -42.084 -8.175  1.00 44.34 ? 526 LEU B CD2   1 
ATOM   9643  N  N     . LEU B 1 527 ? -31.691 -38.421 -11.238 1.00 39.62 ? 527 LEU B N     1 
ATOM   9644  C  CA    . LEU B 1 527 ? -30.951 -38.506 -12.498 1.00 38.85 ? 527 LEU B CA    1 
ATOM   9645  C  C     . LEU B 1 527 ? -29.992 -37.322 -12.638 1.00 37.81 ? 527 LEU B C     1 
ATOM   9646  O  O     . LEU B 1 527 ? -28.882 -37.481 -13.140 1.00 37.36 ? 527 LEU B O     1 
ATOM   9647  C  CB    . LEU B 1 527 ? -31.891 -38.605 -13.711 1.00 38.83 ? 527 LEU B CB    1 
ATOM   9648  C  CG    . LEU B 1 527 ? -31.242 -38.653 -15.109 1.00 38.61 ? 527 LEU B CG    1 
ATOM   9649  C  CD1   . LEU B 1 527 ? -30.408 -39.901 -15.325 1.00 38.86 ? 527 LEU B CD1   1 
ATOM   9650  C  CD2   . LEU B 1 527 ? -32.265 -38.521 -16.226 1.00 39.03 ? 527 LEU B CD2   1 
ATOM   9651  N  N     . ASN B 1 528 ? -30.438 -36.150 -12.180 1.00 37.69 ? 528 ASN B N     1 
ATOM   9652  C  CA    . ASN B 1 528 ? -29.659 -34.917 -12.209 1.00 36.88 ? 528 ASN B CA    1 
ATOM   9653  C  C     . ASN B 1 528 ? -28.345 -35.032 -11.430 1.00 36.50 ? 528 ASN B C     1 
ATOM   9654  O  O     . ASN B 1 528 ? -27.289 -34.643 -11.932 1.00 36.07 ? 528 ASN B O     1 
ATOM   9655  C  CB    . ASN B 1 528 ? -30.498 -33.751 -11.669 1.00 37.14 ? 528 ASN B CB    1 
ATOM   9656  C  CG    . ASN B 1 528 ? -29.775 -32.408 -11.760 1.00 37.05 ? 528 ASN B CG    1 
ATOM   9657  O  OD1   . ASN B 1 528 ? -29.273 -32.021 -12.828 1.00 36.79 ? 528 ASN B OD1   1 
ATOM   9658  N  ND2   . ASN B 1 528 ? -29.718 -31.693 -10.637 1.00 35.01 ? 528 ASN B ND2   1 
ATOM   9659  N  N     . LYS B 1 529 ? -28.414 -35.567 -10.211 1.00 36.69 ? 529 LYS B N     1 
ATOM   9660  C  CA    . LYS B 1 529 ? -27.214 -35.841 -9.430  1.00 36.34 ? 529 LYS B CA    1 
ATOM   9661  C  C     . LYS B 1 529 ? -26.323 -36.830 -10.167 1.00 36.40 ? 529 LYS B C     1 
ATOM   9662  O  O     . LYS B 1 529 ? -25.107 -36.616 -10.272 1.00 36.13 ? 529 LYS B O     1 
ATOM   9663  C  CB    . LYS B 1 529 ? -27.570 -36.434 -8.077  1.00 37.15 ? 529 LYS B CB    1 
ATOM   9664  C  CG    . LYS B 1 529 ? -28.190 -35.481 -7.058  1.00 37.81 ? 529 LYS B CG    1 
ATOM   9665  C  CD    . LYS B 1 529 ? -28.805 -36.324 -5.937  1.00 39.40 ? 529 LYS B CD    1 
ATOM   9666  C  CE    . LYS B 1 529 ? -29.608 -35.496 -4.948  1.00 40.69 ? 529 LYS B CE    1 
ATOM   9667  N  NZ    . LYS B 1 529 ? -30.080 -36.338 -3.806  1.00 40.91 ? 529 LYS B NZ    1 
ATOM   9668  N  N     . GLN B 1 530 ? -26.936 -37.900 -10.683 1.00 36.32 ? 530 GLN B N     1 
ATOM   9669  C  CA    . GLN B 1 530 ? -26.200 -39.002 -11.260 1.00 36.46 ? 530 GLN B CA    1 
ATOM   9670  C  C     . GLN B 1 530 ? -25.432 -38.550 -12.491 1.00 36.09 ? 530 GLN B C     1 
ATOM   9671  O  O     . GLN B 1 530 ? -24.245 -38.877 -12.645 1.00 36.21 ? 530 GLN B O     1 
ATOM   9672  C  CB    . GLN B 1 530 ? -27.136 -40.165 -11.606 1.00 37.62 ? 530 GLN B CB    1 
ATOM   9673  C  CG    . GLN B 1 530 ? -27.632 -40.996 -10.404 1.00 38.25 ? 530 GLN B CG    1 
ATOM   9674  C  CD    . GLN B 1 530 ? -28.697 -42.044 -10.789 1.00 39.23 ? 530 GLN B CD    1 
ATOM   9675  O  OE1   . GLN B 1 530 ? -29.548 -41.814 -11.666 1.00 40.84 ? 530 GLN B OE1   1 
ATOM   9676  N  NE2   . GLN B 1 530 ? -28.658 -43.189 -10.120 1.00 37.46 ? 530 GLN B NE2   1 
ATOM   9677  N  N     . ILE B 1 531 ? -26.102 -37.783 -13.356 1.00 35.27 ? 531 ILE B N     1 
ATOM   9678  C  CA    . ILE B 1 531 ? -25.475 -37.259 -14.561 1.00 34.16 ? 531 ILE B CA    1 
ATOM   9679  C  C     . ILE B 1 531 ? -24.223 -36.453 -14.226 1.00 33.33 ? 531 ILE B C     1 
ATOM   9680  O  O     . ILE B 1 531 ? -23.196 -36.612 -14.876 1.00 33.33 ? 531 ILE B O     1 
ATOM   9681  C  CB    . ILE B 1 531 ? -26.446 -36.400 -15.402 1.00 34.20 ? 531 ILE B CB    1 
ATOM   9682  C  CG1   . ILE B 1 531 ? -27.470 -37.297 -16.107 1.00 34.58 ? 531 ILE B CG1   1 
ATOM   9683  C  CG2   . ILE B 1 531 ? -25.660 -35.537 -16.407 1.00 32.54 ? 531 ILE B CG2   1 
ATOM   9684  C  CD1   . ILE B 1 531 ? -28.632 -36.543 -16.808 1.00 34.69 ? 531 ILE B CD1   1 
ATOM   9685  N  N     . PHE B 1 532 ? -24.305 -35.610 -13.201 1.00 32.51 ? 532 PHE B N     1 
ATOM   9686  C  CA    . PHE B 1 532 ? -23.220 -34.686 -12.894 1.00 31.70 ? 532 PHE B CA    1 
ATOM   9687  C  C     . PHE B 1 532 ? -22.092 -35.306 -12.045 1.00 32.16 ? 532 PHE B C     1 
ATOM   9688  O  O     . PHE B 1 532 ? -20.914 -34.954 -12.206 1.00 31.43 ? 532 PHE B O     1 
ATOM   9689  C  CB    . PHE B 1 532 ? -23.789 -33.355 -12.358 1.00 31.40 ? 532 PHE B CB    1 
ATOM   9690  C  CG    . PHE B 1 532 ? -24.389 -32.495 -13.460 1.00 30.84 ? 532 PHE B CG    1 
ATOM   9691  C  CD1   . PHE B 1 532 ? -23.590 -31.596 -14.174 1.00 30.31 ? 532 PHE B CD1   1 
ATOM   9692  C  CD2   . PHE B 1 532 ? -25.717 -32.651 -13.838 1.00 30.44 ? 532 PHE B CD2   1 
ATOM   9693  C  CE1   . PHE B 1 532 ? -24.115 -30.834 -15.220 1.00 30.69 ? 532 PHE B CE1   1 
ATOM   9694  C  CE2   . PHE B 1 532 ? -26.253 -31.906 -14.878 1.00 31.33 ? 532 PHE B CE2   1 
ATOM   9695  C  CZ    . PHE B 1 532 ? -25.455 -30.987 -15.571 1.00 31.32 ? 532 PHE B CZ    1 
ATOM   9696  N  N     . GLU B 1 533 ? -22.454 -36.259 -11.183 1.00 32.62 ? 533 GLU B N     1 
ATOM   9697  C  CA    . GLU B 1 533 ? -21.471 -37.141 -10.574 1.00 33.70 ? 533 GLU B CA    1 
ATOM   9698  C  C     . GLU B 1 533 ? -20.593 -37.771 -11.662 1.00 33.90 ? 533 GLU B C     1 
ATOM   9699  O  O     . GLU B 1 533 ? -19.356 -37.766 -11.555 1.00 34.06 ? 533 GLU B O     1 
ATOM   9700  C  CB    . GLU B 1 533 ? -22.151 -38.231 -9.742  1.00 34.03 ? 533 GLU B CB    1 
ATOM   9701  C  CG    . GLU B 1 533 ? -22.781 -37.695 -8.444  1.00 35.04 ? 533 GLU B CG    1 
ATOM   9702  C  CD    . GLU B 1 533 ? -23.497 -38.749 -7.607  1.00 36.77 ? 533 GLU B CD    1 
ATOM   9703  O  OE1   . GLU B 1 533 ? -23.596 -39.930 -8.032  1.00 38.28 ? 533 GLU B OE1   1 
ATOM   9704  O  OE2   . GLU B 1 533 ? -23.963 -38.379 -6.502  1.00 38.89 ? 533 GLU B OE2   1 
ATOM   9705  N  N     . THR B 1 534 ? -21.251 -38.280 -12.709 1.00 33.66 ? 534 THR B N     1 
ATOM   9706  C  CA    . THR B 1 534 ? -20.616 -39.025 -13.783 1.00 33.67 ? 534 THR B CA    1 
ATOM   9707  C  C     . THR B 1 534 ? -19.646 -38.130 -14.542 1.00 33.54 ? 534 THR B C     1 
ATOM   9708  O  O     . THR B 1 534 ? -18.499 -38.511 -14.803 1.00 34.15 ? 534 THR B O     1 
ATOM   9709  C  CB    . THR B 1 534 ? -21.680 -39.627 -14.749 1.00 33.75 ? 534 THR B CB    1 
ATOM   9710  O  OG1   . THR B 1 534 ? -22.460 -40.610 -14.059 1.00 32.80 ? 534 THR B OG1   1 
ATOM   9711  C  CG2   . THR B 1 534 ? -21.028 -40.277 -15.955 1.00 33.70 ? 534 THR B CG2   1 
ATOM   9712  N  N     . ILE B 1 535 ? -20.111 -36.931 -14.873 1.00 33.16 ? 535 ILE B N     1 
ATOM   9713  C  CA    . ILE B 1 535 ? -19.324 -35.985 -15.631 1.00 32.80 ? 535 ILE B CA    1 
ATOM   9714  C  C     . ILE B 1 535 ? -18.085 -35.580 -14.838 1.00 33.08 ? 535 ILE B C     1 
ATOM   9715  O  O     . ILE B 1 535 ? -16.967 -35.575 -15.371 1.00 33.31 ? 535 ILE B O     1 
ATOM   9716  C  CB    . ILE B 1 535 ? -20.173 -34.787 -16.068 1.00 32.62 ? 535 ILE B CB    1 
ATOM   9717  C  CG1   . ILE B 1 535 ? -21.243 -35.258 -17.078 1.00 32.42 ? 535 ILE B CG1   1 
ATOM   9718  C  CG2   . ILE B 1 535 ? -19.284 -33.670 -16.666 1.00 32.28 ? 535 ILE B CG2   1 
ATOM   9719  C  CD1   . ILE B 1 535 ? -22.263 -34.174 -17.471 1.00 31.62 ? 535 ILE B CD1   1 
ATOM   9720  N  N     . TYR B 1 536 ? -18.282 -35.289 -13.556 1.00 33.12 ? 536 TYR B N     1 
ATOM   9721  C  CA    . TYR B 1 536 ? -17.183 -34.950 -12.666 1.00 33.27 ? 536 TYR B CA    1 
ATOM   9722  C  C     . TYR B 1 536 ? -16.197 -36.121 -12.527 1.00 34.61 ? 536 TYR B C     1 
ATOM   9723  O  O     . TYR B 1 536 ? -14.968 -35.921 -12.574 1.00 34.88 ? 536 TYR B O     1 
ATOM   9724  C  CB    . TYR B 1 536 ? -17.733 -34.495 -11.304 1.00 33.07 ? 536 TYR B CB    1 
ATOM   9725  C  CG    . TYR B 1 536 ? -16.707 -33.843 -10.385 1.00 32.99 ? 536 TYR B CG    1 
ATOM   9726  C  CD1   . TYR B 1 536 ? -15.766 -32.942 -10.882 1.00 31.80 ? 536 TYR B CD1   1 
ATOM   9727  C  CD2   . TYR B 1 536 ? -16.701 -34.111 -9.007  1.00 33.74 ? 536 TYR B CD2   1 
ATOM   9728  C  CE1   . TYR B 1 536 ? -14.825 -32.344 -10.041 1.00 32.51 ? 536 TYR B CE1   1 
ATOM   9729  C  CE2   . TYR B 1 536 ? -15.771 -33.504 -8.148  1.00 33.29 ? 536 TYR B CE2   1 
ATOM   9730  C  CZ    . TYR B 1 536 ? -14.836 -32.623 -8.680  1.00 33.05 ? 536 TYR B CZ    1 
ATOM   9731  O  OH    . TYR B 1 536 ? -13.901 -32.034 -7.864  1.00 33.08 ? 536 TYR B OH    1 
ATOM   9732  N  N     . TYR B 1 537 ? -16.740 -37.336 -12.385 1.00 35.30 ? 537 TYR B N     1 
ATOM   9733  C  CA    . TYR B 1 537 ? -15.939 -38.550 -12.237 1.00 36.27 ? 537 TYR B CA    1 
ATOM   9734  C  C     . TYR B 1 537 ? -15.054 -38.856 -13.441 1.00 36.68 ? 537 TYR B C     1 
ATOM   9735  O  O     . TYR B 1 537 ? -13.849 -39.061 -13.288 1.00 37.53 ? 537 TYR B O     1 
ATOM   9736  C  CB    . TYR B 1 537 ? -16.820 -39.762 -11.941 1.00 37.19 ? 537 TYR B CB    1 
ATOM   9737  C  CG    . TYR B 1 537 ? -16.027 -40.934 -11.393 1.00 38.47 ? 537 TYR B CG    1 
ATOM   9738  C  CD1   . TYR B 1 537 ? -15.477 -41.896 -12.245 1.00 38.83 ? 537 TYR B CD1   1 
ATOM   9739  C  CD2   . TYR B 1 537 ? -15.813 -41.069 -10.023 1.00 38.89 ? 537 TYR B CD2   1 
ATOM   9740  C  CE1   . TYR B 1 537 ? -14.745 -42.971 -11.740 1.00 39.83 ? 537 TYR B CE1   1 
ATOM   9741  C  CE2   . TYR B 1 537 ? -15.093 -42.134 -9.513  1.00 39.92 ? 537 TYR B CE2   1 
ATOM   9742  C  CZ    . TYR B 1 537 ? -14.559 -43.080 -10.375 1.00 40.74 ? 537 TYR B CZ    1 
ATOM   9743  O  OH    . TYR B 1 537 ? -13.839 -44.136 -9.861  1.00 42.65 ? 537 TYR B OH    1 
ATOM   9744  N  N     . GLY B 1 538 ? -15.648 -38.906 -14.631 1.00 36.38 ? 538 GLY B N     1 
ATOM   9745  C  CA    . GLY B 1 538 ? -14.884 -39.134 -15.854 1.00 36.41 ? 538 GLY B CA    1 
ATOM   9746  C  C     . GLY B 1 538 ? -13.840 -38.062 -16.105 1.00 36.42 ? 538 GLY B C     1 
ATOM   9747  O  O     . GLY B 1 538 ? -12.722 -38.364 -16.522 1.00 37.24 ? 538 GLY B O     1 
ATOM   9748  N  N     . ALA B 1 539 ? -14.203 -36.809 -15.842 1.00 35.96 ? 539 ALA B N     1 
ATOM   9749  C  CA    . ALA B 1 539 ? -13.313 -35.661 -16.062 1.00 35.94 ? 539 ALA B CA    1 
ATOM   9750  C  C     . ALA B 1 539 ? -12.085 -35.719 -15.168 1.00 36.59 ? 539 ALA B C     1 
ATOM   9751  O  O     . ALA B 1 539 ? -10.964 -35.579 -15.650 1.00 36.92 ? 539 ALA B O     1 
ATOM   9752  C  CB    . ALA B 1 539 ? -14.058 -34.351 -15.853 1.00 34.93 ? 539 ALA B CB    1 
ATOM   9753  N  N     . LEU B 1 540 ? -12.298 -35.942 -13.870 1.00 37.14 ? 540 LEU B N     1 
ATOM   9754  C  CA    . LEU B 1 540 ? -11.181 -36.116 -12.935 1.00 38.24 ? 540 LEU B CA    1 
ATOM   9755  C  C     . LEU B 1 540 ? -10.269 -37.249 -13.377 1.00 39.36 ? 540 LEU B C     1 
ATOM   9756  O  O     . LEU B 1 540 ? -9.053  -37.115 -13.324 1.00 40.43 ? 540 LEU B O     1 
ATOM   9757  C  CB    . LEU B 1 540 ? -11.666 -36.351 -11.503 1.00 38.10 ? 540 LEU B CB    1 
ATOM   9758  C  CG    . LEU B 1 540 ? -12.204 -35.124 -10.765 1.00 37.62 ? 540 LEU B CG    1 
ATOM   9759  C  CD1   . LEU B 1 540 ? -13.011 -35.574 -9.562  1.00 37.45 ? 540 LEU B CD1   1 
ATOM   9760  C  CD2   . LEU B 1 540 ? -11.089 -34.154 -10.361 1.00 38.24 ? 540 LEU B CD2   1 
ATOM   9761  N  N     . GLU B 1 541 ? -10.875 -38.336 -13.839 1.00 39.67 ? 541 GLU B N     1 
ATOM   9762  C  CA    . GLU B 1 541 ? -10.172 -39.534 -14.274 1.00 41.40 ? 541 GLU B CA    1 
ATOM   9763  C  C     . GLU B 1 541 ? -9.297  -39.297 -15.511 1.00 41.67 ? 541 GLU B C     1 
ATOM   9764  O  O     . GLU B 1 541 ? -8.170  -39.805 -15.588 1.00 42.81 ? 541 GLU B O     1 
ATOM   9765  C  CB    . GLU B 1 541 ? -11.189 -40.626 -14.558 1.00 41.54 ? 541 GLU B CB    1 
ATOM   9766  C  CG    . GLU B 1 541 ? -10.716 -42.043 -14.337 1.00 45.79 ? 541 GLU B CG    1 
ATOM   9767  C  CD    . GLU B 1 541 ? -11.853 -43.028 -14.554 1.00 50.51 ? 541 GLU B CD    1 
ATOM   9768  O  OE1   . GLU B 1 541 ? -13.024 -42.592 -14.455 1.00 51.65 ? 541 GLU B OE1   1 
ATOM   9769  O  OE2   . GLU B 1 541 ? -11.595 -44.224 -14.834 1.00 52.70 ? 541 GLU B OE2   1 
ATOM   9770  N  N     . ALA B 1 542 ? -9.818  -38.539 -16.475 1.00 40.72 ? 542 ALA B N     1 
ATOM   9771  C  CA    . ALA B 1 542 ? -9.044  -38.141 -17.646 1.00 40.82 ? 542 ALA B CA    1 
ATOM   9772  C  C     . ALA B 1 542 ? -7.909  -37.205 -17.241 1.00 41.01 ? 542 ALA B C     1 
ATOM   9773  O  O     . ALA B 1 542 ? -6.759  -37.367 -17.677 1.00 41.80 ? 542 ALA B O     1 
ATOM   9774  C  CB    . ALA B 1 542 ? -9.941  -37.474 -18.668 1.00 40.04 ? 542 ALA B CB    1 
ATOM   9775  N  N     . SER B 1 543 ? -8.245  -36.237 -16.393 1.00 40.21 ? 543 SER B N     1 
ATOM   9776  C  CA    . SER B 1 543 ? -7.285  -35.268 -15.890 1.00 40.61 ? 543 SER B CA    1 
ATOM   9777  C  C     . SER B 1 543 ? -6.160  -35.950 -15.099 1.00 42.12 ? 543 SER B C     1 
ATOM   9778  O  O     . SER B 1 543 ? -4.980  -35.585 -15.217 1.00 42.35 ? 543 SER B O     1 
ATOM   9779  C  CB    . SER B 1 543 ? -7.997  -34.241 -15.027 1.00 39.35 ? 543 SER B CB    1 
ATOM   9780  O  OG    . SER B 1 543 ? -7.376  -32.982 -15.160 1.00 39.70 ? 543 SER B OG    1 
ATOM   9781  N  N     . CYS B 1 544 ? -6.535  -36.951 -14.307 1.00 42.75 ? 544 CYS B N     1 
ATOM   9782  C  CA    . CYS B 1 544 ? -5.563  -37.751 -13.578 1.00 44.27 ? 544 CYS B CA    1 
ATOM   9783  C  C     . CYS B 1 544 ? -4.636  -38.508 -14.531 1.00 45.76 ? 544 CYS B C     1 
ATOM   9784  O  O     . CYS B 1 544 ? -3.421  -38.512 -14.318 1.00 46.83 ? 544 CYS B O     1 
ATOM   9785  C  CB    . CYS B 1 544 ? -6.261  -38.711 -12.619 1.00 44.29 ? 544 CYS B CB    1 
ATOM   9786  S  SG    . CYS B 1 544 ? -5.139  -39.501 -11.474 1.00 46.33 ? 544 CYS B SG    1 
ATOM   9787  N  N     . ASP B 1 545 ? -5.206  -39.122 -15.577 1.00 45.96 ? 545 ASP B N     1 
ATOM   9788  C  CA    . ASP B 1 545 ? -4.434  -39.837 -16.610 1.00 47.78 ? 545 ASP B CA    1 
ATOM   9789  C  C     . ASP B 1 545 ? -3.407  -38.941 -17.309 1.00 48.20 ? 545 ASP B C     1 
ATOM   9790  O  O     . ASP B 1 545 ? -2.258  -39.351 -17.510 1.00 49.48 ? 545 ASP B O     1 
ATOM   9791  C  CB    . ASP B 1 545 ? -5.355  -40.459 -17.670 1.00 48.04 ? 545 ASP B CB    1 
ATOM   9792  C  CG    . ASP B 1 545 ? -6.183  -41.618 -17.137 1.00 49.75 ? 545 ASP B CG    1 
ATOM   9793  O  OD1   . ASP B 1 545 ? -5.733  -42.271 -16.175 1.00 53.27 ? 545 ASP B OD1   1 
ATOM   9794  O  OD2   . ASP B 1 545 ? -7.286  -41.879 -17.680 1.00 50.93 ? 545 ASP B OD2   1 
ATOM   9795  N  N     . LEU B 1 546 ? -3.832  -37.729 -17.684 1.00 46.93 ? 546 LEU B N     1 
ATOM   9796  C  CA    . LEU B 1 546 ? -2.938  -36.726 -18.283 1.00 47.17 ? 546 LEU B CA    1 
ATOM   9797  C  C     . LEU B 1 546 ? -1.848  -36.257 -17.319 1.00 48.00 ? 546 LEU B C     1 
ATOM   9798  O  O     . LEU B 1 546 ? -0.735  -35.924 -17.743 1.00 49.22 ? 546 LEU B O     1 
ATOM   9799  C  CB    . LEU B 1 546 ? -3.731  -35.525 -18.796 1.00 45.81 ? 546 LEU B CB    1 
ATOM   9800  C  CG    . LEU B 1 546 ? -4.470  -35.676 -20.124 1.00 45.26 ? 546 LEU B CG    1 
ATOM   9801  C  CD1   . LEU B 1 546 ? -5.540  -34.609 -20.236 1.00 43.18 ? 546 LEU B CD1   1 
ATOM   9802  C  CD2   . LEU B 1 546 ? -3.504  -35.623 -21.313 1.00 46.54 ? 546 LEU B CD2   1 
ATOM   9803  N  N     . ALA B 1 547 ? -2.169  -36.231 -16.026 1.00 47.48 ? 547 ALA B N     1 
ATOM   9804  C  CA    . ALA B 1 547 ? -1.177  -35.914 -15.007 1.00 48.58 ? 547 ALA B CA    1 
ATOM   9805  C  C     . ALA B 1 547 ? -0.135  -37.026 -14.882 1.00 50.44 ? 547 ALA B C     1 
ATOM   9806  O  O     . ALA B 1 547 ? 1.038   -36.740 -14.700 1.00 51.89 ? 547 ALA B O     1 
ATOM   9807  C  CB    . ALA B 1 547 ? -1.835  -35.642 -13.681 1.00 47.52 ? 547 ALA B CB    1 
ATOM   9808  N  N     . LYS B 1 548 ? -0.567  -38.283 -14.994 1.00 50.95 ? 548 LYS B N     1 
ATOM   9809  C  CA    . LYS B 1 548 ? 0.344   -39.432 -15.009 1.00 52.99 ? 548 LYS B CA    1 
ATOM   9810  C  C     . LYS B 1 548 ? 1.339   -39.334 -16.165 1.00 54.40 ? 548 LYS B C     1 
ATOM   9811  O  O     . LYS B 1 548 ? 2.525   -39.611 -15.996 1.00 55.72 ? 548 LYS B O     1 
ATOM   9812  C  CB    . LYS B 1 548 ? -0.438  -40.751 -15.089 1.00 52.76 ? 548 LYS B CB    1 
ATOM   9813  N  N     . GLU B 1 549 ? 0.829   -38.918 -17.325 1.00 54.15 ? 549 GLU B N     1 
ATOM   9814  C  CA    . GLU B 1 549 ? 1.592   -38.805 -18.570 1.00 55.53 ? 549 GLU B CA    1 
ATOM   9815  C  C     . GLU B 1 549 ? 2.442   -37.532 -18.683 1.00 55.42 ? 549 GLU B C     1 
ATOM   9816  O  O     . GLU B 1 549 ? 3.507   -37.565 -19.300 1.00 56.84 ? 549 GLU B O     1 
ATOM   9817  C  CB    . GLU B 1 549 ? 0.637   -38.852 -19.770 1.00 55.06 ? 549 GLU B CB    1 
ATOM   9818  C  CG    . GLU B 1 549 ? -0.228  -40.099 -19.874 1.00 57.03 ? 549 GLU B CG    1 
ATOM   9819  C  CD    . GLU B 1 549 ? -1.546  -39.837 -20.598 1.00 58.67 ? 549 GLU B CD    1 
ATOM   9820  O  OE1   . GLU B 1 549 ? -2.547  -40.518 -20.276 1.00 59.10 ? 549 GLU B OE1   1 
ATOM   9821  O  OE2   . GLU B 1 549 ? -1.587  -38.940 -21.474 1.00 59.40 ? 549 GLU B OE2   1 
ATOM   9822  N  N     . GLN B 1 550 ? 1.969   -36.425 -18.104 1.00 53.73 ? 550 GLN B N     1 
ATOM   9823  C  CA    . GLN B 1 550 ? 2.582   -35.098 -18.310 1.00 53.65 ? 550 GLN B CA    1 
ATOM   9824  C  C     . GLN B 1 550 ? 2.926   -34.296 -17.036 1.00 52.83 ? 550 GLN B C     1 
ATOM   9825  O  O     . GLN B 1 550 ? 3.504   -33.213 -17.123 1.00 52.76 ? 550 GLN B O     1 
ATOM   9826  C  CB    . GLN B 1 550 ? 1.675   -34.235 -19.197 1.00 52.55 ? 550 GLN B CB    1 
ATOM   9827  C  CG    . GLN B 1 550 ? 1.521   -34.695 -20.638 1.00 55.00 ? 550 GLN B CG    1 
ATOM   9828  C  CD    . GLN B 1 550 ? 0.261   -34.142 -21.292 1.00 56.78 ? 550 GLN B CD    1 
ATOM   9829  O  OE1   . GLN B 1 550 ? -0.407  -33.263 -20.740 1.00 57.37 ? 550 GLN B OE1   1 
ATOM   9830  N  NE2   . GLN B 1 550 ? -0.079  -34.668 -22.471 1.00 58.53 ? 550 GLN B NE2   1 
ATOM   9831  N  N     . GLY B 1 551 ? 2.560   -34.811 -15.868 1.00 51.99 ? 551 GLY B N     1 
ATOM   9832  C  CA    . GLY B 1 551 ? 2.748   -34.085 -14.610 1.00 51.33 ? 551 GLY B CA    1 
ATOM   9833  C  C     . GLY B 1 551 ? 1.580   -33.154 -14.325 1.00 49.08 ? 551 GLY B C     1 
ATOM   9834  O  O     . GLY B 1 551 ? 0.913   -32.711 -15.252 1.00 48.39 ? 551 GLY B O     1 
ATOM   9835  N  N     . PRO B 1 552 ? 1.326   -32.837 -13.041 1.00 48.36 ? 552 PRO B N     1 
ATOM   9836  C  CA    . PRO B 1 552 ? 0.229   -31.924 -12.698 1.00 46.37 ? 552 PRO B CA    1 
ATOM   9837  C  C     . PRO B 1 552 ? 0.469   -30.500 -13.213 1.00 45.93 ? 552 PRO B C     1 
ATOM   9838  O  O     . PRO B 1 552 ? 1.577   -30.176 -13.654 1.00 47.21 ? 552 PRO B O     1 
ATOM   9839  C  CB    . PRO B 1 552 ? 0.239   -31.919 -11.159 1.00 46.30 ? 552 PRO B CB    1 
ATOM   9840  C  CG    . PRO B 1 552 ? 1.040   -33.098 -10.751 1.00 47.80 ? 552 PRO B CG    1 
ATOM   9841  C  CD    . PRO B 1 552 ? 2.045   -33.298 -11.839 1.00 49.58 ? 552 PRO B CD    1 
ATOM   9842  N  N     . TYR B 1 553 ? -0.555  -29.655 -13.148 1.00 44.23 ? 553 TYR B N     1 
ATOM   9843  C  CA    . TYR B 1 553 ? -0.376  -28.234 -13.442 1.00 43.70 ? 553 TYR B CA    1 
ATOM   9844  C  C     . TYR B 1 553 ? 0.477   -27.553 -12.359 1.00 44.61 ? 553 TYR B C     1 
ATOM   9845  O  O     . TYR B 1 553 ? 0.419   -27.936 -11.187 1.00 44.74 ? 553 TYR B O     1 
ATOM   9846  C  CB    . TYR B 1 553 ? -1.728  -27.532 -13.624 1.00 41.23 ? 553 TYR B CB    1 
ATOM   9847  C  CG    . TYR B 1 553 ? -2.628  -27.566 -12.412 1.00 39.86 ? 553 TYR B CG    1 
ATOM   9848  C  CD1   . TYR B 1 553 ? -2.640  -26.512 -11.503 1.00 38.98 ? 553 TYR B CD1   1 
ATOM   9849  C  CD2   . TYR B 1 553 ? -3.477  -28.646 -12.177 1.00 38.56 ? 553 TYR B CD2   1 
ATOM   9850  C  CE1   . TYR B 1 553 ? -3.459  -26.530 -10.394 1.00 37.94 ? 553 TYR B CE1   1 
ATOM   9851  C  CE2   . TYR B 1 553 ? -4.303  -28.675 -11.070 1.00 37.99 ? 553 TYR B CE2   1 
ATOM   9852  C  CZ    . TYR B 1 553 ? -4.286  -27.613 -10.178 1.00 38.25 ? 553 TYR B CZ    1 
ATOM   9853  O  OH    . TYR B 1 553 ? -5.111  -27.618 -9.080  1.00 37.68 ? 553 TYR B OH    1 
ATOM   9854  N  N     . GLU B 1 554 ? 1.257   -26.551 -12.777 1.00 45.42 ? 554 GLU B N     1 
ATOM   9855  C  CA    . GLU B 1 554 ? 2.197   -25.799 -11.926 1.00 46.58 ? 554 GLU B CA    1 
ATOM   9856  C  C     . GLU B 1 554 ? 1.755   -25.541 -10.488 1.00 45.57 ? 554 GLU B C     1 
ATOM   9857  O  O     . GLU B 1 554 ? 2.547   -25.656 -9.558  1.00 46.59 ? 554 GLU B O     1 
ATOM   9858  C  CB    . GLU B 1 554 ? 2.491   -24.434 -12.551 1.00 46.71 ? 554 GLU B CB    1 
ATOM   9859  C  CG    . GLU B 1 554 ? 3.543   -24.441 -13.617 1.00 51.28 ? 554 GLU B CG    1 
ATOM   9860  C  CD    . GLU B 1 554 ? 4.284   -23.109 -13.733 1.00 55.35 ? 554 GLU B CD    1 
ATOM   9861  O  OE1   . GLU B 1 554 ? 4.951   -22.916 -14.773 1.00 58.60 ? 554 GLU B OE1   1 
ATOM   9862  O  OE2   . GLU B 1 554 ? 4.215   -22.267 -12.801 1.00 54.98 ? 554 GLU B OE2   1 
ATOM   9863  N  N     . THR B 1 555 ? 0.496   -25.156 -10.318 1.00 43.60 ? 555 THR B N     1 
ATOM   9864  C  CA    . THR B 1 555 ? 0.025   -24.677 -9.028  1.00 42.67 ? 555 THR B CA    1 
ATOM   9865  C  C     . THR B 1 555 ? -0.832  -25.718 -8.326  1.00 41.91 ? 555 THR B C     1 
ATOM   9866  O  O     . THR B 1 555 ? -1.657  -25.375 -7.478  1.00 40.97 ? 555 THR B O     1 
ATOM   9867  C  CB    . THR B 1 555 ? -0.769  -23.357 -9.178  1.00 41.48 ? 555 THR B CB    1 
ATOM   9868  O  OG1   . THR B 1 555 ? -1.872  -23.555 -10.075 1.00 39.82 ? 555 THR B OG1   1 
ATOM   9869  C  CG2   . THR B 1 555 ? 0.141   -22.252 -9.715  1.00 41.96 ? 555 THR B CG2   1 
ATOM   9870  N  N     . TYR B 1 556 ? -0.636  -26.983 -8.695  1.00 41.97 ? 556 TYR B N     1 
ATOM   9871  C  CA    . TYR B 1 556 ? -1.349  -28.087 -8.076  1.00 41.88 ? 556 TYR B CA    1 
ATOM   9872  C  C     . TYR B 1 556 ? -1.047  -28.275 -6.583  1.00 42.89 ? 556 TYR B C     1 
ATOM   9873  O  O     . TYR B 1 556 ? -1.969  -28.490 -5.800  1.00 42.31 ? 556 TYR B O     1 
ATOM   9874  C  CB    . TYR B 1 556 ? -1.102  -29.383 -8.845  1.00 42.24 ? 556 TYR B CB    1 
ATOM   9875  C  CG    . TYR B 1 556 ? -1.698  -30.615 -8.197  1.00 42.35 ? 556 TYR B CG    1 
ATOM   9876  C  CD1   . TYR B 1 556 ? -0.884  -31.601 -7.639  1.00 43.82 ? 556 TYR B CD1   1 
ATOM   9877  C  CD2   . TYR B 1 556 ? -3.080  -30.790 -8.137  1.00 41.90 ? 556 TYR B CD2   1 
ATOM   9878  C  CE1   . TYR B 1 556 ? -1.433  -32.725 -7.041  1.00 44.34 ? 556 TYR B CE1   1 
ATOM   9879  C  CE2   . TYR B 1 556 ? -3.637  -31.908 -7.553  1.00 41.06 ? 556 TYR B CE2   1 
ATOM   9880  C  CZ    . TYR B 1 556 ? -2.818  -32.874 -7.006  1.00 42.96 ? 556 TYR B CZ    1 
ATOM   9881  O  OH    . TYR B 1 556 ? -3.393  -33.986 -6.426  1.00 42.93 ? 556 TYR B OH    1 
ATOM   9882  N  N     . GLU B 1 557 ? 0.232   -28.209 -6.202  1.00 44.88 ? 557 GLU B N     1 
ATOM   9883  C  CA    . GLU B 1 557 ? 0.632   -28.402 -4.805  1.00 46.62 ? 557 GLU B CA    1 
ATOM   9884  C  C     . GLU B 1 557 ? 0.120   -27.277 -3.928  1.00 45.38 ? 557 GLU B C     1 
ATOM   9885  O  O     . GLU B 1 557 ? 0.459   -26.120 -4.147  1.00 45.11 ? 557 GLU B O     1 
ATOM   9886  C  CB    . GLU B 1 557 ? 2.157   -28.533 -4.654  1.00 49.05 ? 557 GLU B CB    1 
ATOM   9887  C  CG    . GLU B 1 557 ? 2.757   -29.858 -5.164  1.00 53.38 ? 557 GLU B CG    1 
ATOM   9888  C  CD    . GLU B 1 557 ? 1.916   -31.098 -4.828  1.00 57.06 ? 557 GLU B CD    1 
ATOM   9889  O  OE1   . GLU B 1 557 ? 1.897   -32.040 -5.667  1.00 59.50 ? 557 GLU B OE1   1 
ATOM   9890  O  OE2   . GLU B 1 557 ? 1.281   -31.133 -3.741  1.00 57.57 ? 557 GLU B OE2   1 
ATOM   9891  N  N     . GLY B 1 558 ? -0.698  -27.641 -2.941  1.00 45.00 ? 558 GLY B N     1 
ATOM   9892  C  CA    . GLY B 1 558 ? -1.364  -26.687 -2.059  1.00 44.10 ? 558 GLY B CA    1 
ATOM   9893  C  C     . GLY B 1 558 ? -2.868  -26.619 -2.278  1.00 42.67 ? 558 GLY B C     1 
ATOM   9894  O  O     . GLY B 1 558 ? -3.607  -26.201 -1.390  1.00 42.41 ? 558 GLY B O     1 
ATOM   9895  N  N     . SER B 1 559 ? -3.338  -27.019 -3.458  1.00 41.96 ? 559 SER B N     1 
ATOM   9896  C  CA    . SER B 1 559 ? -4.774  -26.936 -3.763  1.00 40.69 ? 559 SER B CA    1 
ATOM   9897  C  C     . SER B 1 559 ? -5.567  -27.951 -2.926  1.00 40.72 ? 559 SER B C     1 
ATOM   9898  O  O     . SER B 1 559 ? -4.994  -28.936 -2.442  1.00 42.73 ? 559 SER B O     1 
ATOM   9899  C  CB    . SER B 1 559 ? -5.027  -27.150 -5.261  1.00 39.78 ? 559 SER B CB    1 
ATOM   9900  O  OG    . SER B 1 559 ? -4.637  -28.449 -5.642  1.00 40.43 ? 559 SER B OG    1 
ATOM   9901  N  N     . PRO B 1 560 ? -6.868  -27.691 -2.705  1.00 39.37 ? 560 PRO B N     1 
ATOM   9902  C  CA    . PRO B 1 560 ? -7.746  -28.694 -2.089  1.00 39.19 ? 560 PRO B CA    1 
ATOM   9903  C  C     . PRO B 1 560 ? -7.655  -30.109 -2.689  1.00 39.68 ? 560 PRO B C     1 
ATOM   9904  O  O     . PRO B 1 560 ? -7.513  -31.065 -1.924  1.00 40.35 ? 560 PRO B O     1 
ATOM   9905  C  CB    . PRO B 1 560 ? -9.140  -28.099 -2.277  1.00 37.99 ? 560 PRO B CB    1 
ATOM   9906  C  CG    . PRO B 1 560 ? -8.902  -26.618 -2.286  1.00 37.42 ? 560 PRO B CG    1 
ATOM   9907  C  CD    . PRO B 1 560 ? -7.573  -26.415 -2.951  1.00 38.25 ? 560 PRO B CD    1 
ATOM   9908  N  N     . VAL B 1 561 ? -7.711  -30.275 -4.019  1.00 39.06 ? 561 VAL B N     1 
ATOM   9909  C  CA    . VAL B 1 561 ? -7.629  -31.646 -4.543  1.00 39.26 ? 561 VAL B CA    1 
ATOM   9910  C  C     . VAL B 1 561 ? -6.318  -32.339 -4.160  1.00 40.46 ? 561 VAL B C     1 
ATOM   9911  O  O     . VAL B 1 561 ? -6.325  -33.535 -3.898  1.00 41.12 ? 561 VAL B O     1 
ATOM   9912  C  CB    . VAL B 1 561 ? -8.003  -31.868 -6.073  1.00 38.96 ? 561 VAL B CB    1 
ATOM   9913  C  CG1   . VAL B 1 561 ? -9.087  -30.911 -6.585  1.00 36.58 ? 561 VAL B CG1   1 
ATOM   9914  C  CG2   . VAL B 1 561 ? -6.773  -31.903 -6.961  1.00 40.18 ? 561 VAL B CG2   1 
ATOM   9915  N  N     . SER B 1 562 ? -5.214  -31.592 -4.081  1.00 40.85 ? 562 SER B N     1 
ATOM   9916  C  CA    . SER B 1 562 ? -3.936  -32.170 -3.631  1.00 42.13 ? 562 SER B CA    1 
ATOM   9917  C  C     . SER B 1 562 ? -3.990  -32.602 -2.166  1.00 43.34 ? 562 SER B C     1 
ATOM   9918  O  O     . SER B 1 562 ? -3.131  -33.356 -1.705  1.00 45.12 ? 562 SER B O     1 
ATOM   9919  C  CB    . SER B 1 562 ? -2.762  -31.215 -3.875  1.00 42.50 ? 562 SER B CB    1 
ATOM   9920  O  OG    . SER B 1 562 ? -2.662  -30.225 -2.868  1.00 41.44 ? 562 SER B OG    1 
ATOM   9921  N  N     . LYS B 1 563 ? -4.992  -32.107 -1.441  1.00 42.92 ? 563 LYS B N     1 
ATOM   9922  C  CA    . LYS B 1 563 ? -5.253  -32.518 -0.063  1.00 44.45 ? 563 LYS B CA    1 
ATOM   9923  C  C     . LYS B 1 563 ? -6.329  -33.614 -0.006  1.00 44.65 ? 563 LYS B C     1 
ATOM   9924  O  O     . LYS B 1 563 ? -6.773  -34.004 1.077   1.00 45.81 ? 563 LYS B O     1 
ATOM   9925  C  CB    . LYS B 1 563 ? -5.696  -31.327 0.797   1.00 43.77 ? 563 LYS B CB    1 
ATOM   9926  C  CG    . LYS B 1 563 ? -4.768  -30.130 0.810   1.00 45.13 ? 563 LYS B CG    1 
ATOM   9927  C  CD    . LYS B 1 563 ? -5.185  -29.178 1.925   1.00 46.97 ? 563 LYS B CD    1 
ATOM   9928  C  CE    . LYS B 1 563 ? -4.940  -27.706 1.594   1.00 47.79 ? 563 LYS B CE    1 
ATOM   9929  N  NZ    . LYS B 1 563 ? -3.522  -27.305 1.782   1.00 49.05 ? 563 LYS B NZ    1 
ATOM   9930  N  N     . GLY B 1 564 ? -6.751  -34.102 -1.169  1.00 44.08 ? 564 GLY B N     1 
ATOM   9931  C  CA    . GLY B 1 564 ? -7.779  -35.132 -1.241  1.00 43.97 ? 564 GLY B CA    1 
ATOM   9932  C  C     . GLY B 1 564 ? -9.195  -34.593 -1.100  1.00 43.08 ? 564 GLY B C     1 
ATOM   9933  O  O     . GLY B 1 564 ? -10.129 -35.354 -0.823  1.00 43.29 ? 564 GLY B O     1 
ATOM   9934  N  N     . ILE B 1 565 ? -9.354  -33.284 -1.290  1.00 41.61 ? 565 ILE B N     1 
ATOM   9935  C  CA    . ILE B 1 565 ? -10.662 -32.641 -1.206  1.00 40.25 ? 565 ILE B CA    1 
ATOM   9936  C  C     . ILE B 1 565 ? -11.208 -32.395 -2.604  1.00 38.94 ? 565 ILE B C     1 
ATOM   9937  O  O     . ILE B 1 565 ? -10.584 -31.695 -3.412  1.00 38.34 ? 565 ILE B O     1 
ATOM   9938  C  CB    . ILE B 1 565 ? -10.609 -31.299 -0.419  1.00 40.08 ? 565 ILE B CB    1 
ATOM   9939  C  CG1   . ILE B 1 565 ? -9.967  -31.514 0.956   1.00 41.48 ? 565 ILE B CG1   1 
ATOM   9940  C  CG2   . ILE B 1 565 ? -12.012 -30.710 -0.264  1.00 38.32 ? 565 ILE B CG2   1 
ATOM   9941  C  CD1   . ILE B 1 565 ? -9.260  -30.292 1.502   1.00 43.45 ? 565 ILE B CD1   1 
ATOM   9942  N  N     . LEU B 1 566 ? -12.366 -32.988 -2.886  1.00 38.39 ? 566 LEU B N     1 
ATOM   9943  C  CA    . LEU B 1 566 ? -13.061 -32.768 -4.152  1.00 37.40 ? 566 LEU B CA    1 
ATOM   9944  C  C     . LEU B 1 566 ? -14.246 -31.839 -3.927  1.00 36.66 ? 566 LEU B C     1 
ATOM   9945  O  O     . LEU B 1 566 ? -14.584 -31.522 -2.786  1.00 37.17 ? 566 LEU B O     1 
ATOM   9946  C  CB    . LEU B 1 566 ? -13.505 -34.096 -4.777  1.00 37.52 ? 566 LEU B CB    1 
ATOM   9947  C  CG    . LEU B 1 566 ? -12.412 -35.125 -5.087  1.00 38.42 ? 566 LEU B CG    1 
ATOM   9948  C  CD1   . LEU B 1 566 ? -12.999 -36.462 -5.589  1.00 38.35 ? 566 LEU B CD1   1 
ATOM   9949  C  CD2   . LEU B 1 566 ? -11.407 -34.568 -6.097  1.00 39.12 ? 566 LEU B CD2   1 
ATOM   9950  N  N     . GLN B 1 567 ? -14.875 -31.411 -5.016  1.00 35.95 ? 567 GLN B N     1 
ATOM   9951  C  CA    . GLN B 1 567 ? -15.963 -30.432 -4.972  1.00 35.30 ? 567 GLN B CA    1 
ATOM   9952  C  C     . GLN B 1 567 ? -17.078 -30.737 -3.954  1.00 35.78 ? 567 GLN B C     1 
ATOM   9953  O  O     . GLN B 1 567 ? -17.498 -29.847 -3.212  1.00 36.00 ? 567 GLN B O     1 
ATOM   9954  C  CB    . GLN B 1 567 ? -16.538 -30.221 -6.378  1.00 34.32 ? 567 GLN B CB    1 
ATOM   9955  C  CG    . GLN B 1 567 ? -17.501 -29.045 -6.533  1.00 33.90 ? 567 GLN B CG    1 
ATOM   9956  C  CD    . GLN B 1 567 ? -16.960 -27.693 -6.052  1.00 35.39 ? 567 GLN B CD    1 
ATOM   9957  O  OE1   . GLN B 1 567 ? -17.730 -26.852 -5.589  1.00 35.20 ? 567 GLN B OE1   1 
ATOM   9958  N  NE2   . GLN B 1 567 ? -15.645 -27.473 -6.173  1.00 35.81 ? 567 GLN B NE2   1 
ATOM   9959  N  N     . TYR B 1 568 ? -17.548 -31.979 -3.915  1.00 36.29 ? 568 TYR B N     1 
ATOM   9960  C  CA    . TYR B 1 568 ? -18.666 -32.340 -3.038  1.00 36.88 ? 568 TYR B CA    1 
ATOM   9961  C  C     . TYR B 1 568 ? -18.262 -32.327 -1.562  1.00 38.03 ? 568 TYR B C     1 
ATOM   9962  O  O     . TYR B 1 568 ? -19.118 -32.165 -0.690  1.00 38.14 ? 568 TYR B O     1 
ATOM   9963  C  CB    . TYR B 1 568 ? -19.264 -33.702 -3.438  1.00 37.13 ? 568 TYR B CB    1 
ATOM   9964  C  CG    . TYR B 1 568 ? -18.257 -34.830 -3.444  1.00 37.30 ? 568 TYR B CG    1 
ATOM   9965  C  CD1   . TYR B 1 568 ? -17.538 -35.150 -4.606  1.00 37.07 ? 568 TYR B CD1   1 
ATOM   9966  C  CD2   . TYR B 1 568 ? -18.007 -35.565 -2.285  1.00 37.59 ? 568 TYR B CD2   1 
ATOM   9967  C  CE1   . TYR B 1 568 ? -16.595 -36.181 -4.611  1.00 36.89 ? 568 TYR B CE1   1 
ATOM   9968  C  CE2   . TYR B 1 568 ? -17.073 -36.596 -2.273  1.00 39.31 ? 568 TYR B CE2   1 
ATOM   9969  C  CZ    . TYR B 1 568 ? -16.377 -36.901 -3.438  1.00 39.37 ? 568 TYR B CZ    1 
ATOM   9970  O  OH    . TYR B 1 568 ? -15.463 -37.922 -3.406  1.00 40.81 ? 568 TYR B OH    1 
ATOM   9971  N  N     . ASP B 1 569 ? -16.967 -32.516 -1.289  1.00 38.98 ? 569 ASP B N     1 
ATOM   9972  C  CA    . ASP B 1 569 ? -16.443 -32.376 0.063   1.00 40.91 ? 569 ASP B CA    1 
ATOM   9973  C  C     . ASP B 1 569 ? -16.640 -30.937 0.544   1.00 41.09 ? 569 ASP B C     1 
ATOM   9974  O  O     . ASP B 1 569 ? -16.958 -30.692 1.707   1.00 41.76 ? 569 ASP B O     1 
ATOM   9975  C  CB    . ASP B 1 569 ? -14.960 -32.735 0.117   1.00 41.45 ? 569 ASP B CB    1 
ATOM   9976  C  CG    . ASP B 1 569 ? -14.703 -34.208 -0.120  1.00 42.91 ? 569 ASP B CG    1 
ATOM   9977  O  OD1   . ASP B 1 569 ? -13.765 -34.528 -0.884  1.00 42.80 ? 569 ASP B OD1   1 
ATOM   9978  O  OD2   . ASP B 1 569 ? -15.432 -35.048 0.454   1.00 44.16 ? 569 ASP B OD2   1 
ATOM   9979  N  N     . MET B 1 570 ? -16.469 -29.994 -0.375  1.00 41.14 ? 570 MET B N     1 
ATOM   9980  C  CA    . MET B 1 570 ? -16.611 -28.564 -0.079  1.00 41.94 ? 570 MET B CA    1 
ATOM   9981  C  C     . MET B 1 570 ? -18.068 -28.149 0.161   1.00 41.43 ? 570 MET B C     1 
ATOM   9982  O  O     . MET B 1 570 ? -18.333 -27.165 0.860   1.00 41.32 ? 570 MET B O     1 
ATOM   9983  C  CB    . MET B 1 570 ? -15.952 -27.739 -1.185  1.00 40.76 ? 570 MET B CB    1 
ATOM   9984  C  CG    . MET B 1 570 ? -14.432 -27.868 -1.142  1.00 42.37 ? 570 MET B CG    1 
ATOM   9985  S  SD    . MET B 1 570 ? -13.559 -27.359 -2.637  1.00 42.83 ? 570 MET B SD    1 
ATOM   9986  C  CE    . MET B 1 570 ? -12.219 -26.498 -1.859  1.00 42.50 ? 570 MET B CE    1 
ATOM   9987  N  N     . TRP B 1 571 ? -19.002 -28.917 -0.407  1.00 40.96 ? 571 TRP B N     1 
ATOM   9988  C  CA    . TRP B 1 571 ? -20.433 -28.717 -0.157  1.00 40.30 ? 571 TRP B CA    1 
ATOM   9989  C  C     . TRP B 1 571 ? -20.967 -29.594 0.970   1.00 41.54 ? 571 TRP B C     1 
ATOM   9990  O  O     . TRP B 1 571 ? -22.175 -29.602 1.208   1.00 42.52 ? 571 TRP B O     1 
ATOM   9991  C  CB    . TRP B 1 571 ? -21.244 -29.044 -1.407  1.00 37.91 ? 571 TRP B CB    1 
ATOM   9992  C  CG    . TRP B 1 571 ? -21.086 -28.130 -2.545  1.00 35.80 ? 571 TRP B CG    1 
ATOM   9993  C  CD1   . TRP B 1 571 ? -19.979 -27.967 -3.322  1.00 34.26 ? 571 TRP B CD1   1 
ATOM   9994  C  CD2   . TRP B 1 571 ? -22.102 -27.283 -3.109  1.00 34.39 ? 571 TRP B CD2   1 
ATOM   9995  N  NE1   . TRP B 1 571 ? -20.233 -27.063 -4.320  1.00 31.67 ? 571 TRP B NE1   1 
ATOM   9996  C  CE2   . TRP B 1 571 ? -21.524 -26.624 -4.215  1.00 32.08 ? 571 TRP B CE2   1 
ATOM   9997  C  CE3   . TRP B 1 571 ? -23.442 -27.014 -2.780  1.00 32.60 ? 571 TRP B CE3   1 
ATOM   9998  C  CZ2   . TRP B 1 571 ? -22.236 -25.704 -4.998  1.00 33.16 ? 571 TRP B CZ2   1 
ATOM   9999  C  CZ3   . TRP B 1 571 ? -24.146 -26.102 -3.550  1.00 33.51 ? 571 TRP B CZ3   1 
ATOM   10000 C  CH2   . TRP B 1 571 ? -23.542 -25.456 -4.650  1.00 33.28 ? 571 TRP B CH2   1 
ATOM   10001 N  N     . ASN B 1 572 ? -20.088 -30.342 1.640   1.00 42.50 ? 572 ASN B N     1 
ATOM   10002 C  CA    . ASN B 1 572 ? -20.493 -31.387 2.605   1.00 43.38 ? 572 ASN B CA    1 
ATOM   10003 C  C     . ASN B 1 572 ? -21.569 -32.356 2.069   1.00 42.90 ? 572 ASN B C     1 
ATOM   10004 O  O     . ASN B 1 572 ? -22.537 -32.682 2.753   1.00 43.48 ? 572 ASN B O     1 
ATOM   10005 C  CB    . ASN B 1 572 ? -20.938 -30.762 3.936   1.00 44.63 ? 572 ASN B CB    1 
ATOM   10006 C  CG    . ASN B 1 572 ? -19.919 -29.779 4.496   1.00 46.32 ? 572 ASN B CG    1 
ATOM   10007 O  OD1   . ASN B 1 572 ? -20.219 -28.582 4.667   1.00 46.76 ? 572 ASN B OD1   1 
ATOM   10008 N  ND2   . ASN B 1 572 ? -18.705 -30.271 4.779   1.00 46.24 ? 572 ASN B ND2   1 
ATOM   10009 N  N     . VAL B 1 573 ? -21.392 -32.807 0.834   1.00 41.74 ? 573 VAL B N     1 
ATOM   10010 C  CA    . VAL B 1 573 ? -22.316 -33.740 0.217   1.00 41.48 ? 573 VAL B CA    1 
ATOM   10011 C  C     . VAL B 1 573 ? -21.625 -35.092 0.107   1.00 42.27 ? 573 VAL B C     1 
ATOM   10012 O  O     . VAL B 1 573 ? -20.432 -35.165 -0.194  1.00 42.03 ? 573 VAL B O     1 
ATOM   10013 C  CB    . VAL B 1 573 ? -22.779 -33.238 -1.195  1.00 40.59 ? 573 VAL B CB    1 
ATOM   10014 C  CG1   . VAL B 1 573 ? -23.306 -34.381 -2.070  1.00 39.49 ? 573 VAL B CG1   1 
ATOM   10015 C  CG2   . VAL B 1 573 ? -23.826 -32.136 -1.058  1.00 40.48 ? 573 VAL B CG2   1 
ATOM   10016 N  N     . THR B 1 574 ? -22.381 -36.155 0.378   1.00 43.14 ? 574 THR B N     1 
ATOM   10017 C  CA    . THR B 1 574 ? -21.946 -37.518 0.113   1.00 43.60 ? 574 THR B CA    1 
ATOM   10018 C  C     . THR B 1 574 ? -22.586 -37.971 -1.198  1.00 43.07 ? 574 THR B C     1 
ATOM   10019 O  O     . THR B 1 574 ? -23.811 -37.972 -1.317  1.00 42.98 ? 574 THR B O     1 
ATOM   10020 C  CB    . THR B 1 574 ? -22.346 -38.449 1.264   1.00 45.15 ? 574 THR B CB    1 
ATOM   10021 O  OG1   . THR B 1 574 ? -21.769 -37.953 2.478   1.00 45.77 ? 574 THR B OG1   1 
ATOM   10022 C  CG2   . THR B 1 574 ? -21.871 -39.891 1.016   1.00 46.07 ? 574 THR B CG2   1 
ATOM   10023 N  N     . PRO B 1 575 ? -21.754 -38.360 -2.187  1.00 42.62 ? 575 PRO B N     1 
ATOM   10024 C  CA    . PRO B 1 575 ? -22.258 -38.794 -3.491  1.00 41.77 ? 575 PRO B CA    1 
ATOM   10025 C  C     . PRO B 1 575 ? -23.127 -40.048 -3.351  1.00 42.75 ? 575 PRO B C     1 
ATOM   10026 O  O     . PRO B 1 575 ? -23.079 -40.717 -2.313  1.00 43.78 ? 575 PRO B O     1 
ATOM   10027 C  CB    . PRO B 1 575 ? -20.982 -39.158 -4.260  1.00 41.71 ? 575 PRO B CB    1 
ATOM   10028 C  CG    . PRO B 1 575 ? -19.848 -38.529 -3.509  1.00 41.54 ? 575 PRO B CG    1 
ATOM   10029 C  CD    . PRO B 1 575 ? -20.282 -38.451 -2.096  1.00 42.58 ? 575 PRO B CD    1 
ATOM   10030 N  N     . THR B 1 576 ? -23.914 -40.358 -4.383  1.00 42.26 ? 576 THR B N     1 
ATOM   10031 C  CA    . THR B 1 576 ? -24.618 -41.638 -4.445  1.00 42.84 ? 576 THR B CA    1 
ATOM   10032 C  C     . THR B 1 576 ? -23.603 -42.769 -4.622  1.00 43.53 ? 576 THR B C     1 
ATOM   10033 O  O     . THR B 1 576 ? -22.398 -42.530 -4.780  1.00 42.73 ? 576 THR B O     1 
ATOM   10034 C  CB    . THR B 1 576 ? -25.651 -41.694 -5.605  1.00 42.28 ? 576 THR B CB    1 
ATOM   10035 O  OG1   . THR B 1 576 ? -24.975 -41.675 -6.871  1.00 41.00 ? 576 THR B OG1   1 
ATOM   10036 C  CG2   . THR B 1 576 ? -26.627 -40.543 -5.526  1.00 41.58 ? 576 THR B CG2   1 
ATOM   10037 N  N     . ASP B 1 577 ? -24.102 -43.998 -4.627  1.00 44.69 ? 577 ASP B N     1 
ATOM   10038 C  CA    . ASP B 1 577 ? -23.251 -45.169 -4.752  1.00 45.97 ? 577 ASP B CA    1 
ATOM   10039 C  C     . ASP B 1 577 ? -22.873 -45.497 -6.205  1.00 44.89 ? 577 ASP B C     1 
ATOM   10040 O  O     . ASP B 1 577 ? -22.226 -46.505 -6.459  1.00 45.92 ? 577 ASP B O     1 
ATOM   10041 C  CB    . ASP B 1 577 ? -23.934 -46.373 -4.083  1.00 47.92 ? 577 ASP B CB    1 
ATOM   10042 C  CG    . ASP B 1 577 ? -25.218 -46.792 -4.802  1.00 50.16 ? 577 ASP B CG    1 
ATOM   10043 O  OD1   . ASP B 1 577 ? -25.779 -47.857 -4.439  1.00 54.23 ? 577 ASP B OD1   1 
ATOM   10044 O  OD2   . ASP B 1 577 ? -25.660 -46.068 -5.734  1.00 49.80 ? 577 ASP B OD2   1 
ATOM   10045 N  N     . LEU B 1 578 ? -23.269 -44.657 -7.153  1.00 43.52 ? 578 LEU B N     1 
ATOM   10046 C  CA    . LEU B 1 578 ? -23.048 -44.948 -8.576  1.00 43.00 ? 578 LEU B CA    1 
ATOM   10047 C  C     . LEU B 1 578 ? -21.570 -45.165 -8.933  1.00 43.19 ? 578 LEU B C     1 
ATOM   10048 O  O     . LEU B 1 578 ? -21.236 -46.097 -9.662  1.00 43.77 ? 578 LEU B O     1 
ATOM   10049 C  CB    . LEU B 1 578 ? -23.678 -43.865 -9.463  1.00 41.88 ? 578 LEU B CB    1 
ATOM   10050 C  CG    . LEU B 1 578 ? -23.528 -43.957 -10.985 1.00 41.53 ? 578 LEU B CG    1 
ATOM   10051 C  CD1   . LEU B 1 578 ? -24.423 -45.059 -11.561 1.00 42.03 ? 578 LEU B CD1   1 
ATOM   10052 C  CD2   . LEU B 1 578 ? -23.832 -42.611 -11.632 1.00 39.67 ? 578 LEU B CD2   1 
ATOM   10053 N  N     . TRP B 1 579 ? -20.699 -44.311 -8.406  1.00 42.92 ? 579 TRP B N     1 
ATOM   10054 C  CA    . TRP B 1 579 ? -19.266 -44.370 -8.687  1.00 43.22 ? 579 TRP B CA    1 
ATOM   10055 C  C     . TRP B 1 579 ? -18.454 -44.543 -7.409  1.00 43.97 ? 579 TRP B C     1 
ATOM   10056 O  O     . TRP B 1 579 ? -18.852 -44.069 -6.346  1.00 43.76 ? 579 TRP B O     1 
ATOM   10057 C  CB    . TRP B 1 579 ? -18.809 -43.088 -9.392  1.00 42.25 ? 579 TRP B CB    1 
ATOM   10058 C  CG    . TRP B 1 579 ? -19.397 -42.911 -10.733 1.00 41.67 ? 579 TRP B CG    1 
ATOM   10059 C  CD1   . TRP B 1 579 ? -20.401 -42.065 -11.073 1.00 40.94 ? 579 TRP B CD1   1 
ATOM   10060 C  CD2   . TRP B 1 579 ? -19.027 -43.605 -11.936 1.00 42.33 ? 579 TRP B CD2   1 
ATOM   10061 N  NE1   . TRP B 1 579 ? -20.683 -42.176 -12.415 1.00 41.04 ? 579 TRP B NE1   1 
ATOM   10062 C  CE2   . TRP B 1 579 ? -19.861 -43.122 -12.967 1.00 40.72 ? 579 TRP B CE2   1 
ATOM   10063 C  CE3   . TRP B 1 579 ? -18.075 -44.587 -12.238 1.00 43.89 ? 579 TRP B CE3   1 
ATOM   10064 C  CZ2   . TRP B 1 579 ? -19.778 -43.585 -14.281 1.00 41.53 ? 579 TRP B CZ2   1 
ATOM   10065 C  CZ3   . TRP B 1 579 ? -17.989 -45.052 -13.551 1.00 43.68 ? 579 TRP B CZ3   1 
ATOM   10066 C  CH2   . TRP B 1 579 ? -18.837 -44.545 -14.556 1.00 42.99 ? 579 TRP B CH2   1 
ATOM   10067 N  N     . ASP B 1 580 ? -17.312 -45.214 -7.528  1.00 44.86 ? 580 ASP B N     1 
ATOM   10068 C  CA    . ASP B 1 580 ? -16.390 -45.374 -6.415  1.00 45.84 ? 580 ASP B CA    1 
ATOM   10069 C  C     . ASP B 1 580 ? -15.412 -44.205 -6.378  1.00 45.13 ? 580 ASP B C     1 
ATOM   10070 O  O     . ASP B 1 580 ? -14.423 -44.165 -7.118  1.00 44.95 ? 580 ASP B O     1 
ATOM   10071 C  CB    . ASP B 1 580 ? -15.640 -46.711 -6.506  1.00 47.59 ? 580 ASP B CB    1 
ATOM   10072 C  CG    . ASP B 1 580 ? -15.197 -47.232 -5.145  1.00 49.09 ? 580 ASP B CG    1 
ATOM   10073 O  OD1   . ASP B 1 580 ? -14.946 -46.427 -4.226  1.00 50.69 ? 580 ASP B OD1   1 
ATOM   10074 O  OD2   . ASP B 1 580 ? -15.102 -48.461 -4.991  1.00 52.04 ? 580 ASP B OD2   1 
ATOM   10075 N  N     . TRP B 1 581 ? -15.715 -43.255 -5.502  1.00 44.59 ? 581 TRP B N     1 
ATOM   10076 C  CA    . TRP B 1 581 ? -14.939 -42.039 -5.357  1.00 43.82 ? 581 TRP B CA    1 
ATOM   10077 C  C     . TRP B 1 581 ? -13.661 -42.260 -4.546  1.00 44.70 ? 581 TRP B C     1 
ATOM   10078 O  O     . TRP B 1 581 ? -12.668 -41.553 -4.762  1.00 44.52 ? 581 TRP B O     1 
ATOM   10079 C  CB    . TRP B 1 581 ? -15.795 -40.944 -4.723  1.00 43.33 ? 581 TRP B CB    1 
ATOM   10080 C  CG    . TRP B 1 581 ? -16.915 -40.513 -5.607  1.00 42.80 ? 581 TRP B CG    1 
ATOM   10081 C  CD1   . TRP B 1 581 ? -18.191 -40.984 -5.590  1.00 42.97 ? 581 TRP B CD1   1 
ATOM   10082 C  CD2   . TRP B 1 581 ? -16.853 -39.545 -6.667  1.00 41.55 ? 581 TRP B CD2   1 
ATOM   10083 N  NE1   . TRP B 1 581 ? -18.937 -40.360 -6.567  1.00 43.27 ? 581 TRP B NE1   1 
ATOM   10084 C  CE2   . TRP B 1 581 ? -18.139 -39.477 -7.244  1.00 40.91 ? 581 TRP B CE2   1 
ATOM   10085 C  CE3   . TRP B 1 581 ? -15.832 -38.735 -7.188  1.00 41.78 ? 581 TRP B CE3   1 
ATOM   10086 C  CZ2   . TRP B 1 581 ? -18.440 -38.630 -8.314  1.00 40.43 ? 581 TRP B CZ2   1 
ATOM   10087 C  CZ3   . TRP B 1 581 ? -16.130 -37.880 -8.251  1.00 40.70 ? 581 TRP B CZ3   1 
ATOM   10088 C  CH2   . TRP B 1 581 ? -17.425 -37.833 -8.800  1.00 40.26 ? 581 TRP B CH2   1 
ATOM   10089 N  N     . LYS B 1 582 ? -13.699 -43.229 -3.625  1.00 45.45 ? 582 LYS B N     1 
ATOM   10090 C  CA    . LYS B 1 582 ? -12.524 -43.638 -2.837  1.00 46.69 ? 582 LYS B CA    1 
ATOM   10091 C  C     . LYS B 1 582 ? -11.397 -44.149 -3.742  1.00 46.85 ? 582 LYS B C     1 
ATOM   10092 O  O     . LYS B 1 582 ? -10.229 -43.828 -3.533  1.00 47.40 ? 582 LYS B O     1 
ATOM   10093 C  CB    . LYS B 1 582 ? -12.905 -44.699 -1.791  1.00 47.91 ? 582 LYS B CB    1 
ATOM   10094 N  N     . VAL B 1 583 ? -11.764 -44.932 -4.751  1.00 46.44 ? 583 VAL B N     1 
ATOM   10095 C  CA    . VAL B 1 583 ? -10.817 -45.409 -5.752  1.00 46.74 ? 583 VAL B CA    1 
ATOM   10096 C  C     . VAL B 1 583 ? -10.280 -44.269 -6.642  1.00 45.53 ? 583 VAL B C     1 
ATOM   10097 O  O     . VAL B 1 583 ? -9.092  -44.233 -6.964  1.00 46.12 ? 583 VAL B O     1 
ATOM   10098 C  CB    . VAL B 1 583 ? -11.425 -46.564 -6.583  1.00 47.10 ? 583 VAL B CB    1 
ATOM   10099 C  CG1   . VAL B 1 583 ? -10.523 -46.938 -7.731  1.00 47.47 ? 583 VAL B CG1   1 
ATOM   10100 C  CG2   . VAL B 1 583 ? -11.653 -47.782 -5.687  1.00 48.25 ? 583 VAL B CG2   1 
ATOM   10101 N  N     . LEU B 1 584 ? -11.140 -43.326 -7.019  1.00 43.88 ? 584 LEU B N     1 
ATOM   10102 C  CA    . LEU B 1 584 ? -10.663 -42.160 -7.753  1.00 42.73 ? 584 LEU B CA    1 
ATOM   10103 C  C     . LEU B 1 584 ? -9.702  -41.300 -6.922  1.00 43.00 ? 584 LEU B C     1 
ATOM   10104 O  O     . LEU B 1 584 ? -8.632  -40.918 -7.405  1.00 42.93 ? 584 LEU B O     1 
ATOM   10105 C  CB    . LEU B 1 584 ? -11.817 -41.320 -8.277  1.00 41.20 ? 584 LEU B CB    1 
ATOM   10106 C  CG    . LEU B 1 584 ? -11.435 -40.065 -9.060  1.00 39.81 ? 584 LEU B CG    1 
ATOM   10107 C  CD1   . LEU B 1 584 ? -10.607 -40.387 -10.319 1.00 39.46 ? 584 LEU B CD1   1 
ATOM   10108 C  CD2   . LEU B 1 584 ? -12.699 -39.340 -9.414  1.00 38.96 ? 584 LEU B CD2   1 
ATOM   10109 N  N     . LYS B 1 585 ? -10.080 -41.000 -5.683  1.00 43.02 ? 585 LYS B N     1 
ATOM   10110 C  CA    . LYS B 1 585 ? -9.199  -40.247 -4.796  1.00 43.86 ? 585 LYS B CA    1 
ATOM   10111 C  C     . LYS B 1 585 ? -7.796  -40.860 -4.703  1.00 45.29 ? 585 LYS B C     1 
ATOM   10112 O  O     . LYS B 1 585 ? -6.798  -40.133 -4.734  1.00 45.53 ? 585 LYS B O     1 
ATOM   10113 C  CB    . LYS B 1 585 ? -9.826  -40.071 -3.417  1.00 43.92 ? 585 LYS B CB    1 
ATOM   10114 C  CG    . LYS B 1 585 ? -10.829 -38.928 -3.378  1.00 44.08 ? 585 LYS B CG    1 
ATOM   10115 C  CD    . LYS B 1 585 ? -11.299 -38.613 -1.962  1.00 45.32 ? 585 LYS B CD    1 
ATOM   10116 C  CE    . LYS B 1 585 ? -12.188 -37.376 -1.946  1.00 44.48 ? 585 LYS B CE    1 
ATOM   10117 N  NZ    . LYS B 1 585 ? -12.546 -36.984 -0.546  1.00 45.32 ? 585 LYS B NZ    1 
ATOM   10118 N  N     . GLU B 1 586 ? -7.728  -42.192 -4.633  1.00 46.27 ? 586 GLU B N     1 
ATOM   10119 C  CA    . GLU B 1 586 ? -6.453  -42.906 -4.546  1.00 47.72 ? 586 GLU B CA    1 
ATOM   10120 C  C     . GLU B 1 586 ? -5.607  -42.788 -5.818  1.00 47.62 ? 586 GLU B C     1 
ATOM   10121 O  O     . GLU B 1 586 ? -4.384  -42.771 -5.741  1.00 49.07 ? 586 GLU B O     1 
ATOM   10122 C  CB    . GLU B 1 586 ? -6.667  -44.368 -4.164  1.00 48.89 ? 586 GLU B CB    1 
ATOM   10123 N  N     . LYS B 1 587 ? -6.251  -42.699 -6.978  1.00 46.28 ? 587 LYS B N     1 
ATOM   10124 C  CA    . LYS B 1 587 ? -5.532  -42.422 -8.222  1.00 46.08 ? 587 LYS B CA    1 
ATOM   10125 C  C     . LYS B 1 587 ? -5.023  -40.980 -8.255  1.00 45.27 ? 587 LYS B C     1 
ATOM   10126 O  O     . LYS B 1 587 ? -3.909  -40.728 -8.714  1.00 45.87 ? 587 LYS B O     1 
ATOM   10127 C  CB    . LYS B 1 587 ? -6.404  -42.718 -9.444  1.00 45.28 ? 587 LYS B CB    1 
ATOM   10128 N  N     . ILE B 1 588 ? -5.836  -40.042 -7.765  1.00 43.94 ? 588 ILE B N     1 
ATOM   10129 C  CA    . ILE B 1 588 ? -5.443  -38.625 -7.719  1.00 43.16 ? 588 ILE B CA    1 
ATOM   10130 C  C     . ILE B 1 588 ? -4.302  -38.377 -6.737  1.00 44.78 ? 588 ILE B C     1 
ATOM   10131 O  O     . ILE B 1 588 ? -3.399  -37.587 -7.024  1.00 45.58 ? 588 ILE B O     1 
ATOM   10132 C  CB    . ILE B 1 588 ? -6.627  -37.670 -7.417  1.00 41.21 ? 588 ILE B CB    1 
ATOM   10133 C  CG1   . ILE B 1 588 ? -7.588  -37.622 -8.614  1.00 39.69 ? 588 ILE B CG1   1 
ATOM   10134 C  CG2   . ILE B 1 588 ? -6.107  -36.279 -7.091  1.00 38.97 ? 588 ILE B CG2   1 
ATOM   10135 C  CD1   . ILE B 1 588 ? -8.989  -37.154 -8.270  1.00 37.87 ? 588 ILE B CD1   1 
ATOM   10136 N  N     . ALA B 1 589 ? -4.341  -39.047 -5.589  1.00 45.82 ? 589 ALA B N     1 
ATOM   10137 C  CA    . ALA B 1 589 ? -3.232  -38.978 -4.637  1.00 47.54 ? 589 ALA B CA    1 
ATOM   10138 C  C     . ALA B 1 589 ? -1.920  -39.449 -5.273  1.00 49.09 ? 589 ALA B C     1 
ATOM   10139 O  O     . ALA B 1 589 ? -0.854  -38.947 -4.934  1.00 50.12 ? 589 ALA B O     1 
ATOM   10140 C  CB    . ALA B 1 589 ? -3.547  -39.780 -3.382  1.00 48.16 ? 589 ALA B CB    1 
ATOM   10141 N  N     . LYS B 1 590 ? -2.008  -40.397 -6.207  1.00 49.72 ? 590 LYS B N     1 
ATOM   10142 C  CA    . LYS B 1 590 ? -0.816  -40.933 -6.885  1.00 51.67 ? 590 LYS B CA    1 
ATOM   10143 C  C     . LYS B 1 590 ? -0.209  -39.941 -7.878  1.00 51.50 ? 590 LYS B C     1 
ATOM   10144 O  O     . LYS B 1 590 ? 0.970   -39.601 -7.785  1.00 52.79 ? 590 LYS B O     1 
ATOM   10145 C  CB    . LYS B 1 590 ? -1.130  -42.249 -7.609  1.00 52.02 ? 590 LYS B CB    1 
ATOM   10146 C  CG    . LYS B 1 590 ? -1.449  -43.433 -6.712  1.00 53.39 ? 590 LYS B CG    1 
ATOM   10147 C  CD    . LYS B 1 590 ? -1.637  -44.709 -7.537  1.00 54.27 ? 590 LYS B CD    1 
ATOM   10148 C  CE    . LYS B 1 590 ? -2.236  -45.825 -6.701  1.00 56.03 ? 590 LYS B CE    1 
ATOM   10149 N  NZ    . LYS B 1 590 ? -1.619  -47.147 -7.020  1.00 59.76 ? 590 LYS B NZ    1 
ATOM   10150 N  N     . TYR B 1 591 ? -1.031  -39.457 -8.808  1.00 50.34 ? 591 TYR B N     1 
ATOM   10151 C  CA    . TYR B 1 591 ? -0.539  -38.726 -9.975  1.00 50.17 ? 591 TYR B CA    1 
ATOM   10152 C  C     . TYR B 1 591 ? -0.883  -37.234 -9.996  1.00 48.31 ? 591 TYR B C     1 
ATOM   10153 O  O     . TYR B 1 591 ? -0.246  -36.469 -10.718 1.00 48.39 ? 591 TYR B O     1 
ATOM   10154 C  CB    . TYR B 1 591 ? -1.041  -39.401 -11.259 1.00 50.47 ? 591 TYR B CB    1 
ATOM   10155 C  CG    . TYR B 1 591 ? -0.734  -40.890 -11.334 1.00 53.17 ? 591 TYR B CG    1 
ATOM   10156 C  CD1   . TYR B 1 591 ? -1.754  -41.841 -11.221 1.00 53.17 ? 591 TYR B CD1   1 
ATOM   10157 C  CD2   . TYR B 1 591 ? 0.577   -41.346 -11.511 1.00 55.55 ? 591 TYR B CD2   1 
ATOM   10158 C  CE1   . TYR B 1 591 ? -1.479  -43.202 -11.289 1.00 54.91 ? 591 TYR B CE1   1 
ATOM   10159 C  CE2   . TYR B 1 591 ? 0.864   -42.702 -11.574 1.00 57.33 ? 591 TYR B CE2   1 
ATOM   10160 C  CZ    . TYR B 1 591 ? -0.168  -43.629 -11.465 1.00 57.17 ? 591 TYR B CZ    1 
ATOM   10161 O  OH    . TYR B 1 591 ? 0.117   -44.986 -11.527 1.00 58.49 ? 591 TYR B OH    1 
ATOM   10162 N  N     . GLY B 1 592 ? -1.874  -36.822 -9.208  1.00 46.58 ? 592 GLY B N     1 
ATOM   10163 C  CA    . GLY B 1 592 ? -2.386  -35.451 -9.270  1.00 44.71 ? 592 GLY B CA    1 
ATOM   10164 C  C     . GLY B 1 592 ? -3.343  -35.289 -10.438 1.00 43.12 ? 592 GLY B C     1 
ATOM   10165 O  O     . GLY B 1 592 ? -3.761  -36.283 -11.031 1.00 43.03 ? 592 GLY B O     1 
ATOM   10166 N  N     . ILE B 1 593 ? -3.709  -34.046 -10.752 1.00 41.72 ? 593 ILE B N     1 
ATOM   10167 C  CA    . ILE B 1 593 ? -4.523  -33.746 -11.945 1.00 40.60 ? 593 ILE B CA    1 
ATOM   10168 C  C     . ILE B 1 593 ? -3.887  -32.699 -12.848 1.00 40.44 ? 593 ILE B C     1 
ATOM   10169 O  O     . ILE B 1 593 ? -3.101  -31.860 -12.400 1.00 40.76 ? 593 ILE B O     1 
ATOM   10170 C  CB    . ILE B 1 593 ? -6.009  -33.360 -11.634 1.00 39.14 ? 593 ILE B CB    1 
ATOM   10171 C  CG1   . ILE B 1 593 ? -6.091  -32.174 -10.663 1.00 38.50 ? 593 ILE B CG1   1 
ATOM   10172 C  CG2   . ILE B 1 593 ? -6.796  -34.588 -11.138 1.00 39.23 ? 593 ILE B CG2   1 
ATOM   10173 C  CD1   . ILE B 1 593 ? -7.519  -31.728 -10.351 1.00 37.50 ? 593 ILE B CD1   1 
ATOM   10174 N  N     . ARG B 1 594 ? -4.239  -32.771 -14.126 1.00 40.08 ? 594 ARG B N     1 
ATOM   10175 C  CA    . ARG B 1 594 ? -3.681  -31.902 -15.150 1.00 40.27 ? 594 ARG B CA    1 
ATOM   10176 C  C     . ARG B 1 594 ? -4.338  -30.525 -15.133 1.00 38.92 ? 594 ARG B C     1 
ATOM   10177 O  O     . ARG B 1 594 ? -3.767  -29.542 -15.617 1.00 39.53 ? 594 ARG B O     1 
ATOM   10178 C  CB    . ARG B 1 594 ? -3.862  -32.554 -16.529 1.00 40.68 ? 594 ARG B CB    1 
ATOM   10179 C  CG    . ARG B 1 594 ? -3.053  -31.926 -17.655 1.00 41.92 ? 594 ARG B CG    1 
ATOM   10180 C  CD    . ARG B 1 594 ? -1.582  -31.875 -17.279 1.00 45.46 ? 594 ARG B CD    1 
ATOM   10181 N  NE    . ARG B 1 594 ? -0.776  -31.252 -18.317 1.00 47.42 ? 594 ARG B NE    1 
ATOM   10182 C  CZ    . ARG B 1 594 ? 0.341   -30.580 -18.088 1.00 49.15 ? 594 ARG B CZ    1 
ATOM   10183 N  NH1   . ARG B 1 594 ? 0.795   -30.435 -16.848 1.00 50.63 ? 594 ARG B NH1   1 
ATOM   10184 N  NH2   . ARG B 1 594 ? 1.001   -30.043 -19.102 1.00 50.98 ? 594 ARG B NH2   1 
ATOM   10185 N  N     . ASN B 1 595 ? -5.537  -30.457 -14.570 1.00 37.44 ? 595 ASN B N     1 
ATOM   10186 C  CA    . ASN B 1 595 ? -6.373  -29.268 -14.704 1.00 36.40 ? 595 ASN B CA    1 
ATOM   10187 C  C     . ASN B 1 595 ? -6.952  -28.845 -13.387 1.00 35.58 ? 595 ASN B C     1 
ATOM   10188 O  O     . ASN B 1 595 ? -7.545  -29.663 -12.681 1.00 34.87 ? 595 ASN B O     1 
ATOM   10189 C  CB    . ASN B 1 595 ? -7.480  -29.531 -15.721 1.00 35.27 ? 595 ASN B CB    1 
ATOM   10190 C  CG    . ASN B 1 595 ? -6.931  -30.025 -17.040 1.00 36.55 ? 595 ASN B CG    1 
ATOM   10191 O  OD1   . ASN B 1 595 ? -6.947  -31.225 -17.328 1.00 37.46 ? 595 ASN B OD1   1 
ATOM   10192 N  ND2   . ASN B 1 595 ? -6.405  -29.106 -17.838 1.00 36.35 ? 595 ASN B ND2   1 
ATOM   10193 N  N     . SER B 1 596 ? -6.771  -27.563 -13.067 1.00 35.64 ? 596 SER B N     1 
ATOM   10194 C  CA    . SER B 1 596 ? -7.207  -26.991 -11.787 1.00 35.30 ? 596 SER B CA    1 
ATOM   10195 C  C     . SER B 1 596 ? -8.720  -26.985 -11.608 1.00 34.93 ? 596 SER B C     1 
ATOM   10196 O  O     . SER B 1 596 ? -9.200  -27.072 -10.473 1.00 35.48 ? 596 SER B O     1 
ATOM   10197 C  CB    . SER B 1 596 ? -6.661  -25.574 -11.614 1.00 35.05 ? 596 SER B CB    1 
ATOM   10198 O  OG    . SER B 1 596 ? -7.053  -24.731 -12.677 1.00 34.31 ? 596 SER B OG    1 
ATOM   10199 N  N     . LEU B 1 597 ? -9.448  -26.871 -12.727 1.00 34.36 ? 597 LEU B N     1 
ATOM   10200 C  CA    . LEU B 1 597 ? -10.914 -26.826 -12.764 1.00 33.73 ? 597 LEU B CA    1 
ATOM   10201 C  C     . LEU B 1 597 ? -11.398 -27.520 -14.047 1.00 34.34 ? 597 LEU B C     1 
ATOM   10202 O  O     . LEU B 1 597 ? -10.677 -27.568 -15.060 1.00 34.77 ? 597 LEU B O     1 
ATOM   10203 C  CB    . LEU B 1 597 ? -11.422 -25.381 -12.729 1.00 32.78 ? 597 LEU B CB    1 
ATOM   10204 C  CG    . LEU B 1 597 ? -11.095 -24.451 -11.551 1.00 31.99 ? 597 LEU B CG    1 
ATOM   10205 C  CD1   . LEU B 1 597 ? -11.428 -23.020 -11.931 1.00 31.46 ? 597 LEU B CD1   1 
ATOM   10206 C  CD2   . LEU B 1 597 ? -11.822 -24.820 -10.277 1.00 29.60 ? 597 LEU B CD2   1 
ATOM   10207 N  N     . LEU B 1 598 ? -12.616 -28.048 -14.004 1.00 34.18 ? 598 LEU B N     1 
ATOM   10208 C  CA    . LEU B 1 598 ? -13.075 -28.986 -15.022 1.00 34.72 ? 598 LEU B CA    1 
ATOM   10209 C  C     . LEU B 1 598 ? -14.465 -28.700 -15.581 1.00 34.43 ? 598 LEU B C     1 
ATOM   10210 O  O     . LEU B 1 598 ? -14.657 -28.739 -16.795 1.00 34.68 ? 598 LEU B O     1 
ATOM   10211 C  CB    . LEU B 1 598 ? -13.021 -30.429 -14.486 1.00 35.37 ? 598 LEU B CB    1 
ATOM   10212 C  CG    . LEU B 1 598 ? -11.649 -31.095 -14.294 1.00 36.94 ? 598 LEU B CG    1 
ATOM   10213 C  CD1   . LEU B 1 598 ? -11.799 -32.359 -13.483 1.00 38.58 ? 598 LEU B CD1   1 
ATOM   10214 C  CD2   . LEU B 1 598 ? -10.970 -31.403 -15.631 1.00 37.12 ? 598 LEU B CD2   1 
ATOM   10215 N  N     . ILE B 1 599 ? -15.429 -28.430 -14.696 1.00 34.09 ? 599 ILE B N     1 
ATOM   10216 C  CA    . ILE B 1 599 ? -16.846 -28.400 -15.070 1.00 33.49 ? 599 ILE B CA    1 
ATOM   10217 C  C     . ILE B 1 599 ? -17.476 -27.015 -14.868 1.00 33.48 ? 599 ILE B C     1 
ATOM   10218 O  O     . ILE B 1 599 ? -17.352 -26.409 -13.801 1.00 33.13 ? 599 ILE B O     1 
ATOM   10219 C  CB    . ILE B 1 599 ? -17.652 -29.464 -14.271 1.00 33.69 ? 599 ILE B CB    1 
ATOM   10220 C  CG1   . ILE B 1 599 ? -16.859 -30.776 -14.124 1.00 34.30 ? 599 ILE B CG1   1 
ATOM   10221 C  CG2   . ILE B 1 599 ? -19.080 -29.671 -14.857 1.00 31.99 ? 599 ILE B CG2   1 
ATOM   10222 C  CD1   . ILE B 1 599 ? -16.729 -31.605 -15.405 1.00 34.10 ? 599 ILE B CD1   1 
ATOM   10223 N  N     . ALA B 1 600 ? -18.175 -26.541 -15.896 1.00 33.79 ? 600 ALA B N     1 
ATOM   10224 C  CA    . ALA B 1 600 ? -18.761 -25.203 -15.907 1.00 33.69 ? 600 ALA B CA    1 
ATOM   10225 C  C     . ALA B 1 600 ? -19.883 -25.095 -16.955 1.00 33.99 ? 600 ALA B C     1 
ATOM   10226 O  O     . ALA B 1 600 ? -19.638 -24.662 -18.084 1.00 34.09 ? 600 ALA B O     1 
ATOM   10227 C  CB    . ALA B 1 600 ? -17.674 -24.174 -16.182 1.00 33.66 ? 600 ALA B CB    1 
ATOM   10228 N  N     . PRO B 1 601 ? -21.111 -25.523 -16.598 1.00 34.18 ? 601 PRO B N     1 
ATOM   10229 C  CA    . PRO B 1 601 ? -22.270 -25.427 -17.500 1.00 34.80 ? 601 PRO B CA    1 
ATOM   10230 C  C     . PRO B 1 601 ? -22.604 -24.017 -18.036 1.00 35.52 ? 601 PRO B C     1 
ATOM   10231 O  O     . PRO B 1 601 ? -23.236 -23.223 -17.346 1.00 35.47 ? 601 PRO B O     1 
ATOM   10232 C  CB    . PRO B 1 601 ? -23.408 -26.019 -16.663 1.00 34.82 ? 601 PRO B CB    1 
ATOM   10233 C  CG    . PRO B 1 601 ? -22.704 -26.968 -15.725 1.00 33.88 ? 601 PRO B CG    1 
ATOM   10234 C  CD    . PRO B 1 601 ? -21.461 -26.225 -15.349 1.00 33.93 ? 601 PRO B CD    1 
ATOM   10235 N  N     . MET B 1 602 ? -22.174 -23.745 -19.273 1.00 36.30 ? 602 MET B N     1 
ATOM   10236 C  CA    . MET B 1 602 ? -22.340 -22.448 -19.934 1.00 37.62 ? 602 MET B CA    1 
ATOM   10237 C  C     . MET B 1 602 ? -23.686 -22.359 -20.665 1.00 39.02 ? 602 MET B C     1 
ATOM   10238 O  O     . MET B 1 602 ? -24.378 -23.378 -20.807 1.00 39.46 ? 602 MET B O     1 
ATOM   10239 C  CB    . MET B 1 602 ? -21.184 -22.182 -20.928 1.00 38.16 ? 602 MET B CB    1 
ATOM   10240 C  CG    . MET B 1 602 ? -21.077 -23.180 -22.104 1.00 38.03 ? 602 MET B CG    1 
ATOM   10241 S  SD    . MET B 1 602 ? -20.333 -24.758 -21.601 1.00 39.36 ? 602 MET B SD    1 
ATOM   10242 C  CE    . MET B 1 602 ? -21.493 -25.848 -22.348 1.00 40.00 ? 602 MET B CE    1 
ATOM   10243 N  N     . PRO B 1 603 ? -24.079 -21.143 -21.104 1.00 39.85 ? 603 PRO B N     1 
ATOM   10244 C  CA    . PRO B 1 603 ? -25.172 -21.073 -22.062 1.00 41.63 ? 603 PRO B CA    1 
ATOM   10245 C  C     . PRO B 1 603 ? -24.707 -21.656 -23.380 1.00 42.91 ? 603 PRO B C     1 
ATOM   10246 O  O     . PRO B 1 603 ? -23.560 -21.422 -23.812 1.00 43.88 ? 603 PRO B O     1 
ATOM   10247 C  CB    . PRO B 1 603 ? -25.429 -19.567 -22.218 1.00 41.85 ? 603 PRO B CB    1 
ATOM   10248 C  CG    . PRO B 1 603 ? -24.807 -18.950 -21.021 1.00 41.39 ? 603 PRO B CG    1 
ATOM   10249 C  CD    . PRO B 1 603 ? -23.602 -19.802 -20.744 1.00 39.85 ? 603 PRO B CD    1 
ATOM   10250 N  N     . THR B 1 604 ? -25.582 -22.425 -24.005 1.00 43.56 ? 604 THR B N     1 
ATOM   10251 C  CA    . THR B 1 604 ? -25.239 -23.101 -25.237 1.00 44.22 ? 604 THR B CA    1 
ATOM   10252 C  C     . THR B 1 604 ? -26.144 -22.549 -26.328 1.00 45.74 ? 604 THR B C     1 
ATOM   10253 O  O     . THR B 1 604 ? -26.707 -23.299 -27.130 1.00 46.42 ? 604 THR B O     1 
ATOM   10254 C  CB    . THR B 1 604 ? -25.409 -24.637 -25.086 1.00 44.13 ? 604 THR B CB    1 
ATOM   10255 O  OG1   . THR B 1 604 ? -26.726 -24.939 -24.598 1.00 43.46 ? 604 THR B OG1   1 
ATOM   10256 C  CG2   . THR B 1 604 ? -24.372 -25.206 -24.101 1.00 42.53 ? 604 THR B CG2   1 
ATOM   10257 N  N     . ALA B 1 605 ? -26.298 -21.227 -26.350 1.00 46.08 ? 605 ALA B N     1 
ATOM   10258 C  CA    . ALA B 1 605 ? -27.240 -20.602 -27.281 1.00 47.45 ? 605 ALA B CA    1 
ATOM   10259 C  C     . ALA B 1 605 ? -27.073 -21.114 -28.720 1.00 48.25 ? 605 ALA B C     1 
ATOM   10260 O  O     . ALA B 1 605 ? -27.996 -21.716 -29.289 1.00 49.19 ? 605 ALA B O     1 
ATOM   10261 C  CB    . ALA B 1 605 ? -27.146 -19.076 -27.221 1.00 47.93 ? 605 ALA B CB    1 
ATOM   10262 N  N     . SER B 1 606 ? -25.894 -20.911 -29.297 1.00 47.73 ? 606 SER B N     1 
ATOM   10263 C  CA    . SER B 1 606 ? -25.709 -21.245 -30.703 1.00 48.47 ? 606 SER B CA    1 
ATOM   10264 C  C     . SER B 1 606 ? -25.550 -22.745 -30.969 1.00 47.74 ? 606 SER B C     1 
ATOM   10265 O  O     . SER B 1 606 ? -26.158 -23.274 -31.909 1.00 49.33 ? 606 SER B O     1 
ATOM   10266 C  CB    . SER B 1 606 ? -24.545 -20.462 -31.295 1.00 48.96 ? 606 SER B CB    1 
ATOM   10267 O  OG    . SER B 1 606 ? -24.544 -20.584 -32.699 1.00 51.61 ? 606 SER B OG    1 
ATOM   10268 N  N     . THR B 1 607 ? -24.763 -23.430 -30.139 1.00 45.50 ? 607 THR B N     1 
ATOM   10269 C  CA    . THR B 1 607 ? -24.432 -24.839 -30.382 1.00 44.44 ? 607 THR B CA    1 
ATOM   10270 C  C     . THR B 1 607 ? -25.554 -25.813 -30.041 1.00 44.05 ? 607 THR B C     1 
ATOM   10271 O  O     . THR B 1 607 ? -25.599 -26.909 -30.592 1.00 44.27 ? 607 THR B O     1 
ATOM   10272 C  CB    . THR B 1 607 ? -23.101 -25.290 -29.694 1.00 43.51 ? 607 THR B CB    1 
ATOM   10273 O  OG1   . THR B 1 607 ? -23.116 -24.930 -28.312 1.00 40.74 ? 607 THR B OG1   1 
ATOM   10274 C  CG2   . THR B 1 607 ? -21.883 -24.657 -30.379 1.00 43.14 ? 607 THR B CG2   1 
ATOM   10275 N  N     . ALA B 1 608 ? -26.458 -25.422 -29.145 1.00 43.37 ? 608 ALA B N     1 
ATOM   10276 C  CA    . ALA B 1 608 ? -27.592 -26.284 -28.798 1.00 43.04 ? 608 ALA B CA    1 
ATOM   10277 C  C     . ALA B 1 608 ? -28.596 -26.261 -29.928 1.00 44.33 ? 608 ALA B C     1 
ATOM   10278 O  O     . ALA B 1 608 ? -29.213 -27.277 -30.225 1.00 44.98 ? 608 ALA B O     1 
ATOM   10279 C  CB    . ALA B 1 608 ? -28.241 -25.870 -27.477 1.00 42.14 ? 608 ALA B CB    1 
ATOM   10280 N  N     . GLN B 1 609 ? -28.737 -25.099 -30.567 1.00 45.17 ? 609 GLN B N     1 
ATOM   10281 C  CA    . GLN B 1 609 ? -29.564 -24.953 -31.765 1.00 46.69 ? 609 GLN B CA    1 
ATOM   10282 C  C     . GLN B 1 609 ? -29.063 -25.838 -32.901 1.00 47.33 ? 609 GLN B C     1 
ATOM   10283 O  O     . GLN B 1 609 ? -29.867 -26.419 -33.630 1.00 48.73 ? 609 GLN B O     1 
ATOM   10284 C  CB    . GLN B 1 609 ? -29.624 -23.489 -32.217 1.00 47.29 ? 609 GLN B CB    1 
ATOM   10285 N  N     . ILE B 1 610 ? -27.740 -25.937 -33.049 1.00 46.65 ? 610 ILE B N     1 
ATOM   10286 C  CA    . ILE B 1 610 ? -27.145 -26.787 -34.091 1.00 47.10 ? 610 ILE B CA    1 
ATOM   10287 C  C     . ILE B 1 610 ? -27.461 -28.272 -33.871 1.00 46.40 ? 610 ILE B C     1 
ATOM   10288 O  O     . ILE B 1 610 ? -27.813 -28.974 -34.818 1.00 47.35 ? 610 ILE B O     1 
ATOM   10289 C  CB    . ILE B 1 610 ? -25.621 -26.566 -34.220 1.00 46.79 ? 610 ILE B CB    1 
ATOM   10290 C  CG1   . ILE B 1 610 ? -25.338 -25.217 -34.872 1.00 47.73 ? 610 ILE B CG1   1 
ATOM   10291 C  CG2   . ILE B 1 610 ? -24.967 -27.683 -35.031 1.00 47.08 ? 610 ILE B CG2   1 
ATOM   10292 C  CD1   . ILE B 1 610 ? -23.923 -24.710 -34.627 1.00 48.47 ? 610 ILE B CD1   1 
ATOM   10293 N  N     . LEU B 1 611 ? -27.339 -28.734 -32.626 1.00 44.60 ? 611 LEU B N     1 
ATOM   10294 C  CA    . LEU B 1 611 ? -27.625 -30.132 -32.284 1.00 43.99 ? 611 LEU B CA    1 
ATOM   10295 C  C     . LEU B 1 611 ? -29.112 -30.423 -32.118 1.00 44.35 ? 611 LEU B C     1 
ATOM   10296 O  O     . LEU B 1 611 ? -29.516 -31.585 -32.126 1.00 44.59 ? 611 LEU B O     1 
ATOM   10297 C  CB    . LEU B 1 611 ? -26.859 -30.579 -31.028 1.00 42.20 ? 611 LEU B CB    1 
ATOM   10298 C  CG    . LEU B 1 611 ? -25.338 -30.689 -31.144 1.00 41.54 ? 611 LEU B CG    1 
ATOM   10299 C  CD1   . LEU B 1 611 ? -24.734 -31.470 -29.977 1.00 39.86 ? 611 LEU B CD1   1 
ATOM   10300 C  CD2   . LEU B 1 611 ? -24.945 -31.315 -32.455 1.00 42.00 ? 611 LEU B CD2   1 
ATOM   10301 N  N     . GLY B 1 612 ? -29.912 -29.370 -31.954 1.00 44.57 ? 612 GLY B N     1 
ATOM   10302 C  CA    . GLY B 1 612 ? -31.358 -29.506 -31.813 1.00 45.09 ? 612 GLY B CA    1 
ATOM   10303 C  C     . GLY B 1 612 ? -31.775 -29.874 -30.406 1.00 44.30 ? 612 GLY B C     1 
ATOM   10304 O  O     . GLY B 1 612 ? -32.776 -30.562 -30.205 1.00 44.96 ? 612 GLY B O     1 
ATOM   10305 N  N     . ASN B 1 613 ? -31.000 -29.417 -29.431 1.00 42.84 ? 613 ASN B N     1 
ATOM   10306 C  CA    . ASN B 1 613 ? -31.277 -29.686 -28.032 1.00 42.17 ? 613 ASN B CA    1 
ATOM   10307 C  C     . ASN B 1 613 ? -31.707 -28.414 -27.354 1.00 41.87 ? 613 ASN B C     1 
ATOM   10308 O  O     . ASN B 1 613 ? -31.329 -27.317 -27.785 1.00 41.44 ? 613 ASN B O     1 
ATOM   10309 C  CB    . ASN B 1 613 ? -30.030 -30.227 -27.321 1.00 41.07 ? 613 ASN B CB    1 
ATOM   10310 C  CG    . ASN B 1 613 ? -29.597 -31.563 -27.861 1.00 43.03 ? 613 ASN B CG    1 
ATOM   10311 O  OD1   . ASN B 1 613 ? -30.441 -32.417 -28.165 1.00 44.89 ? 613 ASN B OD1   1 
ATOM   10312 N  ND2   . ASN B 1 613 ? -28.282 -31.754 -28.018 1.00 42.68 ? 613 ASN B ND2   1 
ATOM   10313 N  N     . ASN B 1 614 ? -32.484 -28.565 -26.284 1.00 41.58 ? 614 ASN B N     1 
ATOM   10314 C  CA    . ASN B 1 614 ? -32.769 -27.442 -25.429 1.00 41.65 ? 614 ASN B CA    1 
ATOM   10315 C  C     . ASN B 1 614 ? -31.491 -26.969 -24.756 1.00 41.25 ? 614 ASN B C     1 
ATOM   10316 O  O     . ASN B 1 614 ? -30.579 -27.754 -24.489 1.00 40.60 ? 614 ASN B O     1 
ATOM   10317 C  CB    . ASN B 1 614 ? -33.843 -27.757 -24.396 1.00 41.20 ? 614 ASN B CB    1 
ATOM   10318 C  CG    . ASN B 1 614 ? -34.566 -26.510 -23.930 1.00 40.36 ? 614 ASN B CG    1 
ATOM   10319 O  OD1   . ASN B 1 614 ? -35.168 -25.797 -24.726 1.00 38.60 ? 614 ASN B OD1   1 
ATOM   10320 N  ND2   . ASN B 1 614 ? -34.495 -26.229 -22.638 1.00 39.68 ? 614 ASN B ND2   1 
ATOM   10321 N  N     . GLU B 1 615 ? -31.434 -25.673 -24.500 1.00 42.31 ? 615 GLU B N     1 
ATOM   10322 C  CA    . GLU B 1 615 ? -30.247 -25.044 -23.977 1.00 42.65 ? 615 GLU B CA    1 
ATOM   10323 C  C     . GLU B 1 615 ? -29.918 -25.545 -22.586 1.00 41.77 ? 615 GLU B C     1 
ATOM   10324 O  O     . GLU B 1 615 ? -30.791 -25.623 -21.713 1.00 41.51 ? 615 GLU B O     1 
ATOM   10325 C  CB    . GLU B 1 615 ? -30.423 -23.526 -23.952 1.00 43.46 ? 615 GLU B CB    1 
ATOM   10326 C  CG    . GLU B 1 615 ? -29.335 -22.793 -24.705 1.00 46.98 ? 615 GLU B CG    1 
ATOM   10327 C  CD    . GLU B 1 615 ? -28.859 -21.536 -23.986 1.00 51.19 ? 615 GLU B CD    1 
ATOM   10328 O  OE1   . GLU B 1 615 ? -28.122 -21.673 -22.976 1.00 50.63 ? 615 GLU B OE1   1 
ATOM   10329 O  OE2   . GLU B 1 615 ? -29.205 -20.416 -24.453 1.00 53.14 ? 615 GLU B OE2   1 
ATOM   10330 N  N     . SER B 1 616 ? -28.654 -25.926 -22.410 1.00 41.54 ? 616 SER B N     1 
ATOM   10331 C  CA    . SER B 1 616 ? -28.038 -26.042 -21.092 1.00 41.04 ? 616 SER B CA    1 
ATOM   10332 C  C     . SER B 1 616 ? -28.804 -26.946 -20.120 1.00 41.05 ? 616 SER B C     1 
ATOM   10333 O  O     . SER B 1 616 ? -29.200 -28.049 -20.472 1.00 41.71 ? 616 SER B O     1 
ATOM   10334 C  CB    . SER B 1 616 ? -27.864 -24.635 -20.507 1.00 40.58 ? 616 SER B CB    1 
ATOM   10335 O  OG    . SER B 1 616 ? -27.017 -24.662 -19.384 1.00 41.89 ? 616 SER B OG    1 
ATOM   10336 N  N     . ILE B 1 617 ? -29.005 -26.453 -18.902 1.00 40.95 ? 617 ILE B N     1 
ATOM   10337 C  CA    . ILE B 1 617 ? -29.644 -27.188 -17.812 1.00 40.97 ? 617 ILE B CA    1 
ATOM   10338 C  C     . ILE B 1 617 ? -31.112 -26.759 -17.652 1.00 41.89 ? 617 ILE B C     1 
ATOM   10339 O  O     . ILE B 1 617 ? -31.743 -27.000 -16.630 1.00 42.55 ? 617 ILE B O     1 
ATOM   10340 C  CB    . ILE B 1 617 ? -28.846 -27.014 -16.478 1.00 40.34 ? 617 ILE B CB    1 
ATOM   10341 C  CG1   . ILE B 1 617 ? -28.427 -25.557 -16.225 1.00 39.74 ? 617 ILE B CG1   1 
ATOM   10342 C  CG2   . ILE B 1 617 ? -27.552 -27.796 -16.539 1.00 39.57 ? 617 ILE B CG2   1 
ATOM   10343 C  CD1   . ILE B 1 617 ? -29.552 -24.585 -16.019 1.00 40.74 ? 617 ILE B CD1   1 
ATOM   10344 N  N     . GLU B 1 618 ? -31.648 -26.162 -18.707 1.00 42.37 ? 618 GLU B N     1 
ATOM   10345 C  CA    . GLU B 1 618 ? -32.872 -25.389 -18.665 1.00 43.17 ? 618 GLU B CA    1 
ATOM   10346 C  C     . GLU B 1 618 ? -34.092 -26.232 -19.060 1.00 43.84 ? 618 GLU B C     1 
ATOM   10347 O  O     . GLU B 1 618 ? -34.014 -27.023 -19.998 1.00 43.68 ? 618 GLU B O     1 
ATOM   10348 C  CB    . GLU B 1 618 ? -32.705 -24.229 -19.649 1.00 43.68 ? 618 GLU B CB    1 
ATOM   10349 C  CG    . GLU B 1 618 ? -33.421 -22.945 -19.317 1.00 46.43 ? 618 GLU B CG    1 
ATOM   10350 C  CD    . GLU B 1 618 ? -32.812 -21.750 -20.055 1.00 48.49 ? 618 GLU B CD    1 
ATOM   10351 O  OE1   . GLU B 1 618 ? -33.412 -21.295 -21.059 1.00 49.72 ? 618 GLU B OE1   1 
ATOM   10352 O  OE2   . GLU B 1 618 ? -31.727 -21.274 -19.632 1.00 48.46 ? 618 GLU B OE2   1 
ATOM   10353 N  N     . PRO B 1 619 ? -35.227 -26.062 -18.345 1.00 44.36 ? 619 PRO B N     1 
ATOM   10354 C  CA    . PRO B 1 619 ? -36.500 -26.612 -18.825 1.00 45.68 ? 619 PRO B CA    1 
ATOM   10355 C  C     . PRO B 1 619 ? -36.878 -25.947 -20.140 1.00 46.57 ? 619 PRO B C     1 
ATOM   10356 O  O     . PRO B 1 619 ? -36.451 -24.821 -20.401 1.00 46.58 ? 619 PRO B O     1 
ATOM   10357 C  CB    . PRO B 1 619 ? -37.508 -26.183 -17.748 1.00 46.08 ? 619 PRO B CB    1 
ATOM   10358 C  CG    . PRO B 1 619 ? -36.686 -25.857 -16.542 1.00 45.08 ? 619 PRO B CG    1 
ATOM   10359 C  CD    . PRO B 1 619 ? -35.382 -25.353 -17.060 1.00 44.10 ? 619 PRO B CD    1 
ATOM   10360 N  N     . TYR B 1 620 ? -37.651 -26.636 -20.971 1.00 47.81 ? 620 TYR B N     1 
ATOM   10361 C  CA    . TYR B 1 620 ? -38.283 -25.976 -22.111 1.00 48.99 ? 620 TYR B CA    1 
ATOM   10362 C  C     . TYR B 1 620 ? -39.069 -24.783 -21.584 1.00 49.79 ? 620 TYR B C     1 
ATOM   10363 O  O     . TYR B 1 620 ? -39.888 -24.923 -20.667 1.00 49.89 ? 620 TYR B O     1 
ATOM   10364 C  CB    . TYR B 1 620 ? -39.208 -26.934 -22.850 1.00 50.05 ? 620 TYR B CB    1 
ATOM   10365 C  CG    . TYR B 1 620 ? -38.524 -27.737 -23.929 1.00 50.07 ? 620 TYR B CG    1 
ATOM   10366 C  CD1   . TYR B 1 620 ? -38.534 -27.305 -25.258 1.00 50.36 ? 620 TYR B CD1   1 
ATOM   10367 C  CD2   . TYR B 1 620 ? -37.875 -28.933 -23.628 1.00 48.84 ? 620 TYR B CD2   1 
ATOM   10368 C  CE1   . TYR B 1 620 ? -37.913 -28.041 -26.256 1.00 50.35 ? 620 TYR B CE1   1 
ATOM   10369 C  CE2   . TYR B 1 620 ? -37.253 -29.674 -24.617 1.00 49.56 ? 620 TYR B CE2   1 
ATOM   10370 C  CZ    . TYR B 1 620 ? -37.276 -29.224 -25.931 1.00 49.87 ? 620 TYR B CZ    1 
ATOM   10371 O  OH    . TYR B 1 620 ? -36.651 -29.957 -26.913 1.00 49.85 ? 620 TYR B OH    1 
ATOM   10372 N  N     . THR B 1 621 ? -38.795 -23.607 -22.140 1.00 50.24 ? 621 THR B N     1 
ATOM   10373 C  CA    . THR B 1 621 ? -39.436 -22.394 -21.652 1.00 51.74 ? 621 THR B CA    1 
ATOM   10374 C  C     . THR B 1 621 ? -40.874 -22.302 -22.170 1.00 53.83 ? 621 THR B C     1 
ATOM   10375 O  O     . THR B 1 621 ? -41.734 -21.672 -21.545 1.00 54.90 ? 621 THR B O     1 
ATOM   10376 C  CB    . THR B 1 621 ? -38.609 -21.110 -21.954 1.00 51.21 ? 621 THR B CB    1 
ATOM   10377 O  OG1   . THR B 1 621 ? -38.732 -20.760 -23.331 1.00 53.58 ? 621 THR B OG1   1 
ATOM   10378 C  CG2   . THR B 1 621 ? -37.125 -21.319 -21.618 1.00 49.93 ? 621 THR B CG2   1 
ATOM   10379 N  N     . SER B 1 622 ? -41.126 -22.965 -23.297 1.00 54.86 ? 622 SER B N     1 
ATOM   10380 C  CA    . SER B 1 622 ? -42.457 -23.044 -23.887 1.00 57.04 ? 622 SER B CA    1 
ATOM   10381 C  C     . SER B 1 622 ? -42.584 -24.315 -24.718 1.00 57.70 ? 622 SER B C     1 
ATOM   10382 O  O     . SER B 1 622 ? -41.572 -24.880 -25.152 1.00 56.64 ? 622 SER B O     1 
ATOM   10383 C  CB    . SER B 1 622 ? -42.719 -21.818 -24.766 1.00 58.11 ? 622 SER B CB    1 
ATOM   10384 O  OG    . SER B 1 622 ? -44.098 -21.677 -25.028 1.00 60.28 ? 622 SER B OG    1 
ATOM   10385 N  N     . ASN B 1 623 ? -43.824 -24.759 -24.927 1.00 59.55 ? 623 ASN B N     1 
ATOM   10386 C  CA    . ASN B 1 623 ? -44.119 -25.924 -25.765 1.00 60.73 ? 623 ASN B CA    1 
ATOM   10387 C  C     . ASN B 1 623 ? -44.340 -25.536 -27.213 1.00 62.47 ? 623 ASN B C     1 
ATOM   10388 O  O     . ASN B 1 623 ? -44.395 -26.392 -28.100 1.00 62.99 ? 623 ASN B O     1 
ATOM   10389 C  CB    . ASN B 1 623 ? -45.343 -26.682 -25.242 1.00 61.83 ? 623 ASN B CB    1 
ATOM   10390 C  CG    . ASN B 1 623 ? -45.015 -27.557 -24.048 1.00 60.81 ? 623 ASN B CG    1 
ATOM   10391 O  OD1   . ASN B 1 623 ? -44.029 -28.305 -24.060 1.00 59.02 ? 623 ASN B OD1   1 
ATOM   10392 N  ND2   . ASN B 1 623 ? -45.837 -27.464 -23.004 1.00 61.01 ? 623 ASN B ND2   1 
ATOM   10393 N  N     . ILE B 1 624 ? -44.488 -24.234 -27.433 1.00 63.70 ? 624 ILE B N     1 
ATOM   10394 C  CA    . ILE B 1 624 ? -44.556 -23.668 -28.769 1.00 65.52 ? 624 ILE B CA    1 
ATOM   10395 C  C     . ILE B 1 624 ? -43.807 -22.343 -28.789 1.00 65.27 ? 624 ILE B C     1 
ATOM   10396 O  O     . ILE B 1 624 ? -44.060 -21.456 -27.979 1.00 65.38 ? 624 ILE B O     1 
ATOM   10397 C  CB    . ILE B 1 624 ? -46.012 -23.543 -29.300 1.00 67.94 ? 624 ILE B CB    1 
ATOM   10398 C  CG1   . ILE B 1 624 ? -46.000 -23.184 -30.789 1.00 69.53 ? 624 ILE B CG1   1 
ATOM   10399 C  CG2   . ILE B 1 624 ? -46.832 -22.548 -28.466 1.00 68.97 ? 624 ILE B CG2   1 
ATOM   10400 C  CD1   . ILE B 1 624 ? -47.277 -23.553 -31.534 1.00 72.97 ? 624 ILE B CD1   1 
ATOM   10401 N  N     . TYR B 1 625 ? -42.861 -22.237 -29.711 1.00 65.41 ? 625 TYR B N     1 
ATOM   10402 C  CA    . TYR B 1 625 ? -41.972 -21.092 -29.786 1.00 65.34 ? 625 TYR B CA    1 
ATOM   10403 C  C     . TYR B 1 625 ? -41.604 -20.855 -31.241 1.00 66.86 ? 625 TYR B C     1 
ATOM   10404 O  O     . TYR B 1 625 ? -41.887 -21.689 -32.106 1.00 67.64 ? 625 TYR B O     1 
ATOM   10405 C  CB    . TYR B 1 625 ? -40.716 -21.343 -28.944 1.00 63.02 ? 625 TYR B CB    1 
ATOM   10406 C  CG    . TYR B 1 625 ? -40.199 -22.761 -29.039 1.00 62.05 ? 625 TYR B CG    1 
ATOM   10407 C  CD1   . TYR B 1 625 ? -39.221 -23.109 -29.971 1.00 61.63 ? 625 TYR B CD1   1 
ATOM   10408 C  CD2   . TYR B 1 625 ? -40.698 -23.761 -28.199 1.00 62.13 ? 625 TYR B CD2   1 
ATOM   10409 C  CE1   . TYR B 1 625 ? -38.745 -24.414 -30.061 1.00 60.94 ? 625 TYR B CE1   1 
ATOM   10410 C  CE2   . TYR B 1 625 ? -40.237 -25.070 -28.285 1.00 61.52 ? 625 TYR B CE2   1 
ATOM   10411 C  CZ    . TYR B 1 625 ? -39.261 -25.390 -29.217 1.00 61.04 ? 625 TYR B CZ    1 
ATOM   10412 O  OH    . TYR B 1 625 ? -38.805 -26.687 -29.293 1.00 60.26 ? 625 TYR B OH    1 
ATOM   10413 N  N     . THR B 1 626 ? -40.984 -19.714 -31.515 1.00 67.54 ? 626 THR B N     1 
ATOM   10414 C  CA    . THR B 1 626 ? -40.582 -19.405 -32.878 1.00 69.35 ? 626 THR B CA    1 
ATOM   10415 C  C     . THR B 1 626 ? -39.058 -19.341 -33.031 1.00 68.32 ? 626 THR B C     1 
ATOM   10416 O  O     . THR B 1 626 ? -38.340 -18.977 -32.101 1.00 66.74 ? 626 THR B O     1 
ATOM   10417 C  CB    . THR B 1 626 ? -41.306 -18.147 -33.457 1.00 71.27 ? 626 THR B CB    1 
ATOM   10418 O  OG1   . THR B 1 626 ? -41.315 -17.096 -32.486 1.00 71.02 ? 626 THR B OG1   1 
ATOM   10419 C  CG2   . THR B 1 626 ? -42.744 -18.483 -33.823 1.00 73.30 ? 626 THR B CG2   1 
ATOM   10420 N  N     . ARG B 1 627 ? -38.591 -19.729 -34.216 1.00 69.59 ? 627 ARG B N     1 
ATOM   10421 C  CA    . ARG B 1 627 ? -37.192 -19.622 -34.597 1.00 69.01 ? 627 ARG B CA    1 
ATOM   10422 C  C     . ARG B 1 627 ? -37.120 -18.725 -35.826 1.00 70.64 ? 627 ARG B C     1 
ATOM   10423 O  O     . ARG B 1 627 ? -37.816 -18.966 -36.821 1.00 72.16 ? 627 ARG B O     1 
ATOM   10424 C  CB    . ARG B 1 627 ? -36.635 -21.003 -34.934 1.00 68.54 ? 627 ARG B CB    1 
ATOM   10425 C  CG    . ARG B 1 627 ? -35.213 -21.248 -34.478 1.00 68.11 ? 627 ARG B CG    1 
ATOM   10426 C  CD    . ARG B 1 627 ? -35.170 -21.954 -33.126 1.00 69.05 ? 627 ARG B CD    1 
ATOM   10427 N  NE    . ARG B 1 627 ? -35.573 -21.072 -32.033 1.00 70.89 ? 627 ARG B NE    1 
ATOM   10428 C  CZ    . ARG B 1 627 ? -35.491 -21.383 -30.742 1.00 70.86 ? 627 ARG B CZ    1 
ATOM   10429 N  NH1   . ARG B 1 627 ? -35.014 -22.566 -30.362 1.00 69.84 ? 627 ARG B NH1   1 
ATOM   10430 N  NH2   . ARG B 1 627 ? -35.882 -20.503 -29.827 1.00 70.88 ? 627 ARG B NH2   1 
ATOM   10431 N  N     . ARG B 1 628 ? -36.296 -17.683 -35.742 1.00 70.32 ? 628 ARG B N     1 
ATOM   10432 C  CA    . ARG B 1 628 ? -36.104 -16.757 -36.855 1.00 72.14 ? 628 ARG B CA    1 
ATOM   10433 C  C     . ARG B 1 628 ? -34.970 -17.242 -37.760 1.00 72.15 ? 628 ARG B C     1 
ATOM   10434 O  O     . ARG B 1 628 ? -33.897 -17.629 -37.267 1.00 70.18 ? 628 ARG B O     1 
ATOM   10435 C  CB    . ARG B 1 628 ? -35.828 -15.345 -36.340 1.00 72.00 ? 628 ARG B CB    1 
ATOM   10436 N  N     . VAL B 1 629 ? -35.218 -17.234 -39.075 1.00 73.93 ? 629 VAL B N     1 
ATOM   10437 C  CA    . VAL B 1 629 ? -34.205 -17.630 -40.064 1.00 74.27 ? 629 VAL B CA    1 
ATOM   10438 C  C     . VAL B 1 629 ? -33.894 -16.496 -41.058 1.00 76.07 ? 629 VAL B C     1 
ATOM   10439 O  O     . VAL B 1 629 ? -34.540 -16.351 -42.104 1.00 78.29 ? 629 VAL B O     1 
ATOM   10440 C  CB    . VAL B 1 629 ? -34.586 -18.957 -40.798 1.00 74.96 ? 629 VAL B CB    1 
ATOM   10441 C  CG1   . VAL B 1 629 ? -33.632 -19.244 -41.953 1.00 75.66 ? 629 VAL B CG1   1 
ATOM   10442 C  CG2   . VAL B 1 629 ? -34.594 -20.134 -39.824 1.00 72.65 ? 629 VAL B CG2   1 
ATOM   10443 N  N     . GLY B 1 632 ? -37.570 -15.812 -42.886 1.00 83.56 ? 632 GLY B N     1 
ATOM   10444 C  CA    . GLY B 1 632 ? -38.814 -15.594 -42.156 1.00 83.85 ? 632 GLY B CA    1 
ATOM   10445 C  C     . GLY B 1 632 ? -38.812 -16.280 -40.803 1.00 81.34 ? 632 GLY B C     1 
ATOM   10446 O  O     . GLY B 1 632 ? -37.880 -17.022 -40.475 1.00 79.65 ? 632 GLY B O     1 
ATOM   10447 N  N     . GLU B 1 633 ? -39.855 -16.017 -40.012 1.00 81.35 ? 633 GLU B N     1 
ATOM   10448 C  CA    . GLU B 1 633 ? -40.045 -16.657 -38.703 1.00 78.88 ? 633 GLU B CA    1 
ATOM   10449 C  C     . GLU B 1 633 ? -40.678 -18.027 -38.914 1.00 78.27 ? 633 GLU B C     1 
ATOM   10450 O  O     . GLU B 1 633 ? -41.529 -18.192 -39.796 1.00 80.33 ? 633 GLU B O     1 
ATOM   10451 C  CB    . GLU B 1 633 ? -40.963 -15.820 -37.798 1.00 79.56 ? 633 GLU B CB    1 
ATOM   10452 C  CG    . GLU B 1 633 ? -40.549 -14.366 -37.587 1.00 81.32 ? 633 GLU B CG    1 
ATOM   10453 C  CD    . GLU B 1 633 ? -39.456 -14.194 -36.542 1.00 81.84 ? 633 GLU B CD    1 
ATOM   10454 O  OE1   . GLU B 1 633 ? -38.595 -13.302 -36.731 1.00 83.01 ? 633 GLU B OE1   1 
ATOM   10455 O  OE2   . GLU B 1 633 ? -39.453 -14.937 -35.531 1.00 81.26 ? 633 GLU B OE2   1 
ATOM   10456 N  N     . PHE B 1 634 ? -40.269 -19.002 -38.108 1.00 75.25 ? 634 PHE B N     1 
ATOM   10457 C  CA    . PHE B 1 634 ? -40.868 -20.338 -38.161 1.00 74.38 ? 634 PHE B CA    1 
ATOM   10458 C  C     . PHE B 1 634 ? -41.454 -20.756 -36.818 1.00 72.63 ? 634 PHE B C     1 
ATOM   10459 O  O     . PHE B 1 634 ? -40.815 -20.614 -35.774 1.00 70.58 ? 634 PHE B O     1 
ATOM   10460 C  CB    . PHE B 1 634 ? -39.854 -21.385 -38.632 1.00 73.20 ? 634 PHE B CB    1 
ATOM   10461 C  CG    . PHE B 1 634 ? -39.559 -21.334 -40.105 1.00 74.52 ? 634 PHE B CG    1 
ATOM   10462 C  CD1   . PHE B 1 634 ? -38.532 -20.529 -40.596 1.00 73.91 ? 634 PHE B CD1   1 
ATOM   10463 C  CD2   . PHE B 1 634 ? -40.292 -22.106 -41.002 1.00 75.39 ? 634 PHE B CD2   1 
ATOM   10464 C  CE1   . PHE B 1 634 ? -38.253 -20.485 -41.962 1.00 75.93 ? 634 PHE B CE1   1 
ATOM   10465 C  CE2   . PHE B 1 634 ? -40.016 -22.070 -42.374 1.00 77.12 ? 634 PHE B CE2   1 
ATOM   10466 C  CZ    . PHE B 1 634 ? -39.002 -21.256 -42.854 1.00 77.23 ? 634 PHE B CZ    1 
ATOM   10467 N  N     . GLN B 1 635 ? -42.675 -21.279 -36.871 1.00 73.25 ? 635 GLN B N     1 
ATOM   10468 C  CA    . GLN B 1 635 ? -43.369 -21.819 -35.712 1.00 71.62 ? 635 GLN B CA    1 
ATOM   10469 C  C     . GLN B 1 635 ? -42.863 -23.236 -35.389 1.00 69.36 ? 635 GLN B C     1 
ATOM   10470 O  O     . GLN B 1 635 ? -42.802 -24.106 -36.266 1.00 69.81 ? 635 GLN B O     1 
ATOM   10471 C  CB    . GLN B 1 635 ? -44.868 -21.843 -36.003 1.00 74.06 ? 635 GLN B CB    1 
ATOM   10472 C  CG    . GLN B 1 635 ? -45.761 -21.696 -34.790 1.00 74.32 ? 635 GLN B CG    1 
ATOM   10473 C  CD    . GLN B 1 635 ? -47.227 -21.788 -35.156 1.00 76.75 ? 635 GLN B CD    1 
ATOM   10474 O  OE1   . GLN B 1 635 ? -47.669 -22.778 -35.737 1.00 78.38 ? 635 GLN B OE1   1 
ATOM   10475 N  NE2   . GLN B 1 635 ? -47.990 -20.756 -34.820 1.00 77.85 ? 635 GLN B NE2   1 
ATOM   10476 N  N     . ILE B 1 636 ? -42.484 -23.452 -34.131 1.00 66.43 ? 636 ILE B N     1 
ATOM   10477 C  CA    . ILE B 1 636 ? -42.003 -24.754 -33.669 1.00 63.80 ? 636 ILE B CA    1 
ATOM   10478 C  C     . ILE B 1 636 ? -42.760 -25.206 -32.409 1.00 62.73 ? 636 ILE B C     1 
ATOM   10479 O  O     . ILE B 1 636 ? -42.894 -24.445 -31.447 1.00 61.93 ? 636 ILE B O     1 
ATOM   10480 C  CB    . ILE B 1 636 ? -40.469 -24.733 -33.404 1.00 61.78 ? 636 ILE B CB    1 
ATOM   10481 C  CG1   . ILE B 1 636 ? -39.715 -24.308 -34.665 1.00 62.07 ? 636 ILE B CG1   1 
ATOM   10482 C  CG2   . ILE B 1 636 ? -39.963 -26.105 -32.924 1.00 60.02 ? 636 ILE B CG2   1 
ATOM   10483 C  CD1   . ILE B 1 636 ? -38.294 -23.880 -34.402 1.00 61.05 ? 636 ILE B CD1   1 
ATOM   10484 N  N     . VAL B 1 637 ? -43.269 -26.437 -32.448 1.00 62.26 ? 637 VAL B N     1 
ATOM   10485 C  CA    . VAL B 1 637 ? -43.827 -27.118 -31.276 1.00 60.97 ? 637 VAL B CA    1 
ATOM   10486 C  C     . VAL B 1 637 ? -42.727 -27.975 -30.640 1.00 58.26 ? 637 VAL B C     1 
ATOM   10487 O  O     . VAL B 1 637 ? -41.894 -28.528 -31.355 1.00 57.83 ? 637 VAL B O     1 
ATOM   10488 C  CB    . VAL B 1 637 ? -45.021 -28.039 -31.671 1.00 62.79 ? 637 VAL B CB    1 
ATOM   10489 C  CG1   . VAL B 1 637 ? -45.563 -28.796 -30.454 1.00 62.56 ? 637 VAL B CG1   1 
ATOM   10490 C  CG2   . VAL B 1 637 ? -46.134 -27.243 -32.340 1.00 64.68 ? 637 VAL B CG2   1 
ATOM   10491 N  N     . ASN B 1 638 ? -42.715 -28.073 -29.310 1.00 56.54 ? 638 ASN B N     1 
ATOM   10492 C  CA    . ASN B 1 638 ? -41.828 -29.013 -28.603 1.00 54.11 ? 638 ASN B CA    1 
ATOM   10493 C  C     . ASN B 1 638 ? -41.903 -30.382 -29.295 1.00 54.07 ? 638 ASN B C     1 
ATOM   10494 O  O     . ASN B 1 638 ? -42.969 -30.995 -29.327 1.00 55.22 ? 638 ASN B O     1 
ATOM   10495 C  CB    . ASN B 1 638 ? -42.212 -29.102 -27.113 1.00 53.43 ? 638 ASN B CB    1 
ATOM   10496 C  CG    . ASN B 1 638 ? -41.391 -30.135 -26.332 1.00 51.76 ? 638 ASN B CG    1 
ATOM   10497 O  OD1   . ASN B 1 638 ? -40.981 -31.166 -26.862 1.00 52.34 ? 638 ASN B OD1   1 
ATOM   10498 N  ND2   . ASN B 1 638 ? -41.174 -29.864 -25.052 1.00 50.84 ? 638 ASN B ND2   1 
ATOM   10499 N  N     . PRO B 1 639 ? -40.770 -30.850 -29.866 1.00 52.87 ? 639 PRO B N     1 
ATOM   10500 C  CA    . PRO B 1 639 ? -40.747 -32.049 -30.723 1.00 52.93 ? 639 PRO B CA    1 
ATOM   10501 C  C     . PRO B 1 639 ? -41.122 -33.342 -29.983 1.00 52.26 ? 639 PRO B C     1 
ATOM   10502 O  O     . PRO B 1 639 ? -41.712 -34.244 -30.586 1.00 53.28 ? 639 PRO B O     1 
ATOM   10503 C  CB    . PRO B 1 639 ? -39.299 -32.100 -31.223 1.00 51.84 ? 639 PRO B CB    1 
ATOM   10504 C  CG    . PRO B 1 639 ? -38.510 -31.328 -30.207 1.00 50.76 ? 639 PRO B CG    1 
ATOM   10505 C  CD    . PRO B 1 639 ? -39.425 -30.253 -29.712 1.00 51.24 ? 639 PRO B CD    1 
ATOM   10506 N  N     . HIS B 1 640 ? -40.793 -33.416 -28.691 1.00 50.26 ? 640 HIS B N     1 
ATOM   10507 C  CA    . HIS B 1 640 ? -41.189 -34.549 -27.852 1.00 49.56 ? 640 HIS B CA    1 
ATOM   10508 C  C     . HIS B 1 640 ? -42.713 -34.582 -27.642 1.00 50.58 ? 640 HIS B C     1 
ATOM   10509 O  O     . HIS B 1 640 ? -43.341 -35.621 -27.809 1.00 51.07 ? 640 HIS B O     1 
ATOM   10510 C  CB    . HIS B 1 640 ? -40.455 -34.524 -26.503 1.00 47.83 ? 640 HIS B CB    1 
ATOM   10511 C  CG    . HIS B 1 640 ? -38.972 -34.324 -26.613 1.00 46.82 ? 640 HIS B CG    1 
ATOM   10512 N  ND1   . HIS B 1 640 ? -38.103 -35.338 -26.956 1.00 46.52 ? 640 HIS B ND1   1 
ATOM   10513 C  CD2   . HIS B 1 640 ? -38.200 -33.229 -26.402 1.00 46.18 ? 640 HIS B CD2   1 
ATOM   10514 C  CE1   . HIS B 1 640 ? -36.866 -34.875 -26.965 1.00 44.61 ? 640 HIS B CE1   1 
ATOM   10515 N  NE2   . HIS B 1 640 ? -36.896 -33.597 -26.633 1.00 44.20 ? 640 HIS B NE2   1 
ATOM   10516 N  N     . LEU B 1 641 ? -43.292 -33.434 -27.294 1.00 50.83 ? 641 LEU B N     1 
ATOM   10517 C  CA    . LEU B 1 641 ? -44.738 -33.300 -27.090 1.00 52.43 ? 641 LEU B CA    1 
ATOM   10518 C  C     . LEU B 1 641 ? -45.550 -33.556 -28.356 1.00 54.33 ? 641 LEU B C     1 
ATOM   10519 O  O     . LEU B 1 641 ? -46.591 -34.211 -28.296 1.00 55.82 ? 641 LEU B O     1 
ATOM   10520 C  CB    . LEU B 1 641 ? -45.084 -31.917 -26.519 1.00 52.54 ? 641 LEU B CB    1 
ATOM   10521 C  CG    . LEU B 1 641 ? -46.558 -31.477 -26.533 1.00 54.30 ? 641 LEU B CG    1 
ATOM   10522 C  CD1   . LEU B 1 641 ? -47.368 -32.144 -25.424 1.00 54.57 ? 641 LEU B CD1   1 
ATOM   10523 C  CD2   . LEU B 1 641 ? -46.682 -29.965 -26.447 1.00 54.41 ? 641 LEU B CD2   1 
ATOM   10524 N  N     . LEU B 1 642 ? -45.077 -33.044 -29.494 1.00 54.57 ? 642 LEU B N     1 
ATOM   10525 C  CA    . LEU B 1 642 ? -45.790 -33.206 -30.764 1.00 56.51 ? 642 LEU B CA    1 
ATOM   10526 C  C     . LEU B 1 642 ? -45.881 -34.675 -31.193 1.00 57.21 ? 642 LEU B C     1 
ATOM   10527 O  O     . LEU B 1 642 ? -46.933 -35.131 -31.645 1.00 59.22 ? 642 LEU B O     1 
ATOM   10528 C  CB    . LEU B 1 642 ? -45.159 -32.343 -31.859 1.00 56.59 ? 642 LEU B CB    1 
ATOM   10529 C  CG    . LEU B 1 642 ? -45.902 -32.243 -33.199 1.00 58.54 ? 642 LEU B CG    1 
ATOM   10530 C  CD1   . LEU B 1 642 ? -47.382 -32.043 -33.009 1.00 60.54 ? 642 LEU B CD1   1 
ATOM   10531 C  CD2   . LEU B 1 642 ? -45.344 -31.131 -34.050 1.00 58.72 ? 642 LEU B CD2   1 
ATOM   10532 N  N     . LYS B 1 643 ? -44.781 -35.404 -31.036 1.00 55.89 ? 643 LYS B N     1 
ATOM   10533 C  CA    . LYS B 1 643 ? -44.762 -36.851 -31.250 1.00 56.38 ? 643 LYS B CA    1 
ATOM   10534 C  C     . LYS B 1 643 ? -45.767 -37.565 -30.362 1.00 56.79 ? 643 LYS B C     1 
ATOM   10535 O  O     . LYS B 1 643 ? -46.532 -38.393 -30.851 1.00 58.54 ? 643 LYS B O     1 
ATOM   10536 C  CB    . LYS B 1 643 ? -43.361 -37.424 -31.009 1.00 54.88 ? 643 LYS B CB    1 
ATOM   10537 C  CG    . LYS B 1 643 ? -42.438 -37.284 -32.201 1.00 55.47 ? 643 LYS B CG    1 
ATOM   10538 C  CD    . LYS B 1 643 ? -41.026 -37.648 -31.830 1.00 55.76 ? 643 LYS B CD    1 
ATOM   10539 C  CE    . LYS B 1 643 ? -40.047 -37.198 -32.892 1.00 55.90 ? 643 LYS B CE    1 
ATOM   10540 N  NZ    . LYS B 1 643 ? -38.766 -37.928 -32.741 1.00 56.37 ? 643 LYS B NZ    1 
ATOM   10541 N  N     . ASP B 1 644 ? -45.768 -37.238 -29.068 1.00 55.45 ? 644 ASP B N     1 
ATOM   10542 C  CA    . ASP B 1 644 ? -46.713 -37.833 -28.119 1.00 56.16 ? 644 ASP B CA    1 
ATOM   10543 C  C     . ASP B 1 644 ? -48.174 -37.601 -28.525 1.00 58.35 ? 644 ASP B C     1 
ATOM   10544 O  O     . ASP B 1 644 ? -48.966 -38.539 -28.564 1.00 59.56 ? 644 ASP B O     1 
ATOM   10545 C  CB    . ASP B 1 644 ? -46.461 -37.324 -26.696 1.00 54.92 ? 644 ASP B CB    1 
ATOM   10546 C  CG    . ASP B 1 644 ? -45.329 -38.067 -25.990 1.00 53.67 ? 644 ASP B CG    1 
ATOM   10547 O  OD1   . ASP B 1 644 ? -45.053 -39.238 -26.342 1.00 54.74 ? 644 ASP B OD1   1 
ATOM   10548 O  OD2   . ASP B 1 644 ? -44.720 -37.480 -25.066 1.00 51.64 ? 644 ASP B OD2   1 
ATOM   10549 N  N     . LEU B 1 645 ? -48.507 -36.355 -28.850 1.00 58.90 ? 645 LEU B N     1 
ATOM   10550 C  CA    . LEU B 1 645 ? -49.851 -35.993 -29.293 1.00 61.32 ? 645 LEU B CA    1 
ATOM   10551 C  C     . LEU B 1 645 ? -50.273 -36.656 -30.607 1.00 63.04 ? 645 LEU B C     1 
ATOM   10552 O  O     . LEU B 1 645 ? -51.429 -37.069 -30.742 1.00 64.85 ? 645 LEU B O     1 
ATOM   10553 C  CB    . LEU B 1 645 ? -49.994 -34.472 -29.387 1.00 61.49 ? 645 LEU B CB    1 
ATOM   10554 C  CG    . LEU B 1 645 ? -49.814 -33.727 -28.064 1.00 60.65 ? 645 LEU B CG    1 
ATOM   10555 C  CD1   . LEU B 1 645 ? -49.757 -32.225 -28.277 1.00 60.47 ? 645 LEU B CD1   1 
ATOM   10556 C  CD2   . LEU B 1 64