data_3KJO
# 
_entry.id   3KJO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3KJO         
NDB   NA0289       
RCSB  RCSB056075   
WWPDB D_1000056075 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1XJV 'Same protein complexed with all-DNA 10mer oligonucleotide' unspecified 
PDB 3KJP 'Same protein complexed with all-DNA 12mer oligomucleotide' unspecified 
# 
_pdbx_database_status.entry_id                        3KJO 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-11-03 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nandakumar, J.' 1 
'Cech, T.R.'     2 
'Podell, E.R.'   3 
# 
_citation.id                        primary 
_citation.title                     'How telomeric protein POT1 avoids RNA to achieve specificity for single-stranded DNA.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            107 
_citation.page_first                651 
_citation.page_last                 656 
_citation.year                      2010 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20080730 
_citation.pdbx_database_id_DOI      10.1073/pnas.0911099107 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nandakumar, J.' 1 
primary 'Podell, E.R.'   2 
primary 'Cech, T.R.'     3 
# 
_cell.entry_id           3KJO 
_cell.length_a           101.867 
_cell.length_b           103.591 
_cell.length_c           71.736 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3KJO 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protection of telomeres protein 1'                        33724.746 1   ? ? 'UNP residues 1-299' 
'Putative Splice variant of hPOT1'                                                
2 polymer syn 
;DNA/RNA (5'-D(*T)-R(P*U)-D(P*AP*GP*GP*GP*TP*TP*AP*G)-3')
;
3117.023  1   ? ? ?                    'single-stranded DNA containing an rU ribonucleotide substitution at position 4.' 
3 water   nat water                                                      18.015    223 ? ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'hPot1, POT1-like telomere end-binding protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'                                    no no 
;MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALPIIYKNGDIVR
FHRLKIQVYKKETQGITSSGFASLTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQ
YFDLTCQLLGKAEVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEGDLSHIHRLQNLTIDILVYDNHVHVARSLKVGSFLR
IYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTA
;
;MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALPIIYKNGDIVR
FHRLKIQVYKKETQGITSSGFASLTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQ
YFDLTCQLLGKAEVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEGDLSHIHRLQNLTIDILVYDNHVHVARSLKVGSFLR
IYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTA
;
A ? 
2 'polydeoxyribonucleotide/polyribonucleotide hybrid' no no '(DT)U(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)' TUAGGGTTAG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   LEU n 
1 4   VAL n 
1 5   PRO n 
1 6   ALA n 
1 7   THR n 
1 8   ASN n 
1 9   TYR n 
1 10  ILE n 
1 11  TYR n 
1 12  THR n 
1 13  PRO n 
1 14  LEU n 
1 15  ASN n 
1 16  GLN n 
1 17  LEU n 
1 18  LYS n 
1 19  GLY n 
1 20  GLY n 
1 21  THR n 
1 22  ILE n 
1 23  VAL n 
1 24  ASN n 
1 25  VAL n 
1 26  TYR n 
1 27  GLY n 
1 28  VAL n 
1 29  VAL n 
1 30  LYS n 
1 31  PHE n 
1 32  PHE n 
1 33  LYS n 
1 34  PRO n 
1 35  PRO n 
1 36  TYR n 
1 37  LEU n 
1 38  SER n 
1 39  LYS n 
1 40  GLY n 
1 41  THR n 
1 42  ASP n 
1 43  TYR n 
1 44  CYS n 
1 45  SER n 
1 46  VAL n 
1 47  VAL n 
1 48  THR n 
1 49  ILE n 
1 50  VAL n 
1 51  ASP n 
1 52  GLN n 
1 53  THR n 
1 54  ASN n 
1 55  VAL n 
1 56  LYS n 
1 57  LEU n 
1 58  THR n 
1 59  CYS n 
1 60  LEU n 
1 61  LEU n 
1 62  PHE n 
1 63  SER n 
1 64  GLY n 
1 65  ASN n 
1 66  TYR n 
1 67  GLU n 
1 68  ALA n 
1 69  LEU n 
1 70  PRO n 
1 71  ILE n 
1 72  ILE n 
1 73  TYR n 
1 74  LYS n 
1 75  ASN n 
1 76  GLY n 
1 77  ASP n 
1 78  ILE n 
1 79  VAL n 
1 80  ARG n 
1 81  PHE n 
1 82  HIS n 
1 83  ARG n 
1 84  LEU n 
1 85  LYS n 
1 86  ILE n 
1 87  GLN n 
1 88  VAL n 
1 89  TYR n 
1 90  LYS n 
1 91  LYS n 
1 92  GLU n 
1 93  THR n 
1 94  GLN n 
1 95  GLY n 
1 96  ILE n 
1 97  THR n 
1 98  SER n 
1 99  SER n 
1 100 GLY n 
1 101 PHE n 
1 102 ALA n 
1 103 SER n 
1 104 LEU n 
1 105 THR n 
1 106 PHE n 
1 107 GLU n 
1 108 GLY n 
1 109 THR n 
1 110 LEU n 
1 111 GLY n 
1 112 ALA n 
1 113 PRO n 
1 114 ILE n 
1 115 ILE n 
1 116 PRO n 
1 117 ARG n 
1 118 THR n 
1 119 SER n 
1 120 SER n 
1 121 LYS n 
1 122 TYR n 
1 123 PHE n 
1 124 ASN n 
1 125 PHE n 
1 126 THR n 
1 127 THR n 
1 128 GLU n 
1 129 ASP n 
1 130 HIS n 
1 131 LYS n 
1 132 MET n 
1 133 VAL n 
1 134 GLU n 
1 135 ALA n 
1 136 LEU n 
1 137 ARG n 
1 138 VAL n 
1 139 TRP n 
1 140 ALA n 
1 141 SER n 
1 142 THR n 
1 143 HIS n 
1 144 MET n 
1 145 SER n 
1 146 PRO n 
1 147 SER n 
1 148 TRP n 
1 149 THR n 
1 150 LEU n 
1 151 LEU n 
1 152 LYS n 
1 153 LEU n 
1 154 CYS n 
1 155 ASP n 
1 156 VAL n 
1 157 GLN n 
1 158 PRO n 
1 159 MET n 
1 160 GLN n 
1 161 TYR n 
1 162 PHE n 
1 163 ASP n 
1 164 LEU n 
1 165 THR n 
1 166 CYS n 
1 167 GLN n 
1 168 LEU n 
1 169 LEU n 
1 170 GLY n 
1 171 LYS n 
1 172 ALA n 
1 173 GLU n 
1 174 VAL n 
1 175 ASP n 
1 176 GLY n 
1 177 ALA n 
1 178 SER n 
1 179 PHE n 
1 180 LEU n 
1 181 LEU n 
1 182 LYS n 
1 183 VAL n 
1 184 TRP n 
1 185 ASP n 
1 186 GLY n 
1 187 THR n 
1 188 ARG n 
1 189 THR n 
1 190 PRO n 
1 191 PHE n 
1 192 PRO n 
1 193 SER n 
1 194 TRP n 
1 195 ARG n 
1 196 VAL n 
1 197 LEU n 
1 198 ILE n 
1 199 GLN n 
1 200 ASP n 
1 201 LEU n 
1 202 VAL n 
1 203 LEU n 
1 204 GLU n 
1 205 GLY n 
1 206 ASP n 
1 207 LEU n 
1 208 SER n 
1 209 HIS n 
1 210 ILE n 
1 211 HIS n 
1 212 ARG n 
1 213 LEU n 
1 214 GLN n 
1 215 ASN n 
1 216 LEU n 
1 217 THR n 
1 218 ILE n 
1 219 ASP n 
1 220 ILE n 
1 221 LEU n 
1 222 VAL n 
1 223 TYR n 
1 224 ASP n 
1 225 ASN n 
1 226 HIS n 
1 227 VAL n 
1 228 HIS n 
1 229 VAL n 
1 230 ALA n 
1 231 ARG n 
1 232 SER n 
1 233 LEU n 
1 234 LYS n 
1 235 VAL n 
1 236 GLY n 
1 237 SER n 
1 238 PHE n 
1 239 LEU n 
1 240 ARG n 
1 241 ILE n 
1 242 TYR n 
1 243 SER n 
1 244 LEU n 
1 245 HIS n 
1 246 THR n 
1 247 LYS n 
1 248 LEU n 
1 249 GLN n 
1 250 SER n 
1 251 MET n 
1 252 ASN n 
1 253 SER n 
1 254 GLU n 
1 255 ASN n 
1 256 GLN n 
1 257 THR n 
1 258 MET n 
1 259 LEU n 
1 260 SER n 
1 261 LEU n 
1 262 GLU n 
1 263 PHE n 
1 264 HIS n 
1 265 LEU n 
1 266 HIS n 
1 267 GLY n 
1 268 GLY n 
1 269 THR n 
1 270 SER n 
1 271 TYR n 
1 272 GLY n 
1 273 ARG n 
1 274 GLY n 
1 275 ILE n 
1 276 ARG n 
1 277 VAL n 
1 278 LEU n 
1 279 PRO n 
1 280 GLU n 
1 281 SER n 
1 282 ASN n 
1 283 SER n 
1 284 ASP n 
1 285 VAL n 
1 286 ASP n 
1 287 GLN n 
1 288 LEU n 
1 289 LYS n 
1 290 LYS n 
1 291 ASP n 
1 292 LEU n 
1 293 GLU n 
1 294 SER n 
1 295 ALA n 
1 296 ASN n 
1 297 LEU n 
1 298 THR n 
1 299 ALA n 
2 1   DT  n 
2 2   U   n 
2 3   DA  n 
2 4   DG  n 
2 5   DG  n 
2 6   DG  n 
2 7   DT  n 
2 8   DT  n 
2 9   DA  n 
2 10  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 POT1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               SF9 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Bacmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PFASTBAC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'10mer synthetic oligonucleotide containing human telomeric repeat sequence with a single ribonucleotide at position 4' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POTE1_HUMAN Q9NUX5 1 
;MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALPIIYKNGDIVR
FHRLKIQVYKKETQGITSSGFASLTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQ
YFDLTCQLLGKAEVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEGDLSHIHRLQNLTIDILVYDNHVHVARSLKVGSFLR
IYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTA
;
1 ? 
2 PDB 3KJO        3KJO   2 TUAGGGTTAG 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3KJO A 1 ? 299 ? Q9NUX5 1 ? 299 ? 1 299 
2 2 3KJO B 1 ? 10  ? 3KJO   3 ? 12  ? 3 12  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3KJO 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.11 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'AMMONIUM SULFATE, TRISODIUM CITRATE       , pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2009-07-31 
_diffrn_detector.details                'KOHZU: Double Crystal Si(111)' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    KOHZU 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
# 
_reflns.entry_id                     3KJO 
_reflns.d_resolution_high            1.800 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   35300 
_reflns.pdbx_Rmerge_I_obs            0.045 
_reflns.pdbx_netI_over_sigmaI        22.200 
_reflns.pdbx_chi_squared             1.824 
_reflns.pdbx_redundancy              6.900 
_reflns.percent_possible_obs         99.500 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.number_all                   35477 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        28.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.332 
_reflns_shell.meanI_over_sigI_obs    3.9 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       1.099 
_reflns_shell.pdbx_redundancy        6.10 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3408 
_reflns_shell.percent_possible_all   97.80 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3KJO 
_refine.ls_d_res_high                            1.800 
_refine.ls_d_res_low                             32.700 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               208708.000 
_refine.pdbx_data_cutoff_low_absF                0.000 
_refine.ls_percent_reflns_obs                    96.000 
_refine.ls_number_reflns_obs                     34134 
_refine.ls_number_reflns_all                     35556 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            'RANDOM SET that was used for structural solution of 1XJV' 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.228 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.238 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1716 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.B_iso_mean                               34.792 
_refine.solvent_model_param_bsol                 53.747 
_refine.solvent_model_param_ksol                 0.400 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.aniso_B[1][1]                            5.370 
_refine.aniso_B[2][2]                            1.180 
_refine.aniso_B[3][3]                            -6.560 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1XJV' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                73.63 
_refine.B_iso_min                                14.68 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3KJO 
_refine_analyze.Luzzati_coordinate_error_obs    0.240 
_refine_analyze.Luzzati_sigma_a_obs             0.200 
_refine_analyze.Luzzati_d_res_low_obs           5.000 
_refine_analyze.Luzzati_coordinate_error_free   0.270 
_refine_analyze.Luzzati_sigma_a_free            0.210 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2309 
_refine_hist.pdbx_number_atoms_nucleic_acid   207 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             223 
_refine_hist.number_atoms_total               2739 
_refine_hist.d_res_high                       1.800 
_refine_hist.d_res_low                        32.700 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           ? 0.005  ?     ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        ? 1.200  ?     ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d ? 25.200 ?     ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d ? 0.840  ?     ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        ? 1.390  1.500 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       ? 2.190  2.000 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        ? 2.000  2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       ? 3.020  2.500 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.800 
_refine_ls_shell.d_res_low                        1.910 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.percent_reflns_obs               87.300 
_refine_ls_shell.number_reflns_R_work             4843 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.320 
_refine_ls_shell.R_factor_R_free                  0.314 
_refine_ls_shell.percent_reflns_R_free            5.300 
_refine_ls_shell.number_reflns_R_free             269 
_refine_ls_shell.R_factor_R_free_error            0.019 
_refine_ls_shell.number_reflns_all                5112 
_refine_ls_shell.number_reflns_obs                4796 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 ion.param         ion.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3KJO 
_struct.title                     'Crystal Structure of hPOT1V2-dTrUd(AGGGTTAG)' 
_struct.pdbx_descriptor           'Protection of telomeres protein 1/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KJO 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            
;OB domain, Protein-DNA complex, Protein-RNA complex, Alternative splicing, Chromosomal protein, DNA-binding, Nucleus, Polymorphism, Telomere, DNA BINDING PROTEIN-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 65  ? LEU A 69  ? ASN A 65  LEU A 69  5 ? 5  
HELX_P HELX_P2 2 THR A 126 ? MET A 144 ? THR A 126 MET A 144 1 ? 19 
HELX_P HELX_P3 3 LYS A 152 ? VAL A 156 ? LYS A 152 VAL A 156 5 ? 5  
HELX_P HELX_P4 4 ASP A 206 ? GLN A 214 ? ASP A 206 GLN A 214 1 ? 9  
HELX_P HELX_P5 5 ASN A 215 ? THR A 217 ? ASN A 215 THR A 217 5 ? 3  
HELX_P HELX_P6 6 ASN A 225 ? LEU A 233 ? ASN A 225 LEU A 233 1 ? 9  
HELX_P HELX_P7 7 THR A 269 ? ARG A 273 ? THR A 269 ARG A 273 5 ? 5  
HELX_P HELX_P8 8 ASN A 282 ? THR A 298 ? ASN A 282 THR A 298 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 7 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 21  ? LEU A 37  ? THR A 21  LEU A 37  
A 2 TYR A 43  ? VAL A 50  ? TYR A 43  VAL A 50  
A 3 LYS A 56  ? SER A 63  ? LYS A 56  SER A 63  
A 4 GLU A 92  ? PHE A 106 ? GLU A 92  PHE A 106 
A 5 ILE A 78  ? TYR A 89  ? ILE A 78  TYR A 89  
A 6 THR A 21  ? LEU A 37  ? THR A 21  LEU A 37  
B 1 GLU A 204 ? GLY A 205 ? GLU A 204 GLY A 205 
B 2 TYR A 161 ? GLU A 173 ? TYR A 161 GLU A 173 
B 3 SER A 178 ? TRP A 184 ? SER A 178 TRP A 184 
B 4 ILE A 218 ? TYR A 223 ? ILE A 218 TYR A 223 
B 5 THR A 257 ? LEU A 265 ? THR A 257 LEU A 265 
B 6 PHE A 238 ? MET A 251 ? PHE A 238 MET A 251 
B 7 GLY A 274 ? LEU A 278 ? GLY A 274 LEU A 278 
C 1 GLU A 204 ? GLY A 205 ? GLU A 204 GLY A 205 
C 2 TYR A 161 ? GLU A 173 ? TYR A 161 GLU A 173 
C 3 PHE A 238 ? MET A 251 ? PHE A 238 MET A 251 
C 4 GLY A 274 ? LEU A 278 ? GLY A 274 LEU A 278 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 36  ? N TYR A 36  O CYS A 44  ? O CYS A 44  
A 2 3 N TYR A 43  ? N TYR A 43  O SER A 63  ? O SER A 63  
A 3 4 N LEU A 60  ? N LEU A 60  O GLY A 95  ? O GLY A 95  
A 4 5 O GLU A 92  ? O GLU A 92  N TYR A 89  ? N TYR A 89  
A 5 6 O ILE A 86  ? O ILE A 86  N THR A 21  ? N THR A 21  
B 1 2 O GLU A 204 ? O GLU A 204 N LYS A 171 ? N LYS A 171 
B 2 3 N ALA A 172 ? N ALA A 172 O LEU A 180 ? O LEU A 180 
B 3 4 N LEU A 181 ? N LEU A 181 O ILE A 220 ? O ILE A 220 
B 4 5 N LEU A 221 ? N LEU A 221 O LEU A 265 ? O LEU A 265 
B 5 6 O SER A 260 ? O SER A 260 N GLN A 249 ? N GLN A 249 
B 6 7 N PHE A 238 ? N PHE A 238 O LEU A 278 ? O LEU A 278 
C 1 2 O GLU A 204 ? O GLU A 204 N LYS A 171 ? N LYS A 171 
C 2 3 N PHE A 162 ? N PHE A 162 O LEU A 244 ? O LEU A 244 
C 3 4 N PHE A 238 ? N PHE A 238 O LEU A 278 ? O LEU A 278 
# 
_database_PDB_matrix.entry_id          3KJO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    3KJO 
_atom_sites.fract_transf_matrix[1][1]   0.009817 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009653 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013940 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ALA A 1 6   ? 30.378 18.542 59.438  1.00 54.33 ? 6   ALA A N     1 
ATOM   2    C CA    . ALA A 1 6   ? 31.148 19.783 59.138  1.00 54.77 ? 6   ALA A CA    1 
ATOM   3    C C     . ALA A 1 6   ? 31.610 19.797 57.682  1.00 54.79 ? 6   ALA A C     1 
ATOM   4    O O     . ALA A 1 6   ? 31.837 18.744 57.083  1.00 54.78 ? 6   ALA A O     1 
ATOM   5    C CB    . ALA A 1 6   ? 32.353 19.886 60.070  1.00 55.14 ? 6   ALA A CB    1 
ATOM   6    N N     . THR A 1 7   ? 31.742 20.995 57.118  1.00 54.79 ? 7   THR A N     1 
ATOM   7    C CA    . THR A 1 7   ? 32.182 21.147 55.732  1.00 54.39 ? 7   THR A CA    1 
ATOM   8    C C     . THR A 1 7   ? 33.671 21.485 55.701  1.00 53.45 ? 7   THR A C     1 
ATOM   9    O O     . THR A 1 7   ? 34.085 22.547 56.168  1.00 53.40 ? 7   THR A O     1 
ATOM   10   C CB    . THR A 1 7   ? 31.414 22.276 55.014  1.00 54.28 ? 7   THR A CB    1 
ATOM   11   O OG1   . THR A 1 7   ? 31.922 23.547 55.436  1.00 55.11 ? 7   THR A OG1   1 
ATOM   12   C CG2   . THR A 1 7   ? 29.932 22.203 55.344  1.00 55.03 ? 7   THR A CG2   1 
ATOM   13   N N     . ASN A 1 8   ? 34.474 20.586 55.143  1.00 53.24 ? 8   ASN A N     1 
ATOM   14   C CA    . ASN A 1 8   ? 35.914 20.804 55.073  1.00 52.60 ? 8   ASN A CA    1 
ATOM   15   C C     . ASN A 1 8   ? 36.479 20.518 53.682  1.00 50.62 ? 8   ASN A C     1 
ATOM   16   O O     . ASN A 1 8   ? 36.748 19.368 53.333  1.00 52.03 ? 8   ASN A O     1 
ATOM   17   C CB    . ASN A 1 8   ? 36.616 19.929 56.117  1.00 54.49 ? 8   ASN A CB    1 
ATOM   18   C CG    . ASN A 1 8   ? 38.125 20.058 56.070  1.00 56.55 ? 8   ASN A CG    1 
ATOM   19   O OD1   . ASN A 1 8   ? 38.777 19.537 55.163  1.00 57.62 ? 8   ASN A OD1   1 
ATOM   20   N ND2   . ASN A 1 8   ? 38.689 20.763 57.045  1.00 57.61 ? 8   ASN A ND2   1 
ATOM   21   N N     . TYR A 1 9   ? 36.661 21.575 52.895  1.00 47.47 ? 9   TYR A N     1 
ATOM   22   C CA    . TYR A 1 9   ? 37.192 21.442 51.543  1.00 43.85 ? 9   TYR A CA    1 
ATOM   23   C C     . TYR A 1 9   ? 38.713 21.416 51.512  1.00 42.85 ? 9   TYR A C     1 
ATOM   24   O O     . TYR A 1 9   ? 39.375 22.315 52.030  1.00 42.45 ? 9   TYR A O     1 
ATOM   25   C CB    . TYR A 1 9   ? 36.693 22.589 50.661  1.00 42.65 ? 9   TYR A CB    1 
ATOM   26   C CG    . TYR A 1 9   ? 35.293 22.391 50.132  1.00 40.40 ? 9   TYR A CG    1 
ATOM   27   C CD1   . TYR A 1 9   ? 35.045 21.506 49.083  1.00 40.70 ? 9   TYR A CD1   1 
ATOM   28   C CD2   . TYR A 1 9   ? 34.213 23.071 50.688  1.00 39.76 ? 9   TYR A CD2   1 
ATOM   29   C CE1   . TYR A 1 9   ? 33.757 21.305 48.602  1.00 39.32 ? 9   TYR A CE1   1 
ATOM   30   C CE2   . TYR A 1 9   ? 32.925 22.876 50.218  1.00 39.68 ? 9   TYR A CE2   1 
ATOM   31   C CZ    . TYR A 1 9   ? 32.704 21.994 49.174  1.00 39.42 ? 9   TYR A CZ    1 
ATOM   32   O OH    . TYR A 1 9   ? 31.429 21.806 48.694  1.00 40.06 ? 9   TYR A OH    1 
ATOM   33   N N     . ILE A 1 10  ? 39.258 20.371 50.901  1.00 41.39 ? 10  ILE A N     1 
ATOM   34   C CA    . ILE A 1 10  ? 40.699 20.221 50.775  1.00 40.33 ? 10  ILE A CA    1 
ATOM   35   C C     . ILE A 1 10  ? 41.099 20.469 49.322  1.00 39.37 ? 10  ILE A C     1 
ATOM   36   O O     . ILE A 1 10  ? 40.486 19.928 48.403  1.00 38.79 ? 10  ILE A O     1 
ATOM   37   C CB    . ILE A 1 10  ? 41.145 18.802 51.183  1.00 41.12 ? 10  ILE A CB    1 
ATOM   38   C CG1   . ILE A 1 10  ? 40.825 18.565 52.662  1.00 42.13 ? 10  ILE A CG1   1 
ATOM   39   C CG2   . ILE A 1 10  ? 42.631 18.626 50.922  1.00 41.99 ? 10  ILE A CG2   1 
ATOM   40   C CD1   . ILE A 1 10  ? 41.503 19.549 53.620  1.00 42.65 ? 10  ILE A CD1   1 
ATOM   41   N N     . TYR A 1 11  ? 42.122 21.295 49.124  1.00 37.90 ? 11  TYR A N     1 
ATOM   42   C CA    . TYR A 1 11  ? 42.612 21.618 47.785  1.00 37.01 ? 11  TYR A CA    1 
ATOM   43   C C     . TYR A 1 11  ? 43.954 20.942 47.546  1.00 37.51 ? 11  TYR A C     1 
ATOM   44   O O     . TYR A 1 11  ? 44.876 21.075 48.350  1.00 39.55 ? 11  TYR A O     1 
ATOM   45   C CB    . TYR A 1 11  ? 42.736 23.134 47.637  1.00 34.77 ? 11  TYR A CB    1 
ATOM   46   C CG    . TYR A 1 11  ? 41.401 23.820 47.784  1.00 32.54 ? 11  TYR A CG    1 
ATOM   47   C CD1   . TYR A 1 11  ? 40.518 23.897 46.711  1.00 29.85 ? 11  TYR A CD1   1 
ATOM   48   C CD2   . TYR A 1 11  ? 40.976 24.305 49.023  1.00 31.00 ? 11  TYR A CD2   1 
ATOM   49   C CE1   . TYR A 1 11  ? 39.248 24.429 46.863  1.00 29.86 ? 11  TYR A CE1   1 
ATOM   50   C CE2   . TYR A 1 11  ? 39.703 24.840 49.186  1.00 29.81 ? 11  TYR A CE2   1 
ATOM   51   C CZ    . TYR A 1 11  ? 38.845 24.897 48.102  1.00 30.62 ? 11  TYR A CZ    1 
ATOM   52   O OH    . TYR A 1 11  ? 37.577 25.411 48.253  1.00 31.20 ? 11  TYR A OH    1 
ATOM   53   N N     . THR A 1 12  ? 44.057 20.216 46.439  1.00 36.70 ? 12  THR A N     1 
ATOM   54   C CA    . THR A 1 12  ? 45.279 19.494 46.114  1.00 37.75 ? 12  THR A CA    1 
ATOM   55   C C     . THR A 1 12  ? 46.210 20.258 45.175  1.00 38.47 ? 12  THR A C     1 
ATOM   56   O O     . THR A 1 12  ? 45.790 20.725 44.116  1.00 37.27 ? 12  THR A O     1 
ATOM   57   C CB    . THR A 1 12  ? 44.946 18.134 45.465  1.00 38.32 ? 12  THR A CB    1 
ATOM   58   O OG1   . THR A 1 12  ? 44.030 17.417 46.302  1.00 39.72 ? 12  THR A OG1   1 
ATOM   59   C CG2   . THR A 1 12  ? 46.210 17.308 45.271  1.00 38.37 ? 12  THR A CG2   1 
ATOM   60   N N     . PRO A 1 13  ? 47.493 20.400 45.562  1.00 38.88 ? 13  PRO A N     1 
ATOM   61   C CA    . PRO A 1 13  ? 48.474 21.108 44.732  1.00 38.87 ? 13  PRO A CA    1 
ATOM   62   C C     . PRO A 1 13  ? 48.537 20.433 43.366  1.00 38.74 ? 13  PRO A C     1 
ATOM   63   O O     . PRO A 1 13  ? 48.396 19.214 43.271  1.00 38.80 ? 13  PRO A O     1 
ATOM   64   C CB    . PRO A 1 13  ? 49.767 20.950 45.524  1.00 39.15 ? 13  PRO A CB    1 
ATOM   65   C CG    . PRO A 1 13  ? 49.280 20.957 46.942  1.00 39.31 ? 13  PRO A CG    1 
ATOM   66   C CD    . PRO A 1 13  ? 48.077 20.037 46.866  1.00 38.80 ? 13  PRO A CD    1 
ATOM   67   N N     . LEU A 1 14  ? 48.743 21.220 42.316  1.00 37.76 ? 14  LEU A N     1 
ATOM   68   C CA    . LEU A 1 14  ? 48.779 20.680 40.963  1.00 37.00 ? 14  LEU A CA    1 
ATOM   69   C C     . LEU A 1 14  ? 49.908 19.684 40.694  1.00 39.80 ? 14  LEU A C     1 
ATOM   70   O O     . LEU A 1 14  ? 49.908 19.011 39.664  1.00 39.65 ? 14  LEU A O     1 
ATOM   71   C CB    . LEU A 1 14  ? 48.850 21.820 39.949  1.00 33.63 ? 14  LEU A CB    1 
ATOM   72   C CG    . LEU A 1 14  ? 47.775 22.904 40.040  1.00 31.35 ? 14  LEU A CG    1 
ATOM   73   C CD1   . LEU A 1 14  ? 47.949 23.873 38.881  1.00 30.73 ? 14  LEU A CD1   1 
ATOM   74   C CD2   . LEU A 1 14  ? 46.386 22.278 40.006  1.00 30.26 ? 14  LEU A CD2   1 
ATOM   75   N N     . ASN A 1 15  ? 50.863 19.580 41.611  1.00 42.06 ? 15  ASN A N     1 
ATOM   76   C CA    . ASN A 1 15  ? 51.970 18.648 41.415  1.00 45.53 ? 15  ASN A CA    1 
ATOM   77   C C     . ASN A 1 15  ? 51.805 17.395 42.269  1.00 46.69 ? 15  ASN A C     1 
ATOM   78   O O     . ASN A 1 15  ? 52.708 16.560 42.342  1.00 47.83 ? 15  ASN A O     1 
ATOM   79   C CB    . ASN A 1 15  ? 53.304 19.328 41.741  1.00 46.39 ? 15  ASN A CB    1 
ATOM   80   C CG    . ASN A 1 15  ? 53.511 19.529 43.226  1.00 48.67 ? 15  ASN A CG    1 
ATOM   81   O OD1   . ASN A 1 15  ? 52.607 19.964 43.938  1.00 50.06 ? 15  ASN A OD1   1 
ATOM   82   N ND2   . ASN A 1 15  ? 54.713 19.221 43.703  1.00 49.04 ? 15  ASN A ND2   1 
ATOM   83   N N     . GLN A 1 16  ? 50.646 17.268 42.908  1.00 46.81 ? 16  GLN A N     1 
ATOM   84   C CA    . GLN A 1 16  ? 50.346 16.120 43.756  1.00 47.02 ? 16  GLN A CA    1 
ATOM   85   C C     . GLN A 1 16  ? 49.099 15.403 43.253  1.00 46.27 ? 16  GLN A C     1 
ATOM   86   O O     . GLN A 1 16  ? 48.501 14.603 43.970  1.00 46.78 ? 16  GLN A O     1 
ATOM   87   C CB    . GLN A 1 16  ? 50.116 16.576 45.198  1.00 47.64 ? 16  GLN A CB    1 
ATOM   88   C CG    . GLN A 1 16  ? 51.369 17.024 45.924  1.00 48.82 ? 16  GLN A CG    1 
ATOM   89   C CD    . GLN A 1 16  ? 51.066 17.570 47.302  1.00 49.82 ? 16  GLN A CD    1 
ATOM   90   O OE1   . GLN A 1 16  ? 50.274 16.995 48.049  1.00 51.86 ? 16  GLN A OE1   1 
ATOM   91   N NE2   . GLN A 1 16  ? 51.702 18.679 47.652  1.00 50.80 ? 16  GLN A NE2   1 
ATOM   92   N N     . LEU A 1 17  ? 48.709 15.701 42.018  1.00 45.53 ? 17  LEU A N     1 
ATOM   93   C CA    . LEU A 1 17  ? 47.527 15.097 41.411  1.00 44.62 ? 17  LEU A CA    1 
ATOM   94   C C     . LEU A 1 17  ? 47.789 13.659 40.971  1.00 45.01 ? 17  LEU A C     1 
ATOM   95   O O     . LEU A 1 17  ? 48.884 13.327 40.521  1.00 45.78 ? 17  LEU A O     1 
ATOM   96   C CB    . LEU A 1 17  ? 47.075 15.931 40.206  1.00 43.50 ? 17  LEU A CB    1 
ATOM   97   C CG    . LEU A 1 17  ? 46.702 17.387 40.500  1.00 41.86 ? 17  LEU A CG    1 
ATOM   98   C CD1   . LEU A 1 17  ? 46.512 18.145 39.201  1.00 41.14 ? 17  LEU A CD1   1 
ATOM   99   C CD2   . LEU A 1 17  ? 45.438 17.429 41.342  1.00 40.98 ? 17  LEU A CD2   1 
ATOM   100  N N     . LYS A 1 18  ? 46.773 12.811 41.099  1.00 45.11 ? 18  LYS A N     1 
ATOM   101  C CA    . LYS A 1 18  ? 46.883 11.406 40.714  1.00 44.59 ? 18  LYS A CA    1 
ATOM   102  C C     . LYS A 1 18  ? 45.664 10.996 39.891  1.00 43.66 ? 18  LYS A C     1 
ATOM   103  O O     . LYS A 1 18  ? 44.547 11.440 40.158  1.00 42.72 ? 18  LYS A O     1 
ATOM   104  C CB    . LYS A 1 18  ? 46.982 10.524 41.963  1.00 45.71 ? 18  LYS A CB    1 
ATOM   105  C CG    . LYS A 1 18  ? 48.034 10.976 42.967  1.00 47.72 ? 18  LYS A CG    1 
ATOM   106  C CD    . LYS A 1 18  ? 49.427 11.013 42.355  1.00 50.33 ? 18  LYS A CD    1 
ATOM   107  C CE    . LYS A 1 18  ? 50.449 11.564 43.342  1.00 52.09 ? 18  LYS A CE    1 
ATOM   108  N NZ    . LYS A 1 18  ? 51.812 11.670 42.739  1.00 54.16 ? 18  LYS A NZ    1 
ATOM   109  N N     . GLY A 1 19  ? 45.880 10.151 38.889  1.00 42.49 ? 19  GLY A N     1 
ATOM   110  C CA    . GLY A 1 19  ? 44.779 9.713  38.053  1.00 42.64 ? 19  GLY A CA    1 
ATOM   111  C C     . GLY A 1 19  ? 43.777 8.873  38.820  1.00 43.31 ? 19  GLY A C     1 
ATOM   112  O O     . GLY A 1 19  ? 44.125 8.254  39.825  1.00 43.72 ? 19  GLY A O     1 
ATOM   113  N N     . GLY A 1 20  ? 42.533 8.855  38.349  1.00 43.99 ? 20  GLY A N     1 
ATOM   114  C CA    . GLY A 1 20  ? 41.498 8.073  39.007  1.00 44.37 ? 20  GLY A CA    1 
ATOM   115  C C     . GLY A 1 20  ? 41.008 8.653  40.322  1.00 44.56 ? 20  GLY A C     1 
ATOM   116  O O     . GLY A 1 20  ? 40.628 7.912  41.227  1.00 44.93 ? 20  GLY A O     1 
ATOM   117  N N     . THR A 1 21  ? 41.016 9.978  40.434  1.00 44.28 ? 21  THR A N     1 
ATOM   118  C CA    . THR A 1 21  ? 40.568 10.648 41.652  1.00 43.20 ? 21  THR A CA    1 
ATOM   119  C C     . THR A 1 21  ? 39.830 11.949 41.336  1.00 42.30 ? 21  THR A C     1 
ATOM   120  O O     . THR A 1 21  ? 40.081 12.578 40.305  1.00 41.96 ? 21  THR A O     1 
ATOM   121  C CB    . THR A 1 21  ? 41.761 10.974 42.582  1.00 44.80 ? 21  THR A CB    1 
ATOM   122  O OG1   . THR A 1 21  ? 42.651 11.883 41.920  1.00 45.59 ? 21  THR A OG1   1 
ATOM   123  C CG2   . THR A 1 21  ? 42.520 9.701  42.948  1.00 45.84 ? 21  THR A CG2   1 
ATOM   124  N N     . ILE A 1 22  ? 38.914 12.335 42.222  1.00 39.78 ? 22  ILE A N     1 
ATOM   125  C CA    . ILE A 1 22  ? 38.135 13.565 42.074  1.00 38.75 ? 22  ILE A CA    1 
ATOM   126  C C     . ILE A 1 22  ? 38.630 14.526 43.143  1.00 37.96 ? 22  ILE A C     1 
ATOM   127  O O     . ILE A 1 22  ? 38.614 14.202 44.330  1.00 37.37 ? 22  ILE A O     1 
ATOM   128  C CB    . ILE A 1 22  ? 36.620 13.307 42.276  1.00 38.42 ? 22  ILE A CB    1 
ATOM   129  C CG1   . ILE A 1 22  ? 36.091 12.431 41.137  1.00 39.96 ? 22  ILE A CG1   1 
ATOM   130  C CG2   . ILE A 1 22  ? 35.858 14.628 42.319  1.00 37.30 ? 22  ILE A CG2   1 
ATOM   131  C CD1   . ILE A 1 22  ? 34.628 12.052 41.271  1.00 40.31 ? 22  ILE A CD1   1 
ATOM   132  N N     . VAL A 1 23  ? 39.059 15.715 42.733  1.00 34.67 ? 23  VAL A N     1 
ATOM   133  C CA    . VAL A 1 23  ? 39.596 16.664 43.697  1.00 33.24 ? 23  VAL A CA    1 
ATOM   134  C C     . VAL A 1 23  ? 39.084 18.093 43.566  1.00 31.34 ? 23  VAL A C     1 
ATOM   135  O O     . VAL A 1 23  ? 38.163 18.379 42.801  1.00 29.45 ? 23  VAL A O     1 
ATOM   136  C CB    . VAL A 1 23  ? 41.135 16.695 43.608  1.00 35.31 ? 23  VAL A CB    1 
ATOM   137  C CG1   . VAL A 1 23  ? 41.705 15.308 43.895  1.00 36.13 ? 23  VAL A CG1   1 
ATOM   138  C CG2   . VAL A 1 23  ? 41.558 17.153 42.219  1.00 34.98 ? 23  VAL A CG2   1 
ATOM   139  N N     . ASN A 1 24  ? 39.692 18.978 44.347  1.00 29.37 ? 24  ASN A N     1 
ATOM   140  C CA    . ASN A 1 24  ? 39.360 20.400 44.352  1.00 29.97 ? 24  ASN A CA    1 
ATOM   141  C C     . ASN A 1 24  ? 40.685 21.100 44.088  1.00 30.01 ? 24  ASN A C     1 
ATOM   142  O O     . ASN A 1 24  ? 41.708 20.710 44.646  1.00 30.99 ? 24  ASN A O     1 
ATOM   143  C CB    . ASN A 1 24  ? 38.831 20.813 45.725  1.00 30.49 ? 24  ASN A CB    1 
ATOM   144  C CG    . ASN A 1 24  ? 37.632 19.992 46.156  1.00 31.44 ? 24  ASN A CG    1 
ATOM   145  O OD1   . ASN A 1 24  ? 37.531 19.570 47.313  1.00 34.57 ? 24  ASN A OD1   1 
ATOM   146  N ND2   . ASN A 1 24  ? 36.707 19.773 45.231  1.00 27.24 ? 24  ASN A ND2   1 
ATOM   147  N N     . VAL A 1 25  ? 40.686 22.118 43.234  1.00 29.72 ? 25  VAL A N     1 
ATOM   148  C CA    . VAL A 1 25  ? 41.930 22.818 42.936  1.00 29.06 ? 25  VAL A CA    1 
ATOM   149  C C     . VAL A 1 25  ? 41.778 24.317 42.769  1.00 28.88 ? 25  VAL A C     1 
ATOM   150  O O     . VAL A 1 25  ? 40.684 24.825 42.489  1.00 26.97 ? 25  VAL A O     1 
ATOM   151  C CB    . VAL A 1 25  ? 42.594 22.279 41.644  1.00 30.48 ? 25  VAL A CB    1 
ATOM   152  C CG1   . VAL A 1 25  ? 43.070 20.846 41.850  1.00 30.15 ? 25  VAL A CG1   1 
ATOM   153  C CG2   . VAL A 1 25  ? 41.608 22.360 40.476  1.00 29.47 ? 25  VAL A CG2   1 
ATOM   154  N N     . TYR A 1 26  ? 42.896 25.010 42.963  1.00 28.20 ? 26  TYR A N     1 
ATOM   155  C CA    . TYR A 1 26  ? 42.983 26.452 42.801  1.00 28.91 ? 26  TYR A CA    1 
ATOM   156  C C     . TYR A 1 26  ? 44.105 26.676 41.797  1.00 27.81 ? 26  TYR A C     1 
ATOM   157  O O     . TYR A 1 26  ? 45.076 25.918 41.771  1.00 27.72 ? 26  TYR A O     1 
ATOM   158  C CB    . TYR A 1 26  ? 43.363 27.136 44.113  1.00 29.58 ? 26  TYR A CB    1 
ATOM   159  C CG    . TYR A 1 26  ? 42.242 27.904 44.762  1.00 29.06 ? 26  TYR A CG    1 
ATOM   160  C CD1   . TYR A 1 26  ? 41.565 27.391 45.868  1.00 29.63 ? 26  TYR A CD1   1 
ATOM   161  C CD2   . TYR A 1 26  ? 41.857 29.149 44.272  1.00 29.63 ? 26  TYR A CD2   1 
ATOM   162  C CE1   . TYR A 1 26  ? 40.533 28.098 46.471  1.00 28.26 ? 26  TYR A CE1   1 
ATOM   163  C CE2   . TYR A 1 26  ? 40.825 29.867 44.868  1.00 30.46 ? 26  TYR A CE2   1 
ATOM   164  C CZ    . TYR A 1 26  ? 40.168 29.337 45.964  1.00 30.42 ? 26  TYR A CZ    1 
ATOM   165  O OH    . TYR A 1 26  ? 39.142 30.036 46.548  1.00 31.53 ? 26  TYR A OH    1 
ATOM   166  N N     . GLY A 1 27  ? 43.975 27.705 40.970  1.00 25.98 ? 27  GLY A N     1 
ATOM   167  C CA    . GLY A 1 27  ? 45.028 27.981 40.005  1.00 24.64 ? 27  GLY A CA    1 
ATOM   168  C C     . GLY A 1 27  ? 44.823 29.273 39.239  1.00 24.22 ? 27  GLY A C     1 
ATOM   169  O O     . GLY A 1 27  ? 43.779 29.916 39.364  1.00 24.07 ? 27  GLY A O     1 
ATOM   170  N N     . VAL A 1 28  ? 45.834 29.663 38.464  1.00 23.42 ? 28  VAL A N     1 
ATOM   171  C CA    . VAL A 1 28  ? 45.772 30.865 37.640  1.00 23.42 ? 28  VAL A CA    1 
ATOM   172  C C     . VAL A 1 28  ? 45.563 30.367 36.217  1.00 22.89 ? 28  VAL A C     1 
ATOM   173  O O     . VAL A 1 28  ? 46.157 29.368 35.815  1.00 24.26 ? 28  VAL A O     1 
ATOM   174  C CB    . VAL A 1 28  ? 47.106 31.669 37.653  1.00 24.02 ? 28  VAL A CB    1 
ATOM   175  C CG1   . VAL A 1 28  ? 46.942 32.938 36.823  1.00 23.89 ? 28  VAL A CG1   1 
ATOM   176  C CG2   . VAL A 1 28  ? 47.518 31.999 39.070  1.00 24.64 ? 28  VAL A CG2   1 
ATOM   177  N N     . VAL A 1 29  ? 44.736 31.065 35.449  1.00 22.40 ? 29  VAL A N     1 
ATOM   178  C CA    . VAL A 1 29  ? 44.477 30.660 34.070  1.00 22.47 ? 29  VAL A CA    1 
ATOM   179  C C     . VAL A 1 29  ? 45.599 31.104 33.132  1.00 24.24 ? 29  VAL A C     1 
ATOM   180  O O     . VAL A 1 29  ? 45.856 32.295 32.992  1.00 24.19 ? 29  VAL A O     1 
ATOM   181  C CB    . VAL A 1 29  ? 43.148 31.255 33.557  1.00 23.00 ? 29  VAL A CB    1 
ATOM   182  C CG1   . VAL A 1 29  ? 42.966 30.945 32.072  1.00 22.84 ? 29  VAL A CG1   1 
ATOM   183  C CG2   . VAL A 1 29  ? 41.986 30.684 34.367  1.00 21.93 ? 29  VAL A CG2   1 
ATOM   184  N N     . LYS A 1 30  ? 46.262 30.139 32.503  1.00 23.98 ? 30  LYS A N     1 
ATOM   185  C CA    . LYS A 1 30  ? 47.342 30.424 31.558  1.00 27.42 ? 30  LYS A CA    1 
ATOM   186  C C     . LYS A 1 30  ? 46.775 30.466 30.138  1.00 26.84 ? 30  LYS A C     1 
ATOM   187  O O     . LYS A 1 30  ? 47.253 31.231 29.284  1.00 25.68 ? 30  LYS A O     1 
ATOM   188  C CB    . LYS A 1 30  ? 48.425 29.346 31.658  1.00 31.22 ? 30  LYS A CB    1 
ATOM   189  C CG    . LYS A 1 30  ? 49.455 29.383 30.537  1.00 38.28 ? 30  LYS A CG    1 
ATOM   190  C CD    . LYS A 1 30  ? 50.646 28.498 30.861  1.00 42.64 ? 30  LYS A CD    1 
ATOM   191  C CE    . LYS A 1 30  ? 51.383 29.007 32.097  1.00 44.11 ? 30  LYS A CE    1 
ATOM   192  N NZ    . LYS A 1 30  ? 51.932 30.381 31.898  1.00 47.65 ? 30  LYS A NZ    1 
ATOM   193  N N     . PHE A 1 31  ? 45.751 29.649 29.895  1.00 24.28 ? 31  PHE A N     1 
ATOM   194  C CA    . PHE A 1 31  ? 45.096 29.573 28.593  1.00 24.91 ? 31  PHE A CA    1 
ATOM   195  C C     . PHE A 1 31  ? 43.670 29.068 28.770  1.00 24.96 ? 31  PHE A C     1 
ATOM   196  O O     . PHE A 1 31  ? 43.387 28.314 29.704  1.00 23.83 ? 31  PHE A O     1 
ATOM   197  C CB    . PHE A 1 31  ? 45.832 28.595 27.668  1.00 26.99 ? 31  PHE A CB    1 
ATOM   198  C CG    . PHE A 1 31  ? 45.052 28.236 26.428  1.00 30.77 ? 31  PHE A CG    1 
ATOM   199  C CD1   . PHE A 1 31  ? 45.052 29.076 25.320  1.00 30.17 ? 31  PHE A CD1   1 
ATOM   200  C CD2   . PHE A 1 31  ? 44.263 27.082 26.396  1.00 30.71 ? 31  PHE A CD2   1 
ATOM   201  C CE1   . PHE A 1 31  ? 44.277 28.780 24.201  1.00 31.33 ? 31  PHE A CE1   1 
ATOM   202  C CE2   . PHE A 1 31  ? 43.483 26.774 25.282  1.00 30.09 ? 31  PHE A CE2   1 
ATOM   203  C CZ    . PHE A 1 31  ? 43.489 27.626 24.182  1.00 31.02 ? 31  PHE A CZ    1 
ATOM   204  N N     . PHE A 1 32  ? 42.780 29.470 27.871  1.00 23.56 ? 32  PHE A N     1 
ATOM   205  C CA    . PHE A 1 32  ? 41.405 29.001 27.939  1.00 22.91 ? 32  PHE A CA    1 
ATOM   206  C C     . PHE A 1 32  ? 40.641 29.208 26.644  1.00 23.83 ? 32  PHE A C     1 
ATOM   207  O O     . PHE A 1 32  ? 40.894 30.144 25.886  1.00 24.07 ? 32  PHE A O     1 
ATOM   208  C CB    . PHE A 1 32  ? 40.654 29.688 29.090  1.00 22.59 ? 32  PHE A CB    1 
ATOM   209  C CG    . PHE A 1 32  ? 40.249 31.110 28.800  1.00 20.72 ? 32  PHE A CG    1 
ATOM   210  C CD1   . PHE A 1 32  ? 38.949 31.415 28.401  1.00 22.23 ? 32  PHE A CD1   1 
ATOM   211  C CD2   . PHE A 1 32  ? 41.171 32.148 28.917  1.00 20.44 ? 32  PHE A CD2   1 
ATOM   212  C CE1   . PHE A 1 32  ? 38.572 32.736 28.125  1.00 21.98 ? 32  PHE A CE1   1 
ATOM   213  C CE2   . PHE A 1 32  ? 40.804 33.471 28.642  1.00 19.93 ? 32  PHE A CE2   1 
ATOM   214  C CZ    . PHE A 1 32  ? 39.508 33.766 28.246  1.00 20.89 ? 32  PHE A CZ    1 
ATOM   215  N N     . LYS A 1 33  ? 39.722 28.290 26.382  1.00 22.56 ? 33  LYS A N     1 
ATOM   216  C CA    . LYS A 1 33  ? 38.851 28.388 25.225  1.00 23.25 ? 33  LYS A CA    1 
ATOM   217  C C     . LYS A 1 33  ? 37.512 28.693 25.871  1.00 23.95 ? 33  LYS A C     1 
ATOM   218  O O     . LYS A 1 33  ? 37.046 27.927 26.710  1.00 25.40 ? 33  LYS A O     1 
ATOM   219  C CB    . LYS A 1 33  ? 38.738 27.059 24.471  1.00 23.55 ? 33  LYS A CB    1 
ATOM   220  C CG    . LYS A 1 33  ? 40.028 26.548 23.869  1.00 21.81 ? 33  LYS A CG    1 
ATOM   221  C CD    . LYS A 1 33  ? 39.741 25.371 22.930  1.00 23.06 ? 33  LYS A CD    1 
ATOM   222  C CE    . LYS A 1 33  ? 40.998 24.919 22.194  1.00 26.61 ? 33  LYS A CE    1 
ATOM   223  N NZ    . LYS A 1 33  ? 40.681 23.857 21.189  1.00 23.80 ? 33  LYS A NZ    1 
ATOM   224  N N     . PRO A 1 34  ? 36.899 29.832 25.528  1.00 25.04 ? 34  PRO A N     1 
ATOM   225  C CA    . PRO A 1 34  ? 35.599 30.181 26.112  1.00 25.31 ? 34  PRO A CA    1 
ATOM   226  C C     . PRO A 1 34  ? 34.589 29.092 25.752  1.00 26.01 ? 34  PRO A C     1 
ATOM   227  O O     . PRO A 1 34  ? 34.767 28.382 24.760  1.00 25.95 ? 34  PRO A O     1 
ATOM   228  C CB    . PRO A 1 34  ? 35.277 31.523 25.464  1.00 26.46 ? 34  PRO A CB    1 
ATOM   229  C CG    . PRO A 1 34  ? 36.040 31.472 24.159  1.00 27.85 ? 34  PRO A CG    1 
ATOM   230  C CD    . PRO A 1 34  ? 37.349 30.875 24.593  1.00 26.76 ? 34  PRO A CD    1 
ATOM   231  N N     . PRO A 1 35  ? 33.532 28.933 26.564  1.00 25.31 ? 35  PRO A N     1 
ATOM   232  C CA    . PRO A 1 35  ? 32.514 27.910 26.302  1.00 27.71 ? 35  PRO A CA    1 
ATOM   233  C C     . PRO A 1 35  ? 32.035 27.910 24.856  1.00 28.90 ? 35  PRO A C     1 
ATOM   234  O O     . PRO A 1 35  ? 31.759 28.967 24.297  1.00 28.56 ? 35  PRO A O     1 
ATOM   235  C CB    . PRO A 1 35  ? 31.394 28.283 27.269  1.00 25.22 ? 35  PRO A CB    1 
ATOM   236  C CG    . PRO A 1 35  ? 32.159 28.855 28.455  1.00 27.73 ? 35  PRO A CG    1 
ATOM   237  C CD    . PRO A 1 35  ? 33.184 29.734 27.754  1.00 25.24 ? 35  PRO A CD    1 
ATOM   238  N N     . TYR A 1 36  ? 31.941 26.723 24.260  1.00 30.72 ? 36  TYR A N     1 
ATOM   239  C CA    . TYR A 1 36  ? 31.466 26.597 22.883  1.00 33.62 ? 36  TYR A CA    1 
ATOM   240  C C     . TYR A 1 36  ? 30.688 25.297 22.712  1.00 35.09 ? 36  TYR A C     1 
ATOM   241  O O     . TYR A 1 36  ? 30.993 24.293 23.356  1.00 33.77 ? 36  TYR A O     1 
ATOM   242  C CB    . TYR A 1 36  ? 32.640 26.660 21.893  1.00 35.53 ? 36  TYR A CB    1 
ATOM   243  C CG    . TYR A 1 36  ? 33.660 25.540 22.013  1.00 36.11 ? 36  TYR A CG    1 
ATOM   244  C CD1   . TYR A 1 36  ? 33.511 24.345 21.302  1.00 37.24 ? 36  TYR A CD1   1 
ATOM   245  C CD2   . TYR A 1 36  ? 34.787 25.687 22.819  1.00 37.08 ? 36  TYR A CD2   1 
ATOM   246  C CE1   . TYR A 1 36  ? 34.469 23.328 21.390  1.00 37.31 ? 36  TYR A CE1   1 
ATOM   247  C CE2   . TYR A 1 36  ? 35.745 24.678 22.917  1.00 37.27 ? 36  TYR A CE2   1 
ATOM   248  C CZ    . TYR A 1 36  ? 35.584 23.504 22.200  1.00 38.04 ? 36  TYR A CZ    1 
ATOM   249  O OH    . TYR A 1 36  ? 36.544 22.516 22.299  1.00 38.22 ? 36  TYR A OH    1 
ATOM   250  N N     . LEU A 1 37  ? 29.674 25.326 21.851  1.00 36.48 ? 37  LEU A N     1 
ATOM   251  C CA    . LEU A 1 37  ? 28.844 24.153 21.601  1.00 39.43 ? 37  LEU A CA    1 
ATOM   252  C C     . LEU A 1 37  ? 29.652 23.137 20.803  1.00 39.78 ? 37  LEU A C     1 
ATOM   253  O O     . LEU A 1 37  ? 29.956 23.369 19.632  1.00 40.95 ? 37  LEU A O     1 
ATOM   254  C CB    . LEU A 1 37  ? 27.591 24.569 20.818  1.00 40.62 ? 37  LEU A CB    1 
ATOM   255  C CG    . LEU A 1 37  ? 26.398 23.612 20.723  1.00 42.61 ? 37  LEU A CG    1 
ATOM   256  C CD1   . LEU A 1 37  ? 25.878 23.287 22.120  1.00 41.71 ? 37  LEU A CD1   1 
ATOM   257  C CD2   . LEU A 1 37  ? 25.294 24.261 19.894  1.00 42.18 ? 37  LEU A CD2   1 
ATOM   258  N N     . SER A 1 38  ? 30.010 22.020 21.432  1.00 39.59 ? 38  SER A N     1 
ATOM   259  C CA    . SER A 1 38  ? 30.787 20.996 20.740  1.00 40.70 ? 38  SER A CA    1 
ATOM   260  C C     . SER A 1 38  ? 29.892 20.196 19.802  1.00 41.49 ? 38  SER A C     1 
ATOM   261  O O     . SER A 1 38  ? 28.691 20.452 19.713  1.00 40.87 ? 38  SER A O     1 
ATOM   262  C CB    . SER A 1 38  ? 31.451 20.048 21.742  1.00 39.57 ? 38  SER A CB    1 
ATOM   263  O OG    . SER A 1 38  ? 30.497 19.205 22.366  1.00 41.09 ? 38  SER A OG    1 
ATOM   264  N N     . LYS A 1 39  ? 30.481 19.233 19.100  1.00 44.22 ? 39  LYS A N     1 
ATOM   265  C CA    . LYS A 1 39  ? 29.722 18.392 18.179  1.00 46.31 ? 39  LYS A CA    1 
ATOM   266  C C     . LYS A 1 39  ? 28.928 17.349 18.963  1.00 47.13 ? 39  LYS A C     1 
ATOM   267  O O     . LYS A 1 39  ? 28.252 16.500 18.378  1.00 47.92 ? 39  LYS A O     1 
ATOM   268  C CB    . LYS A 1 39  ? 30.657 17.685 17.192  1.00 47.73 ? 39  LYS A CB    1 
ATOM   269  C CG    . LYS A 1 39  ? 31.165 18.556 16.040  1.00 49.81 ? 39  LYS A CG    1 
ATOM   270  C CD    . LYS A 1 39  ? 32.114 19.645 16.511  1.00 52.20 ? 39  LYS A CD    1 
ATOM   271  C CE    . LYS A 1 39  ? 32.541 20.551 15.357  1.00 53.77 ? 39  LYS A CE    1 
ATOM   272  N NZ    . LYS A 1 39  ? 33.244 19.805 14.273  1.00 53.98 ? 39  LYS A NZ    1 
ATOM   273  N N     . GLY A 1 40  ? 29.013 17.428 20.289  1.00 46.58 ? 40  GLY A N     1 
ATOM   274  C CA    . GLY A 1 40  ? 28.308 16.487 21.139  1.00 45.61 ? 40  GLY A CA    1 
ATOM   275  C C     . GLY A 1 40  ? 27.085 17.076 21.811  1.00 45.57 ? 40  GLY A C     1 
ATOM   276  O O     . GLY A 1 40  ? 26.409 17.936 21.246  1.00 45.55 ? 40  GLY A O     1 
ATOM   277  N N     . THR A 1 41  ? 26.800 16.615 23.024  1.00 45.72 ? 41  THR A N     1 
ATOM   278  C CA    . THR A 1 41  ? 25.640 17.089 23.766  1.00 45.92 ? 41  THR A CA    1 
ATOM   279  C C     . THR A 1 41  ? 25.876 18.390 24.528  1.00 45.12 ? 41  THR A C     1 
ATOM   280  O O     . THR A 1 41  ? 25.053 19.307 24.481  1.00 45.46 ? 41  THR A O     1 
ATOM   281  C CB    . THR A 1 41  ? 25.162 16.029 24.791  1.00 47.07 ? 41  THR A CB    1 
ATOM   282  O OG1   . THR A 1 41  ? 23.952 16.478 25.413  1.00 50.03 ? 41  THR A OG1   1 
ATOM   283  C CG2   . THR A 1 41  ? 26.207 15.816 25.871  1.00 47.97 ? 41  THR A CG2   1 
ATOM   284  N N     . ASP A 1 42  ? 27.009 18.466 25.219  1.00 44.78 ? 42  ASP A N     1 
ATOM   285  C CA    . ASP A 1 42  ? 27.335 19.619 26.051  1.00 43.02 ? 42  ASP A CA    1 
ATOM   286  C C     . ASP A 1 42  ? 28.192 20.709 25.417  1.00 40.87 ? 42  ASP A C     1 
ATOM   287  O O     . ASP A 1 42  ? 28.791 20.527 24.355  1.00 39.74 ? 42  ASP A O     1 
ATOM   288  C CB    . ASP A 1 42  ? 28.049 19.140 27.323  1.00 44.78 ? 42  ASP A CB    1 
ATOM   289  C CG    . ASP A 1 42  ? 27.446 17.872 27.897  1.00 45.51 ? 42  ASP A CG    1 
ATOM   290  O OD1   . ASP A 1 42  ? 26.232 17.867 28.198  1.00 46.88 ? 42  ASP A OD1   1 
ATOM   291  O OD2   . ASP A 1 42  ? 28.195 16.881 28.047  1.00 44.95 ? 42  ASP A OD2   1 
ATOM   292  N N     . TYR A 1 43  ? 28.218 21.857 26.088  1.00 37.92 ? 43  TYR A N     1 
ATOM   293  C CA    . TYR A 1 43  ? 29.049 22.979 25.675  1.00 35.67 ? 43  TYR A CA    1 
ATOM   294  C C     . TYR A 1 43  ? 30.411 22.556 26.226  1.00 32.94 ? 43  TYR A C     1 
ATOM   295  O O     . TYR A 1 43  ? 30.474 21.767 27.176  1.00 33.45 ? 43  TYR A O     1 
ATOM   296  C CB    . TYR A 1 43  ? 28.599 24.274 26.361  1.00 35.77 ? 43  TYR A CB    1 
ATOM   297  C CG    . TYR A 1 43  ? 27.381 24.939 25.750  1.00 39.37 ? 43  TYR A CG    1 
ATOM   298  C CD1   . TYR A 1 43  ? 27.506 25.817 24.672  1.00 40.10 ? 43  TYR A CD1   1 
ATOM   299  C CD2   . TYR A 1 43  ? 26.101 24.694 26.254  1.00 39.67 ? 43  TYR A CD2   1 
ATOM   300  C CE1   . TYR A 1 43  ? 26.386 26.436 24.112  1.00 41.99 ? 43  TYR A CE1   1 
ATOM   301  C CE2   . TYR A 1 43  ? 24.980 25.306 25.702  1.00 41.78 ? 43  TYR A CE2   1 
ATOM   302  C CZ    . TYR A 1 43  ? 25.128 26.175 24.633  1.00 42.52 ? 43  TYR A CZ    1 
ATOM   303  O OH    . TYR A 1 43  ? 24.014 26.780 24.090  1.00 45.25 ? 43  TYR A OH    1 
ATOM   304  N N     . CYS A 1 44  ? 31.494 23.065 25.653  1.00 30.50 ? 44  CYS A N     1 
ATOM   305  C CA    . CYS A 1 44  ? 32.825 22.698 26.122  1.00 29.75 ? 44  CYS A CA    1 
ATOM   306  C C     . CYS A 1 44  ? 33.700 23.918 26.371  1.00 29.53 ? 44  CYS A C     1 
ATOM   307  O O     . CYS A 1 44  ? 33.546 24.951 25.725  1.00 29.78 ? 44  CYS A O     1 
ATOM   308  C CB    . CYS A 1 44  ? 33.517 21.784 25.095  1.00 29.78 ? 44  CYS A CB    1 
ATOM   309  S SG    . CYS A 1 44  ? 35.254 21.370 25.471  1.00 34.80 ? 44  CYS A SG    1 
ATOM   310  N N     . SER A 1 45  ? 34.605 23.791 27.332  1.00 28.56 ? 45  SER A N     1 
ATOM   311  C CA    . SER A 1 45  ? 35.549 24.852 27.649  1.00 27.57 ? 45  SER A CA    1 
ATOM   312  C C     . SER A 1 45  ? 36.829 24.182 28.103  1.00 26.62 ? 45  SER A C     1 
ATOM   313  O O     . SER A 1 45  ? 36.799 23.247 28.903  1.00 28.07 ? 45  SER A O     1 
ATOM   314  C CB    . SER A 1 45  ? 35.026 25.763 28.759  1.00 28.32 ? 45  SER A CB    1 
ATOM   315  O OG    . SER A 1 45  ? 35.977 26.771 29.050  1.00 25.22 ? 45  SER A OG    1 
ATOM   316  N N     . VAL A 1 46  ? 37.955 24.645 27.571  1.00 23.94 ? 46  VAL A N     1 
ATOM   317  C CA    . VAL A 1 46  ? 39.250 24.090 27.928  1.00 24.14 ? 46  VAL A CA    1 
ATOM   318  C C     . VAL A 1 46  ? 39.976 25.149 28.725  1.00 23.51 ? 46  VAL A C     1 
ATOM   319  O O     . VAL A 1 46  ? 39.991 26.321 28.342  1.00 22.79 ? 46  VAL A O     1 
ATOM   320  C CB    . VAL A 1 46  ? 40.087 23.745 26.680  1.00 25.04 ? 46  VAL A CB    1 
ATOM   321  C CG1   . VAL A 1 46  ? 41.478 23.313 27.099  1.00 25.81 ? 46  VAL A CG1   1 
ATOM   322  C CG2   . VAL A 1 46  ? 39.410 22.643 25.890  1.00 26.44 ? 46  VAL A CG2   1 
ATOM   323  N N     . VAL A 1 47  ? 40.565 24.739 29.840  1.00 22.54 ? 47  VAL A N     1 
ATOM   324  C CA    . VAL A 1 47  ? 41.260 25.675 30.699  1.00 22.88 ? 47  VAL A CA    1 
ATOM   325  C C     . VAL A 1 47  ? 42.554 25.075 31.192  1.00 24.51 ? 47  VAL A C     1 
ATOM   326  O O     . VAL A 1 47  ? 42.560 23.989 31.758  1.00 25.18 ? 47  VAL A O     1 
ATOM   327  C CB    . VAL A 1 47  ? 40.406 26.035 31.947  1.00 22.26 ? 47  VAL A CB    1 
ATOM   328  C CG1   . VAL A 1 47  ? 41.092 27.131 32.762  1.00 21.65 ? 47  VAL A CG1   1 
ATOM   329  C CG2   . VAL A 1 47  ? 39.019 26.484 31.526  1.00 19.62 ? 47  VAL A CG2   1 
ATOM   330  N N     . THR A 1 48  ? 43.661 25.774 30.976  1.00 24.14 ? 48  THR A N     1 
ATOM   331  C CA    . THR A 1 48  ? 44.935 25.280 31.473  1.00 24.46 ? 48  THR A CA    1 
ATOM   332  C C     . THR A 1 48  ? 45.297 26.186 32.637  1.00 25.17 ? 48  THR A C     1 
ATOM   333  O O     . THR A 1 48  ? 45.396 27.406 32.470  1.00 24.36 ? 48  THR A O     1 
ATOM   334  C CB    . THR A 1 48  ? 46.043 25.330 30.395  1.00 25.56 ? 48  THR A CB    1 
ATOM   335  O OG1   . THR A 1 48  ? 45.725 24.408 29.348  1.00 28.70 ? 48  THR A OG1   1 
ATOM   336  C CG2   . THR A 1 48  ? 47.384 24.938 30.991  1.00 26.38 ? 48  THR A CG2   1 
ATOM   337  N N     . ILE A 1 49  ? 45.467 25.592 33.817  1.00 24.19 ? 49  ILE A N     1 
ATOM   338  C CA    . ILE A 1 49  ? 45.802 26.356 35.010  1.00 24.72 ? 49  ILE A CA    1 
ATOM   339  C C     . ILE A 1 49  ? 47.176 25.978 35.537  1.00 25.55 ? 49  ILE A C     1 
ATOM   340  O O     . ILE A 1 49  ? 47.714 24.927 35.201  1.00 27.60 ? 49  ILE A O     1 
ATOM   341  C CB    . ILE A 1 49  ? 44.775 26.125 36.151  1.00 24.80 ? 49  ILE A CB    1 
ATOM   342  C CG1   . ILE A 1 49  ? 44.702 24.637 36.504  1.00 26.99 ? 49  ILE A CG1   1 
ATOM   343  C CG2   . ILE A 1 49  ? 43.402 26.649 35.734  1.00 24.46 ? 49  ILE A CG2   1 
ATOM   344  C CD1   . ILE A 1 49  ? 43.821 24.339 37.715  1.00 26.60 ? 49  ILE A CD1   1 
ATOM   345  N N     . VAL A 1 50  ? 47.727 26.852 36.371  1.00 27.20 ? 50  VAL A N     1 
ATOM   346  C CA    . VAL A 1 50  ? 49.027 26.638 36.982  1.00 28.87 ? 50  VAL A CA    1 
ATOM   347  C C     . VAL A 1 50  ? 48.980 27.225 38.394  1.00 29.59 ? 50  VAL A C     1 
ATOM   348  O O     . VAL A 1 50  ? 48.143 28.089 38.685  1.00 30.19 ? 50  VAL A O     1 
ATOM   349  C CB    . VAL A 1 50  ? 50.151 27.313 36.140  1.00 30.34 ? 50  VAL A CB    1 
ATOM   350  C CG1   . VAL A 1 50  ? 49.860 28.798 35.957  1.00 31.05 ? 50  VAL A CG1   1 
ATOM   351  C CG2   . VAL A 1 50  ? 51.507 27.110 36.812  1.00 31.13 ? 50  VAL A CG2   1 
ATOM   352  N N     . ASP A 1 51  ? 49.846 26.741 39.280  1.00 29.90 ? 51  ASP A N     1 
ATOM   353  C CA    . ASP A 1 51  ? 49.883 27.248 40.645  1.00 32.15 ? 51  ASP A CA    1 
ATOM   354  C C     . ASP A 1 51  ? 51.332 27.429 41.098  1.00 33.66 ? 51  ASP A C     1 
ATOM   355  O O     . ASP A 1 51  ? 52.244 27.411 40.270  1.00 32.96 ? 51  ASP A O     1 
ATOM   356  C CB    . ASP A 1 51  ? 49.114 26.305 41.585  1.00 33.21 ? 51  ASP A CB    1 
ATOM   357  C CG    . ASP A 1 51  ? 49.815 24.979 41.801  1.00 34.60 ? 51  ASP A CG    1 
ATOM   358  O OD1   . ASP A 1 51  ? 50.707 24.616 41.003  1.00 34.92 ? 51  ASP A OD1   1 
ATOM   359  O OD2   . ASP A 1 51  ? 49.457 24.287 42.778  1.00 37.63 ? 51  ASP A OD2   1 
ATOM   360  N N     . GLN A 1 52  ? 51.543 27.611 42.399  1.00 36.66 ? 52  GLN A N     1 
ATOM   361  C CA    . GLN A 1 52  ? 52.887 27.814 42.939  1.00 39.48 ? 52  GLN A CA    1 
ATOM   362  C C     . GLN A 1 52  ? 53.871 26.689 42.649  1.00 41.43 ? 52  GLN A C     1 
ATOM   363  O O     . GLN A 1 52  ? 55.082 26.915 42.656  1.00 41.95 ? 52  GLN A O     1 
ATOM   364  C CB    . GLN A 1 52  ? 52.838 28.038 44.455  1.00 40.16 ? 52  GLN A CB    1 
ATOM   365  C CG    . GLN A 1 52  ? 52.161 29.331 44.873  1.00 41.46 ? 52  GLN A CG    1 
ATOM   366  C CD    . GLN A 1 52  ? 50.679 29.154 45.098  1.00 41.28 ? 52  GLN A CD    1 
ATOM   367  O OE1   . GLN A 1 52  ? 50.007 28.456 44.340  1.00 42.58 ? 52  GLN A OE1   1 
ATOM   368  N NE2   . GLN A 1 52  ? 50.157 29.788 46.142  1.00 42.82 ? 52  GLN A NE2   1 
ATOM   369  N N     . THR A 1 53  ? 53.361 25.482 42.410  1.00 42.21 ? 53  THR A N     1 
ATOM   370  C CA    . THR A 1 53  ? 54.222 24.333 42.125  1.00 43.76 ? 53  THR A CA    1 
ATOM   371  C C     . THR A 1 53  ? 54.775 24.464 40.715  1.00 44.70 ? 53  THR A C     1 
ATOM   372  O O     . THR A 1 53  ? 55.619 23.677 40.282  1.00 45.63 ? 53  THR A O     1 
ATOM   373  C CB    . THR A 1 53  ? 53.448 23.004 42.217  1.00 43.47 ? 53  THR A CB    1 
ATOM   374  O OG1   . THR A 1 53  ? 52.671 22.820 41.027  1.00 43.91 ? 53  THR A OG1   1 
ATOM   375  C CG2   . THR A 1 53  ? 52.524 23.012 43.422  1.00 43.99 ? 53  THR A CG2   1 
ATOM   376  N N     . ASN A 1 54  ? 54.275 25.465 40.002  1.00 45.79 ? 54  ASN A N     1 
ATOM   377  C CA    . ASN A 1 54  ? 54.692 25.740 38.636  1.00 45.71 ? 54  ASN A CA    1 
ATOM   378  C C     . ASN A 1 54  ? 54.352 24.592 37.682  1.00 45.55 ? 54  ASN A C     1 
ATOM   379  O O     . ASN A 1 54  ? 54.924 24.486 36.595  1.00 45.81 ? 54  ASN A O     1 
ATOM   380  C CB    . ASN A 1 54  ? 56.193 26.034 38.595  1.00 48.14 ? 54  ASN A CB    1 
ATOM   381  C CG    . ASN A 1 54  ? 56.597 26.806 37.356  1.00 49.73 ? 54  ASN A CG    1 
ATOM   382  O OD1   . ASN A 1 54  ? 56.077 27.891 37.093  1.00 51.28 ? 54  ASN A OD1   1 
ATOM   383  N ND2   . ASN A 1 54  ? 57.529 26.252 36.588  1.00 50.48 ? 54  ASN A ND2   1 
ATOM   384  N N     . VAL A 1 55  ? 53.422 23.735 38.091  1.00 43.99 ? 55  VAL A N     1 
ATOM   385  C CA    . VAL A 1 55  ? 52.995 22.618 37.254  1.00 42.11 ? 55  VAL A CA    1 
ATOM   386  C C     . VAL A 1 55  ? 51.704 23.024 36.544  1.00 40.71 ? 55  VAL A C     1 
ATOM   387  O O     . VAL A 1 55  ? 50.797 23.584 37.165  1.00 39.54 ? 55  VAL A O     1 
ATOM   388  C CB    . VAL A 1 55  ? 52.724 21.347 38.090  1.00 43.92 ? 55  VAL A CB    1 
ATOM   389  C CG1   . VAL A 1 55  ? 52.277 20.218 37.181  1.00 43.32 ? 55  VAL A CG1   1 
ATOM   390  C CG2   . VAL A 1 55  ? 53.978 20.940 38.852  1.00 43.23 ? 55  VAL A CG2   1 
ATOM   391  N N     . LYS A 1 56  ? 51.624 22.741 35.248  1.00 38.89 ? 56  LYS A N     1 
ATOM   392  C CA    . LYS A 1 56  ? 50.449 23.094 34.454  1.00 38.42 ? 56  LYS A CA    1 
ATOM   393  C C     . LYS A 1 56  ? 49.459 21.931 34.387  1.00 36.83 ? 56  LYS A C     1 
ATOM   394  O O     . LYS A 1 56  ? 49.856 20.767 34.333  1.00 36.32 ? 56  LYS A O     1 
ATOM   395  C CB    . LYS A 1 56  ? 50.861 23.460 33.020  1.00 40.59 ? 56  LYS A CB    1 
ATOM   396  C CG    . LYS A 1 56  ? 52.165 24.244 32.884  1.00 45.09 ? 56  LYS A CG    1 
ATOM   397  C CD    . LYS A 1 56  ? 52.032 25.675 33.359  1.00 46.72 ? 56  LYS A CD    1 
ATOM   398  C CE    . LYS A 1 56  ? 53.355 26.421 33.225  1.00 49.71 ? 56  LYS A CE    1 
ATOM   399  N NZ    . LYS A 1 56  ? 54.441 25.820 34.057  1.00 51.30 ? 56  LYS A NZ    1 
ATOM   400  N N     . LEU A 1 57  ? 48.170 22.252 34.383  1.00 33.81 ? 57  LEU A N     1 
ATOM   401  C CA    . LEU A 1 57  ? 47.139 21.226 34.293  1.00 30.79 ? 57  LEU A CA    1 
ATOM   402  C C     . LEU A 1 57  ? 46.074 21.659 33.296  1.00 30.10 ? 57  LEU A C     1 
ATOM   403  O O     . LEU A 1 57  ? 45.463 22.718 33.442  1.00 29.09 ? 57  LEU A O     1 
ATOM   404  C CB    . LEU A 1 57  ? 46.484 20.974 35.653  1.00 30.22 ? 57  LEU A CB    1 
ATOM   405  C CG    . LEU A 1 57  ? 45.322 19.966 35.616  1.00 31.84 ? 57  LEU A CG    1 
ATOM   406  C CD1   . LEU A 1 57  ? 45.841 18.557 35.335  1.00 31.78 ? 57  LEU A CD1   1 
ATOM   407  C CD2   . LEU A 1 57  ? 44.586 19.995 36.943  1.00 33.13 ? 57  LEU A CD2   1 
ATOM   408  N N     . THR A 1 58  ? 45.867 20.846 32.270  1.00 28.19 ? 58  THR A N     1 
ATOM   409  C CA    . THR A 1 58  ? 44.862 21.151 31.268  1.00 29.25 ? 58  THR A CA    1 
ATOM   410  C C     . THR A 1 58  ? 43.550 20.471 31.648  1.00 29.43 ? 58  THR A C     1 
ATOM   411  O O     . THR A 1 58  ? 43.509 19.260 31.893  1.00 29.14 ? 58  THR A O     1 
ATOM   412  C CB    . THR A 1 58  ? 45.328 20.704 29.877  1.00 30.83 ? 58  THR A CB    1 
ATOM   413  O OG1   . THR A 1 58  ? 46.432 21.531 29.474  1.00 30.73 ? 58  THR A OG1   1 
ATOM   414  C CG2   . THR A 1 58  ? 44.206 20.834 28.863  1.00 31.04 ? 58  THR A CG2   1 
ATOM   415  N N     . CYS A 1 59  ? 42.488 21.270 31.705  1.00 28.88 ? 59  CYS A N     1 
ATOM   416  C CA    . CYS A 1 59  ? 41.172 20.779 32.092  1.00 29.77 ? 59  CYS A CA    1 
ATOM   417  C C     . CYS A 1 59  ? 40.146 20.855 30.969  1.00 30.49 ? 59  CYS A C     1 
ATOM   418  O O     . CYS A 1 59  ? 39.999 21.888 30.309  1.00 29.31 ? 59  CYS A O     1 
ATOM   419  C CB    . CYS A 1 59  ? 40.664 21.580 33.296  1.00 27.58 ? 59  CYS A CB    1 
ATOM   420  S SG    . CYS A 1 59  ? 41.815 21.679 34.696  1.00 28.01 ? 59  CYS A SG    1 
ATOM   421  N N     . LEU A 1 60  ? 39.432 19.751 30.763  1.00 30.26 ? 60  LEU A N     1 
ATOM   422  C CA    . LEU A 1 60  ? 38.401 19.674 29.741  1.00 30.45 ? 60  LEU A CA    1 
ATOM   423  C C     . LEU A 1 60  ? 37.086 19.688 30.503  1.00 29.97 ? 60  LEU A C     1 
ATOM   424  O O     . LEU A 1 60  ? 36.771 18.741 31.229  1.00 29.56 ? 60  LEU A O     1 
ATOM   425  C CB    . LEU A 1 60  ? 38.534 18.373 28.956  1.00 32.46 ? 60  LEU A CB    1 
ATOM   426  C CG    . LEU A 1 60  ? 39.971 17.985 28.597  1.00 37.01 ? 60  LEU A CG    1 
ATOM   427  C CD1   . LEU A 1 60  ? 39.949 16.719 27.754  1.00 37.88 ? 60  LEU A CD1   1 
ATOM   428  C CD2   . LEU A 1 60  ? 40.654 19.122 27.841  1.00 36.91 ? 60  LEU A CD2   1 
ATOM   429  N N     . LEU A 1 61  ? 36.323 20.761 30.335  1.00 28.77 ? 61  LEU A N     1 
ATOM   430  C CA    . LEU A 1 61  ? 35.067 20.927 31.053  1.00 28.91 ? 61  LEU A CA    1 
ATOM   431  C C     . LEU A 1 61  ? 33.839 20.890 30.154  1.00 28.93 ? 61  LEU A C     1 
ATOM   432  O O     . LEU A 1 61  ? 33.752 21.644 29.189  1.00 27.95 ? 61  LEU A O     1 
ATOM   433  C CB    . LEU A 1 61  ? 35.109 22.249 31.809  1.00 27.42 ? 61  LEU A CB    1 
ATOM   434  C CG    . LEU A 1 61  ? 36.427 22.484 32.553  1.00 29.33 ? 61  LEU A CG    1 
ATOM   435  C CD1   . LEU A 1 61  ? 36.495 23.911 33.062  1.00 29.91 ? 61  LEU A CD1   1 
ATOM   436  C CD2   . LEU A 1 61  ? 36.552 21.496 33.702  1.00 30.04 ? 61  LEU A CD2   1 
ATOM   437  N N     . PHE A 1 62  ? 32.882 20.026 30.496  1.00 30.50 ? 62  PHE A N     1 
ATOM   438  C CA    . PHE A 1 62  ? 31.651 19.879 29.722  1.00 30.77 ? 62  PHE A CA    1 
ATOM   439  C C     . PHE A 1 62  ? 30.421 20.158 30.570  1.00 31.89 ? 62  PHE A C     1 
ATOM   440  O O     . PHE A 1 62  ? 30.396 19.857 31.763  1.00 32.77 ? 62  PHE A O     1 
ATOM   441  C CB    . PHE A 1 62  ? 31.539 18.457 29.162  1.00 33.52 ? 62  PHE A CB    1 
ATOM   442  C CG    . PHE A 1 62  ? 32.655 18.079 28.247  1.00 35.62 ? 62  PHE A CG    1 
ATOM   443  C CD1   . PHE A 1 62  ? 32.689 18.547 26.934  1.00 35.78 ? 62  PHE A CD1   1 
ATOM   444  C CD2   . PHE A 1 62  ? 33.689 17.275 28.700  1.00 35.57 ? 62  PHE A CD2   1 
ATOM   445  C CE1   . PHE A 1 62  ? 33.745 18.216 26.090  1.00 37.90 ? 62  PHE A CE1   1 
ATOM   446  C CE2   . PHE A 1 62  ? 34.750 16.938 27.863  1.00 38.00 ? 62  PHE A CE2   1 
ATOM   447  C CZ    . PHE A 1 62  ? 34.775 17.410 26.557  1.00 37.81 ? 62  PHE A CZ    1 
ATOM   448  N N     . SER A 1 63  ? 29.395 20.725 29.945  1.00 32.86 ? 63  SER A N     1 
ATOM   449  C CA    . SER A 1 63  ? 28.147 21.019 30.640  1.00 34.07 ? 63  SER A CA    1 
ATOM   450  C C     . SER A 1 63  ? 27.002 21.297 29.686  1.00 33.64 ? 63  SER A C     1 
ATOM   451  O O     . SER A 1 63  ? 27.202 21.806 28.585  1.00 32.76 ? 63  SER A O     1 
ATOM   452  C CB    . SER A 1 63  ? 28.305 22.217 31.571  1.00 33.91 ? 63  SER A CB    1 
ATOM   453  O OG    . SER A 1 63  ? 27.044 22.608 32.091  1.00 33.72 ? 63  SER A OG    1 
ATOM   454  N N     . GLY A 1 64  ? 25.794 20.968 30.132  1.00 34.11 ? 64  GLY A N     1 
ATOM   455  C CA    . GLY A 1 64  ? 24.620 21.196 29.315  1.00 35.94 ? 64  GLY A CA    1 
ATOM   456  C C     . GLY A 1 64  ? 24.252 22.666 29.303  1.00 37.39 ? 64  GLY A C     1 
ATOM   457  O O     . GLY A 1 64  ? 23.593 23.134 28.377  1.00 38.14 ? 64  GLY A O     1 
ATOM   458  N N     . ASN A 1 65  ? 24.672 23.395 30.333  1.00 36.89 ? 65  ASN A N     1 
ATOM   459  C CA    . ASN A 1 65  ? 24.387 24.823 30.424  1.00 37.94 ? 65  ASN A CA    1 
ATOM   460  C C     . ASN A 1 65  ? 25.649 25.661 30.224  1.00 36.15 ? 65  ASN A C     1 
ATOM   461  O O     . ASN A 1 65  ? 26.660 25.449 30.893  1.00 35.26 ? 65  ASN A O     1 
ATOM   462  C CB    . ASN A 1 65  ? 23.764 25.162 31.781  1.00 41.24 ? 65  ASN A CB    1 
ATOM   463  C CG    . ASN A 1 65  ? 22.359 24.610 31.930  1.00 45.79 ? 65  ASN A CG    1 
ATOM   464  O OD1   . ASN A 1 65  ? 22.159 23.396 31.999  1.00 47.97 ? 65  ASN A OD1   1 
ATOM   465  N ND2   . ASN A 1 65  ? 21.374 25.504 31.977  1.00 47.14 ? 65  ASN A ND2   1 
ATOM   466  N N     . TYR A 1 66  ? 25.569 26.618 29.304  1.00 34.54 ? 66  TYR A N     1 
ATOM   467  C CA    . TYR A 1 66  ? 26.685 27.508 28.999  1.00 34.12 ? 66  TYR A CA    1 
ATOM   468  C C     . TYR A 1 66  ? 27.264 28.142 30.266  1.00 35.00 ? 66  TYR A C     1 
ATOM   469  O O     . TYR A 1 66  ? 28.482 28.139 30.471  1.00 33.02 ? 66  TYR A O     1 
ATOM   470  C CB    . TYR A 1 66  ? 26.213 28.610 28.045  1.00 33.48 ? 66  TYR A CB    1 
ATOM   471  C CG    . TYR A 1 66  ? 27.265 29.643 27.684  1.00 31.74 ? 66  TYR A CG    1 
ATOM   472  C CD1   . TYR A 1 66  ? 28.037 29.517 26.526  1.00 31.80 ? 66  TYR A CD1   1 
ATOM   473  C CD2   . TYR A 1 66  ? 27.492 30.747 28.506  1.00 31.86 ? 66  TYR A CD2   1 
ATOM   474  C CE1   . TYR A 1 66  ? 29.011 30.471 26.195  1.00 29.10 ? 66  TYR A CE1   1 
ATOM   475  C CE2   . TYR A 1 66  ? 28.461 31.701 28.189  1.00 32.00 ? 66  TYR A CE2   1 
ATOM   476  C CZ    . TYR A 1 66  ? 29.216 31.559 27.034  1.00 31.08 ? 66  TYR A CZ    1 
ATOM   477  O OH    . TYR A 1 66  ? 30.175 32.509 26.732  1.00 30.07 ? 66  TYR A OH    1 
ATOM   478  N N     . GLU A 1 67  ? 26.388 28.666 31.122  1.00 34.41 ? 67  GLU A N     1 
ATOM   479  C CA    . GLU A 1 67  ? 26.827 29.336 32.343  1.00 34.67 ? 67  GLU A CA    1 
ATOM   480  C C     . GLU A 1 67  ? 27.436 28.470 33.432  1.00 32.74 ? 67  GLU A C     1 
ATOM   481  O O     . GLU A 1 67  ? 28.097 28.994 34.327  1.00 31.98 ? 67  GLU A O     1 
ATOM   482  C CB    . GLU A 1 67  ? 25.688 30.171 32.940  1.00 37.79 ? 67  GLU A CB    1 
ATOM   483  C CG    . GLU A 1 67  ? 24.334 29.482 32.972  1.00 42.49 ? 67  GLU A CG    1 
ATOM   484  C CD    . GLU A 1 67  ? 23.724 29.345 31.588  1.00 44.53 ? 67  GLU A CD    1 
ATOM   485  O OE1   . GLU A 1 67  ? 23.484 30.383 30.932  1.00 48.08 ? 67  GLU A OE1   1 
ATOM   486  O OE2   . GLU A 1 67  ? 23.492 28.202 31.148  1.00 47.44 ? 67  GLU A OE2   1 
ATOM   487  N N     . ALA A 1 68  ? 27.231 27.158 33.366  1.00 31.82 ? 68  ALA A N     1 
ATOM   488  C CA    . ALA A 1 68  ? 27.786 26.260 34.380  1.00 32.09 ? 68  ALA A CA    1 
ATOM   489  C C     . ALA A 1 68  ? 29.306 26.133 34.250  1.00 32.10 ? 68  ALA A C     1 
ATOM   490  O O     . ALA A 1 68  ? 29.972 25.615 35.150  1.00 32.89 ? 68  ALA A O     1 
ATOM   491  C CB    . ALA A 1 68  ? 27.132 24.870 34.282  1.00 31.10 ? 68  ALA A CB    1 
ATOM   492  N N     . LEU A 1 69  ? 29.848 26.607 33.134  1.00 28.28 ? 69  LEU A N     1 
ATOM   493  C CA    . LEU A 1 69  ? 31.286 26.537 32.899  1.00 25.78 ? 69  LEU A CA    1 
ATOM   494  C C     . LEU A 1 69  ? 31.969 27.763 33.505  1.00 23.26 ? 69  LEU A C     1 
ATOM   495  O O     . LEU A 1 69  ? 31.335 28.794 33.714  1.00 24.59 ? 69  LEU A O     1 
ATOM   496  C CB    . LEU A 1 69  ? 31.544 26.426 31.394  1.00 26.28 ? 69  LEU A CB    1 
ATOM   497  C CG    . LEU A 1 69  ? 31.040 25.087 30.845  1.00 27.07 ? 69  LEU A CG    1 
ATOM   498  C CD1   . LEU A 1 69  ? 31.083 25.067 29.325  1.00 28.62 ? 69  LEU A CD1   1 
ATOM   499  C CD2   . LEU A 1 69  ? 31.896 23.976 31.430  1.00 28.29 ? 69  LEU A CD2   1 
ATOM   500  N N     . PRO A 1 70  ? 33.272 27.661 33.811  1.00 22.73 ? 70  PRO A N     1 
ATOM   501  C CA    . PRO A 1 70  ? 34.015 28.780 34.410  1.00 23.28 ? 70  PRO A CA    1 
ATOM   502  C C     . PRO A 1 70  ? 33.831 30.091 33.681  1.00 21.28 ? 70  PRO A C     1 
ATOM   503  O O     . PRO A 1 70  ? 33.983 30.151 32.462  1.00 22.69 ? 70  PRO A O     1 
ATOM   504  C CB    . PRO A 1 70  ? 35.460 28.291 34.376  1.00 23.87 ? 70  PRO A CB    1 
ATOM   505  C CG    . PRO A 1 70  ? 35.298 26.779 34.492  1.00 23.57 ? 70  PRO A CG    1 
ATOM   506  C CD    . PRO A 1 70  ? 34.163 26.519 33.543  1.00 21.96 ? 70  PRO A CD    1 
ATOM   507  N N     . ILE A 1 71  ? 33.503 31.132 34.439  1.00 21.34 ? 71  ILE A N     1 
ATOM   508  C CA    . ILE A 1 71  ? 33.290 32.461 33.886  1.00 21.38 ? 71  ILE A CA    1 
ATOM   509  C C     . ILE A 1 71  ? 34.633 33.184 33.840  1.00 21.53 ? 71  ILE A C     1 
ATOM   510  O O     . ILE A 1 71  ? 34.924 34.049 34.672  1.00 23.02 ? 71  ILE A O     1 
ATOM   511  C CB    . ILE A 1 71  ? 32.292 33.249 34.762  1.00 22.12 ? 71  ILE A CB    1 
ATOM   512  C CG1   . ILE A 1 71  ? 31.009 32.435 34.908  1.00 24.22 ? 71  ILE A CG1   1 
ATOM   513  C CG2   . ILE A 1 71  ? 31.990 34.614 34.143  1.00 24.49 ? 71  ILE A CG2   1 
ATOM   514  C CD1   . ILE A 1 71  ? 30.042 32.985 35.942  1.00 23.68 ? 71  ILE A CD1   1 
ATOM   515  N N     . ILE A 1 72  ? 35.447 32.812 32.855  1.00 22.34 ? 72  ILE A N     1 
ATOM   516  C CA    . ILE A 1 72  ? 36.780 33.386 32.677  1.00 19.36 ? 72  ILE A CA    1 
ATOM   517  C C     . ILE A 1 72  ? 36.732 34.455 31.583  1.00 20.53 ? 72  ILE A C     1 
ATOM   518  O O     . ILE A 1 72  ? 36.171 34.219 30.508  1.00 19.10 ? 72  ILE A O     1 
ATOM   519  C CB    . ILE A 1 72  ? 37.781 32.291 32.261  1.00 20.32 ? 72  ILE A CB    1 
ATOM   520  C CG1   . ILE A 1 72  ? 37.828 31.198 33.333  1.00 19.98 ? 72  ILE A CG1   1 
ATOM   521  C CG2   . ILE A 1 72  ? 39.163 32.914 32.013  1.00 19.07 ? 72  ILE A CG2   1 
ATOM   522  C CD1   . ILE A 1 72  ? 38.497 29.910 32.885  1.00 16.60 ? 72  ILE A CD1   1 
ATOM   523  N N     . TYR A 1 73  ? 37.305 35.627 31.856  1.00 19.67 ? 73  TYR A N     1 
ATOM   524  C CA    . TYR A 1 73  ? 37.286 36.696 30.866  1.00 20.75 ? 73  TYR A CA    1 
ATOM   525  C C     . TYR A 1 73  ? 38.647 36.936 30.234  1.00 21.70 ? 73  TYR A C     1 
ATOM   526  O O     . TYR A 1 73  ? 38.724 37.487 29.136  1.00 22.49 ? 73  TYR A O     1 
ATOM   527  C CB    . TYR A 1 73  ? 36.771 37.995 31.481  1.00 22.70 ? 73  TYR A CB    1 
ATOM   528  C CG    . TYR A 1 73  ? 35.311 37.934 31.884  1.00 28.44 ? 73  TYR A CG    1 
ATOM   529  C CD1   . TYR A 1 73  ? 34.337 37.481 30.990  1.00 28.64 ? 73  TYR A CD1   1 
ATOM   530  C CD2   . TYR A 1 73  ? 34.905 38.336 33.154  1.00 29.42 ? 73  TYR A CD2   1 
ATOM   531  C CE1   . TYR A 1 73  ? 32.991 37.428 31.356  1.00 32.76 ? 73  TYR A CE1   1 
ATOM   532  C CE2   . TYR A 1 73  ? 33.552 38.289 33.530  1.00 31.79 ? 73  TYR A CE2   1 
ATOM   533  C CZ    . TYR A 1 73  ? 32.608 37.834 32.624  1.00 31.82 ? 73  TYR A CZ    1 
ATOM   534  O OH    . TYR A 1 73  ? 31.278 37.774 32.992  1.00 35.40 ? 73  TYR A OH    1 
ATOM   535  N N     . LYS A 1 74  ? 39.712 36.518 30.914  1.00 21.33 ? 74  LYS A N     1 
ATOM   536  C CA    . LYS A 1 74  ? 41.057 36.720 30.372  1.00 23.15 ? 74  LYS A CA    1 
ATOM   537  C C     . LYS A 1 74  ? 42.103 35.879 31.089  1.00 22.18 ? 74  LYS A C     1 
ATOM   538  O O     . LYS A 1 74  ? 41.881 35.431 32.222  1.00 20.63 ? 74  LYS A O     1 
ATOM   539  C CB    . LYS A 1 74  ? 41.446 38.201 30.477  1.00 24.91 ? 74  LYS A CB    1 
ATOM   540  C CG    . LYS A 1 74  ? 41.546 38.704 31.914  1.00 28.08 ? 74  LYS A CG    1 
ATOM   541  C CD    . LYS A 1 74  ? 41.951 40.175 31.990  1.00 32.99 ? 74  LYS A CD    1 
ATOM   542  C CE    . LYS A 1 74  ? 40.874 41.098 31.445  1.00 33.80 ? 74  LYS A CE    1 
ATOM   543  N NZ    . LYS A 1 74  ? 41.221 42.540 31.647  1.00 37.02 ? 74  LYS A NZ    1 
ATOM   544  N N     . ASN A 1 75  ? 43.235 35.649 30.423  1.00 20.25 ? 75  ASN A N     1 
ATOM   545  C CA    . ASN A 1 75  ? 44.318 34.897 31.037  1.00 22.29 ? 75  ASN A CA    1 
ATOM   546  C C     . ASN A 1 75  ? 44.712 35.682 32.281  1.00 22.48 ? 75  ASN A C     1 
ATOM   547  O O     . ASN A 1 75  ? 44.623 36.911 32.298  1.00 24.27 ? 75  ASN A O     1 
ATOM   548  C CB    . ASN A 1 75  ? 45.518 34.792 30.086  1.00 25.18 ? 75  ASN A CB    1 
ATOM   549  C CG    . ASN A 1 75  ? 45.210 33.971 28.846  1.00 25.77 ? 75  ASN A CG    1 
ATOM   550  O OD1   . ASN A 1 75  ? 44.399 33.044 28.888  1.00 25.19 ? 75  ASN A OD1   1 
ATOM   551  N ND2   . ASN A 1 75  ? 45.875 34.292 27.740  1.00 26.83 ? 75  ASN A ND2   1 
ATOM   552  N N     . GLY A 1 76  ? 45.162 34.986 33.320  1.00 22.58 ? 76  GLY A N     1 
ATOM   553  C CA    . GLY A 1 76  ? 45.522 35.676 34.547  1.00 22.38 ? 76  GLY A CA    1 
ATOM   554  C C     . GLY A 1 76  ? 44.415 35.582 35.587  1.00 23.91 ? 76  GLY A C     1 
ATOM   555  O O     . GLY A 1 76  ? 44.654 35.767 36.786  1.00 22.96 ? 76  GLY A O     1 
ATOM   556  N N     . ASP A 1 77  ? 43.192 35.314 35.135  1.00 22.06 ? 77  ASP A N     1 
ATOM   557  C CA    . ASP A 1 77  ? 42.075 35.157 36.066  1.00 22.52 ? 77  ASP A CA    1 
ATOM   558  C C     . ASP A 1 77  ? 42.432 33.987 36.988  1.00 21.53 ? 77  ASP A C     1 
ATOM   559  O O     . ASP A 1 77  ? 43.207 33.103 36.616  1.00 20.97 ? 77  ASP A O     1 
ATOM   560  C CB    . ASP A 1 77  ? 40.771 34.830 35.312  1.00 21.26 ? 77  ASP A CB    1 
ATOM   561  C CG    . ASP A 1 77  ? 40.071 36.071 34.767  1.00 22.55 ? 77  ASP A CG    1 
ATOM   562  O OD1   . ASP A 1 77  ? 40.540 37.196 35.045  1.00 25.35 ? 77  ASP A OD1   1 
ATOM   563  O OD2   . ASP A 1 77  ? 39.046 35.919 34.068  1.00 24.39 ? 77  ASP A OD2   1 
ATOM   564  N N     . ILE A 1 78  ? 41.877 33.985 38.194  1.00 21.20 ? 78  ILE A N     1 
ATOM   565  C CA    . ILE A 1 78  ? 42.135 32.918 39.148  1.00 21.94 ? 78  ILE A CA    1 
ATOM   566  C C     . ILE A 1 78  ? 40.865 32.090 39.286  1.00 21.25 ? 78  ILE A C     1 
ATOM   567  O O     . ILE A 1 78  ? 39.766 32.648 39.368  1.00 20.77 ? 78  ILE A O     1 
ATOM   568  C CB    . ILE A 1 78  ? 42.518 33.500 40.523  1.00 24.44 ? 78  ILE A CB    1 
ATOM   569  C CG1   . ILE A 1 78  ? 43.932 34.081 40.461  1.00 23.64 ? 78  ILE A CG1   1 
ATOM   570  C CG2   . ILE A 1 78  ? 42.401 32.433 41.603  1.00 23.28 ? 78  ILE A CG2   1 
ATOM   571  C CD1   . ILE A 1 78  ? 44.318 34.875 41.695  1.00 25.84 ? 78  ILE A CD1   1 
ATOM   572  N N     . VAL A 1 79  ? 41.010 30.768 39.292  1.00 22.69 ? 79  VAL A N     1 
ATOM   573  C CA    . VAL A 1 79  ? 39.835 29.918 39.434  1.00 21.70 ? 79  VAL A CA    1 
ATOM   574  C C     . VAL A 1 79  ? 39.937 28.926 40.570  1.00 21.70 ? 79  VAL A C     1 
ATOM   575  O O     . VAL A 1 79  ? 41.025 28.542 40.994  1.00 22.01 ? 79  VAL A O     1 
ATOM   576  C CB    . VAL A 1 79  ? 39.536 29.096 38.154  1.00 19.82 ? 79  VAL A CB    1 
ATOM   577  C CG1   . VAL A 1 79  ? 39.316 30.010 36.982  1.00 23.45 ? 79  VAL A CG1   1 
ATOM   578  C CG2   . VAL A 1 79  ? 40.657 28.110 37.884  1.00 23.22 ? 79  VAL A CG2   1 
ATOM   579  N N     . ARG A 1 80  ? 38.774 28.530 41.064  1.00 21.53 ? 80  ARG A N     1 
ATOM   580  C CA    . ARG A 1 80  ? 38.677 27.518 42.098  1.00 24.31 ? 80  ARG A CA    1 
ATOM   581  C C     . ARG A 1 80  ? 37.765 26.478 41.467  1.00 22.94 ? 80  ARG A C     1 
ATOM   582  O O     . ARG A 1 80  ? 36.673 26.813 41.016  1.00 25.24 ? 80  ARG A O     1 
ATOM   583  C CB    . ARG A 1 80  ? 38.032 28.075 43.370  1.00 24.45 ? 80  ARG A CB    1 
ATOM   584  C CG    . ARG A 1 80  ? 37.871 27.027 44.466  1.00 30.11 ? 80  ARG A CG    1 
ATOM   585  C CD    . ARG A 1 80  ? 36.422 26.969 44.941  1.00 32.83 ? 80  ARG A CD    1 
ATOM   586  N NE    . ARG A 1 80  ? 36.245 27.615 46.228  1.00 36.10 ? 80  ARG A NE    1 
ATOM   587  C CZ    . ARG A 1 80  ? 35.070 27.810 46.818  1.00 33.83 ? 80  ARG A CZ    1 
ATOM   588  N NH1   . ARG A 1 80  ? 33.941 27.414 46.238  1.00 33.07 ? 80  ARG A NH1   1 
ATOM   589  N NH2   . ARG A 1 80  ? 35.032 28.399 47.998  1.00 34.74 ? 80  ARG A NH2   1 
ATOM   590  N N     . PHE A 1 81  ? 38.229 25.234 41.396  1.00 23.93 ? 81  PHE A N     1 
ATOM   591  C CA    . PHE A 1 81  ? 37.434 24.150 40.817  1.00 24.05 ? 81  PHE A CA    1 
ATOM   592  C C     . PHE A 1 81  ? 37.085 23.124 41.891  1.00 25.99 ? 81  PHE A C     1 
ATOM   593  O O     . PHE A 1 81  ? 37.956 22.692 42.647  1.00 27.28 ? 81  PHE A O     1 
ATOM   594  C CB    . PHE A 1 81  ? 38.205 23.415 39.706  1.00 24.18 ? 81  PHE A CB    1 
ATOM   595  C CG    . PHE A 1 81  ? 38.370 24.200 38.427  1.00 23.07 ? 81  PHE A CG    1 
ATOM   596  C CD1   . PHE A 1 81  ? 37.563 25.295 38.141  1.00 24.05 ? 81  PHE A CD1   1 
ATOM   597  C CD2   . PHE A 1 81  ? 39.320 23.806 37.486  1.00 25.20 ? 81  PHE A CD2   1 
ATOM   598  C CE1   . PHE A 1 81  ? 37.698 25.992 36.928  1.00 23.62 ? 81  PHE A CE1   1 
ATOM   599  C CE2   . PHE A 1 81  ? 39.460 24.487 36.286  1.00 25.43 ? 81  PHE A CE2   1 
ATOM   600  C CZ    . PHE A 1 81  ? 38.643 25.586 36.004  1.00 22.42 ? 81  PHE A CZ    1 
ATOM   601  N N     . HIS A 1 82  ? 35.810 22.755 41.957  1.00 27.02 ? 82  HIS A N     1 
ATOM   602  C CA    . HIS A 1 82  ? 35.353 21.748 42.901  1.00 28.38 ? 82  HIS A CA    1 
ATOM   603  C C     . HIS A 1 82  ? 34.839 20.588 42.062  1.00 27.67 ? 82  HIS A C     1 
ATOM   604  O O     . HIS A 1 82  ? 34.245 20.799 41.003  1.00 26.99 ? 82  HIS A O     1 
ATOM   605  C CB    . HIS A 1 82  ? 34.224 22.299 43.779  1.00 29.27 ? 82  HIS A CB    1 
ATOM   606  C CG    . HIS A 1 82  ? 34.700 23.099 44.953  1.00 29.88 ? 82  HIS A CG    1 
ATOM   607  N ND1   . HIS A 1 82  ? 33.832 23.737 45.815  1.00 29.79 ? 82  HIS A ND1   1 
ATOM   608  C CD2   . HIS A 1 82  ? 35.946 23.363 45.412  1.00 28.93 ? 82  HIS A CD2   1 
ATOM   609  C CE1   . HIS A 1 82  ? 34.524 24.359 46.752  1.00 29.68 ? 82  HIS A CE1   1 
ATOM   610  N NE2   . HIS A 1 82  ? 35.809 24.148 46.532  1.00 30.23 ? 82  HIS A NE2   1 
ATOM   611  N N     . ARG A 1 83  ? 35.078 19.363 42.525  1.00 29.73 ? 83  ARG A N     1 
ATOM   612  C CA    . ARG A 1 83  ? 34.627 18.164 41.819  1.00 28.22 ? 83  ARG A CA    1 
ATOM   613  C C     . ARG A 1 83  ? 35.248 18.017 40.443  1.00 27.31 ? 83  ARG A C     1 
ATOM   614  O O     . ARG A 1 83  ? 34.550 17.822 39.445  1.00 25.72 ? 83  ARG A O     1 
ATOM   615  C CB    . ARG A 1 83  ? 33.103 18.157 41.690  1.00 31.89 ? 83  ARG A CB    1 
ATOM   616  C CG    . ARG A 1 83  ? 32.380 17.617 42.914  1.00 34.87 ? 83  ARG A CG    1 
ATOM   617  C CD    . ARG A 1 83  ? 31.329 18.594 43.356  1.00 36.18 ? 83  ARG A CD    1 
ATOM   618  N NE    . ARG A 1 83  ? 31.680 19.191 44.631  1.00 39.35 ? 83  ARG A NE    1 
ATOM   619  C CZ    . ARG A 1 83  ? 31.237 20.364 45.053  1.00 38.01 ? 83  ARG A CZ    1 
ATOM   620  N NH1   . ARG A 1 83  ? 30.421 21.085 44.296  1.00 38.49 ? 83  ARG A NH1   1 
ATOM   621  N NH2   . ARG A 1 83  ? 31.605 20.806 46.240  1.00 40.86 ? 83  ARG A NH2   1 
ATOM   622  N N     . LEU A 1 84  ? 36.569 18.107 40.400  1.00 26.74 ? 84  LEU A N     1 
ATOM   623  C CA    . LEU A 1 84  ? 37.301 17.959 39.155  1.00 27.15 ? 84  LEU A CA    1 
ATOM   624  C C     . LEU A 1 84  ? 37.914 16.561 39.163  1.00 27.44 ? 84  LEU A C     1 
ATOM   625  O O     . LEU A 1 84  ? 38.631 16.199 40.102  1.00 27.88 ? 84  LEU A O     1 
ATOM   626  C CB    . LEU A 1 84  ? 38.419 18.999 39.069  1.00 26.55 ? 84  LEU A CB    1 
ATOM   627  C CG    . LEU A 1 84  ? 39.251 18.960 37.786  1.00 27.18 ? 84  LEU A CG    1 
ATOM   628  C CD1   . LEU A 1 84  ? 38.406 19.465 36.619  1.00 27.99 ? 84  LEU A CD1   1 
ATOM   629  C CD2   . LEU A 1 84  ? 40.503 19.808 37.956  1.00 28.13 ? 84  LEU A CD2   1 
ATOM   630  N N     . LYS A 1 85  ? 37.626 15.774 38.136  1.00 28.22 ? 85  LYS A N     1 
ATOM   631  C CA    . LYS A 1 85  ? 38.176 14.428 38.051  1.00 29.52 ? 85  LYS A CA    1 
ATOM   632  C C     . LYS A 1 85  ? 39.536 14.481 37.377  1.00 30.54 ? 85  LYS A C     1 
ATOM   633  O O     . LYS A 1 85  ? 39.733 15.223 36.405  1.00 29.07 ? 85  LYS A O     1 
ATOM   634  C CB    . LYS A 1 85  ? 37.259 13.513 37.244  1.00 30.79 ? 85  LYS A CB    1 
ATOM   635  C CG    . LYS A 1 85  ? 37.774 12.081 37.153  1.00 36.34 ? 85  LYS A CG    1 
ATOM   636  C CD    . LYS A 1 85  ? 36.861 11.197 36.321  1.00 39.88 ? 85  LYS A CD    1 
ATOM   637  C CE    . LYS A 1 85  ? 37.409 9.771  36.250  1.00 41.22 ? 85  LYS A CE    1 
ATOM   638  N NZ    . LYS A 1 85  ? 36.629 8.930  35.299  1.00 43.73 ? 85  LYS A NZ    1 
ATOM   639  N N     . ILE A 1 86  ? 40.475 13.703 37.901  1.00 30.80 ? 86  ILE A N     1 
ATOM   640  C CA    . ILE A 1 86  ? 41.816 13.644 37.340  1.00 33.96 ? 86  ILE A CA    1 
ATOM   641  C C     . ILE A 1 86  ? 41.970 12.303 36.633  1.00 37.26 ? 86  ILE A C     1 
ATOM   642  O O     . ILE A 1 86  ? 41.659 11.256 37.204  1.00 37.64 ? 86  ILE A O     1 
ATOM   643  C CB    . ILE A 1 86  ? 42.898 13.760 38.437  1.00 33.59 ? 86  ILE A CB    1 
ATOM   644  C CG1   . ILE A 1 86  ? 42.696 15.051 39.238  1.00 34.27 ? 86  ILE A CG1   1 
ATOM   645  C CG2   . ILE A 1 86  ? 44.287 13.724 37.804  1.00 33.70 ? 86  ILE A CG2   1 
ATOM   646  C CD1   . ILE A 1 86  ? 42.666 16.320 38.385  1.00 33.22 ? 86  ILE A CD1   1 
ATOM   647  N N     . GLN A 1 87  ? 42.426 12.335 35.385  1.00 39.46 ? 87  GLN A N     1 
ATOM   648  C CA    . GLN A 1 87  ? 42.618 11.108 34.618  1.00 41.63 ? 87  GLN A CA    1 
ATOM   649  C C     . GLN A 1 87  ? 43.796 11.243 33.668  1.00 43.20 ? 87  GLN A C     1 
ATOM   650  O O     . GLN A 1 87  ? 44.327 12.336 33.473  1.00 43.40 ? 87  GLN A O     1 
ATOM   651  C CB    . GLN A 1 87  ? 41.356 10.769 33.823  1.00 41.96 ? 87  GLN A CB    1 
ATOM   652  C CG    . GLN A 1 87  ? 40.873 11.883 32.919  1.00 43.47 ? 87  GLN A CG    1 
ATOM   653  C CD    . GLN A 1 87  ? 39.677 11.479 32.080  1.00 44.49 ? 87  GLN A CD    1 
ATOM   654  O OE1   . GLN A 1 87  ? 38.723 10.884 32.581  1.00 46.69 ? 87  GLN A OE1   1 
ATOM   655  N NE2   . GLN A 1 87  ? 39.717 11.812 30.798  1.00 44.95 ? 87  GLN A NE2   1 
ATOM   656  N N     . VAL A 1 88  ? 44.203 10.124 33.081  1.00 44.82 ? 88  VAL A N     1 
ATOM   657  C CA    . VAL A 1 88  ? 45.319 10.119 32.147  1.00 46.48 ? 88  VAL A CA    1 
ATOM   658  C C     . VAL A 1 88  ? 44.830 9.875  30.725  1.00 47.73 ? 88  VAL A C     1 
ATOM   659  O O     . VAL A 1 88  ? 44.050 8.956  30.474  1.00 47.24 ? 88  VAL A O     1 
ATOM   660  C CB    . VAL A 1 88  ? 46.352 9.030  32.518  1.00 46.77 ? 88  VAL A CB    1 
ATOM   661  C CG1   . VAL A 1 88  ? 47.507 9.041  31.520  1.00 46.56 ? 88  VAL A CG1   1 
ATOM   662  C CG2   . VAL A 1 88  ? 46.869 9.267  33.933  1.00 46.14 ? 88  VAL A CG2   1 
ATOM   663  N N     . TYR A 1 89  ? 45.284 10.718 29.802  1.00 49.19 ? 89  TYR A N     1 
ATOM   664  C CA    . TYR A 1 89  ? 44.915 10.604 28.393  1.00 50.83 ? 89  TYR A CA    1 
ATOM   665  C C     . TYR A 1 89  ? 46.201 10.630 27.579  1.00 51.80 ? 89  TYR A C     1 
ATOM   666  O O     . TYR A 1 89  ? 46.863 11.667 27.481  1.00 51.21 ? 89  TYR A O     1 
ATOM   667  C CB    . TYR A 1 89  ? 44.024 11.773 27.971  1.00 51.87 ? 89  TYR A CB    1 
ATOM   668  C CG    . TYR A 1 89  ? 43.527 11.674 26.546  1.00 52.44 ? 89  TYR A CG    1 
ATOM   669  C CD1   . TYR A 1 89  ? 42.550 10.743 26.194  1.00 53.07 ? 89  TYR A CD1   1 
ATOM   670  C CD2   . TYR A 1 89  ? 44.044 12.497 25.546  1.00 52.37 ? 89  TYR A CD2   1 
ATOM   671  C CE1   . TYR A 1 89  ? 42.099 10.634 24.882  1.00 53.72 ? 89  TYR A CE1   1 
ATOM   672  C CE2   . TYR A 1 89  ? 43.602 12.396 24.229  1.00 53.20 ? 89  TYR A CE2   1 
ATOM   673  C CZ    . TYR A 1 89  ? 42.628 11.462 23.904  1.00 53.89 ? 89  TYR A CZ    1 
ATOM   674  O OH    . TYR A 1 89  ? 42.185 11.351 22.605  1.00 54.25 ? 89  TYR A OH    1 
ATOM   675  N N     . LYS A 1 90  ? 46.553 9.485  26.999  1.00 52.90 ? 90  LYS A N     1 
ATOM   676  C CA    . LYS A 1 90  ? 47.775 9.364  26.211  1.00 53.92 ? 90  LYS A CA    1 
ATOM   677  C C     . LYS A 1 90  ? 48.985 9.675  27.089  1.00 54.56 ? 90  LYS A C     1 
ATOM   678  O O     . LYS A 1 90  ? 49.822 10.511 26.747  1.00 55.12 ? 90  LYS A O     1 
ATOM   679  C CB    . LYS A 1 90  ? 47.734 10.307 25.001  1.00 54.31 ? 90  LYS A CB    1 
ATOM   680  C CG    . LYS A 1 90  ? 46.566 10.038 24.056  1.00 55.54 ? 90  LYS A CG    1 
ATOM   681  C CD    . LYS A 1 90  ? 46.752 10.706 22.695  1.00 57.23 ? 90  LYS A CD    1 
ATOM   682  C CE    . LYS A 1 90  ? 46.806 12.222 22.800  1.00 58.50 ? 90  LYS A CE    1 
ATOM   683  N NZ    . LYS A 1 90  ? 46.965 12.864 21.464  1.00 59.42 ? 90  LYS A NZ    1 
ATOM   684  N N     . LYS A 1 91  ? 49.057 8.991  28.229  1.00 54.94 ? 91  LYS A N     1 
ATOM   685  C CA    . LYS A 1 91  ? 50.145 9.161  29.186  1.00 55.77 ? 91  LYS A CA    1 
ATOM   686  C C     . LYS A 1 91  ? 50.142 10.541 29.839  1.00 55.38 ? 91  LYS A C     1 
ATOM   687  O O     . LYS A 1 91  ? 50.848 10.768 30.825  1.00 56.16 ? 91  LYS A O     1 
ATOM   688  C CB    . LYS A 1 91  ? 51.497 8.911  28.505  1.00 57.54 ? 91  LYS A CB    1 
ATOM   689  C CG    . LYS A 1 91  ? 52.704 9.123  29.412  1.00 58.27 ? 91  LYS A CG    1 
ATOM   690  C CD    . LYS A 1 91  ? 54.008 8.852  28.675  1.00 59.81 ? 91  LYS A CD    1 
ATOM   691  C CE    . LYS A 1 91  ? 55.211 9.213  29.533  1.00 60.34 ? 91  LYS A CE    1 
ATOM   692  N NZ    . LYS A 1 91  ? 55.192 10.656 29.915  1.00 61.23 ? 91  LYS A NZ    1 
ATOM   693  N N     . GLU A 1 92  ? 49.343 11.457 29.297  1.00 54.18 ? 92  GLU A N     1 
ATOM   694  C CA    . GLU A 1 92  ? 49.264 12.808 29.842  1.00 52.70 ? 92  GLU A CA    1 
ATOM   695  C C     . GLU A 1 92  ? 48.092 12.994 30.801  1.00 50.96 ? 92  GLU A C     1 
ATOM   696  O O     . GLU A 1 92  ? 46.949 12.659 30.483  1.00 50.25 ? 92  GLU A O     1 
ATOM   697  C CB    . GLU A 1 92  ? 49.166 13.838 28.712  1.00 54.34 ? 92  GLU A CB    1 
ATOM   698  C CG    . GLU A 1 92  ? 50.510 14.216 28.098  1.00 56.27 ? 92  GLU A CG    1 
ATOM   699  C CD    . GLU A 1 92  ? 51.406 14.969 29.070  1.00 57.83 ? 92  GLU A CD    1 
ATOM   700  O OE1   . GLU A 1 92  ? 51.018 16.078 29.499  1.00 57.57 ? 92  GLU A OE1   1 
ATOM   701  O OE2   . GLU A 1 92  ? 52.493 14.450 29.411  1.00 58.81 ? 92  GLU A OE2   1 
ATOM   702  N N     . THR A 1 93  ? 48.393 13.529 31.978  1.00 47.74 ? 93  THR A N     1 
ATOM   703  C CA    . THR A 1 93  ? 47.382 13.789 32.991  1.00 45.52 ? 93  THR A CA    1 
ATOM   704  C C     . THR A 1 93  ? 46.513 14.967 32.548  1.00 43.54 ? 93  THR A C     1 
ATOM   705  O O     . THR A 1 93  ? 47.019 15.951 32.009  1.00 44.02 ? 93  THR A O     1 
ATOM   706  C CB    . THR A 1 93  ? 48.037 14.150 34.339  1.00 45.98 ? 93  THR A CB    1 
ATOM   707  O OG1   . THR A 1 93  ? 48.876 13.069 34.774  1.00 48.16 ? 93  THR A OG1   1 
ATOM   708  C CG2   . THR A 1 93  ? 46.971 14.424 35.392  1.00 45.04 ? 93  THR A CG2   1 
ATOM   709  N N     . GLN A 1 94  ? 45.205 14.862 32.770  1.00 40.53 ? 94  GLN A N     1 
ATOM   710  C CA    . GLN A 1 94  ? 44.288 15.933 32.407  1.00 38.09 ? 94  GLN A CA    1 
ATOM   711  C C     . GLN A 1 94  ? 43.096 15.992 33.352  1.00 36.38 ? 94  GLN A C     1 
ATOM   712  O O     . GLN A 1 94  ? 42.701 14.988 33.940  1.00 35.65 ? 94  GLN A O     1 
ATOM   713  C CB    . GLN A 1 94  ? 43.784 15.766 30.968  1.00 39.14 ? 94  GLN A CB    1 
ATOM   714  C CG    . GLN A 1 94  ? 43.093 14.453 30.679  1.00 41.35 ? 94  GLN A CG    1 
ATOM   715  C CD    . GLN A 1 94  ? 42.225 14.505 29.432  1.00 43.16 ? 94  GLN A CD    1 
ATOM   716  O OE1   . GLN A 1 94  ? 42.641 15.003 28.383  1.00 44.52 ? 94  GLN A OE1   1 
ATOM   717  N NE2   . GLN A 1 94  ? 41.014 13.980 29.541  1.00 42.76 ? 94  GLN A NE2   1 
ATOM   718  N N     . GLY A 1 95  ? 42.532 17.182 33.501  1.00 33.55 ? 95  GLY A N     1 
ATOM   719  C CA    . GLY A 1 95  ? 41.384 17.331 34.365  1.00 30.97 ? 95  GLY A CA    1 
ATOM   720  C C     . GLY A 1 95  ? 40.124 17.298 33.529  1.00 30.04 ? 95  GLY A C     1 
ATOM   721  O O     . GLY A 1 95  ? 40.114 17.742 32.377  1.00 28.41 ? 95  GLY A O     1 
ATOM   722  N N     . ILE A 1 96  ? 39.050 16.766 34.093  1.00 28.59 ? 96  ILE A N     1 
ATOM   723  C CA    . ILE A 1 96  ? 37.804 16.716 33.357  1.00 28.79 ? 96  ILE A CA    1 
ATOM   724  C C     . ILE A 1 96  ? 36.659 16.924 34.337  1.00 27.28 ? 96  ILE A C     1 
ATOM   725  O O     . ILE A 1 96  ? 36.805 16.659 35.527  1.00 25.75 ? 96  ILE A O     1 
ATOM   726  C CB    . ILE A 1 96  ? 37.661 15.366 32.613  1.00 29.69 ? 96  ILE A CB    1 
ATOM   727  C CG1   . ILE A 1 96  ? 36.461 15.411 31.666  1.00 31.99 ? 96  ILE A CG1   1 
ATOM   728  C CG2   . ILE A 1 96  ? 37.532 14.222 33.611  1.00 31.12 ? 96  ILE A CG2   1 
ATOM   729  C CD1   . ILE A 1 96  ? 36.465 14.290 30.630  1.00 32.97 ? 96  ILE A CD1   1 
ATOM   730  N N     . THR A 1 97  ? 35.540 17.438 33.840  1.00 27.36 ? 97  THR A N     1 
ATOM   731  C CA    . THR A 1 97  ? 34.379 17.680 34.681  1.00 28.72 ? 97  THR A CA    1 
ATOM   732  C C     . THR A 1 97  ? 33.846 16.373 35.253  1.00 29.70 ? 97  THR A C     1 
ATOM   733  O O     . THR A 1 97  ? 33.891 15.334 34.597  1.00 27.97 ? 97  THR A O     1 
ATOM   734  C CB    . THR A 1 97  ? 33.245 18.349 33.893  1.00 30.09 ? 97  THR A CB    1 
ATOM   735  O OG1   . THR A 1 97  ? 33.251 17.871 32.541  1.00 33.64 ? 97  THR A OG1   1 
ATOM   736  C CG2   . THR A 1 97  ? 33.402 19.859 33.912  1.00 30.38 ? 97  THR A CG2   1 
ATOM   737  N N     . SER A 1 98  ? 33.368 16.442 36.491  1.00 29.46 ? 98  SER A N     1 
ATOM   738  C CA    . SER A 1 98  ? 32.786 15.289 37.169  1.00 30.45 ? 98  SER A CA    1 
ATOM   739  C C     . SER A 1 98  ? 31.416 15.783 37.623  1.00 29.98 ? 98  SER A C     1 
ATOM   740  O O     . SER A 1 98  ? 31.135 16.979 37.545  1.00 27.97 ? 98  SER A O     1 
ATOM   741  C CB    . SER A 1 98  ? 33.640 14.893 38.379  1.00 31.56 ? 98  SER A CB    1 
ATOM   742  O OG    . SER A 1 98  ? 33.305 13.593 38.833  1.00 38.79 ? 98  SER A OG    1 
ATOM   743  N N     . SER A 1 99  ? 30.553 14.881 38.078  1.00 29.30 ? 99  SER A N     1 
ATOM   744  C CA    . SER A 1 99  ? 29.229 15.295 38.532  1.00 29.12 ? 99  SER A CA    1 
ATOM   745  C C     . SER A 1 99  ? 29.343 16.347 39.629  1.00 26.33 ? 99  SER A C     1 
ATOM   746  O O     . SER A 1 99  ? 30.202 16.250 40.507  1.00 28.45 ? 99  SER A O     1 
ATOM   747  C CB    . SER A 1 99  ? 28.448 14.085 39.052  1.00 30.26 ? 99  SER A CB    1 
ATOM   748  O OG    . SER A 1 99  ? 28.314 13.111 38.035  1.00 35.78 ? 99  SER A OG    1 
ATOM   749  N N     . GLY A 1 100 ? 28.482 17.356 39.574  1.00 26.27 ? 100 GLY A N     1 
ATOM   750  C CA    . GLY A 1 100 ? 28.514 18.400 40.585  1.00 26.49 ? 100 GLY A CA    1 
ATOM   751  C C     . GLY A 1 100 ? 29.636 19.417 40.424  1.00 26.82 ? 100 GLY A C     1 
ATOM   752  O O     . GLY A 1 100 ? 29.836 20.264 41.293  1.00 27.17 ? 100 GLY A O     1 
ATOM   753  N N     . PHE A 1 101 ? 30.384 19.329 39.328  1.00 26.63 ? 101 PHE A N     1 
ATOM   754  C CA    . PHE A 1 101 ? 31.478 20.268 39.086  1.00 25.98 ? 101 PHE A CA    1 
ATOM   755  C C     . PHE A 1 101 ? 31.014 21.703 39.315  1.00 25.85 ? 101 PHE A C     1 
ATOM   756  O O     . PHE A 1 101 ? 29.908 22.083 38.908  1.00 27.04 ? 101 PHE A O     1 
ATOM   757  C CB    . PHE A 1 101 ? 31.985 20.159 37.646  1.00 27.27 ? 101 PHE A CB    1 
ATOM   758  C CG    . PHE A 1 101 ? 33.078 21.144 37.326  1.00 25.95 ? 101 PHE A CG    1 
ATOM   759  C CD1   . PHE A 1 101 ? 34.397 20.875 37.683  1.00 28.08 ? 101 PHE A CD1   1 
ATOM   760  C CD2   . PHE A 1 101 ? 32.780 22.363 36.728  1.00 27.03 ? 101 PHE A CD2   1 
ATOM   761  C CE1   . PHE A 1 101 ? 35.406 21.816 37.448  1.00 27.45 ? 101 PHE A CE1   1 
ATOM   762  C CE2   . PHE A 1 101 ? 33.783 23.307 36.492  1.00 27.25 ? 101 PHE A CE2   1 
ATOM   763  C CZ    . PHE A 1 101 ? 35.095 23.034 36.853  1.00 24.47 ? 101 PHE A CZ    1 
ATOM   764  N N     . ALA A 1 102 ? 31.862 22.503 39.953  1.00 24.95 ? 102 ALA A N     1 
ATOM   765  C CA    . ALA A 1 102 ? 31.528 23.897 40.217  1.00 24.73 ? 102 ALA A CA    1 
ATOM   766  C C     . ALA A 1 102 ? 32.803 24.727 40.216  1.00 25.25 ? 102 ALA A C     1 
ATOM   767  O O     . ALA A 1 102 ? 33.882 24.243 40.586  1.00 23.78 ? 102 ALA A O     1 
ATOM   768  C CB    . ALA A 1 102 ? 30.810 24.031 41.572  1.00 26.50 ? 102 ALA A CB    1 
ATOM   769  N N     . SER A 1 103 ? 32.680 25.983 39.806  1.00 24.95 ? 103 SER A N     1 
ATOM   770  C CA    . SER A 1 103 ? 33.844 26.842 39.774  1.00 26.56 ? 103 SER A CA    1 
ATOM   771  C C     . SER A 1 103 ? 33.537 28.267 40.196  1.00 25.03 ? 103 SER A C     1 
ATOM   772  O O     . SER A 1 103 ? 32.395 28.740 40.095  1.00 26.06 ? 103 SER A O     1 
ATOM   773  C CB    . SER A 1 103 ? 34.439 26.866 38.366  1.00 28.85 ? 103 SER A CB    1 
ATOM   774  O OG    . SER A 1 103 ? 33.659 27.693 37.524  1.00 28.31 ? 103 SER A OG    1 
ATOM   775  N N     . LEU A 1 104 ? 34.570 28.934 40.695  1.00 22.75 ? 104 LEU A N     1 
ATOM   776  C CA    . LEU A 1 104 ? 34.489 30.331 41.084  1.00 23.17 ? 104 LEU A CA    1 
ATOM   777  C C     . LEU A 1 104 ? 35.653 30.990 40.346  1.00 22.65 ? 104 LEU A C     1 
ATOM   778  O O     . LEU A 1 104 ? 36.751 30.430 40.316  1.00 22.28 ? 104 LEU A O     1 
ATOM   779  C CB    . LEU A 1 104 ? 34.702 30.512 42.594  1.00 23.86 ? 104 LEU A CB    1 
ATOM   780  C CG    . LEU A 1 104 ? 33.609 30.070 43.569  1.00 26.55 ? 104 LEU A CG    1 
ATOM   781  C CD1   . LEU A 1 104 ? 34.053 30.389 44.985  1.00 26.72 ? 104 LEU A CD1   1 
ATOM   782  C CD2   . LEU A 1 104 ? 32.307 30.789 43.259  1.00 26.10 ? 104 LEU A CD2   1 
ATOM   783  N N     . THR A 1 105 ? 35.416 32.152 39.743  1.00 19.87 ? 105 THR A N     1 
ATOM   784  C CA    . THR A 1 105 ? 36.488 32.861 39.051  1.00 20.57 ? 105 THR A CA    1 
ATOM   785  C C     . THR A 1 105 ? 36.652 34.251 39.674  1.00 20.98 ? 105 THR A C     1 
ATOM   786  O O     . THR A 1 105 ? 35.662 34.885 40.067  1.00 20.65 ? 105 THR A O     1 
ATOM   787  C CB    . THR A 1 105 ? 36.205 32.984 37.534  1.00 21.81 ? 105 THR A CB    1 
ATOM   788  O OG1   . THR A 1 105 ? 36.097 31.672 36.966  1.00 23.86 ? 105 THR A OG1   1 
ATOM   789  C CG2   . THR A 1 105 ? 37.345 33.694 36.845  1.00 27.45 ? 105 THR A CG2   1 
ATOM   790  N N     . PHE A 1 106 ? 37.903 34.711 39.753  1.00 21.13 ? 106 PHE A N     1 
ATOM   791  C CA    . PHE A 1 106 ? 38.249 36.006 40.338  1.00 21.99 ? 106 PHE A CA    1 
ATOM   792  C C     . PHE A 1 106 ? 39.258 36.743 39.459  1.00 23.45 ? 106 PHE A C     1 
ATOM   793  O O     . PHE A 1 106 ? 39.963 36.122 38.660  1.00 22.20 ? 106 PHE A O     1 
ATOM   794  C CB    . PHE A 1 106 ? 38.935 35.819 41.698  1.00 21.85 ? 106 PHE A CB    1 
ATOM   795  C CG    . PHE A 1 106 ? 38.246 34.862 42.619  1.00 22.32 ? 106 PHE A CG    1 
ATOM   796  C CD1   . PHE A 1 106 ? 37.407 35.327 43.628  1.00 23.93 ? 106 PHE A CD1   1 
ATOM   797  C CD2   . PHE A 1 106 ? 38.478 33.497 42.513  1.00 21.81 ? 106 PHE A CD2   1 
ATOM   798  C CE1   . PHE A 1 106 ? 36.814 34.431 44.526  1.00 24.73 ? 106 PHE A CE1   1 
ATOM   799  C CE2   . PHE A 1 106 ? 37.894 32.602 43.400  1.00 24.97 ? 106 PHE A CE2   1 
ATOM   800  C CZ    . PHE A 1 106 ? 37.063 33.070 44.406  1.00 25.07 ? 106 PHE A CZ    1 
ATOM   801  N N     . GLU A 1 107 ? 39.353 38.058 39.638  1.00 25.29 ? 107 GLU A N     1 
ATOM   802  C CA    . GLU A 1 107 ? 40.339 38.844 38.901  1.00 26.73 ? 107 GLU A CA    1 
ATOM   803  C C     . GLU A 1 107 ? 41.699 38.387 39.443  1.00 25.61 ? 107 GLU A C     1 
ATOM   804  O O     . GLU A 1 107 ? 41.812 38.035 40.620  1.00 26.13 ? 107 GLU A O     1 
ATOM   805  C CB    . GLU A 1 107 ? 40.137 40.342 39.160  1.00 30.98 ? 107 GLU A CB    1 
ATOM   806  C CG    . GLU A 1 107 ? 38.904 40.932 38.479  1.00 34.26 ? 107 GLU A CG    1 
ATOM   807  C CD    . GLU A 1 107 ? 38.760 42.430 38.712  1.00 40.04 ? 107 GLU A CD    1 
ATOM   808  O OE1   . GLU A 1 107 ? 39.703 43.181 38.377  1.00 42.79 ? 107 GLU A OE1   1 
ATOM   809  O OE2   . GLU A 1 107 ? 37.707 42.861 39.233  1.00 42.26 ? 107 GLU A OE2   1 
ATOM   810  N N     . GLY A 1 108 ? 42.731 38.389 38.605  1.00 25.93 ? 108 GLY A N     1 
ATOM   811  C CA    . GLY A 1 108 ? 44.030 37.915 39.068  1.00 27.43 ? 108 GLY A CA    1 
ATOM   812  C C     . GLY A 1 108 ? 45.093 38.945 39.405  1.00 28.26 ? 108 GLY A C     1 
ATOM   813  O O     . GLY A 1 108 ? 46.234 38.585 39.684  1.00 28.28 ? 108 GLY A O     1 
ATOM   814  N N     . THR A 1 109 ? 44.719 40.217 39.397  1.00 28.90 ? 109 THR A N     1 
ATOM   815  C CA    . THR A 1 109 ? 45.650 41.303 39.684  1.00 31.57 ? 109 THR A CA    1 
ATOM   816  C C     . THR A 1 109 ? 45.678 41.715 41.157  1.00 32.32 ? 109 THR A C     1 
ATOM   817  O O     . THR A 1 109 ? 44.639 41.813 41.806  1.00 31.31 ? 109 THR A O     1 
ATOM   818  C CB    . THR A 1 109 ? 45.299 42.517 38.813  1.00 32.79 ? 109 THR A CB    1 
ATOM   819  O OG1   . THR A 1 109 ? 43.875 42.705 38.811  1.00 37.00 ? 109 THR A OG1   1 
ATOM   820  C CG2   . THR A 1 109 ? 45.747 42.285 37.387  1.00 33.61 ? 109 THR A CG2   1 
ATOM   821  N N     . LEU A 1 110 ? 46.880 41.944 41.682  1.00 33.57 ? 110 LEU A N     1 
ATOM   822  C CA    . LEU A 1 110 ? 47.057 42.349 43.076  1.00 34.60 ? 110 LEU A CA    1 
ATOM   823  C C     . LEU A 1 110 ? 46.250 43.587 43.452  1.00 34.45 ? 110 LEU A C     1 
ATOM   824  O O     . LEU A 1 110 ? 46.186 44.549 42.697  1.00 34.33 ? 110 LEU A O     1 
ATOM   825  C CB    . LEU A 1 110 ? 48.534 42.621 43.366  1.00 34.51 ? 110 LEU A CB    1 
ATOM   826  C CG    . LEU A 1 110 ? 49.452 41.407 43.505  1.00 36.68 ? 110 LEU A CG    1 
ATOM   827  C CD1   . LEU A 1 110 ? 50.897 41.873 43.500  1.00 36.66 ? 110 LEU A CD1   1 
ATOM   828  C CD2   . LEU A 1 110 ? 49.127 40.651 44.791  1.00 36.19 ? 110 LEU A CD2   1 
ATOM   829  N N     . GLY A 1 111 ? 45.638 43.550 44.631  1.00 34.93 ? 111 GLY A N     1 
ATOM   830  C CA    . GLY A 1 111 ? 44.858 44.679 45.099  1.00 35.49 ? 111 GLY A CA    1 
ATOM   831  C C     . GLY A 1 111 ? 43.478 44.790 44.484  1.00 35.38 ? 111 GLY A C     1 
ATOM   832  O O     . GLY A 1 111 ? 42.671 45.602 44.925  1.00 36.37 ? 111 GLY A O     1 
ATOM   833  N N     . ALA A 1 112 ? 43.202 43.973 43.472  1.00 34.56 ? 112 ALA A N     1 
ATOM   834  C CA    . ALA A 1 112 ? 41.902 43.997 42.806  1.00 33.43 ? 112 ALA A CA    1 
ATOM   835  C C     . ALA A 1 112 ? 40.807 43.455 43.718  1.00 32.58 ? 112 ALA A C     1 
ATOM   836  O O     . ALA A 1 112 ? 41.073 42.658 44.618  1.00 31.86 ? 112 ALA A O     1 
ATOM   837  C CB    . ALA A 1 112 ? 41.955 43.171 41.526  1.00 32.54 ? 112 ALA A CB    1 
ATOM   838  N N     . PRO A 1 113 ? 39.558 43.895 43.506  1.00 31.55 ? 113 PRO A N     1 
ATOM   839  C CA    . PRO A 1 113 ? 38.459 43.409 44.341  1.00 30.77 ? 113 PRO A CA    1 
ATOM   840  C C     . PRO A 1 113 ? 38.370 41.891 44.228  1.00 30.23 ? 113 PRO A C     1 
ATOM   841  O O     . PRO A 1 113 ? 38.713 41.320 43.190  1.00 28.29 ? 113 PRO A O     1 
ATOM   842  C CB    . PRO A 1 113 ? 37.242 44.101 43.739  1.00 30.14 ? 113 PRO A CB    1 
ATOM   843  C CG    . PRO A 1 113 ? 37.822 45.406 43.237  1.00 34.12 ? 113 PRO A CG    1 
ATOM   844  C CD    . PRO A 1 113 ? 39.092 44.935 42.572  1.00 32.57 ? 113 PRO A CD    1 
ATOM   845  N N     . ILE A 1 114 ? 37.928 41.238 45.296  1.00 29.07 ? 114 ILE A N     1 
ATOM   846  C CA    . ILE A 1 114 ? 37.791 39.789 45.286  1.00 29.46 ? 114 ILE A CA    1 
ATOM   847  C C     . ILE A 1 114 ? 36.300 39.479 45.258  1.00 29.73 ? 114 ILE A C     1 
ATOM   848  O O     . ILE A 1 114 ? 35.640 39.412 46.294  1.00 30.33 ? 114 ILE A O     1 
ATOM   849  C CB    . ILE A 1 114 ? 38.468 39.149 46.528  1.00 31.24 ? 114 ILE A CB    1 
ATOM   850  C CG1   . ILE A 1 114 ? 39.974 39.432 46.490  1.00 31.88 ? 114 ILE A CG1   1 
ATOM   851  C CG2   . ILE A 1 114 ? 38.233 37.644 46.547  1.00 30.29 ? 114 ILE A CG2   1 
ATOM   852  C CD1   . ILE A 1 114 ? 40.738 38.979 47.727  1.00 34.89 ? 114 ILE A CD1   1 
ATOM   853  N N     . ILE A 1 115 ? 35.774 39.319 44.050  1.00 28.73 ? 115 ILE A N     1 
ATOM   854  C CA    . ILE A 1 115 ? 34.362 39.037 43.862  1.00 28.32 ? 115 ILE A CA    1 
ATOM   855  C C     . ILE A 1 115 ? 34.230 37.732 43.083  1.00 28.48 ? 115 ILE A C     1 
ATOM   856  O O     . ILE A 1 115 ? 34.538 37.671 41.892  1.00 29.03 ? 115 ILE A O     1 
ATOM   857  C CB    . ILE A 1 115 ? 33.681 40.199 43.098  1.00 28.45 ? 115 ILE A CB    1 
ATOM   858  C CG1   . ILE A 1 115 ? 33.930 41.518 43.844  1.00 28.78 ? 115 ILE A CG1   1 
ATOM   859  C CG2   . ILE A 1 115 ? 32.184 39.924 42.946  1.00 28.76 ? 115 ILE A CG2   1 
ATOM   860  C CD1   . ILE A 1 115 ? 33.522 42.759 43.084  1.00 27.98 ? 115 ILE A CD1   1 
ATOM   861  N N     . PRO A 1 116 ? 33.772 36.665 43.754  1.00 27.92 ? 116 PRO A N     1 
ATOM   862  C CA    . PRO A 1 116 ? 33.620 35.372 43.082  1.00 27.38 ? 116 PRO A CA    1 
ATOM   863  C C     . PRO A 1 116 ? 32.574 35.408 41.975  1.00 27.20 ? 116 PRO A C     1 
ATOM   864  O O     . PRO A 1 116 ? 31.464 35.906 42.173  1.00 26.72 ? 116 PRO A O     1 
ATOM   865  C CB    . PRO A 1 116 ? 33.230 34.439 44.225  1.00 28.67 ? 116 PRO A CB    1 
ATOM   866  C CG    . PRO A 1 116 ? 32.424 35.339 45.120  1.00 30.29 ? 116 PRO A CG    1 
ATOM   867  C CD    . PRO A 1 116 ? 33.275 36.600 45.141  1.00 28.60 ? 116 PRO A CD    1 
ATOM   868  N N     . ARG A 1 117 ? 32.930 34.886 40.804  1.00 23.78 ? 117 ARG A N     1 
ATOM   869  C CA    . ARG A 1 117 ? 31.996 34.855 39.688  1.00 24.31 ? 117 ARG A CA    1 
ATOM   870  C C     . ARG A 1 117 ? 31.614 33.398 39.456  1.00 24.58 ? 117 ARG A C     1 
ATOM   871  O O     . ARG A 1 117 ? 32.482 32.537 39.308  1.00 21.79 ? 117 ARG A O     1 
ATOM   872  C CB    . ARG A 1 117 ? 32.644 35.441 38.427  1.00 24.95 ? 117 ARG A CB    1 
ATOM   873  C CG    . ARG A 1 117 ? 33.219 36.837 38.631  1.00 25.46 ? 117 ARG A CG    1 
ATOM   874  C CD    . ARG A 1 117 ? 33.580 37.476 37.301  1.00 30.76 ? 117 ARG A CD    1 
ATOM   875  N NE    . ARG A 1 117 ? 34.618 36.735 36.591  1.00 29.85 ? 117 ARG A NE    1 
ATOM   876  C CZ    . ARG A 1 117 ? 35.881 37.130 36.484  1.00 30.73 ? 117 ARG A CZ    1 
ATOM   877  N NH1   . ARG A 1 117 ? 36.270 38.262 37.046  1.00 31.76 ? 117 ARG A NH1   1 
ATOM   878  N NH2   . ARG A 1 117 ? 36.748 36.401 35.795  1.00 28.91 ? 117 ARG A NH2   1 
ATOM   879  N N     . THR A 1 118 ? 30.313 33.123 39.432  1.00 24.77 ? 118 THR A N     1 
ATOM   880  C CA    . THR A 1 118 ? 29.835 31.759 39.230  1.00 26.67 ? 118 THR A CA    1 
ATOM   881  C C     . THR A 1 118 ? 28.340 31.747 38.955  1.00 27.95 ? 118 THR A C     1 
ATOM   882  O O     . THR A 1 118 ? 27.626 32.684 39.313  1.00 28.63 ? 118 THR A O     1 
ATOM   883  C CB    . THR A 1 118 ? 30.080 30.891 40.481  1.00 27.52 ? 118 THR A CB    1 
ATOM   884  O OG1   . THR A 1 118 ? 29.616 29.555 40.243  1.00 27.58 ? 118 THR A OG1   1 
ATOM   885  C CG2   . THR A 1 118 ? 29.329 31.474 41.675  1.00 27.58 ? 118 THR A CG2   1 
ATOM   886  N N     . SER A 1 119 ? 27.876 30.676 38.324  1.00 28.81 ? 119 SER A N     1 
ATOM   887  C CA    . SER A 1 119 ? 26.458 30.528 38.023  1.00 31.09 ? 119 SER A CA    1 
ATOM   888  C C     . SER A 1 119 ? 25.758 29.772 39.153  1.00 30.83 ? 119 SER A C     1 
ATOM   889  O O     . SER A 1 119 ? 24.535 29.706 39.192  1.00 32.59 ? 119 SER A O     1 
ATOM   890  C CB    . SER A 1 119 ? 26.271 29.760 36.719  1.00 30.66 ? 119 SER A CB    1 
ATOM   891  O OG    . SER A 1 119 ? 26.807 28.453 36.831  1.00 33.06 ? 119 SER A OG    1 
ATOM   892  N N     . SER A 1 120 ? 26.536 29.207 40.070  1.00 32.64 ? 120 SER A N     1 
ATOM   893  C CA    . SER A 1 120 ? 25.977 28.447 41.192  1.00 34.17 ? 120 SER A CA    1 
ATOM   894  C C     . SER A 1 120 ? 25.142 29.317 42.124  1.00 34.43 ? 120 SER A C     1 
ATOM   895  O O     . SER A 1 120 ? 25.537 30.427 42.468  1.00 33.73 ? 120 SER A O     1 
ATOM   896  C CB    . SER A 1 120 ? 27.099 27.783 42.001  1.00 35.05 ? 120 SER A CB    1 
ATOM   897  O OG    . SER A 1 120 ? 27.797 26.821 41.233  1.00 36.34 ? 120 SER A OG    1 
ATOM   898  N N     . LYS A 1 121 ? 23.983 28.809 42.534  1.00 35.24 ? 121 LYS A N     1 
ATOM   899  C CA    . LYS A 1 121 ? 23.117 29.554 43.439  1.00 35.90 ? 121 LYS A CA    1 
ATOM   900  C C     . LYS A 1 121 ? 23.663 29.434 44.863  1.00 35.30 ? 121 LYS A C     1 
ATOM   901  O O     . LYS A 1 121 ? 23.652 30.404 45.627  1.00 35.61 ? 121 LYS A O     1 
ATOM   902  C CB    . LYS A 1 121 ? 21.686 29.010 43.369  1.00 37.96 ? 121 LYS A CB    1 
ATOM   903  C CG    . LYS A 1 121 ? 20.677 29.755 44.237  1.00 41.28 ? 121 LYS A CG    1 
ATOM   904  C CD    . LYS A 1 121 ? 19.262 29.235 43.983  1.00 44.12 ? 121 LYS A CD    1 
ATOM   905  C CE    . LYS A 1 121 ? 18.231 29.903 44.888  1.00 45.07 ? 121 LYS A CE    1 
ATOM   906  N NZ    . LYS A 1 121 ? 18.184 31.376 44.690  1.00 47.23 ? 121 LYS A NZ    1 
ATOM   907  N N     . TYR A 1 122 ? 24.152 28.246 45.207  1.00 34.14 ? 122 TYR A N     1 
ATOM   908  C CA    . TYR A 1 122 ? 24.707 27.991 46.534  1.00 35.16 ? 122 TYR A CA    1 
ATOM   909  C C     . TYR A 1 122 ? 26.168 27.566 46.411  1.00 35.76 ? 122 TYR A C     1 
ATOM   910  O O     . TYR A 1 122 ? 26.487 26.660 45.640  1.00 36.74 ? 122 TYR A O     1 
ATOM   911  C CB    . TYR A 1 122 ? 23.916 26.874 47.227  1.00 35.96 ? 122 TYR A CB    1 
ATOM   912  C CG    . TYR A 1 122 ? 22.464 27.209 47.486  1.00 36.17 ? 122 TYR A CG    1 
ATOM   913  C CD1   . TYR A 1 122 ? 22.072 27.837 48.668  1.00 37.58 ? 122 TYR A CD1   1 
ATOM   914  C CD2   . TYR A 1 122 ? 21.484 26.907 46.544  1.00 37.68 ? 122 TYR A CD2   1 
ATOM   915  C CE1   . TYR A 1 122 ? 20.738 28.154 48.904  1.00 38.74 ? 122 TYR A CE1   1 
ATOM   916  C CE2   . TYR A 1 122 ? 20.145 27.219 46.772  1.00 38.70 ? 122 TYR A CE2   1 
ATOM   917  C CZ    . TYR A 1 122 ? 19.782 27.842 47.953  1.00 38.58 ? 122 TYR A CZ    1 
ATOM   918  O OH    . TYR A 1 122 ? 18.461 28.156 48.185  1.00 42.53 ? 122 TYR A OH    1 
ATOM   919  N N     . PHE A 1 123 ? 27.054 28.204 47.169  1.00 35.52 ? 123 PHE A N     1 
ATOM   920  C CA    . PHE A 1 123 ? 28.466 27.837 47.114  1.00 36.07 ? 123 PHE A CA    1 
ATOM   921  C C     . PHE A 1 123 ? 29.245 28.272 48.347  1.00 37.69 ? 123 PHE A C     1 
ATOM   922  O O     . PHE A 1 123 ? 28.956 29.307 48.956  1.00 36.86 ? 123 PHE A O     1 
ATOM   923  C CB    . PHE A 1 123 ? 29.116 28.411 45.850  1.00 33.98 ? 123 PHE A CB    1 
ATOM   924  C CG    . PHE A 1 123 ? 29.220 29.908 45.842  1.00 31.53 ? 123 PHE A CG    1 
ATOM   925  C CD1   . PHE A 1 123 ? 30.302 30.547 46.430  1.00 32.13 ? 123 PHE A CD1   1 
ATOM   926  C CD2   . PHE A 1 123 ? 28.230 30.680 45.250  1.00 32.61 ? 123 PHE A CD2   1 
ATOM   927  C CE1   . PHE A 1 123 ? 30.397 31.937 46.427  1.00 31.00 ? 123 PHE A CE1   1 
ATOM   928  C CE2   . PHE A 1 123 ? 28.316 32.071 45.242  1.00 32.80 ? 123 PHE A CE2   1 
ATOM   929  C CZ    . PHE A 1 123 ? 29.402 32.701 45.831  1.00 32.56 ? 123 PHE A CZ    1 
ATOM   930  N N     . ASN A 1 124 ? 30.238 27.467 48.707  1.00 39.60 ? 124 ASN A N     1 
ATOM   931  C CA    . ASN A 1 124 ? 31.067 27.745 49.869  1.00 43.38 ? 124 ASN A CA    1 
ATOM   932  C C     . ASN A 1 124 ? 32.081 28.831 49.527  1.00 43.91 ? 124 ASN A C     1 
ATOM   933  O O     . ASN A 1 124 ? 32.617 28.866 48.419  1.00 44.74 ? 124 ASN A O     1 
ATOM   934  C CB    . ASN A 1 124 ? 31.779 26.462 50.314  1.00 45.41 ? 124 ASN A CB    1 
ATOM   935  C CG    . ASN A 1 124 ? 32.520 26.627 51.627  1.00 48.84 ? 124 ASN A CG    1 
ATOM   936  O OD1   . ASN A 1 124 ? 33.595 27.225 51.678  1.00 51.80 ? 124 ASN A OD1   1 
ATOM   937  N ND2   . ASN A 1 124 ? 31.942 26.102 52.702  1.00 49.57 ? 124 ASN A ND2   1 
ATOM   938  N N     . PHE A 1 125 ? 32.326 29.725 50.478  1.00 43.55 ? 125 PHE A N     1 
ATOM   939  C CA    . PHE A 1 125 ? 33.267 30.820 50.284  1.00 44.92 ? 125 PHE A CA    1 
ATOM   940  C C     . PHE A 1 125 ? 33.741 31.267 51.662  1.00 45.39 ? 125 PHE A C     1 
ATOM   941  O O     . PHE A 1 125 ? 32.977 31.861 52.422  1.00 46.11 ? 125 PHE A O     1 
ATOM   942  C CB    . PHE A 1 125 ? 32.574 31.973 49.554  1.00 45.15 ? 125 PHE A CB    1 
ATOM   943  C CG    . PHE A 1 125 ? 33.508 33.060 49.110  1.00 46.19 ? 125 PHE A CG    1 
ATOM   944  C CD1   . PHE A 1 125 ? 34.662 32.758 48.389  1.00 46.17 ? 125 PHE A CD1   1 
ATOM   945  C CD2   . PHE A 1 125 ? 33.233 34.391 49.405  1.00 46.12 ? 125 PHE A CD2   1 
ATOM   946  C CE1   . PHE A 1 125 ? 35.528 33.769 47.968  1.00 46.09 ? 125 PHE A CE1   1 
ATOM   947  C CE2   . PHE A 1 125 ? 34.096 35.408 48.987  1.00 47.22 ? 125 PHE A CE2   1 
ATOM   948  C CZ    . PHE A 1 125 ? 35.245 35.093 48.269  1.00 45.57 ? 125 PHE A CZ    1 
ATOM   949  N N     . THR A 1 126 ? 35.002 30.981 51.976  1.00 45.56 ? 126 THR A N     1 
ATOM   950  C CA    . THR A 1 126 ? 35.569 31.321 53.277  1.00 46.21 ? 126 THR A CA    1 
ATOM   951  C C     . THR A 1 126 ? 36.763 32.261 53.223  1.00 46.79 ? 126 THR A C     1 
ATOM   952  O O     . THR A 1 126 ? 37.185 32.703 52.152  1.00 46.06 ? 126 THR A O     1 
ATOM   953  C CB    . THR A 1 126 ? 36.026 30.053 54.017  1.00 46.52 ? 126 THR A CB    1 
ATOM   954  O OG1   . THR A 1 126 ? 37.064 29.410 53.267  1.00 46.67 ? 126 THR A OG1   1 
ATOM   955  C CG2   . THR A 1 126 ? 34.862 29.094 54.190  1.00 47.14 ? 126 THR A CG2   1 
ATOM   956  N N     . THR A 1 127 ? 37.304 32.561 54.399  1.00 46.79 ? 127 THR A N     1 
ATOM   957  C CA    . THR A 1 127 ? 38.473 33.419 54.508  1.00 47.29 ? 127 THR A CA    1 
ATOM   958  C C     . THR A 1 127 ? 39.657 32.638 53.941  1.00 47.40 ? 127 THR A C     1 
ATOM   959  O O     . THR A 1 127 ? 40.665 33.217 53.536  1.00 47.28 ? 127 THR A O     1 
ATOM   960  C CB    . THR A 1 127 ? 38.749 33.806 55.987  1.00 48.51 ? 127 THR A CB    1 
ATOM   961  O OG1   . THR A 1 127 ? 40.014 34.470 56.081  1.00 49.27 ? 127 THR A OG1   1 
ATOM   962  C CG2   . THR A 1 127 ? 38.760 32.575 56.879  1.00 48.34 ? 127 THR A CG2   1 
ATOM   963  N N     . GLU A 1 128 ? 39.520 31.315 53.910  1.00 47.58 ? 128 GLU A N     1 
ATOM   964  C CA    . GLU A 1 128 ? 40.566 30.457 53.369  1.00 47.71 ? 128 GLU A CA    1 
ATOM   965  C C     . GLU A 1 128 ? 40.645 30.662 51.862  1.00 45.89 ? 128 GLU A C     1 
ATOM   966  O O     . GLU A 1 128 ? 41.711 30.523 51.263  1.00 45.15 ? 128 GLU A O     1 
ATOM   967  C CB    . GLU A 1 128 ? 40.282 28.983 53.677  1.00 49.73 ? 128 GLU A CB    1 
ATOM   968  C CG    . GLU A 1 128 ? 40.635 28.558 55.095  1.00 54.08 ? 128 GLU A CG    1 
ATOM   969  C CD    . GLU A 1 128 ? 39.867 29.326 56.151  1.00 56.31 ? 128 GLU A CD    1 
ATOM   970  O OE1   . GLU A 1 128 ? 38.617 29.269 56.143  1.00 58.34 ? 128 GLU A OE1   1 
ATOM   971  O OE2   . GLU A 1 128 ? 40.514 29.982 56.996  1.00 58.17 ? 128 GLU A OE2   1 
ATOM   972  N N     . ASP A 1 129 ? 39.511 30.994 51.252  1.00 44.10 ? 129 ASP A N     1 
ATOM   973  C CA    . ASP A 1 129 ? 39.475 31.237 49.815  1.00 43.08 ? 129 ASP A CA    1 
ATOM   974  C C     . ASP A 1 129 ? 40.169 32.562 49.511  1.00 42.19 ? 129 ASP A C     1 
ATOM   975  O O     . ASP A 1 129 ? 40.937 32.659 48.552  1.00 40.67 ? 129 ASP A O     1 
ATOM   976  C CB    . ASP A 1 129 ? 38.028 31.255 49.308  1.00 41.53 ? 129 ASP A CB    1 
ATOM   977  C CG    . ASP A 1 129 ? 37.401 29.871 49.300  1.00 41.49 ? 129 ASP A CG    1 
ATOM   978  O OD1   . ASP A 1 129 ? 37.927 28.986 48.592  1.00 40.04 ? 129 ASP A OD1   1 
ATOM   979  O OD2   . ASP A 1 129 ? 36.391 29.661 50.004  1.00 39.96 ? 129 ASP A OD2   1 
ATOM   980  N N     . HIS A 1 130 ? 39.908 33.579 50.331  1.00 42.75 ? 130 HIS A N     1 
ATOM   981  C CA    . HIS A 1 130 ? 40.542 34.883 50.141  1.00 43.30 ? 130 HIS A CA    1 
ATOM   982  C C     . HIS A 1 130 ? 42.055 34.711 50.201  1.00 42.72 ? 130 HIS A C     1 
ATOM   983  O O     . HIS A 1 130 ? 42.789 35.248 49.374  1.00 41.50 ? 130 HIS A O     1 
ATOM   984  C CB    . HIS A 1 130 ? 40.118 35.874 51.233  1.00 45.23 ? 130 HIS A CB    1 
ATOM   985  C CG    . HIS A 1 130 ? 38.736 36.420 51.059  1.00 47.96 ? 130 HIS A CG    1 
ATOM   986  N ND1   . HIS A 1 130 ? 37.602 35.687 51.336  1.00 49.27 ? 130 HIS A ND1   1 
ATOM   987  C CD2   . HIS A 1 130 ? 38.306 37.633 50.638  1.00 48.40 ? 130 HIS A CD2   1 
ATOM   988  C CE1   . HIS A 1 130 ? 36.534 36.425 51.095  1.00 49.72 ? 130 HIS A CE1   1 
ATOM   989  N NE2   . HIS A 1 130 ? 36.933 37.611 50.670  1.00 48.38 ? 130 HIS A NE2   1 
ATOM   990  N N     . LYS A 1 131 ? 42.510 33.960 51.199  1.00 42.27 ? 131 LYS A N     1 
ATOM   991  C CA    . LYS A 1 131 ? 43.931 33.707 51.385  1.00 42.46 ? 131 LYS A CA    1 
ATOM   992  C C     . LYS A 1 131 ? 44.504 32.995 50.167  1.00 41.40 ? 131 LYS A C     1 
ATOM   993  O O     . LYS A 1 131 ? 45.605 33.312 49.712  1.00 41.20 ? 131 LYS A O     1 
ATOM   994  C CB    . LYS A 1 131 ? 44.144 32.862 52.647  1.00 45.64 ? 131 LYS A CB    1 
ATOM   995  C CG    . LYS A 1 131 ? 43.781 33.592 53.941  1.00 48.15 ? 131 LYS A CG    1 
ATOM   996  C CD    . LYS A 1 131 ? 43.457 32.620 55.073  1.00 52.33 ? 131 LYS A CD    1 
ATOM   997  C CE    . LYS A 1 131 ? 44.633 31.718 55.418  1.00 53.93 ? 131 LYS A CE    1 
ATOM   998  N NZ    . LYS A 1 131 ? 45.793 32.480 55.958  1.00 56.99 ? 131 LYS A NZ    1 
ATOM   999  N N     . MET A 1 132 ? 43.751 32.036 49.637  1.00 38.82 ? 132 MET A N     1 
ATOM   1000 C CA    . MET A 1 132 ? 44.187 31.287 48.464  1.00 38.36 ? 132 MET A CA    1 
ATOM   1001 C C     . MET A 1 132 ? 44.300 32.202 47.251  1.00 35.55 ? 132 MET A C     1 
ATOM   1002 O O     . MET A 1 132 ? 45.287 32.154 46.519  1.00 35.05 ? 132 MET A O     1 
ATOM   1003 C CB    . MET A 1 132 ? 43.203 30.150 48.160  1.00 40.00 ? 132 MET A CB    1 
ATOM   1004 C CG    . MET A 1 132 ? 43.236 29.010 49.161  1.00 43.76 ? 132 MET A CG    1 
ATOM   1005 S SD    . MET A 1 132 ? 44.787 28.100 49.097  1.00 48.08 ? 132 MET A SD    1 
ATOM   1006 C CE    . MET A 1 132 ? 44.364 26.761 48.003  1.00 46.64 ? 132 MET A CE    1 
ATOM   1007 N N     . VAL A 1 133 ? 43.281 33.029 47.037  1.00 33.40 ? 133 VAL A N     1 
ATOM   1008 C CA    . VAL A 1 133 ? 43.289 33.959 45.914  1.00 32.87 ? 133 VAL A CA    1 
ATOM   1009 C C     . VAL A 1 133 ? 44.474 34.917 46.030  1.00 32.77 ? 133 VAL A C     1 
ATOM   1010 O O     . VAL A 1 133 ? 45.269 35.046 45.105  1.00 33.01 ? 133 VAL A O     1 
ATOM   1011 C CB    . VAL A 1 133 ? 41.979 34.782 45.853  1.00 31.31 ? 133 VAL A CB    1 
ATOM   1012 C CG1   . VAL A 1 133 ? 42.109 35.894 44.829  1.00 31.54 ? 133 VAL A CG1   1 
ATOM   1013 C CG2   . VAL A 1 133 ? 40.817 33.872 45.492  1.00 31.12 ? 133 VAL A CG2   1 
ATOM   1014 N N     . GLU A 1 134 ? 44.592 35.588 47.170  1.00 34.21 ? 134 GLU A N     1 
ATOM   1015 C CA    . GLU A 1 134 ? 45.695 36.524 47.379  1.00 36.62 ? 134 GLU A CA    1 
ATOM   1016 C C     . GLU A 1 134 ? 47.057 35.851 47.174  1.00 35.81 ? 134 GLU A C     1 
ATOM   1017 O O     . GLU A 1 134 ? 47.973 36.445 46.600  1.00 36.72 ? 134 GLU A O     1 
ATOM   1018 C CB    . GLU A 1 134 ? 45.596 37.133 48.780  1.00 39.16 ? 134 GLU A CB    1 
ATOM   1019 C CG    . GLU A 1 134 ? 44.408 38.078 48.937  1.00 45.67 ? 134 GLU A CG    1 
ATOM   1020 C CD    . GLU A 1 134 ? 44.201 38.562 50.363  1.00 49.44 ? 134 GLU A CD    1 
ATOM   1021 O OE1   . GLU A 1 134 ? 45.185 39.004 50.995  1.00 50.84 ? 134 GLU A OE1   1 
ATOM   1022 O OE2   . GLU A 1 134 ? 43.049 38.505 50.851  1.00 52.42 ? 134 GLU A OE2   1 
ATOM   1023 N N     . ALA A 1 135 ? 47.181 34.606 47.627  1.00 35.18 ? 135 ALA A N     1 
ATOM   1024 C CA    . ALA A 1 135 ? 48.428 33.853 47.483  1.00 34.20 ? 135 ALA A CA    1 
ATOM   1025 C C     . ALA A 1 135 ? 48.780 33.631 46.011  1.00 34.05 ? 135 ALA A C     1 
ATOM   1026 O O     . ALA A 1 135 ? 49.950 33.694 45.626  1.00 31.89 ? 135 ALA A O     1 
ATOM   1027 C CB    . ALA A 1 135 ? 48.314 32.506 48.194  1.00 35.94 ? 135 ALA A CB    1 
ATOM   1028 N N     . LEU A 1 136 ? 47.767 33.355 45.192  1.00 32.34 ? 136 LEU A N     1 
ATOM   1029 C CA    . LEU A 1 136 ? 47.990 33.143 43.769  1.00 32.14 ? 136 LEU A CA    1 
ATOM   1030 C C     . LEU A 1 136 ? 48.280 34.461 43.059  1.00 31.07 ? 136 LEU A C     1 
ATOM   1031 O O     . LEU A 1 136 ? 49.044 34.497 42.095  1.00 31.66 ? 136 LEU A O     1 
ATOM   1032 C CB    . LEU A 1 136 ? 46.776 32.450 43.136  1.00 31.67 ? 136 LEU A CB    1 
ATOM   1033 C CG    . LEU A 1 136 ? 46.663 30.954 43.447  1.00 32.09 ? 136 LEU A CG    1 
ATOM   1034 C CD1   . LEU A 1 136 ? 45.371 30.388 42.872  1.00 31.30 ? 136 LEU A CD1   1 
ATOM   1035 C CD2   . LEU A 1 136 ? 47.872 30.231 42.865  1.00 32.63 ? 136 LEU A CD2   1 
ATOM   1036 N N     . ARG A 1 137 ? 47.674 35.546 43.534  1.00 30.97 ? 137 ARG A N     1 
ATOM   1037 C CA    . ARG A 1 137 ? 47.913 36.851 42.928  1.00 31.37 ? 137 ARG A CA    1 
ATOM   1038 C C     . ARG A 1 137 ? 49.355 37.273 43.177  1.00 32.19 ? 137 ARG A C     1 
ATOM   1039 O O     . ARG A 1 137 ? 50.005 37.834 42.299  1.00 31.88 ? 137 ARG A O     1 
ATOM   1040 C CB    . ARG A 1 137 ? 46.966 37.897 43.502  1.00 29.84 ? 137 ARG A CB    1 
ATOM   1041 C CG    . ARG A 1 137 ? 45.542 37.792 42.984  1.00 28.91 ? 137 ARG A CG    1 
ATOM   1042 C CD    . ARG A 1 137 ? 44.658 38.812 43.667  1.00 29.05 ? 137 ARG A CD    1 
ATOM   1043 N NE    . ARG A 1 137 ? 43.337 38.892 43.062  1.00 28.15 ? 137 ARG A NE    1 
ATOM   1044 C CZ    . ARG A 1 137 ? 42.363 39.677 43.507  1.00 29.17 ? 137 ARG A CZ    1 
ATOM   1045 N NH1   . ARG A 1 137 ? 42.562 40.448 44.570  1.00 30.47 ? 137 ARG A NH1   1 
ATOM   1046 N NH2   . ARG A 1 137 ? 41.195 39.704 42.883  1.00 28.52 ? 137 ARG A NH2   1 
ATOM   1047 N N     . VAL A 1 138 ? 49.852 36.997 44.376  1.00 35.09 ? 138 VAL A N     1 
ATOM   1048 C CA    . VAL A 1 138 ? 51.229 37.345 44.706  1.00 36.89 ? 138 VAL A CA    1 
ATOM   1049 C C     . VAL A 1 138 ? 52.180 36.574 43.798  1.00 37.48 ? 138 VAL A C     1 
ATOM   1050 O O     . VAL A 1 138 ? 53.087 37.156 43.201  1.00 38.20 ? 138 VAL A O     1 
ATOM   1051 C CB    . VAL A 1 138 ? 51.547 37.022 46.179  1.00 38.13 ? 138 VAL A CB    1 
ATOM   1052 C CG1   . VAL A 1 138 ? 53.035 37.227 46.452  1.00 39.90 ? 138 VAL A CG1   1 
ATOM   1053 C CG2   . VAL A 1 138 ? 50.721 37.916 47.086  1.00 37.99 ? 138 VAL A CG2   1 
ATOM   1054 N N     . TRP A 1 139 ? 51.956 35.267 43.676  1.00 37.54 ? 139 TRP A N     1 
ATOM   1055 C CA    . TRP A 1 139 ? 52.789 34.417 42.833  1.00 38.58 ? 139 TRP A CA    1 
ATOM   1056 C C     . TRP A 1 139 ? 52.775 34.866 41.377  1.00 38.48 ? 139 TRP A C     1 
ATOM   1057 O O     . TRP A 1 139 ? 53.823 35.011 40.752  1.00 39.45 ? 139 TRP A O     1 
ATOM   1058 C CB    . TRP A 1 139 ? 52.311 32.963 42.909  1.00 39.71 ? 139 TRP A CB    1 
ATOM   1059 C CG    . TRP A 1 139 ? 53.033 32.036 41.969  1.00 41.67 ? 139 TRP A CG    1 
ATOM   1060 C CD1   . TRP A 1 139 ? 54.218 31.397 42.195  1.00 41.31 ? 139 TRP A CD1   1 
ATOM   1061 C CD2   . TRP A 1 139 ? 52.617 31.655 40.652  1.00 42.03 ? 139 TRP A CD2   1 
ATOM   1062 N NE1   . TRP A 1 139 ? 54.565 30.641 41.104  1.00 41.48 ? 139 TRP A NE1   1 
ATOM   1063 C CE2   . TRP A 1 139 ? 53.602 30.781 40.141  1.00 42.35 ? 139 TRP A CE2   1 
ATOM   1064 C CE3   . TRP A 1 139 ? 51.508 31.969 39.854  1.00 41.50 ? 139 TRP A CE3   1 
ATOM   1065 C CZ2   . TRP A 1 139 ? 53.512 30.213 38.867  1.00 41.87 ? 139 TRP A CZ2   1 
ATOM   1066 C CZ3   . TRP A 1 139 ? 51.418 31.403 38.580  1.00 42.47 ? 139 TRP A CZ3   1 
ATOM   1067 C CH2   . TRP A 1 139 ? 52.418 30.534 38.103  1.00 42.90 ? 139 TRP A CH2   1 
ATOM   1068 N N     . ALA A 1 140 ? 51.580 35.089 40.844  1.00 37.63 ? 140 ALA A N     1 
ATOM   1069 C CA    . ALA A 1 140 ? 51.425 35.497 39.455  1.00 36.36 ? 140 ALA A CA    1 
ATOM   1070 C C     . ALA A 1 140 ? 52.011 36.868 39.136  1.00 37.55 ? 140 ALA A C     1 
ATOM   1071 O O     . ALA A 1 140 ? 52.458 37.106 38.011  1.00 36.39 ? 140 ALA A O     1 
ATOM   1072 C CB    . ALA A 1 140 ? 49.953 35.461 39.073  1.00 36.26 ? 140 ALA A CB    1 
ATOM   1073 N N     . SER A 1 141 ? 52.017 37.766 40.118  1.00 37.71 ? 141 SER A N     1 
ATOM   1074 C CA    . SER A 1 141 ? 52.532 39.117 39.904  1.00 40.34 ? 141 SER A CA    1 
ATOM   1075 C C     . SER A 1 141 ? 53.962 39.112 39.383  1.00 42.79 ? 141 SER A C     1 
ATOM   1076 O O     . SER A 1 141 ? 54.382 40.048 38.701  1.00 42.98 ? 141 SER A O     1 
ATOM   1077 C CB    . SER A 1 141 ? 52.460 39.937 41.197  1.00 39.29 ? 141 SER A CB    1 
ATOM   1078 O OG    . SER A 1 141 ? 53.398 39.482 42.157  1.00 40.19 ? 141 SER A OG    1 
ATOM   1079 N N     . THR A 1 142 ? 54.699 38.049 39.694  1.00 45.78 ? 142 THR A N     1 
ATOM   1080 C CA    . THR A 1 142 ? 56.087 37.918 39.266  1.00 50.49 ? 142 THR A CA    1 
ATOM   1081 C C     . THR A 1 142 ? 56.302 36.840 38.201  1.00 51.80 ? 142 THR A C     1 
ATOM   1082 O O     . THR A 1 142 ? 57.273 36.899 37.443  1.00 53.15 ? 142 THR A O     1 
ATOM   1083 C CB    . THR A 1 142 ? 57.008 37.620 40.473  1.00 51.24 ? 142 THR A CB    1 
ATOM   1084 O OG1   . THR A 1 142 ? 58.350 37.425 40.015  1.00 55.19 ? 142 THR A OG1   1 
ATOM   1085 C CG2   . THR A 1 142 ? 56.544 36.377 41.207  1.00 52.24 ? 142 THR A CG2   1 
ATOM   1086 N N     . HIS A 1 143 ? 55.407 35.858 38.136  1.00 52.66 ? 143 HIS A N     1 
ATOM   1087 C CA    . HIS A 1 143 ? 55.546 34.791 37.151  1.00 53.19 ? 143 HIS A CA    1 
ATOM   1088 C C     . HIS A 1 143 ? 54.666 34.970 35.917  1.00 54.40 ? 143 HIS A C     1 
ATOM   1089 O O     . HIS A 1 143 ? 54.608 34.082 35.064  1.00 55.05 ? 143 HIS A O     1 
ATOM   1090 C CB    . HIS A 1 143 ? 55.250 33.428 37.778  1.00 51.94 ? 143 HIS A CB    1 
ATOM   1091 C CG    . HIS A 1 143 ? 56.240 33.009 38.818  1.00 51.39 ? 143 HIS A CG    1 
ATOM   1092 N ND1   . HIS A 1 143 ? 56.236 33.519 40.098  1.00 51.96 ? 143 HIS A ND1   1 
ATOM   1093 C CD2   . HIS A 1 143 ? 57.262 32.123 38.770  1.00 52.06 ? 143 HIS A CD2   1 
ATOM   1094 C CE1   . HIS A 1 143 ? 57.211 32.964 40.794  1.00 51.34 ? 143 HIS A CE1   1 
ATOM   1095 N NE2   . HIS A 1 143 ? 57.850 32.113 40.011  1.00 51.30 ? 143 HIS A NE2   1 
ATOM   1096 N N     . MET A 1 144 ? 53.987 36.109 35.814  1.00 54.73 ? 144 MET A N     1 
ATOM   1097 C CA    . MET A 1 144 ? 53.125 36.363 34.664  1.00 55.84 ? 144 MET A CA    1 
ATOM   1098 C C     . MET A 1 144 ? 53.070 37.840 34.274  1.00 56.53 ? 144 MET A C     1 
ATOM   1099 O O     . MET A 1 144 ? 53.574 38.701 34.993  1.00 56.18 ? 144 MET A O     1 
ATOM   1100 C CB    . MET A 1 144 ? 51.715 35.829 34.941  1.00 56.60 ? 144 MET A CB    1 
ATOM   1101 C CG    . MET A 1 144 ? 51.648 34.306 35.001  1.00 58.05 ? 144 MET A CG    1 
ATOM   1102 S SD    . MET A 1 144 ? 49.975 33.643 35.142  1.00 60.92 ? 144 MET A SD    1 
ATOM   1103 C CE    . MET A 1 144 ? 49.341 33.964 33.483  1.00 59.68 ? 144 MET A CE    1 
ATOM   1104 N N     . SER A 1 145 ? 52.464 38.124 33.124  1.00 57.35 ? 145 SER A N     1 
ATOM   1105 C CA    . SER A 1 145 ? 52.353 39.494 32.631  1.00 58.76 ? 145 SER A CA    1 
ATOM   1106 C C     . SER A 1 145 ? 50.981 40.106 32.909  1.00 59.03 ? 145 SER A C     1 
ATOM   1107 O O     . SER A 1 145 ? 49.954 39.451 32.742  1.00 58.95 ? 145 SER A O     1 
ATOM   1108 C CB    . SER A 1 145 ? 52.643 39.537 31.126  1.00 59.31 ? 145 SER A CB    1 
ATOM   1109 O OG    . SER A 1 145 ? 52.583 40.864 30.629  1.00 60.89 ? 145 SER A OG    1 
ATOM   1110 N N     . PRO A 1 146 ? 50.954 41.387 33.318  1.00 59.89 ? 146 PRO A N     1 
ATOM   1111 C CA    . PRO A 1 146 ? 49.758 42.176 33.647  1.00 60.75 ? 146 PRO A CA    1 
ATOM   1112 C C     . PRO A 1 146 ? 48.617 42.185 32.623  1.00 61.82 ? 146 PRO A C     1 
ATOM   1113 O O     . PRO A 1 146 ? 48.715 41.581 31.555  1.00 61.01 ? 146 PRO A O     1 
ATOM   1114 C CB    . PRO A 1 146 ? 50.326 43.579 33.889  1.00 60.35 ? 146 PRO A CB    1 
ATOM   1115 C CG    . PRO A 1 146 ? 51.574 43.598 33.048  1.00 59.80 ? 146 PRO A CG    1 
ATOM   1116 C CD    . PRO A 1 146 ? 52.154 42.243 33.346  1.00 60.05 ? 146 PRO A CD    1 
ATOM   1117 N N     . SER A 1 147 ? 47.535 42.881 32.974  1.00 63.33 ? 147 SER A N     1 
ATOM   1118 C CA    . SER A 1 147 ? 46.359 42.996 32.114  1.00 64.35 ? 147 SER A CA    1 
ATOM   1119 C C     . SER A 1 147 ? 45.430 44.111 32.594  1.00 64.32 ? 147 SER A C     1 
ATOM   1120 O O     . SER A 1 147 ? 45.879 45.143 33.099  1.00 65.51 ? 147 SER A O     1 
ATOM   1121 C CB    . SER A 1 147 ? 45.587 41.676 32.089  1.00 64.37 ? 147 SER A CB    1 
ATOM   1122 O OG    . SER A 1 147 ? 44.972 41.432 33.343  1.00 65.25 ? 147 SER A OG    1 
ATOM   1123 N N     . THR A 1 149 ? 46.337 45.532 30.351  1.00 46.04 ? 149 THR A N     1 
ATOM   1124 C CA    . THR A 1 149 ? 46.731 45.476 28.950  1.00 45.30 ? 149 THR A CA    1 
ATOM   1125 C C     . THR A 1 149 ? 45.521 45.146 28.083  1.00 43.37 ? 149 THR A C     1 
ATOM   1126 O O     . THR A 1 149 ? 45.074 44.000 28.032  1.00 43.84 ? 149 THR A O     1 
ATOM   1127 C CB    . THR A 1 149 ? 47.826 44.411 28.724  1.00 46.49 ? 149 THR A CB    1 
ATOM   1128 O OG1   . THR A 1 149 ? 48.993 44.762 29.482  1.00 49.22 ? 149 THR A OG1   1 
ATOM   1129 C CG2   . THR A 1 149 ? 48.190 44.318 27.251  1.00 47.80 ? 149 THR A CG2   1 
ATOM   1130 N N     . LEU A 1 150 ? 44.993 46.165 27.415  1.00 39.76 ? 150 LEU A N     1 
ATOM   1131 C CA    . LEU A 1 150 ? 43.832 46.010 26.550  1.00 35.82 ? 150 LEU A CA    1 
ATOM   1132 C C     . LEU A 1 150 ? 44.102 46.797 25.266  1.00 32.05 ? 150 LEU A C     1 
ATOM   1133 O O     . LEU A 1 150 ? 44.174 48.021 25.278  1.00 32.70 ? 150 LEU A O     1 
ATOM   1134 C CB    . LEU A 1 150 ? 42.585 46.534 27.269  1.00 36.43 ? 150 LEU A CB    1 
ATOM   1135 C CG    . LEU A 1 150 ? 41.242 46.278 26.584  1.00 38.47 ? 150 LEU A CG    1 
ATOM   1136 C CD1   . LEU A 1 150 ? 40.111 46.298 27.602  1.00 39.16 ? 150 LEU A CD1   1 
ATOM   1137 C CD2   . LEU A 1 150 ? 41.032 47.321 25.506  1.00 39.21 ? 150 LEU A CD2   1 
ATOM   1138 N N     . LEU A 1 151 ? 44.240 46.080 24.157  1.00 28.35 ? 151 LEU A N     1 
ATOM   1139 C CA    . LEU A 1 151 ? 44.550 46.704 22.874  1.00 25.76 ? 151 LEU A CA    1 
ATOM   1140 C C     . LEU A 1 151 ? 43.363 47.407 22.227  1.00 24.83 ? 151 LEU A C     1 
ATOM   1141 O O     . LEU A 1 151 ? 42.290 46.819 22.066  1.00 26.99 ? 151 LEU A O     1 
ATOM   1142 C CB    . LEU A 1 151 ? 45.111 45.646 21.918  1.00 26.92 ? 151 LEU A CB    1 
ATOM   1143 C CG    . LEU A 1 151 ? 45.811 46.104 20.634  1.00 30.90 ? 151 LEU A CG    1 
ATOM   1144 C CD1   . LEU A 1 151 ? 47.097 46.846 20.986  1.00 31.45 ? 151 LEU A CD1   1 
ATOM   1145 C CD2   . LEU A 1 151 ? 46.129 44.891 19.765  1.00 31.55 ? 151 LEU A CD2   1 
ATOM   1146 N N     . LYS A 1 152 ? 43.552 48.670 21.863  1.00 22.22 ? 152 LYS A N     1 
ATOM   1147 C CA    . LYS A 1 152 ? 42.493 49.437 21.213  1.00 21.81 ? 152 LYS A CA    1 
ATOM   1148 C C     . LYS A 1 152 ? 42.660 49.266 19.698  1.00 20.70 ? 152 LYS A C     1 
ATOM   1149 O O     . LYS A 1 152 ? 43.744 48.919 19.222  1.00 20.38 ? 152 LYS A O     1 
ATOM   1150 C CB    . LYS A 1 152 ? 42.605 50.915 21.592  1.00 27.14 ? 152 LYS A CB    1 
ATOM   1151 C CG    . LYS A 1 152 ? 42.539 51.182 23.091  1.00 32.37 ? 152 LYS A CG    1 
ATOM   1152 C CD    . LYS A 1 152 ? 41.172 50.822 23.665  1.00 35.02 ? 152 LYS A CD    1 
ATOM   1153 C CE    . LYS A 1 152 ? 40.115 51.870 23.310  1.00 38.33 ? 152 LYS A CE    1 
ATOM   1154 N NZ    . LYS A 1 152 ? 38.747 51.565 23.859  1.00 36.43 ? 152 LYS A NZ    1 
ATOM   1155 N N     . LEU A 1 153 ? 41.592 49.501 18.941  1.00 17.26 ? 153 LEU A N     1 
ATOM   1156 C CA    . LEU A 1 153 ? 41.670 49.339 17.496  1.00 18.52 ? 153 LEU A CA    1 
ATOM   1157 C C     . LEU A 1 153 ? 42.701 50.246 16.849  1.00 16.90 ? 153 LEU A C     1 
ATOM   1158 O O     . LEU A 1 153 ? 43.298 49.885 15.840  1.00 17.64 ? 153 LEU A O     1 
ATOM   1159 C CB    . LEU A 1 153 ? 40.309 49.611 16.867  1.00 17.46 ? 153 LEU A CB    1 
ATOM   1160 C CG    . LEU A 1 153 ? 39.256 48.544 17.136  1.00 18.02 ? 153 LEU A CG    1 
ATOM   1161 C CD1   . LEU A 1 153 ? 37.905 49.068 16.646  1.00 17.90 ? 153 LEU A CD1   1 
ATOM   1162 C CD2   . LEU A 1 153 ? 39.643 47.243 16.434  1.00 20.11 ? 153 LEU A CD2   1 
ATOM   1163 N N     . CYS A 1 154 ? 42.909 51.422 17.425  1.00 19.00 ? 154 CYS A N     1 
ATOM   1164 C CA    . CYS A 1 154 ? 43.875 52.348 16.854  1.00 21.68 ? 154 CYS A CA    1 
ATOM   1165 C C     . CYS A 1 154 ? 45.312 51.828 16.911  1.00 24.45 ? 154 CYS A C     1 
ATOM   1166 O O     . CYS A 1 154 ? 46.186 52.336 16.211  1.00 25.58 ? 154 CYS A O     1 
ATOM   1167 C CB    . CYS A 1 154 ? 43.784 53.707 17.552  1.00 24.60 ? 154 CYS A CB    1 
ATOM   1168 S SG    . CYS A 1 154 ? 44.063 53.683 19.332  1.00 27.02 ? 154 CYS A SG    1 
ATOM   1169 N N     . ASP A 1 155 ? 45.557 50.809 17.727  1.00 24.77 ? 155 ASP A N     1 
ATOM   1170 C CA    . ASP A 1 155 ? 46.906 50.267 17.844  1.00 25.41 ? 155 ASP A CA    1 
ATOM   1171 C C     . ASP A 1 155 ? 47.138 48.895 17.223  1.00 23.42 ? 155 ASP A C     1 
ATOM   1172 O O     . ASP A 1 155 ? 48.239 48.351 17.333  1.00 22.49 ? 155 ASP A O     1 
ATOM   1173 C CB    . ASP A 1 155 ? 47.342 50.237 19.315  1.00 28.75 ? 155 ASP A CB    1 
ATOM   1174 C CG    . ASP A 1 155 ? 47.386 51.624 19.937  1.00 32.99 ? 155 ASP A CG    1 
ATOM   1175 O OD1   . ASP A 1 155 ? 47.988 52.538 19.332  1.00 32.78 ? 155 ASP A OD1   1 
ATOM   1176 O OD2   . ASP A 1 155 ? 46.806 51.797 21.027  1.00 32.33 ? 155 ASP A OD2   1 
ATOM   1177 N N     . VAL A 1 156 ? 46.129 48.336 16.551  1.00 20.36 ? 156 VAL A N     1 
ATOM   1178 C CA    . VAL A 1 156 ? 46.302 47.026 15.932  1.00 17.74 ? 156 VAL A CA    1 
ATOM   1179 C C     . VAL A 1 156 ? 47.353 47.084 14.825  1.00 20.21 ? 156 VAL A C     1 
ATOM   1180 O O     . VAL A 1 156 ? 47.515 48.112 14.161  1.00 21.22 ? 156 VAL A O     1 
ATOM   1181 C CB    . VAL A 1 156 ? 44.983 46.479 15.320  1.00 19.84 ? 156 VAL A CB    1 
ATOM   1182 C CG1   . VAL A 1 156 ? 43.968 46.262 16.412  1.00 21.30 ? 156 VAL A CG1   1 
ATOM   1183 C CG2   . VAL A 1 156 ? 44.447 47.432 14.276  1.00 21.54 ? 156 VAL A CG2   1 
ATOM   1184 N N     . GLN A 1 157 ? 48.057 45.973 14.633  1.00 20.16 ? 157 GLN A N     1 
ATOM   1185 C CA    . GLN A 1 157 ? 49.097 45.872 13.613  1.00 22.89 ? 157 GLN A CA    1 
ATOM   1186 C C     . GLN A 1 157 ? 48.527 45.170 12.384  1.00 25.23 ? 157 GLN A C     1 
ATOM   1187 O O     . GLN A 1 157 ? 47.554 44.417 12.489  1.00 25.69 ? 157 GLN A O     1 
ATOM   1188 C CB    . GLN A 1 157 ? 50.304 45.118 14.186  1.00 20.91 ? 157 GLN A CB    1 
ATOM   1189 C CG    . GLN A 1 157 ? 50.970 45.901 15.338  1.00 23.10 ? 157 GLN A CG    1 
ATOM   1190 C CD    . GLN A 1 157 ? 51.910 45.059 16.195  1.00 23.25 ? 157 GLN A CD    1 
ATOM   1191 O OE1   . GLN A 1 157 ? 52.106 43.864 15.953  1.00 23.49 ? 157 GLN A OE1   1 
ATOM   1192 N NE2   . GLN A 1 157 ? 52.487 45.682 17.209  1.00 20.78 ? 157 GLN A NE2   1 
ATOM   1193 N N     . PRO A 1 158 ? 49.132 45.403 11.200  1.00 26.53 ? 158 PRO A N     1 
ATOM   1194 C CA    . PRO A 1 158 ? 48.717 44.828 9.910   1.00 28.35 ? 158 PRO A CA    1 
ATOM   1195 C C     . PRO A 1 158 ? 48.293 43.370 9.912   1.00 28.61 ? 158 PRO A C     1 
ATOM   1196 O O     . PRO A 1 158 ? 47.304 43.016 9.260   1.00 30.88 ? 158 PRO A O     1 
ATOM   1197 C CB    . PRO A 1 158 ? 49.927 45.074 9.013   1.00 28.84 ? 158 PRO A CB    1 
ATOM   1198 C CG    . PRO A 1 158 ? 50.429 46.386 9.518   1.00 28.56 ? 158 PRO A CG    1 
ATOM   1199 C CD    . PRO A 1 158 ? 50.355 46.209 11.030  1.00 28.26 ? 158 PRO A CD    1 
ATOM   1200 N N     . MET A 1 159 ? 49.044 42.515 10.601  1.00 28.07 ? 159 MET A N     1 
ATOM   1201 C CA    . MET A 1 159 ? 48.684 41.107 10.653  1.00 28.63 ? 159 MET A CA    1 
ATOM   1202 C C     . MET A 1 159 ? 49.042 40.498 12.006  1.00 27.81 ? 159 MET A C     1 
ATOM   1203 O O     . MET A 1 159 ? 50.204 40.197 12.292  1.00 26.95 ? 159 MET A O     1 
ATOM   1204 C CB    . MET A 1 159 ? 49.373 40.321 9.528   1.00 33.44 ? 159 MET A CB    1 
ATOM   1205 C CG    . MET A 1 159 ? 48.956 38.858 9.496   1.00 40.28 ? 159 MET A CG    1 
ATOM   1206 S SD    . MET A 1 159 ? 49.391 37.957 7.983   1.00 48.91 ? 159 MET A SD    1 
ATOM   1207 C CE    . MET A 1 159 ? 47.774 37.416 7.410   1.00 48.98 ? 159 MET A CE    1 
ATOM   1208 N N     . GLN A 1 160 ? 48.025 40.313 12.835  1.00 24.24 ? 160 GLN A N     1 
ATOM   1209 C CA    . GLN A 1 160 ? 48.228 39.739 14.158  1.00 22.60 ? 160 GLN A CA    1 
ATOM   1210 C C     . GLN A 1 160 ? 46.911 39.223 14.713  1.00 22.64 ? 160 GLN A C     1 
ATOM   1211 O O     . GLN A 1 160 ? 45.838 39.535 14.199  1.00 18.98 ? 160 GLN A O     1 
ATOM   1212 C CB    . GLN A 1 160 ? 48.750 40.798 15.121  1.00 20.81 ? 160 GLN A CB    1 
ATOM   1213 C CG    . GLN A 1 160 ? 47.710 41.850 15.500  1.00 23.71 ? 160 GLN A CG    1 
ATOM   1214 C CD    . GLN A 1 160 ? 48.120 42.703 16.696  1.00 24.85 ? 160 GLN A CD    1 
ATOM   1215 O OE1   . GLN A 1 160 ? 48.536 42.179 17.732  1.00 30.36 ? 160 GLN A OE1   1 
ATOM   1216 N NE2   . GLN A 1 160 ? 47.995 44.013 16.562  1.00 18.78 ? 160 GLN A NE2   1 
ATOM   1217 N N     . TYR A 1 161 ? 47.012 38.428 15.772  1.00 22.71 ? 161 TYR A N     1 
ATOM   1218 C CA    . TYR A 1 161 ? 45.840 37.910 16.465  1.00 21.73 ? 161 TYR A CA    1 
ATOM   1219 C C     . TYR A 1 161 ? 45.763 38.722 17.754  1.00 21.94 ? 161 TYR A C     1 
ATOM   1220 O O     . TYR A 1 161 ? 46.792 39.110 18.306  1.00 22.88 ? 161 TYR A O     1 
ATOM   1221 C CB    . TYR A 1 161 ? 46.024 36.433 16.814  1.00 24.84 ? 161 TYR A CB    1 
ATOM   1222 C CG    . TYR A 1 161 ? 45.988 35.516 15.619  1.00 25.98 ? 161 TYR A CG    1 
ATOM   1223 C CD1   . TYR A 1 161 ? 44.774 35.074 15.089  1.00 25.72 ? 161 TYR A CD1   1 
ATOM   1224 C CD2   . TYR A 1 161 ? 47.167 35.106 15.002  1.00 27.72 ? 161 TYR A CD2   1 
ATOM   1225 C CE1   . TYR A 1 161 ? 44.741 34.243 13.967  1.00 26.32 ? 161 TYR A CE1   1 
ATOM   1226 C CE2   . TYR A 1 161 ? 47.146 34.276 13.881  1.00 26.61 ? 161 TYR A CE2   1 
ATOM   1227 C CZ    . TYR A 1 161 ? 45.933 33.850 13.371  1.00 27.45 ? 161 TYR A CZ    1 
ATOM   1228 O OH    . TYR A 1 161 ? 45.923 33.032 12.265  1.00 28.97 ? 161 TYR A OH    1 
ATOM   1229 N N     . PHE A 1 162 ? 44.557 39.010 18.217  1.00 19.78 ? 162 PHE A N     1 
ATOM   1230 C CA    . PHE A 1 162 ? 44.422 39.747 19.464  1.00 21.49 ? 162 PHE A CA    1 
ATOM   1231 C C     . PHE A 1 162 ? 43.014 39.610 19.984  1.00 20.60 ? 162 PHE A C     1 
ATOM   1232 O O     . PHE A 1 162 ? 42.111 39.193 19.250  1.00 20.18 ? 162 PHE A O     1 
ATOM   1233 C CB    . PHE A 1 162 ? 44.787 41.234 19.268  1.00 22.10 ? 162 PHE A CB    1 
ATOM   1234 C CG    . PHE A 1 162 ? 43.733 42.049 18.559  1.00 21.31 ? 162 PHE A CG    1 
ATOM   1235 C CD1   . PHE A 1 162 ? 42.988 42.993 19.256  1.00 23.19 ? 162 PHE A CD1   1 
ATOM   1236 C CD2   . PHE A 1 162 ? 43.490 41.879 17.201  1.00 22.73 ? 162 PHE A CD2   1 
ATOM   1237 C CE1   . PHE A 1 162 ? 42.017 43.760 18.619  1.00 23.00 ? 162 PHE A CE1   1 
ATOM   1238 C CE2   . PHE A 1 162 ? 42.518 42.640 16.547  1.00 21.03 ? 162 PHE A CE2   1 
ATOM   1239 C CZ    . PHE A 1 162 ? 41.777 43.588 17.265  1.00 22.12 ? 162 PHE A CZ    1 
ATOM   1240 N N     . ASP A 1 163 ? 42.828 39.937 21.260  1.00 19.75 ? 163 ASP A N     1 
ATOM   1241 C CA    . ASP A 1 163 ? 41.509 39.874 21.860  1.00 20.80 ? 163 ASP A CA    1 
ATOM   1242 C C     . ASP A 1 163 ? 40.922 41.286 21.846  1.00 21.06 ? 163 ASP A C     1 
ATOM   1243 O O     . ASP A 1 163 ? 41.524 42.230 22.367  1.00 20.88 ? 163 ASP A O     1 
ATOM   1244 C CB    . ASP A 1 163 ? 41.593 39.357 23.301  1.00 22.89 ? 163 ASP A CB    1 
ATOM   1245 C CG    . ASP A 1 163 ? 42.283 38.004 23.406  1.00 26.20 ? 163 ASP A CG    1 
ATOM   1246 O OD1   . ASP A 1 163 ? 42.311 37.259 22.404  1.00 23.50 ? 163 ASP A OD1   1 
ATOM   1247 O OD2   . ASP A 1 163 ? 42.784 37.684 24.512  1.00 26.98 ? 163 ASP A OD2   1 
ATOM   1248 N N     . LEU A 1 164 ? 39.751 41.431 21.244  1.00 18.68 ? 164 LEU A N     1 
ATOM   1249 C CA    . LEU A 1 164 ? 39.114 42.736 21.156  1.00 17.87 ? 164 LEU A CA    1 
ATOM   1250 C C     . LEU A 1 164 ? 37.925 42.918 22.090  1.00 17.92 ? 164 LEU A C     1 
ATOM   1251 O O     . LEU A 1 164 ? 36.989 42.116 22.076  1.00 19.48 ? 164 LEU A O     1 
ATOM   1252 C CB    . LEU A 1 164 ? 38.627 42.991 19.721  1.00 16.18 ? 164 LEU A CB    1 
ATOM   1253 C CG    . LEU A 1 164 ? 37.798 44.257 19.481  1.00 16.83 ? 164 LEU A CG    1 
ATOM   1254 C CD1   . LEU A 1 164 ? 38.666 45.481 19.757  1.00 16.87 ? 164 LEU A CD1   1 
ATOM   1255 C CD2   . LEU A 1 164 ? 37.269 44.272 18.040  1.00 19.55 ? 164 LEU A CD2   1 
ATOM   1256 N N     . THR A 1 165 ? 37.976 43.967 22.911  1.00 17.33 ? 165 THR A N     1 
ATOM   1257 C CA    . THR A 1 165 ? 36.853 44.310 23.782  1.00 16.79 ? 165 THR A CA    1 
ATOM   1258 C C     . THR A 1 165 ? 36.141 45.397 22.984  1.00 17.86 ? 165 THR A C     1 
ATOM   1259 O O     . THR A 1 165 ? 36.758 46.377 22.567  1.00 20.66 ? 165 THR A O     1 
ATOM   1260 C CB    . THR A 1 165 ? 37.332 44.873 25.137  1.00 18.04 ? 165 THR A CB    1 
ATOM   1261 O OG1   . THR A 1 165 ? 38.109 43.880 25.811  1.00 21.15 ? 165 THR A OG1   1 
ATOM   1262 C CG2   . THR A 1 165 ? 36.157 45.270 26.008  1.00 20.09 ? 165 THR A CG2   1 
ATOM   1263 N N     . CYS A 1 166 ? 34.847 45.227 22.753  1.00 17.91 ? 166 CYS A N     1 
ATOM   1264 C CA    . CYS A 1 166 ? 34.101 46.198 21.956  1.00 18.41 ? 166 CYS A CA    1 
ATOM   1265 C C     . CYS A 1 166 ? 32.607 46.166 22.261  1.00 18.46 ? 166 CYS A C     1 
ATOM   1266 O O     . CYS A 1 166 ? 32.146 45.411 23.128  1.00 19.59 ? 166 CYS A O     1 
ATOM   1267 C CB    . CYS A 1 166 ? 34.309 45.874 20.468  1.00 20.61 ? 166 CYS A CB    1 
ATOM   1268 S SG    . CYS A 1 166 ? 33.734 44.203 20.024  1.00 22.63 ? 166 CYS A SG    1 
ATOM   1269 N N     . GLN A 1 167 ? 31.861 47.011 21.551  1.00 18.36 ? 167 GLN A N     1 
ATOM   1270 C CA    . GLN A 1 167 ? 30.406 47.030 21.665  1.00 20.31 ? 167 GLN A CA    1 
ATOM   1271 C C     . GLN A 1 167 ? 29.881 46.607 20.295  1.00 19.79 ? 167 GLN A C     1 
ATOM   1272 O O     . GLN A 1 167 ? 30.401 47.044 19.262  1.00 19.60 ? 167 GLN A O     1 
ATOM   1273 C CB    . GLN A 1 167 ? 29.855 48.423 21.994  1.00 18.58 ? 167 GLN A CB    1 
ATOM   1274 C CG    . GLN A 1 167 ? 28.306 48.427 22.017  1.00 19.98 ? 167 GLN A CG    1 
ATOM   1275 C CD    . GLN A 1 167 ? 27.678 49.773 22.343  1.00 21.78 ? 167 GLN A CD    1 
ATOM   1276 O OE1   . GLN A 1 167 ? 27.996 50.789 21.729  1.00 22.36 ? 167 GLN A OE1   1 
ATOM   1277 N NE2   . GLN A 1 167 ? 26.750 49.776 23.308  1.00 22.69 ? 167 GLN A NE2   1 
ATOM   1278 N N     . LEU A 1 168 ? 28.865 45.756 20.288  1.00 19.05 ? 168 LEU A N     1 
ATOM   1279 C CA    . LEU A 1 168 ? 28.288 45.293 19.038  1.00 20.29 ? 168 LEU A CA    1 
ATOM   1280 C C     . LEU A 1 168 ? 27.257 46.314 18.568  1.00 19.52 ? 168 LEU A C     1 
ATOM   1281 O O     . LEU A 1 168 ? 26.348 46.649 19.317  1.00 21.75 ? 168 LEU A O     1 
ATOM   1282 C CB    . LEU A 1 168 ? 27.628 43.932 19.261  1.00 18.42 ? 168 LEU A CB    1 
ATOM   1283 C CG    . LEU A 1 168 ? 26.923 43.317 18.052  1.00 21.48 ? 168 LEU A CG    1 
ATOM   1284 C CD1   . LEU A 1 168 ? 27.954 42.993 16.979  1.00 20.40 ? 168 LEU A CD1   1 
ATOM   1285 C CD2   . LEU A 1 168 ? 26.169 42.055 18.478  1.00 20.46 ? 168 LEU A CD2   1 
ATOM   1286 N N     . LEU A 1 169 ? 27.398 46.811 17.339  1.00 18.43 ? 169 LEU A N     1 
ATOM   1287 C CA    . LEU A 1 169 ? 26.454 47.784 16.803  1.00 21.81 ? 169 LEU A CA    1 
ATOM   1288 C C     . LEU A 1 169 ? 25.533 47.220 15.723  1.00 22.74 ? 169 LEU A C     1 
ATOM   1289 O O     . LEU A 1 169 ? 24.428 47.722 15.543  1.00 24.22 ? 169 LEU A O     1 
ATOM   1290 C CB    . LEU A 1 169 ? 27.192 48.990 16.219  1.00 22.38 ? 169 LEU A CB    1 
ATOM   1291 C CG    . LEU A 1 169 ? 27.843 49.990 17.172  1.00 24.70 ? 169 LEU A CG    1 
ATOM   1292 C CD1   . LEU A 1 169 ? 28.589 51.025 16.351  1.00 26.60 ? 169 LEU A CD1   1 
ATOM   1293 C CD2   . LEU A 1 169 ? 26.780 50.640 18.043  1.00 25.70 ? 169 LEU A CD2   1 
ATOM   1294 N N     . GLY A 1 170 ? 26.001 46.213 14.989  1.00 23.46 ? 170 GLY A N     1 
ATOM   1295 C CA    . GLY A 1 170 ? 25.171 45.642 13.941  1.00 23.73 ? 170 GLY A CA    1 
ATOM   1296 C C     . GLY A 1 170 ? 25.494 44.191 13.627  1.00 23.94 ? 170 GLY A C     1 
ATOM   1297 O O     . GLY A 1 170 ? 26.587 43.709 13.925  1.00 20.61 ? 170 GLY A O     1 
ATOM   1298 N N     . LYS A 1 171 ? 24.533 43.491 13.020  1.00 23.92 ? 171 LYS A N     1 
ATOM   1299 C CA    . LYS A 1 171 ? 24.697 42.088 12.649  1.00 24.90 ? 171 LYS A CA    1 
ATOM   1300 C C     . LYS A 1 171 ? 24.142 41.912 11.243  1.00 25.52 ? 171 LYS A C     1 
ATOM   1301 O O     . LYS A 1 171 ? 23.182 42.586 10.865  1.00 26.32 ? 171 LYS A O     1 
ATOM   1302 C CB    . LYS A 1 171 ? 23.893 41.175 13.583  1.00 27.36 ? 171 LYS A CB    1 
ATOM   1303 C CG    . LYS A 1 171 ? 24.332 41.148 15.031  1.00 29.35 ? 171 LYS A CG    1 
ATOM   1304 C CD    . LYS A 1 171 ? 23.185 40.682 15.930  1.00 31.76 ? 171 LYS A CD    1 
ATOM   1305 C CE    . LYS A 1 171 ? 22.709 39.270 15.597  1.00 32.09 ? 171 LYS A CE    1 
ATOM   1306 N NZ    . LYS A 1 171 ? 21.544 38.882 16.448  1.00 30.92 ? 171 LYS A NZ    1 
ATOM   1307 N N     . ALA A 1 172 ? 24.733 41.006 10.472  1.00 25.67 ? 172 ALA A N     1 
ATOM   1308 C CA    . ALA A 1 172 ? 24.236 40.768 9.125   1.00 25.40 ? 172 ALA A CA    1 
ATOM   1309 C C     . ALA A 1 172 ? 24.607 39.400 8.583   1.00 27.44 ? 172 ALA A C     1 
ATOM   1310 O O     . ALA A 1 172 ? 25.754 38.953 8.690   1.00 24.67 ? 172 ALA A O     1 
ATOM   1311 C CB    . ALA A 1 172 ? 24.739 41.842 8.187   1.00 26.46 ? 172 ALA A CB    1 
ATOM   1312 N N     . GLU A 1 173 ? 23.613 38.722 8.017   1.00 26.20 ? 173 GLU A N     1 
ATOM   1313 C CA    . GLU A 1 173 ? 23.851 37.432 7.404   1.00 27.56 ? 173 GLU A CA    1 
ATOM   1314 C C     . GLU A 1 173 ? 24.699 37.717 6.167   1.00 26.71 ? 173 GLU A C     1 
ATOM   1315 O O     . GLU A 1 173 ? 24.644 38.816 5.605   1.00 26.94 ? 173 GLU A O     1 
ATOM   1316 C CB    . GLU A 1 173 ? 22.524 36.791 6.978   1.00 27.60 ? 173 GLU A CB    1 
ATOM   1317 C CG    . GLU A 1 173 ? 21.640 36.336 8.134   1.00 27.61 ? 173 GLU A CG    1 
ATOM   1318 C CD    . GLU A 1 173 ? 22.178 35.097 8.831   1.00 29.16 ? 173 GLU A CD    1 
ATOM   1319 O OE1   . GLU A 1 173 ? 23.007 34.390 8.223   1.00 31.64 ? 173 GLU A OE1   1 
ATOM   1320 O OE2   . GLU A 1 173 ? 21.759 34.822 9.976   1.00 32.20 ? 173 GLU A OE2   1 
ATOM   1321 N N     . VAL A 1 174 ? 25.481 36.733 5.741   1.00 27.81 ? 174 VAL A N     1 
ATOM   1322 C CA    . VAL A 1 174 ? 26.321 36.895 4.565   1.00 31.18 ? 174 VAL A CA    1 
ATOM   1323 C C     . VAL A 1 174 ? 26.043 35.781 3.562   1.00 33.07 ? 174 VAL A C     1 
ATOM   1324 O O     . VAL A 1 174 ? 25.380 36.004 2.546   1.00 36.11 ? 174 VAL A O     1 
ATOM   1325 C CB    . VAL A 1 174 ? 27.819 36.882 4.941   1.00 30.81 ? 174 VAL A CB    1 
ATOM   1326 C CG1   . VAL A 1 174 ? 28.674 37.010 3.687   1.00 31.24 ? 174 VAL A CG1   1 
ATOM   1327 C CG2   . VAL A 1 174 ? 28.123 38.030 5.902   1.00 31.85 ? 174 VAL A CG2   1 
ATOM   1328 N N     . ASP A 1 175 ? 26.541 34.586 3.856   1.00 34.53 ? 175 ASP A N     1 
ATOM   1329 C CA    . ASP A 1 175 ? 26.355 33.439 2.973   1.00 35.19 ? 175 ASP A CA    1 
ATOM   1330 C C     . ASP A 1 175 ? 26.258 32.132 3.753   1.00 35.36 ? 175 ASP A C     1 
ATOM   1331 O O     . ASP A 1 175 ? 26.642 31.074 3.252   1.00 36.01 ? 175 ASP A O     1 
ATOM   1332 C CB    . ASP A 1 175 ? 27.511 33.350 1.975   1.00 37.47 ? 175 ASP A CB    1 
ATOM   1333 C CG    . ASP A 1 175 ? 28.857 33.197 2.657   1.00 39.72 ? 175 ASP A CG    1 
ATOM   1334 O OD1   . ASP A 1 175 ? 28.885 33.095 3.902   1.00 39.07 ? 175 ASP A OD1   1 
ATOM   1335 O OD2   . ASP A 1 175 ? 29.883 33.179 1.945   1.00 41.97 ? 175 ASP A OD2   1 
ATOM   1336 N N     . GLY A 1 176 ? 25.764 32.214 4.984   1.00 34.45 ? 176 GLY A N     1 
ATOM   1337 C CA    . GLY A 1 176 ? 25.607 31.023 5.800   1.00 34.83 ? 176 GLY A CA    1 
ATOM   1338 C C     . GLY A 1 176 ? 26.893 30.469 6.381   1.00 34.16 ? 176 GLY A C     1 
ATOM   1339 O O     . GLY A 1 176 ? 26.922 30.067 7.547   1.00 36.12 ? 176 GLY A O     1 
ATOM   1340 N N     . ALA A 1 177 ? 27.951 30.432 5.575   1.00 31.54 ? 177 ALA A N     1 
ATOM   1341 C CA    . ALA A 1 177 ? 29.239 29.934 6.046   1.00 30.71 ? 177 ALA A CA    1 
ATOM   1342 C C     . ALA A 1 177 ? 29.954 31.012 6.867   1.00 29.83 ? 177 ALA A C     1 
ATOM   1343 O O     . ALA A 1 177 ? 30.918 30.731 7.580   1.00 29.05 ? 177 ALA A O     1 
ATOM   1344 C CB    . ALA A 1 177 ? 30.100 29.529 4.869   1.00 29.46 ? 177 ALA A CB    1 
ATOM   1345 N N     . SER A 1 178 ? 29.490 32.251 6.739   1.00 30.28 ? 178 SER A N     1 
ATOM   1346 C CA    . SER A 1 178 ? 30.076 33.366 7.477   1.00 28.47 ? 178 SER A CA    1 
ATOM   1347 C C     . SER A 1 178 ? 28.989 34.347 7.915   1.00 29.77 ? 178 SER A C     1 
ATOM   1348 O O     . SER A 1 178 ? 27.895 34.371 7.347   1.00 28.23 ? 178 SER A O     1 
ATOM   1349 C CB    . SER A 1 178 ? 31.129 34.078 6.619   1.00 28.53 ? 178 SER A CB    1 
ATOM   1350 O OG    . SER A 1 178 ? 30.575 34.595 5.422   1.00 27.37 ? 178 SER A OG    1 
ATOM   1351 N N     . PHE A 1 179 ? 29.299 35.157 8.923   1.00 26.91 ? 179 PHE A N     1 
ATOM   1352 C CA    . PHE A 1 179 ? 28.349 36.117 9.459   1.00 26.59 ? 179 PHE A CA    1 
ATOM   1353 C C     . PHE A 1 179 ? 29.083 37.408 9.818   1.00 25.51 ? 179 PHE A C     1 
ATOM   1354 O O     . PHE A 1 179 ? 30.200 37.358 10.328  1.00 24.57 ? 179 PHE A O     1 
ATOM   1355 C CB    . PHE A 1 179 ? 27.700 35.525 10.707  1.00 25.89 ? 179 PHE A CB    1 
ATOM   1356 C CG    . PHE A 1 179 ? 26.503 36.284 11.190  1.00 27.84 ? 179 PHE A CG    1 
ATOM   1357 C CD1   . PHE A 1 179 ? 25.240 36.021 10.671  1.00 26.16 ? 179 PHE A CD1   1 
ATOM   1358 C CD2   . PHE A 1 179 ? 26.637 37.264 12.167  1.00 25.40 ? 179 PHE A CD2   1 
ATOM   1359 C CE1   . PHE A 1 179 ? 24.124 36.725 11.116  1.00 27.33 ? 179 PHE A CE1   1 
ATOM   1360 C CE2   . PHE A 1 179 ? 25.538 37.974 12.621  1.00 25.94 ? 179 PHE A CE2   1 
ATOM   1361 C CZ    . PHE A 1 179 ? 24.273 37.706 12.094  1.00 27.02 ? 179 PHE A CZ    1 
ATOM   1362 N N     . LEU A 1 180 ? 28.451 38.547 9.558   1.00 24.20 ? 180 LEU A N     1 
ATOM   1363 C CA    . LEU A 1 180 ? 29.049 39.856 9.829   1.00 25.21 ? 180 LEU A CA    1 
ATOM   1364 C C     . LEU A 1 180 ? 28.657 40.497 11.163  1.00 25.53 ? 180 LEU A C     1 
ATOM   1365 O O     . LEU A 1 180 ? 27.490 40.529 11.543  1.00 24.91 ? 180 LEU A O     1 
ATOM   1366 C CB    . LEU A 1 180 ? 28.688 40.836 8.707   1.00 27.35 ? 180 LEU A CB    1 
ATOM   1367 C CG    . LEU A 1 180 ? 29.117 42.297 8.904   1.00 28.80 ? 180 LEU A CG    1 
ATOM   1368 C CD1   . LEU A 1 180 ? 30.635 42.396 8.843   1.00 28.25 ? 180 LEU A CD1   1 
ATOM   1369 C CD2   . LEU A 1 180 ? 28.491 43.182 7.833   1.00 28.77 ? 180 LEU A CD2   1 
ATOM   1370 N N     . LEU A 1 181 ? 29.662 41.009 11.862  1.00 23.64 ? 181 LEU A N     1 
ATOM   1371 C CA    . LEU A 1 181 ? 29.463 41.713 13.119  1.00 21.49 ? 181 LEU A CA    1 
ATOM   1372 C C     . LEU A 1 181 ? 30.107 43.086 12.932  1.00 21.79 ? 181 LEU A C     1 
ATOM   1373 O O     . LEU A 1 181 ? 31.281 43.169 12.548  1.00 21.34 ? 181 LEU A O     1 
ATOM   1374 C CB    . LEU A 1 181 ? 30.160 40.988 14.275  1.00 20.55 ? 181 LEU A CB    1 
ATOM   1375 C CG    . LEU A 1 181 ? 29.638 39.618 14.712  1.00 22.14 ? 181 LEU A CG    1 
ATOM   1376 C CD1   . LEU A 1 181 ? 30.445 39.131 15.910  1.00 19.57 ? 181 LEU A CD1   1 
ATOM   1377 C CD2   . LEU A 1 181 ? 28.162 39.722 15.073  1.00 21.88 ? 181 LEU A CD2   1 
ATOM   1378 N N     . LYS A 1 182 ? 29.344 44.155 13.144  1.00 19.92 ? 182 LYS A N     1 
ATOM   1379 C CA    . LYS A 1 182 ? 29.911 45.490 13.029  1.00 20.74 ? 182 LYS A CA    1 
ATOM   1380 C C     . LYS A 1 182 ? 30.076 45.924 14.481  1.00 19.98 ? 182 LYS A C     1 
ATOM   1381 O O     . LYS A 1 182 ? 29.095 45.973 15.241  1.00 19.33 ? 182 LYS A O     1 
ATOM   1382 C CB    . LYS A 1 182 ? 28.963 46.409 12.253  1.00 21.68 ? 182 LYS A CB    1 
ATOM   1383 C CG    . LYS A 1 182 ? 28.786 45.992 10.800  1.00 27.74 ? 182 LYS A CG    1 
ATOM   1384 C CD    . LYS A 1 182 ? 27.830 46.922 10.048  1.00 29.12 ? 182 LYS A CD    1 
ATOM   1385 C CE    . LYS A 1 182 ? 28.540 48.105 9.420   1.00 29.92 ? 182 LYS A CE    1 
ATOM   1386 N NZ    . LYS A 1 182 ? 29.311 47.724 8.191   1.00 26.81 ? 182 LYS A NZ    1 
ATOM   1387 N N     . VAL A 1 183 ? 31.315 46.219 14.863  1.00 18.04 ? 183 VAL A N     1 
ATOM   1388 C CA    . VAL A 1 183 ? 31.621 46.591 16.234  1.00 17.18 ? 183 VAL A CA    1 
ATOM   1389 C C     . VAL A 1 183 ? 32.484 47.850 16.296  1.00 18.29 ? 183 VAL A C     1 
ATOM   1390 O O     . VAL A 1 183 ? 32.937 48.358 15.267  1.00 18.84 ? 183 VAL A O     1 
ATOM   1391 C CB    . VAL A 1 183 ? 32.394 45.450 16.949  1.00 17.50 ? 183 VAL A CB    1 
ATOM   1392 C CG1   . VAL A 1 183 ? 31.653 44.115 16.801  1.00 18.74 ? 183 VAL A CG1   1 
ATOM   1393 C CG2   . VAL A 1 183 ? 33.811 45.335 16.358  1.00 17.64 ? 183 VAL A CG2   1 
ATOM   1394 N N     . TRP A 1 184 ? 32.710 48.356 17.506  1.00 17.42 ? 184 TRP A N     1 
ATOM   1395 C CA    . TRP A 1 184 ? 33.563 49.535 17.672  1.00 17.60 ? 184 TRP A CA    1 
ATOM   1396 C C     . TRP A 1 184 ? 34.079 49.608 19.108  1.00 18.05 ? 184 TRP A C     1 
ATOM   1397 O O     . TRP A 1 184 ? 33.567 48.908 19.992  1.00 15.47 ? 184 TRP A O     1 
ATOM   1398 C CB    . TRP A 1 184 ? 32.812 50.836 17.312  1.00 16.06 ? 184 TRP A CB    1 
ATOM   1399 C CG    . TRP A 1 184 ? 31.800 51.320 18.332  1.00 17.66 ? 184 TRP A CG    1 
ATOM   1400 C CD1   . TRP A 1 184 ? 30.856 50.562 18.983  1.00 19.85 ? 184 TRP A CD1   1 
ATOM   1401 C CD2   . TRP A 1 184 ? 31.559 52.681 18.730  1.00 18.94 ? 184 TRP A CD2   1 
ATOM   1402 N NE1   . TRP A 1 184 ? 30.043 51.371 19.745  1.00 20.94 ? 184 TRP A NE1   1 
ATOM   1403 C CE2   . TRP A 1 184 ? 30.448 52.670 19.608  1.00 21.34 ? 184 TRP A CE2   1 
ATOM   1404 C CE3   . TRP A 1 184 ? 32.164 53.906 18.424  1.00 19.33 ? 184 TRP A CE3   1 
ATOM   1405 C CZ2   . TRP A 1 184 ? 29.931 53.847 20.187  1.00 22.85 ? 184 TRP A CZ2   1 
ATOM   1406 C CZ3   . TRP A 1 184 ? 31.645 55.077 19.004  1.00 23.18 ? 184 TRP A CZ3   1 
ATOM   1407 C CH2   . TRP A 1 184 ? 30.539 55.031 19.871  1.00 21.06 ? 184 TRP A CH2   1 
ATOM   1408 N N     . ASP A 1 185 ? 35.110 50.422 19.326  1.00 18.35 ? 185 ASP A N     1 
ATOM   1409 C CA    . ASP A 1 185 ? 35.653 50.587 20.675  1.00 18.70 ? 185 ASP A CA    1 
ATOM   1410 C C     . ASP A 1 185 ? 35.981 52.055 20.982  1.00 20.76 ? 185 ASP A C     1 
ATOM   1411 O O     . ASP A 1 185 ? 36.554 52.377 22.025  1.00 22.38 ? 185 ASP A O     1 
ATOM   1412 C CB    . ASP A 1 185 ? 36.874 49.679 20.888  1.00 19.24 ? 185 ASP A CB    1 
ATOM   1413 C CG    . ASP A 1 185 ? 38.137 50.192 20.207  1.00 22.94 ? 185 ASP A CG    1 
ATOM   1414 O OD1   . ASP A 1 185 ? 38.085 51.222 19.489  1.00 22.42 ? 185 ASP A OD1   1 
ATOM   1415 O OD2   . ASP A 1 185 ? 39.195 49.544 20.399  1.00 22.01 ? 185 ASP A OD2   1 
ATOM   1416 N N     . GLY A 1 186 ? 35.595 52.947 20.077  1.00 19.64 ? 186 GLY A N     1 
ATOM   1417 C CA    . GLY A 1 186 ? 35.847 54.362 20.297  1.00 22.02 ? 186 GLY A CA    1 
ATOM   1418 C C     . GLY A 1 186 ? 37.119 54.892 19.659  1.00 21.29 ? 186 GLY A C     1 
ATOM   1419 O O     . GLY A 1 186 ? 37.395 56.099 19.730  1.00 21.36 ? 186 GLY A O     1 
ATOM   1420 N N     . THR A 1 187 ? 37.898 54.011 19.035  1.00 20.53 ? 187 THR A N     1 
ATOM   1421 C CA    . THR A 1 187 ? 39.127 54.446 18.363  1.00 19.88 ? 187 THR A CA    1 
ATOM   1422 C C     . THR A 1 187 ? 39.141 53.983 16.897  1.00 20.40 ? 187 THR A C     1 
ATOM   1423 O O     . THR A 1 187 ? 38.465 53.023 16.529  1.00 19.23 ? 187 THR A O     1 
ATOM   1424 C CB    . THR A 1 187 ? 40.381 53.916 19.084  1.00 20.11 ? 187 THR A CB    1 
ATOM   1425 O OG1   . THR A 1 187 ? 40.462 52.496 18.930  1.00 21.63 ? 187 THR A OG1   1 
ATOM   1426 C CG2   . THR A 1 187 ? 40.298 54.250 20.572  1.00 23.83 ? 187 THR A CG2   1 
ATOM   1427 N N     . ARG A 1 188 ? 39.915 54.670 16.061  1.00 20.53 ? 188 ARG A N     1 
ATOM   1428 C CA    . ARG A 1 188 ? 39.994 54.335 14.635  1.00 19.72 ? 188 ARG A CA    1 
ATOM   1429 C C     . ARG A 1 188 ? 41.226 53.520 14.259  1.00 19.72 ? 188 ARG A C     1 
ATOM   1430 O O     . ARG A 1 188 ? 42.342 53.828 14.686  1.00 18.87 ? 188 ARG A O     1 
ATOM   1431 C CB    . ARG A 1 188 ? 39.986 55.621 13.782  1.00 20.99 ? 188 ARG A CB    1 
ATOM   1432 C CG    . ARG A 1 188 ? 38.657 56.352 13.757  1.00 26.01 ? 188 ARG A CG    1 
ATOM   1433 C CD    . ARG A 1 188 ? 38.739 57.505 12.754  1.00 28.44 ? 188 ARG A CD    1 
ATOM   1434 N NE    . ARG A 1 188 ? 37.463 58.199 12.578  1.00 30.15 ? 188 ARG A NE    1 
ATOM   1435 C CZ    . ARG A 1 188 ? 36.970 59.096 13.423  1.00 31.74 ? 188 ARG A CZ    1 
ATOM   1436 N NH1   . ARG A 1 188 ? 37.639 59.419 14.518  1.00 32.24 ? 188 ARG A NH1   1 
ATOM   1437 N NH2   . ARG A 1 188 ? 35.807 59.683 13.163  1.00 35.09 ? 188 ARG A NH2   1 
ATOM   1438 N N     . THR A 1 189 ? 41.016 52.493 13.441  1.00 17.78 ? 189 THR A N     1 
ATOM   1439 C CA    . THR A 1 189 ? 42.100 51.630 12.983  1.00 17.89 ? 189 THR A CA    1 
ATOM   1440 C C     . THR A 1 189 ? 43.063 52.490 12.153  1.00 18.49 ? 189 THR A C     1 
ATOM   1441 O O     . THR A 1 189 ? 42.691 53.547 11.658  1.00 19.63 ? 189 THR A O     1 
ATOM   1442 C CB    . THR A 1 189 ? 41.544 50.480 12.103  1.00 18.54 ? 189 THR A CB    1 
ATOM   1443 O OG1   . THR A 1 189 ? 40.594 51.024 11.179  1.00 14.68 ? 189 THR A OG1   1 
ATOM   1444 C CG2   . THR A 1 189 ? 40.816 49.424 12.958  1.00 16.81 ? 189 THR A CG2   1 
ATOM   1445 N N     . PRO A 1 190 ? 44.320 52.044 12.015  1.00 19.86 ? 190 PRO A N     1 
ATOM   1446 C CA    . PRO A 1 190 ? 45.322 52.789 11.241  1.00 19.85 ? 190 PRO A CA    1 
ATOM   1447 C C     . PRO A 1 190 ? 45.012 52.824 9.736   1.00 18.08 ? 190 PRO A C     1 
ATOM   1448 O O     . PRO A 1 190 ? 45.429 53.745 9.041   1.00 17.99 ? 190 PRO A O     1 
ATOM   1449 C CB    . PRO A 1 190 ? 46.627 52.063 11.565  1.00 22.86 ? 190 PRO A CB    1 
ATOM   1450 C CG    . PRO A 1 190 ? 46.183 50.675 11.905  1.00 22.36 ? 190 PRO A CG    1 
ATOM   1451 C CD    . PRO A 1 190 ? 44.930 50.892 12.701  1.00 20.19 ? 190 PRO A CD    1 
ATOM   1452 N N     . PHE A 1 191 ? 44.298 51.808 9.253   1.00 17.52 ? 191 PHE A N     1 
ATOM   1453 C CA    . PHE A 1 191 ? 43.868 51.741 7.854   1.00 19.01 ? 191 PHE A CA    1 
ATOM   1454 C C     . PHE A 1 191 ? 42.356 51.513 7.922   1.00 18.98 ? 191 PHE A C     1 
ATOM   1455 O O     . PHE A 1 191 ? 41.853 50.903 8.873   1.00 19.38 ? 191 PHE A O     1 
ATOM   1456 C CB    . PHE A 1 191 ? 44.472 50.547 7.116   1.00 19.46 ? 191 PHE A CB    1 
ATOM   1457 C CG    . PHE A 1 191 ? 45.958 50.518 7.113   1.00 20.53 ? 191 PHE A CG    1 
ATOM   1458 C CD1   . PHE A 1 191 ? 46.671 51.221 6.150   1.00 20.01 ? 191 PHE A CD1   1 
ATOM   1459 C CD2   . PHE A 1 191 ? 46.656 49.769 8.066   1.00 23.51 ? 191 PHE A CD2   1 
ATOM   1460 C CE1   . PHE A 1 191 ? 48.064 51.180 6.130   1.00 24.38 ? 191 PHE A CE1   1 
ATOM   1461 C CE2   . PHE A 1 191 ? 48.050 49.720 8.053   1.00 23.65 ? 191 PHE A CE2   1 
ATOM   1462 C CZ    . PHE A 1 191 ? 48.752 50.430 7.078   1.00 22.86 ? 191 PHE A CZ    1 
ATOM   1463 N N     . PRO A 1 192 ? 41.609 51.973 6.908   1.00 21.03 ? 192 PRO A N     1 
ATOM   1464 C CA    . PRO A 1 192 ? 40.157 51.765 6.950   1.00 19.77 ? 192 PRO A CA    1 
ATOM   1465 C C     . PRO A 1 192 ? 39.780 50.281 6.984   1.00 20.18 ? 192 PRO A C     1 
ATOM   1466 O O     . PRO A 1 192 ? 40.408 49.438 6.320   1.00 18.61 ? 192 PRO A O     1 
ATOM   1467 C CB    . PRO A 1 192 ? 39.660 52.433 5.655   1.00 21.63 ? 192 PRO A CB    1 
ATOM   1468 C CG    . PRO A 1 192 ? 40.779 53.398 5.277   1.00 23.54 ? 192 PRO A CG    1 
ATOM   1469 C CD    . PRO A 1 192 ? 42.021 52.627 5.651   1.00 19.25 ? 192 PRO A CD    1 
ATOM   1470 N N     . SER A 1 193 ? 38.745 49.961 7.751   1.00 18.53 ? 193 SER A N     1 
ATOM   1471 C CA    . SER A 1 193 ? 38.264 48.586 7.806   1.00 17.82 ? 193 SER A CA    1 
ATOM   1472 C C     . SER A 1 193 ? 37.745 48.165 6.434   1.00 18.83 ? 193 SER A C     1 
ATOM   1473 O O     . SER A 1 193 ? 37.252 49.000 5.670   1.00 18.79 ? 193 SER A O     1 
ATOM   1474 C CB    . SER A 1 193 ? 37.086 48.445 8.775   1.00 19.62 ? 193 SER A CB    1 
ATOM   1475 O OG    . SER A 1 193 ? 36.535 47.122 8.707   1.00 20.66 ? 193 SER A OG    1 
ATOM   1476 N N     . TRP A 1 194 ? 37.872 46.885 6.114   1.00 17.53 ? 194 TRP A N     1 
ATOM   1477 C CA    . TRP A 1 194 ? 37.292 46.399 4.871   1.00 21.03 ? 194 TRP A CA    1 
ATOM   1478 C C     . TRP A 1 194 ? 35.772 46.445 5.119   1.00 22.05 ? 194 TRP A C     1 
ATOM   1479 O O     . TRP A 1 194 ? 35.320 46.594 6.271   1.00 21.05 ? 194 TRP A O     1 
ATOM   1480 C CB    . TRP A 1 194 ? 37.735 44.963 4.593   1.00 20.44 ? 194 TRP A CB    1 
ATOM   1481 C CG    . TRP A 1 194 ? 37.226 43.923 5.576   1.00 20.68 ? 194 TRP A CG    1 
ATOM   1482 C CD1   . TRP A 1 194 ? 36.959 44.106 6.903   1.00 20.10 ? 194 TRP A CD1   1 
ATOM   1483 C CD2   . TRP A 1 194 ? 37.043 42.528 5.322   1.00 21.47 ? 194 TRP A CD2   1 
ATOM   1484 N NE1   . TRP A 1 194 ? 36.631 42.912 7.495   1.00 21.92 ? 194 TRP A NE1   1 
ATOM   1485 C CE2   . TRP A 1 194 ? 36.671 41.921 6.541   1.00 21.40 ? 194 TRP A CE2   1 
ATOM   1486 C CE3   . TRP A 1 194 ? 37.154 41.726 4.174   1.00 21.74 ? 194 TRP A CE3   1 
ATOM   1487 C CZ2   . TRP A 1 194 ? 36.420 40.548 6.653   1.00 24.53 ? 194 TRP A CZ2   1 
ATOM   1488 C CZ3   . TRP A 1 194 ? 36.905 40.361 4.282   1.00 24.07 ? 194 TRP A CZ3   1 
ATOM   1489 C CH2   . TRP A 1 194 ? 36.538 39.786 5.511   1.00 25.06 ? 194 TRP A CH2   1 
ATOM   1490 N N     . ARG A 1 195 ? 34.979 46.347 4.055   1.00 23.04 ? 195 ARG A N     1 
ATOM   1491 C CA    . ARG A 1 195 ? 33.528 46.352 4.208   1.00 24.56 ? 195 ARG A CA    1 
ATOM   1492 C C     . ARG A 1 195 ? 32.938 45.213 3.393   1.00 28.42 ? 195 ARG A C     1 
ATOM   1493 O O     . ARG A 1 195 ? 33.068 45.182 2.165   1.00 27.01 ? 195 ARG A O     1 
ATOM   1494 C CB    . ARG A 1 195 ? 32.926 47.683 3.746   1.00 24.42 ? 195 ARG A CB    1 
ATOM   1495 C CG    . ARG A 1 195 ? 33.381 48.909 4.542   1.00 24.24 ? 195 ARG A CG    1 
ATOM   1496 C CD    . ARG A 1 195 ? 33.067 48.777 6.027   1.00 24.57 ? 195 ARG A CD    1 
ATOM   1497 N NE    . ARG A 1 195 ? 33.529 49.944 6.777   1.00 23.91 ? 195 ARG A NE    1 
ATOM   1498 C CZ    . ARG A 1 195 ? 33.361 50.103 8.087   1.00 25.08 ? 195 ARG A CZ    1 
ATOM   1499 N NH1   . ARG A 1 195 ? 32.744 49.167 8.797   1.00 22.80 ? 195 ARG A NH1   1 
ATOM   1500 N NH2   . ARG A 1 195 ? 33.800 51.207 8.685   1.00 25.31 ? 195 ARG A NH2   1 
ATOM   1501 N N     . VAL A 1 196 ? 32.299 44.277 4.084   1.00 30.91 ? 196 VAL A N     1 
ATOM   1502 C CA    . VAL A 1 196 ? 31.684 43.131 3.429   1.00 36.77 ? 196 VAL A CA    1 
ATOM   1503 C C     . VAL A 1 196 ? 30.406 43.558 2.703   1.00 39.13 ? 196 VAL A C     1 
ATOM   1504 O O     . VAL A 1 196 ? 29.577 44.280 3.256   1.00 39.12 ? 196 VAL A O     1 
ATOM   1505 C CB    . VAL A 1 196 ? 31.343 42.030 4.462   1.00 36.91 ? 196 VAL A CB    1 
ATOM   1506 C CG1   . VAL A 1 196 ? 30.689 40.839 3.773   1.00 38.43 ? 196 VAL A CG1   1 
ATOM   1507 C CG2   . VAL A 1 196 ? 32.612 41.587 5.180   1.00 36.73 ? 196 VAL A CG2   1 
ATOM   1508 N N     . LEU A 1 197 ? 30.245 43.119 1.459   1.00 43.56 ? 197 LEU A N     1 
ATOM   1509 C CA    . LEU A 1 197 ? 29.046 43.476 0.708   1.00 47.37 ? 197 LEU A CA    1 
ATOM   1510 C C     . LEU A 1 197 ? 27.802 42.910 1.384   1.00 48.76 ? 197 LEU A C     1 
ATOM   1511 O O     . LEU A 1 197 ? 27.608 41.696 1.421   1.00 49.80 ? 197 LEU A O     1 
ATOM   1512 C CB    . LEU A 1 197 ? 29.127 42.949 -0.730  1.00 48.10 ? 197 LEU A CB    1 
ATOM   1513 C CG    . LEU A 1 197 ? 27.839 43.068 -1.558  1.00 49.34 ? 197 LEU A CG    1 
ATOM   1514 C CD1   . LEU A 1 197 ? 27.398 44.524 -1.655  1.00 49.63 ? 197 LEU A CD1   1 
ATOM   1515 C CD2   . LEU A 1 197 ? 28.076 42.487 -2.945  1.00 50.30 ? 197 LEU A CD2   1 
ATOM   1516 N N     . ILE A 1 198 ? 26.963 43.793 1.923   1.00 50.43 ? 198 ILE A N     1 
ATOM   1517 C CA    . ILE A 1 198 ? 25.732 43.371 2.584   1.00 52.34 ? 198 ILE A CA    1 
ATOM   1518 C C     . ILE A 1 198 ? 24.546 43.676 1.679   1.00 54.29 ? 198 ILE A C     1 
ATOM   1519 O O     . ILE A 1 198 ? 24.579 44.630 0.900   1.00 55.20 ? 198 ILE A O     1 
ATOM   1520 C CB    . ILE A 1 198 ? 25.528 44.093 3.945   1.00 52.19 ? 198 ILE A CB    1 
ATOM   1521 C CG1   . ILE A 1 198 ? 26.635 43.687 4.923   1.00 52.47 ? 198 ILE A CG1   1 
ATOM   1522 C CG2   . ILE A 1 198 ? 24.168 43.735 4.536   1.00 52.24 ? 198 ILE A CG2   1 
ATOM   1523 C CD1   . ILE A 1 198 ? 26.739 42.186 5.141   1.00 50.10 ? 198 ILE A CD1   1 
ATOM   1524 N N     . GLN A 1 199 ? 23.507 42.854 1.779   1.00 54.85 ? 199 GLN A N     1 
ATOM   1525 C CA    . GLN A 1 199 ? 22.310 43.028 0.970   1.00 56.24 ? 199 GLN A CA    1 
ATOM   1526 C C     . GLN A 1 199 ? 21.300 43.892 1.714   1.00 56.31 ? 199 GLN A C     1 
ATOM   1527 O O     . GLN A 1 199 ? 21.648 44.567 2.684   1.00 56.60 ? 199 GLN A O     1 
ATOM   1528 C CB    . GLN A 1 199 ? 21.702 41.661 0.650   1.00 56.87 ? 199 GLN A CB    1 
ATOM   1529 C CG    . GLN A 1 199 ? 20.473 41.706 -0.233  1.00 58.23 ? 199 GLN A CG    1 
ATOM   1530 C CD    . GLN A 1 199 ? 19.992 40.322 -0.609  1.00 58.87 ? 199 GLN A CD    1 
ATOM   1531 O OE1   . GLN A 1 199 ? 19.753 39.480 0.258   1.00 58.29 ? 199 GLN A OE1   1 
ATOM   1532 N NE2   . GLN A 1 199 ? 19.847 40.078 -1.908  1.00 58.91 ? 199 GLN A NE2   1 
ATOM   1533 N N     . VAL A 1 202 ? 18.768 43.429 5.733   1.00 37.91 ? 202 VAL A N     1 
ATOM   1534 C CA    . VAL A 1 202 ? 19.630 42.360 6.236   1.00 38.74 ? 202 VAL A CA    1 
ATOM   1535 C C     . VAL A 1 202 ? 20.364 42.787 7.506   1.00 37.69 ? 202 VAL A C     1 
ATOM   1536 O O     . VAL A 1 202 ? 20.320 42.099 8.518   1.00 38.54 ? 202 VAL A O     1 
ATOM   1537 C CB    . VAL A 1 202 ? 20.685 41.943 5.189   1.00 38.53 ? 202 VAL A CB    1 
ATOM   1538 C CG1   . VAL A 1 202 ? 21.527 40.792 5.722   1.00 39.27 ? 202 VAL A CG1   1 
ATOM   1539 C CG2   . VAL A 1 202 ? 19.998 41.541 3.897   1.00 41.32 ? 202 VAL A CG2   1 
ATOM   1540 N N     . LEU A 1 203 ? 21.045 43.924 7.441   1.00 38.52 ? 203 LEU A N     1 
ATOM   1541 C CA    . LEU A 1 203 ? 21.782 44.438 8.593   1.00 38.37 ? 203 LEU A CA    1 
ATOM   1542 C C     . LEU A 1 203 ? 20.824 44.902 9.688   1.00 38.16 ? 203 LEU A C     1 
ATOM   1543 O O     . LEU A 1 203 ? 20.004 45.792 9.463   1.00 39.58 ? 203 LEU A O     1 
ATOM   1544 C CB    . LEU A 1 203 ? 22.677 45.609 8.162   1.00 37.91 ? 203 LEU A CB    1 
ATOM   1545 C CG    . LEU A 1 203 ? 23.565 46.263 9.225   1.00 37.30 ? 203 LEU A CG    1 
ATOM   1546 C CD1   . LEU A 1 203 ? 24.603 45.263 9.700   1.00 36.35 ? 203 LEU A CD1   1 
ATOM   1547 C CD2   . LEU A 1 203 ? 24.247 47.496 8.644   1.00 36.33 ? 203 LEU A CD2   1 
ATOM   1548 N N     . GLU A 1 204 ? 20.919 44.298 10.869  1.00 37.94 ? 204 GLU A N     1 
ATOM   1549 C CA    . GLU A 1 204 ? 20.064 44.702 11.979  1.00 39.09 ? 204 GLU A CA    1 
ATOM   1550 C C     . GLU A 1 204 ? 20.854 45.559 12.962  1.00 39.49 ? 204 GLU A C     1 
ATOM   1551 O O     . GLU A 1 204 ? 21.976 45.212 13.348  1.00 38.20 ? 204 GLU A O     1 
ATOM   1552 C CB    . GLU A 1 204 ? 19.474 43.485 12.704  1.00 41.88 ? 204 GLU A CB    1 
ATOM   1553 C CG    . GLU A 1 204 ? 20.479 42.579 13.389  1.00 45.65 ? 204 GLU A CG    1 
ATOM   1554 C CD    . GLU A 1 204 ? 19.809 41.552 14.296  1.00 49.35 ? 204 GLU A CD    1 
ATOM   1555 O OE1   . GLU A 1 204 ? 19.310 41.933 15.379  1.00 50.03 ? 204 GLU A OE1   1 
ATOM   1556 O OE2   . GLU A 1 204 ? 19.777 40.360 13.922  1.00 50.23 ? 204 GLU A OE2   1 
ATOM   1557 N N     . GLY A 1 205 ? 20.262 46.683 13.352  1.00 38.81 ? 205 GLY A N     1 
ATOM   1558 C CA    . GLY A 1 205 ? 20.907 47.596 14.277  1.00 38.93 ? 205 GLY A CA    1 
ATOM   1559 C C     . GLY A 1 205 ? 20.566 49.022 13.899  1.00 38.15 ? 205 GLY A C     1 
ATOM   1560 O O     . GLY A 1 205 ? 19.806 49.248 12.962  1.00 38.90 ? 205 GLY A O     1 
ATOM   1561 N N     . ASP A 1 206 ? 21.129 49.986 14.620  1.00 39.51 ? 206 ASP A N     1 
ATOM   1562 C CA    . ASP A 1 206 ? 20.873 51.403 14.361  1.00 39.29 ? 206 ASP A CA    1 
ATOM   1563 C C     . ASP A 1 206 ? 21.666 51.861 13.134  1.00 39.73 ? 206 ASP A C     1 
ATOM   1564 O O     . ASP A 1 206 ? 22.799 52.329 13.258  1.00 38.60 ? 206 ASP A O     1 
ATOM   1565 C CB    . ASP A 1 206 ? 21.284 52.231 15.585  1.00 39.85 ? 206 ASP A CB    1 
ATOM   1566 C CG    . ASP A 1 206 ? 20.716 53.642 15.565  1.00 40.29 ? 206 ASP A CG    1 
ATOM   1567 O OD1   . ASP A 1 206 ? 20.499 54.193 14.466  1.00 38.01 ? 206 ASP A OD1   1 
ATOM   1568 O OD2   . ASP A 1 206 ? 20.498 54.208 16.660  1.00 40.86 ? 206 ASP A OD2   1 
ATOM   1569 N N     . LEU A 1 207 ? 21.063 51.731 11.956  1.00 39.37 ? 207 LEU A N     1 
ATOM   1570 C CA    . LEU A 1 207 ? 21.708 52.114 10.703  1.00 40.23 ? 207 LEU A CA    1 
ATOM   1571 C C     . LEU A 1 207 ? 22.230 53.547 10.690  1.00 39.74 ? 207 LEU A C     1 
ATOM   1572 O O     . LEU A 1 207 ? 23.341 53.803 10.220  1.00 38.65 ? 207 LEU A O     1 
ATOM   1573 C CB    . LEU A 1 207 ? 20.736 51.924 9.531   1.00 41.77 ? 207 LEU A CB    1 
ATOM   1574 C CG    . LEU A 1 207 ? 20.237 50.496 9.283   1.00 44.26 ? 207 LEU A CG    1 
ATOM   1575 C CD1   . LEU A 1 207 ? 19.160 50.500 8.208   1.00 45.66 ? 207 LEU A CD1   1 
ATOM   1576 C CD2   . LEU A 1 207 ? 21.400 49.616 8.864   1.00 45.10 ? 207 LEU A CD2   1 
ATOM   1577 N N     . SER A 1 208 ? 21.429 54.482 11.193  1.00 39.38 ? 208 SER A N     1 
ATOM   1578 C CA    . SER A 1 208 ? 21.835 55.881 11.219  1.00 39.20 ? 208 SER A CA    1 
ATOM   1579 C C     . SER A 1 208 ? 23.057 56.082 12.112  1.00 37.54 ? 208 SER A C     1 
ATOM   1580 O O     . SER A 1 208 ? 23.982 56.813 11.747  1.00 38.08 ? 208 SER A O     1 
ATOM   1581 C CB    . SER A 1 208 ? 20.672 56.768 11.694  1.00 40.39 ? 208 SER A CB    1 
ATOM   1582 O OG    . SER A 1 208 ? 20.176 56.348 12.951  1.00 45.06 ? 208 SER A OG    1 
ATOM   1583 N N     . HIS A 1 209 ? 23.064 55.434 13.273  1.00 35.36 ? 209 HIS A N     1 
ATOM   1584 C CA    . HIS A 1 209 ? 24.193 55.553 14.191  1.00 34.91 ? 209 HIS A CA    1 
ATOM   1585 C C     . HIS A 1 209 ? 25.441 54.990 13.507  1.00 33.18 ? 209 HIS A C     1 
ATOM   1586 O O     . HIS A 1 209 ? 26.501 55.618 13.502  1.00 31.35 ? 209 HIS A O     1 
ATOM   1587 C CB    . HIS A 1 209 ? 23.929 54.768 15.484  1.00 36.03 ? 209 HIS A CB    1 
ATOM   1588 C CG    . HIS A 1 209 ? 24.941 55.020 16.561  1.00 35.86 ? 209 HIS A CG    1 
ATOM   1589 N ND1   . HIS A 1 209 ? 25.204 54.115 17.568  1.00 36.39 ? 209 HIS A ND1   1 
ATOM   1590 C CD2   . HIS A 1 209 ? 25.727 56.096 16.810  1.00 36.78 ? 209 HIS A CD2   1 
ATOM   1591 C CE1   . HIS A 1 209 ? 26.107 54.621 18.389  1.00 36.45 ? 209 HIS A CE1   1 
ATOM   1592 N NE2   . HIS A 1 209 ? 26.441 55.823 17.952  1.00 37.53 ? 209 HIS A NE2   1 
ATOM   1593 N N     . ILE A 1 210 ? 25.304 53.806 12.920  1.00 32.21 ? 210 ILE A N     1 
ATOM   1594 C CA    . ILE A 1 210 ? 26.425 53.169 12.241  1.00 31.68 ? 210 ILE A CA    1 
ATOM   1595 C C     . ILE A 1 210 ? 26.988 54.080 11.158  1.00 32.75 ? 210 ILE A C     1 
ATOM   1596 O O     . ILE A 1 210 ? 28.199 54.298 11.078  1.00 31.82 ? 210 ILE A O     1 
ATOM   1597 C CB    . ILE A 1 210 ? 25.998 51.820 11.620  1.00 32.11 ? 210 ILE A CB    1 
ATOM   1598 C CG1   . ILE A 1 210 ? 25.682 50.825 12.740  1.00 31.66 ? 210 ILE A CG1   1 
ATOM   1599 C CG2   . ILE A 1 210 ? 27.098 51.284 10.703  1.00 30.36 ? 210 ILE A CG2   1 
ATOM   1600 C CD1   . ILE A 1 210 ? 25.109 49.503 12.249  1.00 33.90 ? 210 ILE A CD1   1 
ATOM   1601 N N     . HIS A 1 211 ? 26.105 54.615 10.324  1.00 33.09 ? 211 HIS A N     1 
ATOM   1602 C CA    . HIS A 1 211 ? 26.526 55.501 9.247   1.00 36.57 ? 211 HIS A CA    1 
ATOM   1603 C C     . HIS A 1 211 ? 27.210 56.764 9.772   1.00 34.98 ? 211 HIS A C     1 
ATOM   1604 O O     . HIS A 1 211 ? 28.169 57.249 9.179   1.00 34.64 ? 211 HIS A O     1 
ATOM   1605 C CB    . HIS A 1 211 ? 25.318 55.870 8.374   1.00 40.61 ? 211 HIS A CB    1 
ATOM   1606 C CG    . HIS A 1 211 ? 25.648 56.793 7.241   1.00 46.50 ? 211 HIS A CG    1 
ATOM   1607 N ND1   . HIS A 1 211 ? 25.863 58.143 7.418   1.00 48.63 ? 211 HIS A ND1   1 
ATOM   1608 C CD2   . HIS A 1 211 ? 25.808 56.557 5.915   1.00 48.41 ? 211 HIS A CD2   1 
ATOM   1609 C CE1   . HIS A 1 211 ? 26.142 58.700 6.251   1.00 49.63 ? 211 HIS A CE1   1 
ATOM   1610 N NE2   . HIS A 1 211 ? 26.114 57.759 5.324   1.00 50.17 ? 211 HIS A NE2   1 
ATOM   1611 N N     . ARG A 1 212 ? 26.728 57.293 10.889  1.00 35.03 ? 212 ARG A N     1 
ATOM   1612 C CA    . ARG A 1 212 ? 27.330 58.494 11.452  1.00 35.64 ? 212 ARG A CA    1 
ATOM   1613 C C     . ARG A 1 212 ? 28.719 58.227 12.031  1.00 33.72 ? 212 ARG A C     1 
ATOM   1614 O O     . ARG A 1 212 ? 29.582 59.106 12.019  1.00 34.06 ? 212 ARG A O     1 
ATOM   1615 C CB    . ARG A 1 212 ? 26.407 59.106 12.514  1.00 39.82 ? 212 ARG A CB    1 
ATOM   1616 C CG    . ARG A 1 212 ? 25.198 59.808 11.900  1.00 44.31 ? 212 ARG A CG    1 
ATOM   1617 C CD    . ARG A 1 212 ? 24.349 60.569 12.916  1.00 49.96 ? 212 ARG A CD    1 
ATOM   1618 N NE    . ARG A 1 212 ? 23.509 59.706 13.743  1.00 52.90 ? 212 ARG A NE    1 
ATOM   1619 C CZ    . ARG A 1 212 ? 23.919 59.092 14.850  1.00 54.07 ? 212 ARG A CZ    1 
ATOM   1620 N NH1   . ARG A 1 212 ? 25.169 59.243 15.276  1.00 55.60 ? 212 ARG A NH1   1 
ATOM   1621 N NH2   . ARG A 1 212 ? 23.076 58.331 15.538  1.00 54.27 ? 212 ARG A NH2   1 
ATOM   1622 N N     . LEU A 1 213 ? 28.946 57.012 12.513  1.00 30.56 ? 213 LEU A N     1 
ATOM   1623 C CA    . LEU A 1 213 ? 30.245 56.662 13.088  1.00 29.97 ? 213 LEU A CA    1 
ATOM   1624 C C     . LEU A 1 213 ? 31.348 56.461 12.038  1.00 29.87 ? 213 LEU A C     1 
ATOM   1625 O O     . LEU A 1 213 ? 32.538 56.511 12.350  1.00 27.72 ? 213 LEU A O     1 
ATOM   1626 C CB    . LEU A 1 213 ? 30.106 55.410 13.959  1.00 28.90 ? 213 LEU A CB    1 
ATOM   1627 C CG    . LEU A 1 213 ? 29.375 55.634 15.291  1.00 30.37 ? 213 LEU A CG    1 
ATOM   1628 C CD1   . LEU A 1 213 ? 29.263 54.324 16.050  1.00 28.16 ? 213 LEU A CD1   1 
ATOM   1629 C CD2   . LEU A 1 213 ? 30.127 56.671 16.125  1.00 27.74 ? 213 LEU A CD2   1 
ATOM   1630 N N     . GLN A 1 214 ? 30.949 56.237 10.790  1.00 29.62 ? 214 GLN A N     1 
ATOM   1631 C CA    . GLN A 1 214 ? 31.906 56.034 9.715   1.00 29.09 ? 214 GLN A CA    1 
ATOM   1632 C C     . GLN A 1 214 ? 32.967 54.979 10.052  1.00 26.77 ? 214 GLN A C     1 
ATOM   1633 O O     . GLN A 1 214 ? 32.638 53.866 10.478  1.00 23.08 ? 214 GLN A O     1 
ATOM   1634 C CB    . GLN A 1 214 ? 32.581 57.366 9.369   1.00 34.96 ? 214 GLN A CB    1 
ATOM   1635 C CG    . GLN A 1 214 ? 31.613 58.532 9.241   1.00 40.70 ? 214 GLN A CG    1 
ATOM   1636 C CD    . GLN A 1 214 ? 32.315 59.866 9.061   1.00 45.30 ? 214 GLN A CD    1 
ATOM   1637 O OE1   . GLN A 1 214 ? 33.324 60.145 9.713   1.00 47.25 ? 214 GLN A OE1   1 
ATOM   1638 N NE2   . GLN A 1 214 ? 31.774 60.705 8.182   1.00 46.64 ? 214 GLN A NE2   1 
ATOM   1639 N N     . ASN A 1 215 ? 34.235 55.333 9.871   1.00 23.60 ? 215 ASN A N     1 
ATOM   1640 C CA    . ASN A 1 215 ? 35.316 54.394 10.109  1.00 23.71 ? 215 ASN A CA    1 
ATOM   1641 C C     . ASN A 1 215 ? 35.619 54.079 11.568  1.00 24.23 ? 215 ASN A C     1 
ATOM   1642 O O     . ASN A 1 215 ? 36.609 53.413 11.874  1.00 24.40 ? 215 ASN A O     1 
ATOM   1643 C CB    . ASN A 1 215 ? 36.565 54.849 9.344   1.00 26.02 ? 215 ASN A CB    1 
ATOM   1644 C CG    . ASN A 1 215 ? 36.446 54.572 7.852   1.00 29.85 ? 215 ASN A CG    1 
ATOM   1645 O OD1   . ASN A 1 215 ? 36.756 55.419 7.012   1.00 33.59 ? 215 ASN A OD1   1 
ATOM   1646 N ND2   . ASN A 1 215 ? 35.987 53.377 7.518   1.00 27.85 ? 215 ASN A ND2   1 
ATOM   1647 N N     . LEU A 1 216 ? 34.761 54.562 12.462  1.00 22.95 ? 216 LEU A N     1 
ATOM   1648 C CA    . LEU A 1 216 ? 34.904 54.247 13.877  1.00 21.93 ? 216 LEU A CA    1 
ATOM   1649 C C     . LEU A 1 216 ? 34.460 52.786 14.052  1.00 22.87 ? 216 LEU A C     1 
ATOM   1650 O O     . LEU A 1 216 ? 34.887 52.098 14.976  1.00 24.08 ? 216 LEU A O     1 
ATOM   1651 C CB    . LEU A 1 216 ? 34.038 55.178 14.737  1.00 23.04 ? 216 LEU A CB    1 
ATOM   1652 C CG    . LEU A 1 216 ? 34.738 56.475 15.163  1.00 22.96 ? 216 LEU A CG    1 
ATOM   1653 C CD1   . LEU A 1 216 ? 33.752 57.408 15.849  1.00 25.09 ? 216 LEU A CD1   1 
ATOM   1654 C CD2   . LEU A 1 216 ? 35.901 56.138 16.095  1.00 24.28 ? 216 LEU A CD2   1 
ATOM   1655 N N     . THR A 1 217 ? 33.601 52.299 13.158  1.00 22.03 ? 217 THR A N     1 
ATOM   1656 C CA    . THR A 1 217 ? 33.167 50.911 13.251  1.00 19.37 ? 217 THR A CA    1 
ATOM   1657 C C     . THR A 1 217 ? 34.049 50.078 12.327  1.00 20.03 ? 217 THR A C     1 
ATOM   1658 O O     . THR A 1 217 ? 34.673 50.615 11.403  1.00 20.75 ? 217 THR A O     1 
ATOM   1659 C CB    . THR A 1 217 ? 31.692 50.696 12.790  1.00 22.93 ? 217 THR A CB    1 
ATOM   1660 O OG1   . THR A 1 217 ? 31.633 50.682 11.355  1.00 23.47 ? 217 THR A OG1   1 
ATOM   1661 C CG2   . THR A 1 217 ? 30.782 51.803 13.320  1.00 22.47 ? 217 THR A CG2   1 
ATOM   1662 N N     . ILE A 1 218 ? 34.128 48.779 12.599  1.00 19.29 ? 218 ILE A N     1 
ATOM   1663 C CA    . ILE A 1 218 ? 34.886 47.865 11.753  1.00 18.69 ? 218 ILE A CA    1 
ATOM   1664 C C     . ILE A 1 218 ? 33.972 46.686 11.443  1.00 20.11 ? 218 ILE A C     1 
ATOM   1665 O O     . ILE A 1 218 ? 33.017 46.412 12.175  1.00 20.17 ? 218 ILE A O     1 
ATOM   1666 C CB    . ILE A 1 218 ? 36.161 47.305 12.438  1.00 18.84 ? 218 ILE A CB    1 
ATOM   1667 C CG1   . ILE A 1 218 ? 35.787 46.539 13.710  1.00 19.21 ? 218 ILE A CG1   1 
ATOM   1668 C CG2   . ILE A 1 218 ? 37.142 48.443 12.747  1.00 18.28 ? 218 ILE A CG2   1 
ATOM   1669 C CD1   . ILE A 1 218 ? 36.896 45.629 14.205  1.00 19.60 ? 218 ILE A CD1   1 
ATOM   1670 N N     . ASP A 1 219 ? 34.265 46.003 10.342  1.00 18.48 ? 219 ASP A N     1 
ATOM   1671 C CA    . ASP A 1 219 ? 33.502 44.829 9.928   1.00 20.23 ? 219 ASP A CA    1 
ATOM   1672 C C     . ASP A 1 219 ? 34.270 43.585 10.349  1.00 18.25 ? 219 ASP A C     1 
ATOM   1673 O O     . ASP A 1 219 ? 35.448 43.431 9.995   1.00 19.81 ? 219 ASP A O     1 
ATOM   1674 C CB    . ASP A 1 219 ? 33.350 44.798 8.405   1.00 19.19 ? 219 ASP A CB    1 
ATOM   1675 C CG    . ASP A 1 219 ? 32.166 45.609 7.905   1.00 23.78 ? 219 ASP A CG    1 
ATOM   1676 O OD1   . ASP A 1 219 ? 31.710 46.526 8.620   1.00 24.35 ? 219 ASP A OD1   1 
ATOM   1677 O OD2   . ASP A 1 219 ? 31.709 45.333 6.774   1.00 25.29 ? 219 ASP A OD2   1 
ATOM   1678 N N     . ILE A 1 220 ? 33.631 42.706 11.114  1.00 17.26 ? 220 ILE A N     1 
ATOM   1679 C CA    . ILE A 1 220 ? 34.273 41.461 11.501  1.00 18.49 ? 220 ILE A CA    1 
ATOM   1680 C C     . ILE A 1 220 ? 33.493 40.306 10.884  1.00 19.83 ? 220 ILE A C     1 
ATOM   1681 O O     . ILE A 1 220 ? 32.281 40.190 11.065  1.00 21.04 ? 220 ILE A O     1 
ATOM   1682 C CB    . ILE A 1 220 ? 34.289 41.218 13.024  1.00 18.35 ? 220 ILE A CB    1 
ATOM   1683 C CG1   . ILE A 1 220 ? 35.133 42.277 13.733  1.00 19.79 ? 220 ILE A CG1   1 
ATOM   1684 C CG2   . ILE A 1 220 ? 34.889 39.839 13.302  1.00 17.44 ? 220 ILE A CG2   1 
ATOM   1685 C CD1   . ILE A 1 220 ? 35.083 42.191 15.251  1.00 19.28 ? 220 ILE A CD1   1 
ATOM   1686 N N     . LEU A 1 221 ? 34.190 39.457 10.151  1.00 19.55 ? 221 LEU A N     1 
ATOM   1687 C CA    . LEU A 1 221 ? 33.540 38.308 9.552   1.00 22.47 ? 221 LEU A CA    1 
ATOM   1688 C C     . LEU A 1 221 ? 33.886 37.076 10.384  1.00 22.31 ? 221 LEU A C     1 
ATOM   1689 O O     . LEU A 1 221 ? 35.061 36.795 10.605  1.00 22.78 ? 221 LEU A O     1 
ATOM   1690 C CB    . LEU A 1 221 ? 34.032 38.126 8.115   1.00 22.33 ? 221 LEU A CB    1 
ATOM   1691 C CG    . LEU A 1 221 ? 33.088 37.445 7.133   1.00 27.62 ? 221 LEU A CG    1 
ATOM   1692 C CD1   . LEU A 1 221 ? 31.818 38.281 7.007   1.00 28.36 ? 221 LEU A CD1   1 
ATOM   1693 C CD2   . LEU A 1 221 ? 33.781 37.308 5.778   1.00 25.63 ? 221 LEU A CD2   1 
ATOM   1694 N N     . VAL A 1 222 ? 32.875 36.358 10.867  1.00 22.14 ? 222 VAL A N     1 
ATOM   1695 C CA    . VAL A 1 222 ? 33.116 35.142 11.643  1.00 23.09 ? 222 VAL A CA    1 
ATOM   1696 C C     . VAL A 1 222 ? 32.704 33.961 10.764  1.00 24.07 ? 222 VAL A C     1 
ATOM   1697 O O     . VAL A 1 222 ? 31.791 34.090 9.948   1.00 24.69 ? 222 VAL A O     1 
ATOM   1698 C CB    . VAL A 1 222 ? 32.303 35.113 12.962  1.00 23.22 ? 222 VAL A CB    1 
ATOM   1699 C CG1   . VAL A 1 222 ? 32.584 36.374 13.773  1.00 22.92 ? 222 VAL A CG1   1 
ATOM   1700 C CG2   . VAL A 1 222 ? 30.817 34.981 12.671  1.00 24.92 ? 222 VAL A CG2   1 
ATOM   1701 N N     . TYR A 1 223 ? 33.372 32.824 10.932  1.00 24.59 ? 223 TYR A N     1 
ATOM   1702 C CA    . TYR A 1 223 ? 33.080 31.658 10.104  1.00 26.48 ? 223 TYR A CA    1 
ATOM   1703 C C     . TYR A 1 223 ? 32.719 30.371 10.830  1.00 27.04 ? 223 TYR A C     1 
ATOM   1704 O O     . TYR A 1 223 ? 32.966 30.202 12.024  1.00 25.69 ? 223 TYR A O     1 
ATOM   1705 C CB    . TYR A 1 223 ? 34.276 31.336 9.199   1.00 26.75 ? 223 TYR A CB    1 
ATOM   1706 C CG    . TYR A 1 223 ? 34.829 32.494 8.404   1.00 28.57 ? 223 TYR A CG    1 
ATOM   1707 C CD1   . TYR A 1 223 ? 35.663 33.440 9.002   1.00 28.35 ? 223 TYR A CD1   1 
ATOM   1708 C CD2   . TYR A 1 223 ? 34.544 32.631 7.044   1.00 29.13 ? 223 TYR A CD2   1 
ATOM   1709 C CE1   . TYR A 1 223 ? 36.204 34.489 8.266   1.00 29.55 ? 223 TYR A CE1   1 
ATOM   1710 C CE2   . TYR A 1 223 ? 35.080 33.683 6.295   1.00 30.26 ? 223 TYR A CE2   1 
ATOM   1711 C CZ    . TYR A 1 223 ? 35.908 34.606 6.913   1.00 30.52 ? 223 TYR A CZ    1 
ATOM   1712 O OH    . TYR A 1 223 ? 36.441 35.649 6.188   1.00 30.58 ? 223 TYR A OH    1 
ATOM   1713 N N     . ASP A 1 224 ? 32.129 29.458 10.065  1.00 28.36 ? 224 ASP A N     1 
ATOM   1714 C CA    . ASP A 1 224 ? 31.768 28.139 10.550  1.00 29.18 ? 224 ASP A CA    1 
ATOM   1715 C C     . ASP A 1 224 ? 31.014 28.088 11.876  1.00 27.39 ? 224 ASP A C     1 
ATOM   1716 O O     . ASP A 1 224 ? 29.906 28.603 11.994  1.00 27.88 ? 224 ASP A O     1 
ATOM   1717 C CB    . ASP A 1 224 ? 33.043 27.299 10.645  1.00 31.26 ? 224 ASP A CB    1 
ATOM   1718 C CG    . ASP A 1 224 ? 33.908 27.416 9.398   1.00 34.68 ? 224 ASP A CG    1 
ATOM   1719 O OD1   . ASP A 1 224 ? 33.353 27.336 8.281   1.00 37.34 ? 224 ASP A OD1   1 
ATOM   1720 O OD2   . ASP A 1 224 ? 35.138 27.590 9.528   1.00 36.36 ? 224 ASP A OD2   1 
ATOM   1721 N N     . ASN A 1 225 ? 31.629 27.449 12.863  1.00 25.64 ? 225 ASN A N     1 
ATOM   1722 C CA    . ASN A 1 225 ? 31.035 27.287 14.190  1.00 28.95 ? 225 ASN A CA    1 
ATOM   1723 C C     . ASN A 1 225 ? 30.713 28.594 14.913  1.00 28.48 ? 225 ASN A C     1 
ATOM   1724 O O     . ASN A 1 225 ? 29.850 28.624 15.788  1.00 28.74 ? 225 ASN A O     1 
ATOM   1725 C CB    . ASN A 1 225 ? 31.958 26.435 15.066  1.00 28.17 ? 225 ASN A CB    1 
ATOM   1726 C CG    . ASN A 1 225 ? 33.398 26.923 15.040  1.00 30.07 ? 225 ASN A CG    1 
ATOM   1727 O OD1   . ASN A 1 225 ? 34.008 27.027 13.976  1.00 30.46 ? 225 ASN A OD1   1 
ATOM   1728 N ND2   . ASN A 1 225 ? 33.947 27.223 16.214  1.00 30.30 ? 225 ASN A ND2   1 
ATOM   1729 N N     . HIS A 1 226 ? 31.397 29.674 14.551  1.00 28.76 ? 226 HIS A N     1 
ATOM   1730 C CA    . HIS A 1 226 ? 31.157 30.958 15.205  1.00 27.70 ? 226 HIS A CA    1 
ATOM   1731 C C     . HIS A 1 226 ? 29.861 31.622 14.746  1.00 27.83 ? 226 HIS A C     1 
ATOM   1732 O O     . HIS A 1 226 ? 29.332 32.504 15.423  1.00 28.54 ? 226 HIS A O     1 
ATOM   1733 C CB    . HIS A 1 226 ? 32.338 31.901 14.947  1.00 26.86 ? 226 HIS A CB    1 
ATOM   1734 C CG    . HIS A 1 226 ? 33.655 31.341 15.380  1.00 27.33 ? 226 HIS A CG    1 
ATOM   1735 N ND1   . HIS A 1 226 ? 33.915 30.972 16.682  1.00 26.84 ? 226 HIS A ND1   1 
ATOM   1736 C CD2   . HIS A 1 226 ? 34.780 31.067 14.679  1.00 26.05 ? 226 HIS A CD2   1 
ATOM   1737 C CE1   . HIS A 1 226 ? 35.143 30.492 16.764  1.00 26.80 ? 226 HIS A CE1   1 
ATOM   1738 N NE2   . HIS A 1 226 ? 35.689 30.540 15.561  1.00 25.60 ? 226 HIS A NE2   1 
ATOM   1739 N N     . VAL A 1 227 ? 29.347 31.199 13.596  1.00 27.85 ? 227 VAL A N     1 
ATOM   1740 C CA    . VAL A 1 227 ? 28.125 31.793 13.057  1.00 28.64 ? 227 VAL A CA    1 
ATOM   1741 C C     . VAL A 1 227 ? 26.879 31.760 13.945  1.00 30.58 ? 227 VAL A C     1 
ATOM   1742 O O     . VAL A 1 227 ? 26.247 32.795 14.164  1.00 31.14 ? 227 VAL A O     1 
ATOM   1743 C CB    . VAL A 1 227 ? 27.744 31.161 11.705  1.00 27.76 ? 227 VAL A CB    1 
ATOM   1744 C CG1   . VAL A 1 227 ? 26.371 31.666 11.265  1.00 27.57 ? 227 VAL A CG1   1 
ATOM   1745 C CG2   . VAL A 1 227 ? 28.795 31.510 10.655  1.00 26.54 ? 227 VAL A CG2   1 
ATOM   1746 N N     . HIS A 1 228 ? 26.498 30.589 14.445  1.00 31.76 ? 228 HIS A N     1 
ATOM   1747 C CA    . HIS A 1 228 ? 25.287 30.541 15.262  1.00 32.39 ? 228 HIS A CA    1 
ATOM   1748 C C     . HIS A 1 228 ? 25.436 31.380 16.524  1.00 31.49 ? 228 HIS A C     1 
ATOM   1749 O O     . HIS A 1 228 ? 24.464 31.941 17.016  1.00 30.21 ? 228 HIS A O     1 
ATOM   1750 C CB    . HIS A 1 228 ? 24.895 29.100 15.616  1.00 35.36 ? 228 HIS A CB    1 
ATOM   1751 C CG    . HIS A 1 228 ? 25.762 28.464 16.652  1.00 37.07 ? 228 HIS A CG    1 
ATOM   1752 N ND1   . HIS A 1 228 ? 26.984 27.897 16.359  1.00 37.78 ? 228 HIS A ND1   1 
ATOM   1753 C CD2   . HIS A 1 228 ? 25.577 28.297 17.983  1.00 37.62 ? 228 HIS A CD2   1 
ATOM   1754 C CE1   . HIS A 1 228 ? 27.513 27.405 17.466  1.00 39.45 ? 228 HIS A CE1   1 
ATOM   1755 N NE2   . HIS A 1 228 ? 26.680 27.634 18.465  1.00 40.50 ? 228 HIS A NE2   1 
ATOM   1756 N N     . VAL A 1 229 ? 26.657 31.478 17.036  1.00 30.42 ? 229 VAL A N     1 
ATOM   1757 C CA    . VAL A 1 229 ? 26.914 32.285 18.224  1.00 31.44 ? 229 VAL A CA    1 
ATOM   1758 C C     . VAL A 1 229 ? 26.694 33.757 17.877  1.00 30.29 ? 229 VAL A C     1 
ATOM   1759 O O     . VAL A 1 229 ? 25.959 34.468 18.570  1.00 31.60 ? 229 VAL A O     1 
ATOM   1760 C CB    . VAL A 1 229 ? 28.362 32.110 18.722  1.00 31.91 ? 229 VAL A CB    1 
ATOM   1761 C CG1   . VAL A 1 229 ? 28.616 33.027 19.905  1.00 31.64 ? 229 VAL A CG1   1 
ATOM   1762 C CG2   . VAL A 1 229 ? 28.609 30.669 19.104  1.00 32.42 ? 229 VAL A CG2   1 
ATOM   1763 N N     . ALA A 1 230 ? 27.331 34.207 16.798  1.00 29.01 ? 230 ALA A N     1 
ATOM   1764 C CA    . ALA A 1 230 ? 27.199 35.587 16.358  1.00 28.20 ? 230 ALA A CA    1 
ATOM   1765 C C     . ALA A 1 230 ? 25.738 35.915 16.063  1.00 28.86 ? 230 ALA A C     1 
ATOM   1766 O O     . ALA A 1 230 ? 25.263 37.007 16.353  1.00 28.73 ? 230 ALA A O     1 
ATOM   1767 C CB    . ALA A 1 230 ? 28.046 35.820 15.115  1.00 28.21 ? 230 ALA A CB    1 
ATOM   1768 N N     . ARG A 1 231 ? 25.027 34.954 15.486  1.00 29.10 ? 231 ARG A N     1 
ATOM   1769 C CA    . ARG A 1 231 ? 23.625 35.150 15.147  1.00 29.92 ? 231 ARG A CA    1 
ATOM   1770 C C     . ARG A 1 231 ? 22.744 35.404 16.373  1.00 29.24 ? 231 ARG A C     1 
ATOM   1771 O O     . ARG A 1 231 ? 21.714 36.077 16.272  1.00 30.56 ? 231 ARG A O     1 
ATOM   1772 C CB    . ARG A 1 231 ? 23.108 33.929 14.372  1.00 29.96 ? 231 ARG A CB    1 
ATOM   1773 C CG    . ARG A 1 231 ? 21.660 34.030 13.949  1.00 33.77 ? 231 ARG A CG    1 
ATOM   1774 C CD    . ARG A 1 231 ? 21.239 32.798 13.151  1.00 33.71 ? 231 ARG A CD    1 
ATOM   1775 N NE    . ARG A 1 231 ? 21.901 32.726 11.849  1.00 35.65 ? 231 ARG A NE    1 
ATOM   1776 C CZ    . ARG A 1 231 ? 22.657 31.708 11.452  1.00 35.86 ? 231 ARG A CZ    1 
ATOM   1777 N NH1   . ARG A 1 231 ? 22.856 30.673 12.256  1.00 35.70 ? 231 ARG A NH1   1 
ATOM   1778 N NH2   . ARG A 1 231 ? 23.202 31.714 10.244  1.00 36.95 ? 231 ARG A NH2   1 
ATOM   1779 N N     . SER A 1 232 ? 23.146 34.877 17.526  1.00 28.66 ? 232 SER A N     1 
ATOM   1780 C CA    . SER A 1 232 ? 22.363 35.036 18.752  1.00 30.95 ? 232 SER A CA    1 
ATOM   1781 C C     . SER A 1 232 ? 22.697 36.274 19.579  1.00 31.26 ? 232 SER A C     1 
ATOM   1782 O O     . SER A 1 232 ? 21.977 36.599 20.529  1.00 30.83 ? 232 SER A O     1 
ATOM   1783 C CB    . SER A 1 232 ? 22.528 33.805 19.641  1.00 31.69 ? 232 SER A CB    1 
ATOM   1784 O OG    . SER A 1 232 ? 23.846 33.723 20.163  1.00 34.95 ? 232 SER A OG    1 
ATOM   1785 N N     . LEU A 1 233 ? 23.780 36.966 19.227  1.00 29.09 ? 233 LEU A N     1 
ATOM   1786 C CA    . LEU A 1 233 ? 24.192 38.142 19.987  1.00 28.65 ? 233 LEU A CA    1 
ATOM   1787 C C     . LEU A 1 233 ? 23.201 39.288 19.914  1.00 27.58 ? 233 LEU A C     1 
ATOM   1788 O O     . LEU A 1 233 ? 22.571 39.528 18.883  1.00 29.35 ? 233 LEU A O     1 
ATOM   1789 C CB    . LEU A 1 233 ? 25.570 38.636 19.517  1.00 24.74 ? 233 LEU A CB    1 
ATOM   1790 C CG    . LEU A 1 233 ? 26.706 37.614 19.563  1.00 24.49 ? 233 LEU A CG    1 
ATOM   1791 C CD1   . LEU A 1 233 ? 27.987 38.277 19.075  1.00 21.43 ? 233 LEU A CD1   1 
ATOM   1792 C CD2   . LEU A 1 233 ? 26.883 37.078 20.980  1.00 24.29 ? 233 LEU A CD2   1 
ATOM   1793 N N     . LYS A 1 234 ? 23.079 39.999 21.028  1.00 27.53 ? 234 LYS A N     1 
ATOM   1794 C CA    . LYS A 1 234 ? 22.184 41.131 21.123  1.00 27.55 ? 234 LYS A CA    1 
ATOM   1795 C C     . LYS A 1 234 ? 22.897 42.422 20.749  1.00 27.06 ? 234 LYS A C     1 
ATOM   1796 O O     . LYS A 1 234 ? 23.934 42.763 21.319  1.00 26.23 ? 234 LYS A O     1 
ATOM   1797 C CB    . LYS A 1 234 ? 21.641 41.240 22.549  1.00 30.93 ? 234 LYS A CB    1 
ATOM   1798 C CG    . LYS A 1 234 ? 20.688 42.397 22.763  1.00 35.36 ? 234 LYS A CG    1 
ATOM   1799 C CD    . LYS A 1 234 ? 20.195 42.418 24.199  1.00 38.15 ? 234 LYS A CD    1 
ATOM   1800 C CE    . LYS A 1 234 ? 19.053 43.402 24.362  1.00 40.09 ? 234 LYS A CE    1 
ATOM   1801 N NZ    . LYS A 1 234 ? 17.924 43.076 23.443  1.00 41.86 ? 234 LYS A NZ    1 
ATOM   1802 N N     . VAL A 1 235 ? 22.331 43.142 19.790  1.00 26.03 ? 235 VAL A N     1 
ATOM   1803 C CA    . VAL A 1 235 ? 22.906 44.405 19.365  1.00 26.29 ? 235 VAL A CA    1 
ATOM   1804 C C     . VAL A 1 235 ? 22.984 45.345 20.562  1.00 26.96 ? 235 VAL A C     1 
ATOM   1805 O O     . VAL A 1 235 ? 22.027 45.470 21.335  1.00 26.33 ? 235 VAL A O     1 
ATOM   1806 C CB    . VAL A 1 235 ? 22.052 45.049 18.259  1.00 27.99 ? 235 VAL A CB    1 
ATOM   1807 C CG1   . VAL A 1 235 ? 22.455 46.500 18.048  1.00 28.93 ? 235 VAL A CG1   1 
ATOM   1808 C CG2   . VAL A 1 235 ? 22.224 44.260 16.973  1.00 29.43 ? 235 VAL A CG2   1 
ATOM   1809 N N     . GLY A 1 236 ? 24.133 45.990 20.720  1.00 23.68 ? 236 GLY A N     1 
ATOM   1810 C CA    . GLY A 1 236 ? 24.307 46.915 21.824  1.00 23.92 ? 236 GLY A CA    1 
ATOM   1811 C C     . GLY A 1 236 ? 25.028 46.294 23.007  1.00 23.09 ? 236 GLY A C     1 
ATOM   1812 O O     . GLY A 1 236 ? 25.418 47.005 23.940  1.00 24.15 ? 236 GLY A O     1 
ATOM   1813 N N     . SER A 1 237 ? 25.197 44.974 22.993  1.00 22.88 ? 237 SER A N     1 
ATOM   1814 C CA    . SER A 1 237 ? 25.895 44.307 24.083  1.00 23.13 ? 237 SER A CA    1 
ATOM   1815 C C     . SER A 1 237 ? 27.402 44.502 23.940  1.00 22.17 ? 237 SER A C     1 
ATOM   1816 O O     . SER A 1 237 ? 27.895 44.947 22.908  1.00 21.65 ? 237 SER A O     1 
ATOM   1817 C CB    . SER A 1 237 ? 25.566 42.811 24.112  1.00 24.08 ? 237 SER A CB    1 
ATOM   1818 O OG    . SER A 1 237 ? 25.950 42.172 22.908  1.00 26.78 ? 237 SER A OG    1 
ATOM   1819 N N     . PHE A 1 238 ? 28.129 44.172 24.994  1.00 22.46 ? 238 PHE A N     1 
ATOM   1820 C CA    . PHE A 1 238 ? 29.577 44.309 24.995  1.00 21.03 ? 238 PHE A CA    1 
ATOM   1821 C C     . PHE A 1 238 ? 30.189 42.931 24.843  1.00 21.21 ? 238 PHE A C     1 
ATOM   1822 O O     . PHE A 1 238 ? 29.727 41.960 25.450  1.00 23.09 ? 238 PHE A O     1 
ATOM   1823 C CB    . PHE A 1 238 ? 30.014 45.004 26.289  1.00 22.58 ? 238 PHE A CB    1 
ATOM   1824 C CG    . PHE A 1 238 ? 29.451 46.390 26.428  1.00 23.71 ? 238 PHE A CG    1 
ATOM   1825 C CD1   . PHE A 1 238 ? 29.957 47.439 25.666  1.00 25.16 ? 238 PHE A CD1   1 
ATOM   1826 C CD2   . PHE A 1 238 ? 28.356 46.632 27.250  1.00 25.32 ? 238 PHE A CD2   1 
ATOM   1827 C CE1   . PHE A 1 238 ? 29.384 48.704 25.710  1.00 23.84 ? 238 PHE A CE1   1 
ATOM   1828 C CE2   . PHE A 1 238 ? 27.772 47.899 27.301  1.00 27.79 ? 238 PHE A CE2   1 
ATOM   1829 C CZ    . PHE A 1 238 ? 28.291 48.936 26.525  1.00 28.46 ? 238 PHE A CZ    1 
ATOM   1830 N N     . LEU A 1 239 ? 31.230 42.843 24.026  1.00 19.91 ? 239 LEU A N     1 
ATOM   1831 C CA    . LEU A 1 239 ? 31.845 41.556 23.760  1.00 19.88 ? 239 LEU A CA    1 
ATOM   1832 C C     . LEU A 1 239 ? 33.355 41.551 23.849  1.00 22.00 ? 239 LEU A C     1 
ATOM   1833 O O     . LEU A 1 239 ? 34.006 42.598 23.782  1.00 20.80 ? 239 LEU A O     1 
ATOM   1834 C CB    . LEU A 1 239 ? 31.501 41.110 22.334  1.00 22.52 ? 239 LEU A CB    1 
ATOM   1835 C CG    . LEU A 1 239 ? 30.107 41.368 21.771  1.00 23.93 ? 239 LEU A CG    1 
ATOM   1836 C CD1   . LEU A 1 239 ? 30.161 41.284 20.245  1.00 23.26 ? 239 LEU A CD1   1 
ATOM   1837 C CD2   . LEU A 1 239 ? 29.118 40.349 22.332  1.00 23.82 ? 239 LEU A CD2   1 
ATOM   1838 N N     . ARG A 1 240 ? 33.896 40.349 24.017  1.00 21.77 ? 240 ARG A N     1 
ATOM   1839 C CA    . ARG A 1 240 ? 35.330 40.158 23.949  1.00 20.82 ? 240 ARG A CA    1 
ATOM   1840 C C     . ARG A 1 240 ? 35.429 39.091 22.863  1.00 22.58 ? 240 ARG A C     1 
ATOM   1841 O O     . ARG A 1 240 ? 34.846 38.002 22.963  1.00 22.45 ? 240 ARG A O     1 
ATOM   1842 C CB    . ARG A 1 240 ? 35.954 39.657 25.253  1.00 21.09 ? 240 ARG A CB    1 
ATOM   1843 C CG    . ARG A 1 240 ? 37.478 39.457 25.119  1.00 19.30 ? 240 ARG A CG    1 
ATOM   1844 C CD    . ARG A 1 240 ? 38.221 39.645 26.442  1.00 20.51 ? 240 ARG A CD    1 
ATOM   1845 N NE    . ARG A 1 240 ? 38.121 41.021 26.926  1.00 20.68 ? 240 ARG A NE    1 
ATOM   1846 C CZ    . ARG A 1 240 ? 38.146 41.374 28.209  1.00 22.26 ? 240 ARG A CZ    1 
ATOM   1847 N NH1   . ARG A 1 240 ? 38.269 40.449 29.155  1.00 21.46 ? 240 ARG A NH1   1 
ATOM   1848 N NH2   . ARG A 1 240 ? 38.035 42.657 28.548  1.00 19.37 ? 240 ARG A NH2   1 
ATOM   1849 N N     . ILE A 1 241 ? 36.118 39.433 21.785  1.00 21.05 ? 241 ILE A N     1 
ATOM   1850 C CA    . ILE A 1 241 ? 36.293 38.503 20.676  1.00 21.56 ? 241 ILE A CA    1 
ATOM   1851 C C     . ILE A 1 241 ? 37.737 38.051 20.776  1.00 21.55 ? 241 ILE A C     1 
ATOM   1852 O O     . ILE A 1 241 ? 38.660 38.834 20.552  1.00 21.74 ? 241 ILE A O     1 
ATOM   1853 C CB    . ILE A 1 241 ? 36.040 39.205 19.333  1.00 20.95 ? 241 ILE A CB    1 
ATOM   1854 C CG1   . ILE A 1 241 ? 34.612 39.762 19.316  1.00 21.86 ? 241 ILE A CG1   1 
ATOM   1855 C CG2   . ILE A 1 241 ? 36.264 38.228 18.185  1.00 22.42 ? 241 ILE A CG2   1 
ATOM   1856 C CD1   . ILE A 1 241 ? 34.226 40.472 18.031  1.00 23.55 ? 241 ILE A CD1   1 
ATOM   1857 N N     . TYR A 1 242 ? 37.924 36.785 21.128  1.00 20.15 ? 242 TYR A N     1 
ATOM   1858 C CA    . TYR A 1 242 ? 39.252 36.228 21.322  1.00 20.96 ? 242 TYR A CA    1 
ATOM   1859 C C     . TYR A 1 242 ? 39.921 35.739 20.066  1.00 20.17 ? 242 TYR A C     1 
ATOM   1860 O O     . TYR A 1 242 ? 39.304 35.045 19.248  1.00 20.21 ? 242 TYR A O     1 
ATOM   1861 C CB    . TYR A 1 242 ? 39.183 35.063 22.310  1.00 20.08 ? 242 TYR A CB    1 
ATOM   1862 C CG    . TYR A 1 242 ? 38.630 35.442 23.660  1.00 22.41 ? 242 TYR A CG    1 
ATOM   1863 C CD1   . TYR A 1 242 ? 39.459 35.935 24.667  1.00 20.64 ? 242 TYR A CD1   1 
ATOM   1864 C CD2   . TYR A 1 242 ? 37.272 35.313 23.926  1.00 21.87 ? 242 TYR A CD2   1 
ATOM   1865 C CE1   . TYR A 1 242 ? 38.938 36.286 25.919  1.00 21.71 ? 242 TYR A CE1   1 
ATOM   1866 C CE2   . TYR A 1 242 ? 36.743 35.666 25.171  1.00 23.02 ? 242 TYR A CE2   1 
ATOM   1867 C CZ    . TYR A 1 242 ? 37.582 36.150 26.159  1.00 21.06 ? 242 TYR A CZ    1 
ATOM   1868 O OH    . TYR A 1 242 ? 37.043 36.499 27.382  1.00 22.31 ? 242 TYR A OH    1 
ATOM   1869 N N     . SER A 1 243 ? 41.197 36.087 19.946  1.00 20.14 ? 243 SER A N     1 
ATOM   1870 C CA    . SER A 1 243 ? 42.020 35.668 18.826  1.00 20.95 ? 243 SER A CA    1 
ATOM   1871 C C     . SER A 1 243 ? 41.455 36.100 17.480  1.00 20.23 ? 243 SER A C     1 
ATOM   1872 O O     . SER A 1 243 ? 41.414 35.325 16.516  1.00 19.15 ? 243 SER A O     1 
ATOM   1873 C CB    . SER A 1 243 ? 42.207 34.154 18.873  1.00 23.55 ? 243 SER A CB    1 
ATOM   1874 O OG    . SER A 1 243 ? 43.481 33.784 18.390  1.00 28.36 ? 243 SER A OG    1 
ATOM   1875 N N     . LEU A 1 244 ? 41.022 37.354 17.432  1.00 19.33 ? 244 LEU A N     1 
ATOM   1876 C CA    . LEU A 1 244 ? 40.511 37.954 16.206  1.00 19.79 ? 244 LEU A CA    1 
ATOM   1877 C C     . LEU A 1 244 ? 41.769 38.130 15.357  1.00 20.14 ? 244 LEU A C     1 
ATOM   1878 O O     . LEU A 1 244 ? 42.856 38.400 15.892  1.00 19.25 ? 244 LEU A O     1 
ATOM   1879 C CB    . LEU A 1 244 ? 39.872 39.315 16.516  1.00 19.24 ? 244 LEU A CB    1 
ATOM   1880 C CG    . LEU A 1 244 ? 39.279 40.143 15.371  1.00 19.03 ? 244 LEU A CG    1 
ATOM   1881 C CD1   . LEU A 1 244 ? 38.253 39.318 14.593  1.00 20.73 ? 244 LEU A CD1   1 
ATOM   1882 C CD2   . LEU A 1 244 ? 38.625 41.395 15.951  1.00 18.87 ? 244 LEU A CD2   1 
ATOM   1883 N N     . HIS A 1 245 ? 41.643 37.972 14.043  1.00 20.02 ? 245 HIS A N     1 
ATOM   1884 C CA    . HIS A 1 245 ? 42.810 38.073 13.186  1.00 20.83 ? 245 HIS A CA    1 
ATOM   1885 C C     . HIS A 1 245 ? 42.701 39.252 12.241  1.00 21.75 ? 245 HIS A C     1 
ATOM   1886 O O     . HIS A 1 245 ? 41.687 39.416 11.559  1.00 20.50 ? 245 HIS A O     1 
ATOM   1887 C CB    . HIS A 1 245 ? 42.943 36.773 12.386  1.00 21.55 ? 245 HIS A CB    1 
ATOM   1888 C CG    . HIS A 1 245 ? 44.205 36.666 11.590  1.00 24.29 ? 245 HIS A CG    1 
ATOM   1889 N ND1   . HIS A 1 245 ? 45.447 36.953 12.114  1.00 27.88 ? 245 HIS A ND1   1 
ATOM   1890 C CD2   . HIS A 1 245 ? 44.425 36.220 10.331  1.00 26.32 ? 245 HIS A CD2   1 
ATOM   1891 C CE1   . HIS A 1 245 ? 46.378 36.687 11.215  1.00 25.65 ? 245 HIS A CE1   1 
ATOM   1892 N NE2   . HIS A 1 245 ? 45.784 36.241 10.123  1.00 27.84 ? 245 HIS A NE2   1 
ATOM   1893 N N     . THR A 1 246 ? 43.739 40.083 12.216  1.00 22.05 ? 246 THR A N     1 
ATOM   1894 C CA    . THR A 1 246 ? 43.746 41.222 11.308  1.00 23.49 ? 246 THR A CA    1 
ATOM   1895 C C     . THR A 1 246 ? 44.600 40.826 10.119  1.00 23.49 ? 246 THR A C     1 
ATOM   1896 O O     . THR A 1 246 ? 45.566 40.059 10.250  1.00 21.76 ? 246 THR A O     1 
ATOM   1897 C CB    . THR A 1 246 ? 44.378 42.475 11.937  1.00 25.09 ? 246 THR A CB    1 
ATOM   1898 O OG1   . THR A 1 246 ? 45.770 42.233 12.179  1.00 27.70 ? 246 THR A OG1   1 
ATOM   1899 C CG2   . THR A 1 246 ? 43.697 42.824 13.243  1.00 28.44 ? 246 THR A CG2   1 
ATOM   1900 N N     . LYS A 1 247 ? 44.227 41.334 8.952   1.00 22.62 ? 247 LYS A N     1 
ATOM   1901 C CA    . LYS A 1 247 ? 44.979 41.048 7.752   1.00 25.50 ? 247 LYS A CA    1 
ATOM   1902 C C     . LYS A 1 247 ? 44.919 42.275 6.861   1.00 23.98 ? 247 LYS A C     1 
ATOM   1903 O O     . LYS A 1 247 ? 43.845 42.708 6.457   1.00 24.84 ? 247 LYS A O     1 
ATOM   1904 C CB    . LYS A 1 247 ? 44.394 39.839 7.012   1.00 28.63 ? 247 LYS A CB    1 
ATOM   1905 C CG    . LYS A 1 247 ? 45.256 39.371 5.849   1.00 35.87 ? 247 LYS A CG    1 
ATOM   1906 C CD    . LYS A 1 247 ? 44.659 38.154 5.152   1.00 41.18 ? 247 LYS A CD    1 
ATOM   1907 C CE    . LYS A 1 247 ? 45.511 37.740 3.958   1.00 43.98 ? 247 LYS A CE    1 
ATOM   1908 N NZ    . LYS A 1 247 ? 44.875 36.645 3.172   1.00 47.45 ? 247 LYS A NZ    1 
ATOM   1909 N N     . LEU A 1 248 ? 46.074 42.840 6.562   1.00 24.55 ? 248 LEU A N     1 
ATOM   1910 C CA    . LEU A 1 248 ? 46.120 44.007 5.695   1.00 24.42 ? 248 LEU A CA    1 
ATOM   1911 C C     . LEU A 1 248 ? 46.023 43.504 4.263   1.00 24.62 ? 248 LEU A C     1 
ATOM   1912 O O     . LEU A 1 248 ? 46.799 42.643 3.855   1.00 28.44 ? 248 LEU A O     1 
ATOM   1913 C CB    . LEU A 1 248 ? 47.434 44.760 5.901   1.00 26.52 ? 248 LEU A CB    1 
ATOM   1914 C CG    . LEU A 1 248 ? 47.678 45.989 5.022   1.00 27.85 ? 248 LEU A CG    1 
ATOM   1915 C CD1   . LEU A 1 248 ? 46.607 47.046 5.290   1.00 26.92 ? 248 LEU A CD1   1 
ATOM   1916 C CD2   . LEU A 1 248 ? 49.067 46.544 5.323   1.00 29.63 ? 248 LEU A CD2   1 
ATOM   1917 N N     . GLN A 1 249 ? 45.059 44.018 3.511   1.00 21.62 ? 249 GLN A N     1 
ATOM   1918 C CA    . GLN A 1 249 ? 44.885 43.619 2.117   1.00 25.44 ? 249 GLN A CA    1 
ATOM   1919 C C     . GLN A 1 249 ? 45.410 44.744 1.233   1.00 22.97 ? 249 GLN A C     1 
ATOM   1920 O O     . GLN A 1 249 ? 45.049 45.899 1.428   1.00 22.36 ? 249 GLN A O     1 
ATOM   1921 C CB    . GLN A 1 249 ? 43.409 43.369 1.815   1.00 26.87 ? 249 GLN A CB    1 
ATOM   1922 C CG    . GLN A 1 249 ? 43.166 42.783 0.429   1.00 33.27 ? 249 GLN A CG    1 
ATOM   1923 C CD    . GLN A 1 249 ? 43.825 41.422 0.250   1.00 37.12 ? 249 GLN A CD    1 
ATOM   1924 O OE1   . GLN A 1 249 ? 43.398 40.429 0.848   1.00 40.03 ? 249 GLN A OE1   1 
ATOM   1925 N NE2   . GLN A 1 249 ? 44.880 41.371 -0.565  1.00 36.91 ? 249 GLN A NE2   1 
ATOM   1926 N N     . SER A 1 250 ? 46.264 44.413 0.267   1.00 22.34 ? 250 SER A N     1 
ATOM   1927 C CA    . SER A 1 250 ? 46.816 45.441 -0.607  1.00 22.98 ? 250 SER A CA    1 
ATOM   1928 C C     . SER A 1 250 ? 46.391 45.273 -2.062  1.00 22.87 ? 250 SER A C     1 
ATOM   1929 O O     . SER A 1 250 ? 46.812 46.037 -2.921  1.00 23.10 ? 250 SER A O     1 
ATOM   1930 C CB    . SER A 1 250 ? 48.343 45.458 -0.524  1.00 26.03 ? 250 SER A CB    1 
ATOM   1931 O OG    . SER A 1 250 ? 48.894 44.253 -1.015  1.00 29.12 ? 250 SER A OG    1 
ATOM   1932 N N     . MET A 1 251 ? 45.553 44.278 -2.324  1.00 24.46 ? 251 MET A N     1 
ATOM   1933 C CA    . MET A 1 251 ? 45.075 43.999 -3.683  1.00 26.76 ? 251 MET A CA    1 
ATOM   1934 C C     . MET A 1 251 ? 43.628 43.524 -3.570  1.00 27.37 ? 251 MET A C     1 
ATOM   1935 O O     . MET A 1 251 ? 43.358 42.581 -2.826  1.00 28.65 ? 251 MET A O     1 
ATOM   1936 C CB    . MET A 1 251 ? 45.939 42.898 -4.304  1.00 29.47 ? 251 MET A CB    1 
ATOM   1937 C CG    . MET A 1 251 ? 45.638 42.574 -5.756  1.00 35.02 ? 251 MET A CG    1 
ATOM   1938 S SD    . MET A 1 251 ? 46.273 43.828 -6.880  1.00 38.26 ? 251 MET A SD    1 
ATOM   1939 C CE    . MET A 1 251 ? 47.949 43.235 -7.165  1.00 37.37 ? 251 MET A CE    1 
ATOM   1940 N N     . ASN A 1 252 ? 42.694 44.166 -4.278  1.00 25.93 ? 252 ASN A N     1 
ATOM   1941 C CA    . ASN A 1 252 ? 41.303 43.731 -4.182  1.00 25.98 ? 252 ASN A CA    1 
ATOM   1942 C C     . ASN A 1 252 ? 40.978 42.631 -5.188  1.00 26.14 ? 252 ASN A C     1 
ATOM   1943 O O     . ASN A 1 252 ? 41.842 42.224 -5.971  1.00 27.09 ? 252 ASN A O     1 
ATOM   1944 C CB    . ASN A 1 252 ? 40.324 44.916 -4.320  1.00 23.98 ? 252 ASN A CB    1 
ATOM   1945 C CG    . ASN A 1 252 ? 40.322 45.537 -5.715  1.00 23.48 ? 252 ASN A CG    1 
ATOM   1946 O OD1   . ASN A 1 252 ? 40.773 44.928 -6.681  1.00 22.76 ? 252 ASN A OD1   1 
ATOM   1947 N ND2   . ASN A 1 252 ? 39.794 46.749 -5.818  1.00 24.26 ? 252 ASN A ND2   1 
ATOM   1948 N N     . SER A 1 253 ? 39.740 42.145 -5.156  1.00 28.98 ? 253 SER A N     1 
ATOM   1949 C CA    . SER A 1 253 ? 39.305 41.066 -6.040  1.00 30.82 ? 253 SER A CA    1 
ATOM   1950 C C     . SER A 1 253 ? 39.354 41.405 -7.521  1.00 32.06 ? 253 SER A C     1 
ATOM   1951 O O     . SER A 1 253 ? 39.276 40.508 -8.368  1.00 32.64 ? 253 SER A O     1 
ATOM   1952 C CB    . SER A 1 253 ? 37.885 40.629 -5.679  1.00 33.69 ? 253 SER A CB    1 
ATOM   1953 O OG    . SER A 1 253 ? 36.947 41.649 -5.982  1.00 37.56 ? 253 SER A OG    1 
ATOM   1954 N N     . GLU A 1 254 ? 39.475 42.691 -7.839  1.00 29.98 ? 254 GLU A N     1 
ATOM   1955 C CA    . GLU A 1 254 ? 39.526 43.116 -9.233  1.00 27.96 ? 254 GLU A CA    1 
ATOM   1956 C C     . GLU A 1 254 ? 40.956 43.435 -9.647  1.00 27.53 ? 254 GLU A C     1 
ATOM   1957 O O     . GLU A 1 254 ? 41.199 44.089 -10.661 1.00 27.00 ? 254 GLU A O     1 
ATOM   1958 C CB    . GLU A 1 254 ? 38.620 44.328 -9.439  1.00 29.19 ? 254 GLU A CB    1 
ATOM   1959 C CG    . GLU A 1 254 ? 37.163 44.037 -9.126  1.00 28.21 ? 254 GLU A CG    1 
ATOM   1960 C CD    . GLU A 1 254 ? 36.301 45.278 -9.175  1.00 30.95 ? 254 GLU A CD    1 
ATOM   1961 O OE1   . GLU A 1 254 ? 36.009 45.775 -10.286 1.00 30.53 ? 254 GLU A OE1   1 
ATOM   1962 O OE2   . GLU A 1 254 ? 35.919 45.759 -8.092  1.00 33.29 ? 254 GLU A OE2   1 
ATOM   1963 N N     . ASN A 1 255 ? 41.907 42.970 -8.843  1.00 26.43 ? 255 ASN A N     1 
ATOM   1964 C CA    . ASN A 1 255 ? 43.323 43.184 -9.122  1.00 27.23 ? 255 ASN A CA    1 
ATOM   1965 C C     . ASN A 1 255 ? 43.779 44.642 -9.072  1.00 25.25 ? 255 ASN A C     1 
ATOM   1966 O O     . ASN A 1 255 ? 44.694 45.033 -9.796  1.00 25.05 ? 255 ASN A O     1 
ATOM   1967 C CB    . ASN A 1 255 ? 43.679 42.569 -10.484 1.00 31.93 ? 255 ASN A CB    1 
ATOM   1968 C CG    . ASN A 1 255 ? 43.450 41.061 -10.523 1.00 37.51 ? 255 ASN A CG    1 
ATOM   1969 O OD1   . ASN A 1 255 ? 43.076 40.503 -11.560 1.00 41.66 ? 255 ASN A OD1   1 
ATOM   1970 N ND2   . ASN A 1 255 ? 43.692 40.393 -9.400  1.00 37.88 ? 255 ASN A ND2   1 
ATOM   1971 N N     . GLN A 1 256 ? 43.143 45.452 -8.230  1.00 21.02 ? 256 GLN A N     1 
ATOM   1972 C CA    . GLN A 1 256 ? 43.535 46.849 -8.080  1.00 19.13 ? 256 GLN A CA    1 
ATOM   1973 C C     . GLN A 1 256 ? 44.291 46.974 -6.774  1.00 17.70 ? 256 GLN A C     1 
ATOM   1974 O O     . GLN A 1 256 ? 43.973 46.283 -5.802  1.00 19.56 ? 256 GLN A O     1 
ATOM   1975 C CB    . GLN A 1 256 ? 42.309 47.776 -8.035  1.00 18.87 ? 256 GLN A CB    1 
ATOM   1976 C CG    . GLN A 1 256 ? 41.483 47.784 -9.315  1.00 18.54 ? 256 GLN A CG    1 
ATOM   1977 C CD    . GLN A 1 256 ? 40.243 48.658 -9.183  1.00 18.84 ? 256 GLN A CD    1 
ATOM   1978 O OE1   . GLN A 1 256 ? 39.428 48.454 -8.293  1.00 19.10 ? 256 GLN A OE1   1 
ATOM   1979 N NE2   . GLN A 1 256 ? 40.100 49.637 -10.079 1.00 17.87 ? 256 GLN A NE2   1 
ATOM   1980 N N     . THR A 1 257 ? 45.287 47.850 -6.755  1.00 18.90 ? 257 THR A N     1 
ATOM   1981 C CA    . THR A 1 257 ? 46.079 48.065 -5.551  1.00 19.42 ? 257 THR A CA    1 
ATOM   1982 C C     . THR A 1 257 ? 45.360 49.022 -4.600  1.00 18.32 ? 257 THR A C     1 
ATOM   1983 O O     . THR A 1 257 ? 44.822 50.064 -5.011  1.00 18.82 ? 257 THR A O     1 
ATOM   1984 C CB    . THR A 1 257 ? 47.460 48.646 -5.902  1.00 17.95 ? 257 THR A CB    1 
ATOM   1985 O OG1   . THR A 1 257 ? 48.174 47.685 -6.692  1.00 20.62 ? 257 THR A OG1   1 
ATOM   1986 C CG2   . THR A 1 257 ? 48.265 48.972 -4.618  1.00 18.24 ? 257 THR A CG2   1 
ATOM   1987 N N     . MET A 1 258 ? 45.348 48.674 -3.319  1.00 18.71 ? 258 MET A N     1 
ATOM   1988 C CA    . MET A 1 258 ? 44.699 49.523 -2.332  1.00 19.12 ? 258 MET A CA    1 
ATOM   1989 C C     . MET A 1 258 ? 45.124 49.087 -0.934  1.00 19.26 ? 258 MET A C     1 
ATOM   1990 O O     . MET A 1 258 ? 46.038 48.264 -0.798  1.00 18.60 ? 258 MET A O     1 
ATOM   1991 C CB    . MET A 1 258 ? 43.175 49.439 -2.481  1.00 23.09 ? 258 MET A CB    1 
ATOM   1992 C CG    . MET A 1 258 ? 42.665 48.094 -2.938  1.00 25.46 ? 258 MET A CG    1 
ATOM   1993 S SD    . MET A 1 258 ? 42.951 46.773 -1.747  1.00 31.06 ? 258 MET A SD    1 
ATOM   1994 C CE    . MET A 1 258 ? 41.342 46.668 -1.048  1.00 31.87 ? 258 MET A CE    1 
ATOM   1995 N N     . LEU A 1 259 ? 44.495 49.651 0.095   1.00 18.24 ? 259 LEU A N     1 
ATOM   1996 C CA    . LEU A 1 259 ? 44.834 49.265 1.467   1.00 19.74 ? 259 LEU A CA    1 
ATOM   1997 C C     . LEU A 1 259 ? 43.583 49.206 2.332   1.00 19.98 ? 259 LEU A C     1 
ATOM   1998 O O     . LEU A 1 259 ? 42.869 50.203 2.470   1.00 20.07 ? 259 LEU A O     1 
ATOM   1999 C CB    . LEU A 1 259 ? 45.808 50.261 2.105   1.00 20.85 ? 259 LEU A CB    1 
ATOM   2000 C CG    . LEU A 1 259 ? 47.261 50.293 1.628   1.00 21.92 ? 259 LEU A CG    1 
ATOM   2001 C CD1   . LEU A 1 259 ? 47.943 51.523 2.213   1.00 24.84 ? 259 LEU A CD1   1 
ATOM   2002 C CD2   . LEU A 1 259 ? 47.993 49.018 2.039   1.00 20.71 ? 259 LEU A CD2   1 
ATOM   2003 N N     . SER A 1 260 ? 43.326 48.041 2.911   1.00 21.51 ? 260 SER A N     1 
ATOM   2004 C CA    . SER A 1 260 ? 42.179 47.885 3.794   1.00 22.96 ? 260 SER A CA    1 
ATOM   2005 C C     . SER A 1 260 ? 42.559 46.834 4.819   1.00 22.76 ? 260 SER A C     1 
ATOM   2006 O O     . SER A 1 260 ? 43.303 45.899 4.531   1.00 22.39 ? 260 SER A O     1 
ATOM   2007 C CB    . SER A 1 260 ? 40.936 47.436 3.024   1.00 25.09 ? 260 SER A CB    1 
ATOM   2008 O OG    . SER A 1 260 ? 41.066 46.102 2.580   1.00 30.86 ? 260 SER A OG    1 
ATOM   2009 N N     . LEU A 1 261 ? 42.051 47.004 6.027   1.00 21.71 ? 261 LEU A N     1 
ATOM   2010 C CA    . LEU A 1 261 ? 42.349 46.066 7.093   1.00 20.20 ? 261 LEU A CA    1 
ATOM   2011 C C     . LEU A 1 261 ? 41.149 45.141 7.271   1.00 19.10 ? 261 LEU A C     1 
ATOM   2012 O O     . LEU A 1 261 ? 40.033 45.613 7.536   1.00 20.93 ? 261 LEU A O     1 
ATOM   2013 C CB    . LEU A 1 261 ? 42.600 46.844 8.386   1.00 23.19 ? 261 LEU A CB    1 
ATOM   2014 C CG    . LEU A 1 261 ? 43.355 46.182 9.535   1.00 27.55 ? 261 LEU A CG    1 
ATOM   2015 C CD1   . LEU A 1 261 ? 44.772 45.864 9.100   1.00 27.51 ? 261 LEU A CD1   1 
ATOM   2016 C CD2   . LEU A 1 261 ? 43.374 47.135 10.728  1.00 27.86 ? 261 LEU A CD2   1 
ATOM   2017 N N     . GLU A 1 262 ? 41.364 43.837 7.102   1.00 19.49 ? 262 GLU A N     1 
ATOM   2018 C CA    . GLU A 1 262 ? 40.291 42.869 7.287   1.00 19.12 ? 262 GLU A CA    1 
ATOM   2019 C C     . GLU A 1 262 ? 40.369 42.288 8.705   1.00 17.93 ? 262 GLU A C     1 
ATOM   2020 O O     . GLU A 1 262 ? 41.439 42.219 9.297   1.00 18.95 ? 262 GLU A O     1 
ATOM   2021 C CB    . GLU A 1 262 ? 40.424 41.715 6.300   1.00 20.53 ? 262 GLU A CB    1 
ATOM   2022 C CG    . GLU A 1 262 ? 40.719 42.135 4.870   1.00 24.06 ? 262 GLU A CG    1 
ATOM   2023 C CD    . GLU A 1 262 ? 40.746 40.970 3.902   1.00 28.45 ? 262 GLU A CD    1 
ATOM   2024 O OE1   . GLU A 1 262 ? 41.099 39.838 4.309   1.00 26.46 ? 262 GLU A OE1   1 
ATOM   2025 O OE2   . GLU A 1 262 ? 40.427 41.195 2.715   1.00 28.85 ? 262 GLU A OE2   1 
ATOM   2026 N N     . PHE A 1 263 ? 39.223 41.871 9.231   1.00 18.16 ? 263 PHE A N     1 
ATOM   2027 C CA    . PHE A 1 263 ? 39.143 41.256 10.562  1.00 16.52 ? 263 PHE A CA    1 
ATOM   2028 C C     . PHE A 1 263 ? 38.391 39.943 10.381  1.00 17.90 ? 263 PHE A C     1 
ATOM   2029 O O     . PHE A 1 263 ? 37.244 39.943 9.918   1.00 19.44 ? 263 PHE A O     1 
ATOM   2030 C CB    . PHE A 1 263 ? 38.389 42.171 11.533  1.00 17.13 ? 263 PHE A CB    1 
ATOM   2031 C CG    . PHE A 1 263 ? 39.118 43.461 11.835  1.00 19.10 ? 263 PHE A CG    1 
ATOM   2032 C CD1   . PHE A 1 263 ? 40.009 43.535 12.905  1.00 18.58 ? 263 PHE A CD1   1 
ATOM   2033 C CD2   . PHE A 1 263 ? 38.958 44.581 11.019  1.00 18.05 ? 263 PHE A CD2   1 
ATOM   2034 C CE1   . PHE A 1 263 ? 40.736 44.703 13.164  1.00 21.57 ? 263 PHE A CE1   1 
ATOM   2035 C CE2   . PHE A 1 263 ? 39.679 45.761 11.266  1.00 21.39 ? 263 PHE A CE2   1 
ATOM   2036 C CZ    . PHE A 1 263 ? 40.574 45.821 12.347  1.00 20.79 ? 263 PHE A CZ    1 
ATOM   2037 N N     . HIS A 1 264 ? 39.045 38.839 10.726  1.00 18.35 ? 264 HIS A N     1 
ATOM   2038 C CA    . HIS A 1 264 ? 38.469 37.508 10.577  1.00 19.34 ? 264 HIS A CA    1 
ATOM   2039 C C     . HIS A 1 264 ? 38.494 36.731 11.888  1.00 19.78 ? 264 HIS A C     1 
ATOM   2040 O O     . HIS A 1 264 ? 39.502 36.739 12.592  1.00 18.70 ? 264 HIS A O     1 
ATOM   2041 C CB    . HIS A 1 264 ? 39.283 36.661 9.582   1.00 19.94 ? 264 HIS A CB    1 
ATOM   2042 C CG    . HIS A 1 264 ? 39.449 37.269 8.226   1.00 22.00 ? 264 HIS A CG    1 
ATOM   2043 N ND1   . HIS A 1 264 ? 38.694 36.879 7.140   1.00 24.31 ? 264 HIS A ND1   1 
ATOM   2044 C CD2   . HIS A 1 264 ? 40.309 38.208 7.768   1.00 22.95 ? 264 HIS A CD2   1 
ATOM   2045 C CE1   . HIS A 1 264 ? 39.085 37.549 6.072   1.00 24.15 ? 264 HIS A CE1   1 
ATOM   2046 N NE2   . HIS A 1 264 ? 40.065 38.362 6.425   1.00 25.37 ? 264 HIS A NE2   1 
ATOM   2047 N N     . LEU A 1 265 ? 37.389 36.063 12.208  1.00 19.69 ? 265 LEU A N     1 
ATOM   2048 C CA    . LEU A 1 265 ? 37.365 35.191 13.375  1.00 20.56 ? 265 LEU A CA    1 
ATOM   2049 C C     . LEU A 1 265 ? 37.241 33.824 12.700  1.00 22.27 ? 265 LEU A C     1 
ATOM   2050 O O     . LEU A 1 265 ? 36.132 33.362 12.425  1.00 22.53 ? 265 LEU A O     1 
ATOM   2051 C CB    . LEU A 1 265 ? 36.149 35.458 14.273  1.00 20.77 ? 265 LEU A CB    1 
ATOM   2052 C CG    . LEU A 1 265 ? 36.169 34.551 15.511  1.00 22.87 ? 265 LEU A CG    1 
ATOM   2053 C CD1   . LEU A 1 265 ? 37.460 34.795 16.281  1.00 23.03 ? 265 LEU A CD1   1 
ATOM   2054 C CD2   . LEU A 1 265 ? 34.958 34.815 16.396  1.00 19.38 ? 265 LEU A CD2   1 
ATOM   2055 N N     . HIS A 1 266 ? 38.383 33.198 12.418  1.00 21.96 ? 266 HIS A N     1 
ATOM   2056 C CA    . HIS A 1 266 ? 38.409 31.916 11.709  1.00 24.36 ? 266 HIS A CA    1 
ATOM   2057 C C     . HIS A 1 266 ? 37.753 30.736 12.403  1.00 25.60 ? 266 HIS A C     1 
ATOM   2058 O O     . HIS A 1 266 ? 37.702 30.673 13.632  1.00 23.71 ? 266 HIS A O     1 
ATOM   2059 C CB    . HIS A 1 266 ? 39.847 31.547 11.365  1.00 26.30 ? 266 HIS A CB    1 
ATOM   2060 C CG    . HIS A 1 266 ? 40.551 32.576 10.546  1.00 29.58 ? 266 HIS A CG    1 
ATOM   2061 N ND1   . HIS A 1 266 ? 40.150 32.913 9.269   1.00 30.44 ? 266 HIS A ND1   1 
ATOM   2062 C CD2   . HIS A 1 266 ? 41.630 33.346 10.817  1.00 30.43 ? 266 HIS A CD2   1 
ATOM   2063 C CE1   . HIS A 1 266 ? 40.951 33.847 8.793   1.00 29.42 ? 266 HIS A CE1   1 
ATOM   2064 N NE2   . HIS A 1 266 ? 41.860 34.127 9.712   1.00 30.88 ? 266 HIS A NE2   1 
ATOM   2065 N N     . GLY A 1 267 ? 37.256 29.800 11.595  1.00 25.36 ? 267 GLY A N     1 
ATOM   2066 C CA    . GLY A 1 267 ? 36.617 28.608 12.127  1.00 25.41 ? 267 GLY A CA    1 
ATOM   2067 C C     . GLY A 1 267 ? 37.541 27.790 13.008  1.00 28.05 ? 267 GLY A C     1 
ATOM   2068 O O     . GLY A 1 267 ? 38.767 27.831 12.858  1.00 27.75 ? 267 GLY A O     1 
ATOM   2069 N N     . GLY A 1 268 ? 36.956 27.036 13.932  1.00 28.37 ? 268 GLY A N     1 
ATOM   2070 C CA    . GLY A 1 268 ? 37.760 26.236 14.836  1.00 29.41 ? 268 GLY A CA    1 
ATOM   2071 C C     . GLY A 1 268 ? 37.833 26.917 16.191  1.00 30.02 ? 268 GLY A C     1 
ATOM   2072 O O     . GLY A 1 268 ? 37.341 28.036 16.348  1.00 29.64 ? 268 GLY A O     1 
ATOM   2073 N N     . THR A 1 269 ? 38.456 26.258 17.163  1.00 30.02 ? 269 THR A N     1 
ATOM   2074 C CA    . THR A 1 269 ? 38.565 26.813 18.506  1.00 30.00 ? 269 THR A CA    1 
ATOM   2075 C C     . THR A 1 269 ? 40.008 26.949 18.984  1.00 29.20 ? 269 THR A C     1 
ATOM   2076 O O     . THR A 1 269 ? 40.254 27.323 20.129  1.00 28.55 ? 269 THR A O     1 
ATOM   2077 C CB    . THR A 1 269 ? 37.788 25.947 19.514  1.00 30.83 ? 269 THR A CB    1 
ATOM   2078 O OG1   . THR A 1 269 ? 38.261 24.598 19.451  1.00 31.01 ? 269 THR A OG1   1 
ATOM   2079 C CG2   . THR A 1 269 ? 36.295 25.970 19.191  1.00 31.62 ? 269 THR A CG2   1 
ATOM   2080 N N     . SER A 1 270 ? 40.963 26.644 18.109  1.00 29.06 ? 270 SER A N     1 
ATOM   2081 C CA    . SER A 1 270 ? 42.375 26.742 18.464  1.00 30.93 ? 270 SER A CA    1 
ATOM   2082 C C     . SER A 1 270 ? 42.699 28.125 19.012  1.00 30.03 ? 270 SER A C     1 
ATOM   2083 O O     . SER A 1 270 ? 42.114 29.123 18.591  1.00 29.72 ? 270 SER A O     1 
ATOM   2084 C CB    . SER A 1 270 ? 43.259 26.448 17.243  1.00 32.21 ? 270 SER A CB    1 
ATOM   2085 O OG    . SER A 1 270 ? 43.100 25.103 16.824  1.00 39.03 ? 270 SER A OG    1 
ATOM   2086 N N     . TYR A 1 271 ? 43.631 28.173 19.956  1.00 30.81 ? 271 TYR A N     1 
ATOM   2087 C CA    . TYR A 1 271 ? 44.054 29.424 20.581  1.00 32.06 ? 271 TYR A CA    1 
ATOM   2088 C C     . TYR A 1 271 ? 42.940 30.231 21.240  1.00 32.10 ? 271 TYR A C     1 
ATOM   2089 O O     . TYR A 1 271 ? 43.094 31.434 21.479  1.00 32.49 ? 271 TYR A O     1 
ATOM   2090 C CB    . TYR A 1 271 ? 44.795 30.316 19.576  1.00 34.14 ? 271 TYR A CB    1 
ATOM   2091 C CG    . TYR A 1 271 ? 46.285 30.065 19.543  1.00 37.92 ? 271 TYR A CG    1 
ATOM   2092 C CD1   . TYR A 1 271 ? 46.830 29.084 18.717  1.00 39.83 ? 271 TYR A CD1   1 
ATOM   2093 C CD2   . TYR A 1 271 ? 47.146 30.779 20.376  1.00 38.76 ? 271 TYR A CD2   1 
ATOM   2094 C CE1   . TYR A 1 271 ? 48.194 28.818 18.722  1.00 41.73 ? 271 TYR A CE1   1 
ATOM   2095 C CE2   . TYR A 1 271 ? 48.510 30.518 20.389  1.00 42.60 ? 271 TYR A CE2   1 
ATOM   2096 C CZ    . TYR A 1 271 ? 49.026 29.537 19.562  1.00 42.23 ? 271 TYR A CZ    1 
ATOM   2097 O OH    . TYR A 1 271 ? 50.377 29.267 19.586  1.00 47.11 ? 271 TYR A OH    1 
ATOM   2098 N N     . GLY A 1 272 ? 41.820 29.580 21.531  1.00 30.19 ? 272 GLY A N     1 
ATOM   2099 C CA    . GLY A 1 272 ? 40.734 30.280 22.191  1.00 30.23 ? 272 GLY A CA    1 
ATOM   2100 C C     . GLY A 1 272 ? 39.821 31.101 21.306  1.00 30.52 ? 272 GLY A C     1 
ATOM   2101 O O     . GLY A 1 272 ? 38.986 31.843 21.817  1.00 31.21 ? 272 GLY A O     1 
ATOM   2102 N N     . ARG A 1 273 ? 39.964 30.984 19.989  1.00 28.66 ? 273 ARG A N     1 
ATOM   2103 C CA    . ARG A 1 273 ? 39.099 31.731 19.085  1.00 28.83 ? 273 ARG A CA    1 
ATOM   2104 C C     . ARG A 1 273 ? 37.659 31.511 19.526  1.00 28.06 ? 273 ARG A C     1 
ATOM   2105 O O     . ARG A 1 273 ? 37.188 30.375 19.604  1.00 30.17 ? 273 ARG A O     1 
ATOM   2106 C CB    . ARG A 1 273 ? 39.266 31.263 17.634  1.00 27.56 ? 273 ARG A CB    1 
ATOM   2107 C CG    . ARG A 1 273 ? 40.605 31.638 17.009  1.00 30.15 ? 273 ARG A CG    1 
ATOM   2108 C CD    . ARG A 1 273 ? 40.549 31.549 15.489  1.00 31.07 ? 273 ARG A CD    1 
ATOM   2109 N NE    . ARG A 1 273 ? 40.284 30.190 15.025  1.00 29.79 ? 273 ARG A NE    1 
ATOM   2110 C CZ    . ARG A 1 273 ? 41.185 29.213 15.019  1.00 32.42 ? 273 ARG A CZ    1 
ATOM   2111 N NH1   . ARG A 1 273 ? 42.420 29.439 15.452  1.00 30.39 ? 273 ARG A NH1   1 
ATOM   2112 N NH2   . ARG A 1 273 ? 40.854 28.007 14.576  1.00 34.45 ? 273 ARG A NH2   1 
ATOM   2113 N N     . GLY A 1 274 ? 36.973 32.606 19.824  1.00 26.65 ? 274 GLY A N     1 
ATOM   2114 C CA    . GLY A 1 274 ? 35.598 32.516 20.269  1.00 25.12 ? 274 GLY A CA    1 
ATOM   2115 C C     . GLY A 1 274 ? 35.083 33.877 20.685  1.00 25.17 ? 274 GLY A C     1 
ATOM   2116 O O     . GLY A 1 274 ? 35.772 34.892 20.520  1.00 23.77 ? 274 GLY A O     1 
ATOM   2117 N N     . ILE A 1 275 ? 33.876 33.899 21.243  1.00 23.63 ? 275 ILE A N     1 
ATOM   2118 C CA    . ILE A 1 275 ? 33.265 35.141 21.673  1.00 22.18 ? 275 ILE A CA    1 
ATOM   2119 C C     . ILE A 1 275 ? 32.591 34.969 23.017  1.00 23.40 ? 275 ILE A C     1 
ATOM   2120 O O     . ILE A 1 275 ? 31.874 33.987 23.240  1.00 21.89 ? 275 ILE A O     1 
ATOM   2121 C CB    . ILE A 1 275 ? 32.172 35.599 20.685  1.00 24.49 ? 275 ILE A CB    1 
ATOM   2122 C CG1   . ILE A 1 275 ? 32.767 35.797 19.291  1.00 24.05 ? 275 ILE A CG1   1 
ATOM   2123 C CG2   . ILE A 1 275 ? 31.512 36.884 21.197  1.00 21.26 ? 275 ILE A CG2   1 
ATOM   2124 C CD1   . ILE A 1 275 ? 31.725 36.075 18.215  1.00 27.43 ? 275 ILE A CD1   1 
ATOM   2125 N N     . ARG A 1 276 ? 32.823 35.921 23.909  1.00 22.03 ? 276 ARG A N     1 
ATOM   2126 C CA    . ARG A 1 276 ? 32.174 35.883 25.202  1.00 23.65 ? 276 ARG A CA    1 
ATOM   2127 C C     . ARG A 1 276 ? 31.538 37.245 25.435  1.00 23.39 ? 276 ARG A C     1 
ATOM   2128 O O     . ARG A 1 276 ? 32.162 38.284 25.212  1.00 24.11 ? 276 ARG A O     1 
ATOM   2129 C CB    . ARG A 1 276 ? 33.169 35.551 26.322  1.00 25.52 ? 276 ARG A CB    1 
ATOM   2130 C CG    . ARG A 1 276 ? 32.526 35.579 27.701  1.00 29.59 ? 276 ARG A CG    1 
ATOM   2131 C CD    . ARG A 1 276 ? 32.910 34.390 28.584  1.00 29.06 ? 276 ARG A CD    1 
ATOM   2132 N NE    . ARG A 1 276 ? 31.868 34.196 29.590  1.00 28.91 ? 276 ARG A NE    1 
ATOM   2133 C CZ    . ARG A 1 276 ? 31.669 33.081 30.287  1.00 29.26 ? 276 ARG A CZ    1 
ATOM   2134 N NH1   . ARG A 1 276 ? 32.450 32.017 30.123  1.00 27.10 ? 276 ARG A NH1   1 
ATOM   2135 N NH2   . ARG A 1 276 ? 30.636 33.016 31.122  1.00 29.84 ? 276 ARG A NH2   1 
ATOM   2136 N N     . VAL A 1 277 ? 30.279 37.241 25.859  1.00 21.08 ? 277 VAL A N     1 
ATOM   2137 C CA    . VAL A 1 277 ? 29.571 38.479 26.136  1.00 22.58 ? 277 VAL A CA    1 
ATOM   2138 C C     . VAL A 1 277 ? 30.022 38.996 27.498  1.00 23.73 ? 277 VAL A C     1 
ATOM   2139 O O     . VAL A 1 277 ? 30.050 38.249 28.477  1.00 24.20 ? 277 VAL A O     1 
ATOM   2140 C CB    . VAL A 1 277 ? 28.049 38.264 26.175  1.00 22.58 ? 277 VAL A CB    1 
ATOM   2141 C CG1   . VAL A 1 277 ? 27.355 39.560 26.570  1.00 22.35 ? 277 VAL A CG1   1 
ATOM   2142 C CG2   . VAL A 1 277 ? 27.554 37.803 24.814  1.00 23.92 ? 277 VAL A CG2   1 
ATOM   2143 N N     . LEU A 1 278 ? 30.389 40.269 27.547  1.00 23.54 ? 278 LEU A N     1 
ATOM   2144 C CA    . LEU A 1 278 ? 30.835 40.900 28.783  1.00 25.09 ? 278 LEU A CA    1 
ATOM   2145 C C     . LEU A 1 278 ? 29.674 41.611 29.468  1.00 26.58 ? 278 LEU A C     1 
ATOM   2146 O O     . LEU A 1 278 ? 28.998 42.456 28.868  1.00 25.52 ? 278 LEU A O     1 
ATOM   2147 C CB    . LEU A 1 278 ? 31.947 41.906 28.491  1.00 26.35 ? 278 LEU A CB    1 
ATOM   2148 C CG    . LEU A 1 278 ? 33.224 41.332 27.889  1.00 24.51 ? 278 LEU A CG    1 
ATOM   2149 C CD1   . LEU A 1 278 ? 34.226 42.453 27.644  1.00 27.08 ? 278 LEU A CD1   1 
ATOM   2150 C CD2   . LEU A 1 278 ? 33.801 40.294 28.840  1.00 27.72 ? 278 LEU A CD2   1 
ATOM   2151 N N     . PRO A 1 279 ? 29.418 41.270 30.739  1.00 28.72 ? 279 PRO A N     1 
ATOM   2152 C CA    . PRO A 1 279 ? 28.321 41.911 31.466  1.00 30.00 ? 279 PRO A CA    1 
ATOM   2153 C C     . PRO A 1 279 ? 28.709 43.331 31.865  1.00 30.95 ? 279 PRO A C     1 
ATOM   2154 O O     . PRO A 1 279 ? 29.889 43.677 31.903  1.00 28.67 ? 279 PRO A O     1 
ATOM   2155 C CB    . PRO A 1 279 ? 28.124 40.987 32.671  1.00 31.38 ? 279 PRO A CB    1 
ATOM   2156 C CG    . PRO A 1 279 ? 29.495 40.485 32.932  1.00 32.05 ? 279 PRO A CG    1 
ATOM   2157 C CD    . PRO A 1 279 ? 30.022 40.190 31.538  1.00 29.49 ? 279 PRO A CD    1 
ATOM   2158 N N     . GLU A 1 280 ? 27.717 44.157 32.162  1.00 32.88 ? 280 GLU A N     1 
ATOM   2159 C CA    . GLU A 1 280 ? 27.990 45.533 32.554  1.00 35.92 ? 280 GLU A CA    1 
ATOM   2160 C C     . GLU A 1 280 ? 28.670 45.629 33.918  1.00 35.39 ? 280 GLU A C     1 
ATOM   2161 O O     . GLU A 1 280 ? 29.069 46.708 34.343  1.00 36.22 ? 280 GLU A O     1 
ATOM   2162 C CB    . GLU A 1 280 ? 26.694 46.341 32.549  1.00 40.04 ? 280 GLU A CB    1 
ATOM   2163 C CG    . GLU A 1 280 ? 26.092 46.475 31.155  1.00 44.94 ? 280 GLU A CG    1 
ATOM   2164 C CD    . GLU A 1 280 ? 24.868 47.367 31.129  1.00 48.69 ? 280 GLU A CD    1 
ATOM   2165 O OE1   . GLU A 1 280 ? 25.008 48.564 31.458  1.00 49.54 ? 280 GLU A OE1   1 
ATOM   2166 O OE2   . GLU A 1 280 ? 23.772 46.868 30.784  1.00 51.25 ? 280 GLU A OE2   1 
ATOM   2167 N N     . SER A 1 281 ? 28.811 44.496 34.597  1.00 36.48 ? 281 SER A N     1 
ATOM   2168 C CA    . SER A 1 281 ? 29.464 44.473 35.904  1.00 37.30 ? 281 SER A CA    1 
ATOM   2169 C C     . SER A 1 281 ? 30.977 44.315 35.731  1.00 37.76 ? 281 SER A C     1 
ATOM   2170 O O     . SER A 1 281 ? 31.733 44.340 36.704  1.00 38.75 ? 281 SER A O     1 
ATOM   2171 C CB    . SER A 1 281 ? 28.920 43.324 36.753  1.00 37.24 ? 281 SER A CB    1 
ATOM   2172 O OG    . SER A 1 281 ? 29.076 42.078 36.097  1.00 37.81 ? 281 SER A OG    1 
ATOM   2173 N N     . ASN A 1 282 ? 31.405 44.152 34.483  1.00 36.71 ? 282 ASN A N     1 
ATOM   2174 C CA    . ASN A 1 282 ? 32.819 43.994 34.152  1.00 34.93 ? 282 ASN A CA    1 
ATOM   2175 C C     . ASN A 1 282 ? 33.537 45.350 34.142  1.00 32.98 ? 282 ASN A C     1 
ATOM   2176 O O     . ASN A 1 282 ? 33.067 46.309 33.530  1.00 31.60 ? 282 ASN A O     1 
ATOM   2177 C CB    . ASN A 1 282 ? 32.940 43.306 32.787  1.00 33.57 ? 282 ASN A CB    1 
ATOM   2178 C CG    . ASN A 1 282 ? 34.372 43.032 32.396  1.00 35.01 ? 282 ASN A CG    1 
ATOM   2179 O OD1   . ASN A 1 282 ? 35.111 43.944 32.029  1.00 34.94 ? 282 ASN A OD1   1 
ATOM   2180 N ND2   . ASN A 1 282 ? 34.775 41.769 32.474  1.00 34.56 ? 282 ASN A ND2   1 
ATOM   2181 N N     . SER A 1 283 ? 34.683 45.431 34.812  1.00 32.62 ? 283 SER A N     1 
ATOM   2182 C CA    . SER A 1 283 ? 35.431 46.684 34.882  1.00 32.92 ? 283 SER A CA    1 
ATOM   2183 C C     . SER A 1 283 ? 35.892 47.199 33.519  1.00 30.65 ? 283 SER A C     1 
ATOM   2184 O O     . SER A 1 283 ? 35.922 48.408 33.279  1.00 28.72 ? 283 SER A O     1 
ATOM   2185 C CB    . SER A 1 283 ? 36.642 46.526 35.809  1.00 35.58 ? 283 SER A CB    1 
ATOM   2186 O OG    . SER A 1 283 ? 37.548 45.549 35.329  1.00 41.73 ? 283 SER A OG    1 
ATOM   2187 N N     . ASP A 1 284 ? 36.240 46.284 32.622  1.00 28.88 ? 284 ASP A N     1 
ATOM   2188 C CA    . ASP A 1 284 ? 36.696 46.681 31.298  1.00 27.55 ? 284 ASP A CA    1 
ATOM   2189 C C     . ASP A 1 284 ? 35.574 47.346 30.505  1.00 26.94 ? 284 ASP A C     1 
ATOM   2190 O O     . ASP A 1 284 ? 35.823 48.173 29.630  1.00 26.15 ? 284 ASP A O     1 
ATOM   2191 C CB    . ASP A 1 284 ? 37.256 45.472 30.538  1.00 28.93 ? 284 ASP A CB    1 
ATOM   2192 C CG    . ASP A 1 284 ? 38.582 44.987 31.112  1.00 32.26 ? 284 ASP A CG    1 
ATOM   2193 O OD1   . ASP A 1 284 ? 39.327 45.828 31.661  1.00 31.15 ? 284 ASP A OD1   1 
ATOM   2194 O OD2   . ASP A 1 284 ? 38.887 43.776 31.007  1.00 29.48 ? 284 ASP A OD2   1 
ATOM   2195 N N     . VAL A 1 285 ? 34.331 46.997 30.821  1.00 25.05 ? 285 VAL A N     1 
ATOM   2196 C CA    . VAL A 1 285 ? 33.200 47.609 30.133  1.00 23.98 ? 285 VAL A CA    1 
ATOM   2197 C C     . VAL A 1 285 ? 33.021 49.058 30.616  1.00 25.34 ? 285 VAL A C     1 
ATOM   2198 O O     . VAL A 1 285 ? 32.692 49.939 29.828  1.00 24.99 ? 285 VAL A O     1 
ATOM   2199 C CB    . VAL A 1 285 ? 31.900 46.803 30.370  1.00 24.18 ? 285 VAL A CB    1 
ATOM   2200 C CG1   . VAL A 1 285 ? 30.724 47.504 29.736  1.00 23.38 ? 285 VAL A CG1   1 
ATOM   2201 C CG2   . VAL A 1 285 ? 32.050 45.400 29.779  1.00 24.63 ? 285 VAL A CG2   1 
ATOM   2202 N N     . ASP A 1 286 ? 33.250 49.322 31.900  1.00 27.14 ? 286 ASP A N     1 
ATOM   2203 C CA    . ASP A 1 286 ? 33.105 50.692 32.394  1.00 29.06 ? 286 ASP A CA    1 
ATOM   2204 C C     . ASP A 1 286 ? 34.074 51.625 31.665  1.00 29.31 ? 286 ASP A C     1 
ATOM   2205 O O     . ASP A 1 286 ? 33.725 52.743 31.292  1.00 30.29 ? 286 ASP A O     1 
ATOM   2206 C CB    . ASP A 1 286 ? 33.363 50.766 33.903  1.00 31.07 ? 286 ASP A CB    1 
ATOM   2207 C CG    . ASP A 1 286 ? 32.260 50.119 34.718  1.00 33.99 ? 286 ASP A CG    1 
ATOM   2208 O OD1   . ASP A 1 286 ? 31.072 50.363 34.422  1.00 35.54 ? 286 ASP A OD1   1 
ATOM   2209 O OD2   . ASP A 1 286 ? 32.584 49.373 35.663  1.00 39.03 ? 286 ASP A OD2   1 
ATOM   2210 N N     . GLN A 1 287 ? 35.294 51.153 31.465  1.00 28.90 ? 287 GLN A N     1 
ATOM   2211 C CA    . GLN A 1 287 ? 36.317 51.912 30.756  1.00 30.12 ? 287 GLN A CA    1 
ATOM   2212 C C     . GLN A 1 287 ? 35.876 52.130 29.294  1.00 27.96 ? 287 GLN A C     1 
ATOM   2213 O O     . GLN A 1 287 ? 35.926 53.240 28.765  1.00 25.57 ? 287 GLN A O     1 
ATOM   2214 C CB    . GLN A 1 287 ? 37.621 51.117 30.786  1.00 33.94 ? 287 GLN A CB    1 
ATOM   2215 C CG    . GLN A 1 287 ? 38.806 51.773 30.118  1.00 40.87 ? 287 GLN A CG    1 
ATOM   2216 C CD    . GLN A 1 287 ? 39.796 50.744 29.601  1.00 45.76 ? 287 GLN A CD    1 
ATOM   2217 O OE1   . GLN A 1 287 ? 40.147 49.792 30.306  1.00 48.60 ? 287 GLN A OE1   1 
ATOM   2218 N NE2   . GLN A 1 287 ? 40.248 50.925 28.363  1.00 47.04 ? 287 GLN A NE2   1 
ATOM   2219 N N     . LEU A 1 288 ? 35.449 51.051 28.651  1.00 25.06 ? 288 LEU A N     1 
ATOM   2220 C CA    . LEU A 1 288 ? 35.003 51.107 27.263  1.00 24.09 ? 288 LEU A CA    1 
ATOM   2221 C C     . LEU A 1 288 ? 33.875 52.127 27.069  1.00 23.36 ? 288 LEU A C     1 
ATOM   2222 O O     . LEU A 1 288 ? 33.908 52.930 26.136  1.00 20.50 ? 288 LEU A O     1 
ATOM   2223 C CB    . LEU A 1 288 ? 34.530 49.720 26.815  1.00 24.16 ? 288 LEU A CB    1 
ATOM   2224 C CG    . LEU A 1 288 ? 33.882 49.629 25.433  1.00 24.23 ? 288 LEU A CG    1 
ATOM   2225 C CD1   . LEU A 1 288 ? 34.882 50.031 24.362  1.00 25.19 ? 288 LEU A CD1   1 
ATOM   2226 C CD2   . LEU A 1 288 ? 33.396 48.199 25.198  1.00 25.49 ? 288 LEU A CD2   1 
ATOM   2227 N N     . LYS A 1 289 ? 32.879 52.101 27.951  1.00 22.66 ? 289 LYS A N     1 
ATOM   2228 C CA    . LYS A 1 289 ? 31.765 53.037 27.833  1.00 24.79 ? 289 LYS A CA    1 
ATOM   2229 C C     . LYS A 1 289 ? 32.221 54.497 27.767  1.00 23.97 ? 289 LYS A C     1 
ATOM   2230 O O     . LYS A 1 289 ? 31.650 55.294 27.020  1.00 23.63 ? 289 LYS A O     1 
ATOM   2231 C CB    . LYS A 1 289 ? 30.787 52.866 28.997  1.00 24.34 ? 289 LYS A CB    1 
ATOM   2232 C CG    . LYS A 1 289 ? 29.998 51.573 28.971  1.00 28.69 ? 289 LYS A CG    1 
ATOM   2233 C CD    . LYS A 1 289 ? 29.108 51.493 30.206  1.00 31.12 ? 289 LYS A CD    1 
ATOM   2234 C CE    . LYS A 1 289 ? 28.113 50.353 30.113  1.00 35.88 ? 289 LYS A CE    1 
ATOM   2235 N NZ    . LYS A 1 289 ? 27.210 50.342 31.307  1.00 37.24 ? 289 LYS A NZ    1 
ATOM   2236 N N     . LYS A 1 290 ? 33.232 54.850 28.557  1.00 24.72 ? 290 LYS A N     1 
ATOM   2237 C CA    . LYS A 1 290 ? 33.736 56.229 28.563  1.00 26.69 ? 290 LYS A CA    1 
ATOM   2238 C C     . LYS A 1 290 ? 34.408 56.583 27.241  1.00 25.62 ? 290 LYS A C     1 
ATOM   2239 O O     . LYS A 1 290 ? 34.309 57.713 26.770  1.00 25.79 ? 290 LYS A O     1 
ATOM   2240 C CB    . LYS A 1 290 ? 34.725 56.438 29.709  1.00 29.70 ? 290 LYS A CB    1 
ATOM   2241 C CG    . LYS A 1 290 ? 34.114 56.277 31.097  1.00 32.00 ? 290 LYS A CG    1 
ATOM   2242 C CD    . LYS A 1 290 ? 32.961 57.243 31.308  1.00 36.73 ? 290 LYS A CD    1 
ATOM   2243 C CE    . LYS A 1 290 ? 32.349 57.097 32.698  1.00 38.78 ? 290 LYS A CE    1 
ATOM   2244 N NZ    . LYS A 1 290 ? 33.338 57.371 33.779  1.00 42.91 ? 290 LYS A NZ    1 
ATOM   2245 N N     . ASP A 1 291 ? 35.104 55.624 26.643  1.00 24.47 ? 291 ASP A N     1 
ATOM   2246 C CA    . ASP A 1 291 ? 35.754 55.880 25.360  1.00 24.71 ? 291 ASP A CA    1 
ATOM   2247 C C     . ASP A 1 291 ? 34.692 56.066 24.283  1.00 25.05 ? 291 ASP A C     1 
ATOM   2248 O O     . ASP A 1 291 ? 34.839 56.896 23.382  1.00 22.91 ? 291 ASP A O     1 
ATOM   2249 C CB    . ASP A 1 291 ? 36.674 54.724 24.963  1.00 27.29 ? 291 ASP A CB    1 
ATOM   2250 C CG    . ASP A 1 291 ? 37.902 54.632 25.837  1.00 33.63 ? 291 ASP A CG    1 
ATOM   2251 O OD1   . ASP A 1 291 ? 38.250 55.644 26.486  1.00 37.52 ? 291 ASP A OD1   1 
ATOM   2252 O OD2   . ASP A 1 291 ? 38.526 53.550 25.868  1.00 35.38 ? 291 ASP A OD2   1 
ATOM   2253 N N     . LEU A 1 292 ? 33.617 55.290 24.378  1.00 23.12 ? 292 LEU A N     1 
ATOM   2254 C CA    . LEU A 1 292 ? 32.540 55.397 23.399  1.00 24.98 ? 292 LEU A CA    1 
ATOM   2255 C C     . LEU A 1 292 ? 31.844 56.746 23.524  1.00 25.88 ? 292 LEU A C     1 
ATOM   2256 O O     . LEU A 1 292 ? 31.514 57.383 22.528  1.00 27.43 ? 292 LEU A O     1 
ATOM   2257 C CB    . LEU A 1 292 ? 31.530 54.260 23.593  1.00 24.54 ? 292 LEU A CB    1 
ATOM   2258 C CG    . LEU A 1 292 ? 32.110 52.842 23.533  1.00 25.61 ? 292 LEU A CG    1 
ATOM   2259 C CD1   . LEU A 1 292 ? 30.989 51.819 23.652  1.00 25.22 ? 292 LEU A CD1   1 
ATOM   2260 C CD2   . LEU A 1 292 ? 32.868 52.642 22.217  1.00 21.93 ? 292 LEU A CD2   1 
ATOM   2261 N N     . GLU A 1 293 ? 31.635 57.189 24.758  1.00 25.60 ? 293 GLU A N     1 
ATOM   2262 C CA    . GLU A 1 293 ? 30.980 58.466 25.005  1.00 28.58 ? 293 GLU A CA    1 
ATOM   2263 C C     . GLU A 1 293 ? 31.797 59.606 24.407  1.00 27.58 ? 293 GLU A C     1 
ATOM   2264 O O     . GLU A 1 293 ? 31.251 60.515 23.781  1.00 29.42 ? 293 GLU A O     1 
ATOM   2265 C CB    . GLU A 1 293 ? 30.817 58.687 26.512  1.00 30.40 ? 293 GLU A CB    1 
ATOM   2266 C CG    . GLU A 1 293 ? 29.858 59.802 26.881  1.00 36.16 ? 293 GLU A CG    1 
ATOM   2267 C CD    . GLU A 1 293 ? 29.861 60.086 28.371  1.00 38.95 ? 293 GLU A CD    1 
ATOM   2268 O OE1   . GLU A 1 293 ? 29.934 59.121 29.165  1.00 42.22 ? 293 GLU A OE1   1 
ATOM   2269 O OE2   . GLU A 1 293 ? 29.788 61.274 28.749  1.00 42.19 ? 293 GLU A OE2   1 
ATOM   2270 N N     . SER A 1 294 ? 33.108 59.549 24.611  1.00 25.44 ? 294 SER A N     1 
ATOM   2271 C CA    . SER A 1 294 ? 34.030 60.553 24.101  1.00 27.39 ? 294 SER A CA    1 
ATOM   2272 C C     . SER A 1 294 ? 34.030 60.567 22.570  1.00 29.02 ? 294 SER A C     1 
ATOM   2273 O O     . SER A 1 294 ? 33.967 61.627 21.947  1.00 29.65 ? 294 SER A O     1 
ATOM   2274 C CB    . SER A 1 294 ? 35.443 60.256 24.617  1.00 27.14 ? 294 SER A CB    1 
ATOM   2275 O OG    . SER A 1 294 ? 36.378 61.207 24.141  1.00 28.77 ? 294 SER A OG    1 
ATOM   2276 N N     . ALA A 1 295 ? 34.091 59.384 21.971  1.00 30.34 ? 295 ALA A N     1 
ATOM   2277 C CA    . ALA A 1 295 ? 34.099 59.270 20.519  1.00 33.22 ? 295 ALA A CA    1 
ATOM   2278 C C     . ALA A 1 295 ? 32.768 59.730 19.936  1.00 36.17 ? 295 ALA A C     1 
ATOM   2279 O O     . ALA A 1 295 ? 32.735 60.420 18.918  1.00 37.11 ? 295 ALA A O     1 
ATOM   2280 C CB    . ALA A 1 295 ? 34.381 57.825 20.109  1.00 32.21 ? 295 ALA A CB    1 
ATOM   2281 N N     . ASN A 1 296 ? 31.674 59.357 20.591  1.00 39.45 ? 296 ASN A N     1 
ATOM   2282 C CA    . ASN A 1 296 ? 30.348 59.725 20.111  1.00 43.67 ? 296 ASN A CA    1 
ATOM   2283 C C     . ASN A 1 296 ? 30.140 61.232 20.052  1.00 45.80 ? 296 ASN A C     1 
ATOM   2284 O O     . ASN A 1 296 ? 29.551 61.741 19.095  1.00 45.55 ? 296 ASN A O     1 
ATOM   2285 C CB    . ASN A 1 296 ? 29.269 59.089 20.986  1.00 44.66 ? 296 ASN A CB    1 
ATOM   2286 C CG    . ASN A 1 296 ? 28.350 58.180 20.200  1.00 47.14 ? 296 ASN A CG    1 
ATOM   2287 O OD1   . ASN A 1 296 ? 27.859 58.549 19.131  1.00 48.41 ? 296 ASN A OD1   1 
ATOM   2288 N ND2   . ASN A 1 296 ? 28.109 56.983 20.725  1.00 49.24 ? 296 ASN A ND2   1 
ATOM   2289 N N     . LEU A 1 297 ? 30.616 61.940 21.074  1.00 47.95 ? 297 LEU A N     1 
ATOM   2290 C CA    . LEU A 1 297 ? 30.486 63.392 21.119  1.00 50.69 ? 297 LEU A CA    1 
ATOM   2291 C C     . LEU A 1 297 ? 31.185 64.009 19.916  1.00 52.76 ? 297 LEU A C     1 
ATOM   2292 O O     . LEU A 1 297 ? 30.838 65.103 19.472  1.00 53.65 ? 297 LEU A O     1 
ATOM   2293 C CB    . LEU A 1 297 ? 31.095 63.949 22.411  1.00 49.51 ? 297 LEU A CB    1 
ATOM   2294 C CG    . LEU A 1 297 ? 30.303 63.712 23.700  1.00 50.51 ? 297 LEU A CG    1 
ATOM   2295 C CD1   . LEU A 1 297 ? 31.089 64.225 24.903  1.00 49.79 ? 297 LEU A CD1   1 
ATOM   2296 C CD2   . LEU A 1 297 ? 28.957 64.418 23.602  1.00 50.48 ? 297 LEU A CD2   1 
ATOM   2297 N N     . THR A 1 298 ? 32.172 63.293 19.390  1.00 55.22 ? 298 THR A N     1 
ATOM   2298 C CA    . THR A 1 298 ? 32.927 63.757 18.237  1.00 58.00 ? 298 THR A CA    1 
ATOM   2299 C C     . THR A 1 298 ? 32.756 62.779 17.080  1.00 59.39 ? 298 THR A C     1 
ATOM   2300 O O     . THR A 1 298 ? 33.649 61.975 16.800  1.00 60.70 ? 298 THR A O     1 
ATOM   2301 C CB    . THR A 1 298 ? 34.425 63.865 18.564  1.00 58.66 ? 298 THR A CB    1 
ATOM   2302 O OG1   . THR A 1 298 ? 34.598 64.620 19.768  1.00 60.11 ? 298 THR A OG1   1 
ATOM   2303 C CG2   . THR A 1 298 ? 35.166 64.558 17.429  1.00 59.89 ? 298 THR A CG2   1 
ATOM   2304 N N     . ALA A 1 299 ? 31.603 62.845 16.421  1.00 59.40 ? 299 ALA A N     1 
ATOM   2305 C CA    . ALA A 1 299 ? 31.315 61.967 15.289  1.00 59.83 ? 299 ALA A CA    1 
ATOM   2306 C C     . ALA A 1 299 ? 30.000 62.365 14.624  1.00 60.42 ? 299 ALA A C     1 
ATOM   2307 O O     . ALA A 1 299 ? 30.037 62.746 13.433  1.00 60.55 ? 299 ALA A O     1 
ATOM   2308 C CB    . ALA A 1 299 ? 31.246 60.520 15.756  1.00 58.96 ? 299 ALA A CB    1 
ATOM   2309 O OXT   . ALA A 1 299 ? 28.952 62.293 15.305  1.00 60.62 ? 299 ALA A OXT   1 
ATOM   2310 O "O5'" . DT  B 2 1   ? 31.582 9.235  25.694  1.00 59.50 ? 3   DT  B "O5'" 1 
ATOM   2311 C "C5'" . DT  B 2 1   ? 31.486 8.530  24.453  1.00 60.31 ? 3   DT  B "C5'" 1 
ATOM   2312 C "C4'" . DT  B 2 1   ? 31.398 9.472  23.275  1.00 60.75 ? 3   DT  B "C4'" 1 
ATOM   2313 O "O4'" . DT  B 2 1   ? 30.122 10.163 23.333  1.00 60.80 ? 3   DT  B "O4'" 1 
ATOM   2314 C "C3'" . DT  B 2 1   ? 32.478 10.552 23.251  1.00 60.50 ? 3   DT  B "C3'" 1 
ATOM   2315 O "O3'" . DT  B 2 1   ? 33.117 10.671 21.969  1.00 60.57 ? 3   DT  B "O3'" 1 
ATOM   2316 C "C2'" . DT  B 2 1   ? 31.777 11.802 23.739  1.00 59.71 ? 3   DT  B "C2'" 1 
ATOM   2317 C "C1'" . DT  B 2 1   ? 30.305 11.570 23.433  1.00 58.48 ? 3   DT  B "C1'" 1 
ATOM   2318 N N1    . DT  B 2 1   ? 29.446 12.069 24.528  1.00 56.69 ? 3   DT  B N1    1 
ATOM   2319 C C2    . DT  B 2 1   ? 28.501 13.033 24.252  1.00 55.34 ? 3   DT  B C2    1 
ATOM   2320 O O2    . DT  B 2 1   ? 28.292 13.463 23.133  1.00 56.60 ? 3   DT  B O2    1 
ATOM   2321 N N3    . DT  B 2 1   ? 27.804 13.478 25.345  1.00 54.19 ? 3   DT  B N3    1 
ATOM   2322 C C4    . DT  B 2 1   ? 27.945 13.061 26.654  1.00 53.71 ? 3   DT  B C4    1 
ATOM   2323 O O4    . DT  B 2 1   ? 27.262 13.579 27.536  1.00 51.86 ? 3   DT  B O4    1 
ATOM   2324 C C5    . DT  B 2 1   ? 28.928 12.022 26.867  1.00 54.30 ? 3   DT  B C5    1 
ATOM   2325 C C7    . DT  B 2 1   ? 29.127 11.483 28.249  1.00 53.91 ? 3   DT  B C7    1 
ATOM   2326 C C6    . DT  B 2 1   ? 29.620 11.585 25.808  1.00 55.16 ? 3   DT  B C6    1 
ATOM   2327 P P     . U   B 2 2   ? 32.399 11.454 20.760  1.00 62.09 ? 4   U   B P     1 
ATOM   2328 O OP1   . U   B 2 2   ? 31.039 10.869 20.590  1.00 61.12 ? 4   U   B OP1   1 
ATOM   2329 O OP2   . U   B 2 2   ? 33.342 11.435 19.610  1.00 60.90 ? 4   U   B OP2   1 
ATOM   2330 O "O5'" . U   B 2 2   ? 32.226 12.969 21.244  1.00 59.67 ? 4   U   B "O5'" 1 
ATOM   2331 C "C5'" . U   B 2 2   ? 31.252 13.778 20.589  1.00 57.33 ? 4   U   B "C5'" 1 
ATOM   2332 C "C4'" . U   B 2 2   ? 31.293 15.235 21.022  1.00 55.37 ? 4   U   B "C4'" 1 
ATOM   2333 O "O4'" . U   B 2 2   ? 30.746 15.379 22.361  1.00 54.30 ? 4   U   B "O4'" 1 
ATOM   2334 C "C3'" . U   B 2 2   ? 32.704 15.831 21.074  1.00 53.98 ? 4   U   B "C3'" 1 
ATOM   2335 O "O3'" . U   B 2 2   ? 32.789 17.068 20.365  1.00 53.27 ? 4   U   B "O3'" 1 
ATOM   2336 C "C2'" . U   B 2 2   ? 33.109 15.827 22.552  1.00 53.77 ? 4   U   B "C2'" 1 
ATOM   2337 O "O2'" . U   B 2 2   ? 33.738 17.024 22.949  1.00 54.21 ? 4   U   B "O2'" 1 
ATOM   2338 C "C1'" . U   B 2 2   ? 31.741 15.859 23.231  1.00 53.27 ? 4   U   B "C1'" 1 
ATOM   2339 N N1    . U   B 2 2   ? 31.537 15.366 24.601  1.00 52.31 ? 4   U   B N1    1 
ATOM   2340 C C2    . U   B 2 2   ? 30.438 15.872 25.282  1.00 51.75 ? 4   U   B C2    1 
ATOM   2341 O O2    . U   B 2 2   ? 29.611 16.609 24.758  1.00 48.86 ? 4   U   B O2    1 
ATOM   2342 N N3    . U   B 2 2   ? 30.339 15.481 26.593  1.00 51.41 ? 4   U   B N3    1 
ATOM   2343 C C4    . U   B 2 2   ? 31.196 14.651 27.278  1.00 52.15 ? 4   U   B C4    1 
ATOM   2344 O O4    . U   B 2 2   ? 30.983 14.422 28.471  1.00 52.47 ? 4   U   B O4    1 
ATOM   2345 C C5    . U   B 2 2   ? 32.286 14.139 26.498  1.00 51.97 ? 4   U   B C5    1 
ATOM   2346 C C6    . U   B 2 2   ? 32.412 14.500 25.216  1.00 52.67 ? 4   U   B C6    1 
ATOM   2347 P P     . DA  B 2 3   ? 34.140 17.486 19.604  1.00 51.96 ? 5   DA  B P     1 
ATOM   2348 O OP1   . DA  B 2 3   ? 33.833 18.737 18.874  1.00 53.55 ? 5   DA  B OP1   1 
ATOM   2349 O OP2   . DA  B 2 3   ? 34.655 16.304 18.864  1.00 53.95 ? 5   DA  B OP2   1 
ATOM   2350 O "O5'" . DA  B 2 3   ? 35.169 17.837 20.760  1.00 50.93 ? 5   DA  B "O5'" 1 
ATOM   2351 C "C5'" . DA  B 2 3   ? 35.084 19.077 21.456  1.00 50.85 ? 5   DA  B "C5'" 1 
ATOM   2352 C "C4'" . DA  B 2 3   ? 36.241 19.206 22.417  1.00 50.67 ? 5   DA  B "C4'" 1 
ATOM   2353 O "O4'" . DA  B 2 3   ? 36.195 18.088 23.333  1.00 51.36 ? 5   DA  B "O4'" 1 
ATOM   2354 C "C3'" . DA  B 2 3   ? 37.615 19.148 21.756  1.00 49.14 ? 5   DA  B "C3'" 1 
ATOM   2355 O "O3'" . DA  B 2 3   ? 38.522 19.995 22.464  1.00 47.78 ? 5   DA  B "O3'" 1 
ATOM   2356 C "C2'" . DA  B 2 3   ? 38.013 17.687 21.875  1.00 50.21 ? 5   DA  B "C2'" 1 
ATOM   2357 C "C1'" . DA  B 2 3   ? 37.307 17.222 23.143  1.00 51.89 ? 5   DA  B "C1'" 1 
ATOM   2358 N N9    . DA  B 2 3   ? 36.775 15.864 23.041  1.00 53.72 ? 5   DA  B N9    1 
ATOM   2359 C C8    . DA  B 2 3   ? 36.401 15.203 21.896  1.00 53.79 ? 5   DA  B C8    1 
ATOM   2360 N N7    . DA  B 2 3   ? 35.907 14.009 22.113  1.00 54.86 ? 5   DA  B N7    1 
ATOM   2361 C C5    . DA  B 2 3   ? 35.969 13.869 23.492  1.00 55.87 ? 5   DA  B C5    1 
ATOM   2362 C C6    . DA  B 2 3   ? 35.582 12.828 24.354  1.00 56.95 ? 5   DA  B C6    1 
ATOM   2363 N N6    . DA  B 2 3   ? 35.031 11.687 23.934  1.00 56.73 ? 5   DA  B N6    1 
ATOM   2364 N N1    . DA  B 2 3   ? 35.782 13.002 25.679  1.00 57.53 ? 5   DA  B N1    1 
ATOM   2365 C C2    . DA  B 2 3   ? 36.330 14.149 26.098  1.00 56.67 ? 5   DA  B C2    1 
ATOM   2366 N N3    . DA  B 2 3   ? 36.729 15.202 25.388  1.00 56.60 ? 5   DA  B N3    1 
ATOM   2367 C C4    . DA  B 2 3   ? 36.517 14.997 24.075  1.00 55.21 ? 5   DA  B C4    1 
ATOM   2368 P P     . DG  B 2 4   ? 40.054 20.089 21.996  1.00 48.16 ? 6   DG  B P     1 
ATOM   2369 O OP1   . DG  B 2 4   ? 40.588 21.407 22.424  1.00 48.75 ? 6   DG  B OP1   1 
ATOM   2370 O OP2   . DG  B 2 4   ? 40.126 19.699 20.562  1.00 47.91 ? 6   DG  B OP2   1 
ATOM   2371 O "O5'" . DG  B 2 4   ? 40.757 18.961 22.865  1.00 47.98 ? 6   DG  B "O5'" 1 
ATOM   2372 C "C5'" . DG  B 2 4   ? 40.673 18.997 24.281  1.00 48.70 ? 6   DG  B "C5'" 1 
ATOM   2373 C "C4'" . DG  B 2 4   ? 41.527 17.909 24.881  1.00 48.86 ? 6   DG  B "C4'" 1 
ATOM   2374 O "O4'" . DG  B 2 4   ? 40.791 16.665 24.984  1.00 49.51 ? 6   DG  B "O4'" 1 
ATOM   2375 C "C3'" . DG  B 2 4   ? 42.779 17.606 24.059  1.00 48.31 ? 6   DG  B "C3'" 1 
ATOM   2376 O "O3'" . DG  B 2 4   ? 43.942 17.601 24.880  1.00 45.86 ? 6   DG  B "O3'" 1 
ATOM   2377 C "C2'" . DG  B 2 4   ? 42.511 16.227 23.474  1.00 48.94 ? 6   DG  B "C2'" 1 
ATOM   2378 C "C1'" . DG  B 2 4   ? 41.598 15.601 24.513  1.00 49.51 ? 6   DG  B "C1'" 1 
ATOM   2379 N N9    . DG  B 2 4   ? 40.715 14.557 24.000  1.00 50.06 ? 6   DG  B N9    1 
ATOM   2380 C C8    . DG  B 2 4   ? 40.371 14.329 22.687  1.00 49.97 ? 6   DG  B C8    1 
ATOM   2381 N N7    . DG  B 2 4   ? 39.584 13.298 22.533  1.00 49.85 ? 6   DG  B N7    1 
ATOM   2382 C C5    . DG  B 2 4   ? 39.390 12.818 23.822  1.00 49.88 ? 6   DG  B C5    1 
ATOM   2383 C C6    . DG  B 2 4   ? 38.633 11.707 24.284  1.00 49.61 ? 6   DG  B C6    1 
ATOM   2384 O O6    . DG  B 2 4   ? 37.965 10.900 23.624  1.00 48.88 ? 6   DG  B O6    1 
ATOM   2385 N N1    . DG  B 2 4   ? 38.706 11.578 25.668  1.00 49.05 ? 6   DG  B N1    1 
ATOM   2386 C C2    . DG  B 2 4   ? 39.417 12.408 26.503  1.00 49.55 ? 6   DG  B C2    1 
ATOM   2387 N N2    . DG  B 2 4   ? 39.361 12.118 27.813  1.00 47.45 ? 6   DG  B N2    1 
ATOM   2388 N N3    . DG  B 2 4   ? 40.130 13.445 26.083  1.00 48.72 ? 6   DG  B N3    1 
ATOM   2389 C C4    . DG  B 2 4   ? 40.072 13.589 24.741  1.00 49.65 ? 6   DG  B C4    1 
ATOM   2390 P P     . DG  B 2 5   ? 45.322 18.136 24.270  1.00 45.40 ? 7   DG  B P     1 
ATOM   2391 O OP1   . DG  B 2 5   ? 45.712 17.169 23.213  1.00 44.84 ? 7   DG  B OP1   1 
ATOM   2392 O OP2   . DG  B 2 5   ? 46.259 18.441 25.377  1.00 44.28 ? 7   DG  B OP2   1 
ATOM   2393 O "O5'" . DG  B 2 5   ? 44.910 19.498 23.556  1.00 44.63 ? 7   DG  B "O5'" 1 
ATOM   2394 C "C5'" . DG  B 2 5   ? 44.821 20.713 24.298  1.00 42.95 ? 7   DG  B "C5'" 1 
ATOM   2395 C "C4'" . DG  B 2 5   ? 44.054 21.760 23.522  1.00 40.40 ? 7   DG  B "C4'" 1 
ATOM   2396 O "O4'" . DG  B 2 5   ? 44.044 22.970 24.311  1.00 40.28 ? 7   DG  B "O4'" 1 
ATOM   2397 C "C3'" . DG  B 2 5   ? 44.682 22.161 22.190  1.00 39.24 ? 7   DG  B "C3'" 1 
ATOM   2398 O "O3'" . DG  B 2 5   ? 43.661 22.666 21.320  1.00 38.59 ? 7   DG  B "O3'" 1 
ATOM   2399 C "C2'" . DG  B 2 5   ? 45.638 23.268 22.589  1.00 39.98 ? 7   DG  B "C2'" 1 
ATOM   2400 C "C1'" . DG  B 2 5   ? 44.907 23.946 23.740  1.00 39.78 ? 7   DG  B "C1'" 1 
ATOM   2401 N N9    . DG  B 2 5   ? 45.796 24.415 24.795  1.00 39.42 ? 7   DG  B N9    1 
ATOM   2402 C C8    . DG  B 2 5   ? 46.004 23.834 26.026  1.00 40.50 ? 7   DG  B C8    1 
ATOM   2403 N N7    . DG  B 2 5   ? 46.861 24.486 26.762  1.00 39.74 ? 7   DG  B N7    1 
ATOM   2404 C C5    . DG  B 2 5   ? 47.243 25.561 25.971  1.00 40.05 ? 7   DG  B C5    1 
ATOM   2405 C C6    . DG  B 2 5   ? 48.147 26.616 26.236  1.00 40.35 ? 7   DG  B C6    1 
ATOM   2406 O O6    . DG  B 2 5   ? 48.816 26.815 27.256  1.00 40.95 ? 7   DG  B O6    1 
ATOM   2407 N N1    . DG  B 2 5   ? 48.234 27.498 25.162  1.00 40.69 ? 7   DG  B N1    1 
ATOM   2408 C C2    . DG  B 2 5   ? 47.535 27.379 23.983  1.00 40.98 ? 7   DG  B C2    1 
ATOM   2409 N N2    . DG  B 2 5   ? 47.745 28.337 23.063  1.00 42.84 ? 7   DG  B N2    1 
ATOM   2410 N N3    . DG  B 2 5   ? 46.690 26.395 23.723  1.00 40.70 ? 7   DG  B N3    1 
ATOM   2411 C C4    . DG  B 2 5   ? 46.594 25.530 24.754  1.00 40.07 ? 7   DG  B C4    1 
ATOM   2412 P P     . DG  B 2 6   ? 43.911 22.722 19.734  1.00 38.93 ? 8   DG  B P     1 
ATOM   2413 O OP1   . DG  B 2 6   ? 42.688 23.267 19.088  1.00 35.64 ? 8   DG  B OP1   1 
ATOM   2414 O OP2   . DG  B 2 6   ? 44.428 21.394 19.318  1.00 40.10 ? 8   DG  B OP2   1 
ATOM   2415 O "O5'" . DG  B 2 6   ? 45.088 23.782 19.570  1.00 39.48 ? 8   DG  B "O5'" 1 
ATOM   2416 C "C5'" . DG  B 2 6   ? 46.238 23.486 18.776  1.00 44.67 ? 8   DG  B "C5'" 1 
ATOM   2417 C "C4'" . DG  B 2 6   ? 47.175 24.672 18.746  1.00 46.39 ? 8   DG  B "C4'" 1 
ATOM   2418 O "O4'" . DG  B 2 6   ? 47.555 25.039 20.095  1.00 46.41 ? 8   DG  B "O4'" 1 
ATOM   2419 C "C3'" . DG  B 2 6   ? 48.489 24.432 17.997  1.00 49.24 ? 8   DG  B "C3'" 1 
ATOM   2420 O "O3'" . DG  B 2 6   ? 48.916 25.659 17.408  1.00 53.84 ? 8   DG  B "O3'" 1 
ATOM   2421 C "C2'" . DG  B 2 6   ? 49.457 24.103 19.116  1.00 48.62 ? 8   DG  B "C2'" 1 
ATOM   2422 C "C1'" . DG  B 2 6   ? 48.971 25.063 20.183  1.00 47.39 ? 8   DG  B "C1'" 1 
ATOM   2423 N N9    . DG  B 2 6   ? 49.351 24.732 21.552  1.00 48.24 ? 8   DG  B N9    1 
ATOM   2424 C C8    . DG  B 2 6   ? 49.895 25.586 22.481  1.00 47.27 ? 8   DG  B C8    1 
ATOM   2425 N N7    . DG  B 2 6   ? 50.129 25.013 23.628  1.00 47.70 ? 8   DG  B N7    1 
ATOM   2426 C C5    . DG  B 2 6   ? 49.718 23.700 23.445  1.00 47.79 ? 8   DG  B C5    1 
ATOM   2427 C C6    . DG  B 2 6   ? 49.724 22.606 24.344  1.00 48.50 ? 8   DG  B C6    1 
ATOM   2428 O O6    . DG  B 2 6   ? 50.103 22.581 25.523  1.00 49.42 ? 8   DG  B O6    1 
ATOM   2429 N N1    . DG  B 2 6   ? 49.220 21.454 23.750  1.00 46.47 ? 8   DG  B N1    1 
ATOM   2430 C C2    . DG  B 2 6   ? 48.764 21.368 22.456  1.00 47.63 ? 8   DG  B C2    1 
ATOM   2431 N N2    . DG  B 2 6   ? 48.308 20.165 22.060  1.00 45.37 ? 8   DG  B N2    1 
ATOM   2432 N N3    . DG  B 2 6   ? 48.751 22.386 21.609  1.00 46.85 ? 8   DG  B N3    1 
ATOM   2433 C C4    . DG  B 2 6   ? 49.239 23.511 22.167  1.00 47.25 ? 8   DG  B C4    1 
ATOM   2434 P P     . DT  B 2 7   ? 49.000 25.797 15.812  1.00 56.79 ? 9   DT  B P     1 
ATOM   2435 O OP1   . DT  B 2 7   ? 48.813 24.461 15.183  1.00 57.51 ? 9   DT  B OP1   1 
ATOM   2436 O OP2   . DT  B 2 7   ? 50.219 26.588 15.510  1.00 57.90 ? 9   DT  B OP2   1 
ATOM   2437 O "O5'" . DT  B 2 7   ? 47.741 26.696 15.448  1.00 56.71 ? 9   DT  B "O5'" 1 
ATOM   2438 C "C5'" . DT  B 2 7   ? 47.739 27.471 14.261  1.00 55.13 ? 9   DT  B "C5'" 1 
ATOM   2439 C "C4'" . DT  B 2 7   ? 46.358 28.020 14.000  1.00 53.65 ? 9   DT  B "C4'" 1 
ATOM   2440 O "O4'" . DT  B 2 7   ? 45.939 28.857 15.105  1.00 50.93 ? 9   DT  B "O4'" 1 
ATOM   2441 C "C3'" . DT  B 2 7   ? 46.283 28.896 12.755  1.00 54.18 ? 9   DT  B "C3'" 1 
ATOM   2442 O "O3'" . DT  B 2 7   ? 45.026 28.697 12.123  1.00 59.26 ? 9   DT  B "O3'" 1 
ATOM   2443 C "C2'" . DT  B 2 7   ? 46.387 30.301 13.312  1.00 50.73 ? 9   DT  B "C2'" 1 
ATOM   2444 C "C1'" . DT  B 2 7   ? 45.661 30.168 14.636  1.00 47.18 ? 9   DT  B "C1'" 1 
ATOM   2445 N N1    . DT  B 2 7   ? 46.106 31.116 15.669  1.00 42.13 ? 9   DT  B N1    1 
ATOM   2446 C C2    . DT  B 2 7   ? 45.140 31.830 16.334  1.00 38.47 ? 9   DT  B C2    1 
ATOM   2447 O O2    . DT  B 2 7   ? 43.954 31.720 16.087  1.00 38.81 ? 9   DT  B O2    1 
ATOM   2448 N N3    . DT  B 2 7   ? 45.615 32.681 17.298  1.00 34.50 ? 9   DT  B N3    1 
ATOM   2449 C C4    . DT  B 2 7   ? 46.930 32.886 17.650  1.00 33.30 ? 9   DT  B C4    1 
ATOM   2450 O O4    . DT  B 2 7   ? 47.203 33.681 18.541  1.00 31.57 ? 9   DT  B O4    1 
ATOM   2451 C C5    . DT  B 2 7   ? 47.898 32.108 16.904  1.00 34.55 ? 9   DT  B C5    1 
ATOM   2452 C C7    . DT  B 2 7   ? 49.353 32.266 17.214  1.00 33.95 ? 9   DT  B C7    1 
ATOM   2453 C C6    . DT  B 2 7   ? 47.443 31.274 15.964  1.00 38.14 ? 9   DT  B C6    1 
ATOM   2454 P P     . DT  B 2 8   ? 44.804 27.401 11.206  1.00 63.46 ? 10  DT  B P     1 
ATOM   2455 O OP1   . DT  B 2 8   ? 44.306 26.307 12.083  1.00 62.07 ? 10  DT  B OP1   1 
ATOM   2456 O OP2   . DT  B 2 8   ? 46.037 27.197 10.404  1.00 63.05 ? 10  DT  B OP2   1 
ATOM   2457 O "O5'" . DT  B 2 8   ? 43.631 27.841 10.223  1.00 64.90 ? 10  DT  B "O5'" 1 
ATOM   2458 C "C5'" . DT  B 2 8   ? 42.386 28.313 10.741  1.00 67.20 ? 10  DT  B "C5'" 1 
ATOM   2459 C "C4'" . DT  B 2 8   ? 41.660 29.141 9.706   1.00 68.08 ? 10  DT  B "C4'" 1 
ATOM   2460 O "O4'" . DT  B 2 8   ? 42.262 30.455 9.589   1.00 68.81 ? 10  DT  B "O4'" 1 
ATOM   2461 C "C3'" . DT  B 2 8   ? 41.677 28.542 8.298   1.00 69.33 ? 10  DT  B "C3'" 1 
ATOM   2462 O "O3'" . DT  B 2 8   ? 40.404 28.705 7.666   1.00 70.81 ? 10  DT  B "O3'" 1 
ATOM   2463 C "C2'" . DT  B 2 8   ? 42.720 29.378 7.579   1.00 69.05 ? 10  DT  B "C2'" 1 
ATOM   2464 C "C1'" . DT  B 2 8   ? 42.498 30.733 8.219   1.00 68.62 ? 10  DT  B "C1'" 1 
ATOM   2465 N N1    . DT  B 2 8   ? 43.629 31.679 8.117   1.00 68.59 ? 10  DT  B N1    1 
ATOM   2466 C C2    . DT  B 2 8   ? 43.513 32.706 7.206   1.00 68.96 ? 10  DT  B C2    1 
ATOM   2467 O O2    . DT  B 2 8   ? 42.527 32.864 6.500   1.00 68.59 ? 10  DT  B O2    1 
ATOM   2468 N N3    . DT  B 2 8   ? 44.598 33.547 7.146   1.00 69.28 ? 10  DT  B N3    1 
ATOM   2469 C C4    . DT  B 2 8   ? 45.762 33.464 7.889   1.00 70.01 ? 10  DT  B C4    1 
ATOM   2470 O O4    . DT  B 2 8   ? 46.660 34.291 7.721   1.00 70.56 ? 10  DT  B O4    1 
ATOM   2471 C C5    . DT  B 2 8   ? 45.814 32.364 8.831   1.00 69.62 ? 10  DT  B C5    1 
ATOM   2472 C C7    . DT  B 2 8   ? 47.030 32.196 9.684   1.00 69.77 ? 10  DT  B C7    1 
ATOM   2473 C C6    . DT  B 2 8   ? 44.758 31.539 8.897   1.00 69.11 ? 10  DT  B C6    1 
ATOM   2474 P P     . DA  B 2 9   ? 40.132 28.008 6.244   1.00 72.61 ? 11  DA  B P     1 
ATOM   2475 O OP1   . DA  B 2 9   ? 38.716 28.235 5.861   1.00 72.48 ? 11  DA  B OP1   1 
ATOM   2476 O OP2   . DA  B 2 9   ? 40.652 26.618 6.341   1.00 73.63 ? 11  DA  B OP2   1 
ATOM   2477 O "O5'" . DA  B 2 9   ? 41.063 28.828 5.236   1.00 72.26 ? 11  DA  B "O5'" 1 
ATOM   2478 C "C5'" . DA  B 2 9   ? 40.841 30.224 5.006   1.00 69.96 ? 11  DA  B "C5'" 1 
ATOM   2479 C "C4'" . DA  B 2 9   ? 41.985 30.836 4.226   1.00 68.94 ? 11  DA  B "C4'" 1 
ATOM   2480 O "O4'" . DA  B 2 9   ? 43.200 30.857 5.011   1.00 68.68 ? 11  DA  B "O4'" 1 
ATOM   2481 C "C3'" . DA  B 2 9   ? 42.353 30.146 2.911   1.00 68.52 ? 11  DA  B "C3'" 1 
ATOM   2482 O "O3'" . DA  B 2 9   ? 42.742 31.143 1.957   1.00 68.40 ? 11  DA  B "O3'" 1 
ATOM   2483 C "C2'" . DA  B 2 9   ? 43.592 29.352 3.287   1.00 67.97 ? 11  DA  B "C2'" 1 
ATOM   2484 C "C1'" . DA  B 2 9   ? 44.255 30.340 4.221   1.00 67.52 ? 11  DA  B "C1'" 1 
ATOM   2485 N N9    . DA  B 2 9   ? 45.290 29.825 5.116   1.00 67.04 ? 11  DA  B N9    1 
ATOM   2486 C C8    . DA  B 2 9   ? 45.373 28.607 5.743   1.00 67.16 ? 11  DA  B C8    1 
ATOM   2487 N N7    . DA  B 2 9   ? 46.443 28.470 6.491   1.00 66.64 ? 11  DA  B N7    1 
ATOM   2488 C C5    . DA  B 2 9   ? 47.111 29.678 6.342   1.00 67.09 ? 11  DA  B C5    1 
ATOM   2489 C C6    . DA  B 2 9   ? 48.322 30.168 6.871   1.00 68.01 ? 11  DA  B C6    1 
ATOM   2490 N N6    . DA  B 2 9   ? 49.108 29.472 7.697   1.00 68.40 ? 11  DA  B N6    1 
ATOM   2491 N N1    . DA  B 2 9   ? 48.702 31.416 6.516   1.00 67.96 ? 11  DA  B N1    1 
ATOM   2492 C C2    . DA  B 2 9   ? 47.915 32.116 5.688   1.00 67.72 ? 11  DA  B C2    1 
ATOM   2493 N N3    . DA  B 2 9   ? 46.760 31.766 5.128   1.00 67.41 ? 11  DA  B N3    1 
ATOM   2494 C C4    . DA  B 2 9   ? 46.411 30.521 5.498   1.00 67.14 ? 11  DA  B C4    1 
ATOM   2495 P P     . DG  B 2 10  ? 41.673 32.237 1.456   1.00 68.31 ? 12  DG  B P     1 
ATOM   2496 O OP1   . DG  B 2 10  ? 41.697 32.241 -0.030  1.00 68.46 ? 12  DG  B OP1   1 
ATOM   2497 O OP2   . DG  B 2 10  ? 41.927 33.501 2.197   1.00 67.75 ? 12  DG  B OP2   1 
ATOM   2498 O "O5'" . DG  B 2 10  ? 40.265 31.659 1.923   1.00 65.93 ? 12  DG  B "O5'" 1 
ATOM   2499 C "C5'" . DG  B 2 10  ? 39.339 31.139 0.975   1.00 61.67 ? 12  DG  B "C5'" 1 
ATOM   2500 C "C4'" . DG  B 2 10  ? 37.963 31.706 1.231   1.00 58.38 ? 12  DG  B "C4'" 1 
ATOM   2501 O "O4'" . DG  B 2 10  ? 37.518 31.279 2.542   1.00 56.62 ? 12  DG  B "O4'" 1 
ATOM   2502 C "C3'" . DG  B 2 10  ? 37.900 33.234 1.253   1.00 57.33 ? 12  DG  B "C3'" 1 
ATOM   2503 O "O3'" . DG  B 2 10  ? 36.582 33.656 0.905   1.00 57.62 ? 12  DG  B "O3'" 1 
ATOM   2504 C "C2'" . DG  B 2 10  ? 38.067 33.554 2.726   1.00 55.11 ? 12  DG  B "C2'" 1 
ATOM   2505 C "C1'" . DG  B 2 10  ? 37.298 32.412 3.370   1.00 52.80 ? 12  DG  B "C1'" 1 
ATOM   2506 N N9    . DG  B 2 10  ? 37.715 32.068 4.727   1.00 48.71 ? 12  DG  B N9    1 
ATOM   2507 C C8    . DG  B 2 10  ? 38.707 32.662 5.472   1.00 46.72 ? 12  DG  B C8    1 
ATOM   2508 N N7    . DG  B 2 10  ? 38.818 32.157 6.672   1.00 45.53 ? 12  DG  B N7    1 
ATOM   2509 C C5    . DG  B 2 10  ? 37.848 31.164 6.718   1.00 44.20 ? 12  DG  B C5    1 
ATOM   2510 C C6    . DG  B 2 10  ? 37.481 30.280 7.773   1.00 43.27 ? 12  DG  B C6    1 
ATOM   2511 O O6    . DG  B 2 10  ? 37.950 30.205 8.914   1.00 40.51 ? 12  DG  B O6    1 
ATOM   2512 N N1    . DG  B 2 10  ? 36.446 29.430 7.391   1.00 41.31 ? 12  DG  B N1    1 
ATOM   2513 C C2    . DG  B 2 10  ? 35.833 29.434 6.159   1.00 43.16 ? 12  DG  B C2    1 
ATOM   2514 N N2    . DG  B 2 10  ? 34.843 28.538 5.978   1.00 42.90 ? 12  DG  B N2    1 
ATOM   2515 N N3    . DG  B 2 10  ? 36.162 30.257 5.173   1.00 43.17 ? 12  DG  B N3    1 
ATOM   2516 C C4    . DG  B 2 10  ? 37.168 31.088 5.521   1.00 45.48 ? 12  DG  B C4    1 
HETATM 2517 O O     . HOH C 3 .   ? 39.044 47.817 22.703  1.00 23.46 ? 300 HOH A O     1 
HETATM 2518 O O     . HOH C 3 .   ? 35.976 52.157 17.249  1.00 18.56 ? 301 HOH A O     1 
HETATM 2519 O O     . HOH C 3 .   ? 30.516 30.061 31.607  1.00 24.54 ? 302 HOH A O     1 
HETATM 2520 O O     . HOH C 3 .   ? 35.678 29.307 30.492  1.00 23.67 ? 303 HOH A O     1 
HETATM 2521 O O     . HOH C 3 .   ? 37.909 51.588 10.164  1.00 21.66 ? 304 HOH A O     1 
HETATM 2522 O O     . HOH C 3 .   ? 35.236 31.954 29.292  1.00 25.13 ? 305 HOH A O     1 
HETATM 2523 O O     . HOH C 3 .   ? 40.639 34.467 13.823  1.00 21.85 ? 306 HOH A O     1 
HETATM 2524 O O     . HOH C 3 .   ? 38.137 51.772 13.564  1.00 24.39 ? 307 HOH A O     1 
HETATM 2525 O O     . HOH C 3 .   ? 35.836 51.539 5.625   1.00 25.02 ? 308 HOH A O     1 
HETATM 2526 O O     . HOH C 3 .   ? 42.524 38.805 35.834  1.00 24.52 ? 309 HOH A O     1 
HETATM 2527 O O     . HOH C 3 .   ? 33.239 30.541 37.342  1.00 26.71 ? 310 HOH A O     1 
HETATM 2528 O O     . HOH C 3 .   ? 34.409 26.127 43.248  1.00 30.43 ? 311 HOH A O     1 
HETATM 2529 O O     . HOH C 3 .   ? 37.502 41.325 31.763  1.00 30.15 ? 312 HOH A O     1 
HETATM 2530 O O     . HOH C 3 .   ? 25.231 34.320 7.033   1.00 29.08 ? 313 HOH A O     1 
HETATM 2531 O O     . HOH C 3 .   ? 37.621 39.284 41.585  1.00 26.53 ? 314 HOH A O     1 
HETATM 2532 O O     . HOH C 3 .   ? 31.785 31.789 24.982  1.00 26.11 ? 315 HOH A O     1 
HETATM 2533 O O     . HOH C 3 .   ? 20.854 39.609 8.743   1.00 31.06 ? 316 HOH A O     1 
HETATM 2534 O O     . HOH C 3 .   ? 30.352 52.609 10.156  1.00 28.98 ? 317 HOH A O     1 
HETATM 2535 O O     . HOH C 3 .   ? 45.288 26.437 21.275  1.00 33.92 ? 318 HOH A O     1 
HETATM 2536 O O     . HOH C 3 .   ? 45.441 41.032 46.167  1.00 39.27 ? 319 HOH A O     1 
HETATM 2537 O O     . HOH C 3 .   ? 42.461 51.793 -0.001  0.50 31.68 ? 320 HOH A O     1 
HETATM 2538 O O     . HOH C 3 .   ? 43.546 32.019 26.405  1.00 26.21 ? 321 HOH A O     1 
HETATM 2539 O O     . HOH C 3 .   ? 40.799 32.998 25.127  1.00 33.21 ? 322 HOH A O     1 
HETATM 2540 O O     . HOH C 3 .   ? 28.444 28.365 9.567   1.00 33.42 ? 323 HOH A O     1 
HETATM 2541 O O     . HOH C 3 .   ? 32.856 31.251 21.348  1.00 30.73 ? 324 HOH A O     1 
HETATM 2542 O O     . HOH C 3 .   ? 49.003 45.605 -4.740  1.00 28.08 ? 325 HOH A O     1 
HETATM 2543 O O     . HOH C 3 .   ? 30.098 29.103 36.764  1.00 29.02 ? 326 HOH A O     1 
HETATM 2544 O O     . HOH C 3 .   ? 31.926 14.361 41.141  1.00 29.86 ? 327 HOH A O     1 
HETATM 2545 O O     . HOH C 3 .   ? 40.364 45.388 23.113  1.00 32.43 ? 328 HOH A O     1 
HETATM 2546 O O     . HOH C 3 .   ? 24.737 39.620 23.226  1.00 26.91 ? 329 HOH A O     1 
HETATM 2547 O O     . HOH C 3 .   ? 37.955 28.644 21.681  1.00 34.86 ? 330 HOH A O     1 
HETATM 2548 O O     . HOH C 3 .   ? 42.368 45.430 -12.738 1.00 38.52 ? 331 HOH A O     1 
HETATM 2549 O O     . HOH C 3 .   ? 30.194 29.972 22.349  1.00 28.13 ? 332 HOH A O     1 
HETATM 2550 O O     . HOH C 3 .   ? 29.398 50.682 8.022   1.00 35.56 ? 333 HOH A O     1 
HETATM 2551 O O     . HOH C 3 .   ? 30.335 29.336 52.698  1.00 43.05 ? 334 HOH A O     1 
HETATM 2552 O O     . HOH C 3 .   ? 22.974 27.194 27.834  1.00 48.81 ? 335 HOH A O     1 
HETATM 2553 O O     . HOH C 3 .   ? 28.931 34.817 26.170  1.00 27.20 ? 336 HOH A O     1 
HETATM 2554 O O     . HOH C 3 .   ? 28.961 55.378 26.435  1.00 32.71 ? 337 HOH A O     1 
HETATM 2555 O O     . HOH C 3 .   ? 44.979 23.520 44.553  1.00 34.81 ? 338 HOH A O     1 
HETATM 2556 O O     . HOH C 3 .   ? 26.951 43.207 27.384  1.00 24.44 ? 339 HOH A O     1 
HETATM 2557 O O     . HOH C 3 .   ? 46.985 25.138 43.454  1.00 35.37 ? 340 HOH A O     1 
HETATM 2558 O O     . HOH C 3 .   ? 37.356 57.471 22.228  1.00 33.96 ? 341 HOH A O     1 
HETATM 2559 O O     . HOH C 3 .   ? 31.297 53.909 32.339  1.00 32.73 ? 342 HOH A O     1 
HETATM 2560 O O     . HOH C 3 .   ? 35.410 29.126 22.213  1.00 41.11 ? 343 HOH A O     1 
HETATM 2561 O O     . HOH C 3 .   ? 47.191 46.570 -8.996  1.00 35.06 ? 344 HOH A O     1 
HETATM 2562 O O     . HOH C 3 .   ? 30.873 23.361 46.477  1.00 47.60 ? 345 HOH A O     1 
HETATM 2563 O O     . HOH C 3 .   ? 27.757 56.205 23.192  1.00 52.06 ? 346 HOH A O     1 
HETATM 2564 O O     . HOH C 3 .   ? 47.216 29.650 46.774  1.00 40.54 ? 347 HOH A O     1 
HETATM 2565 O O     . HOH C 3 .   ? 38.668 47.995 -3.097  1.00 29.69 ? 348 HOH A O     1 
HETATM 2566 O O     . HOH C 3 .   ? 49.550 37.478 16.647  1.00 27.26 ? 349 HOH A O     1 
HETATM 2567 O O     . HOH C 3 .   ? 43.400 36.689 27.827  1.00 33.99 ? 350 HOH A O     1 
HETATM 2568 O O     . HOH C 3 .   ? 45.126 40.786 22.760  1.00 34.12 ? 351 HOH A O     1 
HETATM 2569 O O     . HOH C 3 .   ? 47.664 18.570 31.864  1.00 37.94 ? 352 HOH A O     1 
HETATM 2570 O O     . HOH C 3 .   ? 17.429 40.557 1.032   1.00 40.89 ? 353 HOH A O     1 
HETATM 2571 O O     . HOH C 3 .   ? 30.260 26.514 37.794  1.00 40.38 ? 354 HOH A O     1 
HETATM 2572 O O     . HOH C 3 .   ? 41.244 18.077 46.771  1.00 34.07 ? 355 HOH A O     1 
HETATM 2573 O O     . HOH C 3 .   ? 29.625 46.303 5.270   1.00 36.15 ? 356 HOH A O     1 
HETATM 2574 O O     . HOH C 3 .   ? 34.860 49.998 36.636  1.00 58.10 ? 357 HOH A O     1 
HETATM 2575 O O     . HOH C 3 .   ? 45.727 32.596 24.940  1.00 36.58 ? 358 HOH A O     1 
HETATM 2576 O O     . HOH C 3 .   ? 43.542 43.193 24.018  1.00 36.00 ? 359 HOH A O     1 
HETATM 2577 O O     . HOH C 3 .   ? 37.205 18.156 50.021  1.00 44.55 ? 360 HOH A O     1 
HETATM 2578 O O     . HOH C 3 .   ? 23.633 51.996 17.985  1.00 38.38 ? 361 HOH A O     1 
HETATM 2579 O O     . HOH C 3 .   ? 36.638 26.586 50.418  1.00 48.07 ? 362 HOH A O     1 
HETATM 2580 O O     . HOH C 3 .   ? 27.341 18.048 37.015  1.00 45.55 ? 363 HOH A O     1 
HETATM 2581 O O     . HOH C 3 .   ? 45.961 50.014 22.601  1.00 33.42 ? 364 HOH A O     1 
HETATM 2582 O O     . HOH C 3 .   ? 38.576 49.136 25.090  1.00 40.31 ? 365 HOH A O     1 
HETATM 2583 O O     . HOH C 3 .   ? 41.198 56.935 17.019  1.00 39.68 ? 366 HOH A O     1 
HETATM 2584 O O     . HOH C 3 .   ? 38.693 58.513 18.331  1.00 41.20 ? 367 HOH A O     1 
HETATM 2585 O O     . HOH C 3 .   ? 25.718 30.836 48.158  1.00 46.53 ? 368 HOH A O     1 
HETATM 2586 O O     . HOH C 3 .   ? 30.484 20.152 12.242  1.00 50.11 ? 369 HOH A O     1 
HETATM 2587 O O     . HOH C 3 .   ? 35.396 39.273 39.748  1.00 39.40 ? 370 HOH A O     1 
HETATM 2588 O O     . HOH C 3 .   ? 49.229 36.295 11.384  1.00 39.53 ? 371 HOH A O     1 
HETATM 2589 O O     . HOH C 3 .   ? 24.934 43.298 31.625  1.00 36.27 ? 372 HOH A O     1 
HETATM 2590 O O     . HOH C 3 .   ? 24.151 25.596 43.632  1.00 49.10 ? 373 HOH A O     1 
HETATM 2591 O O     . HOH C 3 .   ? 47.648 27.687 44.962  1.00 47.22 ? 374 HOH A O     1 
HETATM 2592 O O     . HOH C 3 .   ? 38.127 47.747 40.165  1.00 46.44 ? 375 HOH A O     1 
HETATM 2593 O O     . HOH C 3 .   ? 48.933 39.035 40.356  1.00 46.83 ? 376 HOH A O     1 
HETATM 2594 O O     . HOH C 3 .   ? 27.334 60.229 16.664  1.00 55.12 ? 377 HOH A O     1 
HETATM 2595 O O     . HOH C 3 .   ? 18.724 54.302 11.680  1.00 46.48 ? 378 HOH A O     1 
HETATM 2596 O O     . HOH C 3 .   ? 41.808 38.575 26.735  1.00 32.03 ? 379 HOH A O     1 
HETATM 2597 O O     . HOH C 3 .   ? 21.791 45.435 24.319  1.00 45.87 ? 380 HOH A O     1 
HETATM 2598 O O     . HOH C 3 .   ? 41.544 41.299 27.278  1.00 40.57 ? 381 HOH A O     1 
HETATM 2599 O O     . HOH C 3 .   ? 45.198 54.383 14.109  1.00 33.90 ? 382 HOH A O     1 
HETATM 2600 O O     . HOH C 3 .   ? 50.037 43.017 -3.597  1.00 43.02 ? 383 HOH A O     1 
HETATM 2601 O O     . HOH C 3 .   ? 43.424 22.662 51.539  1.00 49.11 ? 384 HOH A O     1 
HETATM 2602 O O     . HOH C 3 .   ? 37.403 44.417 -5.793  1.00 41.72 ? 385 HOH A O     1 
HETATM 2603 O O     . HOH C 3 .   ? 27.289 27.944 13.268  1.00 37.84 ? 386 HOH A O     1 
HETATM 2604 O O     . HOH C 3 .   ? 21.433 25.015 26.757  1.00 51.44 ? 387 HOH A O     1 
HETATM 2605 O O     . HOH C 3 .   ? 21.671 36.195 23.608  1.00 51.07 ? 388 HOH A O     1 
HETATM 2606 O O     . HOH C 3 .   ? 45.374 38.868 30.007  1.00 43.44 ? 389 HOH A O     1 
HETATM 2607 O O     . HOH C 3 .   ? 40.100 23.996 15.898  1.00 51.67 ? 390 HOH A O     1 
HETATM 2608 O O     . HOH C 3 .   ? 32.019 26.491 44.072  1.00 43.58 ? 391 HOH A O     1 
HETATM 2609 O O     . HOH C 3 .   ? 44.959 36.911 20.938  1.00 41.59 ? 392 HOH A O     1 
HETATM 2610 O O     . HOH C 3 .   ? 33.073 18.360 47.176  1.00 48.30 ? 393 HOH A O     1 
HETATM 2611 O O     . HOH C 3 .   ? 46.980 36.503 37.771  1.00 36.46 ? 394 HOH A O     1 
HETATM 2612 O O     . HOH C 3 .   ? 24.716 45.293 28.125  1.00 44.68 ? 395 HOH A O     1 
HETATM 2613 O O     . HOH C 3 .   ? 30.207 37.953 35.710  1.00 41.13 ? 396 HOH A O     1 
HETATM 2614 O O     . HOH C 3 .   ? 28.908 27.886 20.736  1.00 35.61 ? 397 HOH A O     1 
HETATM 2615 O O     . HOH C 3 .   ? 50.954 48.257 17.943  0.50 31.68 ? 398 HOH A O     1 
HETATM 2616 O O     . HOH C 3 .   ? 32.129 15.465 32.009  1.00 39.37 ? 399 HOH A O     1 
HETATM 2617 O O     . HOH C 3 .   ? 54.874 29.033 34.621  1.00 68.65 ? 400 HOH A O     1 
HETATM 2618 O O     . HOH C 3 .   ? 40.446 42.546 25.188  1.00 27.49 ? 401 HOH A O     1 
HETATM 2619 O O     . HOH C 3 .   ? 44.652 39.161 34.347  1.00 39.13 ? 402 HOH A O     1 
HETATM 2620 O O     . HOH C 3 .   ? 42.717 34.243 22.959  1.00 45.36 ? 403 HOH A O     1 
HETATM 2621 O O     . HOH C 3 .   ? 49.397 42.103 40.070  1.00 48.19 ? 404 HOH A O     1 
HETATM 2622 O O     . HOH C 3 .   ? 30.872 35.031 0.299   1.00 62.18 ? 405 HOH A O     1 
HETATM 2623 O O     . HOH C 3 .   ? 23.326 33.446 45.401  1.00 46.56 ? 406 HOH A O     1 
HETATM 2624 O O     . HOH C 3 .   ? 29.760 35.863 31.269  1.00 44.70 ? 407 HOH A O     1 
HETATM 2625 O O     . HOH C 3 .   ? 36.038 46.326 1.465   1.00 36.65 ? 408 HOH A O     1 
HETATM 2626 O O     . HOH C 3 .   ? 18.920 46.682 6.653   1.00 54.90 ? 409 HOH A O     1 
HETATM 2627 O O     . HOH C 3 .   ? 22.919 49.677 16.538  1.00 28.63 ? 410 HOH A O     1 
HETATM 2628 O O     . HOH C 3 .   ? 40.792 5.221  41.881  1.00 54.06 ? 411 HOH A O     1 
HETATM 2629 O O     . HOH C 3 .   ? 40.300 51.266 1.920   1.00 38.45 ? 412 HOH A O     1 
HETATM 2630 O O     . HOH C 3 .   ? 32.181 30.449 18.579  1.00 41.02 ? 413 HOH A O     1 
HETATM 2631 O O     . HOH C 3 .   ? 30.219 27.421 42.450  1.00 47.05 ? 414 HOH A O     1 
HETATM 2632 O O     . HOH C 3 .   ? 19.829 42.502 18.667  1.00 43.96 ? 415 HOH A O     1 
HETATM 2633 O O     . HOH C 3 .   ? 29.080 20.856 52.880  1.00 52.62 ? 416 HOH A O     1 
HETATM 2634 O O     . HOH C 3 .   ? 52.305 32.841 47.036  1.00 50.21 ? 417 HOH A O     1 
HETATM 2635 O O     . HOH C 3 .   ? 31.228 25.498 17.976  1.00 54.69 ? 418 HOH A O     1 
HETATM 2636 O O     . HOH C 3 .   ? 22.696 57.004 18.386  1.00 54.97 ? 419 HOH A O     1 
HETATM 2637 O O     . HOH C 3 .   ? 34.036 46.995 -0.096  1.00 50.66 ? 420 HOH A O     1 
HETATM 2638 O O     . HOH C 3 .   ? 40.910 59.206 15.204  1.00 44.30 ? 421 HOH A O     1 
HETATM 2639 O O     . HOH C 3 .   ? 52.216 41.953 14.217  1.00 35.30 ? 422 HOH A O     1 
HETATM 2640 O O     . HOH C 3 .   ? 20.838 39.018 12.101  1.00 49.62 ? 423 HOH A O     1 
HETATM 2641 O O     . HOH C 3 .   ? 32.120 35.416 3.472   1.00 47.57 ? 424 HOH A O     1 
HETATM 2642 O O     . HOH C 3 .   ? 28.500 25.474 44.317  1.00 45.07 ? 425 HOH A O     1 
HETATM 2643 O O     . HOH C 3 .   ? 41.447 40.142 -2.921  1.00 42.66 ? 426 HOH A O     1 
HETATM 2644 O O     . HOH C 3 .   ? 38.114 42.862 -2.704  1.00 39.93 ? 427 HOH A O     1 
HETATM 2645 O O     . HOH C 3 .   ? 24.445 26.948 36.813  1.00 56.13 ? 428 HOH A O     1 
HETATM 2646 O O     . HOH C 3 .   ? 31.337 40.447 36.046  1.00 58.03 ? 429 HOH A O     1 
HETATM 2647 O O     . HOH C 3 .   ? 26.078 42.950 35.101  1.00 52.83 ? 430 HOH A O     1 
HETATM 2648 O O     . HOH C 3 .   ? 32.723 27.530 18.655  1.00 43.20 ? 431 HOH A O     1 
HETATM 2649 O O     . HOH C 3 .   ? 38.127 48.689 27.948  1.00 42.95 ? 432 HOH A O     1 
HETATM 2650 O O     . HOH C 3 .   ? 37.219 24.947 10.872  1.00 51.59 ? 433 HOH A O     1 
HETATM 2651 O O     . HOH C 3 .   ? 19.652 36.261 10.948  1.00 44.46 ? 434 HOH A O     1 
HETATM 2652 O O     . HOH C 3 .   ? 46.752 14.130 26.072  1.00 50.25 ? 435 HOH A O     1 
HETATM 2653 O O     . HOH C 3 .   ? 31.754 41.306 -0.105  1.00 56.17 ? 436 HOH A O     1 
HETATM 2654 O O     . HOH C 3 .   ? 24.219 48.125 25.960  1.00 41.87 ? 437 HOH A O     1 
HETATM 2655 O O     . HOH C 3 .   ? 19.195 45.361 20.760  1.00 45.73 ? 438 HOH A O     1 
HETATM 2656 O O     . HOH C 3 .   ? 50.345 42.350 29.559  1.00 45.21 ? 439 HOH A O     1 
HETATM 2657 O O     . HOH C 3 .   ? 25.878 23.670 47.505  1.00 44.66 ? 440 HOH A O     1 
HETATM 2658 O O     . HOH C 3 .   ? 38.820 57.948 24.529  1.00 38.74 ? 441 HOH A O     1 
HETATM 2659 O O     . HOH C 3 .   ? 38.500 46.344 1.287   1.00 44.50 ? 442 HOH A O     1 
HETATM 2660 O O     . HOH C 3 .   ? 18.041 51.331 11.563  1.00 47.95 ? 443 HOH A O     1 
HETATM 2661 O O     . HOH C 3 .   ? 34.185 38.592 1.962   1.00 63.25 ? 444 HOH A O     1 
HETATM 2662 O O     . HOH C 3 .   ? 51.479 30.289 48.820  1.00 58.98 ? 445 HOH A O     1 
HETATM 2663 O O     . HOH C 3 .   ? 37.392 60.322 21.607  1.00 45.24 ? 446 HOH A O     1 
HETATM 2664 O O     . HOH C 3 .   ? 24.247 22.243 35.411  1.00 66.11 ? 447 HOH A O     1 
HETATM 2665 O O     . HOH C 3 .   ? 43.002 7.457  35.256  1.00 55.79 ? 448 HOH A O     1 
HETATM 2666 O O     . HOH C 3 .   ? 30.629 14.859 34.195  1.00 62.28 ? 449 HOH A O     1 
HETATM 2667 O O     . HOH C 3 .   ? 53.917 21.335 34.035  1.00 49.89 ? 450 HOH A O     1 
HETATM 2668 O O     . HOH C 3 .   ? 46.297 18.836 50.046  1.00 54.81 ? 451 HOH A O     1 
HETATM 2669 O O     . HOH C 3 .   ? 23.305 26.092 41.289  1.00 54.70 ? 452 HOH A O     1 
HETATM 2670 O O     . HOH C 3 .   ? 40.621 13.413 46.518  1.00 49.35 ? 453 HOH A O     1 
HETATM 2671 O O     . HOH C 3 .   ? 44.276 13.223 21.064  1.00 60.56 ? 454 HOH A O     1 
HETATM 2672 O O     . HOH C 3 .   ? 26.650 11.279 39.003  1.00 48.86 ? 455 HOH A O     1 
HETATM 2673 O O     . HOH C 3 .   ? 20.591 49.959 18.025  1.00 54.19 ? 456 HOH A O     1 
HETATM 2674 O O     . HOH C 3 .   ? 49.121 21.382 30.222  1.00 57.98 ? 457 HOH A O     1 
HETATM 2675 O O     . HOH C 3 .   ? 37.422 45.513 38.793  1.00 49.17 ? 458 HOH A O     1 
HETATM 2676 O O     . HOH C 3 .   ? 29.600 61.856 10.469  1.00 55.63 ? 459 HOH A O     1 
HETATM 2677 O O     . HOH C 3 .   ? 43.175 42.100 29.111  1.00 50.51 ? 460 HOH A O     1 
HETATM 2678 O O     . HOH C 3 .   ? 28.464 24.896 49.231  1.00 48.53 ? 461 HOH A O     1 
HETATM 2679 O O     . HOH C 3 .   ? 32.858 53.728 6.497   1.00 46.30 ? 462 HOH A O     1 
HETATM 2680 O O     . HOH C 3 .   ? 51.377 36.362 31.516  1.00 60.21 ? 463 HOH A O     1 
HETATM 2681 O O     . HOH C 3 .   ? 23.572 39.475 25.692  1.00 39.49 ? 464 HOH A O     1 
HETATM 2682 O O     . HOH C 3 .   ? 26.306 35.059 28.374  1.00 38.11 ? 465 HOH A O     1 
HETATM 2683 O O     . HOH C 3 .   ? 27.778 52.961 25.957  1.00 41.23 ? 466 HOH A O     1 
HETATM 2684 O O     . HOH C 3 .   ? 27.884 33.272 48.934  1.00 48.39 ? 467 HOH A O     1 
HETATM 2685 O O     . HOH C 3 .   ? 35.021 61.277 14.879  1.00 52.03 ? 468 HOH A O     1 
HETATM 2686 O O     . HOH C 3 .   ? 34.353 29.109 19.985  1.00 40.81 ? 469 HOH A O     1 
HETATM 2687 O O     . HOH C 3 .   ? 25.277 52.093 24.484  1.00 58.73 ? 470 HOH A O     1 
HETATM 2688 O O     . HOH C 3 .   ? 35.360 39.493 49.092  1.00 46.41 ? 471 HOH A O     1 
HETATM 2689 O O     . HOH C 3 .   ? 36.237 42.563 36.043  1.00 55.18 ? 472 HOH A O     1 
HETATM 2690 O O     . HOH C 3 .   ? 49.229 33.079 29.783  1.00 41.00 ? 473 HOH A O     1 
HETATM 2691 O O     . HOH C 3 .   ? 28.225 36.649 29.253  1.00 44.24 ? 474 HOH A O     1 
HETATM 2692 O O     . HOH C 3 .   ? 26.324 34.625 42.614  1.00 44.61 ? 475 HOH A O     1 
HETATM 2693 O O     . HOH C 3 .   ? 29.198 22.182 50.247  1.00 61.28 ? 476 HOH A O     1 
HETATM 2694 O O     . HOH C 3 .   ? 36.104 55.177 4.152   1.00 38.45 ? 477 HOH A O     1 
HETATM 2695 O O     . HOH C 3 .   ? 29.012 17.343 32.149  1.00 57.11 ? 478 HOH A O     1 
HETATM 2696 O O     . HOH C 3 .   ? 26.184 52.549 21.281  1.00 49.04 ? 479 HOH A O     1 
HETATM 2697 O O     . HOH C 3 .   ? 30.420 28.483 18.365  1.00 44.35 ? 480 HOH A O     1 
HETATM 2698 O O     . HOH C 3 .   ? 30.966 25.565 47.225  1.00 53.24 ? 481 HOH A O     1 
HETATM 2699 O O     . HOH C 3 .   ? 49.998 24.758 45.595  1.00 57.36 ? 482 HOH A O     1 
HETATM 2700 O O     . HOH C 3 .   ? 42.152 41.694 36.480  1.00 53.30 ? 483 HOH A O     1 
HETATM 2701 O O     . HOH C 3 .   ? 47.820 31.821 26.351  1.00 53.89 ? 484 HOH A O     1 
HETATM 2702 O O     . HOH C 3 .   ? 32.304 13.629 43.864  1.00 35.55 ? 485 HOH A O     1 
HETATM 2703 O O     . HOH C 3 .   ? 23.063 34.408 25.097  1.00 41.34 ? 486 HOH A O     1 
HETATM 2704 O O     . HOH C 3 .   ? 26.740 28.530 52.637  1.00 52.79 ? 487 HOH A O     1 
HETATM 2705 O O     . HOH C 3 .   ? 25.854 38.601 29.929  1.00 49.61 ? 488 HOH A O     1 
HETATM 2706 O O     . HOH C 3 .   ? 49.700 50.321 13.577  1.00 52.44 ? 489 HOH A O     1 
HETATM 2707 O O     . HOH C 3 .   ? 27.218 63.453 17.270  1.00 54.87 ? 490 HOH A O     1 
HETATM 2708 O O     . HOH C 3 .   ? 37.335 49.382 38.296  1.00 60.09 ? 491 HOH A O     1 
HETATM 2709 O O     . HOH C 3 .   ? 39.840 49.196 33.410  1.00 63.81 ? 492 HOH A O     1 
HETATM 2710 O O     . HOH C 3 .   ? 21.326 34.347 44.064  1.00 61.06 ? 493 HOH A O     1 
HETATM 2711 O O     . HOH C 3 .   ? 25.912 18.898 32.697  1.00 57.35 ? 494 HOH A O     1 
HETATM 2712 O O     . HOH C 3 .   ? 25.425 52.814 31.704  1.00 63.51 ? 495 HOH A O     1 
HETATM 2713 O O     . HOH C 3 .   ? 39.289 49.902 -1.568  1.00 48.75 ? 496 HOH A O     1 
HETATM 2714 O O     . HOH C 3 .   ? 27.678 20.924 38.156  1.00 54.79 ? 497 HOH A O     1 
HETATM 2715 O O     . HOH C 3 .   ? 48.001 54.669 17.490  1.00 42.85 ? 498 HOH A O     1 
HETATM 2716 O O     . HOH C 3 .   ? 38.544 38.991 35.333  1.00 38.06 ? 499 HOH A O     1 
HETATM 2717 O O     . HOH C 3 .   ? 28.817 35.657 39.924  1.00 56.56 ? 500 HOH A O     1 
HETATM 2718 O O     . HOH C 3 .   ? 34.138 12.526 34.242  1.00 57.28 ? 501 HOH A O     1 
HETATM 2719 O O     . HOH C 3 .   ? 26.140 31.277 52.036  1.00 57.80 ? 502 HOH A O     1 
HETATM 2720 O O     . HOH C 3 .   ? 24.797 32.521 49.717  1.00 53.17 ? 503 HOH A O     1 
HETATM 2721 O O     . HOH D 3 .   ? 45.174 26.492 7.955   1.00 57.68 ? 63  HOH B O     1 
HETATM 2722 O O     . HOH D 3 .   ? 41.994 35.779 6.765   1.00 60.51 ? 76  HOH B O     1 
HETATM 2723 O O     . HOH D 3 .   ? 40.524 27.508 3.111   1.00 55.60 ? 98  HOH B O     1 
HETATM 2724 O O     . HOH D 3 .   ? 41.303 35.098 4.445   1.00 42.65 ? 111 HOH B O     1 
HETATM 2725 O O     . HOH D 3 .   ? 41.050 24.397 7.822   1.00 55.53 ? 116 HOH B O     1 
HETATM 2726 O O     . HOH D 3 .   ? 47.448 20.463 26.300  1.00 61.24 ? 121 HOH B O     1 
HETATM 2727 O O     . HOH D 3 .   ? 49.312 18.640 24.951  1.00 60.62 ? 140 HOH B O     1 
HETATM 2728 O O     . HOH D 3 .   ? 46.099 23.501 15.084  1.00 56.90 ? 141 HOH B O     1 
HETATM 2729 O O     . HOH D 3 .   ? 50.477 20.610 27.030  1.00 56.54 ? 143 HOH B O     1 
HETATM 2730 O O     . HOH D 3 .   ? 43.391 20.987 16.015  1.00 61.56 ? 148 HOH B O     1 
HETATM 2731 O O     . HOH D 3 .   ? 50.698 21.204 17.283  1.00 65.25 ? 151 HOH B O     1 
HETATM 2732 O O     . HOH D 3 .   ? 38.393 12.301 19.848  1.00 59.23 ? 161 HOH B O     1 
HETATM 2733 O O     . HOH D 3 .   ? 32.873 28.414 3.359   1.00 55.42 ? 176 HOH B O     1 
HETATM 2734 O O     . HOH D 3 .   ? 48.615 29.908 10.235  1.00 55.63 ? 192 HOH B O     1 
HETATM 2735 O O     . HOH D 3 .   ? 42.791 19.223 19.723  1.00 44.41 ? 196 HOH B O     1 
HETATM 2736 O O     . HOH D 3 .   ? 49.812 24.491 27.510  1.00 60.45 ? 211 HOH B O     1 
HETATM 2737 O O     . HOH D 3 .   ? 40.790 22.040 17.609  1.00 43.54 ? 219 HOH B O     1 
HETATM 2738 O O     . HOH D 3 .   ? 35.703 12.149 19.174  1.00 51.10 ? 221 HOH B O     1 
HETATM 2739 O O     . HOH D 3 .   ? 35.330 21.189 18.391  1.00 51.82 ? 504 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   LEU 3   3   ?   ?   ?   A . n 
A 1 4   VAL 4   4   ?   ?   ?   A . n 
A 1 5   PRO 5   5   ?   ?   ?   A . n 
A 1 6   ALA 6   6   6   ALA ALA A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   TYR 9   9   9   TYR TYR A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  THR 12  12  12  THR THR A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  TYR 26  26  26  TYR TYR A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  PHE 31  31  31  PHE PHE A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  TYR 36  36  36  TYR TYR A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  TYR 43  43  43  TYR TYR A . n 
A 1 44  CYS 44  44  44  CYS CYS A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  GLN 52  52  52  GLN GLN A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  CYS 59  59  59  CYS CYS A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ASN 75  75  75  ASN ASN A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  HIS 82  82  82  HIS HIS A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  GLN 94  94  94  GLN GLN A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 THR 105 105 105 THR THR A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 PRO 116 116 116 PRO PRO A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 TYR 122 122 122 TYR TYR A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 ASN 124 124 124 ASN ASN A . n 
A 1 125 PHE 125 125 125 PHE PHE A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 HIS 130 130 130 HIS HIS A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 MET 132 132 132 MET MET A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 TRP 139 139 139 TRP TRP A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 HIS 143 143 143 HIS HIS A . n 
A 1 144 MET 144 144 144 MET MET A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 PRO 146 146 146 PRO PRO A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TRP 148 148 ?   ?   ?   A . n 
A 1 149 THR 149 149 149 THR THR A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 CYS 154 154 154 CYS CYS A . n 
A 1 155 ASP 155 155 155 ASP ASP A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 GLN 157 157 157 GLN GLN A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 MET 159 159 159 MET MET A . n 
A 1 160 GLN 160 160 160 GLN GLN A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 PHE 162 162 162 PHE PHE A . n 
A 1 163 ASP 163 163 163 ASP ASP A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 CYS 166 166 166 CYS CYS A . n 
A 1 167 GLN 167 167 167 GLN GLN A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 LYS 171 171 171 LYS LYS A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 PHE 179 179 179 PHE PHE A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 TRP 184 184 184 TRP TRP A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 THR 187 187 187 THR THR A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 PRO 190 190 190 PRO PRO A . n 
A 1 191 PHE 191 191 191 PHE PHE A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 TRP 194 194 194 TRP TRP A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 GLN 199 199 199 GLN GLN A . n 
A 1 200 ASP 200 200 ?   ?   ?   A . n 
A 1 201 LEU 201 201 ?   ?   ?   A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 HIS 211 211 211 HIS HIS A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 ASN 215 215 215 ASN ASN A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 ILE 220 220 220 ILE ILE A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 TYR 223 223 223 TYR TYR A . n 
A 1 224 ASP 224 224 224 ASP ASP A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 HIS 226 226 226 HIS HIS A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 HIS 228 228 228 HIS HIS A . n 
A 1 229 VAL 229 229 229 VAL VAL A . n 
A 1 230 ALA 230 230 230 ALA ALA A . n 
A 1 231 ARG 231 231 231 ARG ARG A . n 
A 1 232 SER 232 232 232 SER SER A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 LYS 234 234 234 LYS LYS A . n 
A 1 235 VAL 235 235 235 VAL VAL A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 PHE 238 238 238 PHE PHE A . n 
A 1 239 LEU 239 239 239 LEU LEU A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 TYR 242 242 242 TYR TYR A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 HIS 245 245 245 HIS HIS A . n 
A 1 246 THR 246 246 246 THR THR A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 MET 251 251 251 MET MET A . n 
A 1 252 ASN 252 252 252 ASN ASN A . n 
A 1 253 SER 253 253 253 SER SER A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 GLN 256 256 256 GLN GLN A . n 
A 1 257 THR 257 257 257 THR THR A . n 
A 1 258 MET 258 258 258 MET MET A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 PHE 263 263 263 PHE PHE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 HIS 266 266 266 HIS HIS A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 THR 269 269 269 THR THR A . n 
A 1 270 SER 270 270 270 SER SER A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 ARG 273 273 273 ARG ARG A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 GLU 280 280 280 GLU GLU A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 ASN 282 282 282 ASN ASN A . n 
A 1 283 SER 283 283 283 SER SER A . n 
A 1 284 ASP 284 284 284 ASP ASP A . n 
A 1 285 VAL 285 285 285 VAL VAL A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 GLN 287 287 287 GLN GLN A . n 
A 1 288 LEU 288 288 288 LEU LEU A . n 
A 1 289 LYS 289 289 289 LYS LYS A . n 
A 1 290 LYS 290 290 290 LYS LYS A . n 
A 1 291 ASP 291 291 291 ASP ASP A . n 
A 1 292 LEU 292 292 292 LEU LEU A . n 
A 1 293 GLU 293 293 293 GLU GLU A . n 
A 1 294 SER 294 294 294 SER SER A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 ASN 296 296 296 ASN ASN A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 THR 298 298 298 THR THR A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
B 2 1   DT  1   3   3   DT  DT  B . n 
B 2 2   U   2   4   4   U   U   B . n 
B 2 3   DA  3   5   5   DA  DA  B . n 
B 2 4   DG  4   6   6   DG  DG  B . n 
B 2 5   DG  5   7   7   DG  DG  B . n 
B 2 6   DG  6   8   8   DG  DG  B . n 
B 2 7   DT  7   9   9   DT  DT  B . n 
B 2 8   DT  8   10  10  DT  DT  B . n 
B 2 9   DA  9   11  11  DA  DA  B . n 
B 2 10  DG  10  12  12  DG  DG  B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   300 300 HOH HOH A . 
C 3 HOH 2   301 301 HOH HOH A . 
C 3 HOH 3   302 302 HOH HOH A . 
C 3 HOH 4   303 303 HOH HOH A . 
C 3 HOH 5   304 304 HOH HOH A . 
C 3 HOH 6   305 305 HOH HOH A . 
C 3 HOH 7   306 306 HOH HOH A . 
C 3 HOH 8   307 307 HOH HOH A . 
C 3 HOH 9   308 308 HOH HOH A . 
C 3 HOH 10  309 309 HOH HOH A . 
C 3 HOH 11  310 310 HOH HOH A . 
C 3 HOH 12  311 311 HOH HOH A . 
C 3 HOH 13  312 312 HOH HOH A . 
C 3 HOH 14  313 313 HOH HOH A . 
C 3 HOH 15  314 314 HOH HOH A . 
C 3 HOH 16  315 315 HOH HOH A . 
C 3 HOH 17  316 316 HOH HOH A . 
C 3 HOH 18  317 317 HOH HOH A . 
C 3 HOH 19  318 318 HOH HOH A . 
C 3 HOH 20  319 319 HOH HOH A . 
C 3 HOH 21  320 320 HOH HOH A . 
C 3 HOH 22  321 321 HOH HOH A . 
C 3 HOH 23  322 322 HOH HOH A . 
C 3 HOH 24  323 323 HOH HOH A . 
C 3 HOH 25  324 324 HOH HOH A . 
C 3 HOH 26  325 325 HOH HOH A . 
C 3 HOH 27  326 326 HOH HOH A . 
C 3 HOH 28  327 327 HOH HOH A . 
C 3 HOH 29  328 328 HOH HOH A . 
C 3 HOH 30  329 329 HOH HOH A . 
C 3 HOH 31  330 330 HOH HOH A . 
C 3 HOH 32  331 331 HOH HOH A . 
C 3 HOH 33  332 332 HOH HOH A . 
C 3 HOH 34  333 333 HOH HOH A . 
C 3 HOH 35  334 334 HOH HOH A . 
C 3 HOH 36  335 335 HOH HOH A . 
C 3 HOH 37  336 336 HOH HOH A . 
C 3 HOH 38  337 337 HOH HOH A . 
C 3 HOH 39  338 338 HOH HOH A . 
C 3 HOH 40  339 339 HOH HOH A . 
C 3 HOH 41  340 340 HOH HOH A . 
C 3 HOH 42  341 341 HOH HOH A . 
C 3 HOH 43  342 342 HOH HOH A . 
C 3 HOH 44  343 343 HOH HOH A . 
C 3 HOH 45  344 344 HOH HOH A . 
C 3 HOH 46  345 345 HOH HOH A . 
C 3 HOH 47  346 346 HOH HOH A . 
C 3 HOH 48  347 347 HOH HOH A . 
C 3 HOH 49  348 348 HOH HOH A . 
C 3 HOH 50  349 349 HOH HOH A . 
C 3 HOH 51  350 350 HOH HOH A . 
C 3 HOH 52  351 351 HOH HOH A . 
C 3 HOH 53  352 352 HOH HOH A . 
C 3 HOH 54  353 353 HOH HOH A . 
C 3 HOH 55  354 354 HOH HOH A . 
C 3 HOH 56  355 355 HOH HOH A . 
C 3 HOH 57  356 356 HOH HOH A . 
C 3 HOH 58  357 357 HOH HOH A . 
C 3 HOH 59  358 358 HOH HOH A . 
C 3 HOH 60  359 359 HOH HOH A . 
C 3 HOH 61  360 360 HOH HOH A . 
C 3 HOH 62  361 361 HOH HOH A . 
C 3 HOH 63  362 362 HOH HOH A . 
C 3 HOH 64  363 363 HOH HOH A . 
C 3 HOH 65  364 364 HOH HOH A . 
C 3 HOH 66  365 365 HOH HOH A . 
C 3 HOH 67  366 366 HOH HOH A . 
C 3 HOH 68  367 367 HOH HOH A . 
C 3 HOH 69  368 368 HOH HOH A . 
C 3 HOH 70  369 369 HOH HOH A . 
C 3 HOH 71  370 370 HOH HOH A . 
C 3 HOH 72  371 371 HOH HOH A . 
C 3 HOH 73  372 372 HOH HOH A . 
C 3 HOH 74  373 373 HOH HOH A . 
C 3 HOH 75  374 374 HOH HOH A . 
C 3 HOH 76  375 375 HOH HOH A . 
C 3 HOH 77  376 376 HOH HOH A . 
C 3 HOH 78  377 377 HOH HOH A . 
C 3 HOH 79  378 378 HOH HOH A . 
C 3 HOH 80  379 379 HOH HOH A . 
C 3 HOH 81  380 380 HOH HOH A . 
C 3 HOH 82  381 381 HOH HOH A . 
C 3 HOH 83  382 382 HOH HOH A . 
C 3 HOH 84  383 383 HOH HOH A . 
C 3 HOH 85  384 384 HOH HOH A . 
C 3 HOH 86  385 385 HOH HOH A . 
C 3 HOH 87  386 386 HOH HOH A . 
C 3 HOH 88  387 387 HOH HOH A . 
C 3 HOH 89  388 388 HOH HOH A . 
C 3 HOH 90  389 389 HOH HOH A . 
C 3 HOH 91  390 390 HOH HOH A . 
C 3 HOH 92  391 391 HOH HOH A . 
C 3 HOH 93  392 392 HOH HOH A . 
C 3 HOH 94  393 393 HOH HOH A . 
C 3 HOH 95  394 394 HOH HOH A . 
C 3 HOH 96  395 395 HOH HOH A . 
C 3 HOH 97  396 396 HOH HOH A . 
C 3 HOH 98  397 397 HOH HOH A . 
C 3 HOH 99  398 398 HOH HOH A . 
C 3 HOH 100 399 399 HOH HOH A . 
C 3 HOH 101 400 400 HOH HOH A . 
C 3 HOH 102 401 401 HOH HOH A . 
C 3 HOH 103 402 402 HOH HOH A . 
C 3 HOH 104 403 403 HOH HOH A . 
C 3 HOH 105 404 404 HOH HOH A . 
C 3 HOH 106 405 405 HOH HOH A . 
C 3 HOH 107 406 406 HOH HOH A . 
C 3 HOH 108 407 407 HOH HOH A . 
C 3 HOH 109 408 408 HOH HOH A . 
C 3 HOH 110 409 409 HOH HOH A . 
C 3 HOH 111 410 410 HOH HOH A . 
C 3 HOH 112 411 411 HOH HOH A . 
C 3 HOH 113 412 412 HOH HOH A . 
C 3 HOH 114 413 413 HOH HOH A . 
C 3 HOH 115 414 414 HOH HOH A . 
C 3 HOH 116 415 415 HOH HOH A . 
C 3 HOH 117 416 416 HOH HOH A . 
C 3 HOH 118 417 417 HOH HOH A . 
C 3 HOH 119 418 418 HOH HOH A . 
C 3 HOH 120 419 419 HOH HOH A . 
C 3 HOH 121 420 420 HOH HOH A . 
C 3 HOH 122 421 421 HOH HOH A . 
C 3 HOH 123 422 422 HOH HOH A . 
C 3 HOH 124 423 423 HOH HOH A . 
C 3 HOH 125 424 424 HOH HOH A . 
C 3 HOH 126 425 425 HOH HOH A . 
C 3 HOH 127 426 426 HOH HOH A . 
C 3 HOH 128 427 427 HOH HOH A . 
C 3 HOH 129 428 428 HOH HOH A . 
C 3 HOH 130 429 429 HOH HOH A . 
C 3 HOH 131 430 430 HOH HOH A . 
C 3 HOH 132 431 431 HOH HOH A . 
C 3 HOH 133 432 432 HOH HOH A . 
C 3 HOH 134 433 433 HOH HOH A . 
C 3 HOH 135 434 434 HOH HOH A . 
C 3 HOH 136 435 435 HOH HOH A . 
C 3 HOH 137 436 436 HOH HOH A . 
C 3 HOH 138 437 437 HOH HOH A . 
C 3 HOH 139 438 438 HOH HOH A . 
C 3 HOH 140 439 439 HOH HOH A . 
C 3 HOH 141 440 440 HOH HOH A . 
C 3 HOH 142 441 441 HOH HOH A . 
C 3 HOH 143 442 442 HOH HOH A . 
C 3 HOH 144 443 443 HOH HOH A . 
C 3 HOH 145 444 444 HOH HOH A . 
C 3 HOH 146 445 445 HOH HOH A . 
C 3 HOH 147 446 446 HOH HOH A . 
C 3 HOH 148 447 447 HOH HOH A . 
C 3 HOH 149 448 448 HOH HOH A . 
C 3 HOH 150 449 449 HOH HOH A . 
C 3 HOH 151 450 450 HOH HOH A . 
C 3 HOH 152 451 451 HOH HOH A . 
C 3 HOH 153 452 452 HOH HOH A . 
C 3 HOH 154 453 453 HOH HOH A . 
C 3 HOH 155 454 454 HOH HOH A . 
C 3 HOH 156 455 455 HOH HOH A . 
C 3 HOH 157 456 456 HOH HOH A . 
C 3 HOH 158 457 457 HOH HOH A . 
C 3 HOH 159 458 458 HOH HOH A . 
C 3 HOH 160 459 459 HOH HOH A . 
C 3 HOH 161 460 460 HOH HOH A . 
C 3 HOH 162 461 461 HOH HOH A . 
C 3 HOH 163 462 462 HOH HOH A . 
C 3 HOH 164 463 463 HOH HOH A . 
C 3 HOH 165 464 464 HOH HOH A . 
C 3 HOH 166 465 465 HOH HOH A . 
C 3 HOH 167 466 466 HOH HOH A . 
C 3 HOH 168 467 467 HOH HOH A . 
C 3 HOH 169 468 468 HOH HOH A . 
C 3 HOH 170 469 469 HOH HOH A . 
C 3 HOH 171 470 470 HOH HOH A . 
C 3 HOH 172 471 471 HOH HOH A . 
C 3 HOH 173 472 472 HOH HOH A . 
C 3 HOH 174 473 473 HOH HOH A . 
C 3 HOH 175 474 474 HOH HOH A . 
C 3 HOH 176 475 475 HOH HOH A . 
C 3 HOH 177 476 476 HOH HOH A . 
C 3 HOH 178 477 477 HOH HOH A . 
C 3 HOH 179 478 478 HOH HOH A . 
C 3 HOH 180 479 479 HOH HOH A . 
C 3 HOH 181 480 480 HOH HOH A . 
C 3 HOH 182 481 481 HOH HOH A . 
C 3 HOH 183 482 482 HOH HOH A . 
C 3 HOH 184 483 483 HOH HOH A . 
C 3 HOH 185 484 484 HOH HOH A . 
C 3 HOH 186 485 485 HOH HOH A . 
C 3 HOH 187 486 486 HOH HOH A . 
C 3 HOH 188 487 487 HOH HOH A . 
C 3 HOH 189 488 488 HOH HOH A . 
C 3 HOH 190 489 489 HOH HOH A . 
C 3 HOH 191 490 490 HOH HOH A . 
C 3 HOH 192 491 491 HOH HOH A . 
C 3 HOH 193 492 492 HOH HOH A . 
C 3 HOH 194 493 493 HOH HOH A . 
C 3 HOH 195 494 494 HOH HOH A . 
C 3 HOH 196 495 495 HOH HOH A . 
C 3 HOH 197 496 496 HOH HOH A . 
C 3 HOH 198 497 497 HOH HOH A . 
C 3 HOH 199 498 498 HOH HOH A . 
C 3 HOH 200 499 499 HOH HOH A . 
C 3 HOH 201 500 500 HOH HOH A . 
C 3 HOH 202 501 501 HOH HOH A . 
C 3 HOH 203 502 502 HOH HOH A . 
C 3 HOH 204 503 503 HOH HOH A . 
D 3 HOH 1   63  63  HOH HOH B . 
D 3 HOH 2   76  76  HOH HOH B . 
D 3 HOH 3   98  98  HOH HOH B . 
D 3 HOH 4   111 111 HOH HOH B . 
D 3 HOH 5   116 116 HOH HOH B . 
D 3 HOH 6   121 121 HOH HOH B . 
D 3 HOH 7   140 140 HOH HOH B . 
D 3 HOH 8   141 141 HOH HOH B . 
D 3 HOH 9   143 143 HOH HOH B . 
D 3 HOH 10  148 148 HOH HOH B . 
D 3 HOH 11  151 151 HOH HOH B . 
D 3 HOH 12  161 161 HOH HOH B . 
D 3 HOH 13  176 176 HOH HOH B . 
D 3 HOH 14  192 192 HOH HOH B . 
D 3 HOH 15  196 196 HOH HOH B . 
D 3 HOH 16  211 211 HOH HOH B . 
D 3 HOH 17  219 219 HOH HOH B . 
D 3 HOH 18  221 221 HOH HOH B . 
D 3 HOH 19  504 504 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2160  ? 
1 MORE         -9    ? 
1 'SSA (A^2)'  15110 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 320 ? C HOH . 
2 1 A HOH 398 ? C HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-01-19 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .                          ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data reduction'  
http://www.hkl-xray.com/                  ?          ? 
2 SCALEPACK   .                          ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data scaling'    
http://www.hkl-xray.com/                  ?          ? 
3 CNS         1.2                        ?               package 'Axel T. Brunger'    axel.brunger@yale.edu refinement        
http://cns-online.org/                    Fortran_77 ? 
4 PDB_EXTRACT 3.005                      'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++        ? 
5 BOS         'data collection software' ?               ?       ?                    ?                     'data collection' ? ? 
? 
6 HKL-2000    .                          ?               ?       ?                    ?                     'data reduction'  ? ? 
? 
7 HKL-2000    .                          ?               ?       ?                    ?                     'data scaling'    ? ? 
? 
8 REFMAC      .                          ?               ?       ?                    ?                     phasing           ? ? 
? 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     151 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     151 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_655 
_pdbx_validate_symm_contact.dist              1.38 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N1 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             U 
_pdbx_validate_rmsd_angle.auth_seq_id_1              4 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C1'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             U 
_pdbx_validate_rmsd_angle.auth_seq_id_2              4 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             "C2'" 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             U 
_pdbx_validate_rmsd_angle.auth_seq_id_3              4 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                122.10 
_pdbx_validate_rmsd_angle.angle_target_value         114.00 
_pdbx_validate_rmsd_angle.angle_deviation            8.10 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 91  ? ? 66.71   -11.82  
2 1 PRO A 146 ? ? -50.28  178.19  
3 1 VAL A 174 ? ? -125.54 -75.13  
4 1 ASP A 175 ? ? -147.39 29.03   
5 1 GLN A 214 ? ? 50.50   -128.94 
6 1 ASP A 224 ? ? 48.54   -117.97 
7 1 TYR A 271 ? ? 56.92   19.09   
8 1 THR A 298 ? ? -118.74 76.92   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A SER 2   ? A SER 2   
3 1 Y 1 A LEU 3   ? A LEU 3   
4 1 Y 1 A VAL 4   ? A VAL 4   
5 1 Y 1 A PRO 5   ? A PRO 5   
6 1 Y 1 A TRP 148 ? A TRP 148 
7 1 Y 1 A ASP 200 ? A ASP 200 
8 1 Y 1 A LEU 201 ? A LEU 201 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#