data_3K72
# 
_entry.id   3K72 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3K72         
RCSB  RCSB055627   
WWPDB D_1000055627 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3K6S 'Structure of an integrin with an I domain, complement receptor type 4' unspecified 
PDB 3K71 'Structure of integrin alphaX beta2 ectodomain'                         unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3K72 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xie, C.'        1 
'Zhu, J.'        2 
'Chen, X.'       3 
'Mi, L.'         4 
'Nishida, N.'    5 
'Springer, T.A.' 6 
# 
_citation.id                        primary 
_citation.title                     'Structure of an integrin with an alphaI domain, complement receptor type 4.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            29 
_citation.page_first                666 
_citation.page_last                 679 
_citation.year                      2010 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20033057 
_citation.pdbx_database_id_DOI      10.1038/emboj.2009.367 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Xie, C.'        1 ? 
primary 'Zhu, J.'        2 ? 
primary 'Chen, X.'       3 ? 
primary 'Mi, L.'         4 ? 
primary 'Nishida, N.'    5 ? 
primary 'Springer, T.A.' 6 ? 
# 
_cell.entry_id           3K72 
_cell.length_a           160.962 
_cell.length_b           165.549 
_cell.length_c           536.178 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3K72 
_symmetry.space_group_name_H-M             'I 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                24 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Integrin alpha-X' 120708.203 2 ? ? 'residues 20-1103' ? 
2 polymer     man 'Integrin beta-2' 75942.992  2 ? ? 'residues 23-700'  ? 
3 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401    2 ? ? ? ? 
4 branched    man 
;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
910.823    2 ? ? ?                  ? 
5 branched    man 
'alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542    3 
? ? ?                  ? 
6 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208    7 ? ? ?                  ? 
7 non-polymer syn 'CALCIUM ION' 40.078     8 ? ? ?                  ? 
8 non-polymer man alpha-D-mannopyranose 180.156    1 ? ? ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
'Leukocyte adhesion glycoprotein p150,95 alpha chain, Leukocyte adhesion receptor p150,95, Leu M5, CD11 antigen-like family member C' 
2 'Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLAST
TSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVIS
QFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITD
GKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGT
ETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQS
LVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPR
GWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSS
RLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYID
KRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLV
GKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTI
TFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTAN
VSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQ
EAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQI
LQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKVHGCGGLENLYFQ
;
;FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLAST
TSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVIS
QFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITD
GKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGT
ETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQS
LVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPR
GWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSS
RLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYID
KRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLV
GKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTI
TFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTAN
VSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQ
EAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQI
LQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKVHGCGGLENLYFQ
;
A,C ? 
2 'polypeptide(L)' no no 
;QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQK
VTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNT
HPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFA
TDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAV
GELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQ
EQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNN
SIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGC
LNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTC
KERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPDGCGENLYFQ
;
;QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQK
VTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNT
HPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFA
TDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAV
GELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQ
EQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNN
SIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGC
LNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTC
KERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPDGCGENLYFQ
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    PHE n 
1 2    ASN n 
1 3    LEU n 
1 4    ASP n 
1 5    THR n 
1 6    GLU n 
1 7    GLU n 
1 8    LEU n 
1 9    THR n 
1 10   ALA n 
1 11   PHE n 
1 12   ARG n 
1 13   VAL n 
1 14   ASP n 
1 15   SER n 
1 16   ALA n 
1 17   GLY n 
1 18   PHE n 
1 19   GLY n 
1 20   ASP n 
1 21   SER n 
1 22   VAL n 
1 23   VAL n 
1 24   GLN n 
1 25   TYR n 
1 26   ALA n 
1 27   ASN n 
1 28   SER n 
1 29   TRP n 
1 30   VAL n 
1 31   VAL n 
1 32   VAL n 
1 33   GLY n 
1 34   ALA n 
1 35   PRO n 
1 36   GLN n 
1 37   LYS n 
1 38   ILE n 
1 39   THR n 
1 40   ALA n 
1 41   ALA n 
1 42   ASN n 
1 43   GLN n 
1 44   THR n 
1 45   GLY n 
1 46   GLY n 
1 47   LEU n 
1 48   TYR n 
1 49   GLN n 
1 50   CYS n 
1 51   GLY n 
1 52   TYR n 
1 53   SER n 
1 54   THR n 
1 55   GLY n 
1 56   ALA n 
1 57   CYS n 
1 58   GLU n 
1 59   PRO n 
1 60   ILE n 
1 61   GLY n 
1 62   LEU n 
1 63   GLN n 
1 64   VAL n 
1 65   PRO n 
1 66   PRO n 
1 67   GLU n 
1 68   ALA n 
1 69   VAL n 
1 70   ASN n 
1 71   MET n 
1 72   SER n 
1 73   LEU n 
1 74   GLY n 
1 75   LEU n 
1 76   SER n 
1 77   LEU n 
1 78   ALA n 
1 79   SER n 
1 80   THR n 
1 81   THR n 
1 82   SER n 
1 83   PRO n 
1 84   SER n 
1 85   GLN n 
1 86   LEU n 
1 87   LEU n 
1 88   ALA n 
1 89   CYS n 
1 90   GLY n 
1 91   PRO n 
1 92   THR n 
1 93   VAL n 
1 94   HIS n 
1 95   HIS n 
1 96   GLU n 
1 97   CYS n 
1 98   GLY n 
1 99   ARG n 
1 100  ASN n 
1 101  MET n 
1 102  TYR n 
1 103  LEU n 
1 104  THR n 
1 105  GLY n 
1 106  LEU n 
1 107  CYS n 
1 108  PHE n 
1 109  LEU n 
1 110  LEU n 
1 111  GLY n 
1 112  PRO n 
1 113  THR n 
1 114  GLN n 
1 115  LEU n 
1 116  THR n 
1 117  GLN n 
1 118  ARG n 
1 119  LEU n 
1 120  PRO n 
1 121  VAL n 
1 122  SER n 
1 123  ARG n 
1 124  GLN n 
1 125  GLU n 
1 126  CYS n 
1 127  PRO n 
1 128  ARG n 
1 129  GLN n 
1 130  GLU n 
1 131  GLN n 
1 132  ASP n 
1 133  ILE n 
1 134  VAL n 
1 135  PHE n 
1 136  LEU n 
1 137  ILE n 
1 138  ASP n 
1 139  GLY n 
1 140  SER n 
1 141  GLY n 
1 142  SER n 
1 143  ILE n 
1 144  SER n 
1 145  SER n 
1 146  ARG n 
1 147  ASN n 
1 148  PHE n 
1 149  ALA n 
1 150  THR n 
1 151  MET n 
1 152  MET n 
1 153  ASN n 
1 154  PHE n 
1 155  VAL n 
1 156  ARG n 
1 157  ALA n 
1 158  VAL n 
1 159  ILE n 
1 160  SER n 
1 161  GLN n 
1 162  PHE n 
1 163  GLN n 
1 164  ARG n 
1 165  PRO n 
1 166  SER n 
1 167  THR n 
1 168  GLN n 
1 169  PHE n 
1 170  SER n 
1 171  LEU n 
1 172  MET n 
1 173  GLN n 
1 174  PHE n 
1 175  SER n 
1 176  ASN n 
1 177  LYS n 
1 178  PHE n 
1 179  GLN n 
1 180  THR n 
1 181  HIS n 
1 182  PHE n 
1 183  THR n 
1 184  PHE n 
1 185  GLU n 
1 186  GLU n 
1 187  PHE n 
1 188  ARG n 
1 189  ARG n 
1 190  SER n 
1 191  SER n 
1 192  ASN n 
1 193  PRO n 
1 194  LEU n 
1 195  SER n 
1 196  LEU n 
1 197  LEU n 
1 198  ALA n 
1 199  SER n 
1 200  VAL n 
1 201  HIS n 
1 202  GLN n 
1 203  LEU n 
1 204  GLN n 
1 205  GLY n 
1 206  PHE n 
1 207  THR n 
1 208  TYR n 
1 209  THR n 
1 210  ALA n 
1 211  THR n 
1 212  ALA n 
1 213  ILE n 
1 214  GLN n 
1 215  ASN n 
1 216  VAL n 
1 217  VAL n 
1 218  HIS n 
1 219  ARG n 
1 220  LEU n 
1 221  PHE n 
1 222  HIS n 
1 223  ALA n 
1 224  SER n 
1 225  TYR n 
1 226  GLY n 
1 227  ALA n 
1 228  ARG n 
1 229  ARG n 
1 230  ASP n 
1 231  ALA n 
1 232  ALA n 
1 233  LYS n 
1 234  ILE n 
1 235  LEU n 
1 236  ILE n 
1 237  VAL n 
1 238  ILE n 
1 239  THR n 
1 240  ASP n 
1 241  GLY n 
1 242  LYS n 
1 243  LYS n 
1 244  GLU n 
1 245  GLY n 
1 246  ASP n 
1 247  SER n 
1 248  LEU n 
1 249  ASP n 
1 250  TYR n 
1 251  LYS n 
1 252  ASP n 
1 253  VAL n 
1 254  ILE n 
1 255  PRO n 
1 256  MET n 
1 257  ALA n 
1 258  ASP n 
1 259  ALA n 
1 260  ALA n 
1 261  GLY n 
1 262  ILE n 
1 263  ILE n 
1 264  ARG n 
1 265  TYR n 
1 266  ALA n 
1 267  ILE n 
1 268  GLY n 
1 269  VAL n 
1 270  GLY n 
1 271  LEU n 
1 272  ALA n 
1 273  PHE n 
1 274  GLN n 
1 275  ASN n 
1 276  ARG n 
1 277  ASN n 
1 278  SER n 
1 279  TRP n 
1 280  LYS n 
1 281  GLU n 
1 282  LEU n 
1 283  ASN n 
1 284  ASP n 
1 285  ILE n 
1 286  ALA n 
1 287  SER n 
1 288  LYS n 
1 289  PRO n 
1 290  SER n 
1 291  GLN n 
1 292  GLU n 
1 293  HIS n 
1 294  ILE n 
1 295  PHE n 
1 296  LYS n 
1 297  VAL n 
1 298  GLU n 
1 299  ASP n 
1 300  PHE n 
1 301  ASP n 
1 302  ALA n 
1 303  LEU n 
1 304  LYS n 
1 305  ASP n 
1 306  ILE n 
1 307  GLN n 
1 308  ASN n 
1 309  GLN n 
1 310  LEU n 
1 311  LYS n 
1 312  GLU n 
1 313  LYS n 
1 314  ILE n 
1 315  PHE n 
1 316  ALA n 
1 317  ILE n 
1 318  GLU n 
1 319  GLY n 
1 320  THR n 
1 321  GLU n 
1 322  THR n 
1 323  THR n 
1 324  SER n 
1 325  SER n 
1 326  SER n 
1 327  SER n 
1 328  PHE n 
1 329  GLU n 
1 330  LEU n 
1 331  GLU n 
1 332  MET n 
1 333  ALA n 
1 334  GLN n 
1 335  GLU n 
1 336  GLY n 
1 337  PHE n 
1 338  SER n 
1 339  ALA n 
1 340  VAL n 
1 341  PHE n 
1 342  THR n 
1 343  PRO n 
1 344  ASP n 
1 345  GLY n 
1 346  PRO n 
1 347  VAL n 
1 348  LEU n 
1 349  GLY n 
1 350  ALA n 
1 351  VAL n 
1 352  GLY n 
1 353  SER n 
1 354  PHE n 
1 355  THR n 
1 356  TRP n 
1 357  SER n 
1 358  GLY n 
1 359  GLY n 
1 360  ALA n 
1 361  PHE n 
1 362  LEU n 
1 363  TYR n 
1 364  PRO n 
1 365  PRO n 
1 366  ASN n 
1 367  MET n 
1 368  SER n 
1 369  PRO n 
1 370  THR n 
1 371  PHE n 
1 372  ILE n 
1 373  ASN n 
1 374  MET n 
1 375  SER n 
1 376  GLN n 
1 377  GLU n 
1 378  ASN n 
1 379  VAL n 
1 380  ASP n 
1 381  MET n 
1 382  ARG n 
1 383  ASP n 
1 384  SER n 
1 385  TYR n 
1 386  LEU n 
1 387  GLY n 
1 388  TYR n 
1 389  SER n 
1 390  THR n 
1 391  GLU n 
1 392  LEU n 
1 393  ALA n 
1 394  LEU n 
1 395  TRP n 
1 396  LYS n 
1 397  GLY n 
1 398  VAL n 
1 399  GLN n 
1 400  SER n 
1 401  LEU n 
1 402  VAL n 
1 403  LEU n 
1 404  GLY n 
1 405  ALA n 
1 406  PRO n 
1 407  ARG n 
1 408  TYR n 
1 409  GLN n 
1 410  HIS n 
1 411  THR n 
1 412  GLY n 
1 413  LYS n 
1 414  ALA n 
1 415  VAL n 
1 416  ILE n 
1 417  PHE n 
1 418  THR n 
1 419  GLN n 
1 420  VAL n 
1 421  SER n 
1 422  ARG n 
1 423  GLN n 
1 424  TRP n 
1 425  ARG n 
1 426  MET n 
1 427  LYS n 
1 428  ALA n 
1 429  GLU n 
1 430  VAL n 
1 431  THR n 
1 432  GLY n 
1 433  THR n 
1 434  GLN n 
1 435  ILE n 
1 436  GLY n 
1 437  SER n 
1 438  TYR n 
1 439  PHE n 
1 440  GLY n 
1 441  ALA n 
1 442  SER n 
1 443  LEU n 
1 444  CYS n 
1 445  SER n 
1 446  VAL n 
1 447  ASP n 
1 448  VAL n 
1 449  ASP n 
1 450  SER n 
1 451  ASP n 
1 452  GLY n 
1 453  SER n 
1 454  THR n 
1 455  ASP n 
1 456  LEU n 
1 457  VAL n 
1 458  LEU n 
1 459  ILE n 
1 460  GLY n 
1 461  ALA n 
1 462  PRO n 
1 463  HIS n 
1 464  TYR n 
1 465  TYR n 
1 466  GLU n 
1 467  GLN n 
1 468  THR n 
1 469  ARG n 
1 470  GLY n 
1 471  GLY n 
1 472  GLN n 
1 473  VAL n 
1 474  SER n 
1 475  VAL n 
1 476  CYS n 
1 477  PRO n 
1 478  LEU n 
1 479  PRO n 
1 480  ARG n 
1 481  GLY n 
1 482  TRP n 
1 483  ARG n 
1 484  ARG n 
1 485  TRP n 
1 486  TRP n 
1 487  CYS n 
1 488  ASP n 
1 489  ALA n 
1 490  VAL n 
1 491  LEU n 
1 492  TYR n 
1 493  GLY n 
1 494  GLU n 
1 495  GLN n 
1 496  GLY n 
1 497  HIS n 
1 498  PRO n 
1 499  TRP n 
1 500  GLY n 
1 501  ARG n 
1 502  PHE n 
1 503  GLY n 
1 504  ALA n 
1 505  ALA n 
1 506  LEU n 
1 507  THR n 
1 508  VAL n 
1 509  LEU n 
1 510  GLY n 
1 511  ASP n 
1 512  VAL n 
1 513  ASN n 
1 514  GLY n 
1 515  ASP n 
1 516  LYS n 
1 517  LEU n 
1 518  THR n 
1 519  ASP n 
1 520  VAL n 
1 521  VAL n 
1 522  ILE n 
1 523  GLY n 
1 524  ALA n 
1 525  PRO n 
1 526  GLY n 
1 527  GLU n 
1 528  GLU n 
1 529  GLU n 
1 530  ASN n 
1 531  ARG n 
1 532  GLY n 
1 533  ALA n 
1 534  VAL n 
1 535  TYR n 
1 536  LEU n 
1 537  PHE n 
1 538  HIS n 
1 539  GLY n 
1 540  VAL n 
1 541  LEU n 
1 542  GLY n 
1 543  PRO n 
1 544  SER n 
1 545  ILE n 
1 546  SER n 
1 547  PRO n 
1 548  SER n 
1 549  HIS n 
1 550  SER n 
1 551  GLN n 
1 552  ARG n 
1 553  ILE n 
1 554  ALA n 
1 555  GLY n 
1 556  SER n 
1 557  GLN n 
1 558  LEU n 
1 559  SER n 
1 560  SER n 
1 561  ARG n 
1 562  LEU n 
1 563  GLN n 
1 564  TYR n 
1 565  PHE n 
1 566  GLY n 
1 567  GLN n 
1 568  ALA n 
1 569  LEU n 
1 570  SER n 
1 571  GLY n 
1 572  GLY n 
1 573  GLN n 
1 574  ASP n 
1 575  LEU n 
1 576  THR n 
1 577  GLN n 
1 578  ASP n 
1 579  GLY n 
1 580  LEU n 
1 581  VAL n 
1 582  ASP n 
1 583  LEU n 
1 584  ALA n 
1 585  VAL n 
1 586  GLY n 
1 587  ALA n 
1 588  ARG n 
1 589  GLY n 
1 590  GLN n 
1 591  VAL n 
1 592  LEU n 
1 593  LEU n 
1 594  LEU n 
1 595  ARG n 
1 596  THR n 
1 597  ARG n 
1 598  PRO n 
1 599  VAL n 
1 600  LEU n 
1 601  TRP n 
1 602  VAL n 
1 603  GLY n 
1 604  VAL n 
1 605  SER n 
1 606  MET n 
1 607  GLN n 
1 608  PHE n 
1 609  ILE n 
1 610  PRO n 
1 611  ALA n 
1 612  GLU n 
1 613  ILE n 
1 614  PRO n 
1 615  ARG n 
1 616  SER n 
1 617  ALA n 
1 618  PHE n 
1 619  GLU n 
1 620  CYS n 
1 621  ARG n 
1 622  GLU n 
1 623  GLN n 
1 624  VAL n 
1 625  VAL n 
1 626  SER n 
1 627  GLU n 
1 628  GLN n 
1 629  THR n 
1 630  LEU n 
1 631  VAL n 
1 632  GLN n 
1 633  SER n 
1 634  ASN n 
1 635  ILE n 
1 636  CYS n 
1 637  LEU n 
1 638  TYR n 
1 639  ILE n 
1 640  ASP n 
1 641  LYS n 
1 642  ARG n 
1 643  SER n 
1 644  LYS n 
1 645  ASN n 
1 646  LEU n 
1 647  LEU n 
1 648  GLY n 
1 649  SER n 
1 650  ARG n 
1 651  ASP n 
1 652  LEU n 
1 653  GLN n 
1 654  SER n 
1 655  SER n 
1 656  VAL n 
1 657  THR n 
1 658  LEU n 
1 659  ASP n 
1 660  LEU n 
1 661  ALA n 
1 662  LEU n 
1 663  ASP n 
1 664  PRO n 
1 665  GLY n 
1 666  ARG n 
1 667  LEU n 
1 668  SER n 
1 669  PRO n 
1 670  ARG n 
1 671  ALA n 
1 672  THR n 
1 673  PHE n 
1 674  GLN n 
1 675  GLU n 
1 676  THR n 
1 677  LYS n 
1 678  ASN n 
1 679  ARG n 
1 680  SER n 
1 681  LEU n 
1 682  SER n 
1 683  ARG n 
1 684  VAL n 
1 685  ARG n 
1 686  VAL n 
1 687  LEU n 
1 688  GLY n 
1 689  LEU n 
1 690  LYS n 
1 691  ALA n 
1 692  HIS n 
1 693  CYS n 
1 694  GLU n 
1 695  ASN n 
1 696  PHE n 
1 697  ASN n 
1 698  LEU n 
1 699  LEU n 
1 700  LEU n 
1 701  PRO n 
1 702  SER n 
1 703  CYS n 
1 704  VAL n 
1 705  GLU n 
1 706  ASP n 
1 707  SER n 
1 708  VAL n 
1 709  THR n 
1 710  PRO n 
1 711  ILE n 
1 712  THR n 
1 713  LEU n 
1 714  ARG n 
1 715  LEU n 
1 716  ASN n 
1 717  PHE n 
1 718  THR n 
1 719  LEU n 
1 720  VAL n 
1 721  GLY n 
1 722  LYS n 
1 723  PRO n 
1 724  LEU n 
1 725  LEU n 
1 726  ALA n 
1 727  PHE n 
1 728  ARG n 
1 729  ASN n 
1 730  LEU n 
1 731  ARG n 
1 732  PRO n 
1 733  MET n 
1 734  LEU n 
1 735  ALA n 
1 736  ALA n 
1 737  ASP n 
1 738  ALA n 
1 739  GLN n 
1 740  ARG n 
1 741  TYR n 
1 742  PHE n 
1 743  THR n 
1 744  ALA n 
1 745  SER n 
1 746  LEU n 
1 747  PRO n 
1 748  PHE n 
1 749  GLU n 
1 750  LYS n 
1 751  ASN n 
1 752  CYS n 
1 753  GLY n 
1 754  ALA n 
1 755  ASP n 
1 756  HIS n 
1 757  ILE n 
1 758  CYS n 
1 759  GLN n 
1 760  ASP n 
1 761  ASN n 
1 762  LEU n 
1 763  GLY n 
1 764  ILE n 
1 765  SER n 
1 766  PHE n 
1 767  SER n 
1 768  PHE n 
1 769  PRO n 
1 770  GLY n 
1 771  LEU n 
1 772  LYS n 
1 773  SER n 
1 774  LEU n 
1 775  LEU n 
1 776  VAL n 
1 777  GLY n 
1 778  SER n 
1 779  ASN n 
1 780  LEU n 
1 781  GLU n 
1 782  LEU n 
1 783  ASN n 
1 784  ALA n 
1 785  GLU n 
1 786  VAL n 
1 787  MET n 
1 788  VAL n 
1 789  TRP n 
1 790  ASN n 
1 791  ASP n 
1 792  GLY n 
1 793  GLU n 
1 794  ASP n 
1 795  SER n 
1 796  TYR n 
1 797  GLY n 
1 798  THR n 
1 799  THR n 
1 800  ILE n 
1 801  THR n 
1 802  PHE n 
1 803  SER n 
1 804  HIS n 
1 805  PRO n 
1 806  ALA n 
1 807  GLY n 
1 808  LEU n 
1 809  SER n 
1 810  TYR n 
1 811  ARG n 
1 812  TYR n 
1 813  VAL n 
1 814  ALA n 
1 815  GLU n 
1 816  GLY n 
1 817  GLN n 
1 818  LYS n 
1 819  GLN n 
1 820  GLY n 
1 821  GLN n 
1 822  LEU n 
1 823  ARG n 
1 824  SER n 
1 825  LEU n 
1 826  HIS n 
1 827  LEU n 
1 828  THR n 
1 829  CYS n 
1 830  ASP n 
1 831  SER n 
1 832  ALA n 
1 833  PRO n 
1 834  VAL n 
1 835  GLY n 
1 836  SER n 
1 837  GLN n 
1 838  GLY n 
1 839  THR n 
1 840  TRP n 
1 841  SER n 
1 842  THR n 
1 843  SER n 
1 844  CYS n 
1 845  ARG n 
1 846  ILE n 
1 847  ASN n 
1 848  HIS n 
1 849  LEU n 
1 850  ILE n 
1 851  PHE n 
1 852  ARG n 
1 853  GLY n 
1 854  GLY n 
1 855  ALA n 
1 856  GLN n 
1 857  ILE n 
1 858  THR n 
1 859  PHE n 
1 860  LEU n 
1 861  ALA n 
1 862  THR n 
1 863  PHE n 
1 864  ASP n 
1 865  VAL n 
1 866  SER n 
1 867  PRO n 
1 868  LYS n 
1 869  ALA n 
1 870  VAL n 
1 871  LEU n 
1 872  GLY n 
1 873  ASP n 
1 874  ARG n 
1 875  LEU n 
1 876  LEU n 
1 877  LEU n 
1 878  THR n 
1 879  ALA n 
1 880  ASN n 
1 881  VAL n 
1 882  SER n 
1 883  SER n 
1 884  GLU n 
1 885  ASN n 
1 886  ASN n 
1 887  THR n 
1 888  PRO n 
1 889  ARG n 
1 890  THR n 
1 891  SER n 
1 892  LYS n 
1 893  THR n 
1 894  THR n 
1 895  PHE n 
1 896  GLN n 
1 897  LEU n 
1 898  GLU n 
1 899  LEU n 
1 900  PRO n 
1 901  VAL n 
1 902  LYS n 
1 903  TYR n 
1 904  ALA n 
1 905  VAL n 
1 906  TYR n 
1 907  THR n 
1 908  VAL n 
1 909  VAL n 
1 910  SER n 
1 911  SER n 
1 912  HIS n 
1 913  GLU n 
1 914  GLN n 
1 915  PHE n 
1 916  THR n 
1 917  LYS n 
1 918  TYR n 
1 919  LEU n 
1 920  ASN n 
1 921  PHE n 
1 922  SER n 
1 923  GLU n 
1 924  SER n 
1 925  GLU n 
1 926  GLU n 
1 927  LYS n 
1 928  GLU n 
1 929  SER n 
1 930  HIS n 
1 931  VAL n 
1 932  ALA n 
1 933  MET n 
1 934  HIS n 
1 935  ARG n 
1 936  TYR n 
1 937  GLN n 
1 938  VAL n 
1 939  ASN n 
1 940  ASN n 
1 941  LEU n 
1 942  GLY n 
1 943  GLN n 
1 944  ARG n 
1 945  ASP n 
1 946  LEU n 
1 947  PRO n 
1 948  VAL n 
1 949  SER n 
1 950  ILE n 
1 951  ASN n 
1 952  PHE n 
1 953  TRP n 
1 954  VAL n 
1 955  PRO n 
1 956  VAL n 
1 957  GLU n 
1 958  LEU n 
1 959  ASN n 
1 960  GLN n 
1 961  GLU n 
1 962  ALA n 
1 963  VAL n 
1 964  TRP n 
1 965  MET n 
1 966  ASP n 
1 967  VAL n 
1 968  GLU n 
1 969  VAL n 
1 970  SER n 
1 971  HIS n 
1 972  PRO n 
1 973  GLN n 
1 974  ASN n 
1 975  PRO n 
1 976  SER n 
1 977  LEU n 
1 978  ARG n 
1 979  CYS n 
1 980  SER n 
1 981  SER n 
1 982  GLU n 
1 983  LYS n 
1 984  ILE n 
1 985  ALA n 
1 986  PRO n 
1 987  PRO n 
1 988  ALA n 
1 989  SER n 
1 990  ASP n 
1 991  PHE n 
1 992  LEU n 
1 993  ALA n 
1 994  HIS n 
1 995  ILE n 
1 996  GLN n 
1 997  LYS n 
1 998  ASN n 
1 999  PRO n 
1 1000 VAL n 
1 1001 LEU n 
1 1002 ASP n 
1 1003 CYS n 
1 1004 SER n 
1 1005 ILE n 
1 1006 ALA n 
1 1007 GLY n 
1 1008 CYS n 
1 1009 LEU n 
1 1010 ARG n 
1 1011 PHE n 
1 1012 ARG n 
1 1013 CYS n 
1 1014 ASP n 
1 1015 VAL n 
1 1016 PRO n 
1 1017 SER n 
1 1018 PHE n 
1 1019 SER n 
1 1020 VAL n 
1 1021 GLN n 
1 1022 GLU n 
1 1023 GLU n 
1 1024 LEU n 
1 1025 ASP n 
1 1026 PHE n 
1 1027 THR n 
1 1028 LEU n 
1 1029 LYS n 
1 1030 GLY n 
1 1031 ASN n 
1 1032 LEU n 
1 1033 SER n 
1 1034 PHE n 
1 1035 GLY n 
1 1036 TRP n 
1 1037 VAL n 
1 1038 ARG n 
1 1039 GLN n 
1 1040 ILE n 
1 1041 LEU n 
1 1042 GLN n 
1 1043 LYS n 
1 1044 LYS n 
1 1045 VAL n 
1 1046 SER n 
1 1047 VAL n 
1 1048 VAL n 
1 1049 SER n 
1 1050 VAL n 
1 1051 ALA n 
1 1052 GLU n 
1 1053 ILE n 
1 1054 THR n 
1 1055 PHE n 
1 1056 ASP n 
1 1057 THR n 
1 1058 SER n 
1 1059 VAL n 
1 1060 TYR n 
1 1061 SER n 
1 1062 GLN n 
1 1063 LEU n 
1 1064 PRO n 
1 1065 GLY n 
1 1066 GLN n 
1 1067 GLU n 
1 1068 ALA n 
1 1069 PHE n 
1 1070 MET n 
1 1071 ARG n 
1 1072 ALA n 
1 1073 GLN n 
1 1074 THR n 
1 1075 THR n 
1 1076 THR n 
1 1077 VAL n 
1 1078 LEU n 
1 1079 GLU n 
1 1080 LYS n 
1 1081 TYR n 
1 1082 LYS n 
1 1083 VAL n 
1 1084 HIS n 
1 1085 GLY n 
1 1086 CYS n 
1 1087 GLY n 
1 1088 GLY n 
1 1089 LEU n 
1 1090 GLU n 
1 1091 ASN n 
1 1092 LEU n 
1 1093 TYR n 
1 1094 PHE n 
1 1095 GLN n 
2 1    GLN n 
2 2    GLU n 
2 3    CYS n 
2 4    THR n 
2 5    LYS n 
2 6    PHE n 
2 7    LYS n 
2 8    VAL n 
2 9    SER n 
2 10   SER n 
2 11   CYS n 
2 12   ARG n 
2 13   GLU n 
2 14   CYS n 
2 15   ILE n 
2 16   GLU n 
2 17   SER n 
2 18   GLY n 
2 19   PRO n 
2 20   GLY n 
2 21   CYS n 
2 22   THR n 
2 23   TRP n 
2 24   CYS n 
2 25   GLN n 
2 26   LYS n 
2 27   LEU n 
2 28   ASN n 
2 29   PHE n 
2 30   THR n 
2 31   GLY n 
2 32   PRO n 
2 33   GLY n 
2 34   ASP n 
2 35   PRO n 
2 36   ASP n 
2 37   SER n 
2 38   ILE n 
2 39   ARG n 
2 40   CYS n 
2 41   ASP n 
2 42   THR n 
2 43   ARG n 
2 44   PRO n 
2 45   GLN n 
2 46   LEU n 
2 47   LEU n 
2 48   MET n 
2 49   ARG n 
2 50   GLY n 
2 51   CYS n 
2 52   ALA n 
2 53   ALA n 
2 54   ASP n 
2 55   ASP n 
2 56   ILE n 
2 57   MET n 
2 58   ASP n 
2 59   PRO n 
2 60   THR n 
2 61   SER n 
2 62   LEU n 
2 63   ALA n 
2 64   GLU n 
2 65   THR n 
2 66   GLN n 
2 67   GLU n 
2 68   ASP n 
2 69   HIS n 
2 70   ASN n 
2 71   GLY n 
2 72   GLY n 
2 73   GLN n 
2 74   LYS n 
2 75   GLN n 
2 76   LEU n 
2 77   SER n 
2 78   PRO n 
2 79   GLN n 
2 80   LYS n 
2 81   VAL n 
2 82   THR n 
2 83   LEU n 
2 84   TYR n 
2 85   LEU n 
2 86   ARG n 
2 87   PRO n 
2 88   GLY n 
2 89   GLN n 
2 90   ALA n 
2 91   ALA n 
2 92   ALA n 
2 93   PHE n 
2 94   ASN n 
2 95   VAL n 
2 96   THR n 
2 97   PHE n 
2 98   ARG n 
2 99   ARG n 
2 100  ALA n 
2 101  LYS n 
2 102  GLY n 
2 103  TYR n 
2 104  PRO n 
2 105  ILE n 
2 106  ASP n 
2 107  LEU n 
2 108  TYR n 
2 109  TYR n 
2 110  LEU n 
2 111  MET n 
2 112  ASP n 
2 113  LEU n 
2 114  SER n 
2 115  TYR n 
2 116  SER n 
2 117  MET n 
2 118  LEU n 
2 119  ASP n 
2 120  ASP n 
2 121  LEU n 
2 122  ARG n 
2 123  ASN n 
2 124  VAL n 
2 125  LYS n 
2 126  LYS n 
2 127  LEU n 
2 128  GLY n 
2 129  GLY n 
2 130  ASP n 
2 131  LEU n 
2 132  LEU n 
2 133  ARG n 
2 134  ALA n 
2 135  LEU n 
2 136  ASN n 
2 137  GLU n 
2 138  ILE n 
2 139  THR n 
2 140  GLU n 
2 141  SER n 
2 142  GLY n 
2 143  ARG n 
2 144  ILE n 
2 145  GLY n 
2 146  PHE n 
2 147  GLY n 
2 148  SER n 
2 149  PHE n 
2 150  VAL n 
2 151  ASP n 
2 152  LYS n 
2 153  THR n 
2 154  VAL n 
2 155  LEU n 
2 156  PRO n 
2 157  PHE n 
2 158  VAL n 
2 159  ASN n 
2 160  THR n 
2 161  HIS n 
2 162  PRO n 
2 163  ASP n 
2 164  LYS n 
2 165  LEU n 
2 166  ARG n 
2 167  ASN n 
2 168  PRO n 
2 169  CYS n 
2 170  PRO n 
2 171  ASN n 
2 172  LYS n 
2 173  GLU n 
2 174  LYS n 
2 175  GLU n 
2 176  CYS n 
2 177  GLN n 
2 178  PRO n 
2 179  PRO n 
2 180  PHE n 
2 181  ALA n 
2 182  PHE n 
2 183  ARG n 
2 184  HIS n 
2 185  VAL n 
2 186  LEU n 
2 187  LYS n 
2 188  LEU n 
2 189  THR n 
2 190  ASN n 
2 191  ASN n 
2 192  SER n 
2 193  ASN n 
2 194  GLN n 
2 195  PHE n 
2 196  GLN n 
2 197  THR n 
2 198  GLU n 
2 199  VAL n 
2 200  GLY n 
2 201  LYS n 
2 202  GLN n 
2 203  LEU n 
2 204  ILE n 
2 205  SER n 
2 206  GLY n 
2 207  ASN n 
2 208  LEU n 
2 209  ASP n 
2 210  ALA n 
2 211  PRO n 
2 212  GLU n 
2 213  GLY n 
2 214  GLY n 
2 215  LEU n 
2 216  ASP n 
2 217  ALA n 
2 218  MET n 
2 219  MET n 
2 220  GLN n 
2 221  VAL n 
2 222  ALA n 
2 223  ALA n 
2 224  CYS n 
2 225  PRO n 
2 226  GLU n 
2 227  GLU n 
2 228  ILE n 
2 229  GLY n 
2 230  TRP n 
2 231  ARG n 
2 232  ASN n 
2 233  VAL n 
2 234  THR n 
2 235  ARG n 
2 236  LEU n 
2 237  LEU n 
2 238  VAL n 
2 239  PHE n 
2 240  ALA n 
2 241  THR n 
2 242  ASP n 
2 243  ASP n 
2 244  GLY n 
2 245  PHE n 
2 246  HIS n 
2 247  PHE n 
2 248  ALA n 
2 249  GLY n 
2 250  ASP n 
2 251  GLY n 
2 252  LYS n 
2 253  LEU n 
2 254  GLY n 
2 255  ALA n 
2 256  ILE n 
2 257  LEU n 
2 258  THR n 
2 259  PRO n 
2 260  ASN n 
2 261  ASP n 
2 262  GLY n 
2 263  ARG n 
2 264  CYS n 
2 265  HIS n 
2 266  LEU n 
2 267  GLU n 
2 268  ASP n 
2 269  ASN n 
2 270  LEU n 
2 271  TYR n 
2 272  LYS n 
2 273  ARG n 
2 274  SER n 
2 275  ASN n 
2 276  GLU n 
2 277  PHE n 
2 278  ASP n 
2 279  TYR n 
2 280  PRO n 
2 281  SER n 
2 282  VAL n 
2 283  GLY n 
2 284  GLN n 
2 285  LEU n 
2 286  ALA n 
2 287  HIS n 
2 288  LYS n 
2 289  LEU n 
2 290  ALA n 
2 291  GLU n 
2 292  ASN n 
2 293  ASN n 
2 294  ILE n 
2 295  GLN n 
2 296  PRO n 
2 297  ILE n 
2 298  PHE n 
2 299  ALA n 
2 300  VAL n 
2 301  THR n 
2 302  SER n 
2 303  ARG n 
2 304  MET n 
2 305  VAL n 
2 306  LYS n 
2 307  THR n 
2 308  TYR n 
2 309  GLU n 
2 310  LYS n 
2 311  LEU n 
2 312  THR n 
2 313  GLU n 
2 314  ILE n 
2 315  ILE n 
2 316  PRO n 
2 317  LYS n 
2 318  SER n 
2 319  ALA n 
2 320  VAL n 
2 321  GLY n 
2 322  GLU n 
2 323  LEU n 
2 324  SER n 
2 325  GLU n 
2 326  ASP n 
2 327  SER n 
2 328  SER n 
2 329  ASN n 
2 330  VAL n 
2 331  VAL n 
2 332  GLN n 
2 333  LEU n 
2 334  ILE n 
2 335  LYS n 
2 336  ASN n 
2 337  ALA n 
2 338  TYR n 
2 339  ASN n 
2 340  LYS n 
2 341  LEU n 
2 342  SER n 
2 343  SER n 
2 344  ARG n 
2 345  VAL n 
2 346  PHE n 
2 347  LEU n 
2 348  ASP n 
2 349  HIS n 
2 350  ASN n 
2 351  ALA n 
2 352  LEU n 
2 353  PRO n 
2 354  ASP n 
2 355  THR n 
2 356  LEU n 
2 357  LYS n 
2 358  VAL n 
2 359  THR n 
2 360  TYR n 
2 361  ASP n 
2 362  SER n 
2 363  PHE n 
2 364  CYS n 
2 365  SER n 
2 366  ASN n 
2 367  GLY n 
2 368  VAL n 
2 369  THR n 
2 370  HIS n 
2 371  ARG n 
2 372  ASN n 
2 373  GLN n 
2 374  PRO n 
2 375  ARG n 
2 376  GLY n 
2 377  ASP n 
2 378  CYS n 
2 379  ASP n 
2 380  GLY n 
2 381  VAL n 
2 382  GLN n 
2 383  ILE n 
2 384  ASN n 
2 385  VAL n 
2 386  PRO n 
2 387  ILE n 
2 388  THR n 
2 389  PHE n 
2 390  GLN n 
2 391  VAL n 
2 392  LYS n 
2 393  VAL n 
2 394  THR n 
2 395  ALA n 
2 396  THR n 
2 397  GLU n 
2 398  CYS n 
2 399  ILE n 
2 400  GLN n 
2 401  GLU n 
2 402  GLN n 
2 403  SER n 
2 404  PHE n 
2 405  VAL n 
2 406  ILE n 
2 407  ARG n 
2 408  ALA n 
2 409  LEU n 
2 410  GLY n 
2 411  PHE n 
2 412  THR n 
2 413  ASP n 
2 414  ILE n 
2 415  VAL n 
2 416  THR n 
2 417  VAL n 
2 418  GLN n 
2 419  VAL n 
2 420  LEU n 
2 421  PRO n 
2 422  GLN n 
2 423  CYS n 
2 424  GLU n 
2 425  CYS n 
2 426  ARG n 
2 427  CYS n 
2 428  ARG n 
2 429  ASP n 
2 430  GLN n 
2 431  SER n 
2 432  ARG n 
2 433  ASP n 
2 434  ARG n 
2 435  SER n 
2 436  LEU n 
2 437  CYS n 
2 438  HIS n 
2 439  GLY n 
2 440  LYS n 
2 441  GLY n 
2 442  PHE n 
2 443  LEU n 
2 444  GLU n 
2 445  CYS n 
2 446  GLY n 
2 447  ILE n 
2 448  CYS n 
2 449  ARG n 
2 450  CYS n 
2 451  ASP n 
2 452  THR n 
2 453  GLY n 
2 454  TYR n 
2 455  ILE n 
2 456  GLY n 
2 457  LYS n 
2 458  ASN n 
2 459  CYS n 
2 460  GLU n 
2 461  CYS n 
2 462  GLN n 
2 463  THR n 
2 464  GLN n 
2 465  GLY n 
2 466  ARG n 
2 467  SER n 
2 468  SER n 
2 469  GLN n 
2 470  GLU n 
2 471  LEU n 
2 472  GLU n 
2 473  GLY n 
2 474  SER n 
2 475  CYS n 
2 476  ARG n 
2 477  LYS n 
2 478  ASP n 
2 479  ASN n 
2 480  ASN n 
2 481  SER n 
2 482  ILE n 
2 483  ILE n 
2 484  CYS n 
2 485  SER n 
2 486  GLY n 
2 487  LEU n 
2 488  GLY n 
2 489  ASP n 
2 490  CYS n 
2 491  VAL n 
2 492  CYS n 
2 493  GLY n 
2 494  GLN n 
2 495  CYS n 
2 496  LEU n 
2 497  CYS n 
2 498  HIS n 
2 499  THR n 
2 500  SER n 
2 501  ASP n 
2 502  VAL n 
2 503  PRO n 
2 504  GLY n 
2 505  LYS n 
2 506  LEU n 
2 507  ILE n 
2 508  TYR n 
2 509  GLY n 
2 510  GLN n 
2 511  TYR n 
2 512  CYS n 
2 513  GLU n 
2 514  CYS n 
2 515  ASP n 
2 516  THR n 
2 517  ILE n 
2 518  ASN n 
2 519  CYS n 
2 520  GLU n 
2 521  ARG n 
2 522  TYR n 
2 523  ASN n 
2 524  GLY n 
2 525  GLN n 
2 526  VAL n 
2 527  CYS n 
2 528  GLY n 
2 529  GLY n 
2 530  PRO n 
2 531  GLY n 
2 532  ARG n 
2 533  GLY n 
2 534  LEU n 
2 535  CYS n 
2 536  PHE n 
2 537  CYS n 
2 538  GLY n 
2 539  LYS n 
2 540  CYS n 
2 541  ARG n 
2 542  CYS n 
2 543  HIS n 
2 544  PRO n 
2 545  GLY n 
2 546  PHE n 
2 547  GLU n 
2 548  GLY n 
2 549  SER n 
2 550  ALA n 
2 551  CYS n 
2 552  GLN n 
2 553  CYS n 
2 554  GLU n 
2 555  ARG n 
2 556  THR n 
2 557  THR n 
2 558  GLU n 
2 559  GLY n 
2 560  CYS n 
2 561  LEU n 
2 562  ASN n 
2 563  PRO n 
2 564  ARG n 
2 565  ARG n 
2 566  VAL n 
2 567  GLU n 
2 568  CYS n 
2 569  SER n 
2 570  GLY n 
2 571  ARG n 
2 572  GLY n 
2 573  ARG n 
2 574  CYS n 
2 575  ARG n 
2 576  CYS n 
2 577  ASN n 
2 578  VAL n 
2 579  CYS n 
2 580  GLU n 
2 581  CYS n 
2 582  HIS n 
2 583  SER n 
2 584  GLY n 
2 585  TYR n 
2 586  GLN n 
2 587  LEU n 
2 588  PRO n 
2 589  LEU n 
2 590  CYS n 
2 591  GLN n 
2 592  GLU n 
2 593  CYS n 
2 594  PRO n 
2 595  GLY n 
2 596  CYS n 
2 597  PRO n 
2 598  SER n 
2 599  PRO n 
2 600  CYS n 
2 601  GLY n 
2 602  LYS n 
2 603  TYR n 
2 604  ILE n 
2 605  SER n 
2 606  CYS n 
2 607  ALA n 
2 608  GLU n 
2 609  CYS n 
2 610  LEU n 
2 611  LYS n 
2 612  PHE n 
2 613  GLU n 
2 614  LYS n 
2 615  GLY n 
2 616  PRO n 
2 617  PHE n 
2 618  GLY n 
2 619  LYS n 
2 620  ASN n 
2 621  CYS n 
2 622  SER n 
2 623  ALA n 
2 624  ALA n 
2 625  CYS n 
2 626  PRO n 
2 627  GLY n 
2 628  LEU n 
2 629  GLN n 
2 630  LEU n 
2 631  SER n 
2 632  ASN n 
2 633  ASN n 
2 634  PRO n 
2 635  VAL n 
2 636  LYS n 
2 637  GLY n 
2 638  ARG n 
2 639  THR n 
2 640  CYS n 
2 641  LYS n 
2 642  GLU n 
2 643  ARG n 
2 644  ASP n 
2 645  SER n 
2 646  GLU n 
2 647  GLY n 
2 648  CYS n 
2 649  TRP n 
2 650  VAL n 
2 651  ALA n 
2 652  TYR n 
2 653  THR n 
2 654  LEU n 
2 655  GLU n 
2 656  GLN n 
2 657  GLN n 
2 658  ASP n 
2 659  GLY n 
2 660  MET n 
2 661  ASP n 
2 662  ARG n 
2 663  TYR n 
2 664  LEU n 
2 665  ILE n 
2 666  TYR n 
2 667  VAL n 
2 668  ASP n 
2 669  GLU n 
2 670  SER n 
2 671  ARG n 
2 672  GLU n 
2 673  CYS n 
2 674  VAL n 
2 675  ALA n 
2 676  GLY n 
2 677  PRO n 
2 678  ASP n 
2 679  GLY n 
2 680  CYS n 
2 681  GLY n 
2 682  GLU n 
2 683  ASN n 
2 684  LEU n 
2 685  TYR n 
2 686  PHE n 
2 687  GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'CD11C, ITGAX'      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 'Cricetulus griseus' 
10029 ? ? ? ? ? ? 'CHO Lec 3.2.8.1' ? ? ? ? ? ? ? plasmid ? ? ? pcDNA3.1  ? ? 
2 1 sample ? ? ? human ? 'CD18, ITGB2, MFI7' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 'Cricetulus griseus' 
10029 ? ? ? ? ? ? 'CHO Lec 3.2.8.1' ? ? ? ? ? ? ? plasmid ? ? ? pEF1/puro ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ITAX_HUMAN P20702 1 
;FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLAST
TSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVIS
QFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITD
GKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGT
ETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQS
LVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPR
GWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSS
RLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYID
KRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLV
GKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTI
TFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTAN
VSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQ
EAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQI
LQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKVH
;
20 ? 
2 UNP ITB2_HUMAN P05107 2 
;QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQK
VTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNT
HPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFA
TDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAV
GELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQ
EQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNN
SIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGC
LNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTC
KERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN
;
23 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3K72 A 1 ? 1084 ? P20702 20 ? 1103 ? 1 1084 
2 2 3K72 B 1 ? 683  ? P05107 23 ? 700  ? 1 683  
3 1 3K72 C 1 ? 1084 ? P20702 20 ? 1103 ? 1 1084 
4 2 3K72 D 1 ? 683  ? P05107 23 ? 700  ? 1 683  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3K72 GLY A 1085 ? UNP P20702 ? ? 'expression tag' 1085 1  
1 3K72 CYS A 1086 ? UNP P20702 ? ? 'expression tag' 1086 2  
1 3K72 GLY A 1087 ? UNP P20702 ? ? 'expression tag' 1087 3  
1 3K72 GLY A 1088 ? UNP P20702 ? ? 'expression tag' 1088 4  
1 3K72 LEU A 1089 ? UNP P20702 ? ? 'expression tag' 1089 5  
1 3K72 GLU A 1090 ? UNP P20702 ? ? 'expression tag' 1090 6  
1 3K72 ASN A 1091 ? UNP P20702 ? ? 'expression tag' 1091 7  
1 3K72 LEU A 1092 ? UNP P20702 ? ? 'expression tag' 1092 8  
1 3K72 TYR A 1093 ? UNP P20702 ? ? 'expression tag' 1093 9  
1 3K72 PHE A 1094 ? UNP P20702 ? ? 'expression tag' 1094 10 
1 3K72 GLN A 1095 ? UNP P20702 ? ? 'expression tag' 1095 11 
2 3K72 ASP B 678  ? UNP P05107 ? ? 'expression tag' 678  12 
2 3K72 GLY B 679  ? UNP P05107 ? ? 'expression tag' 679  13 
2 3K72 CYS B 680  ? UNP P05107 ? ? 'expression tag' 680  14 
2 3K72 GLY B 681  ? UNP P05107 ? ? 'expression tag' 681  15 
2 3K72 GLU B 682  ? UNP P05107 ? ? 'expression tag' 682  16 
2 3K72 LEU B 684  ? UNP P05107 ? ? 'expression tag' 684  17 
2 3K72 TYR B 685  ? UNP P05107 ? ? 'expression tag' 685  18 
2 3K72 PHE B 686  ? UNP P05107 ? ? 'expression tag' 686  19 
2 3K72 GLN B 687  ? UNP P05107 ? ? 'expression tag' 687  20 
3 3K72 GLY C 1085 ? UNP P20702 ? ? 'expression tag' 1085 21 
3 3K72 CYS C 1086 ? UNP P20702 ? ? 'expression tag' 1086 22 
3 3K72 GLY C 1087 ? UNP P20702 ? ? 'expression tag' 1087 23 
3 3K72 GLY C 1088 ? UNP P20702 ? ? 'expression tag' 1088 24 
3 3K72 LEU C 1089 ? UNP P20702 ? ? 'expression tag' 1089 25 
3 3K72 GLU C 1090 ? UNP P20702 ? ? 'expression tag' 1090 26 
3 3K72 ASN C 1091 ? UNP P20702 ? ? 'expression tag' 1091 27 
3 3K72 LEU C 1092 ? UNP P20702 ? ? 'expression tag' 1092 28 
3 3K72 TYR C 1093 ? UNP P20702 ? ? 'expression tag' 1093 29 
3 3K72 PHE C 1094 ? UNP P20702 ? ? 'expression tag' 1094 30 
3 3K72 GLN C 1095 ? UNP P20702 ? ? 'expression tag' 1095 31 
4 3K72 ASP D 678  ? UNP P05107 ? ? 'expression tag' 678  32 
4 3K72 GLY D 679  ? UNP P05107 ? ? 'expression tag' 679  33 
4 3K72 CYS D 680  ? UNP P05107 ? ? 'expression tag' 680  34 
4 3K72 GLY D 681  ? UNP P05107 ? ? 'expression tag' 681  35 
4 3K72 GLU D 682  ? UNP P05107 ? ? 'expression tag' 682  36 
4 3K72 LEU D 684  ? UNP P05107 ? ? 'expression tag' 684  37 
4 3K72 TYR D 685  ? UNP P05107 ? ? 'expression tag' 685  38 
4 3K72 PHE D 686  ? UNP P05107 ? ? 'expression tag' 686  39 
4 3K72 GLN D 687  ? UNP P05107 ? ? 'expression tag' 687  40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CA  non-polymer                   . 'CALCIUM ION'                            ? 'Ca 2'           40.078  
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3K72 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.54 
_exptl_crystal.density_percent_sol   72.91 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pdbx_details    '0.915M sodium/potassium phosphate, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    
'double crystal monochromator and K-B pair of biomorph mirrors for vertical and horizontal focusing' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97928 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97928 
# 
_reflns.entry_id                     3K72 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.7 
_reflns.number_obs                   76217 
_reflns.number_all                   76217 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.104 
_reflns.pdbx_Rsym_value              0.104 
_reflns.pdbx_netI_over_sigmaI        12.6 
_reflns.B_iso_Wilson_estimate        124.3 
_reflns.pdbx_redundancy              7.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.7 
_reflns_shell.d_res_low              3.86 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           1.355 
_reflns_shell.pdbx_Rsym_value        1.355 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        7.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      8974 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3K72 
_refine.ls_number_reflns_obs                     76217 
_refine.ls_number_reflns_all                     76217 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.475 
_refine.ls_d_res_high                            3.700 
_refine.ls_percent_reflns_obs                    99.38 
_refine.ls_R_factor_obs                          0.3152 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.3150 
_refine.ls_R_factor_R_free                       0.3346 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.11 
_refine.ls_number_reflns_R_free                  843 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.381 
_refine.solvent_model_param_bsol                 150.000 
_refine.pdbx_solvent_vdw_probe_radii             0.80 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  MLHL 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.69 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3K72 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            0.73 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        23970 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         412 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               24382 
_refine_hist.d_res_high                       3.700 
_refine_hist.d_res_low                        48.475 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.093  ? ? 48556 'X-RAY DIFFRACTION' ? 
f_angle_d          1.179  ? ? 87257 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 19.718 ? ? 12299 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.055  ? ? 3798  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 7656  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 5796 ?     ? POSITIONAL 1  1  'X-RAY DIFFRACTION' ? ? ? 
2 C 5796 0.298 ? POSITIONAL 1  2  'X-RAY DIFFRACTION' ? ? ? 
1 A 2275 ?     ? POSITIONAL 2  3  'X-RAY DIFFRACTION' ? ? ? 
2 C 2275 0.053 ? POSITIONAL 2  4  'X-RAY DIFFRACTION' ? ? ? 
1 A 2158 ?     ? POSITIONAL 3  5  'X-RAY DIFFRACTION' ? ? ? 
2 C 2158 0.625 ? POSITIONAL 3  6  'X-RAY DIFFRACTION' ? ? ? 
1 A 2709 ?     ? POSITIONAL 4  7  'X-RAY DIFFRACTION' ? ? ? 
2 C 2709 0.160 ? POSITIONAL 4  8  'X-RAY DIFFRACTION' ? ? ? 
1 B 826  ?     ? POSITIONAL 5  9  'X-RAY DIFFRACTION' ? ? ? 
2 D 826  0.005 ? POSITIONAL 5  10 'X-RAY DIFFRACTION' ? ? ? 
1 B 1720 ?     ? POSITIONAL 6  11 'X-RAY DIFFRACTION' ? ? ? 
2 D 1720 0.096 ? POSITIONAL 6  12 'X-RAY DIFFRACTION' ? ? ? 
1 B 366  ?     ? POSITIONAL 7  13 'X-RAY DIFFRACTION' ? ? ? 
2 D 366  0.121 ? POSITIONAL 7  14 'X-RAY DIFFRACTION' ? ? ? 
1 B 3752 ?     ? POSITIONAL 8  15 'X-RAY DIFFRACTION' ? ? ? 
2 D 3752 0.064 ? POSITIONAL 8  16 'X-RAY DIFFRACTION' ? ? ? 
1 B 157  ?     ? POSITIONAL 9  17 'X-RAY DIFFRACTION' ? ? ? 
2 D 157  0.590 ? POSITIONAL 9  18 'X-RAY DIFFRACTION' ? ? ? 
1 B 534  ?     ? POSITIONAL 10 19 'X-RAY DIFFRACTION' ? ? ? 
2 D 534  0.301 ? POSITIONAL 10 20 'X-RAY DIFFRACTION' ? ? ? 
1 B 479  ?     ? POSITIONAL 11 21 'X-RAY DIFFRACTION' ? ? ? 
2 D 479  0.009 ? POSITIONAL 11 22 'X-RAY DIFFRACTION' ? ? ? 
1 B 568  ?     ? POSITIONAL 12 23 'X-RAY DIFFRACTION' ? ? ? 
2 D 568  0.014 ? POSITIONAL 12 24 'X-RAY DIFFRACTION' ? ? ? 
1 B 57   ?     ? POSITIONAL 13 25 'X-RAY DIFFRACTION' ? ? ? 
2 D 57   0.520 ? POSITIONAL 13 26 'X-RAY DIFFRACTION' ? ? ? 
1 B 1114 ?     ? POSITIONAL 14 27 'X-RAY DIFFRACTION' ? ? ? 
2 D 1114 0.021 ? POSITIONAL 14 28 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 3.7000 3.9317  12402 0.4126 99.00  0.4249 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 3.9317 4.2351  12463 0.3637 99.00  0.3928 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 4.2351 4.6610  12449 0.2991 99.00  0.3708 . . 128 . . . . 'X-RAY DIFFRACTION' 
. 4.6610 5.3348  12548 0.2645 99.00  0.2442 . . 144 . . . . 'X-RAY DIFFRACTION' 
. 5.3348 6.7184  12585 0.2970 100.00 0.3611 . . 167 . . . . 'X-RAY DIFFRACTION' 
. 6.7184 48.4792 12927 0.2750 99.00  0.2882 . . 146 . . . . 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1  
2 ? 1  
1 ? 2  
2 ? 2  
1 ? 3  
2 ? 3  
1 ? 4  
2 ? 4  
1 ? 5  
2 ? 5  
1 ? 6  
2 ? 6  
1 ? 7  
2 ? 7  
1 ? 8  
2 ? 8  
1 ? 9  
2 ? 9  
1 ? 10 
2 ? 10 
1 ? 11 
2 ? 11 
1 ? 12 
2 ? 12 
1 ? 13 
2 ? 13 
1 ? 14 
2 ? 14 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain A and (resseq 1:126 or resseq 330:595 or resseq 2005-2007)' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain C and (resseq 1:126 or resseq 330:595 or resseq 2005-2007)' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain A and (resseq 600:617 or resseq 627:750 )'                  
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain C and (resseq 600:617 or resseq 627:750 )'                  
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain A and (resseq 760:902 )'                                    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain C and (resseq 760:902 )'                                    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain A and (resseq 903:986 or resseq 995:1081 )'                 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain C and (resseq 903:986 or resseq 995:1081 )'                 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain B and (resseq 1:56 )'                                       
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain D and (resseq 1:56 )'                                       
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain B and (resseq 60:67 or resseq 73:99 or resseq 348:423 )'    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain D and (resseq 60:67 or resseq 73:99 or resseq 348:423 )'    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain B and (resseq 436:461 )'                                    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain D and (resseq 436:461 )'                                    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain B and (resseq 102:342 or resid 2002 )'                      
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain D and (resseq 102:342 or resid 2002 )'                      
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain B and (resseq 463:473 )'                                    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain D and (resseq 463:473 )'                                    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain B and (resseq 475:512 )'                                    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain D and (resseq 475:512 )'                                    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain B and (resseq 516:550 )'                                    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain D and (resseq 516:550 )'                                    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain B and (resseq 555:592 )'                                    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain D and (resseq 555:592 )'                                    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain B and (resseq 593:597 )'                                    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain D and (resseq 593:597 )'                                    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain B and (resseq 600:673 )'                                    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain D and (resseq 600:673 )'                                    
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
12 ? 
13 ? 
14 ? 
# 
_struct.entry_id                  3K72 
_struct.title                     'Structure of integrin alphaX beta2' 
_struct.pdbx_descriptor           'Integrin alpha-X, Integrin beta-2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3K72 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'integrin, cell adhesion, cell receptor, Pyrrolidone carboxylic acid' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 4 ? 
G  N N 5 ? 
H  N N 5 ? 
I  N N 3 ? 
J  N N 4 ? 
K  N N 5 ? 
L  N N 6 ? 
M  N N 7 ? 
N  N N 7 ? 
O  N N 7 ? 
P  N N 6 ? 
Q  N N 7 ? 
R  N N 6 ? 
S  N N 8 ? 
T  N N 6 ? 
U  N N 6 ? 
V  N N 7 ? 
W  N N 7 ? 
X  N N 7 ? 
Y  N N 6 ? 
Z  N N 7 ? 
AA N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 407  ? THR A 411  ? ARG A 407  THR A 411  5 ? 5  
HELX_P HELX_P2  2  ASP A 990  ? ASN A 998  ? ASP A 990  ASN A 998  1 ? 9  
HELX_P HELX_P3  3  PHE A 1034 ? GLN A 1039 ? PHE A 1034 GLN A 1039 5 ? 6  
HELX_P HELX_P4  4  GLU A 1067 ? PHE A 1069 ? GLU A 1067 PHE A 1069 5 ? 3  
HELX_P HELX_P5  5  SER B 10   ? GLU B 16   ? SER B 10   GLU B 16   1 ? 7  
HELX_P HELX_P6  6  ASP B 36   ? ILE B 38   ? ASP B 36   ILE B 38   5 ? 3  
HELX_P HELX_P7  7  THR B 42   ? GLY B 50   ? THR B 42   GLY B 50   1 ? 9  
HELX_P HELX_P8  8  MET B 117  ? ASN B 123  ? MET B 117  ASN B 123  1 ? 7  
HELX_P HELX_P9  9  ASP B 130  ? GLU B 137  ? ASP B 130  GLU B 137  1 ? 8  
HELX_P HELX_P10 10 SER B 192  ? LYS B 201  ? SER B 192  LYS B 201  1 ? 10 
HELX_P HELX_P11 11 GLY B 213  ? ALA B 222  ? GLY B 213  ALA B 222  1 ? 10 
HELX_P HELX_P12 12 CYS B 224  ? GLY B 229  ? CYS B 224  GLY B 229  1 ? 6  
HELX_P HELX_P13 13 GLY B 249  ? ALA B 255  ? GLY B 249  ALA B 255  5 ? 7  
HELX_P HELX_P14 14 ARG B 273  ? PHE B 277  ? ARG B 273  PHE B 277  5 ? 5  
HELX_P HELX_P15 15 GLY B 283  ? ASN B 292  ? GLY B 283  ASN B 292  1 ? 10 
HELX_P HELX_P16 16 THR B 301  ? VAL B 305  ? THR B 301  VAL B 305  5 ? 5  
HELX_P HELX_P17 17 LYS B 306  ? ILE B 315  ? LYS B 306  ILE B 315  1 ? 10 
HELX_P HELX_P18 18 VAL B 331  ? ASN B 336  ? VAL B 331  ASN B 336  1 ? 6  
HELX_P HELX_P19 19 ASN B 336  ? SER B 342  ? ASN B 336  SER B 342  1 ? 7  
HELX_P HELX_P20 20 LEU B 436  ? GLY B 439  ? LEU B 436  GLY B 439  5 ? 4  
HELX_P HELX_P21 21 GLN B 469  ? GLY B 473  ? GLN B 469  GLY B 473  5 ? 5  
HELX_P HELX_P22 22 ILE B 482  ? GLY B 486  ? ILE B 482  GLY B 486  5 ? 5  
HELX_P HELX_P23 23 GLY B 528  ? ARG B 532  ? GLY B 528  ARG B 532  1 ? 5  
HELX_P HELX_P24 24 TYR B 603  ? GLU B 608  ? TYR B 603  GLU B 608  1 ? 6  
HELX_P HELX_P25 25 ARG C 407  ? THR C 411  ? ARG C 407  THR C 411  5 ? 5  
HELX_P HELX_P26 26 ASP C 990  ? ASN C 998  ? ASP C 990  ASN C 998  1 ? 9  
HELX_P HELX_P27 27 PHE C 1034 ? GLN C 1039 ? PHE C 1034 GLN C 1039 5 ? 6  
HELX_P HELX_P28 28 GLU C 1067 ? PHE C 1069 ? GLU C 1067 PHE C 1069 5 ? 3  
HELX_P HELX_P29 29 SER D 10   ? GLU D 16   ? SER D 10   GLU D 16   1 ? 7  
HELX_P HELX_P30 30 ASP D 36   ? ILE D 38   ? ASP D 36   ILE D 38   5 ? 3  
HELX_P HELX_P31 31 THR D 42   ? GLY D 50   ? THR D 42   GLY D 50   1 ? 9  
HELX_P HELX_P32 32 MET D 117  ? ASN D 123  ? MET D 117  ASN D 123  1 ? 7  
HELX_P HELX_P33 33 ASP D 130  ? GLU D 137  ? ASP D 130  GLU D 137  1 ? 8  
HELX_P HELX_P34 34 SER D 192  ? LYS D 201  ? SER D 192  LYS D 201  1 ? 10 
HELX_P HELX_P35 35 GLY D 213  ? ALA D 222  ? GLY D 213  ALA D 222  1 ? 10 
HELX_P HELX_P36 36 CYS D 224  ? GLY D 229  ? CYS D 224  GLY D 229  1 ? 6  
HELX_P HELX_P37 37 GLY D 249  ? ALA D 255  ? GLY D 249  ALA D 255  5 ? 7  
HELX_P HELX_P38 38 ARG D 273  ? PHE D 277  ? ARG D 273  PHE D 277  5 ? 5  
HELX_P HELX_P39 39 GLY D 283  ? ASN D 292  ? GLY D 283  ASN D 292  1 ? 10 
HELX_P HELX_P40 40 THR D 301  ? VAL D 305  ? THR D 301  VAL D 305  5 ? 5  
HELX_P HELX_P41 41 LYS D 306  ? ILE D 315  ? LYS D 306  ILE D 315  1 ? 10 
HELX_P HELX_P42 42 VAL D 330  ? ILE D 334  ? VAL D 330  ILE D 334  5 ? 5  
HELX_P HELX_P43 43 ASN D 336  ? SER D 342  ? ASN D 336  SER D 342  1 ? 7  
HELX_P HELX_P44 44 GLN D 469  ? GLY D 473  ? GLN D 469  GLY D 473  5 ? 5  
HELX_P HELX_P45 45 ILE D 482  ? GLY D 486  ? ILE D 482  GLY D 486  5 ? 5  
HELX_P HELX_P46 46 GLY D 528  ? ARG D 532  ? GLY D 528  ARG D 532  1 ? 5  
HELX_P HELX_P47 47 TYR D 603  ? GLU D 608  ? TYR D 603  GLU D 608  1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 50   SG  ? ? ? 1_555 A  CYS 57   SG ? ? A CYS 50   A CYS 57   1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf2  disulf ?    ? A CYS 89   SG  ? ? ? 1_555 A  CYS 107  SG ? ? A CYS 89   A CYS 107  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf3  disulf ?    ? A CYS 97   SG  ? ? ? 1_555 A  CYS 126  SG ? ? A CYS 97   A CYS 126  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf4  disulf ?    ? A CYS 476  SG  ? ? ? 1_555 A  CYS 487  SG ? ? A CYS 476  A CYS 487  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf5  disulf ?    ? A CYS 620  SG  ? ? ? 1_555 A  CYS 703  SG ? ? A CYS 620  A CYS 703  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf6  disulf ?    ? A CYS 636  SG  ? ? ? 1_555 A  CYS 693  SG ? ? A CYS 636  A CYS 693  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf7  disulf ?    ? A CYS 752  SG  ? ? ? 1_555 A  CYS 758  SG ? ? A CYS 752  A CYS 758  1_555 ? ? ? ? ? ? ? 2.014 ? ? 
disulf8  disulf ?    ? A CYS 829  SG  ? ? ? 1_555 A  CYS 844  SG ? ? A CYS 829  A CYS 844  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf9  disulf ?    ? A CYS 979  SG  ? ? ? 1_555 A  CYS 1013 SG ? ? A CYS 979  A CYS 1013 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf10 disulf ?    ? A CYS 1003 SG  ? ? ? 1_555 A  CYS 1008 SG ? ? A CYS 1003 A CYS 1008 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf11 disulf ?    ? B CYS 3    SG  ? ? ? 1_555 B  CYS 21   SG ? ? B CYS 3    B CYS 21   1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf12 disulf ?    ? B CYS 11   SG  ? ? ? 1_555 B  CYS 425  SG ? ? B CYS 11   B CYS 425  1_555 ? ? ? ? ? ? ? 2.019 ? ? 
disulf13 disulf ?    ? B CYS 14   SG  ? ? ? 1_555 B  CYS 40   SG ? ? B CYS 14   B CYS 40   1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf14 disulf ?    ? B CYS 24   SG  ? ? ? 1_555 B  CYS 51   SG ? ? B CYS 24   B CYS 51   1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf15 disulf ?    ? B CYS 169  SG  ? ? ? 1_555 B  CYS 176  SG ? ? B CYS 169  B CYS 176  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf16 disulf ?    ? B CYS 224  SG  ? ? ? 1_555 B  CYS 264  SG ? ? B CYS 224  B CYS 264  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf17 disulf ?    ? B CYS 364  SG  ? ? ? 1_555 B  CYS 378  SG ? ? B CYS 364  B CYS 378  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf18 disulf ?    ? B CYS 398  SG  ? ? ? 1_555 B  CYS 423  SG ? ? B CYS 398  B CYS 423  1_555 ? ? ? ? ? ? ? 2.059 ? ? 
disulf19 disulf ?    ? B CYS 427  SG  ? ? ? 1_555 B  CYS 445  SG ? ? B CYS 427  B CYS 445  1_555 ? ? ? ? ? ? ? 2.061 ? ? 
disulf20 disulf ?    ? B CYS 437  SG  ? ? ? 1_555 B  CYS 448  SG ? ? B CYS 437  B CYS 448  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf21 disulf ?    ? B CYS 450  SG  ? ? ? 1_555 B  CYS 459  SG ? ? B CYS 450  B CYS 459  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf22 disulf ?    ? B CYS 461  SG  ? ? ? 1_555 B  CYS 492  SG ? ? B CYS 461  B CYS 492  1_555 ? ? ? ? ? ? ? 2.055 ? ? 
disulf23 disulf ?    ? B CYS 475  SG  ? ? ? 1_555 B  CYS 490  SG ? ? B CYS 475  B CYS 490  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf24 disulf ?    ? B CYS 484  SG  ? ? ? 1_555 B  CYS 495  SG ? ? B CYS 484  B CYS 495  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf25 disulf ?    ? B CYS 497  SG  ? ? ? 1_555 B  CYS 512  SG ? ? B CYS 497  B CYS 512  1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf26 disulf ?    ? B CYS 514  SG  ? ? ? 1_555 B  CYS 537  SG ? ? B CYS 514  B CYS 537  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf27 disulf ?    ? B CYS 519  SG  ? ? ? 1_555 B  CYS 535  SG ? ? B CYS 519  B CYS 535  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf28 disulf ?    ? B CYS 527  SG  ? ? ? 1_555 B  CYS 540  SG ? ? B CYS 527  B CYS 540  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf29 disulf ?    ? B CYS 542  SG  ? ? ? 1_555 B  CYS 551  SG ? ? B CYS 542  B CYS 551  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf30 disulf ?    ? B CYS 553  SG  ? ? ? 1_555 B  CYS 576  SG ? ? B CYS 553  B CYS 576  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf31 disulf ?    ? B CYS 560  SG  ? ? ? 1_555 B  CYS 574  SG ? ? B CYS 560  B CYS 574  1_555 ? ? ? ? ? ? ? 2.027 ? ? 
disulf32 disulf ?    ? B CYS 568  SG  ? ? ? 1_555 B  CYS 579  SG ? ? B CYS 568  B CYS 579  1_555 ? ? ? ? ? ? ? 2.027 ? ? 
disulf33 disulf ?    ? B CYS 581  SG  ? ? ? 1_555 B  CYS 590  SG ? ? B CYS 581  B CYS 590  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf34 disulf ?    ? B CYS 593  SG  ? ? ? 1_555 B  CYS 596  SG ? ? B CYS 593  B CYS 596  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf35 disulf ?    ? B CYS 600  SG  ? ? ? 1_555 B  CYS 640  SG ? ? B CYS 600  B CYS 640  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf36 disulf ?    ? B CYS 606  SG  ? ? ? 1_555 B  CYS 625  SG ? ? B CYS 606  B CYS 625  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf37 disulf ?    ? B CYS 609  SG  ? ? ? 1_555 B  CYS 621  SG ? ? B CYS 609  B CYS 621  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf38 disulf ?    ? B CYS 648  SG  ? ? ? 1_555 B  CYS 673  SG ? ? B CYS 648  B CYS 673  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf39 disulf ?    ? C CYS 50   SG  ? ? ? 1_555 C  CYS 57   SG ? ? C CYS 50   C CYS 57   1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf40 disulf ?    ? C CYS 89   SG  ? ? ? 1_555 C  CYS 107  SG ? ? C CYS 89   C CYS 107  1_555 ? ? ? ? ? ? ? 2.055 ? ? 
disulf41 disulf ?    ? C CYS 97   SG  ? ? ? 1_555 C  CYS 126  SG ? ? C CYS 97   C CYS 126  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf42 disulf ?    ? C CYS 476  SG  ? ? ? 1_555 C  CYS 487  SG ? ? C CYS 476  C CYS 487  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf43 disulf ?    ? C CYS 620  SG  ? ? ? 1_555 C  CYS 703  SG ? ? C CYS 620  C CYS 703  1_555 ? ? ? ? ? ? ? 2.011 ? ? 
disulf44 disulf ?    ? C CYS 636  SG  ? ? ? 1_555 C  CYS 693  SG ? ? C CYS 636  C CYS 693  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf45 disulf ?    ? C CYS 752  SG  ? ? ? 1_555 C  CYS 758  SG ? ? C CYS 752  C CYS 758  1_555 ? ? ? ? ? ? ? 2.013 ? ? 
disulf46 disulf ?    ? C CYS 829  SG  ? ? ? 1_555 C  CYS 844  SG ? ? C CYS 829  C CYS 844  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf47 disulf ?    ? C CYS 979  SG  ? ? ? 1_555 C  CYS 1013 SG ? ? C CYS 979  C CYS 1013 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf48 disulf ?    ? C CYS 1003 SG  ? ? ? 1_555 C  CYS 1008 SG ? ? C CYS 1003 C CYS 1008 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf49 disulf ?    ? D CYS 3    SG  ? ? ? 1_555 D  CYS 21   SG ? ? D CYS 3    D CYS 21   1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf50 disulf ?    ? D CYS 11   SG  ? ? ? 1_555 D  CYS 425  SG ? ? D CYS 11   D CYS 425  1_555 ? ? ? ? ? ? ? 1.957 ? ? 
disulf51 disulf ?    ? D CYS 14   SG  ? ? ? 1_555 D  CYS 40   SG ? ? D CYS 14   D CYS 40   1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf52 disulf ?    ? D CYS 24   SG  ? ? ? 1_555 D  CYS 51   SG ? ? D CYS 24   D CYS 51   1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf53 disulf ?    ? D CYS 169  SG  ? ? ? 1_555 D  CYS 176  SG ? ? D CYS 169  D CYS 176  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf54 disulf ?    ? D CYS 224  SG  ? ? ? 1_555 D  CYS 264  SG ? ? D CYS 224  D CYS 264  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf55 disulf ?    ? D CYS 364  SG  ? ? ? 1_555 D  CYS 378  SG ? ? D CYS 364  D CYS 378  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf56 disulf ?    ? D CYS 398  SG  ? ? ? 1_555 D  CYS 423  SG ? ? D CYS 398  D CYS 423  1_555 ? ? ? ? ? ? ? 2.017 ? ? 
disulf57 disulf ?    ? D CYS 427  SG  ? ? ? 1_555 D  CYS 445  SG ? ? D CYS 427  D CYS 445  1_555 ? ? ? ? ? ? ? 2.128 ? ? 
disulf58 disulf ?    ? D CYS 437  SG  ? ? ? 1_555 D  CYS 448  SG ? ? D CYS 437  D CYS 448  1_555 ? ? ? ? ? ? ? 2.285 ? ? 
disulf59 disulf ?    ? D CYS 450  SG  ? ? ? 1_555 D  CYS 459  SG ? ? D CYS 450  D CYS 459  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf60 disulf ?    ? D CYS 461  SG  ? ? ? 1_555 D  CYS 492  SG ? ? D CYS 461  D CYS 492  1_555 ? ? ? ? ? ? ? 1.988 ? ? 
disulf61 disulf ?    ? D CYS 475  SG  ? ? ? 1_555 D  CYS 490  SG ? ? D CYS 475  D CYS 490  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf62 disulf ?    ? D CYS 484  SG  ? ? ? 1_555 D  CYS 495  SG ? ? D CYS 484  D CYS 495  1_555 ? ? ? ? ? ? ? 2.025 ? ? 
disulf63 disulf ?    ? D CYS 497  SG  ? ? ? 1_555 D  CYS 512  SG ? ? D CYS 497  D CYS 512  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf64 disulf ?    ? D CYS 514  SG  ? ? ? 1_555 D  CYS 537  SG ? ? D CYS 514  D CYS 537  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf65 disulf ?    ? D CYS 519  SG  ? ? ? 1_555 D  CYS 535  SG ? ? D CYS 519  D CYS 535  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf66 disulf ?    ? D CYS 527  SG  ? ? ? 1_555 D  CYS 540  SG ? ? D CYS 527  D CYS 540  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf67 disulf ?    ? D CYS 542  SG  ? ? ? 1_555 D  CYS 551  SG ? ? D CYS 542  D CYS 551  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf68 disulf ?    ? D CYS 553  SG  ? ? ? 1_555 D  CYS 576  SG ? ? D CYS 553  D CYS 576  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf69 disulf ?    ? D CYS 560  SG  ? ? ? 1_555 D  CYS 574  SG ? ? D CYS 560  D CYS 574  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf70 disulf ?    ? D CYS 568  SG  ? ? ? 1_555 D  CYS 579  SG ? ? D CYS 568  D CYS 579  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf71 disulf ?    ? D CYS 581  SG  ? ? ? 1_555 D  CYS 590  SG ? ? D CYS 581  D CYS 590  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf72 disulf ?    ? D CYS 593  SG  ? ? ? 1_555 D  CYS 596  SG ? ? D CYS 593  D CYS 596  1_555 ? ? ? ? ? ? ? 2.062 ? ? 
disulf73 disulf ?    ? D CYS 600  SG  ? ? ? 1_555 D  CYS 640  SG ? ? D CYS 600  D CYS 640  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf74 disulf ?    ? D CYS 606  SG  ? ? ? 1_555 D  CYS 625  SG ? ? D CYS 606  D CYS 625  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf75 disulf ?    ? D CYS 609  SG  ? ? ? 1_555 D  CYS 621  SG ? ? D CYS 609  D CYS 621  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf76 disulf ?    ? D CYS 648  SG  ? ? ? 1_555 D  CYS 673  SG ? ? D CYS 648  D CYS 673  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
covale1  covale one  ? A ASN 42   ND2 ? ? ? 1_555 E  NAG .    C1 ? ? A ASN 42   E NAG 1    1_555 ? ? ? ? ? ? ? 1.444 ? 
N-Glycosylation 
covale2  covale one  ? A ASN 373  ND2 ? ? ? 1_555 F  NAG .    C1 ? ? A ASN 373  F NAG 1    1_555 ? ? ? ? ? ? ? 1.453 ? 
N-Glycosylation 
covale3  covale one  ? A ASN 678  ND2 ? ? ? 1_555 L  NAG .    C1 ? ? A ASN 678  A NAG 3678 1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale4  covale one  ? A ASN 716  ND2 ? ? ? 1_555 G  NAG .    C1 ? ? A ASN 716  G NAG 1    1_555 ? ? ? ? ? ? ? 1.457 ? 
N-Glycosylation 
covale5  covale one  ? A ASN 880  ND2 ? ? ? 1_555 H  NAG .    C1 ? ? A ASN 880  H NAG 1    1_555 ? ? ? ? ? ? ? 1.444 ? 
N-Glycosylation 
covale6  covale one  ? B ASN 94   ND2 ? ? ? 1_555 P  NAG .    C1 ? ? B ASN 94   B NAG 3094 1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale7  covale one  ? B ASN 479  ND2 ? ? ? 1_555 R  NAG .    C1 ? ? B ASN 479  B NAG 3479 1_555 ? ? ? ? ? ? ? 1.414 ? 
N-Glycosylation 
covale8  covale one  ? C ASN 42   ND2 ? ? ? 1_555 I  NAG .    C1 ? ? C ASN 42   I NAG 1    1_555 ? ? ? ? ? ? ? 1.446 ? 
N-Glycosylation 
covale9  covale one  ? C ASN 373  ND2 ? ? ? 1_555 J  NAG .    C1 ? ? C ASN 373  J NAG 1    1_555 ? ? ? ? ? ? ? 1.453 ? 
N-Glycosylation 
covale10 covale one  ? C ASN 678  ND2 ? ? ? 1_555 T  NAG .    C1 ? ? C ASN 678  C NAG 3678 1_555 ? ? ? ? ? ? ? 1.441 ? 
N-Glycosylation 
covale11 covale one  ? C ASN 716  ND2 ? ? ? 1_555 K  NAG .    C1 ? ? C ASN 716  K NAG 1    1_555 ? ? ? ? ? ? ? 1.444 ? 
N-Glycosylation 
covale12 covale one  ? C ASN 880  ND2 ? ? ? 1_555 U  NAG .    C1 ? ? C ASN 880  C NAG 3880 1_555 ? ? ? ? ? ? ? 1.463 ? 
N-Glycosylation 
covale13 covale one  ? D ASN 94   ND2 ? ? ? 1_555 Y  NAG .    C1 ? ? D ASN 94   D NAG 3094 1_555 ? ? ? ? ? ? ? 1.430 ? 
N-Glycosylation 
covale14 covale one  ? D ASN 479  ND2 ? ? ? 1_555 AA NAG .    C1 ? ? D ASN 479  D NAG 3479 1_555 ? ? ? ? ? ? ? 1.509 ? 
N-Glycosylation 
covale15 covale both ? E NAG .    O4  ? ? ? 1_555 E  NAG .    C1 ? ? E NAG 1    E NAG 2    1_555 ? ? ? ? ? ? ? 1.453 ? ? 
covale16 covale both ? F NAG .    O4  ? ? ? 1_555 F  NAG .    C1 ? ? F NAG 1    F NAG 2    1_555 ? ? ? ? ? ? ? 1.451 ? ? 
covale17 covale both ? F NAG .    O4  ? ? ? 1_555 F  MAN .    C1 ? ? F NAG 2    F MAN 3    1_555 ? ? ? ? ? ? ? 1.453 ? ? 
covale18 covale both ? F MAN .    O3  ? ? ? 1_555 F  MAN .    C1 ? ? F MAN 3    F MAN 4    1_555 ? ? ? ? ? ? ? 1.437 ? ? 
covale19 covale both ? F MAN .    O6  ? ? ? 1_555 F  MAN .    C1 ? ? F MAN 3    F MAN 5    1_555 ? ? ? ? ? ? ? 1.436 ? ? 
covale20 covale both ? G NAG .    O4  ? ? ? 1_555 G  NAG .    C1 ? ? G NAG 1    G NAG 2    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale21 covale both ? G NAG .    O4  ? ? ? 1_555 G  MAN .    C1 ? ? G NAG 2    G MAN 3    1_555 ? ? ? ? ? ? ? 1.439 ? ? 
covale22 covale both ? H NAG .    O4  ? ? ? 1_555 H  NAG .    C1 ? ? H NAG 1    H NAG 2    1_555 ? ? ? ? ? ? ? 1.468 ? ? 
covale23 covale both ? H NAG .    O4  ? ? ? 1_555 H  MAN .    C1 ? ? H NAG 2    H MAN 3    1_555 ? ? ? ? ? ? ? 1.477 ? ? 
covale24 covale both ? I NAG .    O4  ? ? ? 1_555 I  NAG .    C1 ? ? I NAG 1    I NAG 2    1_555 ? ? ? ? ? ? ? 1.455 ? ? 
covale25 covale both ? J NAG .    O4  ? ? ? 1_555 J  NAG .    C1 ? ? J NAG 1    J NAG 2    1_555 ? ? ? ? ? ? ? 1.452 ? ? 
covale26 covale both ? J NAG .    O4  ? ? ? 1_555 J  MAN .    C1 ? ? J NAG 2    J MAN 3    1_555 ? ? ? ? ? ? ? 1.455 ? ? 
covale27 covale both ? J MAN .    O3  ? ? ? 1_555 J  MAN .    C1 ? ? J MAN 3    J MAN 4    1_555 ? ? ? ? ? ? ? 1.439 ? ? 
covale28 covale both ? J MAN .    O6  ? ? ? 1_555 J  MAN .    C1 ? ? J MAN 3    J MAN 5    1_555 ? ? ? ? ? ? ? 1.439 ? ? 
covale29 covale both ? K NAG .    O4  ? ? ? 1_555 K  NAG .    C1 ? ? K NAG 1    K NAG 2    1_555 ? ? ? ? ? ? ? 1.433 ? ? 
covale30 covale both ? K NAG .    O4  ? ? ? 1_555 K  MAN .    C1 ? ? K NAG 2    K MAN 3    1_555 ? ? ? ? ? ? ? 1.438 ? ? 
metalc1  metalc ?    ? A ASP 447  OD1 ? ? ? 1_555 M  CA  .    CA ? ? A ASP 447  A CA  2005 1_555 ? ? ? ? ? ? ? 2.760 ? ? 
metalc2  metalc ?    ? A ASP 449  OD1 ? ? ? 1_555 M  CA  .    CA ? ? A ASP 449  A CA  2005 1_555 ? ? ? ? ? ? ? 2.897 ? ? 
metalc3  metalc ?    ? A SER 453  O   ? ? ? 1_555 M  CA  .    CA ? ? A SER 453  A CA  2005 1_555 ? ? ? ? ? ? ? 2.583 ? ? 
metalc4  metalc ?    ? A ASP 455  OD2 ? ? ? 1_555 M  CA  .    CA ? ? A ASP 455  A CA  2005 1_555 ? ? ? ? ? ? ? 2.924 ? ? 
metalc5  metalc ?    ? A LEU 517  O   ? ? ? 1_555 N  CA  .    CA ? ? A LEU 517  A CA  2006 1_555 ? ? ? ? ? ? ? 2.596 ? ? 
metalc6  metalc ?    ? A ASP 574  OD1 ? ? ? 1_555 O  CA  .    CA ? ? A ASP 574  A CA  2007 1_555 ? ? ? ? ? ? ? 2.930 ? ? 
metalc7  metalc ?    ? A ASP 578  O   ? ? ? 1_555 O  CA  .    CA ? ? A ASP 578  A CA  2007 1_555 ? ? ? ? ? ? ? 2.689 ? ? 
metalc8  metalc ?    ? A ASP 578  OD1 ? ? ? 1_555 O  CA  .    CA ? ? A ASP 578  A CA  2007 1_555 ? ? ? ? ? ? ? 2.500 ? ? 
metalc9  metalc ?    ? A LEU 580  O   ? ? ? 1_555 O  CA  .    CA ? ? A LEU 580  A CA  2007 1_555 ? ? ? ? ? ? ? 2.491 ? ? 
metalc10 metalc ?    ? A ASP 582  OD1 ? ? ? 1_555 O  CA  .    CA ? ? A ASP 582  A CA  2007 1_555 ? ? ? ? ? ? ? 2.808 ? ? 
metalc11 metalc ?    ? A ASP 582  OD2 ? ? ? 1_555 O  CA  .    CA ? ? A ASP 582  A CA  2007 1_555 ? ? ? ? ? ? ? 2.669 ? ? 
metalc12 metalc ?    ? B SER 116  O   ? ? ? 1_555 Q  CA  .    CA ? ? B SER 116  B CA  2002 1_555 ? ? ? ? ? ? ? 2.527 ? ? 
metalc13 metalc ?    ? B ASP 119  OD1 ? ? ? 1_555 Q  CA  .    CA ? ? B ASP 119  B CA  2002 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc14 metalc ?    ? B ASP 120  OD1 ? ? ? 1_555 Q  CA  .    CA ? ? B ASP 120  B CA  2002 1_555 ? ? ? ? ? ? ? 2.104 ? ? 
metalc15 metalc ?    ? B GLU 325  O   ? ? ? 1_555 Q  CA  .    CA ? ? B GLU 325  B CA  2002 1_555 ? ? ? ? ? ? ? 2.701 ? ? 
metalc16 metalc ?    ? B GLU 325  OE2 ? ? ? 1_555 Q  CA  .    CA ? ? B GLU 325  B CA  2002 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc17 metalc ?    ? C ASP 447  OD1 ? ? ? 1_555 V  CA  .    CA ? ? C ASP 447  C CA  2005 1_555 ? ? ? ? ? ? ? 2.760 ? ? 
metalc18 metalc ?    ? C ASP 449  OD1 ? ? ? 1_555 V  CA  .    CA ? ? C ASP 449  C CA  2005 1_555 ? ? ? ? ? ? ? 2.871 ? ? 
metalc19 metalc ?    ? C SER 453  O   ? ? ? 1_555 V  CA  .    CA ? ? C SER 453  C CA  2005 1_555 ? ? ? ? ? ? ? 2.609 ? ? 
metalc20 metalc ?    ? C ASP 455  OD2 ? ? ? 1_555 V  CA  .    CA ? ? C ASP 455  C CA  2005 1_555 ? ? ? ? ? ? ? 2.929 ? ? 
metalc21 metalc ?    ? C LEU 517  O   ? ? ? 1_555 W  CA  .    CA ? ? C LEU 517  C CA  2006 1_555 ? ? ? ? ? ? ? 2.618 ? ? 
metalc22 metalc ?    ? C ASP 574  OD1 ? ? ? 1_555 X  CA  .    CA ? ? C ASP 574  C CA  2007 1_555 ? ? ? ? ? ? ? 2.934 ? ? 
metalc23 metalc ?    ? C ASP 578  O   ? ? ? 1_555 X  CA  .    CA ? ? C ASP 578  C CA  2007 1_555 ? ? ? ? ? ? ? 2.705 ? ? 
metalc24 metalc ?    ? C ASP 578  OD1 ? ? ? 1_555 X  CA  .    CA ? ? C ASP 578  C CA  2007 1_555 ? ? ? ? ? ? ? 2.492 ? ? 
metalc25 metalc ?    ? C LEU 580  O   ? ? ? 1_555 X  CA  .    CA ? ? C LEU 580  C CA  2007 1_555 ? ? ? ? ? ? ? 2.532 ? ? 
metalc26 metalc ?    ? C ASP 582  OD1 ? ? ? 1_555 X  CA  .    CA ? ? C ASP 582  C CA  2007 1_555 ? ? ? ? ? ? ? 2.815 ? ? 
metalc27 metalc ?    ? C ASP 582  OD2 ? ? ? 1_555 X  CA  .    CA ? ? C ASP 582  C CA  2007 1_555 ? ? ? ? ? ? ? 2.667 ? ? 
metalc28 metalc ?    ? D SER 116  O   ? ? ? 1_555 Z  CA  .    CA ? ? D SER 116  D CA  2002 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc29 metalc ?    ? D ASP 119  OD1 ? ? ? 1_555 Z  CA  .    CA ? ? D ASP 119  D CA  2002 1_555 ? ? ? ? ? ? ? 2.351 ? ? 
metalc30 metalc ?    ? D ASP 120  OD1 ? ? ? 1_555 Z  CA  .    CA ? ? D ASP 120  D CA  2002 1_555 ? ? ? ? ? ? ? 2.097 ? ? 
metalc31 metalc ?    ? D GLU 325  O   ? ? ? 1_555 Z  CA  .    CA ? ? D GLU 325  D CA  2002 1_555 ? ? ? ? ? ? ? 2.703 ? ? 
metalc32 metalc ?    ? D GLU 325  OE2 ? ? ? 1_555 Z  CA  .    CA ? ? D GLU 325  D CA  2002 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LEU 119 A . ? LEU 119 A PRO 120 A ? PRO 120 A 1 -9.18  
2  GLN 817 A . ? GLN 817 A LYS 818 A ? LYS 818 A 1 8.14   
3  GLN 819 A . ? GLN 819 A GLY 820 A ? GLY 820 A 1 -7.92  
4  SER 77  B . ? SER 77  B PRO 78  B ? PRO 78  B 1 1.54   
5  LEU 155 B . ? LEU 155 B PRO 156 B ? PRO 156 B 1 -3.41  
6  HIS 161 B . ? HIS 161 B PRO 162 B ? PRO 162 B 1 -10.00 
7  LEU 587 B . ? LEU 587 B PRO 588 B ? PRO 588 B 1 1.05   
8  LEU 119 C . ? LEU 119 C PRO 120 C ? PRO 120 C 1 -7.32  
9  SER 77  D . ? SER 77  D PRO 78  D ? PRO 78  D 1 1.74   
10 LEU 155 D . ? LEU 155 D PRO 156 D ? PRO 156 D 1 -3.36  
11 HIS 161 D . ? HIS 161 D PRO 162 D ? PRO 162 D 1 -9.34  
12 LEU 587 D . ? LEU 587 D PRO 588 D ? PRO 588 D 1 1.05   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4  ? 
B  ? 4  ? 
C  ? 4  ? 
D  ? 2  ? 
E  ? 3  ? 
F  ? 4  ? 
G  ? 3  ? 
H  ? 3  ? 
I  ? 3  ? 
J  ? 4  ? 
K  ? 4  ? 
L  ? 3  ? 
M  ? 10 ? 
N  ? 4  ? 
O  ? 5  ? 
P  ? 5  ? 
Q  ? 3  ? 
R  ? 3  ? 
S  ? 3  ? 
T  ? 4  ? 
U  ? 2  ? 
V  ? 2  ? 
W  ? 2  ? 
X  ? 2  ? 
Y  ? 2  ? 
Z  ? 2  ? 
AA ? 3  ? 
AB ? 4  ? 
AC ? 4  ? 
AD ? 4  ? 
AE ? 2  ? 
AF ? 3  ? 
AG ? 4  ? 
AH ? 3  ? 
AI ? 3  ? 
AJ ? 3  ? 
AK ? 4  ? 
AL ? 4  ? 
AM ? 3  ? 
AN ? 4  ? 
AO ? 5  ? 
AP ? 5  ? 
AQ ? 3  ? 
AR ? 3  ? 
AS ? 3  ? 
AT ? 4  ? 
AU ? 2  ? 
AV ? 2  ? 
AW ? 2  ? 
AX ? 2  ? 
AY ? 2  ? 
AZ ? 2  ? 
BA ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2  ? anti-parallel 
A  2 3  ? anti-parallel 
A  3 4  ? anti-parallel 
B  1 2  ? anti-parallel 
B  2 3  ? anti-parallel 
B  3 4  ? anti-parallel 
C  1 2  ? anti-parallel 
C  2 3  ? anti-parallel 
C  3 4  ? anti-parallel 
D  1 2  ? anti-parallel 
E  1 2  ? anti-parallel 
E  2 3  ? anti-parallel 
F  1 2  ? anti-parallel 
F  2 3  ? anti-parallel 
F  3 4  ? anti-parallel 
G  1 2  ? anti-parallel 
G  2 3  ? anti-parallel 
H  1 2  ? anti-parallel 
H  2 3  ? anti-parallel 
I  1 2  ? anti-parallel 
I  2 3  ? anti-parallel 
J  1 2  ? anti-parallel 
J  2 3  ? anti-parallel 
J  3 4  ? anti-parallel 
K  1 2  ? anti-parallel 
K  2 3  ? anti-parallel 
K  3 4  ? anti-parallel 
L  1 2  ? parallel      
L  2 3  ? parallel      
M  1 2  ? anti-parallel 
M  2 3  ? anti-parallel 
M  3 4  ? anti-parallel 
M  4 5  ? anti-parallel 
M  5 6  ? anti-parallel 
M  6 7  ? anti-parallel 
M  7 8  ? anti-parallel 
M  8 9  ? anti-parallel 
M  9 10 ? anti-parallel 
N  1 2  ? anti-parallel 
N  2 3  ? anti-parallel 
N  3 4  ? anti-parallel 
O  1 2  ? anti-parallel 
O  2 3  ? anti-parallel 
O  3 4  ? anti-parallel 
O  4 5  ? parallel      
P  1 2  ? anti-parallel 
P  2 3  ? anti-parallel 
P  3 4  ? anti-parallel 
P  4 5  ? anti-parallel 
Q  1 2  ? anti-parallel 
Q  2 3  ? anti-parallel 
R  1 2  ? parallel      
R  2 3  ? anti-parallel 
S  1 2  ? anti-parallel 
S  2 3  ? anti-parallel 
T  1 2  ? anti-parallel 
T  2 3  ? parallel      
T  3 4  ? parallel      
U  1 2  ? parallel      
V  1 2  ? anti-parallel 
W  1 2  ? anti-parallel 
X  1 2  ? anti-parallel 
Y  1 2  ? anti-parallel 
Z  1 2  ? anti-parallel 
AA 1 2  ? anti-parallel 
AA 2 3  ? anti-parallel 
AB 1 2  ? anti-parallel 
AB 2 3  ? anti-parallel 
AB 3 4  ? anti-parallel 
AC 1 2  ? anti-parallel 
AC 2 3  ? anti-parallel 
AC 3 4  ? anti-parallel 
AD 1 2  ? anti-parallel 
AD 2 3  ? anti-parallel 
AD 3 4  ? anti-parallel 
AE 1 2  ? anti-parallel 
AF 1 2  ? anti-parallel 
AF 2 3  ? anti-parallel 
AG 1 2  ? anti-parallel 
AG 2 3  ? anti-parallel 
AG 3 4  ? anti-parallel 
AH 1 2  ? anti-parallel 
AH 2 3  ? anti-parallel 
AI 1 2  ? anti-parallel 
AI 2 3  ? anti-parallel 
AJ 1 2  ? anti-parallel 
AJ 2 3  ? anti-parallel 
AK 1 2  ? anti-parallel 
AK 2 3  ? anti-parallel 
AK 3 4  ? anti-parallel 
AL 1 2  ? anti-parallel 
AL 2 3  ? anti-parallel 
AL 3 4  ? anti-parallel 
AM 1 2  ? parallel      
AM 2 3  ? parallel      
AN 1 2  ? anti-parallel 
AN 2 3  ? anti-parallel 
AN 3 4  ? anti-parallel 
AO 1 2  ? anti-parallel 
AO 2 3  ? anti-parallel 
AO 3 4  ? anti-parallel 
AO 4 5  ? parallel      
AP 1 2  ? anti-parallel 
AP 2 3  ? anti-parallel 
AP 3 4  ? anti-parallel 
AP 4 5  ? anti-parallel 
AQ 1 2  ? anti-parallel 
AQ 2 3  ? anti-parallel 
AR 1 2  ? parallel      
AR 2 3  ? anti-parallel 
AS 1 2  ? anti-parallel 
AS 2 3  ? anti-parallel 
AT 1 2  ? anti-parallel 
AT 2 3  ? parallel      
AT 3 4  ? parallel      
AU 1 2  ? parallel      
AV 1 2  ? anti-parallel 
AW 1 2  ? anti-parallel 
AX 1 2  ? anti-parallel 
AY 1 2  ? anti-parallel 
AZ 1 2  ? anti-parallel 
BA 1 2  ? anti-parallel 
BA 2 3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1  THR A 9    ? PHE A 11   ? THR A 9    PHE A 11   
A  2  VAL A 591  ? ARG A 595  ? VAL A 591  ARG A 595  
A  3  ASP A 582  ? ALA A 587  ? ASP A 582  ALA A 587  
A  4  PHE A 565  ? GLN A 573  ? PHE A 565  GLN A 573  
B  1  SER A 21   ? GLN A 24   ? SER A 21   GLN A 24   
B  2  TRP A 29   ? GLY A 33   ? TRP A 29   GLY A 33   
B  3  LEU A 47   ? GLY A 51   ? LEU A 47   GLY A 51   
B  4  ALA A 56   ? PRO A 59   ? ALA A 56   PRO A 59   
C  1  SER A 76   ? THR A 80   ? SER A 76   THR A 80   
C  2  GLN A 85   ? GLY A 90   ? GLN A 85   GLY A 90   
C  3  LEU A 106  ? LEU A 110  ? LEU A 106  LEU A 110  
C  4  THR A 116  ? GLN A 117  ? THR A 116  GLN A 117  
D  1  HIS A 94   ? HIS A 95   ? HIS A 94   HIS A 95   
D  2  TYR A 102  ? LEU A 103  ? TYR A 102  LEU A 103  
E  1  VAL A 347  ? ALA A 350  ? VAL A 347  ALA A 350  
E  2  GLY A 359  ? LEU A 362  ? GLY A 359  LEU A 362  
E  3  THR A 370  ? ILE A 372  ? THR A 370  ILE A 372  
F  1  THR A 390  ? GLU A 391  ? THR A 390  GLU A 391  
F  2  SER A 400  ? ALA A 405  ? SER A 400  ALA A 405  
F  3  LYS A 413  ? THR A 418  ? LYS A 413  THR A 418  
F  4  MET A 426  ? VAL A 430  ? MET A 426  VAL A 430  
G  1  LEU A 443  ? VAL A 446  ? LEU A 443  VAL A 446  
G  2  LEU A 456  ? GLY A 460  ? LEU A 456  GLY A 460  
G  3  VAL A 473  ? PRO A 477  ? VAL A 473  PRO A 477  
H  1  LEU A 506  ? GLY A 510  ? LEU A 506  GLY A 510  
H  2  ASP A 519  ? GLY A 523  ? ASP A 519  GLY A 523  
H  3  VAL A 534  ? HIS A 538  ? VAL A 534  HIS A 538  
I  1  VAL A 602  ? PHE A 608  ? VAL A 602  PHE A 608  
I  2  THR A 629  ? ILE A 639  ? THR A 629  ILE A 639  
I  3  CYS A 693  ? LEU A 700  ? CYS A 693  LEU A 700  
J  1  SER A 680  ? LEU A 687  ? SER A 680  LEU A 687  
J  2  SER A 654  ? LEU A 662  ? SER A 654  LEU A 662  
J  3  ILE A 711  ? PHE A 717  ? ILE A 711  PHE A 717  
J  4  TYR A 741  ? LEU A 746  ? TYR A 741  LEU A 746  
K  1  ILE A 764  ? SER A 767  ? ILE A 764  SER A 767  
K  2  ASN A 783  ? VAL A 788  ? ASN A 783  VAL A 788  
K  3  ILE A 857  ? VAL A 865  ? ILE A 857  VAL A 865  
K  4  LEU A 808  ? ARG A 811  ? LEU A 808  ARG A 811  
L  1  LEU A 775  ? VAL A 776  ? LEU A 775  VAL A 776  
L  2  LYS A 902  ? VAL A 905  ? LYS A 902  VAL A 905  
L  3  TYR A 1060 ? GLN A 1062 ? TYR A 1060 GLN A 1062 
M  1  THR A 828  ? PRO A 833  ? THR A 828  PRO A 833  
M  2  THR A 839  ? ARG A 845  ? THR A 839  ARG A 845  
M  3  THR A 799  ? PRO A 805  ? THR A 799  PRO A 805  
M  4  ARG A 874  ? SER A 882  ? ARG A 874  SER A 882  
M  5  GLN A 896  ? PRO A 900  ? GLN A 896  PRO A 900  
M  6  GLN C 896  ? PRO C 900  ? GLN C 896  PRO C 900  
M  7  ARG C 874  ? SER C 882  ? ARG C 874  SER C 882  
M  8  THR C 799  ? PRO C 805  ? THR C 799  PRO C 805  
M  9  THR C 839  ? ARG C 845  ? THR C 839  ARG C 845  
M  10 THR C 828  ? PRO C 833  ? THR C 828  PRO C 833  
N  1  THR A 907  ? SER A 911  ? THR A 907  SER A 911  
N  2  ALA A 932  ? ASN A 940  ? ALA A 932  ASN A 940  
N  3  ASP A 1025 ? GLY A 1030 ? ASP A 1025 GLY A 1030 
N  4  GLU A 968  ? SER A 970  ? GLU A 968  SER A 970  
O  1  CYS A 979  ? ILE A 984  ? CYS A 979  ILE A 984  
O  2  CYS A 1008 ? VAL A 1015 ? CYS A 1008 VAL A 1015 
O  3  VAL A 948  ? TRP A 953  ? VAL A 948  TRP A 953  
O  4  SER A 1046 ? THR A 1054 ? SER A 1046 THR A 1054 
O  5  VAL A 1000 ? LEU A 1001 ? VAL A 1000 LEU A 1001 
P  1  CYS A 979  ? ILE A 984  ? CYS A 979  ILE A 984  
P  2  CYS A 1008 ? VAL A 1015 ? CYS A 1008 VAL A 1015 
P  3  VAL A 948  ? TRP A 953  ? VAL A 948  TRP A 953  
P  4  SER A 1046 ? THR A 1054 ? SER A 1046 THR A 1054 
P  5  ARG A 1071 ? VAL A 1077 ? ARG A 1071 VAL A 1077 
Q  1  CYS B 40   ? ASP B 41   ? CYS B 40   ASP B 41   
Q  2  THR B 22   ? CYS B 24   ? THR B 22   CYS B 24   
Q  3  ILE B 56   ? MET B 57   ? ILE B 56   MET B 57   
R  1  LEU B 83   ? LEU B 85   ? LEU B 83   LEU B 85   
R  2  THR B 416  ? PRO B 421  ? THR B 416  PRO B 421  
R  3  GLN B 402  ? VAL B 405  ? GLN B 402  VAL B 405  
S  1  ALA B 91   ? PHE B 97   ? ALA B 91   PHE B 97   
S  2  ILE B 387  ? ALA B 395  ? ILE B 387  ALA B 395  
S  3  LEU B 356  ? THR B 359  ? LEU B 356  THR B 359  
T  1  ARG B 183  ? THR B 189  ? ARG B 183  THR B 189  
T  2  ILE B 144  ? PHE B 149  ? ILE B 144  PHE B 149  
T  3  LEU B 107  ? ASP B 112  ? LEU B 107  ASP B 112  
T  4  LEU B 236  ? ALA B 240  ? LEU B 236  ALA B 240  
U  1  PHE B 298  ? VAL B 300  ? PHE B 298  VAL B 300  
U  2  VAL B 320  ? GLU B 322  ? VAL B 320  GLU B 322  
V  1  GLY B 441  ? LEU B 443  ? GLY B 441  LEU B 443  
V  2  CYS B 448  ? CYS B 450  ? CYS B 448  CYS B 450  
W  1  TYR B 454  ? ILE B 455  ? TYR B 454  ILE B 455  
W  2  CYS B 461  ? GLN B 462  ? CYS B 461  GLN B 462  
X  1  GLY B 488  ? VAL B 491  ? GLY B 488  VAL B 491  
X  2  GLN B 494  ? CYS B 497  ? GLN B 494  CYS B 497  
Y  1  ILE B 507  ? TYR B 508  ? ILE B 507  TYR B 508  
Y  2  CYS B 514  ? ASP B 515  ? CYS B 514  ASP B 515  
Z  1  GLY B 533  ? PHE B 536  ? GLY B 533  PHE B 536  
Z  2  LYS B 539  ? CYS B 542  ? LYS B 539  CYS B 542  
AA 1  CYS B 640  ? ARG B 643  ? CYS B 640  ARG B 643  
AA 2  TRP B 649  ? LEU B 654  ? TRP B 649  LEU B 654  
AA 3  ILE B 665  ? VAL B 667  ? ILE B 665  VAL B 667  
AB 1  THR C 9    ? PHE C 11   ? THR C 9    PHE C 11   
AB 2  VAL C 591  ? ARG C 595  ? VAL C 591  ARG C 595  
AB 3  ASP C 582  ? ALA C 587  ? ASP C 582  ALA C 587  
AB 4  PHE C 565  ? GLN C 573  ? PHE C 565  GLN C 573  
AC 1  SER C 21   ? GLN C 24   ? SER C 21   GLN C 24   
AC 2  TRP C 29   ? GLY C 33   ? TRP C 29   GLY C 33   
AC 3  LEU C 47   ? GLY C 51   ? LEU C 47   GLY C 51   
AC 4  ALA C 56   ? PRO C 59   ? ALA C 56   PRO C 59   
AD 1  SER C 76   ? THR C 80   ? SER C 76   THR C 80   
AD 2  GLN C 85   ? GLY C 90   ? GLN C 85   GLY C 90   
AD 3  LEU C 106  ? LEU C 110  ? LEU C 106  LEU C 110  
AD 4  THR C 116  ? GLN C 117  ? THR C 116  GLN C 117  
AE 1  HIS C 94   ? HIS C 95   ? HIS C 94   HIS C 95   
AE 2  TYR C 102  ? LEU C 103  ? TYR C 102  LEU C 103  
AF 1  VAL C 347  ? ALA C 350  ? VAL C 347  ALA C 350  
AF 2  GLY C 359  ? LEU C 362  ? GLY C 359  LEU C 362  
AF 3  THR C 370  ? ILE C 372  ? THR C 370  ILE C 372  
AG 1  THR C 390  ? GLU C 391  ? THR C 390  GLU C 391  
AG 2  SER C 400  ? ALA C 405  ? SER C 400  ALA C 405  
AG 3  LYS C 413  ? THR C 418  ? LYS C 413  THR C 418  
AG 4  MET C 426  ? VAL C 430  ? MET C 426  VAL C 430  
AH 1  LEU C 443  ? VAL C 446  ? LEU C 443  VAL C 446  
AH 2  LEU C 456  ? GLY C 460  ? LEU C 456  GLY C 460  
AH 3  VAL C 473  ? PRO C 477  ? VAL C 473  PRO C 477  
AI 1  LEU C 506  ? GLY C 510  ? LEU C 506  GLY C 510  
AI 2  ASP C 519  ? GLY C 523  ? ASP C 519  GLY C 523  
AI 3  VAL C 534  ? HIS C 538  ? VAL C 534  HIS C 538  
AJ 1  VAL C 602  ? PHE C 608  ? VAL C 602  PHE C 608  
AJ 2  THR C 629  ? ILE C 639  ? THR C 629  ILE C 639  
AJ 3  CYS C 693  ? LEU C 700  ? CYS C 693  LEU C 700  
AK 1  SER C 680  ? LEU C 687  ? SER C 680  LEU C 687  
AK 2  SER C 654  ? LEU C 662  ? SER C 654  LEU C 662  
AK 3  ILE C 711  ? PHE C 717  ? ILE C 711  PHE C 717  
AK 4  TYR C 741  ? LEU C 746  ? TYR C 741  LEU C 746  
AL 1  ILE C 764  ? SER C 767  ? ILE C 764  SER C 767  
AL 2  GLU C 781  ? VAL C 788  ? GLU C 781  VAL C 788  
AL 3  ILE C 857  ? VAL C 865  ? ILE C 857  VAL C 865  
AL 4  LEU C 808  ? ARG C 811  ? LEU C 808  ARG C 811  
AM 1  LEU C 775  ? VAL C 776  ? LEU C 775  VAL C 776  
AM 2  LYS C 902  ? VAL C 905  ? LYS C 902  VAL C 905  
AM 3  TYR C 1060 ? GLN C 1062 ? TYR C 1060 GLN C 1062 
AN 1  THR C 907  ? SER C 911  ? THR C 907  SER C 911  
AN 2  ALA C 932  ? ASN C 940  ? ALA C 932  ASN C 940  
AN 3  ASP C 1025 ? GLY C 1030 ? ASP C 1025 GLY C 1030 
AN 4  GLU C 968  ? SER C 970  ? GLU C 968  SER C 970  
AO 1  CYS C 979  ? ILE C 984  ? CYS C 979  ILE C 984  
AO 2  CYS C 1008 ? VAL C 1015 ? CYS C 1008 VAL C 1015 
AO 3  VAL C 948  ? TRP C 953  ? VAL C 948  TRP C 953  
AO 4  SER C 1046 ? THR C 1054 ? SER C 1046 THR C 1054 
AO 5  VAL C 1000 ? LEU C 1001 ? VAL C 1000 LEU C 1001 
AP 1  CYS C 979  ? ILE C 984  ? CYS C 979  ILE C 984  
AP 2  CYS C 1008 ? VAL C 1015 ? CYS C 1008 VAL C 1015 
AP 3  VAL C 948  ? TRP C 953  ? VAL C 948  TRP C 953  
AP 4  SER C 1046 ? THR C 1054 ? SER C 1046 THR C 1054 
AP 5  ARG C 1071 ? VAL C 1077 ? ARG C 1071 VAL C 1077 
AQ 1  CYS D 40   ? ASP D 41   ? CYS D 40   ASP D 41   
AQ 2  THR D 22   ? CYS D 24   ? THR D 22   CYS D 24   
AQ 3  ILE D 56   ? MET D 57   ? ILE D 56   MET D 57   
AR 1  LEU D 83   ? LEU D 85   ? LEU D 83   LEU D 85   
AR 2  THR D 416  ? PRO D 421  ? THR D 416  PRO D 421  
AR 3  GLN D 402  ? VAL D 405  ? GLN D 402  VAL D 405  
AS 1  ALA D 91   ? PHE D 97   ? ALA D 91   PHE D 97   
AS 2  ILE D 387  ? ALA D 395  ? ILE D 387  ALA D 395  
AS 3  LEU D 356  ? THR D 359  ? LEU D 356  THR D 359  
AT 1  ARG D 183  ? THR D 189  ? ARG D 183  THR D 189  
AT 2  ILE D 144  ? PHE D 149  ? ILE D 144  PHE D 149  
AT 3  LEU D 107  ? ASP D 112  ? LEU D 107  ASP D 112  
AT 4  LEU D 236  ? ALA D 240  ? LEU D 236  ALA D 240  
AU 1  PHE D 298  ? VAL D 300  ? PHE D 298  VAL D 300  
AU 2  VAL D 320  ? GLU D 322  ? VAL D 320  GLU D 322  
AV 1  GLY D 441  ? LEU D 443  ? GLY D 441  LEU D 443  
AV 2  CYS D 448  ? CYS D 450  ? CYS D 448  CYS D 450  
AW 1  TYR D 454  ? ILE D 455  ? TYR D 454  ILE D 455  
AW 2  CYS D 461  ? GLN D 462  ? CYS D 461  GLN D 462  
AX 1  GLY D 488  ? VAL D 491  ? GLY D 488  VAL D 491  
AX 2  GLN D 494  ? CYS D 497  ? GLN D 494  CYS D 497  
AY 1  ILE D 507  ? TYR D 508  ? ILE D 507  TYR D 508  
AY 2  CYS D 514  ? ASP D 515  ? CYS D 514  ASP D 515  
AZ 1  GLY D 533  ? PHE D 536  ? GLY D 533  PHE D 536  
AZ 2  LYS D 539  ? CYS D 542  ? LYS D 539  CYS D 542  
BA 1  CYS D 640  ? ARG D 643  ? CYS D 640  ARG D 643  
BA 2  TRP D 649  ? LEU D 654  ? TRP D 649  LEU D 654  
BA 3  ILE D 665  ? VAL D 667  ? ILE D 665  VAL D 667  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2  N PHE A 11   ? N PHE A 11   O VAL A 591  ? O VAL A 591  
A  2 3  O LEU A 592  ? O LEU A 592  N VAL A 585  ? N VAL A 585  
A  3 4  O GLY A 586  ? O GLY A 586  N GLY A 566  ? N GLY A 566  
B  1 2  N VAL A 23   ? N VAL A 23   O VAL A 31   ? O VAL A 31   
B  2 3  N VAL A 32   ? N VAL A 32   O TYR A 48   ? O TYR A 48   
B  3 4  N GLN A 49   ? N GLN A 49   O GLU A 58   ? O GLU A 58   
C  1 2  N ALA A 78   ? N ALA A 78   O LEU A 87   ? O LEU A 87   
C  2 3  N GLY A 90   ? N GLY A 90   O LEU A 106  ? O LEU A 106  
C  3 4  N LEU A 109  ? N LEU A 109  O THR A 116  ? O THR A 116  
D  1 2  N HIS A 95   ? N HIS A 95   O TYR A 102  ? O TYR A 102  
E  1 2  N ALA A 350  ? N ALA A 350  O GLY A 359  ? O GLY A 359  
E  2 3  N LEU A 362  ? N LEU A 362  O THR A 370  ? O THR A 370  
F  1 2  N GLU A 391  ? N GLU A 391  O VAL A 402  ? O VAL A 402  
F  2 3  N LEU A 401  ? N LEU A 401  O PHE A 417  ? O PHE A 417  
F  3 4  N ILE A 416  ? N ILE A 416  O ALA A 428  ? O ALA A 428  
G  1 2  N CYS A 444  ? N CYS A 444  O LEU A 458  ? O LEU A 458  
G  2 3  N VAL A 457  ? N VAL A 457  O CYS A 476  ? O CYS A 476  
H  1 2  N GLY A 510  ? N GLY A 510  O ASP A 519  ? O ASP A 519  
H  2 3  N VAL A 520  ? N VAL A 520  O PHE A 537  ? O PHE A 537  
I  1 2  N GLY A 603  ? N GLY A 603  O TYR A 638  ? O TYR A 638  
I  2 3  N SER A 633  ? N SER A 633  O PHE A 696  ? O PHE A 696  
J  1 2  O LEU A 687  ? O LEU A 687  N SER A 654  ? N SER A 654  
J  2 3  N ALA A 661  ? N ALA A 661  O ARG A 714  ? O ARG A 714  
J  3 4  N ILE A 711  ? N ILE A 711  O LEU A 746  ? O LEU A 746  
K  1 2  N SER A 765  ? N SER A 765  O MET A 787  ? O MET A 787  
K  2 3  N VAL A 786  ? N VAL A 786  O PHE A 859  ? O PHE A 859  
K  3 4  O THR A 862  ? O THR A 862  N ARG A 811  ? N ARG A 811  
L  1 2  N VAL A 776  ? N VAL A 776  O ALA A 904  ? O ALA A 904  
L  2 3  N TYR A 903  ? N TYR A 903  O SER A 1061 ? O SER A 1061 
M  1 2  N ASP A 830  ? N ASP A 830  O SER A 843  ? O SER A 843  
M  2 3  O TRP A 840  ? O TRP A 840  N HIS A 804  ? N HIS A 804  
M  3 4  N THR A 801  ? N THR A 801  O ASN A 880  ? O ASN A 880  
M  4 5  N LEU A 875  ? N LEU A 875  O LEU A 899  ? O LEU A 899  
M  5 6  N GLN A 896  ? N GLN A 896  O GLU C 898  ? O GLU C 898  
M  6 7  O LEU C 899  ? O LEU C 899  N LEU C 875  ? N LEU C 875  
M  7 8  O ASN C 880  ? O ASN C 880  N THR C 801  ? N THR C 801  
M  8 9  N HIS C 804  ? N HIS C 804  O TRP C 840  ? O TRP C 840  
M  9 10 O SER C 843  ? O SER C 843  N ASP C 830  ? N ASP C 830  
N  1 2  N SER A 910  ? N SER A 910  O GLN A 937  ? O GLN A 937  
N  2 3  N HIS A 934  ? N HIS A 934  O LEU A 1028 ? O LEU A 1028 
N  3 4  O LYS A 1029 ? O LYS A 1029 N GLU A 968  ? N GLU A 968  
O  1 2  N GLU A 982  ? N GLU A 982  O ARG A 1010 ? O ARG A 1010 
O  2 3  O CYS A 1013 ? O CYS A 1013 N ILE A 950  ? N ILE A 950  
O  3 4  N ASN A 951  ? N ASN A 951  O GLU A 1052 ? O GLU A 1052 
O  4 5  O VAL A 1048 ? O VAL A 1048 N LEU A 1001 ? N LEU A 1001 
P  1 2  N GLU A 982  ? N GLU A 982  O ARG A 1010 ? O ARG A 1010 
P  2 3  O CYS A 1013 ? O CYS A 1013 N ILE A 950  ? N ILE A 950  
P  3 4  N ASN A 951  ? N ASN A 951  O GLU A 1052 ? O GLU A 1052 
P  4 5  N VAL A 1047 ? N VAL A 1047 O THR A 1076 ? O THR A 1076 
Q  1 2  O ASP B 41   ? O ASP B 41   N THR B 22   ? N THR B 22   
Q  2 3  N TRP B 23   ? N TRP B 23   O MET B 57   ? O MET B 57   
R  1 2  N LEU B 83   ? N LEU B 83   O LEU B 420  ? O LEU B 420  
R  2 3  O VAL B 419  ? O VAL B 419  N GLN B 402  ? N GLN B 402  
S  1 2  N ALA B 91   ? N ALA B 91   O VAL B 393  ? O VAL B 393  
S  2 3  O THR B 394  ? O THR B 394  N LYS B 357  ? N LYS B 357  
T  1 2  O THR B 189  ? O THR B 189  N ILE B 144  ? N ILE B 144  
T  2 3  O GLY B 147  ? O GLY B 147  N TYR B 109  ? N TYR B 109  
T  3 4  N ASP B 112  ? N ASP B 112  O ALA B 240  ? O ALA B 240  
U  1 2  N VAL B 300  ? N VAL B 300  O GLY B 321  ? O GLY B 321  
V  1 2  N PHE B 442  ? N PHE B 442  O ARG B 449  ? O ARG B 449  
W  1 2  N ILE B 455  ? N ILE B 455  O CYS B 461  ? O CYS B 461  
X  1 2  N VAL B 491  ? N VAL B 491  O GLN B 494  ? O GLN B 494  
Y  1 2  N TYR B 508  ? N TYR B 508  O CYS B 514  ? O CYS B 514  
Z  1 2  N PHE B 536  ? N PHE B 536  O LYS B 539  ? O LYS B 539  
AA 1 2  N CYS B 640  ? N CYS B 640  O TYR B 652  ? O TYR B 652  
AA 2 3  N THR B 653  ? N THR B 653  O TYR B 666  ? O TYR B 666  
AB 1 2  N PHE C 11   ? N PHE C 11   O VAL C 591  ? O VAL C 591  
AB 2 3  O LEU C 592  ? O LEU C 592  N VAL C 585  ? N VAL C 585  
AB 3 4  O GLY C 586  ? O GLY C 586  N GLY C 566  ? N GLY C 566  
AC 1 2  N VAL C 23   ? N VAL C 23   O VAL C 31   ? O VAL C 31   
AC 2 3  N VAL C 32   ? N VAL C 32   O TYR C 48   ? O TYR C 48   
AC 3 4  N GLN C 49   ? N GLN C 49   O GLU C 58   ? O GLU C 58   
AD 1 2  N ALA C 78   ? N ALA C 78   O LEU C 87   ? O LEU C 87   
AD 2 3  N GLY C 90   ? N GLY C 90   O LEU C 106  ? O LEU C 106  
AD 3 4  N LEU C 109  ? N LEU C 109  O THR C 116  ? O THR C 116  
AE 1 2  N HIS C 95   ? N HIS C 95   O TYR C 102  ? O TYR C 102  
AF 1 2  N ALA C 350  ? N ALA C 350  O GLY C 359  ? O GLY C 359  
AF 2 3  N LEU C 362  ? N LEU C 362  O THR C 370  ? O THR C 370  
AG 1 2  N GLU C 391  ? N GLU C 391  O VAL C 402  ? O VAL C 402  
AG 2 3  N LEU C 401  ? N LEU C 401  O PHE C 417  ? O PHE C 417  
AG 3 4  N ILE C 416  ? N ILE C 416  O ALA C 428  ? O ALA C 428  
AH 1 2  N CYS C 444  ? N CYS C 444  O LEU C 458  ? O LEU C 458  
AH 2 3  N VAL C 457  ? N VAL C 457  O CYS C 476  ? O CYS C 476  
AI 1 2  N GLY C 510  ? N GLY C 510  O ASP C 519  ? O ASP C 519  
AI 2 3  N VAL C 520  ? N VAL C 520  O PHE C 537  ? O PHE C 537  
AJ 1 2  N GLY C 603  ? N GLY C 603  O TYR C 638  ? O TYR C 638  
AJ 2 3  N SER C 633  ? N SER C 633  O PHE C 696  ? O PHE C 696  
AK 1 2  O LEU C 687  ? O LEU C 687  N SER C 654  ? N SER C 654  
AK 2 3  N ALA C 661  ? N ALA C 661  O ARG C 714  ? O ARG C 714  
AK 3 4  N ILE C 711  ? N ILE C 711  O LEU C 746  ? O LEU C 746  
AL 1 2  N SER C 765  ? N SER C 765  O MET C 787  ? O MET C 787  
AL 2 3  N VAL C 786  ? N VAL C 786  O PHE C 859  ? O PHE C 859  
AL 3 4  O THR C 862  ? O THR C 862  N ARG C 811  ? N ARG C 811  
AM 1 2  N VAL C 776  ? N VAL C 776  O ALA C 904  ? O ALA C 904  
AM 2 3  N TYR C 903  ? N TYR C 903  O SER C 1061 ? O SER C 1061 
AN 1 2  N SER C 910  ? N SER C 910  O GLN C 937  ? O GLN C 937  
AN 2 3  N HIS C 934  ? N HIS C 934  O LEU C 1028 ? O LEU C 1028 
AN 3 4  O LYS C 1029 ? O LYS C 1029 N GLU C 968  ? N GLU C 968  
AO 1 2  N GLU C 982  ? N GLU C 982  O ARG C 1010 ? O ARG C 1010 
AO 2 3  O CYS C 1013 ? O CYS C 1013 N ILE C 950  ? N ILE C 950  
AO 3 4  N ASN C 951  ? N ASN C 951  O GLU C 1052 ? O GLU C 1052 
AO 4 5  O VAL C 1048 ? O VAL C 1048 N LEU C 1001 ? N LEU C 1001 
AP 1 2  N GLU C 982  ? N GLU C 982  O ARG C 1010 ? O ARG C 1010 
AP 2 3  O CYS C 1013 ? O CYS C 1013 N ILE C 950  ? N ILE C 950  
AP 3 4  N ASN C 951  ? N ASN C 951  O GLU C 1052 ? O GLU C 1052 
AP 4 5  N VAL C 1047 ? N VAL C 1047 O THR C 1076 ? O THR C 1076 
AQ 1 2  O ASP D 41   ? O ASP D 41   N THR D 22   ? N THR D 22   
AQ 2 3  N TRP D 23   ? N TRP D 23   O MET D 57   ? O MET D 57   
AR 1 2  N LEU D 83   ? N LEU D 83   O LEU D 420  ? O LEU D 420  
AR 2 3  O VAL D 417  ? O VAL D 417  N PHE D 404  ? N PHE D 404  
AS 1 2  N ALA D 91   ? N ALA D 91   O VAL D 393  ? O VAL D 393  
AS 2 3  O THR D 394  ? O THR D 394  N LYS D 357  ? N LYS D 357  
AT 1 2  O THR D 189  ? O THR D 189  N ILE D 144  ? N ILE D 144  
AT 2 3  O GLY D 147  ? O GLY D 147  N TYR D 109  ? N TYR D 109  
AT 3 4  N ASP D 112  ? N ASP D 112  O ALA D 240  ? O ALA D 240  
AU 1 2  N VAL D 300  ? N VAL D 300  O GLY D 321  ? O GLY D 321  
AV 1 2  N PHE D 442  ? N PHE D 442  O ARG D 449  ? O ARG D 449  
AW 1 2  N ILE D 455  ? N ILE D 455  O CYS D 461  ? O CYS D 461  
AX 1 2  N VAL D 491  ? N VAL D 491  O GLN D 494  ? O GLN D 494  
AY 1 2  N TYR D 508  ? N TYR D 508  O CYS D 514  ? O CYS D 514  
AZ 1 2  N PHE D 536  ? N PHE D 536  O LYS D 539  ? O LYS D 539  
BA 1 2  N CYS D 640  ? N CYS D 640  O TYR D 652  ? O TYR D 652  
BA 2 3  N THR D 653  ? N THR D 653  O TYR D 666  ? O TYR D 666  
# 
_database_PDB_matrix.entry_id          3K72 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3K72 
_atom_sites.fract_transf_matrix[1][1]   0.006213 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006041 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001865 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . PHE A  1 1    ? -16.423 7.326   38.921  1.00 203.85 ? 1    PHE A N   1 
ATOM   2     C  CA  . PHE A  1 1    ? -17.167 6.220   39.600  1.00 154.53 ? 1    PHE A CA  1 
ATOM   3     C  C   . PHE A  1 1    ? -18.655 6.548   39.794  1.00 136.59 ? 1    PHE A C   1 
ATOM   4     O  O   . PHE A  1 1    ? -19.388 5.766   40.402  1.00 110.57 ? 1    PHE A O   1 
ATOM   5     C  CB  . PHE A  1 1    ? -16.510 5.913   40.945  1.00 157.39 ? 1    PHE A CB  1 
ATOM   6     C  CG  . PHE A  1 1    ? -16.091 7.143   41.700  1.00 197.96 ? 1    PHE A CG  1 
ATOM   7     C  CD1 . PHE A  1 1    ? -14.809 7.654   41.563  1.00 240.68 ? 1    PHE A CD1 1 
ATOM   8     C  CD2 . PHE A  1 1    ? -16.986 7.800   42.530  1.00 86.57  ? 1    PHE A CD2 1 
ATOM   9     C  CE1 . PHE A  1 1    ? -14.427 8.785   42.248  1.00 228.16 ? 1    PHE A CE1 1 
ATOM   10    C  CE2 . PHE A  1 1    ? -16.610 8.931   43.214  1.00 144.39 ? 1    PHE A CE2 1 
ATOM   11    C  CZ  . PHE A  1 1    ? -15.328 9.424   43.075  1.00 215.50 ? 1    PHE A CZ  1 
ATOM   12    N  N   . ASN A  1 2    ? -19.089 7.689   39.252  1.00 140.28 ? 2    ASN A N   1 
ATOM   13    C  CA  . ASN A  1 2    ? -20.472 8.156   39.364  1.00 117.34 ? 2    ASN A CA  1 
ATOM   14    C  C   . ASN A  1 2    ? -21.179 8.307   38.023  1.00 112.89 ? 2    ASN A C   1 
ATOM   15    O  O   . ASN A  1 2    ? -21.690 9.379   37.713  1.00 193.77 ? 2    ASN A O   1 
ATOM   16    C  CB  . ASN A  1 2    ? -20.520 9.495   40.107  1.00 181.00 ? 2    ASN A CB  1 
ATOM   17    C  CG  . ASN A  1 2    ? -19.482 10.498  39.608  1.00 149.40 ? 2    ASN A CG  1 
ATOM   18    O  OD1 . ASN A  1 2    ? -18.284 10.206  39.539  1.00 114.91 ? 2    ASN A OD1 1 
ATOM   19    N  ND2 . ASN A  1 2    ? -19.939 11.704  39.295  1.00 113.72 ? 2    ASN A ND2 1 
ATOM   20    N  N   . LEU A  1 3    ? -21.197 7.233   37.230  1.00 153.84 ? 3    LEU A N   1 
ATOM   21    C  CA  . LEU A  1 3    ? -21.831 7.231   35.901  1.00 156.83 ? 3    LEU A CA  1 
ATOM   22    C  C   . LEU A  1 3    ? -23.075 6.372   35.947  1.00 155.87 ? 3    LEU A C   1 
ATOM   23    O  O   . LEU A  1 3    ? -22.993 5.150   36.077  1.00 182.19 ? 3    LEU A O   1 
ATOM   24    C  CB  . LEU A  1 3    ? -20.873 6.696   34.827  1.00 184.93 ? 3    LEU A CB  1 
ATOM   25    C  CG  . LEU A  1 3    ? -19.677 7.595   34.483  1.00 195.23 ? 3    LEU A CG  1 
ATOM   26    C  CD1 . LEU A  1 3    ? -18.625 6.850   33.659  1.00 220.63 ? 3    LEU A CD1 1 
ATOM   27    C  CD2 . LEU A  1 3    ? -20.148 8.863   33.762  1.00 79.65  ? 3    LEU A CD2 1 
ATOM   28    N  N   . ASP A  1 4    ? -24.227 7.023   35.840  1.00 144.29 ? 4    ASP A N   1 
ATOM   29    C  CA  . ASP A  1 4    ? -25.494 6.352   36.053  1.00 162.26 ? 4    ASP A CA  1 
ATOM   30    C  C   . ASP A  1 4    ? -25.633 5.120   35.189  1.00 200.76 ? 4    ASP A C   1 
ATOM   31    O  O   . ASP A  1 4    ? -25.370 5.164   33.991  1.00 259.30 ? 4    ASP A O   1 
ATOM   32    C  CB  . ASP A  1 4    ? -26.653 7.284   35.756  1.00 178.50 ? 4    ASP A CB  1 
ATOM   33    C  CG  . ASP A  1 4    ? -27.988 6.584   35.867  1.00 212.27 ? 4    ASP A CG  1 
ATOM   34    O  OD1 . ASP A  1 4    ? -28.164 5.779   36.804  1.00 179.59 ? 4    ASP A OD1 1 
ATOM   35    O  OD2 . ASP A  1 4    ? -28.866 6.838   35.021  1.00 258.61 ? 4    ASP A OD2 1 
ATOM   36    N  N   . THR A  1 5    ? -26.065 4.026   35.806  1.00 153.95 ? 5    THR A N   1 
ATOM   37    C  CA  . THR A  1 5    ? -26.285 2.776   35.096  1.00 163.73 ? 5    THR A CA  1 
ATOM   38    C  C   . THR A  1 5    ? -27.690 2.244   35.401  1.00 206.17 ? 5    THR A C   1 
ATOM   39    O  O   . THR A  1 5    ? -27.877 1.043   35.595  1.00 258.32 ? 5    THR A O   1 
ATOM   40    C  CB  . THR A  1 5    ? -25.223 1.706   35.476  1.00 154.33 ? 5    THR A CB  1 
ATOM   41    O  OG1 . THR A  1 5    ? -23.930 2.315   35.574  1.00 161.20 ? 5    THR A OG1 1 
ATOM   42    C  CG2 . THR A  1 5    ? -25.177 0.586   34.440  1.00 221.24 ? 5    THR A CG2 1 
ATOM   43    N  N   . GLU A  1 6    ? -28.677 3.138   35.439  1.00 165.27 ? 6    GLU A N   1 
ATOM   44    C  CA  . GLU A  1 6    ? -30.054 2.742   35.728  1.00 211.87 ? 6    GLU A CA  1 
ATOM   45    C  C   . GLU A  1 6    ? -31.068 3.658   35.049  1.00 215.92 ? 6    GLU A C   1 
ATOM   46    O  O   . GLU A  1 6    ? -31.795 3.238   34.149  1.00 277.34 ? 6    GLU A O   1 
ATOM   47    C  CB  . GLU A  1 6    ? -30.299 2.742   37.237  1.00 265.82 ? 6    GLU A CB  1 
ATOM   48    C  CG  . GLU A  1 6    ? -29.425 1.773   38.009  1.00 287.63 ? 6    GLU A CG  1 
ATOM   49    C  CD  . GLU A  1 6    ? -29.744 0.327   37.695  1.00 327.03 ? 6    GLU A CD  1 
ATOM   50    O  OE1 . GLU A  1 6    ? -30.744 0.074   36.991  1.00 356.34 ? 6    GLU A OE1 1 
ATOM   51    O  OE2 . GLU A  1 6    ? -28.994 -0.557  38.156  1.00 333.73 ? 6    GLU A OE2 1 
ATOM   52    N  N   . GLU A  1 7    ? -31.119 4.908   35.493  1.00 196.81 ? 7    GLU A N   1 
ATOM   53    C  CA  . GLU A  1 7    ? -32.084 5.867   34.971  1.00 237.81 ? 7    GLU A CA  1 
ATOM   54    C  C   . GLU A  1 7    ? -31.448 6.795   33.942  1.00 267.79 ? 7    GLU A C   1 
ATOM   55    O  O   . GLU A  1 7    ? -31.088 7.928   34.260  1.00 280.83 ? 7    GLU A O   1 
ATOM   56    C  CB  . GLU A  1 7    ? -32.670 6.697   36.113  1.00 248.36 ? 7    GLU A CB  1 
ATOM   57    C  CG  . GLU A  1 7    ? -33.359 5.874   37.188  1.00 257.21 ? 7    GLU A CG  1 
ATOM   58    C  CD  . GLU A  1 7    ? -34.600 5.169   36.680  1.00 282.01 ? 7    GLU A CD  1 
ATOM   59    O  OE1 . GLU A  1 7    ? -35.080 5.525   35.584  1.00 317.52 ? 7    GLU A OE1 1 
ATOM   60    O  OE2 . GLU A  1 7    ? -35.098 4.261   37.378  1.00 269.28 ? 7    GLU A OE2 1 
ATOM   61    N  N   . LEU A  1 8    ? -31.315 6.312   32.709  1.00 269.39 ? 8    LEU A N   1 
ATOM   62    C  CA  . LEU A  1 8    ? -30.722 7.098   31.630  1.00 252.60 ? 8    LEU A CA  1 
ATOM   63    C  C   . LEU A  1 8    ? -31.663 7.176   30.430  1.00 250.97 ? 8    LEU A C   1 
ATOM   64    O  O   . LEU A  1 8    ? -32.711 6.529   30.405  1.00 282.30 ? 8    LEU A O   1 
ATOM   65    C  CB  . LEU A  1 8    ? -29.377 6.500   31.205  1.00 224.32 ? 8    LEU A CB  1 
ATOM   66    C  CG  . LEU A  1 8    ? -29.389 5.008   30.881  1.00 196.50 ? 8    LEU A CG  1 
ATOM   67    C  CD1 . LEU A  1 8    ? -29.998 4.741   29.517  1.00 164.88 ? 8    LEU A CD1 1 
ATOM   68    C  CD2 . LEU A  1 8    ? -27.978 4.464   30.941  1.00 182.83 ? 8    LEU A CD2 1 
ATOM   69    N  N   . THR A  1 9    ? -31.277 7.971   29.438  1.00 227.40 ? 9    THR A N   1 
ATOM   70    C  CA  . THR A  1 9    ? -32.079 8.141   28.234  1.00 232.07 ? 9    THR A CA  1 
ATOM   71    C  C   . THR A  1 9    ? -31.443 7.371   27.079  1.00 235.67 ? 9    THR A C   1 
ATOM   72    O  O   . THR A  1 9    ? -30.217 7.242   27.019  1.00 136.31 ? 9    THR A O   1 
ATOM   73    C  CB  . THR A  1 9    ? -32.212 9.633   27.865  1.00 216.83 ? 9    THR A CB  1 
ATOM   74    O  OG1 . THR A  1 9    ? -30.913 10.229  27.772  1.00 180.18 ? 9    THR A OG1 1 
ATOM   75    C  CG2 . THR A  1 9    ? -33.004 10.373  28.918  1.00 189.58 ? 9    THR A CG2 1 
ATOM   76    N  N   . ALA A  1 10   ? -32.280 6.855   26.177  1.00 258.92 ? 10   ALA A N   1 
ATOM   77    C  CA  . ALA A  1 10   ? -31.811 6.076   25.028  1.00 213.11 ? 10   ALA A CA  1 
ATOM   78    C  C   . ALA A  1 10   ? -32.554 6.462   23.752  1.00 203.41 ? 10   ALA A C   1 
ATOM   79    O  O   . ALA A  1 10   ? -33.785 6.427   23.708  1.00 238.89 ? 10   ALA A O   1 
ATOM   80    C  CB  . ALA A  1 10   ? -31.973 4.581   25.298  1.00 153.86 ? 10   ALA A CB  1 
ATOM   81    N  N   . PHE A  1 11   ? -31.797 6.829   22.719  1.00 173.78 ? 11   PHE A N   1 
ATOM   82    C  CA  . PHE A  1 11   ? -32.369 7.142   21.413  1.00 242.96 ? 11   PHE A CA  1 
ATOM   83    C  C   . PHE A  1 11   ? -32.024 6.049   20.410  1.00 253.89 ? 11   PHE A C   1 
ATOM   84    O  O   . PHE A  1 11   ? -30.910 6.006   19.892  1.00 207.49 ? 11   PHE A O   1 
ATOM   85    C  CB  . PHE A  1 11   ? -31.838 8.476   20.892  1.00 213.39 ? 11   PHE A CB  1 
ATOM   86    C  CG  . PHE A  1 11   ? -32.243 9.656   21.721  1.00 197.41 ? 11   PHE A CG  1 
ATOM   87    C  CD1 . PHE A  1 11   ? -33.570 10.046  21.811  1.00 215.56 ? 11   PHE A CD1 1 
ATOM   88    C  CD2 . PHE A  1 11   ? -31.289 10.384  22.400  1.00 145.37 ? 11   PHE A CD2 1 
ATOM   89    C  CE1 . PHE A  1 11   ? -33.934 11.138  22.574  1.00 193.54 ? 11   PHE A CE1 1 
ATOM   90    C  CE2 . PHE A  1 11   ? -31.647 11.476  23.161  1.00 159.99 ? 11   PHE A CE2 1 
ATOM   91    C  CZ  . PHE A  1 11   ? -32.972 11.853  23.249  1.00 151.63 ? 11   PHE A CZ  1 
ATOM   92    N  N   . ARG A  1 12   ? -32.985 5.176   20.130  1.00 265.93 ? 12   ARG A N   1 
ATOM   93    C  CA  . ARG A  1 12   ? -32.767 4.086   19.188  1.00 248.76 ? 12   ARG A CA  1 
ATOM   94    C  C   . ARG A  1 12   ? -33.445 4.366   17.847  1.00 269.23 ? 12   ARG A C   1 
ATOM   95    O  O   . ARG A  1 12   ? -34.457 3.751   17.515  1.00 309.39 ? 12   ARG A O   1 
ATOM   96    C  CB  . ARG A  1 12   ? -33.259 2.756   19.774  1.00 259.54 ? 12   ARG A CB  1 
ATOM   97    C  CG  . ARG A  1 12   ? -34.690 2.775   20.294  1.00 289.65 ? 12   ARG A CG  1 
ATOM   98    C  CD  . ARG A  1 12   ? -35.096 1.415   20.837  1.00 293.86 ? 12   ARG A CD  1 
ATOM   99    N  NE  . ARG A  1 12   ? -34.212 0.975   21.910  1.00 273.97 ? 12   ARG A NE  1 
ATOM   100   C  CZ  . ARG A  1 12   ? -34.283 -0.213  22.497  1.00 277.99 ? 12   ARG A CZ  1 
ATOM   101   N  NH1 . ARG A  1 12   ? -35.198 -1.095  22.120  1.00 317.31 ? 12   ARG A NH1 1 
ATOM   102   N  NH2 . ARG A  1 12   ? -33.434 -0.521  23.465  1.00 238.37 ? 12   ARG A NH2 1 
ATOM   103   N  N   . VAL A  1 13   ? -32.880 5.299   17.082  1.00 258.36 ? 13   VAL A N   1 
ATOM   104   C  CA  . VAL A  1 13   ? -33.378 5.608   15.743  1.00 260.38 ? 13   VAL A CA  1 
ATOM   105   C  C   . VAL A  1 13   ? -32.667 4.735   14.711  1.00 276.24 ? 13   VAL A C   1 
ATOM   106   O  O   . VAL A  1 13   ? -31.479 4.925   14.447  1.00 238.36 ? 13   VAL A O   1 
ATOM   107   C  CB  . VAL A  1 13   ? -33.152 7.093   15.381  1.00 244.33 ? 13   VAL A CB  1 
ATOM   108   C  CG1 . VAL A  1 13   ? -33.837 7.432   14.061  1.00 252.12 ? 13   VAL A CG1 1 
ATOM   109   C  CG2 . VAL A  1 13   ? -33.662 7.995   16.492  1.00 234.09 ? 13   VAL A CG2 1 
ATOM   110   N  N   . ASP A  1 14   ? -33.398 3.779   14.136  1.00 309.86 ? 14   ASP A N   1 
ATOM   111   C  CA  . ASP A  1 14   ? -32.834 2.840   13.163  1.00 283.88 ? 14   ASP A CA  1 
ATOM   112   C  C   . ASP A  1 14   ? -32.720 3.445   11.760  1.00 243.36 ? 14   ASP A C   1 
ATOM   113   O  O   . ASP A  1 14   ? -33.650 3.361   10.959  1.00 178.36 ? 14   ASP A O   1 
ATOM   114   C  CB  . ASP A  1 14   ? -33.684 1.566   13.102  1.00 260.85 ? 14   ASP A CB  1 
ATOM   115   C  CG  . ASP A  1 14   ? -33.094 0.521   12.181  1.00 254.66 ? 14   ASP A CG  1 
ATOM   116   O  OD1 . ASP A  1 14   ? -31.937 0.699   11.745  1.00 197.77 ? 14   ASP A OD1 1 
ATOM   117   O  OD2 . ASP A  1 14   ? -33.785 -0.479  11.893  1.00 306.20 ? 14   ASP A OD2 1 
ATOM   118   N  N   . SER A  1 15   ? -31.565 4.036   11.467  1.00 261.97 ? 15   SER A N   1 
ATOM   119   C  CA  . SER A  1 15   ? -31.325 4.666   10.172  1.00 223.69 ? 15   SER A CA  1 
ATOM   120   C  C   . SER A  1 15   ? -29.966 4.255   9.613   1.00 195.78 ? 15   SER A C   1 
ATOM   121   O  O   . SER A  1 15   ? -29.114 5.101   9.332   1.00 163.37 ? 15   SER A O   1 
ATOM   122   C  CB  . SER A  1 15   ? -31.398 6.194   10.287  1.00 220.34 ? 15   SER A CB  1 
ATOM   123   O  OG  . SER A  1 15   ? -32.714 6.634   10.578  1.00 196.67 ? 15   SER A OG  1 
ATOM   124   N  N   . ALA A  1 16   ? -29.772 2.950   9.457   1.00 213.37 ? 16   ALA A N   1 
ATOM   125   C  CA  . ALA A  1 16   ? -28.547 2.416   8.876   1.00 223.42 ? 16   ALA A CA  1 
ATOM   126   C  C   . ALA A  1 16   ? -27.344 2.658   9.780   1.00 227.82 ? 16   ALA A C   1 
ATOM   127   O  O   . ALA A  1 16   ? -27.224 2.042   10.837  1.00 248.08 ? 16   ALA A O   1 
ATOM   128   C  CB  . ALA A  1 16   ? -28.309 3.019   7.505   1.00 237.92 ? 16   ALA A CB  1 
ATOM   129   N  N   . GLY A  1 17   ? -26.453 3.551   9.358   1.00 206.60 ? 17   GLY A N   1 
ATOM   130   C  CA  . GLY A  1 17   ? -25.252 3.846   10.117  1.00 230.01 ? 17   GLY A CA  1 
ATOM   131   C  C   . GLY A  1 17   ? -25.471 4.899   11.188  1.00 227.74 ? 17   GLY A C   1 
ATOM   132   O  O   . GLY A  1 17   ? -24.575 5.691   11.481  1.00 130.68 ? 17   GLY A O   1 
ATOM   133   N  N   . PHE A  1 18   ? -26.665 4.902   11.776  1.00 283.98 ? 18   PHE A N   1 
ATOM   134   C  CA  . PHE A  1 18   ? -27.013 5.843   12.837  1.00 264.27 ? 18   PHE A CA  1 
ATOM   135   C  C   . PHE A  1 18   ? -26.234 5.556   14.112  1.00 210.92 ? 18   PHE A C   1 
ATOM   136   O  O   . PHE A  1 18   ? -25.843 4.419   14.369  1.00 163.05 ? 18   PHE A O   1 
ATOM   137   C  CB  . PHE A  1 18   ? -28.508 5.763   13.135  1.00 269.80 ? 18   PHE A CB  1 
ATOM   138   C  CG  . PHE A  1 18   ? -28.947 6.637   14.270  1.00 223.97 ? 18   PHE A CG  1 
ATOM   139   C  CD1 . PHE A  1 18   ? -28.855 6.191   15.574  1.00 211.40 ? 18   PHE A CD1 1 
ATOM   140   C  CD2 . PHE A  1 18   ? -29.462 7.899   14.034  1.00 200.36 ? 18   PHE A CD2 1 
ATOM   141   C  CE1 . PHE A  1 18   ? -29.262 6.988   16.621  1.00 219.29 ? 18   PHE A CE1 1 
ATOM   142   C  CE2 . PHE A  1 18   ? -29.871 8.698   15.075  1.00 173.78 ? 18   PHE A CE2 1 
ATOM   143   C  CZ  . PHE A  1 18   ? -29.770 8.244   16.372  1.00 172.84 ? 18   PHE A CZ  1 
ATOM   144   N  N   . GLY A  1 19   ? -26.028 6.588   14.920  1.00 187.36 ? 19   GLY A N   1 
ATOM   145   C  CA  . GLY A  1 19   ? -25.276 6.436   16.149  1.00 204.06 ? 19   GLY A CA  1 
ATOM   146   C  C   . GLY A  1 19   ? -23.889 5.886   15.887  1.00 232.31 ? 19   GLY A C   1 
ATOM   147   O  O   . GLY A  1 19   ? -23.411 4.998   16.595  1.00 326.98 ? 19   GLY A O   1 
ATOM   148   N  N   . ASP A  1 20   ? -23.242 6.418   14.858  1.00 198.41 ? 20   ASP A N   1 
ATOM   149   C  CA  . ASP A  1 20   ? -21.908 5.974   14.483  1.00 236.54 ? 20   ASP A CA  1 
ATOM   150   C  C   . ASP A  1 20   ? -20.887 7.059   14.809  1.00 179.52 ? 20   ASP A C   1 
ATOM   151   O  O   . ASP A  1 20   ? -19.702 6.777   14.969  1.00 173.35 ? 20   ASP A O   1 
ATOM   152   C  CB  . ASP A  1 20   ? -21.868 5.635   12.988  1.00 293.81 ? 20   ASP A CB  1 
ATOM   153   C  CG  . ASP A  1 20   ? -20.699 4.746   12.618  1.00 278.90 ? 20   ASP A CG  1 
ATOM   154   O  OD1 . ASP A  1 20   ? -19.958 4.336   13.528  1.00 280.36 ? 20   ASP A OD1 1 
ATOM   155   O  OD2 . ASP A  1 20   ? -20.515 4.455   11.418  1.00 196.63 ? 20   ASP A OD2 1 
ATOM   156   N  N   . SER A  1 21   ? -21.356 8.301   14.898  1.00 143.62 ? 21   SER A N   1 
ATOM   157   C  CA  . SER A  1 21   ? -20.512 9.433   15.284  1.00 194.79 ? 21   SER A CA  1 
ATOM   158   C  C   . SER A  1 21   ? -21.383 10.516  15.900  1.00 205.11 ? 21   SER A C   1 
ATOM   159   O  O   . SER A  1 21   ? -22.370 10.940  15.300  1.00 175.19 ? 21   SER A O   1 
ATOM   160   C  CB  . SER A  1 21   ? -19.757 10.003  14.083  1.00 203.11 ? 21   SER A CB  1 
ATOM   161   O  OG  . SER A  1 21   ? -18.928 11.085  14.473  1.00 188.80 ? 21   SER A OG  1 
ATOM   162   N  N   . VAL A  1 22   ? -21.012 10.965  17.094  1.00 229.66 ? 22   VAL A N   1 
ATOM   163   C  CA  . VAL A  1 22   ? -21.848 11.881  17.863  1.00 208.46 ? 22   VAL A CA  1 
ATOM   164   C  C   . VAL A  1 22   ? -21.015 13.004  18.490  1.00 163.75 ? 22   VAL A C   1 
ATOM   165   O  O   . VAL A  1 22   ? -19.796 12.877  18.630  1.00 119.16 ? 22   VAL A O   1 
ATOM   166   C  CB  . VAL A  1 22   ? -22.626 11.112  18.961  1.00 183.46 ? 22   VAL A CB  1 
ATOM   167   C  CG1 . VAL A  1 22   ? -21.664 10.348  19.868  1.00 137.20 ? 22   VAL A CG1 1 
ATOM   168   C  CG2 . VAL A  1 22   ? -23.523 12.057  19.761  1.00 167.18 ? 22   VAL A CG2 1 
ATOM   169   N  N   . VAL A  1 23   ? -21.677 14.106  18.843  1.00 142.97 ? 23   VAL A N   1 
ATOM   170   C  CA  . VAL A  1 23   ? -21.014 15.247  19.478  1.00 208.65 ? 23   VAL A CA  1 
ATOM   171   C  C   . VAL A  1 23   ? -21.988 16.049  20.337  1.00 181.13 ? 23   VAL A C   1 
ATOM   172   O  O   . VAL A  1 23   ? -23.196 16.043  20.101  1.00 146.71 ? 23   VAL A O   1 
ATOM   173   C  CB  . VAL A  1 23   ? -20.383 16.197  18.434  1.00 204.01 ? 23   VAL A CB  1 
ATOM   174   C  CG1 . VAL A  1 23   ? -21.465 16.857  17.582  1.00 189.29 ? 23   VAL A CG1 1 
ATOM   175   C  CG2 . VAL A  1 23   ? -19.523 17.252  19.114  1.00 181.13 ? 23   VAL A CG2 1 
ATOM   176   N  N   . GLN A  1 24   ? -21.453 16.729  21.342  1.00 167.54 ? 24   GLN A N   1 
ATOM   177   C  CA  . GLN A  1 24   ? -22.262 17.588  22.194  1.00 211.37 ? 24   GLN A CA  1 
ATOM   178   C  C   . GLN A  1 24   ? -22.541 18.912  21.510  1.00 229.24 ? 24   GLN A C   1 
ATOM   179   O  O   . GLN A  1 24   ? -21.645 19.747  21.384  1.00 306.55 ? 24   GLN A O   1 
ATOM   180   C  CB  . GLN A  1 24   ? -21.538 17.853  23.510  1.00 237.58 ? 24   GLN A CB  1 
ATOM   181   C  CG  . GLN A  1 24   ? -21.444 16.640  24.414  1.00 229.64 ? 24   GLN A CG  1 
ATOM   182   C  CD  . GLN A  1 24   ? -22.641 16.501  25.332  1.00 194.03 ? 24   GLN A CD  1 
ATOM   183   O  OE1 . GLN A  1 24   ? -23.547 17.335  25.323  1.00 213.25 ? 24   GLN A OE1 1 
ATOM   184   N  NE2 . GLN A  1 24   ? -22.649 15.447  26.135  1.00 92.37  ? 24   GLN A NE2 1 
ATOM   185   N  N   . TYR A  1 25   ? -23.778 19.103  21.060  1.00 105.20 ? 25   TYR A N   1 
ATOM   186   C  CA  . TYR A  1 25   ? -24.180 20.382  20.478  1.00 211.39 ? 25   TYR A CA  1 
ATOM   187   C  C   . TYR A  1 25   ? -24.303 21.415  21.579  1.00 211.54 ? 25   TYR A C   1 
ATOM   188   O  O   . TYR A  1 25   ? -24.052 21.111  22.742  1.00 244.03 ? 25   TYR A O   1 
ATOM   189   C  CB  . TYR A  1 25   ? -25.520 20.256  19.745  1.00 251.79 ? 25   TYR A CB  1 
ATOM   190   C  CG  . TYR A  1 25   ? -25.923 21.490  18.946  1.00 285.44 ? 25   TYR A CG  1 
ATOM   191   C  CD1 . TYR A  1 25   ? -24.995 22.176  18.165  1.00 268.15 ? 25   TYR A CD1 1 
ATOM   192   C  CD2 . TYR A  1 25   ? -27.232 21.958  18.960  1.00 277.47 ? 25   TYR A CD2 1 
ATOM   193   C  CE1 . TYR A  1 25   ? -25.359 23.299  17.432  1.00 193.32 ? 25   TYR A CE1 1 
ATOM   194   C  CE2 . TYR A  1 25   ? -27.605 23.075  18.229  1.00 263.32 ? 25   TYR A CE2 1 
ATOM   195   C  CZ  . TYR A  1 25   ? -26.665 23.741  17.468  1.00 211.89 ? 25   TYR A CZ  1 
ATOM   196   O  OH  . TYR A  1 25   ? -27.031 24.852  16.740  1.00 163.61 ? 25   TYR A OH  1 
ATOM   197   N  N   . ALA A  1 26   ? -24.652 22.643  21.201  1.00 268.49 ? 26   ALA A N   1 
ATOM   198   C  CA  . ALA A  1 26   ? -25.143 23.627  22.153  1.00 257.86 ? 26   ALA A CA  1 
ATOM   199   C  C   . ALA A  1 26   ? -25.854 22.840  23.232  1.00 221.20 ? 26   ALA A C   1 
ATOM   200   O  O   . ALA A  1 26   ? -26.585 21.903  22.920  1.00 162.49 ? 26   ALA A O   1 
ATOM   201   C  CB  . ALA A  1 26   ? -26.098 24.581  21.471  1.00 256.30 ? 26   ALA A CB  1 
ATOM   202   N  N   . ASN A  1 27   ? -25.636 23.218  24.489  1.00 227.12 ? 27   ASN A N   1 
ATOM   203   C  CA  . ASN A  1 27   ? -25.998 22.379  25.633  1.00 223.76 ? 27   ASN A CA  1 
ATOM   204   C  C   . ASN A  1 27   ? -27.367 21.716  25.552  1.00 230.79 ? 27   ASN A C   1 
ATOM   205   O  O   . ASN A  1 27   ? -27.573 20.645  26.116  1.00 266.16 ? 27   ASN A O   1 
ATOM   206   C  CB  . ASN A  1 27   ? -25.938 23.190  26.921  1.00 188.64 ? 27   ASN A CB  1 
ATOM   207   C  CG  . ASN A  1 27   ? -24.525 23.477  27.361  1.00 206.70 ? 27   ASN A CG  1 
ATOM   208   O  OD1 . ASN A  1 27   ? -23.562 22.974  26.782  1.00 155.32 ? 27   ASN A OD1 1 
ATOM   209   N  ND2 . ASN A  1 27   ? -24.391 24.287  28.402  1.00 317.52 ? 27   ASN A ND2 1 
ATOM   210   N  N   . SER A  1 28   ? -28.295 22.349  24.847  1.00 175.36 ? 28   SER A N   1 
ATOM   211   C  CA  . SER A  1 28   ? -29.683 21.901  24.830  1.00 210.50 ? 28   SER A CA  1 
ATOM   212   C  C   . SER A  1 28   ? -29.917 20.599  24.039  1.00 240.93 ? 28   SER A C   1 
ATOM   213   O  O   . SER A  1 28   ? -30.906 19.890  24.274  1.00 133.71 ? 28   SER A O   1 
ATOM   214   C  CB  . SER A  1 28   ? -30.554 23.022  24.261  1.00 190.67 ? 28   SER A CB  1 
ATOM   215   O  OG  . SER A  1 28   ? -30.525 24.169  25.099  1.00 172.60 ? 28   SER A OG  1 
ATOM   216   N  N   . TRP A  1 29   ? -28.991 20.277  23.134  1.00 269.12 ? 29   TRP A N   1 
ATOM   217   C  CA  . TRP A  1 29   ? -29.182 19.213  22.144  1.00 191.46 ? 29   TRP A CA  1 
ATOM   218   C  C   . TRP A  1 29   ? -27.931 18.375  21.880  1.00 153.71 ? 29   TRP A C   1 
ATOM   219   O  O   . TRP A  1 29   ? -26.798 18.820  22.100  1.00 111.63 ? 29   TRP A O   1 
ATOM   220   C  CB  . TRP A  1 29   ? -29.579 19.825  20.807  1.00 172.66 ? 29   TRP A CB  1 
ATOM   221   C  CG  . TRP A  1 29   ? -30.868 20.563  20.814  1.00 225.77 ? 29   TRP A CG  1 
ATOM   222   C  CD1 . TRP A  1 29   ? -31.084 21.821  21.287  1.00 292.45 ? 29   TRP A CD1 1 
ATOM   223   C  CD2 . TRP A  1 29   ? -32.126 20.100  20.309  1.00 191.37 ? 29   TRP A CD2 1 
ATOM   224   N  NE1 . TRP A  1 29   ? -32.402 22.171  21.116  1.00 293.15 ? 29   TRP A NE1 1 
ATOM   225   C  CE2 . TRP A  1 29   ? -33.063 21.131  20.518  1.00 245.80 ? 29   TRP A CE2 1 
ATOM   226   C  CE3 . TRP A  1 29   ? -32.552 18.914  19.707  1.00 186.55 ? 29   TRP A CE3 1 
ATOM   227   C  CZ2 . TRP A  1 29   ? -34.399 21.012  20.145  1.00 265.38 ? 29   TRP A CZ2 1 
ATOM   228   C  CZ3 . TRP A  1 29   ? -33.879 18.798  19.337  1.00 227.45 ? 29   TRP A CZ3 1 
ATOM   229   C  CH2 . TRP A  1 29   ? -34.786 19.841  19.557  1.00 274.20 ? 29   TRP A CH2 1 
ATOM   230   N  N   . VAL A  1 30   ? -28.154 17.170  21.361  1.00 148.33 ? 30   VAL A N   1 
ATOM   231   C  CA  . VAL A  1 30   ? -27.067 16.276  20.985  1.00 150.23 ? 30   VAL A CA  1 
ATOM   232   C  C   . VAL A  1 30   ? -27.264 15.807  19.553  1.00 216.49 ? 30   VAL A C   1 
ATOM   233   O  O   . VAL A  1 30   ? -28.343 15.337  19.175  1.00 202.64 ? 30   VAL A O   1 
ATOM   234   C  CB  . VAL A  1 30   ? -26.981 15.035  21.891  1.00 183.09 ? 30   VAL A CB  1 
ATOM   235   C  CG1 . VAL A  1 30   ? -28.260 14.197  21.788  1.00 131.91 ? 30   VAL A CG1 1 
ATOM   236   C  CG2 . VAL A  1 30   ? -25.752 14.211  21.530  1.00 158.67 ? 30   VAL A CG2 1 
ATOM   237   N  N   . VAL A  1 31   ? -26.206 15.933  18.761  1.00 257.52 ? 31   VAL A N   1 
ATOM   238   C  CA  . VAL A  1 31   ? -26.264 15.609  17.343  1.00 217.68 ? 31   VAL A CA  1 
ATOM   239   C  C   . VAL A  1 31   ? -25.588 14.280  17.054  1.00 215.30 ? 31   VAL A C   1 
ATOM   240   O  O   . VAL A  1 31   ? -24.430 14.068  17.414  1.00 187.40 ? 31   VAL A O   1 
ATOM   241   C  CB  . VAL A  1 31   ? -25.594 16.706  16.493  1.00 176.50 ? 31   VAL A CB  1 
ATOM   242   C  CG1 . VAL A  1 31   ? -25.381 16.229  15.072  1.00 187.31 ? 31   VAL A CG1 1 
ATOM   243   C  CG2 . VAL A  1 31   ? -26.442 17.963  16.507  1.00 154.35 ? 31   VAL A CG2 1 
ATOM   244   N  N   . VAL A  1 32   ? -26.325 13.389  16.399  1.00 229.83 ? 32   VAL A N   1 
ATOM   245   C  CA  . VAL A  1 32   ? -25.797 12.089  16.006  1.00 229.89 ? 32   VAL A CA  1 
ATOM   246   C  C   . VAL A  1 32   ? -25.565 12.049  14.503  1.00 239.70 ? 32   VAL A C   1 
ATOM   247   O  O   . VAL A  1 32   ? -26.047 12.915  13.772  1.00 256.62 ? 32   VAL A O   1 
ATOM   248   C  CB  . VAL A  1 32   ? -26.750 10.948  16.400  1.00 213.97 ? 32   VAL A CB  1 
ATOM   249   C  CG1 . VAL A  1 32   ? -26.805 10.819  17.905  1.00 276.82 ? 32   VAL A CG1 1 
ATOM   250   C  CG2 . VAL A  1 32   ? -28.136 11.190  15.833  1.00 201.26 ? 32   VAL A CG2 1 
ATOM   251   N  N   . GLY A  1 33   ? -24.827 11.042  14.044  1.00 238.35 ? 33   GLY A N   1 
ATOM   252   C  CA  . GLY A  1 33   ? -24.479 10.932  12.639  1.00 243.70 ? 33   GLY A CA  1 
ATOM   253   C  C   . GLY A  1 33   ? -24.906 9.606   12.044  1.00 253.09 ? 33   GLY A C   1 
ATOM   254   O  O   . GLY A  1 33   ? -24.805 8.558   12.684  1.00 263.80 ? 33   GLY A O   1 
ATOM   255   N  N   . ALA A  1 34   ? -25.397 9.661   10.811  1.00 239.13 ? 34   ALA A N   1 
ATOM   256   C  CA  . ALA A  1 34   ? -25.786 8.465   10.078  1.00 216.22 ? 34   ALA A CA  1 
ATOM   257   C  C   . ALA A  1 34   ? -25.294 8.580   8.638   1.00 254.09 ? 34   ALA A C   1 
ATOM   258   O  O   . ALA A  1 34   ? -26.083 8.843   7.728   1.00 268.84 ? 34   ALA A O   1 
ATOM   259   C  CB  . ALA A  1 34   ? -27.299 8.281   10.116  1.00 174.07 ? 34   ALA A CB  1 
ATOM   260   N  N   . PRO A  1 35   ? -23.979 8.390   8.430   1.00 268.99 ? 35   PRO A N   1 
ATOM   261   C  CA  . PRO A  1 35   ? -23.360 8.502   7.103   1.00 289.20 ? 35   PRO A CA  1 
ATOM   262   C  C   . PRO A  1 35   ? -24.048 7.634   6.055   1.00 283.89 ? 35   PRO A C   1 
ATOM   263   O  O   . PRO A  1 35   ? -24.197 8.051   4.906   1.00 323.19 ? 35   PRO A O   1 
ATOM   264   C  CB  . PRO A  1 35   ? -21.927 8.011   7.339   1.00 257.62 ? 35   PRO A CB  1 
ATOM   265   C  CG  . PRO A  1 35   ? -21.665 8.255   8.784   1.00 127.45 ? 35   PRO A CG  1 
ATOM   266   C  CD  . PRO A  1 35   ? -22.994 8.043   9.472   1.00 205.35 ? 35   PRO A CD  1 
ATOM   267   N  N   . GLN A  1 36   ? -24.471 6.441   6.459   1.00 227.40 ? 36   GLN A N   1 
ATOM   268   C  CA  . GLN A  1 36   ? -25.046 5.483   5.531   1.00 214.16 ? 36   GLN A CA  1 
ATOM   269   C  C   . GLN A  1 36   ? -26.569 5.508   5.539   1.00 258.41 ? 36   GLN A C   1 
ATOM   270   O  O   . GLN A  1 36   ? -27.215 4.484   5.326   1.00 286.35 ? 36   GLN A O   1 
ATOM   271   C  CB  . GLN A  1 36   ? -24.552 4.076   5.858   1.00 209.41 ? 36   GLN A CB  1 
ATOM   272   C  CG  . GLN A  1 36   ? -23.058 3.895   5.673   1.00 204.97 ? 36   GLN A CG  1 
ATOM   273   C  CD  . GLN A  1 36   ? -22.249 4.497   6.796   1.00 231.32 ? 36   GLN A CD  1 
ATOM   274   O  OE1 . GLN A  1 36   ? -22.753 4.709   7.897   1.00 294.01 ? 36   GLN A OE1 1 
ATOM   275   N  NE2 . GLN A  1 36   ? -20.979 4.767   6.526   1.00 206.60 ? 36   GLN A NE2 1 
ATOM   276   N  N   . LYS A  1 37   ? -27.143 6.681   5.780   1.00 262.39 ? 37   LYS A N   1 
ATOM   277   C  CA  . LYS A  1 37   ? -28.584 6.842   5.680   1.00 263.23 ? 37   LYS A CA  1 
ATOM   278   C  C   . LYS A  1 37   ? -28.937 7.229   4.244   1.00 301.74 ? 37   LYS A C   1 
ATOM   279   O  O   . LYS A  1 37   ? -29.158 8.400   3.940   1.00 339.46 ? 37   LYS A O   1 
ATOM   280   C  CB  . LYS A  1 37   ? -29.082 7.899   6.667   1.00 266.72 ? 37   LYS A CB  1 
ATOM   281   C  CG  . LYS A  1 37   ? -30.594 7.967   6.771   1.00 270.22 ? 37   LYS A CG  1 
ATOM   282   C  CD  . LYS A  1 37   ? -31.053 9.106   7.662   1.00 234.35 ? 37   LYS A CD  1 
ATOM   283   C  CE  . LYS A  1 37   ? -32.564 9.112   7.815   1.00 209.10 ? 37   LYS A CE  1 
ATOM   284   N  NZ  . LYS A  1 37   ? -33.266 9.149   6.501   1.00 274.83 ? 37   LYS A NZ  1 
ATOM   285   N  N   . ILE A  1 38   ? -28.981 6.226   3.370   1.00 298.93 ? 38   ILE A N   1 
ATOM   286   C  CA  . ILE A  1 38   ? -29.188 6.427   1.935   1.00 269.44 ? 38   ILE A CA  1 
ATOM   287   C  C   . ILE A  1 38   ? -30.254 7.472   1.602   1.00 252.69 ? 38   ILE A C   1 
ATOM   288   O  O   . ILE A  1 38   ? -31.381 7.406   2.092   1.00 218.70 ? 38   ILE A O   1 
ATOM   289   C  CB  . ILE A  1 38   ? -29.581 5.104   1.249   1.00 256.32 ? 38   ILE A CB  1 
ATOM   290   C  CG1 . ILE A  1 38   ? -28.446 4.087   1.369   1.00 240.34 ? 38   ILE A CG1 1 
ATOM   291   C  CG2 . ILE A  1 38   ? -29.924 5.346   -0.214  1.00 271.73 ? 38   ILE A CG2 1 
ATOM   292   C  CD1 . ILE A  1 38   ? -28.795 2.717   0.846   1.00 266.04 ? 38   ILE A CD1 1 
ATOM   293   N  N   . THR A  1 39   ? -29.888 8.425   0.750   1.00 250.67 ? 39   THR A N   1 
ATOM   294   C  CA  . THR A  1 39   ? -30.819 9.442   0.276   1.00 258.96 ? 39   THR A CA  1 
ATOM   295   C  C   . THR A  1 39   ? -30.564 9.732   -1.197  1.00 321.29 ? 39   THR A C   1 
ATOM   296   O  O   . THR A  1 39   ? -29.434 10.012  -1.596  1.00 347.95 ? 39   THR A O   1 
ATOM   297   C  CB  . THR A  1 39   ? -30.687 10.752  1.073   1.00 213.73 ? 39   THR A CB  1 
ATOM   298   O  OG1 . THR A  1 39   ? -29.307 11.125  1.162   1.00 241.87 ? 39   THR A OG1 1 
ATOM   299   C  CG2 . THR A  1 39   ? -31.254 10.585  2.471   1.00 216.17 ? 39   THR A CG2 1 
ATOM   300   N  N   . ALA A  1 40   ? -31.617 9.655   -2.003  1.00 323.28 ? 40   ALA A N   1 
ATOM   301   C  CA  . ALA A  1 40   ? -31.507 9.907   -3.434  1.00 262.28 ? 40   ALA A CA  1 
ATOM   302   C  C   . ALA A  1 40   ? -30.594 8.877   -4.105  1.00 256.40 ? 40   ALA A C   1 
ATOM   303   O  O   . ALA A  1 40   ? -30.609 7.700   -3.745  1.00 270.57 ? 40   ALA A O   1 
ATOM   304   C  CB  . ALA A  1 40   ? -31.002 11.320  -3.678  1.00 249.52 ? 40   ALA A CB  1 
ATOM   305   N  N   . ALA A  1 41   ? -29.801 9.319   -5.078  1.00 239.78 ? 41   ALA A N   1 
ATOM   306   C  CA  . ALA A  1 41   ? -28.952 8.413   -5.844  1.00 310.12 ? 41   ALA A CA  1 
ATOM   307   C  C   . ALA A  1 41   ? -27.572 8.294   -5.213  1.00 293.27 ? 41   ALA A C   1 
ATOM   308   O  O   . ALA A  1 41   ? -26.729 9.175   -5.378  1.00 229.14 ? 41   ALA A O   1 
ATOM   309   C  CB  . ALA A  1 41   ? -28.833 8.896   -7.281  1.00 371.34 ? 41   ALA A CB  1 
ATOM   310   N  N   . ASN A  1 42   ? -27.346 7.199   -4.495  1.00 324.20 ? 42   ASN A N   1 
ATOM   311   C  CA  . ASN A  1 42   ? -26.066 6.966   -3.837  1.00 292.70 ? 42   ASN A CA  1 
ATOM   312   C  C   . ASN A  1 42   ? -25.464 8.271   -3.338  1.00 281.33 ? 42   ASN A C   1 
ATOM   313   O  O   . ASN A  1 42   ? -24.337 8.619   -3.691  1.00 203.27 ? 42   ASN A O   1 
ATOM   314   C  CB  . ASN A  1 42   ? -25.095 6.285   -4.800  1.00 244.87 ? 42   ASN A CB  1 
ATOM   315   C  CG  . ASN A  1 42   ? -25.562 4.912   -5.220  1.00 257.17 ? 42   ASN A CG  1 
ATOM   316   O  OD1 . ASN A  1 42   ? -26.085 4.152   -4.409  1.00 279.57 ? 42   ASN A OD1 1 
ATOM   317   N  ND2 . ASN A  1 42   ? -25.378 4.583   -6.493  1.00 261.79 ? 42   ASN A ND2 1 
ATOM   318   N  N   . GLN A  1 43   ? -26.222 8.993   -2.518  1.00 312.16 ? 43   GLN A N   1 
ATOM   319   C  CA  . GLN A  1 43   ? -25.818 10.324  -2.082  1.00 285.23 ? 43   GLN A CA  1 
ATOM   320   C  C   . GLN A  1 43   ? -25.446 10.374  -0.593  1.00 295.58 ? 43   GLN A C   1 
ATOM   321   O  O   . GLN A  1 43   ? -24.707 9.521   -0.100  1.00 253.85 ? 43   GLN A O   1 
ATOM   322   C  CB  . GLN A  1 43   ? -26.918 11.338  -2.402  1.00 266.07 ? 43   GLN A CB  1 
ATOM   323   C  CG  . GLN A  1 43   ? -26.419 12.766  -2.523  1.00 260.44 ? 43   GLN A CG  1 
ATOM   324   C  CD  . GLN A  1 43   ? -27.546 13.759  -2.685  1.00 282.59 ? 43   GLN A CD  1 
ATOM   325   O  OE1 . GLN A  1 43   ? -28.704 13.379  -2.849  1.00 343.66 ? 43   GLN A OE1 1 
ATOM   326   N  NE2 . GLN A  1 43   ? -27.215 15.042  -2.639  1.00 220.68 ? 43   GLN A NE2 1 
ATOM   327   N  N   . THR A  1 44   ? -25.964 11.373  0.118   1.00 317.28 ? 44   THR A N   1 
ATOM   328   C  CA  . THR A  1 44   ? -25.567 11.632  1.498   1.00 288.10 ? 44   THR A CA  1 
ATOM   329   C  C   . THR A  1 44   ? -26.207 10.655  2.481   1.00 268.30 ? 44   THR A C   1 
ATOM   330   O  O   . THR A  1 44   ? -26.777 9.639   2.086   1.00 247.12 ? 44   THR A O   1 
ATOM   331   C  CB  . THR A  1 44   ? -25.961 13.063  1.920   1.00 275.01 ? 44   THR A CB  1 
ATOM   332   O  OG1 . THR A  1 44   ? -27.388 13.184  1.944   1.00 336.65 ? 44   THR A OG1 1 
ATOM   333   C  CG2 . THR A  1 44   ? -25.397 14.081  0.956   1.00 192.02 ? 44   THR A CG2 1 
ATOM   334   N  N   . GLY A  1 45   ? -26.100 10.975  3.768   1.00 281.34 ? 45   GLY A N   1 
ATOM   335   C  CA  . GLY A  1 45   ? -26.732 10.196  4.817   1.00 261.53 ? 45   GLY A CA  1 
ATOM   336   C  C   . GLY A  1 45   ? -27.809 10.999  5.524   1.00 280.87 ? 45   GLY A C   1 
ATOM   337   O  O   . GLY A  1 45   ? -28.996 10.845  5.241   1.00 335.41 ? 45   GLY A O   1 
ATOM   338   N  N   . GLY A  1 46   ? -27.393 11.863  6.445   1.00 238.86 ? 46   GLY A N   1 
ATOM   339   C  CA  . GLY A  1 46   ? -28.320 12.725  7.155   1.00 251.08 ? 46   GLY A CA  1 
ATOM   340   C  C   . GLY A  1 46   ? -27.967 12.840  8.623   1.00 250.03 ? 46   GLY A C   1 
ATOM   341   O  O   . GLY A  1 46   ? -27.269 11.982  9.163   1.00 187.57 ? 46   GLY A O   1 
ATOM   342   N  N   . LEU A  1 47   ? -28.450 13.904  9.263   1.00 277.64 ? 47   LEU A N   1 
ATOM   343   C  CA  . LEU A  1 47   ? -28.203 14.141  10.688  1.00 258.81 ? 47   LEU A CA  1 
ATOM   344   C  C   . LEU A  1 47   ? -29.499 14.154  11.519  1.00 235.44 ? 47   LEU A C   1 
ATOM   345   O  O   . LEU A  1 47   ? -30.600 14.311  10.984  1.00 201.11 ? 47   LEU A O   1 
ATOM   346   C  CB  . LEU A  1 47   ? -27.466 15.468  10.876  1.00 230.99 ? 47   LEU A CB  1 
ATOM   347   C  CG  . LEU A  1 47   ? -26.167 15.653  10.088  1.00 230.81 ? 47   LEU A CG  1 
ATOM   348   C  CD1 . LEU A  1 47   ? -25.694 17.085  10.199  1.00 211.82 ? 47   LEU A CD1 1 
ATOM   349   C  CD2 . LEU A  1 47   ? -25.082 14.699  10.565  1.00 196.36 ? 47   LEU A CD2 1 
ATOM   350   N  N   . TYR A  1 48   ? -29.357 14.004  12.833  1.00 245.12 ? 48   TYR A N   1 
ATOM   351   C  CA  . TYR A  1 48   ? -30.503 13.985  13.735  1.00 215.45 ? 48   TYR A CA  1 
ATOM   352   C  C   . TYR A  1 48   ? -30.205 14.725  15.032  1.00 230.07 ? 48   TYR A C   1 
ATOM   353   O  O   . TYR A  1 48   ? -29.228 14.428  15.720  1.00 220.22 ? 48   TYR A O   1 
ATOM   354   C  CB  . TYR A  1 48   ? -30.895 12.548  14.078  1.00 218.77 ? 48   TYR A CB  1 
ATOM   355   C  CG  . TYR A  1 48   ? -31.757 11.875  13.044  1.00 201.36 ? 48   TYR A CG  1 
ATOM   356   C  CD1 . TYR A  1 48   ? -33.039 12.333  12.779  1.00 196.91 ? 48   TYR A CD1 1 
ATOM   357   C  CD2 . TYR A  1 48   ? -31.298 10.769  12.346  1.00 195.30 ? 48   TYR A CD2 1 
ATOM   358   C  CE1 . TYR A  1 48   ? -33.833 11.717  11.838  1.00 255.88 ? 48   TYR A CE1 1 
ATOM   359   C  CE2 . TYR A  1 48   ? -32.084 10.146  11.402  1.00 226.89 ? 48   TYR A CE2 1 
ATOM   360   C  CZ  . TYR A  1 48   ? -33.350 10.624  11.152  1.00 271.50 ? 48   TYR A CZ  1 
ATOM   361   O  OH  . TYR A  1 48   ? -34.138 10.006  10.212  1.00 276.50 ? 48   TYR A OH  1 
ATOM   362   N  N   . GLN A  1 49   ? -31.061 15.681  15.371  1.00 219.91 ? 49   GLN A N   1 
ATOM   363   C  CA  . GLN A  1 49   ? -30.942 16.383  16.639  1.00 202.36 ? 49   GLN A CA  1 
ATOM   364   C  C   . GLN A  1 49   ? -31.920 15.768  17.628  1.00 216.00 ? 49   GLN A C   1 
ATOM   365   O  O   . GLN A  1 49   ? -33.071 15.491  17.292  1.00 222.45 ? 49   GLN A O   1 
ATOM   366   C  CB  . GLN A  1 49   ? -31.218 17.879  16.467  1.00 198.66 ? 49   GLN A CB  1 
ATOM   367   C  CG  . GLN A  1 49   ? -32.667 18.225  16.165  1.00 243.77 ? 49   GLN A CG  1 
ATOM   368   C  CD  . GLN A  1 49   ? -32.917 19.718  16.169  1.00 256.14 ? 49   GLN A CD  1 
ATOM   369   O  OE1 . GLN A  1 49   ? -31.988 20.511  16.326  1.00 212.50 ? 49   GLN A OE1 1 
ATOM   370   N  NE2 . GLN A  1 49   ? -34.175 20.110  15.996  1.00 276.77 ? 49   GLN A NE2 1 
ATOM   371   N  N   . CYS A  1 50   ? -31.455 15.547  18.849  1.00 226.11 ? 50   CYS A N   1 
ATOM   372   C  CA  . CYS A  1 50   ? -32.285 14.932  19.870  1.00 224.65 ? 50   CYS A CA  1 
ATOM   373   C  C   . CYS A  1 50   ? -32.292 15.785  21.130  1.00 234.96 ? 50   CYS A C   1 
ATOM   374   O  O   . CYS A  1 50   ? -31.253 16.302  21.544  1.00 168.31 ? 50   CYS A O   1 
ATOM   375   C  CB  . CYS A  1 50   ? -31.775 13.526  20.172  1.00 213.06 ? 50   CYS A CB  1 
ATOM   376   S  SG  . CYS A  1 50   ? -31.826 12.423  18.739  1.00 232.96 ? 50   CYS A SG  1 
ATOM   377   N  N   . GLY A  1 51   ? -33.474 15.946  21.720  1.00 289.82 ? 51   GLY A N   1 
ATOM   378   C  CA  . GLY A  1 51   ? -33.625 16.687  22.959  1.00 300.77 ? 51   GLY A CA  1 
ATOM   379   C  C   . GLY A  1 51   ? -33.960 15.759  24.112  1.00 257.06 ? 51   GLY A C   1 
ATOM   380   O  O   . GLY A  1 51   ? -34.491 14.664  23.897  1.00 191.86 ? 51   GLY A O   1 
ATOM   381   N  N   . TYR A  1 52   ? -33.649 16.194  25.333  1.00 210.28 ? 52   TYR A N   1 
ATOM   382   C  CA  . TYR A  1 52   ? -33.894 15.382  26.523  1.00 183.20 ? 52   TYR A CA  1 
ATOM   383   C  C   . TYR A  1 52   ? -35.366 15.408  26.930  1.00 198.53 ? 52   TYR A C   1 
ATOM   384   O  O   . TYR A  1 52   ? -35.943 14.373  27.266  1.00 213.13 ? 52   TYR A O   1 
ATOM   385   C  CB  . TYR A  1 52   ? -33.023 15.851  27.693  1.00 206.83 ? 52   TYR A CB  1 
ATOM   386   C  CG  . TYR A  1 52   ? -33.343 15.152  29.001  1.00 266.86 ? 52   TYR A CG  1 
ATOM   387   C  CD1 . TYR A  1 52   ? -32.876 13.870  29.262  1.00 253.58 ? 52   TYR A CD1 1 
ATOM   388   C  CD2 . TYR A  1 52   ? -34.116 15.774  29.972  1.00 287.72 ? 52   TYR A CD2 1 
ATOM   389   C  CE1 . TYR A  1 52   ? -33.170 13.228  30.454  1.00 232.89 ? 52   TYR A CE1 1 
ATOM   390   C  CE2 . TYR A  1 52   ? -34.414 15.138  31.168  1.00 246.51 ? 52   TYR A CE2 1 
ATOM   391   C  CZ  . TYR A  1 52   ? -33.938 13.865  31.402  1.00 225.40 ? 52   TYR A CZ  1 
ATOM   392   O  OH  . TYR A  1 52   ? -34.231 13.221  32.585  1.00 219.20 ? 52   TYR A OH  1 
ATOM   393   N  N   . SER A  1 53   ? -35.965 16.594  26.899  1.00 214.00 ? 53   SER A N   1 
ATOM   394   C  CA  . SER A  1 53   ? -37.367 16.766  27.275  1.00 241.14 ? 53   SER A CA  1 
ATOM   395   C  C   . SER A  1 53   ? -38.209 15.573  26.833  1.00 251.89 ? 53   SER A C   1 
ATOM   396   O  O   . SER A  1 53   ? -38.800 14.875  27.657  1.00 287.75 ? 53   SER A O   1 
ATOM   397   C  CB  . SER A  1 53   ? -37.919 18.055  26.661  1.00 253.87 ? 53   SER A CB  1 
ATOM   398   O  OG  . SER A  1 53   ? -37.177 19.184  27.091  1.00 261.27 ? 53   SER A OG  1 
ATOM   399   N  N   . THR A  1 54   ? -38.256 15.346  25.526  1.00 241.97 ? 54   THR A N   1 
ATOM   400   C  CA  . THR A  1 54   ? -38.944 14.191  24.968  1.00 231.15 ? 54   THR A CA  1 
ATOM   401   C  C   . THR A  1 54   ? -37.939 13.236  24.328  1.00 210.63 ? 54   THR A C   1 
ATOM   402   O  O   . THR A  1 54   ? -37.094 13.649  23.531  1.00 148.54 ? 54   THR A O   1 
ATOM   403   C  CB  . THR A  1 54   ? -39.964 14.622  23.909  1.00 275.39 ? 54   THR A CB  1 
ATOM   404   O  OG1 . THR A  1 54   ? -39.339 15.526  22.989  1.00 269.31 ? 54   THR A OG1 1 
ATOM   405   C  CG2 . THR A  1 54   ? -41.156 15.312  24.559  1.00 307.17 ? 54   THR A CG2 1 
ATOM   406   N  N   . GLY A  1 55   ? -38.031 11.960  24.684  1.00 202.49 ? 55   GLY A N   1 
ATOM   407   C  CA  . GLY A  1 55   ? -37.129 10.957  24.151  1.00 183.37 ? 55   GLY A CA  1 
ATOM   408   C  C   . GLY A  1 55   ? -37.430 10.635  22.703  1.00 219.81 ? 55   GLY A C   1 
ATOM   409   O  O   . GLY A  1 55   ? -38.061 9.623   22.404  1.00 266.66 ? 55   GLY A O   1 
ATOM   410   N  N   . ALA A  1 56   ? -36.976 11.497  21.800  1.00 241.63 ? 56   ALA A N   1 
ATOM   411   C  CA  . ALA A  1 56   ? -37.237 11.327  20.378  1.00 269.55 ? 56   ALA A CA  1 
ATOM   412   C  C   . ALA A  1 56   ? -36.261 12.166  19.566  1.00 237.10 ? 56   ALA A C   1 
ATOM   413   O  O   . ALA A  1 56   ? -35.789 13.208  20.023  1.00 189.54 ? 56   ALA A O   1 
ATOM   414   C  CB  . ALA A  1 56   ? -38.675 11.715  20.055  1.00 331.11 ? 56   ALA A CB  1 
ATOM   415   N  N   . CYS A  1 57   ? -35.954 11.704  18.361  1.00 234.96 ? 57   CYS A N   1 
ATOM   416   C  CA  . CYS A  1 57   ? -35.027 12.411  17.488  1.00 253.83 ? 57   CYS A CA  1 
ATOM   417   C  C   . CYS A  1 57   ? -35.738 12.978  16.266  1.00 277.67 ? 57   CYS A C   1 
ATOM   418   O  O   . CYS A  1 57   ? -36.394 12.247  15.526  1.00 280.42 ? 57   CYS A O   1 
ATOM   419   C  CB  . CYS A  1 57   ? -33.913 11.471  17.038  1.00 228.31 ? 57   CYS A CB  1 
ATOM   420   S  SG  . CYS A  1 57   ? -32.961 10.772  18.400  1.00 242.89 ? 57   CYS A SG  1 
ATOM   421   N  N   . GLU A  1 58   ? -35.601 14.284  16.059  1.00 291.96 ? 58   GLU A N   1 
ATOM   422   C  CA  . GLU A  1 58   ? -36.193 14.947  14.903  1.00 276.00 ? 58   GLU A CA  1 
ATOM   423   C  C   . GLU A  1 58   ? -35.149 15.118  13.805  1.00 261.51 ? 58   GLU A C   1 
ATOM   424   O  O   . GLU A  1 58   ? -34.022 15.527  14.078  1.00 255.16 ? 58   GLU A O   1 
ATOM   425   C  CB  . GLU A  1 58   ? -36.758 16.312  15.303  1.00 262.97 ? 58   GLU A CB  1 
ATOM   426   C  CG  . GLU A  1 58   ? -37.948 16.233  16.238  1.00 284.56 ? 58   GLU A CG  1 
ATOM   427   C  CD  . GLU A  1 58   ? -39.158 15.607  15.577  1.00 281.53 ? 58   GLU A CD  1 
ATOM   428   O  OE1 . GLU A  1 58   ? -39.171 15.516  14.333  1.00 279.33 ? 58   GLU A OE1 1 
ATOM   429   O  OE2 . GLU A  1 58   ? -40.096 15.208  16.298  1.00 278.94 ? 58   GLU A OE2 1 
ATOM   430   N  N   . PRO A  1 59   ? -35.517 14.794  12.557  1.00 249.45 ? 59   PRO A N   1 
ATOM   431   C  CA  . PRO A  1 59   ? -34.615 15.033  11.426  1.00 215.31 ? 59   PRO A CA  1 
ATOM   432   C  C   . PRO A  1 59   ? -34.198 16.496  11.365  1.00 234.36 ? 59   PRO A C   1 
ATOM   433   O  O   . PRO A  1 59   ? -34.924 17.350  11.875  1.00 305.82 ? 59   PRO A O   1 
ATOM   434   C  CB  . PRO A  1 59   ? -35.475 14.684  10.209  1.00 282.28 ? 59   PRO A CB  1 
ATOM   435   C  CG  . PRO A  1 59   ? -36.530 13.776  10.724  1.00 300.51 ? 59   PRO A CG  1 
ATOM   436   C  CD  . PRO A  1 59   ? -36.794 14.196  12.134  1.00 289.74 ? 59   PRO A CD  1 
ATOM   437   N  N   . ILE A  1 60   ? -33.054 16.784  10.755  1.00 192.31 ? 60   ILE A N   1 
ATOM   438   C  CA  . ILE A  1 60   ? -32.599 18.162  10.627  1.00 225.00 ? 60   ILE A CA  1 
ATOM   439   C  C   . ILE A  1 60   ? -32.588 18.610  9.169   1.00 262.40 ? 60   ILE A C   1 
ATOM   440   O  O   . ILE A  1 60   ? -32.068 17.914  8.295   1.00 260.13 ? 60   ILE A O   1 
ATOM   441   C  CB  . ILE A  1 60   ? -31.202 18.345  11.233  1.00 215.54 ? 60   ILE A CB  1 
ATOM   442   C  CG1 . ILE A  1 60   ? -30.835 19.831  11.283  1.00 248.67 ? 60   ILE A CG1 1 
ATOM   443   C  CG2 . ILE A  1 60   ? -30.178 17.558  10.442  1.00 202.85 ? 60   ILE A CG2 1 
ATOM   444   C  CD1 . ILE A  1 60   ? -29.581 20.115  12.075  1.00 299.05 ? 60   ILE A CD1 1 
ATOM   445   N  N   . GLY A  1 61   ? -33.168 19.779  8.918   1.00 271.60 ? 61   GLY A N   1 
ATOM   446   C  CA  . GLY A  1 61   ? -33.270 20.310  7.573   1.00 271.68 ? 61   GLY A CA  1 
ATOM   447   C  C   . GLY A  1 61   ? -31.909 20.625  6.990   1.00 276.04 ? 61   GLY A C   1 
ATOM   448   O  O   . GLY A  1 61   ? -31.055 21.204  7.660   1.00 284.79 ? 61   GLY A O   1 
ATOM   449   N  N   . LEU A  1 62   ? -31.707 20.243  5.733   1.00 281.12 ? 62   LEU A N   1 
ATOM   450   C  CA  . LEU A  1 62   ? -30.434 20.471  5.064   1.00 276.42 ? 62   LEU A CA  1 
ATOM   451   C  C   . LEU A  1 62   ? -30.612 20.683  3.566   1.00 280.09 ? 62   LEU A C   1 
ATOM   452   O  O   . LEU A  1 62   ? -31.391 19.985  2.915   1.00 247.82 ? 62   LEU A O   1 
ATOM   453   C  CB  . LEU A  1 62   ? -29.493 19.292  5.314   1.00 257.61 ? 62   LEU A CB  1 
ATOM   454   C  CG  . LEU A  1 62   ? -28.883 19.240  6.713   1.00 219.56 ? 62   LEU A CG  1 
ATOM   455   C  CD1 . LEU A  1 62   ? -28.143 17.932  6.926   1.00 230.68 ? 62   LEU A CD1 1 
ATOM   456   C  CD2 . LEU A  1 62   ? -27.959 20.432  6.916   1.00 153.87 ? 62   LEU A CD2 1 
ATOM   457   N  N   . GLN A  1 63   ? -29.882 21.654  3.027   1.00 273.35 ? 63   GLN A N   1 
ATOM   458   C  CA  . GLN A  1 63   ? -29.896 21.923  1.597   1.00 262.36 ? 63   GLN A CA  1 
ATOM   459   C  C   . GLN A  1 63   ? -28.731 21.207  0.918   1.00 281.51 ? 63   GLN A C   1 
ATOM   460   O  O   . GLN A  1 63   ? -27.747 21.840  0.531   1.00 290.49 ? 63   GLN A O   1 
ATOM   461   C  CB  . GLN A  1 63   ? -29.803 23.427  1.331   1.00 251.22 ? 63   GLN A CB  1 
ATOM   462   C  CG  . GLN A  1 63   ? -30.882 24.251  2.010   1.00 264.43 ? 63   GLN A CG  1 
ATOM   463   C  CD  . GLN A  1 63   ? -30.566 24.540  3.461   1.00 278.67 ? 63   GLN A CD  1 
ATOM   464   O  OE1 . GLN A  1 63   ? -29.419 24.434  3.890   1.00 241.73 ? 63   GLN A OE1 1 
ATOM   465   N  NE2 . GLN A  1 63   ? -31.582 24.914  4.224   1.00 322.72 ? 63   GLN A NE2 1 
ATOM   466   N  N   . VAL A  1 64   ? -28.847 19.888  0.775   1.00 274.66 ? 64   VAL A N   1 
ATOM   467   C  CA  . VAL A  1 64   ? -27.793 19.076  0.164   1.00 276.04 ? 64   VAL A CA  1 
ATOM   468   C  C   . VAL A  1 64   ? -27.656 19.372  -1.334  1.00 273.80 ? 64   VAL A C   1 
ATOM   469   O  O   . VAL A  1 64   ? -28.516 18.984  -2.125  1.00 260.51 ? 64   VAL A O   1 
ATOM   470   C  CB  . VAL A  1 64   ? -28.072 17.567  0.347   1.00 263.81 ? 64   VAL A CB  1 
ATOM   471   C  CG1 . VAL A  1 64   ? -26.934 16.744  -0.232  1.00 268.50 ? 64   VAL A CG1 1 
ATOM   472   C  CG2 . VAL A  1 64   ? -28.287 17.230  1.819   1.00 214.01 ? 64   VAL A CG2 1 
ATOM   473   N  N   . PRO A  1 65   ? -26.567 20.053  -1.730  1.00 275.98 ? 65   PRO A N   1 
ATOM   474   C  CA  . PRO A  1 65   ? -26.379 20.411  -3.140  1.00 260.94 ? 65   PRO A CA  1 
ATOM   475   C  C   . PRO A  1 65   ? -26.264 19.182  -4.024  1.00 275.64 ? 65   PRO A C   1 
ATOM   476   O  O   . PRO A  1 65   ? -25.673 18.185  -3.614  1.00 273.84 ? 65   PRO A O   1 
ATOM   477   C  CB  . PRO A  1 65   ? -25.053 21.182  -3.141  1.00 210.92 ? 65   PRO A CB  1 
ATOM   478   C  CG  . PRO A  1 65   ? -24.825 21.581  -1.721  1.00 218.51 ? 65   PRO A CG  1 
ATOM   479   C  CD  . PRO A  1 65   ? -25.439 20.501  -0.897  1.00 254.20 ? 65   PRO A CD  1 
ATOM   480   N  N   . PRO A  1 66   ? -26.832 19.248  -5.231  1.00 258.91 ? 66   PRO A N   1 
ATOM   481   C  CA  . PRO A  1 66   ? -26.703 18.133  -6.169  1.00 280.21 ? 66   PRO A CA  1 
ATOM   482   C  C   . PRO A  1 66   ? -25.239 17.815  -6.437  1.00 254.99 ? 66   PRO A C   1 
ATOM   483   O  O   . PRO A  1 66   ? -24.910 16.681  -6.789  1.00 198.80 ? 66   PRO A O   1 
ATOM   484   C  CB  . PRO A  1 66   ? -27.381 18.662  -7.434  1.00 317.73 ? 66   PRO A CB  1 
ATOM   485   C  CG  . PRO A  1 66   ? -28.314 19.715  -6.956  1.00 293.45 ? 66   PRO A CG  1 
ATOM   486   C  CD  . PRO A  1 66   ? -27.655 20.341  -5.773  1.00 255.79 ? 66   PRO A CD  1 
ATOM   487   N  N   . GLU A  1 67   ? -24.373 18.811  -6.258  1.00 251.94 ? 67   GLU A N   1 
ATOM   488   C  CA  . GLU A  1 67   ? -22.945 18.649  -6.510  1.00 241.46 ? 67   GLU A CA  1 
ATOM   489   C  C   . GLU A  1 67   ? -22.359 17.551  -5.634  1.00 251.66 ? 67   GLU A C   1 
ATOM   490   O  O   . GLU A  1 67   ? -21.708 16.631  -6.124  1.00 204.25 ? 67   GLU A O   1 
ATOM   491   C  CB  . GLU A  1 67   ? -22.201 19.966  -6.264  1.00 170.96 ? 67   GLU A CB  1 
ATOM   492   C  CG  . GLU A  1 67   ? -22.623 21.087  -7.187  1.00 237.12 ? 67   GLU A CG  1 
ATOM   493   C  CD  . GLU A  1 67   ? -22.408 20.744  -8.645  1.00 356.97 ? 67   GLU A CD  1 
ATOM   494   O  OE1 . GLU A  1 67   ? -21.350 20.168  -8.971  1.00 395.60 ? 67   GLU A OE1 1 
ATOM   495   O  OE2 . GLU A  1 67   ? -23.297 21.052  -9.465  1.00 405.24 ? 67   GLU A OE2 1 
ATOM   496   N  N   . ALA A  1 68   ? -22.598 17.648  -4.333  1.00 280.31 ? 68   ALA A N   1 
ATOM   497   C  CA  . ALA A  1 68   ? -22.070 16.672  -3.388  1.00 289.50 ? 68   ALA A CA  1 
ATOM   498   C  C   . ALA A  1 68   ? -22.792 15.329  -3.512  1.00 258.02 ? 68   ALA A C   1 
ATOM   499   O  O   . ALA A  1 68   ? -23.991 15.229  -3.248  1.00 266.45 ? 68   ALA A O   1 
ATOM   500   C  CB  . ALA A  1 68   ? -22.176 17.210  -1.969  1.00 342.45 ? 68   ALA A CB  1 
ATOM   501   N  N   . VAL A  1 69   ? -22.049 14.299  -3.908  1.00 210.59 ? 69   VAL A N   1 
ATOM   502   C  CA  . VAL A  1 69   ? -22.618 12.970  -4.097  1.00 199.18 ? 69   VAL A CA  1 
ATOM   503   C  C   . VAL A  1 69   ? -21.914 11.928  -3.241  1.00 252.44 ? 69   VAL A C   1 
ATOM   504   O  O   . VAL A  1 69   ? -20.729 12.052  -2.943  1.00 294.98 ? 69   VAL A O   1 
ATOM   505   C  CB  . VAL A  1 69   ? -22.520 12.529  -5.558  1.00 207.33 ? 69   VAL A CB  1 
ATOM   506   C  CG1 . VAL A  1 69   ? -23.059 11.115  -5.722  1.00 236.76 ? 69   VAL A CG1 1 
ATOM   507   C  CG2 . VAL A  1 69   ? -23.271 13.500  -6.447  1.00 275.95 ? 69   VAL A CG2 1 
ATOM   508   N  N   . ASN A  1 70   ? -22.658 10.891  -2.872  1.00 268.49 ? 70   ASN A N   1 
ATOM   509   C  CA  . ASN A  1 70   ? -22.162 9.828   -2.006  1.00 315.50 ? 70   ASN A CA  1 
ATOM   510   C  C   . ASN A  1 70   ? -21.206 10.328  -0.920  1.00 316.80 ? 70   ASN A C   1 
ATOM   511   O  O   . ASN A  1 70   ? -20.215 9.667   -0.606  1.00 340.39 ? 70   ASN A O   1 
ATOM   512   C  CB  . ASN A  1 70   ? -21.482 8.747   -2.847  1.00 326.69 ? 70   ASN A CB  1 
ATOM   513   C  CG  . ASN A  1 70   ? -21.206 7.492   -2.058  1.00 342.42 ? 70   ASN A CG  1 
ATOM   514   O  OD1 . ASN A  1 70   ? -21.686 7.334   -0.935  1.00 348.24 ? 70   ASN A OD1 1 
ATOM   515   N  ND2 . ASN A  1 70   ? -20.424 6.589   -2.636  1.00 335.94 ? 70   ASN A ND2 1 
ATOM   516   N  N   . MET A  1 71   ? -21.514 11.487  -0.340  1.00 259.99 ? 71   MET A N   1 
ATOM   517   C  CA  . MET A  1 71   ? -20.651 12.089  0.672   1.00 220.92 ? 71   MET A CA  1 
ATOM   518   C  C   . MET A  1 71   ? -20.939 11.514  2.045   1.00 204.89 ? 71   MET A C   1 
ATOM   519   O  O   . MET A  1 71   ? -20.158 11.705  2.973   1.00 175.99 ? 71   MET A O   1 
ATOM   520   C  CB  . MET A  1 71   ? -20.826 13.612  0.714   1.00 217.70 ? 71   MET A CB  1 
ATOM   521   C  CG  . MET A  1 71   ? -21.809 14.096  1.772   1.00 198.25 ? 71   MET A CG  1 
ATOM   522   S  SD  . MET A  1 71   ? -21.781 15.889  2.019   1.00 219.27 ? 71   MET A SD  1 
ATOM   523   C  CE  . MET A  1 71   ? -23.174 16.402  1.030   1.00 186.87 ? 71   MET A CE  1 
ATOM   524   N  N   . SER A  1 72   ? -22.066 10.825  2.176   1.00 217.95 ? 72   SER A N   1 
ATOM   525   C  CA  . SER A  1 72   ? -22.422 10.207  3.440   1.00 259.85 ? 72   SER A CA  1 
ATOM   526   C  C   . SER A  1 72   ? -22.029 11.116  4.607   1.00 270.95 ? 72   SER A C   1 
ATOM   527   O  O   . SER A  1 72   ? -21.081 10.823  5.335   1.00 265.46 ? 72   SER A O   1 
ATOM   528   C  CB  . SER A  1 72   ? -21.711 8.860   3.568   1.00 245.39 ? 72   SER A CB  1 
ATOM   529   O  OG  . SER A  1 72   ? -22.081 7.990   2.515   1.00 174.02 ? 72   SER A OG  1 
ATOM   530   N  N   . LEU A  1 73   ? -22.751 12.222  4.777   1.00 266.44 ? 73   LEU A N   1 
ATOM   531   C  CA  . LEU A  1 73   ? -22.433 13.197  5.825   1.00 226.29 ? 73   LEU A CA  1 
ATOM   532   C  C   . LEU A  1 73   ? -22.702 12.652  7.231   1.00 241.83 ? 73   LEU A C   1 
ATOM   533   O  O   . LEU A  1 73   ? -23.390 11.644  7.399   1.00 212.73 ? 73   LEU A O   1 
ATOM   534   C  CB  . LEU A  1 73   ? -23.216 14.498  5.602   1.00 215.62 ? 73   LEU A CB  1 
ATOM   535   C  CG  . LEU A  1 73   ? -24.743 14.396  5.649   1.00 239.05 ? 73   LEU A CG  1 
ATOM   536   C  CD1 . LEU A  1 73   ? -25.244 14.373  7.083   1.00 218.01 ? 73   LEU A CD1 1 
ATOM   537   C  CD2 . LEU A  1 73   ? -25.379 15.548  4.886   1.00 259.20 ? 73   LEU A CD2 1 
ATOM   538   N  N   . GLY A  1 74   ? -22.163 13.336  8.237   1.00 267.86 ? 74   GLY A N   1 
ATOM   539   C  CA  . GLY A  1 74   ? -22.301 12.911  9.617   1.00 240.73 ? 74   GLY A CA  1 
ATOM   540   C  C   . GLY A  1 74   ? -21.131 12.078  10.105  1.00 222.29 ? 74   GLY A C   1 
ATOM   541   O  O   . GLY A  1 74   ? -20.899 11.981  11.310  1.00 221.21 ? 74   GLY A O   1 
ATOM   542   N  N   . LEU A  1 75   ? -20.393 11.478  9.174   1.00 212.67 ? 75   LEU A N   1 
ATOM   543   C  CA  . LEU A  1 75   ? -19.248 10.639  9.520   1.00 222.49 ? 75   LEU A CA  1 
ATOM   544   C  C   . LEU A  1 75   ? -18.287 11.376  10.453  1.00 234.10 ? 75   LEU A C   1 
ATOM   545   O  O   . LEU A  1 75   ? -17.786 10.811  11.427  1.00 246.55 ? 75   LEU A O   1 
ATOM   546   C  CB  . LEU A  1 75   ? -18.508 10.200  8.255   1.00 204.48 ? 75   LEU A CB  1 
ATOM   547   C  CG  . LEU A  1 75   ? -17.276 9.317   8.478   1.00 206.39 ? 75   LEU A CG  1 
ATOM   548   C  CD1 . LEU A  1 75   ? -17.674 7.997   9.107   1.00 191.22 ? 75   LEU A CD1 1 
ATOM   549   C  CD2 . LEU A  1 75   ? -16.528 9.078   7.176   1.00 216.01 ? 75   LEU A CD2 1 
ATOM   550   N  N   . SER A  1 76   ? -18.031 12.642  10.145  1.00 174.89 ? 76   SER A N   1 
ATOM   551   C  CA  . SER A  1 76   ? -17.158 13.470  10.963  1.00 206.71 ? 76   SER A CA  1 
ATOM   552   C  C   . SER A  1 76   ? -18.000 14.580  11.583  1.00 230.90 ? 76   SER A C   1 
ATOM   553   O  O   . SER A  1 76   ? -18.797 15.216  10.892  1.00 211.82 ? 76   SER A O   1 
ATOM   554   C  CB  . SER A  1 76   ? -16.013 14.048  10.113  1.00 176.35 ? 76   SER A CB  1 
ATOM   555   O  OG  . SER A  1 76   ? -15.147 14.862  10.890  1.00 256.48 ? 76   SER A OG  1 
ATOM   556   N  N   . LEU A  1 77   ? -17.842 14.792  12.887  1.00 191.58 ? 77   LEU A N   1 
ATOM   557   C  CA  . LEU A  1 77   ? -18.577 15.837  13.593  1.00 161.84 ? 77   LEU A CA  1 
ATOM   558   C  C   . LEU A  1 77   ? -17.651 16.651  14.487  1.00 185.11 ? 77   LEU A C   1 
ATOM   559   O  O   . LEU A  1 77   ? -16.532 16.235  14.775  1.00 246.42 ? 77   LEU A O   1 
ATOM   560   C  CB  . LEU A  1 77   ? -19.692 15.215  14.426  1.00 179.31 ? 77   LEU A CB  1 
ATOM   561   C  CG  . LEU A  1 77   ? -20.864 14.663  13.617  1.00 174.23 ? 77   LEU A CG  1 
ATOM   562   C  CD1 . LEU A  1 77   ? -21.749 13.784  14.479  1.00 171.45 ? 77   LEU A CD1 1 
ATOM   563   C  CD2 . LEU A  1 77   ? -21.660 15.806  13.018  1.00 191.84 ? 77   LEU A CD2 1 
ATOM   564   N  N   . ALA A  1 78   ? -18.121 17.812  14.925  1.00 182.45 ? 78   ALA A N   1 
ATOM   565   C  CA  . ALA A  1 78   ? -17.339 18.659  15.814  1.00 216.18 ? 78   ALA A CA  1 
ATOM   566   C  C   . ALA A  1 78   ? -18.190 19.826  16.284  1.00 222.54 ? 78   ALA A C   1 
ATOM   567   O  O   . ALA A  1 78   ? -18.966 20.379  15.513  1.00 231.15 ? 78   ALA A O   1 
ATOM   568   C  CB  . ALA A  1 78   ? -16.073 19.154  15.105  1.00 175.43 ? 78   ALA A CB  1 
ATOM   569   N  N   . SER A  1 79   ? -18.059 20.192  17.554  1.00 215.91 ? 79   SER A N   1 
ATOM   570   C  CA  . SER A  1 79   ? -18.849 21.285  18.110  1.00 221.66 ? 79   SER A CA  1 
ATOM   571   C  C   . SER A  1 79   ? -18.006 22.231  18.977  1.00 227.24 ? 79   SER A C   1 
ATOM   572   O  O   . SER A  1 79   ? -17.102 21.784  19.686  1.00 245.26 ? 79   SER A O   1 
ATOM   573   C  CB  . SER A  1 79   ? -19.998 20.711  18.939  1.00 200.41 ? 79   SER A CB  1 
ATOM   574   O  OG  . SER A  1 79   ? -20.860 21.744  19.386  1.00 239.96 ? 79   SER A OG  1 
ATOM   575   N  N   . THR A  1 80   ? -18.302 23.531  18.915  1.00 191.06 ? 80   THR A N   1 
ATOM   576   C  CA  . THR A  1 80   ? -17.645 24.521  19.775  1.00 206.04 ? 80   THR A CA  1 
ATOM   577   C  C   . THR A  1 80   ? -18.653 25.135  20.746  1.00 197.10 ? 80   THR A C   1 
ATOM   578   O  O   . THR A  1 80   ? -19.867 24.972  20.591  1.00 163.76 ? 80   THR A O   1 
ATOM   579   C  CB  . THR A  1 80   ? -16.981 25.666  18.974  1.00 236.29 ? 80   THR A CB  1 
ATOM   580   O  OG1 . THR A  1 80   ? -16.374 26.588  19.890  1.00 111.93 ? 80   THR A OG1 1 
ATOM   581   C  CG2 . THR A  1 80   ? -18.014 26.386  18.117  1.00 294.80 ? 80   THR A CG2 1 
ATOM   582   N  N   . THR A  1 81   ? -18.135 25.839  21.747  1.00 210.13 ? 81   THR A N   1 
ATOM   583   C  CA  . THR A  1 81   ? -18.956 26.440  22.783  1.00 162.20 ? 81   THR A CA  1 
ATOM   584   C  C   . THR A  1 81   ? -18.813 27.953  22.748  1.00 163.65 ? 81   THR A C   1 
ATOM   585   O  O   . THR A  1 81   ? -19.502 28.656  23.475  1.00 165.50 ? 81   THR A O   1 
ATOM   586   C  CB  . THR A  1 81   ? -18.488 25.977  24.168  1.00 202.48 ? 81   THR A CB  1 
ATOM   587   O  OG1 . THR A  1 81   ? -17.095 26.280  24.316  1.00 270.23 ? 81   THR A OG1 1 
ATOM   588   C  CG2 . THR A  1 81   ? -18.701 24.484  24.348  1.00 166.56 ? 81   THR A CG2 1 
ATOM   589   N  N   . SER A  1 82   ? -17.942 28.447  21.878  1.00 219.56 ? 82   SER A N   1 
ATOM   590   C  CA  . SER A  1 82   ? -17.359 29.768  22.051  1.00 218.40 ? 82   SER A CA  1 
ATOM   591   C  C   . SER A  1 82   ? -18.456 30.810  21.874  1.00 195.18 ? 82   SER A C   1 
ATOM   592   O  O   . SER A  1 82   ? -18.801 31.513  22.819  1.00 207.11 ? 82   SER A O   1 
ATOM   593   C  CB  . SER A  1 82   ? -16.157 29.919  21.133  1.00 205.73 ? 82   SER A CB  1 
ATOM   594   O  OG  . SER A  1 82   ? -15.098 29.192  21.748  1.00 160.66 ? 82   SER A OG  1 
ATOM   595   N  N   . PRO A  1 83   ? -18.906 31.018  20.643  1.00 205.21 ? 83   PRO A N   1 
ATOM   596   C  CA  . PRO A  1 83   ? -20.359 30.969  20.484  1.00 165.76 ? 83   PRO A CA  1 
ATOM   597   C  C   . PRO A  1 83   ? -20.750 29.546  20.098  1.00 192.90 ? 83   PRO A C   1 
ATOM   598   O  O   . PRO A  1 83   ? -19.977 28.875  19.418  1.00 239.90 ? 83   PRO A O   1 
ATOM   599   C  CB  . PRO A  1 83   ? -20.617 31.925  19.324  1.00 215.04 ? 83   PRO A CB  1 
ATOM   600   C  CG  . PRO A  1 83   ? -19.517 32.897  19.402  1.00 208.01 ? 83   PRO A CG  1 
ATOM   601   C  CD  . PRO A  1 83   ? -18.316 32.098  19.835  1.00 215.09 ? 83   PRO A CD  1 
ATOM   602   N  N   . SER A  1 84   ? -21.912 29.083  20.535  1.00 137.63 ? 84   SER A N   1 
ATOM   603   C  CA  . SER A  1 84   ? -22.374 27.742  20.185  1.00 214.20 ? 84   SER A CA  1 
ATOM   604   C  C   . SER A  1 84   ? -22.542 27.536  18.670  1.00 235.25 ? 84   SER A C   1 
ATOM   605   O  O   . SER A  1 84   ? -23.427 28.124  18.048  1.00 237.48 ? 84   SER A O   1 
ATOM   606   C  CB  . SER A  1 84   ? -23.704 27.469  20.881  1.00 195.62 ? 84   SER A CB  1 
ATOM   607   O  OG  . SER A  1 84   ? -24.667 28.433  20.504  1.00 221.87 ? 84   SER A OG  1 
ATOM   608   N  N   . GLN A  1 85   ? -21.691 26.698  18.082  1.00 208.53 ? 85   GLN A N   1 
ATOM   609   C  CA  . GLN A  1 85   ? -21.845 26.291  16.685  1.00 186.69 ? 85   GLN A CA  1 
ATOM   610   C  C   . GLN A  1 85   ? -21.632 24.789  16.561  1.00 184.42 ? 85   GLN A C   1 
ATOM   611   O  O   . GLN A  1 85   ? -21.153 24.148  17.494  1.00 185.07 ? 85   GLN A O   1 
ATOM   612   C  CB  . GLN A  1 85   ? -20.852 27.027  15.779  1.00 181.16 ? 85   GLN A CB  1 
ATOM   613   C  CG  . GLN A  1 85   ? -20.944 28.531  15.869  1.00 210.07 ? 85   GLN A CG  1 
ATOM   614   C  CD  . GLN A  1 85   ? -19.907 29.225  15.022  1.00 204.99 ? 85   GLN A CD  1 
ATOM   615   O  OE1 . GLN A  1 85   ? -18.853 28.663  14.731  1.00 197.33 ? 85   GLN A OE1 1 
ATOM   616   N  NE2 . GLN A  1 85   ? -20.197 30.460  14.627  1.00 221.11 ? 85   GLN A NE2 1 
ATOM   617   N  N   . LEU A  1 86   ? -21.987 24.236  15.404  1.00 198.29 ? 86   LEU A N   1 
ATOM   618   C  CA  . LEU A  1 86   ? -21.782 22.814  15.125  1.00 212.41 ? 86   LEU A CA  1 
ATOM   619   C  C   . LEU A  1 86   ? -21.238 22.613  13.717  1.00 221.08 ? 86   LEU A C   1 
ATOM   620   O  O   . LEU A  1 86   ? -21.438 23.451  12.838  1.00 214.31 ? 86   LEU A O   1 
ATOM   621   C  CB  . LEU A  1 86   ? -23.085 22.026  15.283  1.00 194.91 ? 86   LEU A CB  1 
ATOM   622   C  CG  . LEU A  1 86   ? -22.963 20.494  15.215  1.00 174.94 ? 86   LEU A CG  1 
ATOM   623   C  CD1 . LEU A  1 86   ? -23.858 19.848  16.241  1.00 252.18 ? 86   LEU A CD1 1 
ATOM   624   C  CD2 . LEU A  1 86   ? -23.297 19.965  13.842  1.00 103.11 ? 86   LEU A CD2 1 
ATOM   625   N  N   . LEU A  1 87   ? -20.561 21.487  13.509  1.00 245.91 ? 87   LEU A N   1 
ATOM   626   C  CA  . LEU A  1 87   ? -19.936 21.183  12.226  1.00 225.47 ? 87   LEU A CA  1 
ATOM   627   C  C   . LEU A  1 87   ? -20.170 19.716  11.854  1.00 237.78 ? 87   LEU A C   1 
ATOM   628   O  O   . LEU A  1 87   ? -19.590 18.813  12.467  1.00 200.94 ? 87   LEU A O   1 
ATOM   629   C  CB  . LEU A  1 87   ? -18.430 21.490  12.275  1.00 205.54 ? 87   LEU A CB  1 
ATOM   630   C  CG  . LEU A  1 87   ? -17.657 21.410  10.955  1.00 180.65 ? 87   LEU A CG  1 
ATOM   631   C  CD1 . LEU A  1 87   ? -18.356 22.212  9.872   1.00 211.44 ? 87   LEU A CD1 1 
ATOM   632   C  CD2 . LEU A  1 87   ? -16.216 21.886  11.124  1.00 163.47 ? 87   LEU A CD2 1 
ATOM   633   N  N   . ALA A  1 88   ? -21.051 19.493  10.876  1.00 278.43 ? 88   ALA A N   1 
ATOM   634   C  CA  . ALA A  1 88   ? -21.249 18.170  10.278  1.00 259.05 ? 88   ALA A CA  1 
ATOM   635   C  C   . ALA A  1 88   ? -20.525 18.100  8.934   1.00 228.81 ? 88   ALA A C   1 
ATOM   636   O  O   . ALA A  1 88   ? -20.248 19.130  8.319   1.00 240.29 ? 88   ALA A O   1 
ATOM   637   C  CB  . ALA A  1 88   ? -22.729 17.876  10.099  1.00 203.98 ? 88   ALA A CB  1 
ATOM   638   N  N   . CYS A  1 89   ? -20.235 16.890  8.468   1.00 186.11 ? 89   CYS A N   1 
ATOM   639   C  CA  . CYS A  1 89   ? -19.409 16.729  7.277   1.00 199.47 ? 89   CYS A CA  1 
ATOM   640   C  C   . CYS A  1 89   ? -19.759 15.488  6.491   1.00 219.94 ? 89   CYS A C   1 
ATOM   641   O  O   . CYS A  1 89   ? -19.965 14.419  7.059   1.00 229.58 ? 89   CYS A O   1 
ATOM   642   C  CB  . CYS A  1 89   ? -17.929 16.597  7.650   1.00 229.17 ? 89   CYS A CB  1 
ATOM   643   S  SG  . CYS A  1 89   ? -17.105 18.047  8.323   1.00 162.48 ? 89   CYS A SG  1 
ATOM   644   N  N   . GLY A  1 90   ? -19.845 15.640  5.178   1.00 238.42 ? 90   GLY A N   1 
ATOM   645   C  CA  . GLY A  1 90   ? -19.629 14.535  4.264   1.00 212.37 ? 90   GLY A CA  1 
ATOM   646   C  C   . GLY A  1 90   ? -18.176 14.538  3.815   1.00 205.16 ? 90   GLY A C   1 
ATOM   647   O  O   . GLY A  1 90   ? -17.771 15.383  3.028   1.00 221.32 ? 90   GLY A O   1 
ATOM   648   N  N   . PRO A  1 91   ? -17.364 13.634  4.375   1.00 202.39 ? 91   PRO A N   1 
ATOM   649   C  CA  . PRO A  1 91   ? -15.971 13.392  3.970   1.00 204.86 ? 91   PRO A CA  1 
ATOM   650   C  C   . PRO A  1 91   ? -15.802 12.472  2.750   1.00 224.63 ? 91   PRO A C   1 
ATOM   651   O  O   . PRO A  1 91   ? -14.739 11.873  2.591   1.00 223.83 ? 91   PRO A O   1 
ATOM   652   C  CB  . PRO A  1 91   ? -15.362 12.726  5.215   1.00 255.01 ? 91   PRO A CB  1 
ATOM   653   C  CG  . PRO A  1 91   ? -16.240 13.138  6.342   1.00 255.73 ? 91   PRO A CG  1 
ATOM   654   C  CD  . PRO A  1 91   ? -17.610 13.191  5.756   1.00 246.20 ? 91   PRO A CD  1 
ATOM   655   N  N   . THR A  1 92   ? -16.811 12.375  1.890   1.00 258.28 ? 92   THR A N   1 
ATOM   656   C  CA  . THR A  1 92   ? -16.762 11.429  0.772   1.00 272.77 ? 92   THR A CA  1 
ATOM   657   C  C   . THR A  1 92   ? -17.504 11.939  -0.463  1.00 288.67 ? 92   THR A C   1 
ATOM   658   O  O   . THR A  1 92   ? -18.229 11.191  -1.118  1.00 340.44 ? 92   THR A O   1 
ATOM   659   C  CB  . THR A  1 92   ? -17.337 10.044  1.171   1.00 234.13 ? 92   THR A CB  1 
ATOM   660   O  OG1 . THR A  1 92   ? -18.486 10.212  2.009   1.00 223.36 ? 92   THR A OG1 1 
ATOM   661   C  CG2 . THR A  1 92   ? -16.302 9.235   1.921   1.00 207.05 ? 92   THR A CG2 1 
ATOM   662   N  N   . VAL A  1 93   ? -17.316 13.215  -0.780  1.00 250.35 ? 93   VAL A N   1 
ATOM   663   C  CA  . VAL A  1 93   ? -17.946 13.807  -1.954  1.00 222.19 ? 93   VAL A CA  1 
ATOM   664   C  C   . VAL A  1 93   ? -17.378 13.163  -3.202  1.00 229.64 ? 93   VAL A C   1 
ATOM   665   O  O   . VAL A  1 93   ? -16.190 12.861  -3.257  1.00 235.96 ? 93   VAL A O   1 
ATOM   666   C  CB  . VAL A  1 93   ? -17.684 15.316  -2.027  1.00 170.15 ? 93   VAL A CB  1 
ATOM   667   C  CG1 . VAL A  1 93   ? -18.384 15.924  -3.227  1.00 167.81 ? 93   VAL A CG1 1 
ATOM   668   C  CG2 . VAL A  1 93   ? -18.134 15.997  -0.740  1.00 273.80 ? 93   VAL A CG2 1 
ATOM   669   N  N   . HIS A  1 94   ? -18.231 12.939  -4.195  1.00 236.69 ? 94   HIS A N   1 
ATOM   670   C  CA  . HIS A  1 94   ? -17.784 12.419  -5.481  1.00 258.48 ? 94   HIS A CA  1 
ATOM   671   C  C   . HIS A  1 94   ? -18.086 13.398  -6.601  1.00 280.86 ? 94   HIS A C   1 
ATOM   672   O  O   . HIS A  1 94   ? -19.247 13.701  -6.874  1.00 327.82 ? 94   HIS A O   1 
ATOM   673   C  CB  . HIS A  1 94   ? -18.467 11.093  -5.787  1.00 244.97 ? 94   HIS A CB  1 
ATOM   674   C  CG  . HIS A  1 94   ? -18.092 9.998   -4.849  1.00 261.42 ? 94   HIS A CG  1 
ATOM   675   N  ND1 . HIS A  1 94   ? -18.617 9.892   -3.580  1.00 260.10 ? 94   HIS A ND1 1 
ATOM   676   C  CD2 . HIS A  1 94   ? -17.240 8.957   -4.992  1.00 308.69 ? 94   HIS A CD2 1 
ATOM   677   C  CE1 . HIS A  1 94   ? -18.105 8.832   -2.982  1.00 300.68 ? 94   HIS A CE1 1 
ATOM   678   N  NE2 . HIS A  1 94   ? -17.270 8.248   -3.819  1.00 309.82 ? 94   HIS A NE2 1 
ATOM   679   N  N   . HIS A  1 95   ? -17.037 13.891  -7.250  1.00 248.52 ? 95   HIS A N   1 
ATOM   680   C  CA  . HIS A  1 95   ? -17.199 14.775  -8.393  1.00 251.34 ? 95   HIS A CA  1 
ATOM   681   C  C   . HIS A  1 95   ? -16.582 14.124  -9.625  1.00 277.23 ? 95   HIS A C   1 
ATOM   682   O  O   . HIS A  1 95   ? -15.391 13.815  -9.648  1.00 281.79 ? 95   HIS A O   1 
ATOM   683   C  CB  . HIS A  1 95   ? -16.569 16.143  -8.114  1.00 199.06 ? 95   HIS A CB  1 
ATOM   684   C  CG  . HIS A  1 95   ? -15.090 16.098  -7.897  1.00 189.89 ? 95   HIS A CG  1 
ATOM   685   N  ND1 . HIS A  1 95   ? -14.183 16.456  -8.870  1.00 234.15 ? 95   HIS A ND1 1 
ATOM   686   C  CD2 . HIS A  1 95   ? -14.356 15.742  -6.816  1.00 262.00 ? 95   HIS A CD2 1 
ATOM   687   C  CE1 . HIS A  1 95   ? -12.956 16.321  -8.401  1.00 227.28 ? 95   HIS A CE1 1 
ATOM   688   N  NE2 . HIS A  1 95   ? -13.035 15.889  -7.155  1.00 256.72 ? 95   HIS A NE2 1 
ATOM   689   N  N   . GLU A  1 96   ? -17.411 13.906  -10.640 1.00 266.52 ? 96   GLU A N   1 
ATOM   690   C  CA  . GLU A  1 96   ? -16.980 13.226  -11.856 1.00 273.56 ? 96   GLU A CA  1 
ATOM   691   C  C   . GLU A  1 96   ? -16.194 14.149  -12.787 1.00 272.71 ? 96   GLU A C   1 
ATOM   692   O  O   . GLU A  1 96   ? -16.743 15.100  -13.340 1.00 318.79 ? 96   GLU A O   1 
ATOM   693   C  CB  . GLU A  1 96   ? -18.190 12.639  -12.589 1.00 304.11 ? 96   GLU A CB  1 
ATOM   694   C  CG  . GLU A  1 96   ? -19.312 13.629  -12.854 1.00 326.81 ? 96   GLU A CG  1 
ATOM   695   C  CD  . GLU A  1 96   ? -20.592 12.948  -13.297 1.00 339.35 ? 96   GLU A CD  1 
ATOM   696   O  OE1 . GLU A  1 96   ? -20.548 11.738  -13.604 1.00 320.73 ? 96   GLU A OE1 1 
ATOM   697   O  OE2 . GLU A  1 96   ? -21.643 13.619  -13.336 1.00 366.34 ? 96   GLU A OE2 1 
ATOM   698   N  N   . CYS A  1 97   ? -14.905 13.856  -12.951 1.00 244.11 ? 97   CYS A N   1 
ATOM   699   C  CA  . CYS A  1 97   ? -14.044 14.606  -13.860 1.00 259.25 ? 97   CYS A CA  1 
ATOM   700   C  C   . CYS A  1 97   ? -13.833 13.833  -15.156 1.00 257.56 ? 97   CYS A C   1 
ATOM   701   O  O   . CYS A  1 97   ? -12.850 14.043  -15.861 1.00 214.43 ? 97   CYS A O   1 
ATOM   702   C  CB  . CYS A  1 97   ? -12.687 14.887  -13.208 1.00 212.33 ? 97   CYS A CB  1 
ATOM   703   S  SG  . CYS A  1 97   ? -12.767 15.876  -11.706 1.00 360.12 ? 97   CYS A SG  1 
ATOM   704   N  N   . GLY A  1 98   ? -14.758 12.932  -15.463 1.00 261.19 ? 98   GLY A N   1 
ATOM   705   C  CA  . GLY A  1 98   ? -14.680 12.157  -16.683 1.00 249.84 ? 98   GLY A CA  1 
ATOM   706   C  C   . GLY A  1 98   ? -13.967 10.839  -16.467 1.00 236.70 ? 98   GLY A C   1 
ATOM   707   O  O   . GLY A  1 98   ? -14.545 9.890   -15.939 1.00 187.49 ? 98   GLY A O   1 
ATOM   708   N  N   . ARG A  1 99   ? -12.702 10.787  -16.873 1.00 256.59 ? 99   ARG A N   1 
ATOM   709   C  CA  . ARG A  1 99   ? -11.914 9.562   -16.804 1.00 273.94 ? 99   ARG A CA  1 
ATOM   710   C  C   . ARG A  1 99   ? -12.048 8.889   -15.447 1.00 247.15 ? 99   ARG A C   1 
ATOM   711   O  O   . ARG A  1 99   ? -12.276 7.683   -15.360 1.00 154.60 ? 99   ARG A O   1 
ATOM   712   C  CB  . ARG A  1 99   ? -10.442 9.862   -17.093 1.00 284.87 ? 99   ARG A CB  1 
ATOM   713   C  CG  . ARG A  1 99   ? -9.835  10.899  -16.172 1.00 277.20 ? 99   ARG A CG  1 
ATOM   714   C  CD  . ARG A  1 99   ? -8.425  11.260  -16.593 1.00 288.19 ? 99   ARG A CD  1 
ATOM   715   N  NE  . ARG A  1 99   ? -7.840  12.261  -15.709 1.00 322.25 ? 99   ARG A NE  1 
ATOM   716   C  CZ  . ARG A  1 99   ? -6.641  12.807  -15.881 1.00 351.03 ? 99   ARG A CZ  1 
ATOM   717   N  NH1 . ARG A  1 99   ? -5.884  12.450  -16.910 1.00 363.87 ? 99   ARG A NH1 1 
ATOM   718   N  NH2 . ARG A  1 99   ? -6.198  13.712  -15.021 1.00 351.21 ? 99   ARG A NH2 1 
ATOM   719   N  N   . ASN A  1 100  ? -11.910 9.678   -14.388 1.00 288.59 ? 100  ASN A N   1 
ATOM   720   C  CA  . ASN A  1 100  ? -12.011 9.152   -13.034 1.00 316.97 ? 100  ASN A CA  1 
ATOM   721   C  C   . ASN A  1 100  ? -12.418 10.222  -12.028 1.00 341.54 ? 100  ASN A C   1 
ATOM   722   O  O   . ASN A  1 100  ? -11.914 11.345  -12.063 1.00 362.49 ? 100  ASN A O   1 
ATOM   723   C  CB  . ASN A  1 100  ? -10.684 8.524   -12.612 1.00 301.73 ? 100  ASN A CB  1 
ATOM   724   C  CG  . ASN A  1 100  ? -9.500  9.442   -12.850 1.00 278.00 ? 100  ASN A CG  1 
ATOM   725   O  OD1 . ASN A  1 100  ? -9.660  10.638  -13.092 1.00 255.08 ? 100  ASN A OD1 1 
ATOM   726   N  ND2 . ASN A  1 100  ? -8.302  8.882   -12.781 1.00 266.25 ? 100  ASN A ND2 1 
ATOM   727   N  N   . MET A  1 101  ? -13.335 9.865   -11.132 1.00 325.85 ? 101  MET A N   1 
ATOM   728   C  CA  . MET A  1 101  ? -13.809 10.790  -10.107 1.00 277.04 ? 101  MET A CA  1 
ATOM   729   C  C   . MET A  1 101  ? -12.907 10.710  -8.883  1.00 276.78 ? 101  MET A C   1 
ATOM   730   O  O   . MET A  1 101  ? -12.068 9.813   -8.775  1.00 273.41 ? 101  MET A O   1 
ATOM   731   C  CB  . MET A  1 101  ? -15.255 10.475  -9.709  1.00 198.21 ? 101  MET A CB  1 
ATOM   732   C  CG  . MET A  1 101  ? -15.482 9.034   -9.281  1.00 160.73 ? 101  MET A CG  1 
ATOM   733   S  SD  . MET A  1 101  ? -17.175 8.726   -8.741  1.00 519.03 ? 101  MET A SD  1 
ATOM   734   C  CE  . MET A  1 101  ? -18.088 9.184   -10.209 1.00 137.84 ? 101  MET A CE  1 
ATOM   735   N  N   . TYR A  1 102  ? -13.090 11.652  -7.962  1.00 281.77 ? 102  TYR A N   1 
ATOM   736   C  CA  . TYR A  1 102  ? -12.262 11.729  -6.764  1.00 318.30 ? 102  TYR A CA  1 
ATOM   737   C  C   . TYR A  1 102  ? -13.107 12.042  -5.527  1.00 312.07 ? 102  TYR A C   1 
ATOM   738   O  O   . TYR A  1 102  ? -14.335 11.967  -5.572  1.00 348.95 ? 102  TYR A O   1 
ATOM   739   C  CB  . TYR A  1 102  ? -11.174 12.791  -6.945  1.00 334.43 ? 102  TYR A CB  1 
ATOM   740   C  CG  . TYR A  1 102  ? -10.293 12.575  -8.159  1.00 335.33 ? 102  TYR A CG  1 
ATOM   741   C  CD1 . TYR A  1 102  ? -9.234  11.677  -8.119  1.00 392.22 ? 102  TYR A CD1 1 
ATOM   742   C  CD2 . TYR A  1 102  ? -10.513 13.272  -9.340  1.00 259.65 ? 102  TYR A CD2 1 
ATOM   743   C  CE1 . TYR A  1 102  ? -8.423  11.475  -9.221  1.00 377.59 ? 102  TYR A CE1 1 
ATOM   744   C  CE2 . TYR A  1 102  ? -9.707  13.075  -10.449 1.00 280.81 ? 102  TYR A CE2 1 
ATOM   745   C  CZ  . TYR A  1 102  ? -8.664  12.176  -10.382 1.00 336.65 ? 102  TYR A CZ  1 
ATOM   746   O  OH  . TYR A  1 102  ? -7.860  11.975  -11.480 1.00 335.58 ? 102  TYR A OH  1 
ATOM   747   N  N   . LEU A  1 103  ? -12.445 12.392  -4.426  1.00 260.11 ? 103  LEU A N   1 
ATOM   748   C  CA  . LEU A  1 103  ? -13.136 12.690  -3.172  1.00 241.91 ? 103  LEU A CA  1 
ATOM   749   C  C   . LEU A  1 103  ? -12.658 14.000  -2.555  1.00 224.13 ? 103  LEU A C   1 
ATOM   750   O  O   . LEU A  1 103  ? -11.470 14.165  -2.280  1.00 318.47 ? 103  LEU A O   1 
ATOM   751   C  CB  . LEU A  1 103  ? -12.922 11.547  -2.194  1.00 245.36 ? 103  LEU A CB  1 
ATOM   752   C  CG  . LEU A  1 103  ? -13.284 10.195  -2.796  1.00 264.43 ? 103  LEU A CG  1 
ATOM   753   C  CD1 . LEU A  1 103  ? -12.550 9.140   -2.032  1.00 257.63 ? 103  LEU A CD1 1 
ATOM   754   C  CD2 . LEU A  1 103  ? -14.798 9.986   -2.774  1.00 277.53 ? 103  LEU A CD2 1 
ATOM   755   N  N   . THR A  1 104  ? -13.587 14.925  -2.327  1.00 149.03 ? 104  THR A N   1 
ATOM   756   C  CA  . THR A  1 104  ? -13.222 16.278  -1.900  1.00 257.09 ? 104  THR A CA  1 
ATOM   757   C  C   . THR A  1 104  ? -13.656 16.616  -0.472  1.00 273.41 ? 104  THR A C   1 
ATOM   758   O  O   . THR A  1 104  ? -12.893 17.213  0.292   1.00 242.51 ? 104  THR A O   1 
ATOM   759   C  CB  . THR A  1 104  ? -13.804 17.344  -2.859  1.00 291.86 ? 104  THR A CB  1 
ATOM   760   O  OG1 . THR A  1 104  ? -13.579 18.651  -2.318  1.00 324.18 ? 104  THR A OG1 1 
ATOM   761   C  CG2 . THR A  1 104  ? -15.294 17.138  -3.061  1.00 256.66 ? 104  THR A CG2 1 
ATOM   762   N  N   . GLY A  1 105  ? -14.882 16.249  -0.117  1.00 297.77 ? 105  GLY A N   1 
ATOM   763   C  CA  . GLY A  1 105  ? -15.416 16.558  1.198   1.00 278.78 ? 105  GLY A CA  1 
ATOM   764   C  C   . GLY A  1 105  ? -16.167 17.880  1.232   1.00 247.26 ? 105  GLY A C   1 
ATOM   765   O  O   . GLY A  1 105  ? -15.750 18.858  0.611   1.00 258.45 ? 105  GLY A O   1 
ATOM   766   N  N   . LEU A  1 106  ? -17.274 17.905  1.970   1.00 191.82 ? 106  LEU A N   1 
ATOM   767   C  CA  . LEU A  1 106  ? -18.121 19.088  2.084   1.00 207.19 ? 106  LEU A CA  1 
ATOM   768   C  C   . LEU A  1 106  ? -18.726 19.160  3.476   1.00 254.80 ? 106  LEU A C   1 
ATOM   769   O  O   . LEU A  1 106  ? -19.362 18.208  3.929   1.00 269.12 ? 106  LEU A O   1 
ATOM   770   C  CB  . LEU A  1 106  ? -19.250 19.041  1.055   1.00 198.45 ? 106  LEU A CB  1 
ATOM   771   C  CG  . LEU A  1 106  ? -20.290 20.158  1.166   1.00 219.71 ? 106  LEU A CG  1 
ATOM   772   C  CD1 . LEU A  1 106  ? -19.652 21.511  0.877   1.00 269.35 ? 106  LEU A CD1 1 
ATOM   773   C  CD2 . LEU A  1 106  ? -21.456 19.888  0.230   1.00 277.16 ? 106  LEU A CD2 1 
ATOM   774   N  N   . CYS A  1 107  ? -18.564 20.304  4.135   1.00 269.81 ? 107  CYS A N   1 
ATOM   775   C  CA  . CYS A  1 107  ? -19.067 20.474  5.492   1.00 270.55 ? 107  CYS A CA  1 
ATOM   776   C  C   . CYS A  1 107  ? -20.106 21.587  5.601   1.00 239.73 ? 107  CYS A C   1 
ATOM   777   O  O   . CYS A  1 107  ? -20.248 22.411  4.696   1.00 190.82 ? 107  CYS A O   1 
ATOM   778   C  CB  . CYS A  1 107  ? -17.907 20.756  6.441   1.00 230.28 ? 107  CYS A CB  1 
ATOM   779   S  SG  . CYS A  1 107  ? -16.843 19.341  6.770   1.00 221.25 ? 107  CYS A SG  1 
ATOM   780   N  N   . PHE A  1 108  ? -20.832 21.582  6.719   1.00 246.29 ? 108  PHE A N   1 
ATOM   781   C  CA  . PHE A  1 108  ? -21.912 22.533  6.985   1.00 241.20 ? 108  PHE A CA  1 
ATOM   782   C  C   . PHE A  1 108  ? -21.844 23.081  8.421   1.00 244.03 ? 108  PHE A C   1 
ATOM   783   O  O   . PHE A  1 108  ? -21.797 22.312  9.385   1.00 182.74 ? 108  PHE A O   1 
ATOM   784   C  CB  . PHE A  1 108  ? -23.277 21.860  6.799   1.00 220.46 ? 108  PHE A CB  1 
ATOM   785   C  CG  . PHE A  1 108  ? -23.390 21.027  5.555   1.00 204.70 ? 108  PHE A CG  1 
ATOM   786   C  CD1 . PHE A  1 108  ? -23.897 21.571  4.389   1.00 244.04 ? 108  PHE A CD1 1 
ATOM   787   C  CD2 . PHE A  1 108  ? -23.005 19.696  5.556   1.00 244.40 ? 108  PHE A CD2 1 
ATOM   788   C  CE1 . PHE A  1 108  ? -24.011 20.808  3.242   1.00 284.67 ? 108  PHE A CE1 1 
ATOM   789   C  CE2 . PHE A  1 108  ? -23.115 18.926  4.411   1.00 288.14 ? 108  PHE A CE2 1 
ATOM   790   C  CZ  . PHE A  1 108  ? -23.618 19.483  3.253   1.00 291.14 ? 108  PHE A CZ  1 
ATOM   791   N  N   . LEU A  1 109  ? -21.858 24.408  8.558   1.00 259.86 ? 109  LEU A N   1 
ATOM   792   C  CA  . LEU A  1 109  ? -21.882 25.068  9.870   1.00 184.91 ? 109  LEU A CA  1 
ATOM   793   C  C   . LEU A  1 109  ? -23.285 25.566  10.199  1.00 186.88 ? 109  LEU A C   1 
ATOM   794   O  O   . LEU A  1 109  ? -23.844 26.395  9.481   1.00 269.93 ? 109  LEU A O   1 
ATOM   795   C  CB  . LEU A  1 109  ? -20.903 26.250  9.913   1.00 145.88 ? 109  LEU A CB  1 
ATOM   796   C  CG  . LEU A  1 109  ? -19.424 25.923  10.133  1.00 182.74 ? 109  LEU A CG  1 
ATOM   797   C  CD1 . LEU A  1 109  ? -18.574 27.187  10.082  1.00 163.16 ? 109  LEU A CD1 1 
ATOM   798   C  CD2 . LEU A  1 109  ? -19.218 25.201  11.447  1.00 205.89 ? 109  LEU A CD2 1 
ATOM   799   N  N   . LEU A  1 110  ? -23.853 25.059  11.287  1.00 170.63 ? 110  LEU A N   1 
ATOM   800   C  CA  . LEU A  1 110  ? -25.196 25.449  11.698  1.00 197.24 ? 110  LEU A CA  1 
ATOM   801   C  C   . LEU A  1 110  ? -25.154 26.328  12.950  1.00 226.29 ? 110  LEU A C   1 
ATOM   802   O  O   . LEU A  1 110  ? -24.115 26.899  13.288  1.00 209.51 ? 110  LEU A O   1 
ATOM   803   C  CB  . LEU A  1 110  ? -26.054 24.205  11.945  1.00 188.53 ? 110  LEU A CB  1 
ATOM   804   C  CG  . LEU A  1 110  ? -26.368 23.346  10.717  1.00 234.55 ? 110  LEU A CG  1 
ATOM   805   C  CD1 . LEU A  1 110  ? -25.120 22.658  10.172  1.00 282.42 ? 110  LEU A CD1 1 
ATOM   806   C  CD2 . LEU A  1 110  ? -27.426 22.317  11.064  1.00 230.98 ? 110  LEU A CD2 1 
ATOM   807   N  N   . GLY A  1 111  ? -26.291 26.452  13.625  1.00 250.32 ? 111  GLY A N   1 
ATOM   808   C  CA  . GLY A  1 111  ? -26.355 27.214  14.853  1.00 228.23 ? 111  GLY A CA  1 
ATOM   809   C  C   . GLY A  1 111  ? -27.472 28.229  14.816  1.00 227.36 ? 111  GLY A C   1 
ATOM   810   O  O   . GLY A  1 111  ? -28.254 28.277  13.868  1.00 288.46 ? 111  GLY A O   1 
ATOM   811   N  N   . PRO A  1 112  ? -27.561 29.038  15.869  1.00 150.48 ? 112  PRO A N   1 
ATOM   812   C  CA  . PRO A  1 112  ? -28.484 30.168  15.974  1.00 156.51 ? 112  PRO A CA  1 
ATOM   813   C  C   . PRO A  1 112  ? -28.002 31.352  15.152  1.00 217.09 ? 112  PRO A C   1 
ATOM   814   O  O   . PRO A  1 112  ? -27.980 32.472  15.658  1.00 117.30 ? 112  PRO A O   1 
ATOM   815   C  CB  . PRO A  1 112  ? -28.431 30.525  17.459  1.00 241.71 ? 112  PRO A CB  1 
ATOM   816   C  CG  . PRO A  1 112  ? -27.816 29.341  18.133  1.00 271.57 ? 112  PRO A CG  1 
ATOM   817   C  CD  . PRO A  1 112  ? -26.880 28.764  17.140  1.00 181.00 ? 112  PRO A CD  1 
ATOM   818   N  N   . THR A  1 113  ? -27.608 31.101  13.908  1.00 281.86 ? 113  THR A N   1 
ATOM   819   C  CA  . THR A  1 113  ? -27.123 32.151  13.021  1.00 275.78 ? 113  THR A CA  1 
ATOM   820   C  C   . THR A  1 113  ? -27.482 31.803  11.571  1.00 257.01 ? 113  THR A C   1 
ATOM   821   O  O   . THR A  1 113  ? -28.581 31.312  11.305  1.00 241.33 ? 113  THR A O   1 
ATOM   822   C  CB  . THR A  1 113  ? -25.592 32.351  13.164  1.00 232.34 ? 113  THR A CB  1 
ATOM   823   O  OG1 . THR A  1 113  ? -24.907 31.156  12.776  1.00 236.25 ? 113  THR A OG1 1 
ATOM   824   C  CG2 . THR A  1 113  ? -25.214 32.693  14.600  1.00 169.55 ? 113  THR A CG2 1 
ATOM   825   N  N   . GLN A  1 114  ? -26.561 32.061  10.644  1.00 262.16 ? 114  GLN A N   1 
ATOM   826   C  CA  . GLN A  1 114  ? -26.767 31.746  9.234   1.00 237.67 ? 114  GLN A CA  1 
ATOM   827   C  C   . GLN A  1 114  ? -26.238 30.354  8.928   1.00 243.40 ? 114  GLN A C   1 
ATOM   828   O  O   . GLN A  1 114  ? -25.162 29.984  9.392   1.00 311.36 ? 114  GLN A O   1 
ATOM   829   C  CB  . GLN A  1 114  ? -26.045 32.765  8.356   1.00 217.58 ? 114  GLN A CB  1 
ATOM   830   C  CG  . GLN A  1 114  ? -26.292 34.206  8.762   1.00 274.40 ? 114  GLN A CG  1 
ATOM   831   C  CD  . GLN A  1 114  ? -25.403 35.186  8.027   1.00 324.85 ? 114  GLN A CD  1 
ATOM   832   O  OE1 . GLN A  1 114  ? -24.266 34.869  7.679   1.00 346.68 ? 114  GLN A OE1 1 
ATOM   833   N  NE2 . GLN A  1 114  ? -25.914 36.389  7.791   1.00 334.20 ? 114  GLN A NE2 1 
ATOM   834   N  N   . LEU A  1 115  ? -26.991 29.583  8.150   1.00 169.90 ? 115  LEU A N   1 
ATOM   835   C  CA  . LEU A  1 115  ? -26.571 28.233  7.793   1.00 166.98 ? 115  LEU A CA  1 
ATOM   836   C  C   . LEU A  1 115  ? -25.469 28.296  6.748   1.00 159.60 ? 115  LEU A C   1 
ATOM   837   O  O   . LEU A  1 115  ? -25.742 28.242  5.552   1.00 236.83 ? 115  LEU A O   1 
ATOM   838   C  CB  . LEU A  1 115  ? -27.754 27.421  7.263   1.00 149.39 ? 115  LEU A CB  1 
ATOM   839   C  CG  . LEU A  1 115  ? -28.762 26.931  8.303   1.00 208.38 ? 115  LEU A CG  1 
ATOM   840   C  CD1 . LEU A  1 115  ? -30.053 26.513  7.636   1.00 198.53 ? 115  LEU A CD1 1 
ATOM   841   C  CD2 . LEU A  1 115  ? -28.183 25.783  9.110   1.00 247.69 ? 115  LEU A CD2 1 
ATOM   842   N  N   . THR A  1 116  ? -24.223 28.406  7.203   1.00 216.06 ? 116  THR A N   1 
ATOM   843   C  CA  . THR A  1 116  ? -23.068 28.503  6.304   1.00 252.04 ? 116  THR A CA  1 
ATOM   844   C  C   . THR A  1 116  ? -22.698 27.127  5.722   1.00 252.37 ? 116  THR A C   1 
ATOM   845   O  O   . THR A  1 116  ? -23.073 26.096  6.278   1.00 271.68 ? 116  THR A O   1 
ATOM   846   C  CB  . THR A  1 116  ? -21.829 29.095  7.048   1.00 239.27 ? 116  THR A CB  1 
ATOM   847   O  OG1 . THR A  1 116  ? -22.205 30.273  7.777   1.00 226.48 ? 116  THR A OG1 1 
ATOM   848   C  CG2 . THR A  1 116  ? -20.706 29.443  6.070   1.00 167.63 ? 116  THR A CG2 1 
ATOM   849   N  N   . GLN A  1 117  ? -21.981 27.110  4.599   1.00 205.80 ? 117  GLN A N   1 
ATOM   850   C  CA  . GLN A  1 117  ? -21.357 25.877  4.113   1.00 191.99 ? 117  GLN A CA  1 
ATOM   851   C  C   . GLN A  1 117  ? -19.986 26.210  3.612   1.00 217.83 ? 117  GLN A C   1 
ATOM   852   O  O   . GLN A  1 117  ? -19.812 27.071  2.745   1.00 267.98 ? 117  GLN A O   1 
ATOM   853   C  CB  . GLN A  1 117  ? -22.159 25.221  3.007   1.00 270.53 ? 117  GLN A CB  1 
ATOM   854   C  CG  . GLN A  1 117  ? -23.597 25.026  3.361   1.00 313.80 ? 117  GLN A CG  1 
ATOM   855   C  CD  . GLN A  1 117  ? -24.410 24.541  2.182   1.00 300.49 ? 117  GLN A CD  1 
ATOM   856   O  OE1 . GLN A  1 117  ? -24.145 24.904  1.033   1.00 245.67 ? 117  GLN A OE1 1 
ATOM   857   N  NE2 . GLN A  1 117  ? -25.406 23.715  2.458   1.00 322.98 ? 117  GLN A NE2 1 
ATOM   858   N  N   . ARG A  1 118  ? -19.004 25.509  4.148   1.00 220.77 ? 118  ARG A N   1 
ATOM   859   C  CA  . ARG A  1 118  ? -17.674 26.087  4.153   1.00 253.57 ? 118  ARG A CA  1 
ATOM   860   C  C   . ARG A  1 118  ? -16.523 25.112  3.957   1.00 259.26 ? 118  ARG A C   1 
ATOM   861   O  O   . ARG A  1 118  ? -15.827 24.726  4.908   1.00 255.65 ? 118  ARG A O   1 
ATOM   862   C  CB  . ARG A  1 118  ? -17.456 26.883  5.435   1.00 194.36 ? 118  ARG A CB  1 
ATOM   863   C  CG  . ARG A  1 118  ? -16.803 28.226  5.187   1.00 231.64 ? 118  ARG A CG  1 
ATOM   864   C  CD  . ARG A  1 118  ? -15.834 28.611  6.301   1.00 290.75 ? 118  ARG A CD  1 
ATOM   865   N  NE  . ARG A  1 118  ? -16.596 29.011  7.506   1.00 359.70 ? 118  ARG A NE  1 
ATOM   866   C  CZ  . ARG A  1 118  ? -17.103 30.224  7.785   1.00 419.00 ? 118  ARG A CZ  1 
ATOM   867   N  NH1 . ARG A  1 118  ? -16.917 31.166  6.923   1.00 415.23 ? 118  ARG A NH1 1 
ATOM   868   N  NH2 . ARG A  1 118  ? -17.804 30.480  8.923   1.00 464.11 ? 118  ARG A NH2 1 
ATOM   869   N  N   . LEU A  1 119  ? -16.345 24.699  2.710   1.00 234.56 ? 119  LEU A N   1 
ATOM   870   C  CA  . LEU A  1 119  ? -15.023 24.373  2.224   1.00 245.84 ? 119  LEU A CA  1 
ATOM   871   C  C   . LEU A  1 119  ? -14.312 25.580  1.537   1.00 285.24 ? 119  LEU A C   1 
ATOM   872   O  O   . LEU A  1 119  ? -13.091 25.556  1.373   1.00 321.40 ? 119  LEU A O   1 
ATOM   873   C  CB  . LEU A  1 119  ? -15.082 23.199  1.273   1.00 179.31 ? 119  LEU A CB  1 
ATOM   874   C  CG  . LEU A  1 119  ? -13.676 22.845  0.831   1.00 229.63 ? 119  LEU A CG  1 
ATOM   875   C  CD1 . LEU A  1 119  ? -13.229 21.523  1.446   1.00 230.74 ? 119  LEU A CD1 1 
ATOM   876   C  CD2 . LEU A  1 119  ? -13.619 22.760  -0.667  1.00 243.71 ? 119  LEU A CD2 1 
ATOM   877   N  N   . PRO A  1 120  ? -15.047 26.662  1.195   1.00 271.08 ? 120  PRO A N   1 
ATOM   878   C  CA  . PRO A  1 120  ? -16.506 26.819  1.211   1.00 285.06 ? 120  PRO A CA  1 
ATOM   879   C  C   . PRO A  1 120  ? -17.263 26.757  -0.110  1.00 271.05 ? 120  PRO A C   1 
ATOM   880   O  O   . PRO A  1 120  ? -17.405 27.782  -0.785  1.00 226.77 ? 120  PRO A O   1 
ATOM   881   C  CB  . PRO A  1 120  ? -16.689 28.197  1.823   1.00 275.93 ? 120  PRO A CB  1 
ATOM   882   C  CG  . PRO A  1 120  ? -15.517 28.955  1.399   1.00 235.49 ? 120  PRO A CG  1 
ATOM   883   C  CD  . PRO A  1 120  ? -14.378 27.975  1.281   1.00 228.69 ? 120  PRO A CD  1 
ATOM   884   N  N   . VAL A  1 121  ? -17.737 25.564  -0.464  1.00 301.24 ? 121  VAL A N   1 
ATOM   885   C  CA  . VAL A  1 121  ? -18.790 25.427  -1.458  1.00 314.33 ? 121  VAL A CA  1 
ATOM   886   C  C   . VAL A  1 121  ? -18.394 26.025  -2.808  1.00 334.40 ? 121  VAL A C   1 
ATOM   887   O  O   . VAL A  1 121  ? -19.220 26.197  -3.701  1.00 359.60 ? 121  VAL A O   1 
ATOM   888   C  CB  . VAL A  1 121  ? -20.089 26.026  -0.895  1.00 269.79 ? 121  VAL A CB  1 
ATOM   889   C  CG1 . VAL A  1 121  ? -21.214 26.017  -1.908  1.00 268.35 ? 121  VAL A CG1 1 
ATOM   890   C  CG2 . VAL A  1 121  ? -20.502 25.239  0.335   1.00 245.92 ? 121  VAL A CG2 1 
ATOM   891   N  N   . SER A  1 122  ? -17.116 26.351  -2.942  1.00 301.93 ? 122  SER A N   1 
ATOM   892   C  CA  . SER A  1 122  ? -16.495 26.425  -4.244  1.00 266.42 ? 122  SER A CA  1 
ATOM   893   C  C   . SER A  1 122  ? -16.366 24.969  -4.681  1.00 267.92 ? 122  SER A C   1 
ATOM   894   O  O   . SER A  1 122  ? -15.346 24.326  -4.435  1.00 272.59 ? 122  SER A O   1 
ATOM   895   C  CB  . SER A  1 122  ? -15.126 27.103  -4.158  1.00 241.87 ? 122  SER A CB  1 
ATOM   896   O  OG  . SER A  1 122  ? -14.236 26.375  -3.335  1.00 203.09 ? 122  SER A OG  1 
ATOM   897   N  N   . ARG A  1 123  ? -17.421 24.435  -5.290  1.00 250.91 ? 123  ARG A N   1 
ATOM   898   C  CA  . ARG A  1 123  ? -17.424 23.039  -5.711  1.00 247.66 ? 123  ARG A CA  1 
ATOM   899   C  C   . ARG A  1 123  ? -16.101 22.739  -6.404  1.00 299.66 ? 123  ARG A C   1 
ATOM   900   O  O   . ARG A  1 123  ? -15.795 23.307  -7.452  1.00 356.68 ? 123  ARG A O   1 
ATOM   901   C  CB  . ARG A  1 123  ? -18.607 22.762  -6.635  1.00 252.14 ? 123  ARG A CB  1 
ATOM   902   C  CG  . ARG A  1 123  ? -18.600 23.581  -7.901  1.00 294.46 ? 123  ARG A CG  1 
ATOM   903   C  CD  . ARG A  1 123  ? -19.929 23.487  -8.610  1.00 310.55 ? 123  ARG A CD  1 
ATOM   904   N  NE  . ARG A  1 123  ? -19.815 23.828  -10.023 1.00 337.59 ? 123  ARG A NE  1 
ATOM   905   C  CZ  . ARG A  1 123  ? -20.814 23.738  -10.893 1.00 352.34 ? 123  ARG A CZ  1 
ATOM   906   N  NH1 . ARG A  1 123  ? -22.004 23.317  -10.495 1.00 337.71 ? 123  ARG A NH1 1 
ATOM   907   N  NH2 . ARG A  1 123  ? -20.621 24.068  -12.162 1.00 373.02 ? 123  ARG A NH2 1 
ATOM   908   N  N   . GLN A  1 124  ? -15.319 21.845  -5.809  1.00 276.52 ? 124  GLN A N   1 
ATOM   909   C  CA  . GLN A  1 124  ? -13.926 21.664  -6.202  1.00 288.39 ? 124  GLN A CA  1 
ATOM   910   C  C   . GLN A  1 124  ? -13.793 21.082  -7.608  1.00 308.63 ? 124  GLN A C   1 
ATOM   911   O  O   . GLN A  1 124  ? -13.824 19.865  -7.788  1.00 305.46 ? 124  GLN A O   1 
ATOM   912   C  CB  . GLN A  1 124  ? -13.205 20.770  -5.191  1.00 279.27 ? 124  GLN A CB  1 
ATOM   913   C  CG  . GLN A  1 124  ? -12.890 21.448  -3.867  1.00 321.38 ? 124  GLN A CG  1 
ATOM   914   C  CD  . GLN A  1 124  ? -11.826 20.703  -3.083  1.00 381.34 ? 124  GLN A CD  1 
ATOM   915   O  OE1 . GLN A  1 124  ? -11.364 19.644  -3.498  1.00 423.94 ? 124  GLN A OE1 1 
ATOM   916   N  NE2 . GLN A  1 124  ? -11.425 21.261  -1.952  1.00 382.25 ? 124  GLN A NE2 1 
ATOM   917   N  N   . GLU A  1 125  ? -13.621 21.959  -8.596  1.00 301.60 ? 125  GLU A N   1 
ATOM   918   C  CA  . GLU A  1 125  ? -13.572 21.553  -10.001 1.00 284.24 ? 125  GLU A CA  1 
ATOM   919   C  C   . GLU A  1 125  ? -12.407 20.616  -10.300 1.00 289.88 ? 125  GLU A C   1 
ATOM   920   O  O   . GLU A  1 125  ? -11.416 20.592  -9.572  1.00 285.38 ? 125  GLU A O   1 
ATOM   921   C  CB  . GLU A  1 125  ? -13.477 22.780  -10.905 1.00 275.01 ? 125  GLU A CB  1 
ATOM   922   C  CG  . GLU A  1 125  ? -14.685 23.684  -10.829 1.00 305.07 ? 125  GLU A CG  1 
ATOM   923   C  CD  . GLU A  1 125  ? -14.570 24.874  -11.750 1.00 324.40 ? 125  GLU A CD  1 
ATOM   924   O  OE1 . GLU A  1 125  ? -13.494 25.050  -12.356 1.00 345.71 ? 125  GLU A OE1 1 
ATOM   925   O  OE2 . GLU A  1 125  ? -15.554 25.631  -11.867 1.00 323.03 ? 125  GLU A OE2 1 
ATOM   926   N  N   . CYS A  1 126  ? -12.532 19.853  -11.384 1.00 301.15 ? 126  CYS A N   1 
ATOM   927   C  CA  . CYS A  1 126  ? -11.535 18.844  -11.742 1.00 293.38 ? 126  CYS A CA  1 
ATOM   928   C  C   . CYS A  1 126  ? -10.185 19.477  -12.077 1.00 287.09 ? 126  CYS A C   1 
ATOM   929   O  O   . CYS A  1 126  ? -10.080 20.699  -12.197 1.00 245.24 ? 126  CYS A O   1 
ATOM   930   C  CB  . CYS A  1 126  ? -12.020 18.010  -12.933 1.00 221.27 ? 126  CYS A CB  1 
ATOM   931   S  SG  . CYS A  1 126  ? -13.689 17.353  -12.755 1.00 366.28 ? 126  CYS A SG  1 
ATOM   932   N  N   . PRO A  1 127  ? -9.146  18.638  -12.234 1.00 293.57 ? 127  PRO A N   1 
ATOM   933   C  CA  . PRO A  1 127  ? -7.794  19.135  -12.511 1.00 256.04 ? 127  PRO A CA  1 
ATOM   934   C  C   . PRO A  1 127  ? -7.620  19.546  -13.969 1.00 232.69 ? 127  PRO A C   1 
ATOM   935   O  O   . PRO A  1 127  ? -8.121  18.839  -14.842 1.00 261.24 ? 127  PRO A O   1 
ATOM   936   C  CB  . PRO A  1 127  ? -6.896  17.931  -12.183 1.00 277.67 ? 127  PRO A CB  1 
ATOM   937   C  CG  . PRO A  1 127  ? -7.814  16.844  -11.644 1.00 282.39 ? 127  PRO A CG  1 
ATOM   938   C  CD  . PRO A  1 127  ? -9.179  17.171  -12.130 1.00 271.64 ? 127  PRO A CD  1 
ATOM   939   N  N   . SER A  1 326  ? 1.996   8.151   -7.691  1.00 230.26 ? 326  SER A N   1 
ATOM   940   C  CA  . SER A  1 326  ? 2.385   9.120   -8.798  1.00 272.34 ? 326  SER A CA  1 
ATOM   941   C  C   . SER A  1 326  ? 2.832   10.661  -8.343  1.00 280.61 ? 326  SER A C   1 
ATOM   942   O  O   . SER A  1 326  ? 4.040   11.146  -8.647  1.00 228.81 ? 326  SER A O   1 
ATOM   943   C  CB  . SER A  1 326  ? 1.248   9.161   -9.953  1.00 239.47 ? 326  SER A CB  1 
ATOM   944   O  OG  . SER A  1 326  ? -0.069  9.751   -9.523  1.00 236.67 ? 326  SER A OG  1 
ATOM   945   N  N   . SER A  1 327  ? 1.866   11.406  -7.695  1.00 266.39 ? 327  SER A N   1 
ATOM   946   C  CA  . SER A  1 327  ? 1.710   12.856  -8.101  1.00 276.52 ? 327  SER A CA  1 
ATOM   947   C  C   . SER A  1 327  ? 0.932   13.781  -7.126  1.00 249.22 ? 327  SER A C   1 
ATOM   948   O  O   . SER A  1 327  ? 1.267   15.051  -6.977  1.00 224.80 ? 327  SER A O   1 
ATOM   949   C  CB  . SER A  1 327  ? 0.924   12.981  -9.517  1.00 266.55 ? 327  SER A CB  1 
ATOM   950   O  OG  . SER A  1 327  ? 1.721   12.600  -10.711 1.00 266.74 ? 327  SER A OG  1 
ATOM   951   N  N   . PHE A  1 328  ? -0.088  13.152  -6.522  1.00 224.33 ? 328  PHE A N   1 
ATOM   952   C  CA  . PHE A  1 328  ? -1.366  13.791  -6.315  1.00 209.33 ? 328  PHE A CA  1 
ATOM   953   C  C   . PHE A  1 328  ? -1.256  15.148  -5.674  1.00 263.86 ? 328  PHE A C   1 
ATOM   954   O  O   . PHE A  1 328  ? -0.209  15.542  -5.171  1.00 307.44 ? 328  PHE A O   1 
ATOM   955   C  CB  . PHE A  1 328  ? -2.271  12.877  -5.517  1.00 226.40 ? 328  PHE A CB  1 
ATOM   956   C  CG  . PHE A  1 328  ? -2.889  11.804  -6.340  1.00 184.65 ? 328  PHE A CG  1 
ATOM   957   C  CD1 . PHE A  1 328  ? -4.054  12.060  -7.026  1.00 181.17 ? 328  PHE A CD1 1 
ATOM   958   C  CD2 . PHE A  1 328  ? -2.324  10.542  -6.428  1.00 203.13 ? 328  PHE A CD2 1 
ATOM   959   C  CE1 . PHE A  1 328  ? -4.653  11.085  -7.790  1.00 223.56 ? 328  PHE A CE1 1 
ATOM   960   C  CE2 . PHE A  1 328  ? -2.917  9.556   -7.194  1.00 183.46 ? 328  PHE A CE2 1 
ATOM   961   C  CZ  . PHE A  1 328  ? -4.084  9.828   -7.875  1.00 190.75 ? 328  PHE A CZ  1 
ATOM   962   N  N   . GLU A  1 329  ? -2.343  15.890  -5.738  1.00 234.39 ? 329  GLU A N   1 
ATOM   963   C  CA  . GLU A  1 329  ? -2.373  17.188  -5.104  1.00 249.52 ? 329  GLU A CA  1 
ATOM   964   C  C   . GLU A  1 329  ? -3.477  17.223  -4.063  1.00 216.48 ? 329  GLU A C   1 
ATOM   965   O  O   . GLU A  1 329  ? -3.234  17.012  -2.879  1.00 284.77 ? 329  GLU A O   1 
ATOM   966   C  CB  . GLU A  1 329  ? -2.562  18.283  -6.154  1.00 262.50 ? 329  GLU A CB  1 
ATOM   967   C  CG  . GLU A  1 329  ? -1.314  18.538  -7.003  1.00 265.24 ? 329  GLU A CG  1 
ATOM   968   C  CD  . GLU A  1 329  ? -0.182  19.166  -6.205  1.00 269.34 ? 329  GLU A CD  1 
ATOM   969   O  OE1 . GLU A  1 329  ? -0.361  19.383  -4.989  1.00 376.70 ? 329  GLU A OE1 1 
ATOM   970   O  OE2 . GLU A  1 329  ? 0.888   19.443  -6.787  1.00 186.39 ? 329  GLU A OE2 1 
ATOM   971   N  N   . LEU A  1 330  ? -4.696  17.465  -4.512  1.00 189.44 ? 330  LEU A N   1 
ATOM   972   C  CA  . LEU A  1 330  ? -5.823  17.562  -3.605  1.00 177.53 ? 330  LEU A CA  1 
ATOM   973   C  C   . LEU A  1 330  ? -7.083  17.079  -4.292  1.00 196.03 ? 330  LEU A C   1 
ATOM   974   O  O   . LEU A  1 330  ? -8.063  17.812  -4.382  1.00 199.00 ? 330  LEU A O   1 
ATOM   975   C  CB  . LEU A  1 330  ? -5.999  19.005  -3.147  1.00 174.24 ? 330  LEU A CB  1 
ATOM   976   C  CG  . LEU A  1 330  ? -4.969  19.494  -2.131  1.00 235.72 ? 330  LEU A CG  1 
ATOM   977   C  CD1 . LEU A  1 330  ? -5.196  20.962  -1.855  1.00 149.37 ? 330  LEU A CD1 1 
ATOM   978   C  CD2 . LEU A  1 330  ? -5.044  18.686  -0.844  1.00 356.43 ? 330  LEU A CD2 1 
ATOM   979   N  N   . GLU A  1 331  ? -7.054  15.842  -4.775  1.00 198.39 ? 331  GLU A N   1 
ATOM   980   C  CA  . GLU A  1 331  ? -8.195  15.280  -5.488  1.00 234.32 ? 331  GLU A CA  1 
ATOM   981   C  C   . GLU A  1 331  ? -8.984  14.364  -4.560  1.00 229.62 ? 331  GLU A C   1 
ATOM   982   O  O   . GLU A  1 331  ? -10.213 14.398  -4.539  1.00 324.28 ? 331  GLU A O   1 
ATOM   983   C  CB  . GLU A  1 331  ? -7.740  14.509  -6.732  1.00 266.16 ? 331  GLU A CB  1 
ATOM   984   C  CG  . GLU A  1 331  ? -7.074  15.361  -7.799  1.00 251.07 ? 331  GLU A CG  1 
ATOM   985   C  CD  . GLU A  1 331  ? -5.672  15.782  -7.413  1.00 239.01 ? 331  GLU A CD  1 
ATOM   986   O  OE1 . GLU A  1 331  ? -5.032  15.066  -6.617  1.00 218.09 ? 331  GLU A OE1 1 
ATOM   987   O  OE2 . GLU A  1 331  ? -5.208  16.827  -7.911  1.00 225.92 ? 331  GLU A OE2 1 
ATOM   988   N  N   . MET A  1 332  ? -8.267  13.550  -3.790  1.00 141.08 ? 332  MET A N   1 
ATOM   989   C  CA  . MET A  1 332  ? -8.898  12.611  -2.871  1.00 237.67 ? 332  MET A CA  1 
ATOM   990   C  C   . MET A  1 332  ? -8.419  12.893  -1.462  1.00 274.81 ? 332  MET A C   1 
ATOM   991   O  O   . MET A  1 332  ? -7.895  12.005  -0.789  1.00 303.35 ? 332  MET A O   1 
ATOM   992   C  CB  . MET A  1 332  ? -8.552  11.170  -3.240  1.00 209.25 ? 332  MET A CB  1 
ATOM   993   C  CG  . MET A  1 332  ? -8.417  10.949  -4.716  1.00 208.70 ? 332  MET A CG  1 
ATOM   994   S  SD  . MET A  1 332  ? -8.398  9.199   -5.171  1.00 403.25 ? 332  MET A SD  1 
ATOM   995   C  CE  . MET A  1 332  ? -10.144 8.823   -5.160  1.00 204.29 ? 332  MET A CE  1 
ATOM   996   N  N   . ALA A  1 333  ? -8.596  14.133  -1.019  1.00 249.16 ? 333  ALA A N   1 
ATOM   997   C  CA  . ALA A  1 333  ? -8.159  14.534  0.314   1.00 210.55 ? 333  ALA A CA  1 
ATOM   998   C  C   . ALA A  1 333  ? -9.302  14.457  1.336   1.00 254.33 ? 333  ALA A C   1 
ATOM   999   O  O   . ALA A  1 333  ? -9.074  14.590  2.541   1.00 253.38 ? 333  ALA A O   1 
ATOM   1000  C  CB  . ALA A  1 333  ? -7.552  15.940  0.277   1.00 102.55 ? 333  ALA A CB  1 
ATOM   1001  N  N   . GLN A  1 334  ? -10.524 14.233  0.851   1.00 264.07 ? 334  GLN A N   1 
ATOM   1002  C  CA  . GLN A  1 334  ? -11.693 14.068  1.714   1.00 241.16 ? 334  GLN A CA  1 
ATOM   1003  C  C   . GLN A  1 334  ? -11.650 15.014  2.906   1.00 263.76 ? 334  GLN A C   1 
ATOM   1004  O  O   . GLN A  1 334  ? -11.903 14.605  4.038   1.00 282.77 ? 334  GLN A O   1 
ATOM   1005  C  CB  . GLN A  1 334  ? -11.778 12.630  2.224   1.00 220.63 ? 334  GLN A CB  1 
ATOM   1006  C  CG  . GLN A  1 334  ? -11.988 11.593  1.143   1.00 190.78 ? 334  GLN A CG  1 
ATOM   1007  C  CD  . GLN A  1 334  ? -11.911 10.173  1.679   1.00 192.41 ? 334  GLN A CD  1 
ATOM   1008  O  OE1 . GLN A  1 334  ? -10.971 9.809   2.390   1.00 164.34 ? 334  GLN A OE1 1 
ATOM   1009  N  NE2 . GLN A  1 334  ? -12.898 9.361   1.330   1.00 208.50 ? 334  GLN A NE2 1 
ATOM   1010  N  N   . GLU A  1 335  ? -11.319 16.275  2.651   1.00 240.34 ? 335  GLU A N   1 
ATOM   1011  C  CA  . GLU A  1 335  ? -11.224 17.260  3.717   1.00 240.03 ? 335  GLU A CA  1 
ATOM   1012  C  C   . GLU A  1 335  ? -12.479 17.221  4.590   1.00 271.85 ? 335  GLU A C   1 
ATOM   1013  O  O   . GLU A  1 335  ? -13.580 16.986  4.089   1.00 277.21 ? 335  GLU A O   1 
ATOM   1014  C  CB  . GLU A  1 335  ? -11.031 18.654  3.130   1.00 275.24 ? 335  GLU A CB  1 
ATOM   1015  C  CG  . GLU A  1 335  ? -10.786 19.713  4.175   1.00 406.86 ? 335  GLU A CG  1 
ATOM   1016  C  CD  . GLU A  1 335  ? -10.653 21.090  3.575   1.00 487.71 ? 335  GLU A CD  1 
ATOM   1017  O  OE1 . GLU A  1 335  ? -10.411 21.183  2.354   1.00 483.36 ? 335  GLU A OE1 1 
ATOM   1018  O  OE2 . GLU A  1 335  ? -10.790 22.077  4.325   1.00 540.35 ? 335  GLU A OE2 1 
ATOM   1019  N  N   . GLY A  1 336  ? -12.304 17.443  5.892   1.00 257.32 ? 336  GLY A N   1 
ATOM   1020  C  CA  . GLY A  1 336  ? -13.405 17.394  6.841   1.00 158.20 ? 336  GLY A CA  1 
ATOM   1021  C  C   . GLY A  1 336  ? -13.542 16.011  7.442   1.00 206.62 ? 336  GLY A C   1 
ATOM   1022  O  O   . GLY A  1 336  ? -14.487 15.736  8.180   1.00 220.16 ? 336  GLY A O   1 
ATOM   1023  N  N   . PHE A  1 337  ? -12.597 15.136  7.111   1.00 227.24 ? 337  PHE A N   1 
ATOM   1024  C  CA  . PHE A  1 337  ? -12.570 13.785  7.655   1.00 215.54 ? 337  PHE A CA  1 
ATOM   1025  C  C   . PHE A  1 337  ? -12.551 13.856  9.175   1.00 239.36 ? 337  PHE A C   1 
ATOM   1026  O  O   . PHE A  1 337  ? -13.071 12.973  9.854   1.00 284.52 ? 337  PHE A O   1 
ATOM   1027  C  CB  . PHE A  1 337  ? -11.342 13.028  7.143   1.00 182.11 ? 337  PHE A CB  1 
ATOM   1028  C  CG  . PHE A  1 337  ? -11.235 11.622  7.662   1.00 193.54 ? 337  PHE A CG  1 
ATOM   1029  C  CD1 . PHE A  1 337  ? -11.923 10.592  7.046   1.00 161.81 ? 337  PHE A CD1 1 
ATOM   1030  C  CD2 . PHE A  1 337  ? -10.449 11.329  8.764   1.00 254.88 ? 337  PHE A CD2 1 
ATOM   1031  C  CE1 . PHE A  1 337  ? -11.831 9.291   7.516   1.00 228.11 ? 337  PHE A CE1 1 
ATOM   1032  C  CE2 . PHE A  1 337  ? -10.355 10.029  9.240   1.00 295.68 ? 337  PHE A CE2 1 
ATOM   1033  C  CZ  . PHE A  1 337  ? -11.048 9.010   8.613   1.00 281.90 ? 337  PHE A CZ  1 
ATOM   1034  N  N   . SER A  1 338  ? -11.950 14.917  9.701   1.00 235.53 ? 338  SER A N   1 
ATOM   1035  C  CA  . SER A  1 338  ? -11.930 15.166  11.136  1.00 236.60 ? 338  SER A CA  1 
ATOM   1036  C  C   . SER A  1 338  ? -11.764 16.659  11.359  1.00 218.79 ? 338  SER A C   1 
ATOM   1037  O  O   . SER A  1 338  ? -10.867 17.277  10.785  1.00 219.43 ? 338  SER A O   1 
ATOM   1038  C  CB  . SER A  1 338  ? -10.795 14.390  11.810  1.00 239.72 ? 338  SER A CB  1 
ATOM   1039  O  OG  . SER A  1 338  ? -9.531  14.784  11.307  1.00 241.11 ? 338  SER A OG  1 
ATOM   1040  N  N   . ALA A  1 339  ? -12.636 17.241  12.178  1.00 177.48 ? 339  ALA A N   1 
ATOM   1041  C  CA  . ALA A  1 339  ? -12.630 18.686  12.390  1.00 214.58 ? 339  ALA A CA  1 
ATOM   1042  C  C   . ALA A  1 339  ? -12.694 19.079  13.867  1.00 208.79 ? 339  ALA A C   1 
ATOM   1043  O  O   . ALA A  1 339  ? -13.239 18.351  14.691  1.00 201.74 ? 339  ALA A O   1 
ATOM   1044  C  CB  . ALA A  1 339  ? -13.783 19.320  11.637  1.00 258.96 ? 339  ALA A CB  1 
ATOM   1045  N  N   . VAL A  1 340  ? -12.135 20.245  14.183  1.00 222.33 ? 340  VAL A N   1 
ATOM   1046  C  CA  . VAL A  1 340  ? -12.156 20.797  15.539  1.00 169.22 ? 340  VAL A CA  1 
ATOM   1047  C  C   . VAL A  1 340  ? -12.007 22.315  15.485  1.00 170.23 ? 340  VAL A C   1 
ATOM   1048  O  O   . VAL A  1 340  ? -11.220 22.837  14.699  1.00 240.55 ? 340  VAL A O   1 
ATOM   1049  C  CB  . VAL A  1 340  ? -11.015 20.234  16.406  1.00 200.03 ? 340  VAL A CB  1 
ATOM   1050  C  CG1 . VAL A  1 340  ? -9.657  20.560  15.792  1.00 182.78 ? 340  VAL A CG1 1 
ATOM   1051  C  CG2 . VAL A  1 340  ? -11.104 20.790  17.814  1.00 271.62 ? 340  VAL A CG2 1 
ATOM   1052  N  N   . PHE A  1 341  ? -12.747 23.026  16.327  1.00 144.36 ? 341  PHE A N   1 
ATOM   1053  C  CA  . PHE A  1 341  ? -12.766 24.488  16.272  1.00 144.05 ? 341  PHE A CA  1 
ATOM   1054  C  C   . PHE A  1 341  ? -11.532 25.114  16.920  1.00 196.20 ? 341  PHE A C   1 
ATOM   1055  O  O   . PHE A  1 341  ? -10.589 24.418  17.296  1.00 228.47 ? 341  PHE A O   1 
ATOM   1056  C  CB  . PHE A  1 341  ? -14.020 25.024  16.956  1.00 187.11 ? 341  PHE A CB  1 
ATOM   1057  C  CG  . PHE A  1 341  ? -15.299 24.623  16.284  1.00 138.84 ? 341  PHE A CG  1 
ATOM   1058  C  CD1 . PHE A  1 341  ? -16.106 25.574  15.680  1.00 142.37 ? 341  PHE A CD1 1 
ATOM   1059  C  CD2 . PHE A  1 341  ? -15.702 23.297  16.269  1.00 121.03 ? 341  PHE A CD2 1 
ATOM   1060  C  CE1 . PHE A  1 341  ? -17.289 25.212  15.073  1.00 143.35 ? 341  PHE A CE1 1 
ATOM   1061  C  CE2 . PHE A  1 341  ? -16.880 22.929  15.665  1.00 195.67 ? 341  PHE A CE2 1 
ATOM   1062  C  CZ  . PHE A  1 341  ? -17.677 23.887  15.064  1.00 167.75 ? 341  PHE A CZ  1 
ATOM   1063  N  N   . THR A  1 342  ? -11.557 26.438  17.037  1.00 217.38 ? 342  THR A N   1 
ATOM   1064  C  CA  . THR A  1 342  ? -10.507 27.200  17.709  1.00 232.90 ? 342  THR A CA  1 
ATOM   1065  C  C   . THR A  1 342  ? -10.835 28.690  17.580  1.00 205.10 ? 342  THR A C   1 
ATOM   1066  O  O   . THR A  1 342  ? -11.449 29.110  16.602  1.00 206.98 ? 342  THR A O   1 
ATOM   1067  C  CB  . THR A  1 342  ? -9.098  26.893  17.135  1.00 194.59 ? 342  THR A CB  1 
ATOM   1068  O  OG1 . THR A  1 342  ? -8.129  27.788  17.703  1.00 167.78 ? 342  THR A OG1 1 
ATOM   1069  C  CG2 . THR A  1 342  ? -9.089  27.023  15.621  1.00 148.47 ? 342  THR A CG2 1 
ATOM   1070  N  N   . PRO A  1 343  ? -10.444 29.490  18.580  1.00 192.54 ? 343  PRO A N   1 
ATOM   1071  C  CA  . PRO A  1 343  ? -10.784 30.915  18.640  1.00 236.81 ? 343  PRO A CA  1 
ATOM   1072  C  C   . PRO A  1 343  ? -10.636 31.646  17.314  1.00 240.43 ? 343  PRO A C   1 
ATOM   1073  O  O   . PRO A  1 343  ? -11.363 32.604  17.057  1.00 320.97 ? 343  PRO A O   1 
ATOM   1074  C  CB  . PRO A  1 343  ? -9.782  31.455  19.652  1.00 269.72 ? 343  PRO A CB  1 
ATOM   1075  C  CG  . PRO A  1 343  ? -9.574  30.319  20.587  1.00 275.67 ? 343  PRO A CG  1 
ATOM   1076  C  CD  . PRO A  1 343  ? -9.691  29.061  19.771  1.00 239.64 ? 343  PRO A CD  1 
ATOM   1077  N  N   . ASP A  1 344  ? -9.702  31.201  16.486  1.00 175.32 ? 344  ASP A N   1 
ATOM   1078  C  CA  . ASP A  1 344  ? -9.478  31.824  15.186  1.00 195.53 ? 344  ASP A CA  1 
ATOM   1079  C  C   . ASP A  1 344  ? -9.981  30.945  14.036  1.00 244.95 ? 344  ASP A C   1 
ATOM   1080  O  O   . ASP A  1 344  ? -9.212  30.578  13.149  1.00 250.14 ? 344  ASP A O   1 
ATOM   1081  C  CB  . ASP A  1 344  ? -7.993  32.148  15.005  1.00 187.71 ? 344  ASP A CB  1 
ATOM   1082  C  CG  . ASP A  1 344  ? -7.093  30.992  15.388  1.00 204.19 ? 344  ASP A CG  1 
ATOM   1083  O  OD1 . ASP A  1 344  ? -7.532  29.828  15.283  1.00 230.86 ? 344  ASP A OD1 1 
ATOM   1084  O  OD2 . ASP A  1 344  ? -5.943  31.250  15.797  1.00 174.46 ? 344  ASP A OD2 1 
ATOM   1085  N  N   . GLY A  1 345  ? -11.271 30.608  14.061  1.00 267.96 ? 345  GLY A N   1 
ATOM   1086  C  CA  . GLY A  1 345  ? -11.908 29.892  12.963  1.00 258.23 ? 345  GLY A CA  1 
ATOM   1087  C  C   . GLY A  1 345  ? -11.744 28.381  13.001  1.00 177.36 ? 345  GLY A C   1 
ATOM   1088  O  O   . GLY A  1 345  ? -10.742 27.888  13.508  1.00 182.56 ? 345  GLY A O   1 
ATOM   1089  N  N   . PRO A  1 346  ? -12.720 27.635  12.446  1.00 205.19 ? 346  PRO A N   1 
ATOM   1090  C  CA  . PRO A  1 346  ? -12.682 26.161  12.425  1.00 203.28 ? 346  PRO A CA  1 
ATOM   1091  C  C   . PRO A  1 346  ? -11.447 25.596  11.718  1.00 195.94 ? 346  PRO A C   1 
ATOM   1092  O  O   . PRO A  1 346  ? -10.634 26.353  11.186  1.00 170.59 ? 346  PRO A O   1 
ATOM   1093  C  CB  . PRO A  1 346  ? -13.963 25.777  11.666  1.00 98.84  ? 346  PRO A CB  1 
ATOM   1094  C  CG  . PRO A  1 346  ? -14.854 26.978  11.783  1.00 183.58 ? 346  PRO A CG  1 
ATOM   1095  C  CD  . PRO A  1 346  ? -13.934 28.162  11.801  1.00 228.22 ? 346  PRO A CD  1 
ATOM   1096  N  N   . VAL A  1 347  ? -11.313 24.274  11.721  1.00 116.50 ? 347  VAL A N   1 
ATOM   1097  C  CA  . VAL A  1 347  ? -10.154 23.623  11.125  1.00 157.89 ? 347  VAL A CA  1 
ATOM   1098  C  C   . VAL A  1 347  ? -10.510 22.207  10.683  1.00 212.52 ? 347  VAL A C   1 
ATOM   1099  O  O   . VAL A  1 347  ? -10.730 21.332  11.518  1.00 210.90 ? 347  VAL A O   1 
ATOM   1100  C  CB  . VAL A  1 347  ? -8.974  23.556  12.123  1.00 198.19 ? 347  VAL A CB  1 
ATOM   1101  C  CG1 . VAL A  1 347  ? -7.897  22.605  11.628  1.00 177.89 ? 347  VAL A CG1 1 
ATOM   1102  C  CG2 . VAL A  1 347  ? -8.393  24.939  12.363  1.00 217.68 ? 347  VAL A CG2 1 
ATOM   1103  N  N   . LEU A  1 348  ? -10.572 21.985  9.371   1.00 229.00 ? 348  LEU A N   1 
ATOM   1104  C  CA  . LEU A  1 348  ? -10.836 20.652  8.828   1.00 212.05 ? 348  LEU A CA  1 
ATOM   1105  C  C   . LEU A  1 348  ? -9.538  19.986  8.351   1.00 192.27 ? 348  LEU A C   1 
ATOM   1106  O  O   . LEU A  1 348  ? -8.560  20.678  8.034   1.00 93.34  ? 348  LEU A O   1 
ATOM   1107  C  CB  . LEU A  1 348  ? -11.849 20.733  7.686   1.00 148.81 ? 348  LEU A CB  1 
ATOM   1108  C  CG  . LEU A  1 348  ? -13.300 21.021  8.083   1.00 142.83 ? 348  LEU A CG  1 
ATOM   1109  C  CD1 . LEU A  1 348  ? -13.399 22.340  8.838   1.00 241.01 ? 348  LEU A CD1 1 
ATOM   1110  C  CD2 . LEU A  1 348  ? -14.205 21.040  6.866   1.00 110.85 ? 348  LEU A CD2 1 
ATOM   1111  N  N   . GLY A  1 349  ? -9.537  18.651  8.299   1.00 147.57 ? 349  GLY A N   1 
ATOM   1112  C  CA  . GLY A  1 349  ? -8.328  17.896  8.008   1.00 107.92 ? 349  GLY A CA  1 
ATOM   1113  C  C   . GLY A  1 349  ? -8.364  17.149  6.690   1.00 195.81 ? 349  GLY A C   1 
ATOM   1114  O  O   . GLY A  1 349  ? -9.311  16.414  6.411   1.00 209.68 ? 349  GLY A O   1 
ATOM   1115  N  N   . ALA A  1 350  ? -7.325  17.344  5.879   1.00 214.49 ? 350  ALA A N   1 
ATOM   1116  C  CA  . ALA A  1 350  ? -7.169  16.628  4.615   1.00 204.90 ? 350  ALA A CA  1 
ATOM   1117  C  C   . ALA A  1 350  ? -6.209  15.458  4.811   1.00 215.38 ? 350  ALA A C   1 
ATOM   1118  O  O   . ALA A  1 350  ? -5.302  15.534  5.639   1.00 207.41 ? 350  ALA A O   1 
ATOM   1119  C  CB  . ALA A  1 350  ? -6.646  17.565  3.533   1.00 210.18 ? 350  ALA A CB  1 
ATOM   1120  N  N   . VAL A  1 351  ? -6.406  14.384  4.047   1.00 222.93 ? 351  VAL A N   1 
ATOM   1121  C  CA  . VAL A  1 351  ? -5.608  13.165  4.199   1.00 221.83 ? 351  VAL A CA  1 
ATOM   1122  C  C   . VAL A  1 351  ? -4.763  12.871  2.957   1.00 252.06 ? 351  VAL A C   1 
ATOM   1123  O  O   . VAL A  1 351  ? -3.584  12.529  3.060   1.00 249.05 ? 351  VAL A O   1 
ATOM   1124  C  CB  . VAL A  1 351  ? -6.503  11.928  4.489   1.00 194.57 ? 351  VAL A CB  1 
ATOM   1125  C  CG1 . VAL A  1 351  ? -7.165  12.049  5.846   1.00 155.16 ? 351  VAL A CG1 1 
ATOM   1126  C  CG2 . VAL A  1 351  ? -7.551  11.761  3.409   1.00 245.38 ? 351  VAL A CG2 1 
ATOM   1127  N  N   . GLY A  1 352  ? -5.373  13.010  1.786   1.00 250.51 ? 352  GLY A N   1 
ATOM   1128  C  CA  . GLY A  1 352  ? -4.723  12.663  0.535   1.00 196.58 ? 352  GLY A CA  1 
ATOM   1129  C  C   . GLY A  1 352  ? -3.978  13.821  -0.096  1.00 195.82 ? 352  GLY A C   1 
ATOM   1130  O  O   . GLY A  1 352  ? -3.928  13.940  -1.319  1.00 231.22 ? 352  GLY A O   1 
ATOM   1131  N  N   . SER A  1 353  ? -3.395  14.675  0.737   1.00 221.47 ? 353  SER A N   1 
ATOM   1132  C  CA  . SER A  1 353  ? -2.628  15.811  0.246   1.00 264.80 ? 353  SER A CA  1 
ATOM   1133  C  C   . SER A  1 353  ? -1.308  15.351  -0.369  1.00 255.29 ? 353  SER A C   1 
ATOM   1134  O  O   . SER A  1 353  ? -0.375  14.969  0.339   1.00 225.89 ? 353  SER A O   1 
ATOM   1135  C  CB  . SER A  1 353  ? -2.353  16.807  1.375   1.00 272.55 ? 353  SER A CB  1 
ATOM   1136  O  OG  . SER A  1 353  ? -3.557  17.280  1.951   1.00 174.33 ? 353  SER A OG  1 
ATOM   1137  N  N   . PHE A  1 354  ? -1.242  15.389  -1.694  1.00 287.45 ? 354  PHE A N   1 
ATOM   1138  C  CA  . PHE A  1 354  ? -0.015  15.088  -2.417  1.00 332.05 ? 354  PHE A CA  1 
ATOM   1139  C  C   . PHE A  1 354  ? 0.253   13.587  -2.413  1.00 332.33 ? 354  PHE A C   1 
ATOM   1140  O  O   . PHE A  1 354  ? -0.491  12.819  -3.019  1.00 404.85 ? 354  PHE A O   1 
ATOM   1141  C  CB  . PHE A  1 354  ? 1.156   15.875  -1.824  1.00 328.37 ? 354  PHE A CB  1 
ATOM   1142  C  CG  . PHE A  1 354  ? 0.756   17.202  -1.242  1.00 295.42 ? 354  PHE A CG  1 
ATOM   1143  C  CD1 . PHE A  1 354  ? 0.153   18.168  -2.032  1.00 260.56 ? 354  PHE A CD1 1 
ATOM   1144  C  CD2 . PHE A  1 354  ? 0.981   17.483  0.096   1.00 276.16 ? 354  PHE A CD2 1 
ATOM   1145  C  CE1 . PHE A  1 354  ? -0.220  19.390  -1.495  1.00 174.74 ? 354  PHE A CE1 1 
ATOM   1146  C  CE2 . PHE A  1 354  ? 0.612   18.701  0.635   1.00 266.52 ? 354  PHE A CE2 1 
ATOM   1147  C  CZ  . PHE A  1 354  ? 0.012   19.655  -0.162  1.00 215.22 ? 354  PHE A CZ  1 
ATOM   1148  N  N   . THR A  1 355  ? 1.312   13.167  -1.735  1.00 242.26 ? 355  THR A N   1 
ATOM   1149  C  CA  . THR A  1 355  ? 1.598   11.752  -1.595  1.00 258.94 ? 355  THR A CA  1 
ATOM   1150  C  C   . THR A  1 355  ? 0.801   11.196  -0.428  1.00 282.10 ? 355  THR A C   1 
ATOM   1151  O  O   . THR A  1 355  ? 1.319   10.425  0.378   1.00 366.02 ? 355  THR A O   1 
ATOM   1152  C  CB  . THR A  1 355  ? 3.085   11.517  -1.328  1.00 294.35 ? 355  THR A CB  1 
ATOM   1153  O  OG1 . THR A  1 355  ? 3.445   12.101  -0.070  1.00 365.37 ? 355  THR A OG1 1 
ATOM   1154  C  CG2 . THR A  1 355  ? 3.918   12.140  -2.428  1.00 220.65 ? 355  THR A CG2 1 
ATOM   1155  N  N   . TRP A  1 356  ? -0.463  11.596  -0.339  1.00 202.14 ? 356  TRP A N   1 
ATOM   1156  C  CA  . TRP A  1 356  ? -1.300  11.237  0.797   1.00 211.72 ? 356  TRP A CA  1 
ATOM   1157  C  C   . TRP A  1 356  ? -0.587  11.581  2.095   1.00 209.81 ? 356  TRP A C   1 
ATOM   1158  O  O   . TRP A  1 356  ? -0.775  10.909  3.108   1.00 156.45 ? 356  TRP A O   1 
ATOM   1159  C  CB  . TRP A  1 356  ? -1.645  9.749   0.772   1.00 182.77 ? 356  TRP A CB  1 
ATOM   1160  C  CG  . TRP A  1 356  ? -2.547  9.370   -0.352  1.00 204.24 ? 356  TRP A CG  1 
ATOM   1161  C  CD1 . TRP A  1 356  ? -2.182  9.102   -1.636  1.00 221.54 ? 356  TRP A CD1 1 
ATOM   1162  C  CD2 . TRP A  1 356  ? -3.970  9.212   -0.296  1.00 219.69 ? 356  TRP A CD2 1 
ATOM   1163  N  NE1 . TRP A  1 356  ? -3.288  8.786   -2.387  1.00 241.95 ? 356  TRP A NE1 1 
ATOM   1164  C  CE2 . TRP A  1 356  ? -4.399  8.846   -1.589  1.00 227.33 ? 356  TRP A CE2 1 
ATOM   1165  C  CE3 . TRP A  1 356  ? -4.922  9.344   0.717   1.00 204.19 ? 356  TRP A CE3 1 
ATOM   1166  C  CZ2 . TRP A  1 356  ? -5.739  8.611   -1.895  1.00 207.73 ? 356  TRP A CZ2 1 
ATOM   1167  C  CZ3 . TRP A  1 356  ? -6.253  9.112   0.411   1.00 263.96 ? 356  TRP A CZ3 1 
ATOM   1168  C  CH2 . TRP A  1 356  ? -6.648  8.749   -0.886  1.00 250.96 ? 356  TRP A CH2 1 
ATOM   1169  N  N   . SER A  1 357  ? 0.243   12.621  2.050   1.00 218.81 ? 357  SER A N   1 
ATOM   1170  C  CA  . SER A  1 357  ? 0.930   13.118  3.237   1.00 194.36 ? 357  SER A CA  1 
ATOM   1171  C  C   . SER A  1 357  ? -0.087  13.565  4.279   1.00 251.48 ? 357  SER A C   1 
ATOM   1172  O  O   . SER A  1 357  ? -0.159  12.997  5.371   1.00 348.18 ? 357  SER A O   1 
ATOM   1173  C  CB  . SER A  1 357  ? 1.842   14.294  2.880   1.00 240.33 ? 357  SER A CB  1 
ATOM   1174  O  OG  . SER A  1 357  ? 2.488   14.810  4.034   1.00 301.24 ? 357  SER A OG  1 
ATOM   1175  N  N   . GLY A  1 358  ? -0.866  14.590  3.933   1.00 198.58 ? 358  GLY A N   1 
ATOM   1176  C  CA  . GLY A  1 358  ? -1.909  15.101  4.805   1.00 234.63 ? 358  GLY A CA  1 
ATOM   1177  C  C   . GLY A  1 358  ? -1.735  16.560  5.197   1.00 254.32 ? 358  GLY A C   1 
ATOM   1178  O  O   . GLY A  1 358  ? -0.779  17.230  4.795   1.00 195.77 ? 358  GLY A O   1 
ATOM   1179  N  N   . GLY A  1 359  ? -2.681  17.046  5.992   1.00 289.18 ? 359  GLY A N   1 
ATOM   1180  C  CA  . GLY A  1 359  ? -2.659  18.412  6.477   1.00 264.68 ? 359  GLY A CA  1 
ATOM   1181  C  C   . GLY A  1 359  ? -3.997  18.832  7.071   1.00 211.97 ? 359  GLY A C   1 
ATOM   1182  O  O   . GLY A  1 359  ? -4.818  17.990  7.447   1.00 156.46 ? 359  GLY A O   1 
ATOM   1183  N  N   . ALA A  1 360  ? -4.212  20.144  7.160   1.00 148.45 ? 360  ALA A N   1 
ATOM   1184  C  CA  . ALA A  1 360  ? -5.459  20.696  7.697   1.00 89.79  ? 360  ALA A CA  1 
ATOM   1185  C  C   . ALA A  1 360  ? -5.698  22.153  7.272   1.00 186.47 ? 360  ALA A C   1 
ATOM   1186  O  O   . ALA A  1 360  ? -4.859  23.026  7.514   1.00 112.91 ? 360  ALA A O   1 
ATOM   1187  C  CB  . ALA A  1 360  ? -5.445  20.614  9.182   1.00 213.63 ? 360  ALA A CB  1 
ATOM   1188  N  N   . PHE A  1 361  ? -6.857  22.407  6.661   1.00 275.28 ? 361  PHE A N   1 
ATOM   1189  C  CA  . PHE A  1 361  ? -7.215  23.741  6.175   1.00 262.84 ? 361  PHE A CA  1 
ATOM   1190  C  C   . PHE A  1 361  ? -7.853  24.570  7.274   1.00 197.25 ? 361  PHE A C   1 
ATOM   1191  O  O   . PHE A  1 361  ? -8.924  24.231  7.777   1.00 114.13 ? 361  PHE A O   1 
ATOM   1192  C  CB  . PHE A  1 361  ? -8.184  23.643  4.990   1.00 249.24 ? 361  PHE A CB  1 
ATOM   1193  C  CG  . PHE A  1 361  ? -7.541  23.164  3.721   1.00 213.09 ? 361  PHE A CG  1 
ATOM   1194  C  CD1 . PHE A  1 361  ? -7.090  24.072  2.780   1.00 213.57 ? 361  PHE A CD1 1 
ATOM   1195  C  CD2 . PHE A  1 361  ? -7.379  21.807  3.474   1.00 213.45 ? 361  PHE A CD2 1 
ATOM   1196  C  CE1 . PHE A  1 361  ? -6.494  23.639  1.613   1.00 298.47 ? 361  PHE A CE1 1 
ATOM   1197  C  CE2 . PHE A  1 361  ? -6.781  21.365  2.312   1.00 212.67 ? 361  PHE A CE2 1 
ATOM   1198  C  CZ  . PHE A  1 361  ? -6.338  22.282  1.378   1.00 296.93 ? 361  PHE A CZ  1 
ATOM   1199  N  N   . LEU A  1 362  ? -7.185  25.653  7.646   1.00 193.07 ? 362  LEU A N   1 
ATOM   1200  C  CA  . LEU A  1 362  ? -7.731  26.577  8.617   1.00 195.75 ? 362  LEU A CA  1 
ATOM   1201  C  C   . LEU A  1 362  ? -8.562  27.625  7.896   1.00 222.19 ? 362  LEU A C   1 
ATOM   1202  O  O   . LEU A  1 362  ? -8.143  28.154  6.868   1.00 295.36 ? 362  LEU A O   1 
ATOM   1203  C  CB  . LEU A  1 362  ? -6.606  27.253  9.391   1.00 192.06 ? 362  LEU A CB  1 
ATOM   1204  C  CG  . LEU A  1 362  ? -7.055  28.079  10.595  1.00 226.56 ? 362  LEU A CG  1 
ATOM   1205  C  CD1 . LEU A  1 362  ? -5.884  28.346  11.514  1.00 242.07 ? 362  LEU A CD1 1 
ATOM   1206  C  CD2 . LEU A  1 362  ? -7.702  29.386  10.166  1.00 217.17 ? 362  LEU A CD2 1 
ATOM   1207  N  N   . TYR A  1 363  ? -9.746  27.913  8.432   1.00 148.69 ? 363  TYR A N   1 
ATOM   1208  C  CA  . TYR A  1 363  ? -10.586 29.011  7.939   1.00 184.44 ? 363  TYR A CA  1 
ATOM   1209  C  C   . TYR A  1 363  ? -10.705 30.126  8.964   1.00 187.13 ? 363  TYR A C   1 
ATOM   1210  O  O   . TYR A  1 363  ? -11.227 29.906  10.049  1.00 235.11 ? 363  TYR A O   1 
ATOM   1211  C  CB  . TYR A  1 363  ? -12.001 28.528  7.600   1.00 142.29 ? 363  TYR A CB  1 
ATOM   1212  C  CG  . TYR A  1 363  ? -12.008 27.417  6.584   1.00 218.70 ? 363  TYR A CG  1 
ATOM   1213  C  CD1 . TYR A  1 363  ? -12.089 27.686  5.221   1.00 250.75 ? 363  TYR A CD1 1 
ATOM   1214  C  CD2 . TYR A  1 363  ? -11.897 26.100  6.988   1.00 185.68 ? 363  TYR A CD2 1 
ATOM   1215  C  CE1 . TYR A  1 363  ? -12.079 26.656  4.282   1.00 211.86 ? 363  TYR A CE1 1 
ATOM   1216  C  CE2 . TYR A  1 363  ? -11.884 25.071  6.082   1.00 221.50 ? 363  TYR A CE2 1 
ATOM   1217  C  CZ  . TYR A  1 363  ? -11.973 25.342  4.736   1.00 230.15 ? 363  TYR A CZ  1 
ATOM   1218  O  OH  . TYR A  1 363  ? -11.942 24.197  3.966   1.00 229.13 ? 363  TYR A OH  1 
ATOM   1219  N  N   . PRO A  1 364  ? -10.189 31.318  8.634   1.00 222.86 ? 364  PRO A N   1 
ATOM   1220  C  CA  . PRO A  1 364  ? -10.368 32.541  9.428   1.00 201.89 ? 364  PRO A CA  1 
ATOM   1221  C  C   . PRO A  1 364  ? -11.757 33.187  9.296   1.00 217.67 ? 364  PRO A C   1 
ATOM   1222  O  O   . PRO A  1 364  ? -12.671 32.572  8.733   1.00 176.97 ? 364  PRO A O   1 
ATOM   1223  C  CB  . PRO A  1 364  ? -9.290  33.475  8.870   1.00 238.23 ? 364  PRO A CB  1 
ATOM   1224  C  CG  . PRO A  1 364  ? -8.288  32.585  8.258   1.00 237.57 ? 364  PRO A CG  1 
ATOM   1225  C  CD  . PRO A  1 364  ? -9.065  31.446  7.695   1.00 271.38 ? 364  PRO A CD  1 
ATOM   1226  N  N   . PRO A  1 365  ? -11.913 34.417  9.826   1.00 218.42 ? 365  PRO A N   1 
ATOM   1227  C  CA  . PRO A  1 365  ? -13.193 35.139  9.813   1.00 261.40 ? 365  PRO A CA  1 
ATOM   1228  C  C   . PRO A  1 365  ? -13.527 35.764  8.458   1.00 288.23 ? 365  PRO A C   1 
ATOM   1229  O  O   . PRO A  1 365  ? -13.362 36.970  8.273   1.00 281.79 ? 365  PRO A O   1 
ATOM   1230  C  CB  . PRO A  1 365  ? -12.977 36.233  10.859  1.00 289.73 ? 365  PRO A CB  1 
ATOM   1231  C  CG  . PRO A  1 365  ? -11.516 36.477  10.849  1.00 262.56 ? 365  PRO A CG  1 
ATOM   1232  C  CD  . PRO A  1 365  ? -10.867 35.170  10.545  1.00 211.71 ? 365  PRO A CD  1 
ATOM   1233  N  N   . ASN A  1 366  ? -13.991 34.943  7.523   1.00 296.22 ? 366  ASN A N   1 
ATOM   1234  C  CA  . ASN A  1 366  ? -14.352 35.420  6.197   1.00 283.77 ? 366  ASN A CA  1 
ATOM   1235  C  C   . ASN A  1 366  ? -13.117 35.774  5.366   1.00 301.68 ? 366  ASN A C   1 
ATOM   1236  O  O   . ASN A  1 366  ? -13.217 36.002  4.163   1.00 345.62 ? 366  ASN A O   1 
ATOM   1237  C  CB  . ASN A  1 366  ? -15.292 36.620  6.307   1.00 264.59 ? 366  ASN A CB  1 
ATOM   1238  C  CG  . ASN A  1 366  ? -16.408 36.576  5.291   1.00 298.19 ? 366  ASN A CG  1 
ATOM   1239  O  OD1 . ASN A  1 366  ? -16.182 36.283  4.119   1.00 333.64 ? 366  ASN A OD1 1 
ATOM   1240  N  ND2 . ASN A  1 366  ? -17.625 36.859  5.736   1.00 302.88 ? 366  ASN A ND2 1 
ATOM   1241  N  N   . MET A  1 367  ? -11.957 35.828  6.015   1.00 276.11 ? 367  MET A N   1 
ATOM   1242  C  CA  . MET A  1 367  ? -10.685 35.940  5.312   1.00 219.42 ? 367  MET A CA  1 
ATOM   1243  C  C   . MET A  1 367  ? -10.380 34.616  4.628   1.00 253.98 ? 367  MET A C   1 
ATOM   1244  O  O   . MET A  1 367  ? -10.762 33.555  5.117   1.00 330.08 ? 367  MET A O   1 
ATOM   1245  C  CB  . MET A  1 367  ? -9.558  36.282  6.291   1.00 196.64 ? 367  MET A CB  1 
ATOM   1246  C  CG  . MET A  1 367  ? -8.172  35.877  5.807   1.00 187.12 ? 367  MET A CG  1 
ATOM   1247  S  SD  . MET A  1 367  ? -6.970  35.759  7.139   1.00 297.66 ? 367  MET A SD  1 
ATOM   1248  C  CE  . MET A  1 367  ? -6.724  37.483  7.547   1.00 143.79 ? 367  MET A CE  1 
ATOM   1249  N  N   . SER A  1 368  ? -9.685  34.681  3.500   1.00 241.03 ? 368  SER A N   1 
ATOM   1250  C  CA  . SER A  1 368  ? -9.316  33.481  2.766   1.00 246.45 ? 368  SER A CA  1 
ATOM   1251  C  C   . SER A  1 368  ? -8.527  32.548  3.669   1.00 198.42 ? 368  SER A C   1 
ATOM   1252  O  O   . SER A  1 368  ? -7.635  32.990  4.390   1.00 194.65 ? 368  SER A O   1 
ATOM   1253  C  CB  . SER A  1 368  ? -8.487  33.843  1.537   1.00 292.93 ? 368  SER A CB  1 
ATOM   1254  O  OG  . SER A  1 368  ? -7.333  34.578  1.902   1.00 316.57 ? 368  SER A OG  1 
ATOM   1255  N  N   . PRO A  1 369  ? -8.845  31.247  3.620   1.00 198.74 ? 369  PRO A N   1 
ATOM   1256  C  CA  . PRO A  1 369  ? -8.262  30.241  4.515   1.00 234.13 ? 369  PRO A CA  1 
ATOM   1257  C  C   . PRO A  1 369  ? -6.795  29.928  4.232   1.00 236.27 ? 369  PRO A C   1 
ATOM   1258  O  O   . PRO A  1 369  ? -6.310  30.213  3.143   1.00 205.17 ? 369  PRO A O   1 
ATOM   1259  C  CB  . PRO A  1 369  ? -9.123  29.005  4.247   1.00 165.85 ? 369  PRO A CB  1 
ATOM   1260  C  CG  . PRO A  1 369  ? -9.598  29.167  2.871   1.00 157.33 ? 369  PRO A CG  1 
ATOM   1261  C  CD  . PRO A  1 369  ? -9.756  30.640  2.635   1.00 184.24 ? 369  PRO A CD  1 
ATOM   1262  N  N   . THR A  1 370  ? -6.102  29.367  5.220   1.00 235.68 ? 370  THR A N   1 
ATOM   1263  C  CA  . THR A  1 370  ? -4.735  28.895  5.037   1.00 201.33 ? 370  THR A CA  1 
ATOM   1264  C  C   . THR A  1 370  ? -4.706  27.372  5.057   1.00 188.67 ? 370  THR A C   1 
ATOM   1265  O  O   . THR A  1 370  ? -5.753  26.724  5.012   1.00 196.42 ? 370  THR A O   1 
ATOM   1266  C  CB  . THR A  1 370  ? -3.810  29.392  6.150   1.00 210.21 ? 370  THR A CB  1 
ATOM   1267  O  OG1 . THR A  1 370  ? -4.149  28.732  7.376   1.00 261.55 ? 370  THR A OG1 1 
ATOM   1268  C  CG2 . THR A  1 370  ? -3.936  30.892  6.325   1.00 204.56 ? 370  THR A CG2 1 
ATOM   1269  N  N   . PHE A  1 371  ? -3.503  26.809  5.140   1.00 153.33 ? 371  PHE A N   1 
ATOM   1270  C  CA  . PHE A  1 371  ? -3.316  25.359  5.099   1.00 192.69 ? 371  PHE A CA  1 
ATOM   1271  C  C   . PHE A  1 371  ? -1.921  24.984  5.573   1.00 196.17 ? 371  PHE A C   1 
ATOM   1272  O  O   . PHE A  1 371  ? -0.950  25.694  5.306   1.00 192.13 ? 371  PHE A O   1 
ATOM   1273  C  CB  . PHE A  1 371  ? -3.535  24.825  3.678   1.00 213.87 ? 371  PHE A CB  1 
ATOM   1274  C  CG  . PHE A  1 371  ? -3.257  23.340  3.520   1.00 146.74 ? 371  PHE A CG  1 
ATOM   1275  C  CD1 . PHE A  1 371  ? -4.196  22.401  3.911   1.00 197.22 ? 371  PHE A CD1 1 
ATOM   1276  C  CD2 . PHE A  1 371  ? -2.074  22.885  2.952   1.00 217.05 ? 371  PHE A CD2 1 
ATOM   1277  C  CE1 . PHE A  1 371  ? -3.953  21.030  3.760   1.00 238.30 ? 371  PHE A CE1 1 
ATOM   1278  C  CE2 . PHE A  1 371  ? -1.829  21.513  2.797   1.00 170.07 ? 371  PHE A CE2 1 
ATOM   1279  C  CZ  . PHE A  1 371  ? -2.770  20.591  3.202   1.00 151.00 ? 371  PHE A CZ  1 
ATOM   1280  N  N   . ILE A  1 372  ? -1.829  23.858  6.272   1.00 213.31 ? 372  ILE A N   1 
ATOM   1281  C  CA  . ILE A  1 372  ? -0.559  23.393  6.816   1.00 208.57 ? 372  ILE A CA  1 
ATOM   1282  C  C   . ILE A  1 372  ? -0.268  21.919  6.495   1.00 216.25 ? 372  ILE A C   1 
ATOM   1283  O  O   . ILE A  1 372  ? -0.831  21.011  7.112   1.00 117.77 ? 372  ILE A O   1 
ATOM   1284  C  CB  . ILE A  1 372  ? -0.519  23.566  8.349   1.00 191.94 ? 372  ILE A CB  1 
ATOM   1285  C  CG1 . ILE A  1 372  ? -1.794  23.006  8.981   1.00 185.19 ? 372  ILE A CG1 1 
ATOM   1286  C  CG2 . ILE A  1 372  ? -0.362  25.032  8.725   1.00 183.09 ? 372  ILE A CG2 1 
ATOM   1287  C  CD1 . ILE A  1 372  ? -1.722  22.885  10.485  1.00 258.53 ? 372  ILE A CD1 1 
ATOM   1288  N  N   . ASN A  1 373  ? 0.593   21.685  5.509   1.00 273.63 ? 373  ASN A N   1 
ATOM   1289  C  CA  . ASN A  1 373  ? 1.176   20.362  5.309   1.00 259.01 ? 373  ASN A CA  1 
ATOM   1290  C  C   . ASN A  1 373  ? 2.531   20.304  6.008   1.00 204.93 ? 373  ASN A C   1 
ATOM   1291  O  O   . ASN A  1 373  ? 2.778   21.059  6.946   1.00 121.68 ? 373  ASN A O   1 
ATOM   1292  C  CB  . ASN A  1 373  ? 1.301   20.026  3.816   1.00 266.43 ? 373  ASN A CB  1 
ATOM   1293  C  CG  . ASN A  1 373  ? 2.108   21.054  3.040   1.00 318.95 ? 373  ASN A CG  1 
ATOM   1294  O  OD1 . ASN A  1 373  ? 3.120   21.557  3.521   1.00 371.84 ? 373  ASN A OD1 1 
ATOM   1295  N  ND2 . ASN A  1 373  ? 1.644   21.390  1.837   1.00 301.75 ? 373  ASN A ND2 1 
ATOM   1296  N  N   . MET A  1 374  ? 3.409   19.421  5.553   1.00 211.87 ? 374  MET A N   1 
ATOM   1297  C  CA  . MET A  1 374  ? 4.717   19.266  6.169   1.00 253.71 ? 374  MET A CA  1 
ATOM   1298  C  C   . MET A  1 374  ? 5.841   19.642  5.213   1.00 267.86 ? 374  MET A C   1 
ATOM   1299  O  O   . MET A  1 374  ? 6.964   19.161  5.346   1.00 178.20 ? 374  MET A O   1 
ATOM   1300  C  CB  . MET A  1 374  ? 4.894   17.817  6.596   1.00 286.70 ? 374  MET A CB  1 
ATOM   1301  C  CG  . MET A  1 374  ? 4.063   17.432  7.809   1.00 278.22 ? 374  MET A CG  1 
ATOM   1302  S  SD  . MET A  1 374  ? 4.750   18.059  9.356   1.00 513.36 ? 374  MET A SD  1 
ATOM   1303  C  CE  . MET A  1 374  ? 6.092   16.907  9.664   1.00 387.75 ? 374  MET A CE  1 
ATOM   1304  N  N   . SER A  1 375  ? 5.529   20.522  4.270   1.00 326.51 ? 375  SER A N   1 
ATOM   1305  C  CA  . SER A  1 375  ? 6.414   20.848  3.158   1.00 305.32 ? 375  SER A CA  1 
ATOM   1306  C  C   . SER A  1 375  ? 6.722   19.594  2.352   1.00 275.19 ? 375  SER A C   1 
ATOM   1307  O  O   . SER A  1 375  ? 6.220   18.509  2.654   1.00 284.78 ? 375  SER A O   1 
ATOM   1308  C  CB  . SER A  1 375  ? 7.709   21.506  3.650   1.00 283.57 ? 375  SER A CB  1 
ATOM   1309  O  OG  . SER A  1 375  ? 8.608   20.564  4.207   1.00 266.65 ? 375  SER A OG  1 
ATOM   1310  N  N   . GLN A  1 376  ? 7.538   19.747  1.317   1.00 231.52 ? 376  GLN A N   1 
ATOM   1311  C  CA  . GLN A  1 376  ? 7.962   18.608  0.522   1.00 268.23 ? 376  GLN A CA  1 
ATOM   1312  C  C   . GLN A  1 376  ? 9.361   18.203  0.958   1.00 260.44 ? 376  GLN A C   1 
ATOM   1313  O  O   . GLN A  1 376  ? 9.716   17.027  0.905   1.00 175.18 ? 376  GLN A O   1 
ATOM   1314  C  CB  . GLN A  1 376  ? 7.924   18.940  -0.971  1.00 335.49 ? 376  GLN A CB  1 
ATOM   1315  C  CG  . GLN A  1 376  ? 8.070   17.731  -1.880  1.00 358.67 ? 376  GLN A CG  1 
ATOM   1316  C  CD  . GLN A  1 376  ? 8.115   18.106  -3.350  1.00 314.26 ? 376  GLN A CD  1 
ATOM   1317  O  OE1 . GLN A  1 376  ? 7.960   19.272  -3.711  1.00 305.15 ? 376  GLN A OE1 1 
ATOM   1318  N  NE2 . GLN A  1 376  ? 8.327   17.114  -4.208  1.00 273.17 ? 376  GLN A NE2 1 
ATOM   1319  N  N   . GLU A  1 377  ? 10.144  19.176  1.417   1.00 295.43 ? 377  GLU A N   1 
ATOM   1320  C  CA  . GLU A  1 377  ? 11.476  18.897  1.939   1.00 283.87 ? 377  GLU A CA  1 
ATOM   1321  C  C   . GLU A  1 377  ? 11.409  17.778  2.974   1.00 265.42 ? 377  GLU A C   1 
ATOM   1322  O  O   . GLU A  1 377  ? 12.418  17.147  3.285   1.00 248.88 ? 377  GLU A O   1 
ATOM   1323  C  CB  . GLU A  1 377  ? 12.100  20.158  2.543   1.00 288.05 ? 377  GLU A CB  1 
ATOM   1324  C  CG  . GLU A  1 377  ? 12.569  21.164  1.504   1.00 324.60 ? 377  GLU A CG  1 
ATOM   1325  C  CD  . GLU A  1 377  ? 13.287  22.343  2.121   1.00 336.72 ? 377  GLU A CD  1 
ATOM   1326  O  OE1 . GLU A  1 377  ? 13.322  22.431  3.365   1.00 308.37 ? 377  GLU A OE1 1 
ATOM   1327  O  OE2 . GLU A  1 377  ? 13.819  23.181  1.363   1.00 362.46 ? 377  GLU A OE2 1 
ATOM   1328  N  N   . ASN A  1 378  ? 10.215  17.536  3.506   1.00 296.31 ? 378  ASN A N   1 
ATOM   1329  C  CA  . ASN A  1 378  ? 9.990   16.396  4.384   1.00 302.08 ? 378  ASN A CA  1 
ATOM   1330  C  C   . ASN A  1 378  ? 9.746   15.140  3.562   1.00 304.55 ? 378  ASN A C   1 
ATOM   1331  O  O   . ASN A  1 378  ? 8.602   14.793  3.267   1.00 312.43 ? 378  ASN A O   1 
ATOM   1332  C  CB  . ASN A  1 378  ? 8.795   16.640  5.295   1.00 266.72 ? 378  ASN A CB  1 
ATOM   1333  C  CG  . ASN A  1 378  ? 8.679   15.599  6.378   1.00 304.30 ? 378  ASN A CG  1 
ATOM   1334  O  OD1 . ASN A  1 378  ? 9.682   15.057  6.845   1.00 302.19 ? 378  ASN A OD1 1 
ATOM   1335  N  ND2 . ASN A  1 378  ? 7.455   15.309  6.787   1.00 393.10 ? 378  ASN A ND2 1 
ATOM   1336  N  N   . VAL A  1 379  ? 10.829  14.459  3.203   1.00 274.00 ? 379  VAL A N   1 
ATOM   1337  C  CA  . VAL A  1 379  ? 10.760  13.316  2.301   1.00 285.90 ? 379  VAL A CA  1 
ATOM   1338  C  C   . VAL A  1 379  ? 9.754   12.255  2.759   1.00 279.23 ? 379  VAL A C   1 
ATOM   1339  O  O   . VAL A  1 379  ? 8.995   11.719  1.948   1.00 229.43 ? 379  VAL A O   1 
ATOM   1340  C  CB  . VAL A  1 379  ? 12.150  12.661  2.124   1.00 366.82 ? 379  VAL A CB  1 
ATOM   1341  C  CG1 . VAL A  1 379  ? 13.136  13.656  1.522   1.00 405.80 ? 379  VAL A CG1 1 
ATOM   1342  C  CG2 . VAL A  1 379  ? 12.668  12.126  3.449   1.00 386.26 ? 379  VAL A CG2 1 
ATOM   1343  N  N   . ASP A  1 380  ? 9.744   11.965  4.057   1.00 290.83 ? 380  ASP A N   1 
ATOM   1344  C  CA  . ASP A  1 380  ? 8.917   10.890  4.596   1.00 234.20 ? 380  ASP A CA  1 
ATOM   1345  C  C   . ASP A  1 380  ? 7.453   11.299  4.676   1.00 190.12 ? 380  ASP A C   1 
ATOM   1346  O  O   . ASP A  1 380  ? 7.033   12.272  4.058   1.00 178.13 ? 380  ASP A O   1 
ATOM   1347  C  CB  . ASP A  1 380  ? 9.419   10.499  5.983   1.00 192.34 ? 380  ASP A CB  1 
ATOM   1348  C  CG  . ASP A  1 380  ? 9.361   11.646  6.958   1.00 225.49 ? 380  ASP A CG  1 
ATOM   1349  O  OD1 . ASP A  1 380  ? 8.723   12.667  6.629   1.00 266.34 ? 380  ASP A OD1 1 
ATOM   1350  O  OD2 . ASP A  1 380  ? 9.960   11.535  8.044   1.00 191.23 ? 380  ASP A OD2 1 
ATOM   1351  N  N   . MET A  1 381  ? 6.678   10.541  5.440   1.00 212.64 ? 381  MET A N   1 
ATOM   1352  C  CA  . MET A  1 381  ? 5.277   10.864  5.677   1.00 240.38 ? 381  MET A CA  1 
ATOM   1353  C  C   . MET A  1 381  ? 4.402   10.483  4.505   1.00 182.35 ? 381  MET A C   1 
ATOM   1354  O  O   . MET A  1 381  ? 3.293   10.988  4.365   1.00 184.34 ? 381  MET A O   1 
ATOM   1355  C  CB  . MET A  1 381  ? 5.102   12.358  5.983   1.00 258.78 ? 381  MET A CB  1 
ATOM   1356  C  CG  . MET A  1 381  ? 3.731   12.705  6.581   1.00 231.97 ? 381  MET A CG  1 
ATOM   1357  S  SD  . MET A  1 381  ? 3.743   14.052  7.785   1.00 406.07 ? 381  MET A SD  1 
ATOM   1358  C  CE  . MET A  1 381  ? 4.843   13.374  9.038   1.00 242.04 ? 381  MET A CE  1 
ATOM   1359  N  N   . ARG A  1 382  ? 4.895   9.587   3.663   1.00 190.14 ? 382  ARG A N   1 
ATOM   1360  C  CA  . ARG A  1 382  ? 4.107   9.117   2.538   1.00 254.07 ? 382  ARG A CA  1 
ATOM   1361  C  C   . ARG A  1 382  ? 3.074   8.126   3.046   1.00 239.33 ? 382  ARG A C   1 
ATOM   1362  O  O   . ARG A  1 382  ? 3.417   7.145   3.702   1.00 292.95 ? 382  ARG A O   1 
ATOM   1363  C  CB  . ARG A  1 382  ? 5.000   8.460   1.487   1.00 294.39 ? 382  ARG A CB  1 
ATOM   1364  C  CG  . ARG A  1 382  ? 5.926   9.422   0.762   1.00 282.33 ? 382  ARG A CG  1 
ATOM   1365  C  CD  . ARG A  1 382  ? 6.768   8.686   -0.257  1.00 287.43 ? 382  ARG A CD  1 
ATOM   1366  N  NE  . ARG A  1 382  ? 7.596   9.587   -1.048  1.00 284.57 ? 382  ARG A NE  1 
ATOM   1367  C  CZ  . ARG A  1 382  ? 8.440   9.185   -1.993  1.00 311.79 ? 382  ARG A CZ  1 
ATOM   1368  N  NH1 . ARG A  1 382  ? 8.573   7.895   -2.269  1.00 323.19 ? 382  ARG A NH1 1 
ATOM   1369  N  NH2 . ARG A  1 382  ? 9.155   10.074  -2.666  1.00 333.77 ? 382  ARG A NH2 1 
ATOM   1370  N  N   . ASP A  1 383  ? 1.807   8.397   2.756   1.00 177.13 ? 383  ASP A N   1 
ATOM   1371  C  CA  . ASP A  1 383  ? 0.729   7.509   3.155   1.00 214.24 ? 383  ASP A CA  1 
ATOM   1372  C  C   . ASP A  1 383  ? 0.698   7.365   4.665   1.00 263.74 ? 383  ASP A C   1 
ATOM   1373  O  O   . ASP A  1 383  ? 1.012   6.305   5.200   1.00 294.67 ? 383  ASP A O   1 
ATOM   1374  C  CB  . ASP A  1 383  ? 0.911   6.136   2.515   1.00 224.92 ? 383  ASP A CB  1 
ATOM   1375  C  CG  . ASP A  1 383  ? 0.996   6.207   1.008   1.00 323.35 ? 383  ASP A CG  1 
ATOM   1376  O  OD1 . ASP A  1 383  ? 0.163   6.911   0.399   1.00 366.37 ? 383  ASP A OD1 1 
ATOM   1377  O  OD2 . ASP A  1 383  ? 1.893   5.558   0.432   1.00 363.67 ? 383  ASP A OD2 1 
ATOM   1378  N  N   . SER A  1 384  ? 0.322   8.439   5.348   1.00 259.76 ? 384  SER A N   1 
ATOM   1379  C  CA  . SER A  1 384  ? 0.216   8.418   6.801   1.00 229.93 ? 384  SER A CA  1 
ATOM   1380  C  C   . SER A  1 384  ? -1.127  8.972   7.262   1.00 217.41 ? 384  SER A C   1 
ATOM   1381  O  O   . SER A  1 384  ? -1.448  8.914   8.446   1.00 271.16 ? 384  SER A O   1 
ATOM   1382  C  CB  . SER A  1 384  ? 1.360   9.215   7.442   1.00 175.25 ? 384  SER A CB  1 
ATOM   1383  O  OG  . SER A  1 384  ? 1.292   10.590  7.110   1.00 118.62 ? 384  SER A OG  1 
ATOM   1384  N  N   . TYR A  1 385  ? -1.910  9.504   6.326   1.00 167.72 ? 385  TYR A N   1 
ATOM   1385  C  CA  . TYR A  1 385  ? -3.198  10.121  6.642   1.00 177.61 ? 385  TYR A CA  1 
ATOM   1386  C  C   . TYR A  1 385  ? -3.066  11.211  7.699   1.00 212.03 ? 385  TYR A C   1 
ATOM   1387  O  O   . TYR A  1 385  ? -3.928  11.333  8.571   1.00 196.91 ? 385  TYR A O   1 
ATOM   1388  C  CB  . TYR A  1 385  ? -4.201  9.078   7.133   1.00 219.13 ? 385  TYR A CB  1 
ATOM   1389  C  CG  . TYR A  1 385  ? -4.481  7.982   6.145   1.00 203.07 ? 385  TYR A CG  1 
ATOM   1390  C  CD1 . TYR A  1 385  ? -4.992  8.271   4.891   1.00 206.16 ? 385  TYR A CD1 1 
ATOM   1391  C  CD2 . TYR A  1 385  ? -4.253  6.653   6.475   1.00 198.51 ? 385  TYR A CD2 1 
ATOM   1392  C  CE1 . TYR A  1 385  ? -5.255  7.273   3.989   1.00 225.54 ? 385  TYR A CE1 1 
ATOM   1393  C  CE2 . TYR A  1 385  ? -4.516  5.645   5.583   1.00 199.39 ? 385  TYR A CE2 1 
ATOM   1394  C  CZ  . TYR A  1 385  ? -5.016  5.958   4.339   1.00 275.61 ? 385  TYR A CZ  1 
ATOM   1395  O  OH  . TYR A  1 385  ? -5.278  4.948   3.440   1.00 394.31 ? 385  TYR A OH  1 
ATOM   1396  N  N   . LEU A  1 386  ? -1.990  11.993  7.627   1.00 252.14 ? 386  LEU A N   1 
ATOM   1397  C  CA  . LEU A  1 386  ? -1.789  13.105  8.554   1.00 239.40 ? 386  LEU A CA  1 
ATOM   1398  C  C   . LEU A  1 386  ? -3.054  13.973  8.584   1.00 231.51 ? 386  LEU A C   1 
ATOM   1399  O  O   . LEU A  1 386  ? -3.368  14.661  7.614   1.00 258.44 ? 386  LEU A O   1 
ATOM   1400  C  CB  . LEU A  1 386  ? -0.563  13.941  8.151   1.00 219.54 ? 386  LEU A CB  1 
ATOM   1401  C  CG  . LEU A  1 386  ? -0.304  15.207  8.971   1.00 270.26 ? 386  LEU A CG  1 
ATOM   1402  C  CD1 . LEU A  1 386  ? 0.137   14.849  10.375  1.00 306.43 ? 386  LEU A CD1 1 
ATOM   1403  C  CD2 . LEU A  1 386  ? 0.724   16.102  8.300   1.00 316.64 ? 386  LEU A CD2 1 
ATOM   1404  N  N   . GLY A  1 387  ? -3.783  13.927  9.696   1.00 215.81 ? 387  GLY A N   1 
ATOM   1405  C  CA  . GLY A  1 387  ? -5.033  14.657  9.824   1.00 167.95 ? 387  GLY A CA  1 
ATOM   1406  C  C   . GLY A  1 387  ? -6.220  13.721  9.891   1.00 169.51 ? 387  GLY A C   1 
ATOM   1407  O  O   . GLY A  1 387  ? -7.367  14.148  9.764   1.00 196.83 ? 387  GLY A O   1 
ATOM   1408  N  N   . TYR A  1 388  ? -5.938  12.437  10.092  1.00 178.97 ? 388  TYR A N   1 
ATOM   1409  C  CA  . TYR A  1 388  ? -6.976  11.445  10.309  1.00 186.42 ? 388  TYR A CA  1 
ATOM   1410  C  C   . TYR A  1 388  ? -7.816  11.882  11.517  1.00 237.24 ? 388  TYR A C   1 
ATOM   1411  O  O   . TYR A  1 388  ? -9.044  11.801  11.498  1.00 253.06 ? 388  TYR A O   1 
ATOM   1412  C  CB  . TYR A  1 388  ? -6.353  10.056  10.538  1.00 150.32 ? 388  TYR A CB  1 
ATOM   1413  C  CG  . TYR A  1 388  ? -7.374  8.945   10.602  1.00 140.25 ? 388  TYR A CG  1 
ATOM   1414  C  CD1 . TYR A  1 388  ? -8.082  8.691   11.771  1.00 236.28 ? 388  TYR A CD1 1 
ATOM   1415  C  CD2 . TYR A  1 388  ? -7.653  8.168   9.493   1.00 162.54 ? 388  TYR A CD2 1 
ATOM   1416  C  CE1 . TYR A  1 388  ? -9.037  7.681   11.828  1.00 244.69 ? 388  TYR A CE1 1 
ATOM   1417  C  CE2 . TYR A  1 388  ? -8.604  7.161   9.540   1.00 194.09 ? 388  TYR A CE2 1 
ATOM   1418  C  CZ  . TYR A  1 388  ? -9.291  6.919   10.702  1.00 182.24 ? 388  TYR A CZ  1 
ATOM   1419  O  OH  . TYR A  1 388  ? -10.235 5.913   10.717  1.00 130.25 ? 388  TYR A OH  1 
ATOM   1420  N  N   . SER A  1 389  ? -7.141  12.357  12.561  1.00 221.70 ? 389  SER A N   1 
ATOM   1421  C  CA  . SER A  1 389  ? -7.803  12.910  13.737  1.00 162.09 ? 389  SER A CA  1 
ATOM   1422  C  C   . SER A  1 389  ? -7.193  14.272  14.042  1.00 181.98 ? 389  SER A C   1 
ATOM   1423  O  O   . SER A  1 389  ? -5.996  14.477  13.851  1.00 119.28 ? 389  SER A O   1 
ATOM   1424  C  CB  . SER A  1 389  ? -7.633  11.975  14.933  1.00 200.88 ? 389  SER A CB  1 
ATOM   1425  O  OG  . SER A  1 389  ? -6.263  11.722  15.191  1.00 245.63 ? 389  SER A OG  1 
ATOM   1426  N  N   . THR A  1 390  ? -8.011  15.206  14.508  1.00 219.68 ? 390  THR A N   1 
ATOM   1427  C  CA  . THR A  1 390  ? -7.530  16.553  14.790  1.00 205.84 ? 390  THR A CA  1 
ATOM   1428  C  C   . THR A  1 390  ? -8.061  17.070  16.126  1.00 216.91 ? 390  THR A C   1 
ATOM   1429  O  O   . THR A  1 390  ? -9.187  16.761  16.520  1.00 238.81 ? 390  THR A O   1 
ATOM   1430  C  CB  . THR A  1 390  ? -7.954  17.521  13.685  1.00 213.07 ? 390  THR A CB  1 
ATOM   1431  O  OG1 . THR A  1 390  ? -9.383  17.509  13.566  1.00 215.38 ? 390  THR A OG1 1 
ATOM   1432  C  CG2 . THR A  1 390  ? -7.339  17.109  12.362  1.00 211.51 ? 390  THR A CG2 1 
ATOM   1433  N  N   . GLU A  1 391  ? -7.248  17.864  16.817  1.00 199.75 ? 391  GLU A N   1 
ATOM   1434  C  CA  . GLU A  1 391  ? -7.638  18.388  18.118  1.00 216.78 ? 391  GLU A CA  1 
ATOM   1435  C  C   . GLU A  1 391  ? -6.928  19.703  18.424  1.00 196.17 ? 391  GLU A C   1 
ATOM   1436  O  O   . GLU A  1 391  ? -5.838  19.965  17.913  1.00 271.59 ? 391  GLU A O   1 
ATOM   1437  C  CB  . GLU A  1 391  ? -7.329  17.357  19.202  1.00 246.25 ? 391  GLU A CB  1 
ATOM   1438  C  CG  . GLU A  1 391  ? -7.852  17.725  20.579  1.00 226.97 ? 391  GLU A CG  1 
ATOM   1439  C  CD  . GLU A  1 391  ? -9.369  17.806  20.636  1.00 192.50 ? 391  GLU A CD  1 
ATOM   1440  O  OE1 . GLU A  1 391  ? -10.037 17.255  19.737  1.00 261.38 ? 391  GLU A OE1 1 
ATOM   1441  O  OE2 . GLU A  1 391  ? -9.894  18.417  21.589  1.00 221.21 ? 391  GLU A OE2 1 
ATOM   1442  N  N   . LEU A  1 392  ? -7.561  20.527  19.256  1.00 188.33 ? 392  LEU A N   1 
ATOM   1443  C  CA  . LEU A  1 392  ? -6.998  21.814  19.655  1.00 186.20 ? 392  LEU A CA  1 
ATOM   1444  C  C   . LEU A  1 392  ? -6.013  21.634  20.809  1.00 191.99 ? 392  LEU A C   1 
ATOM   1445  O  O   . LEU A  1 392  ? -5.902  20.545  21.368  1.00 210.93 ? 392  LEU A O   1 
ATOM   1446  C  CB  . LEU A  1 392  ? -8.120  22.775  20.062  1.00 137.26 ? 392  LEU A CB  1 
ATOM   1447  C  CG  . LEU A  1 392  ? -7.697  24.207  20.408  1.00 165.87 ? 392  LEU A CG  1 
ATOM   1448  C  CD1 . LEU A  1 392  ? -6.922  24.859  19.268  1.00 158.18 ? 392  LEU A CD1 1 
ATOM   1449  C  CD2 . LEU A  1 392  ? -8.913  25.044  20.780  1.00 257.57 ? 392  LEU A CD2 1 
ATOM   1450  N  N   . ALA A  1 393  ? -5.288  22.695  21.156  1.00 188.73 ? 393  ALA A N   1 
ATOM   1451  C  CA  . ALA A  1 393  ? -4.373  22.660  22.297  1.00 215.22 ? 393  ALA A CA  1 
ATOM   1452  C  C   . ALA A  1 393  ? -4.138  24.058  22.849  1.00 206.63 ? 393  ALA A C   1 
ATOM   1453  O  O   . ALA A  1 393  ? -2.995  24.475  23.061  1.00 122.40 ? 393  ALA A O   1 
ATOM   1454  C  CB  . ALA A  1 393  ? -3.061  22.026  21.903  1.00 242.81 ? 393  ALA A CB  1 
ATOM   1455  N  N   . LEU A  1 394  ? -5.236  24.765  23.099  1.00 260.21 ? 394  LEU A N   1 
ATOM   1456  C  CA  . LEU A  1 394  ? -5.185  26.140  23.575  1.00 224.30 ? 394  LEU A CA  1 
ATOM   1457  C  C   . LEU A  1 394  ? -4.188  26.274  24.696  1.00 221.86 ? 394  LEU A C   1 
ATOM   1458  O  O   . LEU A  1 394  ? -3.872  25.311  25.399  1.00 181.51 ? 394  LEU A O   1 
ATOM   1459  C  CB  . LEU A  1 394  ? -6.561  26.607  24.062  1.00 230.00 ? 394  LEU A CB  1 
ATOM   1460  C  CG  . LEU A  1 394  ? -6.720  28.103  24.365  1.00 238.45 ? 394  LEU A CG  1 
ATOM   1461  C  CD1 . LEU A  1 394  ? -8.158  28.525  24.147  1.00 217.79 ? 394  LEU A CD1 1 
ATOM   1462  C  CD2 . LEU A  1 394  ? -6.275  28.444  25.789  1.00 297.52 ? 394  LEU A CD2 1 
ATOM   1463  N  N   . TRP A  1 395  ? -3.697  27.494  24.839  1.00 285.65 ? 395  TRP A N   1 
ATOM   1464  C  CA  . TRP A  1 395  ? -2.761  27.826  25.886  1.00 283.89 ? 395  TRP A CA  1 
ATOM   1465  C  C   . TRP A  1 395  ? -2.879  29.237  26.416  1.00 291.01 ? 395  TRP A C   1 
ATOM   1466  O  O   . TRP A  1 395  ? -3.560  30.080  25.834  1.00 307.50 ? 395  TRP A O   1 
ATOM   1467  C  CB  . TRP A  1 395  ? -1.461  27.819  25.216  1.00 211.55 ? 395  TRP A CB  1 
ATOM   1468  C  CG  . TRP A  1 395  ? -0.489  26.969  25.821  1.00 212.05 ? 395  TRP A CG  1 
ATOM   1469  C  CD1 . TRP A  1 395  ? -0.680  25.870  26.582  1.00 246.17 ? 395  TRP A CD1 1 
ATOM   1470  C  CD2 . TRP A  1 395  ? 0.885   27.157  25.722  1.00 265.22 ? 395  TRP A CD2 1 
ATOM   1471  N  NE1 . TRP A  1 395  ? 0.521   25.369  26.977  1.00 290.75 ? 395  TRP A NE1 1 
ATOM   1472  C  CE2 . TRP A  1 395  ? 1.509   26.151  26.442  1.00 289.09 ? 395  TRP A CE2 1 
ATOM   1473  C  CE3 . TRP A  1 395  ? 1.652   28.074  25.066  1.00 310.97 ? 395  TRP A CE3 1 
ATOM   1474  C  CZ2 . TRP A  1 395  ? 2.891   26.077  26.531  1.00 317.41 ? 395  TRP A CZ2 1 
ATOM   1475  C  CZ3 . TRP A  1 395  ? 2.980   28.011  25.151  1.00 336.33 ? 395  TRP A CZ3 1 
ATOM   1476  C  CH2 . TRP A  1 395  ? 3.609   27.023  25.871  1.00 330.64 ? 395  TRP A CH2 1 
ATOM   1477  N  N   . LYS A  1 396  ? -2.139  29.522  27.481  1.00 265.81 ? 396  LYS A N   1 
ATOM   1478  C  CA  . LYS A  1 396  ? -2.068  30.888  27.953  1.00 276.19 ? 396  LYS A CA  1 
ATOM   1479  C  C   . LYS A  1 396  ? -1.561  31.770  26.818  1.00 320.18 ? 396  LYS A C   1 
ATOM   1480  O  O   . LYS A  1 396  ? -1.885  32.953  26.759  1.00 359.03 ? 396  LYS A O   1 
ATOM   1481  C  CB  . LYS A  1 396  ? -1.156  31.016  29.166  1.00 282.69 ? 396  LYS A CB  1 
ATOM   1482  C  CG  . LYS A  1 396  ? -1.164  32.417  29.757  1.00 280.24 ? 396  LYS A CG  1 
ATOM   1483  C  CD  . LYS A  1 396  ? -0.333  32.491  31.017  1.00 253.00 ? 396  LYS A CD  1 
ATOM   1484  C  CE  . LYS A  1 396  ? -0.386  33.874  31.643  1.00 211.13 ? 396  LYS A CE  1 
ATOM   1485  N  NZ  . LYS A  1 396  ? 0.408   33.948  32.898  1.00 194.72 ? 396  LYS A NZ  1 
ATOM   1486  N  N   . GLY A  1 397  ? -0.770  31.190  25.917  1.00 320.20 ? 397  GLY A N   1 
ATOM   1487  C  CA  . GLY A  1 397  ? -0.268  31.913  24.758  1.00 321.01 ? 397  GLY A CA  1 
ATOM   1488  C  C   . GLY A  1 397  ? -1.107  31.682  23.512  1.00 269.52 ? 397  GLY A C   1 
ATOM   1489  O  O   . GLY A  1 397  ? -2.324  31.856  23.535  1.00 237.01 ? 397  GLY A O   1 
ATOM   1490  N  N   . VAL A  1 398  ? -0.458  31.292  22.418  1.00 230.97 ? 398  VAL A N   1 
ATOM   1491  C  CA  . VAL A  1 398  ? -1.160  31.040  21.162  1.00 269.09 ? 398  VAL A CA  1 
ATOM   1492  C  C   . VAL A  1 398  ? -1.671  29.609  21.100  1.00 210.68 ? 398  VAL A C   1 
ATOM   1493  O  O   . VAL A  1 398  ? -1.232  28.759  21.867  1.00 126.83 ? 398  VAL A O   1 
ATOM   1494  C  CB  . VAL A  1 398  ? -0.251  31.268  19.948  1.00 349.32 ? 398  VAL A CB  1 
ATOM   1495  C  CG1 . VAL A  1 398  ? 0.192   32.717  19.885  1.00 389.08 ? 398  VAL A CG1 1 
ATOM   1496  C  CG2 . VAL A  1 398  ? 0.945   30.332  20.004  1.00 358.34 ? 398  VAL A CG2 1 
ATOM   1497  N  N   . GLN A  1 399  ? -2.583  29.345  20.167  1.00 240.37 ? 399  GLN A N   1 
ATOM   1498  C  CA  . GLN A  1 399  ? -3.189  28.023  20.030  1.00 202.90 ? 399  GLN A CA  1 
ATOM   1499  C  C   . GLN A  1 399  ? -2.167  27.040  19.459  1.00 177.63 ? 399  GLN A C   1 
ATOM   1500  O  O   . GLN A  1 399  ? -1.065  27.438  19.078  1.00 175.24 ? 399  GLN A O   1 
ATOM   1501  C  CB  . GLN A  1 399  ? -4.442  28.080  19.137  1.00 146.65 ? 399  GLN A CB  1 
ATOM   1502  C  CG  . GLN A  1 399  ? -5.567  28.984  19.658  1.00 181.33 ? 399  GLN A CG  1 
ATOM   1503  C  CD  . GLN A  1 399  ? -5.440  30.427  19.198  1.00 208.65 ? 399  GLN A CD  1 
ATOM   1504  O  OE1 . GLN A  1 399  ? -4.645  30.742  18.316  1.00 250.14 ? 399  GLN A OE1 1 
ATOM   1505  N  NE2 . GLN A  1 399  ? -6.230  31.310  19.794  1.00 228.33 ? 399  GLN A NE2 1 
ATOM   1506  N  N   . SER A  1 400  ? -2.529  25.760  19.422  1.00 159.12 ? 400  SER A N   1 
ATOM   1507  C  CA  . SER A  1 400  ? -1.684  24.722  18.828  1.00 164.29 ? 400  SER A CA  1 
ATOM   1508  C  C   . SER A  1 400  ? -2.565  23.593  18.291  1.00 206.50 ? 400  SER A C   1 
ATOM   1509  O  O   . SER A  1 400  ? -3.473  23.134  18.986  1.00 230.19 ? 400  SER A O   1 
ATOM   1510  C  CB  . SER A  1 400  ? -0.683  24.170  19.857  1.00 174.99 ? 400  SER A CB  1 
ATOM   1511  O  OG  . SER A  1 400  ? 0.278   25.141  20.235  1.00 206.09 ? 400  SER A OG  1 
ATOM   1512  N  N   . LEU A  1 401  ? -2.313  23.163  17.053  1.00 217.95 ? 401  LEU A N   1 
ATOM   1513  C  CA  . LEU A  1 401  ? -3.074  22.070  16.442  1.00 226.03 ? 401  LEU A CA  1 
ATOM   1514  C  C   . LEU A  1 401  ? -2.325  20.754  16.519  1.00 207.57 ? 401  LEU A C   1 
ATOM   1515  O  O   . LEU A  1 401  ? -1.115  20.725  16.725  1.00 128.57 ? 401  LEU A O   1 
ATOM   1516  C  CB  . LEU A  1 401  ? -3.360  22.356  14.972  1.00 187.92 ? 401  LEU A CB  1 
ATOM   1517  C  CG  . LEU A  1 401  ? -4.358  23.469  14.669  1.00 229.72 ? 401  LEU A CG  1 
ATOM   1518  C  CD1 . LEU A  1 401  ? -4.464  23.672  13.171  1.00 256.54 ? 401  LEU A CD1 1 
ATOM   1519  C  CD2 . LEU A  1 401  ? -5.725  23.168  15.269  1.00 281.34 ? 401  LEU A CD2 1 
ATOM   1520  N  N   . VAL A  1 402  ? -3.053  19.664  16.323  1.00 212.64 ? 402  VAL A N   1 
ATOM   1521  C  CA  . VAL A  1 402  ? -2.454  18.345  16.366  1.00 173.99 ? 402  VAL A CA  1 
ATOM   1522  C  C   . VAL A  1 402  ? -3.138  17.421  15.383  1.00 201.89 ? 402  VAL A C   1 
ATOM   1523  O  O   . VAL A  1 402  ? -4.365  17.367  15.309  1.00 210.87 ? 402  VAL A O   1 
ATOM   1524  C  CB  . VAL A  1 402  ? -2.560  17.727  17.762  1.00 155.54 ? 402  VAL A CB  1 
ATOM   1525  C  CG1 . VAL A  1 402  ? -1.933  16.344  17.772  1.00 195.04 ? 402  VAL A CG1 1 
ATOM   1526  C  CG2 . VAL A  1 402  ? -1.882  18.619  18.775  1.00 190.93 ? 402  VAL A CG2 1 
ATOM   1527  N  N   . LEU A  1 403  ? -2.330  16.684  14.635  1.00 194.00 ? 403  LEU A N   1 
ATOM   1528  C  CA  . LEU A  1 403  ? -2.849  15.765  13.644  1.00 205.38 ? 403  LEU A CA  1 
ATOM   1529  C  C   . LEU A  1 403  ? -2.345  14.343  13.909  1.00 180.61 ? 403  LEU A C   1 
ATOM   1530  O  O   . LEU A  1 403  ? -1.227  14.141  14.397  1.00 98.92  ? 403  LEU A O   1 
ATOM   1531  C  CB  . LEU A  1 403  ? -2.442  16.239  12.253  1.00 244.27 ? 403  LEU A CB  1 
ATOM   1532  C  CG  . LEU A  1 403  ? -2.580  17.747  12.018  1.00 238.68 ? 403  LEU A CG  1 
ATOM   1533  C  CD1 . LEU A  1 403  ? -2.032  18.120  10.641  1.00 306.74 ? 403  LEU A CD1 1 
ATOM   1534  C  CD2 . LEU A  1 403  ? -4.031  18.194  12.169  1.00 141.58 ? 403  LEU A CD2 1 
ATOM   1535  N  N   . GLY A  1 404  ? -3.190  13.363  13.595  1.00 158.31 ? 404  GLY A N   1 
ATOM   1536  C  CA  . GLY A  1 404  ? -2.876  11.959  13.807  1.00 145.98 ? 404  GLY A CA  1 
ATOM   1537  C  C   . GLY A  1 404  ? -2.513  11.230  12.528  1.00 166.44 ? 404  GLY A C   1 
ATOM   1538  O  O   . GLY A  1 404  ? -3.296  11.196  11.577  1.00 166.45 ? 404  GLY A O   1 
ATOM   1539  N  N   . ALA A  1 405  ? -1.328  10.630  12.513  1.00 200.08 ? 405  ALA A N   1 
ATOM   1540  C  CA  . ALA A  1 405  ? -0.825  9.958   11.322  1.00 191.85 ? 405  ALA A CA  1 
ATOM   1541  C  C   . ALA A  1 405  ? -0.643  8.473   11.596  1.00 146.73 ? 405  ALA A C   1 
ATOM   1542  O  O   . ALA A  1 405  ? 0.472   8.016   11.834  1.00 189.27 ? 405  ALA A O   1 
ATOM   1543  C  CB  . ALA A  1 405  ? 0.491   10.590  10.867  1.00 240.32 ? 405  ALA A CB  1 
ATOM   1544  N  N   . PRO A  1 406  ? -1.749  7.714   11.555  1.00 208.42 ? 406  PRO A N   1 
ATOM   1545  C  CA  . PRO A  1 406  ? -1.768  6.279   11.875  1.00 212.75 ? 406  PRO A CA  1 
ATOM   1546  C  C   . PRO A  1 406  ? -0.700  5.454   11.164  1.00 229.95 ? 406  PRO A C   1 
ATOM   1547  O  O   . PRO A  1 406  ? -0.280  4.420   11.689  1.00 225.29 ? 406  PRO A O   1 
ATOM   1548  C  CB  . PRO A  1 406  ? -3.153  5.834   11.398  1.00 166.55 ? 406  PRO A CB  1 
ATOM   1549  C  CG  . PRO A  1 406  ? -4.004  7.063   11.488  1.00 89.59  ? 406  PRO A CG  1 
ATOM   1550  C  CD  . PRO A  1 406  ? -3.093  8.228   11.221  1.00 159.22 ? 406  PRO A CD  1 
ATOM   1551  N  N   . ARG A  1 407  ? -0.279  5.905   9.985   1.00 247.98 ? 407  ARG A N   1 
ATOM   1552  C  CA  . ARG A  1 407  ? 0.575   5.099   9.123   1.00 192.25 ? 407  ARG A CA  1 
ATOM   1553  C  C   . ARG A  1 407  ? 1.834   5.838   8.660   1.00 159.57 ? 407  ARG A C   1 
ATOM   1554  O  O   . ARG A  1 407  ? 2.168   5.817   7.477   1.00 268.78 ? 407  ARG A O   1 
ATOM   1555  C  CB  . ARG A  1 407  ? -0.224  4.624   7.904   1.00 215.53 ? 407  ARG A CB  1 
ATOM   1556  C  CG  . ARG A  1 407  ? -1.578  4.023   8.253   1.00 277.04 ? 407  ARG A CG  1 
ATOM   1557  C  CD  . ARG A  1 407  ? -2.357  3.635   7.009   1.00 283.49 ? 407  ARG A CD  1 
ATOM   1558  N  NE  . ARG A  1 407  ? -1.709  2.565   6.255   1.00 254.29 ? 407  ARG A NE  1 
ATOM   1559  C  CZ  . ARG A  1 407  ? -0.832  2.762   5.275   1.00 209.49 ? 407  ARG A CZ  1 
ATOM   1560  N  NH1 . ARG A  1 407  ? -0.483  3.993   4.920   1.00 208.23 ? 407  ARG A NH1 1 
ATOM   1561  N  NH2 . ARG A  1 407  ? -0.298  1.724   4.649   1.00 115.08 ? 407  ARG A NH2 1 
ATOM   1562  N  N   . TYR A  1 408  ? 2.530   6.486   9.589   1.00 201.58 ? 408  TYR A N   1 
ATOM   1563  C  CA  . TYR A  1 408  ? 3.857   7.029   9.304   1.00 171.15 ? 408  TYR A CA  1 
ATOM   1564  C  C   . TYR A  1 408  ? 4.877   5.898   9.367   1.00 208.09 ? 408  TYR A C   1 
ATOM   1565  O  O   . TYR A  1 408  ? 5.151   5.363   10.437  1.00 276.36 ? 408  TYR A O   1 
ATOM   1566  C  CB  . TYR A  1 408  ? 4.229   8.103   10.319  1.00 177.55 ? 408  TYR A CB  1 
ATOM   1567  C  CG  . TYR A  1 408  ? 5.685   8.500   10.261  1.00 162.52 ? 408  TYR A CG  1 
ATOM   1568  C  CD1 . TYR A  1 408  ? 6.649   7.812   10.983  1.00 265.45 ? 408  TYR A CD1 1 
ATOM   1569  C  CD2 . TYR A  1 408  ? 6.095   9.560   9.482   1.00 235.94 ? 408  TYR A CD2 1 
ATOM   1570  C  CE1 . TYR A  1 408  ? 7.981   8.175   10.927  1.00 276.55 ? 408  TYR A CE1 1 
ATOM   1571  C  CE2 . TYR A  1 408  ? 7.423   9.931   9.420   1.00 282.24 ? 408  TYR A CE2 1 
ATOM   1572  C  CZ  . TYR A  1 408  ? 8.360   9.235   10.143  1.00 258.08 ? 408  TYR A CZ  1 
ATOM   1573  O  OH  . TYR A  1 408  ? 9.679   9.614   10.077  1.00 259.15 ? 408  TYR A OH  1 
ATOM   1574  N  N   . GLN A  1 409  ? 5.438   5.533   8.222   1.00 227.84 ? 409  GLN A N   1 
ATOM   1575  C  CA  . GLN A  1 409  ? 6.281   4.346   8.135   1.00 229.77 ? 409  GLN A CA  1 
ATOM   1576  C  C   . GLN A  1 409  ? 5.497   3.090   8.536   1.00 227.84 ? 409  GLN A C   1 
ATOM   1577  O  O   . GLN A  1 409  ? 6.074   2.109   9.004   1.00 282.12 ? 409  GLN A O   1 
ATOM   1578  C  CB  . GLN A  1 409  ? 7.523   4.502   9.012   1.00 207.92 ? 409  GLN A CB  1 
ATOM   1579  C  CG  . GLN A  1 409  ? 8.501   5.550   8.517   1.00 227.75 ? 409  GLN A CG  1 
ATOM   1580  C  CD  . GLN A  1 409  ? 9.742   5.628   9.377   1.00 305.50 ? 409  GLN A CD  1 
ATOM   1581  O  OE1 . GLN A  1 409  ? 9.742   5.182   10.522  1.00 385.53 ? 409  GLN A OE1 1 
ATOM   1582  N  NE2 . GLN A  1 409  ? 10.810  6.188   8.828   1.00 282.62 ? 409  GLN A NE2 1 
ATOM   1583  N  N   . HIS A  1 410  ? 4.178   3.137   8.350   1.00 186.89 ? 410  HIS A N   1 
ATOM   1584  C  CA  . HIS A  1 410  ? 3.288   1.993   8.588   1.00 228.53 ? 410  HIS A CA  1 
ATOM   1585  C  C   . HIS A  1 410  ? 3.106   1.652   10.070  1.00 250.00 ? 410  HIS A C   1 
ATOM   1586  O  O   . HIS A  1 410  ? 2.485   0.641   10.407  1.00 245.40 ? 410  HIS A O   1 
ATOM   1587  C  CB  . HIS A  1 410  ? 3.770   0.752   7.824   1.00 224.92 ? 410  HIS A CB  1 
ATOM   1588  C  CG  . HIS A  1 410  ? 3.872   0.957   6.346   1.00 217.84 ? 410  HIS A CG  1 
ATOM   1589  N  ND1 . HIS A  1 410  ? 2.820   0.727   5.483   1.00 143.55 ? 410  HIS A ND1 1 
ATOM   1590  C  CD2 . HIS A  1 410  ? 4.905   1.375   5.578   1.00 270.97 ? 410  HIS A CD2 1 
ATOM   1591  C  CE1 . HIS A  1 410  ? 3.203   0.996   4.249   1.00 295.53 ? 410  HIS A CE1 1 
ATOM   1592  N  NE2 . HIS A  1 410  ? 4.464   1.390   4.278   1.00 328.96 ? 410  HIS A NE2 1 
ATOM   1593  N  N   . THR A  1 411  ? 3.633   2.498   10.950  1.00 247.41 ? 411  THR A N   1 
ATOM   1594  C  CA  . THR A  1 411  ? 3.497   2.284   12.387  1.00 204.38 ? 411  THR A CA  1 
ATOM   1595  C  C   . THR A  1 411  ? 2.493   3.274   12.983  1.00 188.92 ? 411  THR A C   1 
ATOM   1596  O  O   . THR A  1 411  ? 1.464   2.870   13.525  1.00 230.51 ? 411  THR A O   1 
ATOM   1597  C  CB  . THR A  1 411  ? 4.861   2.398   13.110  1.00 211.59 ? 411  THR A CB  1 
ATOM   1598  O  OG1 . THR A  1 411  ? 5.318   3.754   13.080  1.00 214.74 ? 411  THR A OG1 1 
ATOM   1599  C  CG2 . THR A  1 411  ? 5.902   1.504   12.443  1.00 253.83 ? 411  THR A CG2 1 
ATOM   1600  N  N   . GLY A  1 412  ? 2.790   4.566   12.866  1.00 188.64 ? 412  GLY A N   1 
ATOM   1601  C  CA  . GLY A  1 412  ? 1.919   5.605   13.387  1.00 171.59 ? 412  GLY A CA  1 
ATOM   1602  C  C   . GLY A  1 412  ? 2.640   6.643   14.232  1.00 208.00 ? 412  GLY A C   1 
ATOM   1603  O  O   . GLY A  1 412  ? 3.206   6.328   15.278  1.00 235.74 ? 412  GLY A O   1 
ATOM   1604  N  N   . LYS A  1 413  ? 2.615   7.891   13.775  1.00 194.25 ? 413  LYS A N   1 
ATOM   1605  C  CA  . LYS A  1 413  ? 3.204   8.997   14.519  1.00 198.26 ? 413  LYS A CA  1 
ATOM   1606  C  C   . LYS A  1 413  ? 2.159   10.095  14.724  1.00 170.42 ? 413  LYS A C   1 
ATOM   1607  O  O   . LYS A  1 413  ? 1.181   10.183  13.984  1.00 149.73 ? 413  LYS A O   1 
ATOM   1608  C  CB  . LYS A  1 413  ? 4.445   9.530   13.781  1.00 273.46 ? 413  LYS A CB  1 
ATOM   1609  C  CG  . LYS A  1 413  ? 4.982   10.858  14.297  1.00 318.77 ? 413  LYS A CG  1 
ATOM   1610  C  CD  . LYS A  1 413  ? 6.440   11.081  13.897  1.00 282.00 ? 413  LYS A CD  1 
ATOM   1611  C  CE  . LYS A  1 413  ? 6.599   11.373  12.407  1.00 115.44 ? 413  LYS A CE  1 
ATOM   1612  N  NZ  . LYS A  1 413  ? 8.031   11.603  12.064  1.00 174.69 ? 413  LYS A NZ  1 
ATOM   1613  N  N   . ALA A  1 414  ? 2.357   10.912  15.751  1.00 167.63 ? 414  ALA A N   1 
ATOM   1614  C  CA  . ALA A  1 414  ? 1.497   12.058  15.996  1.00 133.73 ? 414  ALA A CA  1 
ATOM   1615  C  C   . ALA A  1 414  ? 2.337   13.340  15.982  1.00 167.27 ? 414  ALA A C   1 
ATOM   1616  O  O   . ALA A  1 414  ? 3.365   13.426  16.657  1.00 144.96 ? 414  ALA A O   1 
ATOM   1617  C  CB  . ALA A  1 414  ? 0.794   11.891  17.315  1.00 245.32 ? 414  ALA A CB  1 
ATOM   1618  N  N   . VAL A  1 415  ? 1.902   14.329  15.205  1.00 130.31 ? 415  VAL A N   1 
ATOM   1619  C  CA  . VAL A  1 415  ? 2.672   15.563  15.018  1.00 173.52 ? 415  VAL A CA  1 
ATOM   1620  C  C   . VAL A  1 415  ? 1.894   16.790  15.474  1.00 166.01 ? 415  VAL A C   1 
ATOM   1621  O  O   . VAL A  1 415  ? 0.720   16.961  15.137  1.00 88.02  ? 415  VAL A O   1 
ATOM   1622  C  CB  . VAL A  1 415  ? 3.071   15.775  13.530  1.00 258.52 ? 415  VAL A CB  1 
ATOM   1623  C  CG1 . VAL A  1 415  ? 3.897   17.049  13.366  1.00 192.92 ? 415  VAL A CG1 1 
ATOM   1624  C  CG2 . VAL A  1 415  ? 3.835   14.576  13.004  1.00 325.41 ? 415  VAL A CG2 1 
ATOM   1625  N  N   . ILE A  1 416  ? 2.565   17.650  16.235  1.00 159.53 ? 416  ILE A N   1 
ATOM   1626  C  CA  . ILE A  1 416  ? 1.944   18.861  16.766  1.00 174.41 ? 416  ILE A CA  1 
ATOM   1627  C  C   . ILE A  1 416  ? 2.491   20.078  16.051  1.00 141.31 ? 416  ILE A C   1 
ATOM   1628  O  O   . ILE A  1 416  ? 3.698   20.188  15.835  1.00 133.00 ? 416  ILE A O   1 
ATOM   1629  C  CB  . ILE A  1 416  ? 2.217   19.029  18.286  1.00 213.39 ? 416  ILE A CB  1 
ATOM   1630  C  CG1 . ILE A  1 416  ? 1.830   17.752  19.047  1.00 230.19 ? 416  ILE A CG1 1 
ATOM   1631  C  CG2 . ILE A  1 416  ? 1.468   20.252  18.840  1.00 147.13 ? 416  ILE A CG2 1 
ATOM   1632  C  CD1 . ILE A  1 416  ? 2.237   17.740  20.513  1.00 128.65 ? 416  ILE A CD1 1 
ATOM   1633  N  N   . PHE A  1 417  ? 1.599   21.001  15.710  1.00 170.56 ? 417  PHE A N   1 
ATOM   1634  C  CA  . PHE A  1 417  ? 1.981   22.188  14.964  1.00 204.00 ? 417  PHE A CA  1 
ATOM   1635  C  C   . PHE A  1 417  ? 1.655   23.472  15.709  1.00 203.01 ? 417  PHE A C   1 
ATOM   1636  O  O   . PHE A  1 417  ? 0.666   23.550  16.435  1.00 166.91 ? 417  PHE A O   1 
ATOM   1637  C  CB  . PHE A  1 417  ? 1.271   22.204  13.617  1.00 211.78 ? 417  PHE A CB  1 
ATOM   1638  C  CG  . PHE A  1 417  ? 1.641   21.057  12.722  1.00 211.31 ? 417  PHE A CG  1 
ATOM   1639  C  CD1 . PHE A  1 417  ? 0.845   19.926  12.668  1.00 241.68 ? 417  PHE A CD1 1 
ATOM   1640  C  CD2 . PHE A  1 417  ? 2.784   21.109  11.936  1.00 119.86 ? 417  PHE A CD2 1 
ATOM   1641  C  CE1 . PHE A  1 417  ? 1.178   18.869  11.845  1.00 271.36 ? 417  PHE A CE1 1 
ATOM   1642  C  CE2 . PHE A  1 417  ? 3.119   20.055  11.114  1.00 205.57 ? 417  PHE A CE2 1 
ATOM   1643  C  CZ  . PHE A  1 417  ? 2.314   18.933  11.067  1.00 277.34 ? 417  PHE A CZ  1 
ATOM   1644  N  N   . THR A  1 418  ? 2.502   24.476  15.512  1.00 232.46 ? 418  THR A N   1 
ATOM   1645  C  CA  . THR A  1 418  ? 2.278   25.805  16.059  1.00 253.10 ? 418  THR A CA  1 
ATOM   1646  C  C   . THR A  1 418  ? 2.128   26.797  14.916  1.00 261.27 ? 418  THR A C   1 
ATOM   1647  O  O   . THR A  1 418  ? 2.589   26.547  13.803  1.00 300.84 ? 418  THR A O   1 
ATOM   1648  C  CB  . THR A  1 418  ? 3.442   26.259  16.959  1.00 264.24 ? 418  THR A CB  1 
ATOM   1649  O  OG1 . THR A  1 418  ? 3.236   27.618  17.362  1.00 229.95 ? 418  THR A OG1 1 
ATOM   1650  C  CG2 . THR A  1 418  ? 4.769   26.155  16.223  1.00 320.82 ? 418  THR A CG2 1 
ATOM   1651  N  N   . GLN A  1 419  ? 1.480   27.921  15.194  1.00 242.98 ? 419  GLN A N   1 
ATOM   1652  C  CA  . GLN A  1 419  ? 1.260   28.936  14.177  1.00 246.11 ? 419  GLN A CA  1 
ATOM   1653  C  C   . GLN A  1 419  ? 1.812   30.279  14.624  1.00 272.63 ? 419  GLN A C   1 
ATOM   1654  O  O   . GLN A  1 419  ? 1.062   31.221  14.875  1.00 297.26 ? 419  GLN A O   1 
ATOM   1655  C  CB  . GLN A  1 419  ? -0.223  29.053  13.868  1.00 234.71 ? 419  GLN A CB  1 
ATOM   1656  C  CG  . GLN A  1 419  ? -0.842  27.746  13.429  1.00 218.96 ? 419  GLN A CG  1 
ATOM   1657  C  CD  . GLN A  1 419  ? -2.157  27.953  12.718  1.00 213.11 ? 419  GLN A CD  1 
ATOM   1658  O  OE1 . GLN A  1 419  ? -2.812  28.977  12.896  1.00 234.07 ? 419  GLN A OE1 1 
ATOM   1659  N  NE2 . GLN A  1 419  ? -2.553  26.983  11.904  1.00 206.92 ? 419  GLN A NE2 1 
ATOM   1660  N  N   . VAL A  1 420  ? 3.133   30.352  14.721  1.00 268.38 ? 420  VAL A N   1 
ATOM   1661  C  CA  . VAL A  1 420  ? 3.808   31.586  15.088  1.00 284.08 ? 420  VAL A CA  1 
ATOM   1662  C  C   . VAL A  1 420  ? 3.620   32.630  13.999  1.00 350.20 ? 420  VAL A C   1 
ATOM   1663  O  O   . VAL A  1 420  ? 3.392   32.294  12.837  1.00 390.10 ? 420  VAL A O   1 
ATOM   1664  C  CB  . VAL A  1 420  ? 5.311   31.352  15.294  1.00 250.19 ? 420  VAL A CB  1 
ATOM   1665  C  CG1 . VAL A  1 420  ? 6.012   32.655  15.640  1.00 244.62 ? 420  VAL A CG1 1 
ATOM   1666  C  CG2 . VAL A  1 420  ? 5.535   30.316  16.376  1.00 269.33 ? 420  VAL A CG2 1 
ATOM   1667  N  N   . SER A  1 421  ? 3.711   33.898  14.384  1.00 352.54 ? 421  SER A N   1 
ATOM   1668  C  CA  . SER A  1 421  ? 3.571   34.999  13.440  1.00 335.73 ? 421  SER A CA  1 
ATOM   1669  C  C   . SER A  1 421  ? 4.461   34.790  12.225  1.00 278.19 ? 421  SER A C   1 
ATOM   1670  O  O   . SER A  1 421  ? 5.687   34.797  12.329  1.00 245.42 ? 421  SER A O   1 
ATOM   1671  C  CB  . SER A  1 421  ? 3.922   36.325  14.113  1.00 346.98 ? 421  SER A CB  1 
ATOM   1672  O  OG  . SER A  1 421  ? 3.981   37.374  13.162  1.00 350.04 ? 421  SER A OG  1 
ATOM   1673  N  N   . ARG A  1 422  ? 3.830   34.599  11.073  1.00 257.81 ? 422  ARG A N   1 
ATOM   1674  C  CA  . ARG A  1 422  ? 4.555   34.403  9.828   1.00 322.74 ? 422  ARG A CA  1 
ATOM   1675  C  C   . ARG A  1 422  ? 5.511   33.221  9.936   1.00 366.71 ? 422  ARG A C   1 
ATOM   1676  O  O   . ARG A  1 422  ? 6.691   33.338  9.614   1.00 409.11 ? 422  ARG A O   1 
ATOM   1677  C  CB  . ARG A  1 422  ? 5.324   35.672  9.459   1.00 368.99 ? 422  ARG A CB  1 
ATOM   1678  C  CG  . ARG A  1 422  ? 4.444   36.904  9.308   1.00 375.84 ? 422  ARG A CG  1 
ATOM   1679  C  CD  . ARG A  1 422  ? 5.204   38.053  8.675   1.00 347.73 ? 422  ARG A CD  1 
ATOM   1680  N  NE  . ARG A  1 422  ? 6.396   38.402  9.437   1.00 312.94 ? 422  ARG A NE  1 
ATOM   1681  C  CZ  . ARG A  1 422  ? 7.301   39.289  9.043   1.00 292.04 ? 422  ARG A CZ  1 
ATOM   1682  N  NH1 . ARG A  1 422  ? 7.156   39.924  7.889   1.00 263.20 ? 422  ARG A NH1 1 
ATOM   1683  N  NH2 . ARG A  1 422  ? 8.356   39.541  9.803   1.00 314.11 ? 422  ARG A NH2 1 
ATOM   1684  N  N   . GLN A  1 423  ? 4.996   32.084  10.393  1.00 364.90 ? 423  GLN A N   1 
ATOM   1685  C  CA  . GLN A  1 423  ? 5.797   30.870  10.500  1.00 364.97 ? 423  GLN A CA  1 
ATOM   1686  C  C   . GLN A  1 423  ? 4.965   29.617  10.232  1.00 382.18 ? 423  GLN A C   1 
ATOM   1687  O  O   . GLN A  1 423  ? 5.109   28.983  9.188   1.00 440.12 ? 423  GLN A O   1 
ATOM   1688  C  CB  . GLN A  1 423  ? 6.437   30.776  11.883  1.00 331.89 ? 423  GLN A CB  1 
ATOM   1689  C  CG  . GLN A  1 423  ? 7.412   31.895  12.187  1.00 300.15 ? 423  GLN A CG  1 
ATOM   1690  C  CD  . GLN A  1 423  ? 8.593   31.904  11.240  1.00 344.78 ? 423  GLN A CD  1 
ATOM   1691  O  OE1 . GLN A  1 423  ? 8.968   30.870  10.687  1.00 366.15 ? 423  GLN A OE1 1 
ATOM   1692  N  NE2 . GLN A  1 423  ? 9.188   33.074  11.050  1.00 361.92 ? 423  GLN A NE2 1 
ATOM   1693  N  N   . TRP A  1 424  ? 4.100   29.264  11.178  1.00 307.75 ? 424  TRP A N   1 
ATOM   1694  C  CA  . TRP A  1 424  ? 3.270   28.067  11.056  1.00 219.70 ? 424  TRP A CA  1 
ATOM   1695  C  C   . TRP A  1 424  ? 4.113   26.815  10.857  1.00 223.58 ? 424  TRP A C   1 
ATOM   1696  O  O   . TRP A  1 424  ? 3.834   26.004  9.978   1.00 233.54 ? 424  TRP A O   1 
ATOM   1697  C  CB  . TRP A  1 424  ? 2.290   28.217  9.898   1.00 207.22 ? 424  TRP A CB  1 
ATOM   1698  C  CG  . TRP A  1 424  ? 1.135   29.102  10.211  1.00 261.15 ? 424  TRP A CG  1 
ATOM   1699  C  CD1 . TRP A  1 424  ? -0.075  28.714  10.691  1.00 243.67 ? 424  TRP A CD1 1 
ATOM   1700  C  CD2 . TRP A  1 424  ? 1.072   30.529  10.064  1.00 313.85 ? 424  TRP A CD2 1 
ATOM   1701  N  NE1 . TRP A  1 424  ? -0.891  29.806  10.855  1.00 309.87 ? 424  TRP A NE1 1 
ATOM   1702  C  CE2 . TRP A  1 424  ? -0.211  30.933  10.477  1.00 337.85 ? 424  TRP A CE2 1 
ATOM   1703  C  CE3 . TRP A  1 424  ? 1.974   31.502  9.624   1.00 247.93 ? 424  TRP A CE3 1 
ATOM   1704  C  CZ2 . TRP A  1 424  ? -0.616  32.267  10.464  1.00 303.64 ? 424  TRP A CZ2 1 
ATOM   1705  C  CZ3 . TRP A  1 424  ? 1.568   32.827  9.612   1.00 194.18 ? 424  TRP A CZ3 1 
ATOM   1706  C  CH2 . TRP A  1 424  ? 0.287   33.196  10.030  1.00 227.51 ? 424  TRP A CH2 1 
ATOM   1707  N  N   . ARG A  1 425  ? 5.137   26.659  11.686  1.00 248.32 ? 425  ARG A N   1 
ATOM   1708  C  CA  . ARG A  1 425  ? 6.039   25.520  11.584  1.00 265.81 ? 425  ARG A CA  1 
ATOM   1709  C  C   . ARG A  1 425  ? 5.612   24.400  12.525  1.00 214.68 ? 425  ARG A C   1 
ATOM   1710  O  O   . ARG A  1 425  ? 4.538   24.451  13.120  1.00 166.34 ? 425  ARG A O   1 
ATOM   1711  C  CB  . ARG A  1 425  ? 7.476   25.954  11.890  1.00 310.80 ? 425  ARG A CB  1 
ATOM   1712  C  CG  . ARG A  1 425  ? 8.038   26.964  10.897  1.00 320.59 ? 425  ARG A CG  1 
ATOM   1713  C  CD  . ARG A  1 425  ? 9.478   27.340  11.224  1.00 324.66 ? 425  ARG A CD  1 
ATOM   1714  N  NE  . ARG A  1 425  ? 10.039  28.276  10.252  1.00 342.02 ? 425  ARG A NE  1 
ATOM   1715  C  CZ  . ARG A  1 425  ? 11.275  28.764  10.306  1.00 356.77 ? 425  ARG A CZ  1 
ATOM   1716  N  NH1 . ARG A  1 425  ? 12.090  28.412  11.290  1.00 337.86 ? 425  ARG A NH1 1 
ATOM   1717  N  NH2 . ARG A  1 425  ? 11.697  29.608  9.374   1.00 378.44 ? 425  ARG A NH2 1 
ATOM   1718  N  N   . MET A  1 426  ? 6.456   23.383  12.643  1.00 197.78 ? 426  MET A N   1 
ATOM   1719  C  CA  . MET A  1 426  ? 6.173   22.247  13.503  1.00 179.15 ? 426  MET A CA  1 
ATOM   1720  C  C   . MET A  1 426  ? 6.775   22.467  14.887  1.00 241.24 ? 426  MET A C   1 
ATOM   1721  O  O   . MET A  1 426  ? 7.900   22.950  15.017  1.00 272.55 ? 426  MET A O   1 
ATOM   1722  C  CB  . MET A  1 426  ? 6.740   20.971  12.881  1.00 175.44 ? 426  MET A CB  1 
ATOM   1723  C  CG  . MET A  1 426  ? 6.689   19.757  13.780  1.00 232.62 ? 426  MET A CG  1 
ATOM   1724  S  SD  . MET A  1 426  ? 7.536   18.365  13.008  1.00 283.19 ? 426  MET A SD  1 
ATOM   1725  C  CE  . MET A  1 426  ? 9.235   18.909  13.130  1.00 448.67 ? 426  MET A CE  1 
ATOM   1726  N  N   . LYS A  1 427  ? 6.013   22.120  15.919  1.00 244.51 ? 427  LYS A N   1 
ATOM   1727  C  CA  . LYS A  1 427  ? 6.510   22.170  17.284  1.00 192.05 ? 427  LYS A CA  1 
ATOM   1728  C  C   . LYS A  1 427  ? 7.377   20.941  17.534  1.00 171.65 ? 427  LYS A C   1 
ATOM   1729  O  O   . LYS A  1 427  ? 8.582   21.054  17.752  1.00 228.84 ? 427  LYS A O   1 
ATOM   1730  C  CB  . LYS A  1 427  ? 5.345   22.223  18.279  1.00 262.15 ? 427  LYS A CB  1 
ATOM   1731  C  CG  . LYS A  1 427  ? 4.418   23.419  18.093  1.00 338.78 ? 427  LYS A CG  1 
ATOM   1732  C  CD  . LYS A  1 427  ? 3.268   23.410  19.097  1.00 352.96 ? 427  LYS A CD  1 
ATOM   1733  C  CE  . LYS A  1 427  ? 3.736   23.754  20.502  1.00 338.87 ? 427  LYS A CE  1 
ATOM   1734  N  NZ  . LYS A  1 427  ? 4.158   25.173  20.616  1.00 341.98 ? 427  LYS A NZ  1 
ATOM   1735  N  N   . ALA A  1 428  ? 6.754   19.766  17.483  1.00 138.72 ? 428  ALA A N   1 
ATOM   1736  C  CA  . ALA A  1 428  ? 7.450   18.504  17.731  1.00 183.03 ? 428  ALA A CA  1 
ATOM   1737  C  C   . ALA A  1 428  ? 6.573   17.314  17.334  1.00 172.31 ? 428  ALA A C   1 
ATOM   1738  O  O   . ALA A  1 428  ? 5.503   17.483  16.747  1.00 93.76  ? 428  ALA A O   1 
ATOM   1739  C  CB  . ALA A  1 428  ? 7.848   18.390  19.204  1.00 194.16 ? 428  ALA A CB  1 
ATOM   1740  N  N   . GLU A  1 429  ? 7.024   16.113  17.692  1.00 172.64 ? 429  GLU A N   1 
ATOM   1741  C  CA  . GLU A  1 429  ? 6.373   14.880  17.263  1.00 114.32 ? 429  GLU A CA  1 
ATOM   1742  C  C   . GLU A  1 429  ? 6.929   13.653  17.992  1.00 184.49 ? 429  GLU A C   1 
ATOM   1743  O  O   . GLU A  1 429  ? 7.934   13.736  18.698  1.00 246.85 ? 429  GLU A O   1 
ATOM   1744  C  CB  . GLU A  1 429  ? 6.554   14.705  15.758  1.00 205.92 ? 429  GLU A CB  1 
ATOM   1745  C  CG  . GLU A  1 429  ? 8.011   14.802  15.281  1.00 268.21 ? 429  GLU A CG  1 
ATOM   1746  C  CD  . GLU A  1 429  ? 8.159   14.678  13.758  1.00 275.51 ? 429  GLU A CD  1 
ATOM   1747  O  OE1 . GLU A  1 429  ? 7.149   14.433  13.056  1.00 237.22 ? 429  GLU A OE1 1 
ATOM   1748  O  OE2 . GLU A  1 429  ? 9.297   14.827  13.261  1.00 267.94 ? 429  GLU A OE2 1 
ATOM   1749  N  N   . VAL A  1 430  ? 6.261   12.517  17.822  1.00 154.11 ? 430  VAL A N   1 
ATOM   1750  C  CA  . VAL A  1 430  ? 6.728   11.261  18.401  1.00 201.72 ? 430  VAL A CA  1 
ATOM   1751  C  C   . VAL A  1 430  ? 6.295   10.073  17.558  1.00 191.84 ? 430  VAL A C   1 
ATOM   1752  O  O   . VAL A  1 430  ? 5.108   9.888   17.292  1.00 155.08 ? 430  VAL A O   1 
ATOM   1753  C  CB  . VAL A  1 430  ? 6.173   11.044  19.811  1.00 219.21 ? 430  VAL A CB  1 
ATOM   1754  C  CG1 . VAL A  1 430  ? 6.766   12.059  20.786  1.00 245.45 ? 430  VAL A CG1 1 
ATOM   1755  C  CG2 . VAL A  1 430  ? 4.644   11.106  19.787  1.00 162.52 ? 430  VAL A CG2 1 
ATOM   1756  N  N   . THR A  1 431  ? 7.262   9.260   17.153  1.00 209.37 ? 431  THR A N   1 
ATOM   1757  C  CA  . THR A  1 431  ? 6.978   8.077   16.352  1.00 221.75 ? 431  THR A CA  1 
ATOM   1758  C  C   . THR A  1 431  ? 6.057   7.127   17.112  1.00 204.63 ? 431  THR A C   1 
ATOM   1759  O  O   . THR A  1 431  ? 5.703   7.383   18.262  1.00 135.87 ? 431  THR A O   1 
ATOM   1760  C  CB  . THR A  1 431  ? 8.275   7.341   15.975  1.00 272.02 ? 431  THR A CB  1 
ATOM   1761  O  OG1 . THR A  1 431  ? 8.986   6.977   17.164  1.00 289.92 ? 431  THR A OG1 1 
ATOM   1762  C  CG2 . THR A  1 431  ? 9.163   8.226   15.112  1.00 287.01 ? 431  THR A CG2 1 
ATOM   1763  N  N   . GLY A  1 432  ? 5.661   6.038   16.460  1.00 228.40 ? 432  GLY A N   1 
ATOM   1764  C  CA  . GLY A  1 432  ? 4.835   5.025   17.093  1.00 183.98 ? 432  GLY A CA  1 
ATOM   1765  C  C   . GLY A  1 432  ? 5.678   4.023   17.849  1.00 168.23 ? 432  GLY A C   1 
ATOM   1766  O  O   . GLY A  1 432  ? 6.905   4.053   17.778  1.00 196.33 ? 432  GLY A O   1 
ATOM   1767  N  N   . THR A  1 433  ? 5.023   3.125   18.574  1.00 175.34 ? 433  THR A N   1 
ATOM   1768  C  CA  . THR A  1 433  ? 5.739   2.153   19.387  1.00 226.65 ? 433  THR A CA  1 
ATOM   1769  C  C   . THR A  1 433  ? 5.892   0.839   18.642  1.00 183.74 ? 433  THR A C   1 
ATOM   1770  O  O   . THR A  1 433  ? 6.882   0.128   18.812  1.00 235.63 ? 433  THR A O   1 
ATOM   1771  C  CB  . THR A  1 433  ? 5.018   1.893   20.724  1.00 294.19 ? 433  THR A CB  1 
ATOM   1772  O  OG1 . THR A  1 433  ? 5.791   0.988   21.520  1.00 332.37 ? 433  THR A OG1 1 
ATOM   1773  C  CG2 . THR A  1 433  ? 3.638   1.299   20.494  1.00 302.91 ? 433  THR A CG2 1 
ATOM   1774  N  N   . GLN A  1 434  ? 4.907   0.524   17.810  1.00 120.88 ? 434  GLN A N   1 
ATOM   1775  C  CA  . GLN A  1 434  ? 4.893   -0.745  17.098  1.00 170.47 ? 434  GLN A CA  1 
ATOM   1776  C  C   . GLN A  1 434  ? 4.283   -0.600  15.711  1.00 223.86 ? 434  GLN A C   1 
ATOM   1777  O  O   . GLN A  1 434  ? 3.496   0.311   15.455  1.00 242.07 ? 434  GLN A O   1 
ATOM   1778  C  CB  . GLN A  1 434  ? 4.113   -1.786  17.899  1.00 200.46 ? 434  GLN A CB  1 
ATOM   1779  C  CG  . GLN A  1 434  ? 3.880   -3.098  17.170  1.00 207.93 ? 434  GLN A CG  1 
ATOM   1780  C  CD  . GLN A  1 434  ? 3.218   -4.131  18.052  1.00 250.14 ? 434  GLN A CD  1 
ATOM   1781  O  OE1 . GLN A  1 434  ? 3.363   -4.102  19.273  1.00 253.75 ? 434  GLN A OE1 1 
ATOM   1782  N  NE2 . GLN A  1 434  ? 2.488   -5.053  17.440  1.00 292.57 ? 434  GLN A NE2 1 
ATOM   1783  N  N   . ILE A  1 435  ? 4.657   -1.511  14.819  1.00 244.70 ? 435  ILE A N   1 
ATOM   1784  C  CA  . ILE A  1 435  ? 4.134   -1.519  13.460  1.00 260.98 ? 435  ILE A CA  1 
ATOM   1785  C  C   . ILE A  1 435  ? 2.675   -1.972  13.450  1.00 250.27 ? 435  ILE A C   1 
ATOM   1786  O  O   . ILE A  1 435  ? 2.338   -3.008  14.019  1.00 252.20 ? 435  ILE A O   1 
ATOM   1787  C  CB  . ILE A  1 435  ? 4.975   -2.439  12.544  1.00 268.84 ? 435  ILE A CB  1 
ATOM   1788  C  CG1 . ILE A  1 435  ? 4.471   -2.363  11.102  1.00 255.47 ? 435  ILE A CG1 1 
ATOM   1789  C  CG2 . ILE A  1 435  ? 4.946   -3.880  13.047  1.00 253.02 ? 435  ILE A CG2 1 
ATOM   1790  C  CD1 . ILE A  1 435  ? 5.326   -3.130  10.114  1.00 199.68 ? 435  ILE A CD1 1 
ATOM   1791  N  N   . GLY A  1 436  ? 1.813   -1.183  12.813  1.00 231.51 ? 436  GLY A N   1 
ATOM   1792  C  CA  . GLY A  1 436  ? 0.400   -1.509  12.717  1.00 221.76 ? 436  GLY A CA  1 
ATOM   1793  C  C   . GLY A  1 436  ? -0.387  -1.097  13.946  1.00 216.78 ? 436  GLY A C   1 
ATOM   1794  O  O   . GLY A  1 436  ? -1.620  -1.087  13.946  1.00 165.75 ? 436  GLY A O   1 
ATOM   1795  N  N   . SER A  1 437  ? 0.335   -0.758  15.007  1.00 237.91 ? 437  SER A N   1 
ATOM   1796  C  CA  . SER A  1 437  ? -0.284  -0.331  16.252  1.00 242.61 ? 437  SER A CA  1 
ATOM   1797  C  C   . SER A  1 437  ? -1.329  0.730   15.945  1.00 236.65 ? 437  SER A C   1 
ATOM   1798  O  O   . SER A  1 437  ? -2.352  0.829   16.625  1.00 174.01 ? 437  SER A O   1 
ATOM   1799  C  CB  . SER A  1 437  ? 0.771   0.258   17.173  1.00 236.79 ? 437  SER A CB  1 
ATOM   1800  O  OG  . SER A  1 437  ? 1.178   1.459   16.543  1.00 188.49 ? 437  SER A OG  1 
ATOM   1801  N  N   . TYR A  1 438  ? -1.054  1.526   14.918  1.00 263.07 ? 438  TYR A N   1 
ATOM   1802  C  CA  . TYR A  1 438  ? -1.963  2.575   14.508  1.00 236.94 ? 438  TYR A CA  1 
ATOM   1803  C  C   . TYR A  1 438  ? -1.901  3.736   15.501  1.00 229.72 ? 438  TYR A C   1 
ATOM   1804  O  O   . TYR A  1 438  ? -2.924  4.317   15.863  1.00 155.53 ? 438  TYR A O   1 
ATOM   1805  C  CB  . TYR A  1 438  ? -3.380  2.017   14.423  1.00 215.68 ? 438  TYR A CB  1 
ATOM   1806  C  CG  . TYR A  1 438  ? -4.204  2.670   13.351  1.00 230.44 ? 438  TYR A CG  1 
ATOM   1807  C  CD1 . TYR A  1 438  ? -4.321  2.103   12.096  1.00 237.96 ? 438  TYR A CD1 1 
ATOM   1808  C  CD2 . TYR A  1 438  ? -4.856  3.866   13.592  1.00 250.84 ? 438  TYR A CD2 1 
ATOM   1809  C  CE1 . TYR A  1 438  ? -5.072  2.707   11.107  1.00 232.98 ? 438  TYR A CE1 1 
ATOM   1810  C  CE2 . TYR A  1 438  ? -5.610  4.477   12.616  1.00 247.74 ? 438  TYR A CE2 1 
ATOM   1811  C  CZ  . TYR A  1 438  ? -5.715  3.899   11.375  1.00 202.54 ? 438  TYR A CZ  1 
ATOM   1812  O  OH  . TYR A  1 438  ? -6.472  4.532   10.415  1.00 117.20 ? 438  TYR A OH  1 
ATOM   1813  N  N   . PHE A  1 439  ? -0.691  4.061   15.946  1.00 250.36 ? 439  PHE A N   1 
ATOM   1814  C  CA  . PHE A  1 439  ? -0.476  5.167   16.878  1.00 179.03 ? 439  PHE A CA  1 
ATOM   1815  C  C   . PHE A  1 439  ? -0.767  6.530   16.245  1.00 205.87 ? 439  PHE A C   1 
ATOM   1816  O  O   . PHE A  1 439  ? 0.065   7.084   15.526  1.00 274.58 ? 439  PHE A O   1 
ATOM   1817  C  CB  . PHE A  1 439  ? 0.965   5.151   17.388  1.00 148.83 ? 439  PHE A CB  1 
ATOM   1818  C  CG  . PHE A  1 439  ? 1.250   6.203   18.421  1.00 214.61 ? 439  PHE A CG  1 
ATOM   1819  C  CD1 . PHE A  1 439  ? 0.920   5.984   19.747  1.00 303.00 ? 439  PHE A CD1 1 
ATOM   1820  C  CD2 . PHE A  1 439  ? 1.844   7.408   18.071  1.00 141.79 ? 439  PHE A CD2 1 
ATOM   1821  C  CE1 . PHE A  1 439  ? 1.174   6.942   20.709  1.00 319.24 ? 439  PHE A CE1 1 
ATOM   1822  C  CE2 . PHE A  1 439  ? 2.101   8.371   19.029  1.00 231.28 ? 439  PHE A CE2 1 
ATOM   1823  C  CZ  . PHE A  1 439  ? 1.765   8.136   20.351  1.00 292.95 ? 439  PHE A CZ  1 
ATOM   1824  N  N   . GLY A  1 440  ? -1.944  7.072   16.533  1.00 79.97  ? 440  GLY A N   1 
ATOM   1825  C  CA  . GLY A  1 440  ? -2.370  8.338   15.964  1.00 131.81 ? 440  GLY A CA  1 
ATOM   1826  C  C   . GLY A  1 440  ? -3.868  8.364   15.718  1.00 154.65 ? 440  GLY A C   1 
ATOM   1827  O  O   . GLY A  1 440  ? -4.437  9.420   15.437  1.00 125.46 ? 440  GLY A O   1 
ATOM   1828  N  N   . ALA A  1 441  ? -4.505  7.198   15.819  1.00 145.43 ? 441  ALA A N   1 
ATOM   1829  C  CA  . ALA A  1 441  ? -5.948  7.072   15.618  1.00 141.12 ? 441  ALA A CA  1 
ATOM   1830  C  C   . ALA A  1 441  ? -6.729  8.222   16.260  1.00 209.65 ? 441  ALA A C   1 
ATOM   1831  O  O   . ALA A  1 441  ? -7.262  9.079   15.546  1.00 84.32  ? 441  ALA A O   1 
ATOM   1832  C  CB  . ALA A  1 441  ? -6.441  5.730   16.156  1.00 139.78 ? 441  ALA A CB  1 
ATOM   1833  N  N   . SER A  1 442  ? -6.781  8.230   17.596  1.00 270.95 ? 442  SER A N   1 
ATOM   1834  C  CA  . SER A  1 442  ? -7.552  9.212   18.366  1.00 201.61 ? 442  SER A CA  1 
ATOM   1835  C  C   . SER A  1 442  ? -6.657  10.161  19.131  1.00 142.75 ? 442  SER A C   1 
ATOM   1836  O  O   . SER A  1 442  ? -5.544  9.814   19.511  1.00 159.20 ? 442  SER A O   1 
ATOM   1837  C  CB  . SER A  1 442  ? -8.449  8.516   19.382  1.00 124.45 ? 442  SER A CB  1 
ATOM   1838  O  OG  . SER A  1 442  ? -9.320  7.600   18.759  1.00 208.27 ? 442  SER A OG  1 
ATOM   1839  N  N   . LEU A  1 443  ? -7.158  11.359  19.382  1.00 107.82 ? 443  LEU A N   1 
ATOM   1840  C  CA  . LEU A  1 443  ? -6.403  12.328  20.159  1.00 228.07 ? 443  LEU A CA  1 
ATOM   1841  C  C   . LEU A  1 443  ? -7.356  13.212  20.957  1.00 221.19 ? 443  LEU A C   1 
ATOM   1842  O  O   . LEU A  1 443  ? -8.445  13.551  20.481  1.00 137.42 ? 443  LEU A O   1 
ATOM   1843  C  CB  . LEU A  1 443  ? -5.479  13.169  19.257  1.00 215.98 ? 443  LEU A CB  1 
ATOM   1844  C  CG  . LEU A  1 443  ? -4.141  12.531  18.845  1.00 183.78 ? 443  LEU A CG  1 
ATOM   1845  C  CD1 . LEU A  1 443  ? -4.239  11.827  17.509  1.00 210.13 ? 443  LEU A CD1 1 
ATOM   1846  C  CD2 . LEU A  1 443  ? -3.036  13.575  18.786  1.00 172.86 ? 443  LEU A CD2 1 
ATOM   1847  N  N   . CYS A  1 444  ? -6.946  13.560  22.177  1.00 191.24 ? 444  CYS A N   1 
ATOM   1848  C  CA  . CYS A  1 444  ? -7.755  14.394  23.057  1.00 166.76 ? 444  CYS A CA  1 
ATOM   1849  C  C   . CYS A  1 444  ? -6.908  15.223  24.020  1.00 151.42 ? 444  CYS A C   1 
ATOM   1850  O  O   . CYS A  1 444  ? -6.297  14.682  24.939  1.00 120.49 ? 444  CYS A O   1 
ATOM   1851  C  CB  . CYS A  1 444  ? -8.720  13.526  23.856  1.00 110.64 ? 444  CYS A CB  1 
ATOM   1852  S  SG  . CYS A  1 444  ? -9.613  14.440  25.108  1.00 177.28 ? 444  CYS A SG  1 
ATOM   1853  N  N   . SER A  1 445  ? -6.891  16.537  23.800  1.00 162.17 ? 445  SER A N   1 
ATOM   1854  C  CA  . SER A  1 445  ? -6.235  17.477  24.701  1.00 162.99 ? 445  SER A CA  1 
ATOM   1855  C  C   . SER A  1 445  ? -7.119  17.678  25.919  1.00 199.68 ? 445  SER A C   1 
ATOM   1856  O  O   . SER A  1 445  ? -8.243  18.173  25.814  1.00 243.94 ? 445  SER A O   1 
ATOM   1857  C  CB  . SER A  1 445  ? -6.000  18.822  24.012  1.00 176.88 ? 445  SER A CB  1 
ATOM   1858  O  OG  . SER A  1 445  ? -7.222  19.386  23.572  1.00 254.62 ? 445  SER A OG  1 
ATOM   1859  N  N   . VAL A  1 446  ? -6.604  17.293  27.078  1.00 190.88 ? 446  VAL A N   1 
ATOM   1860  C  CA  . VAL A  1 446  ? -7.384  17.330  28.298  1.00 181.93 ? 446  VAL A CA  1 
ATOM   1861  C  C   . VAL A  1 446  ? -6.669  18.175  29.349  1.00 178.12 ? 446  VAL A C   1 
ATOM   1862  O  O   . VAL A  1 446  ? -5.465  18.416  29.258  1.00 115.75 ? 446  VAL A O   1 
ATOM   1863  C  CB  . VAL A  1 446  ? -7.622  15.908  28.821  1.00 172.37 ? 446  VAL A CB  1 
ATOM   1864  C  CG1 . VAL A  1 446  ? -6.397  15.418  29.572  1.00 99.65  ? 446  VAL A CG1 1 
ATOM   1865  C  CG2 . VAL A  1 446  ? -8.863  15.863  29.686  1.00 232.32 ? 446  VAL A CG2 1 
ATOM   1866  N  N   . ASP A  1 447  ? -7.424  18.606  30.352  1.00 224.81 ? 447  ASP A N   1 
ATOM   1867  C  CA  . ASP A  1 447  ? -6.959  19.593  31.321  1.00 192.72 ? 447  ASP A CA  1 
ATOM   1868  C  C   . ASP A  1 447  ? -6.937  19.029  32.749  1.00 218.09 ? 447  ASP A C   1 
ATOM   1869  O  O   . ASP A  1 447  ? -7.927  19.131  33.474  1.00 275.60 ? 447  ASP A O   1 
ATOM   1870  C  CB  . ASP A  1 447  ? -7.885  20.811  31.243  1.00 190.16 ? 447  ASP A CB  1 
ATOM   1871  C  CG  . ASP A  1 447  ? -7.455  21.939  32.147  1.00 211.80 ? 447  ASP A CG  1 
ATOM   1872  O  OD1 . ASP A  1 447  ? -7.085  21.664  33.307  1.00 274.71 ? 447  ASP A OD1 1 
ATOM   1873  O  OD2 . ASP A  1 447  ? -7.490  23.105  31.694  1.00 120.30 ? 447  ASP A OD2 1 
ATOM   1874  N  N   . VAL A  1 448  ? -5.801  18.455  33.153  1.00 156.94 ? 448  VAL A N   1 
ATOM   1875  C  CA  . VAL A  1 448  ? -5.701  17.752  34.430  1.00 175.58 ? 448  VAL A CA  1 
ATOM   1876  C  C   . VAL A  1 448  ? -6.346  18.562  35.543  1.00 204.69 ? 448  VAL A C   1 
ATOM   1877  O  O   . VAL A  1 448  ? -7.014  18.009  36.416  1.00 218.01 ? 448  VAL A O   1 
ATOM   1878  C  CB  . VAL A  1 448  ? -4.238  17.454  34.793  1.00 205.55 ? 448  VAL A CB  1 
ATOM   1879  C  CG1 . VAL A  1 448  ? -3.440  18.738  34.831  1.00 274.93 ? 448  VAL A CG1 1 
ATOM   1880  C  CG2 . VAL A  1 448  ? -4.161  16.717  36.124  1.00 259.84 ? 448  VAL A CG2 1 
ATOM   1881  N  N   . ASP A  1 449  ? -6.147  19.875  35.499  1.00 199.85 ? 449  ASP A N   1 
ATOM   1882  C  CA  . ASP A  1 449  ? -6.739  20.784  36.478  1.00 190.88 ? 449  ASP A CA  1 
ATOM   1883  C  C   . ASP A  1 449  ? -7.892  21.587  35.864  1.00 186.62 ? 449  ASP A C   1 
ATOM   1884  O  O   . ASP A  1 449  ? -8.779  21.013  35.230  1.00 214.14 ? 449  ASP A O   1 
ATOM   1885  C  CB  . ASP A  1 449  ? -5.663  21.708  37.069  1.00 166.36 ? 449  ASP A CB  1 
ATOM   1886  C  CG  . ASP A  1 449  ? -4.771  22.327  36.011  1.00 117.23 ? 449  ASP A CG  1 
ATOM   1887  O  OD1 . ASP A  1 449  ? -5.245  22.534  34.880  1.00 173.46 ? 449  ASP A OD1 1 
ATOM   1888  O  OD2 . ASP A  1 449  ? -3.594  22.615  36.312  1.00 152.61 ? 449  ASP A OD2 1 
ATOM   1889  N  N   . SER A  1 450  ? -7.879  22.906  36.054  1.00 138.32 ? 450  SER A N   1 
ATOM   1890  C  CA  . SER A  1 450  ? -8.925  23.779  35.527  1.00 155.92 ? 450  SER A CA  1 
ATOM   1891  C  C   . SER A  1 450  ? -8.364  25.173  35.244  1.00 138.20 ? 450  SER A C   1 
ATOM   1892  O  O   . SER A  1 450  ? -9.097  26.162  35.255  1.00 202.41 ? 450  SER A O   1 
ATOM   1893  C  CB  . SER A  1 450  ? -10.085 23.875  36.520  1.00 251.46 ? 450  SER A CB  1 
ATOM   1894  O  OG  . SER A  1 450  ? -10.763 22.637  36.653  1.00 302.52 ? 450  SER A OG  1 
ATOM   1895  N  N   . ASP A  1 451  ? -7.061  25.242  34.989  1.00 153.64 ? 451  ASP A N   1 
ATOM   1896  C  CA  . ASP A  1 451  ? -6.390  26.516  34.747  1.00 213.53 ? 451  ASP A CA  1 
ATOM   1897  C  C   . ASP A  1 451  ? -6.673  27.023  33.343  1.00 173.60 ? 451  ASP A C   1 
ATOM   1898  O  O   . ASP A  1 451  ? -6.300  28.141  32.989  1.00 145.11 ? 451  ASP A O   1 
ATOM   1899  C  CB  . ASP A  1 451  ? -4.876  26.394  34.981  1.00 235.63 ? 451  ASP A CB  1 
ATOM   1900  C  CG  . ASP A  1 451  ? -4.192  25.468  33.985  1.00 157.24 ? 451  ASP A CG  1 
ATOM   1901  O  OD1 . ASP A  1 451  ? -4.899  24.757  33.242  1.00 175.35 ? 451  ASP A OD1 1 
ATOM   1902  O  OD2 . ASP A  1 451  ? -2.942  25.447  33.950  1.00 109.62 ? 451  ASP A OD2 1 
ATOM   1903  N  N   . GLY A  1 452  ? -7.327  26.188  32.544  1.00 183.64 ? 452  GLY A N   1 
ATOM   1904  C  CA  . GLY A  1 452  ? -7.768  26.590  31.225  1.00 196.91 ? 452  GLY A CA  1 
ATOM   1905  C  C   . GLY A  1 452  ? -6.700  26.455  30.155  1.00 214.13 ? 452  GLY A C   1 
ATOM   1906  O  O   . GLY A  1 452  ? -6.998  26.585  28.969  1.00 196.45 ? 452  GLY A O   1 
ATOM   1907  N  N   . SER A  1 453  ? -5.454  26.220  30.567  1.00 211.53 ? 453  SER A N   1 
ATOM   1908  C  CA  . SER A  1 453  ? -4.367  25.930  29.630  1.00 153.70 ? 453  SER A CA  1 
ATOM   1909  C  C   . SER A  1 453  ? -4.228  24.418  29.485  1.00 202.31 ? 453  SER A C   1 
ATOM   1910  O  O   . SER A  1 453  ? -4.066  23.719  30.479  1.00 213.46 ? 453  SER A O   1 
ATOM   1911  C  CB  . SER A  1 453  ? -3.038  26.517  30.125  1.00 158.57 ? 453  SER A CB  1 
ATOM   1912  O  OG  . SER A  1 453  ? -3.114  27.919  30.317  1.00 230.05 ? 453  SER A OG  1 
ATOM   1913  N  N   . THR A  1 454  ? -4.281  23.916  28.254  1.00 257.45 ? 454  THR A N   1 
ATOM   1914  C  CA  . THR A  1 454  ? -4.199  22.474  28.009  1.00 244.28 ? 454  THR A CA  1 
ATOM   1915  C  C   . THR A  1 454  ? -2.877  21.907  28.516  1.00 212.30 ? 454  THR A C   1 
ATOM   1916  O  O   . THR A  1 454  ? -1.798  22.360  28.128  1.00 118.55 ? 454  THR A O   1 
ATOM   1917  C  CB  . THR A  1 454  ? -4.357  22.139  26.513  1.00 203.23 ? 454  THR A CB  1 
ATOM   1918  O  OG1 . THR A  1 454  ? -5.724  22.318  26.123  1.00 220.59 ? 454  THR A OG1 1 
ATOM   1919  C  CG2 . THR A  1 454  ? -3.954  20.703  26.235  1.00 123.28 ? 454  THR A CG2 1 
ATOM   1920  N  N   . ASP A  1 455  ? -2.974  20.894  29.369  1.00 229.53 ? 455  ASP A N   1 
ATOM   1921  C  CA  . ASP A  1 455  ? -1.814  20.383  30.086  1.00 192.43 ? 455  ASP A CA  1 
ATOM   1922  C  C   . ASP A  1 455  ? -1.203  19.167  29.416  1.00 143.98 ? 455  ASP A C   1 
ATOM   1923  O  O   . ASP A  1 455  ? 0.016   19.016  29.394  1.00 156.79 ? 455  ASP A O   1 
ATOM   1924  C  CB  . ASP A  1 455  ? -2.193  20.032  31.526  1.00 203.56 ? 455  ASP A CB  1 
ATOM   1925  C  CG  . ASP A  1 455  ? -1.924  21.173  32.497  1.00 236.03 ? 455  ASP A CG  1 
ATOM   1926  O  OD1 . ASP A  1 455  ? -1.417  22.230  32.063  1.00 282.03 ? 455  ASP A OD1 1 
ATOM   1927  O  OD2 . ASP A  1 455  ? -2.235  21.019  33.697  1.00 185.05 ? 455  ASP A OD2 1 
ATOM   1928  N  N   . LEU A  1 456  ? -2.044  18.293  28.881  1.00 180.53 ? 456  LEU A N   1 
ATOM   1929  C  CA  . LEU A  1 456  ? -1.550  17.065  28.269  1.00 191.20 ? 456  LEU A CA  1 
ATOM   1930  C  C   . LEU A  1 456  ? -2.457  16.615  27.134  1.00 198.91 ? 456  LEU A C   1 
ATOM   1931  O  O   . LEU A  1 456  ? -3.476  17.248  26.851  1.00 208.16 ? 456  LEU A O   1 
ATOM   1932  C  CB  . LEU A  1 456  ? -1.414  15.963  29.325  1.00 155.75 ? 456  LEU A CB  1 
ATOM   1933  C  CG  . LEU A  1 456  ? -2.705  15.625  30.076  1.00 228.32 ? 456  LEU A CG  1 
ATOM   1934  C  CD1 . LEU A  1 456  ? -3.431  14.468  29.392  1.00 149.10 ? 456  LEU A CD1 1 
ATOM   1935  C  CD2 . LEU A  1 456  ? -2.409  15.289  31.534  1.00 294.25 ? 456  LEU A CD2 1 
ATOM   1936  N  N   . VAL A  1 457  ? -2.076  15.518  26.486  1.00 178.21 ? 457  VAL A N   1 
ATOM   1937  C  CA  . VAL A  1 457  ? -2.757  15.068  25.281  1.00 176.36 ? 457  VAL A CA  1 
ATOM   1938  C  C   . VAL A  1 457  ? -2.730  13.556  25.126  1.00 173.65 ? 457  VAL A C   1 
ATOM   1939  O  O   . VAL A  1 457  ? -1.672  12.932  25.215  1.00 128.77 ? 457  VAL A O   1 
ATOM   1940  C  CB  . VAL A  1 457  ? -2.101  15.668  24.046  1.00 191.95 ? 457  VAL A CB  1 
ATOM   1941  C  CG1 . VAL A  1 457  ? -2.557  14.936  22.796  1.00 176.12 ? 457  VAL A CG1 1 
ATOM   1942  C  CG2 . VAL A  1 457  ? -2.408  17.160  23.957  1.00 240.61 ? 457  VAL A CG2 1 
ATOM   1943  N  N   . LEU A  1 458  ? -3.901  12.982  24.864  1.00 195.33 ? 458  LEU A N   1 
ATOM   1944  C  CA  . LEU A  1 458  ? -4.049  11.539  24.746  1.00 185.74 ? 458  LEU A CA  1 
ATOM   1945  C  C   . LEU A  1 458  ? -3.928  11.112  23.295  1.00 174.18 ? 458  LEU A C   1 
ATOM   1946  O  O   . LEU A  1 458  ? -4.114  11.919  22.391  1.00 206.23 ? 458  LEU A O   1 
ATOM   1947  C  CB  . LEU A  1 458  ? -5.402  11.098  25.298  1.00 159.70 ? 458  LEU A CB  1 
ATOM   1948  C  CG  . LEU A  1 458  ? -5.615  11.462  26.762  1.00 140.90 ? 458  LEU A CG  1 
ATOM   1949  C  CD1 . LEU A  1 458  ? -7.045  11.202  27.165  1.00 151.93 ? 458  LEU A CD1 1 
ATOM   1950  C  CD2 . LEU A  1 458  ? -4.651  10.685  27.642  1.00 180.21 ? 458  LEU A CD2 1 
ATOM   1951  N  N   . ILE A  1 459  ? -3.621  9.836   23.080  1.00 195.13 ? 459  ILE A N   1 
ATOM   1952  C  CA  . ILE A  1 459  ? -3.456  9.292   21.733  1.00 192.27 ? 459  ILE A CA  1 
ATOM   1953  C  C   . ILE A  1 459  ? -4.062  7.887   21.675  1.00 198.25 ? 459  ILE A C   1 
ATOM   1954  O  O   . ILE A  1 459  ? -4.181  7.219   22.699  1.00 269.59 ? 459  ILE A O   1 
ATOM   1955  C  CB  . ILE A  1 459  ? -1.963  9.265   21.314  1.00 171.32 ? 459  ILE A CB  1 
ATOM   1956  C  CG1 . ILE A  1 459  ? -1.417  10.692  21.198  1.00 166.93 ? 459  ILE A CG1 1 
ATOM   1957  C  CG2 . ILE A  1 459  ? -1.781  8.551   19.988  1.00 235.04 ? 459  ILE A CG2 1 
ATOM   1958  C  CD1 . ILE A  1 459  ? 0.077   10.770  20.928  1.00 183.18 ? 459  ILE A CD1 1 
ATOM   1959  N  N   . GLY A  1 460  ? -4.460  7.449   20.485  1.00 96.10  ? 460  GLY A N   1 
ATOM   1960  C  CA  . GLY A  1 460  ? -5.124  6.164   20.322  1.00 137.49 ? 460  GLY A CA  1 
ATOM   1961  C  C   . GLY A  1 460  ? -4.338  5.170   19.483  1.00 227.23 ? 460  GLY A C   1 
ATOM   1962  O  O   . GLY A  1 460  ? -3.554  5.556   18.620  1.00 304.31 ? 460  GLY A O   1 
ATOM   1963  N  N   . ALA A  1 461  ? -4.550  3.882   19.735  1.00 199.14 ? 461  ALA A N   1 
ATOM   1964  C  CA  . ALA A  1 461  ? -3.883  2.827   18.973  1.00 167.74 ? 461  ALA A CA  1 
ATOM   1965  C  C   . ALA A  1 461  ? -4.559  1.486   19.218  1.00 177.53 ? 461  ALA A C   1 
ATOM   1966  O  O   . ALA A  1 461  ? -3.925  0.536   19.675  1.00 197.69 ? 461  ALA A O   1 
ATOM   1967  C  CB  . ALA A  1 461  ? -2.422  2.750   19.352  1.00 167.23 ? 461  ALA A CB  1 
ATOM   1968  N  N   . PRO A  1 462  ? -5.858  1.409   18.902  1.00 186.01 ? 462  PRO A N   1 
ATOM   1969  C  CA  . PRO A  1 462  ? -6.740  0.272   19.200  1.00 212.89 ? 462  PRO A CA  1 
ATOM   1970  C  C   . PRO A  1 462  ? -6.160  -1.076  18.809  1.00 202.11 ? 462  PRO A C   1 
ATOM   1971  O  O   . PRO A  1 462  ? -6.513  -2.102  19.393  1.00 221.76 ? 462  PRO A O   1 
ATOM   1972  C  CB  . PRO A  1 462  ? -7.984  0.568   18.361  1.00 146.03 ? 462  PRO A CB  1 
ATOM   1973  C  CG  . PRO A  1 462  ? -8.000  2.051   18.230  1.00 160.41 ? 462  PRO A CG  1 
ATOM   1974  C  CD  . PRO A  1 462  ? -6.565  2.487   18.192  1.00 110.10 ? 462  PRO A CD  1 
ATOM   1975  N  N   . HIS A  1 463  ? -5.275  -1.070  17.825  1.00 159.83 ? 463  HIS A N   1 
ATOM   1976  C  CA  . HIS A  1 463  ? -4.733  -2.308  17.304  1.00 202.69 ? 463  HIS A CA  1 
ATOM   1977  C  C   . HIS A  1 463  ? -3.279  -2.443  17.689  1.00 220.08 ? 463  HIS A C   1 
ATOM   1978  O  O   . HIS A  1 463  ? -2.400  -2.475  16.828  1.00 232.19 ? 463  HIS A O   1 
ATOM   1979  C  CB  . HIS A  1 463  ? -4.871  -2.338  15.787  1.00 231.46 ? 463  HIS A CB  1 
ATOM   1980  C  CG  . HIS A  1 463  ? -6.210  -1.876  15.303  1.00 232.41 ? 463  HIS A CG  1 
ATOM   1981  N  ND1 . HIS A  1 463  ? -7.371  -2.564  15.561  1.00 208.04 ? 463  HIS A ND1 1 
ATOM   1982  C  CD2 . HIS A  1 463  ? -6.564  -0.785  14.580  1.00 192.68 ? 463  HIS A CD2 1 
ATOM   1983  C  CE1 . HIS A  1 463  ? -8.393  -1.921  15.016  1.00 164.36 ? 463  HIS A CE1 1 
ATOM   1984  N  NE2 . HIS A  1 463  ? -7.927  -0.842  14.416  1.00 169.94 ? 463  HIS A NE2 1 
ATOM   1985  N  N   . TYR A  1 464  ? -3.030  -2.521  18.990  1.00 185.57 ? 464  TYR A N   1 
ATOM   1986  C  CA  . TYR A  1 464  ? -1.671  -2.650  19.494  1.00 198.48 ? 464  TYR A CA  1 
ATOM   1987  C  C   . TYR A  1 464  ? -1.599  -3.757  20.537  1.00 170.46 ? 464  TYR A C   1 
ATOM   1988  O  O   . TYR A  1 464  ? -2.624  -4.147  21.100  1.00 183.05 ? 464  TYR A O   1 
ATOM   1989  C  CB  . TYR A  1 464  ? -1.203  -1.319  20.082  1.00 175.21 ? 464  TYR A CB  1 
ATOM   1990  C  CG  . TYR A  1 464  ? 0.126   -1.391  20.800  1.00 213.89 ? 464  TYR A CG  1 
ATOM   1991  C  CD1 . TYR A  1 464  ? 1.312   -1.600  20.106  1.00 281.09 ? 464  TYR A CD1 1 
ATOM   1992  C  CD2 . TYR A  1 464  ? 0.196   -1.236  22.173  1.00 221.18 ? 464  TYR A CD2 1 
ATOM   1993  C  CE1 . TYR A  1 464  ? 2.523   -1.661  20.766  1.00 262.97 ? 464  TYR A CE1 1 
ATOM   1994  C  CE2 . TYR A  1 464  ? 1.401   -1.293  22.838  1.00 236.07 ? 464  TYR A CE2 1 
ATOM   1995  C  CZ  . TYR A  1 464  ? 2.560   -1.506  22.128  1.00 214.31 ? 464  TYR A CZ  1 
ATOM   1996  O  OH  . TYR A  1 464  ? 3.763   -1.565  22.783  1.00 207.83 ? 464  TYR A OH  1 
ATOM   1997  N  N   . TYR A  1 465  ? -0.394  -4.274  20.776  1.00 216.84 ? 465  TYR A N   1 
ATOM   1998  C  CA  . TYR A  1 465  ? -0.203  -5.330  21.766  1.00 309.64 ? 465  TYR A CA  1 
ATOM   1999  C  C   . TYR A  1 465  ? 1.251   -5.783  21.913  1.00 363.22 ? 465  TYR A C   1 
ATOM   2000  O  O   . TYR A  1 465  ? 2.163   -5.229  21.298  1.00 366.83 ? 465  TYR A O   1 
ATOM   2001  C  CB  . TYR A  1 465  ? -1.054  -6.544  21.398  1.00 293.15 ? 465  TYR A CB  1 
ATOM   2002  C  CG  . TYR A  1 465  ? -0.541  -7.295  20.192  1.00 253.57 ? 465  TYR A CG  1 
ATOM   2003  C  CD1 . TYR A  1 465  ? -0.741  -6.809  18.908  1.00 195.19 ? 465  TYR A CD1 1 
ATOM   2004  C  CD2 . TYR A  1 465  ? 0.142   -8.494  20.339  1.00 313.79 ? 465  TYR A CD2 1 
ATOM   2005  C  CE1 . TYR A  1 465  ? -0.271  -7.494  17.804  1.00 286.40 ? 465  TYR A CE1 1 
ATOM   2006  C  CE2 . TYR A  1 465  ? 0.615   -9.187  19.240  1.00 330.50 ? 465  TYR A CE2 1 
ATOM   2007  C  CZ  . TYR A  1 465  ? 0.406   -8.683  17.974  1.00 340.73 ? 465  TYR A CZ  1 
ATOM   2008  O  OH  . TYR A  1 465  ? 0.874   -9.368  16.874  1.00 364.42 ? 465  TYR A OH  1 
ATOM   2009  N  N   . GLU A  1 466  ? 1.441   -6.797  22.751  1.00 380.65 ? 466  GLU A N   1 
ATOM   2010  C  CA  . GLU A  1 466  ? 2.716   -7.491  22.893  1.00 366.06 ? 466  GLU A CA  1 
ATOM   2011  C  C   . GLU A  1 466  ? 2.432   -8.925  23.320  1.00 377.78 ? 466  GLU A C   1 
ATOM   2012  O  O   . GLU A  1 466  ? 3.107   -9.860  22.892  1.00 419.44 ? 466  GLU A O   1 
ATOM   2013  C  CB  . GLU A  1 466  ? 3.605   -6.810  23.929  1.00 313.36 ? 466  GLU A CB  1 
ATOM   2014  C  CG  . GLU A  1 466  ? 3.035   -6.828  25.329  1.00 296.72 ? 466  GLU A CG  1 
ATOM   2015  C  CD  . GLU A  1 466  ? 3.983   -6.228  26.337  1.00 332.87 ? 466  GLU A CD  1 
ATOM   2016  O  OE1 . GLU A  1 466  ? 5.083   -5.800  25.930  1.00 339.64 ? 466  GLU A OE1 1 
ATOM   2017  O  OE2 . GLU A  1 466  ? 3.632   -6.186  27.534  1.00 363.59 ? 466  GLU A OE2 1 
ATOM   2018  N  N   . GLN A  1 467  ? 1.432   -9.082  24.180  1.00 332.50 ? 467  GLN A N   1 
ATOM   2019  C  CA  . GLN A  1 467  ? 0.936   -10.396 24.559  1.00 329.61 ? 467  GLN A CA  1 
ATOM   2020  C  C   . GLN A  1 467  ? -0.596  -10.405 24.571  1.00 301.42 ? 467  GLN A C   1 
ATOM   2021  O  O   . GLN A  1 467  ? -1.220  -11.409 24.232  1.00 302.69 ? 467  GLN A O   1 
ATOM   2022  C  CB  . GLN A  1 467  ? 1.484   -10.791 25.930  1.00 341.95 ? 467  GLN A CB  1 
ATOM   2023  C  CG  . GLN A  1 467  ? 3.006   -10.815 26.012  1.00 324.23 ? 467  GLN A CG  1 
ATOM   2024  C  CD  . GLN A  1 467  ? 3.624   -11.903 25.154  1.00 344.63 ? 467  GLN A CD  1 
ATOM   2025  O  OE1 . GLN A  1 467  ? 2.917   -12.662 24.491  1.00 344.19 ? 467  GLN A OE1 1 
ATOM   2026  N  NE2 . GLN A  1 467  ? 4.950   -11.987 25.167  1.00 368.82 ? 467  GLN A NE2 1 
ATOM   2027  N  N   . THR A  1 468  ? -1.195  -9.283  24.961  1.00 258.34 ? 468  THR A N   1 
ATOM   2028  C  CA  . THR A  1 468  ? -2.651  -9.144  24.971  1.00 236.44 ? 468  THR A CA  1 
ATOM   2029  C  C   . THR A  1 468  ? -3.080  -7.946  24.132  1.00 272.69 ? 468  THR A C   1 
ATOM   2030  O  O   . THR A  1 468  ? -2.618  -6.830  24.356  1.00 289.87 ? 468  THR A O   1 
ATOM   2031  C  CB  . THR A  1 468  ? -3.177  -8.952  26.395  1.00 201.83 ? 468  THR A CB  1 
ATOM   2032  O  OG1 . THR A  1 468  ? -2.812  -10.082 27.192  1.00 209.36 ? 468  THR A OG1 1 
ATOM   2033  C  CG2 . THR A  1 468  ? -4.683  -8.814  26.393  1.00 137.81 ? 468  THR A CG2 1 
ATOM   2034  N  N   . ARG A  1 469  ? -3.972  -8.178  23.174  1.00 294.49 ? 469  ARG A N   1 
ATOM   2035  C  CA  . ARG A  1 469  ? -4.351  -7.143  22.215  1.00 307.47 ? 469  ARG A CA  1 
ATOM   2036  C  C   . ARG A  1 469  ? -5.552  -6.331  22.677  1.00 290.22 ? 469  ARG A C   1 
ATOM   2037  O  O   . ARG A  1 469  ? -6.482  -6.089  21.909  1.00 290.70 ? 469  ARG A O   1 
ATOM   2038  C  CB  . ARG A  1 469  ? -4.641  -7.762  20.844  1.00 266.45 ? 469  ARG A CB  1 
ATOM   2039  C  CG  . ARG A  1 469  ? -3.422  -7.882  19.947  1.00 205.89 ? 469  ARG A CG  1 
ATOM   2040  C  CD  . ARG A  1 469  ? -3.749  -8.571  18.635  1.00 236.13 ? 469  ARG A CD  1 
ATOM   2041  N  NE  . ARG A  1 469  ? -4.147  -9.963  18.829  1.00 286.21 ? 469  ARG A NE  1 
ATOM   2042  C  CZ  . ARG A  1 469  ? -3.315  -10.999 18.789  1.00 256.00 ? 469  ARG A CZ  1 
ATOM   2043  N  NH1 . ARG A  1 469  ? -2.023  -10.813 18.559  1.00 163.38 ? 469  ARG A NH1 1 
ATOM   2044  N  NH2 . ARG A  1 469  ? -3.775  -12.228 18.980  1.00 285.12 ? 469  ARG A NH2 1 
ATOM   2045  N  N   . GLY A  1 470  ? -5.525  -5.896  23.929  1.00 208.08 ? 470  GLY A N   1 
ATOM   2046  C  CA  . GLY A  1 470  ? -6.607  -5.093  24.452  1.00 195.26 ? 470  GLY A CA  1 
ATOM   2047  C  C   . GLY A  1 470  ? -6.765  -3.796  23.683  1.00 226.44 ? 470  GLY A C   1 
ATOM   2048  O  O   . GLY A  1 470  ? -7.874  -3.389  23.340  1.00 205.33 ? 470  GLY A O   1 
ATOM   2049  N  N   . GLY A  1 471  ? -5.643  -3.151  23.394  1.00 212.05 ? 471  GLY A N   1 
ATOM   2050  C  CA  . GLY A  1 471  ? -5.654  -1.830  22.798  1.00 121.44 ? 471  GLY A CA  1 
ATOM   2051  C  C   . GLY A  1 471  ? -4.585  -0.974  23.443  1.00 167.04 ? 471  GLY A C   1 
ATOM   2052  O  O   . GLY A  1 471  ? -3.751  -1.491  24.182  1.00 251.93 ? 471  GLY A O   1 
ATOM   2053  N  N   . GLN A  1 472  ? -4.600  0.329   23.179  1.00 145.51 ? 472  GLN A N   1 
ATOM   2054  C  CA  . GLN A  1 472  ? -3.591  1.220   23.740  1.00 150.80 ? 472  GLN A CA  1 
ATOM   2055  C  C   . GLN A  1 472  ? -3.937  2.693   23.573  1.00 146.44 ? 472  GLN A C   1 
ATOM   2056  O  O   . GLN A  1 472  ? -4.142  3.178   22.463  1.00 234.40 ? 472  GLN A O   1 
ATOM   2057  C  CB  . GLN A  1 472  ? -2.222  0.946   23.104  1.00 188.51 ? 472  GLN A CB  1 
ATOM   2058  C  CG  . GLN A  1 472  ? -1.063  1.622   23.827  1.00 123.61 ? 472  GLN A CG  1 
ATOM   2059  C  CD  . GLN A  1 472  ? -0.949  1.170   25.261  1.00 321.77 ? 472  GLN A CD  1 
ATOM   2060  O  OE1 . GLN A  1 472  ? -0.278  0.185   25.562  1.00 371.09 ? 472  GLN A OE1 1 
ATOM   2061  N  NE2 . GLN A  1 472  ? -1.606  1.890   26.158  1.00 424.07 ? 472  GLN A NE2 1 
ATOM   2062  N  N   . VAL A  1 473  ? -3.990  3.398   24.695  1.00 131.78 ? 473  VAL A N   1 
ATOM   2063  C  CA  . VAL A  1 473  ? -4.067  4.850   24.699  1.00 148.23 ? 473  VAL A CA  1 
ATOM   2064  C  C   . VAL A  1 473  ? -2.803  5.398   25.366  1.00 160.87 ? 473  VAL A C   1 
ATOM   2065  O  O   . VAL A  1 473  ? -2.300  4.814   26.324  1.00 285.89 ? 473  VAL A O   1 
ATOM   2066  C  CB  . VAL A  1 473  ? -5.317  5.337   25.444  1.00 189.86 ? 473  VAL A CB  1 
ATOM   2067  C  CG1 . VAL A  1 473  ? -5.373  6.865   25.471  1.00 136.31 ? 473  VAL A CG1 1 
ATOM   2068  C  CG2 . VAL A  1 473  ? -6.565  4.756   24.803  1.00 200.19 ? 473  VAL A CG2 1 
ATOM   2069  N  N   . SER A  1 474  ? -2.293  6.516   24.861  1.00 130.57 ? 474  SER A N   1 
ATOM   2070  C  CA  . SER A  1 474  ? -1.013  7.062   25.312  1.00 181.80 ? 474  SER A CA  1 
ATOM   2071  C  C   . SER A  1 474  ? -1.157  8.493   25.846  1.00 212.66 ? 474  SER A C   1 
ATOM   2072  O  O   . SER A  1 474  ? -1.649  9.379   25.144  1.00 194.49 ? 474  SER A O   1 
ATOM   2073  C  CB  . SER A  1 474  ? -0.002  7.035   24.158  1.00 212.14 ? 474  SER A CB  1 
ATOM   2074  O  OG  . SER A  1 474  ? 1.193   7.729   24.481  1.00 216.09 ? 474  SER A OG  1 
ATOM   2075  N  N   . VAL A  1 475  ? -0.727  8.711   27.089  1.00 225.27 ? 475  VAL A N   1 
ATOM   2076  C  CA  . VAL A  1 475  ? -0.731  10.046  27.685  1.00 207.56 ? 475  VAL A CA  1 
ATOM   2077  C  C   . VAL A  1 475  ? 0.568   10.778  27.372  1.00 211.80 ? 475  VAL A C   1 
ATOM   2078  O  O   . VAL A  1 475  ? 1.662   10.253  27.585  1.00 201.28 ? 475  VAL A O   1 
ATOM   2079  C  CB  . VAL A  1 475  ? -0.922  9.999   29.213  1.00 191.60 ? 475  VAL A CB  1 
ATOM   2080  C  CG1 . VAL A  1 475  ? 0.219   9.243   29.878  1.00 222.20 ? 475  VAL A CG1 1 
ATOM   2081  C  CG2 . VAL A  1 475  ? -1.039  11.412  29.768  1.00 189.42 ? 475  VAL A CG2 1 
ATOM   2082  N  N   . CYS A  1 476  ? 0.436   12.004  26.880  1.00 197.19 ? 476  CYS A N   1 
ATOM   2083  C  CA  . CYS A  1 476  ? 1.574   12.742  26.371  1.00 151.59 ? 476  CYS A CA  1 
ATOM   2084  C  C   . CYS A  1 476  ? 1.410   14.211  26.687  1.00 160.46 ? 476  CYS A C   1 
ATOM   2085  O  O   . CYS A  1 476  ? 0.763   14.942  25.941  1.00 257.68 ? 476  CYS A O   1 
ATOM   2086  C  CB  . CYS A  1 476  ? 1.695   12.540  24.864  1.00 184.55 ? 476  CYS A CB  1 
ATOM   2087  S  SG  . CYS A  1 476  ? 1.749   10.795  24.362  1.00 197.72 ? 476  CYS A SG  1 
ATOM   2088  N  N   . PRO A  1 477  ? 1.996   14.651  27.807  1.00 128.33 ? 477  PRO A N   1 
ATOM   2089  C  CA  . PRO A  1 477  ? 1.944   16.063  28.196  1.00 174.17 ? 477  PRO A CA  1 
ATOM   2090  C  C   . PRO A  1 477  ? 2.525   16.961  27.111  1.00 206.87 ? 477  PRO A C   1 
ATOM   2091  O  O   . PRO A  1 477  ? 3.106   16.435  26.162  1.00 230.79 ? 477  PRO A O   1 
ATOM   2092  C  CB  . PRO A  1 477  ? 2.839   16.122  29.428  1.00 198.43 ? 477  PRO A CB  1 
ATOM   2093  C  CG  . PRO A  1 477  ? 2.837   14.762  29.964  1.00 224.34 ? 477  PRO A CG  1 
ATOM   2094  C  CD  . PRO A  1 477  ? 2.753   13.851  28.778  1.00 141.82 ? 477  PRO A CD  1 
ATOM   2095  N  N   . LEU A  1 478  ? 2.317   18.270  27.249  1.00 231.82 ? 478  LEU A N   1 
ATOM   2096  C  CA  . LEU A  1 478  ? 2.640   19.261  26.219  1.00 208.90 ? 478  LEU A CA  1 
ATOM   2097  C  C   . LEU A  1 478  ? 3.805   20.161  26.682  1.00 249.78 ? 478  LEU A C   1 
ATOM   2098  O  O   . LEU A  1 478  ? 3.623   21.344  26.904  1.00 354.39 ? 478  LEU A O   1 
ATOM   2099  C  CB  . LEU A  1 478  ? 1.442   20.172  26.068  1.00 227.98 ? 478  LEU A CB  1 
ATOM   2100  C  CG  . LEU A  1 478  ? 0.586   20.640  24.812  1.00 243.18 ? 478  LEU A CG  1 
ATOM   2101  C  CD1 . LEU A  1 478  ? 1.485   21.212  24.064  1.00 241.99 ? 478  LEU A CD1 1 
ATOM   2102  C  CD2 . LEU A  1 478  ? 0.031   19.658  24.014  1.00 285.64 ? 478  LEU A CD2 1 
ATOM   2103  N  N   . PRO A  1 479  ? 5.012   19.605  26.873  1.00 187.47 ? 479  PRO A N   1 
ATOM   2104  C  CA  . PRO A  1 479  ? 6.201   20.411  27.194  1.00 206.21 ? 479  PRO A CA  1 
ATOM   2105  C  C   . PRO A  1 479  ? 6.331   21.617  26.264  1.00 215.15 ? 479  PRO A C   1 
ATOM   2106  O  O   . PRO A  1 479  ? 6.012   21.485  25.085  1.00 232.23 ? 479  PRO A O   1 
ATOM   2107  C  CB  . PRO A  1 479  ? 7.343   19.428  26.961  1.00 179.84 ? 479  PRO A CB  1 
ATOM   2108  C  CG  . PRO A  1 479  ? 6.742   18.101  27.279  1.00 201.61 ? 479  PRO A CG  1 
ATOM   2109  C  CD  . PRO A  1 479  ? 5.293   18.168  26.929  1.00 154.72 ? 479  PRO A CD  1 
ATOM   2110  N  N   . ARG A  1 480  ? 6.733   22.773  26.791  1.00 237.37 ? 480  ARG A N   1 
ATOM   2111  C  CA  . ARG A  1 480  ? 7.010   23.947  25.959  1.00 282.92 ? 480  ARG A CA  1 
ATOM   2112  C  C   . ARG A  1 480  ? 8.513   24.128  25.766  1.00 292.56 ? 480  ARG A C   1 
ATOM   2113  O  O   . ARG A  1 480  ? 9.287   24.050  26.723  1.00 232.58 ? 480  ARG A O   1 
ATOM   2114  C  CB  . ARG A  1 480  ? 6.415   25.215  26.570  1.00 244.83 ? 480  ARG A CB  1 
ATOM   2115  C  CG  . ARG A  1 480  ? 6.771   26.492  25.811  1.00 289.32 ? 480  ARG A CG  1 
ATOM   2116  C  CD  . ARG A  1 480  ? 6.294   26.460  24.349  1.00 330.97 ? 480  ARG A CD  1 
ATOM   2117  N  NE  . ARG A  1 480  ? 6.482   27.751  23.690  1.00 351.26 ? 480  ARG A NE  1 
ATOM   2118  C  CZ  . ARG A  1 480  ? 7.563   28.088  22.995  1.00 356.03 ? 480  ARG A CZ  1 
ATOM   2119  N  NH1 . ARG A  1 480  ? 8.564   27.230  22.860  1.00 351.75 ? 480  ARG A NH1 1 
ATOM   2120  N  NH2 . ARG A  1 480  ? 7.642   29.285  22.433  1.00 366.93 ? 480  ARG A NH2 1 
ATOM   2121  N  N   . GLY A  1 481  ? 8.906   24.395  24.523  1.00 301.32 ? 481  GLY A N   1 
ATOM   2122  C  CA  . GLY A  1 481  ? 10.302  24.411  24.126  1.00 263.20 ? 481  GLY A CA  1 
ATOM   2123  C  C   . GLY A  1 481  ? 10.507  23.393  23.018  1.00 261.98 ? 481  GLY A C   1 
ATOM   2124  O  O   . GLY A  1 481  ? 10.819  22.233  23.288  1.00 204.37 ? 481  GLY A O   1 
ATOM   2125  N  N   . TRP A  1 482  ? 10.334  23.826  21.771  1.00 288.86 ? 482  TRP A N   1 
ATOM   2126  C  CA  . TRP A  1 482  ? 10.255  22.907  20.631  1.00 296.75 ? 482  TRP A CA  1 
ATOM   2127  C  C   . TRP A  1 482  ? 11.462  21.973  20.519  1.00 296.08 ? 482  TRP A C   1 
ATOM   2128  O  O   . TRP A  1 482  ? 12.458  22.134  21.225  1.00 340.60 ? 482  TRP A O   1 
ATOM   2129  C  CB  . TRP A  1 482  ? 10.091  23.675  19.313  1.00 347.91 ? 482  TRP A CB  1 
ATOM   2130  C  CG  . TRP A  1 482  ? 9.041   24.751  19.337  1.00 371.80 ? 482  TRP A CG  1 
ATOM   2131  C  CD1 . TRP A  1 482  ? 8.098   24.962  20.301  1.00 380.32 ? 482  TRP A CD1 1 
ATOM   2132  C  CD2 . TRP A  1 482  ? 8.814   25.746  18.331  1.00 350.96 ? 482  TRP A CD2 1 
ATOM   2133  N  NE1 . TRP A  1 482  ? 7.311   26.038  19.966  1.00 370.63 ? 482  TRP A NE1 1 
ATOM   2134  C  CE2 . TRP A  1 482  ? 7.729   26.535  18.760  1.00 373.27 ? 482  TRP A CE2 1 
ATOM   2135  C  CE3 . TRP A  1 482  ? 9.428   26.050  17.112  1.00 285.32 ? 482  TRP A CE3 1 
ATOM   2136  C  CZ2 . TRP A  1 482  ? 7.247   27.607  18.014  1.00 378.34 ? 482  TRP A CZ2 1 
ATOM   2137  C  CZ3 . TRP A  1 482  ? 8.947   27.114  16.373  1.00 281.72 ? 482  TRP A CZ3 1 
ATOM   2138  C  CH2 . TRP A  1 482  ? 7.868   27.879  16.826  1.00 342.69 ? 482  TRP A CH2 1 
ATOM   2139  N  N   . ARG A  1 483  ? 11.352  20.997  19.622  1.00 297.88 ? 483  ARG A N   1 
ATOM   2140  C  CA  . ARG A  1 483  ? 12.420  20.030  19.370  1.00 317.78 ? 483  ARG A CA  1 
ATOM   2141  C  C   . ARG A  1 483  ? 12.624  19.048  20.532  1.00 317.98 ? 483  ARG A C   1 
ATOM   2142  O  O   . ARG A  1 483  ? 13.548  18.235  20.508  1.00 310.57 ? 483  ARG A O   1 
ATOM   2143  C  CB  . ARG A  1 483  ? 13.728  20.752  19.034  1.00 325.02 ? 483  ARG A CB  1 
ATOM   2144  C  CG  . ARG A  1 483  ? 13.677  21.522  17.722  1.00 321.10 ? 483  ARG A CG  1 
ATOM   2145  C  CD  . ARG A  1 483  ? 15.022  22.133  17.374  1.00 305.51 ? 483  ARG A CD  1 
ATOM   2146  N  NE  . ARG A  1 483  ? 14.990  22.825  16.089  1.00 291.51 ? 483  ARG A NE  1 
ATOM   2147  C  CZ  . ARG A  1 483  ? 16.028  23.456  15.550  1.00 278.18 ? 483  ARG A CZ  1 
ATOM   2148  N  NH1 . ARG A  1 483  ? 17.191  23.489  16.182  1.00 266.99 ? 483  ARG A NH1 1 
ATOM   2149  N  NH2 . ARG A  1 483  ? 15.902  24.056  14.376  1.00 281.74 ? 483  ARG A NH2 1 
ATOM   2150  N  N   . ARG A  1 484  ? 11.760  19.126  21.543  1.00 325.62 ? 484  ARG A N   1 
ATOM   2151  C  CA  . ARG A  1 484  ? 11.745  18.135  22.621  1.00 298.12 ? 484  ARG A CA  1 
ATOM   2152  C  C   . ARG A  1 484  ? 10.333  17.903  23.146  1.00 254.78 ? 484  ARG A C   1 
ATOM   2153  O  O   . ARG A  1 484  ? 9.675   18.829  23.618  1.00 210.67 ? 484  ARG A O   1 
ATOM   2154  C  CB  . ARG A  1 484  ? 12.640  18.563  23.778  1.00 276.07 ? 484  ARG A CB  1 
ATOM   2155  C  CG  . ARG A  1 484  ? 12.999  17.414  24.697  1.00 209.99 ? 484  ARG A CG  1 
ATOM   2156  C  CD  . ARG A  1 484  ? 13.935  17.858  25.795  1.00 206.72 ? 484  ARG A CD  1 
ATOM   2157  N  NE  . ARG A  1 484  ? 13.248  18.021  27.071  1.00 246.24 ? 484  ARG A NE  1 
ATOM   2158  C  CZ  . ARG A  1 484  ? 13.802  18.567  28.142  1.00 275.46 ? 484  ARG A CZ  1 
ATOM   2159  N  NH1 . ARG A  1 484  ? 15.034  19.016  28.072  1.00 263.50 ? 484  ARG A NH1 1 
ATOM   2160  N  NH2 . ARG A  1 484  ? 13.127  18.681  29.275  1.00 278.18 ? 484  ARG A NH2 1 
ATOM   2161  N  N   . TRP A  1 485  ? 9.878   16.658  23.083  1.00 220.52 ? 485  TRP A N   1 
ATOM   2162  C  CA  . TRP A  1 485  ? 8.505   16.340  23.438  1.00 209.12 ? 485  TRP A CA  1 
ATOM   2163  C  C   . TRP A  1 485  ? 8.303   14.836  23.515  1.00 198.68 ? 485  TRP A C   1 
ATOM   2164  O  O   . TRP A  1 485  ? 8.552   14.117  22.548  1.00 153.60 ? 485  TRP A O   1 
ATOM   2165  C  CB  . TRP A  1 485  ? 7.549   16.931  22.407  1.00 249.99 ? 485  TRP A CB  1 
ATOM   2166  C  CG  . TRP A  1 485  ? 6.123   16.818  22.793  1.00 255.64 ? 485  TRP A CG  1 
ATOM   2167  C  CD1 . TRP A  1 485  ? 5.470   17.563  23.725  1.00 290.83 ? 485  TRP A CD1 1 
ATOM   2168  C  CD2 . TRP A  1 485  ? 5.159   15.912  22.257  1.00 223.64 ? 485  TRP A CD2 1 
ATOM   2169  N  NE1 . TRP A  1 485  ? 4.159   17.176  23.806  1.00 321.49 ? 485  TRP A NE1 1 
ATOM   2170  C  CE2 . TRP A  1 485  ? 3.940   16.158  22.908  1.00 271.65 ? 485  TRP A CE2 1 
ATOM   2171  C  CE3 . TRP A  1 485  ? 5.207   14.910  21.286  1.00 187.62 ? 485  TRP A CE3 1 
ATOM   2172  C  CZ2 . TRP A  1 485  ? 2.782   15.446  22.628  1.00 223.64 ? 485  TRP A CZ2 1 
ATOM   2173  C  CZ3 . TRP A  1 485  ? 4.057   14.208  21.008  1.00 131.50 ? 485  TRP A CZ3 1 
ATOM   2174  C  CH2 . TRP A  1 485  ? 2.864   14.477  21.670  1.00 148.18 ? 485  TRP A CH2 1 
ATOM   2175  N  N   . TRP A  1 486  ? 7.827   14.370  24.664  1.00 269.90 ? 486  TRP A N   1 
ATOM   2176  C  CA  . TRP A  1 486  ? 7.719   12.941  24.924  1.00 238.69 ? 486  TRP A CA  1 
ATOM   2177  C  C   . TRP A  1 486  ? 6.303   12.523  25.251  1.00 213.46 ? 486  TRP A C   1 
ATOM   2178  O  O   . TRP A  1 486  ? 5.666   13.076  26.147  1.00 219.39 ? 486  TRP A O   1 
ATOM   2179  C  CB  . TRP A  1 486  ? 8.623   12.546  26.089  1.00 173.78 ? 486  TRP A CB  1 
ATOM   2180  C  CG  . TRP A  1 486  ? 8.504   13.467  27.264  1.00 218.59 ? 486  TRP A CG  1 
ATOM   2181  C  CD1 . TRP A  1 486  ? 7.867   13.214  28.438  1.00 266.30 ? 486  TRP A CD1 1 
ATOM   2182  C  CD2 . TRP A  1 486  ? 9.028   14.802  27.371  1.00 276.90 ? 486  TRP A CD2 1 
ATOM   2183  N  NE1 . TRP A  1 486  ? 7.966   14.300  29.275  1.00 285.02 ? 486  TRP A NE1 1 
ATOM   2184  C  CE2 . TRP A  1 486  ? 8.673   15.289  28.643  1.00 273.93 ? 486  TRP A CE2 1 
ATOM   2185  C  CE3 . TRP A  1 486  ? 9.764   15.629  26.515  1.00 276.12 ? 486  TRP A CE3 1 
ATOM   2186  C  CZ2 . TRP A  1 486  ? 9.030   16.568  29.083  1.00 253.36 ? 486  TRP A CZ2 1 
ATOM   2187  C  CZ3 . TRP A  1 486  ? 10.115  16.898  26.953  1.00 266.39 ? 486  TRP A CZ3 1 
ATOM   2188  C  CH2 . TRP A  1 486  ? 9.749   17.354  28.225  1.00 257.36 ? 486  TRP A CH2 1 
ATOM   2189  N  N   . CYS A  1 487  ? 5.816   11.531  24.520  1.00 190.32 ? 487  CYS A N   1 
ATOM   2190  C  CA  . CYS A  1 487  ? 4.566   10.893  24.878  1.00 195.91 ? 487  CYS A CA  1 
ATOM   2191  C  C   . CYS A  1 487  ? 4.815   9.982   26.052  1.00 248.60 ? 487  CYS A C   1 
ATOM   2192  O  O   . CYS A  1 487  ? 3.926   9.253   26.484  1.00 305.91 ? 487  CYS A O   1 
ATOM   2193  C  CB  . CYS A  1 487  ? 3.995   10.091  23.712  1.00 127.60 ? 487  CYS A CB  1 
ATOM   2194  S  SG  . CYS A  1 487  ? 2.859   11.037  22.676  1.00 568.01 ? 487  CYS A SG  1 
ATOM   2195  N  N   . ASP A  1 488  ? 6.034   10.019  26.573  1.00 239.98 ? 488  ASP A N   1 
ATOM   2196  C  CA  . ASP A  1 488  ? 6.359   9.194   27.711  1.00 274.68 ? 488  ASP A CA  1 
ATOM   2197  C  C   . ASP A  1 488  ? 6.595   10.011  28.964  1.00 298.39 ? 488  ASP A C   1 
ATOM   2198  O  O   . ASP A  1 488  ? 7.696   10.038  29.502  1.00 348.36 ? 488  ASP A O   1 
ATOM   2199  C  CB  . ASP A  1 488  ? 7.571   8.322   27.417  1.00 291.84 ? 488  ASP A CB  1 
ATOM   2200  C  CG  . ASP A  1 488  ? 7.943   7.450   28.587  1.00 355.32 ? 488  ASP A CG  1 
ATOM   2201  O  OD1 . ASP A  1 488  ? 7.064   6.712   29.081  1.00 379.51 ? 488  ASP A OD1 1 
ATOM   2202  O  OD2 . ASP A  1 488  ? 9.109   7.512   29.020  1.00 384.83 ? 488  ASP A OD2 1 
ATOM   2203  N  N   . ALA A  1 489  ? 5.556   10.709  29.404  1.00 256.28 ? 489  ALA A N   1 
ATOM   2204  C  CA  . ALA A  1 489  ? 5.422   11.058  30.807  1.00 215.63 ? 489  ALA A CA  1 
ATOM   2205  C  C   . ALA A  1 489  ? 4.894   9.803   31.476  1.00 265.10 ? 489  ALA A C   1 
ATOM   2206  O  O   . ALA A  1 489  ? 3.813   9.799   32.061  1.00 352.69 ? 489  ALA A O   1 
ATOM   2207  C  CB  . ALA A  1 489  ? 4.459   12.197  30.998  1.00 148.11 ? 489  ALA A CB  1 
ATOM   2208  N  N   . VAL A  1 490  ? 5.670   8.733   31.369  1.00 245.78 ? 490  VAL A N   1 
ATOM   2209  C  CA  . VAL A  1 490  ? 5.274   7.417   31.854  1.00 279.72 ? 490  VAL A CA  1 
ATOM   2210  C  C   . VAL A  1 490  ? 4.163   6.783   31.040  1.00 251.45 ? 490  VAL A C   1 
ATOM   2211  O  O   . VAL A  1 490  ? 4.369   6.330   29.922  1.00 168.95 ? 490  VAL A O   1 
ATOM   2212  C  CB  . VAL A  1 490  ? 4.789   7.436   33.328  1.00 387.02 ? 490  VAL A CB  1 
ATOM   2213  C  CG1 . VAL A  1 490  ? 4.461   6.016   33.801  1.00 397.84 ? 490  VAL A CG1 1 
ATOM   2214  C  CG2 . VAL A  1 490  ? 5.828   8.051   34.223  1.00 389.52 ? 490  VAL A CG2 1 
ATOM   2215  N  N   . LEU A  1 491  ? 2.963   6.837   31.598  1.00 332.09 ? 491  LEU A N   1 
ATOM   2216  C  CA  . LEU A  1 491  ? 2.017   5.733   31.513  1.00 351.12 ? 491  LEU A CA  1 
ATOM   2217  C  C   . LEU A  1 491  ? 1.258   5.595   30.203  1.00 237.78 ? 491  LEU A C   1 
ATOM   2218  O  O   . LEU A  1 491  ? 1.481   6.346   29.259  1.00 99.87  ? 491  LEU A O   1 
ATOM   2219  C  CB  . LEU A  1 491  ? 1.025   5.841   32.677  1.00 404.85 ? 491  LEU A CB  1 
ATOM   2220  C  CG  . LEU A  1 491  ? 0.042   7.011   32.616  1.00 405.05 ? 491  LEU A CG  1 
ATOM   2221  C  CD1 . LEU A  1 491  ? -1.095  6.681   31.663  1.00 445.17 ? 491  LEU A CD1 1 
ATOM   2222  C  CD2 . LEU A  1 491  ? -0.491  7.335   33.999  1.00 318.62 ? 491  LEU A CD2 1 
ATOM   2223  N  N   . TYR A  1 492  ? 0.361   4.609   30.178  1.00 214.66 ? 492  TYR A N   1 
ATOM   2224  C  CA  . TYR A  1 492  ? -0.491  4.341   29.029  1.00 185.02 ? 492  TYR A CA  1 
ATOM   2225  C  C   . TYR A  1 492  ? -1.556  3.287   29.380  1.00 202.47 ? 492  TYR A C   1 
ATOM   2226  O  O   . TYR A  1 492  ? -1.235  2.128   29.637  1.00 276.39 ? 492  TYR A O   1 
ATOM   2227  C  CB  . TYR A  1 492  ? 0.360   3.901   27.834  1.00 181.50 ? 492  TYR A CB  1 
ATOM   2228  C  CG  . TYR A  1 492  ? 1.348   2.800   28.144  1.00 306.69 ? 492  TYR A CG  1 
ATOM   2229  C  CD1 . TYR A  1 492  ? 2.671   3.091   28.451  1.00 384.26 ? 492  TYR A CD1 1 
ATOM   2230  C  CD2 . TYR A  1 492  ? 0.961   1.469   28.120  1.00 363.62 ? 492  TYR A CD2 1 
ATOM   2231  C  CE1 . TYR A  1 492  ? 3.576   2.085   28.730  1.00 413.97 ? 492  TYR A CE1 1 
ATOM   2232  C  CE2 . TYR A  1 492  ? 1.856   0.460   28.398  1.00 387.25 ? 492  TYR A CE2 1 
ATOM   2233  C  CZ  . TYR A  1 492  ? 3.161   0.772   28.702  1.00 396.26 ? 492  TYR A CZ  1 
ATOM   2234  O  OH  . TYR A  1 492  ? 4.054   -0.236  28.977  1.00 374.02 ? 492  TYR A OH  1 
ATOM   2235  N  N   . GLY A  1 493  ? -2.823  3.701   29.379  1.00 133.66 ? 493  GLY A N   1 
ATOM   2236  C  CA  . GLY A  1 493  ? -3.937  2.853   29.791  1.00 123.63 ? 493  GLY A CA  1 
ATOM   2237  C  C   . GLY A  1 493  ? -4.300  1.730   28.834  1.00 105.26 ? 493  GLY A C   1 
ATOM   2238  O  O   . GLY A  1 493  ? -4.129  1.853   27.625  1.00 217.35 ? 493  GLY A O   1 
ATOM   2239  N  N   . GLU A  1 494  ? -4.809  0.631   29.378  1.00 142.73 ? 494  GLU A N   1 
ATOM   2240  C  CA  . GLU A  1 494  ? -5.136  -0.533  28.569  1.00 168.23 ? 494  GLU A CA  1 
ATOM   2241  C  C   . GLU A  1 494  ? -6.290  -1.313  29.169  1.00 179.94 ? 494  GLU A C   1 
ATOM   2242  O  O   . GLU A  1 494  ? -7.239  -0.734  29.687  1.00 113.17 ? 494  GLU A O   1 
ATOM   2243  C  CB  . GLU A  1 494  ? -3.927  -1.465  28.456  1.00 160.10 ? 494  GLU A CB  1 
ATOM   2244  C  CG  . GLU A  1 494  ? -2.614  -0.790  28.112  1.00 218.58 ? 494  GLU A CG  1 
ATOM   2245  C  CD  . GLU A  1 494  ? -1.478  -1.789  27.995  1.00 237.37 ? 494  GLU A CD  1 
ATOM   2246  O  OE1 . GLU A  1 494  ? -1.694  -2.968  28.351  1.00 295.88 ? 494  GLU A OE1 1 
ATOM   2247  O  OE2 . GLU A  1 494  ? -0.376  -1.400  27.548  1.00 133.46 ? 494  GLU A OE2 1 
ATOM   2248  N  N   . GLN A  1 495  ? -6.198  -2.636  29.067  1.00 226.16 ? 495  GLN A N   1 
ATOM   2249  C  CA  . GLN A  1 495  ? -7.128  -3.550  29.719  1.00 232.24 ? 495  GLN A CA  1 
ATOM   2250  C  C   . GLN A  1 495  ? -6.722  -4.994  29.430  1.00 268.72 ? 495  GLN A C   1 
ATOM   2251  O  O   . GLN A  1 495  ? -6.032  -5.270  28.446  1.00 340.12 ? 495  GLN A O   1 
ATOM   2252  C  CB  . GLN A  1 495  ? -8.558  -3.310  29.240  1.00 171.43 ? 495  GLN A CB  1 
ATOM   2253  C  CG  . GLN A  1 495  ? -9.579  -4.238  29.883  1.00 100.63 ? 495  GLN A CG  1 
ATOM   2254  C  CD  . GLN A  1 495  ? -9.661  -4.055  31.374  1.00 241.27 ? 495  GLN A CD  1 
ATOM   2255  O  OE1 . GLN A  1 495  ? -9.646  -2.930  31.872  1.00 341.62 ? 495  GLN A OE1 1 
ATOM   2256  N  NE2 . GLN A  1 495  ? -9.746  -5.159  32.101  1.00 234.03 ? 495  GLN A NE2 1 
ATOM   2257  N  N   . GLY A  1 496  ? -7.154  -5.914  30.288  1.00 157.71 ? 496  GLY A N   1 
ATOM   2258  C  CA  . GLY A  1 496  ? -6.821  -7.316  30.127  1.00 147.68 ? 496  GLY A CA  1 
ATOM   2259  C  C   . GLY A  1 496  ? -7.859  -8.052  29.306  1.00 203.42 ? 496  GLY A C   1 
ATOM   2260  O  O   . GLY A  1 496  ? -8.599  -8.883  29.826  1.00 151.99 ? 496  GLY A O   1 
ATOM   2261  N  N   . HIS A  1 497  ? -7.921  -7.738  28.017  1.00 269.14 ? 497  HIS A N   1 
ATOM   2262  C  CA  . HIS A  1 497  ? -8.849  -8.405  27.119  1.00 248.60 ? 497  HIS A CA  1 
ATOM   2263  C  C   . HIS A  1 497  ? -8.480  -8.137  25.661  1.00 255.02 ? 497  HIS A C   1 
ATOM   2264  O  O   . HIS A  1 497  ? -8.756  -7.064  25.134  1.00 236.86 ? 497  HIS A O   1 
ATOM   2265  C  CB  . HIS A  1 497  ? -10.276 -7.933  27.396  1.00 233.20 ? 497  HIS A CB  1 
ATOM   2266  C  CG  . HIS A  1 497  ? -11.305 -8.608  26.552  1.00 203.94 ? 497  HIS A CG  1 
ATOM   2267  N  ND1 . HIS A  1 497  ? -11.894 -9.801  26.912  1.00 232.71 ? 497  HIS A ND1 1 
ATOM   2268  C  CD2 . HIS A  1 497  ? -11.851 -8.267  25.361  1.00 157.97 ? 497  HIS A CD2 1 
ATOM   2269  C  CE1 . HIS A  1 497  ? -12.757 -10.163 25.983  1.00 257.56 ? 497  HIS A CE1 1 
ATOM   2270  N  NE2 . HIS A  1 497  ? -12.750 -9.247  25.029  1.00 228.96 ? 497  HIS A NE2 1 
ATOM   2271  N  N   . PRO A  1 498  ? -7.852  -9.121  25.005  1.00 265.99 ? 498  PRO A N   1 
ATOM   2272  C  CA  . PRO A  1 498  ? -7.408  -9.031  23.608  1.00 251.62 ? 498  PRO A CA  1 
ATOM   2273  C  C   . PRO A  1 498  ? -8.508  -8.608  22.633  1.00 207.66 ? 498  PRO A C   1 
ATOM   2274  O  O   . PRO A  1 498  ? -9.689  -8.715  22.952  1.00 164.31 ? 498  PRO A O   1 
ATOM   2275  C  CB  . PRO A  1 498  ? -6.968  -10.460 23.293  1.00 232.78 ? 498  PRO A CB  1 
ATOM   2276  C  CG  . PRO A  1 498  ? -6.622  -11.057 24.604  1.00 251.63 ? 498  PRO A CG  1 
ATOM   2277  C  CD  . PRO A  1 498  ? -7.530  -10.426 25.606  1.00 249.40 ? 498  PRO A CD  1 
ATOM   2278  N  N   . TRP A  1 499  ? -8.113  -8.147  21.450  1.00 201.72 ? 499  TRP A N   1 
ATOM   2279  C  CA  . TRP A  1 499  ? -9.063  -7.751  20.411  1.00 223.47 ? 499  TRP A CA  1 
ATOM   2280  C  C   . TRP A  1 499  ? -10.188 -6.889  20.972  1.00 256.45 ? 499  TRP A C   1 
ATOM   2281  O  O   . TRP A  1 499  ? -11.368 -7.180  20.773  1.00 254.64 ? 499  TRP A O   1 
ATOM   2282  C  CB  . TRP A  1 499  ? -9.649  -8.992  19.726  1.00 259.71 ? 499  TRP A CB  1 
ATOM   2283  C  CG  . TRP A  1 499  ? -8.726  -9.618  18.701  1.00 289.24 ? 499  TRP A CG  1 
ATOM   2284  C  CD1 . TRP A  1 499  ? -7.389  -9.385  18.556  1.00 264.80 ? 499  TRP A CD1 1 
ATOM   2285  C  CD2 . TRP A  1 499  ? -9.071  -10.596 17.701  1.00 285.89 ? 499  TRP A CD2 1 
ATOM   2286  N  NE1 . TRP A  1 499  ? -6.883  -10.142 17.523  1.00 214.22 ? 499  TRP A NE1 1 
ATOM   2287  C  CE2 . TRP A  1 499  ? -7.893  -10.895 16.983  1.00 283.27 ? 499  TRP A CE2 1 
ATOM   2288  C  CE3 . TRP A  1 499  ? -10.261 -11.241 17.341  1.00 238.74 ? 499  TRP A CE3 1 
ATOM   2289  C  CZ2 . TRP A  1 499  ? -7.870  -11.812 15.927  1.00 306.26 ? 499  TRP A CZ2 1 
ATOM   2290  C  CZ3 . TRP A  1 499  ? -10.233 -12.153 16.290  1.00 266.92 ? 499  TRP A CZ3 1 
ATOM   2291  C  CH2 . TRP A  1 499  ? -9.046  -12.427 15.597  1.00 288.69 ? 499  TRP A CH2 1 
ATOM   2292  N  N   . GLY A  1 500  ? -9.819  -5.820  21.667  1.00 278.51 ? 500  GLY A N   1 
ATOM   2293  C  CA  . GLY A  1 500  ? -10.803 -4.962  22.298  1.00 276.19 ? 500  GLY A CA  1 
ATOM   2294  C  C   . GLY A  1 500  ? -10.966 -3.622  21.609  1.00 207.55 ? 500  GLY A C   1 
ATOM   2295  O  O   . GLY A  1 500  ? -11.991 -2.957  21.764  1.00 158.50 ? 500  GLY A O   1 
ATOM   2296  N  N   . ARG A  1 501  ? -9.964  -3.216  20.839  1.00 211.67 ? 501  ARG A N   1 
ATOM   2297  C  CA  . ARG A  1 501  ? -10.000 -1.904  20.208  1.00 250.74 ? 501  ARG A CA  1 
ATOM   2298  C  C   . ARG A  1 501  ? -10.205 -0.832  21.277  1.00 204.96 ? 501  ARG A C   1 
ATOM   2299  O  O   . ARG A  1 501  ? -11.177 -0.070  21.236  1.00 128.88 ? 501  ARG A O   1 
ATOM   2300  C  CB  . ARG A  1 501  ? -11.130 -1.829  19.176  1.00 260.08 ? 501  ARG A CB  1 
ATOM   2301  C  CG  . ARG A  1 501  ? -10.946 -2.734  17.973  1.00 226.15 ? 501  ARG A CG  1 
ATOM   2302  C  CD  . ARG A  1 501  ? -11.926 -2.380  16.870  1.00 182.46 ? 501  ARG A CD  1 
ATOM   2303  N  NE  . ARG A  1 501  ? -13.324 -2.466  17.295  1.00 148.04 ? 501  ARG A NE  1 
ATOM   2304  C  CZ  . ARG A  1 501  ? -14.042 -3.585  17.305  1.00 187.50 ? 501  ARG A CZ  1 
ATOM   2305  N  NH1 . ARG A  1 501  ? -13.499 -4.730  16.924  1.00 189.96 ? 501  ARG A NH1 1 
ATOM   2306  N  NH2 . ARG A  1 501  ? -15.307 -3.564  17.700  1.00 196.56 ? 501  ARG A NH2 1 
ATOM   2307  N  N   . PHE A  1 502  ? -9.294  -0.794  22.245  1.00 166.40 ? 502  PHE A N   1 
ATOM   2308  C  CA  . PHE A  1 502  ? -9.341  0.206   23.308  1.00 158.09 ? 502  PHE A CA  1 
ATOM   2309  C  C   . PHE A  1 502  ? -8.562  1.464   22.940  1.00 170.77 ? 502  PHE A C   1 
ATOM   2310  O  O   . PHE A  1 502  ? -7.332  1.446   22.852  1.00 104.92 ? 502  PHE A O   1 
ATOM   2311  C  CB  . PHE A  1 502  ? -8.776  -0.368  24.607  1.00 230.00 ? 502  PHE A CB  1 
ATOM   2312  C  CG  . PHE A  1 502  ? -8.615  0.657   25.709  1.00 272.05 ? 502  PHE A CG  1 
ATOM   2313  C  CD1 . PHE A  1 502  ? -7.361  0.970   26.214  1.00 244.18 ? 502  PHE A CD1 1 
ATOM   2314  C  CD2 . PHE A  1 502  ? -9.718  1.310   26.234  1.00 277.14 ? 502  PHE A CD2 1 
ATOM   2315  C  CE1 . PHE A  1 502  ? -7.216  1.912   27.229  1.00 182.42 ? 502  PHE A CE1 1 
ATOM   2316  C  CE2 . PHE A  1 502  ? -9.573  2.252   27.247  1.00 214.73 ? 502  PHE A CE2 1 
ATOM   2317  C  CZ  . PHE A  1 502  ? -8.322  2.551   27.742  1.00 142.94 ? 502  PHE A CZ  1 
ATOM   2318  N  N   . GLY A  1 503  ? -9.286  2.566   22.773  1.00 186.38 ? 503  GLY A N   1 
ATOM   2319  C  CA  . GLY A  1 503  ? -8.704  3.815   22.313  1.00 206.33 ? 503  GLY A CA  1 
ATOM   2320  C  C   . GLY A  1 503  ? -9.351  4.267   21.017  1.00 222.91 ? 503  GLY A C   1 
ATOM   2321  O  O   . GLY A  1 503  ? -8.894  5.222   20.380  1.00 180.00 ? 503  GLY A O   1 
ATOM   2322  N  N   . ALA A  1 504  ? -10.419 3.570   20.630  1.00 232.85 ? 504  ALA A N   1 
ATOM   2323  C  CA  . ALA A  1 504  ? -11.152 3.882   19.411  1.00 226.09 ? 504  ALA A CA  1 
ATOM   2324  C  C   . ALA A  1 504  ? -11.622 5.327   19.431  1.00 231.58 ? 504  ALA A C   1 
ATOM   2325  O  O   . ALA A  1 504  ? -11.609 6.008   18.410  1.00 329.03 ? 504  ALA A O   1 
ATOM   2326  C  CB  . ALA A  1 504  ? -12.341 2.944   19.253  1.00 242.62 ? 504  ALA A CB  1 
ATOM   2327  N  N   . ALA A  1 505  ? -12.038 5.795   20.600  1.00 211.52 ? 505  ALA A N   1 
ATOM   2328  C  CA  . ALA A  1 505  ? -12.463 7.180   20.756  1.00 233.23 ? 505  ALA A CA  1 
ATOM   2329  C  C   . ALA A  1 505  ? -12.254 7.634   22.189  1.00 206.88 ? 505  ALA A C   1 
ATOM   2330  O  O   . ALA A  1 505  ? -11.810 6.858   23.031  1.00 194.95 ? 505  ALA A O   1 
ATOM   2331  C  CB  . ALA A  1 505  ? -13.919 7.340   20.357  1.00 229.00 ? 505  ALA A CB  1 
ATOM   2332  N  N   . LEU A  1 506  ? -12.570 8.896   22.457  1.00 144.09 ? 506  LEU A N   1 
ATOM   2333  C  CA  . LEU A  1 506  ? -12.390 9.460   23.783  1.00 170.29 ? 506  LEU A CA  1 
ATOM   2334  C  C   . LEU A  1 506  ? -12.625 10.977  23.796  1.00 166.68 ? 506  LEU A C   1 
ATOM   2335  O  O   . LEU A  1 506  ? -12.403 11.659  22.797  1.00 233.05 ? 506  LEU A O   1 
ATOM   2336  C  CB  . LEU A  1 506  ? -10.991 9.113   24.324  1.00 237.76 ? 506  LEU A CB  1 
ATOM   2337  C  CG  . LEU A  1 506  ? -9.783  9.254   23.389  1.00 167.16 ? 506  LEU A CG  1 
ATOM   2338  C  CD1 . LEU A  1 506  ? -9.341  10.697  23.334  1.00 77.15  ? 506  LEU A CD1 1 
ATOM   2339  C  CD2 . LEU A  1 506  ? -8.628  8.369   23.837  1.00 147.08 ? 506  LEU A CD2 1 
ATOM   2340  N  N   . THR A  1 507  ? -13.081 11.493  24.937  1.00 218.57 ? 507  THR A N   1 
ATOM   2341  C  CA  . THR A  1 507  ? -13.377 12.917  25.083  1.00 222.10 ? 507  THR A CA  1 
ATOM   2342  C  C   . THR A  1 507  ? -13.156 13.402  26.504  1.00 195.16 ? 507  THR A C   1 
ATOM   2343  O  O   . THR A  1 507  ? -13.346 12.648  27.456  1.00 130.05 ? 507  THR A O   1 
ATOM   2344  C  CB  . THR A  1 507  ? -14.844 13.222  24.766  1.00 220.50 ? 507  THR A CB  1 
ATOM   2345  O  OG1 . THR A  1 507  ? -15.053 14.642  24.782  1.00 189.98 ? 507  THR A OG1 1 
ATOM   2346  C  CG2 . THR A  1 507  ? -15.751 12.570  25.807  1.00 152.86 ? 507  THR A CG2 1 
ATOM   2347  N  N   . VAL A  1 508  ? -12.783 14.671  26.641  1.00 192.29 ? 508  VAL A N   1 
ATOM   2348  C  CA  . VAL A  1 508  ? -12.686 15.293  27.946  1.00 147.43 ? 508  VAL A CA  1 
ATOM   2349  C  C   . VAL A  1 508  ? -14.086 15.322  28.534  1.00 208.38 ? 508  VAL A C   1 
ATOM   2350  O  O   . VAL A  1 508  ? -15.041 15.710  27.852  1.00 219.12 ? 508  VAL A O   1 
ATOM   2351  C  CB  . VAL A  1 508  ? -12.151 16.727  27.857  1.00 180.57 ? 508  VAL A CB  1 
ATOM   2352  C  CG1 . VAL A  1 508  ? -13.009 17.549  26.913  1.00 210.56 ? 508  VAL A CG1 1 
ATOM   2353  C  CG2 . VAL A  1 508  ? -12.121 17.365  29.235  1.00 230.22 ? 508  VAL A CG2 1 
ATOM   2354  N  N   . LEU A  1 509  ? -14.206 14.890  29.789  1.00 210.03 ? 509  LEU A N   1 
ATOM   2355  C  CA  . LEU A  1 509  ? -15.485 14.902  30.502  1.00 195.87 ? 509  LEU A CA  1 
ATOM   2356  C  C   . LEU A  1 509  ? -15.509 16.037  31.536  1.00 176.99 ? 509  LEU A C   1 
ATOM   2357  O  O   . LEU A  1 509  ? -16.558 16.649  31.764  1.00 97.50  ? 509  LEU A O   1 
ATOM   2358  C  CB  . LEU A  1 509  ? -15.759 13.540  31.166  1.00 108.21 ? 509  LEU A CB  1 
ATOM   2359  C  CG  . LEU A  1 509  ? -17.079 13.398  31.938  1.00 103.57 ? 509  LEU A CG  1 
ATOM   2360  C  CD1 . LEU A  1 509  ? -18.265 13.936  31.151  1.00 112.95 ? 509  LEU A CD1 1 
ATOM   2361  C  CD2 . LEU A  1 509  ? -17.321 11.944  32.361  1.00 147.88 ? 509  LEU A CD2 1 
ATOM   2362  N  N   . GLY A  1 510  ? -14.346 16.318  32.134  1.00 189.88 ? 510  GLY A N   1 
ATOM   2363  C  CA  . GLY A  1 510  ? -14.189 17.395  33.107  1.00 211.59 ? 510  GLY A CA  1 
ATOM   2364  C  C   . GLY A  1 510  ? -14.216 16.969  34.577  1.00 193.93 ? 510  GLY A C   1 
ATOM   2365  O  O   . GLY A  1 510  ? -13.882 15.831  34.929  1.00 117.75 ? 510  GLY A O   1 
ATOM   2366  N  N   . ASP A  1 511  ? -14.602 17.905  35.444  1.00 175.01 ? 511  ASP A N   1 
ATOM   2367  C  CA  . ASP A  1 511  ? -14.781 17.633  36.873  1.00 149.47 ? 511  ASP A CA  1 
ATOM   2368  C  C   . ASP A  1 511  ? -16.139 16.976  37.190  1.00 183.34 ? 511  ASP A C   1 
ATOM   2369  O  O   . ASP A  1 511  ? -17.186 17.631  37.149  1.00 230.75 ? 511  ASP A O   1 
ATOM   2370  C  CB  . ASP A  1 511  ? -14.636 18.939  37.660  1.00 216.99 ? 511  ASP A CB  1 
ATOM   2371  C  CG  . ASP A  1 511  ? -14.831 18.754  39.152  1.00 221.73 ? 511  ASP A CG  1 
ATOM   2372  O  OD1 . ASP A  1 511  ? -15.903 18.258  39.566  1.00 233.71 ? 511  ASP A OD1 1 
ATOM   2373  O  OD2 . ASP A  1 511  ? -13.913 19.126  39.912  1.00 157.20 ? 511  ASP A OD2 1 
ATOM   2374  N  N   . VAL A  1 512  ? -16.113 15.686  37.518  1.00 167.31 ? 512  VAL A N   1 
ATOM   2375  C  CA  . VAL A  1 512  ? -17.338 14.941  37.808  1.00 170.86 ? 512  VAL A CA  1 
ATOM   2376  C  C   . VAL A  1 512  ? -17.429 14.572  39.278  1.00 184.32 ? 512  VAL A C   1 
ATOM   2377  O  O   . VAL A  1 512  ? -18.510 14.614  39.871  1.00 183.99 ? 512  VAL A O   1 
ATOM   2378  C  CB  . VAL A  1 512  ? -17.422 13.642  36.987  1.00 177.06 ? 512  VAL A CB  1 
ATOM   2379  C  CG1 . VAL A  1 512  ? -17.570 13.974  35.518  1.00 216.23 ? 512  VAL A CG1 1 
ATOM   2380  C  CG2 . VAL A  1 512  ? -16.195 12.748  37.237  1.00 134.26 ? 512  VAL A CG2 1 
ATOM   2381  N  N   . ASN A  1 513  ? -16.290 14.201  39.858  1.00 195.61 ? 513  ASN A N   1 
ATOM   2382  C  CA  . ASN A  1 513  ? -16.245 13.822  41.263  1.00 204.90 ? 513  ASN A CA  1 
ATOM   2383  C  C   . ASN A  1 513  ? -15.858 14.995  42.190  1.00 167.39 ? 513  ASN A C   1 
ATOM   2384  O  O   . ASN A  1 513  ? -15.829 14.846  43.409  1.00 217.79 ? 513  ASN A O   1 
ATOM   2385  C  CB  . ASN A  1 513  ? -15.346 12.587  41.466  1.00 193.70 ? 513  ASN A CB  1 
ATOM   2386  C  CG  . ASN A  1 513  ? -13.899 12.834  41.088  1.00 178.95 ? 513  ASN A CG  1 
ATOM   2387  O  OD1 . ASN A  1 513  ? -13.415 13.959  41.145  1.00 208.77 ? 513  ASN A OD1 1 
ATOM   2388  N  ND2 . ASN A  1 513  ? -13.194 11.772  40.722  1.00 210.93 ? 513  ASN A ND2 1 
ATOM   2389  N  N   . GLY A  1 514  ? -15.582 16.160  41.609  1.00 163.34 ? 514  GLY A N   1 
ATOM   2390  C  CA  . GLY A  1 514  ? -15.433 17.388  42.377  1.00 146.63 ? 514  GLY A CA  1 
ATOM   2391  C  C   . GLY A  1 514  ? -14.137 17.539  43.157  1.00 170.09 ? 514  GLY A C   1 
ATOM   2392  O  O   . GLY A  1 514  ? -14.046 18.398  44.042  1.00 181.03 ? 514  GLY A O   1 
ATOM   2393  N  N   . ASP A  1 515  ? -13.135 16.721  42.831  1.00 109.07 ? 515  ASP A N   1 
ATOM   2394  C  CA  . ASP A  1 515  ? -11.828 16.817  43.482  1.00 123.68 ? 515  ASP A CA  1 
ATOM   2395  C  C   . ASP A  1 515  ? -10.850 17.679  42.682  1.00 100.56 ? 515  ASP A C   1 
ATOM   2396  O  O   . ASP A  1 515  ? -9.636  17.500  42.790  1.00 130.74 ? 515  ASP A O   1 
ATOM   2397  C  CB  . ASP A  1 515  ? -11.222 15.424  43.744  1.00 174.97 ? 515  ASP A CB  1 
ATOM   2398  C  CG  . ASP A  1 515  ? -11.013 14.614  42.473  1.00 124.69 ? 515  ASP A CG  1 
ATOM   2399  O  OD1 . ASP A  1 515  ? -11.107 15.181  41.369  1.00 179.10 ? 515  ASP A OD1 1 
ATOM   2400  O  OD2 . ASP A  1 515  ? -10.747 13.400  42.577  1.00 197.94 ? 515  ASP A OD2 1 
ATOM   2401  N  N   . LYS A  1 516  ? -11.383 18.610  41.888  1.00 118.28 ? 516  LYS A N   1 
ATOM   2402  C  CA  . LYS A  1 516  ? -10.567 19.544  41.104  1.00 153.93 ? 516  LYS A CA  1 
ATOM   2403  C  C   . LYS A  1 516  ? -9.698  18.848  40.047  1.00 181.95 ? 516  LYS A C   1 
ATOM   2404  O  O   . LYS A  1 516  ? -8.853  19.492  39.417  1.00 105.42 ? 516  LYS A O   1 
ATOM   2405  C  CB  . LYS A  1 516  ? -9.666  20.362  42.031  1.00 203.14 ? 516  LYS A CB  1 
ATOM   2406  C  CG  . LYS A  1 516  ? -10.398 21.049  43.178  1.00 241.18 ? 516  LYS A CG  1 
ATOM   2407  C  CD  . LYS A  1 516  ? -11.071 22.330  42.730  1.00 245.64 ? 516  LYS A CD  1 
ATOM   2408  C  CE  . LYS A  1 516  ? -11.595 23.117  43.918  1.00 239.13 ? 516  LYS A CE  1 
ATOM   2409  N  NZ  . LYS A  1 516  ? -12.190 24.411  43.504  1.00 227.70 ? 516  LYS A NZ  1 
ATOM   2410  N  N   . LEU A  1 517  ? -9.905  17.542  39.866  1.00 211.99 ? 517  LEU A N   1 
ATOM   2411  C  CA  . LEU A  1 517  ? -9.098  16.733  38.947  1.00 148.95 ? 517  LEU A CA  1 
ATOM   2412  C  C   . LEU A  1 517  ? -9.941  16.177  37.816  1.00 206.29 ? 517  LEU A C   1 
ATOM   2413  O  O   . LEU A  1 517  ? -10.597 15.143  37.964  1.00 226.28 ? 517  LEU A O   1 
ATOM   2414  C  CB  . LEU A  1 517  ? -8.441  15.557  39.671  1.00 172.62 ? 517  LEU A CB  1 
ATOM   2415  C  CG  . LEU A  1 517  ? -7.400  15.927  40.717  1.00 242.15 ? 517  LEU A CG  1 
ATOM   2416  C  CD1 . LEU A  1 517  ? -6.956  14.692  41.485  1.00 293.51 ? 517  LEU A CD1 1 
ATOM   2417  C  CD2 . LEU A  1 517  ? -6.221  16.618  40.052  1.00 140.31 ? 517  LEU A CD2 1 
ATOM   2418  N  N   . THR A  1 518  ? -9.894  16.853  36.677  1.00 227.13 ? 518  THR A N   1 
ATOM   2419  C  CA  . THR A  1 518  ? -10.655 16.446  35.511  1.00 203.49 ? 518  THR A CA  1 
ATOM   2420  C  C   . THR A  1 518  ? -10.552 14.940  35.275  1.00 158.56 ? 518  THR A C   1 
ATOM   2421  O  O   . THR A  1 518  ? -9.532  14.307  35.557  1.00 98.20  ? 518  THR A O   1 
ATOM   2422  C  CB  . THR A  1 518  ? -10.146 17.167  34.266  1.00 67.25  ? 518  THR A CB  1 
ATOM   2423  O  OG1 . THR A  1 518  ? -11.143 17.119  33.238  1.00 220.17 ? 518  THR A OG1 1 
ATOM   2424  C  CG2 . THR A  1 518  ? -8.867  16.513  33.788  1.00 155.74 ? 518  THR A CG2 1 
ATOM   2425  N  N   . ASP A  1 519  ? -11.620 14.379  34.729  1.00 125.75 ? 519  ASP A N   1 
ATOM   2426  C  CA  . ASP A  1 519  ? -11.691 12.956  34.458  1.00 197.23 ? 519  ASP A CA  1 
ATOM   2427  C  C   . ASP A  1 519  ? -12.074 12.751  32.985  1.00 223.27 ? 519  ASP A C   1 
ATOM   2428  O  O   . ASP A  1 519  ? -12.795 13.570  32.405  1.00 183.13 ? 519  ASP A O   1 
ATOM   2429  C  CB  . ASP A  1 519  ? -12.716 12.298  35.389  1.00 195.03 ? 519  ASP A CB  1 
ATOM   2430  C  CG  . ASP A  1 519  ? -12.400 12.523  36.865  1.00 179.06 ? 519  ASP A CG  1 
ATOM   2431  O  OD1 . ASP A  1 519  ? -11.211 12.711  37.196  1.00 180.12 ? 519  ASP A OD1 1 
ATOM   2432  O  OD2 . ASP A  1 519  ? -13.338 12.499  37.695  1.00 165.32 ? 519  ASP A OD2 1 
ATOM   2433  N  N   . VAL A  1 520  ? -11.587 11.668  32.379  1.00 199.83 ? 520  VAL A N   1 
ATOM   2434  C  CA  . VAL A  1 520  ? -11.805 11.421  30.952  1.00 158.78 ? 520  VAL A CA  1 
ATOM   2435  C  C   . VAL A  1 520  ? -12.502 10.084  30.708  1.00 172.65 ? 520  VAL A C   1 
ATOM   2436  O  O   . VAL A  1 520  ? -12.485 9.196   31.568  1.00 135.82 ? 520  VAL A O   1 
ATOM   2437  C  CB  . VAL A  1 520  ? -10.473 11.437  30.161  1.00 151.49 ? 520  VAL A CB  1 
ATOM   2438  C  CG1 . VAL A  1 520  ? -9.874  12.849  30.129  1.00 101.65 ? 520  VAL A CG1 1 
ATOM   2439  C  CG2 . VAL A  1 520  ? -9.494  10.415  30.743  1.00 129.49 ? 520  VAL A CG2 1 
ATOM   2440  N  N   . VAL A  1 521  ? -13.106 9.955   29.526  1.00 192.75 ? 521  VAL A N   1 
ATOM   2441  C  CA  . VAL A  1 521  ? -13.783 8.730   29.111  1.00 172.53 ? 521  VAL A CA  1 
ATOM   2442  C  C   . VAL A  1 521  ? -13.133 8.159   27.852  1.00 152.22 ? 521  VAL A C   1 
ATOM   2443  O  O   . VAL A  1 521  ? -12.645 8.917   27.018  1.00 184.00 ? 521  VAL A O   1 
ATOM   2444  C  CB  . VAL A  1 521  ? -15.268 8.991   28.821  1.00 153.28 ? 521  VAL A CB  1 
ATOM   2445  C  CG1 . VAL A  1 521  ? -15.974 7.685   28.482  1.00 139.46 ? 521  VAL A CG1 1 
ATOM   2446  C  CG2 . VAL A  1 521  ? -15.917 9.663   30.013  1.00 136.26 ? 521  VAL A CG2 1 
ATOM   2447  N  N   . ILE A  1 522  ? -13.136 6.831   27.713  1.00 172.76 ? 522  ILE A N   1 
ATOM   2448  C  CA  . ILE A  1 522  ? -12.490 6.159   26.580  1.00 165.00 ? 522  ILE A CA  1 
ATOM   2449  C  C   . ILE A  1 522  ? -13.320 4.969   26.084  1.00 136.30 ? 522  ILE A C   1 
ATOM   2450  O  O   . ILE A  1 522  ? -13.735 4.128   26.873  1.00 189.26 ? 522  ILE A O   1 
ATOM   2451  C  CB  . ILE A  1 522  ? -11.056 5.684   26.954  1.00 176.15 ? 522  ILE A CB  1 
ATOM   2452  C  CG1 . ILE A  1 522  ? -10.201 6.883   27.364  1.00 179.66 ? 522  ILE A CG1 1 
ATOM   2453  C  CG2 . ILE A  1 522  ? -10.396 4.956   25.788  1.00 204.58 ? 522  ILE A CG2 1 
ATOM   2454  C  CD1 . ILE A  1 522  ? -8.788  6.532   27.715  1.00 139.48 ? 522  ILE A CD1 1 
ATOM   2455  N  N   . GLY A  1 523  ? -13.555 4.903   24.776  1.00 185.17 ? 523  GLY A N   1 
ATOM   2456  C  CA  . GLY A  1 523  ? -14.336 3.826   24.192  1.00 208.86 ? 523  GLY A CA  1 
ATOM   2457  C  C   . GLY A  1 523  ? -13.521 2.599   23.801  1.00 212.87 ? 523  GLY A C   1 
ATOM   2458  O  O   . GLY A  1 523  ? -12.297 2.651   23.650  1.00 186.21 ? 523  GLY A O   1 
ATOM   2459  N  N   . ALA A  1 524  ? -14.218 1.482   23.630  1.00 203.34 ? 524  ALA A N   1 
ATOM   2460  C  CA  . ALA A  1 524  ? -13.583 0.220   23.275  1.00 204.40 ? 524  ALA A CA  1 
ATOM   2461  C  C   . ALA A  1 524  ? -14.665 -0.764  22.859  1.00 239.21 ? 524  ALA A C   1 
ATOM   2462  O  O   . ALA A  1 524  ? -15.018 -1.669  23.615  1.00 276.14 ? 524  ALA A O   1 
ATOM   2463  C  CB  . ALA A  1 524  ? -12.786 -0.326  24.449  1.00 186.54 ? 524  ALA A CB  1 
ATOM   2464  N  N   . PRO A  1 525  ? -15.204 -0.576  21.650  1.00 178.39 ? 525  PRO A N   1 
ATOM   2465  C  CA  . PRO A  1 525  ? -16.336 -1.346  21.125  1.00 207.06 ? 525  PRO A CA  1 
ATOM   2466  C  C   . PRO A  1 525  ? -15.983 -2.796  20.798  1.00 243.76 ? 525  PRO A C   1 
ATOM   2467  O  O   . PRO A  1 525  ? -16.840 -3.529  20.307  1.00 312.86 ? 525  PRO A O   1 
ATOM   2468  C  CB  . PRO A  1 525  ? -16.709 -0.597  19.841  1.00 211.75 ? 525  PRO A CB  1 
ATOM   2469  C  CG  . PRO A  1 525  ? -16.008 0.726   19.925  1.00 199.52 ? 525  PRO A CG  1 
ATOM   2470  C  CD  . PRO A  1 525  ? -14.780 0.483   20.724  1.00 97.30  ? 525  PRO A CD  1 
ATOM   2471  N  N   . GLY A  1 526  ? -14.745 -3.200  21.062  1.00 146.73 ? 526  GLY A N   1 
ATOM   2472  C  CA  . GLY A  1 526  ? -14.310 -4.554  20.769  1.00 214.62 ? 526  GLY A CA  1 
ATOM   2473  C  C   . GLY A  1 526  ? -14.233 -5.464  21.985  1.00 285.32 ? 526  GLY A C   1 
ATOM   2474  O  O   . GLY A  1 526  ? -13.989 -6.663  21.847  1.00 290.46 ? 526  GLY A O   1 
ATOM   2475  N  N   . GLU A  1 527  ? -14.442 -4.901  23.174  1.00 308.10 ? 527  GLU A N   1 
ATOM   2476  C  CA  . GLU A  1 527  ? -14.363 -5.667  24.420  1.00 256.73 ? 527  GLU A CA  1 
ATOM   2477  C  C   . GLU A  1 527  ? -15.312 -6.858  24.401  1.00 219.21 ? 527  GLU A C   1 
ATOM   2478  O  O   . GLU A  1 527  ? -16.204 -6.934  23.559  1.00 239.60 ? 527  GLU A O   1 
ATOM   2479  C  CB  . GLU A  1 527  ? -14.683 -4.773  25.623  1.00 258.61 ? 527  GLU A CB  1 
ATOM   2480  C  CG  . GLU A  1 527  ? -13.578 -3.802  25.980  1.00 239.23 ? 527  GLU A CG  1 
ATOM   2481  C  CD  . GLU A  1 527  ? -12.307 -4.510  26.397  1.00 218.61 ? 527  GLU A CD  1 
ATOM   2482  O  OE1 . GLU A  1 527  ? -12.390 -5.666  26.864  1.00 254.12 ? 527  GLU A OE1 1 
ATOM   2483  O  OE2 . GLU A  1 527  ? -11.222 -3.911  26.259  1.00 132.60 ? 527  GLU A OE2 1 
ATOM   2484  N  N   . GLU A  1 528  ? -15.115 -7.785  25.334  1.00 236.70 ? 528  GLU A N   1 
ATOM   2485  C  CA  . GLU A  1 528  ? -15.964 -8.970  25.432  1.00 324.42 ? 528  GLU A CA  1 
ATOM   2486  C  C   . GLU A  1 528  ? -16.115 -9.624  24.057  1.00 343.96 ? 528  GLU A C   1 
ATOM   2487  O  O   . GLU A  1 528  ? -15.222 -9.514  23.216  1.00 344.31 ? 528  GLU A O   1 
ATOM   2488  C  CB  . GLU A  1 528  ? -17.333 -8.601  26.023  1.00 374.71 ? 528  GLU A CB  1 
ATOM   2489  C  CG  . GLU A  1 528  ? -17.261 -8.017  27.438  1.00 359.88 ? 528  GLU A CG  1 
ATOM   2490  C  CD  . GLU A  1 528  ? -18.584 -7.435  27.926  1.00 270.16 ? 528  GLU A CD  1 
ATOM   2491  O  OE1 . GLU A  1 528  ? -19.631 -7.676  27.288  1.00 187.05 ? 528  GLU A OE1 1 
ATOM   2492  O  OE2 . GLU A  1 528  ? -18.574 -6.732  28.959  1.00 241.76 ? 528  GLU A OE2 1 
ATOM   2493  N  N   . GLU A  1 529  ? -17.235 -10.308 23.832  1.00 345.15 ? 529  GLU A N   1 
ATOM   2494  C  CA  . GLU A  1 529  ? -17.495 -10.948 22.545  1.00 314.08 ? 529  GLU A CA  1 
ATOM   2495  C  C   . GLU A  1 529  ? -18.002 -9.919  21.543  1.00 270.33 ? 529  GLU A C   1 
ATOM   2496  O  O   . GLU A  1 529  ? -19.181 -9.911  21.190  1.00 292.22 ? 529  GLU A O   1 
ATOM   2497  C  CB  . GLU A  1 529  ? -18.506 -12.090 22.695  1.00 340.01 ? 529  GLU A CB  1 
ATOM   2498  C  CG  . GLU A  1 529  ? -19.808 -11.700 23.375  1.00 354.38 ? 529  GLU A CG  1 
ATOM   2499  C  CD  . GLU A  1 529  ? -20.763 -12.867 23.504  1.00 354.67 ? 529  GLU A CD  1 
ATOM   2500  O  OE1 . GLU A  1 529  ? -20.436 -13.962 22.998  1.00 350.21 ? 529  GLU A OE1 1 
ATOM   2501  O  OE2 . GLU A  1 529  ? -21.840 -12.691 24.110  1.00 354.86 ? 529  GLU A OE2 1 
ATOM   2502  N  N   . ASN A  1 530  ? -17.097 -9.051  21.095  1.00 226.34 ? 530  ASN A N   1 
ATOM   2503  C  CA  . ASN A  1 530  ? -17.431 -7.957  20.185  1.00 239.71 ? 530  ASN A CA  1 
ATOM   2504  C  C   . ASN A  1 530  ? -18.293 -6.891  20.850  1.00 241.50 ? 530  ASN A C   1 
ATOM   2505  O  O   . ASN A  1 530  ? -18.511 -5.818  20.284  1.00 211.97 ? 530  ASN A O   1 
ATOM   2506  C  CB  . ASN A  1 530  ? -18.144 -8.482  18.939  1.00 287.66 ? 530  ASN A CB  1 
ATOM   2507  C  CG  . ASN A  1 530  ? -18.271 -7.428  17.848  1.00 273.38 ? 530  ASN A CG  1 
ATOM   2508  O  OD1 . ASN A  1 530  ? -17.550 -6.422  17.839  1.00 140.82 ? 530  ASN A OD1 1 
ATOM   2509  N  ND2 . ASN A  1 530  ? -19.193 -7.660  16.917  1.00 330.20 ? 530  ASN A ND2 1 
ATOM   2510  N  N   . ARG A  1 531  ? -18.783 -7.189  22.050  1.00 246.61 ? 531  ARG A N   1 
ATOM   2511  C  CA  . ARG A  1 531  ? -19.620 -6.255  22.787  1.00 233.70 ? 531  ARG A CA  1 
ATOM   2512  C  C   . ARG A  1 531  ? -18.880 -4.934  22.971  1.00 256.41 ? 531  ARG A C   1 
ATOM   2513  O  O   . ARG A  1 531  ? -17.670 -4.852  22.752  1.00 275.59 ? 531  ARG A O   1 
ATOM   2514  C  CB  . ARG A  1 531  ? -19.998 -6.839  24.147  1.00 258.80 ? 531  ARG A CB  1 
ATOM   2515  C  CG  . ARG A  1 531  ? -20.786 -8.135  24.066  1.00 228.74 ? 531  ARG A CG  1 
ATOM   2516  C  CD  . ARG A  1 531  ? -22.227 -7.884  23.660  1.00 202.73 ? 531  ARG A CD  1 
ATOM   2517  N  NE  . ARG A  1 531  ? -22.992 -9.125  23.589  1.00 239.94 ? 531  ARG A NE  1 
ATOM   2518  C  CZ  . ARG A  1 531  ? -24.321 -9.192  23.539  1.00 249.93 ? 531  ARG A CZ  1 
ATOM   2519  N  NH1 . ARG A  1 531  ? -25.057 -8.086  23.554  1.00 123.22 ? 531  ARG A NH1 1 
ATOM   2520  N  NH2 . ARG A  1 531  ? -24.918 -10.374 23.476  1.00 312.30 ? 531  ARG A NH2 1 
ATOM   2521  N  N   . GLY A  1 532  ? -19.607 -3.899  23.373  1.00 254.34 ? 532  GLY A N   1 
ATOM   2522  C  CA  . GLY A  1 532  ? -19.010 -2.593  23.566  1.00 227.40 ? 532  GLY A CA  1 
ATOM   2523  C  C   . GLY A  1 532  ? -18.406 -2.439  24.945  1.00 203.48 ? 532  GLY A C   1 
ATOM   2524  O  O   . GLY A  1 532  ? -18.493 -3.341  25.776  1.00 268.85 ? 532  GLY A O   1 
ATOM   2525  N  N   . ALA A  1 533  ? -17.790 -1.290  25.190  1.00 166.65 ? 533  ALA A N   1 
ATOM   2526  C  CA  . ALA A  1 533  ? -17.187 -1.014  26.488  1.00 227.33 ? 533  ALA A CA  1 
ATOM   2527  C  C   . ALA A  1 533  ? -16.703 0.425   26.569  1.00 234.15 ? 533  ALA A C   1 
ATOM   2528  O  O   . ALA A  1 533  ? -16.409 1.051   25.550  1.00 196.38 ? 533  ALA A O   1 
ATOM   2529  C  CB  . ALA A  1 533  ? -16.037 -1.971  26.757  1.00 217.86 ? 533  ALA A CB  1 
ATOM   2530  N  N   . VAL A  1 534  ? -16.627 0.940   27.792  1.00 245.33 ? 534  VAL A N   1 
ATOM   2531  C  CA  . VAL A  1 534  ? -16.124 2.287   28.045  1.00 225.12 ? 534  VAL A CA  1 
ATOM   2532  C  C   . VAL A  1 534  ? -15.354 2.283   29.374  1.00 163.69 ? 534  VAL A C   1 
ATOM   2533  O  O   . VAL A  1 534  ? -15.562 1.401   30.209  1.00 150.18 ? 534  VAL A O   1 
ATOM   2534  C  CB  . VAL A  1 534  ? -17.274 3.337   28.055  1.00 131.39 ? 534  VAL A CB  1 
ATOM   2535  C  CG1 . VAL A  1 534  ? -16.733 4.737   28.275  1.00 82.62  ? 534  VAL A CG1 1 
ATOM   2536  C  CG2 . VAL A  1 534  ? -18.052 3.295   26.747  1.00 194.44 ? 534  VAL A CG2 1 
ATOM   2537  N  N   . TYR A  1 535  ? -14.451 3.248   29.551  1.00 155.77 ? 535  TYR A N   1 
ATOM   2538  C  CA  . TYR A  1 535  ? -13.612 3.327   30.750  1.00 160.77 ? 535  TYR A CA  1 
ATOM   2539  C  C   . TYR A  1 535  ? -13.604 4.736   31.331  1.00 168.58 ? 535  TYR A C   1 
ATOM   2540  O  O   . TYR A  1 535  ? -13.887 5.702   30.625  1.00 169.90 ? 535  TYR A O   1 
ATOM   2541  C  CB  . TYR A  1 535  ? -12.177 2.899   30.432  1.00 140.21 ? 535  TYR A CB  1 
ATOM   2542  C  CG  . TYR A  1 535  ? -12.087 1.477   29.955  1.00 116.08 ? 535  TYR A CG  1 
ATOM   2543  C  CD1 . TYR A  1 535  ? -11.972 0.435   30.855  1.00 179.15 ? 535  TYR A CD1 1 
ATOM   2544  C  CD2 . TYR A  1 535  ? -12.152 1.171   28.611  1.00 203.48 ? 535  TYR A CD2 1 
ATOM   2545  C  CE1 . TYR A  1 535  ? -11.905 -0.871  30.430  1.00 167.83 ? 535  TYR A CE1 1 
ATOM   2546  C  CE2 . TYR A  1 535  ? -12.086 -0.133  28.177  1.00 214.30 ? 535  TYR A CE2 1 
ATOM   2547  C  CZ  . TYR A  1 535  ? -11.964 -1.150  29.094  1.00 142.75 ? 535  TYR A CZ  1 
ATOM   2548  O  OH  . TYR A  1 535  ? -11.895 -2.451  28.668  1.00 164.41 ? 535  TYR A OH  1 
ATOM   2549  N  N   . LEU A  1 536  ? -13.280 4.851   32.615  1.00 158.65 ? 536  LEU A N   1 
ATOM   2550  C  CA  . LEU A  1 536  ? -13.224 6.149   33.270  1.00 149.50 ? 536  LEU A CA  1 
ATOM   2551  C  C   . LEU A  1 536  ? -11.941 6.233   34.080  1.00 128.53 ? 536  LEU A C   1 
ATOM   2552  O  O   . LEU A  1 536  ? -11.660 5.365   34.907  1.00 129.32 ? 536  LEU A O   1 
ATOM   2553  C  CB  . LEU A  1 536  ? -14.463 6.375   34.149  1.00 109.17 ? 536  LEU A CB  1 
ATOM   2554  C  CG  . LEU A  1 536  ? -14.532 7.702   34.918  1.00 132.66 ? 536  LEU A CG  1 
ATOM   2555  C  CD1 . LEU A  1 536  ? -14.517 8.929   34.015  1.00 69.52  ? 536  LEU A CD1 1 
ATOM   2556  C  CD2 . LEU A  1 536  ? -15.761 7.732   35.804  1.00 155.83 ? 536  LEU A CD2 1 
ATOM   2557  N  N   . PHE A  1 537  ? -11.155 7.273   33.807  1.00 82.01  ? 537  PHE A N   1 
ATOM   2558  C  CA  . PHE A  1 537  ? -9.901  7.525   34.521  1.00 171.93 ? 537  PHE A CA  1 
ATOM   2559  C  C   . PHE A  1 537  ? -9.922  8.903   35.190  1.00 172.66 ? 537  PHE A C   1 
ATOM   2560  O  O   . PHE A  1 537  ? -10.837 9.697   34.959  1.00 109.50 ? 537  PHE A O   1 
ATOM   2561  C  CB  . PHE A  1 537  ? -8.714  7.437   33.560  1.00 163.67 ? 537  PHE A CB  1 
ATOM   2562  C  CG  . PHE A  1 537  ? -8.525  6.072   32.949  1.00 208.56 ? 537  PHE A CG  1 
ATOM   2563  C  CD1 . PHE A  1 537  ? -9.494  5.515   32.121  1.00 155.75 ? 537  PHE A CD1 1 
ATOM   2564  C  CD2 . PHE A  1 537  ? -7.373  5.352   33.194  1.00 246.75 ? 537  PHE A CD2 1 
ATOM   2565  C  CE1 . PHE A  1 537  ? -9.313  4.260   31.556  1.00 100.91 ? 537  PHE A CE1 1 
ATOM   2566  C  CE2 . PHE A  1 537  ? -7.189  4.102   32.634  1.00 240.88 ? 537  PHE A CE2 1 
ATOM   2567  C  CZ  . PHE A  1 537  ? -8.162  3.557   31.812  1.00 157.82 ? 537  PHE A CZ  1 
ATOM   2568  N  N   . HIS A  1 538  ? -8.916  9.187   36.014  1.00 152.32 ? 538  HIS A N   1 
ATOM   2569  C  CA  . HIS A  1 538  ? -8.845  10.468  36.708  1.00 177.88 ? 538  HIS A CA  1 
ATOM   2570  C  C   . HIS A  1 538  ? -7.422  11.000  36.624  1.00 156.54 ? 538  HIS A C   1 
ATOM   2571  O  O   . HIS A  1 538  ? -6.470  10.228  36.478  1.00 97.07  ? 538  HIS A O   1 
ATOM   2572  C  CB  . HIS A  1 538  ? -9.268  10.335  38.182  1.00 212.69 ? 538  HIS A CB  1 
ATOM   2573  C  CG  . HIS A  1 538  ? -10.541 9.565   38.397  1.00 228.32 ? 538  HIS A CG  1 
ATOM   2574  N  ND1 . HIS A  1 538  ? -11.786 10.157  38.368  1.00 214.83 ? 538  HIS A ND1 1 
ATOM   2575  C  CD2 . HIS A  1 538  ? -10.753 8.256   38.673  1.00 193.92 ? 538  HIS A CD2 1 
ATOM   2576  C  CE1 . HIS A  1 538  ? -12.712 9.242   38.601  1.00 176.79 ? 538  HIS A CE1 1 
ATOM   2577  N  NE2 . HIS A  1 538  ? -12.113 8.082   38.791  1.00 157.08 ? 538  HIS A NE2 1 
ATOM   2578  N  N   . GLY A  1 539  ? -7.288  12.321  36.708  1.00 163.20 ? 539  GLY A N   1 
ATOM   2579  C  CA  . GLY A  1 539  ? -5.988  12.969  36.705  1.00 106.78 ? 539  GLY A CA  1 
ATOM   2580  C  C   . GLY A  1 539  ? -5.338  12.836  38.062  1.00 169.94 ? 539  GLY A C   1 
ATOM   2581  O  O   . GLY A  1 539  ? -5.897  12.197  38.953  1.00 236.83 ? 539  GLY A O   1 
ATOM   2582  N  N   . VAL A  1 540  ? -4.163  13.433  38.229  1.00 120.47 ? 540  VAL A N   1 
ATOM   2583  C  CA  . VAL A  1 540  ? -3.477  13.373  39.516  1.00 241.48 ? 540  VAL A CA  1 
ATOM   2584  C  C   . VAL A  1 540  ? -2.928  14.738  39.884  1.00 261.78 ? 540  VAL A C   1 
ATOM   2585  O  O   . VAL A  1 540  ? -3.534  15.473  40.660  1.00 325.84 ? 540  VAL A O   1 
ATOM   2586  C  CB  . VAL A  1 540  ? -2.326  12.348  39.508  1.00 252.07 ? 540  VAL A CB  1 
ATOM   2587  C  CG1 . VAL A  1 540  ? -1.780  12.147  40.922  1.00 305.36 ? 540  VAL A CG1 1 
ATOM   2588  C  CG2 . VAL A  1 540  ? -2.803  11.034  38.928  1.00 174.58 ? 540  VAL A CG2 1 
ATOM   2589  N  N   . LEU A  1 541  ? -1.775  15.074  39.325  1.00 170.72 ? 541  LEU A N   1 
ATOM   2590  C  CA  . LEU A  1 541  ? -1.175  16.373  39.557  1.00 204.81 ? 541  LEU A CA  1 
ATOM   2591  C  C   . LEU A  1 541  ? -0.311  16.711  38.358  1.00 230.71 ? 541  LEU A C   1 
ATOM   2592  O  O   . LEU A  1 541  ? 0.777   16.160  38.176  1.00 188.16 ? 541  LEU A O   1 
ATOM   2593  C  CB  . LEU A  1 541  ? -0.356  16.387  40.853  1.00 249.73 ? 541  LEU A CB  1 
ATOM   2594  C  CG  . LEU A  1 541  ? -1.144  16.514  42.164  1.00 286.31 ? 541  LEU A CG  1 
ATOM   2595  C  CD1 . LEU A  1 541  ? -0.207  16.502  43.364  1.00 305.17 ? 541  LEU A CD1 1 
ATOM   2596  C  CD2 . LEU A  1 541  ? -1.996  17.775  42.180  1.00 283.32 ? 541  LEU A CD2 1 
ATOM   2597  N  N   . GLY A  1 542  ? -0.820  17.609  37.526  1.00 297.15 ? 542  GLY A N   1 
ATOM   2598  C  CA  . GLY A  1 542  ? -0.116  18.019  36.333  1.00 296.10 ? 542  GLY A CA  1 
ATOM   2599  C  C   . GLY A  1 542  ? -0.199  16.955  35.263  1.00 256.26 ? 542  GLY A C   1 
ATOM   2600  O  O   . GLY A  1 542  ? -1.271  16.399  35.009  1.00 248.46 ? 542  GLY A O   1 
ATOM   2601  N  N   . PRO A  1 543  ? 0.941   16.662  34.630  1.00 212.85 ? 543  PRO A N   1 
ATOM   2602  C  CA  . PRO A  1 543  ? 0.960   15.674  33.554  1.00 274.27 ? 543  PRO A CA  1 
ATOM   2603  C  C   . PRO A  1 543  ? 0.922   14.260  34.107  1.00 237.15 ? 543  PRO A C   1 
ATOM   2604  O  O   . PRO A  1 543  ? 1.963   13.731  34.495  1.00 239.35 ? 543  PRO A O   1 
ATOM   2605  C  CB  . PRO A  1 543  ? 2.290   15.946  32.853  1.00 325.47 ? 543  PRO A CB  1 
ATOM   2606  C  CG  . PRO A  1 543  ? 3.154   16.580  33.881  1.00 277.46 ? 543  PRO A CG  1 
ATOM   2607  C  CD  . PRO A  1 543  ? 2.269   17.248  34.883  1.00 192.01 ? 543  PRO A CD  1 
ATOM   2608  N  N   . SER A  1 544  ? -0.267  13.665  34.146  1.00 198.27 ? 544  SER A N   1 
ATOM   2609  C  CA  . SER A  1 544  ? -0.416  12.306  34.642  1.00 187.95 ? 544  SER A CA  1 
ATOM   2610  C  C   . SER A  1 544  ? -1.874  11.878  34.677  1.00 163.48 ? 544  SER A C   1 
ATOM   2611  O  O   . SER A  1 544  ? -2.776  12.714  34.775  1.00 146.06 ? 544  SER A O   1 
ATOM   2612  C  CB  . SER A  1 544  ? 0.164   12.209  36.051  1.00 256.77 ? 544  SER A CB  1 
ATOM   2613  O  OG  . SER A  1 544  ? -0.455  13.150  36.915  1.00 226.83 ? 544  SER A OG  1 
ATOM   2614  N  N   . ILE A  1 545  ? -2.092  10.568  34.600  1.00 140.84 ? 545  ILE A N   1 
ATOM   2615  C  CA  . ILE A  1 545  ? -3.418  9.990   34.823  1.00 193.69 ? 545  ILE A CA  1 
ATOM   2616  C  C   . ILE A  1 545  ? -3.303  8.727   35.664  1.00 190.74 ? 545  ILE A C   1 
ATOM   2617  O  O   . ILE A  1 545  ? -2.198  8.237   35.905  1.00 213.66 ? 545  ILE A O   1 
ATOM   2618  C  CB  . ILE A  1 545  ? -4.124  9.632   33.508  1.00 159.31 ? 545  ILE A CB  1 
ATOM   2619  C  CG1 . ILE A  1 545  ? -3.496  8.376   32.899  1.00 207.68 ? 545  ILE A CG1 1 
ATOM   2620  C  CG2 . ILE A  1 545  ? -4.057  10.810  32.539  1.00 68.40  ? 545  ILE A CG2 1 
ATOM   2621  C  CD1 . ILE A  1 545  ? -4.233  7.843   31.688  1.00 222.95 ? 545  ILE A CD1 1 
ATOM   2622  N  N   . SER A  1 546  ? -4.443  8.194   36.095  1.00 97.20  ? 546  SER A N   1 
ATOM   2623  C  CA  . SER A  1 546  ? -4.446  7.023   36.959  1.00 175.23 ? 546  SER A CA  1 
ATOM   2624  C  C   . SER A  1 546  ? -4.725  5.755   36.167  1.00 167.73 ? 546  SER A C   1 
ATOM   2625  O  O   . SER A  1 546  ? -5.868  5.511   35.782  1.00 135.29 ? 546  SER A O   1 
ATOM   2626  C  CB  . SER A  1 546  ? -5.489  7.176   38.067  1.00 218.25 ? 546  SER A CB  1 
ATOM   2627  O  OG  . SER A  1 546  ? -5.578  5.994   38.843  1.00 235.36 ? 546  SER A OG  1 
ATOM   2628  N  N   . PRO A  1 547  ? -3.681  4.934   35.939  1.00 195.28 ? 547  PRO A N   1 
ATOM   2629  C  CA  . PRO A  1 547  ? -3.826  3.683   35.187  1.00 216.29 ? 547  PRO A CA  1 
ATOM   2630  C  C   . PRO A  1 547  ? -5.033  2.870   35.639  1.00 200.53 ? 547  PRO A C   1 
ATOM   2631  O  O   . PRO A  1 547  ? -5.803  2.397   34.806  1.00 233.36 ? 547  PRO A O   1 
ATOM   2632  C  CB  . PRO A  1 547  ? -2.529  2.934   35.502  1.00 189.42 ? 547  PRO A CB  1 
ATOM   2633  C  CG  . PRO A  1 547  ? -1.538  4.001   35.802  1.00 133.39 ? 547  PRO A CG  1 
ATOM   2634  C  CD  . PRO A  1 547  ? -2.308  5.111   36.450  1.00 167.70 ? 547  PRO A CD  1 
ATOM   2635  N  N   . SER A  1 548  ? -5.192  2.710   36.946  1.00 173.57 ? 548  SER A N   1 
ATOM   2636  C  CA  . SER A  1 548  ? -6.337  1.997   37.488  1.00 218.61 ? 548  SER A CA  1 
ATOM   2637  C  C   . SER A  1 548  ? -7.586  2.848   37.321  1.00 201.99 ? 548  SER A C   1 
ATOM   2638  O  O   . SER A  1 548  ? -7.718  3.912   37.929  1.00 223.61 ? 548  SER A O   1 
ATOM   2639  C  CB  . SER A  1 548  ? -6.117  1.662   38.963  1.00 295.90 ? 548  SER A CB  1 
ATOM   2640  O  OG  . SER A  1 548  ? -5.010  0.795   39.125  1.00 337.24 ? 548  SER A OG  1 
ATOM   2641  N  N   . HIS A  1 549  ? -8.495  2.379   36.477  1.00 120.91 ? 549  HIS A N   1 
ATOM   2642  C  CA  . HIS A  1 549  ? -9.761  3.069   36.262  1.00 176.60 ? 549  HIS A CA  1 
ATOM   2643  C  C   . HIS A  1 549  ? -10.693 2.796   37.430  1.00 223.43 ? 549  HIS A C   1 
ATOM   2644  O  O   . HIS A  1 549  ? -10.527 1.806   38.142  1.00 310.28 ? 549  HIS A O   1 
ATOM   2645  C  CB  . HIS A  1 549  ? -10.414 2.613   34.953  1.00 141.78 ? 549  HIS A CB  1 
ATOM   2646  C  CG  . HIS A  1 549  ? -10.664 1.138   34.879  1.00 133.82 ? 549  HIS A CG  1 
ATOM   2647  N  ND1 . HIS A  1 549  ? -9.692  0.234   34.507  1.00 168.66 ? 549  HIS A ND1 1 
ATOM   2648  C  CD2 . HIS A  1 549  ? -11.780 0.409   35.118  1.00 136.52 ? 549  HIS A CD2 1 
ATOM   2649  C  CE1 . HIS A  1 549  ? -10.196 -0.987  34.523  1.00 201.38 ? 549  HIS A CE1 1 
ATOM   2650  N  NE2 . HIS A  1 549  ? -11.462 -0.907  34.894  1.00 102.92 ? 549  HIS A NE2 1 
ATOM   2651  N  N   . SER A  1 550  ? -11.674 3.672   37.623  1.00 140.81 ? 550  SER A N   1 
ATOM   2652  C  CA  . SER A  1 550  ? -12.615 3.525   38.724  1.00 196.43 ? 550  SER A CA  1 
ATOM   2653  C  C   . SER A  1 550  ? -13.874 2.812   38.263  1.00 218.03 ? 550  SER A C   1 
ATOM   2654  O  O   . SER A  1 550  ? -14.533 2.126   39.044  1.00 289.31 ? 550  SER A O   1 
ATOM   2655  C  CB  . SER A  1 550  ? -12.988 4.888   39.293  1.00 175.84 ? 550  SER A CB  1 
ATOM   2656  O  OG  . SER A  1 550  ? -13.681 5.652   38.333  1.00 141.50 ? 550  SER A OG  1 
ATOM   2657  N  N   . GLN A  1 551  ? -14.207 2.977   36.989  1.00 141.05 ? 551  GLN A N   1 
ATOM   2658  C  CA  . GLN A  1 551  ? -15.415 2.376   36.443  1.00 171.33 ? 551  GLN A CA  1 
ATOM   2659  C  C   . GLN A  1 551  ? -15.152 1.741   35.069  1.00 194.67 ? 551  GLN A C   1 
ATOM   2660  O  O   . GLN A  1 551  ? -14.219 2.131   34.362  1.00 137.64 ? 551  GLN A O   1 
ATOM   2661  C  CB  . GLN A  1 551  ? -16.509 3.439   36.355  1.00 143.32 ? 551  GLN A CB  1 
ATOM   2662  C  CG  . GLN A  1 551  ? -17.924 2.882   36.356  1.00 198.07 ? 551  GLN A CG  1 
ATOM   2663  C  CD  . GLN A  1 551  ? -18.945 3.976   36.509  1.00 182.13 ? 551  GLN A CD  1 
ATOM   2664  O  OE1 . GLN A  1 551  ? -18.585 5.147   36.522  1.00 73.85  ? 551  GLN A OE1 1 
ATOM   2665  N  NE2 . GLN A  1 551  ? -20.224 3.609   36.610  1.00 201.24 ? 551  GLN A NE2 1 
ATOM   2666  N  N   . ARG A  1 552  ? -15.970 0.750   34.711  1.00 202.95 ? 552  ARG A N   1 
ATOM   2667  C  CA  . ARG A  1 552  ? -15.853 0.066   33.422  1.00 152.49 ? 552  ARG A CA  1 
ATOM   2668  C  C   . ARG A  1 552  ? -17.221 -0.358  32.892  1.00 197.05 ? 552  ARG A C   1 
ATOM   2669  O  O   . ARG A  1 552  ? -17.482 -1.547  32.694  1.00 268.48 ? 552  ARG A O   1 
ATOM   2670  C  CB  . ARG A  1 552  ? -14.956 -1.166  33.542  1.00 166.41 ? 552  ARG A CB  1 
ATOM   2671  C  CG  . ARG A  1 552  ? -14.691 -1.870  32.216  1.00 228.83 ? 552  ARG A CG  1 
ATOM   2672  C  CD  . ARG A  1 552  ? -13.903 -3.146  32.423  1.00 247.83 ? 552  ARG A CD  1 
ATOM   2673  N  NE  . ARG A  1 552  ? -13.679 -3.872  31.176  1.00 214.52 ? 552  ARG A NE  1 
ATOM   2674  C  CZ  . ARG A  1 552  ? -13.001 -5.013  31.093  1.00 219.72 ? 552  ARG A CZ  1 
ATOM   2675  N  NH1 . ARG A  1 552  ? -12.484 -5.565  32.183  1.00 262.37 ? 552  ARG A NH1 1 
ATOM   2676  N  NH2 . ARG A  1 552  ? -12.837 -5.607  29.923  1.00 144.99 ? 552  ARG A NH2 1 
ATOM   2677  N  N   . ILE A  1 553  ? -18.092 0.620   32.662  1.00 126.22 ? 553  ILE A N   1 
ATOM   2678  C  CA  . ILE A  1 553  ? -19.426 0.349   32.137  1.00 176.46 ? 553  ILE A CA  1 
ATOM   2679  C  C   . ILE A  1 553  ? -19.310 -0.261  30.742  1.00 223.47 ? 553  ILE A C   1 
ATOM   2680  O  O   . ILE A  1 553  ? -18.925 0.417   29.791  1.00 231.54 ? 553  ILE A O   1 
ATOM   2681  C  CB  . ILE A  1 553  ? -20.284 1.636   32.082  1.00 145.45 ? 553  ILE A CB  1 
ATOM   2682  C  CG1 . ILE A  1 553  ? -20.495 2.202   33.490  1.00 257.17 ? 553  ILE A CG1 1 
ATOM   2683  C  CG2 . ILE A  1 553  ? -21.626 1.356   31.434  1.00 198.40 ? 553  ILE A CG2 1 
ATOM   2684  C  CD1 . ILE A  1 553  ? -21.307 3.487   33.531  1.00 326.79 ? 553  ILE A CD1 1 
ATOM   2685  N  N   . ALA A  1 554  ? -19.635 -1.543  30.625  1.00 233.40 ? 554  ALA A N   1 
ATOM   2686  C  CA  . ALA A  1 554  ? -19.506 -2.244  29.354  1.00 228.44 ? 554  ALA A CA  1 
ATOM   2687  C  C   . ALA A  1 554  ? -20.878 -2.562  28.757  1.00 232.46 ? 554  ALA A C   1 
ATOM   2688  O  O   . ALA A  1 554  ? -21.908 -2.105  29.259  1.00 226.39 ? 554  ALA A O   1 
ATOM   2689  C  CB  . ALA A  1 554  ? -18.691 -3.513  29.540  1.00 181.04 ? 554  ALA A CB  1 
ATOM   2690  N  N   . GLY A  1 555  ? -20.889 -3.350  27.686  1.00 182.90 ? 555  GLY A N   1 
ATOM   2691  C  CA  . GLY A  1 555  ? -22.126 -3.693  27.008  1.00 151.18 ? 555  GLY A CA  1 
ATOM   2692  C  C   . GLY A  1 555  ? -22.917 -4.775  27.718  1.00 152.94 ? 555  GLY A C   1 
ATOM   2693  O  O   . GLY A  1 555  ? -23.849 -5.341  27.158  1.00 166.96 ? 555  GLY A O   1 
ATOM   2694  N  N   . SER A  1 556  ? -22.557 -5.058  28.960  1.00 218.00 ? 556  SER A N   1 
ATOM   2695  C  CA  . SER A  1 556  ? -23.244 -6.084  29.725  1.00 222.38 ? 556  SER A CA  1 
ATOM   2696  C  C   . SER A  1 556  ? -24.236 -5.435  30.666  1.00 219.87 ? 556  SER A C   1 
ATOM   2697  O  O   . SER A  1 556  ? -24.802 -6.095  31.535  1.00 275.54 ? 556  SER A O   1 
ATOM   2698  C  CB  . SER A  1 556  ? -22.235 -6.893  30.533  1.00 259.04 ? 556  SER A CB  1 
ATOM   2699  O  OG  . SER A  1 556  ? -21.262 -7.473  29.684  1.00 275.50 ? 556  SER A OG  1 
ATOM   2700  N  N   . GLN A  1 557  ? -24.459 -4.141  30.476  1.00 156.01 ? 557  GLN A N   1 
ATOM   2701  C  CA  . GLN A  1 557  ? -25.179 -3.355  31.457  1.00 247.44 ? 557  GLN A CA  1 
ATOM   2702  C  C   . GLN A  1 557  ? -26.648 -3.276  31.076  1.00 250.51 ? 557  GLN A C   1 
ATOM   2703  O  O   . GLN A  1 557  ? -27.183 -2.200  30.833  1.00 191.35 ? 557  GLN A O   1 
ATOM   2704  C  CB  . GLN A  1 557  ? -24.569 -1.957  31.554  1.00 292.04 ? 557  GLN A CB  1 
ATOM   2705  C  CG  . GLN A  1 557  ? -23.280 -1.885  32.376  1.00 310.64 ? 557  GLN A CG  1 
ATOM   2706  C  CD  . GLN A  1 557  ? -23.447 -2.420  33.788  1.00 307.39 ? 557  GLN A CD  1 
ATOM   2707  O  OE1 . GLN A  1 557  ? -24.564 -2.575  34.274  1.00 359.42 ? 557  GLN A OE1 1 
ATOM   2708  N  NE2 . GLN A  1 557  ? -22.333 -2.698  34.453  1.00 244.18 ? 557  GLN A NE2 1 
ATOM   2709  N  N   . LEU A  1 558  ? -27.302 -4.430  31.039  1.00 308.76 ? 558  LEU A N   1 
ATOM   2710  C  CA  . LEU A  1 558  ? -28.637 -4.540  30.468  1.00 329.37 ? 558  LEU A CA  1 
ATOM   2711  C  C   . LEU A  1 558  ? -28.788 -3.624  29.264  1.00 304.31 ? 558  LEU A C   1 
ATOM   2712  O  O   . LEU A  1 558  ? -29.830 -3.005  29.063  1.00 316.51 ? 558  LEU A O   1 
ATOM   2713  C  CB  . LEU A  1 558  ? -29.740 -4.284  31.503  1.00 313.39 ? 558  LEU A CB  1 
ATOM   2714  C  CG  . LEU A  1 558  ? -29.853 -5.357  32.588  1.00 242.52 ? 558  LEU A CG  1 
ATOM   2715  C  CD1 . LEU A  1 558  ? -30.862 -4.946  33.640  1.00 223.69 ? 558  LEU A CD1 1 
ATOM   2716  C  CD2 . LEU A  1 558  ? -30.231 -6.705  31.993  1.00 172.12 ? 558  LEU A CD2 1 
ATOM   2717  N  N   . SER A  1 559  ? -27.716 -3.510  28.490  1.00 243.03 ? 559  SER A N   1 
ATOM   2718  C  CA  . SER A  1 559  ? -27.847 -3.254  27.071  1.00 283.80 ? 559  SER A CA  1 
ATOM   2719  C  C   . SER A  1 559  ? -28.348 -4.570  26.515  1.00 270.66 ? 559  SER A C   1 
ATOM   2720  O  O   . SER A  1 559  ? -27.589 -5.532  26.418  1.00 268.83 ? 559  SER A O   1 
ATOM   2721  C  CB  . SER A  1 559  ? -26.506 -2.900  26.435  1.00 319.23 ? 559  SER A CB  1 
ATOM   2722  O  OG  . SER A  1 559  ? -26.661 -2.658  25.045  1.00 338.82 ? 559  SER A OG  1 
ATOM   2723  N  N   . SER A  1 560  ? -29.633 -4.627  26.184  1.00 264.60 ? 560  SER A N   1 
ATOM   2724  C  CA  . SER A  1 560  ? -30.245 -5.868  25.731  1.00 274.04 ? 560  SER A CA  1 
ATOM   2725  C  C   . SER A  1 560  ? -29.406 -6.516  24.644  1.00 265.45 ? 560  SER A C   1 
ATOM   2726  O  O   . SER A  1 560  ? -28.932 -7.639  24.800  1.00 245.65 ? 560  SER A O   1 
ATOM   2727  C  CB  . SER A  1 560  ? -31.659 -5.611  25.210  1.00 266.52 ? 560  SER A CB  1 
ATOM   2728  O  OG  . SER A  1 560  ? -32.538 -5.272  26.267  1.00 229.46 ? 560  SER A OG  1 
ATOM   2729  N  N   . ARG A  1 561  ? -29.207 -5.796  23.548  1.00 260.81 ? 561  ARG A N   1 
ATOM   2730  C  CA  . ARG A  1 561  ? -28.530 -6.363  22.395  1.00 254.94 ? 561  ARG A CA  1 
ATOM   2731  C  C   . ARG A  1 561  ? -27.977 -5.280  21.471  1.00 267.02 ? 561  ARG A C   1 
ATOM   2732  O  O   . ARG A  1 561  ? -28.569 -4.979  20.434  1.00 342.19 ? 561  ARG A O   1 
ATOM   2733  C  CB  . ARG A  1 561  ? -29.491 -7.276  21.619  1.00 287.84 ? 561  ARG A CB  1 
ATOM   2734  C  CG  . ARG A  1 561  ? -30.241 -8.280  22.488  1.00 318.93 ? 561  ARG A CG  1 
ATOM   2735  C  CD  . ARG A  1 561  ? -31.026 -9.275  21.663  1.00 335.96 ? 561  ARG A CD  1 
ATOM   2736  N  NE  . ARG A  1 561  ? -31.265 -10.511 22.401  1.00 326.23 ? 561  ARG A NE  1 
ATOM   2737  C  CZ  . ARG A  1 561  ? -32.297 -11.320 22.193  1.00 301.58 ? 561  ARG A CZ  1 
ATOM   2738  N  NH1 . ARG A  1 561  ? -33.203 -11.022 21.275  1.00 287.60 ? 561  ARG A NH1 1 
ATOM   2739  N  NH2 . ARG A  1 561  ? -32.431 -12.426 22.910  1.00 293.20 ? 561  ARG A NH2 1 
ATOM   2740  N  N   . LEU A  1 562  ? -26.855 -4.680  21.864  1.00 194.92 ? 562  LEU A N   1 
ATOM   2741  C  CA  . LEU A  1 562  ? -26.063 -3.865  20.944  1.00 251.77 ? 562  LEU A CA  1 
ATOM   2742  C  C   . LEU A  1 562  ? -24.647 -4.401  20.816  1.00 268.74 ? 562  LEU A C   1 
ATOM   2743  O  O   . LEU A  1 562  ? -23.968 -4.649  21.813  1.00 152.50 ? 562  LEU A O   1 
ATOM   2744  C  CB  . LEU A  1 562  ? -26.011 -2.406  21.377  1.00 202.77 ? 562  LEU A CB  1 
ATOM   2745  C  CG  . LEU A  1 562  ? -27.116 -1.520  20.813  1.00 254.45 ? 562  LEU A CG  1 
ATOM   2746  C  CD1 . LEU A  1 562  ? -26.640 -0.091  20.798  1.00 250.91 ? 562  LEU A CD1 1 
ATOM   2747  C  CD2 . LEU A  1 562  ? -27.521 -1.932  19.407  1.00 296.63 ? 562  LEU A CD2 1 
ATOM   2748  N  N   . GLN A  1 563  ? -24.196 -4.551  19.575  1.00 326.99 ? 563  GLN A N   1 
ATOM   2749  C  CA  . GLN A  1 563  ? -22.952 -5.253  19.300  1.00 313.56 ? 563  GLN A CA  1 
ATOM   2750  C  C   . GLN A  1 563  ? -21.774 -4.446  19.817  1.00 253.08 ? 563  GLN A C   1 
ATOM   2751  O  O   . GLN A  1 563  ? -21.235 -4.746  20.877  1.00 173.79 ? 563  GLN A O   1 
ATOM   2752  C  CB  . GLN A  1 563  ? -22.809 -5.535  17.801  1.00 316.63 ? 563  GLN A CB  1 
ATOM   2753  C  CG  . GLN A  1 563  ? -22.180 -6.885  17.487  1.00 301.34 ? 563  GLN A CG  1 
ATOM   2754  C  CD  . GLN A  1 563  ? -22.176 -7.193  16.006  1.00 317.08 ? 563  GLN A CD  1 
ATOM   2755  O  OE1 . GLN A  1 563  ? -22.253 -6.288  15.174  1.00 348.34 ? 563  GLN A OE1 1 
ATOM   2756  N  NE2 . GLN A  1 563  ? -22.087 -8.477  15.667  1.00 300.69 ? 563  GLN A NE2 1 
ATOM   2757  N  N   . TYR A  1 564  ? -21.385 -3.414  19.078  1.00 268.54 ? 564  TYR A N   1 
ATOM   2758  C  CA  . TYR A  1 564  ? -20.248 -2.596  19.475  1.00 279.87 ? 564  TYR A CA  1 
ATOM   2759  C  C   . TYR A  1 564  ? -20.717 -1.186  19.796  1.00 238.00 ? 564  TYR A C   1 
ATOM   2760  O  O   . TYR A  1 564  ? -21.343 -0.514  18.973  1.00 146.40 ? 564  TYR A O   1 
ATOM   2761  C  CB  . TYR A  1 564  ? -19.159 -2.590  18.393  1.00 288.60 ? 564  TYR A CB  1 
ATOM   2762  C  CG  . TYR A  1 564  ? -19.698 -2.557  16.987  1.00 269.58 ? 564  TYR A CG  1 
ATOM   2763  C  CD1 . TYR A  1 564  ? -19.942 -1.353  16.344  1.00 240.75 ? 564  TYR A CD1 1 
ATOM   2764  C  CD2 . TYR A  1 564  ? -19.969 -3.732  16.309  1.00 275.05 ? 564  TYR A CD2 1 
ATOM   2765  C  CE1 . TYR A  1 564  ? -20.446 -1.320  15.059  1.00 245.88 ? 564  TYR A CE1 1 
ATOM   2766  C  CE2 . TYR A  1 564  ? -20.466 -3.719  15.039  1.00 259.16 ? 564  TYR A CE2 1 
ATOM   2767  C  CZ  . TYR A  1 564  ? -20.699 -2.524  14.409  1.00 260.68 ? 564  TYR A CZ  1 
ATOM   2768  O  OH  . TYR A  1 564  ? -21.218 -2.705  13.145  1.00 291.29 ? 564  TYR A OH  1 
ATOM   2769  N  N   . PHE A  1 565  ? -20.422 -0.765  21.020  1.00 262.90 ? 565  PHE A N   1 
ATOM   2770  C  CA  . PHE A  1 565  ? -20.816 0.544   21.512  1.00 248.74 ? 565  PHE A CA  1 
ATOM   2771  C  C   . PHE A  1 565  ? -19.584 1.254   22.080  1.00 204.03 ? 565  PHE A C   1 
ATOM   2772  O  O   . PHE A  1 565  ? -18.683 0.614   22.627  1.00 191.09 ? 565  PHE A O   1 
ATOM   2773  C  CB  . PHE A  1 565  ? -21.918 0.387   22.568  1.00 286.67 ? 565  PHE A CB  1 
ATOM   2774  C  CG  . PHE A  1 565  ? -21.546 0.894   23.936  1.00 252.18 ? 565  PHE A CG  1 
ATOM   2775  C  CD1 . PHE A  1 565  ? -22.198 1.998   24.471  1.00 203.78 ? 565  PHE A CD1 1 
ATOM   2776  C  CD2 . PHE A  1 565  ? -20.572 0.263   24.694  1.00 208.36 ? 565  PHE A CD2 1 
ATOM   2777  C  CE1 . PHE A  1 565  ? -21.880 2.469   25.725  1.00 116.70 ? 565  PHE A CE1 1 
ATOM   2778  C  CE2 . PHE A  1 565  ? -20.244 0.728   25.948  1.00 228.72 ? 565  PHE A CE2 1 
ATOM   2779  C  CZ  . PHE A  1 565  ? -20.898 1.833   26.467  1.00 206.98 ? 565  PHE A CZ  1 
ATOM   2780  N  N   . GLY A  1 566  ? -19.541 2.573   21.927  1.00 196.62 ? 566  GLY A N   1 
ATOM   2781  C  CA  . GLY A  1 566  ? -18.398 3.353   22.360  1.00 157.60 ? 566  GLY A CA  1 
ATOM   2782  C  C   . GLY A  1 566  ? -17.531 3.739   21.184  1.00 171.87 ? 566  GLY A C   1 
ATOM   2783  O  O   . GLY A  1 566  ? -16.480 4.345   21.363  1.00 157.89 ? 566  GLY A O   1 
ATOM   2784  N  N   . GLN A  1 567  ? -17.965 3.382   19.980  1.00 197.10 ? 567  GLN A N   1 
ATOM   2785  C  CA  . GLN A  1 567  ? -17.225 3.762   18.786  1.00 239.23 ? 567  GLN A CA  1 
ATOM   2786  C  C   . GLN A  1 567  ? -16.721 5.178   18.952  1.00 231.57 ? 567  GLN A C   1 
ATOM   2787  O  O   . GLN A  1 567  ? -15.527 5.444   18.842  1.00 276.17 ? 567  GLN A O   1 
ATOM   2788  C  CB  . GLN A  1 567  ? -18.106 3.722   17.556  1.00 266.59 ? 567  GLN A CB  1 
ATOM   2789  C  CG  . GLN A  1 567  ? -18.575 2.372   17.225  1.00 261.22 ? 567  GLN A CG  1 
ATOM   2790  C  CD  . GLN A  1 567  ? -19.815 2.477   16.401  1.00 241.13 ? 567  GLN A CD  1 
ATOM   2791  O  OE1 . GLN A  1 567  ? -19.816 3.202   15.421  1.00 270.11 ? 567  GLN A OE1 1 
ATOM   2792  N  NE2 . GLN A  1 567  ? -20.947 1.791   16.835  1.00 205.05 ? 567  GLN A NE2 1 
ATOM   2793  N  N   . ALA A  1 568  ? -17.655 6.089   19.206  1.00 155.89 ? 568  ALA A N   1 
ATOM   2794  C  CA  . ALA A  1 568  ? -17.325 7.493   19.407  1.00 187.87 ? 568  ALA A CA  1 
ATOM   2795  C  C   . ALA A  1 568  ? -18.058 8.002   20.629  1.00 178.26 ? 568  ALA A C   1 
ATOM   2796  O  O   . ALA A  1 568  ? -19.012 7.370   21.090  1.00 173.83 ? 568  ALA A O   1 
ATOM   2797  C  CB  . ALA A  1 568  ? -17.707 8.320   18.187  1.00 261.98 ? 568  ALA A CB  1 
ATOM   2798  N  N   . LEU A  1 569  ? -17.619 9.149   21.143  1.00 192.03 ? 569  LEU A N   1 
ATOM   2799  C  CA  . LEU A  1 569  ? -18.232 9.740   22.327  1.00 183.15 ? 569  LEU A CA  1 
ATOM   2800  C  C   . LEU A  1 569  ? -17.685 11.128  22.634  1.00 137.22 ? 569  LEU A C   1 
ATOM   2801  O  O   . LEU A  1 569  ? -16.498 11.395  22.460  1.00 201.17 ? 569  LEU A O   1 
ATOM   2802  C  CB  . LEU A  1 569  ? -18.036 8.820   23.532  1.00 183.01 ? 569  LEU A CB  1 
ATOM   2803  C  CG  . LEU A  1 569  ? -16.601 8.376   23.814  1.00 190.73 ? 569  LEU A CG  1 
ATOM   2804  C  CD1 . LEU A  1 569  ? -15.882 9.439   24.621  1.00 239.92 ? 569  LEU A CD1 1 
ATOM   2805  C  CD2 . LEU A  1 569  ? -16.587 7.037   24.549  1.00 142.27 ? 569  LEU A CD2 1 
ATOM   2806  N  N   . SER A  1 570  ? -18.574 12.009  23.081  1.00 117.48 ? 570  SER A N   1 
ATOM   2807  C  CA  . SER A  1 570  ? -18.206 13.366  23.464  1.00 183.82 ? 570  SER A CA  1 
ATOM   2808  C  C   . SER A  1 570  ? -19.094 13.820  24.603  1.00 175.37 ? 570  SER A C   1 
ATOM   2809  O  O   . SER A  1 570  ? -20.317 13.678  24.551  1.00 101.92 ? 570  SER A O   1 
ATOM   2810  C  CB  . SER A  1 570  ? -18.345 14.341  22.294  1.00 173.62 ? 570  SER A CB  1 
ATOM   2811  O  OG  . SER A  1 570  ? -17.247 14.235  21.410  1.00 221.98 ? 570  SER A OG  1 
ATOM   2812  N  N   . GLY A  1 571  ? -18.465 14.374  25.631  1.00 189.22 ? 571  GLY A N   1 
ATOM   2813  C  CA  . GLY A  1 571  ? -19.177 14.832  26.804  1.00 156.32 ? 571  GLY A CA  1 
ATOM   2814  C  C   . GLY A  1 571  ? -18.564 16.093  27.384  1.00 183.09 ? 571  GLY A C   1 
ATOM   2815  O  O   . GLY A  1 571  ? -17.553 16.604  26.887  1.00 134.60 ? 571  GLY A O   1 
ATOM   2816  N  N   . GLY A  1 572  ? -19.188 16.593  28.445  1.00 183.70 ? 572  GLY A N   1 
ATOM   2817  C  CA  . GLY A  1 572  ? -18.708 17.774  29.131  1.00 161.70 ? 572  GLY A CA  1 
ATOM   2818  C  C   . GLY A  1 572  ? -19.786 18.824  29.251  1.00 174.00 ? 572  GLY A C   1 
ATOM   2819  O  O   . GLY A  1 572  ? -19.623 19.800  29.977  1.00 180.47 ? 572  GLY A O   1 
ATOM   2820  N  N   . GLN A  1 573  ? -20.894 18.617  28.547  1.00 191.46 ? 573  GLN A N   1 
ATOM   2821  C  CA  . GLN A  1 573  ? -21.963 19.606  28.502  1.00 218.11 ? 573  GLN A CA  1 
ATOM   2822  C  C   . GLN A  1 573  ? -23.192 19.159  29.290  1.00 169.00 ? 573  GLN A C   1 
ATOM   2823  O  O   . GLN A  1 573  ? -23.580 17.992  29.263  1.00 109.34 ? 573  GLN A O   1 
ATOM   2824  C  CB  . GLN A  1 573  ? -22.354 19.905  27.051  1.00 235.91 ? 573  GLN A CB  1 
ATOM   2825  C  CG  . GLN A  1 573  ? -21.347 20.768  26.292  1.00 239.85 ? 573  GLN A CG  1 
ATOM   2826  C  CD  . GLN A  1 573  ? -20.141 19.986  25.805  1.00 245.99 ? 573  GLN A CD  1 
ATOM   2827  O  OE1 . GLN A  1 573  ? -20.075 18.766  25.952  1.00 262.56 ? 573  GLN A OE1 1 
ATOM   2828  N  NE2 . GLN A  1 573  ? -19.179 20.689  25.219  1.00 241.49 ? 573  GLN A NE2 1 
ATOM   2829  N  N   . ASP A  1 574  ? -23.795 20.109  29.996  1.00 184.82 ? 574  ASP A N   1 
ATOM   2830  C  CA  . ASP A  1 574  ? -25.004 19.850  30.765  1.00 195.88 ? 574  ASP A CA  1 
ATOM   2831  C  C   . ASP A  1 574  ? -26.213 20.074  29.883  1.00 173.66 ? 574  ASP A C   1 
ATOM   2832  O  O   . ASP A  1 574  ? -26.578 21.207  29.573  1.00 276.30 ? 574  ASP A O   1 
ATOM   2833  C  CB  . ASP A  1 574  ? -25.070 20.754  32.002  1.00 259.40 ? 574  ASP A CB  1 
ATOM   2834  C  CG  . ASP A  1 574  ? -26.491 20.940  32.525  1.00 251.74 ? 574  ASP A CG  1 
ATOM   2835  O  OD1 . ASP A  1 574  ? -27.329 20.040  32.317  1.00 180.06 ? 574  ASP A OD1 1 
ATOM   2836  O  OD2 . ASP A  1 574  ? -26.770 21.986  33.152  1.00 275.91 ? 574  ASP A OD2 1 
ATOM   2837  N  N   . LEU A  1 575  ? -26.841 18.975  29.501  1.00 129.25 ? 575  LEU A N   1 
ATOM   2838  C  CA  . LEU A  1 575  ? -27.925 19.011  28.539  1.00 215.38 ? 575  LEU A CA  1 
ATOM   2839  C  C   . LEU A  1 575  ? -29.279 18.640  29.160  1.00 237.87 ? 575  LEU A C   1 
ATOM   2840  O  O   . LEU A  1 575  ? -30.320 19.132  28.720  1.00 275.70 ? 575  LEU A O   1 
ATOM   2841  C  CB  . LEU A  1 575  ? -27.588 18.085  27.361  1.00 215.09 ? 575  LEU A CB  1 
ATOM   2842  C  CG  . LEU A  1 575  ? -27.272 16.624  27.704  1.00 178.14 ? 575  LEU A CG  1 
ATOM   2843  C  CD1 . LEU A  1 575  ? -28.562 15.834  27.876  1.00 225.88 ? 575  LEU A CD1 1 
ATOM   2844  C  CD2 . LEU A  1 575  ? -26.399 15.978  26.642  1.00 96.37  ? 575  LEU A CD2 1 
ATOM   2845  N  N   . THR A  1 576  ? -29.273 17.776  30.171  1.00 204.61 ? 576  THR A N   1 
ATOM   2846  C  CA  . THR A  1 576  ? -30.520 17.374  30.825  1.00 180.83 ? 576  THR A CA  1 
ATOM   2847  C  C   . THR A  1 576  ? -30.918 18.437  31.854  1.00 219.34 ? 576  THR A C   1 
ATOM   2848  O  O   . THR A  1 576  ? -32.011 18.402  32.418  1.00 212.13 ? 576  THR A O   1 
ATOM   2849  C  CB  . THR A  1 576  ? -30.402 15.975  31.481  1.00 178.95 ? 576  THR A CB  1 
ATOM   2850  O  OG1 . THR A  1 576  ? -29.652 16.060  32.693  1.00 229.94 ? 576  THR A OG1 1 
ATOM   2851  C  CG2 . THR A  1 576  ? -29.725 14.972  30.550  1.00 207.04 ? 576  THR A CG2 1 
ATOM   2852  N  N   . GLN A  1 577  ? -30.011 19.381  32.087  1.00 241.40 ? 577  GLN A N   1 
ATOM   2853  C  CA  . GLN A  1 577  ? -30.294 20.559  32.898  1.00 239.92 ? 577  GLN A CA  1 
ATOM   2854  C  C   . GLN A  1 577  ? -30.473 20.224  34.376  1.00 218.56 ? 577  GLN A C   1 
ATOM   2855  O  O   . GLN A  1 577  ? -30.707 21.104  35.202  1.00 182.78 ? 577  GLN A O   1 
ATOM   2856  C  CB  . GLN A  1 577  ? -31.491 21.311  32.323  1.00 220.18 ? 577  GLN A CB  1 
ATOM   2857  C  CG  . GLN A  1 577  ? -31.147 22.049  31.040  1.00 213.63 ? 577  GLN A CG  1 
ATOM   2858  C  CD  . GLN A  1 577  ? -32.316 22.832  30.491  1.00 272.51 ? 577  GLN A CD  1 
ATOM   2859  O  OE1 . GLN A  1 577  ? -33.456 22.632  30.903  1.00 307.97 ? 577  GLN A OE1 1 
ATOM   2860  N  NE2 . GLN A  1 577  ? -32.041 23.732  29.555  1.00 295.96 ? 577  GLN A NE2 1 
ATOM   2861  N  N   . ASP A  1 578  ? -30.360 18.944  34.707  1.00 201.69 ? 578  ASP A N   1 
ATOM   2862  C  CA  . ASP A  1 578  ? -29.958 18.579  36.044  1.00 187.97 ? 578  ASP A CA  1 
ATOM   2863  C  C   . ASP A  1 578  ? -28.497 18.994  36.046  1.00 199.04 ? 578  ASP A C   1 
ATOM   2864  O  O   . ASP A  1 578  ? -27.790 18.822  35.069  1.00 315.57 ? 578  ASP A O   1 
ATOM   2865  C  CB  . ASP A  1 578  ? -30.185 17.088  36.347  1.00 204.33 ? 578  ASP A CB  1 
ATOM   2866  C  CG  . ASP A  1 578  ? -29.408 16.168  35.438  1.00 192.78 ? 578  ASP A CG  1 
ATOM   2867  O  OD1 . ASP A  1 578  ? -28.455 16.627  34.797  1.00 184.31 ? 578  ASP A OD1 1 
ATOM   2868  O  OD2 . ASP A  1 578  ? -29.745 14.969  35.381  1.00 189.67 ? 578  ASP A OD2 1 
ATOM   2869  N  N   . GLY A  1 579  ? -28.050 19.535  37.158  1.00 126.60 ? 579  GLY A N   1 
ATOM   2870  C  CA  . GLY A  1 579  ? -26.886 20.396  37.199  1.00 137.59 ? 579  GLY A CA  1 
ATOM   2871  C  C   . GLY A  1 579  ? -25.632 19.956  36.474  1.00 148.47 ? 579  GLY A C   1 
ATOM   2872  O  O   . GLY A  1 579  ? -25.188 20.655  35.573  1.00 191.18 ? 579  GLY A O   1 
ATOM   2873  N  N   . LEU A  1 580  ? -25.065 18.814  36.861  1.00 147.06 ? 580  LEU A N   1 
ATOM   2874  C  CA  . LEU A  1 580  ? -23.694 18.465  36.475  1.00 198.73 ? 580  LEU A CA  1 
ATOM   2875  C  C   . LEU A  1 580  ? -23.599 17.943  35.048  1.00 218.43 ? 580  LEU A C   1 
ATOM   2876  O  O   . LEU A  1 580  ? -24.609 17.627  34.436  1.00 134.10 ? 580  LEU A O   1 
ATOM   2877  C  CB  . LEU A  1 580  ? -23.121 17.421  37.430  1.00 190.85 ? 580  LEU A CB  1 
ATOM   2878  C  CG  . LEU A  1 580  ? -21.609 17.190  37.340  1.00 213.73 ? 580  LEU A CG  1 
ATOM   2879  C  CD1 . LEU A  1 580  ? -20.847 18.514  37.392  1.00 173.99 ? 580  LEU A CD1 1 
ATOM   2880  C  CD2 . LEU A  1 580  ? -21.153 16.260  38.445  1.00 214.46 ? 580  LEU A CD2 1 
ATOM   2881  N  N   . VAL A  1 581  ? -22.374 17.829  34.537  1.00 251.03 ? 581  VAL A N   1 
ATOM   2882  C  CA  . VAL A  1 581  ? -22.140 17.500  33.131  1.00 227.01 ? 581  VAL A CA  1 
ATOM   2883  C  C   . VAL A  1 581  ? -22.785 16.182  32.729  1.00 211.80 ? 581  VAL A C   1 
ATOM   2884  O  O   . VAL A  1 581  ? -23.218 15.406  33.582  1.00 144.83 ? 581  VAL A O   1 
ATOM   2885  C  CB  . VAL A  1 581  ? -20.638 17.396  32.825  1.00 193.84 ? 581  VAL A CB  1 
ATOM   2886  C  CG1 . VAL A  1 581  ? -19.934 18.706  33.157  1.00 245.49 ? 581  VAL A CG1 1 
ATOM   2887  C  CG2 . VAL A  1 581  ? -20.033 16.241  33.599  1.00 121.97 ? 581  VAL A CG2 1 
ATOM   2888  N  N   . ASP A  1 582  ? -22.842 15.938  31.422  1.00 218.41 ? 582  ASP A N   1 
ATOM   2889  C  CA  . ASP A  1 582  ? -23.382 14.694  30.889  1.00 184.03 ? 582  ASP A CA  1 
ATOM   2890  C  C   . ASP A  1 582  ? -22.435 14.100  29.869  1.00 170.12 ? 582  ASP A C   1 
ATOM   2891  O  O   . ASP A  1 582  ? -21.542 14.781  29.361  1.00 185.38 ? 582  ASP A O   1 
ATOM   2892  C  CB  . ASP A  1 582  ? -24.735 14.922  30.217  1.00 163.88 ? 582  ASP A CB  1 
ATOM   2893  C  CG  . ASP A  1 582  ? -25.825 15.252  31.202  1.00 208.05 ? 582  ASP A CG  1 
ATOM   2894  O  OD1 . ASP A  1 582  ? -25.762 14.770  32.356  1.00 237.83 ? 582  ASP A OD1 1 
ATOM   2895  O  OD2 . ASP A  1 582  ? -26.754 15.987  30.811  1.00 146.81 ? 582  ASP A OD2 1 
ATOM   2896  N  N   . LEU A  1 583  ? -22.650 12.827  29.560  1.00 154.37 ? 583  LEU A N   1 
ATOM   2897  C  CA  . LEU A  1 583  ? -21.830 12.131  28.583  1.00 185.29 ? 583  LEU A CA  1 
ATOM   2898  C  C   . LEU A  1 583  ? -22.712 11.500  27.519  1.00 172.71 ? 583  LEU A C   1 
ATOM   2899  O  O   . LEU A  1 583  ? -23.788 10.992  27.822  1.00 159.34 ? 583  LEU A O   1 
ATOM   2900  C  CB  . LEU A  1 583  ? -20.989 11.053  29.268  1.00 145.97 ? 583  LEU A CB  1 
ATOM   2901  C  CG  . LEU A  1 583  ? -20.133 10.182  28.344  1.00 143.91 ? 583  LEU A CG  1 
ATOM   2902  C  CD1 . LEU A  1 583  ? -19.102 11.021  27.587  1.00 144.27 ? 583  LEU A CD1 1 
ATOM   2903  C  CD2 . LEU A  1 583  ? -19.445 9.085   29.120  1.00 125.27 ? 583  LEU A CD2 1 
ATOM   2904  N  N   . ALA A  1 584  ? -22.247 11.548  26.272  1.00 188.94 ? 584  ALA A N   1 
ATOM   2905  C  CA  . ALA A  1 584  ? -22.938 10.919  25.146  1.00 165.12 ? 584  ALA A CA  1 
ATOM   2906  C  C   . ALA A  1 584  ? -22.040 9.892   24.433  1.00 170.31 ? 584  ALA A C   1 
ATOM   2907  O  O   . ALA A  1 584  ? -20.972 10.239  23.902  1.00 115.73 ? 584  ALA A O   1 
ATOM   2908  C  CB  . ALA A  1 584  ? -23.400 11.982  24.169  1.00 195.33 ? 584  ALA A CB  1 
ATOM   2909  N  N   . VAL A  1 585  ? -22.481 8.632   24.427  1.00 159.75 ? 585  VAL A N   1 
ATOM   2910  C  CA  . VAL A  1 585  ? -21.732 7.553   23.791  1.00 189.79 ? 585  VAL A CA  1 
ATOM   2911  C  C   . VAL A  1 585  ? -22.561 6.902   22.700  1.00 206.13 ? 585  VAL A C   1 
ATOM   2912  O  O   . VAL A  1 585  ? -23.611 6.316   22.973  1.00 174.89 ? 585  VAL A O   1 
ATOM   2913  C  CB  . VAL A  1 585  ? -21.321 6.470   24.799  1.00 146.86 ? 585  VAL A CB  1 
ATOM   2914  C  CG1 . VAL A  1 585  ? -20.582 5.350   24.097  1.00 182.90 ? 585  VAL A CG1 1 
ATOM   2915  C  CG2 . VAL A  1 585  ? -20.446 7.066   25.880  1.00 203.28 ? 585  VAL A CG2 1 
ATOM   2916  N  N   . GLY A  1 586  ? -22.075 7.005   21.466  1.00 192.65 ? 586  GLY A N   1 
ATOM   2917  C  CA  . GLY A  1 586  ? -22.754 6.439   20.318  1.00 194.75 ? 586  GLY A CA  1 
ATOM   2918  C  C   . GLY A  1 586  ? -22.535 4.944   20.171  1.00 214.90 ? 586  GLY A C   1 
ATOM   2919  O  O   . GLY A  1 586  ? -21.468 4.421   20.492  1.00 170.28 ? 586  GLY A O   1 
ATOM   2920  N  N   . ALA A  1 587  ? -23.558 4.257   19.674  1.00 223.55 ? 587  ALA A N   1 
ATOM   2921  C  CA  . ALA A  1 587  ? -23.499 2.817   19.470  1.00 214.82 ? 587  ALA A CA  1 
ATOM   2922  C  C   . ALA A  1 587  ? -24.253 2.452   18.205  1.00 220.97 ? 587  ALA A C   1 
ATOM   2923  O  O   . ALA A  1 587  ? -25.048 3.241   17.700  1.00 237.80 ? 587  ALA A O   1 
ATOM   2924  C  CB  . ALA A  1 587  ? -24.097 2.097   20.655  1.00 248.70 ? 587  ALA A CB  1 
ATOM   2925  N  N   . ARG A  1 588  ? -24.011 1.254   17.693  1.00 219.18 ? 588  ARG A N   1 
ATOM   2926  C  CA  . ARG A  1 588  ? -24.682 0.829   16.477  1.00 245.54 ? 588  ARG A CA  1 
ATOM   2927  C  C   . ARG A  1 588  ? -26.190 0.787   16.678  1.00 233.61 ? 588  ARG A C   1 
ATOM   2928  O  O   . ARG A  1 588  ? -26.703 -0.048  17.422  1.00 208.39 ? 588  ARG A O   1 
ATOM   2929  C  CB  . ARG A  1 588  ? -24.182 -0.541  16.029  1.00 272.22 ? 588  ARG A CB  1 
ATOM   2930  C  CG  . ARG A  1 588  ? -24.713 -0.947  14.664  1.00 311.96 ? 588  ARG A CG  1 
ATOM   2931  C  CD  . ARG A  1 588  ? -24.181 -2.293  14.229  1.00 319.63 ? 588  ARG A CD  1 
ATOM   2932  N  NE  . ARG A  1 588  ? -24.459 -2.553  12.820  1.00 317.19 ? 588  ARG A NE  1 
ATOM   2933  C  CZ  . ARG A  1 588  ? -24.026 -3.620  12.159  1.00 356.95 ? 588  ARG A CZ  1 
ATOM   2934  N  NH1 . ARG A  1 588  ? -23.290 -4.533  12.777  1.00 389.84 ? 588  ARG A NH1 1 
ATOM   2935  N  NH2 . ARG A  1 588  ? -24.328 -3.775  10.878  1.00 360.78 ? 588  ARG A NH2 1 
ATOM   2936  N  N   . GLY A  1 589  ? -26.890 1.700   16.012  1.00 196.59 ? 589  GLY A N   1 
ATOM   2937  C  CA  . GLY A  1 589  ? -28.339 1.728   16.036  1.00 189.19 ? 589  GLY A CA  1 
ATOM   2938  C  C   . GLY A  1 589  ? -28.886 2.813   16.940  1.00 202.19 ? 589  GLY A C   1 
ATOM   2939  O  O   . GLY A  1 589  ? -29.757 3.586   16.535  1.00 176.78 ? 589  GLY A O   1 
ATOM   2940  N  N   . GLN A  1 590  ? -28.369 2.875   18.165  1.00 243.32 ? 590  GLN A N   1 
ATOM   2941  C  CA  . GLN A  1 590  ? -28.858 3.825   19.163  1.00 238.14 ? 590  GLN A CA  1 
ATOM   2942  C  C   . GLN A  1 590  ? -27.690 4.523   19.863  1.00 227.19 ? 590  GLN A C   1 
ATOM   2943  O  O   . GLN A  1 590  ? -26.541 4.075   19.782  1.00 186.33 ? 590  GLN A O   1 
ATOM   2944  C  CB  . GLN A  1 590  ? -29.738 3.110   20.195  1.00 204.57 ? 590  GLN A CB  1 
ATOM   2945  C  CG  . GLN A  1 590  ? -28.956 2.406   21.279  1.00 243.66 ? 590  GLN A CG  1 
ATOM   2946  C  CD  . GLN A  1 590  ? -29.750 1.312   21.959  1.00 229.55 ? 590  GLN A CD  1 
ATOM   2947  O  OE1 . GLN A  1 590  ? -30.973 1.231   21.818  1.00 216.85 ? 590  GLN A OE1 1 
ATOM   2948  N  NE2 . GLN A  1 590  ? -29.054 0.463   22.711  1.00 220.75 ? 590  GLN A NE2 1 
ATOM   2949  N  N   . VAL A  1 591  ? -27.992 5.623   20.547  1.00 228.03 ? 591  VAL A N   1 
ATOM   2950  C  CA  . VAL A  1 591  ? -26.987 6.374   21.292  1.00 230.49 ? 591  VAL A CA  1 
ATOM   2951  C  C   . VAL A  1 591  ? -27.520 6.672   22.687  1.00 239.74 ? 591  VAL A C   1 
ATOM   2952  O  O   . VAL A  1 591  ? -28.684 7.054   22.842  1.00 208.04 ? 591  VAL A O   1 
ATOM   2953  C  CB  . VAL A  1 591  ? -26.635 7.693   20.585  1.00 200.65 ? 591  VAL A CB  1 
ATOM   2954  C  CG1 . VAL A  1 591  ? -27.899 8.519   20.345  1.00 243.65 ? 591  VAL A CG1 1 
ATOM   2955  C  CG2 . VAL A  1 591  ? -25.599 8.475   21.389  1.00 168.04 ? 591  VAL A CG2 1 
ATOM   2956  N  N   . LEU A  1 592  ? -26.670 6.480   23.696  1.00 216.15 ? 592  LEU A N   1 
ATOM   2957  C  CA  . LEU A  1 592  ? -27.074 6.642   25.091  1.00 236.84 ? 592  LEU A CA  1 
ATOM   2958  C  C   . LEU A  1 592  ? -26.471 7.870   25.761  1.00 220.67 ? 592  LEU A C   1 
ATOM   2959  O  O   . LEU A  1 592  ? -25.403 8.359   25.351  1.00 111.89 ? 592  LEU A O   1 
ATOM   2960  C  CB  . LEU A  1 592  ? -26.669 5.421   25.907  1.00 210.14 ? 592  LEU A CB  1 
ATOM   2961  C  CG  . LEU A  1 592  ? -27.542 4.185   25.750  1.00 149.27 ? 592  LEU A CG  1 
ATOM   2962  C  CD1 . LEU A  1 592  ? -27.536 3.709   24.320  1.00 188.80 ? 592  LEU A CD1 1 
ATOM   2963  C  CD2 . LEU A  1 592  ? -27.043 3.104   26.680  1.00 242.47 ? 592  LEU A CD2 1 
ATOM   2964  N  N   . LEU A  1 593  ? -27.157 8.324   26.816  1.00 198.31 ? 593  LEU A N   1 
ATOM   2965  C  CA  . LEU A  1 593  ? -26.718 9.449   27.640  1.00 219.90 ? 593  LEU A CA  1 
ATOM   2966  C  C   . LEU A  1 593  ? -26.581 8.997   29.100  1.00 221.01 ? 593  LEU A C   1 
ATOM   2967  O  O   . LEU A  1 593  ? -27.550 8.552   29.729  1.00 183.53 ? 593  LEU A O   1 
ATOM   2968  C  CB  . LEU A  1 593  ? -27.689 10.643  27.529  1.00 150.37 ? 593  LEU A CB  1 
ATOM   2969  C  CG  . LEU A  1 593  ? -27.479 11.632  26.371  1.00 183.72 ? 593  LEU A CG  1 
ATOM   2970  C  CD1 . LEU A  1 593  ? -28.641 12.621  26.299  1.00 208.39 ? 593  LEU A CD1 1 
ATOM   2971  C  CD2 . LEU A  1 593  ? -26.134 12.378  26.457  1.00 137.45 ? 593  LEU A CD2 1 
ATOM   2972  N  N   . LEU A  1 594  ? -25.360 9.090   29.618  1.00 210.79 ? 594  LEU A N   1 
ATOM   2973  C  CA  . LEU A  1 594  ? -25.082 8.754   31.004  1.00 178.53 ? 594  LEU A CA  1 
ATOM   2974  C  C   . LEU A  1 594  ? -24.788 10.015  31.797  1.00 190.65 ? 594  LEU A C   1 
ATOM   2975  O  O   . LEU A  1 594  ? -23.801 10.706  31.540  1.00 178.57 ? 594  LEU A O   1 
ATOM   2976  C  CB  . LEU A  1 594  ? -23.893 7.802   31.088  1.00 163.53 ? 594  LEU A CB  1 
ATOM   2977  C  CG  . LEU A  1 594  ? -24.211 6.354   30.723  1.00 128.02 ? 594  LEU A CG  1 
ATOM   2978  C  CD1 . LEU A  1 594  ? -24.781 6.262   29.320  1.00 215.31 ? 594  LEU A CD1 1 
ATOM   2979  C  CD2 . LEU A  1 594  ? -22.962 5.500   30.857  1.00 197.11 ? 594  LEU A CD2 1 
ATOM   2980  N  N   . ARG A  1 595  ? -25.662 10.319  32.750  1.00 217.48 ? 595  ARG A N   1 
ATOM   2981  C  CA  . ARG A  1 595  ? -25.471 11.471  33.620  1.00 232.70 ? 595  ARG A CA  1 
ATOM   2982  C  C   . ARG A  1 595  ? -24.472 11.141  34.730  1.00 214.41 ? 595  ARG A C   1 
ATOM   2983  O  O   . ARG A  1 595  ? -24.156 9.968   34.968  1.00 95.19  ? 595  ARG A O   1 
ATOM   2984  C  CB  . ARG A  1 595  ? -26.808 11.907  34.216  1.00 216.93 ? 595  ARG A CB  1 
ATOM   2985  C  CG  . ARG A  1 595  ? -27.898 12.105  33.184  1.00 250.98 ? 595  ARG A CG  1 
ATOM   2986  C  CD  . ARG A  1 595  ? -29.107 12.772  33.793  1.00 227.79 ? 595  ARG A CD  1 
ATOM   2987  N  NE  . ARG A  1 595  ? -29.992 11.835  34.485  1.00 226.68 ? 595  ARG A NE  1 
ATOM   2988  C  CZ  . ARG A  1 595  ? -31.010 11.197  33.911  1.00 278.97 ? 595  ARG A CZ  1 
ATOM   2989  N  NH1 . ARG A  1 595  ? -31.277 11.380  32.623  1.00 314.41 ? 595  ARG A NH1 1 
ATOM   2990  N  NH2 . ARG A  1 595  ? -31.763 10.371  34.623  1.00 271.03 ? 595  ARG A NH2 1 
ATOM   2991  N  N   . THR A  1 596  ? -23.967 12.182  35.391  1.00 194.69 ? 596  THR A N   1 
ATOM   2992  C  CA  . THR A  1 596  ? -23.003 12.018  36.479  1.00 171.34 ? 596  THR A CA  1 
ATOM   2993  C  C   . THR A  1 596  ? -23.661 12.223  37.837  1.00 171.20 ? 596  THR A C   1 
ATOM   2994  O  O   . THR A  1 596  ? -24.119 13.327  38.143  1.00 206.19 ? 596  THR A O   1 
ATOM   2995  C  CB  . THR A  1 596  ? -21.813 13.006  36.348  1.00 154.20 ? 596  THR A CB  1 
ATOM   2996  O  OG1 . THR A  1 596  ? -22.298 14.345  36.177  1.00 178.94 ? 596  THR A OG1 1 
ATOM   2997  C  CG2 . THR A  1 596  ? -20.927 12.627  35.159  1.00 118.30 ? 596  THR A CG2 1 
ATOM   2998  N  N   . ARG A  1 597  ? -23.708 11.165  38.651  1.00 155.73 ? 597  ARG A N   1 
ATOM   2999  C  CA  . ARG A  1 597  ? -24.390 11.227  39.944  1.00 188.13 ? 597  ARG A CA  1 
ATOM   3000  C  C   . ARG A  1 597  ? -23.564 12.019  40.951  1.00 193.14 ? 597  ARG A C   1 
ATOM   3001  O  O   . ARG A  1 597  ? -22.348 11.854  41.008  1.00 196.24 ? 597  ARG A O   1 
ATOM   3002  C  CB  . ARG A  1 597  ? -24.703 9.823   40.478  1.00 137.22 ? 597  ARG A CB  1 
ATOM   3003  C  CG  . ARG A  1 597  ? -25.669 9.053   39.592  1.00 282.25 ? 597  ARG A CG  1 
ATOM   3004  C  CD  . ARG A  1 597  ? -27.083 9.656   39.635  1.00 364.32 ? 597  ARG A CD  1 
ATOM   3005  N  NE  . ARG A  1 597  ? -28.059 8.923   38.821  1.00 364.83 ? 597  ARG A NE  1 
ATOM   3006  C  CZ  . ARG A  1 597  ? -28.359 9.203   37.553  1.00 313.88 ? 597  ARG A CZ  1 
ATOM   3007  N  NH1 . ARG A  1 597  ? -27.757 10.197  36.915  1.00 257.01 ? 597  ARG A NH1 1 
ATOM   3008  N  NH2 . ARG A  1 597  ? -29.266 8.481   36.912  1.00 309.58 ? 597  ARG A NH2 1 
ATOM   3009  N  N   . PRO A  1 598  ? -24.222 12.910  41.720  1.00 172.96 ? 598  PRO A N   1 
ATOM   3010  C  CA  . PRO A  1 598  ? -23.518 13.785  42.666  1.00 117.32 ? 598  PRO A CA  1 
ATOM   3011  C  C   . PRO A  1 598  ? -22.708 13.006  43.682  1.00 164.57 ? 598  PRO A C   1 
ATOM   3012  O  O   . PRO A  1 598  ? -23.239 12.093  44.313  1.00 190.85 ? 598  PRO A O   1 
ATOM   3013  C  CB  . PRO A  1 598  ? -24.653 14.540  43.354  1.00 122.60 ? 598  PRO A CB  1 
ATOM   3014  C  CG  . PRO A  1 598  ? -25.767 14.523  42.373  1.00 178.80 ? 598  PRO A CG  1 
ATOM   3015  C  CD  . PRO A  1 598  ? -25.665 13.206  41.674  1.00 184.42 ? 598  PRO A CD  1 
ATOM   3016  N  N   . VAL A  1 599  ? -21.430 13.347  43.812  1.00 152.60 ? 599  VAL A N   1 
ATOM   3017  C  CA  . VAL A  1 599  ? -20.594 12.765  44.854  1.00 163.43 ? 599  VAL A CA  1 
ATOM   3018  C  C   . VAL A  1 599  ? -20.282 13.833  45.890  1.00 176.80 ? 599  VAL A C   1 
ATOM   3019  O  O   . VAL A  1 599  ? -19.477 14.737  45.653  1.00 152.86 ? 599  VAL A O   1 
ATOM   3020  C  CB  . VAL A  1 599  ? -19.269 12.179  44.312  1.00 146.29 ? 599  VAL A CB  1 
ATOM   3021  C  CG1 . VAL A  1 599  ? -19.544 11.075  43.320  1.00 225.31 ? 599  VAL A CG1 1 
ATOM   3022  C  CG2 . VAL A  1 599  ? -18.426 13.264  43.672  1.00 235.17 ? 599  VAL A CG2 1 
ATOM   3023  N  N   . LEU A  1 600  ? -20.960 13.744  47.032  1.00 250.84 ? 600  LEU A N   1 
ATOM   3024  C  CA  . LEU A  1 600  ? -20.626 14.565  48.190  1.00 244.32 ? 600  LEU A CA  1 
ATOM   3025  C  C   . LEU A  1 600  ? -19.906 13.692  49.206  1.00 204.15 ? 600  LEU A C   1 
ATOM   3026  O  O   . LEU A  1 600  ? -20.145 12.482  49.295  1.00 142.70 ? 600  LEU A O   1 
ATOM   3027  C  CB  . LEU A  1 600  ? -21.877 15.209  48.817  1.00 186.53 ? 600  LEU A CB  1 
ATOM   3028  C  CG  . LEU A  1 600  ? -23.145 14.350  48.937  1.00 93.94  ? 600  LEU A CG  1 
ATOM   3029  C  CD1 . LEU A  1 600  ? -23.004 13.255  49.964  1.00 135.87 ? 600  LEU A CD1 1 
ATOM   3030  C  CD2 . LEU A  1 600  ? -24.358 15.225  49.253  1.00 77.24  ? 600  LEU A CD2 1 
ATOM   3031  N  N   . TRP A  1 601  ? -18.987 14.304  49.939  1.00 175.96 ? 601  TRP A N   1 
ATOM   3032  C  CA  . TRP A  1 601  ? -18.378 13.633  51.081  1.00 235.73 ? 601  TRP A CA  1 
ATOM   3033  C  C   . TRP A  1 601  ? -18.461 14.557  52.314  1.00 233.02 ? 601  TRP A C   1 
ATOM   3034  O  O   . TRP A  1 601  ? -18.634 15.797  52.203  1.00 120.65 ? 601  TRP A O   1 
ATOM   3035  C  CB  . TRP A  1 601  ? -16.945 13.151  50.777  1.00 212.39 ? 601  TRP A CB  1 
ATOM   3036  C  CG  . TRP A  1 601  ? -16.026 14.231  50.347  1.00 229.82 ? 601  TRP A CG  1 
ATOM   3037  C  CD1 . TRP A  1 601  ? -15.178 14.950  51.140  1.00 318.36 ? 601  TRP A CD1 1 
ATOM   3038  C  CD2 . TRP A  1 601  ? -15.856 14.730  49.019  1.00 124.81 ? 601  TRP A CD2 1 
ATOM   3039  N  NE1 . TRP A  1 601  ? -14.490 15.869  50.385  1.00 294.55 ? 601  TRP A NE1 1 
ATOM   3040  C  CE2 . TRP A  1 601  ? -14.889 15.756  49.081  1.00 155.90 ? 601  TRP A CE2 1 
ATOM   3041  C  CE3 . TRP A  1 601  ? -16.430 14.413  47.788  1.00 177.41 ? 601  TRP A CE3 1 
ATOM   3042  C  CZ2 . TRP A  1 601  ? -14.483 16.461  47.956  1.00 118.90 ? 601  TRP A CZ2 1 
ATOM   3043  C  CZ3 . TRP A  1 601  ? -16.028 15.115  46.674  1.00 190.84 ? 601  TRP A CZ3 1 
ATOM   3044  C  CH2 . TRP A  1 601  ? -15.063 16.130  46.764  1.00 194.85 ? 601  TRP A CH2 1 
ATOM   3045  N  N   . VAL A  1 602  ? -18.374 13.928  53.484  1.00 207.57 ? 602  VAL A N   1 
ATOM   3046  C  CA  . VAL A  1 602  ? -18.709 14.576  54.738  1.00 153.26 ? 602  VAL A CA  1 
ATOM   3047  C  C   . VAL A  1 602  ? -17.568 14.419  55.723  1.00 201.60 ? 602  VAL A C   1 
ATOM   3048  O  O   . VAL A  1 602  ? -16.829 13.429  55.689  1.00 151.79 ? 602  VAL A O   1 
ATOM   3049  C  CB  . VAL A  1 602  ? -20.006 13.969  55.335  1.00 154.21 ? 602  VAL A CB  1 
ATOM   3050  C  CG1 . VAL A  1 602  ? -19.881 12.453  55.460  1.00 117.10 ? 602  VAL A CG1 1 
ATOM   3051  C  CG2 . VAL A  1 602  ? -20.336 14.600  56.675  1.00 174.56 ? 602  VAL A CG2 1 
ATOM   3052  N  N   . GLY A  1 603  ? -17.426 15.427  56.579  1.00 261.72 ? 603  GLY A N   1 
ATOM   3053  C  CA  . GLY A  1 603  ? -16.504 15.394  57.698  1.00 254.39 ? 603  GLY A CA  1 
ATOM   3054  C  C   . GLY A  1 603  ? -17.228 15.169  59.017  1.00 172.42 ? 603  GLY A C   1 
ATOM   3055  O  O   . GLY A  1 603  ? -18.388 15.581  59.193  1.00 71.36  ? 603  GLY A O   1 
ATOM   3056  N  N   . VAL A  1 604  ? -16.528 14.527  59.952  1.00 194.48 ? 604  VAL A N   1 
ATOM   3057  C  CA  . VAL A  1 604  ? -17.120 14.101  61.217  1.00 172.45 ? 604  VAL A CA  1 
ATOM   3058  C  C   . VAL A  1 604  ? -16.226 14.470  62.414  1.00 185.99 ? 604  VAL A C   1 
ATOM   3059  O  O   . VAL A  1 604  ? -14.996 14.534  62.292  1.00 222.93 ? 604  VAL A O   1 
ATOM   3060  C  CB  . VAL A  1 604  ? -17.403 12.570  61.219  1.00 126.82 ? 604  VAL A CB  1 
ATOM   3061  C  CG1 . VAL A  1 604  ? -16.122 11.784  61.002  1.00 121.83 ? 604  VAL A CG1 1 
ATOM   3062  C  CG2 . VAL A  1 604  ? -18.066 12.156  62.517  1.00 213.84 ? 604  VAL A CG2 1 
ATOM   3063  N  N   . SER A  1 605  ? -16.864 14.728  63.560  1.00 102.15 ? 605  SER A N   1 
ATOM   3064  C  CA  . SER A  1 605  ? -16.157 14.988  64.822  1.00 204.58 ? 605  SER A CA  1 
ATOM   3065  C  C   . SER A  1 605  ? -16.701 14.093  65.941  1.00 182.66 ? 605  SER A C   1 
ATOM   3066  O  O   . SER A  1 605  ? -17.927 13.935  66.099  1.00 92.39  ? 605  SER A O   1 
ATOM   3067  C  CB  . SER A  1 605  ? -16.259 16.467  65.237  1.00 202.08 ? 605  SER A CB  1 
ATOM   3068  O  OG  . SER A  1 605  ? -17.583 16.831  65.620  1.00 77.77  ? 605  SER A OG  1 
ATOM   3069  N  N   . MET A  1 606  ? -15.783 13.508  66.710  1.00 146.24 ? 606  MET A N   1 
ATOM   3070  C  CA  . MET A  1 606  ? -16.162 12.633  67.810  1.00 128.16 ? 606  MET A CA  1 
ATOM   3071  C  C   . MET A  1 606  ? -15.518 13.080  69.119  1.00 190.09 ? 606  MET A C   1 
ATOM   3072  O  O   . MET A  1 606  ? -14.351 13.485  69.145  1.00 243.86 ? 606  MET A O   1 
ATOM   3073  C  CB  . MET A  1 606  ? -15.779 11.187  67.501  1.00 204.76 ? 606  MET A CB  1 
ATOM   3074  C  CG  . MET A  1 606  ? -16.730 10.471  66.545  1.00 84.57  ? 606  MET A CG  1 
ATOM   3075  S  SD  . MET A  1 606  ? -16.173 8.767   66.283  1.00 154.90 ? 606  MET A SD  1 
ATOM   3076  C  CE  . MET A  1 606  ? -17.607 8.087   65.479  1.00 173.64 ? 606  MET A CE  1 
ATOM   3077  N  N   . GLN A  1 607  ? -16.296 13.001  70.201  1.00 180.36 ? 607  GLN A N   1 
ATOM   3078  C  CA  . GLN A  1 607  ? -15.833 13.399  71.525  1.00 168.72 ? 607  GLN A CA  1 
ATOM   3079  C  C   . GLN A  1 607  ? -16.630 12.706  72.632  1.00 131.13 ? 607  GLN A C   1 
ATOM   3080  O  O   . GLN A  1 607  ? -17.789 12.330  72.436  1.00 125.54 ? 607  GLN A O   1 
ATOM   3081  C  CB  . GLN A  1 607  ? -15.944 14.914  71.685  1.00 176.21 ? 607  GLN A CB  1 
ATOM   3082  C  CG  . GLN A  1 607  ? -15.205 15.446  72.891  1.00 187.13 ? 607  GLN A CG  1 
ATOM   3083  C  CD  . GLN A  1 607  ? -15.271 16.950  72.989  1.00 212.98 ? 607  GLN A CD  1 
ATOM   3084  O  OE1 . GLN A  1 607  ? -16.231 17.571  72.527  1.00 129.08 ? 607  GLN A OE1 1 
ATOM   3085  N  NE2 . GLN A  1 607  ? -14.255 17.546  73.609  1.00 291.58 ? 607  GLN A NE2 1 
ATOM   3086  N  N   . PHE A  1 608  ? -15.990 12.539  73.790  1.00 143.28 ? 608  PHE A N   1 
ATOM   3087  C  CA  . PHE A  1 608  ? -16.642 11.980  74.982  1.00 135.91 ? 608  PHE A CA  1 
ATOM   3088  C  C   . PHE A  1 608  ? -16.734 13.006  76.115  1.00 188.54 ? 608  PHE A C   1 
ATOM   3089  O  O   . PHE A  1 608  ? -15.738 13.275  76.796  1.00 225.20 ? 608  PHE A O   1 
ATOM   3090  C  CB  . PHE A  1 608  ? -15.868 10.777  75.484  1.00 107.75 ? 608  PHE A CB  1 
ATOM   3091  C  CG  . PHE A  1 608  ? -15.854 9.652   74.531  1.00 98.72  ? 608  PHE A CG  1 
ATOM   3092  C  CD1 . PHE A  1 608  ? -16.995 8.888   74.340  1.00 67.65  ? 608  PHE A CD1 1 
ATOM   3093  C  CD2 . PHE A  1 608  ? -14.705 9.350   73.820  1.00 94.53  ? 608  PHE A CD2 1 
ATOM   3094  C  CE1 . PHE A  1 608  ? -16.989 7.828   73.458  1.00 145.69 ? 608  PHE A CE1 1 
ATOM   3095  C  CE2 . PHE A  1 608  ? -14.696 8.293   72.931  1.00 174.28 ? 608  PHE A CE2 1 
ATOM   3096  C  CZ  . PHE A  1 608  ? -15.840 7.528   72.749  1.00 167.92 ? 608  PHE A CZ  1 
ATOM   3097  N  N   . ILE A  1 609  ? -17.931 13.561  76.318  1.00 158.36 ? 609  ILE A N   1 
ATOM   3098  C  CA  . ILE A  1 609  ? -18.134 14.672  77.263  1.00 125.20 ? 609  ILE A CA  1 
ATOM   3099  C  C   . ILE A  1 609  ? -17.296 14.455  78.523  1.00 230.10 ? 609  ILE A C   1 
ATOM   3100  O  O   . ILE A  1 609  ? -16.428 15.268  78.841  1.00 345.90 ? 609  ILE A O   1 
ATOM   3101  C  CB  . ILE A  1 609  ? -19.643 14.879  77.596  1.00 178.40 ? 609  ILE A CB  1 
ATOM   3102  C  CG1 . ILE A  1 609  ? -20.363 15.512  76.395  1.00 254.32 ? 609  ILE A CG1 1 
ATOM   3103  C  CG2 . ILE A  1 609  ? -19.810 15.748  78.835  1.00 184.78 ? 609  ILE A CG2 1 
ATOM   3104  C  CD1 . ILE A  1 609  ? -21.858 15.664  76.564  1.00 200.65 ? 609  ILE A CD1 1 
ATOM   3105  N  N   . PRO A  1 610  ? -17.548 13.353  79.242  1.00 182.30 ? 610  PRO A N   1 
ATOM   3106  C  CA  . PRO A  1 610  ? -16.538 12.955  80.231  1.00 130.02 ? 610  PRO A CA  1 
ATOM   3107  C  C   . PRO A  1 610  ? -15.234 12.553  79.541  1.00 130.01 ? 610  PRO A C   1 
ATOM   3108  O  O   . PRO A  1 610  ? -15.135 11.433  79.035  1.00 126.52 ? 610  PRO A O   1 
ATOM   3109  C  CB  . PRO A  1 610  ? -17.184 11.746  80.928  1.00 76.19  ? 610  PRO A CB  1 
ATOM   3110  C  CG  . PRO A  1 610  ? -18.677 11.912  80.676  1.00 148.72 ? 610  PRO A CG  1 
ATOM   3111  C  CD  . PRO A  1 610  ? -18.789 12.557  79.339  1.00 133.45 ? 610  PRO A CD  1 
ATOM   3112  N  N   . ALA A  1 611  ? -14.263 13.462  79.515  1.00 147.73 ? 611  ALA A N   1 
ATOM   3113  C  CA  . ALA A  1 611  ? -12.990 13.209  78.854  1.00 157.95 ? 611  ALA A CA  1 
ATOM   3114  C  C   . ALA A  1 611  ? -12.579 11.755  79.066  1.00 139.46 ? 611  ALA A C   1 
ATOM   3115  O  O   . ALA A  1 611  ? -12.648 10.930  78.148  1.00 100.05 ? 611  ALA A O   1 
ATOM   3116  C  CB  . ALA A  1 611  ? -11.918 14.154  79.381  1.00 216.06 ? 611  ALA A CB  1 
ATOM   3117  N  N   . GLU A  1 612  ? -12.177 11.433  80.290  1.00 174.71 ? 612  GLU A N   1 
ATOM   3118  C  CA  . GLU A  1 612  ? -11.791 10.063  80.632  1.00 167.01 ? 612  GLU A CA  1 
ATOM   3119  C  C   . GLU A  1 612  ? -12.752 9.455   81.660  1.00 137.14 ? 612  GLU A C   1 
ATOM   3120  O  O   . GLU A  1 612  ? -13.897 9.914   81.788  1.00 127.03 ? 612  GLU A O   1 
ATOM   3121  C  CB  . GLU A  1 612  ? -10.349 10.040  81.147  1.00 183.35 ? 612  GLU A CB  1 
ATOM   3122  C  CG  . GLU A  1 612  ? -10.064 11.022  82.268  1.00 169.43 ? 612  GLU A CG  1 
ATOM   3123  C  CD  . GLU A  1 612  ? -8.660  10.890  82.791  1.00 159.82 ? 612  GLU A CD  1 
ATOM   3124  O  OE1 . GLU A  1 612  ? -7.964  9.954   82.360  1.00 109.82 ? 612  GLU A OE1 1 
ATOM   3125  O  OE2 . GLU A  1 612  ? -8.255  11.714  83.635  1.00 221.95 ? 612  GLU A OE2 1 
ATOM   3126  N  N   . ILE A  1 613  ? -12.302 8.419   82.372  1.00 120.28 ? 613  ILE A N   1 
ATOM   3127  C  CA  . ILE A  1 613  ? -13.101 7.842   83.463  1.00 216.73 ? 613  ILE A CA  1 
ATOM   3128  C  C   . ILE A  1 613  ? -12.519 8.135   84.855  1.00 215.07 ? 613  ILE A C   1 
ATOM   3129  O  O   . ILE A  1 613  ? -11.333 7.881   85.098  1.00 193.10 ? 613  ILE A O   1 
ATOM   3130  C  CB  . ILE A  1 613  ? -13.273 6.334   83.284  1.00 180.12 ? 613  ILE A CB  1 
ATOM   3131  C  CG1 . ILE A  1 613  ? -13.965 6.080   81.943  1.00 93.11  ? 613  ILE A CG1 1 
ATOM   3132  C  CG2 . ILE A  1 613  ? -14.074 5.746   84.462  1.00 151.35 ? 613  ILE A CG2 1 
ATOM   3133  C  CD1 . ILE A  1 613  ? -13.951 4.650   81.499  1.00 117.72 ? 613  ILE A CD1 1 
ATOM   3134  N  N   . PRO A  1 614  ? -13.364 8.654   85.780  1.00 174.56 ? 614  PRO A N   1 
ATOM   3135  C  CA  . PRO A  1 614  ? -12.865 9.198   87.055  1.00 272.41 ? 614  PRO A CA  1 
ATOM   3136  C  C   . PRO A  1 614  ? -12.373 8.135   88.032  1.00 266.73 ? 614  PRO A C   1 
ATOM   3137  O  O   . PRO A  1 614  ? -11.998 8.474   89.155  1.00 284.89 ? 614  PRO A O   1 
ATOM   3138  C  CB  . PRO A  1 614  ? -14.092 9.913   87.647  1.00 323.93 ? 614  PRO A CB  1 
ATOM   3139  C  CG  . PRO A  1 614  ? -15.118 9.963   86.546  1.00 261.21 ? 614  PRO A CG  1 
ATOM   3140  C  CD  . PRO A  1 614  ? -14.832 8.792   85.665  1.00 75.39  ? 614  PRO A CD  1 
ATOM   3141  N  N   . ARG A  1 615  ? -12.386 6.874   87.611  1.00 196.85 ? 615  ARG A N   1 
ATOM   3142  C  CA  . ARG A  1 615  ? -12.008 5.770   88.480  1.00 156.72 ? 615  ARG A CA  1 
ATOM   3143  C  C   . ARG A  1 615  ? -13.134 5.472   89.469  1.00 129.51 ? 615  ARG A C   1 
ATOM   3144  O  O   . ARG A  1 615  ? -13.015 4.579   90.303  1.00 178.64 ? 615  ARG A O   1 
ATOM   3145  C  CB  . ARG A  1 615  ? -10.712 6.098   89.222  1.00 158.48 ? 615  ARG A CB  1 
ATOM   3146  C  CG  . ARG A  1 615  ? -10.023 4.895   89.825  1.00 176.62 ? 615  ARG A CG  1 
ATOM   3147  C  CD  . ARG A  1 615  ? -8.713  5.296   90.484  1.00 243.20 ? 615  ARG A CD  1 
ATOM   3148  N  NE  . ARG A  1 615  ? -8.038  4.159   91.103  1.00 262.18 ? 615  ARG A NE  1 
ATOM   3149  C  CZ  . ARG A  1 615  ? -6.923  4.249   91.820  1.00 247.29 ? 615  ARG A CZ  1 
ATOM   3150  N  NH1 . ARG A  1 615  ? -6.344  5.427   92.010  1.00 223.14 ? 615  ARG A NH1 1 
ATOM   3151  N  NH2 . ARG A  1 615  ? -6.384  3.159   92.350  1.00 261.31 ? 615  ARG A NH2 1 
ATOM   3152  N  N   . SER A  1 616  ? -14.233 6.215   89.355  1.00 170.09 ? 616  SER A N   1 
ATOM   3153  C  CA  . SER A  1 616  ? -15.374 6.050   90.248  1.00 144.01 ? 616  SER A CA  1 
ATOM   3154  C  C   . SER A  1 616  ? -16.017 4.689   90.032  1.00 171.33 ? 616  SER A C   1 
ATOM   3155  O  O   . SER A  1 616  ? -16.081 3.871   90.948  1.00 268.45 ? 616  SER A O   1 
ATOM   3156  C  CB  . SER A  1 616  ? -16.401 7.166   90.033  1.00 149.74 ? 616  SER A CB  1 
ATOM   3157  O  OG  . SER A  1 616  ? -15.852 8.428   90.381  1.00 163.19 ? 616  SER A OG  1 
ATOM   3158  N  N   . ALA A  1 617  ? -16.499 4.449   88.820  1.00 146.32 ? 617  ALA A N   1 
ATOM   3159  C  CA  . ALA A  1 617  ? -17.026 3.135   88.471  1.00 185.66 ? 617  ALA A CA  1 
ATOM   3160  C  C   . ALA A  1 617  ? -15.902 2.287   87.874  1.00 197.71 ? 617  ALA A C   1 
ATOM   3161  O  O   . ALA A  1 617  ? -16.053 1.705   86.804  1.00 165.74 ? 617  ALA A O   1 
ATOM   3162  C  CB  . ALA A  1 617  ? -18.208 3.265   87.493  1.00 106.44 ? 617  ALA A CB  1 
ATOM   3163  N  N   . PHE A  1 618  ? -14.773 2.214   88.575  1.00 152.76 ? 618  PHE A N   1 
ATOM   3164  C  CA  . PHE A  1 618  ? -13.593 1.550   88.039  1.00 227.60 ? 618  PHE A CA  1 
ATOM   3165  C  C   . PHE A  1 618  ? -13.459 0.132   88.582  1.00 292.77 ? 618  PHE A C   1 
ATOM   3166  O  O   . PHE A  1 618  ? -13.909 -0.825  87.953  1.00 318.54 ? 618  PHE A O   1 
ATOM   3167  C  CB  . PHE A  1 618  ? -12.338 2.365   88.360  1.00 243.57 ? 618  PHE A CB  1 
ATOM   3168  C  CG  . PHE A  1 618  ? -11.064 1.764   87.832  1.00 273.02 ? 618  PHE A CG  1 
ATOM   3169  C  CD1 . PHE A  1 618  ? -10.633 2.028   86.541  1.00 238.76 ? 618  PHE A CD1 1 
ATOM   3170  C  CD2 . PHE A  1 618  ? -10.288 0.945   88.632  1.00 320.96 ? 618  PHE A CD2 1 
ATOM   3171  C  CE1 . PHE A  1 618  ? -9.454  1.475   86.060  1.00 234.49 ? 618  PHE A CE1 1 
ATOM   3172  C  CE2 . PHE A  1 618  ? -9.112  0.392   88.154  1.00 318.91 ? 618  PHE A CE2 1 
ATOM   3173  C  CZ  . PHE A  1 618  ? -8.695  0.657   86.870  1.00 266.26 ? 618  PHE A CZ  1 
ATOM   3174  N  N   . GLU A  1 619  ? -12.850 -0.002  89.753  1.00 297.99 ? 619  GLU A N   1 
ATOM   3175  C  CA  . GLU A  1 619  ? -12.549 -1.318  90.301  1.00 283.86 ? 619  GLU A CA  1 
ATOM   3176  C  C   . GLU A  1 619  ? -13.717 -1.871  91.096  1.00 262.29 ? 619  GLU A C   1 
ATOM   3177  O  O   . GLU A  1 619  ? -13.810 -3.077  91.304  1.00 231.58 ? 619  GLU A O   1 
ATOM   3178  C  CB  . GLU A  1 619  ? -11.290 -1.262  91.158  1.00 299.39 ? 619  GLU A CB  1 
ATOM   3179  C  CG  . GLU A  1 619  ? -10.094 -1.934  90.515  1.00 345.38 ? 619  GLU A CG  1 
ATOM   3180  C  CD  . GLU A  1 619  ? -8.839  -1.801  91.352  1.00 388.10 ? 619  GLU A CD  1 
ATOM   3181  O  OE1 . GLU A  1 619  ? -8.930  -1.258  92.473  1.00 391.11 ? 619  GLU A OE1 1 
ATOM   3182  O  OE2 . GLU A  1 619  ? -7.762  -2.239  90.892  1.00 425.94 ? 619  GLU A OE2 1 
ATOM   3183  N  N   . CYS A  1 620  ? -14.585 -0.978  91.554  1.00 281.82 ? 620  CYS A N   1 
ATOM   3184  C  CA  . CYS A  1 620  ? -15.902 -1.357  92.050  1.00 299.43 ? 620  CYS A CA  1 
ATOM   3185  C  C   . CYS A  1 620  ? -15.853 -2.285  93.259  1.00 298.99 ? 620  CYS A C   1 
ATOM   3186  O  O   . CYS A  1 620  ? -14.785 -2.551  93.809  1.00 327.97 ? 620  CYS A O   1 
ATOM   3187  C  CB  . CYS A  1 620  ? -16.701 -2.006  90.923  1.00 330.40 ? 620  CYS A CB  1 
ATOM   3188  S  SG  . CYS A  1 620  ? -16.409 -3.786  90.693  1.00 276.01 ? 620  CYS A SG  1 
ATOM   3189  N  N   . ARG A  1 621  ? -17.018 -2.774  93.670  1.00 285.06 ? 621  ARG A N   1 
ATOM   3190  C  CA  . ARG A  1 621  ? -17.120 -3.496  94.923  1.00 329.31 ? 621  ARG A CA  1 
ATOM   3191  C  C   . ARG A  1 621  ? -18.473 -4.179  95.051  1.00 375.52 ? 621  ARG A C   1 
ATOM   3192  O  O   . ARG A  1 621  ? -19.405 -3.882  94.306  1.00 461.45 ? 621  ARG A O   1 
ATOM   3193  C  CB  . ARG A  1 621  ? -16.887 -2.522  96.070  1.00 314.61 ? 621  ARG A CB  1 
ATOM   3194  C  CG  . ARG A  1 621  ? -16.405 -3.168  97.338  1.00 298.66 ? 621  ARG A CG  1 
ATOM   3195  C  CD  . ARG A  1 621  ? -15.969 -2.117  98.341  1.00 300.75 ? 621  ARG A CD  1 
ATOM   3196  N  NE  . ARG A  1 621  ? -16.920 -1.011  98.419  1.00 322.05 ? 621  ARG A NE  1 
ATOM   3197  C  CZ  . ARG A  1 621  ? -17.884 -0.906  99.330  1.00 314.13 ? 621  ARG A CZ  1 
ATOM   3198  N  NH1 . ARG A  1 621  ? -18.038 -1.838  100.259 1.00 277.89 ? 621  ARG A NH1 1 
ATOM   3199  N  NH2 . ARG A  1 621  ? -18.699 0.138   99.318  1.00 336.54 ? 621  ARG A NH2 1 
ATOM   3200  N  N   . GLU A  1 622  ? -18.583 -5.088  96.010  1.00 312.28 ? 622  GLU A N   1 
ATOM   3201  C  CA  . GLU A  1 622  ? -19.701 -6.015  96.029  1.00 275.68 ? 622  GLU A CA  1 
ATOM   3202  C  C   . GLU A  1 622  ? -20.457 -6.094  97.346  1.00 292.37 ? 622  GLU A C   1 
ATOM   3203  O  O   . GLU A  1 622  ? -20.819 -7.176  97.800  1.00 364.26 ? 622  GLU A O   1 
ATOM   3204  C  CB  . GLU A  1 622  ? -19.216 -7.403  95.644  1.00 321.87 ? 622  GLU A CB  1 
ATOM   3205  C  CG  . GLU A  1 622  ? -19.129 -7.613  94.155  1.00 390.10 ? 622  GLU A CG  1 
ATOM   3206  C  CD  . GLU A  1 622  ? -19.147 -9.077  93.786  1.00 476.09 ? 622  GLU A CD  1 
ATOM   3207  O  OE1 . GLU A  1 622  ? -19.917 -9.836  94.409  1.00 511.07 ? 622  GLU A OE1 1 
ATOM   3208  O  OE2 . GLU A  1 622  ? -18.392 -9.469  92.876  1.00 499.10 ? 622  GLU A OE2 1 
ATOM   3209  N  N   . GLN A  1 623  ? -20.681 -4.945  97.963  1.00 271.44 ? 623  GLN A N   1 
ATOM   3210  C  CA  . GLN A  1 623  ? -21.794 -4.789  98.883  1.00 299.02 ? 623  GLN A CA  1 
ATOM   3211  C  C   . GLN A  1 623  ? -22.571 -3.705  98.187  1.00 295.03 ? 623  GLN A C   1 
ATOM   3212  O  O   . GLN A  1 623  ? -22.003 -2.683  97.820  1.00 252.68 ? 623  GLN A O   1 
ATOM   3213  C  CB  . GLN A  1 623  ? -21.379 -4.386  100.308 1.00 290.26 ? 623  GLN A CB  1 
ATOM   3214  C  CG  . GLN A  1 623  ? -21.305 -2.885  100.583 1.00 236.62 ? 623  GLN A CG  1 
ATOM   3215  C  CD  . GLN A  1 623  ? -21.445 -2.548  102.064 1.00 230.80 ? 623  GLN A CD  1 
ATOM   3216  O  OE1 . GLN A  1 623  ? -21.542 -3.436  102.910 1.00 247.31 ? 623  GLN A OE1 1 
ATOM   3217  N  NE2 . GLN A  1 623  ? -21.457 -1.258  102.379 1.00 237.82 ? 623  GLN A NE2 1 
ATOM   3218  N  N   . VAL A  1 624  ? -23.847 -3.969  97.944  1.00 330.36 ? 624  VAL A N   1 
ATOM   3219  C  CA  . VAL A  1 624  ? -24.696 -3.105  97.131  1.00 338.82 ? 624  VAL A CA  1 
ATOM   3220  C  C   . VAL A  1 624  ? -24.269 -3.065  95.670  1.00 355.68 ? 624  VAL A C   1 
ATOM   3221  O  O   . VAL A  1 624  ? -23.709 -4.022  95.137  1.00 367.32 ? 624  VAL A O   1 
ATOM   3222  C  CB  . VAL A  1 624  ? -24.873 -1.649  97.696  1.00 284.87 ? 624  VAL A CB  1 
ATOM   3223  C  CG1 . VAL A  1 624  ? -25.496 -1.697  99.063  1.00 278.20 ? 624  VAL A CG1 1 
ATOM   3224  C  CG2 . VAL A  1 624  ? -23.577 -0.849  97.719  1.00 258.09 ? 624  VAL A CG2 1 
ATOM   3225  N  N   . VAL A  1 625  ? -24.490 -1.916  95.054  1.00 348.65 ? 625  VAL A N   1 
ATOM   3226  C  CA  . VAL A  1 625  ? -24.886 -1.861  93.663  1.00 334.91 ? 625  VAL A CA  1 
ATOM   3227  C  C   . VAL A  1 625  ? -23.821 -1.906  92.593  1.00 334.84 ? 625  VAL A C   1 
ATOM   3228  O  O   . VAL A  1 625  ? -22.632 -1.725  92.840  1.00 305.06 ? 625  VAL A O   1 
ATOM   3229  C  CB  . VAL A  1 625  ? -25.600 -0.533  93.383  1.00 304.52 ? 625  VAL A CB  1 
ATOM   3230  C  CG1 . VAL A  1 625  ? -26.727 -0.291  94.373  1.00 252.72 ? 625  VAL A CG1 1 
ATOM   3231  C  CG2 . VAL A  1 625  ? -24.617 0.612   93.441  1.00 285.29 ? 625  VAL A CG2 1 
ATOM   3232  N  N   . SER A  1 626  ? -24.298 -2.215  91.394  1.00 346.18 ? 626  SER A N   1 
ATOM   3233  C  CA  . SER A  1 626  ? -23.866 -1.512  90.203  1.00 297.19 ? 626  SER A CA  1 
ATOM   3234  C  C   . SER A  1 626  ? -24.517 -0.138  90.240  1.00 321.13 ? 626  SER A C   1 
ATOM   3235  O  O   . SER A  1 626  ? -25.723 -0.008  90.052  1.00 333.31 ? 626  SER A O   1 
ATOM   3236  C  CB  . SER A  1 626  ? -24.342 -2.199  88.921  1.00 212.17 ? 626  SER A CB  1 
ATOM   3237  O  OG  . SER A  1 626  ? -23.570 -3.334  88.582  1.00 171.08 ? 626  SER A OG  1 
ATOM   3238  N  N   . GLU A  1 627  ? -23.734 0.880   90.555  1.00 315.02 ? 627  GLU A N   1 
ATOM   3239  C  CA  . GLU A  1 627  ? -24.007 2.218   90.061  1.00 301.25 ? 627  GLU A CA  1 
ATOM   3240  C  C   . GLU A  1 627  ? -23.266 2.269   88.744  1.00 287.43 ? 627  GLU A C   1 
ATOM   3241  O  O   . GLU A  1 627  ? -22.039 2.368   88.715  1.00 294.84 ? 627  GLU A O   1 
ATOM   3242  C  CB  . GLU A  1 627  ? -23.475 3.299   90.995  1.00 287.30 ? 627  GLU A CB  1 
ATOM   3243  C  CG  . GLU A  1 627  ? -24.323 3.543   92.211  1.00 272.72 ? 627  GLU A CG  1 
ATOM   3244  C  CD  . GLU A  1 627  ? -23.913 4.794   92.952  1.00 281.27 ? 627  GLU A CD  1 
ATOM   3245  O  OE1 . GLU A  1 627  ? -22.732 5.186   92.844  1.00 301.14 ? 627  GLU A OE1 1 
ATOM   3246  O  OE2 . GLU A  1 627  ? -24.767 5.384   93.647  1.00 282.88 ? 627  GLU A OE2 1 
ATOM   3247  N  N   . GLN A  1 628  ? -24.006 2.156   87.650  1.00 229.54 ? 628  GLN A N   1 
ATOM   3248  C  CA  . GLN A  1 628  ? -23.392 2.170   86.337  1.00 222.01 ? 628  GLN A CA  1 
ATOM   3249  C  C   . GLN A  1 628  ? -23.134 3.618   85.928  1.00 233.35 ? 628  GLN A C   1 
ATOM   3250  O  O   . GLN A  1 628  ? -24.073 4.376   85.684  1.00 260.20 ? 628  GLN A O   1 
ATOM   3251  C  CB  . GLN A  1 628  ? -24.297 1.461   85.328  1.00 233.70 ? 628  GLN A CB  1 
ATOM   3252  C  CG  . GLN A  1 628  ? -24.412 -0.046  85.550  1.00 222.02 ? 628  GLN A CG  1 
ATOM   3253  C  CD  . GLN A  1 628  ? -25.331 -0.717  84.546  1.00 242.78 ? 628  GLN A CD  1 
ATOM   3254  O  OE1 . GLN A  1 628  ? -26.206 -0.078  83.965  1.00 264.90 ? 628  GLN A OE1 1 
ATOM   3255  N  NE2 . GLN A  1 628  ? -25.137 -2.013  84.341  1.00 235.43 ? 628  GLN A NE2 1 
ATOM   3256  N  N   . THR A  1 629  ? -21.862 4.006   85.876  1.00 179.81 ? 629  THR A N   1 
ATOM   3257  C  CA  . THR A  1 629  ? -21.491 5.360   85.466  1.00 194.43 ? 629  THR A CA  1 
ATOM   3258  C  C   . THR A  1 629  ? -22.120 5.717   84.113  1.00 216.70 ? 629  THR A C   1 
ATOM   3259  O  O   . THR A  1 629  ? -22.309 4.855   83.254  1.00 210.14 ? 629  THR A O   1 
ATOM   3260  C  CB  . THR A  1 629  ? -19.955 5.524   85.389  1.00 215.89 ? 629  THR A CB  1 
ATOM   3261  O  OG1 . THR A  1 629  ? -19.425 5.694   86.707  1.00 108.18 ? 629  THR A OG1 1 
ATOM   3262  C  CG2 . THR A  1 629  ? -19.567 6.737   84.551  1.00 299.13 ? 629  THR A CG2 1 
ATOM   3263  N  N   . LEU A  1 630  ? -22.445 6.994   83.928  1.00 212.76 ? 630  LEU A N   1 
ATOM   3264  C  CA  . LEU A  1 630  ? -23.068 7.461   82.688  1.00 173.11 ? 630  LEU A CA  1 
ATOM   3265  C  C   . LEU A  1 630  ? -22.129 8.357   81.875  1.00 206.73 ? 630  LEU A C   1 
ATOM   3266  O  O   . LEU A  1 630  ? -21.966 9.544   82.185  1.00 191.97 ? 630  LEU A O   1 
ATOM   3267  C  CB  . LEU A  1 630  ? -24.344 8.240   83.000  1.00 188.81 ? 630  LEU A CB  1 
ATOM   3268  C  CG  . LEU A  1 630  ? -25.102 8.765   81.785  1.00 175.97 ? 630  LEU A CG  1 
ATOM   3269  C  CD1 . LEU A  1 630  ? -25.765 7.602   81.069  1.00 151.55 ? 630  LEU A CD1 1 
ATOM   3270  C  CD2 . LEU A  1 630  ? -26.120 9.802   82.208  1.00 187.87 ? 630  LEU A CD2 1 
ATOM   3271  N  N   . VAL A  1 631  ? -21.525 7.788   80.832  1.00 202.70 ? 631  VAL A N   1 
ATOM   3272  C  CA  . VAL A  1 631  ? -20.665 8.547   79.925  1.00 126.88 ? 631  VAL A CA  1 
ATOM   3273  C  C   . VAL A  1 631  ? -21.512 9.096   78.768  1.00 177.28 ? 631  VAL A C   1 
ATOM   3274  O  O   . VAL A  1 631  ? -22.459 8.446   78.314  1.00 196.66 ? 631  VAL A O   1 
ATOM   3275  C  CB  . VAL A  1 631  ? -19.504 7.680   79.363  1.00 174.67 ? 631  VAL A CB  1 
ATOM   3276  C  CG1 . VAL A  1 631  ? -18.738 8.438   78.291  1.00 228.11 ? 631  VAL A CG1 1 
ATOM   3277  C  CG2 . VAL A  1 631  ? -18.561 7.235   80.478  1.00 119.19 ? 631  VAL A CG2 1 
ATOM   3278  N  N   . GLN A  1 632  ? -21.184 10.301  78.309  1.00 147.16 ? 632  GLN A N   1 
ATOM   3279  C  CA  . GLN A  1 632  ? -21.821 10.848  77.119  1.00 162.56 ? 632  GLN A CA  1 
ATOM   3280  C  C   . GLN A  1 632  ? -20.842 10.927  75.957  1.00 202.58 ? 632  GLN A C   1 
ATOM   3281  O  O   . GLN A  1 632  ? -19.681 11.314  76.129  1.00 189.82 ? 632  GLN A O   1 
ATOM   3282  C  CB  . GLN A  1 632  ? -22.389 12.227  77.400  1.00 159.65 ? 632  GLN A CB  1 
ATOM   3283  C  CG  . GLN A  1 632  ? -23.762 12.184  77.989  1.00 135.45 ? 632  GLN A CG  1 
ATOM   3284  C  CD  . GLN A  1 632  ? -24.510 13.487  77.776  1.00 158.27 ? 632  GLN A CD  1 
ATOM   3285  O  OE1 . GLN A  1 632  ? -23.936 14.580  77.849  1.00 132.57 ? 632  GLN A OE1 1 
ATOM   3286  N  NE2 . GLN A  1 632  ? -25.802 13.378  77.509  1.00 101.93 ? 632  GLN A NE2 1 
ATOM   3287  N  N   . SER A  1 633  ? -21.321 10.551  74.775  1.00 164.19 ? 633  SER A N   1 
ATOM   3288  C  CA  . SER A  1 633  ? -20.512 10.606  73.571  1.00 136.11 ? 633  SER A CA  1 
ATOM   3289  C  C   . SER A  1 633  ? -21.273 11.414  72.530  1.00 133.54 ? 633  SER A C   1 
ATOM   3290  O  O   . SER A  1 633  ? -22.349 11.015  72.088  1.00 169.39 ? 633  SER A O   1 
ATOM   3291  C  CB  . SER A  1 633  ? -20.208 9.194   73.070  1.00 125.53 ? 633  SER A CB  1 
ATOM   3292  O  OG  . SER A  1 633  ? -19.505 9.233   71.846  1.00 125.69 ? 633  SER A OG  1 
ATOM   3293  N  N   . ASN A  1 634  ? -20.713 12.564  72.166  1.00 146.68 ? 634  ASN A N   1 
ATOM   3294  C  CA  . ASN A  1 634  ? -21.320 13.435  71.170  1.00 95.24  ? 634  ASN A CA  1 
ATOM   3295  C  C   . ASN A  1 634  ? -20.602 13.368  69.838  1.00 159.23 ? 634  ASN A C   1 
ATOM   3296  O  O   . ASN A  1 634  ? -19.402 13.674  69.755  1.00 169.01 ? 634  ASN A O   1 
ATOM   3297  C  CB  . ASN A  1 634  ? -21.303 14.884  71.632  1.00 141.12 ? 634  ASN A CB  1 
ATOM   3298  C  CG  . ASN A  1 634  ? -22.028 15.800  70.668  1.00 134.77 ? 634  ASN A CG  1 
ATOM   3299  O  OD1 . ASN A  1 634  ? -22.090 15.532  69.473  1.00 230.18 ? 634  ASN A OD1 1 
ATOM   3300  N  ND2 . ASN A  1 634  ? -22.588 16.875  71.182  1.00 82.77  ? 634  ASN A ND2 1 
ATOM   3301  N  N   . ILE A  1 635  ? -21.357 13.003  68.797  1.00 139.24 ? 635  ILE A N   1 
ATOM   3302  C  CA  . ILE A  1 635  ? -20.836 12.947  67.426  1.00 181.82 ? 635  ILE A CA  1 
ATOM   3303  C  C   . ILE A  1 635  ? -21.589 13.963  66.557  1.00 154.52 ? 635  ILE A C   1 
ATOM   3304  O  O   . ILE A  1 635  ? -22.784 14.210  66.760  1.00 147.89 ? 635  ILE A O   1 
ATOM   3305  C  CB  . ILE A  1 635  ? -20.965 11.522  66.808  1.00 65.34  ? 635  ILE A CB  1 
ATOM   3306  C  CG1 . ILE A  1 635  ? -20.438 10.461  67.772  1.00 109.71 ? 635  ILE A CG1 1 
ATOM   3307  C  CG2 . ILE A  1 635  ? -20.217 11.438  65.481  1.00 189.15 ? 635  ILE A CG2 1 
ATOM   3308  C  CD1 . ILE A  1 635  ? -20.774 9.051   67.380  1.00 111.20 ? 635  ILE A CD1 1 
ATOM   3309  N  N   . CYS A  1 636  ? -20.879 14.554  65.599  1.00 81.80  ? 636  CYS A N   1 
ATOM   3310  C  CA  . CYS A  1 636  ? -21.461 15.562  64.716  1.00 119.73 ? 636  CYS A CA  1 
ATOM   3311  C  C   . CYS A  1 636  ? -21.145 15.271  63.214  1.00 207.08 ? 636  CYS A C   1 
ATOM   3312  O  O   . CYS A  1 636  ? -20.073 14.723  62.907  1.00 192.57 ? 636  CYS A O   1 
ATOM   3313  C  CB  . CYS A  1 636  ? -20.939 16.944  65.141  1.00 87.03  ? 636  CYS A CB  1 
ATOM   3314  S  SG  . CYS A  1 636  ? -21.299 17.414  66.842  1.00 190.31 ? 636  CYS A SG  1 
ATOM   3315  N  N   . LEU A  1 637  ? -22.063 15.625  62.292  1.00 136.49 ? 637  LEU A N   1 
ATOM   3316  C  CA  . LEU A  1 637  ? -21.869 15.371  60.845  1.00 127.83 ? 637  LEU A CA  1 
ATOM   3317  C  C   . LEU A  1 637  ? -22.259 16.536  59.933  1.00 153.28 ? 637  LEU A C   1 
ATOM   3318  O  O   . LEU A  1 637  ? -23.402 17.014  59.946  1.00 117.47 ? 637  LEU A O   1 
ATOM   3319  C  CB  . LEU A  1 637  ? -22.645 14.134  60.412  1.00 120.33 ? 637  LEU A CB  1 
ATOM   3320  C  CG  . LEU A  1 637  ? -22.161 12.835  61.073  1.00 118.46 ? 637  LEU A CG  1 
ATOM   3321  C  CD1 . LEU A  1 637  ? -23.090 11.679  60.731  1.00 89.44  ? 637  LEU A CD1 1 
ATOM   3322  C  CD2 . LEU A  1 637  ? -20.708 12.499  60.724  1.00 155.16 ? 637  LEU A CD2 1 
ATOM   3323  N  N   . TYR A  1 638  ? -21.298 16.941  59.108  1.00 127.34 ? 638  TYR A N   1 
ATOM   3324  C  CA  . TYR A  1 638  ? -21.406 18.150  58.309  1.00 159.84 ? 638  TYR A CA  1 
ATOM   3325  C  C   . TYR A  1 638  ? -20.685 17.939  56.986  1.00 183.77 ? 638  TYR A C   1 
ATOM   3326  O  O   . TYR A  1 638  ? -19.601 17.361  56.950  1.00 210.84 ? 638  TYR A O   1 
ATOM   3327  C  CB  . TYR A  1 638  ? -20.764 19.327  59.053  1.00 192.59 ? 638  TYR A CB  1 
ATOM   3328  C  CG  . TYR A  1 638  ? -19.251 19.224  59.170  1.00 80.08  ? 638  TYR A CG  1 
ATOM   3329  C  CD1 . TYR A  1 638  ? -18.415 20.128  58.526  1.00 172.21 ? 638  TYR A CD1 1 
ATOM   3330  C  CD2 . TYR A  1 638  ? -18.659 18.220  59.923  1.00 225.20 ? 638  TYR A CD2 1 
ATOM   3331  C  CE1 . TYR A  1 638  ? -17.030 20.032  58.630  1.00 191.70 ? 638  TYR A CE1 1 
ATOM   3332  C  CE2 . TYR A  1 638  ? -17.277 18.116  60.028  1.00 175.50 ? 638  TYR A CE2 1 
ATOM   3333  C  CZ  . TYR A  1 638  ? -16.469 19.024  59.382  1.00 170.56 ? 638  TYR A CZ  1 
ATOM   3334  O  OH  . TYR A  1 638  ? -15.100 18.918  59.497  1.00 271.88 ? 638  TYR A OH  1 
ATOM   3335  N  N   . ILE A  1 639  ? -21.277 18.424  55.900  1.00 192.95 ? 639  ILE A N   1 
ATOM   3336  C  CA  . ILE A  1 639  ? -20.665 18.310  54.575  1.00 172.57 ? 639  ILE A CA  1 
ATOM   3337  C  C   . ILE A  1 639  ? -20.140 19.669  54.105  1.00 162.97 ? 639  ILE A C   1 
ATOM   3338  O  O   . ILE A  1 639  ? -20.795 20.696  54.317  1.00 126.32 ? 639  ILE A O   1 
ATOM   3339  C  CB  . ILE A  1 639  ? -21.660 17.751  53.569  1.00 152.78 ? 639  ILE A CB  1 
ATOM   3340  C  CG1 . ILE A  1 639  ? -23.062 18.320  53.839  1.00 90.27  ? 639  ILE A CG1 1 
ATOM   3341  C  CG2 . ILE A  1 639  ? -21.689 16.250  53.669  1.00 185.90 ? 639  ILE A CG2 1 
ATOM   3342  C  CD1 . ILE A  1 639  ? -24.159 17.673  53.012  1.00 100.51 ? 639  ILE A CD1 1 
ATOM   3343  N  N   . ASP A  1 640  ? -18.962 19.669  53.473  1.00 68.45  ? 640  ASP A N   1 
ATOM   3344  C  CA  . ASP A  1 640  ? -18.197 20.917  53.266  1.00 153.05 ? 640  ASP A CA  1 
ATOM   3345  C  C   . ASP A  1 640  ? -17.754 21.210  51.834  1.00 126.63 ? 640  ASP A C   1 
ATOM   3346  O  O   . ASP A  1 640  ? -17.646 22.375  51.436  1.00 121.76 ? 640  ASP A O   1 
ATOM   3347  C  CB  . ASP A  1 640  ? -16.921 20.879  54.096  1.00 207.71 ? 640  ASP A CB  1 
ATOM   3348  C  CG  . ASP A  1 640  ? -15.976 19.775  53.653  1.00 198.51 ? 640  ASP A CG  1 
ATOM   3349  O  OD1 . ASP A  1 640  ? -16.417 18.603  53.576  1.00 58.30  ? 640  ASP A OD1 1 
ATOM   3350  O  OD2 . ASP A  1 640  ? -14.792 20.080  53.387  1.00 191.29 ? 640  ASP A OD2 1 
ATOM   3351  N  N   . LYS A  1 641  ? -17.467 20.148  51.083  1.00 216.92 ? 641  LYS A N   1 
ATOM   3352  C  CA  . LYS A  1 641  ? -16.907 20.264  49.739  1.00 143.50 ? 641  LYS A CA  1 
ATOM   3353  C  C   . LYS A  1 641  ? -18.041 20.136  48.733  1.00 171.41 ? 641  LYS A C   1 
ATOM   3354  O  O   . LYS A  1 641  ? -18.565 19.041  48.481  1.00 110.60 ? 641  LYS A O   1 
ATOM   3355  C  CB  . LYS A  1 641  ? -15.833 19.203  49.530  1.00 77.80  ? 641  LYS A CB  1 
ATOM   3356  C  CG  . LYS A  1 641  ? -14.903 19.493  48.398  1.00 166.34 ? 641  LYS A CG  1 
ATOM   3357  C  CD  . LYS A  1 641  ? -13.468 19.369  48.858  1.00 213.12 ? 641  LYS A CD  1 
ATOM   3358  C  CE  . LYS A  1 641  ? -12.523 19.522  47.697  1.00 207.07 ? 641  LYS A CE  1 
ATOM   3359  N  NZ  . LYS A  1 641  ? -11.177 18.996  48.017  1.00 192.72 ? 641  LYS A NZ  1 
ATOM   3360  N  N   . ARG A  1 642  ? -18.382 21.282  48.151  1.00 210.31 ? 642  ARG A N   1 
ATOM   3361  C  CA  . ARG A  1 642  ? -19.725 21.544  47.651  1.00 136.33 ? 642  ARG A CA  1 
ATOM   3362  C  C   . ARG A  1 642  ? -19.735 22.275  46.322  1.00 179.94 ? 642  ARG A C   1 
ATOM   3363  O  O   . ARG A  1 642  ? -20.795 22.498  45.743  1.00 159.11 ? 642  ARG A O   1 
ATOM   3364  C  CB  . ARG A  1 642  ? -20.422 22.459  48.659  1.00 123.31 ? 642  ARG A CB  1 
ATOM   3365  C  CG  . ARG A  1 642  ? -20.213 23.971  48.386  1.00 209.19 ? 642  ARG A CG  1 
ATOM   3366  C  CD  . ARG A  1 642  ? -20.227 24.816  49.671  1.00 189.10 ? 642  ARG A CD  1 
ATOM   3367  N  NE  . ARG A  1 642  ? -19.533 26.095  49.509  1.00 269.22 ? 642  ARG A NE  1 
ATOM   3368  C  CZ  . ARG A  1 642  ? -18.224 26.268  49.672  1.00 338.67 ? 642  ARG A CZ  1 
ATOM   3369  N  NH1 . ARG A  1 642  ? -17.446 25.243  49.996  1.00 369.12 ? 642  ARG A NH1 1 
ATOM   3370  N  NH2 . ARG A  1 642  ? -17.687 27.471  49.508  1.00 340.03 ? 642  ARG A NH2 1 
ATOM   3371  N  N   . SER A  1 643  ? -18.559 22.660  45.849  1.00 232.54 ? 643  SER A N   1 
ATOM   3372  C  CA  . SER A  1 643  ? -18.453 23.700  44.842  1.00 224.37 ? 643  SER A CA  1 
ATOM   3373  C  C   . SER A  1 643  ? -19.349 23.446  43.640  1.00 212.76 ? 643  SER A C   1 
ATOM   3374  O  O   . SER A  1 643  ? -20.049 24.348  43.177  1.00 197.51 ? 643  SER A O   1 
ATOM   3375  C  CB  . SER A  1 643  ? -16.999 23.839  44.404  1.00 193.96 ? 643  SER A CB  1 
ATOM   3376  O  OG  . SER A  1 643  ? -16.492 22.608  43.915  1.00 154.27 ? 643  SER A OG  1 
ATOM   3377  N  N   . LYS A  1 644  ? -19.336 22.210  43.154  1.00 200.00 ? 644  LYS A N   1 
ATOM   3378  C  CA  . LYS A  1 644  ? -20.059 21.858  41.941  1.00 181.06 ? 644  LYS A CA  1 
ATOM   3379  C  C   . LYS A  1 644  ? -21.572 21.919  42.136  1.00 207.69 ? 644  LYS A C   1 
ATOM   3380  O  O   . LYS A  1 644  ? -22.276 22.577  41.370  1.00 276.06 ? 644  LYS A O   1 
ATOM   3381  C  CB  . LYS A  1 644  ? -19.633 20.463  41.455  1.00 69.46  ? 644  LYS A CB  1 
ATOM   3382  C  CG  . LYS A  1 644  ? -19.898 19.339  42.427  1.00 156.45 ? 644  LYS A CG  1 
ATOM   3383  C  CD  . LYS A  1 644  ? -19.238 18.039  41.987  1.00 146.67 ? 644  LYS A CD  1 
ATOM   3384  C  CE  . LYS A  1 644  ? -19.415 16.975  43.055  1.00 222.27 ? 644  LYS A CE  1 
ATOM   3385  N  NZ  . LYS A  1 644  ? -18.958 17.460  44.388  1.00 244.22 ? 644  LYS A NZ  1 
ATOM   3386  N  N   . ASN A  1 645  ? -22.064 21.249  43.171  1.00 169.08 ? 645  ASN A N   1 
ATOM   3387  C  CA  . ASN A  1 645  ? -23.501 21.081  43.361  1.00 138.32 ? 645  ASN A CA  1 
ATOM   3388  C  C   . ASN A  1 645  ? -24.198 22.390  43.750  1.00 187.50 ? 645  ASN A C   1 
ATOM   3389  O  O   . ASN A  1 645  ? -25.411 22.529  43.571  1.00 160.36 ? 645  ASN A O   1 
ATOM   3390  C  CB  . ASN A  1 645  ? -23.761 19.972  44.389  1.00 154.72 ? 645  ASN A CB  1 
ATOM   3391  C  CG  . ASN A  1 645  ? -23.145 18.631  43.974  1.00 169.59 ? 645  ASN A CG  1 
ATOM   3392  O  OD1 . ASN A  1 645  ? -23.024 18.338  42.789  1.00 256.95 ? 645  ASN A OD1 1 
ATOM   3393  N  ND2 . ASN A  1 645  ? -22.759 17.816  44.949  1.00 134.58 ? 645  ASN A ND2 1 
ATOM   3394  N  N   . LEU A  1 646  ? -23.423 23.345  44.261  1.00 232.20 ? 646  LEU A N   1 
ATOM   3395  C  CA  . LEU A  1 646  ? -23.939 24.667  44.603  1.00 237.75 ? 646  LEU A CA  1 
ATOM   3396  C  C   . LEU A  1 646  ? -24.989 24.596  45.707  1.00 259.42 ? 646  LEU A C   1 
ATOM   3397  O  O   . LEU A  1 646  ? -25.447 23.515  46.077  1.00 242.57 ? 646  LEU A O   1 
ATOM   3398  C  CB  . LEU A  1 646  ? -24.535 25.336  43.364  1.00 247.00 ? 646  LEU A CB  1 
ATOM   3399  C  CG  . LEU A  1 646  ? -23.530 25.713  42.279  1.00 214.44 ? 646  LEU A CG  1 
ATOM   3400  C  CD1 . LEU A  1 646  ? -24.260 26.251  41.060  1.00 202.75 ? 646  LEU A CD1 1 
ATOM   3401  C  CD2 . LEU A  1 646  ? -22.526 26.722  42.804  1.00 165.28 ? 646  LEU A CD2 1 
ATOM   3402  N  N   . LEU A  1 647  ? -25.374 25.756  46.227  1.00 276.60 ? 647  LEU A N   1 
ATOM   3403  C  CA  . LEU A  1 647  ? -26.362 25.826  47.297  1.00 259.84 ? 647  LEU A CA  1 
ATOM   3404  C  C   . LEU A  1 647  ? -27.675 25.203  46.858  1.00 179.63 ? 647  LEU A C   1 
ATOM   3405  O  O   . LEU A  1 647  ? -27.829 24.810  45.708  1.00 182.59 ? 647  LEU A O   1 
ATOM   3406  C  CB  . LEU A  1 647  ? -26.608 27.282  47.693  1.00 269.82 ? 647  LEU A CB  1 
ATOM   3407  C  CG  . LEU A  1 647  ? -25.432 27.998  48.354  1.00 246.35 ? 647  LEU A CG  1 
ATOM   3408  C  CD1 . LEU A  1 647  ? -25.700 29.489  48.458  1.00 219.63 ? 647  LEU A CD1 1 
ATOM   3409  C  CD2 . LEU A  1 647  ? -25.156 27.397  49.724  1.00 220.40 ? 647  LEU A CD2 1 
ATOM   3410  N  N   . GLY A  1 648  ? -28.619 25.101  47.784  1.00 128.49 ? 648  GLY A N   1 
ATOM   3411  C  CA  . GLY A  1 648  ? -29.974 24.722  47.434  1.00 175.94 ? 648  GLY A CA  1 
ATOM   3412  C  C   . GLY A  1 648  ? -30.225 23.226  47.388  1.00 186.77 ? 648  GLY A C   1 
ATOM   3413  O  O   . GLY A  1 648  ? -29.302 22.416  47.553  1.00 90.42  ? 648  GLY A O   1 
ATOM   3414  N  N   . SER A  1 649  ? -31.486 22.881  47.125  1.00 228.71 ? 649  SER A N   1 
ATOM   3415  C  CA  . SER A  1 649  ? -31.975 21.506  47.163  1.00 229.35 ? 649  SER A CA  1 
ATOM   3416  C  C   . SER A  1 649  ? -30.898 20.502  46.803  1.00 220.90 ? 649  SER A C   1 
ATOM   3417  O  O   . SER A  1 649  ? -30.044 20.771  45.966  1.00 230.01 ? 649  SER A O   1 
ATOM   3418  C  CB  . SER A  1 649  ? -33.158 21.335  46.203  1.00 254.27 ? 649  SER A CB  1 
ATOM   3419  O  OG  . SER A  1 649  ? -34.241 22.174  46.564  1.00 284.56 ? 649  SER A OG  1 
ATOM   3420  N  N   . ARG A  1 650  ? -30.951 19.341  47.442  1.00 235.20 ? 650  ARG A N   1 
ATOM   3421  C  CA  . ARG A  1 650  ? -30.009 18.266  47.169  1.00 261.22 ? 650  ARG A CA  1 
ATOM   3422  C  C   . ARG A  1 650  ? -28.688 18.492  47.899  1.00 272.03 ? 650  ARG A C   1 
ATOM   3423  O  O   . ARG A  1 650  ? -28.296 17.685  48.742  1.00 259.01 ? 650  ARG A O   1 
ATOM   3424  C  CB  . ARG A  1 650  ? -29.761 18.136  45.670  1.00 258.11 ? 650  ARG A CB  1 
ATOM   3425  C  CG  . ARG A  1 650  ? -28.944 16.924  45.297  1.00 250.39 ? 650  ARG A CG  1 
ATOM   3426  C  CD  . ARG A  1 650  ? -28.885 16.749  43.794  1.00 280.68 ? 650  ARG A CD  1 
ATOM   3427  N  NE  . ARG A  1 650  ? -28.216 17.867  43.136  1.00 283.19 ? 650  ARG A NE  1 
ATOM   3428  C  CZ  . ARG A  1 650  ? -26.904 18.072  43.165  1.00 326.13 ? 650  ARG A CZ  1 
ATOM   3429  N  NH1 . ARG A  1 650  ? -26.114 17.241  43.831  1.00 389.89 ? 650  ARG A NH1 1 
ATOM   3430  N  NH2 . ARG A  1 650  ? -26.383 19.114  42.534  1.00 315.09 ? 650  ARG A NH2 1 
ATOM   3431  N  N   . ASP A  1 651  ? -28.005 19.588  47.574  1.00 252.94 ? 651  ASP A N   1 
ATOM   3432  C  CA  . ASP A  1 651  ? -26.745 19.929  48.228  1.00 217.40 ? 651  ASP A CA  1 
ATOM   3433  C  C   . ASP A  1 651  ? -26.938 20.020  49.734  1.00 175.28 ? 651  ASP A C   1 
ATOM   3434  O  O   . ASP A  1 651  ? -25.983 19.924  50.500  1.00 198.02 ? 651  ASP A O   1 
ATOM   3435  C  CB  . ASP A  1 651  ? -26.201 21.255  47.692  1.00 231.59 ? 651  ASP A CB  1 
ATOM   3436  C  CG  . ASP A  1 651  ? -24.785 21.541  48.160  1.00 278.65 ? 651  ASP A CG  1 
ATOM   3437  O  OD1 . ASP A  1 651  ? -24.032 20.577  48.412  1.00 286.86 ? 651  ASP A OD1 1 
ATOM   3438  O  OD2 . ASP A  1 651  ? -24.421 22.730  48.267  1.00 301.50 ? 651  ASP A OD2 1 
ATOM   3439  N  N   . LEU A  1 652  ? -28.182 20.199  50.158  1.00 205.05 ? 652  LEU A N   1 
ATOM   3440  C  CA  . LEU A  1 652  ? -28.499 20.217  51.573  1.00 222.27 ? 652  LEU A CA  1 
ATOM   3441  C  C   . LEU A  1 652  ? -29.124 18.879  51.954  1.00 169.24 ? 652  LEU A C   1 
ATOM   3442  O  O   . LEU A  1 652  ? -28.413 17.895  52.178  1.00 113.33 ? 652  LEU A O   1 
ATOM   3443  C  CB  . LEU A  1 652  ? -29.437 21.381  51.897  1.00 248.23 ? 652  LEU A CB  1 
ATOM   3444  C  CG  . LEU A  1 652  ? -28.766 22.753  52.022  1.00 239.74 ? 652  LEU A CG  1 
ATOM   3445  C  CD1 . LEU A  1 652  ? -28.039 23.127  50.742  1.00 248.96 ? 652  LEU A CD1 1 
ATOM   3446  C  CD2 . LEU A  1 652  ? -29.794 23.809  52.375  1.00 221.00 ? 652  LEU A CD2 1 
ATOM   3447  N  N   . GLN A  1 653  ? -30.452 18.834  51.981  1.00 124.75 ? 653  GLN A N   1 
ATOM   3448  C  CA  . GLN A  1 653  ? -31.169 17.695  52.551  1.00 182.55 ? 653  GLN A CA  1 
ATOM   3449  C  C   . GLN A  1 653  ? -30.615 16.343  52.121  1.00 172.84 ? 653  GLN A C   1 
ATOM   3450  O  O   . GLN A  1 653  ? -30.449 16.078  50.935  1.00 189.03 ? 653  GLN A O   1 
ATOM   3451  C  CB  . GLN A  1 653  ? -32.642 17.761  52.172  1.00 191.32 ? 653  GLN A CB  1 
ATOM   3452  C  CG  . GLN A  1 653  ? -33.524 16.796  52.955  1.00 181.52 ? 653  GLN A CG  1 
ATOM   3453  C  CD  . GLN A  1 653  ? -34.816 16.482  52.234  1.00 265.64 ? 653  GLN A CD  1 
ATOM   3454  O  OE1 . GLN A  1 653  ? -35.084 17.021  51.161  1.00 352.65 ? 653  GLN A OE1 1 
ATOM   3455  N  NE2 . GLN A  1 653  ? -35.623 15.604  52.815  1.00 238.65 ? 653  GLN A NE2 1 
ATOM   3456  N  N   . SER A  1 654  ? -30.300 15.505  53.102  1.00 172.42 ? 654  SER A N   1 
ATOM   3457  C  CA  . SER A  1 654  ? -30.103 14.076  52.871  1.00 143.63 ? 654  SER A CA  1 
ATOM   3458  C  C   . SER A  1 654  ? -30.329 13.286  54.152  1.00 128.69 ? 654  SER A C   1 
ATOM   3459  O  O   . SER A  1 654  ? -30.041 13.761  55.244  1.00 184.67 ? 654  SER A O   1 
ATOM   3460  C  CB  . SER A  1 654  ? -28.707 13.774  52.320  1.00 102.31 ? 654  SER A CB  1 
ATOM   3461  O  OG  . SER A  1 654  ? -27.696 14.407  53.079  1.00 220.03 ? 654  SER A OG  1 
ATOM   3462  N  N   . SER A  1 655  ? -30.862 12.082  54.020  1.00 114.46 ? 655  SER A N   1 
ATOM   3463  C  CA  . SER A  1 655  ? -31.000 11.205  55.166  1.00 155.85 ? 655  SER A CA  1 
ATOM   3464  C  C   . SER A  1 655  ? -29.816 10.258  55.207  1.00 154.27 ? 655  SER A C   1 
ATOM   3465  O  O   . SER A  1 655  ? -29.203 9.980   54.173  1.00 126.29 ? 655  SER A O   1 
ATOM   3466  C  CB  . SER A  1 655  ? -32.306 10.425  55.089  1.00 185.86 ? 655  SER A CB  1 
ATOM   3467  O  OG  . SER A  1 655  ? -33.404 11.290  55.290  1.00 160.60 ? 655  SER A OG  1 
ATOM   3468  N  N   . VAL A  1 656  ? -29.498 9.770   56.404  1.00 151.59 ? 656  VAL A N   1 
ATOM   3469  C  CA  . VAL A  1 656  ? -28.350 8.895   56.602  1.00 165.46 ? 656  VAL A CA  1 
ATOM   3470  C  C   . VAL A  1 656  ? -28.636 7.833   57.659  1.00 157.26 ? 656  VAL A C   1 
ATOM   3471  O  O   . VAL A  1 656  ? -29.393 8.073   58.598  1.00 106.99 ? 656  VAL A O   1 
ATOM   3472  C  CB  . VAL A  1 656  ? -27.109 9.710   57.032  1.00 119.90 ? 656  VAL A CB  1 
ATOM   3473  C  CG1 . VAL A  1 656  ? -25.989 8.788   57.525  1.00 117.36 ? 656  VAL A CG1 1 
ATOM   3474  C  CG2 . VAL A  1 656  ? -26.615 10.565  55.890  1.00 150.59 ? 656  VAL A CG2 1 
ATOM   3475  N  N   . THR A  1 657  ? -28.036 6.656   57.491  1.00 74.85  ? 657  THR A N   1 
ATOM   3476  C  CA  . THR A  1 657  ? -28.075 5.615   58.515  1.00 143.71 ? 657  THR A CA  1 
ATOM   3477  C  C   . THR A  1 657  ? -26.775 5.606   59.318  1.00 177.89 ? 657  THR A C   1 
ATOM   3478  O  O   . THR A  1 657  ? -25.685 5.516   58.742  1.00 152.46 ? 657  THR A O   1 
ATOM   3479  C  CB  . THR A  1 657  ? -28.256 4.219   57.907  1.00 195.15 ? 657  THR A CB  1 
ATOM   3480  O  OG1 . THR A  1 657  ? -27.398 4.083   56.770  1.00 245.87 ? 657  THR A OG1 1 
ATOM   3481  C  CG2 . THR A  1 657  ? -29.692 3.997   57.490  1.00 147.52 ? 657  THR A CG2 1 
ATOM   3482  N  N   . LEU A  1 658  ? -26.896 5.700   60.643  1.00 162.27 ? 658  LEU A N   1 
ATOM   3483  C  CA  . LEU A  1 658  ? -25.736 5.687   61.537  1.00 150.67 ? 658  LEU A CA  1 
ATOM   3484  C  C   . LEU A  1 658  ? -25.659 4.382   62.294  1.00 161.39 ? 658  LEU A C   1 
ATOM   3485  O  O   . LEU A  1 658  ? -26.686 3.851   62.716  1.00 191.60 ? 658  LEU A O   1 
ATOM   3486  C  CB  . LEU A  1 658  ? -25.826 6.826   62.546  1.00 106.18 ? 658  LEU A CB  1 
ATOM   3487  C  CG  . LEU A  1 658  ? -25.689 8.214   61.942  1.00 172.92 ? 658  LEU A CG  1 
ATOM   3488  C  CD1 . LEU A  1 658  ? -26.246 9.266   62.887  1.00 135.74 ? 658  LEU A CD1 1 
ATOM   3489  C  CD2 . LEU A  1 658  ? -24.224 8.490   61.584  1.00 219.51 ? 658  LEU A CD2 1 
ATOM   3490  N  N   . ASP A  1 659  ? -24.440 3.880   62.483  1.00 105.22 ? 659  ASP A N   1 
ATOM   3491  C  CA  . ASP A  1 659  ? -24.247 2.623   63.195  1.00 221.59 ? 659  ASP A CA  1 
ATOM   3492  C  C   . ASP A  1 659  ? -23.043 2.650   64.125  1.00 210.47 ? 659  ASP A C   1 
ATOM   3493  O  O   . ASP A  1 659  ? -21.921 2.302   63.742  1.00 153.18 ? 659  ASP A O   1 
ATOM   3494  C  CB  . ASP A  1 659  ? -24.131 1.472   62.207  1.00 239.55 ? 659  ASP A CB  1 
ATOM   3495  C  CG  . ASP A  1 659  ? -25.444 1.172   61.525  1.00 218.47 ? 659  ASP A CG  1 
ATOM   3496  O  OD1 . ASP A  1 659  ? -26.503 1.598   62.025  1.00 224.59 ? 659  ASP A OD1 1 
ATOM   3497  O  OD2 . ASP A  1 659  ? -25.427 0.502   60.488  1.00 227.73 ? 659  ASP A OD2 1 
ATOM   3498  N  N   . LEU A  1 660  ? -23.314 3.051   65.362  1.00 197.69 ? 660  LEU A N   1 
ATOM   3499  C  CA  . LEU A  1 660  ? -22.301 3.132   66.396  1.00 123.75 ? 660  LEU A CA  1 
ATOM   3500  C  C   . LEU A  1 660  ? -22.163 1.783   67.084  1.00 129.68 ? 660  LEU A C   1 
ATOM   3501  O  O   . LEU A  1 660  ? -23.149 1.078   67.326  1.00 138.36 ? 660  LEU A O   1 
ATOM   3502  C  CB  . LEU A  1 660  ? -22.682 4.203   67.413  1.00 131.40 ? 660  LEU A CB  1 
ATOM   3503  C  CG  . LEU A  1 660  ? -23.273 5.484   66.821  1.00 163.92 ? 660  LEU A CG  1 
ATOM   3504  C  CD1 . LEU A  1 660  ? -23.606 6.489   67.923  1.00 185.73 ? 660  LEU A CD1 1 
ATOM   3505  C  CD2 . LEU A  1 660  ? -22.317 6.084   65.796  1.00 240.12 ? 660  LEU A CD2 1 
ATOM   3506  N  N   . ALA A  1 661  ? -20.924 1.432   67.396  1.00 122.11 ? 661  ALA A N   1 
ATOM   3507  C  CA  . ALA A  1 661  ? -20.629 0.157   68.029  1.00 163.93 ? 661  ALA A CA  1 
ATOM   3508  C  C   . ALA A  1 661  ? -19.372 0.299   68.885  1.00 152.08 ? 661  ALA A C   1 
ATOM   3509  O  O   . ALA A  1 661  ? -18.362 0.845   68.433  1.00 156.99 ? 661  ALA A O   1 
ATOM   3510  C  CB  . ALA A  1 661  ? -20.458 -0.936  66.974  1.00 195.61 ? 661  ALA A CB  1 
ATOM   3511  N  N   . LEU A  1 662  ? -19.448 -0.175  70.128  1.00 151.14 ? 662  LEU A N   1 
ATOM   3512  C  CA  . LEU A  1 662  ? -18.334 -0.058  71.070  1.00 118.43 ? 662  LEU A CA  1 
ATOM   3513  C  C   . LEU A  1 662  ? -17.585 -1.391  71.234  1.00 134.89 ? 662  LEU A C   1 
ATOM   3514  O  O   . LEU A  1 662  ? -18.190 -2.492  71.192  1.00 67.08  ? 662  LEU A O   1 
ATOM   3515  C  CB  . LEU A  1 662  ? -18.833 0.428   72.428  1.00 129.46 ? 662  LEU A CB  1 
ATOM   3516  C  CG  . LEU A  1 662  ? -19.668 1.712   72.468  1.00 138.88 ? 662  LEU A CG  1 
ATOM   3517  C  CD1 . LEU A  1 662  ? -21.139 1.470   72.113  1.00 90.78  ? 662  LEU A CD1 1 
ATOM   3518  C  CD2 . LEU A  1 662  ? -19.563 2.322   73.856  1.00 199.45 ? 662  LEU A CD2 1 
ATOM   3519  N  N   . ASP A  1 663  ? -16.267 -1.259  71.429  1.00 136.66 ? 663  ASP A N   1 
ATOM   3520  C  CA  . ASP A  1 663  ? -15.342 -2.397  71.506  1.00 177.69 ? 663  ASP A CA  1 
ATOM   3521  C  C   . ASP A  1 663  ? -15.745 -3.532  70.560  1.00 197.71 ? 663  ASP A C   1 
ATOM   3522  O  O   . ASP A  1 663  ? -16.004 -4.653  71.001  1.00 225.22 ? 663  ASP A O   1 
ATOM   3523  C  CB  . ASP A  1 663  ? -15.246 -2.901  72.947  1.00 161.62 ? 663  ASP A CB  1 
ATOM   3524  C  CG  . ASP A  1 663  ? -14.270 -2.089  73.787  1.00 160.99 ? 663  ASP A CG  1 
ATOM   3525  O  OD1 . ASP A  1 663  ? -13.772 -1.050  73.300  1.00 216.19 ? 663  ASP A OD1 1 
ATOM   3526  O  OD2 . ASP A  1 663  ? -13.999 -2.495  74.935  1.00 161.94 ? 663  ASP A OD2 1 
ATOM   3527  N  N   . PRO A  1 664  ? -15.777 -3.243  69.247  1.00 147.39 ? 664  PRO A N   1 
ATOM   3528  C  CA  . PRO A  1 664  ? -16.320 -4.185  68.263  1.00 152.59 ? 664  PRO A CA  1 
ATOM   3529  C  C   . PRO A  1 664  ? -15.508 -5.467  68.183  1.00 163.84 ? 664  PRO A C   1 
ATOM   3530  O  O   . PRO A  1 664  ? -16.071 -6.559  68.254  1.00 244.02 ? 664  PRO A O   1 
ATOM   3531  C  CB  . PRO A  1 664  ? -16.221 -3.412  66.941  1.00 180.21 ? 664  PRO A CB  1 
ATOM   3532  C  CG  . PRO A  1 664  ? -16.057 -1.983  67.328  1.00 169.56 ? 664  PRO A CG  1 
ATOM   3533  C  CD  . PRO A  1 664  ? -15.294 -2.006  68.607  1.00 86.03  ? 664  PRO A CD  1 
ATOM   3534  N  N   . GLY A  1 665  ? -14.195 -5.327  68.050  1.00 135.32 ? 665  GLY A N   1 
ATOM   3535  C  CA  . GLY A  1 665  ? -13.335 -6.459  67.762  1.00 215.00 ? 665  GLY A CA  1 
ATOM   3536  C  C   . GLY A  1 665  ? -13.321 -7.534  68.829  1.00 216.13 ? 665  GLY A C   1 
ATOM   3537  O  O   . GLY A  1 665  ? -12.929 -8.670  68.564  1.00 248.09 ? 665  GLY A O   1 
ATOM   3538  N  N   . ARG A  1 666  ? -13.752 -7.184  70.034  1.00 173.39 ? 666  ARG A N   1 
ATOM   3539  C  CA  . ARG A  1 666  ? -13.726 -8.127  71.144  1.00 213.11 ? 666  ARG A CA  1 
ATOM   3540  C  C   . ARG A  1 666  ? -15.129 -8.613  71.498  1.00 231.06 ? 666  ARG A C   1 
ATOM   3541  O  O   . ARG A  1 666  ? -16.105 -7.873  71.367  1.00 258.67 ? 666  ARG A O   1 
ATOM   3542  C  CB  . ARG A  1 666  ? -13.064 -7.477  72.356  1.00 200.95 ? 666  ARG A CB  1 
ATOM   3543  C  CG  . ARG A  1 666  ? -13.768 -6.231  72.838  1.00 206.68 ? 666  ARG A CG  1 
ATOM   3544  C  CD  . ARG A  1 666  ? -12.772 -5.180  73.241  1.00 189.78 ? 666  ARG A CD  1 
ATOM   3545  N  NE  . ARG A  1 666  ? -11.774 -5.704  74.161  1.00 192.63 ? 666  ARG A NE  1 
ATOM   3546  C  CZ  . ARG A  1 666  ? -10.678 -5.045  74.516  1.00 217.01 ? 666  ARG A CZ  1 
ATOM   3547  N  NH1 . ARG A  1 666  ? -10.440 -3.839  74.018  1.00 212.12 ? 666  ARG A NH1 1 
ATOM   3548  N  NH2 . ARG A  1 666  ? -9.818  -5.591  75.363  1.00 216.13 ? 666  ARG A NH2 1 
ATOM   3549  N  N   . LEU A  1 667  ? -15.224 -9.863  71.947  1.00 172.75 ? 667  LEU A N   1 
ATOM   3550  C  CA  . LEU A  1 667  ? -16.506 -10.440 72.337  1.00 221.87 ? 667  LEU A CA  1 
ATOM   3551  C  C   . LEU A  1 667  ? -16.781 -10.141 73.797  1.00 233.99 ? 667  LEU A C   1 
ATOM   3552  O  O   . LEU A  1 667  ? -17.350 -10.956 74.520  1.00 306.62 ? 667  LEU A O   1 
ATOM   3553  C  CB  . LEU A  1 667  ? -16.513 -11.948 72.110  1.00 294.66 ? 667  LEU A CB  1 
ATOM   3554  C  CG  . LEU A  1 667  ? -16.513 -12.398 70.651  1.00 334.63 ? 667  LEU A CG  1 
ATOM   3555  C  CD1 . LEU A  1 667  ? -16.433 -13.913 70.570  1.00 367.11 ? 667  LEU A CD1 1 
ATOM   3556  C  CD2 . LEU A  1 667  ? -17.744 -11.887 69.924  1.00 327.46 ? 667  LEU A CD2 1 
ATOM   3557  N  N   . SER A  1 668  ? -16.365 -8.959  74.224  1.00 211.06 ? 668  SER A N   1 
ATOM   3558  C  CA  . SER A  1 668  ? -16.568 -8.522  75.589  1.00 175.52 ? 668  SER A CA  1 
ATOM   3559  C  C   . SER A  1 668  ? -16.928 -7.035  75.570  1.00 161.04 ? 668  SER A C   1 
ATOM   3560  O  O   . SER A  1 668  ? -16.081 -6.169  75.851  1.00 118.17 ? 668  SER A O   1 
ATOM   3561  C  CB  . SER A  1 668  ? -15.310 -8.790  76.426  1.00 201.95 ? 668  SER A CB  1 
ATOM   3562  O  OG  . SER A  1 668  ? -14.167 -8.175  75.853  1.00 236.33 ? 668  SER A OG  1 
ATOM   3563  N  N   . PRO A  1 669  ? -18.187 -6.731  75.201  1.00 153.05 ? 669  PRO A N   1 
ATOM   3564  C  CA  . PRO A  1 669  ? -18.676 -5.345  75.181  1.00 113.42 ? 669  PRO A CA  1 
ATOM   3565  C  C   . PRO A  1 669  ? -18.408 -4.595  76.482  1.00 109.06 ? 669  PRO A C   1 
ATOM   3566  O  O   . PRO A  1 669  ? -18.949 -4.961  77.524  1.00 248.07 ? 669  PRO A O   1 
ATOM   3567  C  CB  . PRO A  1 669  ? -20.184 -5.511  74.965  1.00 182.15 ? 669  PRO A CB  1 
ATOM   3568  C  CG  . PRO A  1 669  ? -20.316 -6.792  74.224  1.00 245.05 ? 669  PRO A CG  1 
ATOM   3569  C  CD  . PRO A  1 669  ? -19.209 -7.682  74.725  1.00 218.61 ? 669  PRO A CD  1 
ATOM   3570  N  N   . ARG A  1 670  ? -17.585 -3.556  76.412  1.00 153.50 ? 670  ARG A N   1 
ATOM   3571  C  CA  . ARG A  1 670  ? -17.217 -2.782  77.592  1.00 124.43 ? 670  ARG A CA  1 
ATOM   3572  C  C   . ARG A  1 670  ? -18.306 -1.759  77.977  1.00 156.87 ? 670  ARG A C   1 
ATOM   3573  O  O   . ARG A  1 670  ? -18.129 -0.986  78.923  1.00 96.12  ? 670  ARG A O   1 
ATOM   3574  C  CB  . ARG A  1 670  ? -15.901 -2.037  77.346  1.00 166.88 ? 670  ARG A CB  1 
ATOM   3575  C  CG  . ARG A  1 670  ? -15.093 -1.748  78.599  1.00 190.77 ? 670  ARG A CG  1 
ATOM   3576  C  CD  . ARG A  1 670  ? -14.070 -2.845  78.859  1.00 176.02 ? 670  ARG A CD  1 
ATOM   3577  N  NE  . ARG A  1 670  ? -13.208 -3.040  77.697  1.00 167.36 ? 670  ARG A NE  1 
ATOM   3578  C  CZ  . ARG A  1 670  ? -12.283 -2.166  77.295  1.00 166.79 ? 670  ARG A CZ  1 
ATOM   3579  N  NH1 . ARG A  1 670  ? -12.093 -1.035  77.959  1.00 162.54 ? 670  ARG A NH1 1 
ATOM   3580  N  NH2 . ARG A  1 670  ? -11.547 -2.416  76.223  1.00 120.71 ? 670  ARG A NH2 1 
ATOM   3581  N  N   . ALA A  1 671  ? -19.414 -1.730  77.237  1.00 167.89 ? 671  ALA A N   1 
ATOM   3582  C  CA  . ALA A  1 671  ? -20.500 -0.798  77.538  1.00 118.52 ? 671  ALA A CA  1 
ATOM   3583  C  C   . ALA A  1 671  ? -21.688 -1.021  76.628  1.00 134.54 ? 671  ALA A C   1 
ATOM   3584  O  O   . ALA A  1 671  ? -21.717 -1.964  75.834  1.00 131.03 ? 671  ALA A O   1 
ATOM   3585  C  CB  . ALA A  1 671  ? -20.018 0.656   77.424  1.00 78.23  ? 671  ALA A CB  1 
ATOM   3586  N  N   . THR A  1 672  ? -22.672 -0.142  76.759  1.00 142.72 ? 672  THR A N   1 
ATOM   3587  C  CA  . THR A  1 672  ? -23.877 -0.222  75.954  1.00 138.09 ? 672  THR A CA  1 
ATOM   3588  C  C   . THR A  1 672  ? -24.542 1.140   75.886  1.00 101.16 ? 672  THR A C   1 
ATOM   3589  O  O   . THR A  1 672  ? -24.347 1.976   76.761  1.00 117.63 ? 672  THR A O   1 
ATOM   3590  C  CB  . THR A  1 672  ? -24.873 -1.224  76.553  1.00 185.83 ? 672  THR A CB  1 
ATOM   3591  O  OG1 . THR A  1 672  ? -25.110 -0.896  77.928  1.00 129.53 ? 672  THR A OG1 1 
ATOM   3592  C  CG2 . THR A  1 672  ? -24.327 -2.643  76.459  1.00 251.75 ? 672  THR A CG2 1 
ATOM   3593  N  N   . PHE A  1 673  ? -25.309 1.372   74.829  1.00 104.13 ? 673  PHE A N   1 
ATOM   3594  C  CA  . PHE A  1 673  ? -26.104 2.589   74.727  1.00 161.74 ? 673  PHE A CA  1 
ATOM   3595  C  C   . PHE A  1 673  ? -27.379 2.377   75.503  1.00 126.60 ? 673  PHE A C   1 
ATOM   3596  O  O   . PHE A  1 673  ? -27.854 1.246   75.609  1.00 157.68 ? 673  PHE A O   1 
ATOM   3597  C  CB  . PHE A  1 673  ? -26.439 2.906   73.271  1.00 203.47 ? 673  PHE A CB  1 
ATOM   3598  C  CG  . PHE A  1 673  ? -25.235 3.140   72.410  1.00 170.06 ? 673  PHE A CG  1 
ATOM   3599  C  CD1 . PHE A  1 673  ? -24.742 2.126   71.596  1.00 91.31  ? 673  PHE A CD1 1 
ATOM   3600  C  CD2 . PHE A  1 673  ? -24.596 4.371   72.412  1.00 138.09 ? 673  PHE A CD2 1 
ATOM   3601  C  CE1 . PHE A  1 673  ? -23.639 2.337   70.807  1.00 169.58 ? 673  PHE A CE1 1 
ATOM   3602  C  CE2 . PHE A  1 673  ? -23.493 4.586   71.627  1.00 175.28 ? 673  PHE A CE2 1 
ATOM   3603  C  CZ  . PHE A  1 673  ? -23.012 3.567   70.820  1.00 209.62 ? 673  PHE A CZ  1 
ATOM   3604  N  N   . GLN A  1 674  ? -27.938 3.460   76.037  1.00 106.49 ? 674  GLN A N   1 
ATOM   3605  C  CA  . GLN A  1 674  ? -29.124 3.350   76.874  1.00 161.08 ? 674  GLN A CA  1 
ATOM   3606  C  C   . GLN A  1 674  ? -30.377 3.241   76.021  1.00 212.02 ? 674  GLN A C   1 
ATOM   3607  O  O   . GLN A  1 674  ? -31.272 2.443   76.306  1.00 272.87 ? 674  GLN A O   1 
ATOM   3608  C  CB  . GLN A  1 674  ? -29.244 4.553   77.805  1.00 157.62 ? 674  GLN A CB  1 
ATOM   3609  C  CG  . GLN A  1 674  ? -30.273 4.362   78.909  1.00 201.79 ? 674  GLN A CG  1 
ATOM   3610  C  CD  . GLN A  1 674  ? -30.417 5.590   79.773  1.00 231.61 ? 674  GLN A CD  1 
ATOM   3611  O  OE1 . GLN A  1 674  ? -29.725 6.588   79.563  1.00 114.82 ? 674  GLN A OE1 1 
ATOM   3612  N  NE2 . GLN A  1 674  ? -31.320 5.530   80.753  1.00 317.29 ? 674  GLN A NE2 1 
ATOM   3613  N  N   . GLU A  1 675  ? -30.430 4.045   74.969  1.00 148.02 ? 675  GLU A N   1 
ATOM   3614  C  CA  . GLU A  1 675  ? -31.608 4.106   74.121  1.00 179.77 ? 675  GLU A CA  1 
ATOM   3615  C  C   . GLU A  1 675  ? -32.060 2.713   73.677  1.00 198.51 ? 675  GLU A C   1 
ATOM   3616  O  O   . GLU A  1 675  ? -33.258 2.447   73.576  1.00 275.86 ? 675  GLU A O   1 
ATOM   3617  C  CB  . GLU A  1 675  ? -31.320 4.986   72.906  1.00 211.53 ? 675  GLU A CB  1 
ATOM   3618  C  CG  . GLU A  1 675  ? -32.519 5.213   72.001  1.00 283.01 ? 675  GLU A CG  1 
ATOM   3619  C  CD  . GLU A  1 675  ? -33.577 6.090   72.638  1.00 284.01 ? 675  GLU A CD  1 
ATOM   3620  O  OE1 . GLU A  1 675  ? -33.316 6.636   73.728  1.00 262.37 ? 675  GLU A OE1 1 
ATOM   3621  O  OE2 . GLU A  1 675  ? -34.668 6.235   72.049  1.00 311.29 ? 675  GLU A OE2 1 
ATOM   3622  N  N   . THR A  1 676  ? -31.099 1.824   73.426  1.00 123.44 ? 676  THR A N   1 
ATOM   3623  C  CA  . THR A  1 676  ? -31.393 0.485   72.903  1.00 189.63 ? 676  THR A CA  1 
ATOM   3624  C  C   . THR A  1 676  ? -30.942 -0.620  73.854  1.00 181.64 ? 676  THR A C   1 
ATOM   3625  O  O   . THR A  1 676  ? -31.424 -1.750  73.773  1.00 254.02 ? 676  THR A O   1 
ATOM   3626  C  CB  . THR A  1 676  ? -30.721 0.249   71.526  1.00 244.44 ? 676  THR A CB  1 
ATOM   3627  O  OG1 . THR A  1 676  ? -31.041 -1.064  71.044  1.00 293.28 ? 676  THR A OG1 1 
ATOM   3628  C  CG2 . THR A  1 676  ? -29.205 0.402   71.624  1.00 115.35 ? 676  THR A CG2 1 
ATOM   3629  N  N   . LYS A  1 677  ? -30.009 -0.289  74.739  1.00 132.32 ? 677  LYS A N   1 
ATOM   3630  C  CA  . LYS A  1 677  ? -29.526 -1.222  75.751  1.00 182.74 ? 677  LYS A CA  1 
ATOM   3631  C  C   . LYS A  1 677  ? -28.481 -2.171  75.170  1.00 182.75 ? 677  LYS A C   1 
ATOM   3632  O  O   . LYS A  1 677  ? -27.802 -2.874  75.916  1.00 158.33 ? 677  LYS A O   1 
ATOM   3633  C  CB  . LYS A  1 677  ? -30.693 -2.009  76.364  1.00 249.85 ? 677  LYS A CB  1 
ATOM   3634  C  CG  . LYS A  1 677  ? -30.386 -2.639  77.717  1.00 266.10 ? 677  LYS A CG  1 
ATOM   3635  C  CD  . LYS A  1 677  ? -31.633 -3.246  78.346  1.00 288.06 ? 677  LYS A CD  1 
ATOM   3636  C  CE  . LYS A  1 677  ? -31.352 -3.790  79.738  1.00 276.03 ? 677  LYS A CE  1 
ATOM   3637  N  NZ  . LYS A  1 677  ? -32.575 -4.345  80.380  1.00 253.06 ? 677  LYS A NZ  1 
ATOM   3638  N  N   . ASN A  1 678  ? -28.353 -2.187  73.843  1.00 182.29 ? 678  ASN A N   1 
ATOM   3639  C  CA  . ASN A  1 678  ? -27.365 -3.029  73.172  1.00 193.43 ? 678  ASN A CA  1 
ATOM   3640  C  C   . ASN A  1 678  ? -25.979 -2.410  73.239  1.00 175.14 ? 678  ASN A C   1 
ATOM   3641  O  O   . ASN A  1 678  ? -25.815 -1.277  73.704  1.00 101.01 ? 678  ASN A O   1 
ATOM   3642  C  CB  . ASN A  1 678  ? -27.747 -3.264  71.708  1.00 188.14 ? 678  ASN A CB  1 
ATOM   3643  C  CG  . ASN A  1 678  ? -28.608 -4.491  71.518  1.00 240.63 ? 678  ASN A CG  1 
ATOM   3644  O  OD1 . ASN A  1 678  ? -29.253 -4.966  72.451  1.00 311.04 ? 678  ASN A OD1 1 
ATOM   3645  N  ND2 . ASN A  1 678  ? -28.624 -5.015  70.301  1.00 248.95 ? 678  ASN A ND2 1 
ATOM   3646  N  N   . ARG A  1 679  ? -24.989 -3.166  72.772  1.00 192.64 ? 679  ARG A N   1 
ATOM   3647  C  CA  . ARG A  1 679  ? -23.611 -2.685  72.696  1.00 208.49 ? 679  ARG A CA  1 
ATOM   3648  C  C   . ARG A  1 679  ? -23.408 -1.793  71.467  1.00 176.64 ? 679  ARG A C   1 
ATOM   3649  O  O   . ARG A  1 679  ? -22.313 -1.263  71.231  1.00 69.97  ? 679  ARG A O   1 
ATOM   3650  C  CB  . ARG A  1 679  ? -22.642 -3.870  72.656  1.00 213.88 ? 679  ARG A CB  1 
ATOM   3651  C  CG  . ARG A  1 679  ? -22.798 -4.774  71.440  1.00 202.51 ? 679  ARG A CG  1 
ATOM   3652  C  CD  . ARG A  1 679  ? -21.910 -4.324  70.285  1.00 135.77 ? 679  ARG A CD  1 
ATOM   3653  N  NE  . ARG A  1 679  ? -20.489 -4.557  70.541  1.00 119.01 ? 679  ARG A NE  1 
ATOM   3654  C  CZ  . ARG A  1 679  ? -19.856 -5.696  70.264  1.00 203.71 ? 679  ARG A CZ  1 
ATOM   3655  N  NH1 . ARG A  1 679  ? -20.511 -6.715  69.720  1.00 278.32 ? 679  ARG A NH1 1 
ATOM   3656  N  NH2 . ARG A  1 679  ? -18.564 -5.819  70.530  1.00 144.45 ? 679  ARG A NH2 1 
ATOM   3657  N  N   . SER A  1 680  ? -24.478 -1.648  70.690  1.00 176.82 ? 680  SER A N   1 
ATOM   3658  C  CA  . SER A  1 680  ? -24.487 -0.797  69.506  1.00 168.24 ? 680  SER A CA  1 
ATOM   3659  C  C   . SER A  1 680  ? -25.898 -0.249  69.279  1.00 145.44 ? 680  SER A C   1 
ATOM   3660  O  O   . SER A  1 680  ? -26.854 -0.680  69.934  1.00 168.31 ? 680  SER A O   1 
ATOM   3661  C  CB  . SER A  1 680  ? -24.031 -1.594  68.285  1.00 188.36 ? 680  SER A CB  1 
ATOM   3662  O  OG  . SER A  1 680  ? -24.820 -2.758  68.132  1.00 155.44 ? 680  SER A OG  1 
ATOM   3663  N  N   . LEU A  1 681  ? -26.028 0.700   68.354  1.00 123.03 ? 681  LEU A N   1 
ATOM   3664  C  CA  . LEU A  1 681  ? -27.338 1.269   68.021  1.00 160.99 ? 681  LEU A CA  1 
ATOM   3665  C  C   . LEU A  1 681  ? -27.335 1.904   66.635  1.00 161.58 ? 681  LEU A C   1 
ATOM   3666  O  O   . LEU A  1 681  ? -26.274 2.228   66.099  1.00 180.91 ? 681  LEU A O   1 
ATOM   3667  C  CB  . LEU A  1 681  ? -27.759 2.319   69.058  1.00 192.85 ? 681  LEU A CB  1 
ATOM   3668  C  CG  . LEU A  1 681  ? -27.208 3.746   68.890  1.00 180.48 ? 681  LEU A CG  1 
ATOM   3669  C  CD1 . LEU A  1 681  ? -27.999 4.542   67.860  1.00 157.73 ? 681  LEU A CD1 1 
ATOM   3670  C  CD2 . LEU A  1 681  ? -27.219 4.483   70.216  1.00 128.70 ? 681  LEU A CD2 1 
ATOM   3671  N  N   . SER A  1 682  ? -28.529 2.092   66.071  1.00 144.18 ? 682  SER A N   1 
ATOM   3672  C  CA  . SER A  1 682  ? -28.682 2.749   64.773  1.00 146.80 ? 682  SER A CA  1 
ATOM   3673  C  C   . SER A  1 682  ? -29.882 3.689   64.761  1.00 140.06 ? 682  SER A C   1 
ATOM   3674  O  O   . SER A  1 682  ? -30.929 3.398   65.339  1.00 199.19 ? 682  SER A O   1 
ATOM   3675  C  CB  . SER A  1 682  ? -28.829 1.715   63.649  1.00 195.85 ? 682  SER A CB  1 
ATOM   3676  O  OG  . SER A  1 682  ? -29.016 2.351   62.393  1.00 184.07 ? 682  SER A OG  1 
ATOM   3677  N  N   . ARG A  1 683  ? -29.713 4.819   64.089  1.00 137.37 ? 683  ARG A N   1 
ATOM   3678  C  CA  . ARG A  1 683  ? -30.783 5.788   63.940  1.00 182.83 ? 683  ARG A CA  1 
ATOM   3679  C  C   . ARG A  1 683  ? -30.563 6.582   62.655  1.00 185.43 ? 683  ARG A C   1 
ATOM   3680  O  O   . ARG A  1 683  ? -29.438 6.988   62.340  1.00 123.48 ? 683  ARG A O   1 
ATOM   3681  C  CB  . ARG A  1 683  ? -30.852 6.719   65.157  1.00 168.29 ? 683  ARG A CB  1 
ATOM   3682  C  CG  . ARG A  1 683  ? -31.217 6.021   66.459  1.00 181.29 ? 683  ARG A CG  1 
ATOM   3683  C  CD  . ARG A  1 683  ? -31.745 7.011   67.480  1.00 185.44 ? 683  ARG A CD  1 
ATOM   3684  N  NE  . ARG A  1 683  ? -33.038 7.563   67.078  1.00 258.85 ? 683  ARG A NE  1 
ATOM   3685  C  CZ  . ARG A  1 683  ? -33.825 8.284   67.871  1.00 266.48 ? 683  ARG A CZ  1 
ATOM   3686  N  NH1 . ARG A  1 683  ? -33.454 8.543   69.118  1.00 268.46 ? 683  ARG A NH1 1 
ATOM   3687  N  NH2 . ARG A  1 683  ? -34.986 8.745   67.419  1.00 212.68 ? 683  ARG A NH2 1 
ATOM   3688  N  N   . VAL A  1 684  ? -31.643 6.775   61.905  1.00 194.40 ? 684  VAL A N   1 
ATOM   3689  C  CA  . VAL A  1 684  ? -31.595 7.539   60.662  1.00 110.11 ? 684  VAL A CA  1 
ATOM   3690  C  C   . VAL A  1 684  ? -31.946 9.001   60.903  1.00 129.90 ? 684  VAL A C   1 
ATOM   3691  O  O   . VAL A  1 684  ? -33.062 9.321   61.317  1.00 191.62 ? 684  VAL A O   1 
ATOM   3692  C  CB  . VAL A  1 684  ? -32.572 6.972   59.626  1.00 201.56 ? 684  VAL A CB  1 
ATOM   3693  C  CG1 . VAL A  1 684  ? -32.517 7.792   58.349  1.00 236.27 ? 684  VAL A CG1 1 
ATOM   3694  C  CG2 . VAL A  1 684  ? -32.255 5.514   59.346  1.00 248.65 ? 684  VAL A CG2 1 
ATOM   3695  N  N   . ARG A  1 685  ? -30.989 9.884   60.632  1.00 142.87 ? 685  ARG A N   1 
ATOM   3696  C  CA  . ARG A  1 685  ? -31.161 11.308  60.915  1.00 152.38 ? 685  ARG A CA  1 
ATOM   3697  C  C   . ARG A  1 685  ? -30.749 12.206  59.739  1.00 154.21 ? 685  ARG A C   1 
ATOM   3698  O  O   . ARG A  1 685  ? -29.910 11.833  58.906  1.00 104.43 ? 685  ARG A O   1 
ATOM   3699  C  CB  . ARG A  1 685  ? -30.372 11.694  62.174  1.00 151.52 ? 685  ARG A CB  1 
ATOM   3700  C  CG  . ARG A  1 685  ? -30.504 10.695  63.326  1.00 216.77 ? 685  ARG A CG  1 
ATOM   3701  C  CD  . ARG A  1 685  ? -30.489 11.382  64.691  1.00 183.79 ? 685  ARG A CD  1 
ATOM   3702  N  NE  . ARG A  1 685  ? -31.648 12.252  64.870  1.00 222.99 ? 685  ARG A NE  1 
ATOM   3703  C  CZ  . ARG A  1 685  ? -32.862 11.824  65.198  1.00 235.13 ? 685  ARG A CZ  1 
ATOM   3704  N  NH1 . ARG A  1 685  ? -33.090 10.529  65.390  1.00 137.63 ? 685  ARG A NH1 1 
ATOM   3705  N  NH2 . ARG A  1 685  ? -33.850 12.697  65.332  1.00 293.23 ? 685  ARG A NH2 1 
ATOM   3706  N  N   . VAL A  1 686  ? -31.331 13.403  59.705  1.00 154.66 ? 686  VAL A N   1 
ATOM   3707  C  CA  . VAL A  1 686  ? -31.171 14.326  58.582  1.00 127.49 ? 686  VAL A CA  1 
ATOM   3708  C  C   . VAL A  1 686  ? -29.906 15.169  58.654  1.00 161.83 ? 686  VAL A C   1 
ATOM   3709  O  O   . VAL A  1 686  ? -29.665 15.856  59.647  1.00 228.44 ? 686  VAL A O   1 
ATOM   3710  C  CB  . VAL A  1 686  ? -32.354 15.300  58.489  1.00 163.98 ? 686  VAL A CB  1 
ATOM   3711  C  CG1 . VAL A  1 686  ? -32.570 16.026  59.816  1.00 128.83 ? 686  VAL A CG1 1 
ATOM   3712  C  CG2 . VAL A  1 686  ? -32.117 16.294  57.373  1.00 165.58 ? 686  VAL A CG2 1 
ATOM   3713  N  N   . LEU A  1 687  ? -29.119 15.132  57.581  1.00 152.75 ? 687  LEU A N   1 
ATOM   3714  C  CA  . LEU A  1 687  ? -27.877 15.901  57.484  1.00 135.84 ? 687  LEU A CA  1 
ATOM   3715  C  C   . LEU A  1 687  ? -28.106 17.219  56.758  1.00 132.46 ? 687  LEU A C   1 
ATOM   3716  O  O   . LEU A  1 687  ? -29.178 17.459  56.202  1.00 148.34 ? 687  LEU A O   1 
ATOM   3717  C  CB  . LEU A  1 687  ? -26.800 15.104  56.743  1.00 101.84 ? 687  LEU A CB  1 
ATOM   3718  C  CG  . LEU A  1 687  ? -26.167 13.926  57.481  1.00 95.91  ? 687  LEU A CG  1 
ATOM   3719  C  CD1 . LEU A  1 687  ? -25.074 13.317  56.618  1.00 150.58 ? 687  LEU A CD1 1 
ATOM   3720  C  CD2 . LEU A  1 687  ? -25.600 14.397  58.795  1.00 214.59 ? 687  LEU A CD2 1 
ATOM   3721  N  N   . GLY A  1 688  ? -27.090 18.072  56.778  1.00 141.85 ? 688  GLY A N   1 
ATOM   3722  C  CA  . GLY A  1 688  ? -27.109 19.305  56.018  1.00 100.72 ? 688  GLY A CA  1 
ATOM   3723  C  C   . GLY A  1 688  ? -25.685 19.771  55.861  1.00 134.68 ? 688  GLY A C   1 
ATOM   3724  O  O   . GLY A  1 688  ? -24.752 19.159  56.394  1.00 140.94 ? 688  GLY A O   1 
ATOM   3725  N  N   . LEU A  1 689  ? -25.507 20.851  55.117  1.00 109.17 ? 689  LEU A N   1 
ATOM   3726  C  CA  . LEU A  1 689  ? -24.194 21.465  55.028  1.00 128.94 ? 689  LEU A CA  1 
ATOM   3727  C  C   . LEU A  1 689  ? -23.839 22.051  56.394  1.00 181.87 ? 689  LEU A C   1 
ATOM   3728  O  O   . LEU A  1 689  ? -22.661 22.261  56.703  1.00 169.16 ? 689  LEU A O   1 
ATOM   3729  C  CB  . LEU A  1 689  ? -24.163 22.529  53.923  1.00 122.63 ? 689  LEU A CB  1 
ATOM   3730  C  CG  . LEU A  1 689  ? -25.089 23.752  54.023  1.00 246.15 ? 689  LEU A CG  1 
ATOM   3731  C  CD1 . LEU A  1 689  ? -24.460 24.823  54.899  1.00 319.58 ? 689  LEU A CD1 1 
ATOM   3732  C  CD2 . LEU A  1 689  ? -25.397 24.327  52.637  1.00 241.93 ? 689  LEU A CD2 1 
ATOM   3733  N  N   . LYS A  1 690  ? -24.870 22.294  57.208  1.00 198.90 ? 690  LYS A N   1 
ATOM   3734  C  CA  . LYS A  1 690  ? -24.690 22.742  58.590  1.00 175.46 ? 690  LYS A CA  1 
ATOM   3735  C  C   . LYS A  1 690  ? -24.667 21.534  59.518  1.00 188.38 ? 690  LYS A C   1 
ATOM   3736  O  O   . LYS A  1 690  ? -25.538 20.659  59.443  1.00 131.18 ? 690  LYS A O   1 
ATOM   3737  C  CB  . LYS A  1 690  ? -25.807 23.693  59.019  1.00 134.50 ? 690  LYS A CB  1 
ATOM   3738  C  CG  . LYS A  1 690  ? -25.614 24.285  60.415  1.00 194.33 ? 690  LYS A CG  1 
ATOM   3739  C  CD  . LYS A  1 690  ? -24.328 25.081  60.521  1.00 233.46 ? 690  LYS A CD  1 
ATOM   3740  C  CE  . LYS A  1 690  ? -24.169 25.672  61.904  1.00 246.33 ? 690  LYS A CE  1 
ATOM   3741  N  NZ  . LYS A  1 690  ? -22.860 26.354  62.063  1.00 281.72 ? 690  LYS A NZ  1 
ATOM   3742  N  N   . ALA A  1 691  ? -23.672 21.507  60.401  1.00 210.04 ? 691  ALA A N   1 
ATOM   3743  C  CA  . ALA A  1 691  ? -23.408 20.351  61.250  1.00 165.84 ? 691  ALA A CA  1 
ATOM   3744  C  C   . ALA A  1 691  ? -24.688 19.745  61.840  1.00 101.86 ? 691  ALA A C   1 
ATOM   3745  O  O   . ALA A  1 691  ? -25.732 20.401  61.898  1.00 149.28 ? 691  ALA A O   1 
ATOM   3746  C  CB  . ALA A  1 691  ? -22.431 20.744  62.363  1.00 181.17 ? 691  ALA A CB  1 
ATOM   3747  N  N   . HIS A  1 692  ? -24.607 18.481  62.249  1.00 124.91 ? 692  HIS A N   1 
ATOM   3748  C  CA  . HIS A  1 692  ? -25.665 17.854  63.039  1.00 145.83 ? 692  HIS A CA  1 
ATOM   3749  C  C   . HIS A  1 692  ? -25.109 17.039  64.204  1.00 114.59 ? 692  HIS A C   1 
ATOM   3750  O  O   . HIS A  1 692  ? -24.671 15.906  64.028  1.00 274.56 ? 692  HIS A O   1 
ATOM   3751  C  CB  . HIS A  1 692  ? -26.519 16.945  62.178  1.00 179.35 ? 692  HIS A CB  1 
ATOM   3752  C  CG  . HIS A  1 692  ? -27.484 16.122  62.972  1.00 204.15 ? 692  HIS A CG  1 
ATOM   3753  N  ND1 . HIS A  1 692  ? -28.819 16.450  63.101  1.00 192.17 ? 692  HIS A ND1 1 
ATOM   3754  C  CD2 . HIS A  1 692  ? -27.298 14.999  63.705  1.00 113.95 ? 692  HIS A CD2 1 
ATOM   3755  C  CE1 . HIS A  1 692  ? -29.418 15.551  63.861  1.00 144.64 ? 692  HIS A CE1 1 
ATOM   3756  N  NE2 . HIS A  1 692  ? -28.519 14.660  64.241  1.00 82.04  ? 692  HIS A NE2 1 
ATOM   3757  N  N   . CYS A  1 693  ? -25.146 17.627  65.393  1.00 98.81  ? 693  CYS A N   1 
ATOM   3758  C  CA  . CYS A  1 693  ? -24.557 17.004  66.564  1.00 154.36 ? 693  CYS A CA  1 
ATOM   3759  C  C   . CYS A  1 693  ? -25.600 16.414  67.501  1.00 149.25 ? 693  CYS A C   1 
ATOM   3760  O  O   . CYS A  1 693  ? -26.533 17.089  67.931  1.00 134.10 ? 693  CYS A O   1 
ATOM   3761  C  CB  . CYS A  1 693  ? -23.715 18.032  67.312  1.00 187.15 ? 693  CYS A CB  1 
ATOM   3762  S  SG  . CYS A  1 693  ? -22.550 18.907  66.236  1.00 144.00 ? 693  CYS A SG  1 
ATOM   3763  N  N   . GLU A  1 694  ? -25.427 15.140  67.815  1.00 119.65 ? 694  GLU A N   1 
ATOM   3764  C  CA  . GLU A  1 694  ? -26.259 14.488  68.799  1.00 102.91 ? 694  GLU A CA  1 
ATOM   3765  C  C   . GLU A  1 694  ? -25.362 13.663  69.701  1.00 148.06 ? 694  GLU A C   1 
ATOM   3766  O  O   . GLU A  1 694  ? -24.476 12.941  69.226  1.00 122.19 ? 694  GLU A O   1 
ATOM   3767  C  CB  . GLU A  1 694  ? -27.304 13.596  68.134  1.00 205.18 ? 694  GLU A CB  1 
ATOM   3768  C  CG  . GLU A  1 694  ? -28.070 12.724  69.119  1.00 186.92 ? 694  GLU A CG  1 
ATOM   3769  C  CD  . GLU A  1 694  ? -29.100 11.847  68.452  1.00 162.55 ? 694  GLU A CD  1 
ATOM   3770  O  OE1 . GLU A  1 694  ? -29.215 11.894  67.214  1.00 123.27 ? 694  GLU A OE1 1 
ATOM   3771  O  OE2 . GLU A  1 694  ? -29.797 11.103  69.166  1.00 167.17 ? 694  GLU A OE2 1 
ATOM   3772  N  N   . ASN A  1 695  ? -25.597 13.792  71.006  1.00 173.46 ? 695  ASN A N   1 
ATOM   3773  C  CA  . ASN A  1 695  ? -24.884 13.015  72.023  1.00 179.30 ? 695  ASN A CA  1 
ATOM   3774  C  C   . ASN A  1 695  ? -25.758 11.885  72.581  1.00 139.05 ? 695  ASN A C   1 
ATOM   3775  O  O   . ASN A  1 695  ? -26.966 12.060  72.795  1.00 129.80 ? 695  ASN A O   1 
ATOM   3776  C  CB  . ASN A  1 695  ? -24.393 13.931  73.149  1.00 134.39 ? 695  ASN A CB  1 
ATOM   3777  C  CG  . ASN A  1 695  ? -25.423 14.985  73.533  1.00 159.15 ? 695  ASN A CG  1 
ATOM   3778  O  OD1 . ASN A  1 695  ? -26.633 14.770  73.400  1.00 133.86 ? 695  ASN A OD1 1 
ATOM   3779  N  ND2 . ASN A  1 695  ? -24.946 16.136  74.002  1.00 154.36 ? 695  ASN A ND2 1 
ATOM   3780  N  N   . PHE A  1 696  ? -25.138 10.722  72.785  1.00 141.93 ? 696  PHE A N   1 
ATOM   3781  C  CA  . PHE A  1 696  ? -25.855 9.519   73.204  1.00 210.25 ? 696  PHE A CA  1 
ATOM   3782  C  C   . PHE A  1 696  ? -25.397 9.085   74.584  1.00 212.54 ? 696  PHE A C   1 
ATOM   3783  O  O   . PHE A  1 696  ? -24.296 9.428   75.034  1.00 150.80 ? 696  PHE A O   1 
ATOM   3784  C  CB  . PHE A  1 696  ? -25.647 8.359   72.215  1.00 200.63 ? 696  PHE A CB  1 
ATOM   3785  C  CG  . PHE A  1 696  ? -26.107 8.662   70.819  1.00 204.90 ? 696  PHE A CG  1 
ATOM   3786  C  CD1 . PHE A  1 696  ? -25.231 9.220   69.904  1.00 201.07 ? 696  PHE A CD1 1 
ATOM   3787  C  CD2 . PHE A  1 696  ? -27.415 8.406   70.426  1.00 201.54 ? 696  PHE A CD2 1 
ATOM   3788  C  CE1 . PHE A  1 696  ? -25.643 9.515   68.627  1.00 149.78 ? 696  PHE A CE1 1 
ATOM   3789  C  CE2 . PHE A  1 696  ? -27.836 8.697   69.144  1.00 128.19 ? 696  PHE A CE2 1 
ATOM   3790  C  CZ  . PHE A  1 696  ? -26.951 9.252   68.245  1.00 156.60 ? 696  PHE A CZ  1 
ATOM   3791  N  N   . ASN A  1 697  ? -26.255 8.313   75.242  1.00 213.06 ? 697  ASN A N   1 
ATOM   3792  C  CA  . ASN A  1 697  ? -25.998 7.854   76.592  1.00 146.67 ? 697  ASN A CA  1 
ATOM   3793  C  C   . ASN A  1 697  ? -25.344 6.489   76.601  1.00 147.17 ? 697  ASN A C   1 
ATOM   3794  O  O   . ASN A  1 697  ? -25.778 5.555   75.910  1.00 92.34  ? 697  ASN A O   1 
ATOM   3795  C  CB  . ASN A  1 697  ? -27.299 7.818   77.386  1.00 175.29 ? 697  ASN A CB  1 
ATOM   3796  C  CG  . ASN A  1 697  ? -27.846 9.197   77.636  1.00 195.64 ? 697  ASN A CG  1 
ATOM   3797  O  OD1 . ASN A  1 697  ? -27.082 10.150  77.801  1.00 83.57  ? 697  ASN A OD1 1 
ATOM   3798  N  ND2 . ASN A  1 697  ? -29.169 9.322   77.648  1.00 263.30 ? 697  ASN A ND2 1 
ATOM   3799  N  N   . LEU A  1 698  ? -24.292 6.398   77.407  1.00 134.07 ? 698  LEU A N   1 
ATOM   3800  C  CA  . LEU A  1 698  ? -23.518 5.176   77.547  1.00 198.40 ? 698  LEU A CA  1 
ATOM   3801  C  C   . LEU A  1 698  ? -23.504 4.713   79.009  1.00 215.95 ? 698  LEU A C   1 
ATOM   3802  O  O   . LEU A  1 698  ? -23.490 5.530   79.930  1.00 197.86 ? 698  LEU A O   1 
ATOM   3803  C  CB  . LEU A  1 698  ? -22.094 5.408   77.046  1.00 151.13 ? 698  LEU A CB  1 
ATOM   3804  C  CG  . LEU A  1 698  ? -21.955 5.842   75.582  1.00 174.25 ? 698  LEU A CG  1 
ATOM   3805  C  CD1 . LEU A  1 698  ? -22.365 7.300   75.357  1.00 182.45 ? 698  LEU A CD1 1 
ATOM   3806  C  CD2 . LEU A  1 698  ? -20.521 5.624   75.134  1.00 185.27 ? 698  LEU A CD2 1 
ATOM   3807  N  N   . LEU A  1 699  ? -23.512 3.398   79.212  1.00 205.98 ? 699  LEU A N   1 
ATOM   3808  C  CA  . LEU A  1 699  ? -23.576 2.824   80.552  1.00 136.78 ? 699  LEU A CA  1 
ATOM   3809  C  C   . LEU A  1 699  ? -22.402 1.903   80.823  1.00 135.12 ? 699  LEU A C   1 
ATOM   3810  O  O   . LEU A  1 699  ? -22.345 0.789   80.298  1.00 141.66 ? 699  LEU A O   1 
ATOM   3811  C  CB  . LEU A  1 699  ? -24.862 2.028   80.727  1.00 155.40 ? 699  LEU A CB  1 
ATOM   3812  C  CG  . LEU A  1 699  ? -26.135 2.855   80.856  1.00 157.84 ? 699  LEU A CG  1 
ATOM   3813  C  CD1 . LEU A  1 699  ? -26.520 3.468   79.532  1.00 152.09 ? 699  LEU A CD1 1 
ATOM   3814  C  CD2 . LEU A  1 699  ? -27.255 1.980   81.380  1.00 247.88 ? 699  LEU A CD2 1 
ATOM   3815  N  N   . LEU A  1 700  ? -21.479 2.368   81.659  1.00 106.87 ? 700  LEU A N   1 
ATOM   3816  C  CA  . LEU A  1 700  ? -20.313 1.583   82.049  1.00 188.07 ? 700  LEU A CA  1 
ATOM   3817  C  C   . LEU A  1 700  ? -20.593 0.772   83.322  1.00 205.15 ? 700  LEU A C   1 
ATOM   3818  O  O   . LEU A  1 700  ? -20.910 1.347   84.370  1.00 223.92 ? 700  LEU A O   1 
ATOM   3819  C  CB  . LEU A  1 700  ? -19.107 2.509   82.271  1.00 183.62 ? 700  LEU A CB  1 
ATOM   3820  C  CG  . LEU A  1 700  ? -18.553 3.236   81.040  1.00 205.55 ? 700  LEU A CG  1 
ATOM   3821  C  CD1 . LEU A  1 700  ? -17.494 4.276   81.416  1.00 202.96 ? 700  LEU A CD1 1 
ATOM   3822  C  CD2 . LEU A  1 700  ? -17.983 2.223   80.053  1.00 290.87 ? 700  LEU A CD2 1 
ATOM   3823  N  N   . PRO A  1 701  ? -20.473 -0.568  83.241  1.00 147.90 ? 701  PRO A N   1 
ATOM   3824  C  CA  . PRO A  1 701  ? -20.671 -1.383  84.448  1.00 213.07 ? 701  PRO A CA  1 
ATOM   3825  C  C   . PRO A  1 701  ? -19.662 -1.022  85.540  1.00 245.67 ? 701  PRO A C   1 
ATOM   3826  O  O   . PRO A  1 701  ? -18.483 -0.833  85.234  1.00 250.19 ? 701  PRO A O   1 
ATOM   3827  C  CB  . PRO A  1 701  ? -20.441 -2.816  83.955  1.00 214.79 ? 701  PRO A CB  1 
ATOM   3828  C  CG  . PRO A  1 701  ? -19.711 -2.692  82.676  1.00 165.18 ? 701  PRO A CG  1 
ATOM   3829  C  CD  . PRO A  1 701  ? -20.078 -1.377  82.077  1.00 138.27 ? 701  PRO A CD  1 
ATOM   3830  N  N   . SER A  1 702  ? -20.116 -0.922  86.787  1.00 226.89 ? 702  SER A N   1 
ATOM   3831  C  CA  . SER A  1 702  ? -19.246 -0.522  87.889  1.00 217.49 ? 702  SER A CA  1 
ATOM   3832  C  C   . SER A  1 702  ? -17.935 -1.314  87.900  1.00 248.72 ? 702  SER A C   1 
ATOM   3833  O  O   . SER A  1 702  ? -16.860 -0.740  88.087  1.00 283.70 ? 702  SER A O   1 
ATOM   3834  C  CB  . SER A  1 702  ? -19.972 -0.707  89.216  1.00 220.69 ? 702  SER A CB  1 
ATOM   3835  O  OG  . SER A  1 702  ? -20.485 -2.023  89.327  1.00 237.87 ? 702  SER A OG  1 
ATOM   3836  N  N   . CYS A  1 703  ? -18.032 -2.626  87.682  1.00 224.04 ? 703  CYS A N   1 
ATOM   3837  C  CA  . CYS A  1 703  ? -16.866 -3.511  87.706  1.00 237.31 ? 703  CYS A CA  1 
ATOM   3838  C  C   . CYS A  1 703  ? -16.443 -3.930  86.296  1.00 238.26 ? 703  CYS A C   1 
ATOM   3839  O  O   . CYS A  1 703  ? -17.275 -4.349  85.490  1.00 222.54 ? 703  CYS A O   1 
ATOM   3840  C  CB  . CYS A  1 703  ? -17.166 -4.765  88.535  1.00 227.97 ? 703  CYS A CB  1 
ATOM   3841  S  SG  . CYS A  1 703  ? -18.191 -4.483  90.001  1.00 551.62 ? 703  CYS A SG  1 
ATOM   3842  N  N   . VAL A  1 704  ? -15.147 -3.826  86.012  1.00 230.95 ? 704  VAL A N   1 
ATOM   3843  C  CA  . VAL A  1 704  ? -14.619 -4.186  84.702  1.00 180.08 ? 704  VAL A CA  1 
ATOM   3844  C  C   . VAL A  1 704  ? -13.182 -4.684  84.787  1.00 173.21 ? 704  VAL A C   1 
ATOM   3845  O  O   . VAL A  1 704  ? -12.408 -4.227  85.627  1.00 259.25 ? 704  VAL A O   1 
ATOM   3846  C  CB  . VAL A  1 704  ? -14.641 -2.987  83.755  1.00 187.21 ? 704  VAL A CB  1 
ATOM   3847  C  CG1 . VAL A  1 704  ? -14.024 -3.368  82.409  1.00 228.91 ? 704  VAL A CG1 1 
ATOM   3848  C  CG2 . VAL A  1 704  ? -16.065 -2.474  83.583  1.00 184.46 ? 704  VAL A CG2 1 
ATOM   3849  N  N   . GLU A  1 705  ? -12.829 -5.614  83.904  1.00 123.71 ? 705  GLU A N   1 
ATOM   3850  C  CA  . GLU A  1 705  ? -11.482 -6.181  83.878  1.00 168.29 ? 705  GLU A CA  1 
ATOM   3851  C  C   . GLU A  1 705  ? -10.483 -5.217  83.248  1.00 202.76 ? 705  GLU A C   1 
ATOM   3852  O  O   . GLU A  1 705  ? -9.725  -4.551  83.952  1.00 219.47 ? 705  GLU A O   1 
ATOM   3853  C  CB  . GLU A  1 705  ? -11.459 -7.505  83.106  1.00 161.78 ? 705  GLU A CB  1 
ATOM   3854  C  CG  . GLU A  1 705  ? -11.968 -8.704  83.884  1.00 236.17 ? 705  GLU A CG  1 
ATOM   3855  C  CD  . GLU A  1 705  ? -11.741 -10.014 83.147  1.00 307.98 ? 705  GLU A CD  1 
ATOM   3856  O  OE1 . GLU A  1 705  ? -11.562 -9.980  81.911  1.00 333.90 ? 705  GLU A OE1 1 
ATOM   3857  O  OE2 . GLU A  1 705  ? -11.742 -11.076 83.804  1.00 329.57 ? 705  GLU A OE2 1 
ATOM   3858  N  N   . ASP A  1 706  ? -10.487 -5.155  81.918  1.00 241.77 ? 706  ASP A N   1 
ATOM   3859  C  CA  . ASP A  1 706  ? -9.550  -4.318  81.173  1.00 232.17 ? 706  ASP A CA  1 
ATOM   3860  C  C   . ASP A  1 706  ? -9.919  -2.834  81.250  1.00 198.36 ? 706  ASP A C   1 
ATOM   3861  O  O   . ASP A  1 706  ? -11.044 -2.450  80.933  1.00 181.15 ? 706  ASP A O   1 
ATOM   3862  C  CB  . ASP A  1 706  ? -9.508  -4.764  79.710  1.00 239.37 ? 706  ASP A CB  1 
ATOM   3863  C  CG  . ASP A  1 706  ? -8.410  -4.079  78.924  1.00 214.61 ? 706  ASP A CG  1 
ATOM   3864  O  OD1 . ASP A  1 706  ? -7.740  -3.189  79.488  1.00 197.14 ? 706  ASP A OD1 1 
ATOM   3865  O  OD2 . ASP A  1 706  ? -8.214  -4.437  77.744  1.00 195.81 ? 706  ASP A OD2 1 
ATOM   3866  N  N   . SER A  1 707  ? -8.965  -2.009  81.674  1.00 177.27 ? 707  SER A N   1 
ATOM   3867  C  CA  . SER A  1 707  ? -9.164  -0.559  81.767  1.00 143.52 ? 707  SER A CA  1 
ATOM   3868  C  C   . SER A  1 707  ? -8.069  0.180   81.015  1.00 209.16 ? 707  SER A C   1 
ATOM   3869  O  O   . SER A  1 707  ? -8.255  1.325   80.597  1.00 272.86 ? 707  SER A O   1 
ATOM   3870  C  CB  . SER A  1 707  ? -9.143  -0.101  83.229  1.00 218.28 ? 707  SER A CB  1 
ATOM   3871  O  OG  . SER A  1 707  ? -7.860  -0.291  83.810  1.00 214.67 ? 707  SER A OG  1 
ATOM   3872  N  N   . VAL A  1 708  ? -6.920  -0.477  80.867  1.00 194.53 ? 708  VAL A N   1 
ATOM   3873  C  CA  . VAL A  1 708  ? -5.769  0.109   80.183  1.00 230.57 ? 708  VAL A CA  1 
ATOM   3874  C  C   . VAL A  1 708  ? -6.115  0.511   78.740  1.00 245.39 ? 708  VAL A C   1 
ATOM   3875  O  O   . VAL A  1 708  ? -5.767  1.609   78.293  1.00 277.97 ? 708  VAL A O   1 
ATOM   3876  C  CB  . VAL A  1 708  ? -4.538  -0.854  80.190  1.00 118.93 ? 708  VAL A CB  1 
ATOM   3877  C  CG1 . VAL A  1 708  ? -3.983  -1.013  81.604  1.00 181.80 ? 708  VAL A CG1 1 
ATOM   3878  C  CG2 . VAL A  1 708  ? -4.898  -2.214  79.594  1.00 181.40 ? 708  VAL A CG2 1 
ATOM   3879  N  N   . THR A  1 709  ? -6.807  -0.375  78.024  1.00 218.80 ? 709  THR A N   1 
ATOM   3880  C  CA  . THR A  1 709  ? -7.215  -0.111  76.642  1.00 185.02 ? 709  THR A CA  1 
ATOM   3881  C  C   . THR A  1 709  ? -8.502  0.735   76.566  1.00 148.81 ? 709  THR A C   1 
ATOM   3882  O  O   . THR A  1 709  ? -9.597  0.232   76.861  1.00 138.34 ? 709  THR A O   1 
ATOM   3883  C  CB  . THR A  1 709  ? -7.431  -1.438  75.855  1.00 244.54 ? 709  THR A CB  1 
ATOM   3884  O  OG1 . THR A  1 709  ? -8.500  -2.193  76.443  1.00 194.01 ? 709  THR A OG1 1 
ATOM   3885  C  CG2 . THR A  1 709  ? -6.161  -2.288  75.854  1.00 263.82 ? 709  THR A CG2 1 
ATOM   3886  N  N   . PRO A  1 710  ? -8.376  2.021   76.159  1.00 126.30 ? 710  PRO A N   1 
ATOM   3887  C  CA  . PRO A  1 710  ? -9.571  2.864   76.001  1.00 114.82 ? 710  PRO A CA  1 
ATOM   3888  C  C   . PRO A  1 710  ? -10.694 2.097   75.283  1.00 133.91 ? 710  PRO A C   1 
ATOM   3889  O  O   . PRO A  1 710  ? -10.433 1.165   74.514  1.00 139.41 ? 710  PRO A O   1 
ATOM   3890  C  CB  . PRO A  1 710  ? -9.069  4.028   75.143  1.00 176.47 ? 710  PRO A CB  1 
ATOM   3891  C  CG  . PRO A  1 710  ? -7.616  4.104   75.422  1.00 225.46 ? 710  PRO A CG  1 
ATOM   3892  C  CD  . PRO A  1 710  ? -7.161  2.694   75.663  1.00 232.29 ? 710  PRO A CD  1 
ATOM   3893  N  N   . ILE A  1 711  ? -11.939 2.460   75.552  1.00 89.43  ? 711  ILE A N   1 
ATOM   3894  C  CA  . ILE A  1 711  ? -13.044 1.834   74.846  1.00 140.05 ? 711  ILE A CA  1 
ATOM   3895  C  C   . ILE A  1 711  ? -13.263 2.585   73.538  1.00 181.27 ? 711  ILE A C   1 
ATOM   3896  O  O   . ILE A  1 711  ? -13.369 3.815   73.532  1.00 170.51 ? 711  ILE A O   1 
ATOM   3897  C  CB  . ILE A  1 711  ? -14.326 1.842   75.680  1.00 143.22 ? 711  ILE A CB  1 
ATOM   3898  C  CG1 . ILE A  1 711  ? -14.605 3.255   76.205  1.00 154.67 ? 711  ILE A CG1 1 
ATOM   3899  C  CG2 . ILE A  1 711  ? -14.200 0.847   76.823  1.00 153.67 ? 711  ILE A CG2 1 
ATOM   3900  C  CD1 . ILE A  1 711  ? -15.840 3.345   77.055  1.00 192.90 ? 711  ILE A CD1 1 
ATOM   3901  N  N   . THR A  1 712  ? -13.307 1.837   72.437  1.00 185.06 ? 712  THR A N   1 
ATOM   3902  C  CA  . THR A  1 712  ? -13.490 2.403   71.103  1.00 88.63  ? 712  THR A CA  1 
ATOM   3903  C  C   . THR A  1 712  ? -14.978 2.591   70.765  1.00 118.89 ? 712  THR A C   1 
ATOM   3904  O  O   . THR A  1 712  ? -15.848 1.840   71.233  1.00 112.97 ? 712  THR A O   1 
ATOM   3905  C  CB  . THR A  1 712  ? -12.866 1.487   70.042  1.00 165.17 ? 712  THR A CB  1 
ATOM   3906  O  OG1 . THR A  1 712  ? -13.537 0.220   70.045  1.00 252.36 ? 712  THR A OG1 1 
ATOM   3907  C  CG2 . THR A  1 712  ? -11.396 1.269   70.332  1.00 151.24 ? 712  THR A CG2 1 
ATOM   3908  N  N   . LEU A  1 713  ? -15.252 3.616   69.959  1.00 116.36 ? 713  LEU A N   1 
ATOM   3909  C  CA  . LEU A  1 713  ? -16.586 3.848   69.406  1.00 141.27 ? 713  LEU A CA  1 
ATOM   3910  C  C   . LEU A  1 713  ? -16.472 4.338   67.954  1.00 187.28 ? 713  LEU A C   1 
ATOM   3911  O  O   . LEU A  1 713  ? -16.066 5.482   67.695  1.00 183.79 ? 713  LEU A O   1 
ATOM   3912  C  CB  . LEU A  1 713  ? -17.372 4.867   70.245  1.00 82.95  ? 713  LEU A CB  1 
ATOM   3913  C  CG  . LEU A  1 713  ? -18.893 4.912   69.976  1.00 110.38 ? 713  LEU A CG  1 
ATOM   3914  C  CD1 . LEU A  1 713  ? -19.576 5.818   70.974  1.00 170.47 ? 713  LEU A CD1 1 
ATOM   3915  C  CD2 . LEU A  1 713  ? -19.239 5.377   68.567  1.00 130.08 ? 713  LEU A CD2 1 
ATOM   3916  N  N   . ARG A  1 714  ? -16.844 3.461   67.020  1.00 178.90 ? 714  ARG A N   1 
ATOM   3917  C  CA  . ARG A  1 714  ? -16.798 3.754   65.587  1.00 167.86 ? 714  ARG A CA  1 
ATOM   3918  C  C   . ARG A  1 714  ? -18.218 3.834   64.995  1.00 165.34 ? 714  ARG A C   1 
ATOM   3919  O  O   . ARG A  1 714  ? -19.164 3.241   65.530  1.00 151.87 ? 714  ARG A O   1 
ATOM   3920  C  CB  . ARG A  1 714  ? -15.982 2.673   64.857  1.00 108.55 ? 714  ARG A CB  1 
ATOM   3921  C  CG  . ARG A  1 714  ? -16.693 1.327   64.736  1.00 132.14 ? 714  ARG A CG  1 
ATOM   3922  C  CD  . ARG A  1 714  ? -17.556 1.227   63.480  1.00 112.23 ? 714  ARG A CD  1 
ATOM   3923  N  NE  . ARG A  1 714  ? -18.229 -0.065  63.367  1.00 125.77 ? 714  ARG A NE  1 
ATOM   3924  C  CZ  . ARG A  1 714  ? -17.599 -1.216  63.154  1.00 175.39 ? 714  ARG A CZ  1 
ATOM   3925  N  NH1 . ARG A  1 714  ? -16.271 -1.249  63.045  1.00 83.64  ? 714  ARG A NH1 1 
ATOM   3926  N  NH2 . ARG A  1 714  ? -18.296 -2.338  63.062  1.00 194.76 ? 714  ARG A NH2 1 
ATOM   3927  N  N   . LEU A  1 715  ? -18.365 4.561   63.889  1.00 146.51 ? 715  LEU A N   1 
ATOM   3928  C  CA  . LEU A  1 715  ? -19.649 4.623   63.202  1.00 168.28 ? 715  LEU A CA  1 
ATOM   3929  C  C   . LEU A  1 715  ? -19.538 4.147   61.760  1.00 203.04 ? 715  LEU A C   1 
ATOM   3930  O  O   . LEU A  1 715  ? -18.579 4.448   61.047  1.00 180.27 ? 715  LEU A O   1 
ATOM   3931  C  CB  . LEU A  1 715  ? -20.225 6.040   63.264  1.00 104.82 ? 715  LEU A CB  1 
ATOM   3932  C  CG  . LEU A  1 715  ? -19.379 7.187   62.696  1.00 96.31  ? 715  LEU A CG  1 
ATOM   3933  C  CD1 . LEU A  1 715  ? -19.425 7.235   61.192  1.00 190.84 ? 715  LEU A CD1 1 
ATOM   3934  C  CD2 . LEU A  1 715  ? -19.894 8.499   63.231  1.00 152.61 ? 715  LEU A CD2 1 
ATOM   3935  N  N   . ASN A  1 716  ? -20.517 3.356   61.351  1.00 206.70 ? 716  ASN A N   1 
ATOM   3936  C  CA  . ASN A  1 716  ? -20.717 3.059   59.948  1.00 180.75 ? 716  ASN A CA  1 
ATOM   3937  C  C   . ASN A  1 716  ? -21.851 3.961   59.492  1.00 203.44 ? 716  ASN A C   1 
ATOM   3938  O  O   . ASN A  1 716  ? -22.957 3.896   60.030  1.00 242.59 ? 716  ASN A O   1 
ATOM   3939  C  CB  . ASN A  1 716  ? -21.065 1.577   59.752  1.00 190.99 ? 716  ASN A CB  1 
ATOM   3940  C  CG  . ASN A  1 716  ? -21.745 1.291   58.418  1.00 196.41 ? 716  ASN A CG  1 
ATOM   3941  O  OD1 . ASN A  1 716  ? -22.501 2.110   57.914  1.00 243.06 ? 716  ASN A OD1 1 
ATOM   3942  N  ND2 . ASN A  1 716  ? -21.463 0.122   57.836  1.00 157.72 ? 716  ASN A ND2 1 
ATOM   3943  N  N   . PHE A  1 717  ? -21.567 4.831   58.529  1.00 180.35 ? 717  PHE A N   1 
ATOM   3944  C  CA  . PHE A  1 717  ? -22.579 5.749   58.016  1.00 176.73 ? 717  PHE A CA  1 
ATOM   3945  C  C   . PHE A  1 717  ? -22.616 5.717   56.492  1.00 192.20 ? 717  PHE A C   1 
ATOM   3946  O  O   . PHE A  1 717  ? -21.581 5.552   55.841  1.00 217.46 ? 717  PHE A O   1 
ATOM   3947  C  CB  . PHE A  1 717  ? -22.308 7.172   58.512  1.00 211.18 ? 717  PHE A CB  1 
ATOM   3948  C  CG  . PHE A  1 717  ? -21.231 7.906   57.737  1.00 191.45 ? 717  PHE A CG  1 
ATOM   3949  C  CD1 . PHE A  1 717  ? -19.884 7.733   58.034  1.00 224.19 ? 717  PHE A CD1 1 
ATOM   3950  C  CD2 . PHE A  1 717  ? -21.576 8.800   56.731  1.00 76.70  ? 717  PHE A CD2 1 
ATOM   3951  C  CE1 . PHE A  1 717  ? -18.906 8.422   57.328  1.00 219.44 ? 717  PHE A CE1 1 
ATOM   3952  C  CE2 . PHE A  1 717  ? -20.598 9.489   56.022  1.00 196.01 ? 717  PHE A CE2 1 
ATOM   3953  C  CZ  . PHE A  1 717  ? -19.265 9.299   56.321  1.00 220.55 ? 717  PHE A CZ  1 
ATOM   3954  N  N   . THR A  1 718  ? -23.815 5.859   55.929  1.00 189.82 ? 718  THR A N   1 
ATOM   3955  C  CA  . THR A  1 718  ? -23.989 5.872   54.476  1.00 250.14 ? 718  THR A CA  1 
ATOM   3956  C  C   . THR A  1 718  ? -25.072 6.885   54.075  1.00 278.32 ? 718  THR A C   1 
ATOM   3957  O  O   . THR A  1 718  ? -25.273 7.884   54.763  1.00 329.69 ? 718  THR A O   1 
ATOM   3958  C  CB  . THR A  1 718  ? -24.366 4.477   53.935  1.00 194.35 ? 718  THR A CB  1 
ATOM   3959  O  OG1 . THR A  1 718  ? -25.642 4.091   54.460  1.00 137.78 ? 718  THR A OG1 1 
ATOM   3960  C  CG2 . THR A  1 718  ? -23.315 3.431   54.316  1.00 137.79 ? 718  THR A CG2 1 
ATOM   3961  N  N   . LEU A  1 719  ? -25.763 6.629   52.966  1.00 186.43 ? 719  LEU A N   1 
ATOM   3962  C  CA  . LEU A  1 719  ? -26.811 7.528   52.487  1.00 135.87 ? 719  LEU A CA  1 
ATOM   3963  C  C   . LEU A  1 719  ? -28.078 6.753   52.185  1.00 163.37 ? 719  LEU A C   1 
ATOM   3964  O  O   . LEU A  1 719  ? -28.298 6.311   51.058  1.00 247.96 ? 719  LEU A O   1 
ATOM   3965  C  CB  . LEU A  1 719  ? -26.346 8.267   51.233  1.00 183.74 ? 719  LEU A CB  1 
ATOM   3966  C  CG  . LEU A  1 719  ? -25.407 9.454   51.470  1.00 160.89 ? 719  LEU A CG  1 
ATOM   3967  C  CD1 . LEU A  1 719  ? -24.558 9.766   50.248  1.00 124.93 ? 719  LEU A CD1 1 
ATOM   3968  C  CD2 . LEU A  1 719  ? -26.211 10.682  51.895  1.00 133.14 ? 719  LEU A CD2 1 
ATOM   3969  N  N   . VAL A  1 720  ? -28.915 6.597   53.200  1.00 159.98 ? 720  VAL A N   1 
ATOM   3970  C  CA  . VAL A  1 720  ? -30.102 5.770   53.077  1.00 227.02 ? 720  VAL A CA  1 
ATOM   3971  C  C   . VAL A  1 720  ? -31.234 6.523   52.417  1.00 205.97 ? 720  VAL A C   1 
ATOM   3972  O  O   . VAL A  1 720  ? -31.346 7.740   52.552  1.00 109.62 ? 720  VAL A O   1 
ATOM   3973  C  CB  . VAL A  1 720  ? -30.599 5.308   54.448  1.00 282.99 ? 720  VAL A CB  1 
ATOM   3974  C  CG1 . VAL A  1 720  ? -31.203 6.479   55.211  1.00 293.78 ? 720  VAL A CG1 1 
ATOM   3975  C  CG2 . VAL A  1 720  ? -31.615 4.193   54.286  1.00 312.69 ? 720  VAL A CG2 1 
ATOM   3976  N  N   . GLY A  1 721  ? -32.070 5.780   51.704  1.00 298.11 ? 721  GLY A N   1 
ATOM   3977  C  CA  . GLY A  1 721  ? -33.297 6.318   51.163  1.00 338.13 ? 721  GLY A CA  1 
ATOM   3978  C  C   . GLY A  1 721  ? -33.068 6.922   49.799  1.00 340.87 ? 721  GLY A C   1 
ATOM   3979  O  O   . GLY A  1 721  ? -33.492 6.373   48.784  1.00 377.17 ? 721  GLY A O   1 
ATOM   3980  N  N   . LYS A  1 722  ? -32.427 8.085   49.785  1.00 304.92 ? 722  LYS A N   1 
ATOM   3981  C  CA  . LYS A  1 722  ? -32.152 8.797   48.547  1.00 298.82 ? 722  LYS A CA  1 
ATOM   3982  C  C   . LYS A  1 722  ? -33.404 9.382   47.868  1.00 274.31 ? 722  LYS A C   1 
ATOM   3983  O  O   . LYS A  1 722  ? -33.397 9.606   46.661  1.00 280.34 ? 722  LYS A O   1 
ATOM   3984  C  CB  . LYS A  1 722  ? -31.399 7.878   47.583  1.00 309.83 ? 722  LYS A CB  1 
ATOM   3985  C  CG  . LYS A  1 722  ? -30.041 7.445   48.097  1.00 280.50 ? 722  LYS A CG  1 
ATOM   3986  C  CD  . LYS A  1 722  ? -29.291 6.657   47.046  1.00 265.14 ? 722  LYS A CD  1 
ATOM   3987  C  CE  . LYS A  1 722  ? -27.865 6.385   47.475  1.00 258.04 ? 722  LYS A CE  1 
ATOM   3988  N  NZ  . LYS A  1 722  ? -27.082 5.713   46.401  1.00 301.78 ? 722  LYS A NZ  1 
ATOM   3989  N  N   . PRO A  1 723  ? -34.494 9.596   48.629  1.00 235.77 ? 723  PRO A N   1 
ATOM   3990  C  CA  . PRO A  1 723  ? -35.580 10.449  48.133  1.00 187.48 ? 723  PRO A CA  1 
ATOM   3991  C  C   . PRO A  1 723  ? -35.425 11.895  48.598  1.00 248.60 ? 723  PRO A C   1 
ATOM   3992  O  O   . PRO A  1 723  ? -35.415 12.143  49.802  1.00 327.17 ? 723  PRO A O   1 
ATOM   3993  C  CB  . PRO A  1 723  ? -36.820 9.831   48.772  1.00 186.96 ? 723  PRO A CB  1 
ATOM   3994  C  CG  . PRO A  1 723  ? -36.327 9.221   50.017  1.00 235.15 ? 723  PRO A CG  1 
ATOM   3995  C  CD  . PRO A  1 723  ? -34.943 8.754   49.749  1.00 253.32 ? 723  PRO A CD  1 
ATOM   3996  N  N   . LEU A  1 724  ? -35.314 12.830  47.659  1.00 233.92 ? 724  LEU A N   1 
ATOM   3997  C  CA  . LEU A  1 724  ? -35.092 14.234  47.994  1.00 282.45 ? 724  LEU A CA  1 
ATOM   3998  C  C   . LEU A  1 724  ? -35.916 15.165  47.110  1.00 296.20 ? 724  LEU A C   1 
ATOM   3999  O  O   . LEU A  1 724  ? -35.495 15.520  46.011  1.00 317.63 ? 724  LEU A O   1 
ATOM   4000  C  CB  . LEU A  1 724  ? -33.608 14.583  47.853  1.00 290.66 ? 724  LEU A CB  1 
ATOM   4001  C  CG  . LEU A  1 724  ? -32.694 14.094  48.977  1.00 313.85 ? 724  LEU A CG  1 
ATOM   4002  C  CD1 . LEU A  1 724  ? -31.239 14.401  48.653  1.00 247.99 ? 724  LEU A CD1 1 
ATOM   4003  C  CD2 . LEU A  1 724  ? -33.097 14.720  50.307  1.00 360.86 ? 724  LEU A CD2 1 
ATOM   4004  N  N   . LEU A  1 725  ? -37.085 15.567  47.603  1.00 281.16 ? 725  LEU A N   1 
ATOM   4005  C  CA  . LEU A  1 725  ? -37.959 16.478  46.870  1.00 289.68 ? 725  LEU A CA  1 
ATOM   4006  C  C   . LEU A  1 725  ? -38.352 15.875  45.521  1.00 347.43 ? 725  LEU A C   1 
ATOM   4007  O  O   . LEU A  1 725  ? -39.183 14.968  45.460  1.00 372.12 ? 725  LEU A O   1 
ATOM   4008  C  CB  . LEU A  1 725  ? -37.272 17.836  46.681  1.00 265.29 ? 725  LEU A CB  1 
ATOM   4009  C  CG  . LEU A  1 725  ? -38.118 18.942  46.043  1.00 246.68 ? 725  LEU A CG  1 
ATOM   4010  C  CD1 . LEU A  1 725  ? -39.381 19.184  46.854  1.00 170.80 ? 725  LEU A CD1 1 
ATOM   4011  C  CD2 . LEU A  1 725  ? -37.317 20.227  45.905  1.00 216.89 ? 725  LEU A CD2 1 
ATOM   4012  N  N   . ALA A  1 726  ? -37.761 16.381  44.444  1.00 354.51 ? 726  ALA A N   1 
ATOM   4013  C  CA  . ALA A  1 726  ? -38.004 15.841  43.112  1.00 304.58 ? 726  ALA A CA  1 
ATOM   4014  C  C   . ALA A  1 726  ? -36.997 14.739  42.810  1.00 373.94 ? 726  ALA A C   1 
ATOM   4015  O  O   . ALA A  1 726  ? -36.067 14.513  43.582  1.00 433.81 ? 726  ALA A O   1 
ATOM   4016  C  CB  . ALA A  1 726  ? -37.896 16.940  42.079  1.00 213.86 ? 726  ALA A CB  1 
ATOM   4017  N  N   . PHE A  1 727  ? -37.178 14.059  41.683  1.00 345.47 ? 727  PHE A N   1 
ATOM   4018  C  CA  . PHE A  1 727  ? -36.237 13.030  41.261  1.00 294.68 ? 727  PHE A CA  1 
ATOM   4019  C  C   . PHE A  1 727  ? -35.145 13.645  40.400  1.00 267.01 ? 727  PHE A C   1 
ATOM   4020  O  O   . PHE A  1 727  ? -34.655 13.020  39.465  1.00 176.21 ? 727  PHE A O   1 
ATOM   4021  C  CB  . PHE A  1 727  ? -36.960 11.932  40.487  1.00 263.15 ? 727  PHE A CB  1 
ATOM   4022  C  CG  . PHE A  1 727  ? -38.064 11.281  41.260  1.00 266.95 ? 727  PHE A CG  1 
ATOM   4023  C  CD1 . PHE A  1 727  ? -37.845 10.100  41.945  1.00 231.47 ? 727  PHE A CD1 1 
ATOM   4024  C  CD2 . PHE A  1 727  ? -39.321 11.856  41.310  1.00 301.07 ? 727  PHE A CD2 1 
ATOM   4025  C  CE1 . PHE A  1 727  ? -38.860 9.501   42.660  1.00 218.42 ? 727  PHE A CE1 1 
ATOM   4026  C  CE2 . PHE A  1 727  ? -40.339 11.262  42.023  1.00 304.52 ? 727  PHE A CE2 1 
ATOM   4027  C  CZ  . PHE A  1 727  ? -40.108 10.082  42.699  1.00 259.42 ? 727  PHE A CZ  1 
ATOM   4028  N  N   . ARG A  1 728  ? -34.765 14.873  40.731  1.00 327.93 ? 728  ARG A N   1 
ATOM   4029  C  CA  . ARG A  1 728  ? -33.764 15.594  39.964  1.00 290.12 ? 728  ARG A CA  1 
ATOM   4030  C  C   . ARG A  1 728  ? -32.379 15.360  40.544  1.00 257.60 ? 728  ARG A C   1 
ATOM   4031  O  O   . ARG A  1 728  ? -31.395 15.897  40.047  1.00 181.96 ? 728  ARG A O   1 
ATOM   4032  C  CB  . ARG A  1 728  ? -34.101 17.082  39.934  1.00 288.93 ? 728  ARG A CB  1 
ATOM   4033  C  CG  . ARG A  1 728  ? -35.443 17.348  39.299  1.00 282.51 ? 728  ARG A CG  1 
ATOM   4034  C  CD  . ARG A  1 728  ? -35.757 18.818  39.207  1.00 284.86 ? 728  ARG A CD  1 
ATOM   4035  N  NE  . ARG A  1 728  ? -37.022 19.028  38.512  1.00 309.10 ? 728  ARG A NE  1 
ATOM   4036  C  CZ  . ARG A  1 728  ? -37.168 18.971  37.193  1.00 291.49 ? 728  ARG A CZ  1 
ATOM   4037  N  NH1 . ARG A  1 728  ? -36.125 18.714  36.419  1.00 277.85 ? 728  ARG A NH1 1 
ATOM   4038  N  NH2 . ARG A  1 728  ? -38.360 19.172  36.648  1.00 284.17 ? 728  ARG A NH2 1 
ATOM   4039  N  N   . ASN A  1 729  ? -32.314 14.560  41.603  1.00 326.06 ? 729  ASN A N   1 
ATOM   4040  C  CA  . ASN A  1 729  ? -31.042 14.113  42.162  1.00 346.92 ? 729  ASN A CA  1 
ATOM   4041  C  C   . ASN A  1 729  ? -30.895 12.605  41.972  1.00 289.20 ? 729  ASN A C   1 
ATOM   4042  O  O   . ASN A  1 729  ? -29.808 12.101  41.695  1.00 185.12 ? 729  ASN A O   1 
ATOM   4043  C  CB  . ASN A  1 729  ? -30.934 14.478  43.652  1.00 367.13 ? 729  ASN A CB  1 
ATOM   4044  C  CG  . ASN A  1 729  ? -31.805 13.606  44.538  1.00 352.86 ? 729  ASN A CG  1 
ATOM   4045  O  OD1 . ASN A  1 729  ? -32.979 13.385  44.247  1.00 377.39 ? 729  ASN A OD1 1 
ATOM   4046  N  ND2 . ASN A  1 729  ? -31.234 13.115  45.636  1.00 307.07 ? 729  ASN A ND2 1 
ATOM   4047  N  N   . LEU A  1 730  ? -32.011 11.895  42.100  1.00 309.33 ? 730  LEU A N   1 
ATOM   4048  C  CA  . LEU A  1 730  ? -32.016 10.437  42.058  1.00 305.50 ? 730  LEU A CA  1 
ATOM   4049  C  C   . LEU A  1 730  ? -31.029 9.832   43.061  1.00 367.37 ? 730  LEU A C   1 
ATOM   4050  O  O   . LEU A  1 730  ? -31.361 9.689   44.237  1.00 443.28 ? 730  LEU A O   1 
ATOM   4051  C  CB  . LEU A  1 730  ? -31.748 9.937   40.642  1.00 248.08 ? 730  LEU A CB  1 
ATOM   4052  C  CG  . LEU A  1 730  ? -32.932 10.120  39.691  1.00 250.18 ? 730  LEU A CG  1 
ATOM   4053  C  CD1 . LEU A  1 730  ? -32.622 9.495   38.346  1.00 281.11 ? 730  LEU A CD1 1 
ATOM   4054  C  CD2 . LEU A  1 730  ? -34.211 9.529   40.273  1.00 180.53 ? 730  LEU A CD2 1 
ATOM   4055  N  N   . ARG A  1 731  ? -29.825 9.477   42.617  1.00 320.58 ? 731  ARG A N   1 
ATOM   4056  C  CA  . ARG A  1 731  ? -28.863 8.854   43.527  1.00 294.79 ? 731  ARG A CA  1 
ATOM   4057  C  C   . ARG A  1 731  ? -27.592 9.678   43.742  1.00 270.32 ? 731  ARG A C   1 
ATOM   4058  O  O   . ARG A  1 731  ? -26.763 9.813   42.839  1.00 236.77 ? 731  ARG A O   1 
ATOM   4059  C  CB  . ARG A  1 731  ? -28.499 7.434   43.070  1.00 275.29 ? 731  ARG A CB  1 
ATOM   4060  C  CG  . ARG A  1 731  ? -27.304 7.327   42.133  1.00 197.95 ? 731  ARG A CG  1 
ATOM   4061  C  CD  . ARG A  1 731  ? -26.572 6.032   42.348  1.00 171.32 ? 731  ARG A CD  1 
ATOM   4062  N  NE  . ARG A  1 731  ? -25.223 6.083   41.811  1.00 138.74 ? 731  ARG A NE  1 
ATOM   4063  C  CZ  . ARG A  1 731  ? -24.319 5.126   41.983  1.00 224.30 ? 731  ARG A CZ  1 
ATOM   4064  N  NH1 . ARG A  1 731  ? -24.611 4.047   42.697  1.00 275.94 ? 731  ARG A NH1 1 
ATOM   4065  N  NH2 . ARG A  1 731  ? -23.117 5.252   41.443  1.00 260.06 ? 731  ARG A NH2 1 
ATOM   4066  N  N   . PRO A  1 732  ? -27.455 10.263  44.942  1.00 246.27 ? 732  PRO A N   1 
ATOM   4067  C  CA  . PRO A  1 732  ? -26.141 10.756  45.373  1.00 200.17 ? 732  PRO A CA  1 
ATOM   4068  C  C   . PRO A  1 732  ? -25.255 9.590   45.844  1.00 185.34 ? 732  PRO A C   1 
ATOM   4069  O  O   . PRO A  1 732  ? -25.741 8.460   45.933  1.00 179.38 ? 732  PRO A O   1 
ATOM   4070  C  CB  . PRO A  1 732  ? -26.488 11.723  46.521  1.00 113.27 ? 732  PRO A CB  1 
ATOM   4071  C  CG  . PRO A  1 732  ? -27.945 12.069  46.323  1.00 132.47 ? 732  PRO A CG  1 
ATOM   4072  C  CD  . PRO A  1 732  ? -28.547 10.820  45.762  1.00 181.93 ? 732  PRO A CD  1 
ATOM   4073  N  N   . MET A  1 733  ? -23.977 9.853   46.111  1.00 136.40 ? 733  MET A N   1 
ATOM   4074  C  CA  . MET A  1 733  ? -23.069 8.824   46.622  1.00 148.44 ? 733  MET A CA  1 
ATOM   4075  C  C   . MET A  1 733  ? -21.787 9.422   47.202  1.00 157.91 ? 733  MET A C   1 
ATOM   4076  O  O   . MET A  1 733  ? -21.583 10.635  47.183  1.00 159.91 ? 733  MET A O   1 
ATOM   4077  C  CB  . MET A  1 733  ? -22.695 7.865   45.518  1.00 201.10 ? 733  MET A CB  1 
ATOM   4078  C  CG  . MET A  1 733  ? -22.004 8.568   44.396  1.00 260.56 ? 733  MET A CG  1 
ATOM   4079  S  SD  . MET A  1 733  ? -21.579 7.447   43.062  1.00 560.77 ? 733  MET A SD  1 
ATOM   4080  C  CE  . MET A  1 733  ? -20.345 6.439   43.880  1.00 360.12 ? 733  MET A CE  1 
ATOM   4081  N  N   . LEU A  1 734  ? -20.917 8.559   47.714  1.00 139.11 ? 734  LEU A N   1 
ATOM   4082  C  CA  . LEU A  1 734  ? -19.720 9.022   48.401  1.00 184.65 ? 734  LEU A CA  1 
ATOM   4083  C  C   . LEU A  1 734  ? -18.543 8.870   47.470  1.00 147.98 ? 734  LEU A C   1 
ATOM   4084  O  O   . LEU A  1 734  ? -18.665 8.263   46.407  1.00 203.06 ? 734  LEU A O   1 
ATOM   4085  C  CB  . LEU A  1 734  ? -19.493 8.239   49.702  1.00 250.62 ? 734  LEU A CB  1 
ATOM   4086  C  CG  . LEU A  1 734  ? -20.574 8.415   50.779  1.00 207.67 ? 734  LEU A CG  1 
ATOM   4087  C  CD1 . LEU A  1 734  ? -20.358 7.449   51.946  1.00 214.93 ? 734  LEU A CD1 1 
ATOM   4088  C  CD2 . LEU A  1 734  ? -20.624 9.863   51.268  1.00 125.28 ? 734  LEU A CD2 1 
ATOM   4089  N  N   . ALA A  1 735  ? -17.407 9.433   47.867  1.00 115.99 ? 735  ALA A N   1 
ATOM   4090  C  CA  . ALA A  1 735  ? -16.214 9.399   47.030  1.00 218.82 ? 735  ALA A CA  1 
ATOM   4091  C  C   . ALA A  1 735  ? -15.403 8.111   47.221  1.00 203.51 ? 735  ALA A C   1 
ATOM   4092  O  O   . ALA A  1 735  ? -15.855 7.173   47.885  1.00 129.48 ? 735  ALA A O   1 
ATOM   4093  C  CB  . ALA A  1 735  ? -15.352 10.617  47.306  1.00 239.05 ? 735  ALA A CB  1 
ATOM   4094  N  N   . ALA A  1 736  ? -14.214 8.069   46.620  1.00 204.97 ? 736  ALA A N   1 
ATOM   4095  C  CA  . ALA A  1 736  ? -13.335 6.906   46.715  1.00 181.51 ? 736  ALA A CA  1 
ATOM   4096  C  C   . ALA A  1 736  ? -12.733 6.811   48.103  1.00 185.76 ? 736  ALA A C   1 
ATOM   4097  O  O   . ALA A  1 736  ? -12.804 5.767   48.748  1.00 239.53 ? 736  ALA A O   1 
ATOM   4098  C  CB  . ALA A  1 736  ? -12.235 6.986   45.676  1.00 252.32 ? 736  ALA A CB  1 
ATOM   4099  N  N   . ASP A  1 737  ? -12.129 7.907   48.551  1.00 212.73 ? 737  ASP A N   1 
ATOM   4100  C  CA  . ASP A  1 737  ? -11.590 7.988   49.904  1.00 272.42 ? 737  ASP A CA  1 
ATOM   4101  C  C   . ASP A  1 737  ? -12.687 8.273   50.932  1.00 249.40 ? 737  ASP A C   1 
ATOM   4102  O  O   . ASP A  1 737  ? -12.769 9.375   51.478  1.00 248.26 ? 737  ASP A O   1 
ATOM   4103  C  CB  . ASP A  1 737  ? -10.515 9.073   49.983  1.00 306.32 ? 737  ASP A CB  1 
ATOM   4104  C  CG  . ASP A  1 737  ? -9.198  8.628   49.395  1.00 316.01 ? 737  ASP A CG  1 
ATOM   4105  O  OD1 . ASP A  1 737  ? -9.079  7.439   49.032  1.00 350.00 ? 737  ASP A OD1 1 
ATOM   4106  O  OD2 . ASP A  1 737  ? -8.281  9.468   49.300  1.00 277.27 ? 737  ASP A OD2 1 
ATOM   4107  N  N   . ALA A  1 738  ? -13.521 7.268   51.191  1.00 224.80 ? 738  ALA A N   1 
ATOM   4108  C  CA  . ALA A  1 738  ? -14.598 7.378   52.169  1.00 204.01 ? 738  ALA A CA  1 
ATOM   4109  C  C   . ALA A  1 738  ? -14.225 6.597   53.408  1.00 228.41 ? 738  ALA A C   1 
ATOM   4110  O  O   . ALA A  1 738  ? -14.383 5.378   53.455  1.00 312.25 ? 738  ALA A O   1 
ATOM   4111  C  CB  . ALA A  1 738  ? -15.886 6.839   51.594  1.00 246.67 ? 738  ALA A CB  1 
ATOM   4112  N  N   . GLN A  1 739  ? -13.716 7.300   54.409  1.00 168.07 ? 739  GLN A N   1 
ATOM   4113  C  CA  . GLN A  1 739  ? -13.334 6.660   55.653  1.00 240.69 ? 739  GLN A CA  1 
ATOM   4114  C  C   . GLN A  1 739  ? -14.584 6.492   56.495  1.00 287.92 ? 739  GLN A C   1 
ATOM   4115  O  O   . GLN A  1 739  ? -14.636 6.957   57.633  1.00 379.10 ? 739  GLN A O   1 
ATOM   4116  C  CB  . GLN A  1 739  ? -12.306 7.510   56.400  1.00 271.75 ? 739  GLN A CB  1 
ATOM   4117  C  CG  . GLN A  1 739  ? -11.139 7.959   55.546  1.00 310.18 ? 739  GLN A CG  1 
ATOM   4118  C  CD  . GLN A  1 739  ? -10.166 6.839   55.266  1.00 319.17 ? 739  GLN A CD  1 
ATOM   4119  O  OE1 . GLN A  1 739  ? -10.021 5.916   56.067  1.00 333.89 ? 739  GLN A OE1 1 
ATOM   4120  N  NE2 . GLN A  1 739  ? -9.489  6.915   54.128  1.00 288.15 ? 739  GLN A NE2 1 
ATOM   4121  N  N   . ARG A  1 740  ? -15.593 5.831   55.931  1.00 207.95 ? 740  ARG A N   1 
ATOM   4122  C  CA  . ARG A  1 740  ? -16.892 5.697   56.592  1.00 228.18 ? 740  ARG A CA  1 
ATOM   4123  C  C   . ARG A  1 740  ? -16.787 5.115   58.001  1.00 227.55 ? 740  ARG A C   1 
ATOM   4124  O  O   . ARG A  1 740  ? -17.718 5.229   58.801  1.00 243.15 ? 740  ARG A O   1 
ATOM   4125  C  CB  . ARG A  1 740  ? -17.826 4.832   55.755  1.00 209.07 ? 740  ARG A CB  1 
ATOM   4126  C  CG  . ARG A  1 740  ? -18.321 5.508   54.494  1.00 201.44 ? 740  ARG A CG  1 
ATOM   4127  C  CD  . ARG A  1 740  ? -19.228 4.587   53.701  1.00 182.26 ? 740  ARG A CD  1 
ATOM   4128  N  NE  . ARG A  1 740  ? -18.523 3.392   53.253  1.00 219.04 ? 740  ARG A NE  1 
ATOM   4129  C  CZ  . ARG A  1 740  ? -19.102 2.374   52.627  1.00 287.02 ? 740  ARG A CZ  1 
ATOM   4130  N  NH1 . ARG A  1 740  ? -20.403 2.397   52.368  1.00 307.80 ? 740  ARG A NH1 1 
ATOM   4131  N  NH2 . ARG A  1 740  ? -18.377 1.328   52.260  1.00 316.12 ? 740  ARG A NH2 1 
ATOM   4132  N  N   . TYR A  1 741  ? -15.655 4.483   58.295  1.00 179.60 ? 741  TYR A N   1 
ATOM   4133  C  CA  . TYR A  1 741  ? -15.372 3.997   59.641  1.00 147.25 ? 741  TYR A CA  1 
ATOM   4134  C  C   . TYR A  1 741  ? -14.487 4.974   60.446  1.00 191.95 ? 741  TYR A C   1 
ATOM   4135  O  O   . TYR A  1 741  ? -13.250 4.934   60.363  1.00 214.07 ? 741  TYR A O   1 
ATOM   4136  C  CB  . TYR A  1 741  ? -14.713 2.626   59.558  1.00 166.71 ? 741  TYR A CB  1 
ATOM   4137  C  CG  . TYR A  1 741  ? -15.649 1.545   59.063  1.00 179.81 ? 741  TYR A CG  1 
ATOM   4138  C  CD1 . TYR A  1 741  ? -16.864 1.305   59.697  1.00 210.43 ? 741  TYR A CD1 1 
ATOM   4139  C  CD2 . TYR A  1 741  ? -15.311 0.760   57.973  1.00 137.64 ? 741  TYR A CD2 1 
ATOM   4140  C  CE1 . TYR A  1 741  ? -17.727 0.304   59.252  1.00 163.94 ? 741  TYR A CE1 1 
ATOM   4141  C  CE2 . TYR A  1 741  ? -16.149 -0.234  57.520  1.00 204.01 ? 741  TYR A CE2 1 
ATOM   4142  C  CZ  . TYR A  1 741  ? -17.351 -0.461  58.150  1.00 175.52 ? 741  TYR A CZ  1 
ATOM   4143  O  OH  . TYR A  1 741  ? -18.048 -1.500  57.571  1.00 161.65 ? 741  TYR A OH  1 
ATOM   4144  N  N   . PHE A  1 742  ? -15.135 5.847   61.221  1.00 117.00 ? 742  PHE A N   1 
ATOM   4145  C  CA  . PHE A  1 742  ? -14.436 6.804   62.082  1.00 152.87 ? 742  PHE A CA  1 
ATOM   4146  C  C   . PHE A  1 742  ? -14.571 6.441   63.566  1.00 175.77 ? 742  PHE A C   1 
ATOM   4147  O  O   . PHE A  1 742  ? -15.683 6.326   64.097  1.00 136.14 ? 742  PHE A O   1 
ATOM   4148  C  CB  . PHE A  1 742  ? -14.983 8.213   61.857  1.00 176.67 ? 742  PHE A CB  1 
ATOM   4149  C  CG  . PHE A  1 742  ? -14.625 8.790   60.531  1.00 212.22 ? 742  PHE A CG  1 
ATOM   4150  C  CD1 . PHE A  1 742  ? -13.297 9.003   60.185  1.00 222.92 ? 742  PHE A CD1 1 
ATOM   4151  C  CD2 . PHE A  1 742  ? -15.616 9.127   59.632  1.00 66.47  ? 742  PHE A CD2 1 
ATOM   4152  C  CE1 . PHE A  1 742  ? -12.964 9.531   58.961  1.00 122.41 ? 742  PHE A CE1 1 
ATOM   4153  C  CE2 . PHE A  1 742  ? -15.292 9.662   58.403  1.00 284.24 ? 742  PHE A CE2 1 
ATOM   4154  C  CZ  . PHE A  1 742  ? -13.963 9.866   58.067  1.00 235.70 ? 742  PHE A CZ  1 
ATOM   4155  N  N   . THR A  1 743  ? -13.432 6.292   64.238  1.00 194.33 ? 743  THR A N   1 
ATOM   4156  C  CA  . THR A  1 743  ? -13.422 5.836   65.621  1.00 156.21 ? 743  THR A CA  1 
ATOM   4157  C  C   . THR A  1 743  ? -12.814 6.883   66.545  1.00 194.24 ? 743  THR A C   1 
ATOM   4158  O  O   . THR A  1 743  ? -11.847 7.563   66.194  1.00 238.79 ? 743  THR A O   1 
ATOM   4159  C  CB  . THR A  1 743  ? -12.637 4.509   65.773  1.00 138.89 ? 743  THR A CB  1 
ATOM   4160  O  OG1 . THR A  1 743  ? -13.115 3.550   64.821  1.00 186.36 ? 743  THR A OG1 1 
ATOM   4161  C  CG2 . THR A  1 743  ? -12.804 3.948   67.173  1.00 211.90 ? 743  THR A CG2 1 
ATOM   4162  N  N   . ALA A  1 744  ? -13.403 7.007   67.729  1.00 168.63 ? 744  ALA A N   1 
ATOM   4163  C  CA  . ALA A  1 744  ? -12.855 7.856   68.776  1.00 206.78 ? 744  ALA A CA  1 
ATOM   4164  C  C   . ALA A  1 744  ? -12.691 7.034   70.063  1.00 186.14 ? 744  ALA A C   1 
ATOM   4165  O  O   . ALA A  1 744  ? -13.506 6.142   70.351  1.00 110.83 ? 744  ALA A O   1 
ATOM   4166  C  CB  . ALA A  1 744  ? -13.751 9.060   69.001  1.00 242.05 ? 744  ALA A CB  1 
ATOM   4167  N  N   . SER A  1 745  ? -11.629 7.338   70.817  1.00 205.80 ? 745  SER A N   1 
ATOM   4168  C  CA  . SER A  1 745  ? -11.257 6.573   72.013  1.00 130.63 ? 745  SER A CA  1 
ATOM   4169  C  C   . SER A  1 745  ? -11.672 7.289   73.321  1.00 182.44 ? 745  SER A C   1 
ATOM   4170  O  O   . SER A  1 745  ? -11.707 8.531   73.389  1.00 183.46 ? 745  SER A O   1 
ATOM   4171  C  CB  . SER A  1 745  ? -9.745  6.299   72.015  1.00 149.44 ? 745  SER A CB  1 
ATOM   4172  O  OG  . SER A  1 745  ? -9.004  7.509   72.013  1.00 213.56 ? 745  SER A OG  1 
ATOM   4173  N  N   . LEU A  1 746  ? -11.992 6.487   74.345  1.00 179.07 ? 746  LEU A N   1 
ATOM   4174  C  CA  . LEU A  1 746  ? -12.286 6.981   75.692  1.00 148.05 ? 746  LEU A CA  1 
ATOM   4175  C  C   . LEU A  1 746  ? -11.298 6.310   76.664  1.00 143.00 ? 746  LEU A C   1 
ATOM   4176  O  O   . LEU A  1 746  ? -11.388 5.095   76.891  1.00 114.09 ? 746  LEU A O   1 
ATOM   4177  C  CB  . LEU A  1 746  ? -13.733 6.662   76.074  1.00 76.05  ? 746  LEU A CB  1 
ATOM   4178  C  CG  . LEU A  1 746  ? -14.308 7.556   77.177  1.00 157.31 ? 746  LEU A CG  1 
ATOM   4179  C  CD1 . LEU A  1 746  ? -15.721 7.104   77.515  1.00 124.71 ? 746  LEU A CD1 1 
ATOM   4180  C  CD2 . LEU A  1 746  ? -13.428 7.551   78.418  1.00 141.08 ? 746  LEU A CD2 1 
ATOM   4181  N  N   . PRO A  1 747  ? -10.330 7.093   77.206  1.00 140.12 ? 747  PRO A N   1 
ATOM   4182  C  CA  . PRO A  1 747  ? -9.297  6.568   78.114  1.00 105.02 ? 747  PRO A CA  1 
ATOM   4183  C  C   . PRO A  1 747  ? -9.833  6.342   79.539  1.00 201.25 ? 747  PRO A C   1 
ATOM   4184  O  O   . PRO A  1 747  ? -10.982 6.697   79.827  1.00 209.55 ? 747  PRO A O   1 
ATOM   4185  C  CB  . PRO A  1 747  ? -8.246  7.690   78.147  1.00 154.89 ? 747  PRO A CB  1 
ATOM   4186  C  CG  . PRO A  1 747  ? -8.621  8.652   77.071  1.00 168.82 ? 747  PRO A CG  1 
ATOM   4187  C  CD  . PRO A  1 747  ? -10.098 8.518   76.905  1.00 184.83 ? 747  PRO A CD  1 
ATOM   4188  N  N   . PHE A  1 748  ? -9.005  5.780   80.421  1.00 163.77 ? 748  PHE A N   1 
ATOM   4189  C  CA  . PHE A  1 748  ? -9.381  5.589   81.826  1.00 152.01 ? 748  PHE A CA  1 
ATOM   4190  C  C   . PHE A  1 748  ? -8.383  6.288   82.736  1.00 196.87 ? 748  PHE A C   1 
ATOM   4191  O  O   . PHE A  1 748  ? -7.240  6.535   82.341  1.00 233.78 ? 748  PHE A O   1 
ATOM   4192  C  CB  . PHE A  1 748  ? -9.406  4.098   82.177  1.00 165.27 ? 748  PHE A CB  1 
ATOM   4193  C  CG  . PHE A  1 748  ? -10.346 3.300   81.339  1.00 166.23 ? 748  PHE A CG  1 
ATOM   4194  C  CD1 . PHE A  1 748  ? -10.195 3.241   79.964  1.00 228.86 ? 748  PHE A CD1 1 
ATOM   4195  C  CD2 . PHE A  1 748  ? -11.388 2.609   81.922  1.00 131.94 ? 748  PHE A CD2 1 
ATOM   4196  C  CE1 . PHE A  1 748  ? -11.072 2.505   79.188  1.00 266.59 ? 748  PHE A CE1 1 
ATOM   4197  C  CE2 . PHE A  1 748  ? -12.266 1.869   81.149  1.00 80.16  ? 748  PHE A CE2 1 
ATOM   4198  C  CZ  . PHE A  1 748  ? -12.107 1.817   79.783  1.00 191.32 ? 748  PHE A CZ  1 
ATOM   4199  N  N   . GLU A  1 749  ? -8.807  6.595   83.959  1.00 132.91 ? 749  GLU A N   1 
ATOM   4200  C  CA  . GLU A  1 749  ? -7.869  7.073   84.971  1.00 188.00 ? 749  GLU A CA  1 
ATOM   4201  C  C   . GLU A  1 749  ? -7.048  5.893   85.502  1.00 225.27 ? 749  GLU A C   1 
ATOM   4202  O  O   . GLU A  1 749  ? -7.422  5.258   86.490  1.00 289.08 ? 749  GLU A O   1 
ATOM   4203  C  CB  . GLU A  1 749  ? -8.618  7.758   86.113  1.00 173.22 ? 749  GLU A CB  1 
ATOM   4204  C  CG  . GLU A  1 749  ? -7.720  8.298   87.207  1.00 204.00 ? 749  GLU A CG  1 
ATOM   4205  C  CD  . GLU A  1 749  ? -8.510  8.838   88.377  1.00 231.33 ? 749  GLU A CD  1 
ATOM   4206  O  OE1 . GLU A  1 749  ? -9.650  9.304   88.160  1.00 205.59 ? 749  GLU A OE1 1 
ATOM   4207  O  OE2 . GLU A  1 749  ? -7.991  8.797   89.511  1.00 259.89 ? 749  GLU A OE2 1 
ATOM   4208  N  N   . LYS A  1 750  ? -5.936  5.598   84.834  1.00 120.84 ? 750  LYS A N   1 
ATOM   4209  C  CA  . LYS A  1 750  ? -5.124  4.447   85.184  1.00 178.01 ? 750  LYS A CA  1 
ATOM   4210  C  C   . LYS A  1 750  ? -4.702  4.476   86.644  1.00 228.82 ? 750  LYS A C   1 
ATOM   4211  O  O   . LYS A  1 750  ? -4.214  5.491   87.136  1.00 191.78 ? 750  LYS A O   1 
ATOM   4212  C  CB  . LYS A  1 750  ? -3.880  4.390   84.300  1.00 223.70 ? 750  LYS A CB  1 
ATOM   4213  C  CG  . LYS A  1 750  ? -2.929  3.266   84.674  1.00 309.77 ? 750  LYS A CG  1 
ATOM   4214  C  CD  . LYS A  1 750  ? -3.648  1.927   84.748  1.00 278.42 ? 750  LYS A CD  1 
ATOM   4215  C  CE  . LYS A  1 750  ? -2.709  0.815   85.170  1.00 175.23 ? 750  LYS A CE  1 
ATOM   4216  N  NZ  . LYS A  1 750  ? -3.416  -0.477  85.274  1.00 126.21 ? 750  LYS A NZ  1 
ATOM   4217  N  N   . ASN A  1 751  ? -4.886  3.352   87.328  1.00 261.32 ? 751  ASN A N   1 
ATOM   4218  C  CA  . ASN A  1 751  ? -4.379  3.192   88.682  1.00 234.71 ? 751  ASN A CA  1 
ATOM   4219  C  C   . ASN A  1 751  ? -2.854  3.258   88.740  1.00 186.09 ? 751  ASN A C   1 
ATOM   4220  O  O   . ASN A  1 751  ? -2.180  2.277   88.442  1.00 194.50 ? 751  ASN A O   1 
ATOM   4221  C  CB  . ASN A  1 751  ? -4.839  1.854   89.247  1.00 252.39 ? 751  ASN A CB  1 
ATOM   4222  C  CG  . ASN A  1 751  ? -6.339  1.752   89.348  1.00 304.47 ? 751  ASN A CG  1 
ATOM   4223  O  OD1 . ASN A  1 751  ? -7.073  2.583   88.814  1.00 327.21 ? 751  ASN A OD1 1 
ATOM   4224  N  ND2 . ASN A  1 751  ? -6.807  0.726   90.041  1.00 331.17 ? 751  ASN A ND2 1 
ATOM   4225  N  N   . CYS A  1 752  ? -2.322  4.412   89.133  1.00 157.28 ? 752  CYS A N   1 
ATOM   4226  C  CA  . CYS A  1 752  ? -0.882  4.570   89.334  1.00 179.35 ? 752  CYS A CA  1 
ATOM   4227  C  C   . CYS A  1 752  ? -0.483  4.254   90.787  1.00 219.47 ? 752  CYS A C   1 
ATOM   4228  O  O   . CYS A  1 752  ? 0.542   4.734   91.282  1.00 130.95 ? 752  CYS A O   1 
ATOM   4229  C  CB  . CYS A  1 752  ? -0.450  5.995   88.989  1.00 124.10 ? 752  CYS A CB  1 
ATOM   4230  S  SG  . CYS A  1 752  ? -0.877  7.190   90.257  1.00 350.67 ? 752  CYS A SG  1 
ATOM   4231  N  N   . GLY A  1 753  ? -1.297  3.449   91.466  1.00 275.52 ? 753  GLY A N   1 
ATOM   4232  C  CA  . GLY A  1 753  ? -1.017  3.067   92.841  1.00 267.27 ? 753  GLY A CA  1 
ATOM   4233  C  C   . GLY A  1 753  ? -2.146  3.400   93.798  1.00 251.43 ? 753  GLY A C   1 
ATOM   4234  O  O   . GLY A  1 753  ? -3.109  4.063   93.418  1.00 297.76 ? 753  GLY A O   1 
ATOM   4235  N  N   . ALA A  1 754  ? -2.030  2.943   95.043  1.00 160.75 ? 754  ALA A N   1 
ATOM   4236  C  CA  . ALA A  1 754  ? -3.016  3.273   96.074  1.00 198.21 ? 754  ALA A CA  1 
ATOM   4237  C  C   . ALA A  1 754  ? -2.910  4.737   96.481  1.00 189.20 ? 754  ALA A C   1 
ATOM   4238  O  O   . ALA A  1 754  ? -3.649  5.223   97.346  1.00 64.92  ? 754  ALA A O   1 
ATOM   4239  C  CB  . ALA A  1 754  ? -2.826  2.396   97.272  1.00 196.00 ? 754  ALA A CB  1 
ATOM   4240  N  N   . ASP A  1 755  ? -1.979  5.440   95.852  1.00 267.50 ? 755  ASP A N   1 
ATOM   4241  C  CA  . ASP A  1 755  ? -1.797  6.857   96.106  1.00 260.75 ? 755  ASP A CA  1 
ATOM   4242  C  C   . ASP A  1 755  ? -0.889  7.428   95.002  1.00 269.43 ? 755  ASP A C   1 
ATOM   4243  O  O   . ASP A  1 755  ? -0.883  6.919   93.875  1.00 194.94 ? 755  ASP A O   1 
ATOM   4244  C  CB  . ASP A  1 755  ? -1.221  7.053   97.523  1.00 69.40  ? 755  ASP A CB  1 
ATOM   4245  C  CG  . ASP A  1 755  ? -0.060  6.098   97.824  1.00 148.32 ? 755  ASP A CG  1 
ATOM   4246  O  OD1 . ASP A  1 755  ? 0.350   5.329   96.924  1.00 184.26 ? 755  ASP A OD1 1 
ATOM   4247  O  OD2 . ASP A  1 755  ? 0.443   6.111   98.966  1.00 104.95 ? 755  ASP A OD2 1 
ATOM   4248  N  N   . HIS A  1 756  ? -0.173  8.506   95.309  1.00 260.36 ? 756  HIS A N   1 
ATOM   4249  C  CA  . HIS A  1 756  ? 0.933   8.979   94.478  1.00 211.62 ? 756  HIS A CA  1 
ATOM   4250  C  C   . HIS A  1 756  ? 0.452   9.858   93.343  1.00 198.29 ? 756  HIS A C   1 
ATOM   4251  O  O   . HIS A  1 756  ? 1.258   10.472  92.656  1.00 216.61 ? 756  HIS A O   1 
ATOM   4252  C  CB  . HIS A  1 756  ? 1.767   7.813   93.952  1.00 216.31 ? 756  HIS A CB  1 
ATOM   4253  C  CG  . HIS A  1 756  ? 2.786   8.212   92.932  1.00 249.10 ? 756  HIS A CG  1 
ATOM   4254  N  ND1 . HIS A  1 756  ? 3.937   8.897   93.257  1.00 270.12 ? 756  HIS A ND1 1 
ATOM   4255  C  CD2 . HIS A  1 756  ? 2.827   8.018   91.594  1.00 263.89 ? 756  HIS A CD2 1 
ATOM   4256  C  CE1 . HIS A  1 756  ? 4.644   9.108   92.160  1.00 293.86 ? 756  HIS A CE1 1 
ATOM   4257  N  NE2 . HIS A  1 756  ? 3.993   8.585   91.138  1.00 284.65 ? 756  HIS A NE2 1 
ATOM   4258  N  N   . ILE A  1 757  ? -0.856  9.863   93.123  1.00 180.86 ? 757  ILE A N   1 
ATOM   4259  C  CA  . ILE A  1 757  ? -1.533  10.979  92.478  1.00 217.77 ? 757  ILE A CA  1 
ATOM   4260  C  C   . ILE A  1 757  ? -1.384  11.018  90.936  1.00 285.73 ? 757  ILE A C   1 
ATOM   4261  O  O   . ILE A  1 757  ? -2.161  11.692  90.267  1.00 282.43 ? 757  ILE A O   1 
ATOM   4262  C  CB  . ILE A  1 757  ? -1.100  12.314  93.148  1.00 161.17 ? 757  ILE A CB  1 
ATOM   4263  C  CG1 . ILE A  1 757  ? -2.217  13.352  93.069  1.00 210.91 ? 757  ILE A CG1 1 
ATOM   4264  C  CG2 . ILE A  1 757  ? 0.170   12.877  92.519  1.00 207.19 ? 757  ILE A CG2 1 
ATOM   4265  C  CD1 . ILE A  1 757  ? -3.539  12.891  93.640  1.00 155.24 ? 757  ILE A CD1 1 
ATOM   4266  N  N   . CYS A  1 758  ? -0.405  10.298  90.384  1.00 288.42 ? 758  CYS A N   1 
ATOM   4267  C  CA  . CYS A  1 758  ? -0.312  10.076  88.933  1.00 211.52 ? 758  CYS A CA  1 
ATOM   4268  C  C   . CYS A  1 758  ? 0.097   11.334  88.169  1.00 192.26 ? 758  CYS A C   1 
ATOM   4269  O  O   . CYS A  1 758  ? -0.709  11.909  87.446  1.00 143.93 ? 758  CYS A O   1 
ATOM   4270  C  CB  . CYS A  1 758  ? -1.658  9.594   88.371  1.00 149.61 ? 758  CYS A CB  1 
ATOM   4271  S  SG  . CYS A  1 758  ? -2.203  7.972   88.958  1.00 182.52 ? 758  CYS A SG  1 
ATOM   4272  N  N   . GLN A  1 759  ? 1.343   11.760  88.323  1.00 178.13 ? 759  GLN A N   1 
ATOM   4273  C  CA  . GLN A  1 759  ? 1.784   12.982  87.674  1.00 167.94 ? 759  GLN A CA  1 
ATOM   4274  C  C   . GLN A  1 759  ? 2.161   12.750  86.214  1.00 233.75 ? 759  GLN A C   1 
ATOM   4275  O  O   . GLN A  1 759  ? 3.000   11.908  85.908  1.00 278.88 ? 759  GLN A O   1 
ATOM   4276  C  CB  . GLN A  1 759  ? 2.964   13.575  88.431  1.00 231.54 ? 759  GLN A CB  1 
ATOM   4277  C  CG  . GLN A  1 759  ? 2.583   14.110  89.791  1.00 250.97 ? 759  GLN A CG  1 
ATOM   4278  C  CD  . GLN A  1 759  ? 1.856   15.430  89.697  1.00 231.38 ? 759  GLN A CD  1 
ATOM   4279  O  OE1 . GLN A  1 759  ? 1.803   16.040  88.630  1.00 97.19  ? 759  GLN A OE1 1 
ATOM   4280  N  NE2 . GLN A  1 759  ? 1.291   15.883  90.817  1.00 286.00 ? 759  GLN A NE2 1 
ATOM   4281  N  N   . ASP A  1 760  ? 1.523   13.496  85.315  1.00 233.09 ? 760  ASP A N   1 
ATOM   4282  C  CA  . ASP A  1 760  ? 1.829   13.406  83.887  1.00 163.19 ? 760  ASP A CA  1 
ATOM   4283  C  C   . ASP A  1 760  ? 2.938   14.376  83.503  1.00 154.75 ? 760  ASP A C   1 
ATOM   4284  O  O   . ASP A  1 760  ? 2.712   15.583  83.346  1.00 121.10 ? 760  ASP A O   1 
ATOM   4285  C  CB  . ASP A  1 760  ? 0.582   13.691  83.053  1.00 139.48 ? 760  ASP A CB  1 
ATOM   4286  C  CG  . ASP A  1 760  ? -0.310  12.473  82.902  1.00 190.64 ? 760  ASP A CG  1 
ATOM   4287  O  OD1 . ASP A  1 760  ? 0.228   11.338  82.907  1.00 175.15 ? 760  ASP A OD1 1 
ATOM   4288  O  OD2 . ASP A  1 760  ? -1.543  12.655  82.773  1.00 210.47 ? 760  ASP A OD2 1 
ATOM   4289  N  N   . ASN A  1 761  ? 4.145   13.841  83.370  1.00 127.63 ? 761  ASN A N   1 
ATOM   4290  C  CA  . ASN A  1 761  ? 5.297   14.656  83.024  1.00 139.43 ? 761  ASN A CA  1 
ATOM   4291  C  C   . ASN A  1 761  ? 6.050   14.037  81.876  1.00 175.70 ? 761  ASN A C   1 
ATOM   4292  O  O   . ASN A  1 761  ? 6.773   13.052  82.062  1.00 129.14 ? 761  ASN A O   1 
ATOM   4293  C  CB  . ASN A  1 761  ? 6.265   14.805  84.195  1.00 186.17 ? 761  ASN A CB  1 
ATOM   4294  C  CG  . ASN A  1 761  ? 7.394   15.772  83.888  1.00 149.83 ? 761  ASN A CG  1 
ATOM   4295  O  OD1 . ASN A  1 761  ? 7.195   16.771  83.193  1.00 131.30 ? 761  ASN A OD1 1 
ATOM   4296  N  ND2 . ASN A  1 761  ? 8.582   15.491  84.416  1.00 173.41 ? 761  ASN A ND2 1 
ATOM   4297  N  N   . LEU A  1 762  ? 5.881   14.635  80.697  1.00 206.21 ? 762  LEU A N   1 
ATOM   4298  C  CA  . LEU A  1 762  ? 6.598   14.224  79.492  1.00 155.82 ? 762  LEU A CA  1 
ATOM   4299  C  C   . LEU A  1 762  ? 7.146   15.458  78.765  1.00 148.34 ? 762  LEU A C   1 
ATOM   4300  O  O   . LEU A  1 762  ? 6.452   16.474  78.639  1.00 209.53 ? 762  LEU A O   1 
ATOM   4301  C  CB  . LEU A  1 762  ? 5.670   13.432  78.561  1.00 54.53  ? 762  LEU A CB  1 
ATOM   4302  C  CG  . LEU A  1 762  ? 4.823   12.322  79.179  1.00 203.42 ? 762  LEU A CG  1 
ATOM   4303  C  CD1 . LEU A  1 762  ? 3.808   11.815  78.166  1.00 142.46 ? 762  LEU A CD1 1 
ATOM   4304  C  CD2 . LEU A  1 762  ? 5.716   11.204  79.665  1.00 181.25 ? 762  LEU A CD2 1 
ATOM   4305  N  N   . GLY A  1 763  ? 8.396   15.364  78.308  1.00 51.85  ? 763  GLY A N   1 
ATOM   4306  C  CA  . GLY A  1 763  ? 8.985   16.402  77.467  1.00 242.11 ? 763  GLY A CA  1 
ATOM   4307  C  C   . GLY A  1 763  ? 9.251   15.955  76.029  1.00 200.82 ? 763  GLY A C   1 
ATOM   4308  O  O   . GLY A  1 763  ? 9.107   14.769  75.686  1.00 95.93  ? 763  GLY A O   1 
ATOM   4309  N  N   . ILE A  1 764  ? 9.655   16.899  75.180  1.00 172.43 ? 764  ILE A N   1 
ATOM   4310  C  CA  . ILE A  1 764  ? 9.916   16.577  73.780  1.00 172.68 ? 764  ILE A CA  1 
ATOM   4311  C  C   . ILE A  1 764  ? 10.843  17.576  73.105  1.00 158.10 ? 764  ILE A C   1 
ATOM   4312  O  O   . ILE A  1 764  ? 10.799  18.777  73.386  1.00 120.43 ? 764  ILE A O   1 
ATOM   4313  C  CB  . ILE A  1 764  ? 8.613   16.492  72.959  1.00 145.22 ? 764  ILE A CB  1 
ATOM   4314  C  CG1 . ILE A  1 764  ? 8.934   16.181  71.488  1.00 58.14  ? 764  ILE A CG1 1 
ATOM   4315  C  CG2 . ILE A  1 764  ? 7.822   17.791  73.103  1.00 165.10 ? 764  ILE A CG2 1 
ATOM   4316  C  CD1 . ILE A  1 764  ? 7.724   15.848  70.665  1.00 141.76 ? 764  ILE A CD1 1 
ATOM   4317  N  N   . SER A  1 765  ? 11.665  17.039  72.201  1.00 164.43 ? 765  SER A N   1 
ATOM   4318  C  CA  . SER A  1 765  ? 12.646  17.801  71.428  1.00 94.97  ? 765  SER A CA  1 
ATOM   4319  C  C   . SER A  1 765  ? 13.038  16.999  70.169  1.00 140.45 ? 765  SER A C   1 
ATOM   4320  O  O   . SER A  1 765  ? 13.309  15.797  70.268  1.00 209.71 ? 765  SER A O   1 
ATOM   4321  C  CB  . SER A  1 765  ? 13.899  18.069  72.273  1.00 133.55 ? 765  SER A CB  1 
ATOM   4322  O  OG  . SER A  1 765  ? 14.862  18.806  71.538  1.00 254.99 ? 765  SER A OG  1 
ATOM   4323  N  N   . PHE A  1 766  ? 13.076  17.668  69.005  1.00 183.64 ? 766  PHE A N   1 
ATOM   4324  C  CA  . PHE A  1 766  ? 13.433  17.045  67.704  1.00 162.75 ? 766  PHE A CA  1 
ATOM   4325  C  C   . PHE A  1 766  ? 14.367  17.960  66.894  1.00 144.06 ? 766  PHE A C   1 
ATOM   4326  O  O   . PHE A  1 766  ? 14.480  19.163  67.159  1.00 174.73 ? 766  PHE A O   1 
ATOM   4327  C  CB  . PHE A  1 766  ? 12.181  16.750  66.852  1.00 84.62  ? 766  PHE A CB  1 
ATOM   4328  C  CG  . PHE A  1 766  ? 11.410  17.988  66.506  1.00 143.76 ? 766  PHE A CG  1 
ATOM   4329  C  CD1 . PHE A  1 766  ? 11.916  18.894  65.578  1.00 121.62 ? 766  PHE A CD1 1 
ATOM   4330  C  CD2 . PHE A  1 766  ? 10.219  18.294  67.161  1.00 183.33 ? 766  PHE A CD2 1 
ATOM   4331  C  CE1 . PHE A  1 766  ? 11.226  20.068  65.275  1.00 96.42  ? 766  PHE A CE1 1 
ATOM   4332  C  CE2 . PHE A  1 766  ? 9.519   19.464  66.862  1.00 137.37 ? 766  PHE A CE2 1 
ATOM   4333  C  CZ  . PHE A  1 766  ? 10.026  20.353  65.918  1.00 95.69  ? 766  PHE A CZ  1 
ATOM   4334  N  N   . SER A  1 767  ? 15.014  17.374  65.891  1.00 113.57 ? 767  SER A N   1 
ATOM   4335  C  CA  . SER A  1 767  ? 15.982  18.086  65.063  1.00 171.30 ? 767  SER A CA  1 
ATOM   4336  C  C   . SER A  1 767  ? 16.000  17.512  63.653  1.00 177.90 ? 767  SER A C   1 
ATOM   4337  O  O   . SER A  1 767  ? 15.297  16.541  63.346  1.00 124.09 ? 767  SER A O   1 
ATOM   4338  C  CB  . SER A  1 767  ? 17.392  17.990  65.652  1.00 189.45 ? 767  SER A CB  1 
ATOM   4339  O  OG  . SER A  1 767  ? 17.873  16.658  65.605  1.00 175.60 ? 767  SER A OG  1 
ATOM   4340  N  N   . PHE A  1 768  ? 16.832  18.113  62.809  1.00 166.11 ? 768  PHE A N   1 
ATOM   4341  C  CA  . PHE A  1 768  ? 16.927  17.737  61.408  1.00 87.25  ? 768  PHE A CA  1 
ATOM   4342  C  C   . PHE A  1 768  ? 18.382  17.450  61.064  1.00 150.00 ? 768  PHE A C   1 
ATOM   4343  O  O   . PHE A  1 768  ? 19.153  18.365  60.763  1.00 213.73 ? 768  PHE A O   1 
ATOM   4344  C  CB  . PHE A  1 768  ? 16.379  18.859  60.532  1.00 83.93  ? 768  PHE A CB  1 
ATOM   4345  C  CG  . PHE A  1 768  ? 14.889  19.009  60.610  1.00 125.93 ? 768  PHE A CG  1 
ATOM   4346  C  CD1 . PHE A  1 768  ? 14.048  17.983  60.180  1.00 92.94  ? 768  PHE A CD1 1 
ATOM   4347  C  CD2 . PHE A  1 768  ? 14.325  20.178  61.111  1.00 162.73 ? 768  PHE A CD2 1 
ATOM   4348  C  CE1 . PHE A  1 768  ? 12.671  18.127  60.254  1.00 151.17 ? 768  PHE A CE1 1 
ATOM   4349  C  CE2 . PHE A  1 768  ? 12.941  20.331  61.183  1.00 92.09  ? 768  PHE A CE2 1 
ATOM   4350  C  CZ  . PHE A  1 768  ? 12.112  19.310  60.759  1.00 51.44  ? 768  PHE A CZ  1 
ATOM   4351  N  N   . PRO A  1 769  ? 18.763  16.167  61.122  1.00 136.91 ? 769  PRO A N   1 
ATOM   4352  C  CA  . PRO A  1 769  ? 20.144  15.725  60.896  1.00 157.17 ? 769  PRO A CA  1 
ATOM   4353  C  C   . PRO A  1 769  ? 20.670  16.028  59.493  1.00 202.01 ? 769  PRO A C   1 
ATOM   4354  O  O   . PRO A  1 769  ? 20.223  15.415  58.524  1.00 265.32 ? 769  PRO A O   1 
ATOM   4355  C  CB  . PRO A  1 769  ? 20.062  14.213  61.112  1.00 222.54 ? 769  PRO A CB  1 
ATOM   4356  C  CG  . PRO A  1 769  ? 18.847  14.013  61.970  1.00 231.66 ? 769  PRO A CG  1 
ATOM   4357  C  CD  . PRO A  1 769  ? 17.882  15.062  61.542  1.00 133.65 ? 769  PRO A CD  1 
ATOM   4358  N  N   . GLY A  1 770  ? 21.601  16.972  59.391  1.00 156.16 ? 770  GLY A N   1 
ATOM   4359  C  CA  . GLY A  1 770  ? 22.271  17.241  58.134  1.00 169.65 ? 770  GLY A CA  1 
ATOM   4360  C  C   . GLY A  1 770  ? 21.507  18.164  57.204  1.00 165.24 ? 770  GLY A C   1 
ATOM   4361  O  O   . GLY A  1 770  ? 22.019  18.563  56.162  1.00 195.63 ? 770  GLY A O   1 
ATOM   4362  N  N   . LEU A  1 771  ? 20.283  18.511  57.579  1.00 171.44 ? 771  LEU A N   1 
ATOM   4363  C  CA  . LEU A  1 771  ? 19.428  19.322  56.721  1.00 150.96 ? 771  LEU A CA  1 
ATOM   4364  C  C   . LEU A  1 771  ? 20.088  20.666  56.394  1.00 104.85 ? 771  LEU A C   1 
ATOM   4365  O  O   . LEU A  1 771  ? 20.261  21.523  57.263  1.00 109.80 ? 771  LEU A O   1 
ATOM   4366  C  CB  . LEU A  1 771  ? 18.071  19.537  57.392  1.00 185.56 ? 771  LEU A CB  1 
ATOM   4367  C  CG  . LEU A  1 771  ? 17.099  20.498  56.706  1.00 89.16  ? 771  LEU A CG  1 
ATOM   4368  C  CD1 . LEU A  1 771  ? 16.590  19.913  55.406  1.00 108.60 ? 771  LEU A CD1 1 
ATOM   4369  C  CD2 . LEU A  1 771  ? 15.932  20.811  57.633  1.00 259.06 ? 771  LEU A CD2 1 
ATOM   4370  N  N   . LYS A  1 772  ? 20.451  20.846  55.131  1.00 196.23 ? 772  LYS A N   1 
ATOM   4371  C  CA  . LYS A  1 772  ? 21.159  22.048  54.715  1.00 211.68 ? 772  LYS A CA  1 
ATOM   4372  C  C   . LYS A  1 772  ? 20.346  22.909  53.768  1.00 228.16 ? 772  LYS A C   1 
ATOM   4373  O  O   . LYS A  1 772  ? 20.284  22.643  52.572  1.00 329.02 ? 772  LYS A O   1 
ATOM   4374  C  CB  . LYS A  1 772  ? 22.478  21.678  54.042  1.00 263.29 ? 772  LYS A CB  1 
ATOM   4375  C  CG  . LYS A  1 772  ? 22.318  20.846  52.773  1.00 327.06 ? 772  LYS A CG  1 
ATOM   4376  C  CD  . LYS A  1 772  ? 23.660  20.489  52.173  1.00 313.31 ? 772  LYS A CD  1 
ATOM   4377  C  CE  . LYS A  1 772  ? 23.508  19.940  50.762  1.00 290.79 ? 772  LYS A CE  1 
ATOM   4378  N  NZ  . LYS A  1 772  ? 24.827  19.716  50.117  1.00 274.55 ? 772  LYS A NZ  1 
ATOM   4379  N  N   . SER A  1 773  ? 19.690  23.918  54.322  1.00 134.58 ? 773  SER A N   1 
ATOM   4380  C  CA  . SER A  1 773  ? 19.129  25.003  53.525  1.00 138.77 ? 773  SER A CA  1 
ATOM   4381  C  C   . SER A  1 773  ? 17.682  24.706  53.090  1.00 157.58 ? 773  SER A C   1 
ATOM   4382  O  O   . SER A  1 773  ? 16.830  25.601  53.143  1.00 131.36 ? 773  SER A O   1 
ATOM   4383  C  CB  . SER A  1 773  ? 20.052  25.304  52.336  1.00 188.11 ? 773  SER A CB  1 
ATOM   4384  O  OG  . SER A  1 773  ? 19.657  26.466  51.630  1.00 275.69 ? 773  SER A OG  1 
ATOM   4385  N  N   . LEU A  1 774  ? 17.396  23.463  52.689  1.00 105.70 ? 774  LEU A N   1 
ATOM   4386  C  CA  . LEU A  1 774  ? 16.020  23.060  52.381  1.00 157.17 ? 774  LEU A CA  1 
ATOM   4387  C  C   . LEU A  1 774  ? 15.347  23.975  51.327  1.00 191.75 ? 774  LEU A C   1 
ATOM   4388  O  O   . LEU A  1 774  ? 14.623  24.922  51.686  1.00 162.91 ? 774  LEU A O   1 
ATOM   4389  C  CB  . LEU A  1 774  ? 15.200  23.061  53.680  1.00 189.12 ? 774  LEU A CB  1 
ATOM   4390  C  CG  . LEU A  1 774  ? 13.669  23.007  53.598  1.00 86.60  ? 774  LEU A CG  1 
ATOM   4391  C  CD1 . LEU A  1 774  ? 13.235  21.904  52.634  1.00 208.21 ? 774  LEU A CD1 1 
ATOM   4392  C  CD2 . LEU A  1 774  ? 13.059  22.791  54.973  1.00 182.91 ? 774  LEU A CD2 1 
ATOM   4393  N  N   . LEU A  1 775  ? 15.600  23.696  50.042  1.00 202.44 ? 775  LEU A N   1 
ATOM   4394  C  CA  . LEU A  1 775  ? 14.928  24.384  48.930  1.00 129.13 ? 775  LEU A CA  1 
ATOM   4395  C  C   . LEU A  1 775  ? 13.861  23.470  48.311  1.00 116.30 ? 775  LEU A C   1 
ATOM   4396  O  O   . LEU A  1 775  ? 14.011  22.241  48.288  1.00 124.92 ? 775  LEU A O   1 
ATOM   4397  C  CB  . LEU A  1 775  ? 15.947  24.811  47.871  1.00 120.38 ? 775  LEU A CB  1 
ATOM   4398  C  CG  . LEU A  1 775  ? 16.627  23.653  47.136  1.00 121.18 ? 775  LEU A CG  1 
ATOM   4399  C  CD1 . LEU A  1 775  ? 15.938  23.387  45.789  1.00 108.60 ? 775  LEU A CD1 1 
ATOM   4400  C  CD2 . LEU A  1 775  ? 18.101  23.966  46.946  1.00 121.52 ? 775  LEU A CD2 1 
ATOM   4401  N  N   . VAL A  1 776  ? 12.785  24.074  47.811  1.00 95.66  ? 776  VAL A N   1 
ATOM   4402  C  CA  . VAL A  1 776  ? 11.636  23.308  47.314  1.00 106.22 ? 776  VAL A CA  1 
ATOM   4403  C  C   . VAL A  1 776  ? 11.893  22.759  45.910  1.00 133.86 ? 776  VAL A C   1 
ATOM   4404  O  O   . VAL A  1 776  ? 11.914  23.508  44.932  1.00 164.85 ? 776  VAL A O   1 
ATOM   4405  C  CB  . VAL A  1 776  ? 10.345  24.165  47.281  1.00 102.05 ? 776  VAL A CB  1 
ATOM   4406  C  CG1 . VAL A  1 776  ? 9.152   23.298  46.920  1.00 122.45 ? 776  VAL A CG1 1 
ATOM   4407  C  CG2 . VAL A  1 776  ? 10.117  24.854  48.602  1.00 73.25  ? 776  VAL A CG2 1 
ATOM   4408  N  N   . GLY A  1 777  ? 12.053  21.443  45.814  1.00 117.10 ? 777  GLY A N   1 
ATOM   4409  C  CA  . GLY A  1 777  ? 12.514  20.827  44.585  1.00 121.03 ? 777  GLY A CA  1 
ATOM   4410  C  C   . GLY A  1 777  ? 13.509  19.732  44.901  1.00 193.90 ? 777  GLY A C   1 
ATOM   4411  O  O   . GLY A  1 777  ? 13.261  18.559  44.624  1.00 303.64 ? 777  GLY A O   1 
ATOM   4412  N  N   . SER A  1 778  ? 14.650  20.118  45.467  1.00 104.36 ? 778  SER A N   1 
ATOM   4413  C  CA  . SER A  1 778  ? 15.511  19.154  46.140  1.00 184.07 ? 778  SER A CA  1 
ATOM   4414  C  C   . SER A  1 778  ? 14.988  18.976  47.567  1.00 221.57 ? 778  SER A C   1 
ATOM   4415  O  O   . SER A  1 778  ? 14.117  19.736  48.031  1.00 149.70 ? 778  SER A O   1 
ATOM   4416  C  CB  . SER A  1 778  ? 16.972  19.619  46.164  1.00 134.04 ? 778  SER A CB  1 
ATOM   4417  O  OG  . SER A  1 778  ? 17.487  19.752  44.856  1.00 191.98 ? 778  SER A OG  1 
ATOM   4418  N  N   . ASN A  1 779  ? 15.520  17.982  48.272  1.00 228.29 ? 779  ASN A N   1 
ATOM   4419  C  CA  . ASN A  1 779  ? 15.095  17.750  49.636  1.00 161.78 ? 779  ASN A CA  1 
ATOM   4420  C  C   . ASN A  1 779  ? 13.578  17.566  49.660  1.00 159.19 ? 779  ASN A C   1 
ATOM   4421  O  O   . ASN A  1 779  ? 12.869  18.305  50.336  1.00 230.69 ? 779  ASN A O   1 
ATOM   4422  C  CB  . ASN A  1 779  ? 15.477  18.954  50.514  1.00 138.98 ? 779  ASN A CB  1 
ATOM   4423  C  CG  . ASN A  1 779  ? 16.895  19.460  50.256  1.00 193.83 ? 779  ASN A CG  1 
ATOM   4424  O  OD1 . ASN A  1 779  ? 17.172  20.656  50.410  1.00 110.28 ? 779  ASN A OD1 1 
ATOM   4425  N  ND2 . ASN A  1 779  ? 17.797  18.557  49.872  1.00 270.41 ? 779  ASN A ND2 1 
ATOM   4426  N  N   . LEU A  1 780  ? 13.073  16.600  48.902  1.00 103.14 ? 780  LEU A N   1 
ATOM   4427  C  CA  . LEU A  1 780  ? 11.640  16.325  48.900  1.00 147.93 ? 780  LEU A CA  1 
ATOM   4428  C  C   . LEU A  1 780  ? 11.199  15.689  50.223  1.00 208.14 ? 780  LEU A C   1 
ATOM   4429  O  O   . LEU A  1 780  ? 10.291  16.181  50.893  1.00 118.48 ? 780  LEU A O   1 
ATOM   4430  C  CB  . LEU A  1 780  ? 11.291  15.402  47.741  1.00 162.38 ? 780  LEU A CB  1 
ATOM   4431  C  CG  . LEU A  1 780  ? 9.800   15.150  47.520  1.00 228.02 ? 780  LEU A CG  1 
ATOM   4432  C  CD1 . LEU A  1 780  ? 9.560   14.723  46.086  1.00 267.28 ? 780  LEU A CD1 1 
ATOM   4433  C  CD2 . LEU A  1 780  ? 9.260   14.106  48.491  1.00 240.36 ? 780  LEU A CD2 1 
ATOM   4434  N  N   . GLU A  1 781  ? 11.835  14.581  50.590  1.00 250.00 ? 781  GLU A N   1 
ATOM   4435  C  CA  . GLU A  1 781  ? 11.579  13.952  51.880  1.00 168.28 ? 781  GLU A CA  1 
ATOM   4436  C  C   . GLU A  1 781  ? 12.276  14.766  52.966  1.00 189.11 ? 781  GLU A C   1 
ATOM   4437  O  O   . GLU A  1 781  ? 13.368  15.303  52.747  1.00 156.16 ? 781  GLU A O   1 
ATOM   4438  C  CB  . GLU A  1 781  ? 12.094  12.509  51.898  1.00 192.75 ? 781  GLU A CB  1 
ATOM   4439  C  CG  . GLU A  1 781  ? 13.619  12.384  51.879  1.00 246.26 ? 781  GLU A CG  1 
ATOM   4440  C  CD  . GLU A  1 781  ? 14.093  10.962  52.107  1.00 254.54 ? 781  GLU A CD  1 
ATOM   4441  O  OE1 . GLU A  1 781  ? 13.242  10.080  52.351  1.00 226.30 ? 781  GLU A OE1 1 
ATOM   4442  O  OE2 . GLU A  1 781  ? 15.319  10.726  52.046  1.00 276.81 ? 781  GLU A OE2 1 
ATOM   4443  N  N   . LEU A  1 782  ? 11.647  14.849  54.138  1.00 220.29 ? 782  LEU A N   1 
ATOM   4444  C  CA  . LEU A  1 782  ? 12.193  15.617  55.256  1.00 188.11 ? 782  LEU A CA  1 
ATOM   4445  C  C   . LEU A  1 782  ? 12.363  14.757  56.517  1.00 170.76 ? 782  LEU A C   1 
ATOM   4446  O  O   . LEU A  1 782  ? 11.375  14.414  57.190  1.00 48.71  ? 782  LEU A O   1 
ATOM   4447  C  CB  . LEU A  1 782  ? 11.295  16.812  55.548  1.00 96.99  ? 782  LEU A CB  1 
ATOM   4448  C  CG  . LEU A  1 782  ? 11.973  17.904  56.369  1.00 130.10 ? 782  LEU A CG  1 
ATOM   4449  C  CD1 . LEU A  1 782  ? 13.386  18.289  55.859  1.00 106.55 ? 782  LEU A CD1 1 
ATOM   4450  C  CD2 . LEU A  1 782  ? 11.031  19.107  56.400  1.00 112.36 ? 782  LEU A CD2 1 
ATOM   4451  N  N   . ASN A  1 783  ? 13.626  14.412  56.808  1.00 175.66 ? 783  ASN A N   1 
ATOM   4452  C  CA  . ASN A  1 783  ? 13.984  13.526  57.918  1.00 128.46 ? 783  ASN A CA  1 
ATOM   4453  C  C   . ASN A  1 783  ? 14.055  14.286  59.252  1.00 144.64 ? 783  ASN A C   1 
ATOM   4454  O  O   . ASN A  1 783  ? 14.914  15.160  59.452  1.00 117.03 ? 783  ASN A O   1 
ATOM   4455  C  CB  . ASN A  1 783  ? 15.324  12.804  57.660  1.00 184.11 ? 783  ASN A CB  1 
ATOM   4456  C  CG  . ASN A  1 783  ? 15.329  11.990  56.376  1.00 225.65 ? 783  ASN A CG  1 
ATOM   4457  O  OD1 . ASN A  1 783  ? 14.294  11.499  55.935  1.00 154.84 ? 783  ASN A OD1 1 
ATOM   4458  N  ND2 . ASN A  1 783  ? 16.508  11.818  55.789  1.00 291.23 ? 783  ASN A ND2 1 
ATOM   4459  N  N   . ALA A  1 784  ? 13.141  13.921  60.155  1.00 151.48 ? 784  ALA A N   1 
ATOM   4460  C  CA  . ALA A  1 784  ? 13.059  14.495  61.493  1.00 114.99 ? 784  ALA A CA  1 
ATOM   4461  C  C   . ALA A  1 784  ? 13.399  13.430  62.543  1.00 142.02 ? 784  ALA A C   1 
ATOM   4462  O  O   . ALA A  1 784  ? 12.814  12.325  62.561  1.00 96.45  ? 784  ALA A O   1 
ATOM   4463  C  CB  . ALA A  1 784  ? 11.674  15.058  61.738  1.00 131.57 ? 784  ALA A CB  1 
ATOM   4464  N  N   . GLU A  1 785  ? 14.368  13.780  63.393  1.00 152.83 ? 785  GLU A N   1 
ATOM   4465  C  CA  . GLU A  1 785  ? 14.833  12.924  64.479  1.00 138.19 ? 785  GLU A CA  1 
ATOM   4466  C  C   . GLU A  1 785  ? 14.297  13.451  65.793  1.00 86.30  ? 785  GLU A C   1 
ATOM   4467  O  O   . GLU A  1 785  ? 14.869  14.366  66.384  1.00 144.37 ? 785  GLU A O   1 
ATOM   4468  C  CB  . GLU A  1 785  ? 16.365  12.893  64.518  1.00 170.03 ? 785  GLU A CB  1 
ATOM   4469  C  CG  . GLU A  1 785  ? 16.943  12.011  65.610  1.00 104.35 ? 785  GLU A CG  1 
ATOM   4470  C  CD  . GLU A  1 785  ? 18.460  11.981  65.580  1.00 218.27 ? 785  GLU A CD  1 
ATOM   4471  O  OE1 . GLU A  1 785  ? 19.054  12.697  64.747  1.00 305.37 ? 785  GLU A OE1 1 
ATOM   4472  O  OE2 . GLU A  1 785  ? 19.062  11.243  66.387  1.00 248.92 ? 785  GLU A OE2 1 
ATOM   4473  N  N   . VAL A  1 786  ? 13.190  12.862  66.235  1.00 110.50 ? 786  VAL A N   1 
ATOM   4474  C  CA  . VAL A  1 786  ? 12.516  13.302  67.449  1.00 176.84 ? 786  VAL A CA  1 
ATOM   4475  C  C   . VAL A  1 786  ? 12.849  12.382  68.629  1.00 172.74 ? 786  VAL A C   1 
ATOM   4476  O  O   . VAL A  1 786  ? 12.668  11.145  68.553  1.00 79.59  ? 786  VAL A O   1 
ATOM   4477  C  CB  . VAL A  1 786  ? 10.975  13.386  67.265  1.00 107.92 ? 786  VAL A CB  1 
ATOM   4478  C  CG1 . VAL A  1 786  ? 10.392  12.007  66.898  1.00 58.76  ? 786  VAL A CG1 1 
ATOM   4479  C  CG2 . VAL A  1 786  ? 10.310  13.938  68.524  1.00 126.74 ? 786  VAL A CG2 1 
ATOM   4480  N  N   . MET A  1 787  ? 13.368  13.016  69.689  1.00 201.51 ? 787  MET A N   1 
ATOM   4481  C  CA  . MET A  1 787  ? 13.568  12.411  71.007  1.00 158.16 ? 787  MET A CA  1 
ATOM   4482  C  C   . MET A  1 787  ? 12.489  12.902  71.970  1.00 125.72 ? 787  MET A C   1 
ATOM   4483  O  O   . MET A  1 787  ? 11.881  13.963  71.771  1.00 110.08 ? 787  MET A O   1 
ATOM   4484  C  CB  . MET A  1 787  ? 14.948  12.771  71.575  1.00 145.87 ? 787  MET A CB  1 
ATOM   4485  C  CG  . MET A  1 787  ? 15.324  11.997  72.836  1.00 88.17  ? 787  MET A CG  1 
ATOM   4486  S  SD  . MET A  1 787  ? 17.001  12.367  73.396  1.00 274.01 ? 787  MET A SD  1 
ATOM   4487  C  CE  . MET A  1 787  ? 16.919  14.136  73.661  1.00 128.66 ? 787  MET A CE  1 
ATOM   4488  N  N   . VAL A  1 788  ? 12.265  12.123  73.023  1.00 148.24 ? 788  VAL A N   1 
ATOM   4489  C  CA  . VAL A  1 788  ? 11.166  12.379  73.948  1.00 163.20 ? 788  VAL A CA  1 
ATOM   4490  C  C   . VAL A  1 788  ? 11.455  11.792  75.342  1.00 143.92 ? 788  VAL A C   1 
ATOM   4491  O  O   . VAL A  1 788  ? 12.133  10.759  75.494  1.00 97.17  ? 788  VAL A O   1 
ATOM   4492  C  CB  . VAL A  1 788  ? 9.811   11.815  73.395  1.00 140.38 ? 788  VAL A CB  1 
ATOM   4493  C  CG1 . VAL A  1 788  ? 9.747   10.263  73.562  1.00 68.46  ? 788  VAL A CG1 1 
ATOM   4494  C  CG2 . VAL A  1 788  ? 8.609   12.531  74.048  1.00 105.19 ? 788  VAL A CG2 1 
ATOM   4495  N  N   . TRP A  1 789  ? 10.915  12.463  76.355  1.00 158.46 ? 789  TRP A N   1 
ATOM   4496  C  CA  . TRP A  1 789  ? 11.163  12.115  77.747  1.00 98.81  ? 789  TRP A CA  1 
ATOM   4497  C  C   . TRP A  1 789  ? 9.901   11.586  78.461  1.00 140.57 ? 789  TRP A C   1 
ATOM   4498  O  O   . TRP A  1 789  ? 8.772   11.687  77.948  1.00 87.90  ? 789  TRP A O   1 
ATOM   4499  C  CB  . TRP A  1 789  ? 11.704  13.351  78.496  1.00 64.93  ? 789  TRP A CB  1 
ATOM   4500  C  CG  . TRP A  1 789  ? 12.993  13.866  77.972  1.00 128.25 ? 789  TRP A CG  1 
ATOM   4501  C  CD1 . TRP A  1 789  ? 14.235  13.327  78.154  1.00 221.78 ? 789  TRP A CD1 1 
ATOM   4502  C  CD2 . TRP A  1 789  ? 13.171  15.036  77.184  1.00 122.10 ? 789  TRP A CD2 1 
ATOM   4503  N  NE1 . TRP A  1 789  ? 15.176  14.090  77.511  1.00 259.86 ? 789  TRP A NE1 1 
ATOM   4504  C  CE2 . TRP A  1 789  ? 14.547  15.145  76.905  1.00 247.17 ? 789  TRP A CE2 1 
ATOM   4505  C  CE3 . TRP A  1 789  ? 12.301  15.996  76.675  1.00 111.55 ? 789  TRP A CE3 1 
ATOM   4506  C  CZ2 . TRP A  1 789  ? 15.069  16.179  76.139  1.00 289.79 ? 789  TRP A CZ2 1 
ATOM   4507  C  CZ3 . TRP A  1 789  ? 12.816  17.020  75.916  1.00 240.27 ? 789  TRP A CZ3 1 
ATOM   4508  C  CH2 . TRP A  1 789  ? 14.189  17.108  75.656  1.00 294.92 ? 789  TRP A CH2 1 
ATOM   4509  N  N   . ASN A  1 790  ? 10.120  11.025  79.653  1.00 186.02 ? 790  ASN A N   1 
ATOM   4510  C  CA  . ASN A  1 790  ? 9.042   10.622  80.563  1.00 120.46 ? 790  ASN A CA  1 
ATOM   4511  C  C   . ASN A  1 790  ? 9.512   10.733  82.016  1.00 117.36 ? 790  ASN A C   1 
ATOM   4512  O  O   . ASN A  1 790  ? 9.770   9.723   82.671  1.00 206.34 ? 790  ASN A O   1 
ATOM   4513  C  CB  . ASN A  1 790  ? 8.580   9.192   80.267  1.00 206.63 ? 790  ASN A CB  1 
ATOM   4514  C  CG  . ASN A  1 790  ? 7.392   8.756   81.131  1.00 154.31 ? 790  ASN A CG  1 
ATOM   4515  O  OD1 . ASN A  1 790  ? 6.660   9.584   81.671  1.00 127.72 ? 790  ASN A OD1 1 
ATOM   4516  N  ND2 . ASN A  1 790  ? 7.195   7.446   81.246  1.00 93.61  ? 790  ASN A ND2 1 
ATOM   4517  N  N   . ASP A  1 791  ? 9.614   11.968  82.512  1.00 108.28 ? 791  ASP A N   1 
ATOM   4518  C  CA  . ASP A  1 791  ? 10.106  12.213  83.862  1.00 170.55 ? 791  ASP A CA  1 
ATOM   4519  C  C   . ASP A  1 791  ? 8.973   12.183  84.886  1.00 170.25 ? 791  ASP A C   1 
ATOM   4520  O  O   . ASP A  1 791  ? 9.115   12.691  85.998  1.00 209.33 ? 791  ASP A O   1 
ATOM   4521  C  CB  . ASP A  1 791  ? 10.846  13.549  83.923  1.00 161.79 ? 791  ASP A CB  1 
ATOM   4522  C  CG  . ASP A  1 791  ? 12.193  13.506  83.206  1.00 172.92 ? 791  ASP A CG  1 
ATOM   4523  O  OD1 . ASP A  1 791  ? 12.688  12.396  82.891  1.00 139.92 ? 791  ASP A OD1 1 
ATOM   4524  O  OD2 . ASP A  1 791  ? 12.761  14.590  82.965  1.00 125.21 ? 791  ASP A OD2 1 
ATOM   4525  N  N   . GLY A  1 792  ? 7.857   11.571  84.507  1.00 159.82 ? 792  GLY A N   1 
ATOM   4526  C  CA  . GLY A  1 792  ? 6.738   11.419  85.410  1.00 177.22 ? 792  GLY A CA  1 
ATOM   4527  C  C   . GLY A  1 792  ? 6.113   10.042  85.336  1.00 169.02 ? 792  GLY A C   1 
ATOM   4528  O  O   . GLY A  1 792  ? 6.727   9.080   84.866  1.00 83.19  ? 792  GLY A O   1 
ATOM   4529  N  N   . GLU A  1 793  ? 4.886   9.952   85.833  1.00 187.21 ? 793  GLU A N   1 
ATOM   4530  C  CA  . GLU A  1 793  ? 4.113   8.719   85.790  1.00 210.83 ? 793  GLU A CA  1 
ATOM   4531  C  C   . GLU A  1 793  ? 4.062   8.146   84.381  1.00 187.30 ? 793  GLU A C   1 
ATOM   4532  O  O   . GLU A  1 793  ? 4.153   8.890   83.396  1.00 139.23 ? 793  GLU A O   1 
ATOM   4533  C  CB  . GLU A  1 793  ? 2.688   8.974   86.281  1.00 241.37 ? 793  GLU A CB  1 
ATOM   4534  C  CG  . GLU A  1 793  ? 1.921   7.709   86.630  1.00 256.76 ? 793  GLU A CG  1 
ATOM   4535  C  CD  . GLU A  1 793  ? 2.544   6.960   87.786  1.00 261.67 ? 793  GLU A CD  1 
ATOM   4536  O  OE1 . GLU A  1 793  ? 3.133   7.624   88.662  1.00 214.80 ? 793  GLU A OE1 1 
ATOM   4537  O  OE2 . GLU A  1 793  ? 2.446   5.713   87.819  1.00 308.02 ? 793  GLU A OE2 1 
ATOM   4538  N  N   . ASP A  1 794  ? 3.889   6.826   84.301  1.00 183.51 ? 794  ASP A N   1 
ATOM   4539  C  CA  . ASP A  1 794  ? 3.871   6.116   83.027  1.00 123.98 ? 794  ASP A CA  1 
ATOM   4540  C  C   . ASP A  1 794  ? 2.766   6.651   82.114  1.00 165.23 ? 794  ASP A C   1 
ATOM   4541  O  O   . ASP A  1 794  ? 1.598   6.748   82.516  1.00 137.77 ? 794  ASP A O   1 
ATOM   4542  C  CB  . ASP A  1 794  ? 3.678   4.607   83.239  1.00 136.41 ? 794  ASP A CB  1 
ATOM   4543  C  CG  . ASP A  1 794  ? 4.806   3.978   84.024  1.00 178.14 ? 794  ASP A CG  1 
ATOM   4544  O  OD1 . ASP A  1 794  ? 5.750   4.706   84.399  1.00 173.95 ? 794  ASP A OD1 1 
ATOM   4545  O  OD2 . ASP A  1 794  ? 4.741   2.751   84.257  1.00 141.49 ? 794  ASP A OD2 1 
ATOM   4546  N  N   . SER A  1 795  ? 3.158   7.008   80.889  1.00 230.12 ? 795  SER A N   1 
ATOM   4547  C  CA  . SER A  1 795  ? 2.214   7.323   79.819  1.00 235.43 ? 795  SER A CA  1 
ATOM   4548  C  C   . SER A  1 795  ? 1.981   6.069   78.974  1.00 168.42 ? 795  SER A C   1 
ATOM   4549  O  O   . SER A  1 795  ? 2.933   5.403   78.530  1.00 75.52  ? 795  SER A O   1 
ATOM   4550  C  CB  . SER A  1 795  ? 2.737   8.468   78.950  1.00 203.35 ? 795  SER A CB  1 
ATOM   4551  O  OG  . SER A  1 795  ? 3.933   8.107   78.285  1.00 162.21 ? 795  SER A OG  1 
ATOM   4552  N  N   . TYR A  1 796  ? 0.708   5.732   78.776  1.00 99.78  ? 796  TYR A N   1 
ATOM   4553  C  CA  . TYR A  1 796  ? 0.368   4.482   78.122  1.00 180.07 ? 796  TYR A CA  1 
ATOM   4554  C  C   . TYR A  1 796  ? 0.145   4.742   76.644  1.00 185.56 ? 796  TYR A C   1 
ATOM   4555  O  O   . TYR A  1 796  ? 1.017   4.445   75.811  1.00 150.70 ? 796  TYR A O   1 
ATOM   4556  C  CB  . TYR A  1 796  ? -0.860  3.833   78.785  1.00 201.62 ? 796  TYR A CB  1 
ATOM   4557  C  CG  . TYR A  1 796  ? -0.503  3.028   80.023  1.00 165.69 ? 796  TYR A CG  1 
ATOM   4558  C  CD1 . TYR A  1 796  ? -0.241  3.658   81.234  1.00 218.80 ? 796  TYR A CD1 1 
ATOM   4559  C  CD2 . TYR A  1 796  ? -0.404  1.636   79.973  1.00 94.67  ? 796  TYR A CD2 1 
ATOM   4560  C  CE1 . TYR A  1 796  ? 0.102   2.928   82.364  1.00 227.82 ? 796  TYR A CE1 1 
ATOM   4561  C  CE2 . TYR A  1 796  ? -0.060  0.894   81.099  1.00 135.87 ? 796  TYR A CE2 1 
ATOM   4562  C  CZ  . TYR A  1 796  ? 0.193   1.548   82.291  1.00 205.56 ? 796  TYR A CZ  1 
ATOM   4563  O  OH  . TYR A  1 796  ? 0.528   0.822   83.416  1.00 243.97 ? 796  TYR A OH  1 
ATOM   4564  N  N   . GLY A  1 797  ? -1.008  5.317   76.321  1.00 136.92 ? 797  GLY A N   1 
ATOM   4565  C  CA  . GLY A  1 797  ? -1.337  5.588   74.938  1.00 186.56 ? 797  GLY A CA  1 
ATOM   4566  C  C   . GLY A  1 797  ? -0.778  6.927   74.537  1.00 164.00 ? 797  GLY A C   1 
ATOM   4567  O  O   . GLY A  1 797  ? -1.451  7.719   73.885  1.00 174.31 ? 797  GLY A O   1 
ATOM   4568  N  N   . THR A  1 798  ? 0.460   7.181   74.936  1.00 174.41 ? 798  THR A N   1 
ATOM   4569  C  CA  . THR A  1 798  ? 1.111   8.440   74.628  1.00 231.06 ? 798  THR A CA  1 
ATOM   4570  C  C   . THR A  1 798  ? 1.013   8.767   73.139  1.00 57.97  ? 798  THR A C   1 
ATOM   4571  O  O   . THR A  1 798  ? 1.293   7.927   72.285  1.00 238.73 ? 798  THR A O   1 
ATOM   4572  C  CB  . THR A  1 798  ? 2.586   8.404   75.031  1.00 204.75 ? 798  THR A CB  1 
ATOM   4573  O  OG1 . THR A  1 798  ? 3.244   9.593   74.571  1.00 197.20 ? 798  THR A OG1 1 
ATOM   4574  C  CG2 . THR A  1 798  ? 3.249   7.187   74.428  1.00 75.33  ? 798  THR A CG2 1 
ATOM   4575  N  N   . THR A  1 799  ? 0.608   10.011  72.855  1.00 240.67 ? 799  THR A N   1 
ATOM   4576  C  CA  . THR A  1 799  ? 0.479   10.533  71.487  1.00 192.52 ? 799  THR A CA  1 
ATOM   4577  C  C   . THR A  1 799  ? 1.420   11.720  71.231  1.00 145.33 ? 799  THR A C   1 
ATOM   4578  O  O   . THR A  1 799  ? 1.727   12.507  72.130  1.00 101.23 ? 799  THR A O   1 
ATOM   4579  C  CB  . THR A  1 799  ? -0.973  10.997  71.161  1.00 124.36 ? 799  THR A CB  1 
ATOM   4580  O  OG1 . THR A  1 799  ? -1.229  12.270  71.766  1.00 190.89 ? 799  THR A OG1 1 
ATOM   4581  C  CG2 . THR A  1 799  ? -1.981  9.991   71.652  1.00 146.07 ? 799  THR A CG2 1 
ATOM   4582  N  N   . ILE A  1 800  ? 1.874   11.845  69.990  1.00 151.77 ? 800  ILE A N   1 
ATOM   4583  C  CA  . ILE A  1 800  ? 2.777   12.923  69.611  1.00 162.73 ? 800  ILE A CA  1 
ATOM   4584  C  C   . ILE A  1 800  ? 2.289   13.534  68.296  1.00 134.75 ? 800  ILE A C   1 
ATOM   4585  O  O   . ILE A  1 800  ? 2.338   12.908  67.236  1.00 124.42 ? 800  ILE A O   1 
ATOM   4586  C  CB  . ILE A  1 800  ? 4.250   12.432  69.513  1.00 135.41 ? 800  ILE A CB  1 
ATOM   4587  C  CG1 . ILE A  1 800  ? 5.162   13.546  68.983  1.00 83.32  ? 800  ILE A CG1 1 
ATOM   4588  C  CG2 . ILE A  1 800  ? 4.340   11.175  68.640  1.00 184.12 ? 800  ILE A CG2 1 
ATOM   4589  C  CD1 . ILE A  1 800  ? 5.109   14.848  69.749  1.00 87.17  ? 800  ILE A CD1 1 
ATOM   4590  N  N   . THR A  1 801  ? 1.793   14.761  68.386  1.00 109.09 ? 801  THR A N   1 
ATOM   4591  C  CA  . THR A  1 801  ? 1.215   15.444  67.238  1.00 152.42 ? 801  THR A CA  1 
ATOM   4592  C  C   . THR A  1 801  ? 2.127   16.590  66.805  1.00 182.61 ? 801  THR A C   1 
ATOM   4593  O  O   . THR A  1 801  ? 2.816   17.194  67.643  1.00 54.17  ? 801  THR A O   1 
ATOM   4594  C  CB  . THR A  1 801  ? -0.193  15.989  67.566  1.00 122.92 ? 801  THR A CB  1 
ATOM   4595  O  OG1 . THR A  1 801  ? -0.083  17.159  68.381  1.00 126.91 ? 801  THR A OG1 1 
ATOM   4596  C  CG2 . THR A  1 801  ? -0.983  14.964  68.318  1.00 153.10 ? 801  THR A CG2 1 
ATOM   4597  N  N   . PHE A  1 802  ? 2.135   16.864  65.496  1.00 162.89 ? 802  PHE A N   1 
ATOM   4598  C  CA  . PHE A  1 802  ? 2.922   17.958  64.921  1.00 94.44  ? 802  PHE A CA  1 
ATOM   4599  C  C   . PHE A  1 802  ? 2.035   19.012  64.272  1.00 135.01 ? 802  PHE A C   1 
ATOM   4600  O  O   . PHE A  1 802  ? 0.915   18.724  63.834  1.00 103.92 ? 802  PHE A O   1 
ATOM   4601  C  CB  . PHE A  1 802  ? 3.876   17.436  63.847  1.00 116.31 ? 802  PHE A CB  1 
ATOM   4602  C  CG  . PHE A  1 802  ? 4.905   16.450  64.339  1.00 144.30 ? 802  PHE A CG  1 
ATOM   4603  C  CD1 . PHE A  1 802  ? 4.664   15.062  64.263  1.00 60.79  ? 802  PHE A CD1 1 
ATOM   4604  C  CD2 . PHE A  1 802  ? 6.140   16.908  64.818  1.00 96.06  ? 802  PHE A CD2 1 
ATOM   4605  C  CE1 . PHE A  1 802  ? 5.629   14.151  64.695  1.00 97.40  ? 802  PHE A CE1 1 
ATOM   4606  C  CE2 . PHE A  1 802  ? 7.107   16.006  65.258  1.00 119.80 ? 802  PHE A CE2 1 
ATOM   4607  C  CZ  . PHE A  1 802  ? 6.854   14.623  65.194  1.00 142.95 ? 802  PHE A CZ  1 
ATOM   4608  N  N   . SER A  1 803  ? 2.563   20.231  64.194  1.00 150.46 ? 803  SER A N   1 
ATOM   4609  C  CA  . SER A  1 803  ? 1.935   21.297  63.420  1.00 111.38 ? 803  SER A CA  1 
ATOM   4610  C  C   . SER A  1 803  ? 2.845   21.682  62.233  1.00 154.72 ? 803  SER A C   1 
ATOM   4611  O  O   . SER A  1 803  ? 4.057   21.894  62.398  1.00 153.45 ? 803  SER A O   1 
ATOM   4612  C  CB  . SER A  1 803  ? 1.649   22.518  64.303  1.00 154.24 ? 803  SER A CB  1 
ATOM   4613  O  OG  . SER A  1 803  ? 2.788   23.359  64.448  1.00 178.47 ? 803  SER A OG  1 
ATOM   4614  N  N   . HIS A  1 804  ? 2.259   21.759  61.036  1.00 135.94 ? 804  HIS A N   1 
ATOM   4615  C  CA  . HIS A  1 804  ? 3.032   22.012  59.827  1.00 129.38 ? 804  HIS A CA  1 
ATOM   4616  C  C   . HIS A  1 804  ? 2.171   22.750  58.793  1.00 156.98 ? 804  HIS A C   1 
ATOM   4617  O  O   . HIS A  1 804  ? 0.938   22.651  58.830  1.00 94.55  ? 804  HIS A O   1 
ATOM   4618  C  CB  . HIS A  1 804  ? 3.586   20.689  59.269  1.00 99.32  ? 804  HIS A CB  1 
ATOM   4619  C  CG  . HIS A  1 804  ? 2.536   19.657  58.968  1.00 86.32  ? 804  HIS A CG  1 
ATOM   4620  N  ND1 . HIS A  1 804  ? 1.791   19.679  57.807  1.00 227.90 ? 804  HIS A ND1 1 
ATOM   4621  C  CD2 . HIS A  1 804  ? 2.128   18.559  59.650  1.00 53.72  ? 804  HIS A CD2 1 
ATOM   4622  C  CE1 . HIS A  1 804  ? 0.958   18.654  57.797  1.00 264.58 ? 804  HIS A CE1 1 
ATOM   4623  N  NE2 . HIS A  1 804  ? 1.138   17.961  58.907  1.00 224.13 ? 804  HIS A NE2 1 
ATOM   4624  N  N   . PRO A  1 805  ? 2.820   23.522  57.896  1.00 185.91 ? 805  PRO A N   1 
ATOM   4625  C  CA  . PRO A  1 805  ? 2.156   24.168  56.753  1.00 97.82  ? 805  PRO A CA  1 
ATOM   4626  C  C   . PRO A  1 805  ? 1.594   23.128  55.765  1.00 162.17 ? 805  PRO A C   1 
ATOM   4627  O  O   . PRO A  1 805  ? 2.113   21.999  55.710  1.00 136.19 ? 805  PRO A O   1 
ATOM   4628  C  CB  . PRO A  1 805  ? 3.289   24.956  56.090  1.00 163.42 ? 805  PRO A CB  1 
ATOM   4629  C  CG  . PRO A  1 805  ? 4.556   24.282  56.585  1.00 141.98 ? 805  PRO A CG  1 
ATOM   4630  C  CD  . PRO A  1 805  ? 4.229   23.941  57.994  1.00 200.99 ? 805  PRO A CD  1 
ATOM   4631  N  N   . ALA A  1 806  ? 0.577   23.508  54.986  1.00 131.94 ? 806  ALA A N   1 
ATOM   4632  C  CA  . ALA A  1 806  ? -0.143  22.562  54.133  1.00 128.24 ? 806  ALA A CA  1 
ATOM   4633  C  C   . ALA A  1 806  ? 0.814   21.739  53.267  1.00 137.60 ? 806  ALA A C   1 
ATOM   4634  O  O   . ALA A  1 806  ? 0.495   20.604  52.880  1.00 97.70  ? 806  ALA A O   1 
ATOM   4635  C  CB  . ALA A  1 806  ? -1.152  23.310  53.270  1.00 204.07 ? 806  ALA A CB  1 
ATOM   4636  N  N   . GLY A  1 807  ? 1.996   22.308  53.012  1.00 133.23 ? 807  GLY A N   1 
ATOM   4637  C  CA  . GLY A  1 807  ? 2.909   21.813  52.000  1.00 159.26 ? 807  GLY A CA  1 
ATOM   4638  C  C   . GLY A  1 807  ? 3.590   20.488  52.276  1.00 142.62 ? 807  GLY A C   1 
ATOM   4639  O  O   . GLY A  1 807  ? 4.545   20.145  51.581  1.00 98.35  ? 807  GLY A O   1 
ATOM   4640  N  N   . LEU A  1 808  ? 3.114   19.729  53.259  1.00 172.66 ? 808  LEU A N   1 
ATOM   4641  C  CA  . LEU A  1 808  ? 3.721   18.430  53.552  1.00 178.43 ? 808  LEU A CA  1 
ATOM   4642  C  C   . LEU A  1 808  ? 2.808   17.567  54.401  1.00 185.55 ? 808  LEU A C   1 
ATOM   4643  O  O   . LEU A  1 808  ? 1.870   18.070  55.017  1.00 156.32 ? 808  LEU A O   1 
ATOM   4644  C  CB  . LEU A  1 808  ? 5.081   18.619  54.242  1.00 151.12 ? 808  LEU A CB  1 
ATOM   4645  C  CG  . LEU A  1 808  ? 5.114   19.558  55.459  1.00 107.60 ? 808  LEU A CG  1 
ATOM   4646  C  CD1 . LEU A  1 808  ? 4.773   18.801  56.714  1.00 213.06 ? 808  LEU A CD1 1 
ATOM   4647  C  CD2 . LEU A  1 808  ? 6.490   20.251  55.626  1.00 119.63 ? 808  LEU A CD2 1 
ATOM   4648  N  N   . SER A  1 809  ? 3.070   16.262  54.394  1.00 191.43 ? 809  SER A N   1 
ATOM   4649  C  CA  . SER A  1 809  ? 2.372   15.318  55.265  1.00 217.90 ? 809  SER A CA  1 
ATOM   4650  C  C   . SER A  1 809  ? 3.294   14.151  55.608  1.00 165.83 ? 809  SER A C   1 
ATOM   4651  O  O   . SER A  1 809  ? 4.402   14.038  55.075  1.00 86.19  ? 809  SER A O   1 
ATOM   4652  C  CB  . SER A  1 809  ? 1.090   14.794  54.612  1.00 205.24 ? 809  SER A CB  1 
ATOM   4653  O  OG  . SER A  1 809  ? 0.117   15.816  54.471  1.00 181.06 ? 809  SER A OG  1 
ATOM   4654  N  N   . TYR A  1 810  ? 2.839   13.282  56.504  1.00 161.78 ? 810  TYR A N   1 
ATOM   4655  C  CA  . TYR A  1 810  ? 3.682   12.189  56.978  1.00 172.02 ? 810  TYR A CA  1 
ATOM   4656  C  C   . TYR A  1 810  ? 3.548   10.955  56.101  1.00 177.49 ? 810  TYR A C   1 
ATOM   4657  O  O   . TYR A  1 810  ? 2.442   10.592  55.689  1.00 185.78 ? 810  TYR A O   1 
ATOM   4658  C  CB  . TYR A  1 810  ? 3.336   11.832  58.431  1.00 118.37 ? 810  TYR A CB  1 
ATOM   4659  C  CG  . TYR A  1 810  ? 4.039   10.578  58.959  1.00 161.17 ? 810  TYR A CG  1 
ATOM   4660  C  CD1 . TYR A  1 810  ? 3.334   9.385   59.170  1.00 138.38 ? 810  TYR A CD1 1 
ATOM   4661  C  CD2 . TYR A  1 810  ? 5.412   10.588  59.248  1.00 181.99 ? 810  TYR A CD2 1 
ATOM   4662  C  CE1 . TYR A  1 810  ? 3.980   8.239   59.656  1.00 176.62 ? 810  TYR A CE1 1 
ATOM   4663  C  CE2 . TYR A  1 810  ? 6.063   9.449   59.733  1.00 180.88 ? 810  TYR A CE2 1 
ATOM   4664  C  CZ  . TYR A  1 810  ? 5.347   8.282   59.936  1.00 203.91 ? 810  TYR A CZ  1 
ATOM   4665  O  OH  . TYR A  1 810  ? 6.014   7.167   60.419  1.00 158.54 ? 810  TYR A OH  1 
ATOM   4666  N  N   . ARG A  1 811  ? 4.683   10.316  55.816  1.00 75.02  ? 811  ARG A N   1 
ATOM   4667  C  CA  . ARG A  1 811  ? 4.671   8.981   55.205  1.00 162.93 ? 811  ARG A CA  1 
ATOM   4668  C  C   . ARG A  1 811  ? 5.494   7.950   55.993  1.00 198.54 ? 811  ARG A C   1 
ATOM   4669  O  O   . ARG A  1 811  ? 6.638   8.225   56.400  1.00 127.04 ? 811  ARG A O   1 
ATOM   4670  C  CB  . ARG A  1 811  ? 5.205   9.044   53.784  1.00 201.43 ? 811  ARG A CB  1 
ATOM   4671  C  CG  . ARG A  1 811  ? 6.702   9.278   53.716  1.00 235.67 ? 811  ARG A CG  1 
ATOM   4672  C  CD  . ARG A  1 811  ? 7.237   8.949   52.345  1.00 208.04 ? 811  ARG A CD  1 
ATOM   4673  N  NE  . ARG A  1 811  ? 8.663   9.228   52.233  1.00 176.91 ? 811  ARG A NE  1 
ATOM   4674  C  CZ  . ARG A  1 811  ? 9.386   8.980   51.147  1.00 239.40 ? 811  ARG A CZ  1 
ATOM   4675  N  NH1 . ARG A  1 811  ? 8.814   8.440   50.078  1.00 293.58 ? 811  ARG A NH1 1 
ATOM   4676  N  NH2 . ARG A  1 811  ? 10.678  9.270   51.129  1.00 218.02 ? 811  ARG A NH2 1 
ATOM   4677  N  N   . TYR A  1 812  ? 4.919   6.755   56.167  1.00 146.01 ? 812  TYR A N   1 
ATOM   4678  C  CA  . TYR A  1 812  ? 5.546   5.699   56.969  1.00 195.39 ? 812  TYR A CA  1 
ATOM   4679  C  C   . TYR A  1 812  ? 6.971   5.390   56.475  1.00 161.40 ? 812  TYR A C   1 
ATOM   4680  O  O   . TYR A  1 812  ? 7.211   5.264   55.277  1.00 122.44 ? 812  TYR A O   1 
ATOM   4681  C  CB  . TYR A  1 812  ? 4.677   4.428   56.983  1.00 130.89 ? 812  TYR A CB  1 
ATOM   4682  C  CG  . TYR A  1 812  ? 5.166   3.360   57.943  1.00 205.94 ? 812  TYR A CG  1 
ATOM   4683  C  CD1 . TYR A  1 812  ? 4.950   3.456   59.316  1.00 230.28 ? 812  TYR A CD1 1 
ATOM   4684  C  CD2 . TYR A  1 812  ? 5.848   2.254   57.471  1.00 215.33 ? 812  TYR A CD2 1 
ATOM   4685  C  CE1 . TYR A  1 812  ? 5.409   2.476   60.183  1.00 240.20 ? 812  TYR A CE1 1 
ATOM   4686  C  CE2 . TYR A  1 812  ? 6.305   1.273   58.332  1.00 244.97 ? 812  TYR A CE2 1 
ATOM   4687  C  CZ  . TYR A  1 812  ? 6.086   1.386   59.676  1.00 263.03 ? 812  TYR A CZ  1 
ATOM   4688  O  OH  . TYR A  1 812  ? 6.566   0.392   60.492  1.00 264.56 ? 812  TYR A OH  1 
ATOM   4689  N  N   . VAL A  1 813  ? 7.916   5.273   57.405  1.00 196.38 ? 813  VAL A N   1 
ATOM   4690  C  CA  . VAL A  1 813  ? 9.310   5.032   57.044  1.00 182.70 ? 813  VAL A CA  1 
ATOM   4691  C  C   . VAL A  1 813  ? 9.508   3.552   56.709  1.00 173.88 ? 813  VAL A C   1 
ATOM   4692  O  O   . VAL A  1 813  ? 9.954   3.223   55.615  1.00 200.50 ? 813  VAL A O   1 
ATOM   4693  C  CB  . VAL A  1 813  ? 10.279  5.479   58.171  1.00 234.82 ? 813  VAL A CB  1 
ATOM   4694  C  CG1 . VAL A  1 813  ? 11.727  5.280   57.755  1.00 206.58 ? 813  VAL A CG1 1 
ATOM   4695  C  CG2 . VAL A  1 813  ? 10.010  6.936   58.568  1.00 181.00 ? 813  VAL A CG2 1 
ATOM   4696  N  N   . ALA A  1 814  ? 9.157   2.669   57.642  1.00 210.88 ? 814  ALA A N   1 
ATOM   4697  C  CA  . ALA A  1 814  ? 9.222   1.219   57.417  1.00 215.23 ? 814  ALA A CA  1 
ATOM   4698  C  C   . ALA A  1 814  ? 10.626  0.760   57.080  1.00 248.30 ? 814  ALA A C   1 
ATOM   4699  O  O   . ALA A  1 814  ? 10.836  0.128   56.048  1.00 342.47 ? 814  ALA A O   1 
ATOM   4700  C  CB  . ALA A  1 814  ? 8.278   0.806   56.279  1.00 217.11 ? 814  ALA A CB  1 
ATOM   4701  N  N   . GLU A  1 815  ? 11.587  1.051   57.942  1.00 214.96 ? 815  GLU A N   1 
ATOM   4702  C  CA  . GLU A  1 815  ? 12.968  0.786   57.602  1.00 246.70 ? 815  GLU A CA  1 
ATOM   4703  C  C   . GLU A  1 815  ? 13.461  -0.427  58.357  1.00 271.23 ? 815  GLU A C   1 
ATOM   4704  O  O   . GLU A  1 815  ? 12.867  -0.847  59.345  1.00 288.90 ? 815  GLU A O   1 
ATOM   4705  C  CB  . GLU A  1 815  ? 13.825  2.019   57.850  1.00 282.61 ? 815  GLU A CB  1 
ATOM   4706  C  CG  . GLU A  1 815  ? 14.021  2.858   56.597  1.00 337.32 ? 815  GLU A CG  1 
ATOM   4707  C  CD  . GLU A  1 815  ? 15.322  2.540   55.891  1.00 375.14 ? 815  GLU A CD  1 
ATOM   4708  O  OE1 . GLU A  1 815  ? 16.287  2.154   56.580  1.00 401.77 ? 815  GLU A OE1 1 
ATOM   4709  O  OE2 . GLU A  1 815  ? 15.381  2.679   54.650  1.00 369.84 ? 815  GLU A OE2 1 
ATOM   4710  N  N   . GLY A  1 816  ? 14.557  -0.993  57.889  1.00 284.90 ? 816  GLY A N   1 
ATOM   4711  C  CA  . GLY A  1 816  ? 14.834  -2.370  58.208  1.00 295.48 ? 816  GLY A CA  1 
ATOM   4712  C  C   . GLY A  1 816  ? 16.269  -2.740  58.445  1.00 320.38 ? 816  GLY A C   1 
ATOM   4713  O  O   . GLY A  1 816  ? 16.612  -3.484  59.364  1.00 332.45 ? 816  GLY A O   1 
ATOM   4714  N  N   . GLN A  1 817  ? 17.123  -2.150  57.633  1.00 328.88 ? 817  GLN A N   1 
ATOM   4715  C  CA  . GLN A  1 817  ? 18.024  -2.956  56.857  1.00 316.65 ? 817  GLN A CA  1 
ATOM   4716  C  C   . GLN A  1 817  ? 19.430  -2.401  56.650  1.00 303.35 ? 817  GLN A C   1 
ATOM   4717  O  O   . GLN A  1 817  ? 19.994  -2.567  55.570  1.00 291.56 ? 817  GLN A O   1 
ATOM   4718  C  CB  . GLN A  1 817  ? 17.327  -3.046  55.506  1.00 315.85 ? 817  GLN A CB  1 
ATOM   4719  C  CG  . GLN A  1 817  ? 17.165  -4.418  54.922  1.00 321.16 ? 817  GLN A CG  1 
ATOM   4720  C  CD  . GLN A  1 817  ? 16.772  -4.353  53.466  1.00 354.44 ? 817  GLN A CD  1 
ATOM   4721  O  OE1 . GLN A  1 817  ? 16.208  -3.357  53.008  1.00 408.63 ? 817  GLN A OE1 1 
ATOM   4722  N  NE2 . GLN A  1 817  ? 17.074  -5.404  52.726  1.00 337.74 ? 817  GLN A NE2 1 
ATOM   4723  N  N   . LYS A  1 818  ? 20.019  -1.805  57.681  1.00 301.79 ? 818  LYS A N   1 
ATOM   4724  C  CA  . LYS A  1 818  ? 19.451  -1.820  59.017  1.00 321.62 ? 818  LYS A CA  1 
ATOM   4725  C  C   . LYS A  1 818  ? 19.886  -0.607  59.814  1.00 361.52 ? 818  LYS A C   1 
ATOM   4726  O  O   . LYS A  1 818  ? 20.684  0.205   59.351  1.00 393.26 ? 818  LYS A O   1 
ATOM   4727  C  CB  . LYS A  1 818  ? 19.835  -3.114  59.730  1.00 306.14 ? 818  LYS A CB  1 
ATOM   4728  C  CG  . LYS A  1 818  ? 21.207  -3.643  59.349  1.00 289.75 ? 818  LYS A CG  1 
ATOM   4729  C  CD  . LYS A  1 818  ? 21.384  -5.083  59.793  1.00 274.17 ? 818  LYS A CD  1 
ATOM   4730  C  CE  . LYS A  1 818  ? 22.304  -5.836  58.849  1.00 236.07 ? 818  LYS A CE  1 
ATOM   4731  N  NZ  . LYS A  1 818  ? 22.631  -7.189  59.359  1.00 205.54 ? 818  LYS A NZ  1 
ATOM   4732  N  N   . GLN A  1 819  ? 19.356  -0.492  61.024  1.00 360.21 ? 819  GLN A N   1 
ATOM   4733  C  CA  . GLN A  1 819  ? 19.510  0.721   61.808  1.00 344.08 ? 819  GLN A CA  1 
ATOM   4734  C  C   . GLN A  1 819  ? 18.610  0.682   63.030  1.00 342.61 ? 819  GLN A C   1 
ATOM   4735  O  O   . GLN A  1 819  ? 17.578  0.011   63.021  1.00 389.46 ? 819  GLN A O   1 
ATOM   4736  C  CB  . GLN A  1 819  ? 19.127  1.929   60.964  1.00 329.06 ? 819  GLN A CB  1 
ATOM   4737  C  CG  . GLN A  1 819  ? 17.756  1.806   60.310  1.00 317.65 ? 819  GLN A CG  1 
ATOM   4738  C  CD  . GLN A  1 819  ? 17.499  2.912   59.313  1.00 299.72 ? 819  GLN A CD  1 
ATOM   4739  O  OE1 . GLN A  1 819  ? 18.434  3.472   58.748  1.00 293.70 ? 819  GLN A OE1 1 
ATOM   4740  N  NE2 . GLN A  1 819  ? 16.232  3.238   59.093  1.00 300.34 ? 819  GLN A NE2 1 
ATOM   4741  N  N   . GLY A  1 820  ? 19.009  1.365   64.096  1.00 297.37 ? 820  GLY A N   1 
ATOM   4742  C  CA  . GLY A  1 820  ? 20.314  1.995   64.208  1.00 309.77 ? 820  GLY A CA  1 
ATOM   4743  C  C   . GLY A  1 820  ? 20.742  1.771   65.639  1.00 361.13 ? 820  GLY A C   1 
ATOM   4744  O  O   . GLY A  1 820  ? 21.260  0.718   65.982  1.00 388.97 ? 820  GLY A O   1 
ATOM   4745  N  N   . GLN A  1 821  ? 20.521  2.773   66.474  1.00 374.58 ? 821  GLN A N   1 
ATOM   4746  C  CA  . GLN A  1 821  ? 20.355  2.563   67.901  1.00 376.54 ? 821  GLN A CA  1 
ATOM   4747  C  C   . GLN A  1 821  ? 18.958  3.095   68.082  1.00 405.60 ? 821  GLN A C   1 
ATOM   4748  O  O   . GLN A  1 821  ? 18.682  3.891   68.971  1.00 440.25 ? 821  GLN A O   1 
ATOM   4749  C  CB  . GLN A  1 821  ? 21.341  3.393   68.714  1.00 345.63 ? 821  GLN A CB  1 
ATOM   4750  C  CG  . GLN A  1 821  ? 22.745  3.428   68.158  1.00 330.38 ? 821  GLN A CG  1 
ATOM   4751  C  CD  . GLN A  1 821  ? 23.567  4.556   68.752  1.00 324.34 ? 821  GLN A CD  1 
ATOM   4752  O  OE1 . GLN A  1 821  ? 23.188  5.724   68.671  1.00 320.45 ? 821  GLN A OE1 1 
ATOM   4753  N  NE2 . GLN A  1 821  ? 24.701  4.211   69.354  1.00 311.54 ? 821  GLN A NE2 1 
ATOM   4754  N  N   . LEU A  1 822  ? 18.071  2.620   67.224  1.00 380.76 ? 822  LEU A N   1 
ATOM   4755  C  CA  . LEU A  1 822  ? 17.113  3.508   66.595  1.00 350.30 ? 822  LEU A CA  1 
ATOM   4756  C  C   . LEU A  1 822  ? 15.725  2.915   66.345  1.00 309.91 ? 822  LEU A C   1 
ATOM   4757  O  O   . LEU A  1 822  ? 15.420  1.827   66.811  1.00 251.41 ? 822  LEU A O   1 
ATOM   4758  C  CB  . LEU A  1 822  ? 17.764  3.967   65.287  1.00 330.19 ? 822  LEU A CB  1 
ATOM   4759  C  CG  . LEU A  1 822  ? 17.040  4.882   64.310  1.00 278.36 ? 822  LEU A CG  1 
ATOM   4760  C  CD1 . LEU A  1 822  ? 16.704  6.186   65.007  1.00 266.65 ? 822  LEU A CD1 1 
ATOM   4761  C  CD2 . LEU A  1 822  ? 17.857  5.101   63.057  1.00 242.84 ? 822  LEU A CD2 1 
ATOM   4762  N  N   . ARG A  1 823  ? 14.910  3.644   65.584  1.00 319.64 ? 823  ARG A N   1 
ATOM   4763  C  CA  . ARG A  1 823  ? 13.479  3.420   65.496  1.00 303.21 ? 823  ARG A CA  1 
ATOM   4764  C  C   . ARG A  1 823  ? 13.114  1.973   65.227  1.00 281.31 ? 823  ARG A C   1 
ATOM   4765  O  O   . ARG A  1 823  ? 13.718  1.298   64.396  1.00 258.46 ? 823  ARG A O   1 
ATOM   4766  C  CB  . ARG A  1 823  ? 12.864  4.346   64.447  1.00 279.44 ? 823  ARG A CB  1 
ATOM   4767  C  CG  . ARG A  1 823  ? 11.745  3.727   63.639  1.00 252.26 ? 823  ARG A CG  1 
ATOM   4768  C  CD  . ARG A  1 823  ? 10.593  4.693   63.512  1.00 234.02 ? 823  ARG A CD  1 
ATOM   4769  N  NE  . ARG A  1 823  ? 10.039  4.726   62.165  1.00 249.94 ? 823  ARG A NE  1 
ATOM   4770  C  CZ  . ARG A  1 823  ? 8.792   4.386   61.852  1.00 277.11 ? 823  ARG A CZ  1 
ATOM   4771  N  NH1 . ARG A  1 823  ? 7.943   3.991   62.785  1.00 286.57 ? 823  ARG A NH1 1 
ATOM   4772  N  NH2 . ARG A  1 823  ? 8.385   4.450   60.598  1.00 295.32 ? 823  ARG A NH2 1 
ATOM   4773  N  N   . SER A  1 824  ? 12.067  1.535   65.909  1.00 263.60 ? 824  SER A N   1 
ATOM   4774  C  CA  . SER A  1 824  ? 11.765  0.123   66.063  1.00 232.40 ? 824  SER A CA  1 
ATOM   4775  C  C   . SER A  1 824  ? 10.280  -0.062  65.925  1.00 214.27 ? 824  SER A C   1 
ATOM   4776  O  O   . SER A  1 824  ? 9.733   -1.135  66.176  1.00 218.22 ? 824  SER A O   1 
ATOM   4777  C  CB  . SER A  1 824  ? 12.117  -0.294  67.495  1.00 229.55 ? 824  SER A CB  1 
ATOM   4778  O  OG  . SER A  1 824  ? 13.510  -0.184  67.769  1.00 242.49 ? 824  SER A OG  1 
ATOM   4779  N  N   . LEU A  1 825  ? 9.634   1.001   65.492  1.00 209.58 ? 825  LEU A N   1 
ATOM   4780  C  CA  . LEU A  1 825  ? 8.444   1.432   66.177  1.00 207.57 ? 825  LEU A CA  1 
ATOM   4781  C  C   . LEU A  1 825  ? 7.169   1.537   65.369  1.00 200.90 ? 825  LEU A C   1 
ATOM   4782  O  O   . LEU A  1 825  ? 6.996   2.459   64.572  1.00 212.16 ? 825  LEU A O   1 
ATOM   4783  C  CB  . LEU A  1 825  ? 8.777   2.789   66.768  1.00 203.56 ? 825  LEU A CB  1 
ATOM   4784  C  CG  . LEU A  1 825  ? 7.692   3.489   67.568  1.00 171.95 ? 825  LEU A CG  1 
ATOM   4785  C  CD1 . LEU A  1 825  ? 7.361   2.652   68.790  1.00 164.90 ? 825  LEU A CD1 1 
ATOM   4786  C  CD2 . LEU A  1 825  ? 8.163   4.876   67.965  1.00 173.84 ? 825  LEU A CD2 1 
ATOM   4787  N  N   . HIS A  1 826  ? 6.253   0.611   65.625  1.00 143.52 ? 826  HIS A N   1 
ATOM   4788  C  CA  . HIS A  1 826  ? 4.957   0.643   64.974  1.00 165.12 ? 826  HIS A CA  1 
ATOM   4789  C  C   . HIS A  1 826  ? 4.147   1.768   65.606  1.00 136.87 ? 826  HIS A C   1 
ATOM   4790  O  O   . HIS A  1 826  ? 3.878   1.751   66.803  1.00 155.35 ? 826  HIS A O   1 
ATOM   4791  C  CB  . HIS A  1 826  ? 4.241   -0.704  65.126  1.00 247.74 ? 826  HIS A CB  1 
ATOM   4792  C  CG  . HIS A  1 826  ? 2.954   -0.797  64.364  1.00 271.48 ? 826  HIS A CG  1 
ATOM   4793  N  ND1 . HIS A  1 826  ? 1.736   -0.445  64.906  1.00 180.53 ? 826  HIS A ND1 1 
ATOM   4794  C  CD2 . HIS A  1 826  ? 2.698   -1.214  63.101  1.00 293.69 ? 826  HIS A CD2 1 
ATOM   4795  C  CE1 . HIS A  1 826  ? 0.786   -0.636  64.008  1.00 164.07 ? 826  HIS A CE1 1 
ATOM   4796  N  NE2 . HIS A  1 826  ? 1.343   -1.103  62.905  1.00 260.60 ? 826  HIS A NE2 1 
ATOM   4797  N  N   . LEU A  1 827  ? 3.775   2.759   64.806  1.00 181.99 ? 827  LEU A N   1 
ATOM   4798  C  CA  . LEU A  1 827  ? 2.985   3.883   65.303  1.00 152.10 ? 827  LEU A CA  1 
ATOM   4799  C  C   . LEU A  1 827  ? 1.906   4.286   64.304  1.00 114.68 ? 827  LEU A C   1 
ATOM   4800  O  O   . LEU A  1 827  ? 2.101   4.171   63.094  1.00 156.57 ? 827  LEU A O   1 
ATOM   4801  C  CB  . LEU A  1 827  ? 3.907   5.065   65.600  1.00 128.35 ? 827  LEU A CB  1 
ATOM   4802  C  CG  . LEU A  1 827  ? 4.832   5.446   64.452  1.00 176.45 ? 827  LEU A CG  1 
ATOM   4803  C  CD1 . LEU A  1 827  ? 4.108   6.392   63.520  1.00 217.11 ? 827  LEU A CD1 1 
ATOM   4804  C  CD2 . LEU A  1 827  ? 6.085   6.078   65.011  1.00 169.78 ? 827  LEU A CD2 1 
ATOM   4805  N  N   . THR A  1 828  ? 0.776   4.764   64.822  1.00 104.27 ? 828  THR A N   1 
ATOM   4806  C  CA  . THR A  1 828  ? -0.374  5.138   63.998  1.00 170.82 ? 828  THR A CA  1 
ATOM   4807  C  C   . THR A  1 828  ? -0.522  6.657   63.877  1.00 193.88 ? 828  THR A C   1 
ATOM   4808  O  O   . THR A  1 828  ? -0.678  7.354   64.878  1.00 224.95 ? 828  THR A O   1 
ATOM   4809  C  CB  . THR A  1 828  ? -1.691  4.567   64.578  1.00 180.73 ? 828  THR A CB  1 
ATOM   4810  O  OG1 . THR A  1 828  ? -1.605  3.139   64.660  1.00 198.22 ? 828  THR A OG1 1 
ATOM   4811  C  CG2 . THR A  1 828  ? -2.883  4.973   63.709  1.00 153.11 ? 828  THR A CG2 1 
ATOM   4812  N  N   . CYS A  1 829  ? -0.494  7.162   62.646  1.00 192.27 ? 829  CYS A N   1 
ATOM   4813  C  CA  . CYS A  1 829  ? -0.577  8.599   62.402  1.00 183.17 ? 829  CYS A CA  1 
ATOM   4814  C  C   . CYS A  1 829  ? -1.779  8.977   61.533  1.00 189.20 ? 829  CYS A C   1 
ATOM   4815  O  O   . CYS A  1 829  ? -2.085  8.291   60.557  1.00 245.66 ? 829  CYS A O   1 
ATOM   4816  C  CB  . CYS A  1 829  ? 0.717   9.077   61.745  1.00 190.47 ? 829  CYS A CB  1 
ATOM   4817  S  SG  . CYS A  1 829  ? 2.189   8.644   62.705  1.00 172.89 ? 829  CYS A SG  1 
ATOM   4818  N  N   . ASP A  1 830  ? -2.450  10.072  61.891  1.00 99.55  ? 830  ASP A N   1 
ATOM   4819  C  CA  . ASP A  1 830  ? -3.601  10.554  61.131  1.00 175.69 ? 830  ASP A CA  1 
ATOM   4820  C  C   . ASP A  1 830  ? -3.504  12.048  60.853  1.00 171.52 ? 830  ASP A C   1 
ATOM   4821  O  O   . ASP A  1 830  ? -3.627  12.865  61.760  1.00 140.15 ? 830  ASP A O   1 
ATOM   4822  C  CB  . ASP A  1 830  ? -4.895  10.263  61.888  1.00 194.99 ? 830  ASP A CB  1 
ATOM   4823  C  CG  . ASP A  1 830  ? -5.224  8.790   61.928  1.00 285.46 ? 830  ASP A CG  1 
ATOM   4824  O  OD1 . ASP A  1 830  ? -4.562  8.013   61.209  1.00 328.11 ? 830  ASP A OD1 1 
ATOM   4825  O  OD2 . ASP A  1 830  ? -6.145  8.410   62.678  1.00 308.51 ? 830  ASP A OD2 1 
ATOM   4826  N  N   . SER A  1 831  ? -3.291  12.403  59.592  1.00 194.28 ? 831  SER A N   1 
ATOM   4827  C  CA  . SER A  1 831  ? -3.213  13.804  59.214  1.00 162.63 ? 831  SER A CA  1 
ATOM   4828  C  C   . SER A  1 831  ? -4.615  14.389  59.247  1.00 153.86 ? 831  SER A C   1 
ATOM   4829  O  O   . SER A  1 831  ? -5.602  13.653  59.195  1.00 200.79 ? 831  SER A O   1 
ATOM   4830  C  CB  . SER A  1 831  ? -2.592  13.955  57.824  1.00 185.18 ? 831  SER A CB  1 
ATOM   4831  O  OG  . SER A  1 831  ? -3.391  13.333  56.838  1.00 255.72 ? 831  SER A OG  1 
ATOM   4832  N  N   . ALA A  1 832  ? -4.705  15.712  59.349  1.00 68.53  ? 832  ALA A N   1 
ATOM   4833  C  CA  . ALA A  1 832  ? -6.007  16.389  59.386  1.00 170.01 ? 832  ALA A CA  1 
ATOM   4834  C  C   . ALA A  1 832  ? -5.852  17.908  59.424  1.00 129.75 ? 832  ALA A C   1 
ATOM   4835  O  O   . ALA A  1 832  ? -4.952  18.422  60.086  1.00 172.67 ? 832  ALA A O   1 
ATOM   4836  C  CB  . ALA A  1 832  ? -6.810  15.922  60.584  1.00 260.06 ? 832  ALA A CB  1 
ATOM   4837  N  N   . PRO A  1 833  ? -6.734  18.633  58.710  1.00 156.42 ? 833  PRO A N   1 
ATOM   4838  C  CA  . PRO A  1 833  ? -6.681  20.103  58.670  1.00 150.47 ? 833  PRO A CA  1 
ATOM   4839  C  C   . PRO A  1 833  ? -7.134  20.736  59.987  1.00 134.26 ? 833  PRO A C   1 
ATOM   4840  O  O   . PRO A  1 833  ? -8.149  20.302  60.534  1.00 231.20 ? 833  PRO A O   1 
ATOM   4841  C  CB  . PRO A  1 833  ? -7.652  20.464  57.543  1.00 186.78 ? 833  PRO A CB  1 
ATOM   4842  C  CG  . PRO A  1 833  ? -8.567  19.299  57.416  1.00 230.18 ? 833  PRO A CG  1 
ATOM   4843  C  CD  . PRO A  1 833  ? -7.830  18.086  57.889  1.00 238.02 ? 833  PRO A CD  1 
ATOM   4844  N  N   . VAL A  1 834  ? -6.414  21.746  60.478  1.00 87.92  ? 834  VAL A N   1 
ATOM   4845  C  CA  . VAL A  1 834  ? -6.743  22.353  61.770  1.00 183.90 ? 834  VAL A CA  1 
ATOM   4846  C  C   . VAL A  1 834  ? -6.986  23.866  61.700  1.00 194.50 ? 834  VAL A C   1 
ATOM   4847  O  O   . VAL A  1 834  ? -8.131  24.329  61.752  1.00 240.51 ? 834  VAL A O   1 
ATOM   4848  C  CB  . VAL A  1 834  ? -5.623  22.091  62.793  1.00 237.40 ? 834  VAL A CB  1 
ATOM   4849  C  CG1 . VAL A  1 834  ? -5.889  22.837  64.095  1.00 245.55 ? 834  VAL A CG1 1 
ATOM   4850  C  CG2 . VAL A  1 834  ? -5.476  20.598  63.046  1.00 322.28 ? 834  VAL A CG2 1 
ATOM   4851  N  N   . GLY A  1 835  ? -5.901  24.623  61.578  1.00 108.48 ? 835  GLY A N   1 
ATOM   4852  C  CA  . GLY A  1 835  ? -5.947  26.063  61.726  1.00 204.06 ? 835  GLY A CA  1 
ATOM   4853  C  C   . GLY A  1 835  ? -6.956  26.755  60.838  1.00 253.02 ? 835  GLY A C   1 
ATOM   4854  O  O   . GLY A  1 835  ? -7.525  26.160  59.922  1.00 246.83 ? 835  GLY A O   1 
ATOM   4855  N  N   . SER A  1 836  ? -7.176  28.031  61.121  1.00 260.46 ? 836  SER A N   1 
ATOM   4856  C  CA  . SER A  1 836  ? -8.125  28.817  60.364  1.00 254.61 ? 836  SER A CA  1 
ATOM   4857  C  C   . SER A  1 836  ? -7.841  28.677  58.883  1.00 243.48 ? 836  SER A C   1 
ATOM   4858  O  O   . SER A  1 836  ? -8.722  28.308  58.110  1.00 246.86 ? 836  SER A O   1 
ATOM   4859  C  CB  . SER A  1 836  ? -8.039  30.282  60.771  1.00 253.55 ? 836  SER A CB  1 
ATOM   4860  O  OG  . SER A  1 836  ? -8.933  31.064  60.004  1.00 303.84 ? 836  SER A OG  1 
ATOM   4861  N  N   . GLN A  1 837  ? -6.605  28.957  58.489  1.00 201.52 ? 837  GLN A N   1 
ATOM   4862  C  CA  . GLN A  1 837  ? -6.246  28.900  57.083  1.00 206.92 ? 837  GLN A CA  1 
ATOM   4863  C  C   . GLN A  1 837  ? -4.751  28.721  56.888  1.00 177.58 ? 837  GLN A C   1 
ATOM   4864  O  O   . GLN A  1 837  ? -3.996  29.689  56.891  1.00 197.77 ? 837  GLN A O   1 
ATOM   4865  C  CB  . GLN A  1 837  ? -6.702  30.176  56.365  1.00 275.21 ? 837  GLN A CB  1 
ATOM   4866  C  CG  . GLN A  1 837  ? -6.896  30.015  54.853  1.00 318.23 ? 837  GLN A CG  1 
ATOM   4867  C  CD  . GLN A  1 837  ? -7.049  31.344  54.134  1.00 338.39 ? 837  GLN A CD  1 
ATOM   4868  O  OE1 . GLN A  1 837  ? -7.078  32.402  54.764  1.00 392.05 ? 837  GLN A OE1 1 
ATOM   4869  N  NE2 . GLN A  1 837  ? -7.145  31.295  52.808  1.00 280.76 ? 837  GLN A NE2 1 
ATOM   4870  N  N   . GLY A  1 838  ? -4.325  27.473  56.749  1.00 174.68 ? 838  GLY A N   1 
ATOM   4871  C  CA  . GLY A  1 838  ? -3.033  27.193  56.157  1.00 213.59 ? 838  GLY A CA  1 
ATOM   4872  C  C   . GLY A  1 838  ? -2.311  26.048  56.809  1.00 202.94 ? 838  GLY A C   1 
ATOM   4873  O  O   . GLY A  1 838  ? -1.740  25.192  56.132  1.00 195.27 ? 838  GLY A O   1 
ATOM   4874  N  N   . THR A  1 839  ? -2.334  26.035  58.133  1.00 152.07 ? 839  THR A N   1 
ATOM   4875  C  CA  . THR A  1 839  ? -1.623  25.022  58.882  1.00 153.73 ? 839  THR A CA  1 
ATOM   4876  C  C   . THR A  1 839  ? -2.582  23.907  59.260  1.00 115.97 ? 839  THR A C   1 
ATOM   4877  O  O   . THR A  1 839  ? -3.799  24.067  59.150  1.00 134.97 ? 839  THR A O   1 
ATOM   4878  C  CB  . THR A  1 839  ? -1.012  25.625  60.136  1.00 169.94 ? 839  THR A CB  1 
ATOM   4879  O  OG1 . THR A  1 839  ? -2.022  26.368  60.836  1.00 106.25 ? 839  THR A OG1 1 
ATOM   4880  C  CG2 . THR A  1 839  ? 0.136   26.562  59.771  1.00 230.91 ? 839  THR A CG2 1 
ATOM   4881  N  N   . TRP A  1 840  ? -2.022  22.780  59.700  1.00 136.98 ? 840  TRP A N   1 
ATOM   4882  C  CA  . TRP A  1 840  ? -2.817  21.620  60.096  1.00 192.19 ? 840  TRP A CA  1 
ATOM   4883  C  C   . TRP A  1 840  ? -1.932  20.541  60.745  1.00 193.64 ? 840  TRP A C   1 
ATOM   4884  O  O   . TRP A  1 840  ? -0.717  20.505  60.515  1.00 99.23  ? 840  TRP A O   1 
ATOM   4885  C  CB  . TRP A  1 840  ? -3.577  21.071  58.891  1.00 162.75 ? 840  TRP A CB  1 
ATOM   4886  C  CG  . TRP A  1 840  ? -2.693  20.645  57.786  1.00 107.58 ? 840  TRP A CG  1 
ATOM   4887  C  CD1 . TRP A  1 840  ? -1.435  21.089  57.533  1.00 205.53 ? 840  TRP A CD1 1 
ATOM   4888  C  CD2 . TRP A  1 840  ? -2.995  19.687  56.767  1.00 161.55 ? 840  TRP A CD2 1 
ATOM   4889  N  NE1 . TRP A  1 840  ? -0.925  20.463  56.425  1.00 297.96 ? 840  TRP A NE1 1 
ATOM   4890  C  CE2 . TRP A  1 840  ? -1.864  19.597  55.933  1.00 251.09 ? 840  TRP A CE2 1 
ATOM   4891  C  CE3 . TRP A  1 840  ? -4.108  18.896  56.479  1.00 147.05 ? 840  TRP A CE3 1 
ATOM   4892  C  CZ2 . TRP A  1 840  ? -1.813  18.744  54.830  1.00 206.76 ? 840  TRP A CZ2 1 
ATOM   4893  C  CZ3 . TRP A  1 840  ? -4.056  18.047  55.382  1.00 128.14 ? 840  TRP A CZ3 1 
ATOM   4894  C  CH2 . TRP A  1 840  ? -2.915  17.979  54.574  1.00 167.37 ? 840  TRP A CH2 1 
ATOM   4895  N  N   . SER A  1 841  ? -2.558  19.666  61.541  1.00 216.61 ? 841  SER A N   1 
ATOM   4896  C  CA  . SER A  1 841  ? -1.852  18.743  62.444  1.00 133.48 ? 841  SER A CA  1 
ATOM   4897  C  C   . SER A  1 841  ? -1.846  17.296  61.978  1.00 149.14 ? 841  SER A C   1 
ATOM   4898  O  O   . SER A  1 841  ? -2.839  16.783  61.459  1.00 190.28 ? 841  SER A O   1 
ATOM   4899  C  CB  . SER A  1 841  ? -2.492  18.775  63.838  1.00 167.96 ? 841  SER A CB  1 
ATOM   4900  O  OG  . SER A  1 841  ? -1.982  17.744  64.679  1.00 213.78 ? 841  SER A OG  1 
ATOM   4901  N  N   . THR A  1 842  ? -0.715  16.639  62.196  1.00 134.48 ? 842  THR A N   1 
ATOM   4902  C  CA  . THR A  1 842  ? -0.593  15.216  61.925  1.00 195.28 ? 842  THR A CA  1 
ATOM   4903  C  C   . THR A  1 842  ? -0.237  14.517  63.246  1.00 194.49 ? 842  THR A C   1 
ATOM   4904  O  O   . THR A  1 842  ? 0.936   14.452  63.639  1.00 145.65 ? 842  THR A O   1 
ATOM   4905  C  CB  . THR A  1 842  ? 0.471   14.916  60.813  1.00 143.30 ? 842  THR A CB  1 
ATOM   4906  O  OG1 . THR A  1 842  ? 1.624   15.738  61.015  1.00 180.78 ? 842  THR A OG1 1 
ATOM   4907  C  CG2 . THR A  1 842  ? -0.077  15.181  59.409  1.00 93.62  ? 842  THR A CG2 1 
ATOM   4908  N  N   . SER A  1 843  ? -1.265  14.014  63.933  1.00 193.65 ? 843  SER A N   1 
ATOM   4909  C  CA  . SER A  1 843  ? -1.090  13.310  65.203  1.00 116.55 ? 843  SER A CA  1 
ATOM   4910  C  C   . SER A  1 843  ? -0.507  11.918  64.962  1.00 168.09 ? 843  SER A C   1 
ATOM   4911  O  O   . SER A  1 843  ? -0.678  11.346  63.886  1.00 252.18 ? 843  SER A O   1 
ATOM   4912  C  CB  . SER A  1 843  ? -2.427  13.194  65.931  1.00 95.17  ? 843  SER A CB  1 
ATOM   4913  O  OG  . SER A  1 843  ? -3.383  12.510  65.139  1.00 212.79 ? 843  SER A OG  1 
ATOM   4914  N  N   . CYS A  1 844  ? 0.186   11.383  65.965  1.00 78.85  ? 844  CYS A N   1 
ATOM   4915  C  CA  . CYS A  1 844  ? 0.832   10.068  65.850  1.00 172.72 ? 844  CYS A CA  1 
ATOM   4916  C  C   . CYS A  1 844  ? 0.964   9.366   67.203  1.00 194.42 ? 844  CYS A C   1 
ATOM   4917  O  O   . CYS A  1 844  ? 1.966   9.530   67.898  1.00 261.13 ? 844  CYS A O   1 
ATOM   4918  C  CB  . CYS A  1 844  ? 2.227   10.198  65.215  1.00 159.50 ? 844  CYS A CB  1 
ATOM   4919  S  SG  . CYS A  1 844  ? 2.233   10.550  63.436  1.00 171.68 ? 844  CYS A SG  1 
ATOM   4920  N  N   . ARG A  1 845  ? -0.038  8.572   67.566  1.00 158.89 ? 845  ARG A N   1 
ATOM   4921  C  CA  . ARG A  1 845  ? -0.016  7.865   68.839  1.00 142.95 ? 845  ARG A CA  1 
ATOM   4922  C  C   . ARG A  1 845  ? 0.784   6.566   68.751  1.00 115.10 ? 845  ARG A C   1 
ATOM   4923  O  O   . ARG A  1 845  ? 0.479   5.695   67.937  1.00 237.07 ? 845  ARG A O   1 
ATOM   4924  C  CB  . ARG A  1 845  ? -1.443  7.569   69.300  1.00 186.47 ? 845  ARG A CB  1 
ATOM   4925  C  CG  . ARG A  1 845  ? -2.195  6.601   68.412  1.00 208.41 ? 845  ARG A CG  1 
ATOM   4926  C  CD  . ARG A  1 845  ? -3.605  6.409   68.910  1.00 229.03 ? 845  ARG A CD  1 
ATOM   4927  N  NE  . ARG A  1 845  ? -3.630  5.895   70.274  1.00 248.84 ? 845  ARG A NE  1 
ATOM   4928  C  CZ  . ARG A  1 845  ? -3.683  4.605   70.587  1.00 256.65 ? 845  ARG A CZ  1 
ATOM   4929  N  NH1 . ARG A  1 845  ? -3.720  3.685   69.632  1.00 257.37 ? 845  ARG A NH1 1 
ATOM   4930  N  NH2 . ARG A  1 845  ? -3.701  4.232   71.861  1.00 249.19 ? 845  ARG A NH2 1 
ATOM   4931  N  N   . ILE A  1 846  ? 1.808   6.437   69.595  1.00 143.94 ? 846  ILE A N   1 
ATOM   4932  C  CA  . ILE A  1 846  ? 2.582   5.197   69.671  1.00 101.15 ? 846  ILE A CA  1 
ATOM   4933  C  C   . ILE A  1 846  ? 1.660   4.044   70.014  1.00 125.25 ? 846  ILE A C   1 
ATOM   4934  O  O   . ILE A  1 846  ? 1.363   3.781   71.178  1.00 185.12 ? 846  ILE A O   1 
ATOM   4935  C  CB  . ILE A  1 846  ? 3.694   5.272   70.716  1.00 88.82  ? 846  ILE A CB  1 
ATOM   4936  C  CG1 . ILE A  1 846  ? 4.718   6.338   70.305  1.00 115.05 ? 846  ILE A CG1 1 
ATOM   4937  C  CG2 . ILE A  1 846  ? 4.344   3.902   70.874  1.00 93.01  ? 846  ILE A CG2 1 
ATOM   4938  C  CD1 . ILE A  1 846  ? 5.931   6.440   71.213  1.00 134.47 ? 846  ILE A CD1 1 
ATOM   4939  N  N   . ASN A  1 847  ? 1.230   3.352   68.974  1.00 171.11 ? 847  ASN A N   1 
ATOM   4940  C  CA  . ASN A  1 847  ? 0.080   2.476   69.050  1.00 209.06 ? 847  ASN A CA  1 
ATOM   4941  C  C   . ASN A  1 847  ? 0.081   1.518   70.238  1.00 202.94 ? 847  ASN A C   1 
ATOM   4942  O  O   . ASN A  1 847  ? -0.615  1.747   71.228  1.00 145.20 ? 847  ASN A O   1 
ATOM   4943  C  CB  . ASN A  1 847  ? -0.038  1.688   67.745  1.00 247.41 ? 847  ASN A CB  1 
ATOM   4944  C  CG  . ASN A  1 847  ? -1.466  1.356   67.400  1.00 257.44 ? 847  ASN A CG  1 
ATOM   4945  O  OD1 . ASN A  1 847  ? -2.398  1.845   68.037  1.00 231.12 ? 847  ASN A OD1 1 
ATOM   4946  N  ND2 . ASN A  1 847  ? -1.650  0.529   66.382  1.00 274.71 ? 847  ASN A ND2 1 
ATOM   4947  N  N   . HIS A  1 848  ? 0.868   0.453   70.143  1.00 217.63 ? 848  HIS A N   1 
ATOM   4948  C  CA  . HIS A  1 848  ? 0.648   -0.708  70.993  1.00 204.41 ? 848  HIS A CA  1 
ATOM   4949  C  C   . HIS A  1 848  ? 1.793   -1.049  71.941  1.00 174.08 ? 848  HIS A C   1 
ATOM   4950  O  O   . HIS A  1 848  ? 2.374   -2.131  71.850  1.00 240.50 ? 848  HIS A O   1 
ATOM   4951  C  CB  . HIS A  1 848  ? 0.344   -1.928  70.124  1.00 230.78 ? 848  HIS A CB  1 
ATOM   4952  C  CG  . HIS A  1 848  ? 1.423   -2.250  69.135  1.00 213.91 ? 848  HIS A CG  1 
ATOM   4953  N  ND1 . HIS A  1 848  ? 2.579   -2.915  69.484  1.00 188.29 ? 848  HIS A ND1 1 
ATOM   4954  C  CD2 . HIS A  1 848  ? 1.515   -2.001  67.808  1.00 230.47 ? 848  HIS A CD2 1 
ATOM   4955  C  CE1 . HIS A  1 848  ? 3.340   -3.059  68.412  1.00 244.05 ? 848  HIS A CE1 1 
ATOM   4956  N  NE2 . HIS A  1 848  ? 2.718   -2.515  67.384  1.00 270.98 ? 848  HIS A NE2 1 
ATOM   4957  N  N   . LEU A  1 849  ? 2.104   -0.133  72.854  1.00 137.20 ? 849  LEU A N   1 
ATOM   4958  C  CA  . LEU A  1 849  ? 2.909   -0.474  74.034  1.00 203.30 ? 849  LEU A CA  1 
ATOM   4959  C  C   . LEU A  1 849  ? 3.231   0.749   74.906  1.00 180.48 ? 849  LEU A C   1 
ATOM   4960  O  O   . LEU A  1 849  ? 2.902   1.892   74.549  1.00 128.06 ? 849  LEU A O   1 
ATOM   4961  C  CB  . LEU A  1 849  ? 4.178   -1.259  73.656  1.00 232.98 ? 849  LEU A CB  1 
ATOM   4962  C  CG  . LEU A  1 849  ? 5.140   -0.662  72.636  1.00 212.09 ? 849  LEU A CG  1 
ATOM   4963  C  CD1 . LEU A  1 849  ? 6.044   0.349   73.332  1.00 139.92 ? 849  LEU A CD1 1 
ATOM   4964  C  CD2 . LEU A  1 849  ? 5.954   -1.769  71.965  1.00 215.14 ? 849  LEU A CD2 1 
ATOM   4965  N  N   . ILE A  1 850  ? 3.865   0.491   76.053  1.00 201.28 ? 850  ILE A N   1 
ATOM   4966  C  CA  . ILE A  1 850  ? 3.969   1.482   77.129  1.00 183.32 ? 850  ILE A CA  1 
ATOM   4967  C  C   . ILE A  1 850  ? 5.281   2.260   77.162  1.00 178.73 ? 850  ILE A C   1 
ATOM   4968  O  O   . ILE A  1 850  ? 6.333   1.769   76.741  1.00 185.58 ? 850  ILE A O   1 
ATOM   4969  C  CB  . ILE A  1 850  ? 3.812   0.828   78.515  1.00 122.36 ? 850  ILE A CB  1 
ATOM   4970  C  CG1 . ILE A  1 850  ? 2.628   -0.137  78.525  1.00 126.38 ? 850  ILE A CG1 1 
ATOM   4971  C  CG2 . ILE A  1 850  ? 3.643   1.905   79.586  1.00 115.05 ? 850  ILE A CG2 1 
ATOM   4972  C  CD1 . ILE A  1 850  ? 2.417   -0.826  79.856  1.00 160.21 ? 850  ILE A CD1 1 
ATOM   4973  N  N   . PHE A  1 851  ? 5.197   3.474   77.703  1.00 123.01 ? 851  PHE A N   1 
ATOM   4974  C  CA  . PHE A  1 851  ? 6.346   4.370   77.824  1.00 126.88 ? 851  PHE A CA  1 
ATOM   4975  C  C   . PHE A  1 851  ? 6.553   4.658   79.305  1.00 155.08 ? 851  PHE A C   1 
ATOM   4976  O  O   . PHE A  1 851  ? 5.915   5.545   79.884  1.00 134.69 ? 851  PHE A O   1 
ATOM   4977  C  CB  . PHE A  1 851  ? 6.088   5.664   77.033  1.00 144.83 ? 851  PHE A CB  1 
ATOM   4978  C  CG  . PHE A  1 851  ? 7.286   6.593   76.936  1.00 172.25 ? 851  PHE A CG  1 
ATOM   4979  C  CD1 . PHE A  1 851  ? 7.099   7.976   76.836  1.00 63.03  ? 851  PHE A CD1 1 
ATOM   4980  C  CD2 . PHE A  1 851  ? 8.592   6.089   76.927  1.00 188.54 ? 851  PHE A CD2 1 
ATOM   4981  C  CE1 . PHE A  1 851  ? 8.204   8.842   76.747  1.00 125.21 ? 851  PHE A CE1 1 
ATOM   4982  C  CE2 . PHE A  1 851  ? 9.694   6.946   76.833  1.00 139.85 ? 851  PHE A CE2 1 
ATOM   4983  C  CZ  . PHE A  1 851  ? 9.501   8.323   76.743  1.00 108.93 ? 851  PHE A CZ  1 
ATOM   4984  N  N   . ARG A  1 852  ? 7.444   3.891   79.920  1.00 120.46 ? 852  ARG A N   1 
ATOM   4985  C  CA  . ARG A  1 852  ? 7.538   3.877   81.369  1.00 148.27 ? 852  ARG A CA  1 
ATOM   4986  C  C   . ARG A  1 852  ? 8.697   4.703   81.908  1.00 158.49 ? 852  ARG A C   1 
ATOM   4987  O  O   . ARG A  1 852  ? 9.660   5.002   81.196  1.00 152.95 ? 852  ARG A O   1 
ATOM   4988  C  CB  . ARG A  1 852  ? 7.658   2.432   81.864  1.00 199.42 ? 852  ARG A CB  1 
ATOM   4989  C  CG  . ARG A  1 852  ? 6.367   1.651   81.780  1.00 221.62 ? 852  ARG A CG  1 
ATOM   4990  C  CD  . ARG A  1 852  ? 6.527   0.279   82.399  1.00 127.91 ? 852  ARG A CD  1 
ATOM   4991  N  NE  . ARG A  1 852  ? 5.237   -0.348  82.688  1.00 160.00 ? 852  ARG A NE  1 
ATOM   4992  C  CZ  . ARG A  1 852  ? 5.094   -1.555  83.227  1.00 236.77 ? 852  ARG A CZ  1 
ATOM   4993  N  NH1 . ARG A  1 852  ? 6.162   -2.274  83.546  1.00 285.51 ? 852  ARG A NH1 1 
ATOM   4994  N  NH2 . ARG A  1 852  ? 3.881   -2.045  83.449  1.00 229.03 ? 852  ARG A NH2 1 
ATOM   4995  N  N   . GLY A  1 853  ? 8.582   5.061   83.183  1.00 134.11 ? 853  GLY A N   1 
ATOM   4996  C  CA  . GLY A  1 853  ? 9.679   5.650   83.930  1.00 166.37 ? 853  GLY A CA  1 
ATOM   4997  C  C   . GLY A  1 853  ? 10.365  6.801   83.231  1.00 137.85 ? 853  GLY A C   1 
ATOM   4998  O  O   . GLY A  1 853  ? 9.826   7.386   82.299  1.00 157.39 ? 853  GLY A O   1 
ATOM   4999  N  N   . GLY A  1 854  ? 11.571  7.114   83.688  1.00 162.54 ? 854  GLY A N   1 
ATOM   5000  C  CA  . GLY A  1 854  ? 12.349  8.195   83.120  1.00 162.87 ? 854  GLY A CA  1 
ATOM   5001  C  C   . GLY A  1 854  ? 13.049  7.752   81.857  1.00 177.17 ? 854  GLY A C   1 
ATOM   5002  O  O   . GLY A  1 854  ? 14.088  8.302   81.493  1.00 235.29 ? 854  GLY A O   1 
ATOM   5003  N  N   . ALA A  1 855  ? 12.488  6.747   81.188  1.00 147.70 ? 855  ALA A N   1 
ATOM   5004  C  CA  . ALA A  1 855  ? 13.068  6.248   79.947  1.00 220.62 ? 855  ALA A CA  1 
ATOM   5005  C  C   . ALA A  1 855  ? 12.808  7.221   78.796  1.00 232.02 ? 855  ALA A C   1 
ATOM   5006  O  O   . ALA A  1 855  ? 11.714  7.780   78.664  1.00 189.71 ? 855  ALA A O   1 
ATOM   5007  C  CB  . ALA A  1 855  ? 12.518  4.865   79.614  1.00 190.42 ? 855  ALA A CB  1 
ATOM   5008  N  N   . GLN A  1 856  ? 13.828  7.430   77.972  1.00 215.69 ? 856  GLN A N   1 
ATOM   5009  C  CA  . GLN A  1 856  ? 13.690  8.253   76.782  1.00 164.56 ? 856  GLN A CA  1 
ATOM   5010  C  C   . GLN A  1 856  ? 13.663  7.324   75.573  1.00 196.05 ? 856  GLN A C   1 
ATOM   5011  O  O   . GLN A  1 856  ? 14.176  6.199   75.628  1.00 212.78 ? 856  GLN A O   1 
ATOM   5012  C  CB  . GLN A  1 856  ? 14.851  9.245   76.666  1.00 157.29 ? 856  GLN A CB  1 
ATOM   5013  C  CG  . GLN A  1 856  ? 16.203  8.581   76.470  1.00 172.87 ? 856  GLN A CG  1 
ATOM   5014  C  CD  . GLN A  1 856  ? 17.326  9.581   76.312  1.00 211.79 ? 856  GLN A CD  1 
ATOM   5015  O  OE1 . GLN A  1 856  ? 17.138  10.782  76.508  1.00 219.09 ? 856  GLN A OE1 1 
ATOM   5016  N  NE2 . GLN A  1 856  ? 18.507  9.088   75.957  1.00 241.22 ? 856  GLN A NE2 1 
ATOM   5017  N  N   . ILE A  1 857  ? 13.051  7.791   74.489  1.00 173.14 ? 857  ILE A N   1 
ATOM   5018  C  CA  . ILE A  1 857  ? 13.015  7.034   73.242  1.00 177.22 ? 857  ILE A CA  1 
ATOM   5019  C  C   . ILE A  1 857  ? 13.088  7.980   72.036  1.00 179.31 ? 857  ILE A C   1 
ATOM   5020  O  O   . ILE A  1 857  ? 12.592  9.122   72.082  1.00 90.43  ? 857  ILE A O   1 
ATOM   5021  C  CB  . ILE A  1 857  ? 11.750  6.165   73.147  1.00 140.44 ? 857  ILE A CB  1 
ATOM   5022  C  CG1 . ILE A  1 857  ? 10.507  7.060   73.104  1.00 102.81 ? 857  ILE A CG1 1 
ATOM   5023  C  CG2 . ILE A  1 857  ? 11.701  5.177   74.316  1.00 168.71 ? 857  ILE A CG2 1 
ATOM   5024  C  CD1 . ILE A  1 857  ? 9.244   6.320   72.762  1.00 128.40 ? 857  ILE A CD1 1 
ATOM   5025  N  N   . THR A  1 858  ? 13.721  7.491   70.969  1.00 188.46 ? 858  THR A N   1 
ATOM   5026  C  CA  . THR A  1 858  ? 13.879  8.251   69.733  1.00 133.90 ? 858  THR A CA  1 
ATOM   5027  C  C   . THR A  1 858  ? 13.373  7.472   68.519  1.00 154.81 ? 858  THR A C   1 
ATOM   5028  O  O   . THR A  1 858  ? 13.718  6.299   68.320  1.00 202.20 ? 858  THR A O   1 
ATOM   5029  C  CB  . THR A  1 858  ? 15.351  8.617   69.489  1.00 150.99 ? 858  THR A CB  1 
ATOM   5030  O  OG1 . THR A  1 858  ? 16.160  7.439   69.619  1.00 218.41 ? 858  THR A OG1 1 
ATOM   5031  C  CG2 . THR A  1 858  ? 15.813  9.693   70.484  1.00 107.86 ? 858  THR A CG2 1 
ATOM   5032  N  N   . PHE A  1 859  ? 12.551  8.139   67.710  1.00 101.38 ? 859  PHE A N   1 
ATOM   5033  C  CA  . PHE A  1 859  ? 12.040  7.539   66.483  1.00 211.01 ? 859  PHE A CA  1 
ATOM   5034  C  C   . PHE A  1 859  ? 12.189  8.543   65.338  1.00 193.65 ? 859  PHE A C   1 
ATOM   5035  O  O   . PHE A  1 859  ? 12.474  9.731   65.580  1.00 92.17  ? 859  PHE A O   1 
ATOM   5036  C  CB  . PHE A  1 859  ? 10.575  7.116   66.665  1.00 243.64 ? 859  PHE A CB  1 
ATOM   5037  C  CG  . PHE A  1 859  ? 9.635   8.271   66.913  1.00 50.10  ? 859  PHE A CG  1 
ATOM   5038  C  CD1 . PHE A  1 859  ? 9.459   8.796   68.179  1.00 176.78 ? 859  PHE A CD1 1 
ATOM   5039  C  CD2 . PHE A  1 859  ? 8.929   8.831   65.867  1.00 158.43 ? 859  PHE A CD2 1 
ATOM   5040  C  CE1 . PHE A  1 859  ? 8.590   9.868   68.395  1.00 148.57 ? 859  PHE A CE1 1 
ATOM   5041  C  CE2 . PHE A  1 859  ? 8.060   9.903   66.076  1.00 196.87 ? 859  PHE A CE2 1 
ATOM   5042  C  CZ  . PHE A  1 859  ? 7.893   10.421  67.340  1.00 97.13  ? 859  PHE A CZ  1 
ATOM   5043  N  N   . LEU A  1 860  ? 12.008  8.056   64.106  1.00 225.35 ? 860  LEU A N   1 
ATOM   5044  C  CA  . LEU A  1 860  ? 12.142  8.882   62.904  1.00 180.03 ? 860  LEU A CA  1 
ATOM   5045  C  C   . LEU A  1 860  ? 10.823  9.023   62.150  1.00 173.90 ? 860  LEU A C   1 
ATOM   5046  O  O   . LEU A  1 860  ? 10.169  8.031   61.795  1.00 160.53 ? 860  LEU A O   1 
ATOM   5047  C  CB  . LEU A  1 860  ? 13.196  8.295   61.974  1.00 154.46 ? 860  LEU A CB  1 
ATOM   5048  C  CG  . LEU A  1 860  ? 13.769  9.269   60.953  1.00 109.79 ? 860  LEU A CG  1 
ATOM   5049  C  CD1 . LEU A  1 860  ? 15.078  8.716   60.430  1.00 229.38 ? 860  LEU A CD1 1 
ATOM   5050  C  CD2 . LEU A  1 860  ? 12.785  9.491   59.819  1.00 207.66 ? 860  LEU A CD2 1 
ATOM   5051  N  N   . ALA A  1 861  ? 10.444  10.275  61.910  1.00 116.16 ? 861  ALA A N   1 
ATOM   5052  C  CA  . ALA A  1 861  ? 9.207   10.579  61.198  1.00 167.87 ? 861  ALA A CA  1 
ATOM   5053  C  C   . ALA A  1 861  ? 9.525   11.492  60.037  1.00 163.83 ? 861  ALA A C   1 
ATOM   5054  O  O   . ALA A  1 861  ? 10.060  12.597  60.247  1.00 106.79 ? 861  ALA A O   1 
ATOM   5055  C  CB  . ALA A  1 861  ? 8.206   11.258  62.116  1.00 212.76 ? 861  ALA A CB  1 
ATOM   5056  N  N   . THR A  1 862  ? 9.175   11.031  58.830  1.00 166.32 ? 862  THR A N   1 
ATOM   5057  C  CA  . THR A  1 862  ? 9.481   11.745  57.590  1.00 154.91 ? 862  THR A CA  1 
ATOM   5058  C  C   . THR A  1 862  ? 8.266   12.389  56.882  1.00 135.25 ? 862  THR A C   1 
ATOM   5059  O  O   . THR A  1 862  ? 7.198   11.775  56.706  1.00 50.29  ? 862  THR A O   1 
ATOM   5060  C  CB  . THR A  1 862  ? 10.215  10.820  56.612  1.00 106.18 ? 862  THR A CB  1 
ATOM   5061  O  OG1 . THR A  1 862  ? 11.539  10.569  57.105  1.00 107.41 ? 862  THR A OG1 1 
ATOM   5062  C  CG2 . THR A  1 862  ? 10.294  11.471  55.232  1.00 209.70 ? 862  THR A CG2 1 
ATOM   5063  N  N   . PHE A  1 863  ? 8.464   13.643  56.472  1.00 93.56  ? 863  PHE A N   1 
ATOM   5064  C  CA  . PHE A  1 863  ? 7.429   14.414  55.791  1.00 97.92  ? 863  PHE A CA  1 
ATOM   5065  C  C   . PHE A  1 863  ? 7.789   14.771  54.364  1.00 158.32 ? 863  PHE A C   1 
ATOM   5066  O  O   . PHE A  1 863  ? 8.702   15.581  54.116  1.00 88.20  ? 863  PHE A O   1 
ATOM   5067  C  CB  . PHE A  1 863  ? 7.146   15.716  56.528  1.00 78.04  ? 863  PHE A CB  1 
ATOM   5068  C  CG  . PHE A  1 863  ? 6.508   15.519  57.883  1.00 191.02 ? 863  PHE A CG  1 
ATOM   5069  C  CD1 . PHE A  1 863  ? 7.248   14.993  58.941  1.00 140.34 ? 863  PHE A CD1 1 
ATOM   5070  C  CD2 . PHE A  1 863  ? 5.167   15.857  58.099  1.00 215.41 ? 863  PHE A CD2 1 
ATOM   5071  C  CE1 . PHE A  1 863  ? 6.673   14.811  60.184  1.00 149.33 ? 863  PHE A CE1 1 
ATOM   5072  C  CE2 . PHE A  1 863  ? 4.574   15.683  59.345  1.00 52.18  ? 863  PHE A CE2 1 
ATOM   5073  C  CZ  . PHE A  1 863  ? 5.334   15.155  60.390  1.00 222.23 ? 863  PHE A CZ  1 
ATOM   5074  N  N   . ASP A  1 864  ? 7.033   14.188  53.437  1.00 208.28 ? 864  ASP A N   1 
ATOM   5075  C  CA  . ASP A  1 864  ? 7.142   14.532  52.039  1.00 179.17 ? 864  ASP A CA  1 
ATOM   5076  C  C   . ASP A  1 864  ? 6.688   15.959  51.845  1.00 174.33 ? 864  ASP A C   1 
ATOM   5077  O  O   . ASP A  1 864  ? 5.666   16.392  52.391  1.00 107.37 ? 864  ASP A O   1 
ATOM   5078  C  CB  . ASP A  1 864  ? 6.287   13.603  51.195  1.00 160.19 ? 864  ASP A CB  1 
ATOM   5079  C  CG  . ASP A  1 864  ? 6.897   12.245  51.058  1.00 183.84 ? 864  ASP A CG  1 
ATOM   5080  O  OD1 . ASP A  1 864  ? 8.089   12.098  51.405  1.00 170.00 ? 864  ASP A OD1 1 
ATOM   5081  O  OD2 . ASP A  1 864  ? 6.188   11.330  50.602  1.00 215.17 ? 864  ASP A OD2 1 
ATOM   5082  N  N   . VAL A  1 865  ? 7.465   16.684  51.055  1.00 197.66 ? 865  VAL A N   1 
ATOM   5083  C  CA  . VAL A  1 865  ? 7.150   18.060  50.742  1.00 178.61 ? 865  VAL A CA  1 
ATOM   5084  C  C   . VAL A  1 865  ? 6.977   18.210  49.234  1.00 202.43 ? 865  VAL A C   1 
ATOM   5085  O  O   . VAL A  1 865  ? 7.783   17.690  48.453  1.00 220.73 ? 865  VAL A O   1 
ATOM   5086  C  CB  . VAL A  1 865  ? 8.247   19.012  51.247  1.00 74.76  ? 865  VAL A CB  1 
ATOM   5087  C  CG1 . VAL A  1 865  ? 9.468   18.992  50.308  1.00 164.03 ? 865  VAL A CG1 1 
ATOM   5088  C  CG2 . VAL A  1 865  ? 7.691   20.432  51.375  1.00 157.43 ? 865  VAL A CG2 1 
ATOM   5089  N  N   . SER A  1 866  ? 5.918   18.914  48.832  1.00 171.66 ? 866  SER A N   1 
ATOM   5090  C  CA  . SER A  1 866  ? 5.607   19.108  47.414  1.00 180.28 ? 866  SER A CA  1 
ATOM   5091  C  C   . SER A  1 866  ? 6.609   20.073  46.750  1.00 172.26 ? 866  SER A C   1 
ATOM   5092  O  O   . SER A  1 866  ? 7.107   21.008  47.401  1.00 141.63 ? 866  SER A O   1 
ATOM   5093  C  CB  . SER A  1 866  ? 4.156   19.597  47.237  1.00 154.34 ? 866  SER A CB  1 
ATOM   5094  O  OG  . SER A  1 866  ? 4.022   20.977  47.520  1.00 212.91 ? 866  SER A OG  1 
ATOM   5095  N  N   . PRO A  1 867  ? 6.935   19.824  45.464  1.00 130.94 ? 867  PRO A N   1 
ATOM   5096  C  CA  . PRO A  1 867  ? 7.813   20.707  44.681  1.00 105.32 ? 867  PRO A CA  1 
ATOM   5097  C  C   . PRO A  1 867  ? 7.213   22.111  44.515  1.00 151.28 ? 867  PRO A C   1 
ATOM   5098  O  O   . PRO A  1 867  ? 7.956   23.071  44.264  1.00 112.60 ? 867  PRO A O   1 
ATOM   5099  C  CB  . PRO A  1 867  ? 7.894   20.002  43.327  1.00 235.03 ? 867  PRO A CB  1 
ATOM   5100  C  CG  . PRO A  1 867  ? 7.546   18.569  43.606  1.00 233.01 ? 867  PRO A CG  1 
ATOM   5101  C  CD  . PRO A  1 867  ? 6.559   18.608  44.718  1.00 127.00 ? 867  PRO A CD  1 
ATOM   5102  N  N   . LYS A  1 868  ? 5.883   22.207  44.637  1.00 127.36 ? 868  LYS A N   1 
ATOM   5103  C  CA  . LYS A  1 868  ? 5.169   23.488  44.617  1.00 109.86 ? 868  LYS A CA  1 
ATOM   5104  C  C   . LYS A  1 868  ? 4.554   23.744  45.991  1.00 133.33 ? 868  LYS A C   1 
ATOM   5105  O  O   . LYS A  1 868  ? 3.335   23.900  46.120  1.00 175.60 ? 868  LYS A O   1 
ATOM   5106  C  CB  . LYS A  1 868  ? 4.067   23.491  43.550  1.00 211.97 ? 868  LYS A CB  1 
ATOM   5107  C  CG  . LYS A  1 868  ? 3.434   24.860  43.315  1.00 272.57 ? 868  LYS A CG  1 
ATOM   5108  C  CD  . LYS A  1 868  ? 2.854   24.995  41.911  1.00 280.23 ? 868  LYS A CD  1 
ATOM   5109  C  CE  . LYS A  1 868  ? 1.593   24.176  41.736  1.00 270.52 ? 868  LYS A CE  1 
ATOM   5110  N  NZ  . LYS A  1 868  ? 0.937   24.473  40.435  1.00 275.53 ? 868  LYS A NZ  1 
ATOM   5111  N  N   . ALA A  1 869  ? 5.409   23.782  47.014  1.00 139.99 ? 869  ALA A N   1 
ATOM   5112  C  CA  . ALA A  1 869  ? 4.972   23.955  48.393  1.00 112.92 ? 869  ALA A CA  1 
ATOM   5113  C  C   . ALA A  1 869  ? 4.761   25.431  48.693  1.00 138.69 ? 869  ALA A C   1 
ATOM   5114  O  O   . ALA A  1 869  ? 5.728   26.189  48.810  1.00 136.24 ? 869  ALA A O   1 
ATOM   5115  C  CB  . ALA A  1 869  ? 6.001   23.355  49.346  1.00 134.25 ? 869  ALA A CB  1 
ATOM   5116  N  N   . VAL A  1 870  ? 3.492   25.832  48.795  1.00 140.27 ? 870  VAL A N   1 
ATOM   5117  C  CA  . VAL A  1 870  ? 3.144   27.198  49.169  1.00 105.54 ? 870  VAL A CA  1 
ATOM   5118  C  C   . VAL A  1 870  ? 3.406   27.385  50.659  1.00 139.42 ? 870  VAL A C   1 
ATOM   5119  O  O   . VAL A  1 870  ? 2.736   26.774  51.493  1.00 253.27 ? 870  VAL A O   1 
ATOM   5120  C  CB  . VAL A  1 870  ? 1.668   27.511  48.871  1.00 203.65 ? 870  VAL A CB  1 
ATOM   5121  C  CG1 . VAL A  1 870  ? 1.333   28.933  49.296  1.00 183.79 ? 870  VAL A CG1 1 
ATOM   5122  C  CG2 . VAL A  1 870  ? 1.371   27.310  47.398  1.00 303.58 ? 870  VAL A CG2 1 
ATOM   5123  N  N   . LEU A  1 871  ? 4.392   28.216  50.989  1.00 150.95 ? 871  LEU A N   1 
ATOM   5124  C  CA  . LEU A  1 871  ? 4.751   28.485  52.386  1.00 195.68 ? 871  LEU A CA  1 
ATOM   5125  C  C   . LEU A  1 871  ? 5.644   29.723  52.505  1.00 207.71 ? 871  LEU A C   1 
ATOM   5126  O  O   . LEU A  1 871  ? 6.425   30.020  51.606  1.00 154.51 ? 871  LEU A O   1 
ATOM   5127  C  CB  . LEU A  1 871  ? 5.450   27.273  53.006  1.00 128.00 ? 871  LEU A CB  1 
ATOM   5128  C  CG  . LEU A  1 871  ? 6.654   26.737  52.233  1.00 97.53  ? 871  LEU A CG  1 
ATOM   5129  C  CD1 . LEU A  1 871  ? 7.919   27.501  52.578  1.00 152.21 ? 871  LEU A CD1 1 
ATOM   5130  C  CD2 . LEU A  1 871  ? 6.835   25.243  52.489  1.00 76.66  ? 871  LEU A CD2 1 
ATOM   5131  N  N   . GLY A  1 872  ? 5.530   30.443  53.618  1.00 222.22 ? 872  GLY A N   1 
ATOM   5132  C  CA  . GLY A  1 872  ? 6.256   31.690  53.789  1.00 213.03 ? 872  GLY A CA  1 
ATOM   5133  C  C   . GLY A  1 872  ? 7.744   31.529  53.543  1.00 158.38 ? 872  GLY A C   1 
ATOM   5134  O  O   . GLY A  1 872  ? 8.227   30.420  53.320  1.00 136.33 ? 872  GLY A O   1 
ATOM   5135  N  N   . ASP A  1 873  ? 8.476   32.639  53.573  1.00 159.64 ? 873  ASP A N   1 
ATOM   5136  C  CA  . ASP A  1 873  ? 9.935   32.597  53.448  1.00 157.25 ? 873  ASP A CA  1 
ATOM   5137  C  C   . ASP A  1 873  ? 10.578  31.805  54.595  1.00 187.03 ? 873  ASP A C   1 
ATOM   5138  O  O   . ASP A  1 873  ? 11.785  31.533  54.588  1.00 112.10 ? 873  ASP A O   1 
ATOM   5139  C  CB  . ASP A  1 873  ? 10.509  34.015  53.378  1.00 156.55 ? 873  ASP A CB  1 
ATOM   5140  C  CG  . ASP A  1 873  ? 10.172  34.848  54.595  1.00 191.33 ? 873  ASP A CG  1 
ATOM   5141  O  OD1 . ASP A  1 873  ? 9.419   34.366  55.465  1.00 251.01 ? 873  ASP A OD1 1 
ATOM   5142  O  OD2 . ASP A  1 873  ? 10.658  35.993  54.678  1.00 197.93 ? 873  ASP A OD2 1 
ATOM   5143  N  N   . ARG A  1 874  ? 9.756   31.432  55.572  1.00 206.41 ? 874  ARG A N   1 
ATOM   5144  C  CA  . ARG A  1 874  ? 10.182  30.587  56.679  1.00 116.88 ? 874  ARG A CA  1 
ATOM   5145  C  C   . ARG A  1 874  ? 9.051   29.627  57.021  1.00 153.66 ? 874  ARG A C   1 
ATOM   5146  O  O   . ARG A  1 874  ? 7.861   29.980  56.941  1.00 119.21 ? 874  ARG A O   1 
ATOM   5147  C  CB  . ARG A  1 874  ? 10.506  31.437  57.902  1.00 149.21 ? 874  ARG A CB  1 
ATOM   5148  C  CG  . ARG A  1 874  ? 11.407  32.620  57.618  1.00 190.74 ? 874  ARG A CG  1 
ATOM   5149  C  CD  . ARG A  1 874  ? 12.070  33.107  58.892  1.00 130.52 ? 874  ARG A CD  1 
ATOM   5150  N  NE  . ARG A  1 874  ? 12.936  32.074  59.454  1.00 104.18 ? 874  ARG A NE  1 
ATOM   5151  C  CZ  . ARG A  1 874  ? 13.514  32.146  60.649  1.00 171.67 ? 874  ARG A CZ  1 
ATOM   5152  N  NH1 . ARG A  1 874  ? 13.308  33.207  61.421  1.00 240.59 ? 874  ARG A NH1 1 
ATOM   5153  N  NH2 . ARG A  1 874  ? 14.289  31.154  61.077  1.00 164.49 ? 874  ARG A NH2 1 
ATOM   5154  N  N   . LEU A  1 875  ? 9.419   28.409  57.400  1.00 112.07 ? 875  LEU A N   1 
ATOM   5155  C  CA  . LEU A  1 875  ? 8.422   27.431  57.808  1.00 141.99 ? 875  LEU A CA  1 
ATOM   5156  C  C   . LEU A  1 875  ? 8.784   26.912  59.190  1.00 183.61 ? 875  LEU A C   1 
ATOM   5157  O  O   . LEU A  1 875  ? 9.922   26.468  59.408  1.00 107.29 ? 875  LEU A O   1 
ATOM   5158  C  CB  . LEU A  1 875  ? 8.358   26.288  56.802  1.00 155.11 ? 875  LEU A CB  1 
ATOM   5159  C  CG  . LEU A  1 875  ? 9.482   25.251  56.855  1.00 118.79 ? 875  LEU A CG  1 
ATOM   5160  C  CD1 . LEU A  1 875  ? 9.034   24.071  57.671  1.00 88.64  ? 875  LEU A CD1 1 
ATOM   5161  C  CD2 . LEU A  1 875  ? 9.818   24.769  55.462  1.00 253.66 ? 875  LEU A CD2 1 
ATOM   5162  N  N   . LEU A  1 876  ? 7.820   27.010  60.114  1.00 206.89 ? 876  LEU A N   1 
ATOM   5163  C  CA  . LEU A  1 876  ? 7.956   26.508  61.482  1.00 138.59 ? 876  LEU A CA  1 
ATOM   5164  C  C   . LEU A  1 876  ? 7.118   25.259  61.653  1.00 109.39 ? 876  LEU A C   1 
ATOM   5165  O  O   . LEU A  1 876  ? 6.222   24.959  60.859  1.00 115.40 ? 876  LEU A O   1 
ATOM   5166  C  CB  . LEU A  1 876  ? 7.494   27.552  62.503  1.00 105.84 ? 876  LEU A CB  1 
ATOM   5167  C  CG  . LEU A  1 876  ? 6.015   27.942  62.424  1.00 184.81 ? 876  LEU A CG  1 
ATOM   5168  C  CD1 . LEU A  1 876  ? 5.126   26.921  63.121  1.00 189.51 ? 876  LEU A CD1 1 
ATOM   5169  C  CD2 . LEU A  1 876  ? 5.802   29.320  63.028  1.00 256.20 ? 876  LEU A CD2 1 
ATOM   5170  N  N   . LEU A  1 877  ? 7.407   24.538  62.719  1.00 140.20 ? 877  LEU A N   1 
ATOM   5171  C  CA  . LEU A  1 877  ? 6.655   23.347  63.035  1.00 172.14 ? 877  LEU A CA  1 
ATOM   5172  C  C   . LEU A  1 877  ? 6.887   22.998  64.513  1.00 184.13 ? 877  LEU A C   1 
ATOM   5173  O  O   . LEU A  1 877  ? 7.982   23.227  65.077  1.00 58.07  ? 877  LEU A O   1 
ATOM   5174  C  CB  . LEU A  1 877  ? 7.040   22.204  62.077  1.00 89.29  ? 877  LEU A CB  1 
ATOM   5175  C  CG  . LEU A  1 877  ? 8.517   21.769  62.095  1.00 59.98  ? 877  LEU A CG  1 
ATOM   5176  C  CD1 . LEU A  1 877  ? 8.737   20.710  63.149  1.00 176.23 ? 877  LEU A CD1 1 
ATOM   5177  C  CD2 . LEU A  1 877  ? 8.931   21.205  60.780  1.00 108.16 ? 877  LEU A CD2 1 
ATOM   5178  N  N   . THR A  1 878  ? 5.833   22.476  65.137  1.00 117.42 ? 878  THR A N   1 
ATOM   5179  C  CA  . THR A  1 878  ? 5.844   22.173  66.559  1.00 111.46 ? 878  THR A CA  1 
ATOM   5180  C  C   . THR A  1 878  ? 5.608   20.685  66.821  1.00 111.18 ? 878  THR A C   1 
ATOM   5181  O  O   . THR A  1 878  ? 5.464   19.878  65.883  1.00 73.76  ? 878  THR A O   1 
ATOM   5182  C  CB  . THR A  1 878  ? 4.767   22.981  67.293  1.00 136.50 ? 878  THR A CB  1 
ATOM   5183  O  OG1 . THR A  1 878  ? 3.488   22.355  67.112  1.00 111.58 ? 878  THR A OG1 1 
ATOM   5184  C  CG2 . THR A  1 878  ? 4.746   24.426  66.782  1.00 77.11  ? 878  THR A CG2 1 
ATOM   5185  N  N   . ALA A  1 879  ? 5.571   20.341  68.110  1.00 80.72  ? 879  ALA A N   1 
ATOM   5186  C  CA  . ALA A  1 879  ? 5.352   18.967  68.559  1.00 141.94 ? 879  ALA A CA  1 
ATOM   5187  C  C   . ALA A  1 879  ? 4.727   18.918  69.963  1.00 161.92 ? 879  ALA A C   1 
ATOM   5188  O  O   . ALA A  1 879  ? 5.440   18.920  70.977  1.00 57.85  ? 879  ALA A O   1 
ATOM   5189  C  CB  . ALA A  1 879  ? 6.662   18.189  68.533  1.00 113.15 ? 879  ALA A CB  1 
ATOM   5190  N  N   . ASN A  1 880  ? 3.395   18.876  70.013  1.00 191.52 ? 880  ASN A N   1 
ATOM   5191  C  CA  . ASN A  1 880  ? 2.685   18.661  71.270  1.00 66.48  ? 880  ASN A CA  1 
ATOM   5192  C  C   . ASN A  1 880  ? 2.886   17.199  71.700  1.00 148.70 ? 880  ASN A C   1 
ATOM   5193  O  O   . ASN A  1 880  ? 2.720   16.275  70.889  1.00 110.89 ? 880  ASN A O   1 
ATOM   5194  C  CB  . ASN A  1 880  ? 1.191   18.981  71.126  1.00 115.50 ? 880  ASN A CB  1 
ATOM   5195  C  CG  . ASN A  1 880  ? 0.930   20.466  70.998  1.00 125.13 ? 880  ASN A CG  1 
ATOM   5196  O  OD1 . ASN A  1 880  ? 1.826   21.227  70.649  1.00 178.10 ? 880  ASN A OD1 1 
ATOM   5197  N  ND2 . ASN A  1 880  ? -0.306  20.877  71.226  1.00 148.38 ? 880  ASN A ND2 1 
ATOM   5198  N  N   . VAL A  1 881  ? 3.258   16.989  72.966  1.00 173.73 ? 881  VAL A N   1 
ATOM   5199  C  CA  . VAL A  1 881  ? 3.429   15.640  73.513  1.00 134.04 ? 881  VAL A CA  1 
ATOM   5200  C  C   . VAL A  1 881  ? 2.659   15.496  74.832  1.00 161.28 ? 881  VAL A C   1 
ATOM   5201  O  O   . VAL A  1 881  ? 2.746   16.363  75.709  1.00 182.09 ? 881  VAL A O   1 
ATOM   5202  C  CB  . VAL A  1 881  ? 4.919   15.306  73.726  1.00 94.72  ? 881  VAL A CB  1 
ATOM   5203  C  CG1 . VAL A  1 881  ? 5.523   16.264  74.743  1.00 136.76 ? 881  VAL A CG1 1 
ATOM   5204  C  CG2 . VAL A  1 881  ? 5.082   13.824  74.129  1.00 77.65  ? 881  VAL A CG2 1 
ATOM   5205  N  N   . SER A  1 882  ? 1.895   14.406  74.947  1.00 64.11  ? 882  SER A N   1 
ATOM   5206  C  CA  . SER A  1 882  ? 1.084   14.129  76.138  1.00 165.35 ? 882  SER A CA  1 
ATOM   5207  C  C   . SER A  1 882  ? 0.839   12.625  76.281  1.00 136.51 ? 882  SER A C   1 
ATOM   5208  O  O   . SER A  1 882  ? 1.282   11.837  75.446  1.00 142.35 ? 882  SER A O   1 
ATOM   5209  C  CB  . SER A  1 882  ? -0.255  14.900  76.113  1.00 203.30 ? 882  SER A CB  1 
ATOM   5210  O  OG  . SER A  1 882  ? -1.229  14.296  75.276  1.00 104.51 ? 882  SER A OG  1 
ATOM   5211  N  N   . SER A  1 883  ? 0.160   12.230  77.359  1.00 179.95 ? 883  SER A N   1 
ATOM   5212  C  CA  . SER A  1 883  ? -0.174  10.821  77.605  1.00 159.23 ? 883  SER A CA  1 
ATOM   5213  C  C   . SER A  1 883  ? -1.549  10.479  77.046  1.00 127.74 ? 883  SER A C   1 
ATOM   5214  O  O   . SER A  1 883  ? -2.284  11.365  76.573  1.00 90.32  ? 883  SER A O   1 
ATOM   5215  C  CB  . SER A  1 883  ? -0.164  10.522  79.111  1.00 201.79 ? 883  SER A CB  1 
ATOM   5216  O  OG  . SER A  1 883  ? -1.129  11.317  79.797  1.00 200.71 ? 883  SER A OG  1 
ATOM   5217  N  N   . GLU A  1 884  ? -1.898  9.195   77.121  1.00 126.67 ? 884  GLU A N   1 
ATOM   5218  C  CA  . GLU A  1 884  ? -3.224  8.760   76.716  1.00 159.77 ? 884  GLU A CA  1 
ATOM   5219  C  C   . GLU A  1 884  ? -4.289  9.465   77.572  1.00 202.54 ? 884  GLU A C   1 
ATOM   5220  O  O   . GLU A  1 884  ? -5.414  9.709   77.109  1.00 90.01  ? 884  GLU A O   1 
ATOM   5221  C  CB  . GLU A  1 884  ? -3.362  7.251   76.850  1.00 130.98 ? 884  GLU A CB  1 
ATOM   5222  C  CG  . GLU A  1 884  ? -4.775  6.770   76.622  1.00 115.26 ? 884  GLU A CG  1 
ATOM   5223  C  CD  . GLU A  1 884  ? -4.967  5.339   77.038  1.00 186.48 ? 884  GLU A CD  1 
ATOM   5224  O  OE1 . GLU A  1 884  ? -4.052  4.530   76.780  1.00 196.76 ? 884  GLU A OE1 1 
ATOM   5225  O  OE2 . GLU A  1 884  ? -6.026  5.028   77.630  1.00 186.47 ? 884  GLU A OE2 1 
ATOM   5226  N  N   . ASN A  1 885  ? -3.918  9.786   78.818  1.00 229.67 ? 885  ASN A N   1 
ATOM   5227  C  CA  . ASN A  1 885  ? -4.810  10.444  79.781  1.00 145.64 ? 885  ASN A CA  1 
ATOM   5228  C  C   . ASN A  1 885  ? -4.891  11.956  79.544  1.00 154.65 ? 885  ASN A C   1 
ATOM   5229  O  O   . ASN A  1 885  ? -5.065  12.740  80.478  1.00 174.59 ? 885  ASN A O   1 
ATOM   5230  C  CB  . ASN A  1 885  ? -4.364  10.163  81.237  1.00 186.25 ? 885  ASN A CB  1 
ATOM   5231  C  CG  . ASN A  1 885  ? -4.599  8.697   81.686  1.00 205.50 ? 885  ASN A CG  1 
ATOM   5232  O  OD1 . ASN A  1 885  ? -5.332  7.932   81.055  1.00 89.76  ? 885  ASN A OD1 1 
ATOM   5233  N  ND2 . ASN A  1 885  ? -3.986  8.326   82.807  1.00 232.83 ? 885  ASN A ND2 1 
ATOM   5234  N  N   . ASN A  1 886  ? -4.762  12.362  78.287  1.00 221.40 ? 886  ASN A N   1 
ATOM   5235  C  CA  . ASN A  1 886  ? -4.968  13.751  77.918  1.00 263.66 ? 886  ASN A CA  1 
ATOM   5236  C  C   . ASN A  1 886  ? -4.029  14.675  78.677  1.00 209.75 ? 886  ASN A C   1 
ATOM   5237  O  O   . ASN A  1 886  ? -3.071  14.221  79.310  1.00 131.10 ? 886  ASN A O   1 
ATOM   5238  C  CB  . ASN A  1 886  ? -6.429  14.141  78.164  1.00 294.54 ? 886  ASN A CB  1 
ATOM   5239  C  CG  . ASN A  1 886  ? -7.400  13.282  77.369  1.00 306.29 ? 886  ASN A CG  1 
ATOM   5240  O  OD1 . ASN A  1 886  ? -7.103  12.875  76.247  1.00 352.55 ? 886  ASN A OD1 1 
ATOM   5241  N  ND2 . ASN A  1 886  ? -8.563  13.004  77.944  1.00 249.59 ? 886  ASN A ND2 1 
ATOM   5242  N  N   . THR A  1 887  ? -4.305  15.972  78.594  1.00 256.27 ? 887  THR A N   1 
ATOM   5243  C  CA  . THR A  1 887  ? -3.495  16.983  79.250  1.00 292.56 ? 887  THR A CA  1 
ATOM   5244  C  C   . THR A  1 887  ? -4.339  17.660  80.312  1.00 239.99 ? 887  THR A C   1 
ATOM   5245  O  O   . THR A  1 887  ? -5.039  18.635  80.041  1.00 167.66 ? 887  THR A O   1 
ATOM   5246  C  CB  . THR A  1 887  ? -2.968  18.024  78.252  1.00 334.04 ? 887  THR A CB  1 
ATOM   5247  O  OG1 . THR A  1 887  ? -4.042  18.492  77.428  1.00 359.24 ? 887  THR A OG1 1 
ATOM   5248  C  CG2 . THR A  1 887  ? -1.904  17.404  77.371  1.00 325.18 ? 887  THR A CG2 1 
ATOM   5249  N  N   . PRO A  1 888  ? -4.276  17.130  81.534  1.00 215.30 ? 888  PRO A N   1 
ATOM   5250  C  CA  . PRO A  1 888  ? -5.093  17.564  82.668  1.00 271.01 ? 888  PRO A CA  1 
ATOM   5251  C  C   . PRO A  1 888  ? -4.802  18.978  83.168  1.00 275.31 ? 888  PRO A C   1 
ATOM   5252  O  O   . PRO A  1 888  ? -5.609  19.508  83.932  1.00 300.56 ? 888  PRO A O   1 
ATOM   5253  C  CB  . PRO A  1 888  ? -4.738  16.547  83.756  1.00 294.10 ? 888  PRO A CB  1 
ATOM   5254  C  CG  . PRO A  1 888  ? -4.185  15.373  83.022  1.00 211.61 ? 888  PRO A CG  1 
ATOM   5255  C  CD  . PRO A  1 888  ? -3.467  15.947  81.864  1.00 169.31 ? 888  PRO A CD  1 
ATOM   5256  N  N   . ARG A  1 889  ? -3.695  19.585  82.756  1.00 245.40 ? 889  ARG A N   1 
ATOM   5257  C  CA  . ARG A  1 889  ? -3.301  20.854  83.354  1.00 284.29 ? 889  ARG A CA  1 
ATOM   5258  C  C   . ARG A  1 889  ? -2.775  21.877  82.360  1.00 263.42 ? 889  ARG A C   1 
ATOM   5259  O  O   . ARG A  1 889  ? -3.050  21.804  81.169  1.00 162.54 ? 889  ARG A O   1 
ATOM   5260  C  CB  . ARG A  1 889  ? -2.300  20.635  84.492  1.00 311.75 ? 889  ARG A CB  1 
ATOM   5261  C  CG  . ARG A  1 889  ? -2.905  19.948  85.698  1.00 326.03 ? 889  ARG A CG  1 
ATOM   5262  C  CD  . ARG A  1 889  ? -1.924  19.879  86.852  1.00 285.77 ? 889  ARG A CD  1 
ATOM   5263  N  NE  . ARG A  1 889  ? -2.591  19.563  88.111  1.00 279.93 ? 889  ARG A NE  1 
ATOM   5264  C  CZ  . ARG A  1 889  ? -3.079  18.367  88.425  1.00 306.81 ? 889  ARG A CZ  1 
ATOM   5265  N  NH1 . ARG A  1 889  ? -2.983  17.359  87.569  1.00 347.37 ? 889  ARG A NH1 1 
ATOM   5266  N  NH2 . ARG A  1 889  ? -3.669  18.179  89.598  1.00 297.20 ? 889  ARG A NH2 1 
ATOM   5267  N  N   . THR A  1 890  ? -1.955  22.787  82.868  1.00 305.08 ? 890  THR A N   1 
ATOM   5268  C  CA  . THR A  1 890  ? -1.983  24.182  82.447  1.00 274.71 ? 890  THR A CA  1 
ATOM   5269  C  C   . THR A  1 890  ? -1.103  24.555  81.265  1.00 226.63 ? 890  THR A C   1 
ATOM   5270  O  O   . THR A  1 890  ? -1.608  24.913  80.204  1.00 292.72 ? 890  THR A O   1 
ATOM   5271  C  CB  . THR A  1 890  ? -1.610  25.081  83.642  1.00 255.75 ? 890  THR A CB  1 
ATOM   5272  O  OG1 . THR A  1 890  ? -2.648  25.010  84.631  1.00 308.65 ? 890  THR A OG1 1 
ATOM   5273  C  CG2 . THR A  1 890  ? -1.425  26.522  83.201  1.00 185.46 ? 890  THR A CG2 1 
ATOM   5274  N  N   . SER A  1 891  ? 0.207   24.492  81.458  1.00 145.35 ? 891  SER A N   1 
ATOM   5275  C  CA  . SER A  1 891  ? 1.134   24.963  80.440  1.00 194.97 ? 891  SER A CA  1 
ATOM   5276  C  C   . SER A  1 891  ? 1.576   23.802  79.554  1.00 268.83 ? 891  SER A C   1 
ATOM   5277  O  O   . SER A  1 891  ? 2.184   22.846  80.034  1.00 324.95 ? 891  SER A O   1 
ATOM   5278  C  CB  . SER A  1 891  ? 2.333   25.650  81.098  1.00 131.54 ? 891  SER A CB  1 
ATOM   5279  O  OG  . SER A  1 891  ? 3.295   26.053  80.142  1.00 188.61 ? 891  SER A OG  1 
ATOM   5280  N  N   . LYS A  1 892  ? 1.253   23.889  78.264  1.00 271.52 ? 892  LYS A N   1 
ATOM   5281  C  CA  . LYS A  1 892  ? 1.582   22.833  77.306  1.00 245.08 ? 892  LYS A CA  1 
ATOM   5282  C  C   . LYS A  1 892  ? 3.100   22.703  77.138  1.00 174.26 ? 892  LYS A C   1 
ATOM   5283  O  O   . LYS A  1 892  ? 3.830   23.682  77.316  1.00 123.40 ? 892  LYS A O   1 
ATOM   5284  C  CB  . LYS A  1 892  ? 0.924   23.115  75.945  1.00 213.63 ? 892  LYS A CB  1 
ATOM   5285  C  CG  . LYS A  1 892  ? -0.580  23.346  75.998  1.00 173.79 ? 892  LYS A CG  1 
ATOM   5286  C  CD  . LYS A  1 892  ? -1.271  22.291  76.832  1.00 249.75 ? 892  LYS A CD  1 
ATOM   5287  C  CE  . LYS A  1 892  ? -2.770  22.487  76.841  1.00 211.02 ? 892  LYS A CE  1 
ATOM   5288  N  NZ  . LYS A  1 892  ? -3.433  21.525  77.754  1.00 206.60 ? 892  LYS A NZ  1 
ATOM   5289  N  N   . THR A  1 893  ? 3.570   21.497  76.805  1.00 159.62 ? 893  THR A N   1 
ATOM   5290  C  CA  . THR A  1 893  ? 5.003   21.252  76.575  1.00 114.03 ? 893  THR A CA  1 
ATOM   5291  C  C   . THR A  1 893  ? 5.311   21.060  75.114  1.00 75.47  ? 893  THR A C   1 
ATOM   5292  O  O   . THR A  1 893  ? 5.790   19.994  74.702  1.00 101.74 ? 893  THR A O   1 
ATOM   5293  C  CB  . THR A  1 893  ? 5.515   19.993  77.308  1.00 232.77 ? 893  THR A CB  1 
ATOM   5294  O  OG1 . THR A  1 893  ? 6.893   19.762  76.969  1.00 221.88 ? 893  THR A OG1 1 
ATOM   5295  C  CG2 . THR A  1 893  ? 4.670   18.762  76.950  1.00 209.80 ? 893  THR A CG2 1 
ATOM   5296  N  N   . THR A  1 894  ? 5.031   22.106  74.342  1.00 218.27 ? 894  THR A N   1 
ATOM   5297  C  CA  . THR A  1 894  ? 5.219   22.099  72.901  1.00 203.83 ? 894  THR A CA  1 
ATOM   5298  C  C   . THR A  1 894  ? 6.636   22.525  72.533  1.00 140.00 ? 894  THR A C   1 
ATOM   5299  O  O   . THR A  1 894  ? 7.222   23.411  73.181  1.00 109.60 ? 894  THR A O   1 
ATOM   5300  C  CB  . THR A  1 894  ? 4.263   23.082  72.200  1.00 68.15  ? 894  THR A CB  1 
ATOM   5301  O  OG1 . THR A  1 894  ? 4.700   24.429  72.444  1.00 165.39 ? 894  THR A OG1 1 
ATOM   5302  C  CG2 . THR A  1 894  ? 2.824   22.936  72.689  1.00 197.42 ? 894  THR A CG2 1 
ATOM   5303  N  N   . PHE A  1 895  ? 7.166   21.906  71.473  1.00 113.88 ? 895  PHE A N   1 
ATOM   5304  C  CA  . PHE A  1 895  ? 8.517   22.194  70.998  1.00 112.30 ? 895  PHE A CA  1 
ATOM   5305  C  C   . PHE A  1 895  ? 8.524   22.564  69.529  1.00 66.61  ? 895  PHE A C   1 
ATOM   5306  O  O   . PHE A  1 895  ? 8.146   21.761  68.673  1.00 122.69 ? 895  PHE A O   1 
ATOM   5307  C  CB  . PHE A  1 895  ? 9.462   21.003  71.221  1.00 131.93 ? 895  PHE A CB  1 
ATOM   5308  C  CG  . PHE A  1 895  ? 10.821  21.204  70.601  1.00 89.67  ? 895  PHE A CG  1 
ATOM   5309  C  CD1 . PHE A  1 895  ? 11.817  21.909  71.277  1.00 109.03 ? 895  PHE A CD1 1 
ATOM   5310  C  CD2 . PHE A  1 895  ? 11.091  20.755  69.327  1.00 187.80 ? 895  PHE A CD2 1 
ATOM   5311  C  CE1 . PHE A  1 895  ? 13.078  22.126  70.694  1.00 126.64 ? 895  PHE A CE1 1 
ATOM   5312  C  CE2 . PHE A  1 895  ? 12.347  20.971  68.742  1.00 221.78 ? 895  PHE A CE2 1 
ATOM   5313  C  CZ  . PHE A  1 895  ? 13.339  21.655  69.434  1.00 123.47 ? 895  PHE A CZ  1 
ATOM   5314  N  N   . GLN A  1 896  ? 8.992   23.778  69.250  1.00 90.97  ? 896  GLN A N   1 
ATOM   5315  C  CA  . GLN A  1 896  ? 8.996   24.293  67.889  1.00 152.44 ? 896  GLN A CA  1 
ATOM   5316  C  C   . GLN A  1 896  ? 10.384  24.772  67.431  1.00 152.93 ? 896  GLN A C   1 
ATOM   5317  O  O   . GLN A  1 896  ? 11.301  25.010  68.255  1.00 64.22  ? 896  GLN A O   1 
ATOM   5318  C  CB  . GLN A  1 896  ? 7.991   25.436  67.773  1.00 143.56 ? 896  GLN A CB  1 
ATOM   5319  C  CG  . GLN A  1 896  ? 8.412   26.672  68.521  1.00 121.12 ? 896  GLN A CG  1 
ATOM   5320  C  CD  . GLN A  1 896  ? 7.320   27.708  68.568  1.00 165.26 ? 896  GLN A CD  1 
ATOM   5321  O  OE1 . GLN A  1 896  ? 6.151   27.377  68.746  1.00 142.31 ? 896  GLN A OE1 1 
ATOM   5322  N  NE2 . GLN A  1 896  ? 7.693   28.973  68.408  1.00 196.45 ? 896  GLN A NE2 1 
ATOM   5323  N  N   . LEU A  1 897  ? 10.514  24.894  66.103  1.00 129.45 ? 897  LEU A N   1 
ATOM   5324  C  CA  . LEU A  1 897  ? 11.682  25.505  65.451  1.00 176.42 ? 897  LEU A CA  1 
ATOM   5325  C  C   . LEU A  1 897  ? 11.325  26.029  64.034  1.00 165.96 ? 897  LEU A C   1 
ATOM   5326  O  O   . LEU A  1 897  ? 10.494  25.450  63.292  1.00 58.46  ? 897  LEU A O   1 
ATOM   5327  C  CB  . LEU A  1 897  ? 12.896  24.543  65.430  1.00 59.78  ? 897  LEU A CB  1 
ATOM   5328  C  CG  . LEU A  1 897  ? 12.695  23.251  64.641  1.00 91.96  ? 897  LEU A CG  1 
ATOM   5329  C  CD1 . LEU A  1 897  ? 12.925  23.539  63.159  1.00 135.24 ? 897  LEU A CD1 1 
ATOM   5330  C  CD2 . LEU A  1 897  ? 13.618  22.147  65.140  1.00 76.79  ? 897  LEU A CD2 1 
ATOM   5331  N  N   . GLU A  1 898  ? 11.958  27.148  63.687  1.00 160.79 ? 898  GLU A N   1 
ATOM   5332  C  CA  . GLU A  1 898  ? 11.700  27.847  62.437  1.00 116.36 ? 898  GLU A CA  1 
ATOM   5333  C  C   . GLU A  1 898  ? 12.937  27.832  61.517  1.00 159.03 ? 898  GLU A C   1 
ATOM   5334  O  O   . GLU A  1 898  ? 14.073  28.133  61.945  1.00 107.13 ? 898  GLU A O   1 
ATOM   5335  C  CB  . GLU A  1 898  ? 11.285  29.285  62.727  1.00 128.32 ? 898  GLU A CB  1 
ATOM   5336  C  CG  . GLU A  1 898  ? 10.371  29.877  61.690  1.00 106.35 ? 898  GLU A CG  1 
ATOM   5337  C  CD  . GLU A  1 898  ? 9.900   31.268  62.068  1.00 168.60 ? 898  GLU A CD  1 
ATOM   5338  O  OE1 . GLU A  1 898  ? 10.736  32.080  62.514  1.00 205.44 ? 898  GLU A OE1 1 
ATOM   5339  O  OE2 . GLU A  1 898  ? 8.694   31.554  61.918  1.00 183.07 ? 898  GLU A OE2 1 
ATOM   5340  N  N   . LEU A  1 899  ? 12.694  27.497  60.246  1.00 174.59 ? 899  LEU A N   1 
ATOM   5341  C  CA  . LEU A  1 899  ? 13.746  27.318  59.245  1.00 107.63 ? 899  LEU A CA  1 
ATOM   5342  C  C   . LEU A  1 899  ? 13.602  28.299  58.085  1.00 158.54 ? 899  LEU A C   1 
ATOM   5343  O  O   . LEU A  1 899  ? 12.483  28.581  57.613  1.00 132.68 ? 899  LEU A O   1 
ATOM   5344  C  CB  . LEU A  1 899  ? 13.729  25.884  58.686  1.00 73.46  ? 899  LEU A CB  1 
ATOM   5345  C  CG  . LEU A  1 899  ? 14.288  24.780  59.583  1.00 176.05 ? 899  LEU A CG  1 
ATOM   5346  C  CD1 . LEU A  1 899  ? 13.980  23.410  59.006  1.00 166.09 ? 899  LEU A CD1 1 
ATOM   5347  C  CD2 . LEU A  1 899  ? 15.791  24.951  59.782  1.00 195.66 ? 899  LEU A CD2 1 
ATOM   5348  N  N   . PRO A  1 900  ? 14.746  28.828  57.628  1.00 156.90 ? 900  PRO A N   1 
ATOM   5349  C  CA  . PRO A  1 900  ? 14.799  29.508  56.333  1.00 146.01 ? 900  PRO A CA  1 
ATOM   5350  C  C   . PRO A  1 900  ? 14.451  28.556  55.168  1.00 152.47 ? 900  PRO A C   1 
ATOM   5351  O  O   . PRO A  1 900  ? 15.010  27.444  55.060  1.00 75.78  ? 900  PRO A O   1 
ATOM   5352  C  CB  . PRO A  1 900  ? 16.259  29.977  56.252  1.00 153.35 ? 900  PRO A CB  1 
ATOM   5353  C  CG  . PRO A  1 900  ? 16.714  30.072  57.668  1.00 129.17 ? 900  PRO A CG  1 
ATOM   5354  C  CD  . PRO A  1 900  ? 16.007  28.969  58.383  1.00 142.97 ? 900  PRO A CD  1 
ATOM   5355  N  N   . VAL A  1 901  ? 13.530  29.002  54.309  1.00 152.72 ? 901  VAL A N   1 
ATOM   5356  C  CA  . VAL A  1 901  ? 13.133  28.242  53.122  1.00 169.58 ? 901  VAL A CA  1 
ATOM   5357  C  C   . VAL A  1 901  ? 13.558  28.934  51.806  1.00 164.67 ? 901  VAL A C   1 
ATOM   5358  O  O   . VAL A  1 901  ? 13.429  30.166  51.650  1.00 73.56  ? 901  VAL A O   1 
ATOM   5359  C  CB  . VAL A  1 901  ? 11.607  28.002  53.085  1.00 114.13 ? 901  VAL A CB  1 
ATOM   5360  C  CG1 . VAL A  1 901  ? 10.894  29.257  52.631  1.00 176.34 ? 901  VAL A CG1 1 
ATOM   5361  C  CG2 . VAL A  1 901  ? 11.282  26.841  52.162  1.00 115.94 ? 901  VAL A CG2 1 
ATOM   5362  N  N   . LYS A  1 902  ? 14.079  28.123  50.875  1.00 141.17 ? 902  LYS A N   1 
ATOM   5363  C  CA  . LYS A  1 902  ? 14.347  28.553  49.504  1.00 138.16 ? 902  LYS A CA  1 
ATOM   5364  C  C   . LYS A  1 902  ? 13.562  27.672  48.507  1.00 159.28 ? 902  LYS A C   1 
ATOM   5365  O  O   . LYS A  1 902  ? 12.699  26.860  48.885  1.00 113.04 ? 902  LYS A O   1 
ATOM   5366  C  CB  . LYS A  1 902  ? 15.850  28.524  49.175  1.00 121.32 ? 902  LYS A CB  1 
ATOM   5367  C  CG  . LYS A  1 902  ? 16.733  29.177  50.215  1.00 115.94 ? 902  LYS A CG  1 
ATOM   5368  C  CD  . LYS A  1 902  ? 18.174  29.278  49.750  1.00 172.53 ? 902  LYS A CD  1 
ATOM   5369  C  CE  . LYS A  1 902  ? 19.012  30.075  50.727  1.00 197.52 ? 902  LYS A CE  1 
ATOM   5370  N  NZ  . LYS A  1 902  ? 20.457  30.032  50.389  1.00 197.18 ? 902  LYS A NZ  1 
ATOM   5371  N  N   . TYR A  1 903  ? 13.871  27.857  47.228  1.00 172.33 ? 903  TYR A N   1 
ATOM   5372  C  CA  . TYR A  1 903  ? 13.091  27.267  46.155  1.00 164.62 ? 903  TYR A CA  1 
ATOM   5373  C  C   . TYR A  1 903  ? 13.999  26.972  44.953  1.00 134.72 ? 903  TYR A C   1 
ATOM   5374  O  O   . TYR A  1 903  ? 14.953  27.723  44.658  1.00 105.58 ? 903  TYR A O   1 
ATOM   5375  C  CB  . TYR A  1 903  ? 11.928  28.205  45.781  1.00 150.87 ? 903  TYR A CB  1 
ATOM   5376  C  CG  . TYR A  1 903  ? 10.932  28.441  46.913  1.00 120.88 ? 903  TYR A CG  1 
ATOM   5377  C  CD1 . TYR A  1 903  ? 9.846   27.590  47.106  1.00 145.82 ? 903  TYR A CD1 1 
ATOM   5378  C  CD2 . TYR A  1 903  ? 11.073  29.520  47.775  1.00 131.30 ? 903  TYR A CD2 1 
ATOM   5379  C  CE1 . TYR A  1 903  ? 8.946   27.803  48.118  1.00 162.69 ? 903  TYR A CE1 1 
ATOM   5380  C  CE2 . TYR A  1 903  ? 10.179  29.737  48.789  1.00 143.95 ? 903  TYR A CE2 1 
ATOM   5381  C  CZ  . TYR A  1 903  ? 9.121   28.875  48.955  1.00 155.05 ? 903  TYR A CZ  1 
ATOM   5382  O  OH  . TYR A  1 903  ? 8.234   29.094  49.972  1.00 157.26 ? 903  TYR A OH  1 
ATOM   5383  N  N   . ALA A  1 904  ? 13.695  25.864  44.279  1.00 179.86 ? 904  ALA A N   1 
ATOM   5384  C  CA  . ALA A  1 904  ? 14.477  25.395  43.144  1.00 197.25 ? 904  ALA A CA  1 
ATOM   5385  C  C   . ALA A  1 904  ? 14.181  26.216  41.896  1.00 162.96 ? 904  ALA A C   1 
ATOM   5386  O  O   . ALA A  1 904  ? 13.050  26.664  41.672  1.00 127.00 ? 904  ALA A O   1 
ATOM   5387  C  CB  . ALA A  1 904  ? 14.198  23.920  42.883  1.00 283.85 ? 904  ALA A CB  1 
ATOM   5388  N  N   . VAL A  1 905  ? 15.214  26.411  41.088  1.00 205.55 ? 905  VAL A N   1 
ATOM   5389  C  CA  . VAL A  1 905  ? 15.083  27.132  39.835  1.00 228.48 ? 905  VAL A CA  1 
ATOM   5390  C  C   . VAL A  1 905  ? 16.113  26.589  38.854  1.00 232.50 ? 905  VAL A C   1 
ATOM   5391  O  O   . VAL A  1 905  ? 17.221  26.207  39.248  1.00 143.46 ? 905  VAL A O   1 
ATOM   5392  C  CB  . VAL A  1 905  ? 15.283  28.650  40.023  1.00 210.73 ? 905  VAL A CB  1 
ATOM   5393  C  CG1 . VAL A  1 905  ? 15.197  29.358  38.693  1.00 241.47 ? 905  VAL A CG1 1 
ATOM   5394  C  CG2 . VAL A  1 905  ? 14.249  29.212  40.984  1.00 131.27 ? 905  VAL A CG2 1 
ATOM   5395  N  N   . TYR A  1 906  ? 15.720  26.524  37.585  1.00 246.30 ? 906  TYR A N   1 
ATOM   5396  C  CA  . TYR A  1 906  ? 16.616  26.119  36.507  1.00 160.76 ? 906  TYR A CA  1 
ATOM   5397  C  C   . TYR A  1 906  ? 16.862  27.341  35.637  1.00 129.36 ? 906  TYR A C   1 
ATOM   5398  O  O   . TYR A  1 906  ? 15.972  27.802  34.926  1.00 199.04 ? 906  TYR A O   1 
ATOM   5399  C  CB  . TYR A  1 906  ? 16.013  24.965  35.685  1.00 123.30 ? 906  TYR A CB  1 
ATOM   5400  C  CG  . TYR A  1 906  ? 17.034  24.127  34.924  1.00 121.79 ? 906  TYR A CG  1 
ATOM   5401  C  CD1 . TYR A  1 906  ? 17.249  24.314  33.566  1.00 206.78 ? 906  TYR A CD1 1 
ATOM   5402  C  CD2 . TYR A  1 906  ? 17.776  23.141  35.565  1.00 193.89 ? 906  TYR A CD2 1 
ATOM   5403  C  CE1 . TYR A  1 906  ? 18.179  23.545  32.872  1.00 243.08 ? 906  TYR A CE1 1 
ATOM   5404  C  CE2 . TYR A  1 906  ? 18.709  22.370  34.874  1.00 113.79 ? 906  TYR A CE2 1 
ATOM   5405  C  CZ  . TYR A  1 906  ? 18.904  22.574  33.535  1.00 196.22 ? 906  TYR A CZ  1 
ATOM   5406  O  OH  . TYR A  1 906  ? 19.827  21.800  32.867  1.00 204.32 ? 906  TYR A OH  1 
ATOM   5407  N  N   . THR A  1 907  ? 18.077  27.870  35.731  1.00 102.10 ? 907  THR A N   1 
ATOM   5408  C  CA  . THR A  1 907  ? 18.508  29.037  34.959  1.00 152.20 ? 907  THR A CA  1 
ATOM   5409  C  C   . THR A  1 907  ? 19.781  28.786  34.102  1.00 211.73 ? 907  THR A C   1 
ATOM   5410  O  O   . THR A  1 907  ? 20.900  28.710  34.627  1.00 162.05 ? 907  THR A O   1 
ATOM   5411  C  CB  . THR A  1 907  ? 18.752  30.241  35.897  1.00 58.96  ? 907  THR A CB  1 
ATOM   5412  O  OG1 . THR A  1 907  ? 17.673  30.347  36.826  1.00 216.38 ? 907  THR A OG1 1 
ATOM   5413  C  CG2 . THR A  1 907  ? 18.862  31.517  35.096  1.00 116.64 ? 907  THR A CG2 1 
ATOM   5414  N  N   . VAL A  1 908  ? 19.596  28.701  32.780  1.00 185.29 ? 908  VAL A N   1 
ATOM   5415  C  CA  . VAL A  1 908  ? 20.664  28.339  31.844  1.00 112.28 ? 908  VAL A CA  1 
ATOM   5416  C  C   . VAL A  1 908  ? 20.894  29.420  30.777  1.00 178.95 ? 908  VAL A C   1 
ATOM   5417  O  O   . VAL A  1 908  ? 19.977  30.157  30.413  1.00 151.41 ? 908  VAL A O   1 
ATOM   5418  C  CB  . VAL A  1 908  ? 20.345  27.005  31.115  1.00 115.39 ? 908  VAL A CB  1 
ATOM   5419  C  CG1 . VAL A  1 908  ? 21.414  26.701  30.073  1.00 215.59 ? 908  VAL A CG1 1 
ATOM   5420  C  CG2 . VAL A  1 908  ? 20.238  25.861  32.099  1.00 181.39 ? 908  VAL A CG2 1 
ATOM   5421  N  N   . VAL A  1 909  ? 22.123  29.482  30.261  1.00 226.24 ? 909  VAL A N   1 
ATOM   5422  C  CA  . VAL A  1 909  ? 22.527  30.482  29.270  1.00 152.25 ? 909  VAL A CA  1 
ATOM   5423  C  C   . VAL A  1 909  ? 23.598  29.911  28.328  1.00 197.66 ? 909  VAL A C   1 
ATOM   5424  O  O   . VAL A  1 909  ? 24.566  29.278  28.765  1.00 197.08 ? 909  VAL A O   1 
ATOM   5425  C  CB  . VAL A  1 909  ? 23.089  31.763  29.942  1.00 115.15 ? 909  VAL A CB  1 
ATOM   5426  C  CG1 . VAL A  1 909  ? 24.413  31.478  30.622  1.00 157.65 ? 909  VAL A CG1 1 
ATOM   5427  C  CG2 . VAL A  1 909  ? 23.309  32.846  28.951  1.00 91.41  ? 909  VAL A CG2 1 
ATOM   5428  N  N   . SER A  1 910  ? 23.416  30.148  27.033  1.00 232.27 ? 910  SER A N   1 
ATOM   5429  C  CA  . SER A  1 910  ? 24.345  29.676  26.015  1.00 187.47 ? 910  SER A CA  1 
ATOM   5430  C  C   . SER A  1 910  ? 24.880  30.845  25.169  1.00 207.35 ? 910  SER A C   1 
ATOM   5431  O  O   . SER A  1 910  ? 24.346  31.976  25.193  1.00 71.84  ? 910  SER A O   1 
ATOM   5432  C  CB  . SER A  1 910  ? 23.651  28.638  25.131  1.00 153.90 ? 910  SER A CB  1 
ATOM   5433  O  OG  . SER A  1 910  ? 24.554  28.046  24.221  1.00 209.78 ? 910  SER A OG  1 
ATOM   5434  N  N   . SER A  1 911  ? 25.946  30.563  24.426  1.00 238.40 ? 911  SER A N   1 
ATOM   5435  C  CA  . SER A  1 911  ? 26.540  31.544  23.525  1.00 198.70 ? 911  SER A CA  1 
ATOM   5436  C  C   . SER A  1 911  ? 26.119  31.262  22.080  1.00 209.68 ? 911  SER A C   1 
ATOM   5437  O  O   . SER A  1 911  ? 26.724  30.430  21.403  1.00 211.45 ? 911  SER A O   1 
ATOM   5438  C  CB  . SER A  1 911  ? 28.061  31.515  23.643  1.00 134.50 ? 911  SER A CB  1 
ATOM   5439  O  OG  . SER A  1 911  ? 28.644  32.377  22.689  1.00 154.81 ? 911  SER A OG  1 
ATOM   5440  N  N   . HIS A  1 912  ? 25.079  31.955  21.618  1.00 216.57 ? 912  HIS A N   1 
ATOM   5441  C  CA  . HIS A  1 912  ? 24.491  31.698  20.303  1.00 195.41 ? 912  HIS A CA  1 
ATOM   5442  C  C   . HIS A  1 912  ? 25.574  31.654  19.246  1.00 221.81 ? 912  HIS A C   1 
ATOM   5443  O  O   . HIS A  1 912  ? 26.549  32.402  19.315  1.00 278.76 ? 912  HIS A O   1 
ATOM   5444  C  CB  . HIS A  1 912  ? 23.442  32.764  19.957  1.00 168.00 ? 912  HIS A CB  1 
ATOM   5445  C  CG  . HIS A  1 912  ? 22.498  32.350  18.876  1.00 151.74 ? 912  HIS A CG  1 
ATOM   5446  N  ND1 . HIS A  1 912  ? 21.831  33.263  18.078  1.00 165.63 ? 912  HIS A ND1 1 
ATOM   5447  C  CD2 . HIS A  1 912  ? 22.101  31.128  18.446  1.00 152.49 ? 912  HIS A CD2 1 
ATOM   5448  C  CE1 . HIS A  1 912  ? 21.075  32.622  17.214  1.00 244.30 ? 912  HIS A CE1 1 
ATOM   5449  N  NE2 . HIS A  1 912  ? 21.217  31.319  17.416  1.00 224.43 ? 912  HIS A NE2 1 
ATOM   5450  N  N   . GLU A  1 913  ? 25.399  30.772  18.269  1.00 204.75 ? 913  GLU A N   1 
ATOM   5451  C  CA  . GLU A  1 913  ? 26.434  30.533  17.272  1.00 210.97 ? 913  GLU A CA  1 
ATOM   5452  C  C   . GLU A  1 913  ? 26.506  31.637  16.222  1.00 185.62 ? 913  GLU A C   1 
ATOM   5453  O  O   . GLU A  1 913  ? 27.172  31.483  15.199  1.00 254.16 ? 913  GLU A O   1 
ATOM   5454  C  CB  . GLU A  1 913  ? 26.222  29.176  16.602  1.00 252.82 ? 913  GLU A CB  1 
ATOM   5455  C  CG  . GLU A  1 913  ? 24.868  29.009  15.937  1.00 286.03 ? 913  GLU A CG  1 
ATOM   5456  C  CD  . GLU A  1 913  ? 24.605  27.581  15.513  1.00 314.21 ? 913  GLU A CD  1 
ATOM   5457  O  OE1 . GLU A  1 913  ? 25.425  26.702  15.852  1.00 345.90 ? 913  GLU A OE1 1 
ATOM   5458  O  OE2 . GLU A  1 913  ? 23.581  27.335  14.842  1.00 298.15 ? 913  GLU A OE2 1 
ATOM   5459  N  N   . GLN A  1 914  ? 25.814  32.745  16.472  1.00 207.01 ? 914  GLN A N   1 
ATOM   5460  C  CA  . GLN A  1 914  ? 25.971  33.946  15.659  1.00 225.19 ? 914  GLN A CA  1 
ATOM   5461  C  C   . GLN A  1 914  ? 27.055  34.819  16.293  1.00 223.98 ? 914  GLN A C   1 
ATOM   5462  O  O   . GLN A  1 914  ? 26.818  35.986  16.636  1.00 106.83 ? 914  GLN A O   1 
ATOM   5463  C  CB  . GLN A  1 914  ? 24.651  34.719  15.549  1.00 211.77 ? 914  GLN A CB  1 
ATOM   5464  C  CG  . GLN A  1 914  ? 23.603  34.052  14.663  1.00 254.70 ? 914  GLN A CG  1 
ATOM   5465  C  CD  . GLN A  1 914  ? 22.371  34.913  14.471  1.00 338.12 ? 914  GLN A CD  1 
ATOM   5466  O  OE1 . GLN A  1 914  ? 22.176  35.905  15.174  1.00 384.40 ? 914  GLN A OE1 1 
ATOM   5467  N  NE2 . GLN A  1 914  ? 21.533  34.541  13.511  1.00 346.41 ? 914  GLN A NE2 1 
ATOM   5468  N  N   . PHE A  1 915  ? 28.241  34.229  16.444  1.00 195.13 ? 915  PHE A N   1 
ATOM   5469  C  CA  . PHE A  1 915  ? 29.370  34.871  17.112  1.00 173.60 ? 915  PHE A CA  1 
ATOM   5470  C  C   . PHE A  1 915  ? 30.544  35.117  16.166  1.00 201.47 ? 915  PHE A C   1 
ATOM   5471  O  O   . PHE A  1 915  ? 30.908  34.254  15.368  1.00 271.65 ? 915  PHE A O   1 
ATOM   5472  C  CB  . PHE A  1 915  ? 29.797  34.019  18.308  1.00 208.73 ? 915  PHE A CB  1 
ATOM   5473  C  CG  . PHE A  1 915  ? 31.236  33.603  18.286  1.00 197.78 ? 915  PHE A CG  1 
ATOM   5474  C  CD1 . PHE A  1 915  ? 32.233  34.477  18.678  1.00 303.23 ? 915  PHE A CD1 1 
ATOM   5475  C  CD2 . PHE A  1 915  ? 31.588  32.323  17.901  1.00 171.63 ? 915  PHE A CD2 1 
ATOM   5476  C  CE1 . PHE A  1 915  ? 33.558  34.085  18.668  1.00 333.64 ? 915  PHE A CE1 1 
ATOM   5477  C  CE2 . PHE A  1 915  ? 32.910  31.927  17.886  1.00 291.93 ? 915  PHE A CE2 1 
ATOM   5478  C  CZ  . PHE A  1 915  ? 33.895  32.808  18.271  1.00 331.10 ? 915  PHE A CZ  1 
ATOM   5479  N  N   . THR A  1 916  ? 31.136  36.304  16.274  1.00 165.64 ? 916  THR A N   1 
ATOM   5480  C  CA  . THR A  1 916  ? 32.108  36.787  15.291  1.00 190.96 ? 916  THR A CA  1 
ATOM   5481  C  C   . THR A  1 916  ? 33.552  36.330  15.526  1.00 202.77 ? 916  THR A C   1 
ATOM   5482  O  O   . THR A  1 916  ? 34.303  37.006  16.222  1.00 172.25 ? 916  THR A O   1 
ATOM   5483  C  CB  . THR A  1 916  ? 32.109  38.338  15.242  1.00 119.09 ? 916  THR A CB  1 
ATOM   5484  O  OG1 . THR A  1 916  ? 30.762  38.814  15.196  1.00 147.84 ? 916  THR A OG1 1 
ATOM   5485  C  CG2 . THR A  1 916  ? 32.872  38.837  14.021  1.00 237.92 ? 916  THR A CG2 1 
ATOM   5486  N  N   . LYS A  1 917  ? 33.935  35.199  14.931  1.00 93.50  ? 917  LYS A N   1 
ATOM   5487  C  CA  . LYS A  1 917  ? 35.336  34.761  14.890  1.00 157.60 ? 917  LYS A CA  1 
ATOM   5488  C  C   . LYS A  1 917  ? 35.902  35.039  13.486  1.00 262.32 ? 917  LYS A C   1 
ATOM   5489  O  O   . LYS A  1 917  ? 35.745  34.220  12.580  1.00 370.18 ? 917  LYS A O   1 
ATOM   5490  C  CB  . LYS A  1 917  ? 35.431  33.268  15.222  1.00 166.35 ? 917  LYS A CB  1 
ATOM   5491  C  CG  . LYS A  1 917  ? 36.783  32.813  15.745  1.00 249.23 ? 917  LYS A CG  1 
ATOM   5492  C  CD  . LYS A  1 917  ? 36.678  31.428  16.354  1.00 273.14 ? 917  LYS A CD  1 
ATOM   5493  C  CE  . LYS A  1 917  ? 38.022  30.922  16.822  1.00 268.60 ? 917  LYS A CE  1 
ATOM   5494  N  NZ  . LYS A  1 917  ? 37.915  29.581  17.445  1.00 264.50 ? 917  LYS A NZ  1 
ATOM   5495  N  N   . TYR A  1 918  ? 36.576  36.180  13.318  1.00 221.11 ? 918  TYR A N   1 
ATOM   5496  C  CA  . TYR A  1 918  ? 36.756  36.789  11.992  1.00 203.26 ? 918  TYR A CA  1 
ATOM   5497  C  C   . TYR A  1 918  ? 38.191  36.941  11.488  1.00 304.40 ? 918  TYR A C   1 
ATOM   5498  O  O   . TYR A  1 918  ? 38.406  37.445  10.386  1.00 450.11 ? 918  TYR A O   1 
ATOM   5499  C  CB  . TYR A  1 918  ? 36.125  38.185  11.985  1.00 224.16 ? 918  TYR A CB  1 
ATOM   5500  C  CG  . TYR A  1 918  ? 36.973  39.234  12.674  1.00 149.32 ? 918  TYR A CG  1 
ATOM   5501  C  CD1 . TYR A  1 918  ? 38.018  39.865  12.008  1.00 195.92 ? 918  TYR A CD1 1 
ATOM   5502  C  CD2 . TYR A  1 918  ? 36.726  39.595  13.992  1.00 260.66 ? 918  TYR A CD2 1 
ATOM   5503  C  CE1 . TYR A  1 918  ? 38.792  40.821  12.635  1.00 207.67 ? 918  TYR A CE1 1 
ATOM   5504  C  CE2 . TYR A  1 918  ? 37.497  40.550  14.627  1.00 310.83 ? 918  TYR A CE2 1 
ATOM   5505  C  CZ  . TYR A  1 918  ? 38.528  41.160  13.942  1.00 294.16 ? 918  TYR A CZ  1 
ATOM   5506  O  OH  . TYR A  1 918  ? 39.299  42.112  14.566  1.00 392.22 ? 918  TYR A OH  1 
ATOM   5507  N  N   . LEU A  1 919  ? 39.164  36.525  12.286  0.93 201.96 ? 919  LEU A N   1 
ATOM   5508  C  CA  . LEU A  1 919  ? 40.570  36.723  11.947  0.93 307.31 ? 919  LEU A CA  1 
ATOM   5509  C  C   . LEU A  1 919  ? 40.841  36.596  10.444  0.93 369.82 ? 919  LEU A C   1 
ATOM   5510  O  O   . LEU A  1 919  ? 40.220  35.789  9.768   0.93 420.38 ? 919  LEU A O   1 
ATOM   5511  C  CB  . LEU A  1 919  ? 41.423  35.712  12.718  0.93 351.80 ? 919  LEU A CB  1 
ATOM   5512  C  CG  . LEU A  1 919  ? 41.322  34.231  12.330  1.00 296.95 ? 919  LEU A CG  1 
ATOM   5513  C  CD1 . LEU A  1 919  ? 42.306  33.898  11.232  1.00 150.85 ? 919  LEU A CD1 1 
ATOM   5514  C  CD2 . LEU A  1 919  ? 41.585  33.340  13.528  1.00 356.80 ? 919  LEU A CD2 1 
ATOM   5515  N  N   . ASN A  1 920  ? 41.745  37.416  9.915   0.93 345.31 ? 920  ASN A N   1 
ATOM   5516  C  CA  . ASN A  1 920  ? 42.266  37.199  8.564   0.93 326.16 ? 920  ASN A CA  1 
ATOM   5517  C  C   . ASN A  1 920  ? 43.447  38.118  8.264   0.93 383.34 ? 920  ASN A C   1 
ATOM   5518  O  O   . ASN A  1 920  ? 43.616  39.163  8.889   0.93 446.47 ? 920  ASN A O   1 
ATOM   5519  C  CB  . ASN A  1 920  ? 41.175  37.332  7.497   0.93 229.91 ? 920  ASN A CB  1 
ATOM   5520  C  CG  . ASN A  1 920  ? 40.966  38.754  7.050   1.00 235.09 ? 920  ASN A CG  1 
ATOM   5521  O  OD1 . ASN A  1 920  ? 40.970  39.675  7.860   1.00 212.11 ? 920  ASN A OD1 1 
ATOM   5522  N  ND2 . ASN A  1 920  ? 40.770  38.942  5.753   1.00 238.73 ? 920  ASN A ND2 1 
ATOM   5523  N  N   . PHE A  1 921  ? 44.254  37.721  7.290   0.93 334.92 ? 921  PHE A N   1 
ATOM   5524  C  CA  . PHE A  1 921  ? 45.615  38.233  7.159   0.93 280.82 ? 921  PHE A CA  1 
ATOM   5525  C  C   . PHE A  1 921  ? 45.744  39.718  6.810   0.93 259.91 ? 921  PHE A C   1 
ATOM   5526  O  O   . PHE A  1 921  ? 46.800  40.313  7.032   0.93 156.30 ? 921  PHE A O   1 
ATOM   5527  C  CB  . PHE A  1 921  ? 46.370  37.390  6.132   0.93 256.68 ? 921  PHE A CB  1 
ATOM   5528  C  CG  . PHE A  1 921  ? 46.428  35.930  6.479   1.00 274.48 ? 921  PHE A CG  1 
ATOM   5529  C  CD1 . PHE A  1 921  ? 47.381  35.456  7.362   1.00 293.15 ? 921  PHE A CD1 1 
ATOM   5530  C  CD2 . PHE A  1 921  ? 45.528  35.031  5.927   1.00 287.47 ? 921  PHE A CD2 1 
ATOM   5531  C  CE1 . PHE A  1 921  ? 47.439  34.114  7.686   1.00 299.53 ? 921  PHE A CE1 1 
ATOM   5532  C  CE2 . PHE A  1 921  ? 45.583  33.686  6.249   1.00 273.69 ? 921  PHE A CE2 1 
ATOM   5533  C  CZ  . PHE A  1 921  ? 46.538  33.228  7.129   1.00 261.95 ? 921  PHE A CZ  1 
ATOM   5534  N  N   . SER A  1 922  ? 44.688  40.319  6.274   0.93 312.80 ? 922  SER A N   1 
ATOM   5535  C  CA  . SER A  1 922  ? 44.772  41.705  5.823   0.93 316.29 ? 922  SER A CA  1 
ATOM   5536  C  C   . SER A  1 922  ? 44.889  42.681  6.994   0.93 294.84 ? 922  SER A C   1 
ATOM   5537  O  O   . SER A  1 922  ? 43.886  43.126  7.546   0.93 309.75 ? 922  SER A O   1 
ATOM   5538  C  CB  . SER A  1 922  ? 43.567  42.059  4.951   0.93 292.76 ? 922  SER A CB  1 
ATOM   5539  O  OG  . SER A  1 922  ? 42.351  41.890  5.654   1.00 238.09 ? 922  SER A OG  1 
ATOM   5540  N  N   . GLU A  1 923  ? 46.123  43.016  7.358   0.93 230.03 ? 923  GLU A N   1 
ATOM   5541  C  CA  . GLU A  1 923  ? 46.376  43.913  8.479   0.93 203.82 ? 923  GLU A CA  1 
ATOM   5542  C  C   . GLU A  1 923  ? 47.475  44.906  8.156   0.93 174.90 ? 923  GLU A C   1 
ATOM   5543  O  O   . GLU A  1 923  ? 48.603  44.775  8.631   0.93 159.64 ? 923  GLU A O   1 
ATOM   5544  C  CB  . GLU A  1 923  ? 46.792  43.109  9.700   0.93 262.92 ? 923  GLU A CB  1 
ATOM   5545  C  CG  . GLU A  1 923  ? 46.785  43.900  10.994  0.93 294.50 ? 923  GLU A CG  1 
ATOM   5546  C  CD  . GLU A  1 923  ? 45.391  44.064  11.570  0.93 254.83 ? 923  GLU A CD  1 
ATOM   5547  O  OE1 . GLU A  1 923  ? 44.469  44.417  10.807  0.85 263.49 ? 923  GLU A OE1 1 
ATOM   5548  O  OE2 . GLU A  1 923  ? 45.217  43.844  12.786  0.85 157.78 ? 923  GLU A OE2 1 
ATOM   5549  N  N   . SER A  1 924  ? 47.142  45.904  7.352   0.93 192.55 ? 924  SER A N   1 
ATOM   5550  C  CA  . SER A  1 924  ? 48.126  46.882  6.930   0.93 255.72 ? 924  SER A CA  1 
ATOM   5551  C  C   . SER A  1 924  ? 48.179  48.036  7.914   0.93 208.50 ? 924  SER A C   1 
ATOM   5552  O  O   . SER A  1 924  ? 49.253  48.423  8.366   0.93 203.68 ? 924  SER A O   1 
ATOM   5553  C  CB  . SER A  1 924  ? 47.796  47.394  5.530   0.93 301.05 ? 924  SER A CB  1 
ATOM   5554  O  OG  . SER A  1 924  ? 46.454  47.835  5.458   1.00 311.30 ? 924  SER A OG  1 
ATOM   5555  N  N   . GLU A  1 925  ? 47.019  48.583  8.252   0.93 180.12 ? 925  GLU A N   1 
ATOM   5556  C  CA  . GLU A  1 925  ? 46.968  49.713  9.167   0.93 210.20 ? 925  GLU A CA  1 
ATOM   5557  C  C   . GLU A  1 925  ? 46.153  49.378  10.399  0.93 242.20 ? 925  GLU A C   1 
ATOM   5558  O  O   . GLU A  1 925  ? 45.653  48.264  10.542  0.93 207.68 ? 925  GLU A O   1 
ATOM   5559  C  CB  . GLU A  1 925  ? 46.373  50.942  8.486   1.00 165.32 ? 925  GLU A CB  1 
ATOM   5560  C  CG  . GLU A  1 925  ? 47.122  51.383  7.256   1.00 210.65 ? 925  GLU A CG  1 
ATOM   5561  C  CD  . GLU A  1 925  ? 46.683  50.627  6.027   1.00 299.54 ? 925  GLU A CD  1 
ATOM   5562  O  OE1 . GLU A  1 925  ? 45.513  50.193  5.989   1.00 322.45 ? 925  GLU A OE1 1 
ATOM   5563  O  OE2 . GLU A  1 925  ? 47.502  50.468  5.100   1.00 340.26 ? 925  GLU A OE2 1 
ATOM   5564  N  N   . GLU A  1 926  ? 46.028  50.359  11.286  0.93 268.32 ? 926  GLU A N   1 
ATOM   5565  C  CA  . GLU A  1 926  ? 45.266  50.203  12.514  0.93 209.04 ? 926  GLU A CA  1 
ATOM   5566  C  C   . GLU A  1 926  ? 43.933  50.919  12.374  0.93 223.84 ? 926  GLU A C   1 
ATOM   5567  O  O   . GLU A  1 926  ? 43.813  52.099  12.705  0.93 193.00 ? 926  GLU A O   1 
ATOM   5568  C  CB  . GLU A  1 926  ? 46.045  50.772  13.695  0.93 138.17 ? 926  GLU A CB  1 
ATOM   5569  C  CG  . GLU A  1 926  ? 47.332  50.036  13.978  0.93 161.20 ? 926  GLU A CG  1 
ATOM   5570  C  CD  . GLU A  1 926  ? 48.196  50.763  14.970  0.93 227.82 ? 926  GLU A CD  1 
ATOM   5571  O  OE1 . GLU A  1 926  ? 47.805  51.872  15.390  0.93 301.98 ? 926  GLU A OE1 1 
ATOM   5572  O  OE2 . GLU A  1 926  ? 49.265  50.228  15.327  0.93 216.73 ? 926  GLU A OE2 1 
ATOM   5573  N  N   . LYS A  1 927  ? 42.936  50.196  11.876  0.93 254.11 ? 927  LYS A N   1 
ATOM   5574  C  CA  . LYS A  1 927  ? 41.609  50.755  11.645  0.93 259.65 ? 927  LYS A CA  1 
ATOM   5575  C  C   . LYS A  1 927  ? 40.709  50.584  12.872  0.93 236.83 ? 927  LYS A C   1 
ATOM   5576  O  O   . LYS A  1 927  ? 41.200  50.390  13.982  0.93 192.16 ? 927  LYS A O   1 
ATOM   5577  C  CB  . LYS A  1 927  ? 40.986  50.098  10.416  0.93 255.84 ? 927  LYS A CB  1 
ATOM   5578  C  CG  . LYS A  1 927  ? 41.866  50.197  9.176   0.93 186.87 ? 927  LYS A CG  1 
ATOM   5579  C  CD  . LYS A  1 927  ? 41.525  49.124  8.165   0.85 199.94 ? 927  LYS A CD  1 
ATOM   5580  C  CE  . LYS A  1 927  ? 42.533  49.091  7.032   1.00 205.64 ? 927  LYS A CE  1 
ATOM   5581  N  NZ  . LYS A  1 927  ? 42.317  47.921  6.139   1.00 215.46 ? 927  LYS A NZ  1 
ATOM   5582  N  N   . GLU A  1 928  ? 39.395  50.651  12.678  1.00 237.02 ? 928  GLU A N   1 
ATOM   5583  C  CA  . GLU A  1 928  ? 38.483  50.691  13.812  1.00 187.52 ? 928  GLU A CA  1 
ATOM   5584  C  C   . GLU A  1 928  ? 37.334  49.698  13.749  1.00 173.27 ? 928  GLU A C   1 
ATOM   5585  O  O   . GLU A  1 928  ? 37.172  48.886  14.647  1.00 151.32 ? 928  GLU A O   1 
ATOM   5586  C  CB  . GLU A  1 928  ? 37.896  52.091  13.965  1.00 236.94 ? 928  GLU A CB  1 
ATOM   5587  C  CG  . GLU A  1 928  ? 37.175  52.597  12.734  1.00 285.58 ? 928  GLU A CG  1 
ATOM   5588  C  CD  . GLU A  1 928  ? 36.035  53.521  13.081  1.00 248.29 ? 928  GLU A CD  1 
ATOM   5589  O  OE1 . GLU A  1 928  ? 35.392  53.296  14.129  1.00 138.26 ? 928  GLU A OE1 1 
ATOM   5590  O  OE2 . GLU A  1 928  ? 35.773  54.462  12.304  1.00 290.24 ? 928  GLU A OE2 1 
ATOM   5591  N  N   . SER A  1 929  ? 36.538  49.753  12.690  1.00 229.32 ? 929  SER A N   1 
ATOM   5592  C  CA  . SER A  1 929  ? 35.195  49.200  12.748  1.00 208.64 ? 929  SER A CA  1 
ATOM   5593  C  C   . SER A  1 929  ? 34.979  47.929  11.941  1.00 204.54 ? 929  SER A C   1 
ATOM   5594  O  O   . SER A  1 929  ? 34.553  47.981  10.793  1.00 286.44 ? 929  SER A O   1 
ATOM   5595  C  CB  . SER A  1 929  ? 34.192  50.254  12.292  1.00 183.65 ? 929  SER A CB  1 
ATOM   5596  O  OG  . SER A  1 929  ? 32.877  49.736  12.311  1.00 190.42 ? 929  SER A OG  1 
ATOM   5597  N  N   . HIS A  1 930  ? 35.273  46.790  12.553  1.00 150.59 ? 930  HIS A N   1 
ATOM   5598  C  CA  . HIS A  1 930  ? 34.746  45.517  12.086  1.00 210.47 ? 930  HIS A CA  1 
ATOM   5599  C  C   . HIS A  1 930  ? 33.943  44.937  13.238  1.00 291.19 ? 930  HIS A C   1 
ATOM   5600  O  O   . HIS A  1 930  ? 34.038  43.748  13.542  1.00 399.74 ? 930  HIS A O   1 
ATOM   5601  C  CB  . HIS A  1 930  ? 35.858  44.553  11.670  1.00 204.00 ? 930  HIS A CB  1 
ATOM   5602  C  CG  . HIS A  1 930  ? 35.364  43.354  10.916  1.00 268.45 ? 930  HIS A CG  1 
ATOM   5603  N  ND1 . HIS A  1 930  ? 35.012  42.177  11.538  1.00 354.19 ? 930  HIS A ND1 1 
ATOM   5604  C  CD2 . HIS A  1 930  ? 35.160  43.155  9.592   1.00 279.05 ? 930  HIS A CD2 1 
ATOM   5605  C  CE1 . HIS A  1 930  ? 34.615  41.302  10.630  1.00 386.08 ? 930  HIS A CE1 1 
ATOM   5606  N  NE2 . HIS A  1 930  ? 34.695  41.871  9.442   1.00 338.25 ? 930  HIS A NE2 1 
ATOM   5607  N  N   . VAL A  1 931  ? 33.165  45.806  13.881  1.00 198.29 ? 931  VAL A N   1 
ATOM   5608  C  CA  . VAL A  1 931  ? 32.361  45.457  15.055  1.00 208.44 ? 931  VAL A CA  1 
ATOM   5609  C  C   . VAL A  1 931  ? 32.053  43.962  15.183  1.00 235.19 ? 931  VAL A C   1 
ATOM   5610  O  O   . VAL A  1 931  ? 31.504  43.354  14.266  1.00 231.32 ? 931  VAL A O   1 
ATOM   5611  C  CB  . VAL A  1 931  ? 31.026  46.233  15.046  1.00 249.43 ? 931  VAL A CB  1 
ATOM   5612  C  CG1 . VAL A  1 931  ? 30.371  46.145  13.678  1.00 216.42 ? 931  VAL A CG1 1 
ATOM   5613  C  CG2 . VAL A  1 931  ? 30.085  45.706  16.123  1.00 329.19 ? 931  VAL A CG2 1 
ATOM   5614  N  N   . ALA A  1 932  ? 32.407  43.377  16.327  1.00 255.45 ? 932  ALA A N   1 
ATOM   5615  C  CA  . ALA A  1 932  ? 32.082  41.980  16.613  1.00 213.78 ? 932  ALA A CA  1 
ATOM   5616  C  C   . ALA A  1 932  ? 30.722  41.894  17.308  1.00 221.65 ? 932  ALA A C   1 
ATOM   5617  O  O   . ALA A  1 932  ? 30.195  42.897  17.816  1.00 100.37 ? 932  ALA A O   1 
ATOM   5618  C  CB  . ALA A  1 932  ? 33.159  41.343  17.470  1.00 145.80 ? 932  ALA A CB  1 
ATOM   5619  N  N   . MET A  1 933  ? 30.159  40.691  17.333  1.00 212.63 ? 933  MET A N   1 
ATOM   5620  C  CA  . MET A  1 933  ? 28.806  40.503  17.835  1.00 208.07 ? 933  MET A CA  1 
ATOM   5621  C  C   . MET A  1 933  ? 28.746  39.249  18.687  1.00 208.11 ? 933  MET A C   1 
ATOM   5622  O  O   . MET A  1 933  ? 28.837  38.134  18.172  1.00 174.61 ? 933  MET A O   1 
ATOM   5623  C  CB  . MET A  1 933  ? 27.816  40.389  16.669  1.00 261.61 ? 933  MET A CB  1 
ATOM   5624  C  CG  . MET A  1 933  ? 26.589  41.294  16.790  1.00 221.41 ? 933  MET A CG  1 
ATOM   5625  S  SD  . MET A  1 933  ? 25.613  41.355  15.273  1.00 565.58 ? 933  MET A SD  1 
ATOM   5626  C  CE  . MET A  1 933  ? 24.822  42.952  15.443  1.00 120.23 ? 933  MET A CE  1 
ATOM   5627  N  N   . HIS A  1 934  ? 28.606  39.449  19.995  1.00 215.54 ? 934  HIS A N   1 
ATOM   5628  C  CA  . HIS A  1 934  ? 28.450  38.352  20.944  1.00 196.11 ? 934  HIS A CA  1 
ATOM   5629  C  C   . HIS A  1 934  ? 26.989  38.224  21.359  1.00 164.73 ? 934  HIS A C   1 
ATOM   5630  O  O   . HIS A  1 934  ? 26.509  38.979  22.209  1.00 169.51 ? 934  HIS A O   1 
ATOM   5631  C  CB  . HIS A  1 934  ? 29.317  38.596  22.177  1.00 191.04 ? 934  HIS A CB  1 
ATOM   5632  C  CG  . HIS A  1 934  ? 30.781  38.606  21.885  1.00 160.88 ? 934  HIS A CG  1 
ATOM   5633  N  ND1 . HIS A  1 934  ? 31.570  37.481  22.011  1.00 100.57 ? 934  HIS A ND1 1 
ATOM   5634  C  CD2 . HIS A  1 934  ? 31.599  39.597  21.460  1.00 159.12 ? 934  HIS A CD2 1 
ATOM   5635  C  CE1 . HIS A  1 934  ? 32.813  37.784  21.682  1.00 117.17 ? 934  HIS A CE1 1 
ATOM   5636  N  NE2 . HIS A  1 934  ? 32.858  39.061  21.344  1.00 166.30 ? 934  HIS A NE2 1 
ATOM   5637  N  N   . ARG A  1 935  ? 26.280  37.276  20.750  1.00 162.44 ? 935  ARG A N   1 
ATOM   5638  C  CA  . ARG A  1 935  ? 24.881  37.056  21.085  1.00 188.49 ? 935  ARG A CA  1 
ATOM   5639  C  C   . ARG A  1 935  ? 24.790  35.957  22.121  1.00 190.79 ? 935  ARG A C   1 
ATOM   5640  O  O   . ARG A  1 935  ? 25.341  34.861  21.915  1.00 102.75 ? 935  ARG A O   1 
ATOM   5641  C  CB  . ARG A  1 935  ? 24.048  36.674  19.858  1.00 256.65 ? 935  ARG A CB  1 
ATOM   5642  C  CG  . ARG A  1 935  ? 22.577  36.410  20.190  1.00 250.44 ? 935  ARG A CG  1 
ATOM   5643  C  CD  . ARG A  1 935  ? 21.754  36.066  18.965  1.00 178.38 ? 935  ARG A CD  1 
ATOM   5644  N  NE  . ARG A  1 935  ? 21.475  37.240  18.147  1.00 230.70 ? 935  ARG A NE  1 
ATOM   5645  C  CZ  . ARG A  1 935  ? 20.591  37.266  17.157  1.00 276.71 ? 935  ARG A CZ  1 
ATOM   5646  N  NH1 . ARG A  1 935  ? 19.892  36.179  16.864  1.00 276.29 ? 935  ARG A NH1 1 
ATOM   5647  N  NH2 . ARG A  1 935  ? 20.404  38.381  16.463  1.00 317.28 ? 935  ARG A NH2 1 
ATOM   5648  N  N   . TYR A  1 936  ? 24.104  36.286  23.224  1.00 215.84 ? 936  TYR A N   1 
ATOM   5649  C  CA  . TYR A  1 936  ? 23.826  35.375  24.332  1.00 118.09 ? 936  TYR A CA  1 
ATOM   5650  C  C   . TYR A  1 936  ? 22.314  35.135  24.448  1.00 137.66 ? 936  TYR A C   1 
ATOM   5651  O  O   . TYR A  1 936  ? 21.513  36.080  24.434  1.00 87.64  ? 936  TYR A O   1 
ATOM   5652  C  CB  . TYR A  1 936  ? 24.377  35.959  25.628  1.00 72.53  ? 936  TYR A CB  1 
ATOM   5653  C  CG  . TYR A  1 936  ? 25.879  35.825  25.800  1.00 110.86 ? 936  TYR A CG  1 
ATOM   5654  C  CD1 . TYR A  1 936  ? 26.711  36.943  25.716  1.00 129.53 ? 936  TYR A CD1 1 
ATOM   5655  C  CD2 . TYR A  1 936  ? 26.466  34.585  26.062  1.00 79.89  ? 936  TYR A CD2 1 
ATOM   5656  C  CE1 . TYR A  1 936  ? 28.084  36.830  25.881  1.00 119.82 ? 936  TYR A CE1 1 
ATOM   5657  C  CE2 . TYR A  1 936  ? 27.833  34.466  26.235  1.00 168.30 ? 936  TYR A CE2 1 
ATOM   5658  C  CZ  . TYR A  1 936  ? 28.635  35.588  26.140  1.00 177.97 ? 936  TYR A CZ  1 
ATOM   5659  O  OH  . TYR A  1 936  ? 29.991  35.460  26.310  1.00 111.44 ? 936  TYR A OH  1 
ATOM   5660  N  N   . GLN A  1 937  ? 21.934  33.860  24.519  1.00 133.92 ? 937  GLN A N   1 
ATOM   5661  C  CA  . GLN A  1 937  ? 20.542  33.473  24.720  1.00 127.59 ? 937  GLN A CA  1 
ATOM   5662  C  C   . GLN A  1 937  ? 20.393  32.810  26.073  1.00 178.78 ? 937  GLN A C   1 
ATOM   5663  O  O   . GLN A  1 937  ? 21.231  32.005  26.462  1.00 233.41 ? 937  GLN A O   1 
ATOM   5664  C  CB  . GLN A  1 937  ? 20.079  32.490  23.647  1.00 154.73 ? 937  GLN A CB  1 
ATOM   5665  C  CG  . GLN A  1 937  ? 19.948  33.103  22.281  1.00 259.64 ? 937  GLN A CG  1 
ATOM   5666  C  CD  . GLN A  1 937  ? 19.234  32.196  21.313  1.00 267.84 ? 937  GLN A CD  1 
ATOM   5667  O  OE1 . GLN A  1 937  ? 18.975  31.028  21.611  1.00 209.83 ? 937  GLN A OE1 1 
ATOM   5668  N  NE2 . GLN A  1 937  ? 18.913  32.726  20.139  1.00 286.00 ? 937  GLN A NE2 1 
ATOM   5669  N  N   . VAL A  1 938  ? 19.321  33.136  26.785  1.00 160.09 ? 938  VAL A N   1 
ATOM   5670  C  CA  . VAL A  1 938  ? 19.117  32.594  28.119  1.00 146.00 ? 938  VAL A CA  1 
ATOM   5671  C  C   . VAL A  1 938  ? 17.665  32.143  28.266  1.00 146.82 ? 938  VAL A C   1 
ATOM   5672  O  O   . VAL A  1 938  ? 16.782  32.591  27.527  1.00 177.17 ? 938  VAL A O   1 
ATOM   5673  C  CB  . VAL A  1 938  ? 19.508  33.636  29.203  1.00 147.67 ? 938  VAL A CB  1 
ATOM   5674  C  CG1 . VAL A  1 938  ? 18.552  34.815  29.186  1.00 210.11 ? 938  VAL A CG1 1 
ATOM   5675  C  CG2 . VAL A  1 938  ? 19.564  33.000  30.584  1.00 129.20 ? 938  VAL A CG2 1 
ATOM   5676  N  N   . ASN A  1 939  ? 17.432  31.232  29.203  1.00 173.51 ? 939  ASN A N   1 
ATOM   5677  C  CA  . ASN A  1 939  ? 16.096  30.709  29.447  1.00 192.03 ? 939  ASN A CA  1 
ATOM   5678  C  C   . ASN A  1 939  ? 16.046  29.845  30.711  1.00 174.82 ? 939  ASN A C   1 
ATOM   5679  O  O   . ASN A  1 939  ? 17.026  29.180  31.068  1.00 105.34 ? 939  ASN A O   1 
ATOM   5680  C  CB  . ASN A  1 939  ? 15.633  29.906  28.231  1.00 156.80 ? 939  ASN A CB  1 
ATOM   5681  C  CG  . ASN A  1 939  ? 16.601  28.790  27.875  1.00 246.13 ? 939  ASN A CG  1 
ATOM   5682  O  OD1 . ASN A  1 939  ? 17.317  28.283  28.737  1.00 386.77 ? 939  ASN A OD1 1 
ATOM   5683  N  ND2 . ASN A  1 939  ? 16.627  28.400  26.606  1.00 119.35 ? 939  ASN A ND2 1 
ATOM   5684  N  N   . ASN A  1 940  ? 14.900  29.852  31.384  1.00 128.63 ? 940  ASN A N   1 
ATOM   5685  C  CA  . ASN A  1 940  ? 14.757  29.110  32.627  1.00 215.43 ? 940  ASN A CA  1 
ATOM   5686  C  C   . ASN A  1 940  ? 13.687  28.040  32.517  1.00 149.60 ? 940  ASN A C   1 
ATOM   5687  O  O   . ASN A  1 940  ? 12.524  28.330  32.235  1.00 125.62 ? 940  ASN A O   1 
ATOM   5688  C  CB  . ASN A  1 940  ? 14.460  30.045  33.809  1.00 275.04 ? 940  ASN A CB  1 
ATOM   5689  C  CG  . ASN A  1 940  ? 13.083  30.676  33.733  1.00 206.99 ? 940  ASN A CG  1 
ATOM   5690  O  OD1 . ASN A  1 940  ? 12.600  31.025  32.658  1.00 117.99 ? 940  ASN A OD1 1 
ATOM   5691  N  ND2 . ASN A  1 940  ? 12.448  30.836  34.887  1.00 177.57 ? 940  ASN A ND2 1 
ATOM   5692  N  N   . LEU A  1 941  ? 14.107  26.798  32.737  1.00 164.51 ? 941  LEU A N   1 
ATOM   5693  C  CA  . LEU A  1 941  ? 13.204  25.655  32.759  1.00 155.32 ? 941  LEU A CA  1 
ATOM   5694  C  C   . LEU A  1 941  ? 12.720  25.371  34.174  1.00 148.84 ? 941  LEU A C   1 
ATOM   5695  O  O   . LEU A  1 941  ? 12.270  24.260  34.467  1.00 120.56 ? 941  LEU A O   1 
ATOM   5696  C  CB  . LEU A  1 941  ? 13.894  24.406  32.199  1.00 193.25 ? 941  LEU A CB  1 
ATOM   5697  C  CG  . LEU A  1 941  ? 14.268  24.489  30.723  1.00 250.99 ? 941  LEU A CG  1 
ATOM   5698  C  CD1 . LEU A  1 941  ? 15.384  25.522  30.547  1.00 84.60  ? 941  LEU A CD1 1 
ATOM   5699  C  CD2 . LEU A  1 941  ? 14.667  23.117  30.171  1.00 317.51 ? 941  LEU A CD2 1 
ATOM   5700  N  N   . GLY A  1 942  ? 12.821  26.373  35.047  1.00 222.00 ? 942  GLY A N   1 
ATOM   5701  C  CA  . GLY A  1 942  ? 12.309  26.258  36.398  1.00 233.39 ? 942  GLY A CA  1 
ATOM   5702  C  C   . GLY A  1 942  ? 10.806  26.135  36.348  1.00 200.44 ? 942  GLY A C   1 
ATOM   5703  O  O   . GLY A  1 942  ? 10.252  25.735  35.325  1.00 249.80 ? 942  GLY A O   1 
ATOM   5704  N  N   . GLN A  1 943  ? 10.137  26.476  37.443  1.00 112.45 ? 943  GLN A N   1 
ATOM   5705  C  CA  . GLN A  1 943  ? 8.677   26.372  37.494  1.00 162.85 ? 943  GLN A CA  1 
ATOM   5706  C  C   . GLN A  1 943  ? 8.082   27.542  38.283  1.00 187.27 ? 943  GLN A C   1 
ATOM   5707  O  O   . GLN A  1 943  ? 6.986   27.441  38.838  1.00 275.30 ? 943  GLN A O   1 
ATOM   5708  C  CB  . GLN A  1 943  ? 8.221   25.007  38.070  1.00 148.81 ? 943  GLN A CB  1 
ATOM   5709  C  CG  . GLN A  1 943  ? 8.854   23.774  37.389  1.00 129.66 ? 943  GLN A CG  1 
ATOM   5710  C  CD  . GLN A  1 943  ? 8.084   22.485  37.632  1.00 228.14 ? 943  GLN A CD  1 
ATOM   5711  O  OE1 . GLN A  1 943  ? 7.192   22.426  38.478  1.00 251.22 ? 943  GLN A OE1 1 
ATOM   5712  N  NE2 . GLN A  1 943  ? 8.432   21.442  36.885  1.00 275.39 ? 943  GLN A NE2 1 
ATOM   5713  N  N   . ARG A  1 944  ? 8.813   28.654  38.321  1.00 149.47 ? 944  ARG A N   1 
ATOM   5714  C  CA  . ARG A  1 944  ? 8.343   29.851  39.006  1.00 216.52 ? 944  ARG A CA  1 
ATOM   5715  C  C   . ARG A  1 944  ? 8.929   31.112  38.384  1.00 201.05 ? 944  ARG A C   1 
ATOM   5716  O  O   . ARG A  1 944  ? 10.130  31.173  38.038  1.00 57.10  ? 944  ARG A O   1 
ATOM   5717  C  CB  . ARG A  1 944  ? 8.685   29.805  40.503  1.00 271.76 ? 944  ARG A CB  1 
ATOM   5718  C  CG  . ARG A  1 944  ? 7.631   29.140  41.400  1.00 299.49 ? 944  ARG A CG  1 
ATOM   5719  C  CD  . ARG A  1 944  ? 8.117   29.038  42.847  1.00 227.41 ? 944  ARG A CD  1 
ATOM   5720  N  NE  . ARG A  1 944  ? 9.291   28.175  42.934  1.00 169.19 ? 944  ARG A NE  1 
ATOM   5721  C  CZ  . ARG A  1 944  ? 9.257   26.886  43.259  1.00 120.94 ? 944  ARG A CZ  1 
ATOM   5722  N  NH1 . ARG A  1 944  ? 8.105   26.295  43.561  1.00 104.48 ? 944  ARG A NH1 1 
ATOM   5723  N  NH2 . ARG A  1 944  ? 10.386  26.184  43.286  1.00 65.02  ? 944  ARG A NH2 1 
ATOM   5724  N  N   . ASP A  1 945  ? 8.062   32.115  38.258  1.00 219.40 ? 945  ASP A N   1 
ATOM   5725  C  CA  . ASP A  1 945  ? 8.462   33.426  37.787  1.00 210.14 ? 945  ASP A CA  1 
ATOM   5726  C  C   . ASP A  1 945  ? 9.307   34.055  38.865  1.00 196.43 ? 945  ASP A C   1 
ATOM   5727  O  O   . ASP A  1 945  ? 8.896   34.123  40.022  1.00 227.67 ? 945  ASP A O   1 
ATOM   5728  C  CB  . ASP A  1 945  ? 7.250   34.316  37.518  1.00 215.50 ? 945  ASP A CB  1 
ATOM   5729  C  CG  . ASP A  1 945  ? 6.288   33.709  36.521  1.00 218.39 ? 945  ASP A CG  1 
ATOM   5730  O  OD1 . ASP A  1 945  ? 6.573   32.608  36.008  1.00 239.15 ? 945  ASP A OD1 1 
ATOM   5731  O  OD2 . ASP A  1 945  ? 5.243   34.336  36.250  1.00 239.29 ? 945  ASP A OD2 1 
ATOM   5732  N  N   . LEU A  1 946  ? 10.488  34.519  38.479  1.00 94.24  ? 946  LEU A N   1 
ATOM   5733  C  CA  . LEU A  1 946  ? 11.450  35.053  39.430  1.00 164.50 ? 946  LEU A CA  1 
ATOM   5734  C  C   . LEU A  1 946  ? 12.362  36.139  38.836  1.00 95.08  ? 946  LEU A C   1 
ATOM   5735  O  O   . LEU A  1 946  ? 13.020  35.903  37.834  1.00 188.19 ? 946  LEU A O   1 
ATOM   5736  C  CB  . LEU A  1 946  ? 12.306  33.893  39.939  1.00 161.37 ? 946  LEU A CB  1 
ATOM   5737  C  CG  . LEU A  1 946  ? 13.161  33.189  38.896  1.00 61.88  ? 946  LEU A CG  1 
ATOM   5738  C  CD1 . LEU A  1 946  ? 14.593  33.748  39.008  1.00 90.09  ? 946  LEU A CD1 1 
ATOM   5739  C  CD2 . LEU A  1 946  ? 13.128  31.672  39.068  1.00 192.67 ? 946  LEU A CD2 1 
ATOM   5740  N  N   . PRO A  1 947  ? 12.413  37.333  39.458  1.00 98.74  ? 947  PRO A N   1 
ATOM   5741  C  CA  . PRO A  1 947  ? 13.333  38.389  39.003  1.00 129.46 ? 947  PRO A CA  1 
ATOM   5742  C  C   . PRO A  1 947  ? 14.787  37.913  38.890  1.00 160.58 ? 947  PRO A C   1 
ATOM   5743  O  O   . PRO A  1 947  ? 15.232  37.057  39.662  1.00 118.71 ? 947  PRO A O   1 
ATOM   5744  C  CB  . PRO A  1 947  ? 13.220  39.457  40.099  1.00 186.92 ? 947  PRO A CB  1 
ATOM   5745  C  CG  . PRO A  1 947  ? 11.917  39.198  40.768  1.00 222.73 ? 947  PRO A CG  1 
ATOM   5746  C  CD  . PRO A  1 947  ? 11.713  37.715  40.698  1.00 226.61 ? 947  PRO A CD  1 
ATOM   5747  N  N   . VAL A  1 948  ? 15.518  38.465  37.927  1.00 180.39 ? 948  VAL A N   1 
ATOM   5748  C  CA  . VAL A  1 948  ? 16.933  38.136  37.757  1.00 158.20 ? 948  VAL A CA  1 
ATOM   5749  C  C   . VAL A  1 948  ? 17.721  39.363  37.311  1.00 146.24 ? 948  VAL A C   1 
ATOM   5750  O  O   . VAL A  1 948  ? 17.163  40.445  37.131  1.00 139.98 ? 948  VAL A O   1 
ATOM   5751  C  CB  . VAL A  1 948  ? 17.141  36.998  36.731  1.00 75.62  ? 948  VAL A CB  1 
ATOM   5752  C  CG1 . VAL A  1 948  ? 16.490  35.713  37.219  1.00 169.80 ? 948  VAL A CG1 1 
ATOM   5753  C  CG2 . VAL A  1 948  ? 16.562  37.403  35.374  1.00 151.92 ? 948  VAL A CG2 1 
ATOM   5754  N  N   . SER A  1 949  ? 19.025  39.191  37.146  1.00 85.61  ? 949  SER A N   1 
ATOM   5755  C  CA  . SER A  1 949  ? 19.868  40.278  36.700  1.00 162.79 ? 949  SER A CA  1 
ATOM   5756  C  C   . SER A  1 949  ? 21.034  39.644  35.982  1.00 194.96 ? 949  SER A C   1 
ATOM   5757  O  O   . SER A  1 949  ? 21.849  38.956  36.604  1.00 168.19 ? 949  SER A O   1 
ATOM   5758  C  CB  . SER A  1 949  ? 20.347  41.117  37.886  1.00 192.58 ? 949  SER A CB  1 
ATOM   5759  O  OG  . SER A  1 949  ? 21.090  42.244  37.455  1.00 221.04 ? 949  SER A OG  1 
ATOM   5760  N  N   . ILE A  1 950  ? 21.087  39.850  34.667  1.00 187.09 ? 950  ILE A N   1 
ATOM   5761  C  CA  . ILE A  1 950  ? 22.132  39.253  33.840  1.00 163.14 ? 950  ILE A CA  1 
ATOM   5762  C  C   . ILE A  1 950  ? 23.365  40.161  33.728  1.00 152.78 ? 950  ILE A C   1 
ATOM   5763  O  O   . ILE A  1 950  ? 23.293  41.273  33.191  1.00 109.22 ? 950  ILE A O   1 
ATOM   5764  C  CB  . ILE A  1 950  ? 21.584  38.887  32.457  1.00 95.84  ? 950  ILE A CB  1 
ATOM   5765  C  CG1 . ILE A  1 950  ? 20.425  37.891  32.604  1.00 135.93 ? 950  ILE A CG1 1 
ATOM   5766  C  CG2 . ILE A  1 950  ? 22.696  38.282  31.592  1.00 164.55 ? 950  ILE A CG2 1 
ATOM   5767  C  CD1 . ILE A  1 950  ? 19.756  37.507  31.301  1.00 185.91 ? 950  ILE A CD1 1 
ATOM   5768  N  N   . ASN A  1 951  ? 24.478  39.673  34.285  1.00 134.33 ? 951  ASN A N   1 
ATOM   5769  C  CA  . ASN A  1 951  ? 25.753  40.395  34.305  1.00 166.08 ? 951  ASN A CA  1 
ATOM   5770  C  C   . ASN A  1 951  ? 26.641  40.027  33.125  1.00 178.89 ? 951  ASN A C   1 
ATOM   5771  O  O   . ASN A  1 951  ? 26.543  38.924  32.576  1.00 117.09 ? 951  ASN A O   1 
ATOM   5772  C  CB  . ASN A  1 951  ? 26.546  40.104  35.593  1.00 155.93 ? 951  ASN A CB  1 
ATOM   5773  C  CG  . ASN A  1 951  ? 26.022  40.862  36.808  1.00 177.92 ? 951  ASN A CG  1 
ATOM   5774  O  OD1 . ASN A  1 951  ? 25.770  40.267  37.858  1.00 174.59 ? 951  ASN A OD1 1 
ATOM   5775  N  ND2 . ASN A  1 951  ? 25.871  42.179  36.675  1.00 209.75 ? 951  ASN A ND2 1 
ATOM   5776  N  N   . PHE A  1 952  ? 27.535  40.947  32.770  1.00 207.55 ? 952  PHE A N   1 
ATOM   5777  C  CA  . PHE A  1 952  ? 28.434  40.767  31.634  1.00 158.52 ? 952  PHE A CA  1 
ATOM   5778  C  C   . PHE A  1 952  ? 29.838  41.273  31.948  1.00 175.19 ? 952  PHE A C   1 
ATOM   5779  O  O   . PHE A  1 952  ? 30.053  41.981  32.938  1.00 239.67 ? 952  PHE A O   1 
ATOM   5780  C  CB  . PHE A  1 952  ? 27.894  41.500  30.398  1.00 139.46 ? 952  PHE A CB  1 
ATOM   5781  C  CG  . PHE A  1 952  ? 26.747  40.792  29.722  1.00 148.14 ? 952  PHE A CG  1 
ATOM   5782  C  CD1 . PHE A  1 952  ? 26.933  39.536  29.153  1.00 161.65 ? 952  PHE A CD1 1 
ATOM   5783  C  CD2 . PHE A  1 952  ? 25.487  41.379  29.651  1.00 116.53 ? 952  PHE A CD2 1 
ATOM   5784  C  CE1 . PHE A  1 952  ? 25.885  38.875  28.529  1.00 129.76 ? 952  PHE A CE1 1 
ATOM   5785  C  CE2 . PHE A  1 952  ? 24.433  40.719  29.032  1.00 84.58  ? 952  PHE A CE2 1 
ATOM   5786  C  CZ  . PHE A  1 952  ? 24.638  39.459  28.471  1.00 96.43  ? 952  PHE A CZ  1 
ATOM   5787  N  N   . TRP A  1 953  ? 30.789  40.896  31.095  1.00 72.68  ? 953  TRP A N   1 
ATOM   5788  C  CA  . TRP A  1 953  ? 32.180  41.299  31.255  1.00 191.38 ? 953  TRP A CA  1 
ATOM   5789  C  C   . TRP A  1 953  ? 32.860  41.460  29.882  1.00 234.99 ? 953  TRP A C   1 
ATOM   5790  O  O   . TRP A  1 953  ? 33.263  40.475  29.253  1.00 149.98 ? 953  TRP A O   1 
ATOM   5791  C  CB  . TRP A  1 953  ? 32.909  40.257  32.111  1.00 247.28 ? 953  TRP A CB  1 
ATOM   5792  C  CG  . TRP A  1 953  ? 32.160  39.867  33.405  1.00 230.01 ? 953  TRP A CG  1 
ATOM   5793  C  CD1 . TRP A  1 953  ? 31.312  38.795  33.596  1.00 199.87 ? 953  TRP A CD1 1 
ATOM   5794  C  CD2 . TRP A  1 953  ? 32.211  40.555  34.662  1.00 177.44 ? 953  TRP A CD2 1 
ATOM   5795  N  NE1 . TRP A  1 953  ? 30.842  38.778  34.894  1.00 81.66  ? 953  TRP A NE1 1 
ATOM   5796  C  CE2 . TRP A  1 953  ? 31.374  39.852  35.562  1.00 179.77 ? 953  TRP A CE2 1 
ATOM   5797  C  CE3 . TRP A  1 953  ? 32.882  41.701  35.112  1.00 95.01  ? 953  TRP A CE3 1 
ATOM   5798  C  CZ2 . TRP A  1 953  ? 31.198  40.267  36.881  1.00 215.86 ? 953  TRP A CZ2 1 
ATOM   5799  C  CZ3 . TRP A  1 953  ? 32.703  42.105  36.417  1.00 141.27 ? 953  TRP A CZ3 1 
ATOM   5800  C  CH2 . TRP A  1 953  ? 31.870  41.392  37.288  1.00 217.50 ? 953  TRP A CH2 1 
ATOM   5801  N  N   . VAL A  1 954  ? 32.971  42.706  29.420  1.00 264.87 ? 954  VAL A N   1 
ATOM   5802  C  CA  . VAL A  1 954  ? 33.528  43.005  28.099  1.00 171.66 ? 954  VAL A CA  1 
ATOM   5803  C  C   . VAL A  1 954  ? 34.801  43.859  28.185  1.00 182.99 ? 954  VAL A C   1 
ATOM   5804  O  O   . VAL A  1 954  ? 34.742  45.012  28.624  1.00 187.40 ? 954  VAL A O   1 
ATOM   5805  C  CB  . VAL A  1 954  ? 32.501  43.762  27.242  1.00 176.66 ? 954  VAL A CB  1 
ATOM   5806  C  CG1 . VAL A  1 954  ? 33.177  44.404  26.033  1.00 265.43 ? 954  VAL A CG1 1 
ATOM   5807  C  CG2 . VAL A  1 954  ? 31.376  42.825  26.816  1.00 118.74 ? 954  VAL A CG2 1 
ATOM   5808  N  N   . PRO A  1 955  ? 35.954  43.300  27.756  1.00 164.69 ? 955  PRO A N   1 
ATOM   5809  C  CA  . PRO A  1 955  ? 37.236  44.023  27.821  1.00 181.26 ? 955  PRO A CA  1 
ATOM   5810  C  C   . PRO A  1 955  ? 37.203  45.324  27.010  1.00 151.28 ? 955  PRO A C   1 
ATOM   5811  O  O   . PRO A  1 955  ? 36.515  45.398  26.000  1.00 231.92 ? 955  PRO A O   1 
ATOM   5812  C  CB  . PRO A  1 955  ? 38.247  43.021  27.232  1.00 139.19 ? 955  PRO A CB  1 
ATOM   5813  C  CG  . PRO A  1 955  ? 37.598  41.679  27.374  1.00 131.09 ? 955  PRO A CG  1 
ATOM   5814  C  CD  . PRO A  1 955  ? 36.119  41.924  27.252  1.00 124.64 ? 955  PRO A CD  1 
ATOM   5815  N  N   . VAL A  1 956  ? 37.923  46.342  27.464  1.00 115.27 ? 956  VAL A N   1 
ATOM   5816  C  CA  . VAL A  1 956  ? 38.041  47.596  26.719  1.00 171.84 ? 956  VAL A CA  1 
ATOM   5817  C  C   . VAL A  1 956  ? 39.430  48.175  26.970  1.00 230.24 ? 956  VAL A C   1 
ATOM   5818  O  O   . VAL A  1 956  ? 40.402  47.748  26.352  1.00 238.34 ? 956  VAL A O   1 
ATOM   5819  C  CB  . VAL A  1 956  ? 36.942  48.633  27.099  1.00 207.33 ? 956  VAL A CB  1 
ATOM   5820  C  CG1 . VAL A  1 956  ? 37.120  49.927  26.301  1.00 153.89 ? 956  VAL A CG1 1 
ATOM   5821  C  CG2 . VAL A  1 956  ? 35.552  48.052  26.870  1.00 182.88 ? 956  VAL A CG2 1 
ATOM   5822  N  N   . GLU A  1 957  ? 39.531  49.124  27.894  1.00 279.08 ? 957  GLU A N   1 
ATOM   5823  C  CA  . GLU A  1 957  ? 40.810  49.751  28.187  1.00 273.54 ? 957  GLU A CA  1 
ATOM   5824  C  C   . GLU A  1 957  ? 41.893  48.695  28.396  1.00 238.88 ? 957  GLU A C   1 
ATOM   5825  O  O   . GLU A  1 957  ? 41.663  47.664  29.028  1.00 204.93 ? 957  GLU A O   1 
ATOM   5826  C  CB  . GLU A  1 957  ? 40.694  50.646  29.422  1.00 281.84 ? 957  GLU A CB  1 
ATOM   5827  C  CG  . GLU A  1 957  ? 39.722  51.801  29.250  1.00 279.26 ? 957  GLU A CG  1 
ATOM   5828  C  CD  . GLU A  1 957  ? 40.084  52.696  28.080  1.00 289.92 ? 957  GLU A CD  1 
ATOM   5829  O  OE1 . GLU A  1 957  ? 41.272  52.734  27.698  1.00 300.40 ? 957  GLU A OE1 1 
ATOM   5830  O  OE2 . GLU A  1 957  ? 39.178  53.364  27.542  1.00 287.89 ? 957  GLU A OE2 1 
ATOM   5831  N  N   . LEU A  1 958  ? 43.070  48.958  27.838  1.00 250.80 ? 958  LEU A N   1 
ATOM   5832  C  CA  . LEU A  1 958  ? 44.218  48.074  27.989  1.00 215.64 ? 958  LEU A CA  1 
ATOM   5833  C  C   . LEU A  1 958  ? 45.494  48.905  27.976  1.00 229.95 ? 958  LEU A C   1 
ATOM   5834  O  O   . LEU A  1 958  ? 46.161  49.035  26.950  1.00 147.75 ? 958  LEU A O   1 
ATOM   5835  C  CB  . LEU A  1 958  ? 44.251  47.034  26.871  1.00 147.64 ? 958  LEU A CB  1 
ATOM   5836  C  CG  . LEU A  1 958  ? 45.557  46.248  26.733  1.00 158.45 ? 958  LEU A CG  1 
ATOM   5837  C  CD1 . LEU A  1 958  ? 45.922  45.583  28.018  1.00 75.83  ? 958  LEU A CD1 1 
ATOM   5838  C  CD2 . LEU A  1 958  ? 45.433  45.213  25.642  1.00 258.02 ? 958  LEU A CD2 1 
ATOM   5839  N  N   . ASN A  1 959  ? 45.826  49.467  29.132  1.00 266.47 ? 959  ASN A N   1 
ATOM   5840  C  CA  . ASN A  1 959  ? 46.958  50.373  29.242  1.00 226.21 ? 959  ASN A CA  1 
ATOM   5841  C  C   . ASN A  1 959  ? 46.696  51.631  28.416  1.00 232.98 ? 959  ASN A C   1 
ATOM   5842  O  O   . ASN A  1 959  ? 47.535  52.041  27.618  1.00 280.52 ? 959  ASN A O   1 
ATOM   5843  C  CB  . ASN A  1 959  ? 48.249  49.679  28.791  1.00 127.81 ? 959  ASN A CB  1 
ATOM   5844  C  CG  . ASN A  1 959  ? 49.472  50.549  28.974  1.00 281.17 ? 959  ASN A CG  1 
ATOM   5845  O  OD1 . ASN A  1 959  ? 49.416  51.593  29.622  1.00 370.28 ? 959  ASN A OD1 1 
ATOM   5846  N  ND2 . ASN A  1 959  ? 50.588  50.123  28.402  1.00 312.19 ? 959  ASN A ND2 1 
ATOM   5847  N  N   . GLN A  1 960  ? 45.517  52.224  28.609  1.00 220.12 ? 960  GLN A N   1 
ATOM   5848  C  CA  . GLN A  1 960  ? 45.099  53.425  27.882  1.00 239.14 ? 960  GLN A CA  1 
ATOM   5849  C  C   . GLN A  1 960  ? 44.705  53.093  26.446  1.00 214.67 ? 960  GLN A C   1 
ATOM   5850  O  O   . GLN A  1 960  ? 43.996  53.859  25.795  1.00 198.23 ? 960  GLN A O   1 
ATOM   5851  C  CB  . GLN A  1 960  ? 46.205  54.485  27.898  1.00 302.08 ? 960  GLN A CB  1 
ATOM   5852  C  CG  . GLN A  1 960  ? 45.811  55.806  27.256  1.00 325.83 ? 960  GLN A CG  1 
ATOM   5853  C  CD  . GLN A  1 960  ? 46.955  56.805  27.226  1.00 339.12 ? 960  GLN A CD  1 
ATOM   5854  O  OE1 . GLN A  1 960  ? 47.952  56.645  27.927  1.00 351.16 ? 960  GLN A OE1 1 
ATOM   5855  N  NE2 . GLN A  1 960  ? 46.815  57.843  26.410  1.00 330.53 ? 960  GLN A NE2 1 
ATOM   5856  N  N   . GLU A  1 961  ? 45.162  51.941  25.966  1.00 197.11 ? 961  GLU A N   1 
ATOM   5857  C  CA  . GLU A  1 961  ? 44.900  51.510  24.600  1.00 227.25 ? 961  GLU A CA  1 
ATOM   5858  C  C   . GLU A  1 961  ? 43.584  50.739  24.556  1.00 213.21 ? 961  GLU A C   1 
ATOM   5859  O  O   . GLU A  1 961  ? 43.528  49.576  24.949  1.00 259.21 ? 961  GLU A O   1 
ATOM   5860  C  CB  . GLU A  1 961  ? 46.054  50.634  24.089  1.00 246.90 ? 961  GLU A CB  1 
ATOM   5861  C  CG  . GLU A  1 961  ? 46.014  50.322  22.594  1.00 247.99 ? 961  GLU A CG  1 
ATOM   5862  C  CD  . GLU A  1 961  ? 46.348  51.519  21.726  1.00 239.64 ? 961  GLU A CD  1 
ATOM   5863  O  OE1 . GLU A  1 961  ? 46.999  52.457  22.227  1.00 240.86 ? 961  GLU A OE1 1 
ATOM   5864  O  OE2 . GLU A  1 961  ? 45.965  51.519  20.537  1.00 225.22 ? 961  GLU A OE2 1 
ATOM   5865  N  N   . ALA A  1 962  ? 42.528  51.396  24.083  1.00 182.68 ? 962  ALA A N   1 
ATOM   5866  C  CA  . ALA A  1 962  ? 41.204  50.782  23.997  1.00 192.98 ? 962  ALA A CA  1 
ATOM   5867  C  C   . ALA A  1 962  ? 41.232  49.500  23.172  1.00 196.31 ? 962  ALA A C   1 
ATOM   5868  O  O   . ALA A  1 962  ? 41.931  49.415  22.164  1.00 234.69 ? 962  ALA A O   1 
ATOM   5869  C  CB  . ALA A  1 962  ? 40.211  51.756  23.395  1.00 196.92 ? 962  ALA A CB  1 
ATOM   5870  N  N   . VAL A  1 963  ? 40.462  48.506  23.601  1.00 196.38 ? 963  VAL A N   1 
ATOM   5871  C  CA  . VAL A  1 963  ? 40.383  47.233  22.891  1.00 205.35 ? 963  VAL A CA  1 
ATOM   5872  C  C   . VAL A  1 963  ? 39.287  47.335  21.839  1.00 254.17 ? 963  VAL A C   1 
ATOM   5873  O  O   . VAL A  1 963  ? 39.550  47.215  20.643  1.00 328.86 ? 963  VAL A O   1 
ATOM   5874  C  CB  . VAL A  1 963  ? 40.112  46.047  23.854  1.00 197.55 ? 963  VAL A CB  1 
ATOM   5875  C  CG1 . VAL A  1 963  ? 39.579  44.846  23.095  1.00 210.22 ? 963  VAL A CG1 1 
ATOM   5876  C  CG2 . VAL A  1 963  ? 41.382  45.668  24.625  1.00 219.89 ? 963  VAL A CG2 1 
ATOM   5877  N  N   . TRP A  1 964  ? 38.058  47.565  22.287  1.00 195.56 ? 964  TRP A N   1 
ATOM   5878  C  CA  . TRP A  1 964  ? 36.975  47.896  21.366  1.00 222.51 ? 964  TRP A CA  1 
ATOM   5879  C  C   . TRP A  1 964  ? 35.985  48.844  21.999  1.00 191.67 ? 964  TRP A C   1 
ATOM   5880  O  O   . TRP A  1 964  ? 35.488  48.611  23.092  1.00 155.90 ? 964  TRP A O   1 
ATOM   5881  C  CB  . TRP A  1 964  ? 36.271  46.653  20.815  1.00 244.95 ? 964  TRP A CB  1 
ATOM   5882  C  CG  . TRP A  1 964  ? 35.652  45.723  21.806  1.00 194.84 ? 964  TRP A CG  1 
ATOM   5883  C  CD1 . TRP A  1 964  ? 36.091  45.447  23.063  1.00 225.26 ? 964  TRP A CD1 1 
ATOM   5884  C  CD2 . TRP A  1 964  ? 34.505  44.882  21.587  1.00 179.63 ? 964  TRP A CD2 1 
ATOM   5885  N  NE1 . TRP A  1 964  ? 35.274  44.509  23.652  1.00 299.26 ? 964  TRP A NE1 1 
ATOM   5886  C  CE2 . TRP A  1 964  ? 34.296  44.145  22.764  1.00 208.84 ? 964  TRP A CE2 1 
ATOM   5887  C  CE3 . TRP A  1 964  ? 33.633  44.690  20.513  1.00 208.99 ? 964  TRP A CE3 1 
ATOM   5888  C  CZ2 . TRP A  1 964  ? 33.246  43.226  22.899  1.00 139.65 ? 964  TRP A CZ2 1 
ATOM   5889  C  CZ3 . TRP A  1 964  ? 32.588  43.779  20.651  1.00 160.21 ? 964  TRP A CZ3 1 
ATOM   5890  C  CH2 . TRP A  1 964  ? 32.408  43.059  21.836  1.00 103.71 ? 964  TRP A CH2 1 
ATOM   5891  N  N   . MET A  1 965  ? 35.688  49.907  21.272  1.00 196.10 ? 965  MET A N   1 
ATOM   5892  C  CA  . MET A  1 965  ? 35.056  51.072  21.851  1.00 241.05 ? 965  MET A CA  1 
ATOM   5893  C  C   . MET A  1 965  ? 33.543  51.062  21.698  1.00 236.56 ? 965  MET A C   1 
ATOM   5894  O  O   . MET A  1 965  ? 32.974  50.186  21.040  1.00 167.47 ? 965  MET A O   1 
ATOM   5895  C  CB  . MET A  1 965  ? 35.636  52.308  21.181  1.00 235.52 ? 965  MET A CB  1 
ATOM   5896  C  CG  . MET A  1 965  ? 37.129  52.185  20.905  1.00 148.49 ? 965  MET A CG  1 
ATOM   5897  S  SD  . MET A  1 965  ? 37.609  53.009  19.391  1.00 340.09 ? 965  MET A SD  1 
ATOM   5898  C  CE  . MET A  1 965  ? 36.682  52.072  18.173  1.00 292.87 ? 965  MET A CE  1 
ATOM   5899  N  N   . ASP A  1 966  ? 32.907  52.044  22.332  1.00 231.18 ? 966  ASP A N   1 
ATOM   5900  C  CA  . ASP A  1 966  ? 31.473  52.261  22.215  1.00 207.12 ? 966  ASP A CA  1 
ATOM   5901  C  C   . ASP A  1 966  ? 30.719  50.946  22.178  1.00 201.54 ? 966  ASP A C   1 
ATOM   5902  O  O   . ASP A  1 966  ? 29.963  50.678  21.250  1.00 146.95 ? 966  ASP A O   1 
ATOM   5903  C  CB  . ASP A  1 966  ? 31.174  53.067  20.956  1.00 260.17 ? 966  ASP A CB  1 
ATOM   5904  C  CG  . ASP A  1 966  ? 31.897  54.389  20.939  1.00 239.23 ? 966  ASP A CG  1 
ATOM   5905  O  OD1 . ASP A  1 966  ? 32.344  54.827  22.017  1.00 169.09 ? 966  ASP A OD1 1 
ATOM   5906  O  OD2 . ASP A  1 966  ? 32.021  54.986  19.851  1.00 277.66 ? 966  ASP A OD2 1 
ATOM   5907  N  N   . VAL A  1 967  ? 30.929  50.118  23.190  1.00 217.12 ? 967  VAL A N   1 
ATOM   5908  C  CA  . VAL A  1 967  ? 30.240  48.843  23.262  1.00 193.15 ? 967  VAL A CA  1 
ATOM   5909  C  C   . VAL A  1 967  ? 28.943  48.991  24.055  1.00 165.05 ? 967  VAL A C   1 
ATOM   5910  O  O   . VAL A  1 967  ? 28.960  49.434  25.198  1.00 198.31 ? 967  VAL A O   1 
ATOM   5911  C  CB  . VAL A  1 967  ? 31.131  47.771  23.906  1.00 143.74 ? 967  VAL A CB  1 
ATOM   5912  C  CG1 . VAL A  1 967  ? 30.382  46.462  24.002  1.00 58.15  ? 967  VAL A CG1 1 
ATOM   5913  C  CG2 . VAL A  1 967  ? 32.411  47.600  23.100  1.00 160.46 ? 967  VAL A CG2 1 
ATOM   5914  N  N   . GLU A  1 968  ? 27.820  48.643  23.431  1.00 154.11 ? 968  GLU A N   1 
ATOM   5915  C  CA  . GLU A  1 968  ? 26.521  48.657  24.103  1.00 190.94 ? 968  GLU A CA  1 
ATOM   5916  C  C   . GLU A  1 968  ? 25.799  47.340  23.845  1.00 212.34 ? 968  GLU A C   1 
ATOM   5917  O  O   . GLU A  1 968  ? 26.257  46.522  23.041  1.00 176.67 ? 968  GLU A O   1 
ATOM   5918  C  CB  . GLU A  1 968  ? 25.662  49.822  23.612  1.00 210.29 ? 968  GLU A CB  1 
ATOM   5919  C  CG  . GLU A  1 968  ? 26.175  51.186  24.013  1.00 236.28 ? 968  GLU A CG  1 
ATOM   5920  C  CD  . GLU A  1 968  ? 25.428  52.306  23.316  1.00 261.50 ? 968  GLU A CD  1 
ATOM   5921  O  OE1 . GLU A  1 968  ? 24.615  52.007  22.412  1.00 174.44 ? 968  GLU A OE1 1 
ATOM   5922  O  OE2 . GLU A  1 968  ? 25.651  53.482  23.672  1.00 319.83 ? 968  GLU A OE2 1 
ATOM   5923  N  N   . VAL A  1 969  ? 24.669  47.141  24.521  1.00 201.20 ? 969  VAL A N   1 
ATOM   5924  C  CA  . VAL A  1 969  ? 23.933  45.884  24.417  1.00 167.14 ? 969  VAL A CA  1 
ATOM   5925  C  C   . VAL A  1 969  ? 22.491  46.076  23.962  1.00 184.20 ? 969  VAL A C   1 
ATOM   5926  O  O   . VAL A  1 969  ? 21.686  46.729  24.635  1.00 138.22 ? 969  VAL A O   1 
ATOM   5927  C  CB  . VAL A  1 969  ? 23.918  45.136  25.749  1.00 160.81 ? 969  VAL A CB  1 
ATOM   5928  C  CG1 . VAL A  1 969  ? 23.404  46.047  26.853  1.00 171.34 ? 969  VAL A CG1 1 
ATOM   5929  C  CG2 . VAL A  1 969  ? 23.077  43.867  25.633  1.00 228.89 ? 969  VAL A CG2 1 
ATOM   5930  N  N   . SER A  1 970  ? 22.180  45.496  22.806  1.00 241.60 ? 970  SER A N   1 
ATOM   5931  C  CA  . SER A  1 970  ? 20.833  45.531  22.260  1.00 272.19 ? 970  SER A CA  1 
ATOM   5932  C  C   . SER A  1 970  ? 19.981  44.456  22.917  1.00 238.72 ? 970  SER A C   1 
ATOM   5933  O  O   . SER A  1 970  ? 20.488  43.402  23.318  1.00 140.80 ? 970  SER A O   1 
ATOM   5934  C  CB  . SER A  1 970  ? 20.863  45.319  20.744  1.00 261.88 ? 970  SER A CB  1 
ATOM   5935  O  OG  . SER A  1 970  ? 19.554  45.340  20.203  1.00 271.92 ? 970  SER A OG  1 
ATOM   5936  N  N   . HIS A  1 971  ? 18.684  44.734  23.023  1.00 272.10 ? 971  HIS A N   1 
ATOM   5937  C  CA  . HIS A  1 971  ? 17.739  43.801  23.623  1.00 215.00 ? 971  HIS A CA  1 
ATOM   5938  C  C   . HIS A  1 971  ? 16.495  43.633  22.755  1.00 216.26 ? 971  HIS A C   1 
ATOM   5939  O  O   . HIS A  1 971  ? 15.394  44.016  23.155  1.00 209.36 ? 971  HIS A O   1 
ATOM   5940  C  CB  . HIS A  1 971  ? 17.334  44.285  25.010  1.00 118.48 ? 971  HIS A CB  1 
ATOM   5941  C  CG  . HIS A  1 971  ? 16.365  43.380  25.698  1.00 243.92 ? 971  HIS A CG  1 
ATOM   5942  N  ND1 . HIS A  1 971  ? 16.439  42.003  25.612  1.00 261.80 ? 971  HIS A ND1 1 
ATOM   5943  C  CD2 . HIS A  1 971  ? 15.300  43.642  26.492  1.00 276.57 ? 971  HIS A CD2 1 
ATOM   5944  C  CE1 . HIS A  1 971  ? 15.469  41.465  26.317  1.00 255.39 ? 971  HIS A CE1 1 
ATOM   5945  N  NE2 . HIS A  1 971  ? 14.759  42.439  26.866  1.00 249.81 ? 971  HIS A NE2 1 
ATOM   5946  N  N   . PRO A  1 972  ? 16.673  43.053  21.559  1.00 214.46 ? 972  PRO A N   1 
ATOM   5947  C  CA  . PRO A  1 972  ? 15.589  42.906  20.585  1.00 237.26 ? 972  PRO A CA  1 
ATOM   5948  C  C   . PRO A  1 972  ? 14.509  41.952  21.064  1.00 227.43 ? 972  PRO A C   1 
ATOM   5949  O  O   . PRO A  1 972  ? 14.705  41.252  22.057  1.00 142.76 ? 972  PRO A O   1 
ATOM   5950  C  CB  . PRO A  1 972  ? 16.296  42.325  19.354  1.00 285.48 ? 972  PRO A CB  1 
ATOM   5951  C  CG  . PRO A  1 972  ? 17.747  42.592  19.564  1.00 272.96 ? 972  PRO A CG  1 
ATOM   5952  C  CD  . PRO A  1 972  ? 17.951  42.547  21.036  1.00 232.63 ? 972  PRO A CD  1 
ATOM   5953  N  N   . GLN A  1 973  ? 13.383  41.941  20.355  1.00 320.41 ? 973  GLN A N   1 
ATOM   5954  C  CA  . GLN A  1 973  ? 12.273  41.042  20.651  1.00 355.24 ? 973  GLN A CA  1 
ATOM   5955  C  C   . GLN A  1 973  ? 11.763  41.223  22.077  1.00 340.09 ? 973  GLN A C   1 
ATOM   5956  O  O   . GLN A  1 973  ? 11.024  40.382  22.588  1.00 357.58 ? 973  GLN A O   1 
ATOM   5957  C  CB  . GLN A  1 973  ? 12.693  39.587  20.428  1.00 366.03 ? 973  GLN A CB  1 
ATOM   5958  C  CG  . GLN A  1 973  ? 13.190  39.291  19.020  1.00 348.05 ? 973  GLN A CG  1 
ATOM   5959  C  CD  . GLN A  1 973  ? 12.109  39.449  17.975  1.00 299.22 ? 973  GLN A CD  1 
ATOM   5960  O  OE1 . GLN A  1 973  ? 10.941  39.652  18.303  1.00 304.98 ? 973  GLN A OE1 1 
ATOM   5961  N  NE2 . GLN A  1 973  ? 12.491  39.356  16.705  1.00 258.84 ? 973  GLN A NE2 1 
ATOM   5962  N  N   . ASN A  1 974  ? 12.151  42.328  22.708  1.00 273.81 ? 974  ASN A N   1 
ATOM   5963  C  CA  . ASN A  1 974  ? 11.767  42.602  24.087  1.00 219.27 ? 974  ASN A CA  1 
ATOM   5964  C  C   . ASN A  1 974  ? 11.847  44.088  24.416  1.00 236.57 ? 974  ASN A C   1 
ATOM   5965  O  O   . ASN A  1 974  ? 12.627  44.817  23.801  1.00 198.90 ? 974  ASN A O   1 
ATOM   5966  C  CB  . ASN A  1 974  ? 12.667  41.821  25.035  1.00 193.80 ? 974  ASN A CB  1 
ATOM   5967  C  CG  . ASN A  1 974  ? 12.449  40.328  24.940  1.00 220.86 ? 974  ASN A CG  1 
ATOM   5968  O  OD1 . ASN A  1 974  ? 11.341  39.841  25.158  1.00 309.32 ? 974  ASN A OD1 1 
ATOM   5969  N  ND2 . ASN A  1 974  ? 13.504  39.590  24.614  1.00 138.35 ? 974  ASN A ND2 1 
ATOM   5970  N  N   . PRO A  1 975  ? 11.044  44.540  25.395  1.00 259.80 ? 975  PRO A N   1 
ATOM   5971  C  CA  . PRO A  1 975  ? 10.971  45.957  25.770  1.00 246.03 ? 975  PRO A CA  1 
ATOM   5972  C  C   . PRO A  1 975  ? 12.349  46.565  26.019  1.00 201.37 ? 975  PRO A C   1 
ATOM   5973  O  O   . PRO A  1 975  ? 13.315  45.827  26.191  1.00 185.32 ? 975  PRO A O   1 
ATOM   5974  C  CB  . PRO A  1 975  ? 10.142  45.929  27.065  1.00 226.30 ? 975  PRO A CB  1 
ATOM   5975  C  CG  . PRO A  1 975  ? 10.170  44.490  27.512  1.00 209.87 ? 975  PRO A CG  1 
ATOM   5976  C  CD  . PRO A  1 975  ? 10.155  43.730  26.241  1.00 238.02 ? 975  PRO A CD  1 
ATOM   5977  N  N   . SER A  1 976  ? 12.439  47.891  26.018  1.00 200.79 ? 976  SER A N   1 
ATOM   5978  C  CA  . SER A  1 976  ? 13.706  48.564  26.283  1.00 226.16 ? 976  SER A CA  1 
ATOM   5979  C  C   . SER A  1 976  ? 14.014  48.502  27.769  1.00 248.78 ? 976  SER A C   1 
ATOM   5980  O  O   . SER A  1 976  ? 13.498  49.296  28.552  1.00 234.40 ? 976  SER A O   1 
ATOM   5981  C  CB  . SER A  1 976  ? 13.655  50.020  25.830  1.00 265.64 ? 976  SER A CB  1 
ATOM   5982  O  OG  . SER A  1 976  ? 12.587  50.708  26.455  1.00 299.94 ? 976  SER A OG  1 
ATOM   5983  N  N   . LEU A  1 977  ? 14.857  47.551  28.153  1.00 269.37 ? 977  LEU A N   1 
ATOM   5984  C  CA  . LEU A  1 977  ? 15.209  47.357  29.554  1.00 227.84 ? 977  LEU A CA  1 
ATOM   5985  C  C   . LEU A  1 977  ? 16.384  48.239  29.966  1.00 162.85 ? 977  LEU A C   1 
ATOM   5986  O  O   . LEU A  1 977  ? 17.097  48.776  29.124  1.00 151.82 ? 977  LEU A O   1 
ATOM   5987  C  CB  . LEU A  1 977  ? 15.533  45.886  29.816  1.00 196.32 ? 977  LEU A CB  1 
ATOM   5988  C  CG  . LEU A  1 977  ? 14.331  44.983  30.118  1.00 198.05 ? 977  LEU A CG  1 
ATOM   5989  C  CD1 . LEU A  1 977  ? 13.213  45.160  29.110  1.00 198.70 ? 977  LEU A CD1 1 
ATOM   5990  C  CD2 . LEU A  1 977  ? 14.758  43.528  30.174  1.00 174.64 ? 977  LEU A CD2 1 
ATOM   5991  N  N   . ARG A  1 978  ? 16.578  48.389  31.270  1.00 210.96 ? 978  ARG A N   1 
ATOM   5992  C  CA  . ARG A  1 978  ? 17.632  49.244  31.792  1.00 259.70 ? 978  ARG A CA  1 
ATOM   5993  C  C   . ARG A  1 978  ? 18.851  48.416  32.161  1.00 245.68 ? 978  ARG A C   1 
ATOM   5994  O  O   . ARG A  1 978  ? 18.742  47.416  32.867  1.00 299.81 ? 978  ARG A O   1 
ATOM   5995  C  CB  . ARG A  1 978  ? 17.135  50.003  33.022  1.00 318.65 ? 978  ARG A CB  1 
ATOM   5996  C  CG  . ARG A  1 978  ? 15.813  50.713  32.805  1.00 338.48 ? 978  ARG A CG  1 
ATOM   5997  C  CD  . ARG A  1 978  ? 15.462  51.617  33.974  1.00 334.05 ? 978  ARG A CD  1 
ATOM   5998  N  NE  . ARG A  1 978  ? 14.327  52.481  33.666  1.00 336.03 ? 978  ARG A NE  1 
ATOM   5999  C  CZ  . ARG A  1 978  ? 13.864  53.431  34.472  1.00 326.34 ? 978  ARG A CZ  1 
ATOM   6000  N  NH1 . ARG A  1 978  ? 14.439  53.652  35.647  1.00 317.29 ? 978  ARG A NH1 1 
ATOM   6001  N  NH2 . ARG A  1 978  ? 12.822  54.163  34.102  1.00 329.61 ? 978  ARG A NH2 1 
ATOM   6002  N  N   . CYS A  1 979  ? 20.014  48.838  31.682  1.00 183.63 ? 979  CYS A N   1 
ATOM   6003  C  CA  . CYS A  1 979  ? 21.261  48.154  32.009  1.00 181.43 ? 979  CYS A CA  1 
ATOM   6004  C  C   . CYS A  1 979  ? 22.300  49.117  32.575  1.00 198.41 ? 979  CYS A C   1 
ATOM   6005  O  O   . CYS A  1 979  ? 22.317  50.303  32.237  1.00 227.60 ? 979  CYS A O   1 
ATOM   6006  C  CB  . CYS A  1 979  ? 21.815  47.447  30.779  1.00 77.85  ? 979  CYS A CB  1 
ATOM   6007  S  SG  . CYS A  1 979  ? 20.863  45.998  30.324  1.00 294.38 ? 979  CYS A SG  1 
ATOM   6008  N  N   . SER A  1 980  ? 23.164  48.594  33.440  1.00 156.07 ? 980  SER A N   1 
ATOM   6009  C  CA  . SER A  1 980  ? 24.158  49.414  34.122  1.00 215.35 ? 980  SER A CA  1 
ATOM   6010  C  C   . SER A  1 980  ? 25.533  49.206  33.511  1.00 192.67 ? 980  SER A C   1 
ATOM   6011  O  O   . SER A  1 980  ? 25.778  48.220  32.809  1.00 117.84 ? 980  SER A O   1 
ATOM   6012  C  CB  . SER A  1 980  ? 24.208  49.069  35.613  1.00 251.51 ? 980  SER A CB  1 
ATOM   6013  O  OG  . SER A  1 980  ? 25.132  49.893  36.306  1.00 245.52 ? 980  SER A OG  1 
ATOM   6014  N  N   . SER A  1 981  ? 26.434  50.134  33.810  1.00 195.51 ? 981  SER A N   1 
ATOM   6015  C  CA  . SER A  1 981  ? 27.776  50.092  33.269  1.00 156.54 ? 981  SER A CA  1 
ATOM   6016  C  C   . SER A  1 981  ? 28.794  50.548  34.306  1.00 145.10 ? 981  SER A C   1 
ATOM   6017  O  O   . SER A  1 981  ? 28.625  51.593  34.944  1.00 163.98 ? 981  SER A O   1 
ATOM   6018  C  CB  . SER A  1 981  ? 27.857  50.985  32.035  1.00 198.25 ? 981  SER A CB  1 
ATOM   6019  O  OG  . SER A  1 981  ? 27.499  52.321  32.347  1.00 275.86 ? 981  SER A OG  1 
ATOM   6020  N  N   . GLU A  1 982  ? 29.857  49.762  34.463  1.00 128.22 ? 982  GLU A N   1 
ATOM   6021  C  CA  . GLU A  1 982  ? 30.932  50.091  35.406  1.00 173.26 ? 982  GLU A CA  1 
ATOM   6022  C  C   . GLU A  1 982  ? 32.313  49.569  34.956  1.00 173.60 ? 982  GLU A C   1 
ATOM   6023  O  O   . GLU A  1 982  ? 32.466  48.393  34.631  1.00 153.31 ? 982  GLU A O   1 
ATOM   6024  C  CB  . GLU A  1 982  ? 30.598  49.518  36.790  1.00 238.67 ? 982  GLU A CB  1 
ATOM   6025  C  CG  . GLU A  1 982  ? 29.327  50.077  37.427  1.00 258.53 ? 982  GLU A CG  1 
ATOM   6026  C  CD  . GLU A  1 982  ? 28.987  49.405  38.753  1.00 243.69 ? 982  GLU A CD  1 
ATOM   6027  O  OE1 . GLU A  1 982  ? 29.699  48.459  39.154  1.00 164.14 ? 982  GLU A OE1 1 
ATOM   6028  O  OE2 . GLU A  1 982  ? 28.001  49.823  39.394  1.00 286.51 ? 982  GLU A OE2 1 
ATOM   6029  N  N   . LYS A  1 983  ? 33.319  50.441  34.952  1.00 183.75 ? 983  LYS A N   1 
ATOM   6030  C  CA  . LYS A  1 983  ? 34.673  50.034  34.581  1.00 158.86 ? 983  LYS A CA  1 
ATOM   6031  C  C   . LYS A  1 983  ? 35.435  49.551  35.800  1.00 174.95 ? 983  LYS A C   1 
ATOM   6032  O  O   . LYS A  1 983  ? 35.216  50.036  36.908  1.00 239.67 ? 983  LYS A O   1 
ATOM   6033  C  CB  . LYS A  1 983  ? 35.431  51.200  33.953  1.00 193.25 ? 983  LYS A CB  1 
ATOM   6034  C  CG  . LYS A  1 983  ? 34.870  51.669  32.628  1.00 230.69 ? 983  LYS A CG  1 
ATOM   6035  C  CD  . LYS A  1 983  ? 35.636  52.876  32.105  1.00 226.03 ? 983  LYS A CD  1 
ATOM   6036  C  CE  . LYS A  1 983  ? 35.221  53.234  30.692  1.00 225.70 ? 983  LYS A CE  1 
ATOM   6037  N  NZ  . LYS A  1 983  ? 35.973  54.405  30.173  1.00 222.38 ? 983  LYS A NZ  1 
ATOM   6038  N  N   . ILE A  1 984  ? 36.337  48.599  35.594  1.00 130.45 ? 984  ILE A N   1 
ATOM   6039  C  CA  . ILE A  1 984  ? 37.159  48.093  36.687  1.00 189.54 ? 984  ILE A CA  1 
ATOM   6040  C  C   . ILE A  1 984  ? 38.541  47.677  36.207  1.00 154.40 ? 984  ILE A C   1 
ATOM   6041  O  O   . ILE A  1 984  ? 38.698  47.221  35.081  1.00 164.80 ? 984  ILE A O   1 
ATOM   6042  C  CB  . ILE A  1 984  ? 36.508  46.880  37.373  1.00 234.31 ? 984  ILE A CB  1 
ATOM   6043  C  CG1 . ILE A  1 984  ? 36.254  45.766  36.358  1.00 175.70 ? 984  ILE A CG1 1 
ATOM   6044  C  CG2 . ILE A  1 984  ? 35.213  47.288  38.066  1.00 277.24 ? 984  ILE A CG2 1 
ATOM   6045  C  CD1 . ILE A  1 984  ? 35.857  44.456  36.995  1.00 235.56 ? 984  ILE A CD1 1 
ATOM   6046  N  N   . ALA A  1 985  ? 39.536  47.825  37.075  1.00 190.84 ? 985  ALA A N   1 
ATOM   6047  C  CA  . ALA A  1 985  ? 40.919  47.520  36.722  1.00 143.50 ? 985  ALA A CA  1 
ATOM   6048  C  C   . ALA A  1 985  ? 41.393  46.233  37.394  1.00 218.56 ? 985  ALA A C   1 
ATOM   6049  O  O   . ALA A  1 985  ? 41.364  46.127  38.618  1.00 317.06 ? 985  ALA A O   1 
ATOM   6050  C  CB  . ALA A  1 985  ? 41.821  48.673  37.115  1.00 195.83 ? 985  ALA A CB  1 
ATOM   6051  N  N   . PRO A  1 986  ? 41.837  45.251  36.591  1.00 187.06 ? 986  PRO A N   1 
ATOM   6052  C  CA  . PRO A  1 986  ? 42.320  43.943  37.064  1.00 231.75 ? 986  PRO A CA  1 
ATOM   6053  C  C   . PRO A  1 986  ? 43.569  44.025  37.953  1.00 227.04 ? 986  PRO A C   1 
ATOM   6054  O  O   . PRO A  1 986  ? 44.046  45.130  38.215  1.00 212.04 ? 986  PRO A O   1 
ATOM   6055  C  CB  . PRO A  1 986  ? 42.644  43.203  35.764  1.00 260.84 ? 986  PRO A CB  1 
ATOM   6056  C  CG  . PRO A  1 986  ? 41.834  43.880  34.728  1.00 237.36 ? 986  PRO A CG  1 
ATOM   6057  C  CD  . PRO A  1 986  ? 41.801  45.313  35.123  1.00 185.93 ? 986  PRO A CD  1 
ATOM   6058  N  N   . PRO A  1 987  ? 44.105  42.866  38.389  1.00 261.57 ? 987  PRO A N   1 
ATOM   6059  C  CA  . PRO A  1 987  ? 45.169  42.823  39.403  1.00 309.14 ? 987  PRO A CA  1 
ATOM   6060  C  C   . PRO A  1 987  ? 46.483  43.456  38.955  1.00 294.09 ? 987  PRO A C   1 
ATOM   6061  O  O   . PRO A  1 987  ? 47.309  43.788  39.802  1.00 360.99 ? 987  PRO A O   1 
ATOM   6062  C  CB  . PRO A  1 987  ? 45.351  41.326  39.664  1.00 330.59 ? 987  PRO A CB  1 
ATOM   6063  C  CG  . PRO A  1 987  ? 44.854  40.653  38.456  1.00 301.00 ? 987  PRO A CG  1 
ATOM   6064  C  CD  . PRO A  1 987  ? 43.811  41.530  37.843  1.00 272.95 ? 987  PRO A CD  1 
ATOM   6065  N  N   . ALA A  1 988  ? 46.672  43.606  37.649  1.00 205.43 ? 988  ALA A N   1 
ATOM   6066  C  CA  . ALA A  1 988  ? 47.830  44.313  37.112  1.00 224.47 ? 988  ALA A CA  1 
ATOM   6067  C  C   . ALA A  1 988  ? 49.103  43.481  37.187  1.00 277.80 ? 988  ALA A C   1 
ATOM   6068  O  O   . ALA A  1 988  ? 50.196  44.026  37.336  1.00 323.89 ? 988  ALA A O   1 
ATOM   6069  C  CB  . ALA A  1 988  ? 48.029  45.641  37.837  1.00 227.77 ? 988  ALA A CB  1 
ATOM   6070  N  N   . SER A  1 989  ? 48.964  42.164  37.083  1.00 279.22 ? 989  SER A N   1 
ATOM   6071  C  CA  . SER A  1 989  ? 50.128  41.289  37.043  1.00 260.72 ? 989  SER A CA  1 
ATOM   6072  C  C   . SER A  1 989  ? 50.885  41.516  35.741  1.00 278.71 ? 989  SER A C   1 
ATOM   6073  O  O   . SER A  1 989  ? 50.440  42.277  34.880  1.00 273.16 ? 989  SER A O   1 
ATOM   6074  C  CB  . SER A  1 989  ? 49.708  39.822  37.159  1.00 219.08 ? 989  SER A CB  1 
ATOM   6075  O  OG  . SER A  1 989  ? 49.002  39.591  38.364  1.00 247.88 ? 989  SER A OG  1 
ATOM   6076  N  N   . ASP A  1 990  ? 52.032  40.862  35.601  1.00 281.02 ? 990  ASP A N   1 
ATOM   6077  C  CA  . ASP A  1 990  ? 52.813  40.962  34.377  1.00 275.59 ? 990  ASP A CA  1 
ATOM   6078  C  C   . ASP A  1 990  ? 52.053  40.338  33.214  1.00 283.77 ? 990  ASP A C   1 
ATOM   6079  O  O   . ASP A  1 990  ? 52.117  39.127  33.004  1.00 305.32 ? 990  ASP A O   1 
ATOM   6080  C  CB  . ASP A  1 990  ? 54.153  40.258  34.547  1.00 259.56 ? 990  ASP A CB  1 
ATOM   6081  C  CG  . ASP A  1 990  ? 54.986  40.302  33.292  1.00 228.60 ? 990  ASP A CG  1 
ATOM   6082  O  OD1 . ASP A  1 990  ? 54.615  41.048  32.362  1.00 259.23 ? 990  ASP A OD1 1 
ATOM   6083  O  OD2 . ASP A  1 990  ? 56.008  39.591  33.233  1.00 218.47 ? 990  ASP A OD2 1 
ATOM   6084  N  N   . PHE A  1 991  ? 51.342  41.168  32.455  1.00 255.30 ? 991  PHE A N   1 
ATOM   6085  C  CA  . PHE A  1 991  ? 50.495  40.676  31.373  1.00 249.43 ? 991  PHE A CA  1 
ATOM   6086  C  C   . PHE A  1 991  ? 51.319  40.203  30.184  1.00 243.34 ? 991  PHE A C   1 
ATOM   6087  O  O   . PHE A  1 991  ? 50.826  39.453  29.340  1.00 206.86 ? 991  PHE A O   1 
ATOM   6088  C  CB  . PHE A  1 991  ? 49.519  41.758  30.921  1.00 255.66 ? 991  PHE A CB  1 
ATOM   6089  C  CG  . PHE A  1 991  ? 50.185  42.975  30.359  1.00 237.39 ? 991  PHE A CG  1 
ATOM   6090  C  CD1 . PHE A  1 991  ? 50.652  42.981  29.062  1.00 204.80 ? 991  PHE A CD1 1 
ATOM   6091  C  CD2 . PHE A  1 991  ? 50.337  44.114  31.126  1.00 247.32 ? 991  PHE A CD2 1 
ATOM   6092  C  CE1 . PHE A  1 991  ? 51.260  44.098  28.540  1.00 219.66 ? 991  PHE A CE1 1 
ATOM   6093  C  CE2 . PHE A  1 991  ? 50.946  45.235  30.607  1.00 235.29 ? 991  PHE A CE2 1 
ATOM   6094  C  CZ  . PHE A  1 991  ? 51.406  45.227  29.314  1.00 210.53 ? 991  PHE A CZ  1 
ATOM   6095  N  N   . LEU A  1 992  ? 52.566  40.657  30.110  1.00 259.20 ? 992  LEU A N   1 
ATOM   6096  C  CA  . LEU A  1 992  ? 53.487  40.197  29.078  1.00 278.82 ? 992  LEU A CA  1 
ATOM   6097  C  C   . LEU A  1 992  ? 53.521  38.669  29.024  1.00 283.89 ? 992  LEU A C   1 
ATOM   6098  O  O   . LEU A  1 992  ? 53.135  38.059  28.024  1.00 243.93 ? 992  LEU A O   1 
ATOM   6099  C  CB  . LEU A  1 992  ? 54.890  40.746  29.347  1.00 280.05 ? 992  LEU A CB  1 
ATOM   6100  C  CG  . LEU A  1 992  ? 55.979  40.415  28.323  1.00 275.42 ? 992  LEU A CG  1 
ATOM   6101  C  CD1 . LEU A  1 992  ? 57.133  41.400  28.444  1.00 281.11 ? 992  LEU A CD1 1 
ATOM   6102  C  CD2 . LEU A  1 992  ? 56.479  38.980  28.475  1.00 263.19 ? 992  LEU A CD2 1 
ATOM   6103  N  N   . ALA A  1 993  ? 53.982  38.056  30.108  1.00 270.66 ? 993  ALA A N   1 
ATOM   6104  C  CA  . ALA A  1 993  ? 54.111  36.606  30.172  1.00 224.41 ? 993  ALA A CA  1 
ATOM   6105  C  C   . ALA A  1 993  ? 52.753  35.933  30.336  1.00 255.37 ? 993  ALA A C   1 
ATOM   6106  O  O   . ALA A  1 993  ? 52.577  34.777  29.949  1.00 289.74 ? 993  ALA A O   1 
ATOM   6107  C  CB  . ALA A  1 993  ? 55.018  36.224  31.318  1.00 221.09 ? 993  ALA A CB  1 
ATOM   6108  N  N   . HIS A  1 994  ? 51.798  36.664  30.907  1.00 275.84 ? 994  HIS A N   1 
ATOM   6109  C  CA  . HIS A  1 994  ? 50.479  36.111  31.214  1.00 313.55 ? 994  HIS A CA  1 
ATOM   6110  C  C   . HIS A  1 994  ? 49.832  35.501  29.977  1.00 324.37 ? 994  HIS A C   1 
ATOM   6111  O  O   . HIS A  1 994  ? 49.580  34.296  29.931  1.00 330.19 ? 994  HIS A O   1 
ATOM   6112  C  CB  . HIS A  1 994  ? 49.555  37.184  31.811  1.00 321.99 ? 994  HIS A CB  1 
ATOM   6113  C  CG  . HIS A  1 994  ? 48.261  36.644  32.347  1.00 287.92 ? 994  HIS A CG  1 
ATOM   6114  N  ND1 . HIS A  1 994  ? 47.161  36.404  31.549  1.00 204.04 ? 994  HIS A ND1 1 
ATOM   6115  C  CD2 . HIS A  1 994  ? 47.891  36.309  33.606  1.00 313.30 ? 994  HIS A CD2 1 
ATOM   6116  C  CE1 . HIS A  1 994  ? 46.173  35.938  32.292  1.00 231.17 ? 994  HIS A CE1 1 
ATOM   6117  N  NE2 . HIS A  1 994  ? 46.589  35.872  33.544  1.00 302.89 ? 994  HIS A NE2 1 
ATOM   6118  N  N   . ILE A  1 995  ? 49.565  36.330  28.974  1.00 284.36 ? 995  ILE A N   1 
ATOM   6119  C  CA  . ILE A  1 995  ? 48.862  35.856  27.790  1.00 269.40 ? 995  ILE A CA  1 
ATOM   6120  C  C   . ILE A  1 995  ? 49.798  35.098  26.855  1.00 261.87 ? 995  ILE A C   1 
ATOM   6121  O  O   . ILE A  1 995  ? 49.356  34.505  25.873  1.00 271.64 ? 995  ILE A O   1 
ATOM   6122  C  CB  . ILE A  1 995  ? 48.168  37.007  27.030  1.00 240.89 ? 995  ILE A CB  1 
ATOM   6123  C  CG1 . ILE A  1 995  ? 49.185  37.856  26.267  1.00 184.87 ? 995  ILE A CG1 1 
ATOM   6124  C  CG2 . ILE A  1 995  ? 47.368  37.875  27.996  1.00 259.79 ? 995  ILE A CG2 1 
ATOM   6125  C  CD1 . ILE A  1 995  ? 48.564  38.654  25.130  1.00 227.64 ? 995  ILE A CD1 1 
ATOM   6126  N  N   . GLN A  1 996  ? 51.091  35.110  27.162  1.00 248.07 ? 996  GLN A N   1 
ATOM   6127  C  CA  . GLN A  1 996  ? 52.036  34.319  26.394  1.00 269.98 ? 996  GLN A CA  1 
ATOM   6128  C  C   . GLN A  1 996  ? 51.760  32.849  26.659  1.00 292.83 ? 996  GLN A C   1 
ATOM   6129  O  O   . GLN A  1 996  ? 51.872  32.015  25.764  1.00 315.28 ? 996  GLN A O   1 
ATOM   6130  C  CB  . GLN A  1 996  ? 53.471  34.670  26.763  1.00 277.46 ? 996  GLN A CB  1 
ATOM   6131  C  CG  . GLN A  1 996  ? 54.492  33.944  25.920  1.00 310.32 ? 996  GLN A CG  1 
ATOM   6132  C  CD  . GLN A  1 996  ? 55.884  34.491  26.107  1.00 337.84 ? 996  GLN A CD  1 
ATOM   6133  O  OE1 . GLN A  1 996  ? 56.121  35.324  26.980  1.00 329.22 ? 996  GLN A OE1 1 
ATOM   6134  N  NE2 . GLN A  1 996  ? 56.819  34.028  25.285  1.00 366.35 ? 996  GLN A NE2 1 
ATOM   6135  N  N   . LYS A  1 997  ? 51.396  32.538  27.898  1.00 279.96 ? 997  LYS A N   1 
ATOM   6136  C  CA  . LYS A  1 997  ? 50.897  31.215  28.230  1.00 302.13 ? 997  LYS A CA  1 
ATOM   6137  C  C   . LYS A  1 997  ? 49.763  30.879  27.282  1.00 332.79 ? 997  LYS A C   1 
ATOM   6138  O  O   . LYS A  1 997  ? 49.830  29.926  26.510  1.00 405.20 ? 997  LYS A O   1 
ATOM   6139  C  CB  . LYS A  1 997  ? 50.341  31.190  29.652  1.00 308.22 ? 997  LYS A CB  1 
ATOM   6140  C  CG  . LYS A  1 997  ? 51.361  31.093  30.766  1.00 309.38 ? 997  LYS A CG  1 
ATOM   6141  C  CD  . LYS A  1 997  ? 50.653  30.718  32.058  1.00 292.22 ? 997  LYS A CD  1 
ATOM   6142  C  CE  . LYS A  1 997  ? 51.391  31.195  33.293  1.00 265.03 ? 997  LYS A CE  1 
ATOM   6143  N  NZ  . LYS A  1 997  ? 50.488  31.217  34.480  1.00 258.12 ? 997  LYS A NZ  1 
ATOM   6144  N  N   . ASN A  1 998  ? 48.717  31.692  27.357  1.00 288.00 ? 998  ASN A N   1 
ATOM   6145  C  CA  . ASN A  1 998  ? 47.494  31.461  26.613  1.00 288.63 ? 998  ASN A CA  1 
ATOM   6146  C  C   . ASN A  1 998  ? 47.082  32.745  25.919  1.00 297.22 ? 998  ASN A C   1 
ATOM   6147  O  O   . ASN A  1 998  ? 46.852  33.759  26.573  1.00 268.19 ? 998  ASN A O   1 
ATOM   6148  C  CB  . ASN A  1 998  ? 46.390  31.014  27.569  1.00 313.83 ? 998  ASN A CB  1 
ATOM   6149  C  CG  . ASN A  1 998  ? 45.278  30.265  26.871  1.00 358.43 ? 998  ASN A CG  1 
ATOM   6150  O  OD1 . ASN A  1 998  ? 45.253  30.170  25.645  1.00 396.97 ? 998  ASN A OD1 1 
ATOM   6151  N  ND2 . ASN A  1 998  ? 44.347  29.724  27.651  1.00 356.20 ? 998  ASN A ND2 1 
ATOM   6152  N  N   . PRO A  1 999  ? 46.991  32.712  24.584  1.00 316.43 ? 999  PRO A N   1 
ATOM   6153  C  CA  . PRO A  1 999  ? 46.633  33.899  23.801  1.00 216.05 ? 999  PRO A CA  1 
ATOM   6154  C  C   . PRO A  1 999  ? 45.353  34.583  24.272  1.00 240.00 ? 999  PRO A C   1 
ATOM   6155  O  O   . PRO A  1 999  ? 45.087  35.710  23.859  1.00 243.21 ? 999  PRO A O   1 
ATOM   6156  C  CB  . PRO A  1 999  ? 46.437  33.338  22.392  1.00 262.95 ? 999  PRO A CB  1 
ATOM   6157  C  CG  . PRO A  1 999  ? 47.295  32.133  22.347  1.00 364.47 ? 999  PRO A CG  1 
ATOM   6158  C  CD  . PRO A  1 999  ? 47.267  31.548  23.726  1.00 390.88 ? 999  PRO A CD  1 
ATOM   6159  N  N   . VAL A  1 1000 ? 44.576  33.913  25.116  1.00 281.18 ? 1000 VAL A N   1 
ATOM   6160  C  CA  . VAL A  1 1000 ? 43.321  34.469  25.622  1.00 251.75 ? 1000 VAL A CA  1 
ATOM   6161  C  C   . VAL A  1 1000 ? 43.491  35.875  26.209  1.00 192.28 ? 1000 VAL A C   1 
ATOM   6162  O  O   . VAL A  1 1000 ? 44.561  36.221  26.710  1.00 194.82 ? 1000 VAL A O   1 
ATOM   6163  C  CB  . VAL A  1 1000 ? 42.711  33.557  26.709  1.00 275.00 ? 1000 VAL A CB  1 
ATOM   6164  C  CG1 . VAL A  1 1000 ? 42.485  32.157  26.164  1.00 315.27 ? 1000 VAL A CG1 1 
ATOM   6165  C  CG2 . VAL A  1 1000 ? 43.608  33.518  27.935  1.00 297.74 ? 1000 VAL A CG2 1 
ATOM   6166  N  N   . LEU A  1 1001 ? 42.429  36.680  26.133  1.00 176.27 ? 1001 LEU A N   1 
ATOM   6167  C  CA  . LEU A  1 1001 ? 42.394  38.004  26.764  1.00 185.86 ? 1001 LEU A CA  1 
ATOM   6168  C  C   . LEU A  1 1001 ? 41.149  38.141  27.640  1.00 249.06 ? 1001 LEU A C   1 
ATOM   6169  O  O   . LEU A  1 1001 ? 40.179  38.812  27.270  1.00 172.93 ? 1001 LEU A O   1 
ATOM   6170  C  CB  . LEU A  1 1001 ? 42.416  39.126  25.719  1.00 115.71 ? 1001 LEU A CB  1 
ATOM   6171  C  CG  . LEU A  1 1001 ? 42.687  40.557  26.219  1.00 158.96 ? 1001 LEU A CG  1 
ATOM   6172  C  CD1 . LEU A  1 1001 ? 43.144  41.436  25.068  1.00 242.55 ? 1001 LEU A CD1 1 
ATOM   6173  C  CD2 . LEU A  1 1001 ? 41.488  41.196  26.917  1.00 154.83 ? 1001 LEU A CD2 1 
ATOM   6174  N  N   . ASP A  1 1002 ? 41.181  37.489  28.798  1.00 295.11 ? 1002 ASP A N   1 
ATOM   6175  C  CA  . ASP A  1 1002 ? 40.101  37.601  29.770  1.00 212.78 ? 1002 ASP A CA  1 
ATOM   6176  C  C   . ASP A  1 1002 ? 40.143  38.986  30.423  1.00 195.00 ? 1002 ASP A C   1 
ATOM   6177  O  O   . ASP A  1 1002 ? 41.040  39.788  30.155  1.00 157.64 ? 1002 ASP A O   1 
ATOM   6178  C  CB  . ASP A  1 1002 ? 40.180  36.475  30.812  1.00 115.84 ? 1002 ASP A CB  1 
ATOM   6179  C  CG  . ASP A  1 1002 ? 41.579  36.270  31.356  1.00 199.83 ? 1002 ASP A CG  1 
ATOM   6180  O  OD1 . ASP A  1 1002 ? 42.414  37.191  31.239  1.00 277.35 ? 1002 ASP A OD1 1 
ATOM   6181  O  OD2 . ASP A  1 1002 ? 41.845  35.180  31.902  1.00 197.25 ? 1002 ASP A OD2 1 
ATOM   6182  N  N   . CYS A  1 1003 ? 39.161  39.280  31.263  1.00 185.50 ? 1003 CYS A N   1 
ATOM   6183  C  CA  . CYS A  1 1003 ? 39.073  40.598  31.870  1.00 141.69 ? 1003 CYS A CA  1 
ATOM   6184  C  C   . CYS A  1 1003 ? 40.156  40.823  32.907  1.00 174.27 ? 1003 CYS A C   1 
ATOM   6185  O  O   . CYS A  1 1003 ? 40.343  41.949  33.364  1.00 128.83 ? 1003 CYS A O   1 
ATOM   6186  C  CB  . CYS A  1 1003 ? 37.719  40.766  32.523  1.00 122.92 ? 1003 CYS A CB  1 
ATOM   6187  S  SG  . CYS A  1 1003 ? 36.402  40.837  31.334  1.00 233.41 ? 1003 CYS A SG  1 
ATOM   6188  N  N   . SER A  1 1004 ? 40.857  39.750  33.275  1.00 182.74 ? 1004 SER A N   1 
ATOM   6189  C  CA  . SER A  1 1004 ? 41.879  39.803  34.319  1.00 162.45 ? 1004 SER A CA  1 
ATOM   6190  C  C   . SER A  1 1004 ? 43.122  40.551  33.863  1.00 219.84 ? 1004 SER A C   1 
ATOM   6191  O  O   . SER A  1 1004 ? 43.992  40.874  34.672  1.00 273.33 ? 1004 SER A O   1 
ATOM   6192  C  CB  . SER A  1 1004 ? 42.272  38.391  34.761  1.00 161.67 ? 1004 SER A CB  1 
ATOM   6193  O  OG  . SER A  1 1004 ? 42.953  37.701  33.728  1.00 133.61 ? 1004 SER A OG  1 
ATOM   6194  N  N   . ILE A  1 1005 ? 43.207  40.818  32.567  1.00 198.73 ? 1005 ILE A N   1 
ATOM   6195  C  CA  . ILE A  1 1005 ? 44.340  41.542  32.020  1.00 143.66 ? 1005 ILE A CA  1 
ATOM   6196  C  C   . ILE A  1 1005 ? 43.898  42.953  31.649  1.00 159.30 ? 1005 ILE A C   1 
ATOM   6197  O  O   . ILE A  1 1005 ? 44.466  43.933  32.129  1.00 138.45 ? 1005 ILE A O   1 
ATOM   6198  C  CB  . ILE A  1 1005 ? 44.926  40.821  30.789  1.00 199.01 ? 1005 ILE A CB  1 
ATOM   6199  C  CG1 . ILE A  1 1005 ? 45.585  39.501  31.199  1.00 189.38 ? 1005 ILE A CG1 1 
ATOM   6200  C  CG2 . ILE A  1 1005 ? 45.945  41.703  30.076  1.00 318.49 ? 1005 ILE A CG2 1 
ATOM   6201  C  CD1 . ILE A  1 1005 ? 46.790  39.673  32.091  1.00 252.89 ? 1005 ILE A CD1 1 
ATOM   6202  N  N   . ALA A  1 1006 ? 42.868  43.054  30.814  1.00 132.28 ? 1006 ALA A N   1 
ATOM   6203  C  CA  . ALA A  1 1006 ? 42.442  44.352  30.302  1.00 187.26 ? 1006 ALA A CA  1 
ATOM   6204  C  C   . ALA A  1 1006 ? 41.255  44.880  31.082  1.00 143.42 ? 1006 ALA A C   1 
ATOM   6205  O  O   . ALA A  1 1006 ? 40.309  44.144  31.380  1.00 112.48 ? 1006 ALA A O   1 
ATOM   6206  C  CB  . ALA A  1 1006 ? 42.111  44.270  28.809  1.00 218.23 ? 1006 ALA A CB  1 
ATOM   6207  N  N   . GLY A  1 1007 ? 41.329  46.167  31.414  1.00 159.73 ? 1007 GLY A N   1 
ATOM   6208  C  CA  . GLY A  1 1007 ? 40.266  46.843  32.125  1.00 178.68 ? 1007 GLY A CA  1 
ATOM   6209  C  C   . GLY A  1 1007 ? 38.935  46.499  31.511  1.00 154.09 ? 1007 GLY A C   1 
ATOM   6210  O  O   . GLY A  1 1007 ? 38.603  46.984  30.439  1.00 160.25 ? 1007 GLY A O   1 
ATOM   6211  N  N   . CYS A  1 1008 ? 38.175  45.659  32.201  1.00 192.83 ? 1008 CYS A N   1 
ATOM   6212  C  CA  . CYS A  1 1008 ? 36.924  45.146  31.677  1.00 144.84 ? 1008 CYS A CA  1 
ATOM   6213  C  C   . CYS A  1 1008 ? 35.778  46.148  31.869  1.00 155.68 ? 1008 CYS A C   1 
ATOM   6214  O  O   . CYS A  1 1008 ? 35.990  47.307  32.234  1.00 96.87  ? 1008 CYS A O   1 
ATOM   6215  C  CB  . CYS A  1 1008 ? 36.615  43.819  32.365  1.00 83.33  ? 1008 CYS A CB  1 
ATOM   6216  S  SG  . CYS A  1 1008 ? 35.584  42.688  31.466  1.00 186.96 ? 1008 CYS A SG  1 
ATOM   6217  N  N   . LEU A  1 1009 ? 34.563  45.699  31.595  1.00 155.70 ? 1009 LEU A N   1 
ATOM   6218  C  CA  . LEU A  1 1009 ? 33.397  46.546  31.735  1.00 162.70 ? 1009 LEU A CA  1 
ATOM   6219  C  C   . LEU A  1 1009 ? 32.216  45.645  32.086  1.00 180.45 ? 1009 LEU A C   1 
ATOM   6220  O  O   . LEU A  1 1009 ? 31.829  44.773  31.309  1.00 139.24 ? 1009 LEU A O   1 
ATOM   6221  C  CB  . LEU A  1 1009 ? 33.146  47.332  30.440  1.00 95.10  ? 1009 LEU A CB  1 
ATOM   6222  C  CG  . LEU A  1 1009 ? 32.358  48.642  30.526  1.00 130.56 ? 1009 LEU A CG  1 
ATOM   6223  C  CD1 . LEU A  1 1009 ? 32.195  49.271  29.144  1.00 217.97 ? 1009 LEU A CD1 1 
ATOM   6224  C  CD2 . LEU A  1 1009 ? 30.994  48.426  31.164  1.00 191.07 ? 1009 LEU A CD2 1 
ATOM   6225  N  N   . ARG A  1 1010 ? 31.674  45.837  33.283  1.00 172.34 ? 1010 ARG A N   1 
ATOM   6226  C  CA  . ARG A  1 1010 ? 30.512  45.081  33.746  1.00 167.88 ? 1010 ARG A CA  1 
ATOM   6227  C  C   . ARG A  1 1010 ? 29.172  45.728  33.342  1.00 169.24 ? 1010 ARG A C   1 
ATOM   6228  O  O   . ARG A  1 1010 ? 28.942  46.939  33.552  1.00 80.31  ? 1010 ARG A O   1 
ATOM   6229  C  CB  . ARG A  1 1010 ? 30.571  44.924  35.270  1.00 210.77 ? 1010 ARG A CB  1 
ATOM   6230  C  CG  . ARG A  1 1010 ? 29.387  44.178  35.888  1.00 174.65 ? 1010 ARG A CG  1 
ATOM   6231  C  CD  . ARG A  1 1010 ? 29.226  44.528  37.359  1.00 95.93  ? 1010 ARG A CD  1 
ATOM   6232  N  NE  . ARG A  1 1010 ? 30.475  44.349  38.089  1.00 220.41 ? 1010 ARG A NE  1 
ATOM   6233  C  CZ  . ARG A  1 1010 ? 30.726  44.868  39.285  1.00 245.17 ? 1010 ARG A CZ  1 
ATOM   6234  N  NH1 . ARG A  1 1010 ? 29.812  45.608  39.897  1.00 244.91 ? 1010 ARG A NH1 1 
ATOM   6235  N  NH2 . ARG A  1 1010 ? 31.899  44.647  39.867  1.00 228.36 ? 1010 ARG A NH2 1 
ATOM   6236  N  N   . PHE A  1 1011 ? 28.293  44.903  32.767  1.00 160.53 ? 1011 PHE A N   1 
ATOM   6237  C  CA  . PHE A  1 1011 ? 26.933  45.327  32.412  1.00 201.25 ? 1011 PHE A CA  1 
ATOM   6238  C  C   . PHE A  1 1011 ? 25.899  44.616  33.270  1.00 161.76 ? 1011 PHE A C   1 
ATOM   6239  O  O   . PHE A  1 1011 ? 25.746  43.397  33.198  1.00 120.34 ? 1011 PHE A O   1 
ATOM   6240  C  CB  . PHE A  1 1011 ? 26.626  45.046  30.934  1.00 207.62 ? 1011 PHE A CB  1 
ATOM   6241  C  CG  . PHE A  1 1011 ? 27.414  45.890  29.980  1.00 191.65 ? 1011 PHE A CG  1 
ATOM   6242  C  CD1 . PHE A  1 1011 ? 28.731  45.569  29.685  1.00 176.32 ? 1011 PHE A CD1 1 
ATOM   6243  C  CD2 . PHE A  1 1011 ? 26.845  47.007  29.385  1.00 152.29 ? 1011 PHE A CD2 1 
ATOM   6244  C  CE1 . PHE A  1 1011 ? 29.467  46.344  28.819  1.00 182.38 ? 1011 PHE A CE1 1 
ATOM   6245  C  CE2 . PHE A  1 1011 ? 27.574  47.783  28.517  1.00 178.32 ? 1011 PHE A CE2 1 
ATOM   6246  C  CZ  . PHE A  1 1011 ? 28.890  47.452  28.232  1.00 207.85 ? 1011 PHE A CZ  1 
ATOM   6247  N  N   . ARG A  1 1012 ? 25.177  45.379  34.076  1.00 130.56 ? 1012 ARG A N   1 
ATOM   6248  C  CA  . ARG A  1 1012 ? 24.208  44.777  34.975  1.00 181.84 ? 1012 ARG A CA  1 
ATOM   6249  C  C   . ARG A  1 1012 ? 22.813  44.999  34.426  1.00 168.27 ? 1012 ARG A C   1 
ATOM   6250  O  O   . ARG A  1 1012 ? 22.161  45.997  34.732  1.00 233.35 ? 1012 ARG A O   1 
ATOM   6251  C  CB  . ARG A  1 1012 ? 24.334  45.350  36.392  1.00 247.91 ? 1012 ARG A CB  1 
ATOM   6252  C  CG  . ARG A  1 1012 ? 23.442  44.664  37.426  1.00 217.09 ? 1012 ARG A CG  1 
ATOM   6253  C  CD  . ARG A  1 1012 ? 23.776  45.118  38.838  1.00 227.35 ? 1012 ARG A CD  1 
ATOM   6254  N  NE  . ARG A  1 1012 ? 23.488  46.533  39.053  1.00 267.77 ? 1012 ARG A NE  1 
ATOM   6255  C  CZ  . ARG A  1 1012 ? 22.294  47.010  39.389  1.00 277.14 ? 1012 ARG A CZ  1 
ATOM   6256  N  NH1 . ARG A  1 1012 ? 21.264  46.187  39.545  1.00 203.17 ? 1012 ARG A NH1 1 
ATOM   6257  N  NH2 . ARG A  1 1012 ? 22.126  48.311  39.567  1.00 325.76 ? 1012 ARG A NH2 1 
ATOM   6258  N  N   . CYS A  1 1013 ? 22.362  44.056  33.606  1.00 140.09 ? 1013 CYS A N   1 
ATOM   6259  C  CA  . CYS A  1 1013 ? 21.035  44.144  33.008  1.00 158.54 ? 1013 CYS A CA  1 
ATOM   6260  C  C   . CYS A  1 1013 ? 19.964  43.477  33.874  1.00 61.63  ? 1013 CYS A C   1 
ATOM   6261  O  O   . CYS A  1 1013 ? 19.755  42.267  33.828  1.00 337.79 ? 1013 CYS A O   1 
ATOM   6262  C  CB  . CYS A  1 1013 ? 21.053  43.557  31.596  1.00 161.76 ? 1013 CYS A CB  1 
ATOM   6263  S  SG  . CYS A  1 1013 ? 22.183  44.457  30.460  1.00 158.33 ? 1013 CYS A SG  1 
ATOM   6264  N  N   . ASP A  1 1014 ? 19.292  44.314  34.665  1.00 205.46 ? 1014 ASP A N   1 
ATOM   6265  C  CA  . ASP A  1 1014 ? 18.234  43.868  35.563  1.00 168.42 ? 1014 ASP A CA  1 
ATOM   6266  C  C   . ASP A  1 1014 ? 17.024  43.401  34.761  1.00 82.94  ? 1014 ASP A C   1 
ATOM   6267  O  O   . ASP A  1 1014 ? 16.870  43.751  33.596  1.00 179.37 ? 1014 ASP A O   1 
ATOM   6268  C  CB  . ASP A  1 1014 ? 17.808  44.996  36.517  1.00 181.15 ? 1014 ASP A CB  1 
ATOM   6269  C  CG  . ASP A  1 1014 ? 18.885  45.358  37.537  1.00 206.74 ? 1014 ASP A CG  1 
ATOM   6270  O  OD1 . ASP A  1 1014 ? 19.613  44.455  38.008  1.00 163.38 ? 1014 ASP A OD1 1 
ATOM   6271  O  OD2 . ASP A  1 1014 ? 18.988  46.556  37.882  1.00 237.70 ? 1014 ASP A OD2 1 
ATOM   6272  N  N   . VAL A  1 1015 ? 16.172  42.608  35.402  1.00 188.32 ? 1015 VAL A N   1 
ATOM   6273  C  CA  . VAL A  1 1015 ? 14.993  42.026  34.756  1.00 174.64 ? 1015 VAL A CA  1 
ATOM   6274  C  C   . VAL A  1 1015 ? 13.823  41.969  35.724  1.00 187.51 ? 1015 VAL A C   1 
ATOM   6275  O  O   . VAL A  1 1015 ? 13.944  41.404  36.811  1.00 226.95 ? 1015 VAL A O   1 
ATOM   6276  C  CB  . VAL A  1 1015 ? 15.265  40.589  34.294  1.00 138.15 ? 1015 VAL A CB  1 
ATOM   6277  C  CG1 . VAL A  1 1015 ? 13.985  39.947  33.747  1.00 115.70 ? 1015 VAL A CG1 1 
ATOM   6278  C  CG2 . VAL A  1 1015 ? 16.417  40.575  33.277  1.00 119.83 ? 1015 VAL A CG2 1 
ATOM   6279  N  N   . PRO A  1 1016 ? 12.675  42.528  35.324  1.00 149.95 ? 1016 PRO A N   1 
ATOM   6280  C  CA  . PRO A  1 1016 ? 11.533  42.618  36.236  1.00 195.22 ? 1016 PRO A CA  1 
ATOM   6281  C  C   . PRO A  1 1016 ? 11.107  41.245  36.729  1.00 202.34 ? 1016 PRO A C   1 
ATOM   6282  O  O   . PRO A  1 1016 ? 11.207  40.953  37.922  1.00 247.63 ? 1016 PRO A O   1 
ATOM   6283  C  CB  . PRO A  1 1016 ? 10.436  43.251  35.377  1.00 261.39 ? 1016 PRO A CB  1 
ATOM   6284  C  CG  . PRO A  1 1016 ? 10.848  43.023  33.975  1.00 279.61 ? 1016 PRO A CG  1 
ATOM   6285  C  CD  . PRO A  1 1016 ? 12.337  42.938  33.955  1.00 220.93 ? 1016 PRO A CD  1 
ATOM   6286  N  N   . SER A  1 1017 ? 10.650  40.403  35.813  1.00 123.07 ? 1017 SER A N   1 
ATOM   6287  C  CA  . SER A  1 1017 ? 10.195  39.073  36.173  1.00 157.62 ? 1017 SER A CA  1 
ATOM   6288  C  C   . SER A  1 1017 ? 10.472  38.131  35.026  1.00 124.21 ? 1017 SER A C   1 
ATOM   6289  O  O   . SER A  1 1017 ? 9.765   38.141  34.024  1.00 156.89 ? 1017 SER A O   1 
ATOM   6290  C  CB  . SER A  1 1017 ? 8.700   39.073  36.487  1.00 223.16 ? 1017 SER A CB  1 
ATOM   6291  O  OG  . SER A  1 1017 ? 8.237   37.759  36.749  1.00 118.34 ? 1017 SER A OG  1 
ATOM   6292  N  N   . PHE A  1 1018 ? 11.506  37.315  35.189  1.00 154.76 ? 1018 PHE A N   1 
ATOM   6293  C  CA  . PHE A  1 1018 ? 11.899  36.341  34.184  1.00 145.27 ? 1018 PHE A CA  1 
ATOM   6294  C  C   . PHE A  1 1018 ? 10.967  35.129  34.119  1.00 127.30 ? 1018 PHE A C   1 
ATOM   6295  O  O   . PHE A  1 1018 ? 11.358  34.014  34.477  1.00 157.09 ? 1018 PHE A O   1 
ATOM   6296  C  CB  . PHE A  1 1018 ? 13.309  35.859  34.482  1.00 121.35 ? 1018 PHE A CB  1 
ATOM   6297  C  CG  . PHE A  1 1018 ? 13.897  35.044  33.390  1.00 110.36 ? 1018 PHE A CG  1 
ATOM   6298  C  CD1 . PHE A  1 1018 ? 13.850  35.506  32.089  1.00 228.71 ? 1018 PHE A CD1 1 
ATOM   6299  C  CD2 . PHE A  1 1018 ? 14.517  33.830  33.644  1.00 132.38 ? 1018 PHE A CD2 1 
ATOM   6300  C  CE1 . PHE A  1 1018 ? 14.399  34.771  31.052  1.00 245.08 ? 1018 PHE A CE1 1 
ATOM   6301  C  CE2 . PHE A  1 1018 ? 15.075  33.087  32.609  1.00 143.49 ? 1018 PHE A CE2 1 
ATOM   6302  C  CZ  . PHE A  1 1018 ? 15.019  33.556  31.316  1.00 99.72  ? 1018 PHE A CZ  1 
ATOM   6303  N  N   . SER A  1 1019 ? 9.745   35.351  33.645  1.00 130.31 ? 1019 SER A N   1 
ATOM   6304  C  CA  . SER A  1 1019 ? 8.743   34.300  33.576  1.00 204.55 ? 1019 SER A CA  1 
ATOM   6305  C  C   . SER A  1 1019 ? 9.418   32.998  33.131  1.00 183.17 ? 1019 SER A C   1 
ATOM   6306  O  O   . SER A  1 1019 ? 10.405  33.021  32.393  1.00 129.32 ? 1019 SER A O   1 
ATOM   6307  C  CB  . SER A  1 1019 ? 7.610   34.715  32.626  1.00 226.54 ? 1019 SER A CB  1 
ATOM   6308  O  OG  . SER A  1 1019 ? 6.586   33.741  32.563  1.00 221.98 ? 1019 SER A OG  1 
ATOM   6309  N  N   . VAL A  1 1020 ? 8.921   31.871  33.630  1.00 179.12 ? 1020 VAL A N   1 
ATOM   6310  C  CA  . VAL A  1 1020 ? 9.432   30.566  33.233  1.00 159.67 ? 1020 VAL A CA  1 
ATOM   6311  C  C   . VAL A  1 1020 ? 9.120   30.324  31.765  1.00 181.77 ? 1020 VAL A C   1 
ATOM   6312  O  O   . VAL A  1 1020 ? 8.078   30.756  31.268  1.00 164.74 ? 1020 VAL A O   1 
ATOM   6313  C  CB  . VAL A  1 1020 ? 8.788   29.434  34.041  1.00 229.98 ? 1020 VAL A CB  1 
ATOM   6314  C  CG1 . VAL A  1 1020 ? 9.452   28.109  33.706  1.00 252.94 ? 1020 VAL A CG1 1 
ATOM   6315  C  CG2 . VAL A  1 1020 ? 8.873   29.713  35.539  1.00 307.38 ? 1020 VAL A CG2 1 
ATOM   6316  N  N   . GLN A  1 1021 ? 10.027  29.631  31.082  1.00 229.42 ? 1021 GLN A N   1 
ATOM   6317  C  CA  . GLN A  1 1021 ? 9.854   29.304  29.671  1.00 204.87 ? 1021 GLN A CA  1 
ATOM   6318  C  C   . GLN A  1 1021 ? 10.305  30.461  28.772  1.00 212.87 ? 1021 GLN A C   1 
ATOM   6319  O  O   . GLN A  1 1021 ? 10.600  30.267  27.593  1.00 205.09 ? 1021 GLN A O   1 
ATOM   6320  C  CB  . GLN A  1 1021 ? 8.391   28.946  29.388  1.00 183.39 ? 1021 GLN A CB  1 
ATOM   6321  C  CG  . GLN A  1 1021 ? 7.792   27.978  30.389  1.00 255.22 ? 1021 GLN A CG  1 
ATOM   6322  C  CD  . GLN A  1 1021 ? 6.285   28.081  30.463  1.00 320.78 ? 1021 GLN A CD  1 
ATOM   6323  O  OE1 . GLN A  1 1021 ? 5.718   29.171  30.392  1.00 363.95 ? 1021 GLN A OE1 1 
ATOM   6324  N  NE2 . GLN A  1 1021 ? 5.627   26.944  30.617  1.00 320.74 ? 1021 GLN A NE2 1 
ATOM   6325  N  N   . GLU A  1 1022 ? 10.371  31.661  29.338  1.00 231.64 ? 1022 GLU A N   1 
ATOM   6326  C  CA  . GLU A  1 1022 ? 10.771  32.847  28.591  1.00 152.55 ? 1022 GLU A CA  1 
ATOM   6327  C  C   . GLU A  1 1022 ? 12.223  32.701  28.169  1.00 160.59 ? 1022 GLU A C   1 
ATOM   6328  O  O   . GLU A  1 1022 ? 13.111  32.584  29.006  1.00 262.59 ? 1022 GLU A O   1 
ATOM   6329  C  CB  . GLU A  1 1022 ? 10.599  34.093  29.462  1.00 230.10 ? 1022 GLU A CB  1 
ATOM   6330  C  CG  . GLU A  1 1022 ? 10.664  35.415  28.712  1.00 230.43 ? 1022 GLU A CG  1 
ATOM   6331  C  CD  . GLU A  1 1022 ? 10.313  36.606  29.593  1.00 205.94 ? 1022 GLU A CD  1 
ATOM   6332  O  OE1 . GLU A  1 1022 ? 9.674   36.408  30.646  1.00 159.87 ? 1022 GLU A OE1 1 
ATOM   6333  O  OE2 . GLU A  1 1022 ? 10.668  37.746  29.230  1.00 206.70 ? 1022 GLU A OE2 1 
ATOM   6334  N  N   . GLU A  1 1023 ? 12.463  32.689  26.866  1.00 165.66 ? 1023 GLU A N   1 
ATOM   6335  C  CA  . GLU A  1 1023 ? 13.821  32.573  26.355  1.00 175.68 ? 1023 GLU A CA  1 
ATOM   6336  C  C   . GLU A  1 1023 ? 14.418  33.951  26.112  1.00 114.71 ? 1023 GLU A C   1 
ATOM   6337  O  O   . GLU A  1 1023 ? 15.206  34.135  25.186  1.00 203.48 ? 1023 GLU A O   1 
ATOM   6338  C  CB  . GLU A  1 1023 ? 13.833  31.776  25.051  1.00 220.88 ? 1023 GLU A CB  1 
ATOM   6339  C  CG  . GLU A  1 1023 ? 15.222  31.353  24.601  1.00 187.64 ? 1023 GLU A CG  1 
ATOM   6340  C  CD  . GLU A  1 1023 ? 15.269  30.965  23.142  1.00 154.07 ? 1023 GLU A CD  1 
ATOM   6341  O  OE1 . GLU A  1 1023 ? 14.201  30.935  22.495  1.00 216.31 ? 1023 GLU A OE1 1 
ATOM   6342  O  OE2 . GLU A  1 1023 ? 16.379  30.691  22.645  1.00 174.52 ? 1023 GLU A OE2 1 
ATOM   6343  N  N   . LEU A  1 1024 ? 14.028  34.920  26.934  1.00 190.52 ? 1024 LEU A N   1 
ATOM   6344  C  CA  . LEU A  1 1024 ? 14.519  36.284  26.793  1.00 193.09 ? 1024 LEU A CA  1 
ATOM   6345  C  C   . LEU A  1 1024 ? 16.001  36.265  26.409  1.00 174.96 ? 1024 LEU A C   1 
ATOM   6346  O  O   . LEU A  1 1024 ? 16.845  35.845  27.199  1.00 129.73 ? 1024 LEU A O   1 
ATOM   6347  C  CB  . LEU A  1 1024 ? 14.307  37.052  28.104  1.00 256.30 ? 1024 LEU A CB  1 
ATOM   6348  C  CG  . LEU A  1 1024 ? 14.597  38.557  28.123  1.00 276.61 ? 1024 LEU A CG  1 
ATOM   6349  C  CD1 . LEU A  1 1024 ? 13.911  39.223  29.309  1.00 287.72 ? 1024 LEU A CD1 1 
ATOM   6350  C  CD2 . LEU A  1 1024 ? 16.089  38.824  28.166  1.00 242.33 ? 1024 LEU A CD2 1 
ATOM   6351  N  N   . ASP A  1 1025 ? 16.307  36.702  25.186  1.00 214.17 ? 1025 ASP A N   1 
ATOM   6352  C  CA  . ASP A  1 1025 ? 17.693  36.764  24.704  1.00 197.03 ? 1025 ASP A CA  1 
ATOM   6353  C  C   . ASP A  1 1025 ? 18.045  38.146  24.141  1.00 180.03 ? 1025 ASP A C   1 
ATOM   6354  O  O   . ASP A  1 1025 ? 17.168  38.928  23.758  1.00 173.09 ? 1025 ASP A O   1 
ATOM   6355  C  CB  . ASP A  1 1025 ? 17.953  35.696  23.642  1.00 185.46 ? 1025 ASP A CB  1 
ATOM   6356  C  CG  . ASP A  1 1025 ? 17.235  35.980  22.350  1.00 211.92 ? 1025 ASP A CG  1 
ATOM   6357  O  OD1 . ASP A  1 1025 ? 16.314  36.826  22.345  1.00 277.63 ? 1025 ASP A OD1 1 
ATOM   6358  O  OD2 . ASP A  1 1025 ? 17.596  35.349  21.337  1.00 176.79 ? 1025 ASP A OD2 1 
ATOM   6359  N  N   . PHE A  1 1026 ? 19.343  38.434  24.099  1.00 146.88 ? 1026 PHE A N   1 
ATOM   6360  C  CA  . PHE A  1 1026 ? 19.840  39.731  23.645  1.00 171.12 ? 1026 PHE A CA  1 
ATOM   6361  C  C   . PHE A  1 1026 ? 21.344  39.675  23.384  1.00 191.33 ? 1026 PHE A C   1 
ATOM   6362  O  O   . PHE A  1 1026 ? 22.067  38.812  23.919  1.00 82.93  ? 1026 PHE A O   1 
ATOM   6363  C  CB  . PHE A  1 1026 ? 19.537  40.840  24.661  1.00 200.61 ? 1026 PHE A CB  1 
ATOM   6364  C  CG  . PHE A  1 1026 ? 19.821  40.456  26.089  1.00 227.53 ? 1026 PHE A CG  1 
ATOM   6365  C  CD1 . PHE A  1 1026 ? 21.128  40.325  26.555  1.00 142.03 ? 1026 PHE A CD1 1 
ATOM   6366  C  CD2 . PHE A  1 1026 ? 18.779  40.236  26.972  1.00 230.72 ? 1026 PHE A CD2 1 
ATOM   6367  C  CE1 . PHE A  1 1026 ? 21.382  39.971  27.870  1.00 126.38 ? 1026 PHE A CE1 1 
ATOM   6368  C  CE2 . PHE A  1 1026 ? 19.029  39.883  28.279  1.00 88.78  ? 1026 PHE A CE2 1 
ATOM   6369  C  CZ  . PHE A  1 1026 ? 20.335  39.750  28.730  1.00 196.68 ? 1026 PHE A CZ  1 
ATOM   6370  N  N   . THR A  1 1027 ? 21.806  40.611  22.561  1.00 228.15 ? 1027 THR A N   1 
ATOM   6371  C  CA  . THR A  1 1027 ? 23.178  40.614  22.092  1.00 165.95 ? 1027 THR A CA  1 
ATOM   6372  C  C   . THR A  1 1027 ? 23.854  41.967  22.319  1.00 144.71 ? 1027 THR A C   1 
ATOM   6373  O  O   . THR A  1 1027 ? 23.195  42.980  22.574  1.00 110.52 ? 1027 THR A O   1 
ATOM   6374  C  CB  . THR A  1 1027 ? 23.230  40.263  20.590  1.00 173.48 ? 1027 THR A CB  1 
ATOM   6375  O  OG1 . THR A  1 1027 ? 24.592  40.242  20.154  1.00 221.31 ? 1027 THR A OG1 1 
ATOM   6376  C  CG2 . THR A  1 1027 ? 22.444  41.276  19.780  1.00 200.85 ? 1027 THR A CG2 1 
ATOM   6377  N  N   . LEU A  1 1028 ? 25.181  41.956  22.213  1.00 133.07 ? 1028 LEU A N   1 
ATOM   6378  C  CA  . LEU A  1 1028 ? 26.004  43.140  22.432  1.00 154.12 ? 1028 LEU A CA  1 
ATOM   6379  C  C   . LEU A  1 1028 ? 27.032  43.279  21.312  1.00 189.45 ? 1028 LEU A C   1 
ATOM   6380  O  O   . LEU A  1 1028 ? 27.615  42.288  20.856  1.00 146.26 ? 1028 LEU A O   1 
ATOM   6381  C  CB  . LEU A  1 1028 ? 26.720  43.046  23.788  1.00 174.12 ? 1028 LEU A CB  1 
ATOM   6382  C  CG  . LEU A  1 1028 ? 27.646  41.837  24.037  1.00 174.63 ? 1028 LEU A CG  1 
ATOM   6383  C  CD1 . LEU A  1 1028 ? 29.066  42.078  23.538  1.00 169.52 ? 1028 LEU A CD1 1 
ATOM   6384  C  CD2 . LEU A  1 1028 ? 27.697  41.479  25.513  1.00 109.64 ? 1028 LEU A CD2 1 
ATOM   6385  N  N   . LYS A  1 1029 ? 27.251  44.512  20.868  1.00 201.40 ? 1029 LYS A N   1 
ATOM   6386  C  CA  . LYS A  1 1029 ? 28.189  44.773  19.785  1.00 189.86 ? 1029 LYS A CA  1 
ATOM   6387  C  C   . LYS A  1 1029 ? 28.944  46.073  20.023  1.00 157.02 ? 1029 LYS A C   1 
ATOM   6388  O  O   . LYS A  1 1029 ? 28.509  46.917  20.807  1.00 108.58 ? 1029 LYS A O   1 
ATOM   6389  C  CB  . LYS A  1 1029 ? 27.448  44.828  18.445  1.00 186.16 ? 1029 LYS A CB  1 
ATOM   6390  C  CG  . LYS A  1 1029 ? 26.486  46.004  18.308  1.00 241.33 ? 1029 LYS A CG  1 
ATOM   6391  C  CD  . LYS A  1 1029 ? 25.906  46.093  16.901  1.00 204.29 ? 1029 LYS A CD  1 
ATOM   6392  C  CE  . LYS A  1 1029 ? 25.043  47.333  16.720  1.00 204.77 ? 1029 LYS A CE  1 
ATOM   6393  N  NZ  . LYS A  1 1029 ? 23.783  47.264  17.504  1.00 229.56 ? 1029 LYS A NZ  1 
ATOM   6394  N  N   . GLY A  1 1030 ? 30.082  46.219  19.348  1.00 168.04 ? 1030 GLY A N   1 
ATOM   6395  C  CA  . GLY A  1 1030 ? 30.865  47.445  19.392  1.00 161.65 ? 1030 GLY A CA  1 
ATOM   6396  C  C   . GLY A  1 1030 ? 32.035  47.404  18.424  1.00 227.53 ? 1030 GLY A C   1 
ATOM   6397  O  O   . GLY A  1 1030 ? 32.699  46.377  18.302  1.00 204.22 ? 1030 GLY A O   1 
ATOM   6398  N  N   . ASN A  1 1031 ? 32.285  48.512  17.726  1.00 272.34 ? 1031 ASN A N   1 
ATOM   6399  C  CA  . ASN A  1 1031 ? 33.411  48.588  16.797  1.00 233.88 ? 1031 ASN A CA  1 
ATOM   6400  C  C   . ASN A  1 1031 ? 34.689  48.145  17.488  1.00 212.83 ? 1031 ASN A C   1 
ATOM   6401  O  O   . ASN A  1 1031 ? 35.081  48.722  18.503  1.00 148.82 ? 1031 ASN A O   1 
ATOM   6402  C  CB  . ASN A  1 1031 ? 33.589  50.009  16.259  1.00 178.26 ? 1031 ASN A CB  1 
ATOM   6403  C  CG  . ASN A  1 1031 ? 32.517  50.397  15.269  1.00 206.05 ? 1031 ASN A CG  1 
ATOM   6404  O  OD1 . ASN A  1 1031 ? 31.646  49.598  14.938  1.00 241.60 ? 1031 ASN A OD1 1 
ATOM   6405  N  ND2 . ASN A  1 1031 ? 32.580  51.626  14.784  1.00 202.82 ? 1031 ASN A ND2 1 
ATOM   6406  N  N   . LEU A  1 1032 ? 35.338  47.128  16.932  1.00 205.00 ? 1032 LEU A N   1 
ATOM   6407  C  CA  . LEU A  1 1032 ? 36.506  46.528  17.564  1.00 109.18 ? 1032 LEU A CA  1 
ATOM   6408  C  C   . LEU A  1 1032 ? 37.809  47.081  16.992  1.00 246.93 ? 1032 LEU A C   1 
ATOM   6409  O  O   . LEU A  1 1032 ? 38.140  46.848  15.828  1.00 341.93 ? 1032 LEU A O   1 
ATOM   6410  C  CB  . LEU A  1 1032 ? 36.451  45.008  17.422  1.00 159.37 ? 1032 LEU A CB  1 
ATOM   6411  C  CG  . LEU A  1 1032 ? 37.439  44.227  18.286  1.00 93.73  ? 1032 LEU A CG  1 
ATOM   6412  C  CD1 . LEU A  1 1032 ? 36.869  42.848  18.641  1.00 141.89 ? 1032 LEU A CD1 1 
ATOM   6413  C  CD2 . LEU A  1 1032 ? 38.790  44.089  17.626  1.00 215.24 ? 1032 LEU A CD2 1 
ATOM   6414  N  N   . SER A  1 1033 ? 38.546  47.811  17.825  1.00 193.67 ? 1033 SER A N   1 
ATOM   6415  C  CA  . SER A  1 1033 ? 39.778  48.467  17.397  1.00 261.37 ? 1033 SER A CA  1 
ATOM   6416  C  C   . SER A  1 1033 ? 40.913  47.470  17.176  1.00 260.83 ? 1033 SER A C   1 
ATOM   6417  O  O   . SER A  1 1033 ? 41.020  46.467  17.888  1.00 163.68 ? 1033 SER A O   1 
ATOM   6418  C  CB  . SER A  1 1033 ? 40.204  49.507  18.433  1.00 231.94 ? 1033 SER A CB  1 
ATOM   6419  O  OG  . SER A  1 1033 ? 41.436  50.106  18.072  1.00 211.64 ? 1033 SER A OG  1 
ATOM   6420  N  N   . PHE A  1 1034 ? 41.757  47.765  16.188  1.00 275.60 ? 1034 PHE A N   1 
ATOM   6421  C  CA  . PHE A  1 1034 ? 42.899  46.919  15.851  1.00 223.93 ? 1034 PHE A CA  1 
ATOM   6422  C  C   . PHE A  1 1034 ? 44.189  47.471  16.436  1.00 205.15 ? 1034 PHE A C   1 
ATOM   6423  O  O   . PHE A  1 1034 ? 45.237  46.841  16.333  1.00 213.32 ? 1034 PHE A O   1 
ATOM   6424  C  CB  . PHE A  1 1034 ? 43.054  46.810  14.334  1.00 200.81 ? 1034 PHE A CB  1 
ATOM   6425  C  CG  . PHE A  1 1034 ? 41.904  46.128  13.657  1.00 212.47 ? 1034 PHE A CG  1 
ATOM   6426  C  CD1 . PHE A  1 1034 ? 42.007  44.803  13.265  1.00 214.64 ? 1034 PHE A CD1 1 
ATOM   6427  C  CD2 . PHE A  1 1034 ? 40.719  46.807  13.415  1.00 171.30 ? 1034 PHE A CD2 1 
ATOM   6428  C  CE1 . PHE A  1 1034 ? 40.950  44.165  12.643  1.00 285.17 ? 1034 PHE A CE1 1 
ATOM   6429  C  CE2 . PHE A  1 1034 ? 39.656  46.176  12.793  1.00 187.29 ? 1034 PHE A CE2 1 
ATOM   6430  C  CZ  . PHE A  1 1034 ? 39.773  44.852  12.406  1.00 288.22 ? 1034 PHE A CZ  1 
ATOM   6431  N  N   . GLY A  1 1035 ? 44.108  48.649  17.047  1.00 219.95 ? 1035 GLY A N   1 
ATOM   6432  C  CA  . GLY A  1 1035 ? 45.283  49.329  17.564  1.00 223.27 ? 1035 GLY A CA  1 
ATOM   6433  C  C   . GLY A  1 1035 ? 46.013  48.583  18.667  1.00 195.91 ? 1035 GLY A C   1 
ATOM   6434  O  O   . GLY A  1 1035 ? 47.233  48.436  18.624  1.00 229.67 ? 1035 GLY A O   1 
ATOM   6435  N  N   . TRP A  1 1036 ? 45.271  48.115  19.662  1.00 195.64 ? 1036 TRP A N   1 
ATOM   6436  C  CA  . TRP A  1 1036 ? 45.862  47.453  20.821  1.00 215.25 ? 1036 TRP A CA  1 
ATOM   6437  C  C   . TRP A  1 1036 ? 46.588  46.148  20.480  1.00 226.28 ? 1036 TRP A C   1 
ATOM   6438  O  O   . TRP A  1 1036 ? 47.346  45.622  21.296  1.00 224.20 ? 1036 TRP A O   1 
ATOM   6439  C  CB  . TRP A  1 1036 ? 44.768  47.157  21.838  1.00 216.37 ? 1036 TRP A CB  1 
ATOM   6440  C  CG  . TRP A  1 1036 ? 43.848  46.060  21.396  1.00 220.71 ? 1036 TRP A CG  1 
ATOM   6441  C  CD1 . TRP A  1 1036 ? 42.672  46.194  20.713  1.00 238.84 ? 1036 TRP A CD1 1 
ATOM   6442  C  CD2 . TRP A  1 1036 ? 44.035  44.655  21.600  1.00 199.80 ? 1036 TRP A CD2 1 
ATOM   6443  N  NE1 . TRP A  1 1036 ? 42.112  44.959  20.487  1.00 236.24 ? 1036 TRP A NE1 1 
ATOM   6444  C  CE2 . TRP A  1 1036 ? 42.930  43.998  21.022  1.00 222.08 ? 1036 TRP A CE2 1 
ATOM   6445  C  CE3 . TRP A  1 1036 ? 45.030  43.887  22.219  1.00 161.73 ? 1036 TRP A CE3 1 
ATOM   6446  C  CZ2 . TRP A  1 1036 ? 42.791  42.610  21.046  1.00 208.83 ? 1036 TRP A CZ2 1 
ATOM   6447  C  CZ3 . TRP A  1 1036 ? 44.891  42.509  22.242  1.00 163.61 ? 1036 TRP A CZ3 1 
ATOM   6448  C  CH2 . TRP A  1 1036 ? 43.780  41.885  21.659  1.00 185.19 ? 1036 TRP A CH2 1 
ATOM   6449  N  N   . VAL A  1 1037 ? 46.353  45.628  19.279  1.00 218.16 ? 1037 VAL A N   1 
ATOM   6450  C  CA  . VAL A  1 1037 ? 46.892  44.329  18.874  1.00 232.11 ? 1037 VAL A CA  1 
ATOM   6451  C  C   . VAL A  1 1037 ? 48.422  44.283  18.952  1.00 210.96 ? 1037 VAL A C   1 
ATOM   6452  O  O   . VAL A  1 1037 ? 49.016  43.235  19.225  1.00 118.05 ? 1037 VAL A O   1 
ATOM   6453  C  CB  . VAL A  1 1037 ? 46.451  43.976  17.437  1.00 269.98 ? 1037 VAL A CB  1 
ATOM   6454  C  CG1 . VAL A  1 1037 ? 47.048  42.647  17.006  1.00 331.55 ? 1037 VAL A CG1 1 
ATOM   6455  C  CG2 . VAL A  1 1037 ? 44.929  43.941  17.338  1.00 239.61 ? 1037 VAL A CG2 1 
ATOM   6456  N  N   . ARG A  1 1038 ? 49.054  45.426  18.707  1.00 258.46 ? 1038 ARG A N   1 
ATOM   6457  C  CA  . ARG A  1 1038 ? 50.508  45.511  18.705  1.00 279.81 ? 1038 ARG A CA  1 
ATOM   6458  C  C   . ARG A  1 1038 ? 51.025  45.630  20.130  1.00 238.88 ? 1038 ARG A C   1 
ATOM   6459  O  O   . ARG A  1 1038 ? 52.142  45.213  20.425  1.00 180.85 ? 1038 ARG A O   1 
ATOM   6460  C  CB  . ARG A  1 1038 ? 50.973  46.708  17.866  1.00 305.79 ? 1038 ARG A CB  1 
ATOM   6461  C  CG  . ARG A  1 1038 ? 52.482  46.890  17.817  1.00 299.24 ? 1038 ARG A CG  1 
ATOM   6462  C  CD  . ARG A  1 1038 ? 52.865  48.202  17.160  1.00 290.67 ? 1038 ARG A CD  1 
ATOM   6463  N  NE  . ARG A  1 1038 ? 54.278  48.504  17.353  1.00 315.60 ? 1038 ARG A NE  1 
ATOM   6464  C  CZ  . ARG A  1 1038 ? 54.768  49.135  18.415  1.00 345.94 ? 1038 ARG A CZ  1 
ATOM   6465  N  NH1 . ARG A  1 1038 ? 53.958  49.537  19.386  1.00 363.97 ? 1038 ARG A NH1 1 
ATOM   6466  N  NH2 . ARG A  1 1038 ? 56.069  49.366  18.508  1.00 354.58 ? 1038 ARG A NH2 1 
ATOM   6467  N  N   . GLN A  1 1039 ? 50.197  46.187  21.010  1.00 255.10 ? 1039 GLN A N   1 
ATOM   6468  C  CA  . GLN A  1 1039 ? 50.585  46.460  22.391  1.00 245.65 ? 1039 GLN A CA  1 
ATOM   6469  C  C   . GLN A  1 1039 ? 51.202  45.251  23.084  1.00 220.16 ? 1039 GLN A C   1 
ATOM   6470  O  O   . GLN A  1 1039 ? 51.999  45.404  24.005  1.00 223.71 ? 1039 GLN A O   1 
ATOM   6471  C  CB  . GLN A  1 1039 ? 49.374  46.942  23.195  1.00 223.02 ? 1039 GLN A CB  1 
ATOM   6472  C  CG  . GLN A  1 1039 ? 49.669  47.242  24.657  1.00 247.48 ? 1039 GLN A CG  1 
ATOM   6473  C  CD  . GLN A  1 1039 ? 50.484  48.499  24.846  1.00 284.30 ? 1039 GLN A CD  1 
ATOM   6474  O  OE1 . GLN A  1 1039 ? 51.468  48.506  25.582  1.00 354.56 ? 1039 GLN A OE1 1 
ATOM   6475  N  NE2 . GLN A  1 1039 ? 50.080  49.575  24.183  1.00 247.66 ? 1039 GLN A NE2 1 
ATOM   6476  N  N   . ILE A  1 1040 ? 50.841  44.050  22.649  1.00 227.53 ? 1040 ILE A N   1 
ATOM   6477  C  CA  . ILE A  1 1040 ? 51.295  42.845  23.334  1.00 268.67 ? 1040 ILE A CA  1 
ATOM   6478  C  C   . ILE A  1 1040 ? 52.347  42.060  22.543  1.00 269.74 ? 1040 ILE A C   1 
ATOM   6479  O  O   . ILE A  1 1040 ? 52.953  41.128  23.068  1.00 290.18 ? 1040 ILE A O   1 
ATOM   6480  C  CB  . ILE A  1 1040 ? 50.106  41.939  23.697  1.00 293.37 ? 1040 ILE A CB  1 
ATOM   6481  C  CG1 . ILE A  1 1040 ? 49.376  41.475  22.439  1.00 209.72 ? 1040 ILE A CG1 1 
ATOM   6482  C  CG2 . ILE A  1 1040 ? 49.149  42.674  24.614  1.00 381.14 ? 1040 ILE A CG2 1 
ATOM   6483  C  CD1 . ILE A  1 1040 ? 49.926  40.200  21.872  1.00 239.20 ? 1040 ILE A CD1 1 
ATOM   6484  N  N   . LEU A  1 1041 ? 52.563  42.436  21.287  1.00 243.42 ? 1041 LEU A N   1 
ATOM   6485  C  CA  . LEU A  1 1041 ? 53.657  41.877  20.497  1.00 267.96 ? 1041 LEU A CA  1 
ATOM   6486  C  C   . LEU A  1 1041 ? 53.491  40.384  20.237  1.00 266.38 ? 1041 LEU A C   1 
ATOM   6487  O  O   . LEU A  1 1041 ? 54.391  39.593  20.512  1.00 276.27 ? 1041 LEU A O   1 
ATOM   6488  C  CB  . LEU A  1 1041 ? 54.997  42.120  21.197  1.00 322.52 ? 1041 LEU A CB  1 
ATOM   6489  C  CG  . LEU A  1 1041 ? 56.252  41.884  20.353  1.00 356.56 ? 1041 LEU A CG  1 
ATOM   6490  C  CD1 . LEU A  1 1041 ? 56.242  42.759  19.115  1.00 318.00 ? 1041 LEU A CD1 1 
ATOM   6491  C  CD2 . LEU A  1 1041 ? 57.503  42.143  21.174  1.00 400.21 ? 1041 LEU A CD2 1 
ATOM   6492  N  N   . GLN A  1 1042 ? 52.333  40.004  19.712  1.00 230.59 ? 1042 GLN A N   1 
ATOM   6493  C  CA  . GLN A  1 1042 ? 52.110  38.638  19.246  1.00 239.12 ? 1042 GLN A CA  1 
ATOM   6494  C  C   . GLN A  1 1042 ? 51.005  38.639  18.195  1.00 272.78 ? 1042 GLN A C   1 
ATOM   6495  O  O   . GLN A  1 1042 ? 50.444  39.690  17.877  1.00 318.95 ? 1042 GLN A O   1 
ATOM   6496  C  CB  . GLN A  1 1042 ? 51.745  37.700  20.406  1.00 234.84 ? 1042 GLN A CB  1 
ATOM   6497  C  CG  . GLN A  1 1042 ? 52.939  37.074  21.130  1.00 185.88 ? 1042 GLN A CG  1 
ATOM   6498  C  CD  . GLN A  1 1042 ? 52.551  35.860  21.965  1.00 247.38 ? 1042 GLN A CD  1 
ATOM   6499  O  OE1 . GLN A  1 1042 ? 51.386  35.475  22.016  1.00 295.74 ? 1042 GLN A OE1 1 
ATOM   6500  N  NE2 . GLN A  1 1042 ? 53.531  35.251  22.621  1.00 261.90 ? 1042 GLN A NE2 1 
ATOM   6501  N  N   . LYS A  1 1043 ? 50.700  37.462  17.654  1.00 237.69 ? 1043 LYS A N   1 
ATOM   6502  C  CA  . LYS A  1 1043 ? 49.622  37.317  16.675  1.00 258.67 ? 1043 LYS A CA  1 
ATOM   6503  C  C   . LYS A  1 1043 ? 48.706  36.145  17.028  1.00 292.75 ? 1043 LYS A C   1 
ATOM   6504  O  O   . LYS A  1 1043 ? 49.071  35.271  17.816  1.00 279.36 ? 1043 LYS A O   1 
ATOM   6505  C  CB  . LYS A  1 1043 ? 50.194  37.117  15.272  1.00 229.78 ? 1043 LYS A CB  1 
ATOM   6506  C  CG  . LYS A  1 1043 ? 51.107  38.236  14.815  1.00 237.18 ? 1043 LYS A CG  1 
ATOM   6507  C  CD  . LYS A  1 1043 ? 50.362  39.554  14.705  1.00 255.75 ? 1043 LYS A CD  1 
ATOM   6508  C  CE  . LYS A  1 1043 ? 51.309  40.690  14.377  1.00 287.16 ? 1043 LYS A CE  1 
ATOM   6509  N  NZ  . LYS A  1 1043 ? 50.614  42.005  14.343  1.00 275.32 ? 1043 LYS A NZ  1 
ATOM   6510  N  N   . LYS A  1 1044 ? 47.514  36.137  16.437  1.00 313.85 ? 1044 LYS A N   1 
ATOM   6511  C  CA  . LYS A  1 1044 ? 46.521  35.102  16.707  1.00 319.01 ? 1044 LYS A CA  1 
ATOM   6512  C  C   . LYS A  1 1044 ? 45.986  35.196  18.136  1.00 305.38 ? 1044 LYS A C   1 
ATOM   6513  O  O   . LYS A  1 1044 ? 45.619  34.188  18.740  1.00 363.95 ? 1044 LYS A O   1 
ATOM   6514  C  CB  . LYS A  1 1044 ? 47.113  33.715  16.456  1.00 336.12 ? 1044 LYS A CB  1 
ATOM   6515  C  CG  . LYS A  1 1044 ? 46.078  32.615  16.326  1.00 340.16 ? 1044 LYS A CG  1 
ATOM   6516  C  CD  . LYS A  1 1044 ? 46.735  31.271  16.100  1.00 302.01 ? 1044 LYS A CD  1 
ATOM   6517  C  CE  . LYS A  1 1044 ? 45.711  30.156  16.105  1.00 248.86 ? 1044 LYS A CE  1 
ATOM   6518  N  NZ  . LYS A  1 1044 ? 46.345  28.826  15.947  1.00 233.49 ? 1044 LYS A NZ  1 
ATOM   6519  N  N   . VAL A  1 1045 ? 45.945  36.414  18.669  1.00 256.04 ? 1045 VAL A N   1 
ATOM   6520  C  CA  . VAL A  1 1045 ? 45.368  36.667  19.986  1.00 242.79 ? 1045 VAL A CA  1 
ATOM   6521  C  C   . VAL A  1 1045 ? 43.862  36.451  19.900  1.00 273.99 ? 1045 VAL A C   1 
ATOM   6522  O  O   . VAL A  1 1045 ? 43.308  36.412  18.802  1.00 288.12 ? 1045 VAL A O   1 
ATOM   6523  C  CB  . VAL A  1 1045 ? 45.670  38.114  20.470  1.00 234.89 ? 1045 VAL A CB  1 
ATOM   6524  C  CG1 . VAL A  1 1045 ? 44.980  39.147  19.580  1.00 228.95 ? 1045 VAL A CG1 1 
ATOM   6525  C  CG2 . VAL A  1 1045 ? 45.257  38.302  21.918  1.00 198.12 ? 1045 VAL A CG2 1 
ATOM   6526  N  N   . SER A  1 1046 ? 43.204  36.297  21.047  1.00 262.78 ? 1046 SER A N   1 
ATOM   6527  C  CA  . SER A  1 1046 ? 41.746  36.146  21.088  1.00 239.79 ? 1046 SER A CA  1 
ATOM   6528  C  C   . SER A  1 1046 ? 41.148  36.796  22.337  1.00 197.67 ? 1046 SER A C   1 
ATOM   6529  O  O   . SER A  1 1046 ? 41.554  36.487  23.457  1.00 263.74 ? 1046 SER A O   1 
ATOM   6530  C  CB  . SER A  1 1046 ? 41.359  34.673  21.083  1.00 202.01 ? 1046 SER A CB  1 
ATOM   6531  O  OG  . SER A  1 1046 ? 41.758  34.106  22.323  1.00 130.53 ? 1046 SER A OG  1 
ATOM   6532  N  N   . VAL A  1 1047 ? 40.166  37.674  22.141  1.00 146.72 ? 1047 VAL A N   1 
ATOM   6533  C  CA  . VAL A  1 1047 ? 39.520  38.371  23.250  1.00 192.11 ? 1047 VAL A CA  1 
ATOM   6534  C  C   . VAL A  1 1047 ? 38.243  37.637  23.645  1.00 233.32 ? 1047 VAL A C   1 
ATOM   6535  O  O   . VAL A  1 1047 ? 37.495  37.173  22.783  1.00 202.00 ? 1047 VAL A O   1 
ATOM   6536  C  CB  . VAL A  1 1047 ? 39.202  39.847  22.891  1.00 181.35 ? 1047 VAL A CB  1 
ATOM   6537  C  CG1 . VAL A  1 1047 ? 38.157  39.924  21.781  1.00 159.07 ? 1047 VAL A CG1 1 
ATOM   6538  C  CG2 . VAL A  1 1047 ? 38.741  40.611  24.125  1.00 223.42 ? 1047 VAL A CG2 1 
ATOM   6539  N  N   . VAL A  1 1048 ? 38.005  37.527  24.951  1.00 253.45 ? 1048 VAL A N   1 
ATOM   6540  C  CA  . VAL A  1 1048 ? 36.841  36.806  25.466  1.00 204.43 ? 1048 VAL A CA  1 
ATOM   6541  C  C   . VAL A  1 1048 ? 35.910  37.704  26.288  1.00 183.23 ? 1048 VAL A C   1 
ATOM   6542  O  O   . VAL A  1 1048 ? 36.361  38.616  26.996  1.00 161.43 ? 1048 VAL A O   1 
ATOM   6543  C  CB  . VAL A  1 1048 ? 37.263  35.611  26.348  1.00 177.63 ? 1048 VAL A CB  1 
ATOM   6544  C  CG1 . VAL A  1 1048 ? 36.053  35.038  27.086  1.00 172.02 ? 1048 VAL A CG1 1 
ATOM   6545  C  CG2 . VAL A  1 1048 ? 37.949  34.542  25.505  1.00 196.09 ? 1048 VAL A CG2 1 
ATOM   6546  N  N   . SER A  1 1049 ? 34.607  37.441  26.172  1.00 168.38 ? 1049 SER A N   1 
ATOM   6547  C  CA  . SER A  1 1049 ? 33.603  38.102  26.997  1.00 159.47 ? 1049 SER A CA  1 
ATOM   6548  C  C   . SER A  1 1049 ? 32.960  37.003  27.834  1.00 200.66 ? 1049 SER A C   1 
ATOM   6549  O  O   . SER A  1 1049 ? 32.694  35.891  27.342  1.00 123.45 ? 1049 SER A O   1 
ATOM   6550  C  CB  . SER A  1 1049 ? 32.558  38.880  26.162  1.00 154.02 ? 1049 SER A CB  1 
ATOM   6551  O  OG  . SER A  1 1049 ? 31.598  38.031  25.546  1.00 117.55 ? 1049 SER A OG  1 
ATOM   6552  N  N   . VAL A  1 1050 ? 32.769  37.307  29.115  1.00 204.64 ? 1050 VAL A N   1 
ATOM   6553  C  CA  . VAL A  1 1050 ? 32.098  36.403  30.040  1.00 111.22 ? 1050 VAL A CA  1 
ATOM   6554  C  C   . VAL A  1 1050 ? 30.717  36.960  30.399  1.00 146.91 ? 1050 VAL A C   1 
ATOM   6555  O  O   . VAL A  1 1050 ? 30.560  38.150  30.699  1.00 150.66 ? 1050 VAL A O   1 
ATOM   6556  C  CB  . VAL A  1 1050 ? 32.897  36.217  31.330  1.00 185.41 ? 1050 VAL A CB  1 
ATOM   6557  C  CG1 . VAL A  1 1050 ? 32.158  35.273  32.258  1.00 247.72 ? 1050 VAL A CG1 1 
ATOM   6558  C  CG2 . VAL A  1 1050 ? 34.291  35.703  31.027  1.00 218.65 ? 1050 VAL A CG2 1 
ATOM   6559  N  N   . ALA A  1 1051 ? 29.722  36.082  30.363  1.00 141.21 ? 1051 ALA A N   1 
ATOM   6560  C  CA  . ALA A  1 1051 ? 28.353  36.467  30.651  1.00 122.79 ? 1051 ALA A CA  1 
ATOM   6561  C  C   . ALA A  1 1051 ? 27.843  35.512  31.683  1.00 188.60 ? 1051 ALA A C   1 
ATOM   6562  O  O   . ALA A  1 1051 ? 27.797  34.292  31.466  1.00 146.57 ? 1051 ALA A O   1 
ATOM   6563  C  CB  . ALA A  1 1051 ? 27.494  36.377  29.422  1.00 190.42 ? 1051 ALA A CB  1 
ATOM   6564  N  N   . GLU A  1 1052 ? 27.450  36.078  32.809  1.00 218.33 ? 1052 GLU A N   1 
ATOM   6565  C  CA  . GLU A  1 1052 ? 27.006  35.290  33.921  1.00 216.62 ? 1052 GLU A CA  1 
ATOM   6566  C  C   . GLU A  1 1052 ? 25.708  35.842  34.521  1.00 139.43 ? 1052 GLU A C   1 
ATOM   6567  O  O   . GLU A  1 1052 ? 25.638  37.025  34.882  1.00 110.08 ? 1052 GLU A O   1 
ATOM   6568  C  CB  . GLU A  1 1052 ? 28.111  35.284  34.940  1.00 213.84 ? 1052 GLU A CB  1 
ATOM   6569  C  CG  . GLU A  1 1052 ? 27.691  35.641  36.360  1.00 228.60 ? 1052 GLU A CG  1 
ATOM   6570  C  CD  . GLU A  1 1052 ? 28.927  35.754  37.203  1.00 228.12 ? 1052 GLU A CD  1 
ATOM   6571  O  OE1 . GLU A  1 1052 ? 29.949  35.063  36.902  1.00 211.91 ? 1052 GLU A OE1 1 
ATOM   6572  O  OE2 . GLU A  1 1052 ? 28.889  36.495  38.200  1.00 245.42 ? 1052 GLU A OE2 1 
ATOM   6573  N  N   . ILE A  1 1053 ? 24.676  34.991  34.584  1.00 168.14 ? 1053 ILE A N   1 
ATOM   6574  C  CA  . ILE A  1 1053 ? 23.369  35.369  35.135  1.00 180.47 ? 1053 ILE A CA  1 
ATOM   6575  C  C   . ILE A  1 1053 ? 23.352  35.171  36.645  1.00 147.30 ? 1053 ILE A C   1 
ATOM   6576  O  O   . ILE A  1 1053 ? 23.993  34.257  37.175  1.00 181.12 ? 1053 ILE A O   1 
ATOM   6577  C  CB  . ILE A  1 1053 ? 22.183  34.579  34.486  1.00 212.59 ? 1053 ILE A CB  1 
ATOM   6578  C  CG1 . ILE A  1 1053 ? 20.840  35.101  35.020  1.00 223.79 ? 1053 ILE A CG1 1 
ATOM   6579  C  CG2 . ILE A  1 1053 ? 22.319  33.051  34.700  1.00 59.42  ? 1053 ILE A CG2 1 
ATOM   6580  C  CD1 . ILE A  1 1053 ? 19.641  34.585  34.255  1.00 272.69 ? 1053 ILE A CD1 1 
ATOM   6581  N  N   . THR A  1 1054 ? 22.619  36.039  37.335  1.00 135.88 ? 1054 THR A N   1 
ATOM   6582  C  CA  . THR A  1 1054 ? 22.564  35.986  38.786  1.00 161.04 ? 1054 THR A CA  1 
ATOM   6583  C  C   . THR A  1 1054 ? 21.132  36.199  39.258  1.00 229.01 ? 1054 THR A C   1 
ATOM   6584  O  O   . THR A  1 1054 ? 20.263  36.596  38.479  1.00 262.15 ? 1054 THR A O   1 
ATOM   6585  C  CB  . THR A  1 1054 ? 23.496  37.048  39.429  1.00 158.76 ? 1054 THR A CB  1 
ATOM   6586  O  OG1 . THR A  1 1054 ? 22.951  38.358  39.239  1.00 161.33 ? 1054 THR A OG1 1 
ATOM   6587  C  CG2 . THR A  1 1054 ? 24.892  36.987  38.818  1.00 165.90 ? 1054 THR A CG2 1 
ATOM   6588  N  N   . PHE A  1 1055 ? 20.893  35.909  40.533  1.00 212.82 ? 1055 PHE A N   1 
ATOM   6589  C  CA  . PHE A  1 1055 ? 19.597  36.148  41.162  1.00 165.97 ? 1055 PHE A CA  1 
ATOM   6590  C  C   . PHE A  1 1055 ? 19.776  36.055  42.670  1.00 170.89 ? 1055 PHE A C   1 
ATOM   6591  O  O   . PHE A  1 1055 ? 20.783  35.516  43.139  1.00 209.56 ? 1055 PHE A O   1 
ATOM   6592  C  CB  . PHE A  1 1055 ? 18.556  35.142  40.665  1.00 101.39 ? 1055 PHE A CB  1 
ATOM   6593  C  CG  . PHE A  1 1055 ? 19.127  33.795  40.367  1.00 148.76 ? 1055 PHE A CG  1 
ATOM   6594  C  CD1 . PHE A  1 1055 ? 19.058  32.802  41.301  1.00 61.87  ? 1055 PHE A CD1 1 
ATOM   6595  C  CD2 . PHE A  1 1055 ? 19.742  33.524  39.162  1.00 263.53 ? 1055 PHE A CD2 1 
ATOM   6596  C  CE1 . PHE A  1 1055 ? 19.590  31.542  41.055  1.00 125.23 ? 1055 PHE A CE1 1 
ATOM   6597  C  CE2 . PHE A  1 1055 ? 20.271  32.271  38.910  1.00 278.68 ? 1055 PHE A CE2 1 
ATOM   6598  C  CZ  . PHE A  1 1055 ? 20.191  31.278  39.866  1.00 194.74 ? 1055 PHE A CZ  1 
ATOM   6599  N  N   . ASP A  1 1056 ? 18.818  36.593  43.428  1.00 169.62 ? 1056 ASP A N   1 
ATOM   6600  C  CA  . ASP A  1 1056 ? 18.933  36.639  44.896  1.00 224.02 ? 1056 ASP A CA  1 
ATOM   6601  C  C   . ASP A  1 1056 ? 19.264  35.260  45.458  1.00 198.75 ? 1056 ASP A C   1 
ATOM   6602  O  O   . ASP A  1 1056 ? 18.418  34.357  45.437  1.00 117.79 ? 1056 ASP A O   1 
ATOM   6603  C  CB  . ASP A  1 1056 ? 17.645  37.173  45.542  1.00 245.34 ? 1056 ASP A CB  1 
ATOM   6604  C  CG  . ASP A  1 1056 ? 17.804  37.450  47.042  1.00 208.31 ? 1056 ASP A CG  1 
ATOM   6605  O  OD1 . ASP A  1 1056 ? 18.951  37.451  47.547  1.00 169.17 ? 1056 ASP A OD1 1 
ATOM   6606  O  OD2 . ASP A  1 1056 ? 16.776  37.673  47.717  1.00 187.44 ? 1056 ASP A OD2 1 
ATOM   6607  N  N   . THR A  1 1057 ? 20.500  35.108  45.939  1.00 185.66 ? 1057 THR A N   1 
ATOM   6608  C  CA  . THR A  1 1057 ? 20.975  33.852  46.517  1.00 131.49 ? 1057 THR A CA  1 
ATOM   6609  C  C   . THR A  1 1057 ? 19.990  33.320  47.547  1.00 179.63 ? 1057 THR A C   1 
ATOM   6610  O  O   . THR A  1 1057 ? 19.852  32.101  47.712  1.00 150.45 ? 1057 THR A O   1 
ATOM   6611  C  CB  . THR A  1 1057 ? 22.342  34.026  47.193  1.00 152.04 ? 1057 THR A CB  1 
ATOM   6612  O  OG1 . THR A  1 1057 ? 22.679  32.830  47.903  1.00 138.43 ? 1057 THR A OG1 1 
ATOM   6613  C  CG2 . THR A  1 1057 ? 22.316  35.188  48.162  1.00 160.09 ? 1057 THR A CG2 1 
ATOM   6614  N  N   . SER A  1 1058 ? 19.325  34.251  48.239  1.00 186.88 ? 1058 SER A N   1 
ATOM   6615  C  CA  . SER A  1 1058 ? 18.272  33.939  49.211  1.00 59.69  ? 1058 SER A CA  1 
ATOM   6616  C  C   . SER A  1 1058 ? 16.904  33.871  48.547  1.00 185.31 ? 1058 SER A C   1 
ATOM   6617  O  O   . SER A  1 1058 ? 16.607  34.661  47.647  1.00 205.75 ? 1058 SER A O   1 
ATOM   6618  C  CB  . SER A  1 1058 ? 18.230  35.008  50.300  1.00 132.34 ? 1058 SER A CB  1 
ATOM   6619  O  OG  . SER A  1 1058 ? 17.135  34.776  51.165  1.00 234.59 ? 1058 SER A OG  1 
ATOM   6620  N  N   . VAL A  1 1059 ? 16.071  32.942  49.021  1.00 188.25 ? 1059 VAL A N   1 
ATOM   6621  C  CA  . VAL A  1 1059 ? 14.734  32.715  48.465  1.00 176.89 ? 1059 VAL A CA  1 
ATOM   6622  C  C   . VAL A  1 1059 ? 14.767  31.769  47.251  1.00 196.10 ? 1059 VAL A C   1 
ATOM   6623  O  O   . VAL A  1 1059 ? 13.967  30.835  47.165  1.00 226.21 ? 1059 VAL A O   1 
ATOM   6624  C  CB  . VAL A  1 1059 ? 14.044  34.039  48.056  1.00 180.34 ? 1059 VAL A CB  1 
ATOM   6625  C  CG1 . VAL A  1 1059 ? 12.606  33.775  47.646  1.00 178.24 ? 1059 VAL A CG1 1 
ATOM   6626  C  CG2 . VAL A  1 1059 ? 14.099  35.051  49.187  1.00 260.47 ? 1059 VAL A CG2 1 
ATOM   6627  N  N   . TYR A  1 1060 ? 15.687  32.028  46.318  1.00 191.87 ? 1060 TYR A N   1 
ATOM   6628  C  CA  . TYR A  1 1060 ? 15.861  31.211  45.110  1.00 117.64 ? 1060 TYR A CA  1 
ATOM   6629  C  C   . TYR A  1 1060 ? 17.268  30.606  45.036  1.00 76.93  ? 1060 TYR A C   1 
ATOM   6630  O  O   . TYR A  1 1060 ? 18.218  31.075  45.673  1.00 103.96 ? 1060 TYR A O   1 
ATOM   6631  C  CB  . TYR A  1 1060 ? 15.625  32.069  43.862  1.00 117.25 ? 1060 TYR A CB  1 
ATOM   6632  C  CG  . TYR A  1 1060 ? 14.238  32.662  43.768  1.00 108.24 ? 1060 TYR A CG  1 
ATOM   6633  C  CD1 . TYR A  1 1060 ? 13.120  31.843  43.664  1.00 150.74 ? 1060 TYR A CD1 1 
ATOM   6634  C  CD2 . TYR A  1 1060 ? 14.051  34.047  43.769  1.00 105.47 ? 1060 TYR A CD2 1 
ATOM   6635  C  CE1 . TYR A  1 1060 ? 11.852  32.384  43.576  1.00 271.70 ? 1060 TYR A CE1 1 
ATOM   6636  C  CE2 . TYR A  1 1060 ? 12.787  34.597  43.681  1.00 144.46 ? 1060 TYR A CE2 1 
ATOM   6637  C  CZ  . TYR A  1 1060 ? 11.692  33.765  43.574  1.00 41.29  ? 1060 TYR A CZ  1 
ATOM   6638  O  OH  . TYR A  1 1060 ? 10.419  34.296  43.496  1.00 280.87 ? 1060 TYR A OH  1 
ATOM   6639  N  N   . SER A  1 1061 ? 17.403  29.580  44.211  1.00 135.59 ? 1061 SER A N   1 
ATOM   6640  C  CA  . SER A  1 1061 ? 18.665  28.857  44.102  1.00 161.08 ? 1061 SER A CA  1 
ATOM   6641  C  C   . SER A  1 1061 ? 18.550  27.703  43.096  1.00 185.62 ? 1061 SER A C   1 
ATOM   6642  O  O   . SER A  1 1061 ? 17.468  27.088  42.997  1.00 147.51 ? 1061 SER A O   1 
ATOM   6643  C  CB  . SER A  1 1061 ? 19.058  28.307  45.469  1.00 142.13 ? 1061 SER A CB  1 
ATOM   6644  O  OG  . SER A  1 1061 ? 18.151  27.284  45.872  1.00 50.36  ? 1061 SER A OG  1 
ATOM   6645  N  N   . GLN A  1 1062 ? 19.658  27.398  42.385  1.00 182.11 ? 1062 GLN A N   1 
ATOM   6646  C  CA  . GLN A  1 1062 ? 19.673  26.322  41.348  1.00 183.21 ? 1062 GLN A CA  1 
ATOM   6647  C  C   . GLN A  1 1062 ? 19.806  24.908  41.927  1.00 148.12 ? 1062 GLN A C   1 
ATOM   6648  O  O   . GLN A  1 1062 ? 20.499  24.684  42.920  1.00 229.34 ? 1062 GLN A O   1 
ATOM   6649  C  CB  . GLN A  1 1062 ? 20.750  26.555  40.290  1.00 169.68 ? 1062 GLN A CB  1 
ATOM   6650  C  CG  . GLN A  1 1062 ? 20.309  26.028  38.947  1.00 227.77 ? 1062 GLN A CG  1 
ATOM   6651  C  CD  . GLN A  1 1062 ? 21.052  26.617  37.802  1.00 173.67 ? 1062 GLN A CD  1 
ATOM   6652  O  OE1 . GLN A  1 1062 ? 20.450  26.966  36.803  1.00 114.91 ? 1062 GLN A OE1 1 
ATOM   6653  N  NE2 . GLN A  1 1062 ? 22.362  26.734  37.926  1.00 251.76 ? 1062 GLN A NE2 1 
ATOM   6654  N  N   . LEU A  1 1063 ? 19.152  23.962  41.264  1.00 109.37 ? 1063 LEU A N   1 
ATOM   6655  C  CA  . LEU A  1 1063 ? 18.660  22.765  41.940  1.00 252.32 ? 1063 LEU A CA  1 
ATOM   6656  C  C   . LEU A  1 1063 ? 19.641  21.592  42.143  1.00 157.51 ? 1063 LEU A C   1 
ATOM   6657  O  O   . LEU A  1 1063 ? 19.741  21.054  43.245  1.00 145.36 ? 1063 LEU A O   1 
ATOM   6658  C  CB  . LEU A  1 1063 ? 17.402  22.271  41.201  1.00 301.00 ? 1063 LEU A CB  1 
ATOM   6659  C  CG  . LEU A  1 1063 ? 17.627  21.804  39.763  1.00 102.30 ? 1063 LEU A CG  1 
ATOM   6660  C  CD1 . LEU A  1 1063 ? 18.161  20.359  39.736  1.00 269.88 ? 1063 LEU A CD1 1 
ATOM   6661  C  CD2 . LEU A  1 1063 ? 16.394  21.856  38.892  1.00 154.93 ? 1063 LEU A CD2 1 
ATOM   6662  N  N   . PRO A  1 1064 ? 20.386  21.221  41.089  1.00 159.04 ? 1064 PRO A N   1 
ATOM   6663  C  CA  . PRO A  1 1064 ? 20.856  19.838  40.857  1.00 264.14 ? 1064 PRO A CA  1 
ATOM   6664  C  C   . PRO A  1 1064 ? 22.055  19.435  41.663  1.00 264.32 ? 1064 PRO A C   1 
ATOM   6665  O  O   . PRO A  1 1064 ? 22.592  18.335  41.515  1.00 339.67 ? 1064 PRO A O   1 
ATOM   6666  C  CB  . PRO A  1 1064 ? 21.275  19.867  39.394  1.00 303.96 ? 1064 PRO A CB  1 
ATOM   6667  C  CG  . PRO A  1 1064 ? 21.750  21.258  39.195  1.00 252.43 ? 1064 PRO A CG  1 
ATOM   6668  C  CD  . PRO A  1 1064 ? 20.949  22.163  40.101  1.00 209.63 ? 1064 PRO A CD  1 
ATOM   6669  N  N   . GLY A  1 1065 ? 22.458  20.339  42.534  1.00 201.71 ? 1065 GLY A N   1 
ATOM   6670  C  CA  . GLY A  1 1065 ? 23.806  20.345  43.038  1.00 260.70 ? 1065 GLY A CA  1 
ATOM   6671  C  C   . GLY A  1 1065 ? 24.324  21.716  42.682  1.00 250.63 ? 1065 GLY A C   1 
ATOM   6672  O  O   . GLY A  1 1065 ? 24.137  22.681  43.424  1.00 311.79 ? 1065 GLY A O   1 
ATOM   6673  N  N   . GLN A  1 1066 ? 24.930  21.816  41.509  1.00 202.95 ? 1066 GLN A N   1 
ATOM   6674  C  CA  . GLN A  1 1066 ? 25.521  23.068  41.089  1.00 246.70 ? 1066 GLN A CA  1 
ATOM   6675  C  C   . GLN A  1 1066 ? 25.721  23.054  39.597  1.00 217.67 ? 1066 GLN A C   1 
ATOM   6676  O  O   . GLN A  1 1066 ? 26.533  22.303  39.056  1.00 241.31 ? 1066 GLN A O   1 
ATOM   6677  C  CB  . GLN A  1 1066 ? 26.856  23.296  41.795  1.00 313.06 ? 1066 GLN A CB  1 
ATOM   6678  C  CG  . GLN A  1 1066 ? 26.758  23.249  43.313  1.00 325.49 ? 1066 GLN A CG  1 
ATOM   6679  C  CD  . GLN A  1 1066 ? 28.107  23.273  43.994  1.00 309.46 ? 1066 GLN A CD  1 
ATOM   6680  O  OE1 . GLN A  1 1066 ? 29.097  22.769  43.462  1.00 320.16 ? 1066 GLN A OE1 1 
ATOM   6681  N  NE2 . GLN A  1 1066 ? 28.153  23.850  45.186  1.00 267.63 ? 1066 GLN A NE2 1 
ATOM   6682  N  N   . GLU A  1 1067 ? 24.940  23.880  38.931  1.00 170.60 ? 1067 GLU A N   1 
ATOM   6683  C  CA  . GLU A  1 1067 ? 25.079  24.039  37.513  1.00 164.16 ? 1067 GLU A CA  1 
ATOM   6684  C  C   . GLU A  1 1067 ? 25.666  25.420  37.143  1.00 174.89 ? 1067 GLU A C   1 
ATOM   6685  O  O   . GLU A  1 1067 ? 25.091  26.474  37.490  1.00 95.27  ? 1067 GLU A O   1 
ATOM   6686  C  CB  . GLU A  1 1067 ? 23.718  23.807  36.882  1.00 129.62 ? 1067 GLU A CB  1 
ATOM   6687  C  CG  . GLU A  1 1067 ? 23.266  22.347  36.961  1.00 112.26 ? 1067 GLU A CG  1 
ATOM   6688  C  CD  . GLU A  1 1067 ? 21.907  22.146  36.283  1.00 190.35 ? 1067 GLU A CD  1 
ATOM   6689  O  OE1 . GLU A  1 1067 ? 21.215  23.173  36.053  1.00 205.00 ? 1067 GLU A OE1 1 
ATOM   6690  O  OE2 . GLU A  1 1067 ? 21.543  20.975  35.974  1.00 127.90 ? 1067 GLU A OE2 1 
ATOM   6691  N  N   . ALA A  1 1068 ? 26.821  25.391  36.455  1.00 174.67 ? 1068 ALA A N   1 
ATOM   6692  C  CA  . ALA A  1 1068 ? 27.481  26.596  35.910  1.00 197.11 ? 1068 ALA A CA  1 
ATOM   6693  C  C   . ALA A  1 1068 ? 26.900  26.973  34.542  1.00 175.13 ? 1068 ALA A C   1 
ATOM   6694  O  O   . ALA A  1 1068 ? 27.507  27.747  33.789  1.00 188.68 ? 1068 ALA A O   1 
ATOM   6695  C  CB  . ALA A  1 1068 ? 29.012  26.380  35.788  1.00 241.42 ? 1068 ALA A CB  1 
ATOM   6696  N  N   . PHE A  1 1069 ? 25.729  26.410  34.234  1.00 138.48 ? 1069 PHE A N   1 
ATOM   6697  C  CA  . PHE A  1 1069 ? 25.010  26.716  33.007  1.00 179.19 ? 1069 PHE A CA  1 
ATOM   6698  C  C   . PHE A  1 1069 ? 24.565  28.170  33.032  1.00 228.01 ? 1069 PHE A C   1 
ATOM   6699  O  O   . PHE A  1 1069 ? 24.067  28.676  32.037  1.00 317.32 ? 1069 PHE A O   1 
ATOM   6700  C  CB  . PHE A  1 1069 ? 23.789  25.804  32.833  1.00 122.18 ? 1069 PHE A CB  1 
ATOM   6701  C  CG  . PHE A  1 1069 ? 24.121  24.411  32.359  1.00 152.31 ? 1069 PHE A CG  1 
ATOM   6702  C  CD1 . PHE A  1 1069 ? 25.366  23.847  32.603  1.00 185.15 ? 1069 PHE A CD1 1 
ATOM   6703  C  CD2 . PHE A  1 1069 ? 23.171  23.656  31.694  1.00 136.61 ? 1069 PHE A CD2 1 
ATOM   6704  C  CE1 . PHE A  1 1069 ? 25.660  22.566  32.174  1.00 187.53 ? 1069 PHE A CE1 1 
ATOM   6705  C  CE2 . PHE A  1 1069 ? 23.461  22.371  31.263  1.00 191.28 ? 1069 PHE A CE2 1 
ATOM   6706  C  CZ  . PHE A  1 1069 ? 24.707  21.827  31.504  1.00 211.41 ? 1069 PHE A CZ  1 
ATOM   6707  N  N   . MET A  1 1070 ? 24.750  28.844  34.164  1.00 79.87  ? 1070 MET A N   1 
ATOM   6708  C  CA  . MET A  1 1070 ? 24.468  30.277  34.237  1.00 157.52 ? 1070 MET A CA  1 
ATOM   6709  C  C   . MET A  1 1070 ? 25.739  31.149  34.102  1.00 190.89 ? 1070 MET A C   1 
ATOM   6710  O  O   . MET A  1 1070 ? 25.845  32.223  34.716  1.00 102.60 ? 1070 MET A O   1 
ATOM   6711  C  CB  . MET A  1 1070 ? 23.735  30.596  35.529  1.00 251.51 ? 1070 MET A CB  1 
ATOM   6712  C  CG  . MET A  1 1070 ? 24.174  29.731  36.697  1.00 309.13 ? 1070 MET A CG  1 
ATOM   6713  S  SD  . MET A  1 1070 ? 23.127  29.902  38.159  1.00 590.03 ? 1070 MET A SD  1 
ATOM   6714  C  CE  . MET A  1 1070 ? 23.359  31.632  38.544  1.00 380.85 ? 1070 MET A CE  1 
ATOM   6715  N  N   . ARG A  1 1071 ? 26.667  30.697  33.254  1.00 240.83 ? 1071 ARG A N   1 
ATOM   6716  C  CA  . ARG A  1 1071 ? 27.919  31.405  32.993  1.00 216.37 ? 1071 ARG A CA  1 
ATOM   6717  C  C   . ARG A  1 1071 ? 28.519  30.992  31.641  1.00 210.84 ? 1071 ARG A C   1 
ATOM   6718  O  O   . ARG A  1 1071 ? 29.422  30.152  31.587  1.00 246.33 ? 1071 ARG A O   1 
ATOM   6719  C  CB  . ARG A  1 1071 ? 28.914  31.141  34.127  1.00 175.59 ? 1071 ARG A CB  1 
ATOM   6720  C  CG  . ARG A  1 1071 ? 30.230  31.877  33.993  1.00 243.54 ? 1071 ARG A CG  1 
ATOM   6721  C  CD  . ARG A  1 1071 ? 31.002  31.820  35.292  1.00 142.58 ? 1071 ARG A CD  1 
ATOM   6722  N  NE  . ARG A  1 1071 ? 32.429  32.023  35.073  1.00 242.19 ? 1071 ARG A NE  1 
ATOM   6723  C  CZ  . ARG A  1 1071 ? 33.040  33.192  35.218  1.00 230.59 ? 1071 ARG A CZ  1 
ATOM   6724  N  NH1 . ARG A  1 1071 ? 32.332  34.264  35.595  1.00 117.15 ? 1071 ARG A NH1 1 
ATOM   6725  N  NH2 . ARG A  1 1071 ? 34.353  33.275  34.992  1.00 234.88 ? 1071 ARG A NH2 1 
ATOM   6726  N  N   . ALA A  1 1072 ? 28.010  31.583  30.558  1.00 125.36 ? 1072 ALA A N   1 
ATOM   6727  C  CA  . ALA A  1 1072 ? 28.510  31.294  29.214  1.00 200.46 ? 1072 ALA A CA  1 
ATOM   6728  C  C   . ALA A  1 1072 ? 29.741  32.133  28.862  1.00 204.20 ? 1072 ALA A C   1 
ATOM   6729  O  O   . ALA A  1 1072 ? 30.198  32.969  29.650  1.00 134.88 ? 1072 ALA A O   1 
ATOM   6730  C  CB  . ALA A  1 1072 ? 27.415  31.519  28.187  1.00 252.90 ? 1072 ALA A CB  1 
ATOM   6731  N  N   . GLN A  1 1073 ? 30.263  31.911  27.660  1.00 191.83 ? 1073 GLN A N   1 
ATOM   6732  C  CA  . GLN A  1 1073 ? 31.501  32.545  27.234  1.00 155.85 ? 1073 GLN A CA  1 
ATOM   6733  C  C   . GLN A  1 1073 ? 31.579  32.571  25.705  1.00 224.39 ? 1073 GLN A C   1 
ATOM   6734  O  O   . GLN A  1 1073 ? 31.089  31.660  25.032  1.00 236.93 ? 1073 GLN A O   1 
ATOM   6735  C  CB  . GLN A  1 1073 ? 32.696  31.782  27.818  1.00 171.04 ? 1073 GLN A CB  1 
ATOM   6736  C  CG  . GLN A  1 1073 ? 34.047  32.437  27.591  1.00 161.56 ? 1073 GLN A CG  1 
ATOM   6737  C  CD  . GLN A  1 1073 ? 35.163  31.714  28.313  1.00 233.57 ? 1073 GLN A CD  1 
ATOM   6738  O  OE1 . GLN A  1 1073 ? 34.931  31.023  29.306  1.00 352.47 ? 1073 GLN A OE1 1 
ATOM   6739  N  NE2 . GLN A  1 1073 ? 36.385  31.873  27.822  1.00 186.42 ? 1073 GLN A NE2 1 
ATOM   6740  N  N   . THR A  1 1074 ? 32.191  33.620  25.164  1.00 221.86 ? 1074 THR A N   1 
ATOM   6741  C  CA  . THR A  1 1074 ? 32.361  33.758  23.720  1.00 168.03 ? 1074 THR A CA  1 
ATOM   6742  C  C   . THR A  1 1074 ? 33.775  34.256  23.436  1.00 176.33 ? 1074 THR A C   1 
ATOM   6743  O  O   . THR A  1 1074 ? 34.155  35.330  23.892  1.00 151.64 ? 1074 THR A O   1 
ATOM   6744  C  CB  . THR A  1 1074 ? 31.336  34.753  23.104  1.00 121.09 ? 1074 THR A CB  1 
ATOM   6745  O  OG1 . THR A  1 1074 ? 30.001  34.393  23.476  1.00 133.56 ? 1074 THR A OG1 1 
ATOM   6746  C  CG2 . THR A  1 1074 ? 31.427  34.743  21.599  1.00 235.87 ? 1074 THR A CG2 1 
ATOM   6747  N  N   . THR A  1 1075 ? 34.552  33.471  22.692  1.00 194.04 ? 1075 THR A N   1 
ATOM   6748  C  CA  . THR A  1 1075 ? 35.937  33.829  22.382  1.00 216.46 ? 1075 THR A CA  1 
ATOM   6749  C  C   . THR A  1 1075 ? 36.131  34.175  20.902  1.00 235.14 ? 1075 THR A C   1 
ATOM   6750  O  O   . THR A  1 1075 ? 36.122  33.298  20.036  1.00 278.25 ? 1075 THR A O   1 
ATOM   6751  C  CB  . THR A  1 1075 ? 36.913  32.695  22.766  1.00 202.80 ? 1075 THR A CB  1 
ATOM   6752  O  OG1 . THR A  1 1075 ? 38.231  33.010  22.298  1.00 220.85 ? 1075 THR A OG1 1 
ATOM   6753  C  CG2 . THR A  1 1075 ? 36.469  31.378  22.165  1.00 233.60 ? 1075 THR A CG2 1 
ATOM   6754  N  N   . THR A  1 1076 ? 36.306  35.466  20.628  1.00 175.51 ? 1076 THR A N   1 
ATOM   6755  C  CA  . THR A  1 1076 ? 36.584  35.960  19.280  1.00 191.90 ? 1076 THR A CA  1 
ATOM   6756  C  C   . THR A  1 1076 ? 38.095  35.982  19.034  1.00 236.41 ? 1076 THR A C   1 
ATOM   6757  O  O   . THR A  1 1076 ? 38.871  36.051  19.985  1.00 281.40 ? 1076 THR A O   1 
ATOM   6758  C  CB  . THR A  1 1076 ? 35.996  37.382  19.097  1.00 167.84 ? 1076 THR A CB  1 
ATOM   6759  O  OG1 . THR A  1 1076 ? 34.567  37.302  19.034  1.00 232.73 ? 1076 THR A OG1 1 
ATOM   6760  C  CG2 . THR A  1 1076 ? 36.519  38.049  17.831  1.00 96.43  ? 1076 THR A CG2 1 
ATOM   6761  N  N   . VAL A  1 1077 ? 38.510  35.921  17.768  1.00 174.25 ? 1077 VAL A N   1 
ATOM   6762  C  CA  . VAL A  1 1077 ? 39.936  35.920  17.422  1.00 166.75 ? 1077 VAL A CA  1 
ATOM   6763  C  C   . VAL A  1 1077 ? 40.355  37.098  16.517  1.00 245.66 ? 1077 VAL A C   1 
ATOM   6764  O  O   . VAL A  1 1077 ? 39.631  37.471  15.593  1.00 320.88 ? 1077 VAL A O   1 
ATOM   6765  C  CB  . VAL A  1 1077 ? 40.327  34.603  16.731  1.00 96.38  ? 1077 VAL A CB  1 
ATOM   6766  C  CG1 . VAL A  1 1077 ? 41.834  34.551  16.514  1.00 266.23 ? 1077 VAL A CG1 1 
ATOM   6767  C  CG2 . VAL A  1 1077 ? 39.857  33.423  17.547  1.00 216.59 ? 1077 VAL A CG2 1 
ATOM   6768  N  N   . LEU A  1 1078 ? 41.533  37.668  16.787  1.00 158.62 ? 1078 LEU A N   1 
ATOM   6769  C  CA  . LEU A  1 1078 ? 42.069  38.790  16.010  1.00 161.55 ? 1078 LEU A CA  1 
ATOM   6770  C  C   . LEU A  1 1078 ? 43.391  38.443  15.316  1.00 305.78 ? 1078 LEU A C   1 
ATOM   6771  O  O   . LEU A  1 1078 ? 44.344  39.221  15.366  1.00 380.73 ? 1078 LEU A O   1 
ATOM   6772  C  CB  . LEU A  1 1078 ? 42.291  40.012  16.913  1.00 171.70 ? 1078 LEU A CB  1 
ATOM   6773  C  CG  . LEU A  1 1078 ? 41.145  41.006  17.110  1.00 258.62 ? 1078 LEU A CG  1 
ATOM   6774  C  CD1 . LEU A  1 1078 ? 40.010  40.392  17.911  1.00 335.45 ? 1078 LEU A CD1 1 
ATOM   6775  C  CD2 . LEU A  1 1078 ? 41.679  42.256  17.797  1.00 238.26 ? 1078 LEU A CD2 1 
ATOM   6776  N  N   . GLU A  1 1079 ? 43.458  37.282  14.670  1.00 338.02 ? 1079 GLU A N   1 
ATOM   6777  C  CA  . GLU A  1 1079 ? 44.659  36.910  13.925  1.00 301.44 ? 1079 GLU A CA  1 
ATOM   6778  C  C   . GLU A  1 1079 ? 44.758  37.732  12.645  1.00 230.91 ? 1079 GLU A C   1 
ATOM   6779  O  O   . GLU A  1 1079 ? 44.021  37.503  11.685  1.00 229.79 ? 1079 GLU A O   1 
ATOM   6780  C  CB  . GLU A  1 1079 ? 44.672  35.414  13.596  1.00 310.37 ? 1079 GLU A CB  1 
ATOM   6781  C  CG  . GLU A  1 1079 ? 45.679  35.038  12.525  1.00 232.55 ? 1079 GLU A CG  1 
ATOM   6782  C  CD  . GLU A  1 1079 ? 45.611  33.572  12.149  1.00 272.81 ? 1079 GLU A CD  1 
ATOM   6783  O  OE1 . GLU A  1 1079 ? 45.061  32.777  12.938  1.00 290.05 ? 1079 GLU A OE1 1 
ATOM   6784  O  OE2 . GLU A  1 1079 ? 46.106  33.215  11.060  1.00 307.73 ? 1079 GLU A OE2 1 
ATOM   6785  N  N   . LYS A  1 1080 ? 45.665  38.700  12.644  1.00 224.44 ? 1080 LYS A N   1 
ATOM   6786  C  CA  . LYS A  1 1080 ? 45.876  39.543  11.480  1.00 270.86 ? 1080 LYS A CA  1 
ATOM   6787  C  C   . LYS A  1 1080 ? 47.365  39.793  11.300  1.00 297.00 ? 1080 LYS A C   1 
ATOM   6788  O  O   . LYS A  1 1080 ? 47.986  40.509  12.085  1.00 218.05 ? 1080 LYS A O   1 
ATOM   6789  C  CB  . LYS A  1 1080 ? 45.108  40.858  11.625  1.00 207.47 ? 1080 LYS A CB  1 
ATOM   6790  C  CG  . LYS A  1 1080 ? 43.609  40.711  11.439  1.00 180.70 ? 1080 LYS A CG  1 
ATOM   6791  C  CD  . LYS A  1 1080 ? 43.021  41.880  10.676  1.00 159.48 ? 1080 LYS A CD  1 
ATOM   6792  C  CE  . LYS A  1 1080 ? 41.686  41.503  10.065  1.00 155.63 ? 1080 LYS A CE  1 
ATOM   6793  N  NZ  . LYS A  1 1080 ? 41.111  42.596  9.239   1.00 182.92 ? 1080 LYS A NZ  1 
ATOM   6794  N  N   . TYR A  1 1081 ? 47.927  39.188  10.258  1.00 349.06 ? 1081 TYR A N   1 
ATOM   6795  C  CA  . TYR A  1 1081 ? 49.367  39.180  10.051  1.00 344.21 ? 1081 TYR A CA  1 
ATOM   6796  C  C   . TYR A  1 1081 ? 49.787  40.221  9.020   1.00 315.09 ? 1081 TYR A C   1 
ATOM   6797  O  O   . TYR A  1 1081 ? 48.980  41.040  8.576   1.00 174.55 ? 1081 TYR A O   1 
ATOM   6798  C  CB  . TYR A  1 1081 ? 49.817  37.781  9.618   1.00 326.15 ? 1081 TYR A CB  1 
ATOM   6799  C  CG  . TYR A  1 1081 ? 51.287  37.499  9.830   1.00 346.71 ? 1081 TYR A CG  1 
ATOM   6800  C  CD1 . TYR A  1 1081 ? 51.870  37.652  11.080  1.00 367.68 ? 1081 TYR A CD1 1 
ATOM   6801  C  CD2 . TYR A  1 1081 ? 52.089  37.064  8.783   1.00 361.18 ? 1081 TYR A CD2 1 
ATOM   6802  C  CE1 . TYR A  1 1081 ? 53.211  37.391  11.280  1.00 385.45 ? 1081 TYR A CE1 1 
ATOM   6803  C  CE2 . TYR A  1 1081 ? 53.430  36.800  8.973   1.00 377.20 ? 1081 TYR A CE2 1 
ATOM   6804  C  CZ  . TYR A  1 1081 ? 53.985  36.964  10.222  1.00 389.76 ? 1081 TYR A CZ  1 
ATOM   6805  O  OH  . TYR A  1 1081 ? 55.321  36.700  10.414  1.00 402.43 ? 1081 TYR A OH  1 
ATOM   6806  N  N   . LYS A  1 1082 ? 51.059  40.182  8.643   1.00 320.14 ? 1082 LYS A N   1 
ATOM   6807  C  CA  . LYS A  1 1082 ? 51.630  41.193  7.769   1.00 304.55 ? 1082 LYS A CA  1 
ATOM   6808  C  C   . LYS A  1 1082 ? 51.526  42.567  8.423   1.00 293.60 ? 1082 LYS A C   1 
ATOM   6809  O  O   . LYS A  1 1082 ? 52.480  43.345  8.413   1.00 300.68 ? 1082 LYS A O   1 
ATOM   6810  C  CB  . LYS A  1 1082 ? 50.928  41.210  6.410   1.00 272.87 ? 1082 LYS A CB  1 
ATOM   6811  C  CG  . LYS A  1 1082 ? 51.453  40.183  5.407   1.00 250.05 ? 1082 LYS A CG  1 
ATOM   6812  C  CD  . LYS A  1 1082 ? 51.382  40.724  3.981   1.00 232.22 ? 1082 LYS A CD  1 
ATOM   6813  C  CE  . LYS A  1 1082 ? 51.693  39.654  2.944   1.00 224.07 ? 1082 LYS A CE  1 
ATOM   6814  N  NZ  . LYS A  1 1082 ? 51.860  40.238  1.584   1.00 207.95 ? 1082 LYS A NZ  1 
ATOM   6815  N  N   . GLN B  2 1    ? 16.375  -18.626 56.707  1.00 316.45 ? 1    GLN B N   1 
ATOM   6816  C  CA  . GLN B  2 1    ? 16.460  -17.836 55.447  1.00 291.83 ? 1    GLN B CA  1 
ATOM   6817  C  C   . GLN B  2 1    ? 15.521  -16.641 55.492  1.00 296.37 ? 1    GLN B C   1 
ATOM   6818  O  O   . GLN B  2 1    ? 15.959  -15.493 55.549  1.00 303.35 ? 1    GLN B O   1 
ATOM   6819  C  CB  . GLN B  2 1    ? 16.107  -18.707 54.244  1.00 229.70 ? 1    GLN B CB  1 
ATOM   6820  C  CG  . GLN B  2 1    ? 16.108  -17.956 52.927  1.00 222.63 ? 1    GLN B CG  1 
ATOM   6821  C  CD  . GLN B  2 1    ? 15.574  -18.792 51.789  1.00 257.26 ? 1    GLN B CD  1 
ATOM   6822  O  OE1 . GLN B  2 1    ? 15.244  -19.961 51.971  1.00 286.66 ? 1    GLN B OE1 1 
ATOM   6823  N  NE2 . GLN B  2 1    ? 15.486  -18.199 50.607  1.00 263.50 ? 1    GLN B NE2 1 
ATOM   6824  N  N   . GLU B  2 2    ? 14.224  -16.920 55.461  1.00 272.87 ? 2    GLU B N   1 
ATOM   6825  C  CA  . GLU B  2 2    ? 13.225  -15.865 55.459  1.00 246.94 ? 2    GLU B CA  1 
ATOM   6826  C  C   . GLU B  2 2    ? 11.845  -16.453 55.697  1.00 254.91 ? 2    GLU B C   1 
ATOM   6827  O  O   . GLU B  2 2    ? 11.454  -17.419 55.044  1.00 280.64 ? 2    GLU B O   1 
ATOM   6828  C  CB  . GLU B  2 2    ? 13.250  -15.123 54.124  1.00 232.81 ? 2    GLU B CB  1 
ATOM   6829  C  CG  . GLU B  2 2    ? 12.916  -15.999 52.934  1.00 258.00 ? 2    GLU B CG  1 
ATOM   6830  C  CD  . GLU B  2 2    ? 13.138  -15.292 51.615  1.00 290.36 ? 2    GLU B CD  1 
ATOM   6831  O  OE1 . GLU B  2 2    ? 13.399  -14.070 51.629  1.00 313.74 ? 2    GLU B OE1 1 
ATOM   6832  O  OE2 . GLU B  2 2    ? 13.051  -15.958 50.564  1.00 281.31 ? 2    GLU B OE2 1 
ATOM   6833  N  N   . CYS B  2 3    ? 11.109  -15.869 56.636  1.00 249.34 ? 3    CYS B N   1 
ATOM   6834  C  CA  . CYS B  2 3    ? 9.757   -16.323 56.928  1.00 235.94 ? 3    CYS B CA  1 
ATOM   6835  C  C   . CYS B  2 3    ? 9.025   -15.392 57.891  1.00 231.23 ? 3    CYS B C   1 
ATOM   6836  O  O   . CYS B  2 3    ? 9.291   -15.405 59.091  1.00 285.98 ? 3    CYS B O   1 
ATOM   6837  C  CB  . CYS B  2 3    ? 9.799   -17.730 57.517  1.00 246.87 ? 3    CYS B CB  1 
ATOM   6838  S  SG  . CYS B  2 3    ? 8.165   -18.463 57.708  1.00 283.81 ? 3    CYS B SG  1 
ATOM   6839  N  N   . THR B  2 4    ? 8.107   -14.584 57.363  1.00 191.82 ? 4    THR B N   1 
ATOM   6840  C  CA  . THR B  2 4    ? 7.262   -13.738 58.201  1.00 253.65 ? 4    THR B CA  1 
ATOM   6841  C  C   . THR B  2 4    ? 5.924   -14.430 58.423  1.00 240.70 ? 4    THR B C   1 
ATOM   6842  O  O   . THR B  2 4    ? 5.299   -14.926 57.484  1.00 184.47 ? 4    THR B O   1 
ATOM   6843  C  CB  . THR B  2 4    ? 7.025   -12.349 57.578  1.00 278.81 ? 4    THR B CB  1 
ATOM   6844  O  OG1 . THR B  2 4    ? 8.258   -11.838 57.062  1.00 286.68 ? 4    THR B OG1 1 
ATOM   6845  C  CG2 . THR B  2 4    ? 6.478   -11.380 58.620  1.00 289.55 ? 4    THR B CG2 1 
ATOM   6846  N  N   . LYS B  2 5    ? 5.494   -14.460 59.678  1.00 238.78 ? 5    LYS B N   1 
ATOM   6847  C  CA  . LYS B  2 5    ? 4.334   -15.244 60.069  1.00 220.04 ? 5    LYS B CA  1 
ATOM   6848  C  C   . LYS B  2 5    ? 3.034   -14.568 59.675  1.00 237.88 ? 5    LYS B C   1 
ATOM   6849  O  O   . LYS B  2 5    ? 2.715   -13.479 60.150  1.00 274.67 ? 5    LYS B O   1 
ATOM   6850  C  CB  . LYS B  2 5    ? 4.347   -15.492 61.582  1.00 233.40 ? 5    LYS B CB  1 
ATOM   6851  C  CG  . LYS B  2 5    ? 5.503   -16.356 62.064  1.00 208.76 ? 5    LYS B CG  1 
ATOM   6852  C  CD  . LYS B  2 5    ? 5.518   -16.483 63.579  1.00 227.85 ? 5    LYS B CD  1 
ATOM   6853  C  CE  . LYS B  2 5    ? 6.669   -17.358 64.049  1.00 207.59 ? 5    LYS B CE  1 
ATOM   6854  N  NZ  . LYS B  2 5    ? 6.745   -17.429 65.532  1.00 253.24 ? 5    LYS B NZ  1 
ATOM   6855  N  N   . PHE B  2 6    ? 2.291   -15.220 58.794  1.00 185.61 ? 6    PHE B N   1 
ATOM   6856  C  CA  . PHE B  2 6    ? 0.913   -14.848 58.557  1.00 186.70 ? 6    PHE B CA  1 
ATOM   6857  C  C   . PHE B  2 6    ? 0.085   -15.577 59.599  1.00 230.21 ? 6    PHE B C   1 
ATOM   6858  O  O   . PHE B  2 6    ? 0.642   -16.294 60.426  1.00 315.16 ? 6    PHE B O   1 
ATOM   6859  C  CB  . PHE B  2 6    ? 0.485   -15.276 57.168  1.00 234.90 ? 6    PHE B CB  1 
ATOM   6860  C  CG  . PHE B  2 6    ? -0.915  -14.886 56.830  1.00 244.37 ? 6    PHE B CG  1 
ATOM   6861  C  CD1 . PHE B  2 6    ? -1.221  -13.576 56.518  1.00 189.59 ? 6    PHE B CD1 1 
ATOM   6862  C  CD2 . PHE B  2 6    ? -1.931  -15.825 56.841  1.00 289.24 ? 6    PHE B CD2 1 
ATOM   6863  C  CE1 . PHE B  2 6    ? -2.510  -13.209 56.210  1.00 190.65 ? 6    PHE B CE1 1 
ATOM   6864  C  CE2 . PHE B  2 6    ? -3.224  -15.464 56.536  1.00 270.92 ? 6    PHE B CE2 1 
ATOM   6865  C  CZ  . PHE B  2 6    ? -3.514  -14.154 56.219  1.00 219.06 ? 6    PHE B CZ  1 
ATOM   6866  N  N   . LYS B  2 7    ? -1.233  -15.407 59.575  1.00 203.81 ? 7    LYS B N   1 
ATOM   6867  C  CA  . LYS B  2 7    ? -2.091  -16.140 60.500  1.00 272.23 ? 7    LYS B CA  1 
ATOM   6868  C  C   . LYS B  2 7    ? -1.776  -17.632 60.422  1.00 285.65 ? 7    LYS B C   1 
ATOM   6869  O  O   . LYS B  2 7    ? -2.075  -18.283 59.424  1.00 229.16 ? 7    LYS B O   1 
ATOM   6870  C  CB  . LYS B  2 7    ? -3.572  -15.898 60.192  1.00 266.08 ? 7    LYS B CB  1 
ATOM   6871  C  CG  . LYS B  2 7    ? -4.515  -16.496 61.228  1.00 276.65 ? 7    LYS B CG  1 
ATOM   6872  C  CD  . LYS B  2 7    ? -5.961  -16.159 60.930  1.00 281.41 ? 7    LYS B CD  1 
ATOM   6873  C  CE  . LYS B  2 7    ? -6.873  -16.628 62.045  1.00 249.93 ? 7    LYS B CE  1 
ATOM   6874  N  NZ  . LYS B  2 7    ? -8.289  -16.249 61.803  1.00 233.08 ? 7    LYS B NZ  1 
ATOM   6875  N  N   . VAL B  2 8    ? -1.163  -18.163 61.478  1.00 313.65 ? 8    VAL B N   1 
ATOM   6876  C  CA  . VAL B  2 8    ? -0.775  -19.571 61.524  1.00 241.29 ? 8    VAL B CA  1 
ATOM   6877  C  C   . VAL B  2 8    ? -1.735  -20.371 62.398  1.00 217.26 ? 8    VAL B C   1 
ATOM   6878  O  O   . VAL B  2 8    ? -1.670  -20.295 63.623  1.00 253.91 ? 8    VAL B O   1 
ATOM   6879  C  CB  . VAL B  2 8    ? 0.656   -19.752 62.089  1.00 222.03 ? 8    VAL B CB  1 
ATOM   6880  C  CG1 . VAL B  2 8    ? 1.005   -21.228 62.202  1.00 243.15 ? 8    VAL B CG1 1 
ATOM   6881  C  CG2 . VAL B  2 8    ? 1.672   -19.030 61.223  1.00 184.97 ? 8    VAL B CG2 1 
ATOM   6882  N  N   . SER B  2 9    ? -2.618  -21.139 61.764  1.00 206.46 ? 9    SER B N   1 
ATOM   6883  C  CA  . SER B  2 9    ? -3.562  -21.995 62.484  1.00 250.54 ? 9    SER B CA  1 
ATOM   6884  C  C   . SER B  2 9    ? -3.197  -23.475 62.324  1.00 288.21 ? 9    SER B C   1 
ATOM   6885  O  O   . SER B  2 9    ? -3.445  -24.281 63.223  1.00 344.60 ? 9    SER B O   1 
ATOM   6886  C  CB  . SER B  2 9    ? -4.992  -21.754 61.990  1.00 236.21 ? 9    SER B CB  1 
ATOM   6887  O  OG  . SER B  2 9    ? -5.902  -22.662 62.590  1.00 224.94 ? 9    SER B OG  1 
ATOM   6888  N  N   . SER B  2 10   ? -2.608  -23.823 61.182  1.00 258.70 ? 10   SER B N   1 
ATOM   6889  C  CA  . SER B  2 10   ? -2.207  -25.201 60.909  1.00 232.81 ? 10   SER B CA  1 
ATOM   6890  C  C   . SER B  2 10   ? -0.842  -25.242 60.233  1.00 218.62 ? 10   SER B C   1 
ATOM   6891  O  O   . SER B  2 10   ? -0.182  -24.216 60.083  1.00 250.01 ? 10   SER B O   1 
ATOM   6892  C  CB  . SER B  2 10   ? -3.254  -25.893 60.032  1.00 241.92 ? 10   SER B CB  1 
ATOM   6893  O  OG  . SER B  2 10   ? -3.385  -25.250 58.776  1.00 192.17 ? 10   SER B OG  1 
ATOM   6894  N  N   . CYS B  2 11   ? -0.411  -26.431 59.830  1.00 220.31 ? 11   CYS B N   1 
ATOM   6895  C  CA  . CYS B  2 11   ? 0.843   -26.557 59.102  1.00 241.10 ? 11   CYS B CA  1 
ATOM   6896  C  C   . CYS B  2 11   ? 0.724   -25.924 57.728  1.00 264.17 ? 11   CYS B C   1 
ATOM   6897  O  O   . CYS B  2 11   ? 1.708   -25.445 57.176  1.00 289.80 ? 11   CYS B O   1 
ATOM   6898  C  CB  . CYS B  2 11   ? 1.254   -28.024 58.956  1.00 216.08 ? 11   CYS B CB  1 
ATOM   6899  S  SG  . CYS B  2 11   ? 0.327   -28.948 57.678  1.00 322.92 ? 11   CYS B SG  1 
ATOM   6900  N  N   . ARG B  2 12   ? -0.491  -25.912 57.190  1.00 243.19 ? 12   ARG B N   1 
ATOM   6901  C  CA  . ARG B  2 12   ? -0.727  -25.358 55.867  1.00 243.50 ? 12   ARG B CA  1 
ATOM   6902  C  C   . ARG B  2 12   ? -0.680  -23.836 55.856  1.00 205.58 ? 12   ARG B C   1 
ATOM   6903  O  O   . ARG B  2 12   ? -0.188  -23.230 54.907  1.00 201.96 ? 12   ARG B O   1 
ATOM   6904  C  CB  . ARG B  2 12   ? -2.076  -25.817 55.330  1.00 265.25 ? 12   ARG B CB  1 
ATOM   6905  C  CG  . ARG B  2 12   ? -2.386  -25.253 53.967  1.00 250.04 ? 12   ARG B CG  1 
ATOM   6906  C  CD  . ARG B  2 12   ? -3.676  -25.802 53.420  1.00 226.83 ? 12   ARG B CD  1 
ATOM   6907  N  NE  . ARG B  2 12   ? -3.906  -25.342 52.057  1.00 251.87 ? 12   ARG B NE  1 
ATOM   6908  C  CZ  . ARG B  2 12   ? -4.968  -25.665 51.329  1.00 270.18 ? 12   ARG B CZ  1 
ATOM   6909  N  NH1 . ARG B  2 12   ? -5.908  -26.450 51.833  1.00 286.96 ? 12   ARG B NH1 1 
ATOM   6910  N  NH2 . ARG B  2 12   ? -5.092  -25.200 50.093  1.00 278.38 ? 12   ARG B NH2 1 
ATOM   6911  N  N   . GLU B  2 13   ? -1.204  -23.220 56.908  1.00 193.97 ? 13   GLU B N   1 
ATOM   6912  C  CA  . GLU B  2 13   ? -1.179  -21.768 57.020  1.00 221.37 ? 13   GLU B CA  1 
ATOM   6913  C  C   . GLU B  2 13   ? 0.236   -21.239 57.296  1.00 265.41 ? 13   GLU B C   1 
ATOM   6914  O  O   . GLU B  2 13   ? 0.485   -20.037 57.203  1.00 292.00 ? 13   GLU B O   1 
ATOM   6915  C  CB  . GLU B  2 13   ? -2.144  -21.303 58.110  1.00 217.48 ? 13   GLU B CB  1 
ATOM   6916  C  CG  . GLU B  2 13   ? -3.598  -21.609 57.806  1.00 192.33 ? 13   GLU B CG  1 
ATOM   6917  C  CD  . GLU B  2 13   ? -4.549  -20.899 58.744  1.00 242.70 ? 13   GLU B CD  1 
ATOM   6918  O  OE1 . GLU B  2 13   ? -4.104  -19.986 59.471  1.00 250.90 ? 13   GLU B OE1 1 
ATOM   6919  O  OE2 . GLU B  2 13   ? -5.744  -21.252 58.751  1.00 262.59 ? 13   GLU B OE2 1 
ATOM   6920  N  N   . CYS B  2 14   ? 1.153   -22.139 57.640  1.00 263.41 ? 14   CYS B N   1 
ATOM   6921  C  CA  . CYS B  2 14   ? 2.566   -21.792 57.805  1.00 248.49 ? 14   CYS B CA  1 
ATOM   6922  C  C   . CYS B  2 14   ? 3.253   -21.856 56.444  1.00 250.76 ? 14   CYS B C   1 
ATOM   6923  O  O   . CYS B  2 14   ? 4.211   -21.133 56.158  1.00 247.91 ? 14   CYS B O   1 
ATOM   6924  C  CB  . CYS B  2 14   ? 3.233   -22.768 58.775  1.00 198.52 ? 14   CYS B CB  1 
ATOM   6925  S  SG  . CYS B  2 14   ? 5.038   -22.653 58.857  1.00 219.88 ? 14   CYS B SG  1 
ATOM   6926  N  N   . ILE B  2 15   ? 2.733   -22.745 55.613  1.00 208.40 ? 15   ILE B N   1 
ATOM   6927  C  CA  . ILE B  2 15   ? 3.206   -22.936 54.260  1.00 191.89 ? 15   ILE B CA  1 
ATOM   6928  C  C   . ILE B  2 15   ? 2.813   -21.728 53.404  1.00 212.11 ? 15   ILE B C   1 
ATOM   6929  O  O   . ILE B  2 15   ? 3.589   -21.283 52.559  1.00 231.38 ? 15   ILE B O   1 
ATOM   6930  C  CB  . ILE B  2 15   ? 2.607   -24.237 53.725  1.00 257.85 ? 15   ILE B CB  1 
ATOM   6931  C  CG1 . ILE B  2 15   ? 3.198   -25.434 54.472  1.00 253.08 ? 15   ILE B CG1 1 
ATOM   6932  C  CG2 . ILE B  2 15   ? 2.866   -24.419 52.307  1.00 329.47 ? 15   ILE B CG2 1 
ATOM   6933  C  CD1 . ILE B  2 15   ? 4.715   -25.363 54.690  1.00 245.96 ? 15   ILE B CD1 1 
ATOM   6934  N  N   . GLU B  2 16   ? 1.627   -21.177 53.658  1.00 214.55 ? 16   GLU B N   1 
ATOM   6935  C  CA  . GLU B  2 16   ? 1.108   -20.044 52.896  1.00 201.16 ? 16   GLU B CA  1 
ATOM   6936  C  C   . GLU B  2 16   ? 1.722   -18.727 53.363  1.00 211.79 ? 16   GLU B C   1 
ATOM   6937  O  O   . GLU B  2 16   ? 1.194   -17.655 53.076  1.00 212.25 ? 16   GLU B O   1 
ATOM   6938  C  CB  . GLU B  2 16   ? -0.415  -19.978 53.029  1.00 193.55 ? 16   GLU B CB  1 
ATOM   6939  C  CG  . GLU B  2 16   ? -1.139  -21.167 52.417  1.00 213.47 ? 16   GLU B CG  1 
ATOM   6940  C  CD  . GLU B  2 16   ? -2.640  -21.080 52.576  1.00 253.59 ? 16   GLU B CD  1 
ATOM   6941  O  OE1 . GLU B  2 16   ? -3.095  -20.384 53.505  1.00 277.32 ? 16   GLU B OE1 1 
ATOM   6942  O  OE2 . GLU B  2 16   ? -3.364  -21.709 51.775  1.00 264.35 ? 16   GLU B OE2 1 
ATOM   6943  N  N   . SER B  2 17   ? 2.838   -18.810 54.081  1.00 216.39 ? 17   SER B N   1 
ATOM   6944  C  CA  . SER B  2 17   ? 3.511   -17.618 54.582  1.00 220.87 ? 17   SER B CA  1 
ATOM   6945  C  C   . SER B  2 17   ? 4.646   -17.205 53.660  1.00 250.33 ? 17   SER B C   1 
ATOM   6946  O  O   . SER B  2 17   ? 4.895   -16.020 53.474  1.00 285.98 ? 17   SER B O   1 
ATOM   6947  C  CB  . SER B  2 17   ? 4.057   -17.853 55.989  1.00 198.83 ? 17   SER B CB  1 
ATOM   6948  O  OG  . SER B  2 17   ? 3.008   -18.065 56.915  1.00 231.01 ? 17   SER B OG  1 
ATOM   6949  N  N   . GLY B  2 18   ? 5.342   -18.182 53.091  1.00 221.36 ? 18   GLY B N   1 
ATOM   6950  C  CA  . GLY B  2 18   ? 6.432   -17.888 52.178  1.00 214.53 ? 18   GLY B CA  1 
ATOM   6951  C  C   . GLY B  2 18   ? 7.308   -19.089 51.894  1.00 196.91 ? 18   GLY B C   1 
ATOM   6952  O  O   . GLY B  2 18   ? 7.194   -20.121 52.556  1.00 200.97 ? 18   GLY B O   1 
ATOM   6953  N  N   . PRO B  2 19   ? 8.196   -18.959 50.899  1.00 201.11 ? 19   PRO B N   1 
ATOM   6954  C  CA  . PRO B  2 19   ? 9.101   -20.039 50.500  1.00 248.12 ? 19   PRO B CA  1 
ATOM   6955  C  C   . PRO B  2 19   ? 9.964   -20.533 51.655  1.00 261.68 ? 19   PRO B C   1 
ATOM   6956  O  O   . PRO B  2 19   ? 10.072  -21.740 51.862  1.00 252.46 ? 19   PRO B O   1 
ATOM   6957  C  CB  . PRO B  2 19   ? 9.976   -19.385 49.424  1.00 285.70 ? 19   PRO B CB  1 
ATOM   6958  C  CG  . PRO B  2 19   ? 9.169   -18.253 48.907  1.00 273.14 ? 19   PRO B CG  1 
ATOM   6959  C  CD  . PRO B  2 19   ? 8.374   -17.755 50.071  1.00 230.79 ? 19   PRO B CD  1 
ATOM   6960  N  N   . GLY B  2 20   ? 10.563  -19.608 52.399  1.00 264.12 ? 20   GLY B N   1 
ATOM   6961  C  CA  . GLY B  2 20   ? 11.477  -19.967 53.468  1.00 247.57 ? 20   GLY B CA  1 
ATOM   6962  C  C   . GLY B  2 20   ? 10.776  -20.287 54.775  1.00 270.17 ? 20   GLY B C   1 
ATOM   6963  O  O   . GLY B  2 20   ? 11.359  -20.135 55.850  1.00 281.67 ? 20   GLY B O   1 
ATOM   6964  N  N   . CYS B  2 21   ? 9.525   -20.733 54.684  1.00 278.29 ? 21   CYS B N   1 
ATOM   6965  C  CA  . CYS B  2 21   ? 8.744   -21.086 55.866  1.00 260.50 ? 21   CYS B CA  1 
ATOM   6966  C  C   . CYS B  2 21   ? 8.653   -22.601 56.041  1.00 246.15 ? 21   CYS B C   1 
ATOM   6967  O  O   . CYS B  2 21   ? 8.211   -23.316 55.142  1.00 235.90 ? 21   CYS B O   1 
ATOM   6968  C  CB  . CYS B  2 21   ? 7.332   -20.495 55.773  1.00 200.08 ? 21   CYS B CB  1 
ATOM   6969  S  SG  . CYS B  2 21   ? 7.245   -18.689 55.913  1.00 257.29 ? 21   CYS B SG  1 
ATOM   6970  N  N   . THR B  2 22   ? 9.071   -23.077 57.211  1.00 248.94 ? 22   THR B N   1 
ATOM   6971  C  CA  . THR B  2 22   ? 9.011   -24.495 57.547  1.00 246.71 ? 22   THR B CA  1 
ATOM   6972  C  C   . THR B  2 22   ? 8.116   -24.709 58.766  1.00 263.89 ? 22   THR B C   1 
ATOM   6973  O  O   . THR B  2 22   ? 7.810   -23.762 59.491  1.00 255.19 ? 22   THR B O   1 
ATOM   6974  C  CB  . THR B  2 22   ? 10.411  -25.062 57.848  1.00 241.23 ? 22   THR B CB  1 
ATOM   6975  O  OG1 . THR B  2 22   ? 11.052  -24.263 58.851  1.00 261.25 ? 22   THR B OG1 1 
ATOM   6976  C  CG2 . THR B  2 22   ? 11.263  -25.067 56.597  1.00 229.54 ? 22   THR B CG2 1 
ATOM   6977  N  N   . TRP B  2 23   ? 7.704   -25.954 58.987  1.00 263.79 ? 23   TRP B N   1 
ATOM   6978  C  CA  . TRP B  2 23   ? 6.808   -26.288 60.092  1.00 239.65 ? 23   TRP B CA  1 
ATOM   6979  C  C   . TRP B  2 23   ? 7.312   -27.501 60.868  1.00 247.41 ? 23   TRP B C   1 
ATOM   6980  O  O   . TRP B  2 23   ? 7.890   -28.415 60.287  1.00 247.64 ? 23   TRP B O   1 
ATOM   6981  C  CB  . TRP B  2 23   ? 5.396   -26.561 59.565  1.00 211.01 ? 23   TRP B CB  1 
ATOM   6982  C  CG  . TRP B  2 23   ? 4.440   -27.018 60.625  1.00 221.67 ? 23   TRP B CG  1 
ATOM   6983  C  CD1 . TRP B  2 23   ? 4.188   -28.303 61.000  1.00 234.09 ? 23   TRP B CD1 1 
ATOM   6984  C  CD2 . TRP B  2 23   ? 3.613   -26.189 61.453  1.00 238.46 ? 23   TRP B CD2 1 
ATOM   6985  N  NE1 . TRP B  2 23   ? 3.256   -28.327 62.010  1.00 240.76 ? 23   TRP B NE1 1 
ATOM   6986  C  CE2 . TRP B  2 23   ? 2.888   -27.041 62.305  1.00 215.47 ? 23   TRP B CE2 1 
ATOM   6987  C  CE3 . TRP B  2 23   ? 3.417   -24.807 61.556  1.00 257.80 ? 23   TRP B CE3 1 
ATOM   6988  C  CZ2 . TRP B  2 23   ? 1.982   -26.559 63.245  1.00 208.73 ? 23   TRP B CZ2 1 
ATOM   6989  C  CZ3 . TRP B  2 23   ? 2.516   -24.331 62.492  1.00 226.63 ? 23   TRP B CZ3 1 
ATOM   6990  C  CH2 . TRP B  2 23   ? 1.811   -25.204 63.323  1.00 201.00 ? 23   TRP B CH2 1 
ATOM   6991  N  N   . CYS B  2 24   ? 7.090   -27.503 62.181  1.00 289.85 ? 24   CYS B N   1 
ATOM   6992  C  CA  . CYS B  2 24   ? 7.506   -28.613 63.040  1.00 299.72 ? 24   CYS B CA  1 
ATOM   6993  C  C   . CYS B  2 24   ? 6.289   -29.364 63.583  1.00 267.10 ? 24   CYS B C   1 
ATOM   6994  O  O   . CYS B  2 24   ? 5.337   -28.761 64.083  1.00 200.22 ? 24   CYS B O   1 
ATOM   6995  C  CB  . CYS B  2 24   ? 8.377   -28.103 64.198  1.00 306.70 ? 24   CYS B CB  1 
ATOM   6996  S  SG  . CYS B  2 24   ? 9.144   -29.398 65.216  1.00 237.35 ? 24   CYS B SG  1 
ATOM   6997  N  N   . GLN B  2 25   ? 6.332   -30.688 63.482  1.00 273.70 ? 25   GLN B N   1 
ATOM   6998  C  CA  . GLN B  2 25   ? 5.223   -31.526 63.909  1.00 234.96 ? 25   GLN B CA  1 
ATOM   6999  C  C   . GLN B  2 25   ? 5.503   -32.131 65.282  1.00 236.98 ? 25   GLN B C   1 
ATOM   7000  O  O   . GLN B  2 25   ? 4.582   -32.564 65.974  1.00 213.83 ? 25   GLN B O   1 
ATOM   7001  C  CB  . GLN B  2 25   ? 4.968   -32.626 62.872  1.00 264.11 ? 25   GLN B CB  1 
ATOM   7002  C  CG  . GLN B  2 25   ? 6.138   -33.584 62.665  1.00 267.08 ? 25   GLN B CG  1 
ATOM   7003  C  CD  . GLN B  2 25   ? 5.883   -34.597 61.563  1.00 245.06 ? 25   GLN B CD  1 
ATOM   7004  O  OE1 . GLN B  2 25   ? 4.963   -34.442 60.758  1.00 283.29 ? 25   GLN B OE1 1 
ATOM   7005  N  NE2 . GLN B  2 25   ? 6.701   -35.643 61.523  1.00 207.53 ? 25   GLN B NE2 1 
ATOM   7006  N  N   . LYS B  2 26   ? 6.776   -32.142 65.677  1.00 267.35 ? 26   LYS B N   1 
ATOM   7007  C  CA  . LYS B  2 26   ? 7.189   -32.734 66.947  1.00 270.98 ? 26   LYS B CA  1 
ATOM   7008  C  C   . LYS B  2 26   ? 6.352   -32.187 68.102  1.00 274.70 ? 26   LYS B C   1 
ATOM   7009  O  O   . LYS B  2 26   ? 6.357   -30.987 68.381  1.00 300.17 ? 26   LYS B O   1 
ATOM   7010  C  CB  . LYS B  2 26   ? 8.682   -32.486 67.203  1.00 254.11 ? 26   LYS B CB  1 
ATOM   7011  C  CG  . LYS B  2 26   ? 9.225   -33.165 68.456  1.00 234.76 ? 26   LYS B CG  1 
ATOM   7012  C  CD  . LYS B  2 26   ? 10.746  -33.119 68.509  1.00 226.40 ? 26   LYS B CD  1 
ATOM   7013  C  CE  . LYS B  2 26   ? 11.276  -33.865 69.721  1.00 255.59 ? 26   LYS B CE  1 
ATOM   7014  N  NZ  . LYS B  2 26   ? 12.761  -33.884 69.762  1.00 244.04 ? 26   LYS B NZ  1 
ATOM   7015  N  N   . LEU B  2 27   ? 5.626   -33.078 68.764  1.00 241.97 ? 27   LEU B N   1 
ATOM   7016  C  CA  . LEU B  2 27   ? 4.789   -32.698 69.891  1.00 238.21 ? 27   LEU B CA  1 
ATOM   7017  C  C   . LEU B  2 27   ? 5.630   -32.265 71.077  1.00 234.04 ? 27   LEU B C   1 
ATOM   7018  O  O   . LEU B  2 27   ? 6.856   -32.349 71.049  1.00 242.24 ? 27   LEU B O   1 
ATOM   7019  C  CB  . LEU B  2 27   ? 3.902   -33.868 70.300  1.00 247.09 ? 27   LEU B CB  1 
ATOM   7020  C  CG  . LEU B  2 27   ? 2.603   -33.985 69.512  1.00 235.29 ? 27   LEU B CG  1 
ATOM   7021  C  CD1 . LEU B  2 27   ? 1.927   -35.313 69.793  1.00 223.06 ? 27   LEU B CD1 1 
ATOM   7022  C  CD2 . LEU B  2 27   ? 1.698   -32.824 69.869  1.00 260.10 ? 27   LEU B CD2 1 
ATOM   7023  N  N   . ASN B  2 28   ? 4.961   -31.808 72.127  1.00 227.80 ? 28   ASN B N   1 
ATOM   7024  C  CA  . ASN B  2 28   ? 5.649   -31.355 73.323  1.00 283.37 ? 28   ASN B CA  1 
ATOM   7025  C  C   . ASN B  2 28   ? 6.679   -30.294 72.980  1.00 287.63 ? 28   ASN B C   1 
ATOM   7026  O  O   . ASN B  2 28   ? 7.614   -30.058 73.743  1.00 323.45 ? 28   ASN B O   1 
ATOM   7027  C  CB  . ASN B  2 28   ? 6.329   -32.529 74.031  1.00 311.83 ? 28   ASN B CB  1 
ATOM   7028  C  CG  . ASN B  2 28   ? 5.338   -33.544 74.552  1.00 309.88 ? 28   ASN B CG  1 
ATOM   7029  O  OD1 . ASN B  2 28   ? 4.132   -33.305 74.543  1.00 308.60 ? 28   ASN B OD1 1 
ATOM   7030  N  ND2 . ASN B  2 28   ? 5.838   -34.685 75.011  1.00 297.15 ? 28   ASN B ND2 1 
ATOM   7031  N  N   . PHE B  2 29   ? 6.509   -29.657 71.826  1.00 229.46 ? 29   PHE B N   1 
ATOM   7032  C  CA  . PHE B  2 29   ? 7.416   -28.599 71.407  1.00 232.05 ? 29   PHE B CA  1 
ATOM   7033  C  C   . PHE B  2 29   ? 6.957   -27.256 71.961  1.00 252.12 ? 29   PHE B C   1 
ATOM   7034  O  O   . PHE B  2 29   ? 7.746   -26.318 72.073  1.00 273.26 ? 29   PHE B O   1 
ATOM   7035  C  CB  . PHE B  2 29   ? 7.499   -28.536 69.883  1.00 219.23 ? 29   PHE B CB  1 
ATOM   7036  C  CG  . PHE B  2 29   ? 8.503   -27.539 69.371  1.00 247.50 ? 29   PHE B CG  1 
ATOM   7037  C  CD1 . PHE B  2 29   ? 9.832   -27.897 69.192  1.00 248.86 ? 29   PHE B CD1 1 
ATOM   7038  C  CD2 . PHE B  2 29   ? 8.118   -26.245 69.067  1.00 258.71 ? 29   PHE B CD2 1 
ATOM   7039  C  CE1 . PHE B  2 29   ? 10.755  -26.980 68.720  1.00 230.04 ? 29   PHE B CE1 1 
ATOM   7040  C  CE2 . PHE B  2 29   ? 9.037   -25.325 68.595  1.00 262.42 ? 29   PHE B CE2 1 
ATOM   7041  C  CZ  . PHE B  2 29   ? 10.356  -25.693 68.421  1.00 232.42 ? 29   PHE B CZ  1 
ATOM   7042  N  N   . THR B  2 30   ? 5.678   -27.166 72.309  1.00 235.96 ? 30   THR B N   1 
ATOM   7043  C  CA  . THR B  2 30   ? 5.131   -25.946 72.890  1.00 232.23 ? 30   THR B CA  1 
ATOM   7044  C  C   . THR B  2 30   ? 5.392   -25.902 74.391  1.00 250.33 ? 30   THR B C   1 
ATOM   7045  O  O   . THR B  2 30   ? 4.995   -26.808 75.120  1.00 258.80 ? 30   THR B O   1 
ATOM   7046  C  CB  . THR B  2 30   ? 3.618   -25.853 72.658  1.00 212.99 ? 30   THR B CB  1 
ATOM   7047  O  OG1 . THR B  2 30   ? 3.342   -25.932 71.254  1.00 200.66 ? 30   THR B OG1 1 
ATOM   7048  C  CG2 . THR B  2 30   ? 3.070   -24.549 73.214  1.00 185.26 ? 30   THR B CG2 1 
ATOM   7049  N  N   . GLY B  2 31   ? 6.057   -24.846 74.850  1.00 254.55 ? 31   GLY B N   1 
ATOM   7050  C  CA  . GLY B  2 31   ? 6.378   -24.700 76.258  1.00 256.20 ? 31   GLY B CA  1 
ATOM   7051  C  C   . GLY B  2 31   ? 5.138   -24.566 77.118  1.00 263.20 ? 31   GLY B C   1 
ATOM   7052  O  O   . GLY B  2 31   ? 4.019   -24.597 76.603  1.00 281.23 ? 31   GLY B O   1 
ATOM   7053  N  N   . PRO B  2 32   ? 5.332   -24.418 78.439  1.00 274.07 ? 32   PRO B N   1 
ATOM   7054  C  CA  . PRO B  2 32   ? 4.226   -24.287 79.390  1.00 307.35 ? 32   PRO B CA  1 
ATOM   7055  C  C   . PRO B  2 32   ? 3.128   -23.375 78.863  1.00 300.33 ? 32   PRO B C   1 
ATOM   7056  O  O   . PRO B  2 32   ? 1.952   -23.719 78.948  1.00 310.00 ? 32   PRO B O   1 
ATOM   7057  C  CB  . PRO B  2 32   ? 4.900   -23.674 80.618  1.00 337.64 ? 32   PRO B CB  1 
ATOM   7058  C  CG  . PRO B  2 32   ? 6.288   -24.193 80.571  1.00 329.15 ? 32   PRO B CG  1 
ATOM   7059  C  CD  . PRO B  2 32   ? 6.642   -24.344 79.111  1.00 285.89 ? 32   PRO B CD  1 
ATOM   7060  N  N   . GLY B  2 33   ? 3.514   -22.229 78.315  1.00 291.38 ? 33   GLY B N   1 
ATOM   7061  C  CA  . GLY B  2 33   ? 2.550   -21.281 77.788  1.00 290.93 ? 33   GLY B CA  1 
ATOM   7062  C  C   . GLY B  2 33   ? 3.081   -20.557 76.572  1.00 272.55 ? 33   GLY B C   1 
ATOM   7063  O  O   . GLY B  2 33   ? 3.135   -19.327 76.537  1.00 250.53 ? 33   GLY B O   1 
ATOM   7064  N  N   . ASP B  2 34   ? 3.473   -21.328 75.567  1.00 273.70 ? 34   ASP B N   1 
ATOM   7065  C  CA  . ASP B  2 34   ? 4.020   -20.757 74.351  1.00 264.67 ? 34   ASP B CA  1 
ATOM   7066  C  C   . ASP B  2 34   ? 3.005   -20.815 73.221  1.00 253.09 ? 34   ASP B C   1 
ATOM   7067  O  O   . ASP B  2 34   ? 2.141   -21.693 73.198  1.00 223.84 ? 34   ASP B O   1 
ATOM   7068  C  CB  . ASP B  2 34   ? 5.291   -21.499 73.945  1.00 249.58 ? 34   ASP B CB  1 
ATOM   7069  C  CG  . ASP B  2 34   ? 6.421   -21.301 74.935  1.00 253.93 ? 34   ASP B CG  1 
ATOM   7070  O  OD1 . ASP B  2 34   ? 6.260   -20.492 75.873  1.00 261.07 ? 34   ASP B OD1 1 
ATOM   7071  O  OD2 . ASP B  2 34   ? 7.473   -21.953 74.772  1.00 227.71 ? 34   ASP B OD2 1 
ATOM   7072  N  N   . PRO B  2 35   ? 3.111   -19.869 72.278  1.00 284.71 ? 35   PRO B N   1 
ATOM   7073  C  CA  . PRO B  2 35   ? 2.241   -19.826 71.099  1.00 278.64 ? 35   PRO B CA  1 
ATOM   7074  C  C   . PRO B  2 35   ? 2.396   -21.080 70.240  1.00 278.06 ? 35   PRO B C   1 
ATOM   7075  O  O   . PRO B  2 35   ? 3.428   -21.745 70.308  1.00 292.49 ? 35   PRO B O   1 
ATOM   7076  C  CB  . PRO B  2 35   ? 2.737   -18.585 70.339  1.00 292.90 ? 35   PRO B CB  1 
ATOM   7077  C  CG  . PRO B  2 35   ? 3.492   -17.779 71.343  1.00 298.81 ? 35   PRO B CG  1 
ATOM   7078  C  CD  . PRO B  2 35   ? 4.085   -18.765 72.286  1.00 312.08 ? 35   PRO B CD  1 
ATOM   7079  N  N   . ASP B  2 36   ? 1.373   -21.405 69.456  1.00 274.95 ? 36   ASP B N   1 
ATOM   7080  C  CA  . ASP B  2 36   ? 1.457   -22.499 68.491  1.00 259.95 ? 36   ASP B CA  1 
ATOM   7081  C  C   . ASP B  2 36   ? 2.112   -22.036 67.188  1.00 224.14 ? 36   ASP B C   1 
ATOM   7082  O  O   . ASP B  2 36   ? 2.557   -22.850 66.375  1.00 211.94 ? 36   ASP B O   1 
ATOM   7083  C  CB  . ASP B  2 36   ? 0.062   -23.047 68.201  1.00 225.34 ? 36   ASP B CB  1 
ATOM   7084  C  CG  . ASP B  2 36   ? -0.489  -23.871 69.346  1.00 218.89 ? 36   ASP B CG  1 
ATOM   7085  O  OD1 . ASP B  2 36   ? 0.309   -24.513 70.061  1.00 201.83 ? 36   ASP B OD1 1 
ATOM   7086  O  OD2 . ASP B  2 36   ? -1.721  -23.877 69.529  1.00 215.51 ? 36   ASP B OD2 1 
ATOM   7087  N  N   . SER B  2 37   ? 2.164   -20.722 66.999  1.00 229.40 ? 37   SER B N   1 
ATOM   7088  C  CA  . SER B  2 37   ? 2.750   -20.135 65.801  1.00 193.19 ? 37   SER B CA  1 
ATOM   7089  C  C   . SER B  2 37   ? 4.270   -20.225 65.827  1.00 226.12 ? 37   SER B C   1 
ATOM   7090  O  O   . SER B  2 37   ? 4.927   -19.930 64.831  1.00 261.21 ? 37   SER B O   1 
ATOM   7091  C  CB  . SER B  2 37   ? 2.324   -18.670 65.665  1.00 248.16 ? 37   SER B CB  1 
ATOM   7092  O  OG  . SER B  2 37   ? 2.655   -17.927 66.827  1.00 320.31 ? 37   SER B OG  1 
ATOM   7093  N  N   . ILE B  2 38   ? 4.824   -20.622 66.970  1.00 231.52 ? 38   ILE B N   1 
ATOM   7094  C  CA  . ILE B  2 38   ? 6.271   -20.757 67.112  1.00 240.45 ? 38   ILE B CA  1 
ATOM   7095  C  C   . ILE B  2 38   ? 6.762   -21.956 66.317  1.00 235.56 ? 38   ILE B C   1 
ATOM   7096  O  O   . ILE B  2 38   ? 7.933   -22.033 65.943  1.00 255.73 ? 38   ILE B O   1 
ATOM   7097  C  CB  . ILE B  2 38   ? 6.698   -20.937 68.589  1.00 252.48 ? 38   ILE B CB  1 
ATOM   7098  C  CG1 . ILE B  2 38   ? 6.205   -22.285 69.129  1.00 265.83 ? 38   ILE B CG1 1 
ATOM   7099  C  CG2 . ILE B  2 38   ? 6.188   -19.779 69.441  1.00 255.00 ? 38   ILE B CG2 1 
ATOM   7100  C  CD1 . ILE B  2 38   ? 6.532   -22.524 70.594  1.00 266.43 ? 38   ILE B CD1 1 
ATOM   7101  N  N   . ARG B  2 39   ? 5.858   -22.895 66.065  1.00 230.14 ? 39   ARG B N   1 
ATOM   7102  C  CA  . ARG B  2 39   ? 6.195   -24.087 65.306  1.00 265.88 ? 39   ARG B CA  1 
ATOM   7103  C  C   . ARG B  2 39   ? 6.559   -23.730 63.865  1.00 273.33 ? 39   ARG B C   1 
ATOM   7104  O  O   . ARG B  2 39   ? 7.161   -24.533 63.153  1.00 258.30 ? 39   ARG B O   1 
ATOM   7105  C  CB  . ARG B  2 39   ? 5.027   -25.075 65.333  1.00 285.21 ? 39   ARG B CB  1 
ATOM   7106  C  CG  . ARG B  2 39   ? 4.701   -25.615 66.721  1.00 287.27 ? 39   ARG B CG  1 
ATOM   7107  C  CD  . ARG B  2 39   ? 3.440   -26.462 66.702  1.00 274.60 ? 39   ARG B CD  1 
ATOM   7108  N  NE  . ARG B  2 39   ? 3.123   -27.014 68.018  1.00 262.24 ? 39   ARG B NE  1 
ATOM   7109  C  CZ  . ARG B  2 39   ? 3.443   -28.241 68.421  1.00 236.01 ? 39   ARG B CZ  1 
ATOM   7110  N  NH1 . ARG B  2 39   ? 4.091   -29.068 67.614  1.00 219.08 ? 39   ARG B NH1 1 
ATOM   7111  N  NH2 . ARG B  2 39   ? 3.109   -28.645 69.637  1.00 208.82 ? 39   ARG B NH2 1 
ATOM   7112  N  N   . CYS B  2 40   ? 6.203   -22.518 63.445  1.00 292.35 ? 40   CYS B N   1 
ATOM   7113  C  CA  . CYS B  2 40   ? 6.452   -22.067 62.077  1.00 278.36 ? 40   CYS B CA  1 
ATOM   7114  C  C   . CYS B  2 40   ? 7.573   -21.025 62.019  1.00 263.17 ? 40   CYS B C   1 
ATOM   7115  O  O   . CYS B  2 40   ? 7.326   -19.830 62.180  1.00 243.47 ? 40   CYS B O   1 
ATOM   7116  C  CB  . CYS B  2 40   ? 5.162   -21.488 61.483  1.00 245.64 ? 40   CYS B CB  1 
ATOM   7117  S  SG  . CYS B  2 40   ? 5.300   -20.874 59.797  1.00 227.84 ? 40   CYS B SG  1 
ATOM   7118  N  N   . ASP B  2 41   ? 8.802   -21.488 61.792  1.00 252.17 ? 41   ASP B N   1 
ATOM   7119  C  CA  . ASP B  2 41   ? 9.960   -20.601 61.657  1.00 254.74 ? 41   ASP B CA  1 
ATOM   7120  C  C   . ASP B  2 41   ? 10.771  -21.030 60.435  1.00 239.09 ? 41   ASP B C   1 
ATOM   7121  O  O   . ASP B  2 41   ? 10.237  -21.666 59.532  1.00 212.37 ? 41   ASP B O   1 
ATOM   7122  C  CB  . ASP B  2 41   ? 10.827  -20.652 62.920  1.00 264.04 ? 41   ASP B CB  1 
ATOM   7123  C  CG  . ASP B  2 41   ? 11.629  -19.375 63.136  1.00 266.69 ? 41   ASP B CG  1 
ATOM   7124  O  OD1 . ASP B  2 41   ? 11.547  -18.460 62.289  1.00 275.72 ? 41   ASP B OD1 1 
ATOM   7125  O  OD2 . ASP B  2 41   ? 12.342  -19.285 64.157  1.00 260.49 ? 41   ASP B OD2 1 
ATOM   7126  N  N   . THR B  2 42   ? 12.055  -20.684 60.401  1.00 259.42 ? 42   THR B N   1 
ATOM   7127  C  CA  . THR B  2 42   ? 12.928  -21.129 59.320  1.00 243.99 ? 42   THR B CA  1 
ATOM   7128  C  C   . THR B  2 42   ? 13.595  -22.434 59.730  1.00 249.68 ? 42   THR B C   1 
ATOM   7129  O  O   . THR B  2 42   ? 13.780  -22.687 60.915  1.00 278.76 ? 42   THR B O   1 
ATOM   7130  C  CB  . THR B  2 42   ? 14.007  -20.084 58.997  1.00 225.14 ? 42   THR B CB  1 
ATOM   7131  O  OG1 . THR B  2 42   ? 14.874  -19.921 60.125  1.00 229.08 ? 42   THR B OG1 1 
ATOM   7132  C  CG2 . THR B  2 42   ? 13.369  -18.750 58.649  1.00 253.20 ? 42   THR B CG2 1 
ATOM   7133  N  N   . ARG B  2 43   ? 13.949  -23.264 58.755  1.00 224.50 ? 43   ARG B N   1 
ATOM   7134  C  CA  . ARG B  2 43   ? 14.552  -24.563 59.045  1.00 263.57 ? 43   ARG B CA  1 
ATOM   7135  C  C   . ARG B  2 43   ? 15.728  -24.454 60.011  1.00 274.68 ? 43   ARG B C   1 
ATOM   7136  O  O   . ARG B  2 43   ? 15.866  -25.279 60.917  1.00 215.49 ? 43   ARG B O   1 
ATOM   7137  C  CB  . ARG B  2 43   ? 15.020  -25.241 57.760  1.00 258.41 ? 43   ARG B CB  1 
ATOM   7138  C  CG  . ARG B  2 43   ? 15.613  -26.621 57.980  1.00 243.18 ? 43   ARG B CG  1 
ATOM   7139  C  CD  . ARG B  2 43   ? 16.040  -27.244 56.669  1.00 253.44 ? 43   ARG B CD  1 
ATOM   7140  N  NE  . ARG B  2 43   ? 17.089  -26.472 56.008  1.00 293.64 ? 43   ARG B NE  1 
ATOM   7141  C  CZ  . ARG B  2 43   ? 18.389  -26.621 56.239  1.00 311.47 ? 43   ARG B CZ  1 
ATOM   7142  N  NH1 . ARG B  2 43   ? 18.811  -27.512 57.126  1.00 305.44 ? 43   ARG B NH1 1 
ATOM   7143  N  NH2 . ARG B  2 43   ? 19.271  -25.875 55.584  1.00 321.08 ? 43   ARG B NH2 1 
ATOM   7144  N  N   . PRO B  2 44   ? 16.594  -23.445 59.808  1.00 288.71 ? 44   PRO B N   1 
ATOM   7145  C  CA  . PRO B  2 44   ? 17.741  -23.245 60.699  1.00 279.98 ? 44   PRO B CA  1 
ATOM   7146  C  C   . PRO B  2 44   ? 17.316  -22.971 62.136  1.00 252.52 ? 44   PRO B C   1 
ATOM   7147  O  O   . PRO B  2 44   ? 17.848  -23.579 63.064  1.00 232.84 ? 44   PRO B O   1 
ATOM   7148  C  CB  . PRO B  2 44   ? 18.435  -22.011 60.111  1.00 246.02 ? 44   PRO B CB  1 
ATOM   7149  C  CG  . PRO B  2 44   ? 18.002  -21.963 58.697  1.00 229.16 ? 44   PRO B CG  1 
ATOM   7150  C  CD  . PRO B  2 44   ? 16.605  -22.493 58.683  1.00 238.05 ? 44   PRO B CD  1 
ATOM   7151  N  N   . GLN B  2 45   ? 16.365  -22.059 62.308  0.50 215.55 ? 45   GLN B N   1 
ATOM   7152  C  CA  . GLN B  2 45   ? 15.875  -21.704 63.633  0.50 187.83 ? 45   GLN B CA  1 
ATOM   7153  C  C   . GLN B  2 45   ? 15.273  -22.913 64.350  0.50 213.55 ? 45   GLN B C   1 
ATOM   7154  O  O   . GLN B  2 45   ? 15.432  -23.066 65.560  0.50 233.88 ? 45   GLN B O   1 
ATOM   7155  C  CB  . GLN B  2 45   ? 14.834  -20.588 63.528  0.50 174.06 ? 45   GLN B CB  1 
ATOM   7156  C  CG  . GLN B  2 45   ? 15.398  -19.260 63.059  1.00 193.69 ? 45   GLN B CG  1 
ATOM   7157  C  CD  . GLN B  2 45   ? 16.364  -18.656 64.058  1.00 232.41 ? 45   GLN B CD  1 
ATOM   7158  O  OE1 . GLN B  2 45   ? 16.492  -19.134 65.185  1.00 222.71 ? 45   GLN B OE1 1 
ATOM   7159  N  NE2 . GLN B  2 45   ? 17.049  -17.600 63.647  1.00 263.09 ? 45   GLN B NE2 1 
ATOM   7160  N  N   . LEU B  2 46   ? 14.586  -23.768 63.597  1.00 235.04 ? 46   LEU B N   1 
ATOM   7161  C  CA  . LEU B  2 46   ? 13.946  -24.952 64.161  1.00 256.89 ? 46   LEU B CA  1 
ATOM   7162  C  C   . LEU B  2 46   ? 14.972  -25.881 64.797  1.00 271.23 ? 46   LEU B C   1 
ATOM   7163  O  O   . LEU B  2 46   ? 14.745  -26.427 65.875  1.00 271.74 ? 46   LEU B O   1 
ATOM   7164  C  CB  . LEU B  2 46   ? 13.174  -25.706 63.077  1.00 240.29 ? 46   LEU B CB  1 
ATOM   7165  C  CG  . LEU B  2 46   ? 11.962  -24.978 62.493  1.00 223.55 ? 46   LEU B CG  1 
ATOM   7166  C  CD1 . LEU B  2 46   ? 11.309  -25.817 61.408  1.00 252.42 ? 46   LEU B CD1 1 
ATOM   7167  C  CD2 . LEU B  2 46   ? 10.961  -24.640 63.584  1.00 177.11 ? 46   LEU B CD2 1 
ATOM   7168  N  N   . LEU B  2 47   ? 16.101  -26.058 64.120  1.00 258.67 ? 47   LEU B N   1 
ATOM   7169  C  CA  . LEU B  2 47   ? 17.168  -26.909 64.627  1.00 260.16 ? 47   LEU B CA  1 
ATOM   7170  C  C   . LEU B  2 47   ? 17.840  -26.272 65.843  1.00 263.64 ? 47   LEU B C   1 
ATOM   7171  O  O   . LEU B  2 47   ? 18.266  -26.970 66.762  1.00 241.45 ? 47   LEU B O   1 
ATOM   7172  C  CB  . LEU B  2 47   ? 18.196  -27.169 63.526  1.00 252.65 ? 47   LEU B CB  1 
ATOM   7173  C  CG  . LEU B  2 47   ? 17.660  -27.904 62.295  1.00 223.62 ? 47   LEU B CG  1 
ATOM   7174  C  CD1 . LEU B  2 47   ? 18.716  -27.961 61.214  1.00 215.07 ? 47   LEU B CD1 1 
ATOM   7175  C  CD2 . LEU B  2 47   ? 17.202  -29.299 62.669  1.00 219.38 ? 47   LEU B CD2 1 
ATOM   7176  N  N   . MET B  2 48   ? 17.927  -24.945 65.843  1.00 287.01 ? 48   MET B N   1 
ATOM   7177  C  CA  . MET B  2 48   ? 18.531  -24.213 66.950  1.00 297.81 ? 48   MET B CA  1 
ATOM   7178  C  C   . MET B  2 48   ? 17.626  -24.263 68.173  1.00 325.21 ? 48   MET B C   1 
ATOM   7179  O  O   . MET B  2 48   ? 18.085  -24.105 69.304  1.00 368.75 ? 48   MET B O   1 
ATOM   7180  C  CB  . MET B  2 48   ? 18.785  -22.757 66.553  1.00 289.73 ? 48   MET B CB  1 
ATOM   7181  C  CG  . MET B  2 48   ? 19.349  -21.899 67.670  1.00 288.24 ? 48   MET B CG  1 
ATOM   7182  S  SD  . MET B  2 48   ? 19.708  -20.220 67.126  1.00 295.42 ? 48   MET B SD  1 
ATOM   7183  C  CE  . MET B  2 48   ? 21.122  -20.509 66.066  1.00 167.23 ? 48   MET B CE  1 
ATOM   7184  N  N   . ARG B  2 49   ? 16.338  -24.484 67.938  1.00 305.96 ? 49   ARG B N   1 
ATOM   7185  C  CA  . ARG B  2 49   ? 15.366  -24.561 69.020  1.00 297.50 ? 49   ARG B CA  1 
ATOM   7186  C  C   . ARG B  2 49   ? 15.265  -25.988 69.558  1.00 318.52 ? 49   ARG B C   1 
ATOM   7187  O  O   . ARG B  2 49   ? 14.909  -26.198 70.719  1.00 361.87 ? 49   ARG B O   1 
ATOM   7188  C  CB  . ARG B  2 49   ? 13.995  -24.072 68.542  1.00 268.49 ? 49   ARG B CB  1 
ATOM   7189  C  CG  . ARG B  2 49   ? 13.945  -22.587 68.208  1.00 252.58 ? 49   ARG B CG  1 
ATOM   7190  C  CD  . ARG B  2 49   ? 12.551  -22.154 67.781  1.00 258.68 ? 49   ARG B CD  1 
ATOM   7191  N  NE  . ARG B  2 49   ? 11.613  -22.137 68.901  1.00 283.85 ? 49   ARG B NE  1 
ATOM   7192  C  CZ  . ARG B  2 49   ? 11.440  -21.105 69.720  1.00 296.80 ? 49   ARG B CZ  1 
ATOM   7193  N  NH1 . ARG B  2 49   ? 12.141  -19.991 69.554  1.00 299.57 ? 49   ARG B NH1 1 
ATOM   7194  N  NH2 . ARG B  2 49   ? 10.563  -21.185 70.712  1.00 296.73 ? 49   ARG B NH2 1 
ATOM   7195  N  N   . GLY B  2 50   ? 15.584  -26.966 68.715  1.00 275.54 ? 50   GLY B N   1 
ATOM   7196  C  CA  . GLY B  2 50   ? 15.550  -28.359 69.123  1.00 267.18 ? 50   GLY B CA  1 
ATOM   7197  C  C   . GLY B  2 50   ? 14.726  -29.224 68.193  1.00 275.34 ? 50   GLY B C   1 
ATOM   7198  O  O   . GLY B  2 50   ? 14.890  -30.443 68.158  1.00 273.15 ? 50   GLY B O   1 
ATOM   7199  N  N   . CYS B  2 51   ? 13.830  -28.594 67.444  1.00 296.91 ? 51   CYS B N   1 
ATOM   7200  C  CA  . CYS B  2 51   ? 12.979  -29.314 66.510  1.00 306.87 ? 51   CYS B CA  1 
ATOM   7201  C  C   . CYS B  2 51   ? 13.806  -30.234 65.624  1.00 270.15 ? 51   CYS B C   1 
ATOM   7202  O  O   . CYS B  2 51   ? 14.691  -29.782 64.897  1.00 233.55 ? 51   CYS B O   1 
ATOM   7203  C  CB  . CYS B  2 51   ? 12.199  -28.335 65.640  1.00 337.91 ? 51   CYS B CB  1 
ATOM   7204  S  SG  . CYS B  2 51   ? 11.039  -29.143 64.525  1.00 286.97 ? 51   CYS B SG  1 
ATOM   7205  N  N   . ALA B  2 52   ? 13.508  -31.527 65.689  1.00 258.56 ? 52   ALA B N   1 
ATOM   7206  C  CA  . ALA B  2 52   ? 14.239  -32.522 64.917  1.00 255.55 ? 52   ALA B CA  1 
ATOM   7207  C  C   . ALA B  2 52   ? 14.232  -32.178 63.430  1.00 292.21 ? 52   ALA B C   1 
ATOM   7208  O  O   . ALA B  2 52   ? 13.385  -31.420 62.963  1.00 319.70 ? 52   ALA B O   1 
ATOM   7209  C  CB  . ALA B  2 52   ? 13.643  -33.899 65.147  1.00 205.05 ? 52   ALA B CB  1 
ATOM   7210  N  N   . ALA B  2 53   ? 15.187  -32.737 62.693  1.00 281.66 ? 53   ALA B N   1 
ATOM   7211  C  CA  . ALA B  2 53   ? 15.300  -32.485 61.263  1.00 244.48 ? 53   ALA B CA  1 
ATOM   7212  C  C   . ALA B  2 53   ? 14.222  -33.232 60.483  1.00 280.46 ? 53   ALA B C   1 
ATOM   7213  O  O   . ALA B  2 53   ? 13.646  -32.692 59.541  1.00 323.32 ? 53   ALA B O   1 
ATOM   7214  C  CB  . ALA B  2 53   ? 16.675  -32.886 60.768  1.00 214.24 ? 53   ALA B CB  1 
ATOM   7215  N  N   . ASP B  2 54   ? 13.950  -34.474 60.878  1.00 274.68 ? 54   ASP B N   1 
ATOM   7216  C  CA  . ASP B  2 54   ? 12.946  -35.293 60.200  1.00 268.91 ? 54   ASP B CA  1 
ATOM   7217  C  C   . ASP B  2 54   ? 11.528  -34.903 60.613  1.00 287.50 ? 54   ASP B C   1 
ATOM   7218  O  O   . ASP B  2 54   ? 10.556  -35.495 60.145  1.00 293.06 ? 54   ASP B O   1 
ATOM   7219  C  CB  . ASP B  2 54   ? 13.178  -36.779 60.481  1.00 256.30 ? 54   ASP B CB  1 
ATOM   7220  C  CG  . ASP B  2 54   ? 13.187  -37.099 61.959  1.00 316.99 ? 54   ASP B CG  1 
ATOM   7221  O  OD1 . ASP B  2 54   ? 12.771  -36.236 62.761  1.00 376.32 ? 54   ASP B OD1 1 
ATOM   7222  O  OD2 . ASP B  2 54   ? 13.609  -38.218 62.319  1.00 290.47 ? 54   ASP B OD2 1 
ATOM   7223  N  N   . ASP B  2 55   ? 11.417  -33.908 61.490  1.00 295.30 ? 55   ASP B N   1 
ATOM   7224  C  CA  . ASP B  2 55   ? 10.118  -33.404 61.928  1.00 273.25 ? 55   ASP B CA  1 
ATOM   7225  C  C   . ASP B  2 55   ? 9.737   -32.125 61.182  1.00 297.02 ? 55   ASP B C   1 
ATOM   7226  O  O   . ASP B  2 55   ? 8.688   -31.536 61.444  1.00 318.19 ? 55   ASP B O   1 
ATOM   7227  C  CB  . ASP B  2 55   ? 10.136  -33.134 63.436  1.00 237.97 ? 55   ASP B CB  1 
ATOM   7228  C  CG  . ASP B  2 55   ? 9.917   -34.386 64.256  1.00 250.28 ? 55   ASP B CG  1 
ATOM   7229  O  OD1 . ASP B  2 55   ? 9.151   -35.264 63.807  1.00 279.19 ? 55   ASP B OD1 1 
ATOM   7230  O  OD2 . ASP B  2 55   ? 10.504  -34.485 65.353  1.00 252.70 ? 55   ASP B OD2 1 
ATOM   7231  N  N   . ILE B  2 56   ? 10.585  -31.706 60.246  1.00 295.88 ? 56   ILE B N   1 
ATOM   7232  C  CA  . ILE B  2 56   ? 10.395  -30.439 59.544  1.00 280.55 ? 56   ILE B CA  1 
ATOM   7233  C  C   . ILE B  2 56   ? 9.683   -30.653 58.210  1.00 277.38 ? 56   ILE B C   1 
ATOM   7234  O  O   . ILE B  2 56   ? 10.298  -31.082 57.235  1.00 314.92 ? 56   ILE B O   1 
ATOM   7235  C  CB  . ILE B  2 56   ? 11.749  -29.730 59.303  1.00 295.57 ? 56   ILE B CB  1 
ATOM   7236  C  CG1 . ILE B  2 56   ? 12.429  -29.424 60.640  1.00 319.55 ? 56   ILE B CG1 1 
ATOM   7237  C  CG2 . ILE B  2 56   ? 11.549  -28.451 58.509  1.00 309.93 ? 56   ILE B CG2 1 
ATOM   7238  C  CD1 . ILE B  2 56   ? 13.778  -28.750 60.510  1.00 313.04 ? 56   ILE B CD1 1 
ATOM   7239  N  N   . MET B  2 57   ? 8.390   -30.339 58.169  1.00 175.88 ? 57   MET B N   1 
ATOM   7240  C  CA  . MET B  2 57   ? 7.583   -30.552 56.971  1.00 257.12 ? 57   MET B CA  1 
ATOM   7241  C  C   . MET B  2 57   ? 7.848   -29.445 55.949  1.00 341.85 ? 57   MET B C   1 
ATOM   7242  O  O   . MET B  2 57   ? 8.178   -28.315 56.310  1.00 362.80 ? 57   MET B O   1 
ATOM   7243  C  CB  . MET B  2 57   ? 6.094   -30.630 57.332  1.00 218.36 ? 57   MET B CB  1 
ATOM   7244  C  CG  . MET B  2 57   ? 5.762   -31.669 58.414  1.00 196.27 ? 57   MET B CG  1 
ATOM   7245  S  SD  . MET B  2 57   ? 5.679   -33.393 57.871  1.00 217.17 ? 57   MET B SD  1 
ATOM   7246  C  CE  . MET B  2 57   ? 7.385   -33.909 58.079  1.00 382.18 ? 57   MET B CE  1 
ATOM   7247  N  N   . ASP B  2 58   ? 7.692   -29.781 54.672  1.00 361.21 ? 58   ASP B N   1 
ATOM   7248  C  CA  . ASP B  2 58   ? 8.191   -28.949 53.582  1.00 305.06 ? 58   ASP B CA  1 
ATOM   7249  C  C   . ASP B  2 58   ? 7.675   -29.480 52.236  1.00 304.77 ? 58   ASP B C   1 
ATOM   7250  O  O   . ASP B  2 58   ? 8.456   -29.975 51.426  1.00 345.31 ? 58   ASP B O   1 
ATOM   7251  C  CB  . ASP B  2 58   ? 9.723   -28.991 53.600  1.00 219.21 ? 58   ASP B CB  1 
ATOM   7252  C  CG  . ASP B  2 58   ? 10.356  -27.695 53.150  1.00 244.55 ? 58   ASP B CG  1 
ATOM   7253  O  OD1 . ASP B  2 58   ? 9.658   -26.871 52.526  1.00 266.21 ? 58   ASP B OD1 1 
ATOM   7254  O  OD2 . ASP B  2 58   ? 11.562  -27.504 53.422  1.00 276.33 ? 58   ASP B OD2 1 
ATOM   7255  N  N   . PRO B  2 59   ? 6.350   -29.400 52.009  1.00 266.16 ? 59   PRO B N   1 
ATOM   7256  C  CA  . PRO B  2 59   ? 5.672   -29.890 50.796  1.00 248.97 ? 59   PRO B CA  1 
ATOM   7257  C  C   . PRO B  2 59   ? 6.036   -29.115 49.529  1.00 263.98 ? 59   PRO B C   1 
ATOM   7258  O  O   . PRO B  2 59   ? 5.782   -27.916 49.429  1.00 289.39 ? 59   PRO B O   1 
ATOM   7259  C  CB  . PRO B  2 59   ? 4.186   -29.735 51.140  1.00 228.32 ? 59   PRO B CB  1 
ATOM   7260  C  CG  . PRO B  2 59   ? 4.150   -29.721 52.641  1.00 257.58 ? 59   PRO B CG  1 
ATOM   7261  C  CD  . PRO B  2 59   ? 5.386   -28.997 53.045  1.00 265.76 ? 59   PRO B CD  1 
ATOM   7262  N  N   . THR B  2 60   ? 6.581   -29.828 48.547  1.00 244.60 ? 60   THR B N   1 
ATOM   7263  C  CA  . THR B  2 60   ? 7.335   -29.198 47.471  1.00 261.22 ? 60   THR B CA  1 
ATOM   7264  C  C   . THR B  2 60   ? 6.797   -29.518 46.075  1.00 263.80 ? 60   THR B C   1 
ATOM   7265  O  O   . THR B  2 60   ? 6.181   -30.560 45.857  1.00 296.46 ? 60   THR B O   1 
ATOM   7266  C  CB  . THR B  2 60   ? 8.811   -29.632 47.557  1.00 247.55 ? 60   THR B CB  1 
ATOM   7267  O  OG1 . THR B  2 60   ? 9.308   -29.376 48.877  1.00 305.81 ? 60   THR B OG1 1 
ATOM   7268  C  CG2 . THR B  2 60   ? 9.657   -28.882 46.553  1.00 172.57 ? 60   THR B CG2 1 
ATOM   7269  N  N   . SER B  2 61   ? 7.047   -28.616 45.130  1.00 227.14 ? 61   SER B N   1 
ATOM   7270  C  CA  . SER B  2 61   ? 6.559   -28.774 43.765  1.00 209.74 ? 61   SER B CA  1 
ATOM   7271  C  C   . SER B  2 61   ? 7.466   -29.701 42.969  1.00 217.08 ? 61   SER B C   1 
ATOM   7272  O  O   . SER B  2 61   ? 8.687   -29.634 43.088  1.00 228.78 ? 61   SER B O   1 
ATOM   7273  C  CB  . SER B  2 61   ? 6.494   -27.415 43.069  1.00 193.74 ? 61   SER B CB  1 
ATOM   7274  O  OG  . SER B  2 61   ? 5.879   -26.440 43.894  1.00 142.50 ? 61   SER B OG  1 
ATOM   7275  N  N   . LEU B  2 62   ? 6.867   -30.566 42.157  1.00 216.73 ? 62   LEU B N   1 
ATOM   7276  C  CA  . LEU B  2 62   ? 7.631   -31.431 41.261  1.00 251.09 ? 62   LEU B CA  1 
ATOM   7277  C  C   . LEU B  2 62   ? 6.827   -31.754 40.001  1.00 260.20 ? 62   LEU B C   1 
ATOM   7278  O  O   . LEU B  2 62   ? 5.681   -31.330 39.866  1.00 263.75 ? 62   LEU B O   1 
ATOM   7279  C  CB  . LEU B  2 62   ? 8.063   -32.706 41.984  1.00 258.51 ? 62   LEU B CB  1 
ATOM   7280  C  CG  . LEU B  2 62   ? 6.959   -33.478 42.696  1.00 275.99 ? 62   LEU B CG  1 
ATOM   7281  C  CD1 . LEU B  2 62   ? 6.576   -34.696 41.882  1.00 345.27 ? 62   LEU B CD1 1 
ATOM   7282  C  CD2 . LEU B  2 62   ? 7.422   -33.890 44.079  1.00 267.61 ? 62   LEU B CD2 1 
ATOM   7283  N  N   . ALA B  2 63   ? 7.431   -32.502 39.082  1.00 253.86 ? 63   ALA B N   1 
ATOM   7284  C  CA  . ALA B  2 63   ? 6.845   -32.702 37.761  1.00 220.61 ? 63   ALA B CA  1 
ATOM   7285  C  C   . ALA B  2 63   ? 6.686   -34.175 37.412  1.00 229.89 ? 63   ALA B C   1 
ATOM   7286  O  O   . ALA B  2 63   ? 7.553   -34.994 37.708  1.00 245.26 ? 63   ALA B O   1 
ATOM   7287  C  CB  . ALA B  2 63   ? 7.694   -32.010 36.712  1.00 228.57 ? 63   ALA B CB  1 
ATOM   7288  N  N   . GLU B  2 64   ? 5.571   -34.499 36.768  1.00 228.05 ? 64   GLU B N   1 
ATOM   7289  C  CA  . GLU B  2 64   ? 5.295   -35.863 36.345  1.00 262.14 ? 64   GLU B CA  1 
ATOM   7290  C  C   . GLU B  2 64   ? 5.433   -35.970 34.836  1.00 275.67 ? 64   GLU B C   1 
ATOM   7291  O  O   . GLU B  2 64   ? 4.630   -35.411 34.092  1.00 286.18 ? 64   GLU B O   1 
ATOM   7292  C  CB  . GLU B  2 64   ? 3.883   -36.267 36.763  1.00 280.61 ? 64   GLU B CB  1 
ATOM   7293  C  CG  . GLU B  2 64   ? 3.552   -37.729 36.513  1.00 301.25 ? 64   GLU B CG  1 
ATOM   7294  C  CD  . GLU B  2 64   ? 2.155   -38.091 36.972  1.00 299.46 ? 64   GLU B CD  1 
ATOM   7295  O  OE1 . GLU B  2 64   ? 1.485   -37.220 37.567  1.00 288.76 ? 64   GLU B OE1 1 
ATOM   7296  O  OE2 . GLU B  2 64   ? 1.729   -39.242 36.741  1.00 292.68 ? 64   GLU B OE2 1 
ATOM   7297  N  N   . THR B  2 65   ? 6.456   -36.689 34.387  1.00 275.75 ? 65   THR B N   1 
ATOM   7298  C  CA  . THR B  2 65   ? 6.717   -36.832 32.960  1.00 291.01 ? 65   THR B CA  1 
ATOM   7299  C  C   . THR B  2 65   ? 6.213   -38.168 32.409  1.00 326.29 ? 65   THR B C   1 
ATOM   7300  O  O   . THR B  2 65   ? 6.987   -39.110 32.232  1.00 372.80 ? 65   THR B O   1 
ATOM   7301  C  CB  . THR B  2 65   ? 8.221   -36.699 32.663  1.00 266.52 ? 65   THR B CB  1 
ATOM   7302  O  OG1 . THR B  2 65   ? 8.964   -37.539 33.555  1.00 273.52 ? 65   THR B OG1 1 
ATOM   7303  C  CG2 . THR B  2 65   ? 8.672   -35.256 32.840  1.00 226.72 ? 65   THR B CG2 1 
ATOM   7304  N  N   . GLN B  2 66   ? 4.912   -38.241 32.136  1.00 306.33 ? 66   GLN B N   1 
ATOM   7305  C  CA  . GLN B  2 66   ? 4.316   -39.430 31.531  1.00 304.28 ? 66   GLN B CA  1 
ATOM   7306  C  C   . GLN B  2 66   ? 4.572   -39.465 30.030  1.00 318.85 ? 66   GLN B C   1 
ATOM   7307  O  O   . GLN B  2 66   ? 3.744   -39.014 29.238  1.00 287.71 ? 66   GLN B O   1 
ATOM   7308  C  CB  . GLN B  2 66   ? 2.812   -39.467 31.794  1.00 277.28 ? 66   GLN B CB  1 
ATOM   7309  C  CG  . GLN B  2 66   ? 2.456   -39.642 33.248  1.00 278.72 ? 66   GLN B CG  1 
ATOM   7310  C  CD  . GLN B  2 66   ? 3.003   -40.925 33.819  1.00 304.98 ? 66   GLN B CD  1 
ATOM   7311  O  OE1 . GLN B  2 66   ? 2.993   -41.970 33.167  1.00 318.67 ? 66   GLN B OE1 1 
ATOM   7312  N  NE2 . GLN B  2 66   ? 3.478   -40.857 35.048  1.00 300.31 ? 66   GLN B NE2 1 
ATOM   7313  N  N   . GLU B  2 67   ? 5.721   -40.012 29.648  1.00 346.49 ? 67   GLU B N   1 
ATOM   7314  C  CA  . GLU B  2 67   ? 6.114   -40.073 28.248  1.00 350.63 ? 67   GLU B CA  1 
ATOM   7315  C  C   . GLU B  2 67   ? 5.290   -41.109 27.494  1.00 356.17 ? 67   GLU B C   1 
ATOM   7316  O  O   . GLU B  2 67   ? 4.901   -42.134 28.053  1.00 398.77 ? 67   GLU B O   1 
ATOM   7317  C  CB  . GLU B  2 67   ? 7.599   -40.405 28.134  1.00 328.56 ? 67   GLU B CB  1 
ATOM   7318  C  CG  . GLU B  2 67   ? 8.505   -39.387 28.796  1.00 334.54 ? 67   GLU B CG  1 
ATOM   7319  C  CD  . GLU B  2 67   ? 9.963   -39.784 28.730  1.00 332.61 ? 67   GLU B CD  1 
ATOM   7320  O  OE1 . GLU B  2 67   ? 10.254  -40.912 28.280  1.00 368.90 ? 67   GLU B OE1 1 
ATOM   7321  O  OE2 . GLU B  2 67   ? 10.820  -38.970 29.130  1.00 300.70 ? 67   GLU B OE2 1 
ATOM   7322  N  N   . ASP B  2 68   ? 5.031   -40.832 26.220  1.00 320.20 ? 68   ASP B N   1 
ATOM   7323  C  CA  . ASP B  2 68   ? 4.220   -41.715 25.390  1.00 293.97 ? 68   ASP B CA  1 
ATOM   7324  C  C   . ASP B  2 68   ? 5.043   -42.860 24.807  1.00 311.35 ? 68   ASP B C   1 
ATOM   7325  O  O   . ASP B  2 68   ? 6.245   -42.951 25.047  1.00 328.25 ? 68   ASP B O   1 
ATOM   7326  C  CB  . ASP B  2 68   ? 3.564   -40.928 24.254  1.00 283.76 ? 68   ASP B CB  1 
ATOM   7327  C  CG  . ASP B  2 68   ? 2.742   -39.750 24.752  1.00 278.28 ? 68   ASP B CG  1 
ATOM   7328  O  OD1 . ASP B  2 68   ? 2.541   -39.629 25.979  1.00 270.75 ? 68   ASP B OD1 1 
ATOM   7329  O  OD2 . ASP B  2 68   ? 2.296   -38.943 23.910  1.00 286.82 ? 68   ASP B OD2 1 
ATOM   7330  N  N   . HIS B  2 69   ? 4.389   -43.732 24.041  1.00 312.77 ? 69   HIS B N   1 
ATOM   7331  C  CA  . HIS B  2 69   ? 5.074   -44.847 23.393  1.00 299.41 ? 69   HIS B CA  1 
ATOM   7332  C  C   . HIS B  2 69   ? 5.942   -44.294 22.268  1.00 334.97 ? 69   HIS B C   1 
ATOM   7333  O  O   . HIS B  2 69   ? 7.136   -44.064 22.450  1.00 376.39 ? 69   HIS B O   1 
ATOM   7334  C  CB  . HIS B  2 69   ? 4.073   -45.865 22.837  1.00 268.72 ? 69   HIS B CB  1 
ATOM   7335  C  CG  . HIS B  2 69   ? 2.952   -46.200 23.772  1.00 304.59 ? 69   HIS B CG  1 
ATOM   7336  N  ND1 . HIS B  2 69   ? 1.837   -45.403 23.911  1.00 324.99 ? 69   HIS B ND1 1 
ATOM   7337  C  CD2 . HIS B  2 69   ? 2.757   -47.262 24.592  1.00 309.83 ? 69   HIS B CD2 1 
ATOM   7338  C  CE1 . HIS B  2 69   ? 1.005   -45.955 24.777  1.00 313.82 ? 69   HIS B CE1 1 
ATOM   7339  N  NE2 . HIS B  2 69   ? 1.546   -47.078 25.212  1.00 313.35 ? 69   HIS B NE2 1 
ATOM   7340  N  N   . ASN B  2 70   ? 5.338   -44.085 21.104  1.00 333.71 ? 70   ASN B N   1 
ATOM   7341  C  CA  . ASN B  2 70   ? 5.996   -43.365 20.023  1.00 339.80 ? 70   ASN B CA  1 
ATOM   7342  C  C   . ASN B  2 70   ? 5.041   -43.129 18.860  1.00 341.03 ? 70   ASN B C   1 
ATOM   7343  O  O   . ASN B  2 70   ? 4.109   -43.900 18.642  1.00 345.29 ? 70   ASN B O   1 
ATOM   7344  C  CB  . ASN B  2 70   ? 7.243   -44.105 19.540  1.00 335.74 ? 70   ASN B CB  1 
ATOM   7345  C  CG  . ASN B  2 70   ? 8.255   -43.173 18.910  1.00 336.42 ? 70   ASN B CG  1 
ATOM   7346  O  OD1 . ASN B  2 70   ? 8.128   -41.953 19.004  1.00 341.74 ? 70   ASN B OD1 1 
ATOM   7347  N  ND2 . ASN B  2 70   ? 9.267   -43.739 18.268  1.00 331.90 ? 70   ASN B ND2 1 
ATOM   7348  N  N   . GLY B  2 71   ? 5.274   -42.053 18.118  1.00 322.41 ? 71   GLY B N   1 
ATOM   7349  C  CA  . GLY B  2 71   ? 4.355   -41.639 17.076  1.00 324.20 ? 71   GLY B CA  1 
ATOM   7350  C  C   . GLY B  2 71   ? 3.151   -40.952 17.683  1.00 340.82 ? 71   GLY B C   1 
ATOM   7351  O  O   . GLY B  2 71   ? 2.330   -40.382 16.969  1.00 348.41 ? 71   GLY B O   1 
ATOM   7352  N  N   . GLY B  2 72   ? 3.035   -41.024 19.005  1.00 363.60 ? 72   GLY B N   1 
ATOM   7353  C  CA  . GLY B  2 72   ? 2.080   -40.208 19.726  1.00 378.79 ? 72   GLY B CA  1 
ATOM   7354  C  C   . GLY B  2 72   ? 2.298   -38.772 19.303  1.00 377.34 ? 72   GLY B C   1 
ATOM   7355  O  O   . GLY B  2 72   ? 1.422   -38.149 18.712  1.00 381.29 ? 72   GLY B O   1 
ATOM   7356  N  N   . GLN B  2 73   ? 3.478   -38.246 19.611  1.00 379.35 ? 73   GLN B N   1 
ATOM   7357  C  CA  . GLN B  2 73   ? 3.947   -37.018 18.979  1.00 361.66 ? 73   GLN B CA  1 
ATOM   7358  C  C   . GLN B  2 73   ? 5.429   -37.144 18.679  1.00 360.10 ? 73   GLN B C   1 
ATOM   7359  O  O   . GLN B  2 73   ? 6.106   -38.032 19.195  1.00 376.37 ? 73   GLN B O   1 
ATOM   7360  C  CB  . GLN B  2 73   ? 3.640   -35.776 19.816  1.00 313.11 ? 73   GLN B CB  1 
ATOM   7361  C  CG  . GLN B  2 73   ? 2.158   -35.538 19.985  1.00 302.65 ? 73   GLN B CG  1 
ATOM   7362  C  CD  . GLN B  2 73   ? 1.837   -34.140 20.460  1.00 287.89 ? 73   GLN B CD  1 
ATOM   7363  O  OE1 . GLN B  2 73   ? 2.708   -33.413 20.938  1.00 259.54 ? 73   GLN B OE1 1 
ATOM   7364  N  NE2 . GLN B  2 73   ? 0.575   -33.754 20.327  1.00 321.15 ? 73   GLN B NE2 1 
ATOM   7365  N  N   . LYS B  2 74   ? 5.929   -36.239 17.852  1.00 329.70 ? 74   LYS B N   1 
ATOM   7366  C  CA  . LYS B  2 74   ? 7.140   -36.506 17.100  1.00 320.36 ? 74   LYS B CA  1 
ATOM   7367  C  C   . LYS B  2 74   ? 8.404   -35.960 17.732  1.00 331.73 ? 74   LYS B C   1 
ATOM   7368  O  O   . LYS B  2 74   ? 9.351   -36.704 17.977  1.00 367.38 ? 74   LYS B O   1 
ATOM   7369  C  CB  . LYS B  2 74   ? 6.983   -35.938 15.698  1.00 305.78 ? 74   LYS B CB  1 
ATOM   7370  C  CG  . LYS B  2 74   ? 5.703   -36.393 15.026  1.00 286.73 ? 74   LYS B CG  1 
ATOM   7371  C  CD  . LYS B  2 74   ? 5.878   -36.533 13.534  1.00 304.06 ? 74   LYS B CD  1 
ATOM   7372  C  CE  . LYS B  2 74   ? 4.842   -37.464 12.944  1.00 300.31 ? 74   LYS B CE  1 
ATOM   7373  N  NZ  . LYS B  2 74   ? 4.619   -37.187 11.504  1.00 314.07 ? 74   LYS B NZ  1 
ATOM   7374  N  N   . GLN B  2 75   ? 8.429   -34.660 17.984  1.00 285.30 ? 75   GLN B N   1 
ATOM   7375  C  CA  . GLN B  2 75   ? 9.632   -34.033 18.499  1.00 270.86 ? 75   GLN B CA  1 
ATOM   7376  C  C   . GLN B  2 75   ? 9.317   -33.027 19.595  1.00 272.99 ? 75   GLN B C   1 
ATOM   7377  O  O   . GLN B  2 75   ? 10.144  -32.183 19.923  1.00 268.09 ? 75   GLN B O   1 
ATOM   7378  C  CB  . GLN B  2 75   ? 10.411  -33.370 17.362  1.00 242.56 ? 75   GLN B CB  1 
ATOM   7379  C  CG  . GLN B  2 75   ? 11.027  -34.362 16.387  1.00 269.26 ? 75   GLN B CG  1 
ATOM   7380  C  CD  . GLN B  2 75   ? 11.961  -35.345 17.069  1.00 299.02 ? 75   GLN B CD  1 
ATOM   7381  O  OE1 . GLN B  2 75   ? 12.396  -35.123 18.197  1.00 310.41 ? 75   GLN B OE1 1 
ATOM   7382  N  NE2 . GLN B  2 75   ? 12.283  -36.432 16.381  1.00 322.17 ? 75   GLN B NE2 1 
ATOM   7383  N  N   . LEU B  2 76   ? 8.121   -33.121 20.162  1.00 282.28 ? 76   LEU B N   1 
ATOM   7384  C  CA  . LEU B  2 76   ? 7.791   -32.346 21.350  1.00 308.48 ? 76   LEU B CA  1 
ATOM   7385  C  C   . LEU B  2 76   ? 7.498   -33.287 22.516  1.00 290.45 ? 76   LEU B C   1 
ATOM   7386  O  O   . LEU B  2 76   ? 6.377   -33.772 22.675  1.00 260.59 ? 76   LEU B O   1 
ATOM   7387  C  CB  . LEU B  2 76   ? 6.602   -31.416 21.093  1.00 309.72 ? 76   LEU B CB  1 
ATOM   7388  C  CG  . LEU B  2 76   ? 6.922   -30.017 20.553  1.00 278.74 ? 76   LEU B CG  1 
ATOM   7389  C  CD1 . LEU B  2 76   ? 5.646   -29.209 20.387  1.00 262.09 ? 76   LEU B CD1 1 
ATOM   7390  C  CD2 . LEU B  2 76   ? 7.893   -29.275 21.463  1.00 272.28 ? 76   LEU B CD2 1 
ATOM   7391  N  N   . SER B  2 77   ? 8.526   -33.550 23.318  1.00 274.89 ? 77   SER B N   1 
ATOM   7392  C  CA  . SER B  2 77   ? 8.394   -34.384 24.505  1.00 260.80 ? 77   SER B CA  1 
ATOM   7393  C  C   . SER B  2 77   ? 8.966   -33.657 25.717  1.00 272.13 ? 77   SER B C   1 
ATOM   7394  O  O   . SER B  2 77   ? 9.881   -32.850 25.576  1.00 276.27 ? 77   SER B O   1 
ATOM   7395  C  CB  . SER B  2 77   ? 9.134   -35.701 24.308  1.00 279.05 ? 77   SER B CB  1 
ATOM   7396  O  OG  . SER B  2 77   ? 10.498  -35.465 24.010  1.00 298.67 ? 77   SER B OG  1 
ATOM   7397  N  N   . PRO B  2 78   ? 8.439   -33.950 26.917  1.00 276.86 ? 78   PRO B N   1 
ATOM   7398  C  CA  . PRO B  2 78   ? 7.379   -34.941 27.136  1.00 281.48 ? 78   PRO B CA  1 
ATOM   7399  C  C   . PRO B  2 78   ? 6.055   -34.517 26.510  1.00 303.17 ? 78   PRO B C   1 
ATOM   7400  O  O   . PRO B  2 78   ? 5.923   -33.385 26.047  1.00 352.16 ? 78   PRO B O   1 
ATOM   7401  C  CB  . PRO B  2 78   ? 7.262   -35.008 28.664  1.00 274.80 ? 78   PRO B CB  1 
ATOM   7402  C  CG  . PRO B  2 78   ? 7.844   -33.739 29.171  1.00 277.53 ? 78   PRO B CG  1 
ATOM   7403  C  CD  . PRO B  2 78   ? 8.851   -33.279 28.164  1.00 273.07 ? 78   PRO B CD  1 
ATOM   7404  N  N   . GLN B  2 79   ? 5.086   -35.424 26.499  1.00 284.34 ? 79   GLN B N   1 
ATOM   7405  C  CA  . GLN B  2 79   ? 3.805   -35.165 25.855  1.00 276.42 ? 79   GLN B CA  1 
ATOM   7406  C  C   . GLN B  2 79   ? 2.713   -34.846 26.879  1.00 276.52 ? 79   GLN B C   1 
ATOM   7407  O  O   . GLN B  2 79   ? 1.679   -34.270 26.537  1.00 249.88 ? 79   GLN B O   1 
ATOM   7408  C  CB  . GLN B  2 79   ? 3.394   -36.365 24.998  1.00 262.43 ? 79   GLN B CB  1 
ATOM   7409  C  CG  . GLN B  2 79   ? 4.322   -36.637 23.816  1.00 215.16 ? 79   GLN B CG  1 
ATOM   7410  C  CD  . GLN B  2 79   ? 5.580   -37.380 24.214  1.00 252.64 ? 79   GLN B CD  1 
ATOM   7411  O  OE1 . GLN B  2 79   ? 5.745   -37.774 25.366  1.00 298.59 ? 79   GLN B OE1 1 
ATOM   7412  N  NE2 . GLN B  2 79   ? 6.473   -37.583 23.256  1.00 263.37 ? 79   GLN B NE2 1 
ATOM   7413  N  N   . LYS B  2 80   ? 2.947   -35.216 28.134  1.00 290.54 ? 80   LYS B N   1 
ATOM   7414  C  CA  . LYS B  2 80   ? 1.974   -34.979 29.191  1.00 278.31 ? 80   LYS B CA  1 
ATOM   7415  C  C   . LYS B  2 80   ? 2.678   -34.674 30.510  1.00 276.21 ? 80   LYS B C   1 
ATOM   7416  O  O   . LYS B  2 80   ? 3.257   -35.565 31.130  1.00 276.85 ? 80   LYS B O   1 
ATOM   7417  C  CB  . LYS B  2 80   ? 1.066   -36.201 29.354  1.00 263.40 ? 80   LYS B CB  1 
ATOM   7418  C  CG  . LYS B  2 80   ? 0.414   -36.665 28.067  1.00 240.27 ? 80   LYS B CG  1 
ATOM   7419  C  CD  . LYS B  2 80   ? -0.451  -37.883 28.304  1.00 249.64 ? 80   LYS B CD  1 
ATOM   7420  C  CE  . LYS B  2 80   ? -0.911  -38.470 27.000  1.00 262.79 ? 80   LYS B CE  1 
ATOM   7421  N  NZ  . LYS B  2 80   ? -1.890  -39.557 27.157  1.00 267.69 ? 80   LYS B NZ  1 
ATOM   7422  N  N   . VAL B  2 81   ? 2.626   -33.414 30.935  1.00 269.56 ? 81   VAL B N   1 
ATOM   7423  C  CA  . VAL B  2 81   ? 3.261   -33.001 32.184  1.00 282.21 ? 81   VAL B CA  1 
ATOM   7424  C  C   . VAL B  2 81   ? 2.222   -32.720 33.265  1.00 302.43 ? 81   VAL B C   1 
ATOM   7425  O  O   . VAL B  2 81   ? 1.556   -31.684 33.248  1.00 309.04 ? 81   VAL B O   1 
ATOM   7426  C  CB  . VAL B  2 81   ? 4.124   -31.740 31.991  1.00 236.06 ? 81   VAL B CB  1 
ATOM   7427  C  CG1 . VAL B  2 81   ? 4.777   -31.336 33.304  1.00 244.18 ? 81   VAL B CG1 1 
ATOM   7428  C  CG2 . VAL B  2 81   ? 5.176   -31.977 30.926  1.00 171.78 ? 81   VAL B CG2 1 
ATOM   7429  N  N   . THR B  2 82   ? 2.087   -33.651 34.203  1.00 305.93 ? 82   THR B N   1 
ATOM   7430  C  CA  . THR B  2 82   ? 1.173   -33.485 35.325  1.00 289.61 ? 82   THR B CA  1 
ATOM   7431  C  C   . THR B  2 82   ? 1.926   -32.916 36.518  1.00 263.26 ? 82   THR B C   1 
ATOM   7432  O  O   . THR B  2 82   ? 2.444   -33.661 37.349  1.00 353.02 ? 82   THR B O   1 
ATOM   7433  C  CB  . THR B  2 82   ? 0.531   -34.823 35.728  1.00 322.54 ? 82   THR B CB  1 
ATOM   7434  O  OG1 . THR B  2 82   ? -0.218  -35.346 34.624  1.00 341.67 ? 82   THR B OG1 1 
ATOM   7435  C  CG2 . THR B  2 82   ? -0.393  -34.643 36.925  1.00 339.57 ? 82   THR B CG2 1 
ATOM   7436  N  N   . LEU B  2 83   ? 1.988   -31.592 36.595  1.00 231.92 ? 83   LEU B N   1 
ATOM   7437  C  CA  . LEU B  2 83   ? 2.706   -30.925 37.674  1.00 251.62 ? 83   LEU B CA  1 
ATOM   7438  C  C   . LEU B  2 83   ? 1.852   -30.826 38.933  1.00 291.47 ? 83   LEU B C   1 
ATOM   7439  O  O   . LEU B  2 83   ? 0.629   -30.707 38.862  1.00 313.01 ? 83   LEU B O   1 
ATOM   7440  C  CB  . LEU B  2 83   ? 3.153   -29.529 37.237  1.00 221.12 ? 83   LEU B CB  1 
ATOM   7441  C  CG  . LEU B  2 83   ? 2.055   -28.571 36.770  1.00 223.46 ? 83   LEU B CG  1 
ATOM   7442  C  CD1 . LEU B  2 83   ? 1.337   -27.919 37.934  1.00 208.42 ? 83   LEU B CD1 1 
ATOM   7443  C  CD2 . LEU B  2 83   ? 2.663   -27.512 35.884  1.00 235.24 ? 83   LEU B CD2 1 
ATOM   7444  N  N   . TYR B  2 84   ? 2.514   -30.895 40.085  1.00 277.03 ? 84   TYR B N   1 
ATOM   7445  C  CA  . TYR B  2 84   ? 1.869   -30.673 41.373  1.00 224.66 ? 84   TYR B CA  1 
ATOM   7446  C  C   . TYR B  2 84   ? 2.445   -29.394 41.959  1.00 200.53 ? 84   TYR B C   1 
ATOM   7447  O  O   . TYR B  2 84   ? 3.501   -29.398 42.593  1.00 154.38 ? 84   TYR B O   1 
ATOM   7448  C  CB  . TYR B  2 84   ? 2.110   -31.852 42.315  1.00 208.30 ? 84   TYR B CB  1 
ATOM   7449  C  CG  . TYR B  2 84   ? 1.480   -33.145 41.845  1.00 258.52 ? 84   TYR B CG  1 
ATOM   7450  C  CD1 . TYR B  2 84   ? 1.774   -33.668 40.592  1.00 339.75 ? 84   TYR B CD1 1 
ATOM   7451  C  CD2 . TYR B  2 84   ? 0.597   -33.847 42.656  1.00 248.40 ? 84   TYR B CD2 1 
ATOM   7452  C  CE1 . TYR B  2 84   ? 1.203   -34.849 40.158  1.00 341.86 ? 84   TYR B CE1 1 
ATOM   7453  C  CE2 . TYR B  2 84   ? 0.022   -35.029 42.231  1.00 270.01 ? 84   TYR B CE2 1 
ATOM   7454  C  CZ  . TYR B  2 84   ? 0.328   -35.524 40.983  1.00 290.94 ? 84   TYR B CZ  1 
ATOM   7455  O  OH  . TYR B  2 84   ? -0.242  -36.701 40.559  1.00 250.96 ? 84   TYR B OH  1 
ATOM   7456  N  N   . LEU B  2 85   ? 1.740   -28.295 41.729  1.00 216.01 ? 85   LEU B N   1 
ATOM   7457  C  CA  . LEU B  2 85   ? 2.281   -26.974 41.990  1.00 240.02 ? 85   LEU B CA  1 
ATOM   7458  C  C   . LEU B  2 85   ? 1.793   -26.398 43.315  1.00 193.94 ? 85   LEU B C   1 
ATOM   7459  O  O   . LEU B  2 85   ? 0.597   -26.188 43.520  1.00 125.72 ? 85   LEU B O   1 
ATOM   7460  C  CB  . LEU B  2 85   ? 1.915   -26.036 40.837  1.00 267.51 ? 85   LEU B CB  1 
ATOM   7461  C  CG  . LEU B  2 85   ? 2.249   -24.557 41.021  1.00 240.34 ? 85   LEU B CG  1 
ATOM   7462  C  CD1 . LEU B  2 85   ? 3.722   -24.376 41.335  1.00 214.78 ? 85   LEU B CD1 1 
ATOM   7463  C  CD2 . LEU B  2 85   ? 1.858   -23.772 39.780  1.00 185.39 ? 85   LEU B CD2 1 
ATOM   7464  N  N   . ARG B  2 86   ? 2.733   -26.156 44.222  1.00 188.31 ? 86   ARG B N   1 
ATOM   7465  C  CA  . ARG B  2 86   ? 2.440   -25.410 45.439  1.00 215.70 ? 86   ARG B CA  1 
ATOM   7466  C  C   . ARG B  2 86   ? 2.621   -23.926 45.166  1.00 239.49 ? 86   ARG B C   1 
ATOM   7467  O  O   . ARG B  2 86   ? 3.621   -23.524 44.570  1.00 186.61 ? 86   ARG B O   1 
ATOM   7468  C  CB  . ARG B  2 86   ? 3.368   -25.833 46.578  1.00 215.48 ? 86   ARG B CB  1 
ATOM   7469  C  CG  . ARG B  2 86   ? 3.344   -24.889 47.774  1.00 201.63 ? 86   ARG B CG  1 
ATOM   7470  C  CD  . ARG B  2 86   ? 4.256   -25.370 48.884  1.00 194.73 ? 86   ARG B CD  1 
ATOM   7471  N  NE  . ARG B  2 86   ? 4.472   -24.346 49.898  1.00 258.21 ? 86   ARG B NE  1 
ATOM   7472  C  CZ  . ARG B  2 86   ? 5.077   -24.559 51.061  1.00 285.74 ? 86   ARG B CZ  1 
ATOM   7473  N  NH1 . ARG B  2 86   ? 5.427   -25.792 51.408  1.00 291.95 ? 86   ARG B NH1 1 
ATOM   7474  N  NH2 . ARG B  2 86   ? 5.240   -23.555 51.932  1.00 281.84 ? 86   ARG B NH2 1 
ATOM   7475  N  N   . PRO B  2 87   ? 1.657   -23.105 45.612  1.00 274.01 ? 87   PRO B N   1 
ATOM   7476  C  CA  . PRO B  2 87   ? 1.723   -21.654 45.408  1.00 251.38 ? 87   PRO B CA  1 
ATOM   7477  C  C   . PRO B  2 87   ? 3.042   -21.064 45.895  1.00 225.26 ? 87   PRO B C   1 
ATOM   7478  O  O   . PRO B  2 87   ? 3.539   -21.459 46.949  1.00 131.55 ? 87   PRO B O   1 
ATOM   7479  C  CB  . PRO B  2 87   ? 0.552   -21.126 46.247  1.00 211.28 ? 87   PRO B CB  1 
ATOM   7480  C  CG  . PRO B  2 87   ? -0.404  -22.263 46.321  1.00 215.21 ? 87   PRO B CG  1 
ATOM   7481  C  CD  . PRO B  2 87   ? 0.438   -23.506 46.336  1.00 256.07 ? 87   PRO B CD  1 
ATOM   7482  N  N   . GLY B  2 88   ? 3.605   -20.142 45.121  1.00 239.78 ? 88   GLY B N   1 
ATOM   7483  C  CA  . GLY B  2 88   ? 4.837   -19.474 45.497  1.00 220.94 ? 88   GLY B CA  1 
ATOM   7484  C  C   . GLY B  2 88   ? 6.071   -20.259 45.099  1.00 208.34 ? 88   GLY B C   1 
ATOM   7485  O  O   . GLY B  2 88   ? 7.132   -19.683 44.866  1.00 195.87 ? 88   GLY B O   1 
ATOM   7486  N  N   . GLN B  2 89   ? 5.930   -21.579 45.021  1.00 222.61 ? 89   GLN B N   1 
ATOM   7487  C  CA  . GLN B  2 89   ? 7.048   -22.450 44.687  1.00 229.97 ? 89   GLN B CA  1 
ATOM   7488  C  C   . GLN B  2 89   ? 6.967   -22.888 43.237  1.00 244.98 ? 89   GLN B C   1 
ATOM   7489  O  O   . GLN B  2 89   ? 5.923   -23.346 42.777  1.00 253.30 ? 89   GLN B O   1 
ATOM   7490  C  CB  . GLN B  2 89   ? 7.047   -23.679 45.584  1.00 201.45 ? 89   GLN B CB  1 
ATOM   7491  C  CG  . GLN B  2 89   ? 8.411   -24.301 45.756  1.00 198.89 ? 89   GLN B CG  1 
ATOM   7492  C  CD  . GLN B  2 89   ? 8.419   -25.348 46.835  1.00 232.38 ? 89   GLN B CD  1 
ATOM   7493  O  OE1 . GLN B  2 89   ? 7.436   -26.060 47.024  1.00 251.67 ? 89   GLN B OE1 1 
ATOM   7494  N  NE2 . GLN B  2 89   ? 9.525   -25.442 47.563  1.00 266.19 ? 89   GLN B NE2 1 
ATOM   7495  N  N   . ALA B  2 90   ? 8.080   -22.761 42.525  1.00 237.71 ? 90   ALA B N   1 
ATOM   7496  C  CA  . ALA B  2 90   ? 8.101   -23.022 41.093  1.00 221.15 ? 90   ALA B CA  1 
ATOM   7497  C  C   . ALA B  2 90   ? 8.363   -24.500 40.794  1.00 240.17 ? 90   ALA B C   1 
ATOM   7498  O  O   . ALA B  2 90   ? 9.214   -25.125 41.424  1.00 234.45 ? 90   ALA B O   1 
ATOM   7499  C  CB  . ALA B  2 90   ? 9.148   -22.143 40.424  1.00 190.09 ? 90   ALA B CB  1 
ATOM   7500  N  N   . ALA B  2 91   ? 7.608   -25.053 39.844  1.00 252.55 ? 91   ALA B N   1 
ATOM   7501  C  CA  . ALA B  2 91   ? 7.827   -26.416 39.357  1.00 235.84 ? 91   ALA B CA  1 
ATOM   7502  C  C   . ALA B  2 91   ? 8.505   -26.363 37.997  1.00 267.32 ? 91   ALA B C   1 
ATOM   7503  O  O   . ALA B  2 91   ? 8.048   -25.655 37.104  1.00 339.52 ? 91   ALA B O   1 
ATOM   7504  C  CB  . ALA B  2 91   ? 6.509   -27.158 39.249  1.00 184.75 ? 91   ALA B CB  1 
ATOM   7505  N  N   . ALA B  2 92   ? 9.588   -27.117 37.836  1.00 218.53 ? 92   ALA B N   1 
ATOM   7506  C  CA  . ALA B  2 92   ? 10.371  -27.071 36.603  1.00 254.93 ? 92   ALA B CA  1 
ATOM   7507  C  C   . ALA B  2 92   ? 10.349  -28.406 35.866  1.00 294.77 ? 92   ALA B C   1 
ATOM   7508  O  O   . ALA B  2 92   ? 10.621  -29.454 36.449  1.00 316.34 ? 92   ALA B O   1 
ATOM   7509  C  CB  . ALA B  2 92   ? 11.808  -26.658 36.904  1.00 264.00 ? 92   ALA B CB  1 
ATOM   7510  N  N   . PHE B  2 93   ? 10.019  -28.354 34.580  1.00 298.23 ? 93   PHE B N   1 
ATOM   7511  C  CA  . PHE B  2 93   ? 10.027  -29.538 33.730  1.00 270.12 ? 93   PHE B CA  1 
ATOM   7512  C  C   . PHE B  2 93   ? 10.617  -29.183 32.371  1.00 277.57 ? 93   PHE B C   1 
ATOM   7513  O  O   . PHE B  2 93   ? 10.236  -28.188 31.756  1.00 266.53 ? 93   PHE B O   1 
ATOM   7514  C  CB  . PHE B  2 93   ? 8.614   -30.110 33.570  1.00 259.18 ? 93   PHE B CB  1 
ATOM   7515  C  CG  . PHE B  2 93   ? 7.589   -29.096 33.132  1.00 285.37 ? 93   PHE B CG  1 
ATOM   7516  C  CD1 . PHE B  2 93   ? 7.182   -29.022 31.809  1.00 205.68 ? 93   PHE B CD1 1 
ATOM   7517  C  CD2 . PHE B  2 93   ? 7.027   -28.221 34.048  1.00 349.01 ? 93   PHE B CD2 1 
ATOM   7518  C  CE1 . PHE B  2 93   ? 6.236   -28.088 31.407  1.00 218.64 ? 93   PHE B CE1 1 
ATOM   7519  C  CE2 . PHE B  2 93   ? 6.082   -27.288 33.651  1.00 361.51 ? 93   PHE B CE2 1 
ATOM   7520  C  CZ  . PHE B  2 93   ? 5.688   -27.223 32.328  1.00 307.31 ? 93   PHE B CZ  1 
ATOM   7521  N  N   . ASN B  2 94   ? 11.558  -29.999 31.910  1.00 296.68 ? 94   ASN B N   1 
ATOM   7522  C  CA  . ASN B  2 94   ? 12.268  -29.720 30.668  1.00 292.75 ? 94   ASN B CA  1 
ATOM   7523  C  C   . ASN B  2 94   ? 11.479  -30.119 29.430  1.00 302.72 ? 94   ASN B C   1 
ATOM   7524  O  O   . ASN B  2 94   ? 10.505  -30.870 29.515  1.00 283.31 ? 94   ASN B O   1 
ATOM   7525  C  CB  . ASN B  2 94   ? 13.618  -30.426 30.676  1.00 256.03 ? 94   ASN B CB  1 
ATOM   7526  C  CG  . ASN B  2 94   ? 14.550  -29.855 31.712  1.00 250.40 ? 94   ASN B CG  1 
ATOM   7527  O  OD1 . ASN B  2 94   ? 14.180  -28.946 32.456  1.00 242.84 ? 94   ASN B OD1 1 
ATOM   7528  N  ND2 . ASN B  2 94   ? 15.764  -30.367 31.763  1.00 275.92 ? 94   ASN B ND2 1 
ATOM   7529  N  N   . VAL B  2 95   ? 11.919  -29.618 28.278  1.00 303.13 ? 95   VAL B N   1 
ATOM   7530  C  CA  . VAL B  2 95   ? 11.257  -29.895 27.011  1.00 284.91 ? 95   VAL B CA  1 
ATOM   7531  C  C   . VAL B  2 95   ? 12.286  -30.191 25.921  1.00 288.49 ? 95   VAL B C   1 
ATOM   7532  O  O   . VAL B  2 95   ? 12.937  -29.277 25.409  1.00 212.29 ? 95   VAL B O   1 
ATOM   7533  C  CB  . VAL B  2 95   ? 10.374  -28.707 26.573  1.00 217.81 ? 95   VAL B CB  1 
ATOM   7534  C  CG1 . VAL B  2 95   ? 9.576   -29.068 25.330  1.00 201.43 ? 95   VAL B CG1 1 
ATOM   7535  C  CG2 . VAL B  2 95   ? 9.437   -28.303 27.694  1.00 265.76 ? 95   VAL B CG2 1 
ATOM   7536  N  N   . THR B  2 96   ? 12.429  -31.474 25.585  1.00 302.29 ? 96   THR B N   1 
ATOM   7537  C  CA  . THR B  2 96   ? 13.311  -31.915 24.506  1.00 240.29 ? 96   THR B CA  1 
ATOM   7538  C  C   . THR B  2 96   ? 12.638  -31.778 23.148  1.00 221.60 ? 96   THR B C   1 
ATOM   7539  O  O   . THR B  2 96   ? 11.580  -32.363 22.910  1.00 208.22 ? 96   THR B O   1 
ATOM   7540  C  CB  . THR B  2 96   ? 13.705  -33.394 24.667  1.00 223.54 ? 96   THR B CB  1 
ATOM   7541  O  OG1 . THR B  2 96   ? 14.514  -33.557 25.836  1.00 269.62 ? 96   THR B OG1 1 
ATOM   7542  C  CG2 . THR B  2 96   ? 14.481  -33.876 23.452  1.00 279.46 ? 96   THR B CG2 1 
ATOM   7543  N  N   . PHE B  2 97   ? 13.261  -31.016 22.254  1.00 236.03 ? 97   PHE B N   1 
ATOM   7544  C  CA  . PHE B  2 97   ? 12.738  -30.836 20.902  1.00 282.16 ? 97   PHE B CA  1 
ATOM   7545  C  C   . PHE B  2 97   ? 13.842  -31.029 19.860  1.00 297.61 ? 97   PHE B C   1 
ATOM   7546  O  O   . PHE B  2 97   ? 14.752  -30.207 19.750  1.00 294.92 ? 97   PHE B O   1 
ATOM   7547  C  CB  . PHE B  2 97   ? 12.100  -29.449 20.747  1.00 304.84 ? 97   PHE B CB  1 
ATOM   7548  C  CG  . PHE B  2 97   ? 11.496  -29.206 19.389  1.00 300.25 ? 97   PHE B CG  1 
ATOM   7549  C  CD1 . PHE B  2 97   ? 10.197  -29.601 19.110  1.00 324.33 ? 97   PHE B CD1 1 
ATOM   7550  C  CD2 . PHE B  2 97   ? 12.229  -28.582 18.392  1.00 243.51 ? 97   PHE B CD2 1 
ATOM   7551  C  CE1 . PHE B  2 97   ? 9.643   -29.382 17.863  1.00 312.63 ? 97   PHE B CE1 1 
ATOM   7552  C  CE2 . PHE B  2 97   ? 11.679  -28.359 17.142  1.00 224.57 ? 97   PHE B CE2 1 
ATOM   7553  C  CZ  . PHE B  2 97   ? 10.385  -28.759 16.878  1.00 262.85 ? 97   PHE B CZ  1 
ATOM   7554  N  N   . ARG B  2 98   ? 13.755  -32.120 19.103  1.00 297.50 ? 98   ARG B N   1 
ATOM   7555  C  CA  . ARG B  2 98   ? 14.741  -32.424 18.069  1.00 286.89 ? 98   ARG B CA  1 
ATOM   7556  C  C   . ARG B  2 98   ? 14.065  -32.581 16.713  1.00 319.47 ? 98   ARG B C   1 
ATOM   7557  O  O   . ARG B  2 98   ? 13.780  -33.695 16.277  1.00 368.82 ? 98   ARG B O   1 
ATOM   7558  C  CB  . ARG B  2 98   ? 15.516  -33.694 18.431  1.00 267.52 ? 98   ARG B CB  1 
ATOM   7559  C  CG  . ARG B  2 98   ? 16.296  -34.315 17.279  1.00 296.57 ? 98   ARG B CG  1 
ATOM   7560  C  CD  . ARG B  2 98   ? 16.961  -35.612 17.699  1.00 290.08 ? 98   ARG B CD  1 
ATOM   7561  N  NE  . ARG B  2 98   ? 15.989  -36.677 17.921  1.00 281.22 ? 98   ARG B NE  1 
ATOM   7562  C  CZ  . ARG B  2 98   ? 15.536  -37.488 16.971  1.00 279.47 ? 98   ARG B CZ  1 
ATOM   7563  N  NH1 . ARG B  2 98   ? 15.962  -37.362 15.722  1.00 267.13 ? 98   ARG B NH1 1 
ATOM   7564  N  NH2 . ARG B  2 98   ? 14.652  -38.428 17.273  1.00 281.74 ? 98   ARG B NH2 1 
ATOM   7565  N  N   . ARG B  2 99   ? 13.817  -31.456 16.050  1.00 309.68 ? 99   ARG B N   1 
ATOM   7566  C  CA  . ARG B  2 99   ? 13.170  -31.470 14.748  1.00 284.77 ? 99   ARG B CA  1 
ATOM   7567  C  C   . ARG B  2 99   ? 13.875  -32.485 13.864  1.00 305.90 ? 99   ARG B C   1 
ATOM   7568  O  O   . ARG B  2 99   ? 15.024  -32.850 14.108  1.00 350.71 ? 99   ARG B O   1 
ATOM   7569  C  CB  . ARG B  2 99   ? 13.176  -30.069 14.126  1.00 257.67 ? 99   ARG B CB  1 
ATOM   7570  C  CG  . ARG B  2 99   ? 12.579  -29.994 12.734  1.00 254.25 ? 99   ARG B CG  1 
ATOM   7571  C  CD  . ARG B  2 99   ? 12.499  -28.556 12.243  1.00 257.39 ? 99   ARG B CD  1 
ATOM   7572  N  NE  . ARG B  2 99   ? 11.752  -28.449 10.994  1.00 272.81 ? 99   ARG B NE  1 
ATOM   7573  C  CZ  . ARG B  2 99   ? 12.243  -28.762 9.801   1.00 271.87 ? 99   ARG B CZ  1 
ATOM   7574  N  NH1 . ARG B  2 99   ? 13.487  -29.206 9.690   1.00 266.65 ? 99   ARG B NH1 1 
ATOM   7575  N  NH2 . ARG B  2 99   ? 11.490  -28.636 8.717   1.00 274.67 ? 99   ARG B NH2 1 
ATOM   7576  N  N   . ALA B  2 100  ? 13.189  -32.937 12.826  1.00 220.21 ? 100  ALA B N   1 
ATOM   7577  C  CA  . ALA B  2 100  ? 13.625  -34.125 12.113  1.00 270.73 ? 100  ALA B CA  1 
ATOM   7578  C  C   . ALA B  2 100  ? 13.993  -33.880 10.662  1.00 306.56 ? 100  ALA B C   1 
ATOM   7579  O  O   . ALA B  2 100  ? 15.045  -34.317 10.195  1.00 308.00 ? 100  ALA B O   1 
ATOM   7580  C  CB  . ALA B  2 100  ? 12.521  -35.162 12.159  1.00 293.23 ? 100  ALA B CB  1 
ATOM   7581  N  N   . LYS B  2 101  ? 13.126  -33.163 9.959   1.00 321.65 ? 101  LYS B N   1 
ATOM   7582  C  CA  . LYS B  2 101  ? 12.962  -33.388 8.539   1.00 292.38 ? 101  LYS B CA  1 
ATOM   7583  C  C   . LYS B  2 101  ? 11.943  -32.429 7.964   1.00 280.33 ? 101  LYS B C   1 
ATOM   7584  O  O   . LYS B  2 101  ? 11.659  -31.372 8.528   1.00 323.73 ? 101  LYS B O   1 
ATOM   7585  C  CB  . LYS B  2 101  ? 12.449  -34.821 8.349   1.00 262.69 ? 101  LYS B CB  1 
ATOM   7586  C  CG  . LYS B  2 101  ? 12.932  -35.535 7.101   1.00 226.33 ? 101  LYS B CG  1 
ATOM   7587  C  CD  . LYS B  2 101  ? 12.582  -37.018 7.151   1.00 187.07 ? 101  LYS B CD  1 
ATOM   7588  C  CE  . LYS B  2 101  ? 12.870  -37.696 5.825   1.00 217.02 ? 101  LYS B CE  1 
ATOM   7589  N  NZ  . LYS B  2 101  ? 12.870  -39.178 5.927   1.00 208.92 ? 101  LYS B NZ  1 
ATOM   7590  N  N   . GLY B  2 102  ? 11.375  -32.827 6.839   1.00 274.89 ? 102  GLY B N   1 
ATOM   7591  C  CA  . GLY B  2 102  ? 10.345  -32.033 6.212   1.00 239.62 ? 102  GLY B CA  1 
ATOM   7592  C  C   . GLY B  2 102  ? 9.109   -32.824 5.860   1.00 243.96 ? 102  GLY B C   1 
ATOM   7593  O  O   . GLY B  2 102  ? 9.189   -33.870 5.227   1.00 249.23 ? 102  GLY B O   1 
ATOM   7594  N  N   . TYR B  2 103  ? 7.956   -32.313 6.271   1.00 268.96 ? 103  TYR B N   1 
ATOM   7595  C  CA  . TYR B  2 103  ? 6.687   -32.966 5.994   1.00 298.98 ? 103  TYR B CA  1 
ATOM   7596  C  C   . TYR B  2 103  ? 6.091   -32.464 4.683   1.00 302.13 ? 103  TYR B C   1 
ATOM   7597  O  O   . TYR B  2 103  ? 6.686   -31.624 4.011   1.00 288.74 ? 103  TYR B O   1 
ATOM   7598  C  CB  . TYR B  2 103  ? 5.713   -32.708 7.143   1.00 312.89 ? 103  TYR B CB  1 
ATOM   7599  C  CG  . TYR B  2 103  ? 6.191   -33.237 8.465   1.00 302.66 ? 103  TYR B CG  1 
ATOM   7600  C  CD1 . TYR B  2 103  ? 6.928   -32.442 9.322   1.00 281.77 ? 103  TYR B CD1 1 
ATOM   7601  C  CD2 . TYR B  2 103  ? 5.908   -34.537 8.857   1.00 314.90 ? 103  TYR B CD2 1 
ATOM   7602  C  CE1 . TYR B  2 103  ? 7.368   -32.921 10.534  1.00 290.79 ? 103  TYR B CE1 1 
ATOM   7603  C  CE2 . TYR B  2 103  ? 6.344   -35.024 10.064  1.00 316.65 ? 103  TYR B CE2 1 
ATOM   7604  C  CZ  . TYR B  2 103  ? 7.074   -34.214 10.900  1.00 309.14 ? 103  TYR B CZ  1 
ATOM   7605  O  OH  . TYR B  2 103  ? 7.511   -34.695 12.110  1.00 314.19 ? 103  TYR B OH  1 
ATOM   7606  N  N   . PRO B  2 104  ? 4.916   -32.993 4.311   1.00 293.43 ? 104  PRO B N   1 
ATOM   7607  C  CA  . PRO B  2 104  ? 4.212   -32.559 3.102   1.00 275.03 ? 104  PRO B CA  1 
ATOM   7608  C  C   . PRO B  2 104  ? 4.002   -31.056 3.080   1.00 267.74 ? 104  PRO B C   1 
ATOM   7609  O  O   . PRO B  2 104  ? 3.323   -30.513 3.949   1.00 288.30 ? 104  PRO B O   1 
ATOM   7610  C  CB  . PRO B  2 104  ? 2.870   -33.281 3.207   1.00 284.89 ? 104  PRO B CB  1 
ATOM   7611  C  CG  . PRO B  2 104  ? 3.163   -34.494 4.006   1.00 285.46 ? 104  PRO B CG  1 
ATOM   7612  C  CD  . PRO B  2 104  ? 4.214   -34.098 4.985   1.00 291.70 ? 104  PRO B CD  1 
ATOM   7613  N  N   . ILE B  2 105  ? 4.576   -30.396 2.084   1.00 251.12 ? 105  ILE B N   1 
ATOM   7614  C  CA  . ILE B  2 105  ? 4.493   -28.947 1.986   1.00 275.93 ? 105  ILE B CA  1 
ATOM   7615  C  C   . ILE B  2 105  ? 3.178   -28.520 1.340   1.00 289.17 ? 105  ILE B C   1 
ATOM   7616  O  O   . ILE B  2 105  ? 2.486   -29.334 0.730   1.00 341.17 ? 105  ILE B O   1 
ATOM   7617  C  CB  . ILE B  2 105  ? 5.667   -28.384 1.169   1.00 288.45 ? 105  ILE B CB  1 
ATOM   7618  C  CG1 . ILE B  2 105  ? 5.707   -26.859 1.287   1.00 225.65 ? 105  ILE B CG1 1 
ATOM   7619  C  CG2 . ILE B  2 105  ? 5.561   -28.817 -0.291  1.00 321.78 ? 105  ILE B CG2 1 
ATOM   7620  C  CD1 . ILE B  2 105  ? 6.889   -26.227 0.610   1.00 272.07 ? 105  ILE B CD1 1 
ATOM   7621  N  N   . ASP B  2 106  ? 2.836   -27.242 1.482   1.00 249.80 ? 106  ASP B N   1 
ATOM   7622  C  CA  . ASP B  2 106  ? 1.619   -26.701 0.887   1.00 305.64 ? 106  ASP B CA  1 
ATOM   7623  C  C   . ASP B  2 106  ? 1.742   -25.188 0.687   1.00 362.75 ? 106  ASP B C   1 
ATOM   7624  O  O   . ASP B  2 106  ? 1.321   -24.408 1.540   1.00 392.40 ? 106  ASP B O   1 
ATOM   7625  C  CB  . ASP B  2 106  ? 0.420   -27.019 1.784   1.00 284.85 ? 106  ASP B CB  1 
ATOM   7626  C  CG  . ASP B  2 106  ? -0.891  -27.050 1.025   1.00 224.16 ? 106  ASP B CG  1 
ATOM   7627  O  OD1 . ASP B  2 106  ? -0.943  -26.517 -0.099  1.00 192.18 ? 106  ASP B OD1 1 
ATOM   7628  O  OD2 . ASP B  2 106  ? -1.872  -27.608 1.554   1.00 213.93 ? 106  ASP B OD2 1 
ATOM   7629  N  N   . LEU B  2 107  ? 2.313   -24.779 -0.445  1.00 355.31 ? 107  LEU B N   1 
ATOM   7630  C  CA  . LEU B  2 107  ? 2.553   -23.361 -0.727  1.00 299.74 ? 107  LEU B CA  1 
ATOM   7631  C  C   . LEU B  2 107  ? 1.323   -22.636 -1.274  1.00 279.02 ? 107  LEU B C   1 
ATOM   7632  O  O   . LEU B  2 107  ? 0.366   -23.260 -1.731  1.00 243.39 ? 107  LEU B O   1 
ATOM   7633  C  CB  . LEU B  2 107  ? 3.709   -23.207 -1.719  1.00 237.64 ? 107  LEU B CB  1 
ATOM   7634  C  CG  . LEU B  2 107  ? 5.113   -23.479 -1.178  1.00 234.43 ? 107  LEU B CG  1 
ATOM   7635  C  CD1 . LEU B  2 107  ? 6.119   -23.456 -2.307  1.00 290.51 ? 107  LEU B CD1 1 
ATOM   7636  C  CD2 . LEU B  2 107  ? 5.490   -22.463 -0.120  1.00 206.02 ? 107  LEU B CD2 1 
ATOM   7637  N  N   . TYR B  2 108  ? 1.362   -21.308 -1.220  1.00 283.03 ? 108  TYR B N   1 
ATOM   7638  C  CA  . TYR B  2 108  ? 0.309   -20.480 -1.788  1.00 257.70 ? 108  TYR B CA  1 
ATOM   7639  C  C   . TYR B  2 108  ? 0.890   -19.123 -2.163  1.00 226.97 ? 108  TYR B C   1 
ATOM   7640  O  O   . TYR B  2 108  ? 1.467   -18.431 -1.330  1.00 191.43 ? 108  TYR B O   1 
ATOM   7641  C  CB  . TYR B  2 108  ? -0.842  -20.308 -0.800  1.00 249.71 ? 108  TYR B CB  1 
ATOM   7642  C  CG  . TYR B  2 108  ? -2.107  -19.793 -1.437  1.00 234.33 ? 108  TYR B CG  1 
ATOM   7643  C  CD1 . TYR B  2 108  ? -3.099  -20.668 -1.854  1.00 182.61 ? 108  TYR B CD1 1 
ATOM   7644  C  CD2 . TYR B  2 108  ? -2.308  -18.433 -1.630  1.00 302.41 ? 108  TYR B CD2 1 
ATOM   7645  C  CE1 . TYR B  2 108  ? -4.259  -20.203 -2.443  1.00 241.10 ? 108  TYR B CE1 1 
ATOM   7646  C  CE2 . TYR B  2 108  ? -3.463  -17.959 -2.216  1.00 326.51 ? 108  TYR B CE2 1 
ATOM   7647  C  CZ  . TYR B  2 108  ? -4.436  -18.848 -2.622  1.00 300.86 ? 108  TYR B CZ  1 
ATOM   7648  O  OH  . TYR B  2 108  ? -5.590  -18.384 -3.208  1.00 313.62 ? 108  TYR B OH  1 
ATOM   7649  N  N   . TYR B  2 109  ? 0.737   -18.747 -3.425  1.00 237.21 ? 109  TYR B N   1 
ATOM   7650  C  CA  . TYR B  2 109  ? 1.398   -17.561 -3.949  1.00 264.00 ? 109  TYR B CA  1 
ATOM   7651  C  C   . TYR B  2 109  ? 0.477   -16.351 -3.947  1.00 294.39 ? 109  TYR B C   1 
ATOM   7652  O  O   . TYR B  2 109  ? -0.340  -16.176 -4.850  1.00 303.87 ? 109  TYR B O   1 
ATOM   7653  C  CB  . TYR B  2 109  ? 1.881   -17.832 -5.370  1.00 251.35 ? 109  TYR B CB  1 
ATOM   7654  C  CG  . TYR B  2 109  ? 2.988   -16.917 -5.847  1.00 260.83 ? 109  TYR B CG  1 
ATOM   7655  C  CD1 . TYR B  2 109  ? 4.317   -17.222 -5.594  1.00 239.49 ? 109  TYR B CD1 1 
ATOM   7656  C  CD2 . TYR B  2 109  ? 2.709   -15.762 -6.566  1.00 257.14 ? 109  TYR B CD2 1 
ATOM   7657  C  CE1 . TYR B  2 109  ? 5.339   -16.396 -6.038  1.00 244.85 ? 109  TYR B CE1 1 
ATOM   7658  C  CE2 . TYR B  2 109  ? 3.723   -14.932 -7.011  1.00 223.51 ? 109  TYR B CE2 1 
ATOM   7659  C  CZ  . TYR B  2 109  ? 5.035   -15.250 -6.747  1.00 221.19 ? 109  TYR B CZ  1 
ATOM   7660  O  OH  . TYR B  2 109  ? 6.043   -14.424 -7.198  1.00 167.29 ? 109  TYR B OH  1 
ATOM   7661  N  N   . LEU B  2 110  ? 0.616   -15.512 -2.929  1.00 281.30 ? 110  LEU B N   1 
ATOM   7662  C  CA  . LEU B  2 110  ? -0.143  -14.274 -2.860  1.00 249.40 ? 110  LEU B CA  1 
ATOM   7663  C  C   . LEU B  2 110  ? 0.571   -13.183 -3.647  1.00 264.42 ? 110  LEU B C   1 
ATOM   7664  O  O   . LEU B  2 110  ? 1.475   -12.531 -3.127  1.00 274.62 ? 110  LEU B O   1 
ATOM   7665  C  CB  . LEU B  2 110  ? -0.303  -13.833 -1.408  1.00 254.68 ? 110  LEU B CB  1 
ATOM   7666  C  CG  . LEU B  2 110  ? -1.110  -14.769 -0.511  1.00 294.56 ? 110  LEU B CG  1 
ATOM   7667  C  CD1 . LEU B  2 110  ? -1.135  -14.236 0.912   1.00 279.95 ? 110  LEU B CD1 1 
ATOM   7668  C  CD2 . LEU B  2 110  ? -2.520  -14.939 -1.055  1.00 274.12 ? 110  LEU B CD2 1 
ATOM   7669  N  N   . MET B  2 111  ? 0.166   -12.985 -4.898  1.00 278.77 ? 111  MET B N   1 
ATOM   7670  C  CA  . MET B  2 111  ? 0.794   -11.982 -5.747  1.00 226.22 ? 111  MET B CA  1 
ATOM   7671  C  C   . MET B  2 111  ? -0.117  -10.791 -5.999  1.00 248.06 ? 111  MET B C   1 
ATOM   7672  O  O   . MET B  2 111  ? -1.287  -10.957 -6.339  1.00 258.06 ? 111  MET B O   1 
ATOM   7673  C  CB  . MET B  2 111  ? 1.170   -12.584 -7.084  1.00 187.33 ? 111  MET B CB  1 
ATOM   7674  C  CG  . MET B  2 111  ? 1.423   -11.531 -8.125  1.00 210.65 ? 111  MET B CG  1 
ATOM   7675  S  SD  . MET B  2 111  ? 2.345   -12.168 -9.529  1.00 526.12 ? 111  MET B SD  1 
ATOM   7676  C  CE  . MET B  2 111  ? 4.040   -11.999 -8.960  1.00 358.34 ? 111  MET B CE  1 
ATOM   7677  N  N   . ASP B  2 112  ? 0.437   -9.591  -5.840  1.00 250.16 ? 112  ASP B N   1 
ATOM   7678  C  CA  . ASP B  2 112  ? -0.293  -8.351  -6.094  1.00 283.13 ? 112  ASP B CA  1 
ATOM   7679  C  C   . ASP B  2 112  ? -0.326  -8.093  -7.599  1.00 288.03 ? 112  ASP B C   1 
ATOM   7680  O  O   . ASP B  2 112  ? 0.720   -7.966  -8.236  1.00 219.12 ? 112  ASP B O   1 
ATOM   7681  C  CB  . ASP B  2 112  ? 0.375   -7.182  -5.348  1.00 268.40 ? 112  ASP B CB  1 
ATOM   7682  C  CG  . ASP B  2 112  ? -0.270  -5.834  -5.646  1.00 253.35 ? 112  ASP B CG  1 
ATOM   7683  O  OD1 . ASP B  2 112  ? -1.504  -5.780  -5.828  1.00 287.63 ? 112  ASP B OD1 1 
ATOM   7684  O  OD2 . ASP B  2 112  ? 0.463   -4.821  -5.679  1.00 200.41 ? 112  ASP B OD2 1 
ATOM   7685  N  N   . LEU B  2 113  ? -1.530  -8.041  -8.167  1.00 326.08 ? 113  LEU B N   1 
ATOM   7686  C  CA  . LEU B  2 113  ? -1.698  -7.787  -9.596  1.00 284.39 ? 113  LEU B CA  1 
ATOM   7687  C  C   . LEU B  2 113  ? -1.959  -6.306  -9.876  1.00 285.08 ? 113  LEU B C   1 
ATOM   7688  O  O   . LEU B  2 113  ? -3.107  -5.856  -9.902  1.00 307.93 ? 113  LEU B O   1 
ATOM   7689  C  CB  . LEU B  2 113  ? -2.840  -8.633  -10.169 1.00 261.86 ? 113  LEU B CB  1 
ATOM   7690  C  CG  . LEU B  2 113  ? -2.605  -10.144 -10.241 1.00 248.27 ? 113  LEU B CG  1 
ATOM   7691  C  CD1 . LEU B  2 113  ? -3.585  -10.777 -11.221 1.00 292.69 ? 113  LEU B CD1 1 
ATOM   7692  C  CD2 . LEU B  2 113  ? -1.182  -10.456 -10.648 1.00 216.66 ? 113  LEU B CD2 1 
ATOM   7693  N  N   . SER B  2 114  ? -0.882  -5.558  -10.086 1.00 255.29 ? 114  SER B N   1 
ATOM   7694  C  CA  . SER B  2 114  ? -0.973  -4.138  -10.398 1.00 237.97 ? 114  SER B CA  1 
ATOM   7695  C  C   . SER B  2 114  ? -0.296  -3.876  -11.733 1.00 265.38 ? 114  SER B C   1 
ATOM   7696  O  O   . SER B  2 114  ? 0.202   -4.800  -12.375 1.00 313.70 ? 114  SER B O   1 
ATOM   7697  C  CB  . SER B  2 114  ? -0.293  -3.312  -9.307  1.00 288.46 ? 114  SER B CB  1 
ATOM   7698  O  OG  . SER B  2 114  ? -0.838  -3.601  -8.031  1.00 339.73 ? 114  SER B OG  1 
ATOM   7699  N  N   . TYR B  2 115  ? -0.268  -2.617  -12.151 1.00 288.56 ? 115  TYR B N   1 
ATOM   7700  C  CA  . TYR B  2 115  ? 0.413   -2.262  -13.385 1.00 335.20 ? 115  TYR B CA  1 
ATOM   7701  C  C   . TYR B  2 115  ? 1.915   -2.186  -13.134 1.00 330.55 ? 115  TYR B C   1 
ATOM   7702  O  O   . TYR B  2 115  ? 2.709   -2.163  -14.073 1.00 362.50 ? 115  TYR B O   1 
ATOM   7703  C  CB  . TYR B  2 115  ? -0.110  -0.936  -13.934 1.00 347.51 ? 115  TYR B CB  1 
ATOM   7704  C  CG  . TYR B  2 115  ? 0.165   -0.738  -15.409 1.00 316.65 ? 115  TYR B CG  1 
ATOM   7705  C  CD1 . TYR B  2 115  ? -0.764  -1.118  -16.367 1.00 256.20 ? 115  TYR B CD1 1 
ATOM   7706  C  CD2 . TYR B  2 115  ? 1.356   -0.175  -15.842 1.00 341.61 ? 115  TYR B CD2 1 
ATOM   7707  C  CE1 . TYR B  2 115  ? -0.515  -0.938  -17.714 1.00 293.19 ? 115  TYR B CE1 1 
ATOM   7708  C  CE2 . TYR B  2 115  ? 1.614   0.008   -17.186 1.00 337.61 ? 115  TYR B CE2 1 
ATOM   7709  C  CZ  . TYR B  2 115  ? 0.676   -0.375  -18.116 1.00 329.47 ? 115  TYR B CZ  1 
ATOM   7710  O  OH  . TYR B  2 115  ? 0.932   -0.194  -19.452 1.00 346.65 ? 115  TYR B OH  1 
ATOM   7711  N  N   . SER B  2 116  ? 2.296   -2.152  -11.861 1.00 278.95 ? 116  SER B N   1 
ATOM   7712  C  CA  . SER B  2 116  ? 3.702   -2.179  -11.475 1.00 265.19 ? 116  SER B CA  1 
ATOM   7713  C  C   . SER B  2 116  ? 4.204   -3.619  -11.415 1.00 255.55 ? 116  SER B C   1 
ATOM   7714  O  O   . SER B  2 116  ? 5.409   -3.872  -11.416 1.00 198.11 ? 116  SER B O   1 
ATOM   7715  C  CB  . SER B  2 116  ? 3.897   -1.494  -10.118 1.00 271.77 ? 116  SER B CB  1 
ATOM   7716  O  OG  . SER B  2 116  ? 3.128   -2.120  -9.104  1.00 262.70 ? 116  SER B OG  1 
ATOM   7717  N  N   . MET B  2 117  ? 3.270   -4.562  -11.370 1.00 279.59 ? 117  MET B N   1 
ATOM   7718  C  CA  . MET B  2 117  ? 3.612   -5.976  -11.318 1.00 272.51 ? 117  MET B CA  1 
ATOM   7719  C  C   . MET B  2 117  ? 3.389   -6.619  -12.687 1.00 288.46 ? 117  MET B C   1 
ATOM   7720  O  O   . MET B  2 117  ? 2.901   -7.745  -12.785 1.00 277.29 ? 117  MET B O   1 
ATOM   7721  C  CB  . MET B  2 117  ? 2.765   -6.679  -10.255 1.00 275.86 ? 117  MET B CB  1 
ATOM   7722  C  CG  . MET B  2 117  ? 2.904   -6.096  -8.845  1.00 265.46 ? 117  MET B CG  1 
ATOM   7723  S  SD  . MET B  2 117  ? 4.443   -6.497  -8.000  1.00 257.92 ? 117  MET B SD  1 
ATOM   7724  C  CE  . MET B  2 117  ? 4.421   -8.290  -8.035  1.00 192.49 ? 117  MET B CE  1 
ATOM   7725  N  N   . LEU B  2 118  ? 3.753   -5.894  -13.742 1.00 303.02 ? 118  LEU B N   1 
ATOM   7726  C  CA  . LEU B  2 118  ? 3.595   -6.388  -15.106 1.00 282.15 ? 118  LEU B CA  1 
ATOM   7727  C  C   . LEU B  2 118  ? 4.733   -7.336  -15.471 1.00 284.74 ? 118  LEU B C   1 
ATOM   7728  O  O   . LEU B  2 118  ? 4.504   -8.516  -15.733 1.00 316.01 ? 118  LEU B O   1 
ATOM   7729  C  CB  . LEU B  2 118  ? 3.541   -5.221  -16.099 1.00 294.74 ? 118  LEU B CB  1 
ATOM   7730  C  CG  . LEU B  2 118  ? 2.210   -4.467  -16.185 1.00 317.50 ? 118  LEU B CG  1 
ATOM   7731  C  CD1 . LEU B  2 118  ? 2.350   -3.204  -17.024 1.00 342.99 ? 118  LEU B CD1 1 
ATOM   7732  C  CD2 . LEU B  2 118  ? 1.130   -5.368  -16.756 1.00 315.61 ? 118  LEU B CD2 1 
ATOM   7733  N  N   . ASP B  2 119  ? 5.959   -6.818  -15.484 1.00 290.90 ? 119  ASP B N   1 
ATOM   7734  C  CA  . ASP B  2 119  ? 7.129   -7.630  -15.813 1.00 310.11 ? 119  ASP B CA  1 
ATOM   7735  C  C   . ASP B  2 119  ? 7.350   -8.717  -14.765 1.00 352.93 ? 119  ASP B C   1 
ATOM   7736  O  O   . ASP B  2 119  ? 8.142   -9.639  -14.969 1.00 372.74 ? 119  ASP B O   1 
ATOM   7737  C  CB  . ASP B  2 119  ? 8.379   -6.754  -15.945 1.00 291.95 ? 119  ASP B CB  1 
ATOM   7738  C  CG  . ASP B  2 119  ? 8.656   -5.934  -14.701 1.00 360.89 ? 119  ASP B CG  1 
ATOM   7739  O  OD1 . ASP B  2 119  ? 7.976   -6.151  -13.676 1.00 425.87 ? 119  ASP B OD1 1 
ATOM   7740  O  OD2 . ASP B  2 119  ? 9.557   -5.072  -14.748 1.00 371.73 ? 119  ASP B OD2 1 
ATOM   7741  N  N   . ASP B  2 120  ? 6.648   -8.599  -13.642 1.00 344.42 ? 120  ASP B N   1 
ATOM   7742  C  CA  . ASP B  2 120  ? 6.654   -9.638  -12.622 1.00 281.48 ? 120  ASP B CA  1 
ATOM   7743  C  C   . ASP B  2 120  ? 5.755   -10.783 -13.060 1.00 187.77 ? 120  ASP B C   1 
ATOM   7744  O  O   . ASP B  2 120  ? 6.086   -11.948 -12.876 1.00 136.91 ? 120  ASP B O   1 
ATOM   7745  C  CB  . ASP B  2 120  ? 6.160   -9.086  -11.286 1.00 265.46 ? 120  ASP B CB  1 
ATOM   7746  C  CG  . ASP B  2 120  ? 7.109   -8.076  -10.682 1.00 259.93 ? 120  ASP B CG  1 
ATOM   7747  O  OD1 . ASP B  2 120  ? 7.906   -7.473  -11.431 1.00 283.87 ? 120  ASP B OD1 1 
ATOM   7748  O  OD2 . ASP B  2 120  ? 7.052   -7.881  -9.450  1.00 299.91 ? 120  ASP B OD2 1 
ATOM   7749  N  N   . LEU B  2 121  ? 4.607   -10.440 -13.631 1.00 254.03 ? 121  LEU B N   1 
ATOM   7750  C  CA  . LEU B  2 121  ? 3.678   -11.437 -14.139 1.00 278.27 ? 121  LEU B CA  1 
ATOM   7751  C  C   . LEU B  2 121  ? 4.266   -12.148 -15.356 1.00 312.54 ? 121  LEU B C   1 
ATOM   7752  O  O   . LEU B  2 121  ? 3.950   -13.304 -15.618 1.00 280.59 ? 121  LEU B O   1 
ATOM   7753  C  CB  . LEU B  2 121  ? 2.348   -10.775 -14.500 1.00 249.91 ? 121  LEU B CB  1 
ATOM   7754  C  CG  . LEU B  2 121  ? 1.106   -11.669 -14.493 1.00 203.65 ? 121  LEU B CG  1 
ATOM   7755  C  CD1 . LEU B  2 121  ? -0.144  -10.810 -14.388 1.00 183.01 ? 121  LEU B CD1 1 
ATOM   7756  C  CD2 . LEU B  2 121  ? 1.036   -12.562 -15.724 1.00 238.82 ? 121  LEU B CD2 1 
ATOM   7757  N  N   . ARG B  2 122  ? 5.128   -11.454 -16.092 1.00 342.31 ? 122  ARG B N   1 
ATOM   7758  C  CA  . ARG B  2 122  ? 5.736   -12.017 -17.295 1.00 321.46 ? 122  ARG B CA  1 
ATOM   7759  C  C   . ARG B  2 122  ? 6.872   -12.971 -16.947 1.00 346.00 ? 122  ARG B C   1 
ATOM   7760  O  O   . ARG B  2 122  ? 6.968   -14.060 -17.509 1.00 398.03 ? 122  ARG B O   1 
ATOM   7761  C  CB  . ARG B  2 122  ? 6.254   -10.903 -18.209 1.00 299.76 ? 122  ARG B CB  1 
ATOM   7762  C  CG  . ARG B  2 122  ? 7.147   -11.393 -19.335 1.00 269.34 ? 122  ARG B CG  1 
ATOM   7763  C  CD  . ARG B  2 122  ? 7.385   -10.307 -20.370 1.00 270.09 ? 122  ARG B CD  1 
ATOM   7764  N  NE  . ARG B  2 122  ? 6.175   -9.997  -21.124 1.00 285.64 ? 122  ARG B NE  1 
ATOM   7765  C  CZ  . ARG B  2 122  ? 6.119   -9.126  -22.126 1.00 318.49 ? 122  ARG B CZ  1 
ATOM   7766  N  NH1 . ARG B  2 122  ? 7.208   -8.472  -22.504 1.00 329.50 ? 122  ARG B NH1 1 
ATOM   7767  N  NH2 . ARG B  2 122  ? 4.972   -8.910  -22.754 1.00 339.98 ? 122  ARG B NH2 1 
ATOM   7768  N  N   . ASN B  2 123  ? 7.728   -12.556 -16.019 1.00 315.38 ? 123  ASN B N   1 
ATOM   7769  C  CA  . ASN B  2 123  ? 8.871   -13.366 -15.611 1.00 277.14 ? 123  ASN B CA  1 
ATOM   7770  C  C   . ASN B  2 123  ? 8.500   -14.389 -14.546 1.00 277.14 ? 123  ASN B C   1 
ATOM   7771  O  O   . ASN B  2 123  ? 9.374   -14.970 -13.900 1.00 252.37 ? 123  ASN B O   1 
ATOM   7772  C  CB  . ASN B  2 123  ? 9.995   -12.471 -15.086 1.00 252.56 ? 123  ASN B CB  1 
ATOM   7773  C  CG  . ASN B  2 123  ? 10.507  -11.505 -16.131 1.00 289.20 ? 123  ASN B CG  1 
ATOM   7774  O  OD1 . ASN B  2 123  ? 10.707  -10.323 -15.854 1.00 299.23 ? 123  ASN B OD1 1 
ATOM   7775  N  ND2 . ASN B  2 123  ? 10.724  -12.003 -17.343 1.00 317.78 ? 123  ASN B ND2 1 
ATOM   7776  N  N   . VAL B  2 124  ? 7.202   -14.609 -14.366 1.00 303.85 ? 124  VAL B N   1 
ATOM   7777  C  CA  . VAL B  2 124  ? 6.721   -15.516 -13.334 1.00 299.91 ? 124  VAL B CA  1 
ATOM   7778  C  C   . VAL B  2 124  ? 5.464   -16.284 -13.769 1.00 282.70 ? 124  VAL B C   1 
ATOM   7779  O  O   . VAL B  2 124  ? 5.134   -17.310 -13.179 1.00 274.55 ? 124  VAL B O   1 
ATOM   7780  C  CB  . VAL B  2 124  ? 6.441   -14.742 -12.017 1.00 286.30 ? 124  VAL B CB  1 
ATOM   7781  C  CG1 . VAL B  2 124  ? 5.786   -15.635 -10.988 1.00 222.15 ? 124  VAL B CG1 1 
ATOM   7782  C  CG2 . VAL B  2 124  ? 7.729   -14.151 -11.451 1.00 308.53 ? 124  VAL B CG2 1 
ATOM   7783  N  N   . LYS B  2 125  ? 4.785   -15.808 -14.812 1.00 270.90 ? 125  LYS B N   1 
ATOM   7784  C  CA  . LYS B  2 125  ? 3.488   -16.368 -15.207 1.00 267.20 ? 125  LYS B CA  1 
ATOM   7785  C  C   . LYS B  2 125  ? 3.487   -17.895 -15.261 1.00 295.99 ? 125  LYS B C   1 
ATOM   7786  O  O   . LYS B  2 125  ? 2.454   -18.526 -15.033 1.00 293.26 ? 125  LYS B O   1 
ATOM   7787  C  CB  . LYS B  2 125  ? 3.033   -15.808 -16.559 1.00 242.79 ? 125  LYS B CB  1 
ATOM   7788  C  CG  . LYS B  2 125  ? 4.077   -15.884 -17.650 1.00 297.41 ? 125  LYS B CG  1 
ATOM   7789  C  CD  . LYS B  2 125  ? 3.589   -15.212 -18.917 1.00 325.59 ? 125  LYS B CD  1 
ATOM   7790  C  CE  . LYS B  2 125  ? 4.583   -15.375 -20.049 1.00 295.43 ? 125  LYS B CE  1 
ATOM   7791  N  NZ  . LYS B  2 125  ? 4.110   -14.723 -21.295 1.00 238.11 ? 125  LYS B NZ  1 
ATOM   7792  N  N   . LYS B  2 126  ? 4.636   -18.491 -15.560 1.00 313.63 ? 126  LYS B N   1 
ATOM   7793  C  CA  . LYS B  2 126  ? 4.725   -19.943 -15.635 1.00 305.79 ? 126  LYS B CA  1 
ATOM   7794  C  C   . LYS B  2 126  ? 6.128   -20.470 -15.364 1.00 322.60 ? 126  LYS B C   1 
ATOM   7795  O  O   . LYS B  2 126  ? 6.743   -21.081 -16.234 1.00 359.27 ? 126  LYS B O   1 
ATOM   7796  C  CB  . LYS B  2 126  ? 4.256   -20.425 -17.006 1.00 303.61 ? 126  LYS B CB  1 
ATOM   7797  C  CG  . LYS B  2 126  ? 2.787   -20.175 -17.265 1.00 316.53 ? 126  LYS B CG  1 
ATOM   7798  C  CD  . LYS B  2 126  ? 2.286   -20.975 -18.445 1.00 306.27 ? 126  LYS B CD  1 
ATOM   7799  C  CE  . LYS B  2 126  ? 3.001   -20.580 -19.722 1.00 276.77 ? 126  LYS B CE  1 
ATOM   7800  N  NZ  . LYS B  2 126  ? 2.798   -19.144 -20.063 1.00 244.90 ? 126  LYS B NZ  1 
ATOM   7801  N  N   . LEU B  2 127  ? 6.631   -20.234 -14.158 1.00 298.70 ? 127  LEU B N   1 
ATOM   7802  C  CA  . LEU B  2 127  ? 7.881   -20.846 -13.728 1.00 300.59 ? 127  LEU B CA  1 
ATOM   7803  C  C   . LEU B  2 127  ? 7.623   -21.688 -12.490 1.00 286.36 ? 127  LEU B C   1 
ATOM   7804  O  O   . LEU B  2 127  ? 8.088   -21.360 -11.402 1.00 300.14 ? 127  LEU B O   1 
ATOM   7805  C  CB  . LEU B  2 127  ? 8.947   -19.787 -13.435 1.00 282.76 ? 127  LEU B CB  1 
ATOM   7806  C  CG  . LEU B  2 127  ? 10.296  -20.343 -12.966 1.00 266.10 ? 127  LEU B CG  1 
ATOM   7807  C  CD1 . LEU B  2 127  ? 10.772  -21.450 -13.888 1.00 256.53 ? 127  LEU B CD1 1 
ATOM   7808  C  CD2 . LEU B  2 127  ? 11.338  -19.245 -12.875 1.00 249.39 ? 127  LEU B CD2 1 
ATOM   7809  N  N   . GLY B  2 128  ? 6.875   -22.774 -12.664 1.00 253.53 ? 128  GLY B N   1 
ATOM   7810  C  CA  . GLY B  2 128  ? 6.507   -23.638 -11.557 1.00 241.28 ? 128  GLY B CA  1 
ATOM   7811  C  C   . GLY B  2 128  ? 7.054   -25.048 -11.685 1.00 237.28 ? 128  GLY B C   1 
ATOM   7812  O  O   . GLY B  2 128  ? 6.902   -25.871 -10.783 1.00 218.26 ? 128  GLY B O   1 
ATOM   7813  N  N   . GLY B  2 129  ? 7.689   -25.335 -12.813 1.00 281.37 ? 129  GLY B N   1 
ATOM   7814  C  CA  . GLY B  2 129  ? 8.321   -26.623 -13.005 1.00 301.39 ? 129  GLY B CA  1 
ATOM   7815  C  C   . GLY B  2 129  ? 9.617   -26.699 -12.221 1.00 334.21 ? 129  GLY B C   1 
ATOM   7816  O  O   . GLY B  2 129  ? 10.119  -27.784 -11.934 1.00 332.14 ? 129  GLY B O   1 
ATOM   7817  N  N   . ASP B  2 130  ? 10.157  -25.535 -11.872 1.00 354.85 ? 130  ASP B N   1 
ATOM   7818  C  CA  . ASP B  2 130  ? 11.372  -25.460 -11.071 1.00 335.69 ? 130  ASP B CA  1 
ATOM   7819  C  C   . ASP B  2 130  ? 11.035  -25.283 -9.595  1.00 334.75 ? 130  ASP B C   1 
ATOM   7820  O  O   . ASP B  2 130  ? 11.924  -25.248 -8.746  1.00 293.74 ? 130  ASP B O   1 
ATOM   7821  C  CB  . ASP B  2 130  ? 12.259  -24.309 -11.545 1.00 288.60 ? 130  ASP B CB  1 
ATOM   7822  C  CG  . ASP B  2 130  ? 11.672  -22.948 -11.226 1.00 294.60 ? 130  ASP B CG  1 
ATOM   7823  O  OD1 . ASP B  2 130  ? 10.461  -22.870 -10.941 1.00 291.52 ? 130  ASP B OD1 1 
ATOM   7824  O  OD2 . ASP B  2 130  ? 12.424  -21.953 -11.264 1.00 310.03 ? 130  ASP B OD2 1 
ATOM   7825  N  N   . LEU B  2 131  ? 9.747   -25.157 -9.298  1.00 337.12 ? 131  LEU B N   1 
ATOM   7826  C  CA  . LEU B  2 131  ? 9.285   -25.067 -7.920  1.00 286.21 ? 131  LEU B CA  1 
ATOM   7827  C  C   . LEU B  2 131  ? 9.166   -26.460 -7.314  1.00 282.15 ? 131  LEU B C   1 
ATOM   7828  O  O   . LEU B  2 131  ? 9.655   -26.712 -6.216  1.00 275.24 ? 131  LEU B O   1 
ATOM   7829  C  CB  . LEU B  2 131  ? 7.937   -24.353 -7.860  1.00 275.23 ? 131  LEU B CB  1 
ATOM   7830  C  CG  . LEU B  2 131  ? 7.967   -22.862 -8.199  1.00 234.79 ? 131  LEU B CG  1 
ATOM   7831  C  CD1 . LEU B  2 131  ? 6.548   -22.301 -8.214  1.00 241.81 ? 131  LEU B CD1 1 
ATOM   7832  C  CD2 . LEU B  2 131  ? 8.846   -22.097 -7.217  1.00 174.27 ? 131  LEU B CD2 1 
ATOM   7833  N  N   . LEU B  2 132  ? 8.505   -27.362 -8.030  1.00 312.34 ? 132  LEU B N   1 
ATOM   7834  C  CA  . LEU B  2 132  ? 8.447   -28.754 -7.614  1.00 321.08 ? 132  LEU B CA  1 
ATOM   7835  C  C   . LEU B  2 132  ? 9.851   -29.338 -7.681  1.00 350.18 ? 132  LEU B C   1 
ATOM   7836  O  O   . LEU B  2 132  ? 10.177  -30.283 -6.964  1.00 312.48 ? 132  LEU B O   1 
ATOM   7837  C  CB  . LEU B  2 132  ? 7.495   -29.549 -8.507  1.00 313.81 ? 132  LEU B CB  1 
ATOM   7838  C  CG  . LEU B  2 132  ? 6.008   -29.453 -8.162  1.00 245.25 ? 132  LEU B CG  1 
ATOM   7839  C  CD1 . LEU B  2 132  ? 5.474   -28.070 -8.451  1.00 203.13 ? 132  LEU B CD1 1 
ATOM   7840  C  CD2 . LEU B  2 132  ? 5.224   -30.488 -8.940  1.00 271.58 ? 132  LEU B CD2 1 
ATOM   7841  N  N   . ARG B  2 133  ? 10.679  -28.762 -8.549  1.00 401.02 ? 133  ARG B N   1 
ATOM   7842  C  CA  . ARG B  2 133  ? 12.070  -29.173 -8.679  1.00 388.34 ? 133  ARG B CA  1 
ATOM   7843  C  C   . ARG B  2 133  ? 12.841  -28.726 -7.448  1.00 354.16 ? 133  ARG B C   1 
ATOM   7844  O  O   . ARG B  2 133  ? 13.713  -29.438 -6.953  1.00 339.97 ? 133  ARG B O   1 
ATOM   7845  C  CB  . ARG B  2 133  ? 12.688  -28.568 -9.942  1.00 379.88 ? 133  ARG B CB  1 
ATOM   7846  C  CG  . ARG B  2 133  ? 14.108  -29.027 -10.225 1.00 344.08 ? 133  ARG B CG  1 
ATOM   7847  C  CD  . ARG B  2 133  ? 14.650  -28.406 -11.503 1.00 294.44 ? 133  ARG B CD  1 
ATOM   7848  N  NE  . ARG B  2 133  ? 13.913  -28.842 -12.685 1.00 290.26 ? 133  ARG B NE  1 
ATOM   7849  C  CZ  . ARG B  2 133  ? 14.213  -29.922 -13.401 1.00 332.90 ? 133  ARG B CZ  1 
ATOM   7850  N  NH1 . ARG B  2 133  ? 15.240  -30.690 -13.062 1.00 339.41 ? 133  ARG B NH1 1 
ATOM   7851  N  NH2 . ARG B  2 133  ? 13.483  -30.237 -14.462 1.00 355.17 ? 133  ARG B NH2 1 
ATOM   7852  N  N   . ALA B  2 134  ? 12.506  -27.541 -6.952  1.00 330.10 ? 134  ALA B N   1 
ATOM   7853  C  CA  . ALA B  2 134  ? 13.117  -27.021 -5.739  1.00 295.46 ? 134  ALA B CA  1 
ATOM   7854  C  C   . ALA B  2 134  ? 12.450  -27.657 -4.521  1.00 299.99 ? 134  ALA B C   1 
ATOM   7855  O  O   . ALA B  2 134  ? 12.931  -27.529 -3.396  1.00 242.77 ? 134  ALA B O   1 
ATOM   7856  C  CB  . ALA B  2 134  ? 12.996  -25.501 -5.700  1.00 231.63 ? 134  ALA B CB  1 
ATOM   7857  N  N   . LEU B  2 135  ? 11.346  -28.357 -4.762  1.00 332.92 ? 135  LEU B N   1 
ATOM   7858  C  CA  . LEU B  2 135  ? 10.598  -29.023 -3.703  1.00 319.75 ? 135  LEU B CA  1 
ATOM   7859  C  C   . LEU B  2 135  ? 11.002  -30.485 -3.626  1.00 320.93 ? 135  LEU B C   1 
ATOM   7860  O  O   . LEU B  2 135  ? 10.758  -31.162 -2.628  1.00 294.56 ? 135  LEU B O   1 
ATOM   7861  C  CB  . LEU B  2 135  ? 9.096   -28.916 -3.978  1.00 296.18 ? 135  LEU B CB  1 
ATOM   7862  C  CG  . LEU B  2 135  ? 8.179   -29.846 -3.182  1.00 262.65 ? 135  LEU B CG  1 
ATOM   7863  C  CD1 . LEU B  2 135  ? 8.324   -29.577 -1.705  1.00 204.56 ? 135  LEU B CD1 1 
ATOM   7864  C  CD2 . LEU B  2 135  ? 6.734   -29.675 -3.618  1.00 247.52 ? 135  LEU B CD2 1 
ATOM   7865  N  N   . ASN B  2 136  ? 11.636  -30.958 -4.691  1.00 333.79 ? 136  ASN B N   1 
ATOM   7866  C  CA  . ASN B  2 136  ? 11.970  -32.362 -4.822  1.00 353.01 ? 136  ASN B CA  1 
ATOM   7867  C  C   . ASN B  2 136  ? 12.949  -32.830 -3.752  1.00 365.57 ? 136  ASN B C   1 
ATOM   7868  O  O   . ASN B  2 136  ? 12.770  -33.896 -3.168  1.00 377.62 ? 136  ASN B O   1 
ATOM   7869  C  CB  . ASN B  2 136  ? 12.548  -32.624 -6.213  1.00 376.03 ? 136  ASN B CB  1 
ATOM   7870  C  CG  . ASN B  2 136  ? 12.727  -34.098 -6.500  1.00 380.14 ? 136  ASN B CG  1 
ATOM   7871  O  OD1 . ASN B  2 136  ? 12.368  -34.948 -5.686  1.00 388.00 ? 136  ASN B OD1 1 
ATOM   7872  N  ND2 . ASN B  2 136  ? 13.284  -34.411 -7.665  1.00 370.55 ? 136  ASN B ND2 1 
ATOM   7873  N  N   . GLU B  2 137  ? 13.975  -32.028 -3.489  1.00 358.09 ? 137  GLU B N   1 
ATOM   7874  C  CA  . GLU B  2 137  ? 15.048  -32.443 -2.592  1.00 319.75 ? 137  GLU B CA  1 
ATOM   7875  C  C   . GLU B  2 137  ? 14.519  -32.849 -1.231  1.00 298.83 ? 137  GLU B C   1 
ATOM   7876  O  O   . GLU B  2 137  ? 14.545  -34.021 -0.869  1.00 318.18 ? 137  GLU B O   1 
ATOM   7877  C  CB  . GLU B  2 137  ? 16.078  -31.329 -2.410  1.00 284.84 ? 137  GLU B CB  1 
ATOM   7878  C  CG  . GLU B  2 137  ? 16.648  -30.803 -3.702  1.00 295.21 ? 137  GLU B CG  1 
ATOM   7879  C  CD  . GLU B  2 137  ? 15.833  -29.659 -4.256  1.00 298.48 ? 137  GLU B CD  1 
ATOM   7880  O  OE1 . GLU B  2 137  ? 15.006  -29.104 -3.504  1.00 284.88 ? 137  GLU B OE1 1 
ATOM   7881  O  OE2 . GLU B  2 137  ? 16.017  -29.315 -5.440  1.00 304.25 ? 137  GLU B OE2 1 
ATOM   7882  N  N   . ILE B  2 138  ? 14.039  -31.874 -0.477  1.00 248.37 ? 138  ILE B N   1 
ATOM   7883  C  CA  . ILE B  2 138  ? 13.649  -32.124 0.899   1.00 274.42 ? 138  ILE B CA  1 
ATOM   7884  C  C   . ILE B  2 138  ? 12.318  -32.861 0.970   1.00 319.98 ? 138  ILE B C   1 
ATOM   7885  O  O   . ILE B  2 138  ? 12.267  -34.032 1.336   1.00 366.67 ? 138  ILE B O   1 
ATOM   7886  C  CB  . ILE B  2 138  ? 13.548  -30.817 1.682   1.00 258.64 ? 138  ILE B CB  1 
ATOM   7887  C  CG1 . ILE B  2 138  ? 14.711  -29.895 1.311   1.00 209.80 ? 138  ILE B CG1 1 
ATOM   7888  C  CG2 . ILE B  2 138  ? 13.530  -31.094 3.178   1.00 224.89 ? 138  ILE B CG2 1 
ATOM   7889  C  CD1 . ILE B  2 138  ? 16.065  -30.546 1.405   1.00 188.36 ? 138  ILE B CD1 1 
ATOM   7890  N  N   . THR B  2 139  ? 11.240  -32.172 0.613   1.00 295.61 ? 139  THR B N   1 
ATOM   7891  C  CA  . THR B  2 139  ? 9.902   -32.749 0.693   1.00 266.30 ? 139  THR B CA  1 
ATOM   7892  C  C   . THR B  2 139  ? 9.573   -33.493 -0.590  1.00 252.83 ? 139  THR B C   1 
ATOM   7893  O  O   . THR B  2 139  ? 10.232  -33.315 -1.613  1.00 265.22 ? 139  THR B O   1 
ATOM   7894  C  CB  . THR B  2 139  ? 8.843   -31.661 0.906   1.00 265.12 ? 139  THR B CB  1 
ATOM   7895  O  OG1 . THR B  2 139  ? 9.312   -30.726 1.878   1.00 299.75 ? 139  THR B OG1 1 
ATOM   7896  C  CG2 . THR B  2 139  ? 7.530   -32.253 1.374   1.00 234.32 ? 139  THR B CG2 1 
ATOM   7897  N  N   . GLU B  2 140  ? 8.547   -34.331 -0.531  1.00 232.39 ? 140  GLU B N   1 
ATOM   7898  C  CA  . GLU B  2 140  ? 8.126   -35.095 -1.693  1.00 287.62 ? 140  GLU B CA  1 
ATOM   7899  C  C   . GLU B  2 140  ? 6.883   -34.467 -2.314  1.00 311.50 ? 140  GLU B C   1 
ATOM   7900  O  O   . GLU B  2 140  ? 6.861   -33.266 -2.583  1.00 303.55 ? 140  GLU B O   1 
ATOM   7901  C  CB  . GLU B  2 140  ? 7.876   -36.553 -1.306  1.00 308.76 ? 140  GLU B CB  1 
ATOM   7902  C  CG  . GLU B  2 140  ? 6.957   -36.737 -0.117  1.00 293.27 ? 140  GLU B CG  1 
ATOM   7903  C  CD  . GLU B  2 140  ? 6.696   -38.196 0.182   1.00 300.66 ? 140  GLU B CD  1 
ATOM   7904  O  OE1 . GLU B  2 140  ? 7.257   -39.058 -0.526  1.00 353.51 ? 140  GLU B OE1 1 
ATOM   7905  O  OE2 . GLU B  2 140  ? 5.931   -38.484 1.124   1.00 251.37 ? 140  GLU B OE2 1 
ATOM   7906  N  N   . SER B  2 141  ? 5.854   -35.276 -2.538  1.00 335.33 ? 141  SER B N   1 
ATOM   7907  C  CA  . SER B  2 141  ? 4.641   -34.797 -3.180  1.00 339.84 ? 141  SER B CA  1 
ATOM   7908  C  C   . SER B  2 141  ? 3.977   -33.732 -2.327  1.00 323.16 ? 141  SER B C   1 
ATOM   7909  O  O   . SER B  2 141  ? 3.217   -34.044 -1.414  1.00 311.45 ? 141  SER B O   1 
ATOM   7910  C  CB  . SER B  2 141  ? 3.673   -35.955 -3.422  1.00 352.94 ? 141  SER B CB  1 
ATOM   7911  O  OG  . SER B  2 141  ? 3.381   -36.640 -2.218  1.00 370.65 ? 141  SER B OG  1 
ATOM   7912  N  N   . GLY B  2 142  ? 4.272   -32.472 -2.624  1.00 309.80 ? 142  GLY B N   1 
ATOM   7913  C  CA  . GLY B  2 142  ? 3.659   -31.365 -1.920  1.00 287.36 ? 142  GLY B CA  1 
ATOM   7914  C  C   . GLY B  2 142  ? 2.424   -30.876 -2.649  1.00 307.34 ? 142  GLY B C   1 
ATOM   7915  O  O   . GLY B  2 142  ? 1.812   -31.613 -3.421  1.00 342.67 ? 142  GLY B O   1 
ATOM   7916  N  N   . ARG B  2 143  ? 2.055   -29.625 -2.400  1.00 298.24 ? 143  ARG B N   1 
ATOM   7917  C  CA  . ARG B  2 143  ? 0.893   -29.024 -3.042  1.00 275.09 ? 143  ARG B CA  1 
ATOM   7918  C  C   . ARG B  2 143  ? 1.232   -27.612 -3.481  1.00 228.13 ? 143  ARG B C   1 
ATOM   7919  O  O   . ARG B  2 143  ? 2.125   -26.979 -2.923  1.00 240.33 ? 143  ARG B O   1 
ATOM   7920  C  CB  . ARG B  2 143  ? -0.301  -28.999 -2.086  1.00 316.42 ? 143  ARG B CB  1 
ATOM   7921  C  CG  . ARG B  2 143  ? -0.804  -30.369 -1.698  1.00 299.61 ? 143  ARG B CG  1 
ATOM   7922  C  CD  . ARG B  2 143  ? -1.443  -31.063 -2.877  1.00 261.33 ? 143  ARG B CD  1 
ATOM   7923  N  NE  . ARG B  2 143  ? -1.931  -32.383 -2.510  1.00 272.29 ? 143  ARG B NE  1 
ATOM   7924  C  CZ  . ARG B  2 143  ? -3.073  -32.606 -1.869  1.00 270.87 ? 143  ARG B CZ  1 
ATOM   7925  N  NH1 . ARG B  2 143  ? -3.855  -31.593 -1.520  1.00 241.44 ? 143  ARG B NH1 1 
ATOM   7926  N  NH2 . ARG B  2 143  ? -3.433  -33.848 -1.576  1.00 286.62 ? 143  ARG B NH2 1 
ATOM   7927  N  N   . ILE B  2 144  ? 0.520   -27.121 -4.485  1.00 220.37 ? 144  ILE B N   1 
ATOM   7928  C  CA  . ILE B  2 144  ? 0.759   -25.780 -4.993  1.00 250.52 ? 144  ILE B CA  1 
ATOM   7929  C  C   . ILE B  2 144  ? -0.560  -25.065 -5.270  1.00 254.48 ? 144  ILE B C   1 
ATOM   7930  O  O   . ILE B  2 144  ? -1.434  -25.596 -5.953  1.00 264.37 ? 144  ILE B O   1 
ATOM   7931  C  CB  . ILE B  2 144  ? 1.607   -25.818 -6.279  1.00 283.98 ? 144  ILE B CB  1 
ATOM   7932  C  CG1 . ILE B  2 144  ? 3.013   -26.361 -5.987  1.00 289.45 ? 144  ILE B CG1 1 
ATOM   7933  C  CG2 . ILE B  2 144  ? 1.706   -24.432 -6.890  1.00 286.05 ? 144  ILE B CG2 1 
ATOM   7934  C  CD1 . ILE B  2 144  ? 3.121   -27.873 -6.004  1.00 287.09 ? 144  ILE B CD1 1 
ATOM   7935  N  N   . GLY B  2 145  ? -0.699  -23.859 -4.728  1.00 255.79 ? 145  GLY B N   1 
ATOM   7936  C  CA  . GLY B  2 145  ? -1.898  -23.061 -4.922  1.00 280.78 ? 145  GLY B CA  1 
ATOM   7937  C  C   . GLY B  2 145  ? -1.571  -21.612 -5.231  1.00 288.80 ? 145  GLY B C   1 
ATOM   7938  O  O   . GLY B  2 145  ? -0.463  -21.154 -4.962  1.00 281.11 ? 145  GLY B O   1 
ATOM   7939  N  N   . PHE B  2 146  ? -2.535  -20.888 -5.795  1.00 303.06 ? 146  PHE B N   1 
ATOM   7940  C  CA  . PHE B  2 146  ? -2.333  -19.481 -6.135  1.00 288.63 ? 146  PHE B CA  1 
ATOM   7941  C  C   . PHE B  2 146  ? -3.526  -18.618 -5.733  1.00 270.06 ? 146  PHE B C   1 
ATOM   7942  O  O   . PHE B  2 146  ? -4.675  -19.059 -5.779  1.00 250.12 ? 146  PHE B O   1 
ATOM   7943  C  CB  . PHE B  2 146  ? -2.075  -19.325 -7.636  1.00 266.44 ? 146  PHE B CB  1 
ATOM   7944  C  CG  . PHE B  2 146  ? -1.876  -17.895 -8.076  1.00 273.08 ? 146  PHE B CG  1 
ATOM   7945  C  CD1 . PHE B  2 146  ? -0.618  -17.309 -8.031  1.00 244.50 ? 146  PHE B CD1 1 
ATOM   7946  C  CD2 . PHE B  2 146  ? -2.942  -17.139 -8.539  1.00 275.37 ? 146  PHE B CD2 1 
ATOM   7947  C  CE1 . PHE B  2 146  ? -0.429  -15.994 -8.436  1.00 199.22 ? 146  PHE B CE1 1 
ATOM   7948  C  CE2 . PHE B  2 146  ? -2.758  -15.823 -8.946  1.00 253.75 ? 146  PHE B CE2 1 
ATOM   7949  C  CZ  . PHE B  2 146  ? -1.498  -15.251 -8.894  1.00 174.95 ? 146  PHE B CZ  1 
ATOM   7950  N  N   . GLY B  2 147  ? -3.238  -17.381 -5.345  1.00 259.36 ? 147  GLY B N   1 
ATOM   7951  C  CA  . GLY B  2 147  ? -4.272  -16.433 -4.989  1.00 251.15 ? 147  GLY B CA  1 
ATOM   7952  C  C   . GLY B  2 147  ? -3.846  -15.023 -5.327  1.00 233.89 ? 147  GLY B C   1 
ATOM   7953  O  O   . GLY B  2 147  ? -2.787  -14.562 -4.904  1.00 248.85 ? 147  GLY B O   1 
ATOM   7954  N  N   . SER B  2 148  ? -4.679  -14.335 -6.097  1.00 187.50 ? 148  SER B N   1 
ATOM   7955  C  CA  . SER B  2 148  ? -4.382  -12.972 -6.510  1.00 210.46 ? 148  SER B CA  1 
ATOM   7956  C  C   . SER B  2 148  ? -5.039  -11.957 -5.578  1.00 267.85 ? 148  SER B C   1 
ATOM   7957  O  O   . SER B  2 148  ? -5.958  -12.293 -4.833  1.00 300.39 ? 148  SER B O   1 
ATOM   7958  C  CB  . SER B  2 148  ? -4.869  -12.752 -7.936  1.00 219.31 ? 148  SER B CB  1 
ATOM   7959  O  OG  . SER B  2 148  ? -4.606  -11.429 -8.357  1.00 251.09 ? 148  SER B OG  1 
ATOM   7960  N  N   . PHE B  2 149  ? -4.561  -10.716 -5.623  1.00 288.90 ? 149  PHE B N   1 
ATOM   7961  C  CA  . PHE B  2 149  ? -5.122  -9.642  -4.804  1.00 291.43 ? 149  PHE B CA  1 
ATOM   7962  C  C   . PHE B  2 149  ? -4.633  -8.263  -5.249  1.00 282.73 ? 149  PHE B C   1 
ATOM   7963  O  O   . PHE B  2 149  ? -3.521  -8.125  -5.751  1.00 304.63 ? 149  PHE B O   1 
ATOM   7964  C  CB  . PHE B  2 149  ? -4.766  -9.855  -3.331  1.00 270.96 ? 149  PHE B CB  1 
ATOM   7965  C  CG  . PHE B  2 149  ? -3.318  -9.601  -3.010  1.00 266.18 ? 149  PHE B CG  1 
ATOM   7966  C  CD1 . PHE B  2 149  ? -2.856  -8.310  -2.784  1.00 258.30 ? 149  PHE B CD1 1 
ATOM   7967  C  CD2 . PHE B  2 149  ? -2.421  -10.652 -2.924  1.00 263.17 ? 149  PHE B CD2 1 
ATOM   7968  C  CE1 . PHE B  2 149  ? -1.527  -8.075  -2.486  1.00 253.81 ? 149  PHE B CE1 1 
ATOM   7969  C  CE2 . PHE B  2 149  ? -1.092  -10.423 -2.626  1.00 270.38 ? 149  PHE B CE2 1 
ATOM   7970  C  CZ  . PHE B  2 149  ? -0.644  -9.133  -2.407  1.00 275.17 ? 149  PHE B CZ  1 
ATOM   7971  N  N   . VAL B  2 150  ? -5.461  -7.241  -5.052  1.00 246.12 ? 150  VAL B N   1 
ATOM   7972  C  CA  . VAL B  2 150  ? -5.100  -5.881  -5.440  1.00 236.11 ? 150  VAL B CA  1 
ATOM   7973  C  C   . VAL B  2 150  ? -5.409  -4.883  -4.326  1.00 276.52 ? 150  VAL B C   1 
ATOM   7974  O  O   . VAL B  2 150  ? -4.511  -4.451  -3.602  1.00 291.40 ? 150  VAL B O   1 
ATOM   7975  C  CB  . VAL B  2 150  ? -5.842  -5.449  -6.718  1.00 315.40 ? 150  VAL B CB  1 
ATOM   7976  C  CG1 . VAL B  2 150  ? -5.394  -4.060  -7.147  1.00 393.66 ? 150  VAL B CG1 1 
ATOM   7977  C  CG2 . VAL B  2 150  ? -5.613  -6.455  -7.833  1.00 327.29 ? 150  VAL B CG2 1 
ATOM   7978  N  N   . ASP B  2 151  ? -6.684  -4.524  -4.197  1.00 292.52 ? 151  ASP B N   1 
ATOM   7979  C  CA  . ASP B  2 151  ? -7.121  -3.552  -3.198  1.00 251.77 ? 151  ASP B CA  1 
ATOM   7980  C  C   . ASP B  2 151  ? -8.647  -3.437  -3.225  1.00 238.19 ? 151  ASP B C   1 
ATOM   7981  O  O   . ASP B  2 151  ? -9.283  -3.810  -4.209  1.00 284.04 ? 151  ASP B O   1 
ATOM   7982  C  CB  . ASP B  2 151  ? -6.474  -2.193  -3.478  1.00 215.26 ? 151  ASP B CB  1 
ATOM   7983  C  CG  . ASP B  2 151  ? -6.295  -1.360  -2.234  1.00 218.47 ? 151  ASP B CG  1 
ATOM   7984  O  OD1 . ASP B  2 151  ? -6.745  -1.791  -1.152  1.00 288.41 ? 151  ASP B OD1 1 
ATOM   7985  O  OD2 . ASP B  2 151  ? -5.692  -0.271  -2.342  1.00 185.69 ? 151  ASP B OD2 1 
ATOM   7986  N  N   . LYS B  2 152  ? -9.233  -2.928  -2.146  1.00 210.01 ? 152  LYS B N   1 
ATOM   7987  C  CA  . LYS B  2 152  ? -10.687 -2.811  -2.046  1.00 252.50 ? 152  LYS B CA  1 
ATOM   7988  C  C   . LYS B  2 152  ? -11.292 -2.256  -3.334  1.00 253.15 ? 152  LYS B C   1 
ATOM   7989  O  O   . LYS B  2 152  ? -10.684 -1.431  -4.027  1.00 195.56 ? 152  LYS B O   1 
ATOM   7990  C  CB  . LYS B  2 152  ? -11.074 -1.918  -0.864  1.00 300.41 ? 152  LYS B CB  1 
ATOM   7991  C  CG  . LYS B  2 152  ? -12.545 -2.000  -0.471  1.00 333.53 ? 152  LYS B CG  1 
ATOM   7992  C  CD  . LYS B  2 152  ? -12.958 -0.809  0.374   1.00 393.60 ? 152  LYS B CD  1 
ATOM   7993  C  CE  . LYS B  2 152  ? -12.074 -0.657  1.596   1.00 452.82 ? 152  LYS B CE  1 
ATOM   7994  N  NZ  . LYS B  2 152  ? -12.375 0.599   2.329   1.00 493.81 ? 152  LYS B NZ  1 
ATOM   7995  N  N   . THR B  2 153  ? -12.500 -2.715  -3.645  1.00 270.95 ? 153  THR B N   1 
ATOM   7996  C  CA  . THR B  2 153  ? -13.184 -2.295  -4.856  1.00 251.52 ? 153  THR B CA  1 
ATOM   7997  C  C   . THR B  2 153  ? -13.541 -0.821  -4.780  1.00 236.10 ? 153  THR B C   1 
ATOM   7998  O  O   . THR B  2 153  ? -13.247 -0.058  -5.695  1.00 163.51 ? 153  THR B O   1 
ATOM   7999  C  CB  . THR B  2 153  ? -14.478 -3.092  -5.077  1.00 279.35 ? 153  THR B CB  1 
ATOM   8000  O  OG1 . THR B  2 153  ? -14.235 -4.481  -4.829  1.00 294.61 ? 153  THR B OG1 1 
ATOM   8001  C  CG2 . THR B  2 153  ? -14.986 -2.902  -6.503  1.00 283.96 ? 153  THR B CG2 1 
ATOM   8002  N  N   . VAL B  2 154  ? -14.166 -0.424  -3.675  1.00 276.76 ? 154  VAL B N   1 
ATOM   8003  C  CA  . VAL B  2 154  ? -14.677 0.936   -3.533  1.00 271.70 ? 154  VAL B CA  1 
ATOM   8004  C  C   . VAL B  2 154  ? -13.573 1.920   -3.155  1.00 245.15 ? 154  VAL B C   1 
ATOM   8005  O  O   . VAL B  2 154  ? -12.548 1.526   -2.598  1.00 232.19 ? 154  VAL B O   1 
ATOM   8006  C  CB  . VAL B  2 154  ? -15.818 1.006   -2.490  1.00 289.64 ? 154  VAL B CB  1 
ATOM   8007  C  CG1 . VAL B  2 154  ? -15.305 0.654   -1.102  1.00 315.99 ? 154  VAL B CG1 1 
ATOM   8008  C  CG2 . VAL B  2 154  ? -16.469 2.387   -2.497  1.00 263.35 ? 154  VAL B CG2 1 
ATOM   8009  N  N   . LEU B  2 155  ? -13.791 3.194   -3.468  1.00 233.87 ? 155  LEU B N   1 
ATOM   8010  C  CA  . LEU B  2 155  ? -12.822 4.236   -3.181  1.00 231.96 ? 155  LEU B CA  1 
ATOM   8011  C  C   . LEU B  2 155  ? -12.751 4.404   -1.680  1.00 282.05 ? 155  LEU B C   1 
ATOM   8012  O  O   . LEU B  2 155  ? -13.546 3.806   -0.948  1.00 335.30 ? 155  LEU B O   1 
ATOM   8013  C  CB  . LEU B  2 155  ? -13.241 5.546   -3.846  1.00 207.46 ? 155  LEU B CB  1 
ATOM   8014  C  CG  . LEU B  2 155  ? -14.610 6.090   -3.460  1.00 232.81 ? 155  LEU B CG  1 
ATOM   8015  C  CD1 . LEU B  2 155  ? -14.623 6.799   -2.111  1.00 282.99 ? 155  LEU B CD1 1 
ATOM   8016  C  CD2 . LEU B  2 155  ? -15.005 7.023   -4.550  1.00 210.55 ? 155  LEU B CD2 1 
ATOM   8017  N  N   . PRO B  2 156  ? -11.832 5.256   -1.212  1.00 266.47 ? 156  PRO B N   1 
ATOM   8018  C  CA  . PRO B  2 156  ? -10.844 5.985   -2.023  1.00 233.93 ? 156  PRO B CA  1 
ATOM   8019  C  C   . PRO B  2 156  ? -9.652  5.159   -2.526  1.00 215.48 ? 156  PRO B C   1 
ATOM   8020  O  O   . PRO B  2 156  ? -8.676  5.753   -2.997  1.00 168.16 ? 156  PRO B O   1 
ATOM   8021  C  CB  . PRO B  2 156  ? -10.357 7.079   -1.074  1.00 251.32 ? 156  PRO B CB  1 
ATOM   8022  C  CG  . PRO B  2 156  ? -11.430 7.184   -0.022  1.00 284.37 ? 156  PRO B CG  1 
ATOM   8023  C  CD  . PRO B  2 156  ? -11.954 5.814   0.144   1.00 275.54 ? 156  PRO B CD  1 
ATOM   8024  N  N   . PHE B  2 157  ? -9.740  3.831   -2.452  1.00 238.45 ? 157  PHE B N   1 
ATOM   8025  C  CA  . PHE B  2 157  ? -8.631  2.954   -2.829  1.00 249.91 ? 157  PHE B CA  1 
ATOM   8026  C  C   . PHE B  2 157  ? -8.517  2.778   -4.340  1.00 268.88 ? 157  PHE B C   1 
ATOM   8027  O  O   . PHE B  2 157  ? -7.449  2.438   -4.854  1.00 234.86 ? 157  PHE B O   1 
ATOM   8028  C  CB  . PHE B  2 157  ? -8.791  1.583   -2.170  1.00 245.64 ? 157  PHE B CB  1 
ATOM   8029  C  CG  . PHE B  2 157  ? -8.778  1.627   -0.666  1.00 246.78 ? 157  PHE B CG  1 
ATOM   8030  C  CD1 . PHE B  2 157  ? -9.869  2.106   0.039   1.00 226.11 ? 157  PHE B CD1 1 
ATOM   8031  C  CD2 . PHE B  2 157  ? -7.678  1.179   0.042   1.00 239.11 ? 157  PHE B CD2 1 
ATOM   8032  C  CE1 . PHE B  2 157  ? -9.859  2.141   1.416   1.00 197.96 ? 157  PHE B CE1 1 
ATOM   8033  C  CE2 . PHE B  2 157  ? -7.664  1.214   1.422   1.00 199.18 ? 157  PHE B CE2 1 
ATOM   8034  C  CZ  . PHE B  2 157  ? -8.757  1.694   2.109   1.00 240.77 ? 157  PHE B CZ  1 
ATOM   8035  N  N   . VAL B  2 158  ? -9.632  2.977   -5.039  1.00 299.80 ? 158  VAL B N   1 
ATOM   8036  C  CA  . VAL B  2 158  ? -9.640  3.017   -6.500  1.00 301.77 ? 158  VAL B CA  1 
ATOM   8037  C  C   . VAL B  2 158  ? -10.960 3.588   -7.029  1.00 324.69 ? 158  VAL B C   1 
ATOM   8038  O  O   . VAL B  2 158  ? -12.028 3.271   -6.508  1.00 349.21 ? 158  VAL B O   1 
ATOM   8039  C  CB  . VAL B  2 158  ? -9.418  1.620   -7.109  1.00 254.62 ? 158  VAL B CB  1 
ATOM   8040  C  CG1 . VAL B  2 158  ? -10.382 0.607   -6.504  1.00 195.48 ? 158  VAL B CG1 1 
ATOM   8041  C  CG2 . VAL B  2 158  ? -9.564  1.680   -8.628  1.00 242.54 ? 158  VAL B CG2 1 
ATOM   8042  N  N   . ASN B  2 159  ? -10.882 4.422   -8.065  1.00 316.97 ? 159  ASN B N   1 
ATOM   8043  C  CA  . ASN B  2 159  ? -12.067 5.074   -8.623  1.00 282.62 ? 159  ASN B CA  1 
ATOM   8044  C  C   . ASN B  2 159  ? -13.186 4.065   -8.881  1.00 272.53 ? 159  ASN B C   1 
ATOM   8045  O  O   . ASN B  2 159  ? -13.014 3.108   -9.634  1.00 211.27 ? 159  ASN B O   1 
ATOM   8046  C  CB  . ASN B  2 159  ? -11.702 5.825   -9.905  1.00 187.31 ? 159  ASN B CB  1 
ATOM   8047  C  CG  . ASN B  2 159  ? -10.876 4.985   -10.848 1.00 233.22 ? 159  ASN B CG  1 
ATOM   8048  O  OD1 . ASN B  2 159  ? -11.188 3.823   -11.097 1.00 293.11 ? 159  ASN B OD1 1 
ATOM   8049  N  ND2 . ASN B  2 159  ? -9.810  5.565   -11.377 1.00 237.08 ? 159  ASN B ND2 1 
ATOM   8050  N  N   . THR B  2 160  ? -14.329 4.282   -8.237  1.00 303.24 ? 160  THR B N   1 
ATOM   8051  C  CA  . THR B  2 160  ? -15.429 3.326   -8.282  1.00 322.46 ? 160  THR B CA  1 
ATOM   8052  C  C   . THR B  2 160  ? -16.296 3.523   -9.505  1.00 334.06 ? 160  THR B C   1 
ATOM   8053  O  O   . THR B  2 160  ? -16.934 2.586   -9.976  1.00 364.53 ? 160  THR B O   1 
ATOM   8054  C  CB  . THR B  2 160  ? -16.323 3.445   -7.039  1.00 361.87 ? 160  THR B CB  1 
ATOM   8055  O  OG1 . THR B  2 160  ? -16.865 4.770   -6.948  1.00 355.62 ? 160  THR B OG1 1 
ATOM   8056  C  CG2 . THR B  2 160  ? -15.519 3.144   -5.807  1.00 388.58 ? 160  THR B CG2 1 
ATOM   8057  N  N   . HIS B  2 161  ? -16.339 4.753   -9.997  1.00 337.13 ? 161  HIS B N   1 
ATOM   8058  C  CA  . HIS B  2 161  ? -17.042 5.036   -11.233 1.00 376.85 ? 161  HIS B CA  1 
ATOM   8059  C  C   . HIS B  2 161  ? -16.248 6.013   -12.095 1.00 356.74 ? 161  HIS B C   1 
ATOM   8060  O  O   . HIS B  2 161  ? -15.450 6.797   -11.578 1.00 352.40 ? 161  HIS B O   1 
ATOM   8061  C  CB  . HIS B  2 161  ? -18.435 5.609   -10.946 1.00 405.09 ? 161  HIS B CB  1 
ATOM   8062  C  CG  . HIS B  2 161  ? -19.487 4.569   -10.707 1.00 415.64 ? 161  HIS B CG  1 
ATOM   8063  N  ND1 . HIS B  2 161  ? -20.119 4.409   -9.492  1.00 402.68 ? 161  HIS B ND1 1 
ATOM   8064  C  CD2 . HIS B  2 161  ? -20.023 3.638   -11.533 1.00 423.16 ? 161  HIS B CD2 1 
ATOM   8065  C  CE1 . HIS B  2 161  ? -20.997 3.426   -9.580  1.00 403.53 ? 161  HIS B CE1 1 
ATOM   8066  N  NE2 . HIS B  2 161  ? -20.958 2.941   -10.808 1.00 415.07 ? 161  HIS B NE2 1 
ATOM   8067  N  N   . PRO B  2 162  ? -16.476 5.976   -13.417 1.00 290.31 ? 162  PRO B N   1 
ATOM   8068  C  CA  . PRO B  2 162  ? -17.267 4.925   -14.072 1.00 236.51 ? 162  PRO B CA  1 
ATOM   8069  C  C   . PRO B  2 162  ? -16.478 3.859   -14.845 1.00 222.32 ? 162  PRO B C   1 
ATOM   8070  O  O   . PRO B  2 162  ? -15.947 2.949   -14.229 1.00 172.56 ? 162  PRO B O   1 
ATOM   8071  C  CB  . PRO B  2 162  ? -18.137 5.711   -15.035 1.00 230.00 ? 162  PRO B CB  1 
ATOM   8072  C  CG  . PRO B  2 162  ? -17.301 6.886   -15.391 1.00 142.03 ? 162  PRO B CG  1 
ATOM   8073  C  CD  . PRO B  2 162  ? -16.485 7.226   -14.193 1.00 247.16 ? 162  PRO B CD  1 
ATOM   8074  N  N   . ASP B  2 163  ? -16.409 3.969   -16.168 1.00 315.07 ? 163  ASP B N   1 
ATOM   8075  C  CA  . ASP B  2 163  ? -16.023 2.832   -17.005 1.00 347.78 ? 163  ASP B CA  1 
ATOM   8076  C  C   . ASP B  2 163  ? -14.515 2.734   -17.220 1.00 333.48 ? 163  ASP B C   1 
ATOM   8077  O  O   . ASP B  2 163  ? -14.038 1.885   -17.973 1.00 328.76 ? 163  ASP B O   1 
ATOM   8078  C  CB  . ASP B  2 163  ? -16.787 2.871   -18.332 1.00 345.19 ? 163  ASP B CB  1 
ATOM   8079  C  CG  . ASP B  2 163  ? -16.243 3.902   -19.298 1.00 301.81 ? 163  ASP B CG  1 
ATOM   8080  O  OD1 . ASP B  2 163  ? -15.495 4.798   -18.860 1.00 307.45 ? 163  ASP B OD1 1 
ATOM   8081  O  OD2 . ASP B  2 163  ? -16.576 3.819   -20.498 1.00 255.66 ? 163  ASP B OD2 1 
ATOM   8082  N  N   . LYS B  2 164  ? -13.775 3.621   -16.567 1.00 305.32 ? 164  LYS B N   1 
ATOM   8083  C  CA  . LYS B  2 164  ? -12.374 3.376   -16.276 1.00 260.87 ? 164  LYS B CA  1 
ATOM   8084  C  C   . LYS B  2 164  ? -12.313 2.230   -15.267 1.00 244.20 ? 164  LYS B C   1 
ATOM   8085  O  O   . LYS B  2 164  ? -11.266 1.616   -15.060 1.00 214.89 ? 164  LYS B O   1 
ATOM   8086  C  CB  . LYS B  2 164  ? -11.716 4.633   -15.713 1.00 211.33 ? 164  LYS B CB  1 
ATOM   8087  C  CG  . LYS B  2 164  ? -10.385 4.373   -15.049 1.00 176.54 ? 164  LYS B CG  1 
ATOM   8088  C  CD  . LYS B  2 164  ? -9.497  5.600   -15.096 1.00 211.10 ? 164  LYS B CD  1 
ATOM   8089  C  CE  . LYS B  2 164  ? -8.075  5.253   -14.713 1.00 235.25 ? 164  LYS B CE  1 
ATOM   8090  N  NZ  . LYS B  2 164  ? -7.167  6.421   -14.840 1.00 248.72 ? 164  LYS B NZ  1 
ATOM   8091  N  N   . LEU B  2 165  ? -13.452 1.966   -14.631 1.00 248.18 ? 165  LEU B N   1 
ATOM   8092  C  CA  . LEU B  2 165  ? -13.637 0.787   -13.785 1.00 246.66 ? 165  LEU B CA  1 
ATOM   8093  C  C   . LEU B  2 165  ? -13.652 -0.444  -14.672 1.00 253.10 ? 165  LEU B C   1 
ATOM   8094  O  O   . LEU B  2 165  ? -13.079 -1.476  -14.326 1.00 212.17 ? 165  LEU B O   1 
ATOM   8095  C  CB  . LEU B  2 165  ? -14.953 0.866   -12.997 1.00 269.89 ? 165  LEU B CB  1 
ATOM   8096  C  CG  . LEU B  2 165  ? -15.319 -0.340  -12.124 1.00 269.43 ? 165  LEU B CG  1 
ATOM   8097  C  CD1 . LEU B  2 165  ? -14.326 -0.504  -10.990 1.00 204.87 ? 165  LEU B CD1 1 
ATOM   8098  C  CD2 . LEU B  2 165  ? -16.738 -0.205  -11.577 1.00 315.05 ? 165  LEU B CD2 1 
ATOM   8099  N  N   . ARG B  2 166  ? -14.321 -0.330  -15.817 1.00 307.41 ? 166  ARG B N   1 
ATOM   8100  C  CA  . ARG B  2 166  ? -14.328 -1.396  -16.811 1.00 323.32 ? 166  ARG B CA  1 
ATOM   8101  C  C   . ARG B  2 166  ? -12.964 -1.493  -17.484 1.00 308.29 ? 166  ARG B C   1 
ATOM   8102  O  O   . ARG B  2 166  ? -12.623 -2.517  -18.069 1.00 302.02 ? 166  ARG B O   1 
ATOM   8103  C  CB  . ARG B  2 166  ? -15.407 -1.151  -17.873 1.00 330.31 ? 166  ARG B CB  1 
ATOM   8104  C  CG  . ARG B  2 166  ? -16.829 -1.204  -17.348 1.00 343.00 ? 166  ARG B CG  1 
ATOM   8105  C  CD  . ARG B  2 166  ? -17.837 -1.014  -18.466 1.00 344.40 ? 166  ARG B CD  1 
ATOM   8106  N  NE  . ARG B  2 166  ? -19.209 -1.108  -17.980 1.00 342.07 ? 166  ARG B NE  1 
ATOM   8107  C  CZ  . ARG B  2 166  ? -20.284 -0.969  -18.747 1.00 323.27 ? 166  ARG B CZ  1 
ATOM   8108  N  NH1 . ARG B  2 166  ? -20.148 -0.729  -20.045 1.00 337.99 ? 166  ARG B NH1 1 
ATOM   8109  N  NH2 . ARG B  2 166  ? -21.496 -1.069  -18.218 1.00 279.78 ? 166  ARG B NH2 1 
ATOM   8110  N  N   . ASN B  2 167  ? -12.182 -0.423  -17.393 1.00 311.18 ? 167  ASN B N   1 
ATOM   8111  C  CA  . ASN B  2 167  ? -10.895 -0.371  -18.069 1.00 298.38 ? 167  ASN B CA  1 
ATOM   8112  C  C   . ASN B  2 167  ? -9.876  0.474   -17.315 1.00 317.25 ? 167  ASN B C   1 
ATOM   8113  O  O   . ASN B  2 167  ? -9.537  1.575   -17.745 1.00 322.18 ? 167  ASN B O   1 
ATOM   8114  C  CB  . ASN B  2 167  ? -11.080 0.188   -19.473 1.00 302.23 ? 167  ASN B CB  1 
ATOM   8115  C  CG  . ASN B  2 167  ? -9.818  0.117   -20.295 1.00 321.49 ? 167  ASN B CG  1 
ATOM   8116  O  OD1 . ASN B  2 167  ? -8.742  -0.190  -19.783 1.00 327.80 ? 167  ASN B OD1 1 
ATOM   8117  N  ND2 . ASN B  2 167  ? -9.943  0.400   -21.583 1.00 338.80 ? 167  ASN B ND2 1 
ATOM   8118  N  N   . PRO B  2 168  ? -9.384  -0.044  -16.183 1.00 309.32 ? 168  PRO B N   1 
ATOM   8119  C  CA  . PRO B  2 168  ? -8.409  0.663   -15.344 1.00 275.85 ? 168  PRO B CA  1 
ATOM   8120  C  C   . PRO B  2 168  ? -7.036  0.813   -16.000 1.00 306.52 ? 168  PRO B C   1 
ATOM   8121  O  O   . PRO B  2 168  ? -6.313  1.758   -15.687 1.00 287.05 ? 168  PRO B O   1 
ATOM   8122  C  CB  . PRO B  2 168  ? -8.302  -0.231  -14.101 1.00 217.24 ? 168  PRO B CB  1 
ATOM   8123  C  CG  . PRO B  2 168  ? -9.523  -1.083  -14.117 1.00 215.53 ? 168  PRO B CG  1 
ATOM   8124  C  CD  . PRO B  2 168  ? -9.848  -1.292  -15.555 1.00 262.90 ? 168  PRO B CD  1 
ATOM   8125  N  N   . CYS B  2 169  ? -6.687  -0.108  -16.893 1.00 316.60 ? 169  CYS B N   1 
ATOM   8126  C  CA  . CYS B  2 169  ? -5.361  -0.121  -17.504 1.00 310.77 ? 169  CYS B CA  1 
ATOM   8127  C  C   . CYS B  2 169  ? -4.928  1.257   -17.995 1.00 325.86 ? 169  CYS B C   1 
ATOM   8128  O  O   . CYS B  2 169  ? -5.578  1.846   -18.860 1.00 334.83 ? 169  CYS B O   1 
ATOM   8129  C  CB  . CYS B  2 169  ? -5.326  -1.115  -18.658 1.00 322.49 ? 169  CYS B CB  1 
ATOM   8130  S  SG  . CYS B  2 169  ? -5.121  -2.828  -18.122 1.00 357.06 ? 169  CYS B SG  1 
ATOM   8131  N  N   . PRO B  2 170  ? -3.822  1.774   -17.437 1.00 306.37 ? 170  PRO B N   1 
ATOM   8132  C  CA  . PRO B  2 170  ? -3.301  3.103   -17.774 1.00 301.73 ? 170  PRO B CA  1 
ATOM   8133  C  C   . PRO B  2 170  ? -2.606  3.172   -19.126 1.00 307.09 ? 170  PRO B C   1 
ATOM   8134  O  O   . PRO B  2 170  ? -1.497  2.659   -19.274 1.00 309.23 ? 170  PRO B O   1 
ATOM   8135  C  CB  . PRO B  2 170  ? -2.273  3.372   -16.666 1.00 280.36 ? 170  PRO B CB  1 
ATOM   8136  C  CG  . PRO B  2 170  ? -2.539  2.363   -15.612 1.00 265.76 ? 170  PRO B CG  1 
ATOM   8137  C  CD  . PRO B  2 170  ? -3.086  1.176   -16.314 1.00 275.20 ? 170  PRO B CD  1 
ATOM   8138  N  N   . ASN B  2 171  ? -3.261  3.804   -20.093 1.00 306.19 ? 171  ASN B N   1 
ATOM   8139  C  CA  . ASN B  2 171  ? -2.637  4.142   -21.367 1.00 320.26 ? 171  ASN B CA  1 
ATOM   8140  C  C   . ASN B  2 171  ? -2.590  2.995   -22.376 1.00 336.23 ? 171  ASN B C   1 
ATOM   8141  O  O   . ASN B  2 171  ? -2.879  3.195   -23.553 1.00 355.62 ? 171  ASN B O   1 
ATOM   8142  C  CB  . ASN B  2 171  ? -1.225  4.685   -21.139 1.00 309.74 ? 171  ASN B CB  1 
ATOM   8143  C  CG  . ASN B  2 171  ? -0.671  5.378   -22.359 1.00 314.33 ? 171  ASN B CG  1 
ATOM   8144  O  OD1 . ASN B  2 171  ? -1.393  5.622   -23.323 1.00 334.26 ? 171  ASN B OD1 1 
ATOM   8145  N  ND2 . ASN B  2 171  ? 0.614   5.700   -22.328 1.00 302.45 ? 171  ASN B ND2 1 
ATOM   8146  N  N   . LYS B  2 172  ? -2.223  1.800   -21.926 1.00 331.02 ? 172  LYS B N   1 
ATOM   8147  C  CA  . LYS B  2 172  ? -2.094  0.666   -22.835 1.00 295.33 ? 172  LYS B CA  1 
ATOM   8148  C  C   . LYS B  2 172  ? -3.425  -0.044  -23.031 1.00 299.20 ? 172  LYS B C   1 
ATOM   8149  O  O   . LYS B  2 172  ? -3.784  -0.404  -24.150 1.00 269.11 ? 172  LYS B O   1 
ATOM   8150  C  CB  . LYS B  2 172  ? -1.048  -0.323  -22.321 1.00 279.57 ? 172  LYS B CB  1 
ATOM   8151  C  CG  . LYS B  2 172  ? 0.371   0.189   -22.431 1.00 281.53 ? 172  LYS B CG  1 
ATOM   8152  C  CD  . LYS B  2 172  ? 1.376   -0.925  -22.245 1.00 266.47 ? 172  LYS B CD  1 
ATOM   8153  C  CE  . LYS B  2 172  ? 2.781   -0.372  -22.180 1.00 269.58 ? 172  LYS B CE  1 
ATOM   8154  N  NZ  . LYS B  2 172  ? 3.785   -1.440  -21.966 1.00 258.46 ? 172  LYS B NZ  1 
ATOM   8155  N  N   . GLU B  2 173  ? -4.155  -0.242  -21.939 1.00 336.54 ? 173  GLU B N   1 
ATOM   8156  C  CA  . GLU B  2 173  ? -5.457  -0.889  -22.004 1.00 328.41 ? 173  GLU B CA  1 
ATOM   8157  C  C   . GLU B  2 173  ? -5.374  -2.184  -22.804 1.00 292.22 ? 173  GLU B C   1 
ATOM   8158  O  O   . GLU B  2 173  ? -6.065  -2.345  -23.807 1.00 300.15 ? 173  GLU B O   1 
ATOM   8159  C  CB  . GLU B  2 173  ? -6.480  0.058   -22.632 1.00 333.96 ? 173  GLU B CB  1 
ATOM   8160  C  CG  . GLU B  2 173  ? -6.667  1.353   -21.856 1.00 327.56 ? 173  GLU B CG  1 
ATOM   8161  C  CD  . GLU B  2 173  ? -7.563  2.337   -22.569 1.00 332.85 ? 173  GLU B CD  1 
ATOM   8162  O  OE1 . GLU B  2 173  ? -7.990  2.040   -23.704 1.00 337.71 ? 173  GLU B OE1 1 
ATOM   8163  O  OE2 . GLU B  2 173  ? -7.840  3.409   -21.993 1.00 338.53 ? 173  GLU B OE2 1 
ATOM   8164  N  N   . LYS B  2 174  ? -4.525  -3.105  -22.358 1.00 256.76 ? 174  LYS B N   1 
ATOM   8165  C  CA  . LYS B  2 174  ? -4.364  -4.383  -23.040 1.00 270.76 ? 174  LYS B CA  1 
ATOM   8166  C  C   . LYS B  2 174  ? -5.348  -5.413  -22.504 1.00 302.73 ? 174  LYS B C   1 
ATOM   8167  O  O   . LYS B  2 174  ? -4.993  -6.570  -22.278 1.00 295.26 ? 174  LYS B O   1 
ATOM   8168  C  CB  . LYS B  2 174  ? -2.937  -4.895  -22.883 1.00 239.45 ? 174  LYS B CB  1 
ATOM   8169  C  CG  . LYS B  2 174  ? -2.519  -5.100  -21.451 1.00 198.26 ? 174  LYS B CG  1 
ATOM   8170  C  CD  . LYS B  2 174  ? -1.149  -5.718  -21.388 1.00 229.06 ? 174  LYS B CD  1 
ATOM   8171  C  CE  . LYS B  2 174  ? -0.732  -5.971  -19.963 1.00 256.46 ? 174  LYS B CE  1 
ATOM   8172  N  NZ  . LYS B  2 174  ? 0.538   -6.735  -19.908 1.00 279.55 ? 174  LYS B NZ  1 
ATOM   8173  N  N   . GLU B  2 175  ? -6.586  -4.977  -22.302 1.00 335.60 ? 175  GLU B N   1 
ATOM   8174  C  CA  . GLU B  2 175  ? -7.656  -5.860  -21.862 1.00 353.47 ? 175  GLU B CA  1 
ATOM   8175  C  C   . GLU B  2 175  ? -7.341  -6.450  -20.492 1.00 380.86 ? 175  GLU B C   1 
ATOM   8176  O  O   . GLU B  2 175  ? -7.474  -7.653  -20.280 1.00 416.02 ? 175  GLU B O   1 
ATOM   8177  C  CB  . GLU B  2 175  ? -7.875  -6.980  -22.883 1.00 334.83 ? 175  GLU B CB  1 
ATOM   8178  C  CG  . GLU B  2 175  ? -9.260  -7.603  -22.837 1.00 305.58 ? 175  GLU B CG  1 
ATOM   8179  C  CD  . GLU B  2 175  ? -10.346 -6.633  -23.247 1.00 309.36 ? 175  GLU B CD  1 
ATOM   8180  O  OE1 . GLU B  2 175  ? -10.009 -5.548  -23.763 1.00 348.52 ? 175  GLU B OE1 1 
ATOM   8181  O  OE2 . GLU B  2 175  ? -11.537 -6.954  -23.057 1.00 294.38 ? 175  GLU B OE2 1 
ATOM   8182  N  N   . CYS B  2 176  ? -6.919  -5.595  -19.565 1.00 356.43 ? 176  CYS B N   1 
ATOM   8183  C  CA  . CYS B  2 176  ? -6.654  -6.025  -18.197 1.00 321.98 ? 176  CYS B CA  1 
ATOM   8184  C  C   . CYS B  2 176  ? -7.967  -6.337  -17.493 1.00 359.74 ? 176  CYS B C   1 
ATOM   8185  O  O   . CYS B  2 176  ? -9.003  -5.758  -17.817 1.00 417.87 ? 176  CYS B O   1 
ATOM   8186  C  CB  . CYS B  2 176  ? -5.894  -4.944  -17.427 1.00 293.37 ? 176  CYS B CB  1 
ATOM   8187  S  SG  . CYS B  2 176  ? -6.815  -3.408  -17.165 1.00 259.22 ? 176  CYS B SG  1 
ATOM   8188  N  N   . GLN B  2 177  ? -7.922  -7.250  -16.528 1.00 337.48 ? 177  GLN B N   1 
ATOM   8189  C  CA  . GLN B  2 177  ? -9.130  -7.678  -15.828 1.00 324.49 ? 177  GLN B CA  1 
ATOM   8190  C  C   . GLN B  2 177  ? -9.683  -6.569  -14.935 1.00 314.78 ? 177  GLN B C   1 
ATOM   8191  O  O   . GLN B  2 177  ? -8.955  -5.651  -14.552 1.00 283.47 ? 177  GLN B O   1 
ATOM   8192  C  CB  . GLN B  2 177  ? -8.851  -8.931  -14.998 1.00 288.49 ? 177  GLN B CB  1 
ATOM   8193  C  CG  . GLN B  2 177  ? -7.860  -8.717  -13.877 1.00 257.34 ? 177  GLN B CG  1 
ATOM   8194  C  CD  . GLN B  2 177  ? -7.475  -10.006 -13.174 1.00 279.48 ? 177  GLN B CD  1 
ATOM   8195  O  OE1 . GLN B  2 177  ? -6.601  -10.007 -12.312 1.00 295.22 ? 177  GLN B OE1 1 
ATOM   8196  N  NE2 . GLN B  2 177  ? -8.125  -11.109 -13.536 1.00 313.15 ? 177  GLN B NE2 1 
ATOM   8197  N  N   . PRO B  2 178  ? -10.982 -6.653  -14.603 1.00 309.08 ? 178  PRO B N   1 
ATOM   8198  C  CA  . PRO B  2 178  ? -11.654 -5.645  -13.776 1.00 279.39 ? 178  PRO B CA  1 
ATOM   8199  C  C   . PRO B  2 178  ? -11.006 -5.509  -12.405 1.00 327.92 ? 178  PRO B C   1 
ATOM   8200  O  O   . PRO B  2 178  ? -10.477 -6.494  -11.890 1.00 360.08 ? 178  PRO B O   1 
ATOM   8201  C  CB  . PRO B  2 178  ? -13.079 -6.198  -13.634 1.00 230.73 ? 178  PRO B CB  1 
ATOM   8202  C  CG  . PRO B  2 178  ? -13.251 -7.139  -14.765 1.00 271.28 ? 178  PRO B CG  1 
ATOM   8203  C  CD  . PRO B  2 178  ? -11.900 -7.730  -15.010 1.00 308.90 ? 178  PRO B CD  1 
ATOM   8204  N  N   . PRO B  2 179  ? -11.042 -4.301  -11.821 1.00 309.63 ? 179  PRO B N   1 
ATOM   8205  C  CA  . PRO B  2 179  ? -10.511 -4.083  -10.472 1.00 247.82 ? 179  PRO B CA  1 
ATOM   8206  C  C   . PRO B  2 179  ? -11.090 -5.068  -9.456  1.00 249.68 ? 179  PRO B C   1 
ATOM   8207  O  O   . PRO B  2 179  ? -12.311 -5.170  -9.329  1.00 175.05 ? 179  PRO B O   1 
ATOM   8208  C  CB  . PRO B  2 179  ? -10.954 -2.651  -10.155 1.00 174.08 ? 179  PRO B CB  1 
ATOM   8209  C  CG  . PRO B  2 179  ? -11.056 -1.992  -11.476 1.00 218.25 ? 179  PRO B CG  1 
ATOM   8210  C  CD  . PRO B  2 179  ? -11.544 -3.053  -12.421 1.00 273.37 ? 179  PRO B CD  1 
ATOM   8211  N  N   . PHE B  2 180  ? -10.217 -5.780  -8.746  1.00 279.11 ? 180  PHE B N   1 
ATOM   8212  C  CA  . PHE B  2 180  ? -10.643 -6.766  -7.759  1.00 272.51 ? 180  PHE B CA  1 
ATOM   8213  C  C   . PHE B  2 180  ? -9.823  -6.635  -6.479  1.00 304.09 ? 180  PHE B C   1 
ATOM   8214  O  O   . PHE B  2 180  ? -9.265  -5.577  -6.195  1.00 340.92 ? 180  PHE B O   1 
ATOM   8215  C  CB  . PHE B  2 180  ? -10.504 -8.175  -8.329  1.00 262.14 ? 180  PHE B CB  1 
ATOM   8216  C  CG  . PHE B  2 180  ? -9.096  -8.550  -8.660  1.00 293.40 ? 180  PHE B CG  1 
ATOM   8217  C  CD1 . PHE B  2 180  ? -8.417  -9.487  -7.902  1.00 267.44 ? 180  PHE B CD1 1 
ATOM   8218  C  CD2 . PHE B  2 180  ? -8.448  -7.956  -9.727  1.00 343.32 ? 180  PHE B CD2 1 
ATOM   8219  C  CE1 . PHE B  2 180  ? -7.120  -9.828  -8.207  1.00 275.58 ? 180  PHE B CE1 1 
ATOM   8220  C  CE2 . PHE B  2 180  ? -7.153  -8.291  -10.037 1.00 356.63 ? 180  PHE B CE2 1 
ATOM   8221  C  CZ  . PHE B  2 180  ? -6.486  -9.229  -9.278  1.00 332.91 ? 180  PHE B CZ  1 
ATOM   8222  N  N   . ALA B  2 181  ? -9.748  -7.715  -5.709  1.00 287.29 ? 181  ALA B N   1 
ATOM   8223  C  CA  . ALA B  2 181  ? -9.076  -7.682  -4.418  1.00 240.48 ? 181  ALA B CA  1 
ATOM   8224  C  C   . ALA B  2 181  ? -8.604  -9.075  -4.002  1.00 257.39 ? 181  ALA B C   1 
ATOM   8225  O  O   . ALA B  2 181  ? -7.556  -9.218  -3.377  1.00 244.42 ? 181  ALA B O   1 
ATOM   8226  C  CB  . ALA B  2 181  ? -10.000 -7.088  -3.360  1.00 212.12 ? 181  ALA B CB  1 
ATOM   8227  N  N   . PHE B  2 182  ? -9.377  -10.100 -4.347  1.00 275.64 ? 182  PHE B N   1 
ATOM   8228  C  CA  . PHE B  2 182  ? -8.985  -11.472 -4.057  1.00 251.50 ? 182  PHE B CA  1 
ATOM   8229  C  C   . PHE B  2 182  ? -9.717  -12.453 -4.952  1.00 265.50 ? 182  PHE B C   1 
ATOM   8230  O  O   . PHE B  2 182  ? -10.929 -12.632 -4.835  1.00 283.76 ? 182  PHE B O   1 
ATOM   8231  C  CB  . PHE B  2 182  ? -9.267  -11.813 -2.598  1.00 189.93 ? 182  PHE B CB  1 
ATOM   8232  C  CG  . PHE B  2 182  ? -8.901  -13.221 -2.226  1.00 233.72 ? 182  PHE B CG  1 
ATOM   8233  C  CD1 . PHE B  2 182  ? -7.572  -13.601 -2.129  1.00 231.39 ? 182  PHE B CD1 1 
ATOM   8234  C  CD2 . PHE B  2 182  ? -9.884  -14.162 -1.965  1.00 247.90 ? 182  PHE B CD2 1 
ATOM   8235  C  CE1 . PHE B  2 182  ? -7.230  -14.896 -1.784  1.00 238.31 ? 182  PHE B CE1 1 
ATOM   8236  C  CE2 . PHE B  2 182  ? -9.549  -15.458 -1.617  1.00 252.95 ? 182  PHE B CE2 1 
ATOM   8237  C  CZ  . PHE B  2 182  ? -8.220  -15.826 -1.527  1.00 250.99 ? 182  PHE B CZ  1 
ATOM   8238  N  N   . ARG B  2 183  ? -8.971  -13.091 -5.844  1.00 222.11 ? 183  ARG B N   1 
ATOM   8239  C  CA  . ARG B  2 183  ? -9.545  -14.080 -6.737  1.00 236.09 ? 183  ARG B CA  1 
ATOM   8240  C  C   . ARG B  2 183  ? -8.766  -15.390 -6.634  1.00 246.42 ? 183  ARG B C   1 
ATOM   8241  O  O   . ARG B  2 183  ? -7.648  -15.503 -7.136  1.00 250.75 ? 183  ARG B O   1 
ATOM   8242  C  CB  . ARG B  2 183  ? -9.544  -13.554 -8.174  1.00 269.89 ? 183  ARG B CB  1 
ATOM   8243  C  CG  . ARG B  2 183  ? -10.348 -14.402 -9.144  1.00 266.56 ? 183  ARG B CG  1 
ATOM   8244  C  CD  . ARG B  2 183  ? -10.585 -13.689 -10.466 1.00 176.36 ? 183  ARG B CD  1 
ATOM   8245  N  NE  . ARG B  2 183  ? -11.291 -14.541 -11.417 1.00 248.87 ? 183  ARG B NE  1 
ATOM   8246  C  CZ  . ARG B  2 183  ? -11.654 -14.161 -12.636 1.00 330.54 ? 183  ARG B CZ  1 
ATOM   8247  N  NH1 . ARG B  2 183  ? -11.376 -12.936 -13.061 1.00 353.07 ? 183  ARG B NH1 1 
ATOM   8248  N  NH2 . ARG B  2 183  ? -12.294 -15.006 -13.431 1.00 348.53 ? 183  ARG B NH2 1 
ATOM   8249  N  N   . HIS B  2 184  ? -9.359  -16.370 -5.959  1.00 225.36 ? 184  HIS B N   1 
ATOM   8250  C  CA  . HIS B  2 184  ? -8.755  -17.692 -5.822  1.00 228.84 ? 184  HIS B CA  1 
ATOM   8251  C  C   . HIS B  2 184  ? -8.729  -18.397 -7.169  1.00 290.83 ? 184  HIS B C   1 
ATOM   8252  O  O   . HIS B  2 184  ? -9.673  -19.098 -7.531  1.00 345.16 ? 184  HIS B O   1 
ATOM   8253  C  CB  . HIS B  2 184  ? -9.544  -18.532 -4.813  1.00 268.16 ? 184  HIS B CB  1 
ATOM   8254  C  CG  . HIS B  2 184  ? -8.965  -19.893 -4.568  1.00 268.41 ? 184  HIS B CG  1 
ATOM   8255  N  ND1 . HIS B  2 184  ? -7.880  -20.104 -3.747  1.00 241.73 ? 184  HIS B ND1 1 
ATOM   8256  C  CD2 . HIS B  2 184  ? -9.334  -21.114 -5.025  1.00 288.59 ? 184  HIS B CD2 1 
ATOM   8257  C  CE1 . HIS B  2 184  ? -7.598  -21.395 -3.713  1.00 230.55 ? 184  HIS B CE1 1 
ATOM   8258  N  NE2 . HIS B  2 184  ? -8.467  -22.029 -4.480  1.00 267.62 ? 184  HIS B NE2 1 
ATOM   8259  N  N   . VAL B  2 185  ? -7.641  -18.211 -7.906  1.00 288.15 ? 185  VAL B N   1 
ATOM   8260  C  CA  . VAL B  2 185  ? -7.538  -18.742 -9.259  1.00 293.34 ? 185  VAL B CA  1 
ATOM   8261  C  C   . VAL B  2 185  ? -7.294  -20.244 -9.260  1.00 312.76 ? 185  VAL B C   1 
ATOM   8262  O  O   . VAL B  2 185  ? -7.918  -20.978 -10.024 1.00 368.54 ? 185  VAL B O   1 
ATOM   8263  C  CB  . VAL B  2 185  ? -6.397  -18.067 -10.033 1.00 286.40 ? 185  VAL B CB  1 
ATOM   8264  C  CG1 . VAL B  2 185  ? -6.280  -18.656 -11.431 1.00 303.28 ? 185  VAL B CG1 1 
ATOM   8265  C  CG2 . VAL B  2 185  ? -6.620  -16.567 -10.097 1.00 292.60 ? 185  VAL B CG2 1 
ATOM   8266  N  N   . LEU B  2 186  ? -6.384  -20.696 -8.403  1.00 288.45 ? 186  LEU B N   1 
ATOM   8267  C  CA  . LEU B  2 186  ? -5.990  -22.100 -8.385  1.00 283.97 ? 186  LEU B CA  1 
ATOM   8268  C  C   . LEU B  2 186  ? -6.051  -22.709 -6.986  1.00 276.99 ? 186  LEU B C   1 
ATOM   8269  O  O   . LEU B  2 186  ? -5.591  -22.112 -6.014  1.00 328.38 ? 186  LEU B O   1 
ATOM   8270  C  CB  . LEU B  2 186  ? -4.581  -22.246 -8.959  1.00 319.55 ? 186  LEU B CB  1 
ATOM   8271  C  CG  . LEU B  2 186  ? -4.505  -22.140 -10.483 1.00 365.60 ? 186  LEU B CG  1 
ATOM   8272  C  CD1 . LEU B  2 186  ? -3.123  -21.711 -10.932 1.00 380.22 ? 186  LEU B CD1 1 
ATOM   8273  C  CD2 . LEU B  2 186  ? -4.891  -23.462 -11.123 1.00 394.31 ? 186  LEU B CD2 1 
ATOM   8274  N  N   . LYS B  2 187  ? -6.628  -23.903 -6.898  1.00 217.50 ? 187  LYS B N   1 
ATOM   8275  C  CA  . LYS B  2 187  ? -6.701  -24.640 -5.643  1.00 248.20 ? 187  LYS B CA  1 
ATOM   8276  C  C   . LYS B  2 187  ? -5.454  -25.504 -5.475  1.00 285.03 ? 187  LYS B C   1 
ATOM   8277  O  O   . LYS B  2 187  ? -4.718  -25.740 -6.431  1.00 279.06 ? 187  LYS B O   1 
ATOM   8278  C  CB  . LYS B  2 187  ? -7.955  -25.518 -5.616  1.00 243.09 ? 187  LYS B CB  1 
ATOM   8279  C  CG  . LYS B  2 187  ? -8.162  -26.273 -4.313  1.00 250.25 ? 187  LYS B CG  1 
ATOM   8280  C  CD  . LYS B  2 187  ? -9.434  -27.102 -4.348  1.00 224.56 ? 187  LYS B CD  1 
ATOM   8281  C  CE  . LYS B  2 187  ? -9.751  -27.693 -2.985  1.00 227.62 ? 187  LYS B CE  1 
ATOM   8282  N  NZ  . LYS B  2 187  ? -8.673  -28.582 -2.480  1.00 245.65 ? 187  LYS B NZ  1 
ATOM   8283  N  N   . LEU B  2 188  ? -5.220  -25.968 -4.254  1.00 325.05 ? 188  LEU B N   1 
ATOM   8284  C  CA  . LEU B  2 188  ? -4.064  -26.807 -3.960  1.00 296.63 ? 188  LEU B CA  1 
ATOM   8285  C  C   . LEU B  2 188  ? -4.148  -28.109 -4.740  1.00 292.81 ? 188  LEU B C   1 
ATOM   8286  O  O   . LEU B  2 188  ? -5.020  -28.937 -4.488  1.00 311.08 ? 188  LEU B O   1 
ATOM   8287  C  CB  . LEU B  2 188  ? -3.996  -27.101 -2.463  1.00 290.51 ? 188  LEU B CB  1 
ATOM   8288  C  CG  . LEU B  2 188  ? -4.136  -25.877 -1.554  1.00 250.71 ? 188  LEU B CG  1 
ATOM   8289  C  CD1 . LEU B  2 188  ? -4.170  -26.294 -0.098  1.00 150.77 ? 188  LEU B CD1 1 
ATOM   8290  C  CD2 . LEU B  2 188  ? -3.012  -24.878 -1.805  1.00 255.39 ? 188  LEU B CD2 1 
ATOM   8291  N  N   . THR B  2 189  ? -3.235  -28.283 -5.689  1.00 302.67 ? 189  THR B N   1 
ATOM   8292  C  CA  . THR B  2 189  ? -3.260  -29.447 -6.566  1.00 326.40 ? 189  THR B CA  1 
ATOM   8293  C  C   . THR B  2 189  ? -1.886  -30.091 -6.694  1.00 318.35 ? 189  THR B C   1 
ATOM   8294  O  O   . THR B  2 189  ? -0.869  -29.486 -6.353  1.00 310.34 ? 189  THR B O   1 
ATOM   8295  C  CB  . THR B  2 189  ? -3.754  -29.068 -7.974  1.00 342.30 ? 189  THR B CB  1 
ATOM   8296  O  OG1 . THR B  2 189  ? -3.004  -27.949 -8.461  1.00 369.42 ? 189  THR B OG1 1 
ATOM   8297  C  CG2 . THR B  2 189  ? -5.232  -28.707 -7.943  1.00 343.70 ? 189  THR B CG2 1 
ATOM   8298  N  N   . ASN B  2 190  ? -1.867  -31.325 -7.187  1.00 312.89 ? 190  ASN B N   1 
ATOM   8299  C  CA  . ASN B  2 190  ? -0.622  -32.052 -7.394  1.00 287.89 ? 190  ASN B CA  1 
ATOM   8300  C  C   . ASN B  2 190  ? 0.094   -31.583 -8.650  1.00 270.03 ? 190  ASN B C   1 
ATOM   8301  O  O   . ASN B  2 190  ? 1.291   -31.302 -8.626  1.00 235.91 ? 190  ASN B O   1 
ATOM   8302  C  CB  . ASN B  2 190  ? -0.893  -33.552 -7.493  1.00 277.63 ? 190  ASN B CB  1 
ATOM   8303  C  CG  . ASN B  2 190  ? -1.369  -34.141 -6.188  1.00 263.90 ? 190  ASN B CG  1 
ATOM   8304  O  OD1 . ASN B  2 190  ? -1.212  -33.535 -5.129  1.00 267.33 ? 190  ASN B OD1 1 
ATOM   8305  N  ND2 . ASN B  2 190  ? -1.955  -35.329 -6.253  1.00 245.08 ? 190  ASN B ND2 1 
ATOM   8306  N  N   . ASN B  2 191  ? -0.650  -31.504 -9.748  1.00 294.28 ? 191  ASN B N   1 
ATOM   8307  C  CA  . ASN B  2 191  ? -0.086  -31.100 -11.030 1.00 299.82 ? 191  ASN B CA  1 
ATOM   8308  C  C   . ASN B  2 191  ? 0.685   -29.790 -10.922 1.00 321.06 ? 191  ASN B C   1 
ATOM   8309  O  O   . ASN B  2 191  ? 0.481   -29.017 -9.987  1.00 355.23 ? 191  ASN B O   1 
ATOM   8310  C  CB  . ASN B  2 191  ? -1.191  -30.975 -12.081 1.00 270.73 ? 191  ASN B CB  1 
ATOM   8311  C  CG  . ASN B  2 191  ? -2.307  -30.051 -11.646 1.00 268.99 ? 191  ASN B CG  1 
ATOM   8312  O  OD1 . ASN B  2 191  ? -2.159  -29.289 -10.693 1.00 307.68 ? 191  ASN B OD1 1 
ATOM   8313  N  ND2 . ASN B  2 191  ? -3.433  -30.116 -12.343 1.00 239.88 ? 191  ASN B ND2 1 
ATOM   8314  N  N   . SER B  2 192  ? 1.575   -29.552 -11.881 1.00 283.35 ? 192  SER B N   1 
ATOM   8315  C  CA  . SER B  2 192  ? 2.391   -28.340 -11.892 1.00 268.14 ? 192  SER B CA  1 
ATOM   8316  C  C   . SER B  2 192  ? 2.192   -27.536 -13.180 1.00 289.30 ? 192  SER B C   1 
ATOM   8317  O  O   . SER B  2 192  ? 2.121   -26.309 -13.149 1.00 271.25 ? 192  SER B O   1 
ATOM   8318  C  CB  . SER B  2 192  ? 3.872   -28.692 -11.716 1.00 210.06 ? 192  SER B CB  1 
ATOM   8319  O  OG  . SER B  2 192  ? 4.329   -29.515 -12.772 1.00 249.91 ? 192  SER B OG  1 
ATOM   8320  N  N   . ASN B  2 193  ? 2.106   -28.226 -14.312 1.00 333.62 ? 193  ASN B N   1 
ATOM   8321  C  CA  . ASN B  2 193  ? 1.938   -27.552 -15.594 1.00 347.77 ? 193  ASN B CA  1 
ATOM   8322  C  C   . ASN B  2 193  ? 0.542   -26.951 -15.751 1.00 369.95 ? 193  ASN B C   1 
ATOM   8323  O  O   . ASN B  2 193  ? 0.378   -25.900 -16.369 1.00 384.08 ? 193  ASN B O   1 
ATOM   8324  C  CB  . ASN B  2 193  ? 2.228   -28.516 -16.743 1.00 320.15 ? 193  ASN B CB  1 
ATOM   8325  C  CG  . ASN B  2 193  ? 1.201   -29.621 -16.850 1.00 322.11 ? 193  ASN B CG  1 
ATOM   8326  O  OD1 . ASN B  2 193  ? 0.675   -30.099 -15.845 1.00 371.48 ? 193  ASN B OD1 1 
ATOM   8327  N  ND2 . ASN B  2 193  ? 0.912   -30.035 -18.073 1.00 269.40 ? 193  ASN B ND2 1 
ATOM   8328  N  N   . GLN B  2 194  ? -0.459  -27.620 -15.187 1.00 351.88 ? 194  GLN B N   1 
ATOM   8329  C  CA  . GLN B  2 194  ? -1.828  -27.119 -15.210 1.00 321.78 ? 194  GLN B CA  1 
ATOM   8330  C  C   . GLN B  2 194  ? -1.922  -25.853 -14.377 1.00 317.81 ? 194  GLN B C   1 
ATOM   8331  O  O   . GLN B  2 194  ? -2.743  -24.972 -14.640 1.00 310.91 ? 194  GLN B O   1 
ATOM   8332  C  CB  . GLN B  2 194  ? -2.782  -28.170 -14.647 1.00 289.81 ? 194  GLN B CB  1 
ATOM   8333  C  CG  . GLN B  2 194  ? -4.205  -27.674 -14.456 1.00 299.12 ? 194  GLN B CG  1 
ATOM   8334  C  CD  . GLN B  2 194  ? -4.886  -27.347 -15.766 1.00 335.11 ? 194  GLN B CD  1 
ATOM   8335  O  OE1 . GLN B  2 194  ? -5.517  -26.299 -15.907 1.00 348.94 ? 194  GLN B OE1 1 
ATOM   8336  N  NE2 . GLN B  2 194  ? -4.760  -28.244 -16.736 1.00 348.48 ? 194  GLN B NE2 1 
ATOM   8337  N  N   . PHE B  2 195  ? -1.071  -25.778 -13.363 1.00 319.07 ? 195  PHE B N   1 
ATOM   8338  C  CA  . PHE B  2 195  ? -1.046  -24.646 -12.454 1.00 317.10 ? 195  PHE B CA  1 
ATOM   8339  C  C   . PHE B  2 195  ? -0.493  -23.418 -13.170 1.00 289.22 ? 195  PHE B C   1 
ATOM   8340  O  O   . PHE B  2 195  ? -1.053  -22.327 -13.069 1.00 252.10 ? 195  PHE B O   1 
ATOM   8341  C  CB  . PHE B  2 195  ? -0.193  -24.992 -11.229 1.00 356.78 ? 195  PHE B CB  1 
ATOM   8342  C  CG  . PHE B  2 195  ? -0.268  -23.978 -10.123 1.00 369.63 ? 195  PHE B CG  1 
ATOM   8343  C  CD1 . PHE B  2 195  ? -1.297  -24.010 -9.194  1.00 381.58 ? 195  PHE B CD1 1 
ATOM   8344  C  CD2 . PHE B  2 195  ? 0.703   -23.003 -10.003 1.00 379.47 ? 195  PHE B CD2 1 
ATOM   8345  C  CE1 . PHE B  2 195  ? -1.358  -23.078 -8.176  1.00 400.57 ? 195  PHE B CE1 1 
ATOM   8346  C  CE2 . PHE B  2 195  ? 0.646   -22.072 -8.987  1.00 410.44 ? 195  PHE B CE2 1 
ATOM   8347  C  CZ  . PHE B  2 195  ? -0.385  -22.110 -8.073  1.00 421.44 ? 195  PHE B CZ  1 
ATOM   8348  N  N   . GLN B  2 196  ? 0.597   -23.608 -13.908 1.00 306.49 ? 196  GLN B N   1 
ATOM   8349  C  CA  . GLN B  2 196  ? 1.261   -22.511 -14.603 1.00 301.88 ? 196  GLN B CA  1 
ATOM   8350  C  C   . GLN B  2 196  ? 0.338   -21.877 -15.626 1.00 318.56 ? 196  GLN B C   1 
ATOM   8351  O  O   . GLN B  2 196  ? 0.213   -20.657 -15.698 1.00 322.49 ? 196  GLN B O   1 
ATOM   8352  C  CB  . GLN B  2 196  ? 2.518   -23.019 -15.306 1.00 285.87 ? 196  GLN B CB  1 
ATOM   8353  C  CG  . GLN B  2 196  ? 3.528   -23.662 -14.377 1.00 317.10 ? 196  GLN B CG  1 
ATOM   8354  C  CD  . GLN B  2 196  ? 4.615   -24.423 -15.113 1.00 354.13 ? 196  GLN B CD  1 
ATOM   8355  O  OE1 . GLN B  2 196  ? 5.639   -24.774 -14.530 1.00 385.70 ? 196  GLN B OE1 1 
ATOM   8356  N  NE2 . GLN B  2 196  ? 4.399   -24.686 -16.397 1.00 343.49 ? 196  GLN B NE2 1 
ATOM   8357  N  N   . THR B  2 197  ? -0.312  -22.721 -16.415 1.00 339.81 ? 197  THR B N   1 
ATOM   8358  C  CA  . THR B  2 197  ? -1.144  -22.260 -17.513 1.00 346.37 ? 197  THR B CA  1 
ATOM   8359  C  C   . THR B  2 197  ? -2.408  -21.548 -17.032 1.00 334.40 ? 197  THR B C   1 
ATOM   8360  O  O   . THR B  2 197  ? -2.951  -20.693 -17.730 1.00 293.88 ? 197  THR B O   1 
ATOM   8361  C  CB  . THR B  2 197  ? -1.547  -23.435 -18.407 1.00 309.61 ? 197  THR B CB  1 
ATOM   8362  O  OG1 . THR B  2 197  ? -2.319  -24.365 -17.643 1.00 290.71 ? 197  THR B OG1 1 
ATOM   8363  C  CG2 . THR B  2 197  ? -0.316  -24.129 -18.969 1.00 269.22 ? 197  THR B CG2 1 
ATOM   8364  N  N   . GLU B  2 198  ? -2.880  -21.902 -15.843 1.00 322.56 ? 198  GLU B N   1 
ATOM   8365  C  CA  . GLU B  2 198  ? -4.078  -21.278 -15.299 1.00 283.23 ? 198  GLU B CA  1 
ATOM   8366  C  C   . GLU B  2 198  ? -3.773  -19.898 -14.739 1.00 293.72 ? 198  GLU B C   1 
ATOM   8367  O  O   . GLU B  2 198  ? -4.683  -19.135 -14.413 1.00 259.52 ? 198  GLU B O   1 
ATOM   8368  C  CB  . GLU B  2 198  ? -4.684  -22.159 -14.215 1.00 245.30 ? 198  GLU B CB  1 
ATOM   8369  C  CG  . GLU B  2 198  ? -5.648  -23.186 -14.755 1.00 245.96 ? 198  GLU B CG  1 
ATOM   8370  C  CD  . GLU B  2 198  ? -6.914  -22.551 -15.288 1.00 261.19 ? 198  GLU B CD  1 
ATOM   8371  O  OE1 . GLU B  2 198  ? -7.013  -21.306 -15.261 1.00 236.66 ? 198  GLU B OE1 1 
ATOM   8372  O  OE2 . GLU B  2 198  ? -7.807  -23.296 -15.736 1.00 289.05 ? 198  GLU B OE2 1 
ATOM   8373  N  N   . VAL B  2 199  ? -2.486  -19.586 -14.635 1.00 333.67 ? 199  VAL B N   1 
ATOM   8374  C  CA  . VAL B  2 199  ? -2.040  -18.307 -14.098 1.00 312.24 ? 199  VAL B CA  1 
ATOM   8375  C  C   . VAL B  2 199  ? -1.893  -17.263 -15.197 1.00 278.13 ? 199  VAL B C   1 
ATOM   8376  O  O   . VAL B  2 199  ? -2.537  -16.214 -15.160 1.00 275.01 ? 199  VAL B O   1 
ATOM   8377  C  CB  . VAL B  2 199  ? -0.689  -18.455 -13.374 1.00 285.18 ? 199  VAL B CB  1 
ATOM   8378  C  CG1 . VAL B  2 199  ? -0.054  -17.089 -13.134 1.00 277.12 ? 199  VAL B CG1 1 
ATOM   8379  C  CG2 . VAL B  2 199  ? -0.876  -19.204 -12.062 1.00 280.77 ? 199  VAL B CG2 1 
ATOM   8380  N  N   . GLY B  2 200  ? -1.038  -17.553 -16.170 1.00 236.01 ? 200  GLY B N   1 
ATOM   8381  C  CA  . GLY B  2 200  ? -0.810  -16.638 -17.270 1.00 210.75 ? 200  GLY B CA  1 
ATOM   8382  C  C   . GLY B  2 200  ? -2.123  -16.100 -17.801 1.00 279.82 ? 200  GLY B C   1 
ATOM   8383  O  O   . GLY B  2 200  ? -2.189  -14.963 -18.267 1.00 282.10 ? 200  GLY B O   1 
ATOM   8384  N  N   . LYS B  2 201  ? -3.168  -16.921 -17.724 1.00 316.25 ? 201  LYS B N   1 
ATOM   8385  C  CA  . LYS B  2 201  ? -4.495  -16.533 -18.185 1.00 311.38 ? 201  LYS B CA  1 
ATOM   8386  C  C   . LYS B  2 201  ? -4.825  -15.106 -17.771 1.00 354.05 ? 201  LYS B C   1 
ATOM   8387  O  O   . LYS B  2 201  ? -4.896  -14.206 -18.606 1.00 401.40 ? 201  LYS B O   1 
ATOM   8388  C  CB  . LYS B  2 201  ? -5.552  -17.489 -17.629 1.00 207.24 ? 201  LYS B CB  1 
ATOM   8389  C  CG  . LYS B  2 201  ? -6.964  -16.949 -17.707 1.00 225.53 ? 201  LYS B CG  1 
ATOM   8390  C  CD  . LYS B  2 201  ? -7.925  -17.807 -16.918 1.00 244.32 ? 201  LYS B CD  1 
ATOM   8391  C  CE  . LYS B  2 201  ? -8.225  -19.108 -17.633 1.00 194.10 ? 201  LYS B CE  1 
ATOM   8392  N  NZ  . LYS B  2 201  ? -9.285  -19.877 -16.933 1.00 212.82 ? 201  LYS B NZ  1 
ATOM   8393  N  N   . GLN B  2 202  ? -5.021  -14.903 -16.476 1.00 317.07 ? 202  GLN B N   1 
ATOM   8394  C  CA  . GLN B  2 202  ? -5.428  -13.605 -15.963 1.00 243.83 ? 202  GLN B CA  1 
ATOM   8395  C  C   . GLN B  2 202  ? -4.337  -12.553 -16.132 1.00 225.93 ? 202  GLN B C   1 
ATOM   8396  O  O   . GLN B  2 202  ? -3.153  -12.834 -15.946 1.00 209.05 ? 202  GLN B O   1 
ATOM   8397  C  CB  . GLN B  2 202  ? -5.799  -13.726 -14.491 1.00 209.63 ? 202  GLN B CB  1 
ATOM   8398  C  CG  . GLN B  2 202  ? -6.998  -14.613 -14.233 1.00 224.27 ? 202  GLN B CG  1 
ATOM   8399  C  CD  . GLN B  2 202  ? -7.417  -14.600 -12.781 1.00 304.59 ? 202  GLN B CD  1 
ATOM   8400  O  OE1 . GLN B  2 202  ? -6.724  -14.046 -11.932 1.00 339.36 ? 202  GLN B OE1 1 
ATOM   8401  N  NE2 . GLN B  2 202  ? -8.556  -15.209 -12.485 1.00 329.63 ? 202  GLN B NE2 1 
ATOM   8402  N  N   . LEU B  2 203  ? -4.750  -11.340 -16.490 1.00 242.82 ? 203  LEU B N   1 
ATOM   8403  C  CA  . LEU B  2 203  ? -3.833  -10.212 -16.611 1.00 264.74 ? 203  LEU B CA  1 
ATOM   8404  C  C   . LEU B  2 203  ? -4.022  -9.281  -15.425 1.00 222.48 ? 203  LEU B C   1 
ATOM   8405  O  O   . LEU B  2 203  ? -4.904  -9.494  -14.594 1.00 193.35 ? 203  LEU B O   1 
ATOM   8406  C  CB  . LEU B  2 203  ? -4.072  -9.442  -17.913 1.00 287.70 ? 203  LEU B CB  1 
ATOM   8407  C  CG  . LEU B  2 203  ? -3.723  -10.194 -19.198 1.00 297.53 ? 203  LEU B CG  1 
ATOM   8408  C  CD1 . LEU B  2 203  ? -4.119  -9.385  -20.425 1.00 312.86 ? 203  LEU B CD1 1 
ATOM   8409  C  CD2 . LEU B  2 203  ? -2.242  -10.541 -19.236 1.00 246.70 ? 203  LEU B CD2 1 
ATOM   8410  N  N   . ILE B  2 204  ? -3.198  -8.241  -15.363 1.00 237.54 ? 204  ILE B N   1 
ATOM   8411  C  CA  . ILE B  2 204  ? -3.199  -7.325  -14.232 1.00 309.07 ? 204  ILE B CA  1 
ATOM   8412  C  C   . ILE B  2 204  ? -4.476  -6.499  -14.148 1.00 314.00 ? 204  ILE B C   1 
ATOM   8413  O  O   . ILE B  2 204  ? -5.427  -6.717  -14.899 1.00 272.12 ? 204  ILE B O   1 
ATOM   8414  C  CB  . ILE B  2 204  ? -2.024  -6.342  -14.320 1.00 304.18 ? 204  ILE B CB  1 
ATOM   8415  C  CG1 . ILE B  2 204  ? -2.177  -5.460  -15.561 1.00 287.70 ? 204  ILE B CG1 1 
ATOM   8416  C  CG2 . ILE B  2 204  ? -0.698  -7.098  -14.343 1.00 241.42 ? 204  ILE B CG2 1 
ATOM   8417  C  CD1 . ILE B  2 204  ? -1.596  -4.079  -15.398 1.00 272.05 ? 204  ILE B CD1 1 
ATOM   8418  N  N   . SER B  2 205  ? -4.479  -5.545  -13.220 1.00 328.54 ? 205  SER B N   1 
ATOM   8419  C  CA  . SER B  2 205  ? -5.582  -4.610  -13.067 1.00 301.43 ? 205  SER B CA  1 
ATOM   8420  C  C   . SER B  2 205  ? -5.027  -3.228  -12.723 1.00 282.46 ? 205  SER B C   1 
ATOM   8421  O  O   . SER B  2 205  ? -4.164  -2.711  -13.431 1.00 320.94 ? 205  SER B O   1 
ATOM   8422  C  CB  . SER B  2 205  ? -6.544  -5.097  -11.984 1.00 291.72 ? 205  SER B CB  1 
ATOM   8423  O  OG  . SER B  2 205  ? -7.750  -4.355  -12.013 1.00 291.35 ? 205  SER B OG  1 
ATOM   8424  N  N   . GLY B  2 206  ? -5.517  -2.631  -11.639 1.00 229.01 ? 206  GLY B N   1 
ATOM   8425  C  CA  . GLY B  2 206  ? -5.025  -1.336  -11.204 1.00 204.71 ? 206  GLY B CA  1 
ATOM   8426  C  C   . GLY B  2 206  ? -5.914  -0.665  -10.169 1.00 232.92 ? 206  GLY B C   1 
ATOM   8427  O  O   . GLY B  2 206  ? -7.107  -0.961  -10.085 1.00 180.39 ? 206  GLY B O   1 
ATOM   8428  N  N   . ASN B  2 207  ? -5.330  0.247   -9.389  1.00 280.26 ? 207  ASN B N   1 
ATOM   8429  C  CA  . ASN B  2 207  ? -6.062  1.001   -8.365  1.00 305.70 ? 207  ASN B CA  1 
ATOM   8430  C  C   . ASN B  2 207  ? -5.500  2.413   -8.186  1.00 323.08 ? 207  ASN B C   1 
ATOM   8431  O  O   . ASN B  2 207  ? -4.526  2.787   -8.837  1.00 354.77 ? 207  ASN B O   1 
ATOM   8432  C  CB  . ASN B  2 207  ? -6.045  0.263   -7.020  1.00 289.94 ? 207  ASN B CB  1 
ATOM   8433  C  CG  . ASN B  2 207  ? -4.652  0.138   -6.434  1.00 268.09 ? 207  ASN B CG  1 
ATOM   8434  O  OD1 . ASN B  2 207  ? -3.792  0.991   -6.648  1.00 259.20 ? 207  ASN B OD1 1 
ATOM   8435  N  ND2 . ASN B  2 207  ? -4.427  -0.930  -5.682  1.00 270.77 ? 207  ASN B ND2 1 
ATOM   8436  N  N   . LEU B  2 208  ? -6.113  3.190   -7.299  1.00 299.50 ? 208  LEU B N   1 
ATOM   8437  C  CA  . LEU B  2 208  ? -5.685  4.565   -7.060  1.00 272.55 ? 208  LEU B CA  1 
ATOM   8438  C  C   . LEU B  2 208  ? -4.600  4.646   -5.990  1.00 291.60 ? 208  LEU B C   1 
ATOM   8439  O  O   . LEU B  2 208  ? -3.421  4.782   -6.309  1.00 266.51 ? 208  LEU B O   1 
ATOM   8440  C  CB  . LEU B  2 208  ? -6.879  5.439   -6.664  1.00 268.72 ? 208  LEU B CB  1 
ATOM   8441  C  CG  . LEU B  2 208  ? -7.864  5.781   -7.786  1.00 314.99 ? 208  LEU B CG  1 
ATOM   8442  C  CD1 . LEU B  2 208  ? -9.062  6.530   -7.232  1.00 343.47 ? 208  LEU B CD1 1 
ATOM   8443  C  CD2 . LEU B  2 208  ? -7.188  6.594   -8.872  1.00 340.08 ? 208  LEU B CD2 1 
ATOM   8444  N  N   . ASP B  2 209  ? -5.003  4.564   -4.725  1.00 346.13 ? 209  ASP B N   1 
ATOM   8445  C  CA  . ASP B  2 209  ? -4.065  4.697   -3.612  1.00 308.40 ? 209  ASP B CA  1 
ATOM   8446  C  C   . ASP B  2 209  ? -2.832  3.830   -3.831  1.00 277.45 ? 209  ASP B C   1 
ATOM   8447  O  O   . ASP B  2 209  ? -2.924  2.732   -4.382  1.00 274.84 ? 209  ASP B O   1 
ATOM   8448  C  CB  . ASP B  2 209  ? -4.736  4.324   -2.292  1.00 248.74 ? 209  ASP B CB  1 
ATOM   8449  C  CG  . ASP B  2 209  ? -5.115  2.859   -2.224  1.00 269.89 ? 209  ASP B CG  1 
ATOM   8450  O  OD1 . ASP B  2 209  ? -5.228  2.211   -3.287  1.00 260.65 ? 209  ASP B OD1 1 
ATOM   8451  O  OD2 . ASP B  2 209  ? -5.300  2.354   -1.101  1.00 283.76 ? 209  ASP B OD2 1 
ATOM   8452  N  N   . ALA B  2 210  ? -1.680  4.327   -3.393  1.00 239.88 ? 210  ALA B N   1 
ATOM   8453  C  CA  . ALA B  2 210  ? -0.411  3.666   -3.673  1.00 292.79 ? 210  ALA B CA  1 
ATOM   8454  C  C   . ALA B  2 210  ? -0.284  2.333   -2.935  1.00 288.77 ? 210  ALA B C   1 
ATOM   8455  O  O   . ALA B  2 210  ? -0.145  1.288   -3.567  1.00 303.89 ? 210  ALA B O   1 
ATOM   8456  C  CB  . ALA B  2 210  ? 0.762   4.589   -3.347  1.00 332.99 ? 210  ALA B CB  1 
ATOM   8457  N  N   . PRO B  2 211  ? -0.329  2.358   -1.597  1.00 249.80 ? 211  PRO B N   1 
ATOM   8458  C  CA  . PRO B  2 211  ? -0.265  1.068   -0.903  1.00 212.94 ? 211  PRO B CA  1 
ATOM   8459  C  C   . PRO B  2 211  ? -1.430  0.160   -1.266  1.00 221.34 ? 211  PRO B C   1 
ATOM   8460  O  O   . PRO B  2 211  ? -2.470  0.643   -1.712  1.00 222.02 ? 211  PRO B O   1 
ATOM   8461  C  CB  . PRO B  2 211  ? -0.349  1.459   0.571   1.00 257.76 ? 211  PRO B CB  1 
ATOM   8462  C  CG  . PRO B  2 211  ? 0.115   2.865   0.623   1.00 271.24 ? 211  PRO B CG  1 
ATOM   8463  C  CD  . PRO B  2 211  ? -0.325  3.490   -0.656  1.00 252.68 ? 211  PRO B CD  1 
ATOM   8464  N  N   . GLU B  2 212  ? -1.257  -1.140  -1.060  1.00 260.96 ? 212  GLU B N   1 
ATOM   8465  C  CA  . GLU B  2 212  ? -2.268  -2.114  -1.444  1.00 274.76 ? 212  GLU B CA  1 
ATOM   8466  C  C   . GLU B  2 212  ? -3.153  -2.465  -0.264  1.00 256.70 ? 212  GLU B C   1 
ATOM   8467  O  O   . GLU B  2 212  ? -2.902  -2.041  0.860   1.00 328.75 ? 212  GLU B O   1 
ATOM   8468  C  CB  . GLU B  2 212  ? -1.609  -3.388  -1.968  1.00 293.74 ? 212  GLU B CB  1 
ATOM   8469  C  CG  . GLU B  2 212  ? -0.624  -3.149  -3.089  1.00 316.36 ? 212  GLU B CG  1 
ATOM   8470  C  CD  . GLU B  2 212  ? -1.289  -2.638  -4.348  1.00 291.96 ? 212  GLU B CD  1 
ATOM   8471  O  OE1 . GLU B  2 212  ? -2.411  -3.091  -4.654  1.00 302.09 ? 212  GLU B OE1 1 
ATOM   8472  O  OE2 . GLU B  2 212  ? -0.687  -1.787  -5.035  1.00 226.83 ? 212  GLU B OE2 1 
ATOM   8473  N  N   . GLY B  2 213  ? -4.194  -3.242  -0.536  1.00 186.86 ? 213  GLY B N   1 
ATOM   8474  C  CA  . GLY B  2 213  ? -5.064  -3.749  0.507   1.00 252.69 ? 213  GLY B CA  1 
ATOM   8475  C  C   . GLY B  2 213  ? -4.931  -5.253  0.603   1.00 241.25 ? 213  GLY B C   1 
ATOM   8476  O  O   . GLY B  2 213  ? -5.927  -5.969  0.692   1.00 188.20 ? 213  GLY B O   1 
ATOM   8477  N  N   . GLY B  2 214  ? -3.689  -5.728  0.585   1.00 227.98 ? 214  GLY B N   1 
ATOM   8478  C  CA  . GLY B  2 214  ? -3.407  -7.153  0.575   1.00 157.18 ? 214  GLY B CA  1 
ATOM   8479  C  C   . GLY B  2 214  ? -3.761  -7.874  1.867   1.00 224.38 ? 214  GLY B C   1 
ATOM   8480  O  O   . GLY B  2 214  ? -3.911  -9.099  1.882   1.00 162.74 ? 214  GLY B O   1 
ATOM   8481  N  N   . LEU B  2 215  ? -3.889  -7.119  2.956   1.00 286.44 ? 215  LEU B N   1 
ATOM   8482  C  CA  . LEU B  2 215  ? -4.194  -7.698  4.266   1.00 284.60 ? 215  LEU B CA  1 
ATOM   8483  C  C   . LEU B  2 215  ? -5.581  -8.339  4.307   1.00 284.29 ? 215  LEU B C   1 
ATOM   8484  O  O   . LEU B  2 215  ? -5.772  -9.379  4.944   1.00 271.82 ? 215  LEU B O   1 
ATOM   8485  C  CB  . LEU B  2 215  ? -4.076  -6.639  5.371   1.00 263.53 ? 215  LEU B CB  1 
ATOM   8486  C  CG  . LEU B  2 215  ? -2.663  -6.154  5.705   1.00 175.32 ? 215  LEU B CG  1 
ATOM   8487  C  CD1 . LEU B  2 215  ? -2.678  -5.253  6.914   1.00 210.31 ? 215  LEU B CD1 1 
ATOM   8488  C  CD2 . LEU B  2 215  ? -1.749  -7.336  5.961   1.00 147.92 ? 215  LEU B CD2 1 
ATOM   8489  N  N   . ASP B  2 216  ? -6.545  -7.715  3.634   1.00 262.45 ? 216  ASP B N   1 
ATOM   8490  C  CA  . ASP B  2 216  ? -7.901  -8.248  3.577   1.00 257.03 ? 216  ASP B CA  1 
ATOM   8491  C  C   . ASP B  2 216  ? -7.880  -9.617  2.906   1.00 286.54 ? 216  ASP B C   1 
ATOM   8492  O  O   . ASP B  2 216  ? -8.635  -10.515 3.282   1.00 320.65 ? 216  ASP B O   1 
ATOM   8493  C  CB  . ASP B  2 216  ? -8.824  -7.290  2.818   1.00 209.25 ? 216  ASP B CB  1 
ATOM   8494  C  CG  . ASP B  2 216  ? -10.296 -7.619  3.005   1.00 203.48 ? 216  ASP B CG  1 
ATOM   8495  O  OD1 . ASP B  2 216  ? -10.615 -8.759  3.397   1.00 214.89 ? 216  ASP B OD1 1 
ATOM   8496  O  OD2 . ASP B  2 216  ? -11.137 -6.733  2.757   1.00 203.15 ? 216  ASP B OD2 1 
ATOM   8497  N  N   . ALA B  2 217  ? -7.001  -9.771  1.919   1.00 275.88 ? 217  ALA B N   1 
ATOM   8498  C  CA  . ALA B  2 217  ? -6.853  -11.035 1.201   1.00 284.16 ? 217  ALA B CA  1 
ATOM   8499  C  C   . ALA B  2 217  ? -6.306  -12.126 2.116   1.00 266.29 ? 217  ALA B C   1 
ATOM   8500  O  O   . ALA B  2 217  ? -6.708  -13.285 2.025   1.00 239.13 ? 217  ALA B O   1 
ATOM   8501  C  CB  . ALA B  2 217  ? -5.940  -10.858 -0.016  1.00 299.65 ? 217  ALA B CB  1 
ATOM   8502  N  N   . MET B  2 218  ? -5.387  -11.752 2.996   1.00 272.79 ? 218  MET B N   1 
ATOM   8503  C  CA  . MET B  2 218  ? -4.764  -12.711 3.892   1.00 262.52 ? 218  MET B CA  1 
ATOM   8504  C  C   . MET B  2 218  ? -5.816  -13.530 4.627   1.00 232.06 ? 218  MET B C   1 
ATOM   8505  O  O   . MET B  2 218  ? -5.845  -14.756 4.522   1.00 224.76 ? 218  MET B O   1 
ATOM   8506  C  CB  . MET B  2 218  ? -3.879  -11.979 4.889   1.00 264.06 ? 218  MET B CB  1 
ATOM   8507  C  CG  . MET B  2 218  ? -2.821  -11.134 4.211   1.00 275.14 ? 218  MET B CG  1 
ATOM   8508  S  SD  . MET B  2 218  ? -1.779  -12.101 3.085   1.00 214.48 ? 218  MET B SD  1 
ATOM   8509  C  CE  . MET B  2 218  ? -0.842  -13.073 4.259   1.00 160.35 ? 218  MET B CE  1 
ATOM   8510  N  N   . MET B  2 219  ? -6.679  -12.845 5.369   1.00 211.79 ? 219  MET B N   1 
ATOM   8511  C  CA  . MET B  2 219  ? -7.725  -13.510 6.144   1.00 279.29 ? 219  MET B CA  1 
ATOM   8512  C  C   . MET B  2 219  ? -8.623  -14.374 5.257   1.00 309.82 ? 219  MET B C   1 
ATOM   8513  O  O   . MET B  2 219  ? -8.783  -15.573 5.496   1.00 385.05 ? 219  MET B O   1 
ATOM   8514  C  CB  . MET B  2 219  ? -8.577  -12.478 6.895   1.00 286.82 ? 219  MET B CB  1 
ATOM   8515  C  CG  . MET B  2 219  ? -7.848  -11.766 8.044   1.00 367.23 ? 219  MET B CG  1 
ATOM   8516  S  SD  . MET B  2 219  ? -7.472  -12.807 9.485   1.00 464.34 ? 219  MET B SD  1 
ATOM   8517  C  CE  . MET B  2 219  ? -9.112  -13.238 10.061  1.00 308.84 ? 219  MET B CE  1 
ATOM   8518  N  N   . GLN B  2 220  ? -9.204  -13.758 4.233   1.00 260.28 ? 220  GLN B N   1 
ATOM   8519  C  CA  . GLN B  2 220  ? -10.123 -14.452 3.336   1.00 251.57 ? 220  GLN B CA  1 
ATOM   8520  C  C   . GLN B  2 220  ? -9.552  -15.794 2.849   1.00 265.42 ? 220  GLN B C   1 
ATOM   8521  O  O   . GLN B  2 220  ? -10.298 -16.747 2.609   1.00 251.06 ? 220  GLN B O   1 
ATOM   8522  C  CB  . GLN B  2 220  ? -10.485 -13.545 2.152   1.00 210.15 ? 220  GLN B CB  1 
ATOM   8523  C  CG  . GLN B  2 220  ? -11.331 -12.328 2.541   1.00 256.43 ? 220  GLN B CG  1 
ATOM   8524  C  CD  . GLN B  2 220  ? -11.625 -11.411 1.367   1.00 283.15 ? 220  GLN B CD  1 
ATOM   8525  O  OE1 . GLN B  2 220  ? -11.046 -11.562 0.292   1.00 365.46 ? 220  GLN B OE1 1 
ATOM   8526  N  NE2 . GLN B  2 220  ? -12.526 -10.452 1.569   1.00 166.29 ? 220  GLN B NE2 1 
ATOM   8527  N  N   . VAL B  2 221  ? -8.229  -15.864 2.719   1.00 294.95 ? 221  VAL B N   1 
ATOM   8528  C  CA  . VAL B  2 221  ? -7.554  -17.090 2.295   1.00 281.20 ? 221  VAL B CA  1 
ATOM   8529  C  C   . VAL B  2 221  ? -7.700  -18.169 3.358   1.00 243.60 ? 221  VAL B C   1 
ATOM   8530  O  O   . VAL B  2 221  ? -8.353  -19.192 3.143   1.00 230.69 ? 221  VAL B O   1 
ATOM   8531  C  CB  . VAL B  2 221  ? -6.045  -16.848 2.043   1.00 267.45 ? 221  VAL B CB  1 
ATOM   8532  C  CG1 . VAL B  2 221  ? -5.284  -18.168 2.007   1.00 209.85 ? 221  VAL B CG1 1 
ATOM   8533  C  CG2 . VAL B  2 221  ? -5.834  -16.069 0.752   1.00 307.83 ? 221  VAL B CG2 1 
ATOM   8534  N  N   . ALA B  2 222  ? -7.077  -17.926 4.505   1.00 218.58 ? 222  ALA B N   1 
ATOM   8535  C  CA  . ALA B  2 222  ? -7.110  -18.861 5.617   1.00 228.64 ? 222  ALA B CA  1 
ATOM   8536  C  C   . ALA B  2 222  ? -8.303  -18.564 6.518   1.00 260.65 ? 222  ALA B C   1 
ATOM   8537  O  O   . ALA B  2 222  ? -8.136  -18.281 7.701   1.00 295.26 ? 222  ALA B O   1 
ATOM   8538  C  CB  . ALA B  2 222  ? -5.813  -18.773 6.408   1.00 154.79 ? 222  ALA B CB  1 
ATOM   8539  N  N   . ALA B  2 223  ? -9.506  -18.626 5.956   1.00 264.57 ? 223  ALA B N   1 
ATOM   8540  C  CA  . ALA B  2 223  ? -10.717 -18.340 6.718   1.00 258.04 ? 223  ALA B CA  1 
ATOM   8541  C  C   . ALA B  2 223  ? -11.719 -19.476 6.604   1.00 290.62 ? 223  ALA B C   1 
ATOM   8542  O  O   . ALA B  2 223  ? -12.328 -19.879 7.594   1.00 254.26 ? 223  ALA B O   1 
ATOM   8543  C  CB  . ALA B  2 223  ? -11.345 -17.048 6.244   1.00 239.43 ? 223  ALA B CB  1 
ATOM   8544  N  N   . CYS B  2 224  ? -11.896 -19.985 5.391   1.00 345.85 ? 224  CYS B N   1 
ATOM   8545  C  CA  . CYS B  2 224  ? -12.835 -21.069 5.160   1.00 363.02 ? 224  CYS B CA  1 
ATOM   8546  C  C   . CYS B  2 224  ? -12.365 -21.990 4.041   1.00 332.42 ? 224  CYS B C   1 
ATOM   8547  O  O   . CYS B  2 224  ? -12.840 -21.894 2.910   1.00 306.44 ? 224  CYS B O   1 
ATOM   8548  C  CB  . CYS B  2 224  ? -14.209 -20.503 4.815   1.00 391.20 ? 224  CYS B CB  1 
ATOM   8549  S  SG  . CYS B  2 224  ? -14.212 -19.484 3.328   1.00 328.78 ? 224  CYS B SG  1 
ATOM   8550  N  N   . PRO B  2 225  ? -11.417 -22.885 4.354   1.00 333.11 ? 225  PRO B N   1 
ATOM   8551  C  CA  . PRO B  2 225  ? -11.003 -23.946 3.429   1.00 311.75 ? 225  PRO B CA  1 
ATOM   8552  C  C   . PRO B  2 225  ? -12.119 -24.952 3.150   1.00 324.94 ? 225  PRO B C   1 
ATOM   8553  O  O   . PRO B  2 225  ? -11.876 -25.969 2.499   1.00 258.16 ? 225  PRO B O   1 
ATOM   8554  C  CB  . PRO B  2 225  ? -9.848  -24.627 4.169   1.00 274.94 ? 225  PRO B CB  1 
ATOM   8555  C  CG  . PRO B  2 225  ? -9.332  -23.592 5.105   1.00 280.20 ? 225  PRO B CG  1 
ATOM   8556  C  CD  . PRO B  2 225  ? -10.539 -22.811 5.533   1.00 317.05 ? 225  PRO B CD  1 
ATOM   8557  N  N   . GLU B  2 226  ? -13.322 -24.680 3.649   1.00 362.32 ? 226  GLU B N   1 
ATOM   8558  C  CA  . GLU B  2 226  ? -14.489 -25.474 3.288   1.00 336.76 ? 226  GLU B CA  1 
ATOM   8559  C  C   . GLU B  2 226  ? -14.831 -25.200 1.831   1.00 298.81 ? 226  GLU B C   1 
ATOM   8560  O  O   . GLU B  2 226  ? -15.692 -25.858 1.248   1.00 259.58 ? 226  GLU B O   1 
ATOM   8561  C  CB  . GLU B  2 226  ? -15.683 -25.133 4.184   1.00 311.02 ? 226  GLU B CB  1 
ATOM   8562  C  CG  . GLU B  2 226  ? -15.538 -25.604 5.624   1.00 312.46 ? 226  GLU B CG  1 
ATOM   8563  C  CD  . GLU B  2 226  ? -16.756 -25.288 6.470   1.00 336.71 ? 226  GLU B CD  1 
ATOM   8564  O  OE1 . GLU B  2 226  ? -17.662 -24.587 5.973   1.00 335.71 ? 226  GLU B OE1 1 
ATOM   8565  O  OE2 . GLU B  2 226  ? -16.809 -25.740 7.634   1.00 347.19 ? 226  GLU B OE2 1 
ATOM   8566  N  N   . GLU B  2 227  ? -14.150 -24.217 1.251   1.00 303.96 ? 227  GLU B N   1 
ATOM   8567  C  CA  . GLU B  2 227  ? -14.346 -23.860 -0.145  1.00 296.50 ? 227  GLU B CA  1 
ATOM   8568  C  C   . GLU B  2 227  ? -13.015 -23.684 -0.874  1.00 307.55 ? 227  GLU B C   1 
ATOM   8569  O  O   . GLU B  2 227  ? -12.981 -23.629 -2.103  1.00 345.31 ? 227  GLU B O   1 
ATOM   8570  C  CB  . GLU B  2 227  ? -15.153 -22.569 -0.242  1.00 288.87 ? 227  GLU B CB  1 
ATOM   8571  C  CG  . GLU B  2 227  ? -16.480 -22.623 0.473   1.00 300.36 ? 227  GLU B CG  1 
ATOM   8572  C  CD  . GLU B  2 227  ? -17.110 -21.255 0.601   1.00 336.18 ? 227  GLU B CD  1 
ATOM   8573  O  OE1 . GLU B  2 227  ? -16.411 -20.251 0.341   1.00 337.44 ? 227  GLU B OE1 1 
ATOM   8574  O  OE2 . GLU B  2 227  ? -18.302 -21.182 0.962   1.00 371.89 ? 227  GLU B OE2 1 
ATOM   8575  N  N   . ILE B  2 228  ? -11.923 -23.594 -0.120  1.00 264.09 ? 228  ILE B N   1 
ATOM   8576  C  CA  . ILE B  2 228  ? -10.600 -23.407 -0.710  1.00 269.98 ? 228  ILE B CA  1 
ATOM   8577  C  C   . ILE B  2 228  ? -9.726  -24.646 -0.552  1.00 261.86 ? 228  ILE B C   1 
ATOM   8578  O  O   . ILE B  2 228  ? -8.885  -24.939 -1.401  1.00 204.83 ? 228  ILE B O   1 
ATOM   8579  C  CB  . ILE B  2 228  ? -9.880  -22.218 -0.074  1.00 275.96 ? 228  ILE B CB  1 
ATOM   8580  C  CG1 . ILE B  2 228  ? -10.580 -20.917 -0.468  1.00 345.52 ? 228  ILE B CG1 1 
ATOM   8581  C  CG2 . ILE B  2 228  ? -8.427  -22.198 -0.507  1.00 188.76 ? 228  ILE B CG2 1 
ATOM   8582  C  CD1 . ILE B  2 228  ? -9.970  -19.689 0.150   1.00 369.77 ? 228  ILE B CD1 1 
ATOM   8583  N  N   . GLY B  2 229  ? -9.919  -25.362 0.548   1.00 254.55 ? 229  GLY B N   1 
ATOM   8584  C  CA  . GLY B  2 229  ? -9.225  -26.614 0.774   1.00 250.50 ? 229  GLY B CA  1 
ATOM   8585  C  C   . GLY B  2 229  ? -7.795  -26.401 1.218   1.00 250.07 ? 229  GLY B C   1 
ATOM   8586  O  O   . GLY B  2 229  ? -7.093  -25.538 0.694   1.00 229.04 ? 229  GLY B O   1 
ATOM   8587  N  N   . TRP B  2 230  ? -7.366  -27.196 2.192   1.00 263.62 ? 230  TRP B N   1 
ATOM   8588  C  CA  . TRP B  2 230  ? -6.015  -27.093 2.724   1.00 285.46 ? 230  TRP B CA  1 
ATOM   8589  C  C   . TRP B  2 230  ? -5.528  -28.422 3.288   1.00 316.85 ? 230  TRP B C   1 
ATOM   8590  O  O   . TRP B  2 230  ? -6.299  -29.178 3.876   1.00 368.81 ? 230  TRP B O   1 
ATOM   8591  C  CB  . TRP B  2 230  ? -5.955  -26.010 3.802   1.00 278.14 ? 230  TRP B CB  1 
ATOM   8592  C  CG  . TRP B  2 230  ? -5.700  -24.647 3.248   1.00 310.47 ? 230  TRP B CG  1 
ATOM   8593  C  CD1 . TRP B  2 230  ? -6.631  -23.715 2.882   1.00 303.45 ? 230  TRP B CD1 1 
ATOM   8594  C  CD2 . TRP B  2 230  ? -4.423  -24.062 2.989   1.00 320.79 ? 230  TRP B CD2 1 
ATOM   8595  N  NE1 . TRP B  2 230  ? -6.007  -22.584 2.413   1.00 317.48 ? 230  TRP B NE1 1 
ATOM   8596  C  CE2 . TRP B  2 230  ? -4.651  -22.772 2.469   1.00 328.98 ? 230  TRP B CE2 1 
ATOM   8597  C  CE3 . TRP B  2 230  ? -3.106  -24.503 3.148   1.00 266.50 ? 230  TRP B CE3 1 
ATOM   8598  C  CZ2 . TRP B  2 230  ? -3.611  -21.921 2.107   1.00 296.40 ? 230  TRP B CZ2 1 
ATOM   8599  C  CZ3 . TRP B  2 230  ? -2.077  -23.659 2.790   1.00 216.61 ? 230  TRP B CZ3 1 
ATOM   8600  C  CH2 . TRP B  2 230  ? -2.334  -22.382 2.275   1.00 237.72 ? 230  TRP B CH2 1 
ATOM   8601  N  N   . ARG B  2 231  ? -4.243  -28.699 3.100   1.00 298.51 ? 231  ARG B N   1 
ATOM   8602  C  CA  . ARG B  2 231  ? -3.632  -29.922 3.605   1.00 283.58 ? 231  ARG B CA  1 
ATOM   8603  C  C   . ARG B  2 231  ? -3.597  -29.900 5.129   1.00 272.49 ? 231  ARG B C   1 
ATOM   8604  O  O   . ARG B  2 231  ? -3.551  -28.831 5.732   1.00 288.84 ? 231  ARG B O   1 
ATOM   8605  C  CB  . ARG B  2 231  ? -2.212  -30.065 3.058   1.00 276.21 ? 231  ARG B CB  1 
ATOM   8606  C  CG  . ARG B  2 231  ? -1.583  -31.417 3.319   1.00 280.67 ? 231  ARG B CG  1 
ATOM   8607  C  CD  . ARG B  2 231  ? -2.292  -32.506 2.535   1.00 310.88 ? 231  ARG B CD  1 
ATOM   8608  N  NE  . ARG B  2 231  ? -1.713  -33.824 2.781   1.00 334.09 ? 231  ARG B NE  1 
ATOM   8609  C  CZ  . ARG B  2 231  ? -2.137  -34.947 2.210   1.00 335.50 ? 231  ARG B CZ  1 
ATOM   8610  N  NH1 . ARG B  2 231  ? -3.149  -34.921 1.352   1.00 302.11 ? 231  ARG B NH1 1 
ATOM   8611  N  NH2 . ARG B  2 231  ? -1.549  -36.101 2.496   1.00 362.10 ? 231  ARG B NH2 1 
ATOM   8612  N  N   . ASN B  2 232  ? -3.616  -31.079 5.746   1.00 259.23 ? 232  ASN B N   1 
ATOM   8613  C  CA  . ASN B  2 232  ? -3.630  -31.187 7.204   1.00 286.94 ? 232  ASN B CA  1 
ATOM   8614  C  C   . ASN B  2 232  ? -2.218  -31.267 7.775   1.00 304.04 ? 232  ASN B C   1 
ATOM   8615  O  O   . ASN B  2 232  ? -2.029  -31.669 8.924   1.00 322.35 ? 232  ASN B O   1 
ATOM   8616  C  CB  . ASN B  2 232  ? -4.440  -32.415 7.644   1.00 268.00 ? 232  ASN B CB  1 
ATOM   8617  C  CG  . ASN B  2 232  ? -4.688  -32.452 9.143   1.00 241.06 ? 232  ASN B CG  1 
ATOM   8618  O  OD1 . ASN B  2 232  ? -4.786  -31.414 9.788   1.00 191.77 ? 232  ASN B OD1 1 
ATOM   8619  N  ND2 . ASN B  2 232  ? -4.798  -33.653 9.700   1.00 270.78 ? 232  ASN B ND2 1 
ATOM   8620  N  N   . VAL B  2 233  ? -1.228  -30.881 6.974   1.00 275.32 ? 233  VAL B N   1 
ATOM   8621  C  CA  . VAL B  2 233  ? 0.163   -30.928 7.412   1.00 271.94 ? 233  VAL B CA  1 
ATOM   8622  C  C   . VAL B  2 233  ? 0.798   -29.546 7.449   1.00 275.07 ? 233  VAL B C   1 
ATOM   8623  O  O   . VAL B  2 233  ? 0.771   -28.878 8.478   1.00 324.83 ? 233  VAL B O   1 
ATOM   8624  C  CB  . VAL B  2 233  ? 1.011   -31.822 6.505   1.00 277.59 ? 233  VAL B CB  1 
ATOM   8625  C  CG1 . VAL B  2 233  ? 2.459   -31.817 6.976   1.00 311.63 ? 233  VAL B CG1 1 
ATOM   8626  C  CG2 . VAL B  2 233  ? 0.450   -33.226 6.494   1.00 276.48 ? 233  VAL B CG2 1 
ATOM   8627  N  N   . THR B  2 234  ? 1.378   -29.126 6.331   1.00 239.73 ? 234  THR B N   1 
ATOM   8628  C  CA  . THR B  2 234  ? 2.082   -27.854 6.276   1.00 279.32 ? 234  THR B CA  1 
ATOM   8629  C  C   . THR B  2 234  ? 1.290   -26.842 5.459   1.00 320.61 ? 234  THR B C   1 
ATOM   8630  O  O   . THR B  2 234  ? 0.487   -27.214 4.605   1.00 350.05 ? 234  THR B O   1 
ATOM   8631  C  CB  . THR B  2 234  ? 3.481   -28.020 5.658   1.00 253.36 ? 234  THR B CB  1 
ATOM   8632  O  OG1 . THR B  2 234  ? 4.244   -28.950 6.437   1.00 232.45 ? 234  THR B OG1 1 
ATOM   8633  C  CG2 . THR B  2 234  ? 4.209   -26.685 5.603   1.00 239.88 ? 234  THR B CG2 1 
ATOM   8634  N  N   . ARG B  2 235  ? 1.514   -25.562 5.739   1.00 289.80 ? 235  ARG B N   1 
ATOM   8635  C  CA  . ARG B  2 235  ? 0.858   -24.486 5.008   1.00 257.72 ? 235  ARG B CA  1 
ATOM   8636  C  C   . ARG B  2 235  ? 1.733   -23.235 4.998   1.00 281.55 ? 235  ARG B C   1 
ATOM   8637  O  O   . ARG B  2 235  ? 1.717   -22.455 5.948   1.00 345.14 ? 235  ARG B O   1 
ATOM   8638  C  CB  . ARG B  2 235  ? -0.494  -24.152 5.644   1.00 242.20 ? 235  ARG B CB  1 
ATOM   8639  C  CG  . ARG B  2 235  ? -1.417  -25.341 5.831   1.00 224.73 ? 235  ARG B CG  1 
ATOM   8640  C  CD  . ARG B  2 235  ? -2.768  -24.908 6.381   1.00 287.39 ? 235  ARG B CD  1 
ATOM   8641  N  NE  . ARG B  2 235  ? -3.574  -26.047 6.804   1.00 302.22 ? 235  ARG B NE  1 
ATOM   8642  C  CZ  . ARG B  2 235  ? -4.772  -25.949 7.373   1.00 301.04 ? 235  ARG B CZ  1 
ATOM   8643  N  NH1 . ARG B  2 235  ? -5.318  -24.758 7.585   1.00 324.96 ? 235  ARG B NH1 1 
ATOM   8644  N  NH2 . ARG B  2 235  ? -5.426  -27.045 7.730   1.00 266.54 ? 235  ARG B NH2 1 
ATOM   8645  N  N   . LEU B  2 236  ? 2.502   -23.050 3.930   1.00 240.00 ? 236  LEU B N   1 
ATOM   8646  C  CA  . LEU B  2 236  ? 3.326   -21.853 3.778   1.00 245.21 ? 236  LEU B CA  1 
ATOM   8647  C  C   . LEU B  2 236  ? 2.737   -20.893 2.742   1.00 269.96 ? 236  LEU B C   1 
ATOM   8648  O  O   . LEU B  2 236  ? 2.330   -21.312 1.659   1.00 292.39 ? 236  LEU B O   1 
ATOM   8649  C  CB  . LEU B  2 236  ? 4.751   -22.233 3.373   1.00 231.92 ? 236  LEU B CB  1 
ATOM   8650  C  CG  . LEU B  2 236  ? 5.713   -22.583 4.508   1.00 238.73 ? 236  LEU B CG  1 
ATOM   8651  C  CD1 . LEU B  2 236  ? 5.204   -23.771 5.297   1.00 299.41 ? 236  LEU B CD1 1 
ATOM   8652  C  CD2 . LEU B  2 236  ? 7.096   -22.862 3.954   1.00 148.60 ? 236  LEU B CD2 1 
ATOM   8653  N  N   . LEU B  2 237  ? 2.687   -19.606 3.085   1.00 303.74 ? 237  LEU B N   1 
ATOM   8654  C  CA  . LEU B  2 237  ? 2.281   -18.565 2.140   1.00 300.63 ? 237  LEU B CA  1 
ATOM   8655  C  C   . LEU B  2 237  ? 3.461   -17.654 1.822   1.00 266.31 ? 237  LEU B C   1 
ATOM   8656  O  O   . LEU B  2 237  ? 4.499   -17.714 2.480   1.00 194.66 ? 237  LEU B O   1 
ATOM   8657  C  CB  . LEU B  2 237  ? 1.115   -17.732 2.694   1.00 287.16 ? 237  LEU B CB  1 
ATOM   8658  C  CG  . LEU B  2 237  ? -0.289  -18.169 2.263   1.00 263.11 ? 237  LEU B CG  1 
ATOM   8659  C  CD1 . LEU B  2 237  ? -0.545  -19.625 2.633   1.00 274.43 ? 237  LEU B CD1 1 
ATOM   8660  C  CD2 . LEU B  2 237  ? -1.354  -17.256 2.867   1.00 164.94 ? 237  LEU B CD2 1 
ATOM   8661  N  N   . VAL B  2 238  ? 3.298   -16.813 0.809   1.00 277.50 ? 238  VAL B N   1 
ATOM   8662  C  CA  . VAL B  2 238  ? 4.355   -15.897 0.413   1.00 249.09 ? 238  VAL B CA  1 
ATOM   8663  C  C   . VAL B  2 238  ? 3.768   -14.605 -0.123  1.00 233.36 ? 238  VAL B C   1 
ATOM   8664  O  O   . VAL B  2 238  ? 3.107   -14.593 -1.159  1.00 160.88 ? 238  VAL B O   1 
ATOM   8665  C  CB  . VAL B  2 238  ? 5.264   -16.522 -0.652  1.00 232.22 ? 238  VAL B CB  1 
ATOM   8666  C  CG1 . VAL B  2 238  ? 4.434   -17.171 -1.753  1.00 198.81 ? 238  VAL B CG1 1 
ATOM   8667  C  CG2 . VAL B  2 238  ? 6.216   -15.474 -1.213  1.00 220.64 ? 238  VAL B CG2 1 
ATOM   8668  N  N   . PHE B  2 239  ? 4.008   -13.517 0.596   1.00 251.82 ? 239  PHE B N   1 
ATOM   8669  C  CA  . PHE B  2 239  ? 3.515   -12.217 0.178   1.00 254.03 ? 239  PHE B CA  1 
ATOM   8670  C  C   . PHE B  2 239  ? 4.447   -11.622 -0.870  1.00 231.06 ? 239  PHE B C   1 
ATOM   8671  O  O   . PHE B  2 239  ? 5.672   -11.718 -0.761  1.00 185.19 ? 239  PHE B O   1 
ATOM   8672  C  CB  . PHE B  2 239  ? 3.392   -11.275 1.376   1.00 259.89 ? 239  PHE B CB  1 
ATOM   8673  C  CG  . PHE B  2 239  ? 2.368   -10.188 1.188   1.00 269.64 ? 239  PHE B CG  1 
ATOM   8674  C  CD1 . PHE B  2 239  ? 1.013   -10.479 1.230   1.00 248.63 ? 239  PHE B CD1 1 
ATOM   8675  C  CD2 . PHE B  2 239  ? 2.760   -8.874  0.970   1.00 280.30 ? 239  PHE B CD2 1 
ATOM   8676  C  CE1 . PHE B  2 239  ? 0.067   -9.481  1.056   1.00 225.44 ? 239  PHE B CE1 1 
ATOM   8677  C  CE2 . PHE B  2 239  ? 1.816   -7.870  0.795   1.00 259.19 ? 239  PHE B CE2 1 
ATOM   8678  C  CZ  . PHE B  2 239  ? 0.470   -8.173  0.838   1.00 218.15 ? 239  PHE B CZ  1 
ATOM   8679  N  N   . ALA B  2 240  ? 3.852   -11.016 -1.891  1.00 266.05 ? 240  ALA B N   1 
ATOM   8680  C  CA  . ALA B  2 240  ? 4.609   -10.422 -2.985  1.00 261.63 ? 240  ALA B CA  1 
ATOM   8681  C  C   . ALA B  2 240  ? 3.922   -9.162  -3.491  1.00 262.10 ? 240  ALA B C   1 
ATOM   8682  O  O   . ALA B  2 240  ? 2.799   -9.215  -3.989  1.00 273.51 ? 240  ALA B O   1 
ATOM   8683  C  CB  . ALA B  2 240  ? 4.761   -11.422 -4.119  1.00 217.45 ? 240  ALA B CB  1 
ATOM   8684  N  N   . THR B  2 241  ? 4.607   -8.031  -3.378  1.00 235.35 ? 241  THR B N   1 
ATOM   8685  C  CA  . THR B  2 241  ? 4.038   -6.760  -3.799  1.00 256.65 ? 241  THR B CA  1 
ATOM   8686  C  C   . THR B  2 241  ? 5.093   -5.665  -3.766  1.00 236.80 ? 241  THR B C   1 
ATOM   8687  O  O   . THR B  2 241  ? 5.893   -5.581  -2.839  1.00 252.09 ? 241  THR B O   1 
ATOM   8688  C  CB  . THR B  2 241  ? 2.857   -6.348  -2.894  1.00 294.24 ? 241  THR B CB  1 
ATOM   8689  O  OG1 . THR B  2 241  ? 2.252   -5.152  -3.399  1.00 311.52 ? 241  THR B OG1 1 
ATOM   8690  C  CG2 . THR B  2 241  ? 3.330   -6.109  -1.471  1.00 296.67 ? 241  THR B CG2 1 
ATOM   8691  N  N   . ASP B  2 242  ? 5.098   -4.835  -4.796  1.00 230.66 ? 242  ASP B N   1 
ATOM   8692  C  CA  . ASP B  2 242  ? 5.962   -3.669  -4.821  1.00 239.16 ? 242  ASP B CA  1 
ATOM   8693  C  C   . ASP B  2 242  ? 5.179   -2.472  -4.315  1.00 252.73 ? 242  ASP B C   1 
ATOM   8694  O  O   . ASP B  2 242  ? 5.240   -1.388  -4.889  1.00 240.90 ? 242  ASP B O   1 
ATOM   8695  C  CB  . ASP B  2 242  ? 6.447   -3.413  -6.240  1.00 271.57 ? 242  ASP B CB  1 
ATOM   8696  C  CG  . ASP B  2 242  ? 5.305   -3.310  -7.234  1.00 290.61 ? 242  ASP B CG  1 
ATOM   8697  O  OD1 . ASP B  2 242  ? 4.135   -3.233  -6.803  1.00 257.88 ? 242  ASP B OD1 1 
ATOM   8698  O  OD2 . ASP B  2 242  ? 5.578   -3.309  -8.449  1.00 334.15 ? 242  ASP B OD2 1 
ATOM   8699  N  N   . ASP B  2 243  ? 4.433   -2.682  -3.237  1.00 289.12 ? 243  ASP B N   1 
ATOM   8700  C  CA  . ASP B  2 243  ? 3.568   -1.648  -2.695  1.00 303.59 ? 243  ASP B CA  1 
ATOM   8701  C  C   . ASP B  2 243  ? 3.308   -1.876  -1.217  1.00 275.38 ? 243  ASP B C   1 
ATOM   8702  O  O   . ASP B  2 243  ? 3.677   -2.908  -0.652  1.00 190.20 ? 243  ASP B O   1 
ATOM   8703  C  CB  . ASP B  2 243  ? 2.241   -1.622  -3.449  1.00 323.96 ? 243  ASP B CB  1 
ATOM   8704  C  CG  . ASP B  2 243  ? 2.388   -1.116  -4.867  1.00 321.16 ? 243  ASP B CG  1 
ATOM   8705  O  OD1 . ASP B  2 243  ? 2.971   -0.028  -5.052  1.00 331.26 ? 243  ASP B OD1 1 
ATOM   8706  O  OD2 . ASP B  2 243  ? 1.918   -1.804  -5.798  1.00 311.83 ? 243  ASP B OD2 1 
ATOM   8707  N  N   . GLY B  2 244  ? 2.659   -0.899  -0.598  1.00 301.75 ? 244  GLY B N   1 
ATOM   8708  C  CA  . GLY B  2 244  ? 2.381   -0.951  0.823   1.00 315.36 ? 244  GLY B CA  1 
ATOM   8709  C  C   . GLY B  2 244  ? 1.309   -1.958  1.194   1.00 290.27 ? 244  GLY B C   1 
ATOM   8710  O  O   . GLY B  2 244  ? 1.096   -2.958  0.495   1.00 214.18 ? 244  GLY B O   1 
ATOM   8711  N  N   . PHE B  2 245  ? 0.629   -1.676  2.304   1.00 316.27 ? 245  PHE B N   1 
ATOM   8712  C  CA  . PHE B  2 245  ? -0.374  -2.575  2.858   1.00 251.76 ? 245  PHE B CA  1 
ATOM   8713  C  C   . PHE B  2 245  ? -1.277  -1.834  3.838   1.00 208.34 ? 245  PHE B C   1 
ATOM   8714  O  O   . PHE B  2 245  ? -0.796  -1.176  4.757   1.00 166.27 ? 245  PHE B O   1 
ATOM   8715  C  CB  . PHE B  2 245  ? 0.309   -3.745  3.561   1.00 222.63 ? 245  PHE B CB  1 
ATOM   8716  C  CG  . PHE B  2 245  ? 1.233   -3.334  4.672   1.00 194.91 ? 245  PHE B CG  1 
ATOM   8717  C  CD1 . PHE B  2 245  ? 2.418   -2.666  4.407   1.00 245.50 ? 245  PHE B CD1 1 
ATOM   8718  C  CD2 . PHE B  2 245  ? 0.926   -3.638  5.982   1.00 186.49 ? 245  PHE B CD2 1 
ATOM   8719  C  CE1 . PHE B  2 245  ? 3.271   -2.296  5.433   1.00 258.89 ? 245  PHE B CE1 1 
ATOM   8720  C  CE2 . PHE B  2 245  ? 1.778   -3.271  7.011   1.00 245.28 ? 245  PHE B CE2 1 
ATOM   8721  C  CZ  . PHE B  2 245  ? 2.951   -2.600  6.735   1.00 257.19 ? 245  PHE B CZ  1 
ATOM   8722  N  N   . HIS B  2 246  ? -2.586  -1.948  3.626   1.00 219.01 ? 246  HIS B N   1 
ATOM   8723  C  CA  . HIS B  2 246  ? -3.575  -1.249  4.437   1.00 228.74 ? 246  HIS B CA  1 
ATOM   8724  C  C   . HIS B  2 246  ? -4.120  -2.149  5.534   1.00 271.39 ? 246  HIS B C   1 
ATOM   8725  O  O   . HIS B  2 246  ? -4.414  -3.320  5.292   1.00 276.92 ? 246  HIS B O   1 
ATOM   8726  C  CB  . HIS B  2 246  ? -4.736  -0.781  3.563   1.00 191.41 ? 246  HIS B CB  1 
ATOM   8727  C  CG  . HIS B  2 246  ? -4.435  0.443   2.765   1.00 215.11 ? 246  HIS B CG  1 
ATOM   8728  N  ND1 . HIS B  2 246  ? -3.720  0.412   1.585   1.00 264.99 ? 246  HIS B ND1 1 
ATOM   8729  C  CD2 . HIS B  2 246  ? -4.759  1.741   2.969   1.00 268.13 ? 246  HIS B CD2 1 
ATOM   8730  C  CE1 . HIS B  2 246  ? -3.616  1.635   1.102   1.00 284.05 ? 246  HIS B CE1 1 
ATOM   8731  N  NE2 . HIS B  2 246  ? -4.238  2.462   1.925   1.00 303.44 ? 246  HIS B NE2 1 
ATOM   8732  N  N   . PHE B  2 247  ? -4.269  -1.591  6.733   1.00 271.49 ? 247  PHE B N   1 
ATOM   8733  C  CA  . PHE B  2 247  ? -4.822  -2.326  7.869   1.00 243.93 ? 247  PHE B CA  1 
ATOM   8734  C  C   . PHE B  2 247  ? -6.075  -1.651  8.413   1.00 224.30 ? 247  PHE B C   1 
ATOM   8735  O  O   . PHE B  2 247  ? -6.503  -0.611  7.912   1.00 228.57 ? 247  PHE B O   1 
ATOM   8736  C  CB  . PHE B  2 247  ? -3.782  -2.465  8.982   1.00 249.70 ? 247  PHE B CB  1 
ATOM   8737  C  CG  . PHE B  2 247  ? -2.853  -1.287  9.105   1.00 238.08 ? 247  PHE B CG  1 
ATOM   8738  C  CD1 . PHE B  2 247  ? -3.206  -0.176  9.849   1.00 252.33 ? 247  PHE B CD1 1 
ATOM   8739  C  CD2 . PHE B  2 247  ? -1.618  -1.301  8.483   1.00 190.23 ? 247  PHE B CD2 1 
ATOM   8740  C  CE1 . PHE B  2 247  ? -2.342  0.899   9.961   1.00 253.29 ? 247  PHE B CE1 1 
ATOM   8741  C  CE2 . PHE B  2 247  ? -0.757  -0.232  8.593   1.00 197.79 ? 247  PHE B CE2 1 
ATOM   8742  C  CZ  . PHE B  2 247  ? -1.119  0.868   9.332   1.00 249.42 ? 247  PHE B CZ  1 
ATOM   8743  N  N   . ALA B  2 248  ? -6.659  -2.252  9.442   1.00 211.46 ? 248  ALA B N   1 
ATOM   8744  C  CA  . ALA B  2 248  ? -7.889  -1.741  10.027  1.00 217.97 ? 248  ALA B CA  1 
ATOM   8745  C  C   . ALA B  2 248  ? -7.795  -0.243  10.271  1.00 207.85 ? 248  ALA B C   1 
ATOM   8746  O  O   . ALA B  2 248  ? -6.710  0.305   10.467  1.00 213.57 ? 248  ALA B O   1 
ATOM   8747  C  CB  . ALA B  2 248  ? -8.192  -2.464  11.323  1.00 226.08 ? 248  ALA B CB  1 
ATOM   8748  N  N   . GLY B  2 249  ? -8.948  0.413   10.261  1.00 184.37 ? 249  GLY B N   1 
ATOM   8749  C  CA  . GLY B  2 249  ? -9.009  1.841   10.491  1.00 194.91 ? 249  GLY B CA  1 
ATOM   8750  C  C   . GLY B  2 249  ? -9.094  2.613   9.194   1.00 202.17 ? 249  GLY B C   1 
ATOM   8751  O  O   . GLY B  2 249  ? -9.732  3.668   9.128   1.00 147.68 ? 249  GLY B O   1 
ATOM   8752  N  N   . ASP B  2 250  ? -8.448  2.083   8.158   1.00 241.62 ? 250  ASP B N   1 
ATOM   8753  C  CA  . ASP B  2 250  ? -8.415  2.738   6.856   1.00 209.06 ? 250  ASP B CA  1 
ATOM   8754  C  C   . ASP B  2 250  ? -9.782  2.632   6.184   1.00 177.63 ? 250  ASP B C   1 
ATOM   8755  O  O   . ASP B  2 250  ? -10.127 3.453   5.328   1.00 147.75 ? 250  ASP B O   1 
ATOM   8756  C  CB  . ASP B  2 250  ? -7.321  2.122   5.972   1.00 207.99 ? 250  ASP B CB  1 
ATOM   8757  C  CG  . ASP B  2 250  ? -5.928  2.239   6.589   1.00 209.02 ? 250  ASP B CG  1 
ATOM   8758  O  OD1 . ASP B  2 250  ? -5.816  2.736   7.727   1.00 231.00 ? 250  ASP B OD1 1 
ATOM   8759  O  OD2 . ASP B  2 250  ? -4.941  1.830   5.940   1.00 162.24 ? 250  ASP B OD2 1 
ATOM   8760  N  N   . GLY B  2 251  ? -10.565 1.638   6.609   1.00 200.87 ? 251  GLY B N   1 
ATOM   8761  C  CA  . GLY B  2 251  ? -11.874 1.385   6.035   1.00 220.73 ? 251  GLY B CA  1 
ATOM   8762  C  C   . GLY B  2 251  ? -12.848 2.517   6.290   1.00 215.28 ? 251  GLY B C   1 
ATOM   8763  O  O   . GLY B  2 251  ? -13.788 2.710   5.522   1.00 174.95 ? 251  GLY B O   1 
ATOM   8764  N  N   . LYS B  2 252  ? -12.623 3.269   7.366   1.00 202.11 ? 252  LYS B N   1 
ATOM   8765  C  CA  . LYS B  2 252  ? -13.496 4.392   7.707   1.00 235.06 ? 252  LYS B CA  1 
ATOM   8766  C  C   . LYS B  2 252  ? -13.524 5.400   6.566   1.00 269.78 ? 252  LYS B C   1 
ATOM   8767  O  O   . LYS B  2 252  ? -14.449 6.208   6.465   1.00 292.99 ? 252  LYS B O   1 
ATOM   8768  C  CB  . LYS B  2 252  ? -13.044 5.080   9.001   1.00 193.81 ? 252  LYS B CB  1 
ATOM   8769  C  CG  . LYS B  2 252  ? -14.029 6.125   9.521   1.00 227.52 ? 252  LYS B CG  1 
ATOM   8770  C  CD  . LYS B  2 252  ? -13.658 6.607   10.908  1.00 251.20 ? 252  LYS B CD  1 
ATOM   8771  C  CE  . LYS B  2 252  ? -14.729 7.521   11.480  1.00 245.65 ? 252  LYS B CE  1 
ATOM   8772  N  NZ  . LYS B  2 252  ? -14.421 7.944   12.872  1.00 235.47 ? 252  LYS B NZ  1 
ATOM   8773  N  N   . LEU B  2 253  ? -12.511 5.348   5.707   1.00 238.23 ? 253  LEU B N   1 
ATOM   8774  C  CA  . LEU B  2 253  ? -12.437 6.239   4.559   1.00 208.31 ? 253  LEU B CA  1 
ATOM   8775  C  C   . LEU B  2 253  ? -13.533 5.897   3.559   1.00 186.83 ? 253  LEU B C   1 
ATOM   8776  O  O   . LEU B  2 253  ? -14.157 6.791   2.975   1.00 137.67 ? 253  LEU B O   1 
ATOM   8777  C  CB  . LEU B  2 253  ? -11.062 6.140   3.903   1.00 170.80 ? 253  LEU B CB  1 
ATOM   8778  C  CG  . LEU B  2 253  ? -9.887  6.526   4.802   1.00 171.74 ? 253  LEU B CG  1 
ATOM   8779  C  CD1 . LEU B  2 253  ? -8.597  5.965   4.266   1.00 150.93 ? 253  LEU B CD1 1 
ATOM   8780  C  CD2 . LEU B  2 253  ? -9.795  8.040   4.936   1.00 157.64 ? 253  LEU B CD2 1 
ATOM   8781  N  N   . GLY B  2 254  ? -13.767 4.599   3.376   1.00 234.25 ? 254  GLY B N   1 
ATOM   8782  C  CA  . GLY B  2 254  ? -14.775 4.114   2.448   1.00 292.27 ? 254  GLY B CA  1 
ATOM   8783  C  C   . GLY B  2 254  ? -16.151 3.955   3.073   1.00 332.20 ? 254  GLY B C   1 
ATOM   8784  O  O   . GLY B  2 254  ? -16.956 3.148   2.607   1.00 398.97 ? 254  GLY B O   1 
ATOM   8785  N  N   . ALA B  2 255  ? -16.418 4.720   4.130   1.00 256.57 ? 255  ALA B N   1 
ATOM   8786  C  CA  . ALA B  2 255  ? -17.727 4.723   4.778   1.00 167.76 ? 255  ALA B CA  1 
ATOM   8787  C  C   . ALA B  2 255  ? -18.106 3.334   5.309   1.00 188.85 ? 255  ALA B C   1 
ATOM   8788  O  O   . ALA B  2 255  ? -19.275 2.956   5.288   1.00 268.15 ? 255  ALA B O   1 
ATOM   8789  C  CB  . ALA B  2 255  ? -18.796 5.245   3.803   1.00 263.67 ? 255  ALA B CB  1 
ATOM   8790  N  N   . ILE B  2 256  ? -17.113 2.582   5.786   1.00 176.31 ? 256  ILE B N   1 
ATOM   8791  C  CA  . ILE B  2 256  ? -17.353 1.250   6.356   1.00 226.06 ? 256  ILE B CA  1 
ATOM   8792  C  C   . ILE B  2 256  ? -16.736 1.084   7.748   1.00 230.28 ? 256  ILE B C   1 
ATOM   8793  O  O   . ILE B  2 256  ? -15.512 1.024   7.900   1.00 184.70 ? 256  ILE B O   1 
ATOM   8794  C  CB  . ILE B  2 256  ? -16.813 0.124   5.447   1.00 246.76 ? 256  ILE B CB  1 
ATOM   8795  C  CG1 . ILE B  2 256  ? -15.351 0.379   5.088   1.00 271.40 ? 256  ILE B CG1 1 
ATOM   8796  C  CG2 . ILE B  2 256  ? -17.646 0.018   4.184   1.00 295.61 ? 256  ILE B CG2 1 
ATOM   8797  C  CD1 . ILE B  2 256  ? -14.695 -0.775  4.392   1.00 325.87 ? 256  ILE B CD1 1 
ATOM   8798  N  N   . LEU B  2 257  ? -17.597 0.990   8.759   1.00 227.93 ? 257  LEU B N   1 
ATOM   8799  C  CA  . LEU B  2 257  ? -17.152 0.878   10.141  1.00 245.74 ? 257  LEU B CA  1 
ATOM   8800  C  C   . LEU B  2 257  ? -17.533 -0.481  10.722  1.00 279.65 ? 257  LEU B C   1 
ATOM   8801  O  O   . LEU B  2 257  ? -17.694 -0.629  11.934  1.00 360.45 ? 257  LEU B O   1 
ATOM   8802  C  CB  . LEU B  2 257  ? -17.737 2.011   10.996  1.00 281.46 ? 257  LEU B CB  1 
ATOM   8803  C  CG  . LEU B  2 257  ? -17.207 3.418   10.698  1.00 275.65 ? 257  LEU B CG  1 
ATOM   8804  C  CD1 . LEU B  2 257  ? -17.876 3.991   9.466   1.00 223.50 ? 257  LEU B CD1 1 
ATOM   8805  C  CD2 . LEU B  2 257  ? -17.414 4.343   11.879  1.00 328.96 ? 257  LEU B CD2 1 
ATOM   8806  N  N   . THR B  2 258  ? -17.676 -1.471  9.850   1.00 188.44 ? 258  THR B N   1 
ATOM   8807  C  CA  . THR B  2 258  ? -17.926 -2.832  10.287  1.00 193.26 ? 258  THR B CA  1 
ATOM   8808  C  C   . THR B  2 258  ? -16.598 -3.573  10.325  1.00 154.02 ? 258  THR B C   1 
ATOM   8809  O  O   . THR B  2 258  ? -16.021 -3.862  9.285   1.00 231.51 ? 258  THR B O   1 
ATOM   8810  C  CB  . THR B  2 258  ? -18.897 -3.555  9.344   1.00 284.93 ? 258  THR B CB  1 
ATOM   8811  O  OG1 . THR B  2 258  ? -18.547 -3.271  7.983   1.00 323.66 ? 258  THR B OG1 1 
ATOM   8812  C  CG2 . THR B  2 258  ? -20.326 -3.099  9.603   1.00 294.11 ? 258  THR B CG2 1 
ATOM   8813  N  N   . PRO B  2 259  ? -16.103 -3.881  11.532  1.00 169.85 ? 259  PRO B N   1 
ATOM   8814  C  CA  . PRO B  2 259  ? -14.776 -4.494  11.687  1.00 194.89 ? 259  PRO B CA  1 
ATOM   8815  C  C   . PRO B  2 259  ? -14.664 -5.858  11.028  1.00 187.31 ? 259  PRO B C   1 
ATOM   8816  O  O   . PRO B  2 259  ? -15.633 -6.358  10.469  1.00 200.54 ? 259  PRO B O   1 
ATOM   8817  C  CB  . PRO B  2 259  ? -14.616 -4.627  13.206  1.00 261.33 ? 259  PRO B CB  1 
ATOM   8818  C  CG  . PRO B  2 259  ? -15.984 -4.493  13.778  1.00 293.16 ? 259  PRO B CG  1 
ATOM   8819  C  CD  . PRO B  2 259  ? -16.783 -3.671  12.823  1.00 249.96 ? 259  PRO B CD  1 
ATOM   8820  N  N   . ASN B  2 260  ? -13.482 -6.454  11.103  1.00 141.54 ? 260  ASN B N   1 
ATOM   8821  C  CA  . ASN B  2 260  ? -13.238 -7.742  10.472  1.00 192.30 ? 260  ASN B CA  1 
ATOM   8822  C  C   . ASN B  2 260  ? -13.780 -8.893  11.309  1.00 294.05 ? 260  ASN B C   1 
ATOM   8823  O  O   . ASN B  2 260  ? -13.481 -8.992  12.495  1.00 380.25 ? 260  ASN B O   1 
ATOM   8824  C  CB  . ASN B  2 260  ? -11.741 -7.926  10.245  1.00 217.30 ? 260  ASN B CB  1 
ATOM   8825  C  CG  . ASN B  2 260  ? -11.398 -9.290  9.686   1.00 263.51 ? 260  ASN B CG  1 
ATOM   8826  O  OD1 . ASN B  2 260  ? -11.893 -10.315 10.149  1.00 326.70 ? 260  ASN B OD1 1 
ATOM   8827  N  ND2 . ASN B  2 260  ? -10.533 -9.307  8.690   1.00 215.69 ? 260  ASN B ND2 1 
ATOM   8828  N  N   . ASP B  2 261  ? -14.574 -9.762  10.691  1.00 296.05 ? 261  ASP B N   1 
ATOM   8829  C  CA  . ASP B  2 261  ? -15.150 -10.903 11.399  1.00 293.39 ? 261  ASP B CA  1 
ATOM   8830  C  C   . ASP B  2 261  ? -14.156 -12.058 11.517  1.00 305.85 ? 261  ASP B C   1 
ATOM   8831  O  O   . ASP B  2 261  ? -14.013 -12.648 12.587  1.00 369.73 ? 261  ASP B O   1 
ATOM   8832  C  CB  . ASP B  2 261  ? -16.430 -11.383 10.712  1.00 260.68 ? 261  ASP B CB  1 
ATOM   8833  C  CG  . ASP B  2 261  ? -16.172 -11.965 9.335   1.00 261.60 ? 261  ASP B CG  1 
ATOM   8834  O  OD1 . ASP B  2 261  ? -15.428 -11.341 8.550   1.00 251.05 ? 261  ASP B OD1 1 
ATOM   8835  O  OD2 . ASP B  2 261  ? -16.718 -13.047 9.034   1.00 276.52 ? 261  ASP B OD2 1 
ATOM   8836  N  N   . GLY B  2 262  ? -13.476 -12.382 10.420  1.00 220.37 ? 262  GLY B N   1 
ATOM   8837  C  CA  . GLY B  2 262  ? -12.456 -13.416 10.442  1.00 178.95 ? 262  GLY B CA  1 
ATOM   8838  C  C   . GLY B  2 262  ? -12.714 -14.539 9.461   1.00 222.63 ? 262  GLY B C   1 
ATOM   8839  O  O   . GLY B  2 262  ? -11.797 -15.277 9.110   1.00 173.76 ? 262  GLY B O   1 
ATOM   8840  N  N   . ARG B  2 263  ? -13.962 -14.675 9.024   1.00 292.60 ? 263  ARG B N   1 
ATOM   8841  C  CA  . ARG B  2 263  ? -14.336 -15.723 8.082   1.00 289.10 ? 263  ARG B CA  1 
ATOM   8842  C  C   . ARG B  2 263  ? -14.638 -15.150 6.706   1.00 302.03 ? 263  ARG B C   1 
ATOM   8843  O  O   . ARG B  2 263  ? -15.256 -14.093 6.584   1.00 338.28 ? 263  ARG B O   1 
ATOM   8844  C  CB  . ARG B  2 263  ? -15.551 -16.489 8.596   1.00 284.55 ? 263  ARG B CB  1 
ATOM   8845  C  CG  . ARG B  2 263  ? -15.254 -17.347 9.808   1.00 292.76 ? 263  ARG B CG  1 
ATOM   8846  C  CD  . ARG B  2 263  ? -16.500 -18.036 10.328  1.00 276.71 ? 263  ARG B CD  1 
ATOM   8847  N  NE  . ARG B  2 263  ? -16.210 -18.878 11.484  1.00 277.72 ? 263  ARG B NE  1 
ATOM   8848  C  CZ  . ARG B  2 263  ? -17.123 -19.565 12.159  1.00 308.96 ? 263  ARG B CZ  1 
ATOM   8849  N  NH1 . ARG B  2 263  ? -18.396 -19.513 11.799  1.00 316.09 ? 263  ARG B NH1 1 
ATOM   8850  N  NH2 . ARG B  2 263  ? -16.763 -20.304 13.198  1.00 339.83 ? 263  ARG B NH2 1 
ATOM   8851  N  N   . CYS B  2 264  ? -14.203 -15.860 5.672   1.00 289.39 ? 264  CYS B N   1 
ATOM   8852  C  CA  . CYS B  2 264  ? -14.415 -15.421 4.302   1.00 301.67 ? 264  CYS B CA  1 
ATOM   8853  C  C   . CYS B  2 264  ? -15.751 -15.944 3.815   1.00 309.74 ? 264  CYS B C   1 
ATOM   8854  O  O   . CYS B  2 264  ? -16.170 -17.037 4.191   1.00 327.91 ? 264  CYS B O   1 
ATOM   8855  C  CB  . CYS B  2 264  ? -13.290 -15.919 3.392   1.00 294.85 ? 264  CYS B CB  1 
ATOM   8856  S  SG  . CYS B  2 264  ? -13.308 -17.691 3.056   1.00 297.44 ? 264  CYS B SG  1 
ATOM   8857  N  N   . HIS B  2 265  ? -16.420 -15.156 2.982   1.00 298.97 ? 265  HIS B N   1 
ATOM   8858  C  CA  . HIS B  2 265  ? -17.728 -15.531 2.473   1.00 307.49 ? 265  HIS B CA  1 
ATOM   8859  C  C   . HIS B  2 265  ? -17.822 -15.252 0.981   1.00 316.57 ? 265  HIS B C   1 
ATOM   8860  O  O   . HIS B  2 265  ? -18.373 -14.236 0.558   1.00 338.34 ? 265  HIS B O   1 
ATOM   8861  C  CB  . HIS B  2 265  ? -18.819 -14.786 3.240   1.00 260.92 ? 265  HIS B CB  1 
ATOM   8862  C  CG  . HIS B  2 265  ? -18.698 -14.923 4.726   1.00 260.23 ? 265  HIS B CG  1 
ATOM   8863  N  ND1 . HIS B  2 265  ? -19.177 -16.017 5.413   1.00 319.62 ? 265  HIS B ND1 1 
ATOM   8864  C  CD2 . HIS B  2 265  ? -18.136 -14.113 5.652   1.00 265.25 ? 265  HIS B CD2 1 
ATOM   8865  C  CE1 . HIS B  2 265  ? -18.924 -15.871 6.701   1.00 337.82 ? 265  HIS B CE1 1 
ATOM   8866  N  NE2 . HIS B  2 265  ? -18.293 -14.724 6.873   1.00 316.30 ? 265  HIS B NE2 1 
ATOM   8867  N  N   . LEU B  2 266  ? -17.273 -16.172 0.193   1.00 266.76 ? 266  LEU B N   1 
ATOM   8868  C  CA  . LEU B  2 266  ? -17.271 -16.061 -1.261  1.00 246.94 ? 266  LEU B CA  1 
ATOM   8869  C  C   . LEU B  2 266  ? -18.276 -17.027 -1.890  1.00 282.22 ? 266  LEU B C   1 
ATOM   8870  O  O   . LEU B  2 266  ? -18.638 -18.033 -1.283  1.00 322.03 ? 266  LEU B O   1 
ATOM   8871  C  CB  . LEU B  2 266  ? -15.867 -16.343 -1.799  1.00 241.53 ? 266  LEU B CB  1 
ATOM   8872  C  CG  . LEU B  2 266  ? -15.221 -17.668 -1.378  1.00 247.64 ? 266  LEU B CG  1 
ATOM   8873  C  CD1 . LEU B  2 266  ? -15.704 -18.808 -2.263  1.00 313.76 ? 266  LEU B CD1 1 
ATOM   8874  C  CD2 . LEU B  2 266  ? -13.709 -17.559 -1.436  1.00 186.85 ? 266  LEU B CD2 1 
ATOM   8875  N  N   . GLU B  2 267  ? -18.721 -16.717 -3.106  1.00 297.12 ? 267  GLU B N   1 
ATOM   8876  C  CA  . GLU B  2 267  ? -19.695 -17.552 -3.808  1.00 307.69 ? 267  GLU B CA  1 
ATOM   8877  C  C   . GLU B  2 267  ? -19.148 -18.046 -5.143  1.00 313.44 ? 267  GLU B C   1 
ATOM   8878  O  O   . GLU B  2 267  ? -19.658 -19.011 -5.712  1.00 328.13 ? 267  GLU B O   1 
ATOM   8879  C  CB  . GLU B  2 267  ? -20.995 -16.774 -4.032  1.00 315.13 ? 267  GLU B CB  1 
ATOM   8880  C  CG  . GLU B  2 267  ? -22.126 -17.595 -4.635  1.00 325.72 ? 267  GLU B CG  1 
ATOM   8881  C  CD  . GLU B  2 267  ? -22.034 -17.711 -6.143  1.00 355.44 ? 267  GLU B CD  1 
ATOM   8882  O  OE1 . GLU B  2 267  ? -21.313 -16.902 -6.763  1.00 362.14 ? 267  GLU B OE1 1 
ATOM   8883  O  OE2 . GLU B  2 267  ? -22.687 -18.611 -6.711  1.00 383.27 ? 267  GLU B OE2 1 
ATOM   8884  N  N   . ASP B  2 268  ? -18.107 -17.384 -5.635  1.00 311.63 ? 268  ASP B N   1 
ATOM   8885  C  CA  . ASP B  2 268  ? -17.509 -17.736 -6.916  1.00 326.03 ? 268  ASP B CA  1 
ATOM   8886  C  C   . ASP B  2 268  ? -15.991 -17.586 -6.872  1.00 343.64 ? 268  ASP B C   1 
ATOM   8887  O  O   . ASP B  2 268  ? -15.401 -16.931 -7.730  1.00 409.35 ? 268  ASP B O   1 
ATOM   8888  C  CB  . ASP B  2 268  ? -18.088 -16.860 -8.030  1.00 337.01 ? 268  ASP B CB  1 
ATOM   8889  C  CG  . ASP B  2 268  ? -17.859 -15.377 -7.791  1.00 394.98 ? 268  ASP B CG  1 
ATOM   8890  O  OD1 . ASP B  2 268  ? -17.498 -14.997 -6.658  1.00 388.60 ? 268  ASP B OD1 1 
ATOM   8891  O  OD2 . ASP B  2 268  ? -18.043 -14.588 -8.740  1.00 452.99 ? 268  ASP B OD2 1 
ATOM   8892  N  N   . ASN B  2 269  ? -15.365 -18.203 -5.873  1.00 270.58 ? 269  ASN B N   1 
ATOM   8893  C  CA  . ASN B  2 269  ? -13.923 -18.083 -5.681  1.00 216.69 ? 269  ASN B CA  1 
ATOM   8894  C  C   . ASN B  2 269  ? -13.475 -16.632 -5.804  1.00 255.65 ? 269  ASN B C   1 
ATOM   8895  O  O   . ASN B  2 269  ? -12.358 -16.350 -6.239  1.00 236.11 ? 269  ASN B O   1 
ATOM   8896  C  CB  . ASN B  2 269  ? -13.170 -18.938 -6.697  1.00 230.23 ? 269  ASN B CB  1 
ATOM   8897  C  CG  . ASN B  2 269  ? -13.347 -20.420 -6.456  1.00 290.87 ? 269  ASN B CG  1 
ATOM   8898  O  OD1 . ASN B  2 269  ? -13.576 -20.854 -5.329  1.00 251.91 ? 269  ASN B OD1 1 
ATOM   8899  N  ND2 . ASN B  2 269  ? -13.236 -21.208 -7.518  1.00 351.12 ? 269  ASN B ND2 1 
ATOM   8900  N  N   . LEU B  2 270  ? -14.353 -15.713 -5.415  1.00 297.18 ? 270  LEU B N   1 
ATOM   8901  C  CA  . LEU B  2 270  ? -14.073 -14.291 -5.535  1.00 305.36 ? 270  LEU B CA  1 
ATOM   8902  C  C   . LEU B  2 270  ? -14.838 -13.490 -4.484  1.00 329.01 ? 270  LEU B C   1 
ATOM   8903  O  O   . LEU B  2 270  ? -16.054 -13.622 -4.347  1.00 348.36 ? 270  LEU B O   1 
ATOM   8904  C  CB  . LEU B  2 270  ? -14.426 -13.812 -6.943  1.00 287.43 ? 270  LEU B CB  1 
ATOM   8905  C  CG  . LEU B  2 270  ? -14.257 -12.322 -7.219  1.00 272.80 ? 270  LEU B CG  1 
ATOM   8906  C  CD1 . LEU B  2 270  ? -13.850 -12.094 -8.663  1.00 273.80 ? 270  LEU B CD1 1 
ATOM   8907  C  CD2 . LEU B  2 270  ? -15.540 -11.580 -6.892  1.00 304.33 ? 270  LEU B CD2 1 
ATOM   8908  N  N   . TYR B  2 271  ? -14.105 -12.664 -3.745  1.00 308.79 ? 271  TYR B N   1 
ATOM   8909  C  CA  . TYR B  2 271  ? -14.673 -11.847 -2.682  1.00 266.14 ? 271  TYR B CA  1 
ATOM   8910  C  C   . TYR B  2 271  ? -15.783 -10.943 -3.196  1.00 321.91 ? 271  TYR B C   1 
ATOM   8911  O  O   . TYR B  2 271  ? -15.669 -10.356 -4.268  1.00 424.01 ? 271  TYR B O   1 
ATOM   8912  C  CB  . TYR B  2 271  ? -13.588 -10.952 -2.095  1.00 190.19 ? 271  TYR B CB  1 
ATOM   8913  C  CG  . TYR B  2 271  ? -13.318 -9.742  -2.956  1.00 240.27 ? 271  TYR B CG  1 
ATOM   8914  C  CD1 . TYR B  2 271  ? -13.778 -8.482  -2.588  1.00 267.19 ? 271  TYR B CD1 1 
ATOM   8915  C  CD2 . TYR B  2 271  ? -12.634 -9.864  -4.154  1.00 293.96 ? 271  TYR B CD2 1 
ATOM   8916  C  CE1 . TYR B  2 271  ? -13.542 -7.374  -3.384  1.00 273.84 ? 271  TYR B CE1 1 
ATOM   8917  C  CE2 . TYR B  2 271  ? -12.395 -8.767  -4.954  1.00 320.89 ? 271  TYR B CE2 1 
ATOM   8918  C  CZ  . TYR B  2 271  ? -12.850 -7.523  -4.565  1.00 303.51 ? 271  TYR B CZ  1 
ATOM   8919  O  OH  . TYR B  2 271  ? -12.611 -6.426  -5.364  1.00 314.44 ? 271  TYR B OH  1 
ATOM   8920  N  N   . LYS B  2 272  ? -16.854 -10.824 -2.422  1.00 246.34 ? 272  LYS B N   1 
ATOM   8921  C  CA  . LYS B  2 272  ? -17.850 -9.787  -2.656  1.00 247.99 ? 272  LYS B CA  1 
ATOM   8922  C  C   . LYS B  2 272  ? -18.345 -9.308  -1.300  1.00 276.62 ? 272  LYS B C   1 
ATOM   8923  O  O   . LYS B  2 272  ? -19.501 -8.915  -1.139  1.00 312.64 ? 272  LYS B O   1 
ATOM   8924  C  CB  . LYS B  2 272  ? -18.999 -10.297 -3.530  1.00 294.75 ? 272  LYS B CB  1 
ATOM   8925  C  CG  . LYS B  2 272  ? -18.606 -10.506 -4.992  1.00 329.85 ? 272  LYS B CG  1 
ATOM   8926  C  CD  . LYS B  2 272  ? -19.818 -10.629 -5.909  1.00 315.04 ? 272  LYS B CD  1 
ATOM   8927  C  CE  . LYS B  2 272  ? -19.398 -10.721 -7.369  1.00 253.00 ? 272  LYS B CE  1 
ATOM   8928  N  NZ  . LYS B  2 272  ? -20.560 -10.822 -8.289  1.00 190.16 ? 272  LYS B NZ  1 
ATOM   8929  N  N   . ARG B  2 273  ? -17.440 -9.348  -0.327  1.00 260.07 ? 273  ARG B N   1 
ATOM   8930  C  CA  . ARG B  2 273  ? -17.741 -8.929  1.030   1.00 261.91 ? 273  ARG B CA  1 
ATOM   8931  C  C   . ARG B  2 273  ? -16.794 -7.820  1.481   1.00 291.65 ? 273  ARG B C   1 
ATOM   8932  O  O   . ARG B  2 273  ? -17.156 -6.998  2.317   1.00 388.99 ? 273  ARG B O   1 
ATOM   8933  C  CB  . ARG B  2 273  ? -17.634 -10.122 1.982   1.00 296.36 ? 273  ARG B CB  1 
ATOM   8934  C  CG  . ARG B  2 273  ? -18.580 -11.265 1.654   1.00 316.50 ? 273  ARG B CG  1 
ATOM   8935  C  CD  . ARG B  2 273  ? -20.032 -10.849 1.811   1.00 317.47 ? 273  ARG B CD  1 
ATOM   8936  N  NE  . ARG B  2 273  ? -20.340 -10.443 3.178   1.00 283.26 ? 273  ARG B NE  1 
ATOM   8937  C  CZ  . ARG B  2 273  ? -21.478 -9.864  3.550   1.00 261.79 ? 273  ARG B CZ  1 
ATOM   8938  N  NH1 . ARG B  2 273  ? -22.429 -9.615  2.663   1.00 227.52 ? 273  ARG B NH1 1 
ATOM   8939  N  NH2 . ARG B  2 273  ? -21.665 -9.527  4.817   1.00 303.24 ? 273  ARG B NH2 1 
ATOM   8940  N  N   . SER B  2 274  ? -15.587 -7.794  0.923   1.00 237.01 ? 274  SER B N   1 
ATOM   8941  C  CA  . SER B  2 274  ? -14.571 -6.825  1.332   1.00 241.17 ? 274  SER B CA  1 
ATOM   8942  C  C   . SER B  2 274  ? -15.058 -5.376  1.267   1.00 270.20 ? 274  SER B C   1 
ATOM   8943  O  O   . SER B  2 274  ? -14.486 -4.494  1.909   1.00 268.31 ? 274  SER B O   1 
ATOM   8944  C  CB  . SER B  2 274  ? -13.333 -6.959  0.455   1.00 220.57 ? 274  SER B CB  1 
ATOM   8945  O  OG  . SER B  2 274  ? -13.515 -6.256  -0.761  1.00 185.37 ? 274  SER B OG  1 
ATOM   8946  N  N   . ASN B  2 275  ? -16.095 -5.125  0.475   1.00 261.30 ? 275  ASN B N   1 
ATOM   8947  C  CA  . ASN B  2 275  ? -16.675 -3.788  0.373   1.00 251.01 ? 275  ASN B CA  1 
ATOM   8948  C  C   . ASN B  2 275  ? -17.540 -3.428  1.581   1.00 289.37 ? 275  ASN B C   1 
ATOM   8949  O  O   . ASN B  2 275  ? -17.456 -2.318  2.108   1.00 253.70 ? 275  ASN B O   1 
ATOM   8950  C  CB  . ASN B  2 275  ? -17.496 -3.681  -0.907  1.00 237.44 ? 275  ASN B CB  1 
ATOM   8951  C  CG  . ASN B  2 275  ? -16.637 -3.758  -2.145  1.00 256.58 ? 275  ASN B CG  1 
ATOM   8952  O  OD1 . ASN B  2 275  ? -15.425 -3.545  -2.085  1.00 207.54 ? 275  ASN B OD1 1 
ATOM   8953  N  ND2 . ASN B  2 275  ? -17.256 -4.068  -3.277  1.00 309.31 ? 275  ASN B ND2 1 
ATOM   8954  N  N   . GLU B  2 276  ? -18.372 -4.374  2.008   1.00 332.60 ? 276  GLU B N   1 
ATOM   8955  C  CA  . GLU B  2 276  ? -19.200 -4.207  3.199   1.00 306.51 ? 276  GLU B CA  1 
ATOM   8956  C  C   . GLU B  2 276  ? -18.462 -4.759  4.421   1.00 282.28 ? 276  GLU B C   1 
ATOM   8957  O  O   . GLU B  2 276  ? -19.051 -5.455  5.245   1.00 257.73 ? 276  GLU B O   1 
ATOM   8958  C  CB  . GLU B  2 276  ? -20.537 -4.946  3.031   1.00 293.20 ? 276  GLU B CB  1 
ATOM   8959  C  CG  . GLU B  2 276  ? -21.284 -4.650  1.733   1.00 275.52 ? 276  GLU B CG  1 
ATOM   8960  C  CD  . GLU B  2 276  ? -20.791 -5.479  0.556   1.00 280.82 ? 276  GLU B CD  1 
ATOM   8961  O  OE1 . GLU B  2 276  ? -20.167 -6.540  0.778   1.00 184.14 ? 276  GLU B OE1 1 
ATOM   8962  O  OE2 . GLU B  2 276  ? -21.039 -5.073  -0.597  1.00 338.86 ? 276  GLU B OE2 1 
ATOM   8963  N  N   . PHE B  2 277  ? -17.176 -4.438  4.541   1.00 261.30 ? 277  PHE B N   1 
ATOM   8964  C  CA  . PHE B  2 277  ? -16.309 -5.109  5.508   1.00 205.20 ? 277  PHE B CA  1 
ATOM   8965  C  C   . PHE B  2 277  ? -14.996 -4.353  5.661   1.00 209.99 ? 277  PHE B C   1 
ATOM   8966  O  O   . PHE B  2 277  ? -14.420 -3.884  4.682   1.00 241.66 ? 277  PHE B O   1 
ATOM   8967  C  CB  . PHE B  2 277  ? -16.067 -6.555  5.055   1.00 236.71 ? 277  PHE B CB  1 
ATOM   8968  C  CG  . PHE B  2 277  ? -14.861 -7.207  5.669   1.00 255.90 ? 277  PHE B CG  1 
ATOM   8969  C  CD1 . PHE B  2 277  ? -13.614 -7.074  5.086   1.00 304.59 ? 277  PHE B CD1 1 
ATOM   8970  C  CD2 . PHE B  2 277  ? -14.981 -7.991  6.803   1.00 215.88 ? 277  PHE B CD2 1 
ATOM   8971  C  CE1 . PHE B  2 277  ? -12.507 -7.687  5.636   1.00 303.29 ? 277  PHE B CE1 1 
ATOM   8972  C  CE2 . PHE B  2 277  ? -13.874 -8.608  7.358   1.00 226.84 ? 277  PHE B CE2 1 
ATOM   8973  C  CZ  . PHE B  2 277  ? -12.638 -8.452  6.773   1.00 259.88 ? 277  PHE B CZ  1 
ATOM   8974  N  N   . ASP B  2 278  ? -14.529 -4.236  6.897   1.00 228.16 ? 278  ASP B N   1 
ATOM   8975  C  CA  . ASP B  2 278  ? -13.351 -3.435  7.197   1.00 237.00 ? 278  ASP B CA  1 
ATOM   8976  C  C   . ASP B  2 278  ? -12.085 -4.285  7.185   1.00 214.45 ? 278  ASP B C   1 
ATOM   8977  O  O   . ASP B  2 278  ? -12.142 -5.512  7.256   1.00 242.57 ? 278  ASP B O   1 
ATOM   8978  C  CB  . ASP B  2 278  ? -13.505 -2.755  8.556   1.00 252.81 ? 278  ASP B CB  1 
ATOM   8979  C  CG  . ASP B  2 278  ? -12.455 -1.689  8.794   1.00 212.35 ? 278  ASP B CG  1 
ATOM   8980  O  OD1 . ASP B  2 278  ? -12.051 -1.019  7.820   1.00 132.29 ? 278  ASP B OD1 1 
ATOM   8981  O  OD2 . ASP B  2 278  ? -12.034 -1.520  9.955   1.00 219.65 ? 278  ASP B OD2 1 
ATOM   8982  N  N   . TYR B  2 279  ? -10.942 -3.616  7.104   1.00 175.57 ? 279  TYR B N   1 
ATOM   8983  C  CA  . TYR B  2 279  ? -9.657  -4.293  7.000   1.00 204.41 ? 279  TYR B CA  1 
ATOM   8984  C  C   . TYR B  2 279  ? -9.295  -5.076  8.255   1.00 222.06 ? 279  TYR B C   1 
ATOM   8985  O  O   . TYR B  2 279  ? -9.597  -4.649  9.370   1.00 213.05 ? 279  TYR B O   1 
ATOM   8986  C  CB  . TYR B  2 279  ? -8.556  -3.273  6.702   1.00 230.08 ? 279  TYR B CB  1 
ATOM   8987  C  CG  . TYR B  2 279  ? -8.480  -2.873  5.243   1.00 259.43 ? 279  TYR B CG  1 
ATOM   8988  C  CD1 . TYR B  2 279  ? -7.496  -3.390  4.411   1.00 243.18 ? 279  TYR B CD1 1 
ATOM   8989  C  CD2 . TYR B  2 279  ? -9.397  -1.984  4.697   1.00 269.84 ? 279  TYR B CD2 1 
ATOM   8990  C  CE1 . TYR B  2 279  ? -7.425  -3.030  3.086   1.00 224.91 ? 279  TYR B CE1 1 
ATOM   8991  C  CE2 . TYR B  2 279  ? -9.333  -1.620  3.368   1.00 206.89 ? 279  TYR B CE2 1 
ATOM   8992  C  CZ  . TYR B  2 279  ? -8.346  -2.144  2.572   1.00 194.10 ? 279  TYR B CZ  1 
ATOM   8993  O  OH  . TYR B  2 279  ? -8.283  -1.787  1.252   1.00 240.16 ? 279  TYR B OH  1 
ATOM   8994  N  N   . PRO B  2 280  ? -8.644  -6.235  8.072   1.00 193.51 ? 280  PRO B N   1 
ATOM   8995  C  CA  . PRO B  2 280  ? -8.111  -7.005  9.195   1.00 209.69 ? 280  PRO B CA  1 
ATOM   8996  C  C   . PRO B  2 280  ? -7.075  -6.182  9.937   1.00 226.12 ? 280  PRO B C   1 
ATOM   8997  O  O   . PRO B  2 280  ? -6.150  -5.669  9.307   1.00 196.73 ? 280  PRO B O   1 
ATOM   8998  C  CB  . PRO B  2 280  ? -7.441  -8.208  8.523   1.00 210.74 ? 280  PRO B CB  1 
ATOM   8999  C  CG  . PRO B  2 280  ? -8.000  -8.271  7.161   1.00 213.69 ? 280  PRO B CG  1 
ATOM   9000  C  CD  . PRO B  2 280  ? -8.377  -6.883  6.780   1.00 188.51 ? 280  PRO B CD  1 
ATOM   9001  N  N   . SER B  2 281  ? -7.238  -6.048  11.250  1.00 246.66 ? 281  SER B N   1 
ATOM   9002  C  CA  . SER B  2 281  ? -6.272  -5.329  12.070  1.00 237.55 ? 281  SER B CA  1 
ATOM   9003  C  C   . SER B  2 281  ? -4.910  -5.982  11.936  1.00 239.42 ? 281  SER B C   1 
ATOM   9004  O  O   . SER B  2 281  ? -4.806  -7.142  11.536  1.00 252.85 ? 281  SER B O   1 
ATOM   9005  C  CB  . SER B  2 281  ? -6.685  -5.345  13.540  1.00 269.92 ? 281  SER B CB  1 
ATOM   9006  O  OG  . SER B  2 281  ? -6.456  -6.622  14.109  1.00 232.05 ? 281  SER B OG  1 
ATOM   9007  N  N   . VAL B  2 282  ? -3.868  -5.239  12.285  1.00 220.12 ? 282  VAL B N   1 
ATOM   9008  C  CA  . VAL B  2 282  ? -2.505  -5.737  12.164  1.00 235.75 ? 282  VAL B CA  1 
ATOM   9009  C  C   . VAL B  2 282  ? -2.296  -7.016  12.980  1.00 249.46 ? 282  VAL B C   1 
ATOM   9010  O  O   . VAL B  2 282  ? -1.646  -7.956  12.526  1.00 93.07  ? 282  VAL B O   1 
ATOM   9011  C  CB  . VAL B  2 282  ? -1.476  -4.662  12.587  1.00 211.68 ? 282  VAL B CB  1 
ATOM   9012  C  CG1 . VAL B  2 282  ? -1.767  -4.165  13.996  1.00 229.51 ? 282  VAL B CG1 1 
ATOM   9013  C  CG2 . VAL B  2 282  ? -0.057  -5.211  12.480  1.00 155.03 ? 282  VAL B CG2 1 
ATOM   9014  N  N   . GLY B  2 283  ? -2.854  -7.057  14.183  1.00 294.00 ? 283  GLY B N   1 
ATOM   9015  C  CA  . GLY B  2 283  ? -2.651  -8.197  15.058  1.00 287.54 ? 283  GLY B CA  1 
ATOM   9016  C  C   . GLY B  2 283  ? -3.668  -9.310  14.871  1.00 232.43 ? 283  GLY B C   1 
ATOM   9017  O  O   . GLY B  2 283  ? -3.645  -10.300 15.606  1.00 240.42 ? 283  GLY B O   1 
ATOM   9018  N  N   . GLN B  2 284  ? -4.559  -9.162  13.892  1.00 173.96 ? 284  GLN B N   1 
ATOM   9019  C  CA  . GLN B  2 284  ? -5.632  -10.137 13.702  1.00 189.13 ? 284  GLN B CA  1 
ATOM   9020  C  C   . GLN B  2 284  ? -5.163  -11.315 12.878  1.00 185.52 ? 284  GLN B C   1 
ATOM   9021  O  O   . GLN B  2 284  ? -5.934  -12.224 12.553  1.00 154.48 ? 284  GLN B O   1 
ATOM   9022  C  CB  . GLN B  2 284  ? -6.835  -9.491  13.035  1.00 162.22 ? 284  GLN B CB  1 
ATOM   9023  C  CG  . GLN B  2 284  ? -7.981  -10.449 12.824  1.00 195.86 ? 284  GLN B CG  1 
ATOM   9024  C  CD  . GLN B  2 284  ? -9.293  -9.724  12.766  1.00 239.77 ? 284  GLN B CD  1 
ATOM   9025  O  OE1 . GLN B  2 284  ? -9.322  -8.498  12.691  1.00 166.71 ? 284  GLN B OE1 1 
ATOM   9026  N  NE2 . GLN B  2 284  ? -10.390 -10.465 12.817  1.00 293.75 ? 284  GLN B NE2 1 
ATOM   9027  N  N   . LEU B  2 285  ? -3.881  -11.285 12.548  1.00 191.64 ? 285  LEU B N   1 
ATOM   9028  C  CA  . LEU B  2 285  ? -3.282  -12.328 11.749  1.00 239.72 ? 285  LEU B CA  1 
ATOM   9029  C  C   . LEU B  2 285  ? -2.409  -13.201 12.630  1.00 251.87 ? 285  LEU B C   1 
ATOM   9030  O  O   . LEU B  2 285  ? -2.601  -14.409 12.682  1.00 278.31 ? 285  LEU B O   1 
ATOM   9031  C  CB  . LEU B  2 285  ? -2.461  -11.724 10.610  1.00 246.86 ? 285  LEU B CB  1 
ATOM   9032  C  CG  . LEU B  2 285  ? -3.250  -10.868 9.616   1.00 233.25 ? 285  LEU B CG  1 
ATOM   9033  C  CD1 . LEU B  2 285  ? -2.341  -10.271 8.565   1.00 294.03 ? 285  LEU B CD1 1 
ATOM   9034  C  CD2 . LEU B  2 285  ? -4.323  -11.687 8.958   1.00 162.36 ? 285  LEU B CD2 1 
ATOM   9035  N  N   . ALA B  2 286  ? -1.462  -12.593 13.339  1.00 200.36 ? 286  ALA B N   1 
ATOM   9036  C  CA  . ALA B  2 286  ? -0.564  -13.361 14.191  1.00 185.94 ? 286  ALA B CA  1 
ATOM   9037  C  C   . ALA B  2 286  ? -1.369  -14.338 15.047  1.00 283.36 ? 286  ALA B C   1 
ATOM   9038  O  O   . ALA B  2 286  ? -0.823  -15.311 15.568  1.00 318.73 ? 286  ALA B O   1 
ATOM   9039  C  CB  . ALA B  2 286  ? 0.269   -12.440 15.061  1.00 147.19 ? 286  ALA B CB  1 
ATOM   9040  N  N   . HIS B  2 287  ? -2.668  -14.078 15.181  1.00 307.83 ? 287  HIS B N   1 
ATOM   9041  C  CA  . HIS B  2 287  ? -3.563  -14.965 15.913  1.00 298.53 ? 287  HIS B CA  1 
ATOM   9042  C  C   . HIS B  2 287  ? -4.251  -15.965 14.989  1.00 345.28 ? 287  HIS B C   1 
ATOM   9043  O  O   . HIS B  2 287  ? -3.955  -17.159 15.023  1.00 442.10 ? 287  HIS B O   1 
ATOM   9044  C  CB  . HIS B  2 287  ? -4.624  -14.154 16.645  1.00 227.41 ? 287  HIS B CB  1 
ATOM   9045  C  CG  . HIS B  2 287  ? -5.569  -14.993 17.439  1.00 228.54 ? 287  HIS B CG  1 
ATOM   9046  N  ND1 . HIS B  2 287  ? -6.876  -15.214 17.052  1.00 217.07 ? 287  HIS B ND1 1 
ATOM   9047  C  CD2 . HIS B  2 287  ? -5.397  -15.686 18.588  1.00 259.72 ? 287  HIS B CD2 1 
ATOM   9048  C  CE1 . HIS B  2 287  ? -7.466  -15.994 17.935  1.00 278.92 ? 287  HIS B CE1 1 
ATOM   9049  N  NE2 . HIS B  2 287  ? -6.590  -16.297 18.880  1.00 299.43 ? 287  HIS B NE2 1 
ATOM   9050  N  N   . LYS B  2 288  ? -5.176  -15.473 14.171  1.00 284.75 ? 288  LYS B N   1 
ATOM   9051  C  CA  . LYS B  2 288  ? -5.935  -16.329 13.266  1.00 287.14 ? 288  LYS B CA  1 
ATOM   9052  C  C   . LYS B  2 288  ? -5.009  -17.123 12.349  1.00 275.73 ? 288  LYS B C   1 
ATOM   9053  O  O   . LYS B  2 288  ? -5.125  -18.344 12.230  1.00 261.94 ? 288  LYS B O   1 
ATOM   9054  C  CB  . LYS B  2 288  ? -6.890  -15.483 12.428  1.00 239.30 ? 288  LYS B CB  1 
ATOM   9055  C  CG  . LYS B  2 288  ? -7.760  -16.294 11.497  1.00 173.79 ? 288  LYS B CG  1 
ATOM   9056  C  CD  . LYS B  2 288  ? -8.652  -17.245 12.265  1.00 251.33 ? 288  LYS B CD  1 
ATOM   9057  C  CE  . LYS B  2 288  ? -9.600  -17.977 11.336  1.00 229.15 ? 288  LYS B CE  1 
ATOM   9058  N  NZ  . LYS B  2 288  ? -10.505 -17.043 10.598  1.00 157.17 ? 288  LYS B NZ  1 
ATOM   9059  N  N   . LEU B  2 289  ? -4.097  -16.411 11.697  1.00 252.48 ? 289  LEU B N   1 
ATOM   9060  C  CA  . LEU B  2 289  ? -3.089  -17.016 10.831  1.00 268.93 ? 289  LEU B CA  1 
ATOM   9061  C  C   . LEU B  2 289  ? -2.306  -18.127 11.526  1.00 280.43 ? 289  LEU B C   1 
ATOM   9062  O  O   . LEU B  2 289  ? -2.265  -19.262 11.052  1.00 342.24 ? 289  LEU B O   1 
ATOM   9063  C  CB  . LEU B  2 289  ? -2.118  -15.937 10.347  1.00 278.48 ? 289  LEU B CB  1 
ATOM   9064  C  CG  . LEU B  2 289  ? -1.026  -16.350 9.361   1.00 334.51 ? 289  LEU B CG  1 
ATOM   9065  C  CD1 . LEU B  2 289  ? -1.611  -16.814 8.034   1.00 367.99 ? 289  LEU B CD1 1 
ATOM   9066  C  CD2 . LEU B  2 289  ? -0.089  -15.180 9.152   1.00 339.67 ? 289  LEU B CD2 1 
ATOM   9067  N  N   . ALA B  2 290  ? -1.676  -17.796 12.645  1.00 241.44 ? 290  ALA B N   1 
ATOM   9068  C  CA  . ALA B  2 290  ? -0.843  -18.754 13.355  1.00 226.49 ? 290  ALA B CA  1 
ATOM   9069  C  C   . ALA B  2 290  ? -1.683  -19.879 13.965  1.00 273.62 ? 290  ALA B C   1 
ATOM   9070  O  O   . ALA B  2 290  ? -1.141  -20.889 14.416  1.00 251.43 ? 290  ALA B O   1 
ATOM   9071  C  CB  . ALA B  2 290  ? -0.040  -18.041 14.425  1.00 194.14 ? 290  ALA B CB  1 
ATOM   9072  N  N   . GLU B  2 291  ? -3.004  -19.701 13.967  1.00 306.65 ? 291  GLU B N   1 
ATOM   9073  C  CA  . GLU B  2 291  ? -3.921  -20.701 14.511  1.00 281.07 ? 291  GLU B CA  1 
ATOM   9074  C  C   . GLU B  2 291  ? -4.138  -21.805 13.496  1.00 263.07 ? 291  GLU B C   1 
ATOM   9075  O  O   . GLU B  2 291  ? -4.319  -22.965 13.855  1.00 281.31 ? 291  GLU B O   1 
ATOM   9076  C  CB  . GLU B  2 291  ? -5.272  -20.074 14.877  1.00 269.87 ? 291  GLU B CB  1 
ATOM   9077  C  CG  . GLU B  2 291  ? -6.302  -21.072 15.404  1.00 273.30 ? 291  GLU B CG  1 
ATOM   9078  C  CD  . GLU B  2 291  ? -7.635  -20.424 15.725  1.00 284.90 ? 291  GLU B CD  1 
ATOM   9079  O  OE1 . GLU B  2 291  ? -7.776  -19.207 15.487  1.00 270.57 ? 291  GLU B OE1 1 
ATOM   9080  O  OE2 . GLU B  2 291  ? -8.541  -21.130 16.215  1.00 311.10 ? 291  GLU B OE2 1 
ATOM   9081  N  N   . ASN B  2 292  ? -4.124  -21.435 12.222  1.00 265.69 ? 292  ASN B N   1 
ATOM   9082  C  CA  . ASN B  2 292  ? -4.304  -22.399 11.151  1.00 271.99 ? 292  ASN B CA  1 
ATOM   9083  C  C   . ASN B  2 292  ? -2.962  -22.899 10.630  1.00 283.23 ? 292  ASN B C   1 
ATOM   9084  O  O   . ASN B  2 292  ? -2.887  -23.478 9.549   1.00 313.57 ? 292  ASN B O   1 
ATOM   9085  C  CB  . ASN B  2 292  ? -5.122  -21.778 10.018  1.00 257.32 ? 292  ASN B CB  1 
ATOM   9086  C  CG  . ASN B  2 292  ? -6.479  -21.286 10.484  1.00 278.44 ? 292  ASN B CG  1 
ATOM   9087  O  OD1 . ASN B  2 292  ? -6.931  -21.619 11.580  1.00 274.94 ? 292  ASN B OD1 1 
ATOM   9088  N  ND2 . ASN B  2 292  ? -7.136  -20.487 9.653   1.00 289.86 ? 292  ASN B ND2 1 
ATOM   9089  N  N   . ASN B  2 293  ? -1.905  -22.672 11.405  1.00 265.90 ? 293  ASN B N   1 
ATOM   9090  C  CA  . ASN B  2 293  ? -0.575  -23.146 11.047  1.00 263.57 ? 293  ASN B CA  1 
ATOM   9091  C  C   . ASN B  2 293  ? -0.126  -22.634 9.682   1.00 268.59 ? 293  ASN B C   1 
ATOM   9092  O  O   . ASN B  2 293  ? 0.448   -23.382 8.892   1.00 288.64 ? 293  ASN B O   1 
ATOM   9093  C  CB  . ASN B  2 293  ? -0.542  -24.675 11.055  1.00 292.33 ? 293  ASN B CB  1 
ATOM   9094  C  CG  . ASN B  2 293  ? -1.013  -25.262 12.369  1.00 275.98 ? 293  ASN B CG  1 
ATOM   9095  O  OD1 . ASN B  2 293  ? -1.649  -26.314 12.398  1.00 341.80 ? 293  ASN B OD1 1 
ATOM   9096  N  ND2 . ASN B  2 293  ? -0.706  -24.584 13.465  1.00 203.08 ? 293  ASN B ND2 1 
ATOM   9097  N  N   . ILE B  2 294  ? -0.392  -21.361 9.408   1.00 258.64 ? 294  ILE B N   1 
ATOM   9098  C  CA  . ILE B  2 294  ? 0.028   -20.735 8.154   1.00 266.69 ? 294  ILE B CA  1 
ATOM   9099  C  C   . ILE B  2 294  ? 1.048   -19.629 8.431   1.00 311.52 ? 294  ILE B C   1 
ATOM   9100  O  O   . ILE B  2 294  ? 0.926   -18.903 9.418   1.00 388.85 ? 294  ILE B O   1 
ATOM   9101  C  CB  . ILE B  2 294  ? -1.174  -20.148 7.381   1.00 237.20 ? 294  ILE B CB  1 
ATOM   9102  C  CG1 . ILE B  2 294  ? -2.136  -21.265 6.964   1.00 275.73 ? 294  ILE B CG1 1 
ATOM   9103  C  CG2 . ILE B  2 294  ? -0.699  -19.390 6.154   1.00 242.71 ? 294  ILE B CG2 1 
ATOM   9104  C  CD1 . ILE B  2 294  ? -3.416  -20.770 6.328   1.00 243.07 ? 294  ILE B CD1 1 
ATOM   9105  N  N   . GLN B  2 295  ? 2.054   -19.509 7.566   1.00 251.11 ? 295  GLN B N   1 
ATOM   9106  C  CA  . GLN B  2 295  ? 3.119   -18.526 7.761   1.00 254.62 ? 295  GLN B CA  1 
ATOM   9107  C  C   . GLN B  2 295  ? 3.629   -17.930 6.453   1.00 303.63 ? 295  GLN B C   1 
ATOM   9108  O  O   . GLN B  2 295  ? 4.363   -18.584 5.713   1.00 335.56 ? 295  GLN B O   1 
ATOM   9109  C  CB  . GLN B  2 295  ? 4.290   -19.157 8.516   1.00 252.29 ? 295  GLN B CB  1 
ATOM   9110  C  CG  . GLN B  2 295  ? 3.957   -19.544 9.950   1.00 334.02 ? 295  GLN B CG  1 
ATOM   9111  C  CD  . GLN B  2 295  ? 3.360   -18.396 10.762  1.00 359.10 ? 295  GLN B CD  1 
ATOM   9112  O  OE1 . GLN B  2 295  ? 2.608   -18.620 11.713  1.00 325.39 ? 295  GLN B OE1 1 
ATOM   9113  N  NE2 . GLN B  2 295  ? 3.691   -17.164 10.387  1.00 376.08 ? 295  GLN B NE2 1 
ATOM   9114  N  N   . PRO B  2 296  ? 3.246   -16.677 6.174   1.00 312.45 ? 296  PRO B N   1 
ATOM   9115  C  CA  . PRO B  2 296  ? 3.691   -15.936 4.990   1.00 320.43 ? 296  PRO B CA  1 
ATOM   9116  C  C   . PRO B  2 296  ? 5.203   -15.758 4.955   1.00 304.15 ? 296  PRO B C   1 
ATOM   9117  O  O   . PRO B  2 296  ? 5.867   -15.862 5.988   1.00 264.71 ? 296  PRO B O   1 
ATOM   9118  C  CB  . PRO B  2 296  ? 3.010   -14.576 5.151   1.00 315.26 ? 296  PRO B CB  1 
ATOM   9119  C  CG  . PRO B  2 296  ? 1.847   -14.832 6.028   1.00 320.23 ? 296  PRO B CG  1 
ATOM   9120  C  CD  . PRO B  2 296  ? 2.271   -15.913 6.964   1.00 307.82 ? 296  PRO B CD  1 
ATOM   9121  N  N   . ILE B  2 297  ? 5.729   -15.491 3.764   1.00 306.31 ? 297  ILE B N   1 
ATOM   9122  C  CA  . ILE B  2 297  ? 7.155   -15.260 3.571   1.00 283.71 ? 297  ILE B CA  1 
ATOM   9123  C  C   . ILE B  2 297  ? 7.350   -13.951 2.809   1.00 261.49 ? 297  ILE B C   1 
ATOM   9124  O  O   . ILE B  2 297  ? 7.212   -13.904 1.584   1.00 223.02 ? 297  ILE B O   1 
ATOM   9125  C  CB  . ILE B  2 297  ? 7.817   -16.416 2.792   1.00 277.03 ? 297  ILE B CB  1 
ATOM   9126  C  CG1 . ILE B  2 297  ? 7.691   -17.730 3.572   1.00 255.08 ? 297  ILE B CG1 1 
ATOM   9127  C  CG2 . ILE B  2 297  ? 9.280   -16.102 2.513   1.00 281.38 ? 297  ILE B CG2 1 
ATOM   9128  C  CD1 . ILE B  2 297  ? 8.269   -18.937 2.854   1.00 158.36 ? 297  ILE B CD1 1 
ATOM   9129  N  N   . PHE B  2 298  ? 7.663   -12.889 3.545   1.00 285.19 ? 298  PHE B N   1 
ATOM   9130  C  CA  . PHE B  2 298  ? 7.804   -11.566 2.953   1.00 281.07 ? 298  PHE B CA  1 
ATOM   9131  C  C   . PHE B  2 298  ? 8.850   -11.569 1.856   1.00 294.00 ? 298  PHE B C   1 
ATOM   9132  O  O   . PHE B  2 298  ? 9.989   -11.983 2.063   1.00 312.24 ? 298  PHE B O   1 
ATOM   9133  C  CB  . PHE B  2 298  ? 8.173   -10.533 4.016   1.00 247.61 ? 298  PHE B CB  1 
ATOM   9134  C  CG  . PHE B  2 298  ? 7.183   -10.447 5.126   1.00 229.13 ? 298  PHE B CG  1 
ATOM   9135  C  CD1 . PHE B  2 298  ? 5.906   -9.986  4.883   1.00 185.46 ? 298  PHE B CD1 1 
ATOM   9136  C  CD2 . PHE B  2 298  ? 7.523   -10.839 6.410   1.00 276.01 ? 298  PHE B CD2 1 
ATOM   9137  C  CE1 . PHE B  2 298  ? 4.988   -9.912  5.897   1.00 225.25 ? 298  PHE B CE1 1 
ATOM   9138  C  CE2 . PHE B  2 298  ? 6.605   -10.765 7.435   1.00 284.92 ? 298  PHE B CE2 1 
ATOM   9139  C  CZ  . PHE B  2 298  ? 5.337   -10.301 7.180   1.00 273.74 ? 298  PHE B CZ  1 
ATOM   9140  N  N   . ALA B  2 299  ? 8.448   -11.103 0.684   1.00 277.01 ? 299  ALA B N   1 
ATOM   9141  C  CA  . ALA B  2 299  ? 9.353   -11.004 -0.440  1.00 231.55 ? 299  ALA B CA  1 
ATOM   9142  C  C   . ALA B  2 299  ? 8.877   -9.865  -1.330  1.00 236.30 ? 299  ALA B C   1 
ATOM   9143  O  O   . ALA B  2 299  ? 7.973   -10.037 -2.143  1.00 215.64 ? 299  ALA B O   1 
ATOM   9144  C  CB  . ALA B  2 299  ? 9.387   -12.316 -1.196  1.00 142.16 ? 299  ALA B CB  1 
ATOM   9145  N  N   . VAL B  2 300  ? 9.471   -8.689  -1.143  1.00 232.46 ? 300  VAL B N   1 
ATOM   9146  C  CA  . VAL B  2 300  ? 9.095   -7.508  -1.909  1.00 233.35 ? 300  VAL B CA  1 
ATOM   9147  C  C   . VAL B  2 300  ? 10.327  -6.705  -2.312  1.00 236.57 ? 300  VAL B C   1 
ATOM   9148  O  O   . VAL B  2 300  ? 11.458  -7.169  -2.162  1.00 238.36 ? 300  VAL B O   1 
ATOM   9149  C  CB  . VAL B  2 300  ? 8.167   -6.598  -1.098  1.00 287.58 ? 300  VAL B CB  1 
ATOM   9150  C  CG1 . VAL B  2 300  ? 6.939   -7.370  -0.649  1.00 287.94 ? 300  VAL B CG1 1 
ATOM   9151  C  CG2 . VAL B  2 300  ? 8.908   -6.021  0.100   1.00 295.24 ? 300  VAL B CG2 1 
ATOM   9152  N  N   . THR B  2 301  ? 10.103  -5.496  -2.818  1.00 251.03 ? 301  THR B N   1 
ATOM   9153  C  CA  . THR B  2 301  ? 11.194  -4.633  -3.256  1.00 255.92 ? 301  THR B CA  1 
ATOM   9154  C  C   . THR B  2 301  ? 12.092  -4.233  -2.085  1.00 266.25 ? 301  THR B C   1 
ATOM   9155  O  O   . THR B  2 301  ? 11.715  -4.398  -0.927  1.00 284.30 ? 301  THR B O   1 
ATOM   9156  C  CB  . THR B  2 301  ? 10.651  -3.362  -3.945  1.00 249.18 ? 301  THR B CB  1 
ATOM   9157  O  OG1 . THR B  2 301  ? 9.817   -2.630  -3.038  1.00 191.47 ? 301  THR B OG1 1 
ATOM   9158  C  CG2 . THR B  2 301  ? 9.840   -3.729  -5.173  1.00 243.04 ? 301  THR B CG2 1 
ATOM   9159  N  N   . SER B  2 302  ? 13.283  -3.724  -2.388  1.00 270.56 ? 302  SER B N   1 
ATOM   9160  C  CA  . SER B  2 302  ? 14.186  -3.221  -1.356  1.00 255.07 ? 302  SER B CA  1 
ATOM   9161  C  C   . SER B  2 302  ? 13.628  -1.926  -0.773  1.00 284.63 ? 302  SER B C   1 
ATOM   9162  O  O   . SER B  2 302  ? 14.064  -1.469  0.284   1.00 288.52 ? 302  SER B O   1 
ATOM   9163  C  CB  . SER B  2 302  ? 15.584  -2.977  -1.927  1.00 255.57 ? 302  SER B CB  1 
ATOM   9164  O  OG  . SER B  2 302  ? 15.548  -2.002  -2.952  1.00 328.59 ? 302  SER B OG  1 
ATOM   9165  N  N   . ARG B  2 303  ? 12.662  -1.339  -1.476  1.00 286.76 ? 303  ARG B N   1 
ATOM   9166  C  CA  . ARG B  2 303  ? 11.997  -0.126  -1.022  1.00 283.63 ? 303  ARG B CA  1 
ATOM   9167  C  C   . ARG B  2 303  ? 11.046  -0.455  0.124   1.00 306.21 ? 303  ARG B C   1 
ATOM   9168  O  O   . ARG B  2 303  ? 10.758  0.391   0.967   1.00 294.45 ? 303  ARG B O   1 
ATOM   9169  C  CB  . ARG B  2 303  ? 11.222  0.507   -2.178  1.00 276.20 ? 303  ARG B CB  1 
ATOM   9170  C  CG  . ARG B  2 303  ? 10.641  1.872   -1.879  1.00 301.63 ? 303  ARG B CG  1 
ATOM   9171  C  CD  . ARG B  2 303  ? 9.484   2.166   -2.810  1.00 312.23 ? 303  ARG B CD  1 
ATOM   9172  N  NE  . ARG B  2 303  ? 8.342   1.301   -2.528  1.00 322.31 ? 303  ARG B NE  1 
ATOM   9173  C  CZ  . ARG B  2 303  ? 7.321   1.107   -3.355  1.00 263.13 ? 303  ARG B CZ  1 
ATOM   9174  N  NH1 . ARG B  2 303  ? 7.291   1.709   -4.533  1.00 219.10 ? 303  ARG B NH1 1 
ATOM   9175  N  NH2 . ARG B  2 303  ? 6.327   0.304   -3.006  1.00 276.07 ? 303  ARG B NH2 1 
ATOM   9176  N  N   . MET B  2 304  ? 10.570  -1.697  0.148   1.00 307.52 ? 304  MET B N   1 
ATOM   9177  C  CA  . MET B  2 304  ? 9.632   -2.155  1.169   1.00 241.04 ? 304  MET B CA  1 
ATOM   9178  C  C   . MET B  2 304  ? 10.233  -3.279  2.009   1.00 259.21 ? 304  MET B C   1 
ATOM   9179  O  O   . MET B  2 304  ? 9.502   -4.089  2.576   1.00 232.51 ? 304  MET B O   1 
ATOM   9180  C  CB  . MET B  2 304  ? 8.350   -2.665  0.508   1.00 218.40 ? 304  MET B CB  1 
ATOM   9181  C  CG  . MET B  2 304  ? 7.539   -1.593  -0.174  1.00 285.71 ? 304  MET B CG  1 
ATOM   9182  S  SD  . MET B  2 304  ? 6.705   -0.568  1.035   1.00 215.73 ? 304  MET B SD  1 
ATOM   9183  C  CE  . MET B  2 304  ? 5.620   -1.759  1.808   1.00 268.85 ? 304  MET B CE  1 
ATOM   9184  N  N   . VAL B  2 305  ? 11.559  -3.334  2.087   1.00 305.57 ? 305  VAL B N   1 
ATOM   9185  C  CA  . VAL B  2 305  ? 12.232  -4.428  2.784   1.00 287.12 ? 305  VAL B CA  1 
ATOM   9186  C  C   . VAL B  2 305  ? 12.296  -4.223  4.293   1.00 271.99 ? 305  VAL B C   1 
ATOM   9187  O  O   . VAL B  2 305  ? 12.082  -5.161  5.059   1.00 225.69 ? 305  VAL B O   1 
ATOM   9188  C  CB  . VAL B  2 305  ? 13.666  -4.638  2.263   1.00 280.00 ? 305  VAL B CB  1 
ATOM   9189  C  CG1 . VAL B  2 305  ? 14.548  -3.447  2.613   1.00 297.56 ? 305  VAL B CG1 1 
ATOM   9190  C  CG2 . VAL B  2 305  ? 14.246  -5.916  2.838   1.00 200.14 ? 305  VAL B CG2 1 
ATOM   9191  N  N   . LYS B  2 306  ? 12.595  -2.998  4.716   1.00 297.26 ? 306  LYS B N   1 
ATOM   9192  C  CA  . LYS B  2 306  ? 12.763  -2.703  6.135   1.00 261.72 ? 306  LYS B CA  1 
ATOM   9193  C  C   . LYS B  2 306  ? 11.452  -2.288  6.798   1.00 214.25 ? 306  LYS B C   1 
ATOM   9194  O  O   . LYS B  2 306  ? 11.415  -2.037  8.000   1.00 264.08 ? 306  LYS B O   1 
ATOM   9195  C  CB  . LYS B  2 306  ? 13.826  -1.621  6.334   1.00 261.95 ? 306  LYS B CB  1 
ATOM   9196  C  CG  . LYS B  2 306  ? 15.230  -2.091  6.015   1.00 285.64 ? 306  LYS B CG  1 
ATOM   9197  C  CD  . LYS B  2 306  ? 16.281  -1.130  6.531   1.00 282.81 ? 306  LYS B CD  1 
ATOM   9198  C  CE  . LYS B  2 306  ? 17.670  -1.701  6.336   1.00 290.26 ? 306  LYS B CE  1 
ATOM   9199  N  NZ  . LYS B  2 306  ? 18.727  -0.814  6.885   1.00 276.21 ? 306  LYS B NZ  1 
ATOM   9200  N  N   . THR B  2 307  ? 10.380  -2.214  6.014   1.00 195.03 ? 307  THR B N   1 
ATOM   9201  C  CA  . THR B  2 307  ? 9.051   -1.960  6.562   1.00 199.68 ? 307  THR B CA  1 
ATOM   9202  C  C   . THR B  2 307  ? 8.404   -3.280  6.947   1.00 222.53 ? 307  THR B C   1 
ATOM   9203  O  O   . THR B  2 307  ? 7.674   -3.363  7.936   1.00 263.55 ? 307  THR B O   1 
ATOM   9204  C  CB  . THR B  2 307  ? 8.134   -1.230  5.564   1.00 265.52 ? 307  THR B CB  1 
ATOM   9205  O  OG1 . THR B  2 307  ? 6.849   -1.027  6.164   1.00 205.40 ? 307  THR B OG1 1 
ATOM   9206  C  CG2 . THR B  2 307  ? 7.963   -2.036  4.279   1.00 316.22 ? 307  THR B CG2 1 
ATOM   9207  N  N   . TYR B  2 308  ? 8.670   -4.309  6.149   1.00 233.25 ? 308  TYR B N   1 
ATOM   9208  C  CA  . TYR B  2 308  ? 8.251   -5.662  6.484   1.00 242.37 ? 308  TYR B CA  1 
ATOM   9209  C  C   . TYR B  2 308  ? 9.232   -6.251  7.493   1.00 255.98 ? 308  TYR B C   1 
ATOM   9210  O  O   . TYR B  2 308  ? 8.954   -7.270  8.122   1.00 243.32 ? 308  TYR B O   1 
ATOM   9211  C  CB  . TYR B  2 308  ? 8.171   -6.549  5.232   1.00 251.25 ? 308  TYR B CB  1 
ATOM   9212  C  CG  . TYR B  2 308  ? 7.022   -6.211  4.300   1.00 263.70 ? 308  TYR B CG  1 
ATOM   9213  C  CD1 . TYR B  2 308  ? 5.703   -6.297  4.727   1.00 266.52 ? 308  TYR B CD1 1 
ATOM   9214  C  CD2 . TYR B  2 308  ? 7.255   -5.817  2.991   1.00 246.37 ? 308  TYR B CD2 1 
ATOM   9215  C  CE1 . TYR B  2 308  ? 4.650   -5.988  3.875   1.00 251.45 ? 308  TYR B CE1 1 
ATOM   9216  C  CE2 . TYR B  2 308  ? 6.212   -5.506  2.135   1.00 229.27 ? 308  TYR B CE2 1 
ATOM   9217  C  CZ  . TYR B  2 308  ? 4.914   -5.592  2.578   1.00 222.65 ? 308  TYR B CZ  1 
ATOM   9218  O  OH  . TYR B  2 308  ? 3.884   -5.281  1.715   1.00 166.72 ? 308  TYR B OH  1 
ATOM   9219  N  N   . GLU B  2 309  ? 10.383  -5.603  7.645   1.00 288.31 ? 309  GLU B N   1 
ATOM   9220  C  CA  . GLU B  2 309  ? 11.372  -6.026  8.628   1.00 289.67 ? 309  GLU B CA  1 
ATOM   9221  C  C   . GLU B  2 309  ? 10.849  -5.806  10.047  1.00 325.19 ? 309  GLU B C   1 
ATOM   9222  O  O   . GLU B  2 309  ? 10.999  -6.666  10.917  1.00 346.07 ? 309  GLU B O   1 
ATOM   9223  C  CB  . GLU B  2 309  ? 12.675  -5.256  8.423   1.00 246.76 ? 309  GLU B CB  1 
ATOM   9224  C  CG  . GLU B  2 309  ? 13.729  -5.559  9.459   1.00 253.02 ? 309  GLU B CG  1 
ATOM   9225  C  CD  . GLU B  2 309  ? 14.196  -6.991  9.394   1.00 269.08 ? 309  GLU B CD  1 
ATOM   9226  O  OE1 . GLU B  2 309  ? 13.965  -7.641  8.355   1.00 256.43 ? 309  GLU B OE1 1 
ATOM   9227  O  OE2 . GLU B  2 309  ? 14.793  -7.467  10.379  1.00 310.31 ? 309  GLU B OE2 1 
ATOM   9228  N  N   . LYS B  2 310  ? 10.238  -4.647  10.274  1.00 310.27 ? 310  LYS B N   1 
ATOM   9229  C  CA  . LYS B  2 310  ? 9.619   -4.339  11.559  1.00 249.91 ? 310  LYS B CA  1 
ATOM   9230  C  C   . LYS B  2 310  ? 8.411   -5.236  11.792  1.00 251.60 ? 310  LYS B C   1 
ATOM   9231  O  O   . LYS B  2 310  ? 8.021   -5.490  12.932  1.00 295.60 ? 310  LYS B O   1 
ATOM   9232  C  CB  . LYS B  2 310  ? 9.189   -2.874  11.606  1.00 206.92 ? 310  LYS B CB  1 
ATOM   9233  C  CG  . LYS B  2 310  ? 10.341  -1.895  11.696  1.00 223.22 ? 310  LYS B CG  1 
ATOM   9234  C  CD  . LYS B  2 310  ? 11.054  -2.008  13.028  1.00 260.02 ? 310  LYS B CD  1 
ATOM   9235  C  CE  . LYS B  2 310  ? 12.158  -0.977  13.155  1.00 269.04 ? 310  LYS B CE  1 
ATOM   9236  N  NZ  . LYS B  2 310  ? 11.634  0.416   13.111  1.00 260.69 ? 310  LYS B NZ  1 
ATOM   9237  N  N   . LEU B  2 311  ? 7.819   -5.707  10.700  1.00 246.72 ? 311  LEU B N   1 
ATOM   9238  C  CA  . LEU B  2 311  ? 6.682   -6.613  10.768  1.00 238.95 ? 311  LEU B CA  1 
ATOM   9239  C  C   . LEU B  2 311  ? 7.118   -8.032  11.142  1.00 230.24 ? 311  LEU B C   1 
ATOM   9240  O  O   . LEU B  2 311  ? 6.329   -8.819  11.660  1.00 241.82 ? 311  LEU B O   1 
ATOM   9241  C  CB  . LEU B  2 311  ? 5.954   -6.627  9.427   1.00 243.68 ? 311  LEU B CB  1 
ATOM   9242  C  CG  . LEU B  2 311  ? 4.800   -7.617  9.321   1.00 221.62 ? 311  LEU B CG  1 
ATOM   9243  C  CD1 . LEU B  2 311  ? 3.841   -7.455  10.481  1.00 189.52 ? 311  LEU B CD1 1 
ATOM   9244  C  CD2 . LEU B  2 311  ? 4.082   -7.436  7.993   1.00 228.60 ? 311  LEU B CD2 1 
ATOM   9245  N  N   . THR B  2 312  ? 8.377   -8.356  10.872  1.00 208.91 ? 312  THR B N   1 
ATOM   9246  C  CA  . THR B  2 312  ? 8.924   -9.656  11.232  1.00 212.70 ? 312  THR B CA  1 
ATOM   9247  C  C   . THR B  2 312  ? 9.060   -9.789  12.746  1.00 257.13 ? 312  THR B C   1 
ATOM   9248  O  O   . THR B  2 312  ? 8.897   -10.876 13.306  1.00 208.24 ? 312  THR B O   1 
ATOM   9249  C  CB  . THR B  2 312  ? 10.303  -9.854  10.601  1.00 248.18 ? 312  THR B CB  1 
ATOM   9250  O  OG1 . THR B  2 312  ? 10.176  -9.907  9.176   1.00 303.62 ? 312  THR B OG1 1 
ATOM   9251  C  CG2 . THR B  2 312  ? 10.920  -11.134 11.089  1.00 231.39 ? 312  THR B CG2 1 
ATOM   9252  N  N   . GLU B  2 313  ? 9.365   -8.673  13.400  1.00 318.63 ? 313  GLU B N   1 
ATOM   9253  C  CA  . GLU B  2 313  ? 9.515   -8.643  14.847  1.00 324.37 ? 313  GLU B CA  1 
ATOM   9254  C  C   . GLU B  2 313  ? 8.244   -9.131  15.517  1.00 310.97 ? 313  GLU B C   1 
ATOM   9255  O  O   . GLU B  2 313  ? 8.277   -10.022 16.365  1.00 300.50 ? 313  GLU B O   1 
ATOM   9256  C  CB  . GLU B  2 313  ? 9.820   -7.220  15.313  1.00 314.89 ? 313  GLU B CB  1 
ATOM   9257  C  CG  . GLU B  2 313  ? 11.089  -6.639  14.725  1.00 322.11 ? 313  GLU B CG  1 
ATOM   9258  C  CD  . GLU B  2 313  ? 12.323  -7.386  15.176  1.00 334.47 ? 313  GLU B CD  1 
ATOM   9259  O  OE1 . GLU B  2 313  ? 12.212  -8.205  16.112  1.00 342.06 ? 313  GLU B OE1 1 
ATOM   9260  O  OE2 . GLU B  2 313  ? 13.403  -7.155  14.596  1.00 333.59 ? 313  GLU B OE2 1 
ATOM   9261  N  N   . ILE B  2 314  ? 7.122   -8.540  15.123  1.00 290.31 ? 314  ILE B N   1 
ATOM   9262  C  CA  . ILE B  2 314  ? 5.832   -8.862  15.711  1.00 234.71 ? 314  ILE B CA  1 
ATOM   9263  C  C   . ILE B  2 314  ? 5.430   -10.301 15.406  1.00 218.33 ? 314  ILE B C   1 
ATOM   9264  O  O   . ILE B  2 314  ? 5.629   -11.193 16.228  1.00 223.27 ? 314  ILE B O   1 
ATOM   9265  C  CB  . ILE B  2 314  ? 4.736   -7.897  15.205  1.00 226.92 ? 314  ILE B CB  1 
ATOM   9266  C  CG1 . ILE B  2 314  ? 5.007   -6.477  15.710  1.00 337.46 ? 314  ILE B CG1 1 
ATOM   9267  C  CG2 . ILE B  2 314  ? 3.360   -8.361  15.648  1.00 117.43 ? 314  ILE B CG2 1 
ATOM   9268  C  CD1 . ILE B  2 314  ? 5.147   -6.373  17.214  1.00 409.49 ? 314  ILE B CD1 1 
ATOM   9269  N  N   . ILE B  2 315  ? 4.875   -10.529 14.221  1.00 248.32 ? 315  ILE B N   1 
ATOM   9270  C  CA  . ILE B  2 315  ? 4.345   -11.841 13.876  1.00 257.28 ? 315  ILE B CA  1 
ATOM   9271  C  C   . ILE B  2 315  ? 5.454   -12.888 13.820  1.00 251.45 ? 315  ILE B C   1 
ATOM   9272  O  O   . ILE B  2 315  ? 6.571   -12.600 13.388  1.00 252.63 ? 315  ILE B O   1 
ATOM   9273  C  CB  . ILE B  2 315  ? 3.604   -11.811 12.533  1.00 264.30 ? 315  ILE B CB  1 
ATOM   9274  C  CG1 . ILE B  2 315  ? 2.734   -13.062 12.377  1.00 245.19 ? 315  ILE B CG1 1 
ATOM   9275  C  CG2 . ILE B  2 315  ? 4.599   -11.674 11.377  1.00 208.42 ? 315  ILE B CG2 1 
ATOM   9276  C  CD1 . ILE B  2 315  ? 1.696   -12.946 11.284  1.00 216.13 ? 315  ILE B CD1 1 
ATOM   9277  N  N   . PRO B  2 316  ? 5.145   -14.112 14.264  1.00 227.18 ? 316  PRO B N   1 
ATOM   9278  C  CA  . PRO B  2 316  ? 6.132   -15.192 14.302  1.00 222.71 ? 316  PRO B CA  1 
ATOM   9279  C  C   . PRO B  2 316  ? 6.354   -15.830 12.940  1.00 254.17 ? 316  PRO B C   1 
ATOM   9280  O  O   . PRO B  2 316  ? 5.582   -15.587 12.015  1.00 283.09 ? 316  PRO B O   1 
ATOM   9281  C  CB  . PRO B  2 316  ? 5.495   -16.219 15.246  1.00 223.90 ? 316  PRO B CB  1 
ATOM   9282  C  CG  . PRO B  2 316  ? 4.303   -15.543 15.855  1.00 207.35 ? 316  PRO B CG  1 
ATOM   9283  C  CD  . PRO B  2 316  ? 3.872   -14.520 14.876  1.00 196.79 ? 316  PRO B CD  1 
ATOM   9284  N  N   . LYS B  2 317  ? 7.400   -16.642 12.834  1.00 256.81 ? 317  LYS B N   1 
ATOM   9285  C  CA  . LYS B  2 317  ? 7.692   -17.391 11.616  1.00 300.75 ? 317  LYS B CA  1 
ATOM   9286  C  C   . LYS B  2 317  ? 7.438   -16.566 10.360  1.00 310.92 ? 317  LYS B C   1 
ATOM   9287  O  O   . LYS B  2 317  ? 6.441   -16.757 9.666   1.00 276.45 ? 317  LYS B O   1 
ATOM   9288  C  CB  . LYS B  2 317  ? 6.864   -18.673 11.574  1.00 301.77 ? 317  LYS B CB  1 
ATOM   9289  C  CG  . LYS B  2 317  ? 7.205   -19.652 12.680  1.00 238.04 ? 317  LYS B CG  1 
ATOM   9290  C  CD  . LYS B  2 317  ? 6.247   -20.824 12.690  1.00 267.92 ? 317  LYS B CD  1 
ATOM   9291  C  CE  . LYS B  2 317  ? 4.823   -20.362 12.955  1.00 279.82 ? 317  LYS B CE  1 
ATOM   9292  N  NZ  . LYS B  2 317  ? 4.682   -19.659 14.247  1.00 262.88 ? 317  LYS B NZ  1 
ATOM   9293  N  N   . SER B  2 318  ? 8.354   -15.650 10.072  1.00 321.20 ? 318  SER B N   1 
ATOM   9294  C  CA  . SER B  2 318  ? 8.252   -14.811 8.887   1.00 291.98 ? 318  SER B CA  1 
ATOM   9295  C  C   . SER B  2 318  ? 9.628   -14.269 8.512   1.00 289.92 ? 318  SER B C   1 
ATOM   9296  O  O   . SER B  2 318  ? 10.335  -13.722 9.359   1.00 298.01 ? 318  SER B O   1 
ATOM   9297  C  CB  . SER B  2 318  ? 7.281   -13.659 9.139   1.00 279.47 ? 318  SER B CB  1 
ATOM   9298  O  OG  . SER B  2 318  ? 7.694   -12.877 10.248  1.00 269.85 ? 318  SER B OG  1 
ATOM   9299  N  N   . ALA B  2 319  ? 10.002  -14.426 7.242   1.00 274.23 ? 319  ALA B N   1 
ATOM   9300  C  CA  . ALA B  2 319  ? 11.311  -13.990 6.757   1.00 297.15 ? 319  ALA B CA  1 
ATOM   9301  C  C   . ALA B  2 319  ? 11.201  -12.807 5.792   1.00 273.81 ? 319  ALA B C   1 
ATOM   9302  O  O   . ALA B  2 319  ? 10.160  -12.598 5.168   1.00 219.13 ? 319  ALA B O   1 
ATOM   9303  C  CB  . ALA B  2 319  ? 12.027  -15.148 6.079   1.00 331.75 ? 319  ALA B CB  1 
ATOM   9304  N  N   . VAL B  2 320  ? 12.285  -12.045 5.668   1.00 278.98 ? 320  VAL B N   1 
ATOM   9305  C  CA  . VAL B  2 320  ? 12.325  -10.895 4.770   1.00 257.78 ? 320  VAL B CA  1 
ATOM   9306  C  C   . VAL B  2 320  ? 13.203  -11.205 3.566   1.00 314.16 ? 320  VAL B C   1 
ATOM   9307  O  O   . VAL B  2 320  ? 14.308  -11.725 3.713   1.00 349.07 ? 320  VAL B O   1 
ATOM   9308  C  CB  . VAL B  2 320  ? 12.867  -9.636  5.477   1.00 239.17 ? 320  VAL B CB  1 
ATOM   9309  C  CG1 . VAL B  2 320  ? 11.900  -9.182  6.557   1.00 248.63 ? 320  VAL B CG1 1 
ATOM   9310  C  CG2 . VAL B  2 320  ? 14.247  -9.900  6.065   1.00 251.26 ? 320  VAL B CG2 1 
ATOM   9311  N  N   . GLY B  2 321  ? 12.708  -10.883 2.374   1.00 339.81 ? 321  GLY B N   1 
ATOM   9312  C  CA  . GLY B  2 321  ? 13.422  -11.187 1.147   1.00 317.34 ? 321  GLY B CA  1 
ATOM   9313  C  C   . GLY B  2 321  ? 13.460  -10.023 0.174   1.00 300.68 ? 321  GLY B C   1 
ATOM   9314  O  O   . GLY B  2 321  ? 12.489  -9.768  -0.539  1.00 281.39 ? 321  GLY B O   1 
ATOM   9315  N  N   . GLU B  2 322  ? 14.586  -9.316  0.145   1.00 300.74 ? 322  GLU B N   1 
ATOM   9316  C  CA  . GLU B  2 322  ? 14.779  -8.208  -0.785  1.00 280.87 ? 322  GLU B CA  1 
ATOM   9317  C  C   . GLU B  2 322  ? 15.132  -8.757  -2.160  1.00 323.41 ? 322  GLU B C   1 
ATOM   9318  O  O   . GLU B  2 322  ? 16.088  -9.519  -2.302  1.00 340.36 ? 322  GLU B O   1 
ATOM   9319  C  CB  . GLU B  2 322  ? 15.888  -7.276  -0.287  1.00 249.70 ? 322  GLU B CB  1 
ATOM   9320  C  CG  . GLU B  2 322  ? 16.121  -6.051  -1.158  1.00 230.56 ? 322  GLU B CG  1 
ATOM   9321  C  CD  . GLU B  2 322  ? 16.924  -6.363  -2.401  1.00 329.58 ? 322  GLU B CD  1 
ATOM   9322  O  OE1 . GLU B  2 322  ? 17.735  -7.311  -2.363  1.00 374.93 ? 322  GLU B OE1 1 
ATOM   9323  O  OE2 . GLU B  2 322  ? 16.749  -5.657  -3.414  1.00 359.28 ? 322  GLU B OE2 1 
ATOM   9324  N  N   . LEU B  2 323  ? 14.357  -8.372  -3.170  1.00 350.77 ? 323  LEU B N   1 
ATOM   9325  C  CA  . LEU B  2 323  ? 14.551  -8.882  -4.526  1.00 351.28 ? 323  LEU B CA  1 
ATOM   9326  C  C   . LEU B  2 323  ? 14.388  -7.781  -5.569  1.00 351.32 ? 323  LEU B C   1 
ATOM   9327  O  O   . LEU B  2 323  ? 13.930  -6.681  -5.259  1.00 372.68 ? 323  LEU B O   1 
ATOM   9328  C  CB  . LEU B  2 323  ? 13.565  -10.020 -4.810  1.00 322.27 ? 323  LEU B CB  1 
ATOM   9329  C  CG  . LEU B  2 323  ? 12.100  -9.755  -4.456  1.00 280.40 ? 323  LEU B CG  1 
ATOM   9330  C  CD1 . LEU B  2 323  ? 11.439  -8.881  -5.504  1.00 290.70 ? 323  LEU B CD1 1 
ATOM   9331  C  CD2 . LEU B  2 323  ? 11.345  -11.066 -4.309  1.00 209.82 ? 323  LEU B CD2 1 
ATOM   9332  N  N   . SER B  2 324  ? 14.766  -8.083  -6.807  1.00 314.83 ? 324  SER B N   1 
ATOM   9333  C  CA  . SER B  2 324  ? 14.653  -7.121  -7.894  1.00 293.08 ? 324  SER B CA  1 
ATOM   9334  C  C   . SER B  2 324  ? 13.197  -6.962  -8.302  1.00 285.85 ? 324  SER B C   1 
ATOM   9335  O  O   . SER B  2 324  ? 12.361  -7.803  -7.983  1.00 258.61 ? 324  SER B O   1 
ATOM   9336  C  CB  . SER B  2 324  ? 15.484  -7.569  -9.093  1.00 288.40 ? 324  SER B CB  1 
ATOM   9337  O  OG  . SER B  2 324  ? 16.862  -7.606  -8.768  1.00 294.78 ? 324  SER B OG  1 
ATOM   9338  N  N   . GLU B  2 325  ? 12.904  -5.887  -9.022  1.00 302.29 ? 325  GLU B N   1 
ATOM   9339  C  CA  . GLU B  2 325  ? 11.534  -5.563  -9.400  1.00 285.71 ? 325  GLU B CA  1 
ATOM   9340  C  C   . GLU B  2 325  ? 11.000  -6.487  -10.501 1.00 287.15 ? 325  GLU B C   1 
ATOM   9341  O  O   . GLU B  2 325  ? 9.899   -6.279  -11.009 1.00 274.58 ? 325  GLU B O   1 
ATOM   9342  C  CB  . GLU B  2 325  ? 11.455  -4.099  -9.846  1.00 245.67 ? 325  GLU B CB  1 
ATOM   9343  C  CG  . GLU B  2 325  ? 10.067  -3.623  -10.235 1.00 270.93 ? 325  GLU B CG  1 
ATOM   9344  C  CD  . GLU B  2 325  ? 9.018   -3.970  -9.201  1.00 340.20 ? 325  GLU B CD  1 
ATOM   9345  O  OE1 . GLU B  2 325  ? 9.338   -3.941  -7.994  1.00 371.27 ? 325  GLU B OE1 1 
ATOM   9346  O  OE2 . GLU B  2 325  ? 7.871   -4.267  -9.594  1.00 364.38 ? 325  GLU B OE2 1 
ATOM   9347  N  N   . ASP B  2 326  ? 11.771  -7.513  -10.856 1.00 314.07 ? 326  ASP B N   1 
ATOM   9348  C  CA  . ASP B  2 326  ? 11.382  -8.432  -11.929 1.00 333.05 ? 326  ASP B CA  1 
ATOM   9349  C  C   . ASP B  2 326  ? 10.905  -9.790  -11.410 1.00 318.96 ? 326  ASP B C   1 
ATOM   9350  O  O   . ASP B  2 326  ? 10.428  -10.621 -12.184 1.00 321.68 ? 326  ASP B O   1 
ATOM   9351  C  CB  . ASP B  2 326  ? 12.539  -8.634  -12.915 1.00 320.56 ? 326  ASP B CB  1 
ATOM   9352  C  CG  . ASP B  2 326  ? 13.747  -9.295  -12.280 1.00 306.49 ? 326  ASP B CG  1 
ATOM   9353  O  OD1 . ASP B  2 326  ? 13.745  -9.497  -11.048 1.00 347.74 ? 326  ASP B OD1 1 
ATOM   9354  O  OD2 . ASP B  2 326  ? 14.703  -9.614  -13.017 1.00 234.93 ? 326  ASP B OD2 1 
ATOM   9355  N  N   . SER B  2 327  ? 11.035  -10.013 -10.105 1.00 269.60 ? 327  SER B N   1 
ATOM   9356  C  CA  . SER B  2 327  ? 10.598  -11.265 -9.494  1.00 254.98 ? 327  SER B CA  1 
ATOM   9357  C  C   . SER B  2 327  ? 11.266  -12.456 -10.166 1.00 305.15 ? 327  SER B C   1 
ATOM   9358  O  O   . SER B  2 327  ? 10.653  -13.510 -10.327 1.00 272.96 ? 327  SER B O   1 
ATOM   9359  C  CB  . SER B  2 327  ? 9.076   -11.414 -9.589  1.00 165.29 ? 327  SER B CB  1 
ATOM   9360  O  OG  . SER B  2 327  ? 8.416   -10.368 -8.910  1.00 155.94 ? 327  SER B OG  1 
ATOM   9361  N  N   . SER B  2 328  ? 12.525  -12.283 -10.557 1.00 344.73 ? 328  SER B N   1 
ATOM   9362  C  CA  . SER B  2 328  ? 13.273  -13.346 -11.215 1.00 331.00 ? 328  SER B CA  1 
ATOM   9363  C  C   . SER B  2 328  ? 13.934  -14.245 -10.177 1.00 344.67 ? 328  SER B C   1 
ATOM   9364  O  O   . SER B  2 328  ? 13.966  -15.464 -10.334 1.00 364.91 ? 328  SER B O   1 
ATOM   9365  C  CB  . SER B  2 328  ? 14.330  -12.759 -12.150 1.00 299.34 ? 328  SER B CB  1 
ATOM   9366  O  OG  . SER B  2 328  ? 15.254  -11.957 -11.438 1.00 311.29 ? 328  SER B OG  1 
ATOM   9367  N  N   . ASN B  2 329  ? 14.457  -13.637 -9.116  1.00 331.67 ? 329  ASN B N   1 
ATOM   9368  C  CA  . ASN B  2 329  ? 15.079  -14.387 -8.030  1.00 294.76 ? 329  ASN B CA  1 
ATOM   9369  C  C   . ASN B  2 329  ? 14.070  -14.705 -6.941  1.00 275.06 ? 329  ASN B C   1 
ATOM   9370  O  O   . ASN B  2 329  ? 14.359  -14.563 -5.755  1.00 233.71 ? 329  ASN B O   1 
ATOM   9371  C  CB  . ASN B  2 329  ? 16.251  -13.606 -7.433  1.00 290.62 ? 329  ASN B CB  1 
ATOM   9372  C  CG  . ASN B  2 329  ? 15.830  -12.265 -6.865  1.00 253.36 ? 329  ASN B CG  1 
ATOM   9373  O  OD1 . ASN B  2 329  ? 14.646  -11.929 -6.841  1.00 212.10 ? 329  ASN B OD1 1 
ATOM   9374  N  ND2 . ASN B  2 329  ? 16.802  -11.489 -6.404  1.00 223.76 ? 329  ASN B ND2 1 
ATOM   9375  N  N   . VAL B  2 330  ? 12.886  -15.143 -7.354  1.00 299.35 ? 330  VAL B N   1 
ATOM   9376  C  CA  . VAL B  2 330  ? 11.799  -15.418 -6.425  1.00 301.88 ? 330  VAL B CA  1 
ATOM   9377  C  C   . VAL B  2 330  ? 11.908  -16.826 -5.839  1.00 327.59 ? 330  VAL B C   1 
ATOM   9378  O  O   . VAL B  2 330  ? 11.454  -17.073 -4.723  1.00 374.49 ? 330  VAL B O   1 
ATOM   9379  C  CB  . VAL B  2 330  ? 10.427  -15.254 -7.113  1.00 279.13 ? 330  VAL B CB  1 
ATOM   9380  C  CG1 . VAL B  2 330  ? 10.257  -16.287 -8.215  1.00 301.33 ? 330  VAL B CG1 1 
ATOM   9381  C  CG2 . VAL B  2 330  ? 9.302   -15.363 -6.097  1.00 261.22 ? 330  VAL B CG2 1 
ATOM   9382  N  N   . VAL B  2 331  ? 12.511  -17.746 -6.587  1.00 289.30 ? 331  VAL B N   1 
ATOM   9383  C  CA  . VAL B  2 331  ? 12.636  -19.131 -6.137  1.00 240.02 ? 331  VAL B CA  1 
ATOM   9384  C  C   . VAL B  2 331  ? 13.752  -19.276 -5.100  1.00 237.20 ? 331  VAL B C   1 
ATOM   9385  O  O   . VAL B  2 331  ? 13.761  -20.227 -4.321  1.00 256.18 ? 331  VAL B O   1 
ATOM   9386  C  CB  . VAL B  2 331  ? 12.900  -20.099 -7.314  1.00 243.20 ? 331  VAL B CB  1 
ATOM   9387  C  CG1 . VAL B  2 331  ? 12.888  -21.547 -6.838  1.00 205.82 ? 331  VAL B CG1 1 
ATOM   9388  C  CG2 . VAL B  2 331  ? 11.869  -19.900 -8.407  1.00 247.60 ? 331  VAL B CG2 1 
ATOM   9389  N  N   . GLN B  2 332  ? 14.692  -18.334 -5.090  1.00 259.08 ? 332  GLN B N   1 
ATOM   9390  C  CA  . GLN B  2 332  ? 15.762  -18.337 -4.094  1.00 274.43 ? 332  GLN B CA  1 
ATOM   9391  C  C   . GLN B  2 332  ? 15.253  -17.842 -2.738  1.00 315.89 ? 332  GLN B C   1 
ATOM   9392  O  O   . GLN B  2 332  ? 15.959  -17.930 -1.731  1.00 335.28 ? 332  GLN B O   1 
ATOM   9393  C  CB  . GLN B  2 332  ? 16.936  -17.474 -4.559  1.00 258.14 ? 332  GLN B CB  1 
ATOM   9394  C  CG  . GLN B  2 332  ? 18.120  -17.493 -3.612  1.00 245.50 ? 332  GLN B CG  1 
ATOM   9395  C  CD  . GLN B  2 332  ? 19.364  -16.903 -4.232  1.00 287.74 ? 332  GLN B CD  1 
ATOM   9396  O  OE1 . GLN B  2 332  ? 19.357  -16.484 -5.388  1.00 326.49 ? 332  GLN B OE1 1 
ATOM   9397  N  NE2 . GLN B  2 332  ? 20.443  -16.868 -3.466  1.00 293.17 ? 332  GLN B NE2 1 
ATOM   9398  N  N   . LEU B  2 333  ? 14.028  -17.318 -2.726  1.00 317.43 ? 333  LEU B N   1 
ATOM   9399  C  CA  . LEU B  2 333  ? 13.377  -16.884 -1.491  1.00 266.12 ? 333  LEU B CA  1 
ATOM   9400  C  C   . LEU B  2 333  ? 13.202  -18.054 -0.541  1.00 278.82 ? 333  LEU B C   1 
ATOM   9401  O  O   . LEU B  2 333  ? 13.385  -17.919 0.667   1.00 321.25 ? 333  LEU B O   1 
ATOM   9402  C  CB  . LEU B  2 333  ? 11.995  -16.293 -1.786  1.00 250.99 ? 333  LEU B CB  1 
ATOM   9403  C  CG  . LEU B  2 333  ? 11.937  -14.958 -2.524  1.00 278.13 ? 333  LEU B CG  1 
ATOM   9404  C  CD1 . LEU B  2 333  ? 10.509  -14.651 -2.947  1.00 330.74 ? 333  LEU B CD1 1 
ATOM   9405  C  CD2 . LEU B  2 333  ? 12.493  -13.845 -1.656  1.00 199.87 ? 333  LEU B CD2 1 
ATOM   9406  N  N   . ILE B  2 334  ? 12.833  -19.202 -1.099  1.00 275.48 ? 334  ILE B N   1 
ATOM   9407  C  CA  . ILE B  2 334  ? 12.510  -20.376 -0.299  1.00 267.50 ? 334  ILE B CA  1 
ATOM   9408  C  C   . ILE B  2 334  ? 13.776  -21.137 0.110   1.00 307.60 ? 334  ILE B C   1 
ATOM   9409  O  O   . ILE B  2 334  ? 13.753  -21.912 1.066   1.00 301.82 ? 334  ILE B O   1 
ATOM   9410  C  CB  . ILE B  2 334  ? 11.520  -21.304 -1.040  1.00 282.54 ? 334  ILE B CB  1 
ATOM   9411  C  CG1 . ILE B  2 334  ? 10.314  -20.496 -1.535  1.00 185.06 ? 334  ILE B CG1 1 
ATOM   9412  C  CG2 . ILE B  2 334  ? 11.053  -22.436 -0.133  1.00 371.59 ? 334  ILE B CG2 1 
ATOM   9413  C  CD1 . ILE B  2 334  ? 9.282   -21.317 -2.286  1.00 212.37 ? 334  ILE B CD1 1 
ATOM   9414  N  N   . LYS B  2 335  ? 14.878  -20.913 -0.605  1.00 355.94 ? 335  LYS B N   1 
ATOM   9415  C  CA  . LYS B  2 335  ? 16.179  -21.408 -0.162  1.00 352.55 ? 335  LYS B CA  1 
ATOM   9416  C  C   . LYS B  2 335  ? 16.585  -20.624 1.073   1.00 302.15 ? 335  LYS B C   1 
ATOM   9417  O  O   . LYS B  2 335  ? 17.393  -21.075 1.884   1.00 296.23 ? 335  LYS B O   1 
ATOM   9418  C  CB  . LYS B  2 335  ? 17.239  -21.247 -1.252  1.00 360.85 ? 335  LYS B CB  1 
ATOM   9419  C  CG  . LYS B  2 335  ? 18.666  -21.432 -0.751  1.00 350.74 ? 335  LYS B CG  1 
ATOM   9420  C  CD  . LYS B  2 335  ? 18.855  -22.789 -0.088  1.00 333.81 ? 335  LYS B CD  1 
ATOM   9421  C  CE  . LYS B  2 335  ? 20.145  -22.848 0.713   1.00 290.00 ? 335  LYS B CE  1 
ATOM   9422  N  NZ  . LYS B  2 335  ? 21.352  -22.717 -0.145  1.00 252.90 ? 335  LYS B NZ  1 
ATOM   9423  N  N   . ASN B  2 336  ? 16.009  -19.435 1.197   1.00 284.52 ? 336  ASN B N   1 
ATOM   9424  C  CA  . ASN B  2 336  ? 16.191  -18.605 2.374   1.00 304.05 ? 336  ASN B CA  1 
ATOM   9425  C  C   . ASN B  2 336  ? 15.008  -18.737 3.348   1.00 316.47 ? 336  ASN B C   1 
ATOM   9426  O  O   . ASN B  2 336  ? 15.051  -18.209 4.460   1.00 263.27 ? 336  ASN B O   1 
ATOM   9427  C  CB  . ASN B  2 336  ? 16.372  -17.146 1.952   1.00 287.22 ? 336  ASN B CB  1 
ATOM   9428  C  CG  . ASN B  2 336  ? 17.497  -16.962 0.945   1.00 235.42 ? 336  ASN B CG  1 
ATOM   9429  O  OD1 . ASN B  2 336  ? 18.223  -17.902 0.623   1.00 229.82 ? 336  ASN B OD1 1 
ATOM   9430  N  ND2 . ASN B  2 336  ? 17.643  -15.743 0.444   1.00 183.69 ? 336  ASN B ND2 1 
ATOM   9431  N  N   . ALA B  2 337  ? 13.956  -19.441 2.927   1.00 340.18 ? 337  ALA B N   1 
ATOM   9432  C  CA  . ALA B  2 337  ? 12.788  -19.679 3.779   1.00 282.82 ? 337  ALA B CA  1 
ATOM   9433  C  C   . ALA B  2 337  ? 13.094  -20.748 4.822   1.00 261.25 ? 337  ALA B C   1 
ATOM   9434  O  O   . ALA B  2 337  ? 13.215  -20.446 6.004   1.00 252.10 ? 337  ALA B O   1 
ATOM   9435  C  CB  . ALA B  2 337  ? 11.587  -20.090 2.940   1.00 260.79 ? 337  ALA B CB  1 
ATOM   9436  N  N   . TYR B  2 338  ? 13.216  -21.996 4.378   1.00 255.78 ? 338  TYR B N   1 
ATOM   9437  C  CA  . TYR B  2 338  ? 13.608  -23.092 5.261   1.00 221.81 ? 338  TYR B CA  1 
ATOM   9438  C  C   . TYR B  2 338  ? 14.899  -22.757 6.008   1.00 221.65 ? 338  TYR B C   1 
ATOM   9439  O  O   . TYR B  2 338  ? 15.173  -23.314 7.070   1.00 208.41 ? 338  TYR B O   1 
ATOM   9440  C  CB  . TYR B  2 338  ? 13.801  -24.385 4.461   1.00 252.53 ? 338  TYR B CB  1 
ATOM   9441  C  CG  . TYR B  2 338  ? 12.513  -25.062 4.032   1.00 283.04 ? 338  TYR B CG  1 
ATOM   9442  C  CD1 . TYR B  2 338  ? 12.072  -24.991 2.716   1.00 373.80 ? 338  TYR B CD1 1 
ATOM   9443  C  CD2 . TYR B  2 338  ? 11.746  -25.784 4.939   1.00 185.55 ? 338  TYR B CD2 1 
ATOM   9444  C  CE1 . TYR B  2 338  ? 10.899  -25.615 2.317   1.00 387.22 ? 338  TYR B CE1 1 
ATOM   9445  C  CE2 . TYR B  2 338  ? 10.573  -26.409 4.550   1.00 217.53 ? 338  TYR B CE2 1 
ATOM   9446  C  CZ  . TYR B  2 338  ? 10.151  -26.322 3.239   1.00 300.99 ? 338  TYR B CZ  1 
ATOM   9447  O  OH  . TYR B  2 338  ? 8.983   -26.947 2.851   1.00 256.48 ? 338  TYR B OH  1 
ATOM   9448  N  N   . ASN B  2 339  ? 15.693  -21.855 5.438   1.00 271.67 ? 339  ASN B N   1 
ATOM   9449  C  CA  . ASN B  2 339  ? 16.934  -21.410 6.060   1.00 306.08 ? 339  ASN B CA  1 
ATOM   9450  C  C   . ASN B  2 339  ? 16.715  -20.974 7.504   1.00 338.13 ? 339  ASN B C   1 
ATOM   9451  O  O   . ASN B  2 339  ? 17.407  -21.433 8.412   1.00 364.70 ? 339  ASN B O   1 
ATOM   9452  C  CB  . ASN B  2 339  ? 17.534  -20.252 5.261   1.00 316.88 ? 339  ASN B CB  1 
ATOM   9453  C  CG  . ASN B  2 339  ? 18.920  -19.869 5.740   1.00 312.96 ? 339  ASN B CG  1 
ATOM   9454  O  OD1 . ASN B  2 339  ? 19.416  -20.402 6.732   1.00 310.17 ? 339  ASN B OD1 1 
ATOM   9455  N  ND2 . ASN B  2 339  ? 19.553  -18.938 5.034   1.00 310.88 ? 339  ASN B ND2 1 
ATOM   9456  N  N   . LYS B  2 340  ? 15.748  -20.085 7.707   1.00 322.81 ? 340  LYS B N   1 
ATOM   9457  C  CA  . LYS B  2 340  ? 15.461  -19.563 9.037   1.00 290.49 ? 340  LYS B CA  1 
ATOM   9458  C  C   . LYS B  2 340  ? 13.967  -19.629 9.373   1.00 273.11 ? 340  LYS B C   1 
ATOM   9459  O  O   . LYS B  2 340  ? 13.493  -18.916 10.256  1.00 287.42 ? 340  LYS B O   1 
ATOM   9460  C  CB  . LYS B  2 340  ? 15.974  -18.126 9.160   1.00 271.61 ? 340  LYS B CB  1 
ATOM   9461  C  CG  . LYS B  2 340  ? 17.467  -17.984 8.907   1.00 260.72 ? 340  LYS B CG  1 
ATOM   9462  C  CD  . LYS B  2 340  ? 18.278  -18.761 9.922   1.00 266.16 ? 340  LYS B CD  1 
ATOM   9463  C  CE  . LYS B  2 340  ? 19.752  -18.715 9.594   1.00 271.45 ? 340  LYS B CE  1 
ATOM   9464  N  NZ  . LYS B  2 340  ? 20.545  -19.534 10.542  1.00 265.02 ? 340  LYS B NZ  1 
ATOM   9465  N  N   . LEU B  2 341  ? 13.234  -20.489 8.669   1.00 271.80 ? 341  LEU B N   1 
ATOM   9466  C  CA  . LEU B  2 341  ? 11.825  -20.739 8.975   1.00 281.63 ? 341  LEU B CA  1 
ATOM   9467  C  C   . LEU B  2 341  ? 11.711  -22.083 9.689   1.00 311.26 ? 341  LEU B C   1 
ATOM   9468  O  O   . LEU B  2 341  ? 10.798  -22.298 10.488  1.00 327.25 ? 341  LEU B O   1 
ATOM   9469  C  CB  . LEU B  2 341  ? 10.966  -20.729 7.705   1.00 282.61 ? 341  LEU B CB  1 
ATOM   9470  C  CG  . LEU B  2 341  ? 9.479   -21.044 7.899   1.00 245.86 ? 341  LEU B CG  1 
ATOM   9471  C  CD1 . LEU B  2 341  ? 8.818   -20.039 8.816   1.00 140.88 ? 341  LEU B CD1 1 
ATOM   9472  C  CD2 . LEU B  2 341  ? 8.762   -21.084 6.558   1.00 292.20 ? 341  LEU B CD2 1 
ATOM   9473  N  N   . SER B  2 342  ? 12.646  -22.985 9.390   1.00 297.47 ? 342  SER B N   1 
ATOM   9474  C  CA  . SER B  2 342  ? 12.791  -24.235 10.135  1.00 239.68 ? 342  SER B CA  1 
ATOM   9475  C  C   . SER B  2 342  ? 13.752  -24.001 11.287  1.00 239.38 ? 342  SER B C   1 
ATOM   9476  O  O   . SER B  2 342  ? 14.237  -24.945 11.920  1.00 196.02 ? 342  SER B O   1 
ATOM   9477  C  CB  . SER B  2 342  ? 13.330  -25.358 9.243   1.00 240.44 ? 342  SER B CB  1 
ATOM   9478  O  OG  . SER B  2 342  ? 12.453  -25.644 8.169   1.00 280.51 ? 342  SER B OG  1 
ATOM   9479  N  N   . SER B  2 343  ? 14.014  -22.724 11.546  1.00 285.72 ? 343  SER B N   1 
ATOM   9480  C  CA  . SER B  2 343  ? 14.956  -22.306 12.571  1.00 263.93 ? 343  SER B CA  1 
ATOM   9481  C  C   . SER B  2 343  ? 14.249  -21.691 13.786  1.00 240.53 ? 343  SER B C   1 
ATOM   9482  O  O   . SER B  2 343  ? 14.672  -21.897 14.924  1.00 213.50 ? 343  SER B O   1 
ATOM   9483  C  CB  . SER B  2 343  ? 15.943  -21.299 11.977  1.00 256.97 ? 343  SER B CB  1 
ATOM   9484  O  OG  . SER B  2 343  ? 16.798  -21.922 11.032  1.00 179.13 ? 343  SER B OG  1 
ATOM   9485  N  N   . ARG B  2 344  ? 13.174  -20.942 13.547  1.00 225.95 ? 344  ARG B N   1 
ATOM   9486  C  CA  . ARG B  2 344  ? 12.446  -20.292 14.635  1.00 222.02 ? 344  ARG B CA  1 
ATOM   9487  C  C   . ARG B  2 344  ? 11.588  -21.271 15.421  1.00 261.26 ? 344  ARG B C   1 
ATOM   9488  O  O   . ARG B  2 344  ? 10.393  -21.415 15.154  1.00 276.10 ? 344  ARG B O   1 
ATOM   9489  C  CB  . ARG B  2 344  ? 11.559  -19.170 14.103  1.00 179.67 ? 344  ARG B CB  1 
ATOM   9490  C  CG  . ARG B  2 344  ? 12.327  -17.976 13.612  1.00 166.10 ? 344  ARG B CG  1 
ATOM   9491  C  CD  . ARG B  2 344  ? 11.389  -16.842 13.276  1.00 249.47 ? 344  ARG B CD  1 
ATOM   9492  N  NE  . ARG B  2 344  ? 12.124  -15.662 12.848  1.00 313.43 ? 344  ARG B NE  1 
ATOM   9493  C  CZ  . ARG B  2 344  ? 11.559  -14.531 12.448  1.00 313.61 ? 344  ARG B CZ  1 
ATOM   9494  N  NH1 . ARG B  2 344  ? 10.237  -14.408 12.419  1.00 280.15 ? 344  ARG B NH1 1 
ATOM   9495  N  NH2 . ARG B  2 344  ? 12.328  -13.521 12.076  1.00 330.11 ? 344  ARG B NH2 1 
ATOM   9496  N  N   . VAL B  2 345  ? 12.205  -21.937 16.392  1.00 253.57 ? 345  VAL B N   1 
ATOM   9497  C  CA  . VAL B  2 345  ? 11.485  -22.846 17.273  1.00 242.04 ? 345  VAL B CA  1 
ATOM   9498  C  C   . VAL B  2 345  ? 10.713  -22.049 18.310  1.00 248.59 ? 345  VAL B C   1 
ATOM   9499  O  O   . VAL B  2 345  ? 11.304  -21.329 19.116  1.00 242.95 ? 345  VAL B O   1 
ATOM   9500  C  CB  . VAL B  2 345  ? 12.439  -23.805 18.008  1.00 220.81 ? 345  VAL B CB  1 
ATOM   9501  C  CG1 . VAL B  2 345  ? 11.641  -24.806 18.833  1.00 235.53 ? 345  VAL B CG1 1 
ATOM   9502  C  CG2 . VAL B  2 345  ? 13.333  -24.529 17.021  1.00 215.42 ? 345  VAL B CG2 1 
ATOM   9503  N  N   . PHE B  2 346  ? 9.392   -22.183 18.289  1.00 253.09 ? 346  PHE B N   1 
ATOM   9504  C  CA  . PHE B  2 346  ? 8.540   -21.455 19.221  1.00 262.52 ? 346  PHE B CA  1 
ATOM   9505  C  C   . PHE B  2 346  ? 7.958   -22.389 20.285  1.00 264.71 ? 346  PHE B C   1 
ATOM   9506  O  O   . PHE B  2 346  ? 7.838   -23.600 20.071  1.00 216.57 ? 346  PHE B O   1 
ATOM   9507  C  CB  . PHE B  2 346  ? 7.426   -20.722 18.463  1.00 246.98 ? 346  PHE B CB  1 
ATOM   9508  C  CG  . PHE B  2 346  ? 7.871   -19.421 17.831  1.00 257.32 ? 346  PHE B CG  1 
ATOM   9509  C  CD1 . PHE B  2 346  ? 7.810   -19.241 16.456  1.00 288.79 ? 346  PHE B CD1 1 
ATOM   9510  C  CD2 . PHE B  2 346  ? 8.350   -18.380 18.614  1.00 218.14 ? 346  PHE B CD2 1 
ATOM   9511  C  CE1 . PHE B  2 346  ? 8.216   -18.047 15.877  1.00 259.75 ? 346  PHE B CE1 1 
ATOM   9512  C  CE2 . PHE B  2 346  ? 8.758   -17.185 18.040  1.00 218.33 ? 346  PHE B CE2 1 
ATOM   9513  C  CZ  . PHE B  2 346  ? 8.690   -17.019 16.670  1.00 229.81 ? 346  PHE B CZ  1 
ATOM   9514  N  N   . LEU B  2 347  ? 7.602   -21.813 21.432  1.00 258.18 ? 347  LEU B N   1 
ATOM   9515  C  CA  . LEU B  2 347  ? 7.143   -22.593 22.573  1.00 223.11 ? 347  LEU B CA  1 
ATOM   9516  C  C   . LEU B  2 347  ? 6.222   -21.782 23.492  1.00 243.46 ? 347  LEU B C   1 
ATOM   9517  O  O   . LEU B  2 347  ? 6.443   -21.713 24.700  1.00 276.25 ? 347  LEU B O   1 
ATOM   9518  C  CB  . LEU B  2 347  ? 8.352   -23.085 23.363  1.00 187.82 ? 347  LEU B CB  1 
ATOM   9519  C  CG  . LEU B  2 347  ? 8.145   -24.405 24.101  1.00 226.40 ? 347  LEU B CG  1 
ATOM   9520  C  CD1 . LEU B  2 347  ? 8.090   -25.557 23.114  1.00 140.51 ? 347  LEU B CD1 1 
ATOM   9521  C  CD2 . LEU B  2 347  ? 9.255   -24.612 25.110  1.00 291.21 ? 347  LEU B CD2 1 
ATOM   9522  N  N   . ASP B  2 348  ? 5.190   -21.169 22.916  1.00 264.85 ? 348  ASP B N   1 
ATOM   9523  C  CA  . ASP B  2 348  ? 4.210   -20.409 23.693  1.00 257.96 ? 348  ASP B CA  1 
ATOM   9524  C  C   . ASP B  2 348  ? 3.107   -21.324 24.225  1.00 245.51 ? 348  ASP B C   1 
ATOM   9525  O  O   . ASP B  2 348  ? 3.231   -22.549 24.176  1.00 232.24 ? 348  ASP B O   1 
ATOM   9526  C  CB  . ASP B  2 348  ? 3.615   -19.283 22.843  1.00 261.18 ? 348  ASP B CB  1 
ATOM   9527  C  CG  . ASP B  2 348  ? 4.549   -18.098 22.720  1.00 256.75 ? 348  ASP B CG  1 
ATOM   9528  O  OD1 . ASP B  2 348  ? 5.606   -18.105 23.386  1.00 239.82 ? 348  ASP B OD1 1 
ATOM   9529  O  OD2 . ASP B  2 348  ? 4.226   -17.160 21.961  1.00 252.12 ? 348  ASP B OD2 1 
ATOM   9530  N  N   . HIS B  2 349  ? 2.032   -20.729 24.735  1.00 236.27 ? 349  HIS B N   1 
ATOM   9531  C  CA  . HIS B  2 349  ? 0.949   -21.505 25.333  1.00 211.91 ? 349  HIS B CA  1 
ATOM   9532  C  C   . HIS B  2 349  ? -0.388  -20.783 25.240  1.00 256.07 ? 349  HIS B C   1 
ATOM   9533  O  O   . HIS B  2 349  ? -0.436  -19.571 25.024  1.00 288.12 ? 349  HIS B O   1 
ATOM   9534  C  CB  . HIS B  2 349  ? 1.263   -21.743 26.797  1.00 191.10 ? 349  HIS B CB  1 
ATOM   9535  C  CG  . HIS B  2 349  ? 1.558   -20.482 27.547  1.00 244.22 ? 349  HIS B CG  1 
ATOM   9536  N  ND1 . HIS B  2 349  ? 2.750   -19.800 27.413  1.00 202.98 ? 349  HIS B ND1 1 
ATOM   9537  C  CD2 . HIS B  2 349  ? 0.809   -19.765 28.415  1.00 264.67 ? 349  HIS B CD2 1 
ATOM   9538  C  CE1 . HIS B  2 349  ? 2.727   -18.727 28.181  1.00 210.15 ? 349  HIS B CE1 1 
ATOM   9539  N  NE2 . HIS B  2 349  ? 1.560   -18.680 28.799  1.00 247.24 ? 349  HIS B NE2 1 
ATOM   9540  N  N   . ASN B  2 350  ? -1.474  -21.532 25.415  1.00 225.04 ? 350  ASN B N   1 
ATOM   9541  C  CA  . ASN B  2 350  ? -2.803  -20.942 25.430  1.00 229.71 ? 350  ASN B CA  1 
ATOM   9542  C  C   . ASN B  2 350  ? -2.890  -19.883 26.514  1.00 243.11 ? 350  ASN B C   1 
ATOM   9543  O  O   . ASN B  2 350  ? -2.290  -20.031 27.578  1.00 261.18 ? 350  ASN B O   1 
ATOM   9544  C  CB  . ASN B  2 350  ? -3.866  -22.013 25.659  1.00 195.42 ? 350  ASN B CB  1 
ATOM   9545  C  CG  . ASN B  2 350  ? -4.127  -22.843 24.425  1.00 233.19 ? 350  ASN B CG  1 
ATOM   9546  O  OD1 . ASN B  2 350  ? -3.445  -22.699 23.412  1.00 281.79 ? 350  ASN B OD1 1 
ATOM   9547  N  ND2 . ASN B  2 350  ? -5.120  -23.713 24.499  1.00 223.05 ? 350  ASN B ND2 1 
ATOM   9548  N  N   . ALA B  2 351  ? -3.628  -18.813 26.237  1.00 206.16 ? 351  ALA B N   1 
ATOM   9549  C  CA  . ALA B  2 351  ? -3.792  -17.733 27.197  1.00 242.16 ? 351  ALA B CA  1 
ATOM   9550  C  C   . ALA B  2 351  ? -4.219  -18.297 28.549  1.00 292.73 ? 351  ALA B C   1 
ATOM   9551  O  O   . ALA B  2 351  ? -5.377  -18.665 28.743  1.00 312.99 ? 351  ALA B O   1 
ATOM   9552  C  CB  . ALA B  2 351  ? -4.813  -16.727 26.691  1.00 276.32 ? 351  ALA B CB  1 
ATOM   9553  N  N   . LEU B  2 352  ? -3.271  -18.372 29.476  1.00 291.25 ? 352  LEU B N   1 
ATOM   9554  C  CA  . LEU B  2 352  ? -3.538  -18.896 30.810  1.00 262.42 ? 352  LEU B CA  1 
ATOM   9555  C  C   . LEU B  2 352  ? -4.301  -17.887 31.660  1.00 291.46 ? 352  LEU B C   1 
ATOM   9556  O  O   . LEU B  2 352  ? -4.234  -16.684 31.412  1.00 308.50 ? 352  LEU B O   1 
ATOM   9557  C  CB  . LEU B  2 352  ? -2.226  -19.264 31.504  1.00 205.27 ? 352  LEU B CB  1 
ATOM   9558  C  CG  . LEU B  2 352  ? -1.160  -18.166 31.580  1.00 221.06 ? 352  LEU B CG  1 
ATOM   9559  C  CD1 . LEU B  2 352  ? -1.454  -17.167 32.686  1.00 245.46 ? 352  LEU B CD1 1 
ATOM   9560  C  CD2 . LEU B  2 352  ? 0.198   -18.791 31.794  1.00 209.89 ? 352  LEU B CD2 1 
ATOM   9561  N  N   . PRO B  2 353  ? -5.036  -18.379 32.669  1.00 276.57 ? 353  PRO B N   1 
ATOM   9562  C  CA  . PRO B  2 353  ? -5.750  -17.509 33.608  1.00 258.90 ? 353  PRO B CA  1 
ATOM   9563  C  C   . PRO B  2 353  ? -4.786  -16.609 34.371  1.00 258.46 ? 353  PRO B C   1 
ATOM   9564  O  O   . PRO B  2 353  ? -3.619  -16.965 34.531  1.00 222.00 ? 353  PRO B O   1 
ATOM   9565  C  CB  . PRO B  2 353  ? -6.427  -18.507 34.560  1.00 240.87 ? 353  PRO B CB  1 
ATOM   9566  C  CG  . PRO B  2 353  ? -5.651  -19.779 34.389  1.00 219.92 ? 353  PRO B CG  1 
ATOM   9567  C  CD  . PRO B  2 353  ? -5.325  -19.796 32.936  1.00 250.64 ? 353  PRO B CD  1 
ATOM   9568  N  N   . ASP B  2 354  ? -5.273  -15.463 34.835  1.00 295.11 ? 354  ASP B N   1 
ATOM   9569  C  CA  . ASP B  2 354  ? -4.431  -14.505 35.545  1.00 280.75 ? 354  ASP B CA  1 
ATOM   9570  C  C   . ASP B  2 354  ? -3.832  -15.107 36.815  1.00 249.79 ? 354  ASP B C   1 
ATOM   9571  O  O   . ASP B  2 354  ? -2.821  -14.618 37.321  1.00 192.27 ? 354  ASP B O   1 
ATOM   9572  C  CB  . ASP B  2 354  ? -5.226  -13.239 35.886  1.00 269.84 ? 354  ASP B CB  1 
ATOM   9573  C  CG  . ASP B  2 354  ? -6.488  -13.532 36.672  1.00 313.21 ? 354  ASP B CG  1 
ATOM   9574  O  OD1 . ASP B  2 354  ? -6.691  -14.700 37.066  1.00 353.63 ? 354  ASP B OD1 1 
ATOM   9575  O  OD2 . ASP B  2 354  ? -7.279  -12.591 36.897  1.00 309.92 ? 354  ASP B OD2 1 
ATOM   9576  N  N   . THR B  2 355  ? -4.448  -16.176 37.318  1.00 274.14 ? 355  THR B N   1 
ATOM   9577  C  CA  . THR B  2 355  ? -3.994  -16.813 38.551  1.00 261.85 ? 355  THR B CA  1 
ATOM   9578  C  C   . THR B  2 355  ? -2.726  -17.631 38.340  1.00 242.80 ? 355  THR B C   1 
ATOM   9579  O  O   . THR B  2 355  ? -2.311  -18.375 39.228  1.00 172.88 ? 355  THR B O   1 
ATOM   9580  C  CB  . THR B  2 355  ? -5.068  -17.753 39.138  1.00 256.72 ? 355  THR B CB  1 
ATOM   9581  O  OG1 . THR B  2 355  ? -5.412  -18.755 38.175  1.00 235.64 ? 355  THR B OG1 1 
ATOM   9582  C  CG2 . THR B  2 355  ? -6.309  -16.974 39.522  1.00 303.67 ? 355  THR B CG2 1 
ATOM   9583  N  N   . LEU B  2 356  ? -2.118  -17.501 37.165  1.00 266.48 ? 356  LEU B N   1 
ATOM   9584  C  CA  . LEU B  2 356  ? -0.902  -18.238 36.852  1.00 248.22 ? 356  LEU B CA  1 
ATOM   9585  C  C   . LEU B  2 356  ? 0.089   -17.377 36.078  1.00 249.54 ? 356  LEU B C   1 
ATOM   9586  O  O   . LEU B  2 356  ? -0.290  -16.413 35.412  1.00 254.86 ? 356  LEU B O   1 
ATOM   9587  C  CB  . LEU B  2 356  ? -1.241  -19.493 36.047  1.00 225.85 ? 356  LEU B CB  1 
ATOM   9588  C  CG  . LEU B  2 356  ? -2.046  -20.559 36.795  1.00 171.85 ? 356  LEU B CG  1 
ATOM   9589  C  CD1 . LEU B  2 356  ? -2.649  -21.558 35.826  1.00 132.09 ? 356  LEU B CD1 1 
ATOM   9590  C  CD2 . LEU B  2 356  ? -1.178  -21.268 37.826  1.00 184.21 ? 356  LEU B CD2 1 
ATOM   9591  N  N   . LYS B  2 357  ? 1.363   -17.735 36.180  1.00 235.65 ? 357  LYS B N   1 
ATOM   9592  C  CA  . LYS B  2 357  ? 2.422   -17.030 35.476  1.00 233.45 ? 357  LYS B CA  1 
ATOM   9593  C  C   . LYS B  2 357  ? 3.454   -18.034 34.993  1.00 254.07 ? 357  LYS B C   1 
ATOM   9594  O  O   . LYS B  2 357  ? 3.978   -18.819 35.785  1.00 206.39 ? 357  LYS B O   1 
ATOM   9595  C  CB  . LYS B  2 357  ? 3.086   -16.015 36.399  1.00 164.20 ? 357  LYS B CB  1 
ATOM   9596  C  CG  . LYS B  2 357  ? 2.133   -14.979 36.949  1.00 217.52 ? 357  LYS B CG  1 
ATOM   9597  C  CD  . LYS B  2 357  ? 1.610   -14.071 35.856  1.00 225.29 ? 357  LYS B CD  1 
ATOM   9598  C  CE  . LYS B  2 357  ? 0.587   -13.094 36.402  1.00 229.59 ? 357  LYS B CE  1 
ATOM   9599  N  NZ  . LYS B  2 357  ? 0.100   -12.162 35.355  1.00 252.78 ? 357  LYS B NZ  1 
ATOM   9600  N  N   . VAL B  2 358  ? 3.743   -18.003 33.695  1.00 291.97 ? 358  VAL B N   1 
ATOM   9601  C  CA  . VAL B  2 358  ? 4.647   -18.971 33.084  1.00 275.48 ? 358  VAL B CA  1 
ATOM   9602  C  C   . VAL B  2 358  ? 5.889   -18.306 32.488  1.00 287.21 ? 358  VAL B C   1 
ATOM   9603  O  O   . VAL B  2 358  ? 5.824   -17.190 31.972  1.00 370.36 ? 358  VAL B O   1 
ATOM   9604  C  CB  . VAL B  2 358  ? 3.930   -19.772 31.975  1.00 230.55 ? 358  VAL B CB  1 
ATOM   9605  C  CG1 . VAL B  2 358  ? 4.894   -20.738 31.311  1.00 175.72 ? 358  VAL B CG1 1 
ATOM   9606  C  CG2 . VAL B  2 358  ? 2.737   -20.523 32.544  1.00 200.31 ? 358  VAL B CG2 1 
ATOM   9607  N  N   . THR B  2 359  ? 7.018   -19.006 32.566  1.00 202.88 ? 359  THR B N   1 
ATOM   9608  C  CA  . THR B  2 359  ? 8.267   -18.543 31.970  1.00 217.96 ? 359  THR B CA  1 
ATOM   9609  C  C   . THR B  2 359  ? 8.994   -19.716 31.317  1.00 265.34 ? 359  THR B C   1 
ATOM   9610  O  O   . THR B  2 359  ? 8.555   -20.861 31.421  1.00 267.03 ? 359  THR B O   1 
ATOM   9611  C  CB  . THR B  2 359  ? 9.196   -17.929 33.020  1.00 200.61 ? 359  THR B CB  1 
ATOM   9612  O  OG1 . THR B  2 359  ? 9.642   -18.953 33.917  1.00 182.84 ? 359  THR B OG1 1 
ATOM   9613  C  CG2 . THR B  2 359  ? 8.473   -16.848 33.796  1.00 249.93 ? 359  THR B CG2 1 
ATOM   9614  N  N   . TYR B  2 360  ? 10.109  -19.431 30.652  1.00 297.21 ? 360  TYR B N   1 
ATOM   9615  C  CA  . TYR B  2 360  ? 10.886  -20.469 29.979  1.00 274.90 ? 360  TYR B CA  1 
ATOM   9616  C  C   . TYR B  2 360  ? 12.382  -20.180 30.091  1.00 260.17 ? 360  TYR B C   1 
ATOM   9617  O  O   . TYR B  2 360  ? 12.788  -19.135 30.597  1.00 253.42 ? 360  TYR B O   1 
ATOM   9618  C  CB  . TYR B  2 360  ? 10.494  -20.562 28.498  1.00 208.17 ? 360  TYR B CB  1 
ATOM   9619  C  CG  . TYR B  2 360  ? 9.024   -20.832 28.231  1.00 192.19 ? 360  TYR B CG  1 
ATOM   9620  C  CD1 . TYR B  2 360  ? 8.073   -19.824 28.354  1.00 228.95 ? 360  TYR B CD1 1 
ATOM   9621  C  CD2 . TYR B  2 360  ? 8.591   -22.091 27.832  1.00 163.34 ? 360  TYR B CD2 1 
ATOM   9622  C  CE1 . TYR B  2 360  ? 6.731   -20.066 28.102  1.00 225.01 ? 360  TYR B CE1 1 
ATOM   9623  C  CE2 . TYR B  2 360  ? 7.252   -22.343 27.576  1.00 234.00 ? 360  TYR B CE2 1 
ATOM   9624  C  CZ  . TYR B  2 360  ? 6.328   -21.329 27.712  1.00 232.07 ? 360  TYR B CZ  1 
ATOM   9625  O  OH  . TYR B  2 360  ? 4.999   -21.589 27.458  1.00 191.87 ? 360  TYR B OH  1 
ATOM   9626  N  N   . ASP B  2 361  ? 13.197  -21.122 29.627  1.00 229.35 ? 361  ASP B N   1 
ATOM   9627  C  CA  . ASP B  2 361  ? 14.631  -20.900 29.486  1.00 241.58 ? 361  ASP B CA  1 
ATOM   9628  C  C   . ASP B  2 361  ? 15.036  -21.283 28.072  1.00 294.27 ? 361  ASP B C   1 
ATOM   9629  O  O   . ASP B  2 361  ? 14.227  -21.820 27.316  1.00 319.03 ? 361  ASP B O   1 
ATOM   9630  C  CB  . ASP B  2 361  ? 15.421  -21.729 30.496  1.00 219.07 ? 361  ASP B CB  1 
ATOM   9631  C  CG  . ASP B  2 361  ? 15.227  -21.255 31.916  1.00 239.12 ? 361  ASP B CG  1 
ATOM   9632  O  OD1 . ASP B  2 361  ? 14.269  -20.498 32.171  1.00 286.29 ? 361  ASP B OD1 1 
ATOM   9633  O  OD2 . ASP B  2 361  ? 16.037  -21.645 32.779  1.00 210.16 ? 361  ASP B OD2 1 
ATOM   9634  N  N   . SER B  2 362  ? 16.285  -21.013 27.711  1.00 292.88 ? 362  SER B N   1 
ATOM   9635  C  CA  . SER B  2 362  ? 16.753  -21.320 26.364  1.00 261.48 ? 362  SER B CA  1 
ATOM   9636  C  C   . SER B  2 362  ? 18.228  -21.722 26.332  1.00 254.81 ? 362  SER B C   1 
ATOM   9637  O  O   . SER B  2 362  ? 19.088  -21.035 26.887  1.00 200.17 ? 362  SER B O   1 
ATOM   9638  C  CB  . SER B  2 362  ? 16.507  -20.128 25.435  1.00 249.41 ? 362  SER B CB  1 
ATOM   9639  O  OG  . SER B  2 362  ? 15.119  -19.922 25.219  1.00 220.98 ? 362  SER B OG  1 
ATOM   9640  N  N   . PHE B  2 363  ? 18.501  -22.848 25.678  1.00 279.92 ? 363  PHE B N   1 
ATOM   9641  C  CA  . PHE B  2 363  ? 19.861  -23.330 25.472  1.00 270.35 ? 363  PHE B CA  1 
ATOM   9642  C  C   . PHE B  2 363  ? 20.086  -23.685 24.005  1.00 259.90 ? 363  PHE B C   1 
ATOM   9643  O  O   . PHE B  2 363  ? 20.158  -24.859 23.646  1.00 229.63 ? 363  PHE B O   1 
ATOM   9644  C  CB  . PHE B  2 363  ? 20.127  -24.555 26.343  1.00 247.86 ? 363  PHE B CB  1 
ATOM   9645  C  CG  . PHE B  2 363  ? 20.750  -24.231 27.662  1.00 252.03 ? 363  PHE B CG  1 
ATOM   9646  C  CD1 . PHE B  2 363  ? 19.990  -24.197 28.815  1.00 266.99 ? 363  PHE B CD1 1 
ATOM   9647  C  CD2 . PHE B  2 363  ? 22.102  -23.959 27.747  1.00 271.61 ? 363  PHE B CD2 1 
ATOM   9648  C  CE1 . PHE B  2 363  ? 20.570  -23.898 30.032  1.00 289.30 ? 363  PHE B CE1 1 
ATOM   9649  C  CE2 . PHE B  2 363  ? 22.687  -23.660 28.958  1.00 299.90 ? 363  PHE B CE2 1 
ATOM   9650  C  CZ  . PHE B  2 363  ? 21.921  -23.629 30.103  1.00 299.64 ? 363  PHE B CZ  1 
ATOM   9651  N  N   . CYS B  2 364  ? 20.195  -22.669 23.158  1.00 243.16 ? 364  CYS B N   1 
ATOM   9652  C  CA  . CYS B  2 364  ? 20.374  -22.893 21.730  1.00 220.60 ? 364  CYS B CA  1 
ATOM   9653  C  C   . CYS B  2 364  ? 21.616  -23.725 21.481  1.00 255.56 ? 364  CYS B C   1 
ATOM   9654  O  O   . CYS B  2 364  ? 22.480  -23.846 22.348  1.00 267.32 ? 364  CYS B O   1 
ATOM   9655  C  CB  . CYS B  2 364  ? 20.477  -21.568 20.988  1.00 240.31 ? 364  CYS B CB  1 
ATOM   9656  S  SG  . CYS B  2 364  ? 18.962  -20.598 21.055  1.00 333.41 ? 364  CYS B SG  1 
ATOM   9657  N  N   . SER B  2 365  ? 21.704  -24.293 20.286  1.00 290.40 ? 365  SER B N   1 
ATOM   9658  C  CA  . SER B  2 365  ? 22.784  -25.211 19.967  1.00 275.37 ? 365  SER B CA  1 
ATOM   9659  C  C   . SER B  2 365  ? 24.108  -24.481 19.794  1.00 280.67 ? 365  SER B C   1 
ATOM   9660  O  O   . SER B  2 365  ? 25.142  -24.943 20.270  1.00 250.48 ? 365  SER B O   1 
ATOM   9661  C  CB  . SER B  2 365  ? 22.452  -25.996 18.700  1.00 223.40 ? 365  SER B CB  1 
ATOM   9662  O  OG  . SER B  2 365  ? 22.324  -25.131 17.588  1.00 264.00 ? 365  SER B OG  1 
ATOM   9663  N  N   . ASN B  2 366  ? 24.080  -23.340 19.117  1.00 300.52 ? 366  ASN B N   1 
ATOM   9664  C  CA  . ASN B  2 366  ? 25.312  -22.616 18.829  1.00 311.85 ? 366  ASN B CA  1 
ATOM   9665  C  C   . ASN B  2 366  ? 25.670  -21.570 19.881  1.00 290.75 ? 366  ASN B C   1 
ATOM   9666  O  O   . ASN B  2 366  ? 25.544  -20.372 19.643  1.00 271.31 ? 366  ASN B O   1 
ATOM   9667  C  CB  . ASN B  2 366  ? 25.245  -21.969 17.443  1.00 329.93 ? 366  ASN B CB  1 
ATOM   9668  C  CG  . ASN B  2 366  ? 24.023  -21.094 17.262  1.00 310.04 ? 366  ASN B CG  1 
ATOM   9669  O  OD1 . ASN B  2 366  ? 23.269  -20.854 18.204  1.00 314.08 ? 366  ASN B OD1 1 
ATOM   9670  N  ND2 . ASN B  2 366  ? 23.823  -20.609 16.044  1.00 287.41 ? 366  ASN B ND2 1 
ATOM   9671  N  N   . GLY B  2 367  ? 26.114  -22.035 21.046  1.00 293.14 ? 367  GLY B N   1 
ATOM   9672  C  CA  . GLY B  2 367  ? 26.730  -21.169 22.036  1.00 292.38 ? 367  GLY B CA  1 
ATOM   9673  C  C   . GLY B  2 367  ? 25.799  -20.546 23.058  1.00 299.67 ? 367  GLY B C   1 
ATOM   9674  O  O   . GLY B  2 367  ? 26.165  -20.401 24.223  1.00 319.96 ? 367  GLY B O   1 
ATOM   9675  N  N   . VAL B  2 368  ? 24.598  -20.175 22.632  1.00 292.68 ? 368  VAL B N   1 
ATOM   9676  C  CA  . VAL B  2 368  ? 23.714  -19.369 23.468  1.00 273.17 ? 368  VAL B CA  1 
ATOM   9677  C  C   . VAL B  2 368  ? 23.343  -20.068 24.775  1.00 278.36 ? 368  VAL B C   1 
ATOM   9678  O  O   . VAL B  2 368  ? 22.917  -21.223 24.777  1.00 246.04 ? 368  VAL B O   1 
ATOM   9679  C  CB  . VAL B  2 368  ? 22.416  -19.001 22.733  1.00 256.85 ? 368  VAL B CB  1 
ATOM   9680  C  CG1 . VAL B  2 368  ? 21.671  -17.924 23.497  1.00 261.78 ? 368  VAL B CG1 1 
ATOM   9681  C  CG2 . VAL B  2 368  ? 22.712  -18.528 21.320  1.00 264.92 ? 368  VAL B CG2 1 
ATOM   9682  N  N   . THR B  2 369  ? 23.507  -19.347 25.882  1.00 306.27 ? 369  THR B N   1 
ATOM   9683  C  CA  . THR B  2 369  ? 23.111  -19.833 27.201  1.00 308.96 ? 369  THR B CA  1 
ATOM   9684  C  C   . THR B  2 369  ? 22.104  -18.876 27.825  1.00 316.18 ? 369  THR B C   1 
ATOM   9685  O  O   . THR B  2 369  ? 22.408  -18.183 28.795  1.00 356.88 ? 369  THR B O   1 
ATOM   9686  C  CB  . THR B  2 369  ? 24.321  -19.956 28.143  1.00 302.27 ? 369  THR B CB  1 
ATOM   9687  O  OG1 . THR B  2 369  ? 25.302  -20.817 27.554  1.00 336.55 ? 369  THR B OG1 1 
ATOM   9688  C  CG2 . THR B  2 369  ? 23.902  -20.520 29.496  1.00 238.40 ? 369  THR B CG2 1 
ATOM   9689  N  N   . HIS B  2 370  ? 20.906  -18.834 27.257  1.00 278.52 ? 370  HIS B N   1 
ATOM   9690  C  CA  . HIS B  2 370  ? 19.865  -17.935 27.739  1.00 271.12 ? 370  HIS B CA  1 
ATOM   9691  C  C   . HIS B  2 370  ? 19.202  -18.466 29.008  1.00 310.30 ? 370  HIS B C   1 
ATOM   9692  O  O   . HIS B  2 370  ? 19.318  -19.647 29.334  1.00 364.72 ? 370  HIS B O   1 
ATOM   9693  C  CB  . HIS B  2 370  ? 18.807  -17.719 26.658  1.00 239.27 ? 370  HIS B CB  1 
ATOM   9694  C  CG  . HIS B  2 370  ? 19.137  -16.620 25.695  1.00 267.39 ? 370  HIS B CG  1 
ATOM   9695  N  ND1 . HIS B  2 370  ? 19.088  -16.791 24.327  1.00 300.52 ? 370  HIS B ND1 1 
ATOM   9696  C  CD2 . HIS B  2 370  ? 19.517  -15.337 25.897  1.00 260.17 ? 370  HIS B CD2 1 
ATOM   9697  C  CE1 . HIS B  2 370  ? 19.421  -15.662 23.731  1.00 292.18 ? 370  HIS B CE1 1 
ATOM   9698  N  NE2 . HIS B  2 370  ? 19.688  -14.761 24.662  1.00 271.36 ? 370  HIS B NE2 1 
ATOM   9699  N  N   . ARG B  2 371  ? 18.508  -17.580 29.717  1.00 286.67 ? 371  ARG B N   1 
ATOM   9700  C  CA  . ARG B  2 371  ? 17.837  -17.937 30.961  1.00 260.62 ? 371  ARG B CA  1 
ATOM   9701  C  C   . ARG B  2 371  ? 16.680  -16.994 31.266  1.00 261.67 ? 371  ARG B C   1 
ATOM   9702  O  O   . ARG B  2 371  ? 16.835  -15.774 31.235  1.00 295.32 ? 371  ARG B O   1 
ATOM   9703  C  CB  . ARG B  2 371  ? 18.828  -17.894 32.121  1.00 274.04 ? 371  ARG B CB  1 
ATOM   9704  C  CG  . ARG B  2 371  ? 19.940  -18.917 32.028  1.00 290.98 ? 371  ARG B CG  1 
ATOM   9705  C  CD  . ARG B  2 371  ? 20.892  -18.790 33.199  1.00 289.20 ? 371  ARG B CD  1 
ATOM   9706  N  NE  . ARG B  2 371  ? 21.977  -19.764 33.133  1.00 297.70 ? 371  ARG B NE  1 
ATOM   9707  C  CZ  . ARG B  2 371  ? 22.998  -19.803 33.983  1.00 317.03 ? 371  ARG B CZ  1 
ATOM   9708  N  NH1 . ARG B  2 371  ? 23.079  -18.918 34.968  1.00 338.95 ? 371  ARG B NH1 1 
ATOM   9709  N  NH2 . ARG B  2 371  ? 23.940  -20.726 33.848  1.00 298.04 ? 371  ARG B NH2 1 
ATOM   9710  N  N   . ASN B  2 372  ? 15.519  -17.566 31.561  1.00 218.59 ? 372  ASN B N   1 
ATOM   9711  C  CA  . ASN B  2 372  ? 14.377  -16.792 32.031  1.00 216.70 ? 372  ASN B CA  1 
ATOM   9712  C  C   . ASN B  2 372  ? 13.822  -15.802 31.011  1.00 222.74 ? 372  ASN B C   1 
ATOM   9713  O  O   . ASN B  2 372  ? 14.248  -14.650 30.952  1.00 211.98 ? 372  ASN B O   1 
ATOM   9714  C  CB  . ASN B  2 372  ? 14.752  -16.049 33.310  1.00 248.50 ? 372  ASN B CB  1 
ATOM   9715  C  CG  . ASN B  2 372  ? 15.129  -16.988 34.427  1.00 261.33 ? 372  ASN B CG  1 
ATOM   9716  O  OD1 . ASN B  2 372  ? 14.808  -18.174 34.384  1.00 201.12 ? 372  ASN B OD1 1 
ATOM   9717  N  ND2 . ASN B  2 372  ? 15.813  -16.468 35.436  1.00 309.82 ? 372  ASN B ND2 1 
ATOM   9718  N  N   . GLN B  2 373  ? 12.862  -16.269 30.221  1.00 219.40 ? 373  GLN B N   1 
ATOM   9719  C  CA  . GLN B  2 373  ? 12.111  -15.430 29.288  1.00 242.02 ? 373  GLN B CA  1 
ATOM   9720  C  C   . GLN B  2 373  ? 11.107  -16.300 28.526  1.00 262.40 ? 373  GLN B C   1 
ATOM   9721  O  O   . GLN B  2 373  ? 11.380  -17.470 28.257  1.00 262.65 ? 373  GLN B O   1 
ATOM   9722  C  CB  . GLN B  2 373  ? 13.040  -14.709 28.303  1.00 235.29 ? 373  GLN B CB  1 
ATOM   9723  C  CG  . GLN B  2 373  ? 13.328  -13.252 28.651  1.00 190.03 ? 373  GLN B CG  1 
ATOM   9724  C  CD  . GLN B  2 373  ? 13.659  -12.411 27.433  1.00 249.49 ? 373  GLN B CD  1 
ATOM   9725  O  OE1 . GLN B  2 373  ? 13.828  -12.931 26.333  1.00 291.65 ? 373  GLN B OE1 1 
ATOM   9726  N  NE2 . GLN B  2 373  ? 13.748  -11.101 27.625  1.00 265.93 ? 373  GLN B NE2 1 
ATOM   9727  N  N   . PRO B  2 374  ? 9.934   -15.735 28.188  1.00 259.75 ? 374  PRO B N   1 
ATOM   9728  C  CA  . PRO B  2 374  ? 8.900   -16.444 27.418  1.00 257.31 ? 374  PRO B CA  1 
ATOM   9729  C  C   . PRO B  2 374  ? 9.403   -16.886 26.042  1.00 270.33 ? 374  PRO B C   1 
ATOM   9730  O  O   . PRO B  2 374  ? 10.579  -16.691 25.735  1.00 262.99 ? 374  PRO B O   1 
ATOM   9731  C  CB  . PRO B  2 374  ? 7.794   -15.389 27.273  1.00 220.84 ? 374  PRO B CB  1 
ATOM   9732  C  CG  . PRO B  2 374  ? 8.490   -14.079 27.513  1.00 213.15 ? 374  PRO B CG  1 
ATOM   9733  C  CD  . PRO B  2 374  ? 9.474   -14.394 28.580  1.00 202.33 ? 374  PRO B CD  1 
ATOM   9734  N  N   . ARG B  2 375  ? 8.529   -17.468 25.226  1.00 260.49 ? 375  ARG B N   1 
ATOM   9735  C  CA  . ARG B  2 375  ? 8.915   -17.903 23.887  1.00 260.82 ? 375  ARG B CA  1 
ATOM   9736  C  C   . ARG B  2 375  ? 10.000  -18.981 23.938  1.00 230.59 ? 375  ARG B C   1 
ATOM   9737  O  O   . ARG B  2 375  ? 10.289  -19.541 24.992  1.00 184.62 ? 375  ARG B O   1 
ATOM   9738  C  CB  . ARG B  2 375  ? 9.407   -16.704 23.061  1.00 257.33 ? 375  ARG B CB  1 
ATOM   9739  C  CG  . ARG B  2 375  ? 8.348   -16.055 22.175  1.00 227.41 ? 375  ARG B CG  1 
ATOM   9740  C  CD  . ARG B  2 375  ? 8.960   -14.971 21.290  1.00 221.63 ? 375  ARG B CD  1 
ATOM   9741  N  NE  . ARG B  2 375  ? 8.199   -14.749 20.062  1.00 240.65 ? 375  ARG B NE  1 
ATOM   9742  C  CZ  . ARG B  2 375  ? 8.629   -14.018 19.036  1.00 282.03 ? 375  ARG B CZ  1 
ATOM   9743  N  NH1 . ARG B  2 375  ? 7.870   -13.872 17.959  1.00 298.06 ? 375  ARG B NH1 1 
ATOM   9744  N  NH2 . ARG B  2 375  ? 9.818   -13.434 19.083  1.00 301.95 ? 375  ARG B NH2 1 
ATOM   9745  N  N   . GLY B  2 376  ? 10.586  -19.276 22.784  1.00 228.40 ? 376  GLY B N   1 
ATOM   9746  C  CA  . GLY B  2 376  ? 11.713  -20.186 22.698  1.00 132.49 ? 376  GLY B CA  1 
ATOM   9747  C  C   . GLY B  2 376  ? 12.589  -19.797 21.520  1.00 229.19 ? 376  GLY B C   1 
ATOM   9748  O  O   . GLY B  2 376  ? 13.145  -20.655 20.837  1.00 252.60 ? 376  GLY B O   1 
ATOM   9749  N  N   . ASP B  2 377  ? 12.711  -18.492 21.290  1.00 269.05 ? 377  ASP B N   1 
ATOM   9750  C  CA  . ASP B  2 377  ? 13.411  -17.965 20.120  1.00 271.49 ? 377  ASP B CA  1 
ATOM   9751  C  C   . ASP B  2 377  ? 14.858  -18.449 20.046  1.00 291.24 ? 377  ASP B C   1 
ATOM   9752  O  O   . ASP B  2 377  ? 15.734  -17.919 20.725  1.00 275.84 ? 377  ASP B O   1 
ATOM   9753  C  CB  . ASP B  2 377  ? 13.372  -16.432 20.128  1.00 238.48 ? 377  ASP B CB  1 
ATOM   9754  C  CG  . ASP B  2 377  ? 13.909  -15.825 18.846  1.00 262.00 ? 377  ASP B CG  1 
ATOM   9755  O  OD1 . ASP B  2 377  ? 14.214  -16.585 17.905  1.00 260.96 ? 377  ASP B OD1 1 
ATOM   9756  O  OD2 . ASP B  2 377  ? 14.024  -14.584 18.779  1.00 295.33 ? 377  ASP B OD2 1 
ATOM   9757  N  N   . CYS B  2 378  ? 15.097  -19.460 19.215  1.00 307.12 ? 378  CYS B N   1 
ATOM   9758  C  CA  . CYS B  2 378  ? 16.446  -19.944 18.942  1.00 283.31 ? 378  CYS B CA  1 
ATOM   9759  C  C   . CYS B  2 378  ? 16.659  -20.025 17.436  1.00 328.51 ? 378  CYS B C   1 
ATOM   9760  O  O   . CYS B  2 378  ? 16.391  -21.057 16.823  1.00 308.01 ? 378  CYS B O   1 
ATOM   9761  C  CB  . CYS B  2 378  ? 16.671  -21.325 19.564  1.00 195.44 ? 378  CYS B CB  1 
ATOM   9762  S  SG  . CYS B  2 378  ? 17.077  -21.310 21.311  1.00 311.28 ? 378  CYS B SG  1 
ATOM   9763  N  N   . ASP B  2 379  ? 17.142  -18.936 16.845  1.00 359.49 ? 379  ASP B N   1 
ATOM   9764  C  CA  . ASP B  2 379  ? 17.339  -18.869 15.401  1.00 327.08 ? 379  ASP B CA  1 
ATOM   9765  C  C   . ASP B  2 379  ? 18.686  -19.460 14.997  1.00 305.36 ? 379  ASP B C   1 
ATOM   9766  O  O   . ASP B  2 379  ? 19.410  -18.882 14.186  1.00 306.47 ? 379  ASP B O   1 
ATOM   9767  C  CB  . ASP B  2 379  ? 17.251  -17.422 14.918  1.00 295.79 ? 379  ASP B CB  1 
ATOM   9768  C  CG  . ASP B  2 379  ? 17.071  -17.321 13.419  1.00 276.14 ? 379  ASP B CG  1 
ATOM   9769  O  OD1 . ASP B  2 379  ? 16.826  -18.364 12.780  1.00 266.01 ? 379  ASP B OD1 1 
ATOM   9770  O  OD2 . ASP B  2 379  ? 17.175  -16.202 12.879  1.00 296.54 ? 379  ASP B OD2 1 
ATOM   9771  N  N   . GLY B  2 380  ? 19.013  -20.616 15.565  1.00 276.36 ? 380  GLY B N   1 
ATOM   9772  C  CA  . GLY B  2 380  ? 20.277  -21.273 15.291  1.00 259.67 ? 380  GLY B CA  1 
ATOM   9773  C  C   . GLY B  2 380  ? 20.158  -22.779 15.392  1.00 275.57 ? 380  GLY B C   1 
ATOM   9774  O  O   . GLY B  2 380  ? 21.087  -23.458 15.833  1.00 277.90 ? 380  GLY B O   1 
ATOM   9775  N  N   . VAL B  2 381  ? 19.008  -23.303 14.985  1.00 283.61 ? 381  VAL B N   1 
ATOM   9776  C  CA  . VAL B  2 381  ? 18.779  -24.739 14.996  1.00 299.20 ? 381  VAL B CA  1 
ATOM   9777  C  C   . VAL B  2 381  ? 17.875  -25.111 13.830  1.00 284.42 ? 381  VAL B C   1 
ATOM   9778  O  O   . VAL B  2 381  ? 16.917  -24.405 13.525  1.00 245.86 ? 381  VAL B O   1 
ATOM   9779  C  CB  . VAL B  2 381  ? 18.169  -25.199 16.330  1.00 330.46 ? 381  VAL B CB  1 
ATOM   9780  C  CG1 . VAL B  2 381  ? 19.091  -24.824 17.480  1.00 327.04 ? 381  VAL B CG1 1 
ATOM   9781  C  CG2 . VAL B  2 381  ? 16.792  -24.590 16.526  1.00 349.61 ? 381  VAL B CG2 1 
ATOM   9782  N  N   . GLN B  2 382  ? 18.182  -26.230 13.184  1.00 285.39 ? 382  GLN B N   1 
ATOM   9783  C  CA  . GLN B  2 382  ? 17.582  -26.549 11.895  1.00 295.05 ? 382  GLN B CA  1 
ATOM   9784  C  C   . GLN B  2 382  ? 17.016  -27.964 11.797  1.00 277.99 ? 382  GLN B C   1 
ATOM   9785  O  O   . GLN B  2 382  ? 15.817  -28.178 11.976  1.00 228.25 ? 382  GLN B O   1 
ATOM   9786  C  CB  . GLN B  2 382  ? 18.629  -26.348 10.797  1.00 332.20 ? 382  GLN B CB  1 
ATOM   9787  C  CG  . GLN B  2 382  ? 20.053  -26.698 11.233  1.00 344.55 ? 382  GLN B CG  1 
ATOM   9788  C  CD  . GLN B  2 382  ? 21.072  -26.509 10.128  1.00 347.73 ? 382  GLN B CD  1 
ATOM   9789  O  OE1 . GLN B  2 382  ? 20.778  -25.908 9.095   1.00 362.74 ? 382  GLN B OE1 1 
ATOM   9790  N  NE2 . GLN B  2 382  ? 22.279  -27.021 10.341  1.00 331.23 ? 382  GLN B NE2 1 
ATOM   9791  N  N   . ILE B  2 383  ? 17.890  -28.926 11.518  1.00 296.69 ? 383  ILE B N   1 
ATOM   9792  C  CA  . ILE B  2 383  ? 17.465  -30.257 11.105  1.00 285.21 ? 383  ILE B CA  1 
ATOM   9793  C  C   . ILE B  2 383  ? 17.391  -31.233 12.268  1.00 250.96 ? 383  ILE B C   1 
ATOM   9794  O  O   . ILE B  2 383  ? 16.322  -31.449 12.825  1.00 226.00 ? 383  ILE B O   1 
ATOM   9795  C  CB  . ILE B  2 383  ? 18.411  -30.830 10.028  1.00 273.73 ? 383  ILE B CB  1 
ATOM   9796  C  CG1 . ILE B  2 383  ? 18.280  -30.027 8.731   1.00 279.72 ? 383  ILE B CG1 1 
ATOM   9797  C  CG2 . ILE B  2 383  ? 18.106  -32.296 9.769   1.00 235.14 ? 383  ILE B CG2 1 
ATOM   9798  C  CD1 . ILE B  2 383  ? 19.040  -30.617 7.562   1.00 256.64 ? 383  ILE B CD1 1 
ATOM   9799  N  N   . ASN B  2 384  ? 18.527  -31.821 12.626  1.00 257.26 ? 384  ASN B N   1 
ATOM   9800  C  CA  . ASN B  2 384  ? 18.553  -32.872 13.634  1.00 282.19 ? 384  ASN B CA  1 
ATOM   9801  C  C   . ASN B  2 384  ? 19.498  -32.547 14.785  1.00 303.36 ? 384  ASN B C   1 
ATOM   9802  O  O   . ASN B  2 384  ? 20.457  -33.276 15.035  1.00 294.06 ? 384  ASN B O   1 
ATOM   9803  C  CB  . ASN B  2 384  ? 18.954  -34.201 12.991  1.00 277.95 ? 384  ASN B CB  1 
ATOM   9804  C  CG  . ASN B  2 384  ? 18.697  -35.391 13.898  1.00 244.56 ? 384  ASN B CG  1 
ATOM   9805  O  OD1 . ASN B  2 384  ? 18.248  -35.236 15.030  1.00 215.99 ? 384  ASN B OD1 1 
ATOM   9806  N  ND2 . ASN B  2 384  ? 18.982  -36.587 13.401  1.00 238.88 ? 384  ASN B ND2 1 
ATOM   9807  N  N   . VAL B  2 385  ? 19.226  -31.447 15.481  1.00 329.98 ? 385  VAL B N   1 
ATOM   9808  C  CA  . VAL B  2 385  ? 19.994  -31.078 16.666  1.00 322.59 ? 385  VAL B CA  1 
ATOM   9809  C  C   . VAL B  2 385  ? 19.065  -30.590 17.768  1.00 323.95 ? 385  VAL B C   1 
ATOM   9810  O  O   . VAL B  2 385  ? 18.566  -29.466 17.708  1.00 334.34 ? 385  VAL B O   1 
ATOM   9811  C  CB  . VAL B  2 385  ? 21.018  -29.972 16.366  1.00 277.57 ? 385  VAL B CB  1 
ATOM   9812  C  CG1 . VAL B  2 385  ? 21.716  -29.540 17.651  1.00 260.16 ? 385  VAL B CG1 1 
ATOM   9813  C  CG2 . VAL B  2 385  ? 22.021  -30.457 15.346  1.00 228.10 ? 385  VAL B CG2 1 
ATOM   9814  N  N   . PRO B  2 386  ? 18.840  -31.434 18.786  1.00 293.47 ? 386  PRO B N   1 
ATOM   9815  C  CA  . PRO B  2 386  ? 17.906  -31.120 19.872  1.00 277.42 ? 386  PRO B CA  1 
ATOM   9816  C  C   . PRO B  2 386  ? 18.161  -29.758 20.522  1.00 277.04 ? 386  PRO B C   1 
ATOM   9817  O  O   . PRO B  2 386  ? 19.201  -29.134 20.293  1.00 267.14 ? 386  PRO B O   1 
ATOM   9818  C  CB  . PRO B  2 386  ? 18.147  -32.250 20.879  1.00 266.31 ? 386  PRO B CB  1 
ATOM   9819  C  CG  . PRO B  2 386  ? 18.693  -33.374 20.073  1.00 236.54 ? 386  PRO B CG  1 
ATOM   9820  C  CD  . PRO B  2 386  ? 19.481  -32.749 18.967  1.00 260.78 ? 386  PRO B CD  1 
ATOM   9821  N  N   . ILE B  2 387  ? 17.197  -29.309 21.320  1.00 281.59 ? 387  ILE B N   1 
ATOM   9822  C  CA  . ILE B  2 387  ? 17.300  -28.050 22.048  1.00 286.20 ? 387  ILE B CA  1 
ATOM   9823  C  C   . ILE B  2 387  ? 16.784  -28.252 23.478  1.00 275.50 ? 387  ILE B C   1 
ATOM   9824  O  O   . ILE B  2 387  ? 16.388  -29.358 23.850  1.00 208.59 ? 387  ILE B O   1 
ATOM   9825  C  CB  . ILE B  2 387  ? 16.500  -26.930 21.345  1.00 272.01 ? 387  ILE B CB  1 
ATOM   9826  C  CG1 . ILE B  2 387  ? 15.022  -27.319 21.250  1.00 304.88 ? 387  ILE B CG1 1 
ATOM   9827  C  CG2 . ILE B  2 387  ? 17.073  -26.650 19.960  1.00 218.78 ? 387  ILE B CG2 1 
ATOM   9828  C  CD1 . ILE B  2 387  ? 14.215  -26.471 20.290  1.00 296.81 ? 387  ILE B CD1 1 
ATOM   9829  N  N   . THR B  2 388  ? 16.787  -27.190 24.279  1.00 297.92 ? 388  THR B N   1 
ATOM   9830  C  CA  . THR B  2 388  ? 16.391  -27.300 25.681  1.00 241.73 ? 388  THR B CA  1 
ATOM   9831  C  C   . THR B  2 388  ? 15.623  -26.086 26.186  1.00 226.15 ? 388  THR B C   1 
ATOM   9832  O  O   . THR B  2 388  ? 16.162  -24.979 26.229  1.00 224.27 ? 388  THR B O   1 
ATOM   9833  C  CB  . THR B  2 388  ? 17.619  -27.475 26.576  1.00 250.41 ? 388  THR B CB  1 
ATOM   9834  O  OG1 . THR B  2 388  ? 18.299  -28.683 26.218  1.00 275.47 ? 388  THR B OG1 1 
ATOM   9835  C  CG2 . THR B  2 388  ? 17.206  -27.534 28.032  1.00 248.17 ? 388  THR B CG2 1 
ATOM   9836  N  N   . PHE B  2 389  ? 14.370  -26.299 26.577  1.00 210.22 ? 389  PHE B N   1 
ATOM   9837  C  CA  . PHE B  2 389  ? 13.569  -25.237 27.178  1.00 296.16 ? 389  PHE B CA  1 
ATOM   9838  C  C   . PHE B  2 389  ? 13.162  -25.665 28.580  1.00 305.12 ? 389  PHE B C   1 
ATOM   9839  O  O   . PHE B  2 389  ? 12.531  -26.707 28.757  1.00 284.44 ? 389  PHE B O   1 
ATOM   9840  C  CB  . PHE B  2 389  ? 12.313  -24.935 26.350  1.00 305.60 ? 389  PHE B CB  1 
ATOM   9841  C  CG  . PHE B  2 389  ? 12.590  -24.553 24.918  1.00 273.70 ? 389  PHE B CG  1 
ATOM   9842  C  CD1 . PHE B  2 389  ? 12.276  -25.428 23.893  1.00 251.20 ? 389  PHE B CD1 1 
ATOM   9843  C  CD2 . PHE B  2 389  ? 13.147  -23.319 24.594  1.00 228.26 ? 389  PHE B CD2 1 
ATOM   9844  C  CE1 . PHE B  2 389  ? 12.518  -25.091 22.575  1.00 295.39 ? 389  PHE B CE1 1 
ATOM   9845  C  CE2 . PHE B  2 389  ? 13.393  -22.976 23.272  1.00 223.76 ? 389  PHE B CE2 1 
ATOM   9846  C  CZ  . PHE B  2 389  ? 13.078  -23.864 22.264  1.00 286.96 ? 389  PHE B CZ  1 
ATOM   9847  N  N   . GLN B  2 390  ? 13.527  -24.864 29.573  1.00 302.06 ? 390  GLN B N   1 
ATOM   9848  C  CA  . GLN B  2 390  ? 13.160  -25.151 30.951  1.00 262.47 ? 390  GLN B CA  1 
ATOM   9849  C  C   . GLN B  2 390  ? 11.917  -24.363 31.336  1.00 282.37 ? 390  GLN B C   1 
ATOM   9850  O  O   . GLN B  2 390  ? 11.996  -23.176 31.654  1.00 313.71 ? 390  GLN B O   1 
ATOM   9851  C  CB  . GLN B  2 390  ? 14.305  -24.803 31.895  1.00 237.11 ? 390  GLN B CB  1 
ATOM   9852  C  CG  . GLN B  2 390  ? 14.052  -25.214 33.322  1.00 236.32 ? 390  GLN B CG  1 
ATOM   9853  C  CD  . GLN B  2 390  ? 15.213  -24.884 34.220  1.00 280.13 ? 390  GLN B CD  1 
ATOM   9854  O  OE1 . GLN B  2 390  ? 16.224  -24.342 33.773  1.00 338.66 ? 390  GLN B OE1 1 
ATOM   9855  N  NE2 . GLN B  2 390  ? 15.079  -25.205 35.499  1.00 272.67 ? 390  GLN B NE2 1 
ATOM   9856  N  N   . VAL B  2 391  ? 10.771  -25.032 31.301  1.00 273.04 ? 391  VAL B N   1 
ATOM   9857  C  CA  . VAL B  2 391  ? 9.497   -24.396 31.615  1.00 281.16 ? 391  VAL B CA  1 
ATOM   9858  C  C   . VAL B  2 391  ? 9.291   -24.337 33.127  1.00 337.42 ? 391  VAL B C   1 
ATOM   9859  O  O   . VAL B  2 391  ? 9.271   -25.369 33.797  1.00 398.21 ? 391  VAL B O   1 
ATOM   9860  C  CB  . VAL B  2 391  ? 8.318   -25.159 30.969  1.00 228.67 ? 391  VAL B CB  1 
ATOM   9861  C  CG1 . VAL B  2 391  ? 7.005   -24.423 31.202  1.00 257.03 ? 391  VAL B CG1 1 
ATOM   9862  C  CG2 . VAL B  2 391  ? 8.562   -25.348 29.483  1.00 199.16 ? 391  VAL B CG2 1 
ATOM   9863  N  N   . LYS B  2 392  ? 9.138   -23.125 33.655  1.00 297.71 ? 392  LYS B N   1 
ATOM   9864  C  CA  . LYS B  2 392  ? 8.929   -22.925 35.088  1.00 249.75 ? 392  LYS B CA  1 
ATOM   9865  C  C   . LYS B  2 392  ? 7.566   -22.302 35.374  1.00 233.86 ? 392  LYS B C   1 
ATOM   9866  O  O   . LYS B  2 392  ? 7.357   -21.110 35.146  1.00 235.96 ? 392  LYS B O   1 
ATOM   9867  C  CB  . LYS B  2 392  ? 10.033  -22.038 35.661  1.00 210.47 ? 392  LYS B CB  1 
ATOM   9868  C  CG  . LYS B  2 392  ? 11.429  -22.604 35.477  1.00 173.13 ? 392  LYS B CG  1 
ATOM   9869  C  CD  . LYS B  2 392  ? 12.480  -21.695 36.084  1.00 197.06 ? 392  LYS B CD  1 
ATOM   9870  C  CE  . LYS B  2 392  ? 13.863  -22.305 35.967  1.00 242.26 ? 392  LYS B CE  1 
ATOM   9871  N  NZ  . LYS B  2 392  ? 14.902  -21.444 36.590  1.00 221.86 ? 392  LYS B NZ  1 
ATOM   9872  N  N   . VAL B  2 393  ? 6.643   -23.117 35.880  1.00 217.62 ? 393  VAL B N   1 
ATOM   9873  C  CA  . VAL B  2 393  ? 5.289   -22.664 36.174  1.00 242.57 ? 393  VAL B CA  1 
ATOM   9874  C  C   . VAL B  2 393  ? 5.115   -22.376 37.663  1.00 249.08 ? 393  VAL B C   1 
ATOM   9875  O  O   . VAL B  2 393  ? 5.373   -23.236 38.507  1.00 258.80 ? 393  VAL B O   1 
ATOM   9876  C  CB  . VAL B  2 393  ? 4.238   -23.713 35.741  1.00 276.60 ? 393  VAL B CB  1 
ATOM   9877  C  CG1 . VAL B  2 393  ? 2.833   -23.244 36.105  1.00 312.62 ? 393  VAL B CG1 1 
ATOM   9878  C  CG2 . VAL B  2 393  ? 4.339   -23.996 34.241  1.00 261.30 ? 393  VAL B CG2 1 
ATOM   9879  N  N   . THR B  2 394  ? 4.668   -21.162 37.974  1.00 252.07 ? 394  THR B N   1 
ATOM   9880  C  CA  . THR B  2 394  ? 4.421   -20.763 39.351  1.00 241.19 ? 394  THR B CA  1 
ATOM   9881  C  C   . THR B  2 394  ? 2.997   -20.239 39.501  1.00 233.65 ? 394  THR B C   1 
ATOM   9882  O  O   . THR B  2 394  ? 2.414   -19.715 38.550  1.00 204.45 ? 394  THR B O   1 
ATOM   9883  C  CB  . THR B  2 394  ? 5.400   -19.669 39.803  1.00 198.53 ? 394  THR B CB  1 
ATOM   9884  O  OG1 . THR B  2 394  ? 6.746   -20.102 39.578  1.00 176.27 ? 394  THR B OG1 1 
ATOM   9885  C  CG2 . THR B  2 394  ? 5.218   -19.369 41.276  1.00 279.80 ? 394  THR B CG2 1 
ATOM   9886  N  N   . ALA B  2 395  ? 2.443   -20.392 40.700  1.00 227.39 ? 395  ALA B N   1 
ATOM   9887  C  CA  . ALA B  2 395  ? 1.103   -19.900 41.007  1.00 226.43 ? 395  ALA B CA  1 
ATOM   9888  C  C   . ALA B  2 395  ? 1.175   -18.847 42.113  1.00 230.18 ? 395  ALA B C   1 
ATOM   9889  O  O   . ALA B  2 395  ? 2.195   -18.716 42.790  1.00 250.88 ? 395  ALA B O   1 
ATOM   9890  C  CB  . ALA B  2 395  ? 0.189   -21.055 41.425  1.00 156.24 ? 395  ALA B CB  1 
ATOM   9891  N  N   . THR B  2 396  ? 0.090   -18.098 42.289  1.00 197.45 ? 396  THR B N   1 
ATOM   9892  C  CA  . THR B  2 396  ? 0.026   -17.071 43.321  1.00 186.03 ? 396  THR B CA  1 
ATOM   9893  C  C   . THR B  2 396  ? -0.826  -17.547 44.486  1.00 215.24 ? 396  THR B C   1 
ATOM   9894  O  O   . THR B  2 396  ? -0.541  -17.235 45.639  1.00 283.01 ? 396  THR B O   1 
ATOM   9895  C  CB  . THR B  2 396  ? -0.565  -15.753 42.780  1.00 213.33 ? 396  THR B CB  1 
ATOM   9896  O  OG1 . THR B  2 396  ? -1.904  -15.974 42.324  1.00 232.46 ? 396  THR B OG1 1 
ATOM   9897  C  CG2 . THR B  2 396  ? 0.281   -15.217 41.637  1.00 234.40 ? 396  THR B CG2 1 
ATOM   9898  N  N   . GLU B  2 397  ? -1.872  -18.304 44.180  1.00 224.27 ? 397  GLU B N   1 
ATOM   9899  C  CA  . GLU B  2 397  ? -2.752  -18.840 45.207  1.00 240.42 ? 397  GLU B CA  1 
ATOM   9900  C  C   . GLU B  2 397  ? -3.029  -20.311 44.938  1.00 248.79 ? 397  GLU B C   1 
ATOM   9901  O  O   . GLU B  2 397  ? -2.563  -20.868 43.945  1.00 241.36 ? 397  GLU B O   1 
ATOM   9902  C  CB  . GLU B  2 397  ? -4.064  -18.059 45.240  1.00 239.57 ? 397  GLU B CB  1 
ATOM   9903  C  CG  . GLU B  2 397  ? -4.823  -18.091 43.932  1.00 226.68 ? 397  GLU B CG  1 
ATOM   9904  C  CD  . GLU B  2 397  ? -6.156  -17.384 44.020  1.00 226.65 ? 397  GLU B CD  1 
ATOM   9905  O  OE1 . GLU B  2 397  ? -6.489  -16.872 45.109  1.00 301.16 ? 397  GLU B OE1 1 
ATOM   9906  O  OE2 . GLU B  2 397  ? -6.872  -17.341 43.002  1.00 192.41 ? 397  GLU B OE2 1 
ATOM   9907  N  N   . CYS B  2 398  ? -3.796  -20.934 45.824  1.00 235.95 ? 398  CYS B N   1 
ATOM   9908  C  CA  . CYS B  2 398  ? -4.176  -22.325 45.636  1.00 254.16 ? 398  CYS B CA  1 
ATOM   9909  C  C   . CYS B  2 398  ? -5.208  -22.457 44.519  1.00 251.10 ? 398  CYS B C   1 
ATOM   9910  O  O   . CYS B  2 398  ? -6.420  -22.433 44.750  1.00 249.14 ? 398  CYS B O   1 
ATOM   9911  C  CB  . CYS B  2 398  ? -4.688  -22.914 46.942  1.00 265.73 ? 398  CYS B CB  1 
ATOM   9912  S  SG  . CYS B  2 398  ? -3.361  -23.507 48.015  1.00 258.73 ? 398  CYS B SG  1 
ATOM   9913  N  N   . ILE B  2 399  ? -4.699  -22.571 43.299  1.00 238.62 ? 399  ILE B N   1 
ATOM   9914  C  CA  . ILE B  2 399  ? -5.529  -22.685 42.111  1.00 233.22 ? 399  ILE B CA  1 
ATOM   9915  C  C   . ILE B  2 399  ? -6.534  -23.821 42.217  1.00 191.80 ? 399  ILE B C   1 
ATOM   9916  O  O   . ILE B  2 399  ? -6.435  -24.670 43.095  1.00 165.84 ? 399  ILE B O   1 
ATOM   9917  C  CB  . ILE B  2 399  ? -4.655  -22.945 40.875  1.00 241.48 ? 399  ILE B CB  1 
ATOM   9918  C  CG1 . ILE B  2 399  ? -3.681  -24.098 41.150  1.00 195.19 ? 399  ILE B CG1 1 
ATOM   9919  C  CG2 . ILE B  2 399  ? -3.888  -21.687 40.493  1.00 267.26 ? 399  ILE B CG2 1 
ATOM   9920  C  CD1 . ILE B  2 399  ? -2.779  -24.439 39.981  1.00 224.33 ? 399  ILE B CD1 1 
ATOM   9921  N  N   . GLN B  2 400  ? -7.505  -23.829 41.314  0.50 154.98 ? 400  GLN B N   1 
ATOM   9922  C  CA  . GLN B  2 400  ? -8.420  -24.952 41.198  0.50 132.37 ? 400  GLN B CA  1 
ATOM   9923  C  C   . GLN B  2 400  ? -7.913  -25.846 40.081  0.50 150.75 ? 400  GLN B C   1 
ATOM   9924  O  O   . GLN B  2 400  ? -7.355  -25.362 39.099  0.50 99.94  ? 400  GLN B O   1 
ATOM   9925  C  CB  . GLN B  2 400  ? -9.835  -24.473 40.888  0.50 113.95 ? 400  GLN B CB  1 
ATOM   9926  C  CG  . GLN B  2 400  ? -10.852 -25.592 40.844  0.50 144.79 ? 400  GLN B CG  1 
ATOM   9927  C  CD  . GLN B  2 400  ? -11.017 -26.271 42.184  0.50 134.03 ? 400  GLN B CD  1 
ATOM   9928  O  OE1 . GLN B  2 400  ? -11.257 -25.615 43.194  0.50 140.64 ? 400  GLN B OE1 1 
ATOM   9929  N  NE2 . GLN B  2 400  ? -10.892 -27.592 42.201  0.50 125.24 ? 400  GLN B NE2 1 
ATOM   9930  N  N   . GLU B  2 401  ? -8.094  -27.151 40.230  1.00 206.16 ? 401  GLU B N   1 
ATOM   9931  C  CA  . GLU B  2 401  ? -7.568  -28.086 39.250  1.00 247.24 ? 401  GLU B CA  1 
ATOM   9932  C  C   . GLU B  2 401  ? -8.032  -27.703 37.854  1.00 271.87 ? 401  GLU B C   1 
ATOM   9933  O  O   . GLU B  2 401  ? -9.229  -27.603 37.593  1.00 290.85 ? 401  GLU B O   1 
ATOM   9934  C  CB  . GLU B  2 401  ? -8.003  -29.511 39.573  1.00 242.67 ? 401  GLU B CB  1 
ATOM   9935  C  CG  . GLU B  2 401  ? -7.356  -30.551 38.683  1.00 258.40 ? 401  GLU B CG  1 
ATOM   9936  C  CD  . GLU B  2 401  ? -7.888  -31.940 38.941  1.00 301.91 ? 401  GLU B CD  1 
ATOM   9937  O  OE1 . GLU B  2 401  ? -8.710  -32.098 39.866  1.00 333.25 ? 401  GLU B OE1 1 
ATOM   9938  O  OE2 . GLU B  2 401  ? -7.484  -32.872 38.217  1.00 320.72 ? 401  GLU B OE2 1 
ATOM   9939  N  N   . GLN B  2 402  ? -7.071  -27.479 36.965  1.00 260.89 ? 402  GLN B N   1 
ATOM   9940  C  CA  . GLN B  2 402  ? -7.368  -27.139 35.583  1.00 255.82 ? 402  GLN B CA  1 
ATOM   9941  C  C   . GLN B  2 402  ? -6.276  -27.683 34.666  1.00 259.34 ? 402  GLN B C   1 
ATOM   9942  O  O   . GLN B  2 402  ? -5.403  -28.429 35.107  1.00 261.38 ? 402  GLN B O   1 
ATOM   9943  C  CB  . GLN B  2 402  ? -7.496  -25.625 35.434  1.00 238.04 ? 402  GLN B CB  1 
ATOM   9944  C  CG  . GLN B  2 402  ? -8.662  -25.029 36.214  1.00 226.99 ? 402  GLN B CG  1 
ATOM   9945  C  CD  . GLN B  2 402  ? -8.704  -23.524 36.129  1.00 241.07 ? 402  GLN B CD  1 
ATOM   9946  O  OE1 . GLN B  2 402  ? -7.751  -22.896 35.677  1.00 256.46 ? 402  GLN B OE1 1 
ATOM   9947  N  NE2 . GLN B  2 402  ? -9.810  -22.933 36.563  1.00 248.17 ? 402  GLN B NE2 1 
ATOM   9948  N  N   . SER B  2 403  ? -6.326  -27.313 33.391  1.00 254.16 ? 403  SER B N   1 
ATOM   9949  C  CA  . SER B  2 403  ? -5.352  -27.803 32.422  1.00 241.17 ? 403  SER B CA  1 
ATOM   9950  C  C   . SER B  2 403  ? -5.191  -26.843 31.251  1.00 252.84 ? 403  SER B C   1 
ATOM   9951  O  O   . SER B  2 403  ? -6.167  -26.284 30.756  1.00 284.37 ? 403  SER B O   1 
ATOM   9952  C  CB  . SER B  2 403  ? -5.777  -29.172 31.897  1.00 231.79 ? 403  SER B CB  1 
ATOM   9953  O  OG  . SER B  2 403  ? -7.051  -29.106 31.282  1.00 270.91 ? 403  SER B OG  1 
ATOM   9954  N  N   . PHE B  2 404  ? -3.952  -26.659 30.809  1.00 226.58 ? 404  PHE B N   1 
ATOM   9955  C  CA  . PHE B  2 404  ? -3.668  -25.825 29.647  1.00 238.35 ? 404  PHE B CA  1 
ATOM   9956  C  C   . PHE B  2 404  ? -2.736  -26.572 28.704  1.00 296.99 ? 404  PHE B C   1 
ATOM   9957  O  O   . PHE B  2 404  ? -2.455  -27.753 28.909  1.00 323.34 ? 404  PHE B O   1 
ATOM   9958  C  CB  . PHE B  2 404  ? -3.025  -24.510 30.079  1.00 211.57 ? 404  PHE B CB  1 
ATOM   9959  C  CG  . PHE B  2 404  ? -1.655  -24.676 30.656  1.00 221.86 ? 404  PHE B CG  1 
ATOM   9960  C  CD1 . PHE B  2 404  ? -0.534  -24.549 29.858  1.00 232.57 ? 404  PHE B CD1 1 
ATOM   9961  C  CD2 . PHE B  2 404  ? -1.487  -24.973 31.994  1.00 273.44 ? 404  PHE B CD2 1 
ATOM   9962  C  CE1 . PHE B  2 404  ? 0.732   -24.708 30.388  1.00 202.91 ? 404  PHE B CE1 1 
ATOM   9963  C  CE2 . PHE B  2 404  ? -0.224  -25.132 32.525  1.00 265.92 ? 404  PHE B CE2 1 
ATOM   9964  C  CZ  . PHE B  2 404  ? 0.887   -24.999 31.718  1.00 159.58 ? 404  PHE B CZ  1 
ATOM   9965  N  N   . VAL B  2 405  ? -2.254  -25.883 27.673  1.00 308.15 ? 405  VAL B N   1 
ATOM   9966  C  CA  . VAL B  2 405  ? -1.387  -26.511 26.682  1.00 280.08 ? 405  VAL B CA  1 
ATOM   9967  C  C   . VAL B  2 405  ? -0.226  -25.611 26.282  1.00 251.26 ? 405  VAL B C   1 
ATOM   9968  O  O   . VAL B  2 405  ? -0.353  -24.382 26.249  1.00 185.39 ? 405  VAL B O   1 
ATOM   9969  C  CB  . VAL B  2 405  ? -2.168  -26.876 25.411  1.00 257.08 ? 405  VAL B CB  1 
ATOM   9970  C  CG1 . VAL B  2 405  ? -3.249  -27.890 25.730  1.00 271.90 ? 405  VAL B CG1 1 
ATOM   9971  C  CG2 . VAL B  2 405  ? -2.765  -25.625 24.779  1.00 233.41 ? 405  VAL B CG2 1 
ATOM   9972  N  N   . ILE B  2 406  ? 0.905   -26.240 25.974  1.00 236.73 ? 406  ILE B N   1 
ATOM   9973  C  CA  . ILE B  2 406  ? 2.077   -25.528 25.489  1.00 249.49 ? 406  ILE B CA  1 
ATOM   9974  C  C   . ILE B  2 406  ? 2.415   -26.016 24.085  1.00 271.94 ? 406  ILE B C   1 
ATOM   9975  O  O   . ILE B  2 406  ? 3.040   -27.063 23.912  1.00 239.08 ? 406  ILE B O   1 
ATOM   9976  C  CB  . ILE B  2 406  ? 3.289   -25.742 26.406  1.00 248.15 ? 406  ILE B CB  1 
ATOM   9977  C  CG1 . ILE B  2 406  ? 3.008   -25.175 27.798  1.00 311.84 ? 406  ILE B CG1 1 
ATOM   9978  C  CG2 . ILE B  2 406  ? 4.526   -25.086 25.811  1.00 211.08 ? 406  ILE B CG2 1 
ATOM   9979  C  CD1 . ILE B  2 406  ? 4.114   -25.436 28.799  1.00 343.77 ? 406  ILE B