data_3KQG
# 
_entry.id   3KQG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3KQG         
RCSB  RCSB056318   
WWPDB D_1000056318 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3KQG 
_pdbx_database_status.recvd_initial_deposition_date   2009-11-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Feinberg, H.'     1 
'Powlesland, A.S.' 2 
'Taylor, M.E.'     3 
'Weis, W.I.'       4 
# 
_citation.id                        primary 
_citation.title                     'Trimeric structure of langerin.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            285 
_citation.page_first                13285 
_citation.page_last                 13293 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20181944 
_citation.pdbx_database_id_DOI      10.1074/jbc.M109.086058 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Feinberg, H.'     1 
primary 'Powlesland, A.S.' 2 
primary 'Taylor, M.E.'     3 
primary 'Weis, W.I.'       4 
# 
_cell.entry_id           3KQG 
_cell.length_a           80.78 
_cell.length_b           77.46 
_cell.length_c           85.92 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.42 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3KQG 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'C-type lectin domain family 4 member K' 20632.229 6   ? V147A,V278A 'UNP residues 147-328' ? 
2 non-polymer syn 'CALCIUM ION'                            40.078    6   ? ?           ?                      ? 
3 water       nat water                                    18.015    407 ? ?           ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Langerin 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ASTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSR
NSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAW
NDAPCDKTFLFICKRPYVPSEP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ASTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSR
NSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAW
NDAPCDKTFLFICKRPYVPSEP
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   SER n 
1 3   THR n 
1 4   LEU n 
1 5   ASN n 
1 6   ALA n 
1 7   GLN n 
1 8   ILE n 
1 9   PRO n 
1 10  GLU n 
1 11  LEU n 
1 12  LYS n 
1 13  SER n 
1 14  ASP n 
1 15  LEU n 
1 16  GLU n 
1 17  LYS n 
1 18  ALA n 
1 19  SER n 
1 20  ALA n 
1 21  LEU n 
1 22  ASN n 
1 23  THR n 
1 24  LYS n 
1 25  ILE n 
1 26  ARG n 
1 27  ALA n 
1 28  LEU n 
1 29  GLN n 
1 30  GLY n 
1 31  SER n 
1 32  LEU n 
1 33  GLU n 
1 34  ASN n 
1 35  MET n 
1 36  SER n 
1 37  LYS n 
1 38  LEU n 
1 39  LEU n 
1 40  LYS n 
1 41  ARG n 
1 42  GLN n 
1 43  ASN n 
1 44  ASP n 
1 45  ILE n 
1 46  LEU n 
1 47  GLN n 
1 48  VAL n 
1 49  VAL n 
1 50  SER n 
1 51  GLN n 
1 52  GLY n 
1 53  TRP n 
1 54  LYS n 
1 55  TYR n 
1 56  PHE n 
1 57  LYS n 
1 58  GLY n 
1 59  ASN n 
1 60  PHE n 
1 61  TYR n 
1 62  TYR n 
1 63  PHE n 
1 64  SER n 
1 65  LEU n 
1 66  ILE n 
1 67  PRO n 
1 68  LYS n 
1 69  THR n 
1 70  TRP n 
1 71  TYR n 
1 72  SER n 
1 73  ALA n 
1 74  GLU n 
1 75  GLN n 
1 76  PHE n 
1 77  CYS n 
1 78  VAL n 
1 79  SER n 
1 80  ARG n 
1 81  ASN n 
1 82  SER n 
1 83  HIS n 
1 84  LEU n 
1 85  THR n 
1 86  SER n 
1 87  VAL n 
1 88  THR n 
1 89  SER n 
1 90  GLU n 
1 91  SER n 
1 92  GLU n 
1 93  GLN n 
1 94  GLU n 
1 95  PHE n 
1 96  LEU n 
1 97  TYR n 
1 98  LYS n 
1 99  THR n 
1 100 ALA n 
1 101 GLY n 
1 102 GLY n 
1 103 LEU n 
1 104 ILE n 
1 105 TYR n 
1 106 TRP n 
1 107 ILE n 
1 108 GLY n 
1 109 LEU n 
1 110 THR n 
1 111 LYS n 
1 112 ALA n 
1 113 GLY n 
1 114 MET n 
1 115 GLU n 
1 116 GLY n 
1 117 ASP n 
1 118 TRP n 
1 119 SER n 
1 120 TRP n 
1 121 VAL n 
1 122 ASP n 
1 123 ASP n 
1 124 THR n 
1 125 PRO n 
1 126 PHE n 
1 127 ASN n 
1 128 LYS n 
1 129 VAL n 
1 130 GLN n 
1 131 SER n 
1 132 ALA n 
1 133 ARG n 
1 134 PHE n 
1 135 TRP n 
1 136 ILE n 
1 137 PRO n 
1 138 GLY n 
1 139 GLU n 
1 140 PRO n 
1 141 ASN n 
1 142 ASN n 
1 143 ALA n 
1 144 GLY n 
1 145 ASN n 
1 146 ASN n 
1 147 GLU n 
1 148 HIS n 
1 149 CYS n 
1 150 GLY n 
1 151 ASN n 
1 152 ILE n 
1 153 LYS n 
1 154 ALA n 
1 155 PRO n 
1 156 SER n 
1 157 LEU n 
1 158 GLN n 
1 159 ALA n 
1 160 TRP n 
1 161 ASN n 
1 162 ASP n 
1 163 ALA n 
1 164 PRO n 
1 165 CYS n 
1 166 ASP n 
1 167 LYS n 
1 168 THR n 
1 169 PHE n 
1 170 LEU n 
1 171 PHE n 
1 172 ILE n 
1 173 CYS n 
1 174 LYS n 
1 175 ARG n 
1 176 PRO n 
1 177 TYR n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CD207, CLEC4K' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21/DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pT5T expression vector' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CLC4K_HUMAN 
_struct_ref.pdbx_db_accession          Q9UJ71 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSR
NSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAW
NDAPCDKTFLFICKRPYVPSEP
;
_struct_ref.pdbx_align_begin           147 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3KQG A 1 ? 182 ? Q9UJ71 147 ? 328 ? 147 328 
2 1 3KQG B 1 ? 182 ? Q9UJ71 147 ? 328 ? 147 328 
3 1 3KQG C 1 ? 182 ? Q9UJ71 147 ? 328 ? 147 328 
4 1 3KQG D 1 ? 182 ? Q9UJ71 147 ? 328 ? 147 328 
5 1 3KQG E 1 ? 182 ? Q9UJ71 147 ? 328 ? 147 328 
6 1 3KQG F 1 ? 182 ? Q9UJ71 147 ? 328 ? 147 328 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3KQG ALA A 1   ? UNP Q9UJ71 VAL 147 ENGINEERED 147 1  
1 3KQG ALA A 132 ? UNP Q9UJ71 VAL 278 ENGINEERED 278 2  
2 3KQG ALA B 1   ? UNP Q9UJ71 VAL 147 ENGINEERED 147 3  
2 3KQG ALA B 132 ? UNP Q9UJ71 VAL 278 ENGINEERED 278 4  
3 3KQG ALA C 1   ? UNP Q9UJ71 VAL 147 ENGINEERED 147 5  
3 3KQG ALA C 132 ? UNP Q9UJ71 VAL 278 ENGINEERED 278 6  
4 3KQG ALA D 1   ? UNP Q9UJ71 VAL 147 ENGINEERED 147 7  
4 3KQG ALA D 132 ? UNP Q9UJ71 VAL 278 ENGINEERED 278 8  
5 3KQG ALA E 1   ? UNP Q9UJ71 VAL 147 ENGINEERED 147 9  
5 3KQG ALA E 132 ? UNP Q9UJ71 VAL 278 ENGINEERED 278 10 
6 3KQG ALA F 1   ? UNP Q9UJ71 VAL 147 ENGINEERED 147 11 
6 3KQG ALA F 132 ? UNP Q9UJ71 VAL 278 ENGINEERED 278 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3KQG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.16 
_exptl_crystal.density_percent_sol   43.19 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
;Protein solution: 10 mg/ml protein, 10 mM Tris pH 8.0, 25 mM NaCl. 
Reservoir solution: 15% PEG3350, 0.2M Ammonium chloride., VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.pdbx_collection_date   2008-12-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92748 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.92748 
# 
_reflns.entry_id                     3KQG 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             85.75 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   46977 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.079 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.2 
_reflns.B_iso_Wilson_estimate        39.7 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.42 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           0.34 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.2 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6800 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3KQG 
_refine.ls_number_reflns_obs                     46871 
_refine.ls_number_reflns_all                     46871 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.958 
_refine.ls_d_res_high                            2.300 
_refine.ls_percent_reflns_obs                    99.42 
_refine.ls_R_factor_obs                          0.1849 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1821 
_refine.ls_R_factor_R_free                       0.2385 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.08 
_refine.ls_number_reflns_R_free                  2380 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.319 
_refine.solvent_model_param_bsol                 41.750 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'a model from a low resolution data set.' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            shells 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.31 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7795 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             407 
_refine_hist.number_atoms_total               8208 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        47.958 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 8122  'X-RAY DIFFRACTION' ? 
f_angle_d          0.818  ? ? 10947 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.077 ? ? 2849  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.057  ? ? 1121  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 1398  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.3000 2.3470  2543 0.2300 98.00  0.2951 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 2.3470 2.3980  2633 0.2389 99.00  0.3330 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 2.3980 2.4538  2605 0.2332 99.00  0.3046 . . 156 . . . . 'X-RAY DIFFRACTION' 
. 2.4538 2.5151  2502 0.2195 99.00  0.3191 . . 201 . . . . 'X-RAY DIFFRACTION' 
. 2.5151 2.5831  2617 0.2098 99.00  0.2845 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 2.5831 2.6591  2617 0.2052 100.00 0.2847 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 2.6591 2.7449  2635 0.2039 99.00  0.2860 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 2.7449 2.8430  2625 0.2087 99.00  0.2700 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 2.8430 2.9569  2578 0.2095 99.00  0.3015 . . 179 . . . . 'X-RAY DIFFRACTION' 
. 2.9569 3.0914  2591 0.2037 100.00 0.2692 . . 178 . . . . 'X-RAY DIFFRACTION' 
. 3.0914 3.2544  2610 0.1941 100.00 0.2536 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 3.2544 3.4582  2642 0.1864 100.00 0.2625 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 3.4582 3.7251  2667 0.1642 100.00 0.2420 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 3.7251 4.0998  2668 0.1573 100.00 0.2167 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 4.0998 4.6926  2531 0.1347 100.00 0.1695 . . 238 . . . . 'X-RAY DIFFRACTION' 
. 4.6926 5.9105  2682 0.1510 100.00 0.1965 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 5.9105 47.9687 2745 0.1571 100.00 0.1695 . . 119 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3KQG 
_struct.title                     'Trimeric Structure of Langerin' 
_struct.pdbx_descriptor           'C-type lectin domain family 4 member K' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3KQG 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'trimer, neck and CRD, Coiled coil, Lectin, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 13  ? SER A 50  ? SER A 159 SER A 196 1 ? 38 
HELX_P HELX_P2  2  THR A 69  ? ARG A 80  ? THR A 215 ARG A 226 1 ? 12 
HELX_P HELX_P3  3  SER A 89  ? GLY A 101 ? SER A 235 GLY A 247 1 ? 13 
HELX_P HELX_P4  4  ASN A 127 ? ALA A 132 ? ASN A 273 ALA A 278 1 ? 6  
HELX_P HELX_P5  5  LEU B 21  ? SER B 50  ? LEU B 167 SER B 196 1 ? 30 
HELX_P HELX_P6  6  THR B 69  ? SER B 79  ? THR B 215 SER B 225 1 ? 11 
HELX_P HELX_P7  7  SER B 89  ? GLY B 101 ? SER B 235 GLY B 247 1 ? 13 
HELX_P HELX_P8  8  ASN B 127 ? ALA B 132 ? ASN B 273 ALA B 278 1 ? 6  
HELX_P HELX_P9  9  ASN B 142 ? ASN B 146 ? ASN B 288 ASN B 292 5 ? 5  
HELX_P HELX_P10 10 ASN C 22  ? SER C 50  ? ASN C 168 SER C 196 1 ? 29 
HELX_P HELX_P11 11 THR C 69  ? ARG C 80  ? THR C 215 ARG C 226 1 ? 12 
HELX_P HELX_P12 12 SER C 89  ? GLY C 101 ? SER C 235 GLY C 247 1 ? 13 
HELX_P HELX_P13 13 ASN C 127 ? ALA C 132 ? ASN C 273 ALA C 278 1 ? 6  
HELX_P HELX_P14 14 ARG C 133 ? TRP C 135 ? ARG C 279 TRP C 281 5 ? 3  
HELX_P HELX_P15 15 ASN C 142 ? ASN C 146 ? ASN C 288 ASN C 292 5 ? 5  
HELX_P HELX_P16 16 LEU D 21  ? SER D 50  ? LEU D 167 SER D 196 1 ? 30 
HELX_P HELX_P17 17 THR D 69  ? ARG D 80  ? THR D 215 ARG D 226 1 ? 12 
HELX_P HELX_P18 18 SER D 89  ? GLY D 101 ? SER D 235 GLY D 247 1 ? 13 
HELX_P HELX_P19 19 ASN D 127 ? ALA D 132 ? ASN D 273 ALA D 278 1 ? 6  
HELX_P HELX_P20 20 ARG D 133 ? TRP D 135 ? ARG D 279 TRP D 281 5 ? 3  
HELX_P HELX_P21 21 ASN D 142 ? ASN D 146 ? ASN D 288 ASN D 292 5 ? 5  
HELX_P HELX_P22 22 LYS E 24  ? SER E 50  ? LYS E 170 SER E 196 1 ? 27 
HELX_P HELX_P23 23 THR E 69  ? SER E 79  ? THR E 215 SER E 225 1 ? 11 
HELX_P HELX_P24 24 SER E 89  ? GLY E 101 ? SER E 235 GLY E 247 1 ? 13 
HELX_P HELX_P25 25 VAL E 129 ? TRP E 135 ? VAL E 275 TRP E 281 5 ? 7  
HELX_P HELX_P26 26 ASN E 142 ? ASN E 146 ? ASN E 288 ASN E 292 5 ? 5  
HELX_P HELX_P27 27 SER F 19  ? SER F 50  ? SER F 165 SER F 196 1 ? 32 
HELX_P HELX_P28 28 THR F 69  ? SER F 79  ? THR F 215 SER F 225 1 ? 11 
HELX_P HELX_P29 29 SER F 89  ? GLY F 101 ? SER F 235 GLY F 247 1 ? 13 
HELX_P HELX_P30 30 ASN F 127 ? ALA F 132 ? ASN F 273 ALA F 278 1 ? 6  
HELX_P HELX_P31 31 ARG F 133 ? TRP F 135 ? ARG F 279 TRP F 281 5 ? 3  
HELX_P HELX_P32 32 ASN F 142 ? ASN F 146 ? ASN F 288 ASN F 292 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 77  SG  ? ? ? 1_555 A CYS 173 SG ? ? A CYS 223 A CYS 319 1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf2  disulf ? ? A CYS 149 SG  ? ? ? 1_555 A CYS 165 SG ? ? A CYS 295 A CYS 311 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf3  disulf ? ? B CYS 77  SG  ? ? ? 1_555 B CYS 173 SG ? ? B CYS 223 B CYS 319 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf4  disulf ? ? B CYS 149 SG  ? ? ? 1_555 B CYS 165 SG ? ? B CYS 295 B CYS 311 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf5  disulf ? ? C CYS 77  SG  ? ? ? 1_555 C CYS 173 SG ? ? C CYS 223 C CYS 319 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf6  disulf ? ? C CYS 149 SG  ? ? ? 1_555 C CYS 165 SG ? ? C CYS 295 C CYS 311 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf7  disulf ? ? D CYS 77  SG  ? ? ? 1_555 D CYS 173 SG ? ? D CYS 223 D CYS 319 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf8  disulf ? ? D CYS 149 SG  ? ? ? 1_555 D CYS 165 SG ? ? D CYS 295 D CYS 311 1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf9  disulf ? ? E CYS 77  SG  ? ? ? 1_555 E CYS 173 SG ? ? E CYS 223 E CYS 319 1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf10 disulf ? ? E CYS 149 SG  ? ? ? 1_555 E CYS 165 SG ? ? E CYS 295 E CYS 311 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf11 disulf ? ? F CYS 77  SG  ? ? ? 1_555 F CYS 173 SG ? ? F CYS 223 F CYS 319 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf12 disulf ? ? F CYS 149 SG  ? ? ? 1_555 F CYS 165 SG ? ? F CYS 295 F CYS 311 1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc1  metalc ? ? B ASP 162 OD1 ? ? ? 1_555 H CA  .   CA ? ? B ASP 308 B CA  400 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc2  metalc ? ? C ASP 162 OD1 ? ? ? 1_555 I CA  .   CA ? ? C ASP 308 C CA  400 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc3  metalc ? ? F GLU 147 OE1 ? ? ? 1_555 L CA  .   CA ? ? F GLU 293 F CA  400 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc4  metalc ? ? F ASP 162 OD1 ? ? ? 1_555 L CA  .   CA ? ? F ASP 308 F CA  400 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc5  metalc ? ? A ASP 162 OD1 ? ? ? 1_555 G CA  .   CA ? ? A ASP 308 A CA  400 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc6  metalc ? ? E ASP 162 OD1 ? ? ? 1_555 K CA  .   CA ? ? E ASP 308 E CA  400 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc7  metalc ? ? B ASN 161 OD1 ? ? ? 1_555 H CA  .   CA ? ? B ASN 307 B CA  400 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc8  metalc ? ? C GLU 147 OE1 ? ? ? 1_555 I CA  .   CA ? ? C GLU 293 C CA  400 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc9  metalc ? ? B ASN 141 OD1 ? ? ? 1_555 H CA  .   CA ? ? B ASN 287 B CA  400 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc10 metalc ? ? D ASN 141 OD1 ? ? ? 1_555 J CA  .   CA ? ? D ASN 287 D CA  400 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc11 metalc ? ? D ASP 162 OD1 ? ? ? 1_555 J CA  .   CA ? ? D ASP 308 D CA  400 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc12 metalc ? ? A ASP 162 O   ? ? ? 1_555 G CA  .   CA ? ? A ASP 308 A CA  400 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc13 metalc ? ? F ASN 161 OD1 ? ? ? 1_555 L CA  .   CA ? ? F ASN 307 F CA  400 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc14 metalc ? ? D ASP 162 O   ? ? ? 1_555 J CA  .   CA ? ? D ASP 308 D CA  400 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc15 metalc ? ? F GLU 139 OE1 ? ? ? 1_555 L CA  .   CA ? ? F GLU 285 F CA  400 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc16 metalc ? ? F ASN 141 OD1 ? ? ? 1_555 L CA  .   CA ? ? F ASN 287 F CA  400 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc17 metalc ? ? A GLU 139 OE1 ? ? ? 1_555 G CA  .   CA ? ? A GLU 285 A CA  400 1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc18 metalc ? ? E ASN 141 OD1 ? ? ? 1_555 K CA  .   CA ? ? E ASN 287 E CA  400 1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc19 metalc ? ? A GLU 147 OE1 ? ? ? 1_555 G CA  .   CA ? ? A GLU 293 A CA  400 1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc20 metalc ? ? D GLU 147 OE1 ? ? ? 1_555 J CA  .   CA ? ? D GLU 293 D CA  400 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc21 metalc ? ? B GLU 139 OE1 ? ? ? 1_555 H CA  .   CA ? ? B GLU 285 B CA  400 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc22 metalc ? ? E GLU 147 OE1 ? ? ? 1_555 K CA  .   CA ? ? E GLU 293 E CA  400 1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc23 metalc ? ? B GLU 147 OE1 ? ? ? 1_555 H CA  .   CA ? ? B GLU 293 B CA  400 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc24 metalc ? ? E GLU 139 OE1 ? ? ? 1_555 K CA  .   CA ? ? E GLU 285 E CA  400 1_555 ? ? ? ? ? ? ? 2.417 ? 
metalc25 metalc ? ? D ASN 161 OD1 ? ? ? 1_555 J CA  .   CA ? ? D ASN 307 D CA  400 1_555 ? ? ? ? ? ? ? 2.418 ? 
metalc26 metalc ? ? E ASP 162 O   ? ? ? 1_555 K CA  .   CA ? ? E ASP 308 E CA  400 1_555 ? ? ? ? ? ? ? 2.418 ? 
metalc27 metalc ? ? A ASN 141 OD1 ? ? ? 1_555 G CA  .   CA ? ? A ASN 287 A CA  400 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc28 metalc ? ? C ASN 161 OD1 ? ? ? 1_555 I CA  .   CA ? ? C ASN 307 C CA  400 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc29 metalc ? ? C ASN 141 OD1 ? ? ? 1_555 I CA  .   CA ? ? C ASN 287 C CA  400 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc30 metalc ? ? E ASN 161 OD1 ? ? ? 1_555 K CA  .   CA ? ? E ASN 307 E CA  400 1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc31 metalc ? ? C GLU 139 OE1 ? ? ? 1_555 I CA  .   CA ? ? C GLU 285 C CA  400 1_555 ? ? ? ? ? ? ? 2.425 ? 
metalc32 metalc ? ? D GLU 139 OE1 ? ? ? 1_555 J CA  .   CA ? ? D GLU 285 D CA  400 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc33 metalc ? ? B ASP 162 O   ? ? ? 1_555 H CA  .   CA ? ? B ASP 308 B CA  400 1_555 ? ? ? ? ? ? ? 2.428 ? 
metalc34 metalc ? ? A ASN 161 OD1 ? ? ? 1_555 G CA  .   CA ? ? A ASN 307 A CA  400 1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc35 metalc ? ? C ASP 162 O   ? ? ? 1_555 I CA  .   CA ? ? C ASP 308 C CA  400 1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc36 metalc ? ? F ASP 162 O   ? ? ? 1_555 L CA  .   CA ? ? F ASP 308 F CA  400 1_555 ? ? ? ? ? ? ? 2.586 ? 
metalc37 metalc ? ? I CA  .   CA  ? ? ? 1_555 O HOH .   O  ? ? C CA  400 C HOH 6   1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc38 metalc ? ? I CA  .   CA  ? ? ? 1_555 O HOH .   O  ? ? C CA  400 C HOH 5   1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc39 metalc ? ? L CA  .   CA  ? ? ? 1_555 R HOH .   O  ? ? F CA  400 F HOH 11  1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc40 metalc ? ? K CA  .   CA  ? ? ? 1_555 Q HOH .   O  ? ? E CA  400 E HOH 9   1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc41 metalc ? ? L CA  .   CA  ? ? ? 1_555 R HOH .   O  ? ? F CA  400 F HOH 12  1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc42 metalc ? ? G CA  .   CA  ? ? ? 1_555 M HOH .   O  ? ? A CA  400 A HOH 1   1_555 ? ? ? ? ? ? ? 2.404 ? 
metalc43 metalc ? ? K CA  .   CA  ? ? ? 1_555 Q HOH .   O  ? ? E CA  400 E HOH 10  1_555 ? ? ? ? ? ? ? 2.404 ? 
metalc44 metalc ? ? J CA  .   CA  ? ? ? 1_555 P HOH .   O  ? ? D CA  400 D HOH 8   1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc45 metalc ? ? G CA  .   CA  ? ? ? 1_555 M HOH .   O  ? ? A CA  400 A HOH 2   1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc46 metalc ? ? H CA  .   CA  ? ? ? 1_555 N HOH .   O  ? ? B CA  400 B HOH 3   1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc47 metalc ? ? H CA  .   CA  ? ? ? 1_555 N HOH .   O  ? ? B CA  400 B HOH 4   1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc48 metalc ? ? J CA  .   CA  ? ? ? 1_555 P HOH .   O  ? ? D CA  400 D HOH 7   1_555 ? ? ? ? ? ? ? 2.441 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 139 A . ? GLU 285 A PRO 140 A ? PRO 286 A 1 -2.96 
2 GLU 139 B . ? GLU 285 B PRO 140 B ? PRO 286 B 1 4.95  
3 GLU 139 C . ? GLU 285 C PRO 140 C ? PRO 286 C 1 -1.56 
4 GLU 139 D . ? GLU 285 D PRO 140 D ? PRO 286 D 1 3.89  
5 GLU 139 E . ? GLU 285 E PRO 140 E ? PRO 286 E 1 0.14  
6 GLU 139 F . ? GLU 285 F PRO 140 F ? PRO 286 F 1 -1.56 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
D ? 5 ? 
E ? 5 ? 
F ? 5 ? 
G ? 5 ? 
H ? 5 ? 
I ? 5 ? 
J ? 5 ? 
K ? 5 ? 
L ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? parallel      
I 4 5 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? parallel      
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? parallel      
K 4 5 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? parallel      
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 54  ? PHE A 56  ? LYS A 200 PHE A 202 
A 2 ASN A 59  ? PHE A 63  ? ASN A 205 PHE A 209 
A 3 LEU A 170 ? PRO A 176 ? LEU A 316 PRO A 322 
A 4 TYR A 105 ? LYS A 111 ? TYR A 251 LYS A 257 
A 5 TRP A 118 ? TRP A 120 ? TRP A 264 TRP A 266 
B 1 HIS A 83  ? LEU A 84  ? HIS A 229 LEU A 230 
B 2 LEU A 170 ? PRO A 176 ? LEU A 316 PRO A 322 
B 3 TYR A 105 ? LYS A 111 ? TYR A 251 LYS A 257 
B 4 CYS A 149 ? ILE A 152 ? CYS A 295 ILE A 298 
B 5 TRP A 160 ? ALA A 163 ? TRP A 306 ALA A 309 
C 1 LYS B 54  ? PHE B 56  ? LYS B 200 PHE B 202 
C 2 ASN B 59  ? PHE B 63  ? ASN B 205 PHE B 209 
C 3 LEU B 170 ? PRO B 176 ? LEU B 316 PRO B 322 
C 4 TYR B 105 ? ALA B 112 ? TYR B 251 ALA B 258 
C 5 ASP B 117 ? TRP B 120 ? ASP B 263 TRP B 266 
D 1 HIS B 83  ? LEU B 84  ? HIS B 229 LEU B 230 
D 2 LEU B 170 ? PRO B 176 ? LEU B 316 PRO B 322 
D 3 TYR B 105 ? ALA B 112 ? TYR B 251 ALA B 258 
D 4 CYS B 149 ? ILE B 152 ? CYS B 295 ILE B 298 
D 5 TRP B 160 ? ALA B 163 ? TRP B 306 ALA B 309 
E 1 LYS C 54  ? PHE C 56  ? LYS C 200 PHE C 202 
E 2 ASN C 59  ? PHE C 63  ? ASN C 205 PHE C 209 
E 3 LEU C 170 ? PRO C 176 ? LEU C 316 PRO C 322 
E 4 TYR C 105 ? ALA C 112 ? TYR C 251 ALA C 258 
E 5 ASP C 117 ? TRP C 120 ? ASP C 263 TRP C 266 
F 1 HIS C 83  ? LEU C 84  ? HIS C 229 LEU C 230 
F 2 LEU C 170 ? PRO C 176 ? LEU C 316 PRO C 322 
F 3 TYR C 105 ? ALA C 112 ? TYR C 251 ALA C 258 
F 4 CYS C 149 ? ILE C 152 ? CYS C 295 ILE C 298 
F 5 TRP C 160 ? ALA C 163 ? TRP C 306 ALA C 309 
G 1 LYS D 54  ? PHE D 56  ? LYS D 200 PHE D 202 
G 2 ASN D 59  ? PHE D 63  ? ASN D 205 PHE D 209 
G 3 LEU D 170 ? PRO D 176 ? LEU D 316 PRO D 322 
G 4 TYR D 105 ? LYS D 111 ? TYR D 251 LYS D 257 
G 5 TRP D 118 ? TRP D 120 ? TRP D 264 TRP D 266 
H 1 HIS D 83  ? LEU D 84  ? HIS D 229 LEU D 230 
H 2 LEU D 170 ? PRO D 176 ? LEU D 316 PRO D 322 
H 3 TYR D 105 ? LYS D 111 ? TYR D 251 LYS D 257 
H 4 CYS D 149 ? ILE D 152 ? CYS D 295 ILE D 298 
H 5 TRP D 160 ? ALA D 163 ? TRP D 306 ALA D 309 
I 1 LYS E 54  ? PHE E 56  ? LYS E 200 PHE E 202 
I 2 ASN E 59  ? PHE E 63  ? ASN E 205 PHE E 209 
I 3 LEU E 170 ? PRO E 176 ? LEU E 316 PRO E 322 
I 4 TYR E 105 ? LYS E 111 ? TYR E 251 LYS E 257 
I 5 TRP E 118 ? TRP E 120 ? TRP E 264 TRP E 266 
J 1 HIS E 83  ? LEU E 84  ? HIS E 229 LEU E 230 
J 2 LEU E 170 ? PRO E 176 ? LEU E 316 PRO E 322 
J 3 TYR E 105 ? LYS E 111 ? TYR E 251 LYS E 257 
J 4 CYS E 149 ? ILE E 152 ? CYS E 295 ILE E 298 
J 5 TRP E 160 ? ALA E 163 ? TRP E 306 ALA E 309 
K 1 LYS F 54  ? PHE F 56  ? LYS F 200 PHE F 202 
K 2 ASN F 59  ? PHE F 63  ? ASN F 205 PHE F 209 
K 3 LEU F 170 ? PRO F 176 ? LEU F 316 PRO F 322 
K 4 TYR F 105 ? ALA F 112 ? TYR F 251 ALA F 258 
K 5 ASP F 117 ? TRP F 120 ? ASP F 263 TRP F 266 
L 1 HIS F 83  ? LEU F 84  ? HIS F 229 LEU F 230 
L 2 LEU F 170 ? PRO F 176 ? LEU F 316 PRO F 322 
L 3 TYR F 105 ? ALA F 112 ? TYR F 251 ALA F 258 
L 4 CYS F 149 ? ILE F 152 ? CYS F 295 ILE F 298 
L 5 TRP F 160 ? ALA F 163 ? TRP F 306 ALA F 309 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 54  ? N LYS A 200 O TYR A 61  ? O TYR A 207 
A 2 3 N PHE A 60  ? N PHE A 206 O ARG A 175 ? O ARG A 321 
A 3 4 O LEU A 170 ? O LEU A 316 N TRP A 106 ? N TRP A 252 
A 4 5 N THR A 110 ? N THR A 256 O SER A 119 ? O SER A 265 
B 1 2 N HIS A 83  ? N HIS A 229 O LYS A 174 ? O LYS A 320 
B 2 3 O LEU A 170 ? O LEU A 316 N TRP A 106 ? N TRP A 252 
B 3 4 N TYR A 105 ? N TYR A 251 O ILE A 152 ? O ILE A 298 
B 4 5 N CYS A 149 ? N CYS A 295 O ALA A 163 ? O ALA A 309 
C 1 2 N LYS B 54  ? N LYS B 200 O TYR B 61  ? O TYR B 207 
C 2 3 N PHE B 60  ? N PHE B 206 O ARG B 175 ? O ARG B 321 
C 3 4 O LEU B 170 ? O LEU B 316 N TRP B 106 ? N TRP B 252 
C 4 5 N ALA B 112 ? N ALA B 258 O ASP B 117 ? O ASP B 263 
D 1 2 N HIS B 83  ? N HIS B 229 O LYS B 174 ? O LYS B 320 
D 2 3 O LEU B 170 ? O LEU B 316 N TRP B 106 ? N TRP B 252 
D 3 4 N TYR B 105 ? N TYR B 251 O ILE B 152 ? O ILE B 298 
D 4 5 N CYS B 149 ? N CYS B 295 O ALA B 163 ? O ALA B 309 
E 1 2 N LYS C 54  ? N LYS C 200 O TYR C 61  ? O TYR C 207 
E 2 3 N PHE C 60  ? N PHE C 206 O ARG C 175 ? O ARG C 321 
E 3 4 O LEU C 170 ? O LEU C 316 N TRP C 106 ? N TRP C 252 
E 4 5 N ALA C 112 ? N ALA C 258 O ASP C 117 ? O ASP C 263 
F 1 2 N HIS C 83  ? N HIS C 229 O LYS C 174 ? O LYS C 320 
F 2 3 O LEU C 170 ? O LEU C 316 N TRP C 106 ? N TRP C 252 
F 3 4 N TYR C 105 ? N TYR C 251 O ILE C 152 ? O ILE C 298 
F 4 5 N ASN C 151 ? N ASN C 297 O ASN C 161 ? O ASN C 307 
G 1 2 N LYS D 54  ? N LYS D 200 O TYR D 61  ? O TYR D 207 
G 2 3 N PHE D 60  ? N PHE D 206 O ARG D 175 ? O ARG D 321 
G 3 4 O LEU D 170 ? O LEU D 316 N TRP D 106 ? N TRP D 252 
G 4 5 N THR D 110 ? N THR D 256 O SER D 119 ? O SER D 265 
H 1 2 N HIS D 83  ? N HIS D 229 O LYS D 174 ? O LYS D 320 
H 2 3 O LEU D 170 ? O LEU D 316 N TRP D 106 ? N TRP D 252 
H 3 4 N TYR D 105 ? N TYR D 251 O ILE D 152 ? O ILE D 298 
H 4 5 N CYS D 149 ? N CYS D 295 O ALA D 163 ? O ALA D 309 
I 1 2 N LYS E 54  ? N LYS E 200 O TYR E 61  ? O TYR E 207 
I 2 3 N PHE E 60  ? N PHE E 206 O ARG E 175 ? O ARG E 321 
I 3 4 O LEU E 170 ? O LEU E 316 N TRP E 106 ? N TRP E 252 
I 4 5 N THR E 110 ? N THR E 256 O SER E 119 ? O SER E 265 
J 1 2 N HIS E 83  ? N HIS E 229 O LYS E 174 ? O LYS E 320 
J 2 3 O LEU E 170 ? O LEU E 316 N TRP E 106 ? N TRP E 252 
J 3 4 N TYR E 105 ? N TYR E 251 O ILE E 152 ? O ILE E 298 
J 4 5 N CYS E 149 ? N CYS E 295 O ALA E 163 ? O ALA E 309 
K 1 2 N LYS F 54  ? N LYS F 200 O TYR F 61  ? O TYR F 207 
K 2 3 N PHE F 60  ? N PHE F 206 O ARG F 175 ? O ARG F 321 
K 3 4 O LEU F 170 ? O LEU F 316 N TRP F 106 ? N TRP F 252 
K 4 5 N THR F 110 ? N THR F 256 O SER F 119 ? O SER F 265 
L 1 2 N HIS F 83  ? N HIS F 229 O LYS F 174 ? O LYS F 320 
L 2 3 O LEU F 170 ? O LEU F 316 N TRP F 106 ? N TRP F 252 
L 3 4 N TYR F 105 ? N TYR F 251 O ILE F 152 ? O ILE F 298 
L 4 5 N CYS F 149 ? N CYS F 295 O ALA F 163 ? O ALA F 309 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA A 400' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA B 400' 
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA C 400' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA D 400' 
AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA E 400' 
AC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA F 400' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 HOH M .   ? HOH A 1   . ? 1_555 ? 
2  AC1 7 HOH M .   ? HOH A 2   . ? 1_555 ? 
3  AC1 7 GLU A 139 ? GLU A 285 . ? 1_555 ? 
4  AC1 7 ASN A 141 ? ASN A 287 . ? 1_555 ? 
5  AC1 7 GLU A 147 ? GLU A 293 . ? 1_555 ? 
6  AC1 7 ASN A 161 ? ASN A 307 . ? 1_555 ? 
7  AC1 7 ASP A 162 ? ASP A 308 . ? 1_555 ? 
8  AC2 7 HOH N .   ? HOH B 3   . ? 1_555 ? 
9  AC2 7 HOH N .   ? HOH B 4   . ? 1_555 ? 
10 AC2 7 GLU B 139 ? GLU B 285 . ? 1_555 ? 
11 AC2 7 ASN B 141 ? ASN B 287 . ? 1_555 ? 
12 AC2 7 GLU B 147 ? GLU B 293 . ? 1_555 ? 
13 AC2 7 ASN B 161 ? ASN B 307 . ? 1_555 ? 
14 AC2 7 ASP B 162 ? ASP B 308 . ? 1_555 ? 
15 AC3 7 HOH O .   ? HOH C 5   . ? 1_555 ? 
16 AC3 7 HOH O .   ? HOH C 6   . ? 1_555 ? 
17 AC3 7 GLU C 139 ? GLU C 285 . ? 1_555 ? 
18 AC3 7 ASN C 141 ? ASN C 287 . ? 1_555 ? 
19 AC3 7 GLU C 147 ? GLU C 293 . ? 1_555 ? 
20 AC3 7 ASN C 161 ? ASN C 307 . ? 1_555 ? 
21 AC3 7 ASP C 162 ? ASP C 308 . ? 1_555 ? 
22 AC4 7 HOH P .   ? HOH D 7   . ? 1_555 ? 
23 AC4 7 HOH P .   ? HOH D 8   . ? 1_555 ? 
24 AC4 7 GLU D 139 ? GLU D 285 . ? 1_555 ? 
25 AC4 7 ASN D 141 ? ASN D 287 . ? 1_555 ? 
26 AC4 7 GLU D 147 ? GLU D 293 . ? 1_555 ? 
27 AC4 7 ASN D 161 ? ASN D 307 . ? 1_555 ? 
28 AC4 7 ASP D 162 ? ASP D 308 . ? 1_555 ? 
29 AC5 7 HOH Q .   ? HOH E 9   . ? 1_555 ? 
30 AC5 7 HOH Q .   ? HOH E 10  . ? 1_555 ? 
31 AC5 7 GLU E 139 ? GLU E 285 . ? 1_555 ? 
32 AC5 7 ASN E 141 ? ASN E 287 . ? 1_555 ? 
33 AC5 7 GLU E 147 ? GLU E 293 . ? 1_555 ? 
34 AC5 7 ASN E 161 ? ASN E 307 . ? 1_555 ? 
35 AC5 7 ASP E 162 ? ASP E 308 . ? 1_555 ? 
36 AC6 7 HOH R .   ? HOH F 11  . ? 1_555 ? 
37 AC6 7 HOH R .   ? HOH F 12  . ? 1_555 ? 
38 AC6 7 GLU F 139 ? GLU F 285 . ? 1_555 ? 
39 AC6 7 ASN F 141 ? ASN F 287 . ? 1_555 ? 
40 AC6 7 GLU F 147 ? GLU F 293 . ? 1_555 ? 
41 AC6 7 ASN F 161 ? ASN F 307 . ? 1_555 ? 
42 AC6 7 ASP F 162 ? ASP F 308 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3KQG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3KQG 
_atom_sites.fract_transf_matrix[1][1]   0.012380 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000956 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012909 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011674 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 13  ? 21.801  22.321  89.312  1.00 62.45  ? 159 SER A N   1 
ATOM   2    C  CA  . SER A 1 13  ? 21.732  21.119  90.139  1.00 66.23  ? 159 SER A CA  1 
ATOM   3    C  C   . SER A 1 13  ? 20.958  21.357  91.436  1.00 68.18  ? 159 SER A C   1 
ATOM   4    O  O   . SER A 1 13  ? 21.257  22.288  92.186  1.00 67.15  ? 159 SER A O   1 
ATOM   5    C  CB  . SER A 1 13  ? 23.137  20.611  90.459  1.00 68.50  ? 159 SER A CB  1 
ATOM   6    O  OG  . SER A 1 13  ? 23.096  19.616  91.469  1.00 71.26  ? 159 SER A OG  1 
ATOM   7    N  N   . ASP A 1 14  ? 19.975  20.501  91.703  1.00 69.00  ? 160 ASP A N   1 
ATOM   8    C  CA  . ASP A 1 14  ? 19.081  20.678  92.849  1.00 70.20  ? 160 ASP A CA  1 
ATOM   9    C  C   . ASP A 1 14  ? 19.787  20.608  94.207  1.00 68.70  ? 160 ASP A C   1 
ATOM   10   O  O   . ASP A 1 14  ? 19.345  21.230  95.176  1.00 68.62  ? 160 ASP A O   1 
ATOM   11   C  CB  . ASP A 1 14  ? 17.932  19.666  92.796  1.00 73.49  ? 160 ASP A CB  1 
ATOM   12   C  CG  . ASP A 1 14  ? 16.990  19.914  91.632  1.00 75.75  ? 160 ASP A CG  1 
ATOM   13   O  OD1 . ASP A 1 14  ? 16.498  21.056  91.495  1.00 75.27  ? 160 ASP A OD1 1 
ATOM   14   O  OD2 . ASP A 1 14  ? 16.738  18.967  90.856  1.00 77.63  ? 160 ASP A OD2 1 
ATOM   15   N  N   . LEU A 1 15  ? 20.877  19.849  94.276  1.00 64.48  ? 161 LEU A N   1 
ATOM   16   C  CA  . LEU A 1 15  ? 21.645  19.732  95.510  1.00 60.54  ? 161 LEU A CA  1 
ATOM   17   C  C   . LEU A 1 15  ? 22.495  20.985  95.729  1.00 54.43  ? 161 LEU A C   1 
ATOM   18   O  O   . LEU A 1 15  ? 22.599  21.491  96.847  1.00 46.65  ? 161 LEU A O   1 
ATOM   19   C  CB  . LEU A 1 15  ? 22.524  18.478  95.479  1.00 61.20  ? 161 LEU A CB  1 
ATOM   20   C  CG  . LEU A 1 15  ? 23.214  18.027  96.773  1.00 61.60  ? 161 LEU A CG  1 
ATOM   21   C  CD1 . LEU A 1 15  ? 22.210  17.779  97.893  1.00 63.97  ? 161 LEU A CD1 1 
ATOM   22   C  CD2 . LEU A 1 15  ? 24.045  16.779  96.518  1.00 59.97  ? 161 LEU A CD2 1 
ATOM   23   N  N   . GLU A 1 16  ? 23.091  21.485  94.650  1.00 54.58  ? 162 GLU A N   1 
ATOM   24   C  CA  . GLU A 1 16  ? 23.906  22.691  94.718  1.00 57.08  ? 162 GLU A CA  1 
ATOM   25   C  C   . GLU A 1 16  ? 23.059  23.938  94.975  1.00 58.58  ? 162 GLU A C   1 
ATOM   26   O  O   . GLU A 1 16  ? 23.495  24.853  95.675  1.00 55.25  ? 162 GLU A O   1 
ATOM   27   C  CB  . GLU A 1 16  ? 24.734  22.854  93.442  1.00 57.28  ? 162 GLU A CB  1 
ATOM   28   C  CG  . GLU A 1 16  ? 25.858  21.840  93.314  1.00 61.79  ? 162 GLU A CG  1 
ATOM   29   C  CD  . GLU A 1 16  ? 26.422  21.752  91.905  1.00 65.28  ? 162 GLU A CD  1 
ATOM   30   O  OE1 . GLU A 1 16  ? 25.849  22.376  90.984  1.00 66.32  ? 162 GLU A OE1 1 
ATOM   31   O  OE2 . GLU A 1 16  ? 27.437  21.049  91.718  1.00 64.75  ? 162 GLU A OE2 1 
ATOM   32   N  N   . LYS A 1 17  ? 21.853  23.969  94.409  1.00 61.17  ? 163 LYS A N   1 
ATOM   33   C  CA  . LYS A 1 17  ? 20.936  25.091  94.611  1.00 61.54  ? 163 LYS A CA  1 
ATOM   34   C  C   . LYS A 1 17  ? 20.550  25.212  96.079  1.00 59.86  ? 163 LYS A C   1 
ATOM   35   O  O   . LYS A 1 17  ? 20.365  26.316  96.592  1.00 59.98  ? 163 LYS A O   1 
ATOM   36   C  CB  . LYS A 1 17  ? 19.669  24.933  93.767  1.00 65.74  ? 163 LYS A CB  1 
ATOM   37   C  CG  . LYS A 1 17  ? 19.877  25.020  92.259  1.00 69.24  ? 163 LYS A CG  1 
ATOM   38   C  CD  . LYS A 1 17  ? 18.567  24.759  91.525  1.00 72.38  ? 163 LYS A CD  1 
ATOM   39   C  CE  . LYS A 1 17  ? 18.781  24.525  90.039  1.00 74.75  ? 163 LYS A CE  1 
ATOM   40   N  NZ  . LYS A 1 17  ? 17.515  24.107  89.367  1.00 76.48  ? 163 LYS A NZ  1 
ATOM   41   N  N   . ALA A 1 18  ? 20.418  24.070  96.747  1.00 58.08  ? 164 ALA A N   1 
ATOM   42   C  CA  . ALA A 1 18  ? 20.083  24.050  98.166  1.00 60.05  ? 164 ALA A CA  1 
ATOM   43   C  C   . ALA A 1 18  ? 21.248  24.576  98.995  1.00 58.01  ? 164 ALA A C   1 
ATOM   44   O  O   . ALA A 1 18  ? 21.061  25.398  99.891  1.00 56.56  ? 164 ALA A O   1 
ATOM   45   C  CB  . ALA A 1 18  ? 19.707  22.641  98.608  1.00 62.90  ? 164 ALA A CB  1 
ATOM   46   N  N   . SER A 1 19  ? 22.448  24.089  98.688  1.00 56.84  ? 165 SER A N   1 
ATOM   47   C  CA  . SER A 1 19  ? 23.660  24.524  99.370  1.00 55.55  ? 165 SER A CA  1 
ATOM   48   C  C   . SER A 1 19  ? 23.842  26.033  99.245  1.00 51.08  ? 165 SER A C   1 
ATOM   49   O  O   . SER A 1 19  ? 23.913  26.743  100.244 1.00 50.60  ? 165 SER A O   1 
ATOM   50   C  CB  . SER A 1 19  ? 24.880  23.796  98.802  1.00 55.07  ? 165 SER A CB  1 
ATOM   51   O  OG  . SER A 1 19  ? 24.840  22.417  99.129  1.00 59.51  ? 165 SER A OG  1 
ATOM   52   N  N   . ALA A 1 20  ? 23.910  26.509  98.006  1.00 48.26  ? 166 ALA A N   1 
ATOM   53   C  CA  . ALA A 1 20  ? 24.059  27.930  97.726  1.00 44.63  ? 166 ALA A CA  1 
ATOM   54   C  C   . ALA A 1 20  ? 23.026  28.762  98.484  1.00 45.84  ? 166 ALA A C   1 
ATOM   55   O  O   . ALA A 1 20  ? 23.381  29.609  99.303  1.00 41.69  ? 166 ALA A O   1 
ATOM   56   C  CB  . ALA A 1 20  ? 23.948  28.183  96.237  1.00 42.56  ? 166 ALA A CB  1 
ATOM   57   N  N   . LEU A 1 21  ? 21.750  28.513  98.203  1.00 48.81  ? 167 LEU A N   1 
ATOM   58   C  CA  . LEU A 1 21  ? 20.663  29.224  98.865  1.00 48.49  ? 167 LEU A CA  1 
ATOM   59   C  C   . LEU A 1 21  ? 20.877  29.304  100.367 1.00 50.81  ? 167 LEU A C   1 
ATOM   60   O  O   . LEU A 1 21  ? 20.717  30.363  100.969 1.00 49.03  ? 167 LEU A O   1 
ATOM   61   C  CB  . LEU A 1 21  ? 19.323  28.547  98.584  1.00 48.58  ? 167 LEU A CB  1 
ATOM   62   C  CG  . LEU A 1 21  ? 18.160  29.124  99.390  1.00 49.65  ? 167 LEU A CG  1 
ATOM   63   C  CD1 . LEU A 1 21  ? 17.888  30.557  98.963  1.00 49.46  ? 167 LEU A CD1 1 
ATOM   64   C  CD2 . LEU A 1 21  ? 16.910  28.275  99.234  1.00 52.86  ? 167 LEU A CD2 1 
ATOM   65   N  N   . ASN A 1 22  ? 21.231  28.178  100.975 1.00 54.84  ? 168 ASN A N   1 
ATOM   66   C  CA  . ASN A 1 22  ? 21.436  28.143  102.417 1.00 56.71  ? 168 ASN A CA  1 
ATOM   67   C  C   . ASN A 1 22  ? 22.608  28.999  102.878 1.00 53.57  ? 168 ASN A C   1 
ATOM   68   O  O   . ASN A 1 22  ? 22.466  29.808  103.794 1.00 51.87  ? 168 ASN A O   1 
ATOM   69   C  CB  . ASN A 1 22  ? 21.588  26.710  102.920 1.00 61.30  ? 168 ASN A CB  1 
ATOM   70   C  CG  . ASN A 1 22  ? 20.278  26.130  103.404 1.00 68.04  ? 168 ASN A CG  1 
ATOM   71   O  OD1 . ASN A 1 22  ? 20.251  25.305  104.317 1.00 72.00  ? 168 ASN A OD1 1 
ATOM   72   N  ND2 . ASN A 1 22  ? 19.178  26.572  102.804 1.00 68.09  ? 168 ASN A ND2 1 
ATOM   73   N  N   . THR A 1 23  ? 23.762  28.816  102.245 1.00 53.59  ? 169 THR A N   1 
ATOM   74   C  CA  . THR A 1 23  ? 24.947  29.590  102.599 1.00 53.58  ? 169 THR A CA  1 
ATOM   75   C  C   . THR A 1 23  ? 24.677  31.091  102.464 1.00 52.54  ? 169 THR A C   1 
ATOM   76   O  O   . THR A 1 23  ? 25.174  31.890  103.256 1.00 51.13  ? 169 THR A O   1 
ATOM   77   C  CB  . THR A 1 23  ? 26.171  29.189  101.749 1.00 52.31  ? 169 THR A CB  1 
ATOM   78   O  OG1 . THR A 1 23  ? 25.959  29.579  100.389 1.00 58.90  ? 169 THR A OG1 1 
ATOM   79   C  CG2 . THR A 1 23  ? 26.394  27.685  101.807 1.00 45.73  ? 169 THR A CG2 1 
ATOM   80   N  N   . LYS A 1 24  ? 23.873  31.465  101.472 1.00 54.48  ? 170 LYS A N   1 
ATOM   81   C  CA  . LYS A 1 24  ? 23.506  32.868  101.270 1.00 54.86  ? 170 LYS A CA  1 
ATOM   82   C  C   . LYS A 1 24  ? 22.557  33.385  102.347 1.00 52.61  ? 170 LYS A C   1 
ATOM   83   O  O   . LYS A 1 24  ? 22.678  34.524  102.796 1.00 50.68  ? 170 LYS A O   1 
ATOM   84   C  CB  . LYS A 1 24  ? 22.888  33.080  99.888  1.00 55.73  ? 170 LYS A CB  1 
ATOM   85   C  CG  . LYS A 1 24  ? 23.895  33.079  98.754  1.00 60.50  ? 170 LYS A CG  1 
ATOM   86   C  CD  . LYS A 1 24  ? 23.194  33.253  97.417  1.00 64.45  ? 170 LYS A CD  1 
ATOM   87   C  CE  . LYS A 1 24  ? 24.182  33.250  96.268  1.00 65.35  ? 170 LYS A CE  1 
ATOM   88   N  NZ  . LYS A 1 24  ? 23.486  33.433  94.965  1.00 66.22  ? 170 LYS A NZ  1 
ATOM   89   N  N   . ILE A 1 25  ? 21.604  32.554  102.755 1.00 49.78  ? 171 ILE A N   1 
ATOM   90   C  CA  . ILE A 1 25  ? 20.692  32.941  103.822 1.00 48.16  ? 171 ILE A CA  1 
ATOM   91   C  C   . ILE A 1 25  ? 21.410  33.058  105.171 1.00 45.01  ? 171 ILE A C   1 
ATOM   92   O  O   . ILE A 1 25  ? 21.156  33.986  105.933 1.00 43.21  ? 171 ILE A O   1 
ATOM   93   C  CB  . ILE A 1 25  ? 19.495  31.985  103.924 1.00 48.93  ? 171 ILE A CB  1 
ATOM   94   C  CG1 . ILE A 1 25  ? 18.447  32.356  102.876 1.00 53.31  ? 171 ILE A CG1 1 
ATOM   95   C  CG2 . ILE A 1 25  ? 18.874  32.043  105.308 1.00 46.67  ? 171 ILE A CG2 1 
ATOM   96   C  CD1 . ILE A 1 25  ? 17.214  31.469  102.904 1.00 56.39  ? 171 ILE A CD1 1 
ATOM   97   N  N   . ARG A 1 26  ? 22.303  32.116  105.459 1.00 45.51  ? 172 ARG A N   1 
ATOM   98   C  CA  . ARG A 1 26  ? 23.128  32.194  106.658 1.00 49.25  ? 172 ARG A CA  1 
ATOM   99   C  C   . ARG A 1 26  ? 23.934  33.483  106.622 1.00 48.68  ? 172 ARG A C   1 
ATOM   100  O  O   . ARG A 1 26  ? 24.112  34.147  107.642 1.00 49.31  ? 172 ARG A O   1 
ATOM   101  C  CB  . ARG A 1 26  ? 24.072  30.992  106.758 1.00 55.54  ? 172 ARG A CB  1 
ATOM   102  C  CG  . ARG A 1 26  ? 23.416  29.719  107.270 1.00 66.83  ? 172 ARG A CG  1 
ATOM   103  C  CD  . ARG A 1 26  ? 24.288  28.491  107.014 1.00 75.67  ? 172 ARG A CD  1 
ATOM   104  N  NE  . ARG A 1 26  ? 24.140  27.969  105.654 1.00 80.96  ? 172 ARG A NE  1 
ATOM   105  C  CZ  . ARG A 1 26  ? 24.770  26.890  105.191 1.00 86.83  ? 172 ARG A CZ  1 
ATOM   106  N  NH1 . ARG A 1 26  ? 25.599  26.215  105.976 1.00 90.59  ? 172 ARG A NH1 1 
ATOM   107  N  NH2 . ARG A 1 26  ? 24.573  26.482  103.942 1.00 87.26  ? 172 ARG A NH2 1 
ATOM   108  N  N   . ALA A 1 27  ? 24.408  33.838  105.433 1.00 48.90  ? 173 ALA A N   1 
ATOM   109  C  CA  . ALA A 1 27  ? 25.219  35.033  105.265 1.00 48.69  ? 173 ALA A CA  1 
ATOM   110  C  C   . ALA A 1 27  ? 24.416  36.285  105.606 1.00 51.03  ? 173 ALA A C   1 
ATOM   111  O  O   . ALA A 1 27  ? 24.856  37.112  106.409 1.00 52.75  ? 173 ALA A O   1 
ATOM   112  C  CB  . ALA A 1 27  ? 25.770  35.110  103.854 1.00 46.94  ? 173 ALA A CB  1 
ATOM   113  N  N   . LEU A 1 28  ? 23.238  36.414  104.999 1.00 48.67  ? 174 LEU A N   1 
ATOM   114  C  CA  . LEU A 1 28  ? 22.342  37.526  105.289 1.00 47.18  ? 174 LEU A CA  1 
ATOM   115  C  C   . LEU A 1 28  ? 22.037  37.624  106.777 1.00 46.49  ? 174 LEU A C   1 
ATOM   116  O  O   . LEU A 1 28  ? 21.988  38.721  107.333 1.00 45.68  ? 174 LEU A O   1 
ATOM   117  C  CB  . LEU A 1 28  ? 21.038  37.402  104.500 1.00 48.66  ? 174 LEU A CB  1 
ATOM   118  C  CG  . LEU A 1 28  ? 21.119  37.732  103.012 1.00 49.86  ? 174 LEU A CG  1 
ATOM   119  C  CD1 . LEU A 1 28  ? 19.746  37.611  102.371 1.00 51.58  ? 174 LEU A CD1 1 
ATOM   120  C  CD2 . LEU A 1 28  ? 21.689  39.128  102.807 1.00 47.48  ? 174 LEU A CD2 1 
ATOM   121  N  N   . GLN A 1 29  ? 21.823  36.480  107.419 1.00 44.74  ? 175 GLN A N   1 
ATOM   122  C  CA  . GLN A 1 29  ? 21.592  36.465  108.858 1.00 49.90  ? 175 GLN A CA  1 
ATOM   123  C  C   . GLN A 1 29  ? 22.803  37.014  109.593 1.00 46.26  ? 175 GLN A C   1 
ATOM   124  O  O   . GLN A 1 29  ? 22.667  37.831  110.495 1.00 45.24  ? 175 GLN A O   1 
ATOM   125  C  CB  . GLN A 1 29  ? 21.278  35.056  109.357 1.00 57.91  ? 175 GLN A CB  1 
ATOM   126  C  CG  . GLN A 1 29  ? 19.892  34.569  109.000 1.00 66.33  ? 175 GLN A CG  1 
ATOM   127  C  CD  . GLN A 1 29  ? 19.570  33.232  109.632 1.00 75.10  ? 175 GLN A CD  1 
ATOM   128  O  OE1 . GLN A 1 29  ? 18.658  33.124  110.452 1.00 80.01  ? 175 GLN A OE1 1 
ATOM   129  N  NE2 . GLN A 1 29  ? 20.323  32.203  109.258 1.00 77.24  ? 175 GLN A NE2 1 
ATOM   130  N  N   . GLY A 1 30  ? 23.989  36.557  109.206 1.00 43.79  ? 176 GLY A N   1 
ATOM   131  C  CA  . GLY A 1 30  ? 25.217  37.053  109.797 1.00 41.69  ? 176 GLY A CA  1 
ATOM   132  C  C   . GLY A 1 30  ? 25.339  38.561  109.669 1.00 40.80  ? 176 GLY A C   1 
ATOM   133  O  O   . GLY A 1 30  ? 25.617  39.258  110.648 1.00 39.68  ? 176 GLY A O   1 
ATOM   134  N  N   . SER A 1 31  ? 25.125  39.067  108.458 1.00 39.98  ? 177 SER A N   1 
ATOM   135  C  CA  . SER A 1 31  ? 25.218  40.501  108.193 1.00 40.83  ? 177 SER A CA  1 
ATOM   136  C  C   . SER A 1 31  ? 24.164  41.319  108.940 1.00 41.89  ? 177 SER A C   1 
ATOM   137  O  O   . SER A 1 31  ? 24.479  42.350  109.527 1.00 40.90  ? 177 SER A O   1 
ATOM   138  C  CB  . SER A 1 31  ? 25.119  40.775  106.695 1.00 40.40  ? 177 SER A CB  1 
ATOM   139  O  OG  . SER A 1 31  ? 26.228  40.229  106.010 1.00 42.31  ? 177 SER A OG  1 
ATOM   140  N  N   . LEU A 1 32  ? 22.915  40.864  108.907 1.00 43.80  ? 178 LEU A N   1 
ATOM   141  C  CA  . LEU A 1 32  ? 21.829  41.574  109.574 1.00 47.97  ? 178 LEU A CA  1 
ATOM   142  C  C   . LEU A 1 32  ? 22.116  41.761  111.057 1.00 49.74  ? 178 LEU A C   1 
ATOM   143  O  O   . LEU A 1 32  ? 21.775  42.791  111.643 1.00 48.58  ? 178 LEU A O   1 
ATOM   144  C  CB  . LEU A 1 32  ? 20.506  40.832  109.396 1.00 51.22  ? 178 LEU A CB  1 
ATOM   145  C  CG  . LEU A 1 32  ? 19.498  41.528  108.485 1.00 57.23  ? 178 LEU A CG  1 
ATOM   146  C  CD1 . LEU A 1 32  ? 20.154  41.926  107.170 1.00 59.33  ? 178 LEU A CD1 1 
ATOM   147  C  CD2 . LEU A 1 32  ? 18.289  40.639  108.245 1.00 60.42  ? 178 LEU A CD2 1 
ATOM   148  N  N   . GLU A 1 33  ? 22.736  40.751  111.657 1.00 50.82  ? 179 GLU A N   1 
ATOM   149  C  CA  . GLU A 1 33  ? 23.065  40.781  113.074 1.00 53.63  ? 179 GLU A CA  1 
ATOM   150  C  C   . GLU A 1 33  ? 24.274  41.680  113.326 1.00 45.82  ? 179 GLU A C   1 
ATOM   151  O  O   . GLU A 1 33  ? 24.326  42.404  114.320 1.00 41.85  ? 179 GLU A O   1 
ATOM   152  C  CB  . GLU A 1 33  ? 23.320  39.362  113.597 1.00 61.40  ? 179 GLU A CB  1 
ATOM   153  C  CG  . GLU A 1 33  ? 22.102  38.437  113.499 1.00 68.94  ? 179 GLU A CG  1 
ATOM   154  C  CD  . GLU A 1 33  ? 22.426  36.991  113.845 1.00 76.01  ? 179 GLU A CD  1 
ATOM   155  O  OE1 . GLU A 1 33  ? 23.541  36.737  114.348 1.00 79.45  ? 179 GLU A OE1 1 
ATOM   156  O  OE2 . GLU A 1 33  ? 21.567  36.109  113.612 1.00 77.41  ? 179 GLU A OE2 1 
ATOM   157  N  N   . ASN A 1 34  ? 25.241  41.627  112.417 1.00 43.22  ? 180 ASN A N   1 
ATOM   158  C  CA  . ASN A 1 34  ? 26.398  42.503  112.478 1.00 44.53  ? 180 ASN A CA  1 
ATOM   159  C  C   . ASN A 1 34  ? 25.982  43.966  112.345 1.00 42.86  ? 180 ASN A C   1 
ATOM   160  O  O   . ASN A 1 34  ? 26.478  44.837  113.062 1.00 48.36  ? 180 ASN A O   1 
ATOM   161  C  CB  . ASN A 1 34  ? 27.397  42.137  111.379 1.00 47.86  ? 180 ASN A CB  1 
ATOM   162  C  CG  . ASN A 1 34  ? 28.564  43.103  111.313 1.00 53.02  ? 180 ASN A CG  1 
ATOM   163  O  OD1 . ASN A 1 34  ? 29.300  43.273  112.288 1.00 54.61  ? 180 ASN A OD1 1 
ATOM   164  N  ND2 . ASN A 1 34  ? 28.738  43.745  110.160 1.00 52.22  ? 180 ASN A ND2 1 
ATOM   165  N  N   . MET A 1 35  ? 25.061  44.220  111.425 1.00 37.31  ? 181 MET A N   1 
ATOM   166  C  CA  . MET A 1 35  ? 24.557  45.560  111.171 1.00 37.60  ? 181 MET A CA  1 
ATOM   167  C  C   . MET A 1 35  ? 23.882  46.124  112.410 1.00 37.79  ? 181 MET A C   1 
ATOM   168  O  O   . MET A 1 35  ? 24.059  47.294  112.750 1.00 39.74  ? 181 MET A O   1 
ATOM   169  C  CB  . MET A 1 35  ? 23.552  45.534  110.017 1.00 38.79  ? 181 MET A CB  1 
ATOM   170  C  CG  . MET A 1 35  ? 23.165  46.908  109.501 1.00 39.81  ? 181 MET A CG  1 
ATOM   171  S  SD  . MET A 1 35  ? 23.869  47.229  107.874 1.00 89.07  ? 181 MET A SD  1 
ATOM   172  C  CE  . MET A 1 35  ? 25.550  46.655  108.107 1.00 58.32  ? 181 MET A CE  1 
ATOM   173  N  N   . SER A 1 36  ? 23.092  45.286  113.070 1.00 35.89  ? 182 SER A N   1 
ATOM   174  C  CA  . SER A 1 36  ? 22.402  45.681  114.287 1.00 40.68  ? 182 SER A CA  1 
ATOM   175  C  C   . SER A 1 36  ? 23.419  46.144  115.338 1.00 40.16  ? 182 SER A C   1 
ATOM   176  O  O   . SER A 1 36  ? 23.222  47.151  116.017 1.00 35.82  ? 182 SER A O   1 
ATOM   177  C  CB  . SER A 1 36  ? 21.575  44.504  114.811 1.00 44.83  ? 182 SER A CB  1 
ATOM   178  O  OG  . SER A 1 36  ? 20.817  44.865  115.951 1.00 50.50  ? 182 SER A OG  1 
ATOM   179  N  N   . LYS A 1 37  ? 24.507  45.388  115.450 1.00 41.84  ? 183 LYS A N   1 
ATOM   180  C  CA  . LYS A 1 37  ? 25.618  45.694  116.338 1.00 39.40  ? 183 LYS A CA  1 
ATOM   181  C  C   . LYS A 1 37  ? 26.223  47.059  116.006 1.00 36.65  ? 183 LYS A C   1 
ATOM   182  O  O   . LYS A 1 37  ? 26.489  47.868  116.901 1.00 39.10  ? 183 LYS A O   1 
ATOM   183  C  CB  . LYS A 1 37  ? 26.669  44.593  116.203 1.00 43.97  ? 183 LYS A CB  1 
ATOM   184  C  CG  . LYS A 1 37  ? 27.792  44.615  117.217 1.00 49.73  ? 183 LYS A CG  1 
ATOM   185  C  CD  . LYS A 1 37  ? 28.472  43.245  117.275 1.00 54.38  ? 183 LYS A CD  1 
ATOM   186  C  CE  . LYS A 1 37  ? 29.940  43.359  117.657 1.00 58.85  ? 183 LYS A CE  1 
ATOM   187  N  NZ  . LYS A 1 37  ? 30.140  44.158  118.901 1.00 60.99  ? 183 LYS A NZ  1 
ATOM   188  N  N   . LEU A 1 38  ? 26.425  47.318  114.717 1.00 30.68  ? 184 LEU A N   1 
ATOM   189  C  CA  . LEU A 1 38  ? 26.998  48.589  114.274 1.00 32.58  ? 184 LEU A CA  1 
ATOM   190  C  C   . LEU A 1 38  ? 26.063  49.790  114.456 1.00 32.05  ? 184 LEU A C   1 
ATOM   191  O  O   . LEU A 1 38  ? 26.529  50.913  114.662 1.00 34.75  ? 184 LEU A O   1 
ATOM   192  C  CB  . LEU A 1 38  ? 27.457  48.497  112.822 1.00 36.39  ? 184 LEU A CB  1 
ATOM   193  C  CG  . LEU A 1 38  ? 28.479  47.402  112.534 1.00 40.75  ? 184 LEU A CG  1 
ATOM   194  C  CD1 . LEU A 1 38  ? 28.701  47.264  111.035 1.00 42.43  ? 184 LEU A CD1 1 
ATOM   195  C  CD2 . LEU A 1 38  ? 29.783  47.697  113.254 1.00 41.12  ? 184 LEU A CD2 1 
ATOM   196  N  N   . LEU A 1 39  ? 24.753  49.565  114.382 1.00 28.28  ? 185 LEU A N   1 
ATOM   197  C  CA  . LEU A 1 39  ? 23.797  50.639  114.643 1.00 31.87  ? 185 LEU A CA  1 
ATOM   198  C  C   . LEU A 1 39  ? 23.813  51.002  116.118 1.00 33.67  ? 185 LEU A C   1 
ATOM   199  O  O   . LEU A 1 39  ? 23.645  52.168  116.484 1.00 37.40  ? 185 LEU A O   1 
ATOM   200  C  CB  . LEU A 1 39  ? 22.383  50.243  114.223 1.00 34.99  ? 185 LEU A CB  1 
ATOM   201  C  CG  . LEU A 1 39  ? 22.159  50.145  112.713 1.00 41.61  ? 185 LEU A CG  1 
ATOM   202  C  CD1 . LEU A 1 39  ? 20.751  49.648  112.388 1.00 44.07  ? 185 LEU A CD1 1 
ATOM   203  C  CD2 . LEU A 1 39  ? 22.427  51.485  112.052 1.00 39.08  ? 185 LEU A CD2 1 
ATOM   204  N  N   . LYS A 1 40  ? 24.013  49.995  116.962 1.00 31.75  ? 186 LYS A N   1 
ATOM   205  C  CA  . LYS A 1 40  ? 24.120  50.208  118.400 1.00 33.33  ? 186 LYS A CA  1 
ATOM   206  C  C   . LYS A 1 40  ? 25.344  51.051  118.740 1.00 25.06  ? 186 LYS A C   1 
ATOM   207  O  O   . LYS A 1 40  ? 25.278  51.918  119.600 1.00 29.40  ? 186 LYS A O   1 
ATOM   208  C  CB  . LYS A 1 40  ? 24.174  48.875  119.151 1.00 42.94  ? 186 LYS A CB  1 
ATOM   209  C  CG  . LYS A 1 40  ? 22.816  48.216  119.357 1.00 49.96  ? 186 LYS A CG  1 
ATOM   210  C  CD  . LYS A 1 40  ? 22.966  46.880  120.083 1.00 55.89  ? 186 LYS A CD  1 
ATOM   211  C  CE  . LYS A 1 40  ? 21.617  46.285  120.465 1.00 56.72  ? 186 LYS A CE  1 
ATOM   212  N  NZ  . LYS A 1 40  ? 20.773  46.007  119.277 1.00 53.86  ? 186 LYS A NZ  1 
ATOM   213  N  N   . ARG A 1 41  ? 26.459  50.797  118.062 1.00 25.73  ? 187 ARG A N   1 
ATOM   214  C  CA  . ARG A 1 41  ? 27.658  51.594  118.278 1.00 32.63  ? 187 ARG A CA  1 
ATOM   215  C  C   . ARG A 1 41  ? 27.398  53.025  117.847 1.00 37.16  ? 187 ARG A C   1 
ATOM   216  O  O   . ARG A 1 41  ? 27.762  53.971  118.546 1.00 40.22  ? 187 ARG A O   1 
ATOM   217  C  CB  . ARG A 1 41  ? 28.854  51.037  117.507 1.00 36.97  ? 187 ARG A CB  1 
ATOM   218  C  CG  . ARG A 1 41  ? 30.028  52.006  117.467 1.00 44.45  ? 187 ARG A CG  1 
ATOM   219  C  CD  . ARG A 1 41  ? 31.151  51.515  116.576 1.00 51.98  ? 187 ARG A CD  1 
ATOM   220  N  NE  . ARG A 1 41  ? 32.182  52.534  116.370 1.00 58.02  ? 187 ARG A NE  1 
ATOM   221  C  CZ  . ARG A 1 41  ? 33.289  52.649  117.102 1.00 64.64  ? 187 ARG A CZ  1 
ATOM   222  N  NH1 . ARG A 1 41  ? 33.526  51.809  118.105 1.00 65.61  ? 187 ARG A NH1 1 
ATOM   223  N  NH2 . ARG A 1 41  ? 34.164  53.608  116.829 1.00 66.19  ? 187 ARG A NH2 1 
ATOM   224  N  N   . GLN A 1 42  ? 26.773  53.175  116.683 1.00 37.29  ? 188 GLN A N   1 
ATOM   225  C  CA  . GLN A 1 42  ? 26.386  54.487  116.187 1.00 37.78  ? 188 GLN A CA  1 
ATOM   226  C  C   . GLN A 1 42  ? 25.548  55.177  117.239 1.00 34.77  ? 188 GLN A C   1 
ATOM   227  O  O   . GLN A 1 42  ? 25.793  56.328  117.580 1.00 34.27  ? 188 GLN A O   1 
ATOM   228  C  CB  . GLN A 1 42  ? 25.570  54.365  114.901 1.00 43.98  ? 188 GLN A CB  1 
ATOM   229  C  CG  . GLN A 1 42  ? 26.360  53.875  113.710 1.00 49.98  ? 188 GLN A CG  1 
ATOM   230  C  CD  . GLN A 1 42  ? 27.008  55.003  112.947 1.00 54.18  ? 188 GLN A CD  1 
ATOM   231  O  OE1 . GLN A 1 42  ? 26.378  56.023  112.682 1.00 53.34  ? 188 GLN A OE1 1 
ATOM   232  N  NE2 . GLN A 1 42  ? 28.271  54.824  112.577 1.00 58.25  ? 188 GLN A NE2 1 
ATOM   233  N  N   . ASN A 1 43  ? 24.558  54.465  117.760 1.00 34.50  ? 189 ASN A N   1 
ATOM   234  C  CA  . ASN A 1 43  ? 23.665  55.064  118.735 1.00 33.42  ? 189 ASN A CA  1 
ATOM   235  C  C   . ASN A 1 43  ? 24.371  55.477  120.027 1.00 28.45  ? 189 ASN A C   1 
ATOM   236  O  O   . ASN A 1 43  ? 24.058  56.520  120.594 1.00 26.29  ? 189 ASN A O   1 
ATOM   237  C  CB  . ASN A 1 43  ? 22.482  54.151  119.036 1.00 37.92  ? 189 ASN A CB  1 
ATOM   238  C  CG  . ASN A 1 43  ? 21.311  54.913  119.613 1.00 47.24  ? 189 ASN A CG  1 
ATOM   239  O  OD1 . ASN A 1 43  ? 20.882  55.927  119.053 1.00 52.40  ? 189 ASN A OD1 1 
ATOM   240  N  ND2 . ASN A 1 43  ? 20.793  54.444  120.742 1.00 48.20  ? 189 ASN A ND2 1 
ATOM   241  N  N   . ASP A 1 44  ? 25.315  54.659  120.488 1.00 25.65  ? 190 ASP A N   1 
ATOM   242  C  CA  . ASP A 1 44  ? 26.063  54.973  121.700 1.00 25.73  ? 190 ASP A CA  1 
ATOM   243  C  C   . ASP A 1 44  ? 26.761  56.305  121.523 1.00 24.22  ? 190 ASP A C   1 
ATOM   244  O  O   . ASP A 1 44  ? 26.614  57.213  122.338 1.00 27.74  ? 190 ASP A O   1 
ATOM   245  C  CB  . ASP A 1 44  ? 27.125  53.908  121.993 1.00 24.57  ? 190 ASP A CB  1 
ATOM   246  C  CG  . ASP A 1 44  ? 26.530  52.576  122.399 1.00 28.84  ? 190 ASP A CG  1 
ATOM   247  O  OD1 . ASP A 1 44  ? 25.399  52.554  122.927 1.00 28.67  ? 190 ASP A OD1 1 
ATOM   248  O  OD2 . ASP A 1 44  ? 27.209  51.547  122.191 1.00 32.91  ? 190 ASP A OD2 1 
ATOM   249  N  N   . ILE A 1 45  ? 27.532  56.401  120.448 1.00 22.93  ? 191 ILE A N   1 
ATOM   250  C  CA  . ILE A 1 45  ? 28.306  57.593  120.164 1.00 27.08  ? 191 ILE A CA  1 
ATOM   251  C  C   . ILE A 1 45  ? 27.401  58.801  119.928 1.00 27.73  ? 191 ILE A C   1 
ATOM   252  O  O   . ILE A 1 45  ? 27.686  59.893  120.405 1.00 31.73  ? 191 ILE A O   1 
ATOM   253  C  CB  . ILE A 1 45  ? 29.239  57.375  118.957 1.00 27.85  ? 191 ILE A CB  1 
ATOM   254  C  CG1 . ILE A 1 45  ? 30.292  56.315  119.292 1.00 27.93  ? 191 ILE A CG1 1 
ATOM   255  C  CG2 . ILE A 1 45  ? 29.912  58.677  118.560 1.00 31.58  ? 191 ILE A CG2 1 
ATOM   256  C  CD1 . ILE A 1 45  ? 31.097  55.846  118.093 1.00 26.40  ? 191 ILE A CD1 1 
ATOM   257  N  N   . LEU A 1 46  ? 26.298  58.596  119.218 1.00 23.23  ? 192 LEU A N   1 
ATOM   258  C  CA  . LEU A 1 46  ? 25.405  59.696  118.868 1.00 25.88  ? 192 LEU A CA  1 
ATOM   259  C  C   . LEU A 1 46  ? 24.778  60.304  120.120 1.00 26.34  ? 192 LEU A C   1 
ATOM   260  O  O   . LEU A 1 46  ? 24.693  61.529  120.254 1.00 23.05  ? 192 LEU A O   1 
ATOM   261  C  CB  . LEU A 1 46  ? 24.317  59.224  117.888 1.00 25.36  ? 192 LEU A CB  1 
ATOM   262  C  CG  . LEU A 1 46  ? 23.309  60.257  117.364 1.00 27.55  ? 192 LEU A CG  1 
ATOM   263  C  CD1 . LEU A 1 46  ? 24.016  61.380  116.623 1.00 23.38  ? 192 LEU A CD1 1 
ATOM   264  C  CD2 . LEU A 1 46  ? 22.249  59.608  116.463 1.00 24.05  ? 192 LEU A CD2 1 
ATOM   265  N  N   . GLN A 1 47  ? 24.340  59.445  121.035 1.00 27.82  ? 193 GLN A N   1 
ATOM   266  C  CA  . GLN A 1 47  ? 23.684  59.907  122.252 1.00 32.15  ? 193 GLN A CA  1 
ATOM   267  C  C   . GLN A 1 47  ? 24.600  60.818  123.055 1.00 30.25  ? 193 GLN A C   1 
ATOM   268  O  O   . GLN A 1 47  ? 24.158  61.819  123.609 1.00 36.24  ? 193 GLN A O   1 
ATOM   269  C  CB  . GLN A 1 47  ? 23.225  58.729  123.117 1.00 41.20  ? 193 GLN A CB  1 
ATOM   270  C  CG  . GLN A 1 47  ? 22.259  57.776  122.418 1.00 52.57  ? 193 GLN A CG  1 
ATOM   271  C  CD  . GLN A 1 47  ? 21.049  58.482  121.824 1.00 59.72  ? 193 GLN A CD  1 
ATOM   272  O  OE1 . GLN A 1 47  ? 20.176  58.958  122.551 1.00 63.18  ? 193 GLN A OE1 1 
ATOM   273  N  NE2 . GLN A 1 47  ? 20.989  58.546  120.494 1.00 60.34  ? 193 GLN A NE2 1 
ATOM   274  N  N   . VAL A 1 48  ? 25.880  60.471  123.116 1.00 25.59  ? 194 VAL A N   1 
ATOM   275  C  CA  . VAL A 1 48  ? 26.827  61.255  123.897 1.00 24.35  ? 194 VAL A CA  1 
ATOM   276  C  C   . VAL A 1 48  ? 27.198  62.535  123.161 1.00 24.94  ? 194 VAL A C   1 
ATOM   277  O  O   . VAL A 1 48  ? 27.275  63.605  123.762 1.00 28.68  ? 194 VAL A O   1 
ATOM   278  C  CB  . VAL A 1 48  ? 28.088  60.443  124.244 1.00 25.79  ? 194 VAL A CB  1 
ATOM   279  C  CG1 . VAL A 1 48  ? 29.144  61.338  124.857 1.00 25.36  ? 194 VAL A CG1 1 
ATOM   280  C  CG2 . VAL A 1 48  ? 27.730  59.287  125.194 1.00 22.62  ? 194 VAL A CG2 1 
ATOM   281  N  N   . VAL A 1 49  ? 27.415  62.430  121.856 1.00 24.78  ? 195 VAL A N   1 
ATOM   282  C  CA  . VAL A 1 49  ? 27.675  63.615  121.051 1.00 25.68  ? 195 VAL A CA  1 
ATOM   283  C  C   . VAL A 1 49  ? 26.467  64.556  121.049 1.00 26.99  ? 195 VAL A C   1 
ATOM   284  O  O   . VAL A 1 49  ? 26.628  65.770  121.072 1.00 30.85  ? 195 VAL A O   1 
ATOM   285  C  CB  . VAL A 1 49  ? 28.069  63.261  119.610 1.00 24.19  ? 195 VAL A CB  1 
ATOM   286  C  CG1 . VAL A 1 49  ? 28.113  64.519  118.765 1.00 27.76  ? 195 VAL A CG1 1 
ATOM   287  C  CG2 . VAL A 1 49  ? 29.415  62.569  119.585 1.00 24.06  ? 195 VAL A CG2 1 
ATOM   288  N  N   . SER A 1 50  ? 25.263  63.991  121.039 1.00 24.86  ? 196 SER A N   1 
ATOM   289  C  CA  . SER A 1 50  ? 24.041  64.790  121.121 1.00 30.03  ? 196 SER A CA  1 
ATOM   290  C  C   . SER A 1 50  ? 23.927  65.510  122.464 1.00 33.51  ? 196 SER A C   1 
ATOM   291  O  O   . SER A 1 50  ? 22.950  66.214  122.718 1.00 33.48  ? 196 SER A O   1 
ATOM   292  C  CB  . SER A 1 50  ? 22.796  63.914  120.918 1.00 31.29  ? 196 SER A CB  1 
ATOM   293  O  OG  . SER A 1 50  ? 22.720  63.401  119.599 1.00 32.63  ? 196 SER A OG  1 
ATOM   294  N  N   . GLN A 1 51  ? 24.920  65.326  123.326 1.00 33.29  ? 197 GLN A N   1 
ATOM   295  C  CA  . GLN A 1 51  ? 24.860  65.881  124.670 1.00 34.52  ? 197 GLN A CA  1 
ATOM   296  C  C   . GLN A 1 51  ? 26.046  66.792  124.958 1.00 33.63  ? 197 GLN A C   1 
ATOM   297  O  O   . GLN A 1 51  ? 26.423  66.994  126.113 1.00 37.63  ? 197 GLN A O   1 
ATOM   298  C  CB  . GLN A 1 51  ? 24.772  64.762  125.713 1.00 39.59  ? 197 GLN A CB  1 
ATOM   299  C  CG  . GLN A 1 51  ? 23.505  63.920  125.601 1.00 48.95  ? 197 GLN A CG  1 
ATOM   300  C  CD  . GLN A 1 51  ? 23.483  62.754  126.576 1.00 54.72  ? 197 GLN A CD  1 
ATOM   301  O  OE1 . GLN A 1 51  ? 24.449  62.522  127.306 1.00 60.40  ? 197 GLN A OE1 1 
ATOM   302  N  NE2 . GLN A 1 51  ? 22.379  62.013  126.590 1.00 51.07  ? 197 GLN A NE2 1 
ATOM   303  N  N   . GLY A 1 52  ? 26.640  67.325  123.900 1.00 30.02  ? 198 GLY A N   1 
ATOM   304  C  CA  . GLY A 1 52  ? 27.666  68.338  124.038 1.00 32.64  ? 198 GLY A CA  1 
ATOM   305  C  C   . GLY A 1 52  ? 29.057  67.776  124.236 1.00 34.66  ? 198 GLY A C   1 
ATOM   306  O  O   . GLY A 1 52  ? 29.997  68.520  124.512 1.00 35.78  ? 198 GLY A O   1 
ATOM   307  N  N   . TRP A 1 53  ? 29.196  66.463  124.103 1.00 30.11  ? 199 TRP A N   1 
ATOM   308  C  CA  . TRP A 1 53  ? 30.506  65.849  124.216 1.00 28.22  ? 199 TRP A CA  1 
ATOM   309  C  C   . TRP A 1 53  ? 31.088  65.601  122.838 1.00 26.93  ? 199 TRP A C   1 
ATOM   310  O  O   . TRP A 1 53  ? 30.365  65.552  121.842 1.00 28.82  ? 199 TRP A O   1 
ATOM   311  C  CB  . TRP A 1 53  ? 30.433  64.534  124.995 1.00 33.54  ? 199 TRP A CB  1 
ATOM   312  C  CG  . TRP A 1 53  ? 30.366  64.712  126.478 1.00 32.87  ? 199 TRP A CG  1 
ATOM   313  C  CD1 . TRP A 1 53  ? 29.383  65.338  127.184 1.00 32.54  ? 199 TRP A CD1 1 
ATOM   314  C  CD2 . TRP A 1 53  ? 31.318  64.245  127.439 1.00 32.09  ? 199 TRP A CD2 1 
ATOM   315  N  NE1 . TRP A 1 53  ? 29.666  65.297  128.529 1.00 34.19  ? 199 TRP A NE1 1 
ATOM   316  C  CE2 . TRP A 1 53  ? 30.850  64.632  128.712 1.00 34.97  ? 199 TRP A CE2 1 
ATOM   317  C  CE3 . TRP A 1 53  ? 32.524  63.547  127.349 1.00 28.59  ? 199 TRP A CE3 1 
ATOM   318  C  CZ2 . TRP A 1 53  ? 31.544  64.337  129.884 1.00 32.10  ? 199 TRP A CZ2 1 
ATOM   319  C  CZ3 . TRP A 1 53  ? 33.211  63.256  128.512 1.00 26.09  ? 199 TRP A CZ3 1 
ATOM   320  C  CH2 . TRP A 1 53  ? 32.720  63.651  129.762 1.00 29.79  ? 199 TRP A CH2 1 
ATOM   321  N  N   . LYS A 1 54  ? 32.403  65.441  122.789 1.00 23.43  ? 200 LYS A N   1 
ATOM   322  C  CA  . LYS A 1 54  ? 33.072  65.113  121.548 1.00 25.72  ? 200 LYS A CA  1 
ATOM   323  C  C   . LYS A 1 54  ? 33.483  63.643  121.515 1.00 27.66  ? 200 LYS A C   1 
ATOM   324  O  O   . LYS A 1 54  ? 33.461  62.962  122.541 1.00 29.37  ? 200 LYS A O   1 
ATOM   325  C  CB  . LYS A 1 54  ? 34.246  66.065  121.303 1.00 28.82  ? 200 LYS A CB  1 
ATOM   326  C  CG  . LYS A 1 54  ? 33.800  67.347  120.594 1.00 35.85  ? 200 LYS A CG  1 
ATOM   327  C  CD  . LYS A 1 54  ? 34.686  68.542  120.892 1.00 43.31  ? 200 LYS A CD  1 
ATOM   328  C  CE  . LYS A 1 54  ? 34.040  69.483  121.906 1.00 47.03  ? 200 LYS A CE  1 
ATOM   329  N  NZ  . LYS A 1 54  ? 32.751  70.057  121.435 1.00 48.01  ? 200 LYS A NZ  1 
ATOM   330  N  N   . TYR A 1 55  ? 33.807  63.146  120.325 1.00 25.45  ? 201 TYR A N   1 
ATOM   331  C  CA  . TYR A 1 55  ? 34.250  61.768  120.177 1.00 27.92  ? 201 TYR A CA  1 
ATOM   332  C  C   . TYR A 1 55  ? 35.427  61.637  119.226 1.00 26.23  ? 201 TYR A C   1 
ATOM   333  O  O   . TYR A 1 55  ? 35.430  62.204  118.137 1.00 30.36  ? 201 TYR A O   1 
ATOM   334  C  CB  . TYR A 1 55  ? 33.120  60.862  119.678 1.00 30.63  ? 201 TYR A CB  1 
ATOM   335  C  CG  . TYR A 1 55  ? 33.618  59.466  119.391 1.00 28.76  ? 201 TYR A CG  1 
ATOM   336  C  CD1 . TYR A 1 55  ? 33.805  58.552  120.423 1.00 30.72  ? 201 TYR A CD1 1 
ATOM   337  C  CD2 . TYR A 1 55  ? 33.937  59.072  118.099 1.00 27.40  ? 201 TYR A CD2 1 
ATOM   338  C  CE1 . TYR A 1 55  ? 34.272  57.277  120.173 1.00 29.45  ? 201 TYR A CE1 1 
ATOM   339  C  CE2 . TYR A 1 55  ? 34.408  57.802  117.837 1.00 28.93  ? 201 TYR A CE2 1 
ATOM   340  C  CZ  . TYR A 1 55  ? 34.570  56.907  118.880 1.00 32.33  ? 201 TYR A CZ  1 
ATOM   341  O  OH  . TYR A 1 55  ? 35.037  55.640  118.630 1.00 36.09  ? 201 TYR A OH  1 
ATOM   342  N  N   . PHE A 1 56  ? 36.417  60.858  119.633 1.00 20.95  ? 202 PHE A N   1 
ATOM   343  C  CA  . PHE A 1 56  ? 37.572  60.619  118.790 1.00 23.93  ? 202 PHE A CA  1 
ATOM   344  C  C   . PHE A 1 56  ? 38.251  59.300  119.137 1.00 26.29  ? 202 PHE A C   1 
ATOM   345  O  O   . PHE A 1 56  ? 38.770  59.135  120.240 1.00 27.43  ? 202 PHE A O   1 
ATOM   346  C  CB  . PHE A 1 56  ? 38.567  61.770  118.918 1.00 27.24  ? 202 PHE A CB  1 
ATOM   347  C  CG  . PHE A 1 56  ? 39.794  61.604  118.073 1.00 29.15  ? 202 PHE A CG  1 
ATOM   348  C  CD1 . PHE A 1 56  ? 39.723  61.732  116.695 1.00 31.09  ? 202 PHE A CD1 1 
ATOM   349  C  CD2 . PHE A 1 56  ? 41.019  61.327  118.656 1.00 28.39  ? 202 PHE A CD2 1 
ATOM   350  C  CE1 . PHE A 1 56  ? 40.847  61.581  115.915 1.00 33.12  ? 202 PHE A CE1 1 
ATOM   351  C  CE2 . PHE A 1 56  ? 42.152  61.174  117.881 1.00 29.10  ? 202 PHE A CE2 1 
ATOM   352  C  CZ  . PHE A 1 56  ? 42.066  61.301  116.509 1.00 33.94  ? 202 PHE A CZ  1 
ATOM   353  N  N   . LYS A 1 57  ? 38.222  58.366  118.188 1.00 29.66  ? 203 LYS A N   1 
ATOM   354  C  CA  . LYS A 1 57  ? 38.962  57.107  118.283 1.00 29.52  ? 203 LYS A CA  1 
ATOM   355  C  C   . LYS A 1 57  ? 38.835  56.403  119.631 1.00 30.73  ? 203 LYS A C   1 
ATOM   356  O  O   . LYS A 1 57  ? 39.822  56.247  120.358 1.00 29.53  ? 203 LYS A O   1 
ATOM   357  C  CB  . LYS A 1 57  ? 40.441  57.333  117.948 1.00 32.71  ? 203 LYS A CB  1 
ATOM   358  C  CG  . LYS A 1 57  ? 40.685  57.814  116.523 1.00 40.44  ? 203 LYS A CG  1 
ATOM   359  C  CD  . LYS A 1 57  ? 42.171  57.861  116.186 1.00 46.10  ? 203 LYS A CD  1 
ATOM   360  C  CE  . LYS A 1 57  ? 42.385  58.114  114.695 1.00 49.03  ? 203 LYS A CE  1 
ATOM   361  N  NZ  . LYS A 1 57  ? 43.830  58.164  114.332 1.00 49.20  ? 203 LYS A NZ  1 
ATOM   362  N  N   . GLY A 1 58  ? 37.618  55.984  119.964 1.00 28.64  ? 204 GLY A N   1 
ATOM   363  C  CA  . GLY A 1 58  ? 37.401  55.168  121.144 1.00 27.88  ? 204 GLY A CA  1 
ATOM   364  C  C   . GLY A 1 58  ? 37.326  55.914  122.463 1.00 31.45  ? 204 GLY A C   1 
ATOM   365  O  O   . GLY A 1 58  ? 37.256  55.289  123.526 1.00 36.07  ? 204 GLY A O   1 
ATOM   366  N  N   . ASN A 1 59  ? 37.336  57.244  122.404 1.00 28.29  ? 205 ASN A N   1 
ATOM   367  C  CA  . ASN A 1 59  ? 37.234  58.062  123.609 1.00 25.74  ? 205 ASN A CA  1 
ATOM   368  C  C   . ASN A 1 59  ? 36.264  59.228  123.457 1.00 26.20  ? 205 ASN A C   1 
ATOM   369  O  O   . ASN A 1 59  ? 36.183  59.845  122.397 1.00 25.83  ? 205 ASN A O   1 
ATOM   370  C  CB  . ASN A 1 59  ? 38.608  58.601  124.010 1.00 23.87  ? 205 ASN A CB  1 
ATOM   371  C  CG  . ASN A 1 59  ? 39.513  57.528  124.579 1.00 25.85  ? 205 ASN A CG  1 
ATOM   372  O  OD1 . ASN A 1 59  ? 39.207  56.926  125.607 1.00 27.40  ? 205 ASN A OD1 1 
ATOM   373  N  ND2 . ASN A 1 59  ? 40.643  57.295  123.921 1.00 24.01  ? 205 ASN A ND2 1 
ATOM   374  N  N   . PHE A 1 60  ? 35.530  59.520  124.524 1.00 24.00  ? 206 PHE A N   1 
ATOM   375  C  CA  . PHE A 1 60  ? 34.729  60.729  124.588 1.00 21.89  ? 206 PHE A CA  1 
ATOM   376  C  C   . PHE A 1 60  ? 35.535  61.828  125.291 1.00 25.51  ? 206 PHE A C   1 
ATOM   377  O  O   . PHE A 1 60  ? 36.326  61.550  126.199 1.00 25.72  ? 206 PHE A O   1 
ATOM   378  C  CB  . PHE A 1 60  ? 33.412  60.477  125.322 1.00 23.36  ? 206 PHE A CB  1 
ATOM   379  C  CG  . PHE A 1 60  ? 32.518  59.471  124.645 1.00 26.53  ? 206 PHE A CG  1 
ATOM   380  C  CD1 . PHE A 1 60  ? 31.881  59.778  123.451 1.00 24.61  ? 206 PHE A CD1 1 
ATOM   381  C  CD2 . PHE A 1 60  ? 32.302  58.224  125.207 1.00 27.39  ? 206 PHE A CD2 1 
ATOM   382  C  CE1 . PHE A 1 60  ? 31.056  58.858  122.827 1.00 26.49  ? 206 PHE A CE1 1 
ATOM   383  C  CE2 . PHE A 1 60  ? 31.473  57.295  124.583 1.00 27.09  ? 206 PHE A CE2 1 
ATOM   384  C  CZ  . PHE A 1 60  ? 30.852  57.614  123.392 1.00 24.95  ? 206 PHE A CZ  1 
ATOM   385  N  N   . TYR A 1 61  ? 35.341  63.068  124.852 1.00 24.35  ? 207 TYR A N   1 
ATOM   386  C  CA  . TYR A 1 61  ? 36.026  64.213  125.434 1.00 26.41  ? 207 TYR A CA  1 
ATOM   387  C  C   . TYR A 1 61  ? 35.035  65.310  125.766 1.00 27.95  ? 207 TYR A C   1 
ATOM   388  O  O   . TYR A 1 61  ? 34.073  65.535  125.034 1.00 28.20  ? 207 TYR A O   1 
ATOM   389  C  CB  . TYR A 1 61  ? 37.055  64.776  124.462 1.00 25.12  ? 207 TYR A CB  1 
ATOM   390  C  CG  . TYR A 1 61  ? 38.142  63.812  124.072 1.00 25.55  ? 207 TYR A CG  1 
ATOM   391  C  CD1 . TYR A 1 61  ? 39.409  63.902  124.639 1.00 23.19  ? 207 TYR A CD1 1 
ATOM   392  C  CD2 . TYR A 1 61  ? 37.905  62.808  123.133 1.00 25.99  ? 207 TYR A CD2 1 
ATOM   393  C  CE1 . TYR A 1 61  ? 40.411  63.028  124.275 1.00 24.91  ? 207 TYR A CE1 1 
ATOM   394  C  CE2 . TYR A 1 61  ? 38.900  61.928  122.767 1.00 24.92  ? 207 TYR A CE2 1 
ATOM   395  C  CZ  . TYR A 1 61  ? 40.151  62.045  123.341 1.00 24.74  ? 207 TYR A CZ  1 
ATOM   396  O  OH  . TYR A 1 61  ? 41.149  61.176  122.987 1.00 24.82  ? 207 TYR A OH  1 
ATOM   397  N  N   . TYR A 1 62  ? 35.282  66.004  126.869 1.00 26.95  ? 208 TYR A N   1 
ATOM   398  C  CA  . TYR A 1 62  ? 34.454  67.135  127.230 1.00 26.44  ? 208 TYR A CA  1 
ATOM   399  C  C   . TYR A 1 62  ? 35.282  68.408  127.280 1.00 28.10  ? 208 TYR A C   1 
ATOM   400  O  O   . TYR A 1 62  ? 36.184  68.549  128.106 1.00 28.93  ? 208 TYR A O   1 
ATOM   401  C  CB  . TYR A 1 62  ? 33.759  66.903  128.566 1.00 26.84  ? 208 TYR A CB  1 
ATOM   402  C  CG  . TYR A 1 62  ? 32.811  68.021  128.925 1.00 28.46  ? 208 TYR A CG  1 
ATOM   403  C  CD1 . TYR A 1 62  ? 31.631  68.206  128.216 1.00 24.39  ? 208 TYR A CD1 1 
ATOM   404  C  CD2 . TYR A 1 62  ? 33.096  68.897  129.967 1.00 29.08  ? 208 TYR A CD2 1 
ATOM   405  C  CE1 . TYR A 1 62  ? 30.761  69.230  128.536 1.00 27.25  ? 208 TYR A CE1 1 
ATOM   406  C  CE2 . TYR A 1 62  ? 32.231  69.925  130.295 1.00 26.09  ? 208 TYR A CE2 1 
ATOM   407  C  CZ  . TYR A 1 62  ? 31.065  70.087  129.576 1.00 28.27  ? 208 TYR A CZ  1 
ATOM   408  O  OH  . TYR A 1 62  ? 30.199  71.106  129.898 1.00 31.17  ? 208 TYR A OH  1 
ATOM   409  N  N   . PHE A 1 63  ? 34.970  69.328  126.378 1.00 28.12  ? 209 PHE A N   1 
ATOM   410  C  CA  . PHE A 1 63  ? 35.607  70.634  126.352 1.00 25.36  ? 209 PHE A CA  1 
ATOM   411  C  C   . PHE A 1 63  ? 34.723  71.600  127.119 1.00 26.34  ? 209 PHE A C   1 
ATOM   412  O  O   . PHE A 1 63  ? 33.645  71.968  126.658 1.00 30.27  ? 209 PHE A O   1 
ATOM   413  C  CB  . PHE A 1 63  ? 35.809  71.096  124.908 1.00 23.42  ? 209 PHE A CB  1 
ATOM   414  C  CG  . PHE A 1 63  ? 36.848  70.306  124.159 1.00 26.58  ? 209 PHE A CG  1 
ATOM   415  C  CD1 . PHE A 1 63  ? 38.072  70.876  123.830 1.00 26.53  ? 209 PHE A CD1 1 
ATOM   416  C  CD2 . PHE A 1 63  ? 36.607  68.989  123.792 1.00 26.87  ? 209 PHE A CD2 1 
ATOM   417  C  CE1 . PHE A 1 63  ? 39.034  70.151  123.140 1.00 25.33  ? 209 PHE A CE1 1 
ATOM   418  C  CE2 . PHE A 1 63  ? 37.564  68.257  123.103 1.00 27.60  ? 209 PHE A CE2 1 
ATOM   419  C  CZ  . PHE A 1 63  ? 38.780  68.840  122.777 1.00 28.34  ? 209 PHE A CZ  1 
ATOM   420  N  N   . SER A 1 64  ? 35.178  71.997  128.301 1.00 24.73  ? 210 SER A N   1 
ATOM   421  C  CA  . SER A 1 64  ? 34.331  72.740  129.224 1.00 27.59  ? 210 SER A CA  1 
ATOM   422  C  C   . SER A 1 64  ? 33.947  74.133  128.716 1.00 25.86  ? 210 SER A C   1 
ATOM   423  O  O   . SER A 1 64  ? 34.598  74.698  127.838 1.00 25.49  ? 210 SER A O   1 
ATOM   424  C  CB  . SER A 1 64  ? 34.994  72.843  130.600 1.00 25.89  ? 210 SER A CB  1 
ATOM   425  O  OG  . SER A 1 64  ? 36.028  73.806  130.574 1.00 23.62  ? 210 SER A OG  1 
ATOM   426  N  N   . LEU A 1 65  ? 32.879  74.671  129.291 1.00 25.46  ? 211 LEU A N   1 
ATOM   427  C  CA  . LEU A 1 65  ? 32.360  75.982  128.932 1.00 29.19  ? 211 LEU A CA  1 
ATOM   428  C  C   . LEU A 1 65  ? 32.659  76.961  130.053 1.00 30.14  ? 211 LEU A C   1 
ATOM   429  O  O   . LEU A 1 65  ? 32.538  78.171  129.890 1.00 30.64  ? 211 LEU A O   1 
ATOM   430  C  CB  . LEU A 1 65  ? 30.847  75.903  128.738 1.00 28.13  ? 211 LEU A CB  1 
ATOM   431  C  CG  . LEU A 1 65  ? 30.371  74.894  127.694 1.00 28.79  ? 211 LEU A CG  1 
ATOM   432  C  CD1 . LEU A 1 65  ? 28.880  74.625  127.851 1.00 33.40  ? 211 LEU A CD1 1 
ATOM   433  C  CD2 . LEU A 1 65  ? 30.703  75.384  126.287 1.00 23.96  ? 211 LEU A CD2 1 
ATOM   434  N  N   . ILE A 1 66  ? 33.044  76.415  131.197 1.00 26.58  ? 212 ILE A N   1 
ATOM   435  C  CA  . ILE A 1 66  ? 33.295  77.208  132.386 1.00 31.42  ? 212 ILE A CA  1 
ATOM   436  C  C   . ILE A 1 66  ? 34.732  76.958  132.849 1.00 31.47  ? 212 ILE A C   1 
ATOM   437  O  O   . ILE A 1 66  ? 35.219  75.829  132.788 1.00 30.68  ? 212 ILE A O   1 
ATOM   438  C  CB  . ILE A 1 66  ? 32.278  76.842  133.480 1.00 37.53  ? 212 ILE A CB  1 
ATOM   439  C  CG1 . ILE A 1 66  ? 32.446  77.725  134.713 1.00 43.11  ? 212 ILE A CG1 1 
ATOM   440  C  CG2 . ILE A 1 66  ? 32.383  75.361  133.841 1.00 39.11  ? 212 ILE A CG2 1 
ATOM   441  C  CD1 . ILE A 1 66  ? 31.507  77.348  135.840 1.00 46.29  ? 212 ILE A CD1 1 
ATOM   442  N  N   . PRO A 1 67  ? 35.434  78.019  133.275 1.00 32.30  ? 213 PRO A N   1 
ATOM   443  C  CA  . PRO A 1 67  ? 36.836  77.872  133.679 1.00 29.23  ? 213 PRO A CA  1 
ATOM   444  C  C   . PRO A 1 67  ? 36.941  77.370  135.111 1.00 29.77  ? 213 PRO A C   1 
ATOM   445  O  O   . PRO A 1 67  ? 36.074  77.684  135.923 1.00 30.66  ? 213 PRO A O   1 
ATOM   446  C  CB  . PRO A 1 67  ? 37.380  79.301  133.599 1.00 30.20  ? 213 PRO A CB  1 
ATOM   447  C  CG  . PRO A 1 67  ? 36.281  80.138  133.008 1.00 35.53  ? 213 PRO A CG  1 
ATOM   448  C  CD  . PRO A 1 67  ? 35.008  79.424  133.297 1.00 35.75  ? 213 PRO A CD  1 
ATOM   449  N  N   . LYS A 1 68  ? 37.982  76.600  135.414 1.00 24.56  ? 214 LYS A N   1 
ATOM   450  C  CA  . LYS A 1 68  ? 38.221  76.153  136.782 1.00 25.25  ? 214 LYS A CA  1 
ATOM   451  C  C   . LYS A 1 68  ? 39.711  76.043  137.080 1.00 24.83  ? 214 LYS A C   1 
ATOM   452  O  O   . LYS A 1 68  ? 40.531  76.037  136.161 1.00 20.29  ? 214 LYS A O   1 
ATOM   453  C  CB  . LYS A 1 68  ? 37.535  74.810  137.044 1.00 26.52  ? 214 LYS A CB  1 
ATOM   454  C  CG  . LYS A 1 68  ? 36.019  74.890  137.057 1.00 30.26  ? 214 LYS A CG  1 
ATOM   455  C  CD  . LYS A 1 68  ? 35.399  73.698  137.760 1.00 36.70  ? 214 LYS A CD  1 
ATOM   456  C  CE  . LYS A 1 68  ? 33.909  73.911  137.949 1.00 42.57  ? 214 LYS A CE  1 
ATOM   457  N  NZ  . LYS A 1 68  ? 33.629  75.261  138.523 1.00 46.89  ? 214 LYS A NZ  1 
ATOM   458  N  N   . THR A 1 69  ? 40.059  75.962  138.363 1.00 26.16  ? 215 THR A N   1 
ATOM   459  C  CA  . THR A 1 69  ? 41.428  75.641  138.744 1.00 24.36  ? 215 THR A CA  1 
ATOM   460  C  C   . THR A 1 69  ? 41.674  74.214  138.303 1.00 24.93  ? 215 THR A C   1 
ATOM   461  O  O   . THR A 1 69  ? 40.732  73.492  137.975 1.00 27.36  ? 215 THR A O   1 
ATOM   462  C  CB  . THR A 1 69  ? 41.676  75.743  140.271 1.00 39.11  ? 215 THR A CB  1 
ATOM   463  O  OG1 . THR A 1 69  ? 40.832  74.815  140.962 1.00 40.88  ? 215 THR A OG1 1 
ATOM   464  C  CG2 . THR A 1 69  ? 41.418  77.166  140.788 1.00 33.70  ? 215 THR A CG2 1 
ATOM   465  N  N   . TRP A 1 70  ? 42.933  73.803  138.290 1.00 27.13  ? 216 TRP A N   1 
ATOM   466  C  CA  . TRP A 1 70  ? 43.275  72.447  137.887 1.00 30.45  ? 216 TRP A CA  1 
ATOM   467  C  C   . TRP A 1 70  ? 42.595  71.401  138.767 1.00 33.99  ? 216 TRP A C   1 
ATOM   468  O  O   . TRP A 1 70  ? 41.957  70.470  138.263 1.00 35.35  ? 216 TRP A O   1 
ATOM   469  C  CB  . TRP A 1 70  ? 44.791  72.240  137.907 1.00 31.86  ? 216 TRP A CB  1 
ATOM   470  C  CG  . TRP A 1 70  ? 45.217  70.975  137.230 1.00 30.84  ? 216 TRP A CG  1 
ATOM   471  C  CD1 . TRP A 1 70  ? 45.610  70.832  135.931 1.00 28.45  ? 216 TRP A CD1 1 
ATOM   472  C  CD2 . TRP A 1 70  ? 45.284  69.671  137.816 1.00 28.33  ? 216 TRP A CD2 1 
ATOM   473  N  NE1 . TRP A 1 70  ? 45.923  69.519  135.673 1.00 26.27  ? 216 TRP A NE1 1 
ATOM   474  C  CE2 . TRP A 1 70  ? 45.730  68.785  136.814 1.00 30.94  ? 216 TRP A CE2 1 
ATOM   475  C  CE3 . TRP A 1 70  ? 45.012  69.166  139.092 1.00 29.62  ? 216 TRP A CE3 1 
ATOM   476  C  CZ2 . TRP A 1 70  ? 45.915  67.417  137.050 1.00 29.91  ? 216 TRP A CZ2 1 
ATOM   477  C  CZ3 . TRP A 1 70  ? 45.195  67.807  139.323 1.00 29.30  ? 216 TRP A CZ3 1 
ATOM   478  C  CH2 . TRP A 1 70  ? 45.641  66.952  138.306 1.00 27.67  ? 216 TRP A CH2 1 
ATOM   479  N  N   . TYR A 1 71  ? 42.726  71.543  140.079 1.00 33.70  ? 217 TYR A N   1 
ATOM   480  C  CA  A TYR A 1 71  ? 42.163  70.558  140.992 0.50 34.92  ? 217 TYR A CA  1 
ATOM   481  C  CA  B TYR A 1 71  ? 42.155  70.559  140.993 0.50 34.92  ? 217 TYR A CA  1 
ATOM   482  C  C   . TYR A 1 71  ? 40.642  70.499  140.885 1.00 34.16  ? 217 TYR A C   1 
ATOM   483  O  O   . TYR A 1 71  ? 40.047  69.426  140.970 1.00 38.09  ? 217 TYR A O   1 
ATOM   484  C  CB  A TYR A 1 71  ? 42.611  70.841  142.429 0.50 36.25  ? 217 TYR A CB  1 
ATOM   485  C  CB  B TYR A 1 71  ? 42.543  70.848  142.441 0.50 36.84  ? 217 TYR A CB  1 
ATOM   486  C  CG  A TYR A 1 71  ? 44.101  70.656  142.631 0.50 36.89  ? 217 TYR A CG  1 
ATOM   487  C  CG  B TYR A 1 71  ? 41.797  69.976  143.429 0.50 40.21  ? 217 TYR A CG  1 
ATOM   488  C  CD1 A TYR A 1 71  ? 44.638  69.394  142.862 0.50 40.26  ? 217 TYR A CD1 1 
ATOM   489  C  CD1 B TYR A 1 71  ? 42.167  68.654  143.635 0.50 42.29  ? 217 TYR A CD1 1 
ATOM   490  C  CD2 A TYR A 1 71  ? 44.970  71.735  142.576 0.50 33.83  ? 217 TYR A CD2 1 
ATOM   491  C  CD2 B TYR A 1 71  ? 40.716  70.471  144.143 0.50 41.73  ? 217 TYR A CD2 1 
ATOM   492  C  CE1 A TYR A 1 71  ? 45.997  69.214  143.036 0.50 40.53  ? 217 TYR A CE1 1 
ATOM   493  C  CE1 B TYR A 1 71  ? 41.486  67.853  144.529 0.50 44.15  ? 217 TYR A CE1 1 
ATOM   494  C  CE2 A TYR A 1 71  ? 46.330  71.567  142.749 0.50 35.22  ? 217 TYR A CE2 1 
ATOM   495  C  CE2 B TYR A 1 71  ? 40.033  69.678  145.042 0.50 42.86  ? 217 TYR A CE2 1 
ATOM   496  C  CZ  A TYR A 1 71  ? 46.839  70.305  142.978 0.50 39.73  ? 217 TYR A CZ  1 
ATOM   497  C  CZ  B TYR A 1 71  ? 40.420  68.371  145.230 0.50 45.65  ? 217 TYR A CZ  1 
ATOM   498  O  OH  A TYR A 1 71  ? 48.193  70.130  143.154 0.50 42.25  ? 217 TYR A OH  1 
ATOM   499  O  OH  B TYR A 1 71  ? 39.742  67.576  146.126 0.50 50.57  ? 217 TYR A OH  1 
ATOM   500  N  N   . SER A 1 72  ? 40.022  71.654  140.696 1.00 32.50  ? 218 SER A N   1 
ATOM   501  C  CA  . SER A 1 72  ? 38.573  71.720  140.628 1.00 32.62  ? 218 SER A CA  1 
ATOM   502  C  C   . SER A 1 72  ? 38.090  71.216  139.277 1.00 32.99  ? 218 SER A C   1 
ATOM   503  O  O   . SER A 1 72  ? 36.984  70.685  139.153 1.00 34.41  ? 218 SER A O   1 
ATOM   504  C  CB  . SER A 1 72  ? 38.100  73.146  140.872 1.00 36.98  ? 218 SER A CB  1 
ATOM   505  O  OG  . SER A 1 72  ? 36.692  73.201  140.988 1.00 42.88  ? 218 SER A OG  1 
ATOM   506  N  N   . ALA A 1 73  ? 38.932  71.376  138.263 1.00 29.13  ? 219 ALA A N   1 
ATOM   507  C  CA  . ALA A 1 73  ? 38.615  70.861  136.945 1.00 29.59  ? 219 ALA A CA  1 
ATOM   508  C  C   . ALA A 1 73  ? 38.579  69.341  137.000 1.00 31.71  ? 219 ALA A C   1 
ATOM   509  O  O   . ALA A 1 73  ? 37.611  68.720  136.558 1.00 31.03  ? 219 ALA A O   1 
ATOM   510  C  CB  . ALA A 1 73  ? 39.627  71.345  135.923 1.00 27.01  ? 219 ALA A CB  1 
ATOM   511  N  N   . GLU A 1 74  ? 39.632  68.746  137.555 1.00 31.86  ? 220 GLU A N   1 
ATOM   512  C  CA  . GLU A 1 74  ? 39.690  67.294  137.712 1.00 31.63  ? 220 GLU A CA  1 
ATOM   513  C  C   . GLU A 1 74  ? 38.473  66.794  138.481 1.00 35.01  ? 220 GLU A C   1 
ATOM   514  O  O   . GLU A 1 74  ? 37.881  65.775  138.124 1.00 37.52  ? 220 GLU A O   1 
ATOM   515  C  CB  . GLU A 1 74  ? 40.984  66.867  138.414 1.00 30.98  ? 220 GLU A CB  1 
ATOM   516  C  CG  . GLU A 1 74  ? 40.982  65.440  138.945 1.00 31.85  ? 220 GLU A CG  1 
ATOM   517  C  CD  . GLU A 1 74  ? 40.955  64.379  137.843 1.00 35.04  ? 220 GLU A CD  1 
ATOM   518  O  OE1 . GLU A 1 74  ? 41.070  64.737  136.653 1.00 34.78  ? 220 GLU A OE1 1 
ATOM   519  O  OE2 . GLU A 1 74  ? 40.821  63.179  138.172 1.00 34.85  ? 220 GLU A OE2 1 
ATOM   520  N  N   . GLN A 1 75  ? 38.097  67.520  139.530 1.00 33.14  ? 221 GLN A N   1 
ATOM   521  C  CA  . GLN A 1 75  ? 36.949  67.147  140.349 1.00 35.71  ? 221 GLN A CA  1 
ATOM   522  C  C   . GLN A 1 75  ? 35.677  67.066  139.524 1.00 34.63  ? 221 GLN A C   1 
ATOM   523  O  O   . GLN A 1 75  ? 34.892  66.131  139.662 1.00 31.97  ? 221 GLN A O   1 
ATOM   524  C  CB  . GLN A 1 75  ? 36.753  68.142  141.491 1.00 42.68  ? 221 GLN A CB  1 
ATOM   525  C  CG  . GLN A 1 75  ? 37.584  67.847  142.722 1.00 51.85  ? 221 GLN A CG  1 
ATOM   526  C  CD  . GLN A 1 75  ? 37.388  68.886  143.809 1.00 61.08  ? 221 GLN A CD  1 
ATOM   527  O  OE1 . GLN A 1 75  ? 37.347  70.086  143.535 1.00 64.16  ? 221 GLN A OE1 1 
ATOM   528  N  NE2 . GLN A 1 75  ? 37.276  68.431  145.053 1.00 64.81  ? 221 GLN A NE2 1 
ATOM   529  N  N   . PHE A 1 76  ? 35.472  68.062  138.673 1.00 37.95  ? 222 PHE A N   1 
ATOM   530  C  CA  . PHE A 1 76  ? 34.311  68.084  137.803 1.00 39.78  ? 222 PHE A CA  1 
ATOM   531  C  C   . PHE A 1 76  ? 34.298  66.857  136.901 1.00 38.27  ? 222 PHE A C   1 
ATOM   532  O  O   . PHE A 1 76  ? 33.275  66.187  136.758 1.00 40.66  ? 222 PHE A O   1 
ATOM   533  C  CB  . PHE A 1 76  ? 34.305  69.355  136.960 1.00 40.93  ? 222 PHE A CB  1 
ATOM   534  C  CG  . PHE A 1 76  ? 33.239  69.373  135.912 1.00 43.26  ? 222 PHE A CG  1 
ATOM   535  C  CD1 . PHE A 1 76  ? 31.966  69.824  136.209 1.00 48.12  ? 222 PHE A CD1 1 
ATOM   536  C  CD2 . PHE A 1 76  ? 33.507  68.931  134.629 1.00 44.25  ? 222 PHE A CD2 1 
ATOM   537  C  CE1 . PHE A 1 76  ? 30.979  69.840  135.242 1.00 52.02  ? 222 PHE A CE1 1 
ATOM   538  C  CE2 . PHE A 1 76  ? 32.526  68.943  133.657 1.00 46.50  ? 222 PHE A CE2 1 
ATOM   539  C  CZ  . PHE A 1 76  ? 31.260  69.397  133.963 1.00 50.26  ? 222 PHE A CZ  1 
ATOM   540  N  N   . CYS A 1 77  ? 35.444  66.571  136.293 1.00 35.71  ? 223 CYS A N   1 
ATOM   541  C  CA  . CYS A 1 77  ? 35.580  65.416  135.413 1.00 31.64  ? 223 CYS A CA  1 
ATOM   542  C  C   . CYS A 1 77  ? 35.149  64.147  136.132 1.00 31.07  ? 223 CYS A C   1 
ATOM   543  O  O   . CYS A 1 77  ? 34.306  63.395  135.641 1.00 29.94  ? 223 CYS A O   1 
ATOM   544  C  CB  . CYS A 1 77  ? 37.021  65.281  134.917 1.00 29.26  ? 223 CYS A CB  1 
ATOM   545  S  SG  . CYS A 1 77  ? 37.526  66.547  133.728 1.00 31.77  ? 223 CYS A SG  1 
ATOM   546  N  N   . VAL A 1 78  ? 35.725  63.918  137.306 1.00 32.21  ? 224 VAL A N   1 
ATOM   547  C  CA  . VAL A 1 78  ? 35.379  62.751  138.101 1.00 32.65  ? 224 VAL A CA  1 
ATOM   548  C  C   . VAL A 1 78  ? 33.866  62.640  138.280 1.00 37.94  ? 224 VAL A C   1 
ATOM   549  O  O   . VAL A 1 78  ? 33.308  61.544  138.218 1.00 38.86  ? 224 VAL A O   1 
ATOM   550  C  CB  . VAL A 1 78  ? 36.089  62.769  139.460 1.00 29.58  ? 224 VAL A CB  1 
ATOM   551  C  CG1 . VAL A 1 78  ? 35.542  61.674  140.356 1.00 27.07  ? 224 VAL A CG1 1 
ATOM   552  C  CG2 . VAL A 1 78  ? 37.590  62.604  139.257 1.00 29.10  ? 224 VAL A CG2 1 
ATOM   553  N  N   . SER A 1 79  ? 33.203  63.777  138.471 1.00 38.35  ? 225 SER A N   1 
ATOM   554  C  CA  . SER A 1 79  ? 31.753  63.794  138.638 1.00 38.56  ? 225 SER A CA  1 
ATOM   555  C  C   . SER A 1 79  ? 31.039  63.360  137.356 1.00 36.23  ? 225 SER A C   1 
ATOM   556  O  O   . SER A 1 79  ? 29.899  62.906  137.395 1.00 40.75  ? 225 SER A O   1 
ATOM   557  C  CB  . SER A 1 79  ? 31.273  65.188  139.045 1.00 37.17  ? 225 SER A CB  1 
ATOM   558  O  OG  . SER A 1 79  ? 31.047  66.001  137.907 1.00 35.07  ? 225 SER A OG  1 
ATOM   559  N  N   . ARG A 1 80  ? 31.711  63.514  136.222 1.00 27.15  ? 226 ARG A N   1 
ATOM   560  C  CA  . ARG A 1 80  ? 31.161  63.078  134.949 1.00 29.73  ? 226 ARG A CA  1 
ATOM   561  C  C   . ARG A 1 80  ? 31.849  61.781  134.522 1.00 31.93  ? 226 ARG A C   1 
ATOM   562  O  O   . ARG A 1 80  ? 32.019  61.506  133.332 1.00 31.00  ? 226 ARG A O   1 
ATOM   563  C  CB  . ARG A 1 80  ? 31.333  64.168  133.891 1.00 32.26  ? 226 ARG A CB  1 
ATOM   564  C  CG  . ARG A 1 80  ? 30.844  65.554  134.329 1.00 36.97  ? 226 ARG A CG  1 
ATOM   565  C  CD  . ARG A 1 80  ? 29.323  65.637  134.402 1.00 42.73  ? 226 ARG A CD  1 
ATOM   566  N  NE  . ARG A 1 80  ? 28.820  66.838  133.735 1.00 47.37  ? 226 ARG A NE  1 
ATOM   567  C  CZ  . ARG A 1 80  ? 28.399  67.928  134.367 1.00 50.91  ? 226 ARG A CZ  1 
ATOM   568  N  NH1 . ARG A 1 80  ? 28.403  67.974  135.693 1.00 57.36  ? 226 ARG A NH1 1 
ATOM   569  N  NH2 . ARG A 1 80  ? 27.969  68.971  133.674 1.00 47.73  ? 226 ARG A NH2 1 
ATOM   570  N  N   . ASN A 1 81  ? 32.255  60.999  135.517 1.00 30.72  ? 227 ASN A N   1 
ATOM   571  C  CA  . ASN A 1 81  ? 32.883  59.699  135.301 1.00 30.61  ? 227 ASN A CA  1 
ATOM   572  C  C   . ASN A 1 81  ? 34.076  59.722  134.341 1.00 28.33  ? 227 ASN A C   1 
ATOM   573  O  O   . ASN A 1 81  ? 34.224  58.832  133.510 1.00 33.07  ? 227 ASN A O   1 
ATOM   574  C  CB  . ASN A 1 81  ? 31.838  58.677  134.838 1.00 37.33  ? 227 ASN A CB  1 
ATOM   575  C  CG  . ASN A 1 81  ? 32.387  57.262  134.781 1.00 41.80  ? 227 ASN A CG  1 
ATOM   576  O  OD1 . ASN A 1 81  ? 33.156  56.840  135.651 1.00 42.19  ? 227 ASN A OD1 1 
ATOM   577  N  ND2 . ASN A 1 81  ? 31.990  56.518  133.750 1.00 41.00  ? 227 ASN A ND2 1 
ATOM   578  N  N   . SER A 1 82  ? 34.928  60.735  134.459 1.00 21.55  ? 228 SER A N   1 
ATOM   579  C  CA  . SER A 1 82  ? 36.129  60.803  133.632 1.00 20.78  ? 228 SER A CA  1 
ATOM   580  C  C   . SER A 1 82  ? 37.298  61.455  134.380 1.00 25.25  ? 228 SER A C   1 
ATOM   581  O  O   . SER A 1 82  ? 37.275  61.561  135.602 1.00 25.77  ? 228 SER A O   1 
ATOM   582  C  CB  . SER A 1 82  ? 35.841  61.533  132.316 1.00 27.59  ? 228 SER A CB  1 
ATOM   583  O  OG  . SER A 1 82  ? 34.880  62.558  132.497 1.00 29.45  ? 228 SER A OG  1 
ATOM   584  N  N   . HIS A 1 83  ? 38.321  61.867  133.637 1.00 25.76  ? 229 HIS A N   1 
ATOM   585  C  CA  . HIS A 1 83  ? 39.485  62.542  134.202 1.00 27.68  ? 229 HIS A CA  1 
ATOM   586  C  C   . HIS A 1 83  ? 39.937  63.623  133.237 1.00 27.64  ? 229 HIS A C   1 
ATOM   587  O  O   . HIS A 1 83  ? 39.597  63.587  132.052 1.00 31.89  ? 229 HIS A O   1 
ATOM   588  C  CB  . HIS A 1 83  ? 40.650  61.566  134.383 1.00 29.89  ? 229 HIS A CB  1 
ATOM   589  C  CG  . HIS A 1 83  ? 40.401  60.495  135.397 1.00 32.80  ? 229 HIS A CG  1 
ATOM   590  N  ND1 . HIS A 1 83  ? 40.527  60.712  136.752 1.00 30.39  ? 229 HIS A ND1 1 
ATOM   591  C  CD2 . HIS A 1 83  ? 40.052  59.195  135.253 1.00 33.71  ? 229 HIS A CD2 1 
ATOM   592  C  CE1 . HIS A 1 83  ? 40.254  59.593  137.400 1.00 35.17  ? 229 HIS A CE1 1 
ATOM   593  N  NE2 . HIS A 1 83  ? 39.966  58.657  136.513 1.00 34.58  ? 229 HIS A NE2 1 
ATOM   594  N  N   . LEU A 1 84  ? 40.714  64.578  133.732 1.00 25.93  ? 230 LEU A N   1 
ATOM   595  C  CA  . LEU A 1 84  ? 41.422  65.473  132.834 1.00 25.03  ? 230 LEU A CA  1 
ATOM   596  C  C   . LEU A 1 84  ? 42.152  64.595  131.825 1.00 28.25  ? 230 LEU A C   1 
ATOM   597  O  O   . LEU A 1 84  ? 42.764  63.582  132.194 1.00 28.05  ? 230 LEU A O   1 
ATOM   598  C  CB  . LEU A 1 84  ? 42.397  66.356  133.601 1.00 23.88  ? 230 LEU A CB  1 
ATOM   599  C  CG  . LEU A 1 84  ? 41.750  67.546  134.313 1.00 25.45  ? 230 LEU A CG  1 
ATOM   600  C  CD1 . LEU A 1 84  ? 42.769  68.294  135.179 1.00 23.74  ? 230 LEU A CD1 1 
ATOM   601  C  CD2 . LEU A 1 84  ? 41.088  68.479  133.305 1.00 22.80  ? 230 LEU A CD2 1 
ATOM   602  N  N   . THR A 1 85  ? 42.070  64.966  130.552 1.00 24.70  ? 231 THR A N   1 
ATOM   603  C  CA  . THR A 1 85  ? 42.562  64.103  129.488 1.00 20.01  ? 231 THR A CA  1 
ATOM   604  C  C   . THR A 1 85  ? 44.071  63.887  129.522 1.00 20.26  ? 231 THR A C   1 
ATOM   605  O  O   . THR A 1 85  ? 44.847  64.786  129.853 1.00 23.59  ? 231 THR A O   1 
ATOM   606  C  CB  . THR A 1 85  ? 42.167  64.618  128.087 1.00 20.68  ? 231 THR A CB  1 
ATOM   607  O  OG1 . THR A 1 85  ? 42.437  63.599  127.118 1.00 26.31  ? 231 THR A OG1 1 
ATOM   608  C  CG2 . THR A 1 85  ? 42.958  65.845  127.731 1.00 20.07  ? 231 THR A CG2 1 
ATOM   609  N  N   . SER A 1 86  ? 44.472  62.674  129.170 1.00 20.89  ? 232 SER A N   1 
ATOM   610  C  CA  . SER A 1 86  ? 45.870  62.355  128.948 1.00 23.19  ? 232 SER A CA  1 
ATOM   611  C  C   . SER A 1 86  ? 46.131  62.454  127.452 1.00 24.00  ? 232 SER A C   1 
ATOM   612  O  O   . SER A 1 86  ? 45.191  62.520  126.662 1.00 20.72  ? 232 SER A O   1 
ATOM   613  C  CB  . SER A 1 86  ? 46.154  60.936  129.435 1.00 24.37  ? 232 SER A CB  1 
ATOM   614  O  OG  . SER A 1 86  ? 45.233  60.023  128.853 1.00 25.04  ? 232 SER A OG  1 
ATOM   615  N  N   . VAL A 1 87  ? 47.401  62.473  127.063 1.00 25.02  ? 233 VAL A N   1 
ATOM   616  C  CA  . VAL A 1 87  ? 47.757  62.430  125.650 1.00 24.66  ? 233 VAL A CA  1 
ATOM   617  C  C   . VAL A 1 87  ? 48.618  61.202  125.367 1.00 25.70  ? 233 VAL A C   1 
ATOM   618  O  O   . VAL A 1 87  ? 49.751  61.108  125.839 1.00 31.64  ? 233 VAL A O   1 
ATOM   619  C  CB  . VAL A 1 87  ? 48.504  63.698  125.224 1.00 25.87  ? 233 VAL A CB  1 
ATOM   620  C  CG1 . VAL A 1 87  ? 48.734  63.694  123.721 1.00 26.62  ? 233 VAL A CG1 1 
ATOM   621  C  CG2 . VAL A 1 87  ? 47.714  64.920  125.639 1.00 24.82  ? 233 VAL A CG2 1 
ATOM   622  N  N   . THR A 1 88  ? 48.078  60.262  124.597 1.00 25.72  ? 234 THR A N   1 
ATOM   623  C  CA  . THR A 1 88  ? 48.727  58.965  124.412 1.00 31.52  ? 234 THR A CA  1 
ATOM   624  C  C   . THR A 1 88  ? 49.367  58.787  123.041 1.00 33.96  ? 234 THR A C   1 
ATOM   625  O  O   . THR A 1 88  ? 50.120  57.840  122.823 1.00 35.59  ? 234 THR A O   1 
ATOM   626  C  CB  . THR A 1 88  ? 47.750  57.797  124.678 1.00 35.03  ? 234 THR A CB  1 
ATOM   627  O  OG1 . THR A 1 88  ? 46.645  57.862  123.764 1.00 38.70  ? 234 THR A OG1 1 
ATOM   628  C  CG2 . THR A 1 88  ? 47.226  57.862  126.105 1.00 34.26  ? 234 THR A CG2 1 
ATOM   629  N  N   . SER A 1 89  ? 49.083  59.705  122.123 1.00 33.30  ? 235 SER A N   1 
ATOM   630  C  CA  . SER A 1 89  ? 49.626  59.615  120.773 1.00 31.37  ? 235 SER A CA  1 
ATOM   631  C  C   . SER A 1 89  ? 49.642  60.974  120.081 1.00 28.60  ? 235 SER A C   1 
ATOM   632  O  O   . SER A 1 89  ? 48.998  61.919  120.533 1.00 21.66  ? 235 SER A O   1 
ATOM   633  C  CB  . SER A 1 89  ? 48.784  58.647  119.946 1.00 32.89  ? 235 SER A CB  1 
ATOM   634  O  OG  . SER A 1 89  ? 47.521  59.225  119.665 1.00 32.20  ? 235 SER A OG  1 
ATOM   635  N  N   . GLU A 1 90  ? 50.369  61.058  118.973 1.00 34.17  ? 236 GLU A N   1 
ATOM   636  C  CA  . GLU A 1 90  ? 50.374  62.266  118.161 1.00 38.34  ? 236 GLU A CA  1 
ATOM   637  C  C   . GLU A 1 90  ? 48.984  62.555  117.639 1.00 35.65  ? 236 GLU A C   1 
ATOM   638  O  O   . GLU A 1 90  ? 48.544  63.703  117.633 1.00 31.42  ? 236 GLU A O   1 
ATOM   639  C  CB  . GLU A 1 90  ? 51.323  62.128  116.975 1.00 44.41  ? 236 GLU A CB  1 
ATOM   640  C  CG  . GLU A 1 90  ? 52.776  62.322  117.316 1.00 51.64  ? 236 GLU A CG  1 
ATOM   641  C  CD  . GLU A 1 90  ? 53.541  62.969  116.182 1.00 59.47  ? 236 GLU A CD  1 
ATOM   642  O  OE1 . GLU A 1 90  ? 52.967  63.097  115.076 1.00 61.94  ? 236 GLU A OE1 1 
ATOM   643  O  OE2 . GLU A 1 90  ? 54.710  63.358  116.400 1.00 61.53  ? 236 GLU A OE2 1 
ATOM   644  N  N   . SER A 1 91  ? 48.294  61.511  117.189 1.00 35.02  ? 237 SER A N   1 
ATOM   645  C  CA  . SER A 1 91  ? 46.958  61.697  116.637 1.00 33.65  ? 237 SER A CA  1 
ATOM   646  C  C   . SER A 1 91  ? 46.032  62.344  117.666 1.00 31.20  ? 237 SER A C   1 
ATOM   647  O  O   . SER A 1 91  ? 45.268  63.252  117.335 1.00 31.88  ? 237 SER A O   1 
ATOM   648  C  CB  . SER A 1 91  ? 46.375  60.380  116.095 1.00 32.44  ? 237 SER A CB  1 
ATOM   649  O  OG  . SER A 1 91  ? 46.183  59.427  117.128 1.00 42.84  ? 237 SER A OG  1 
ATOM   650  N  N   . GLU A 1 92  ? 46.110  61.885  118.912 1.00 28.01  ? 238 GLU A N   1 
ATOM   651  C  CA  . GLU A 1 92  ? 45.303  62.466  119.980 1.00 26.75  ? 238 GLU A CA  1 
ATOM   652  C  C   . GLU A 1 92  ? 45.726  63.910  120.315 1.00 27.52  ? 238 GLU A C   1 
ATOM   653  O  O   . GLU A 1 92  ? 44.882  64.779  120.529 1.00 29.44  ? 238 GLU A O   1 
ATOM   654  C  CB  . GLU A 1 92  ? 45.329  61.582  121.230 1.00 25.53  ? 238 GLU A CB  1 
ATOM   655  C  CG  . GLU A 1 92  ? 44.485  62.127  122.366 1.00 26.56  ? 238 GLU A CG  1 
ATOM   656  C  CD  . GLU A 1 92  ? 44.404  61.193  123.555 1.00 29.99  ? 238 GLU A CD  1 
ATOM   657  O  OE1 . GLU A 1 92  ? 45.414  60.538  123.887 1.00 31.74  ? 238 GLU A OE1 1 
ATOM   658  O  OE2 . GLU A 1 92  ? 43.324  61.130  124.171 1.00 31.19  ? 238 GLU A OE2 1 
ATOM   659  N  N   . GLN A 1 93  ? 47.029  64.162  120.350 1.00 23.00  ? 239 GLN A N   1 
ATOM   660  C  CA  . GLN A 1 93  ? 47.531  65.513  120.544 1.00 24.86  ? 239 GLN A CA  1 
ATOM   661  C  C   . GLN A 1 93  ? 46.969  66.465  119.478 1.00 30.97  ? 239 GLN A C   1 
ATOM   662  O  O   . GLN A 1 93  ? 46.495  67.563  119.788 1.00 28.70  ? 239 GLN A O   1 
ATOM   663  C  CB  . GLN A 1 93  ? 49.056  65.521  120.486 1.00 24.11  ? 239 GLN A CB  1 
ATOM   664  C  CG  . GLN A 1 93  ? 49.666  66.896  120.664 1.00 30.69  ? 239 GLN A CG  1 
ATOM   665  C  CD  . GLN A 1 93  ? 49.644  67.370  122.110 1.00 33.11  ? 239 GLN A CD  1 
ATOM   666  O  OE1 . GLN A 1 93  ? 48.895  66.852  122.936 1.00 33.72  ? 239 GLN A OE1 1 
ATOM   667  N  NE2 . GLN A 1 93  ? 50.474  68.359  122.419 1.00 31.68  ? 239 GLN A NE2 1 
ATOM   668  N  N   . GLU A 1 94  ? 47.029  66.034  118.223 1.00 29.72  ? 240 GLU A N   1 
ATOM   669  C  CA  . GLU A 1 94  ? 46.526  66.831  117.115 1.00 33.33  ? 240 GLU A CA  1 
ATOM   670  C  C   . GLU A 1 94  ? 45.020  67.062  117.221 1.00 30.33  ? 240 GLU A C   1 
ATOM   671  O  O   . GLU A 1 94  ? 44.540  68.170  116.999 1.00 29.32  ? 240 GLU A O   1 
ATOM   672  C  CB  . GLU A 1 94  ? 46.862  66.169  115.779 1.00 39.10  ? 240 GLU A CB  1 
ATOM   673  C  CG  . GLU A 1 94  ? 46.160  66.810  114.596 1.00 46.25  ? 240 GLU A CG  1 
ATOM   674  C  CD  . GLU A 1 94  ? 46.627  66.255  113.267 1.00 53.59  ? 240 GLU A CD  1 
ATOM   675  O  OE1 . GLU A 1 94  ? 47.736  65.683  113.220 1.00 57.14  ? 240 GLU A OE1 1 
ATOM   676  O  OE2 . GLU A 1 94  ? 45.887  66.398  112.269 1.00 54.97  ? 240 GLU A OE2 1 
ATOM   677  N  N   . PHE A 1 95  ? 44.274  66.017  117.557 1.00 26.34  ? 241 PHE A N   1 
ATOM   678  C  CA  . PHE A 1 95  ? 42.840  66.172  117.768 1.00 22.39  ? 241 PHE A CA  1 
ATOM   679  C  C   . PHE A 1 95  ? 42.547  67.181  118.870 1.00 24.68  ? 241 PHE A C   1 
ATOM   680  O  O   . PHE A 1 95  ? 41.618  67.982  118.768 1.00 28.01  ? 241 PHE A O   1 
ATOM   681  C  CB  . PHE A 1 95  ? 42.195  64.843  118.143 1.00 19.26  ? 241 PHE A CB  1 
ATOM   682  C  CG  . PHE A 1 95  ? 40.884  65.001  118.849 1.00 23.32  ? 241 PHE A CG  1 
ATOM   683  C  CD1 . PHE A 1 95  ? 39.741  65.355  118.149 1.00 25.99  ? 241 PHE A CD1 1 
ATOM   684  C  CD2 . PHE A 1 95  ? 40.795  64.824  120.214 1.00 23.64  ? 241 PHE A CD2 1 
ATOM   685  C  CE1 . PHE A 1 95  ? 38.533  65.517  118.800 1.00 24.27  ? 241 PHE A CE1 1 
ATOM   686  C  CE2 . PHE A 1 95  ? 39.588  64.980  120.870 1.00 24.10  ? 241 PHE A CE2 1 
ATOM   687  C  CZ  . PHE A 1 95  ? 38.456  65.332  120.160 1.00 22.81  ? 241 PHE A CZ  1 
ATOM   688  N  N   . LEU A 1 96  ? 43.342  67.124  119.930 1.00 24.78  ? 242 LEU A N   1 
ATOM   689  C  CA  . LEU A 1 96  ? 43.156  67.999  121.078 1.00 25.33  ? 242 LEU A CA  1 
ATOM   690  C  C   . LEU A 1 96  ? 43.462  69.468  120.769 1.00 27.17  ? 242 LEU A C   1 
ATOM   691  O  O   . LEU A 1 96  ? 42.655  70.347  121.075 1.00 23.31  ? 242 LEU A O   1 
ATOM   692  C  CB  . LEU A 1 96  ? 44.002  67.517  122.259 1.00 21.30  ? 242 LEU A CB  1 
ATOM   693  C  CG  . LEU A 1 96  ? 43.531  66.237  122.945 1.00 19.82  ? 242 LEU A CG  1 
ATOM   694  C  CD1 . LEU A 1 96  ? 44.548  65.784  123.974 1.00 23.90  ? 242 LEU A CD1 1 
ATOM   695  C  CD2 . LEU A 1 96  ? 42.174  66.452  123.587 1.00 20.22  ? 242 LEU A CD2 1 
ATOM   696  N  N   . TYR A 1 97  ? 44.620  69.742  120.174 1.00 27.58  ? 243 TYR A N   1 
ATOM   697  C  CA  . TYR A 1 97  ? 44.981  71.132  119.917 1.00 26.76  ? 243 TYR A CA  1 
ATOM   698  C  C   . TYR A 1 97  ? 44.096  71.733  118.833 1.00 30.11  ? 243 TYR A C   1 
ATOM   699  O  O   . TYR A 1 97  ? 43.654  72.866  118.957 1.00 33.08  ? 243 TYR A O   1 
ATOM   700  C  CB  . TYR A 1 97  ? 46.483  71.318  119.628 1.00 25.67  ? 243 TYR A CB  1 
ATOM   701  C  CG  . TYR A 1 97  ? 46.934  71.164  118.181 1.00 27.72  ? 243 TYR A CG  1 
ATOM   702  C  CD1 . TYR A 1 97  ? 46.696  72.165  117.238 1.00 27.49  ? 243 TYR A CD1 1 
ATOM   703  C  CD2 . TYR A 1 97  ? 47.654  70.045  117.774 1.00 29.64  ? 243 TYR A CD2 1 
ATOM   704  C  CE1 . TYR A 1 97  ? 47.135  72.036  115.928 1.00 28.37  ? 243 TYR A CE1 1 
ATOM   705  C  CE2 . TYR A 1 97  ? 48.091  69.906  116.460 1.00 32.30  ? 243 TYR A CE2 1 
ATOM   706  C  CZ  . TYR A 1 97  ? 47.827  70.902  115.540 1.00 33.59  ? 243 TYR A CZ  1 
ATOM   707  O  OH  . TYR A 1 97  ? 48.259  70.764  114.233 1.00 34.29  ? 243 TYR A OH  1 
ATOM   708  N  N   . LYS A 1 98  ? 43.807  70.967  117.789 1.00 29.96  ? 244 LYS A N   1 
ATOM   709  C  CA  . LYS A 1 98  ? 42.925  71.465  116.739 1.00 29.47  ? 244 LYS A CA  1 
ATOM   710  C  C   . LYS A 1 98  ? 41.517  71.720  117.262 1.00 28.18  ? 244 LYS A C   1 
ATOM   711  O  O   . LYS A 1 98  ? 40.880  72.705  116.888 1.00 30.48  ? 244 LYS A O   1 
ATOM   712  C  CB  . LYS A 1 98  ? 42.896  70.524  115.527 1.00 28.62  ? 244 LYS A CB  1 
ATOM   713  C  CG  . LYS A 1 98  ? 44.134  70.648  114.652 1.00 35.13  ? 244 LYS A CG  1 
ATOM   714  C  CD  . LYS A 1 98  ? 44.057  69.775  113.410 1.00 39.18  ? 244 LYS A CD  1 
ATOM   715  C  CE  . LYS A 1 98  ? 45.193  70.102  112.446 1.00 41.49  ? 244 LYS A CE  1 
ATOM   716  N  NZ  . LYS A 1 98  ? 45.257  69.139  111.302 1.00 43.59  ? 244 LYS A NZ  1 
ATOM   717  N  N   . THR A 1 99  ? 41.025  70.845  118.131 1.00 25.32  ? 245 THR A N   1 
ATOM   718  C  CA  . THR A 1 99  ? 39.670  71.019  118.640 1.00 25.76  ? 245 THR A CA  1 
ATOM   719  C  C   . THR A 1 99  ? 39.633  72.118  119.707 1.00 28.37  ? 245 THR A C   1 
ATOM   720  O  O   . THR A 1 99  ? 38.583  72.708  119.972 1.00 26.76  ? 245 THR A O   1 
ATOM   721  C  CB  . THR A 1 99  ? 39.081  69.696  119.170 1.00 24.81  ? 245 THR A CB  1 
ATOM   722  O  OG1 . THR A 1 99  ? 39.141  68.698  118.145 1.00 27.34  ? 245 THR A OG1 1 
ATOM   723  C  CG2 . THR A 1 99  ? 37.639  69.876  119.586 1.00 21.62  ? 245 THR A CG2 1 
ATOM   724  N  N   . ALA A 1 100 ? 40.787  72.398  120.310 1.00 30.34  ? 246 ALA A N   1 
ATOM   725  C  CA  . ALA A 1 100 ? 40.890  73.465  121.305 1.00 30.30  ? 246 ALA A CA  1 
ATOM   726  C  C   . ALA A 1 100 ? 40.525  74.815  120.684 1.00 32.04  ? 246 ALA A C   1 
ATOM   727  O  O   . ALA A 1 100 ? 40.143  75.749  121.388 1.00 35.84  ? 246 ALA A O   1 
ATOM   728  C  CB  . ALA A 1 100 ? 42.298  73.507  121.915 1.00 25.38  ? 246 ALA A CB  1 
ATOM   729  N  N   . GLY A 1 101 ? 40.643  74.912  119.362 1.00 30.87  ? 247 GLY A N   1 
ATOM   730  C  CA  . GLY A 1 101 ? 40.177  76.084  118.638 1.00 30.41  ? 247 GLY A CA  1 
ATOM   731  C  C   . GLY A 1 101 ? 40.866  77.385  119.006 1.00 28.58  ? 247 GLY A C   1 
ATOM   732  O  O   . GLY A 1 101 ? 40.331  78.465  118.762 1.00 26.15  ? 247 GLY A O   1 
ATOM   733  N  N   . GLY A 1 102 ? 42.057  77.285  119.588 1.00 29.05  ? 248 GLY A N   1 
ATOM   734  C  CA  . GLY A 1 102 ? 42.826  78.463  119.940 1.00 29.62  ? 248 GLY A CA  1 
ATOM   735  C  C   . GLY A 1 102 ? 42.621  78.872  121.383 1.00 30.64  ? 248 GLY A C   1 
ATOM   736  O  O   . GLY A 1 102 ? 43.263  79.801  121.877 1.00 32.94  ? 248 GLY A O   1 
ATOM   737  N  N   . LEU A 1 103 ? 41.720  78.175  122.065 1.00 25.43  ? 249 LEU A N   1 
ATOM   738  C  CA  . LEU A 1 103 ? 41.484  78.445  123.472 1.00 25.13  ? 249 LEU A CA  1 
ATOM   739  C  C   . LEU A 1 103 ? 42.433  77.611  124.322 1.00 28.82  ? 249 LEU A C   1 
ATOM   740  O  O   . LEU A 1 103 ? 42.960  76.589  123.864 1.00 26.04  ? 249 LEU A O   1 
ATOM   741  C  CB  . LEU A 1 103 ? 40.030  78.161  123.846 1.00 21.69  ? 249 LEU A CB  1 
ATOM   742  C  CG  . LEU A 1 103 ? 38.979  78.898  123.013 1.00 22.72  ? 249 LEU A CG  1 
ATOM   743  C  CD1 . LEU A 1 103 ? 37.617  78.809  123.678 1.00 21.56  ? 249 LEU A CD1 1 
ATOM   744  C  CD2 . LEU A 1 103 ? 39.372  80.353  122.797 1.00 24.49  ? 249 LEU A CD2 1 
ATOM   745  N  N   . ILE A 1 104 ? 42.652  78.061  125.555 1.00 29.84  ? 250 ILE A N   1 
ATOM   746  C  CA  . ILE A 1 104 ? 43.516  77.364  126.504 1.00 24.48  ? 250 ILE A CA  1 
ATOM   747  C  C   . ILE A 1 104 ? 42.697  76.433  127.400 1.00 23.87  ? 250 ILE A C   1 
ATOM   748  O  O   . ILE A 1 104 ? 41.719  76.847  128.020 1.00 26.15  ? 250 ILE A O   1 
ATOM   749  C  CB  . ILE A 1 104 ? 44.298  78.364  127.378 1.00 24.80  ? 250 ILE A CB  1 
ATOM   750  C  CG1 . ILE A 1 104 ? 45.087  79.335  126.493 1.00 24.51  ? 250 ILE A CG1 1 
ATOM   751  C  CG2 . ILE A 1 104 ? 45.209  77.626  128.342 1.00 27.81  ? 250 ILE A CG2 1 
ATOM   752  C  CD1 . ILE A 1 104 ? 45.806  80.442  127.251 1.00 28.51  ? 250 ILE A CD1 1 
ATOM   753  N  N   . TYR A 1 105 ? 43.103  75.170  127.459 1.00 21.40  ? 251 TYR A N   1 
ATOM   754  C  CA  . TYR A 1 105 ? 42.408  74.171  128.255 1.00 19.94  ? 251 TYR A CA  1 
ATOM   755  C  C   . TYR A 1 105 ? 43.380  73.413  129.151 1.00 22.93  ? 251 TYR A C   1 
ATOM   756  O  O   . TYR A 1 105 ? 44.441  72.989  128.692 1.00 22.33  ? 251 TYR A O   1 
ATOM   757  C  CB  . TYR A 1 105 ? 41.738  73.154  127.339 1.00 16.84  ? 251 TYR A CB  1 
ATOM   758  C  CG  . TYR A 1 105 ? 40.571  73.682  126.549 1.00 15.63  ? 251 TYR A CG  1 
ATOM   759  C  CD1 . TYR A 1 105 ? 39.277  73.487  126.989 1.00 17.35  ? 251 TYR A CD1 1 
ATOM   760  C  CD2 . TYR A 1 105 ? 40.764  74.362  125.359 1.00 18.44  ? 251 TYR A CD2 1 
ATOM   761  C  CE1 . TYR A 1 105 ? 38.196  73.952  126.266 1.00 21.70  ? 251 TYR A CE1 1 
ATOM   762  C  CE2 . TYR A 1 105 ? 39.689  74.834  124.626 1.00 22.48  ? 251 TYR A CE2 1 
ATOM   763  C  CZ  . TYR A 1 105 ? 38.409  74.622  125.087 1.00 24.03  ? 251 TYR A CZ  1 
ATOM   764  O  OH  . TYR A 1 105 ? 37.333  75.084  124.377 1.00 29.79  ? 251 TYR A OH  1 
ATOM   765  N  N   . TRP A 1 106 ? 43.011  73.243  130.419 1.00 21.21  ? 252 TRP A N   1 
ATOM   766  C  CA  . TRP A 1 106 ? 43.723  72.349  131.317 1.00 22.63  ? 252 TRP A CA  1 
ATOM   767  C  C   . TRP A 1 106 ? 43.647  70.935  130.767 1.00 27.14  ? 252 TRP A C   1 
ATOM   768  O  O   . TRP A 1 106 ? 42.621  70.530  130.214 1.00 26.58  ? 252 TRP A O   1 
ATOM   769  C  CB  . TRP A 1 106 ? 43.052  72.318  132.687 1.00 21.57  ? 252 TRP A CB  1 
ATOM   770  C  CG  . TRP A 1 106 ? 43.331  73.464  133.652 1.00 25.70  ? 252 TRP A CG  1 
ATOM   771  C  CD1 . TRP A 1 106 ? 42.398  74.208  134.316 1.00 27.23  ? 252 TRP A CD1 1 
ATOM   772  C  CD2 . TRP A 1 106 ? 44.613  73.938  134.105 1.00 23.85  ? 252 TRP A CD2 1 
ATOM   773  N  NE1 . TRP A 1 106 ? 43.014  75.122  135.137 1.00 29.90  ? 252 TRP A NE1 1 
ATOM   774  C  CE2 . TRP A 1 106 ? 44.372  74.979  135.026 1.00 28.11  ? 252 TRP A CE2 1 
ATOM   775  C  CE3 . TRP A 1 106 ? 45.937  73.591  133.814 1.00 20.39  ? 252 TRP A CE3 1 
ATOM   776  C  CZ2 . TRP A 1 106 ? 45.409  75.680  135.658 1.00 24.25  ? 252 TRP A CZ2 1 
ATOM   777  C  CZ3 . TRP A 1 106 ? 46.963  74.288  134.439 1.00 21.46  ? 252 TRP A CZ3 1 
ATOM   778  C  CH2 . TRP A 1 106 ? 46.692  75.318  135.353 1.00 19.13  ? 252 TRP A CH2 1 
ATOM   779  N  N   . ILE A 1 107 ? 44.723  70.175  130.940 1.00 28.93  ? 253 ILE A N   1 
ATOM   780  C  CA  . ILE A 1 107 ? 44.678  68.737  130.696 1.00 25.02  ? 253 ILE A CA  1 
ATOM   781  C  C   . ILE A 1 107 ? 45.211  67.976  131.906 1.00 25.92  ? 253 ILE A C   1 
ATOM   782  O  O   . ILE A 1 107 ? 45.444  68.570  132.961 1.00 26.17  ? 253 ILE A O   1 
ATOM   783  C  CB  . ILE A 1 107 ? 45.428  68.330  129.410 1.00 25.04  ? 253 ILE A CB  1 
ATOM   784  C  CG1 . ILE A 1 107 ? 46.884  68.784  129.463 1.00 24.73  ? 253 ILE A CG1 1 
ATOM   785  C  CG2 . ILE A 1 107 ? 44.733  68.910  128.177 1.00 23.48  ? 253 ILE A CG2 1 
ATOM   786  C  CD1 . ILE A 1 107 ? 47.680  68.382  128.238 1.00 24.33  ? 253 ILE A CD1 1 
ATOM   787  N  N   . GLY A 1 108 ? 45.398  66.666  131.755 1.00 23.78  ? 254 GLY A N   1 
ATOM   788  C  CA  . GLY A 1 108 ? 45.749  65.806  132.874 1.00 25.18  ? 254 GLY A CA  1 
ATOM   789  C  C   . GLY A 1 108 ? 47.202  65.853  133.317 1.00 27.92  ? 254 GLY A C   1 
ATOM   790  O  O   . GLY A 1 108 ? 47.625  65.042  134.133 1.00 34.87  ? 254 GLY A O   1 
ATOM   791  N  N   . LEU A 1 109 ? 47.968  66.796  132.782 1.00 30.24  ? 255 LEU A N   1 
ATOM   792  C  CA  . LEU A 1 109 ? 49.374  66.946  133.149 1.00 31.36  ? 255 LEU A CA  1 
ATOM   793  C  C   . LEU A 1 109 ? 49.517  67.466  134.569 1.00 34.44  ? 255 LEU A C   1 
ATOM   794  O  O   . LEU A 1 109 ? 48.946  68.504  134.917 1.00 35.93  ? 255 LEU A O   1 
ATOM   795  C  CB  . LEU A 1 109 ? 50.084  67.908  132.200 1.00 30.35  ? 255 LEU A CB  1 
ATOM   796  C  CG  . LEU A 1 109 ? 50.544  67.361  130.856 1.00 34.60  ? 255 LEU A CG  1 
ATOM   797  C  CD1 . LEU A 1 109 ? 51.194  68.459  130.022 1.00 34.60  ? 255 LEU A CD1 1 
ATOM   798  C  CD2 . LEU A 1 109 ? 51.507  66.216  131.089 1.00 37.27  ? 255 LEU A CD2 1 
ATOM   799  N  N   . THR A 1 110 ? 50.302  66.760  135.375 1.00 28.54  ? 256 THR A N   1 
ATOM   800  C  CA  . THR A 1 110 ? 50.476  67.123  136.772 1.00 31.50  ? 256 THR A CA  1 
ATOM   801  C  C   . THR A 1 110 ? 51.884  66.781  137.269 1.00 34.42  ? 256 THR A C   1 
ATOM   802  O  O   . THR A 1 110 ? 52.418  65.707  136.983 1.00 34.92  ? 256 THR A O   1 
ATOM   803  C  CB  . THR A 1 110 ? 49.409  66.444  137.657 1.00 32.05  ? 256 THR A CB  1 
ATOM   804  O  OG1 . THR A 1 110 ? 49.522  66.914  139.000 1.00 31.37  ? 256 THR A OG1 1 
ATOM   805  C  CG2 . THR A 1 110 ? 49.565  64.922  137.633 1.00 30.74  ? 256 THR A CG2 1 
ATOM   806  N  N   . LYS A 1 111 ? 52.483  67.709  138.006 1.00 35.82  ? 257 LYS A N   1 
ATOM   807  C  CA  . LYS A 1 111 ? 53.840  67.535  138.508 1.00 38.89  ? 257 LYS A CA  1 
ATOM   808  C  C   . LYS A 1 111 ? 53.790  67.315  140.012 1.00 40.52  ? 257 LYS A C   1 
ATOM   809  O  O   . LYS A 1 111 ? 53.082  68.027  140.720 1.00 40.96  ? 257 LYS A O   1 
ATOM   810  C  CB  . LYS A 1 111 ? 54.672  68.775  138.180 1.00 40.76  ? 257 LYS A CB  1 
ATOM   811  C  CG  . LYS A 1 111 ? 56.172  68.655  138.430 1.00 44.79  ? 257 LYS A CG  1 
ATOM   812  C  CD  . LYS A 1 111 ? 56.828  70.027  138.265 1.00 48.26  ? 257 LYS A CD  1 
ATOM   813  C  CE  . LYS A 1 111 ? 58.325  69.936  138.016 1.00 51.90  ? 257 LYS A CE  1 
ATOM   814  N  NZ  . LYS A 1 111 ? 59.066  69.470  139.217 1.00 56.84  ? 257 LYS A NZ  1 
ATOM   815  N  N   . ALA A 1 112 ? 54.528  66.320  140.496 1.00 44.25  ? 258 ALA A N   1 
ATOM   816  C  CA  . ALA A 1 112 ? 54.589  66.034  141.931 1.00 45.68  ? 258 ALA A CA  1 
ATOM   817  C  C   . ALA A 1 112 ? 55.410  67.079  142.688 1.00 47.67  ? 258 ALA A C   1 
ATOM   818  O  O   . ALA A 1 112 ? 56.546  66.823  143.088 1.00 49.45  ? 258 ALA A O   1 
ATOM   819  C  CB  . ALA A 1 112 ? 55.151  64.633  142.174 1.00 42.16  ? 258 ALA A CB  1 
ATOM   820  N  N   . GLY A 1 113 ? 54.827  68.257  142.880 1.00 49.27  ? 259 GLY A N   1 
ATOM   821  C  CA  . GLY A 1 113 ? 55.488  69.332  143.600 1.00 49.69  ? 259 GLY A CA  1 
ATOM   822  C  C   . GLY A 1 113 ? 56.817  69.722  142.981 1.00 49.07  ? 259 GLY A C   1 
ATOM   823  O  O   . GLY A 1 113 ? 57.105  69.380  141.832 1.00 48.04  ? 259 GLY A O   1 
ATOM   824  N  N   . MET A 1 114 ? 57.630  70.444  143.745 1.00 48.99  ? 260 MET A N   1 
ATOM   825  C  CA  . MET A 1 114 ? 58.941  70.860  143.273 1.00 47.22  ? 260 MET A CA  1 
ATOM   826  C  C   . MET A 1 114 ? 59.780  69.640  142.933 1.00 46.16  ? 260 MET A C   1 
ATOM   827  O  O   . MET A 1 114 ? 59.771  68.646  143.661 1.00 48.78  ? 260 MET A O   1 
ATOM   828  C  CB  . MET A 1 114 ? 59.654  71.691  144.338 1.00 47.86  ? 260 MET A CB  1 
ATOM   829  C  CG  . MET A 1 114 ? 58.942  72.974  144.713 1.00 48.39  ? 260 MET A CG  1 
ATOM   830  S  SD  . MET A 1 114 ? 59.714  73.776  146.142 1.00 81.59  ? 260 MET A SD  1 
ATOM   831  C  CE  . MET A 1 114 ? 61.391  74.012  145.554 1.00 32.75  ? 260 MET A CE  1 
ATOM   832  N  N   . GLU A 1 115 ? 60.497  69.719  141.820 1.00 44.06  ? 261 GLU A N   1 
ATOM   833  C  CA  . GLU A 1 115 ? 61.398  68.647  141.409 1.00 47.25  ? 261 GLU A CA  1 
ATOM   834  C  C   . GLU A 1 115 ? 60.699  67.308  141.145 1.00 50.22  ? 261 GLU A C   1 
ATOM   835  O  O   . GLU A 1 115 ? 61.347  66.330  140.772 1.00 52.51  ? 261 GLU A O   1 
ATOM   836  C  CB  . GLU A 1 115 ? 62.528  68.477  142.430 1.00 48.15  ? 261 GLU A CB  1 
ATOM   837  C  CG  . GLU A 1 115 ? 63.547  69.602  142.390 1.00 51.44  ? 261 GLU A CG  1 
ATOM   838  C  CD  . GLU A 1 115 ? 64.656  69.434  143.408 1.00 57.34  ? 261 GLU A CD  1 
ATOM   839  O  OE1 . GLU A 1 115 ? 64.752  68.349  144.022 1.00 58.56  ? 261 GLU A OE1 1 
ATOM   840  O  OE2 . GLU A 1 115 ? 65.433  70.394  143.593 1.00 58.79  ? 261 GLU A OE2 1 
ATOM   841  N  N   . GLY A 1 116 ? 59.385  67.260  141.333 1.00 48.64  ? 262 GLY A N   1 
ATOM   842  C  CA  . GLY A 1 116 ? 58.643  66.047  141.043 1.00 50.74  ? 262 GLY A CA  1 
ATOM   843  C  C   . GLY A 1 116 ? 58.588  65.779  139.549 1.00 49.40  ? 262 GLY A C   1 
ATOM   844  O  O   . GLY A 1 116 ? 58.770  66.690  138.741 1.00 52.36  ? 262 GLY A O   1 
ATOM   845  N  N   . ASP A 1 117 ? 58.347  64.529  139.174 1.00 44.94  ? 263 ASP A N   1 
ATOM   846  C  CA  . ASP A 1 117 ? 58.192  64.186  137.766 1.00 46.93  ? 263 ASP A CA  1 
ATOM   847  C  C   . ASP A 1 117 ? 56.804  64.566  137.260 1.00 40.12  ? 263 ASP A C   1 
ATOM   848  O  O   . ASP A 1 117 ? 55.896  64.846  138.043 1.00 39.23  ? 263 ASP A O   1 
ATOM   849  C  CB  . ASP A 1 117 ? 58.454  62.696  137.531 1.00 52.95  ? 263 ASP A CB  1 
ATOM   850  C  CG  . ASP A 1 117 ? 59.929  62.384  137.355 1.00 60.28  ? 263 ASP A CG  1 
ATOM   851  O  OD1 . ASP A 1 117 ? 60.514  62.800  136.330 1.00 63.17  ? 263 ASP A OD1 1 
ATOM   852  O  OD2 . ASP A 1 117 ? 60.507  61.715  138.236 1.00 62.84  ? 263 ASP A OD2 1 
ATOM   853  N  N   . TRP A 1 118 ? 56.648  64.593  135.945 1.00 34.83  ? 264 TRP A N   1 
ATOM   854  C  CA  . TRP A 1 118 ? 55.345  64.857  135.357 1.00 31.24  ? 264 TRP A CA  1 
ATOM   855  C  C   . TRP A 1 118 ? 54.595  63.547  135.199 1.00 34.69  ? 264 TRP A C   1 
ATOM   856  O  O   . TRP A 1 118 ? 55.195  62.524  134.856 1.00 38.61  ? 264 TRP A O   1 
ATOM   857  C  CB  . TRP A 1 118 ? 55.495  65.561  134.011 1.00 26.38  ? 264 TRP A CB  1 
ATOM   858  C  CG  . TRP A 1 118 ? 55.800  67.011  134.154 1.00 26.56  ? 264 TRP A CG  1 
ATOM   859  C  CD1 . TRP A 1 118 ? 57.030  67.599  134.104 1.00 28.70  ? 264 TRP A CD1 1 
ATOM   860  C  CD2 . TRP A 1 118 ? 54.858  68.065  134.394 1.00 28.30  ? 264 TRP A CD2 1 
ATOM   861  N  NE1 . TRP A 1 118 ? 56.913  68.953  134.295 1.00 35.07  ? 264 TRP A NE1 1 
ATOM   862  C  CE2 . TRP A 1 118 ? 55.590  69.267  134.474 1.00 30.24  ? 264 TRP A CE2 1 
ATOM   863  C  CE3 . TRP A 1 118 ? 53.467  68.110  134.547 1.00 26.40  ? 264 TRP A CE3 1 
ATOM   864  C  CZ2 . TRP A 1 118 ? 54.979  70.503  134.695 1.00 22.71  ? 264 TRP A CZ2 1 
ATOM   865  C  CZ3 . TRP A 1 118 ? 52.862  69.339  134.769 1.00 25.09  ? 264 TRP A CZ3 1 
ATOM   866  C  CH2 . TRP A 1 118 ? 53.619  70.518  134.843 1.00 24.21  ? 264 TRP A CH2 1 
ATOM   867  N  N   . SER A 1 119 ? 53.292  63.573  135.463 1.00 30.70  ? 265 SER A N   1 
ATOM   868  C  CA  . SER A 1 119 ? 52.464  62.384  135.294 1.00 31.38  ? 265 SER A CA  1 
ATOM   869  C  C   . SER A 1 119 ? 51.057  62.730  134.810 1.00 31.17  ? 265 SER A C   1 
ATOM   870  O  O   . SER A 1 119 ? 50.669  63.897  134.772 1.00 31.86  ? 265 SER A O   1 
ATOM   871  C  CB  . SER A 1 119 ? 52.400  61.576  136.593 1.00 32.80  ? 265 SER A CB  1 
ATOM   872  O  OG  . SER A 1 119 ? 51.580  62.205  137.559 1.00 35.84  ? 265 SER A OG  1 
ATOM   873  N  N   . TRP A 1 120 ? 50.303  61.705  134.432 1.00 30.17  ? 266 TRP A N   1 
ATOM   874  C  CA  . TRP A 1 120 ? 48.924  61.882  133.992 1.00 31.16  ? 266 TRP A CA  1 
ATOM   875  C  C   . TRP A 1 120 ? 47.959  61.543  135.115 1.00 31.99  ? 266 TRP A C   1 
ATOM   876  O  O   . TRP A 1 120 ? 48.100  60.511  135.770 1.00 31.16  ? 266 TRP A O   1 
ATOM   877  C  CB  . TRP A 1 120 ? 48.625  60.981  132.799 1.00 29.20  ? 266 TRP A CB  1 
ATOM   878  C  CG  . TRP A 1 120 ? 49.390  61.329  131.569 1.00 28.47  ? 266 TRP A CG  1 
ATOM   879  C  CD1 . TRP A 1 120 ? 50.385  60.600  130.987 1.00 27.49  ? 266 TRP A CD1 1 
ATOM   880  C  CD2 . TRP A 1 120 ? 49.226  62.503  130.766 1.00 25.05  ? 266 TRP A CD2 1 
ATOM   881  N  NE1 . TRP A 1 120 ? 50.845  61.243  129.863 1.00 29.78  ? 266 TRP A NE1 1 
ATOM   882  C  CE2 . TRP A 1 120 ? 50.150  62.415  129.706 1.00 28.13  ? 266 TRP A CE2 1 
ATOM   883  C  CE3 . TRP A 1 120 ? 48.381  63.615  130.836 1.00 22.03  ? 266 TRP A CE3 1 
ATOM   884  C  CZ2 . TRP A 1 120 ? 50.255  63.399  128.722 1.00 24.12  ? 266 TRP A CZ2 1 
ATOM   885  C  CZ3 . TRP A 1 120 ? 48.485  64.586  129.859 1.00 22.12  ? 266 TRP A CZ3 1 
ATOM   886  C  CH2 . TRP A 1 120 ? 49.417  64.473  128.817 1.00 20.01  ? 266 TRP A CH2 1 
ATOM   887  N  N   . VAL A 1 121 ? 46.966  62.397  135.325 1.00 32.12  ? 267 VAL A N   1 
ATOM   888  C  CA  . VAL A 1 121 ? 46.025  62.180  136.415 1.00 34.43  ? 267 VAL A CA  1 
ATOM   889  C  C   . VAL A 1 121 ? 45.155  60.942  136.201 1.00 34.72  ? 267 VAL A C   1 
ATOM   890  O  O   . VAL A 1 121 ? 44.558  60.433  137.146 1.00 36.71  ? 267 VAL A O   1 
ATOM   891  C  CB  . VAL A 1 121 ? 45.113  63.397  136.636 1.00 31.38  ? 267 VAL A CB  1 
ATOM   892  C  CG1 . VAL A 1 121 ? 44.009  63.419  135.588 1.00 30.99  ? 267 VAL A CG1 1 
ATOM   893  C  CG2 . VAL A 1 121 ? 44.526  63.363  138.047 1.00 27.62  ? 267 VAL A CG2 1 
ATOM   894  N  N   . ASP A 1 122 ? 45.072  60.461  134.964 1.00 34.52  ? 268 ASP A N   1 
ATOM   895  C  CA  . ASP A 1 122 ? 44.291  59.256  134.694 1.00 35.96  ? 268 ASP A CA  1 
ATOM   896  C  C   . ASP A 1 122 ? 45.174  58.007  134.714 1.00 35.87  ? 268 ASP A C   1 
ATOM   897  O  O   . ASP A 1 122 ? 44.742  56.923  134.315 1.00 29.12  ? 268 ASP A O   1 
ATOM   898  C  CB  . ASP A 1 122 ? 43.502  59.368  133.381 1.00 36.58  ? 268 ASP A CB  1 
ATOM   899  C  CG  . ASP A 1 122 ? 44.379  59.237  132.149 1.00 38.82  ? 268 ASP A CG  1 
ATOM   900  O  OD1 . ASP A 1 122 ? 45.583  58.928  132.284 1.00 36.78  ? 268 ASP A OD1 1 
ATOM   901  O  OD2 . ASP A 1 122 ? 43.855  59.445  131.033 1.00 42.12  ? 268 ASP A OD2 1 
ATOM   902  N  N   . ASP A 1 123 ? 46.411  58.183  135.178 1.00 41.25  ? 269 ASP A N   1 
ATOM   903  C  CA  . ASP A 1 123 ? 47.354  57.082  135.402 1.00 45.14  ? 269 ASP A CA  1 
ATOM   904  C  C   . ASP A 1 123 ? 47.997  56.520  134.144 1.00 43.15  ? 269 ASP A C   1 
ATOM   905  O  O   . ASP A 1 123 ? 48.770  55.566  134.214 1.00 45.36  ? 269 ASP A O   1 
ATOM   906  C  CB  . ASP A 1 123 ? 46.706  55.957  136.204 1.00 50.72  ? 269 ASP A CB  1 
ATOM   907  C  CG  . ASP A 1 123 ? 46.536  56.314  137.659 1.00 58.85  ? 269 ASP A CG  1 
ATOM   908  O  OD1 . ASP A 1 123 ? 47.343  57.124  138.168 1.00 59.53  ? 269 ASP A OD1 1 
ATOM   909  O  OD2 . ASP A 1 123 ? 45.600  55.786  138.292 1.00 64.74  ? 269 ASP A OD2 1 
ATOM   910  N  N   . THR A 1 124 ? 47.667  57.101  132.998 1.00 40.01  ? 270 THR A N   1 
ATOM   911  C  CA  . THR A 1 124 ? 48.377  56.791  131.770 1.00 36.31  ? 270 THR A CA  1 
ATOM   912  C  C   . THR A 1 124 ? 49.861  57.016  132.034 1.00 37.21  ? 270 THR A C   1 
ATOM   913  O  O   . THR A 1 124 ? 50.242  58.041  132.597 1.00 35.93  ? 270 THR A O   1 
ATOM   914  C  CB  . THR A 1 124 ? 47.933  57.710  130.624 1.00 32.77  ? 270 THR A CB  1 
ATOM   915  O  OG1 . THR A 1 124 ? 46.565  57.445  130.297 1.00 35.03  ? 270 THR A OG1 1 
ATOM   916  C  CG2 . THR A 1 124 ? 48.801  57.491  129.396 1.00 29.17  ? 270 THR A CG2 1 
ATOM   917  N  N   . PRO A 1 125 ? 50.705  56.050  131.645 1.00 39.73  ? 271 PRO A N   1 
ATOM   918  C  CA  . PRO A 1 125 ? 52.143  56.210  131.881 1.00 40.59  ? 271 PRO A CA  1 
ATOM   919  C  C   . PRO A 1 125 ? 52.669  57.415  131.116 1.00 38.25  ? 271 PRO A C   1 
ATOM   920  O  O   . PRO A 1 125 ? 52.285  57.620  129.966 1.00 36.99  ? 271 PRO A O   1 
ATOM   921  C  CB  . PRO A 1 125 ? 52.740  54.917  131.314 1.00 45.06  ? 271 PRO A CB  1 
ATOM   922  C  CG  . PRO A 1 125 ? 51.592  53.932  131.286 1.00 44.00  ? 271 PRO A CG  1 
ATOM   923  C  CD  . PRO A 1 125 ? 50.378  54.759  131.014 1.00 41.21  ? 271 PRO A CD  1 
ATOM   924  N  N   . PHE A 1 126 ? 53.531  58.205  131.749 1.00 38.33  ? 272 PHE A N   1 
ATOM   925  C  CA  . PHE A 1 126 ? 54.069  59.396  131.110 1.00 39.05  ? 272 PHE A CA  1 
ATOM   926  C  C   . PHE A 1 126 ? 55.317  59.072  130.302 1.00 42.95  ? 272 PHE A C   1 
ATOM   927  O  O   . PHE A 1 126 ? 56.343  58.689  130.856 1.00 46.24  ? 272 PHE A O   1 
ATOM   928  C  CB  . PHE A 1 126 ? 54.379  60.482  132.149 1.00 37.82  ? 272 PHE A CB  1 
ATOM   929  C  CG  . PHE A 1 126 ? 54.709  61.814  131.542 1.00 35.96  ? 272 PHE A CG  1 
ATOM   930  C  CD1 . PHE A 1 126 ? 53.700  62.686  131.165 1.00 35.32  ? 272 PHE A CD1 1 
ATOM   931  C  CD2 . PHE A 1 126 ? 56.026  62.188  131.331 1.00 37.97  ? 272 PHE A CD2 1 
ATOM   932  C  CE1 . PHE A 1 126 ? 53.999  63.911  130.599 1.00 36.80  ? 272 PHE A CE1 1 
ATOM   933  C  CE2 . PHE A 1 126 ? 56.333  63.415  130.765 1.00 37.67  ? 272 PHE A CE2 1 
ATOM   934  C  CZ  . PHE A 1 126 ? 55.317  64.275  130.397 1.00 37.38  ? 272 PHE A CZ  1 
ATOM   935  N  N   . ASN A 1 127 ? 55.231  59.232  128.988 1.00 47.76  ? 273 ASN A N   1 
ATOM   936  C  CA  . ASN A 1 127 ? 56.375  58.961  128.128 1.00 54.07  ? 273 ASN A CA  1 
ATOM   937  C  C   . ASN A 1 127 ? 57.310  60.164  128.033 1.00 53.03  ? 273 ASN A C   1 
ATOM   938  O  O   . ASN A 1 127 ? 57.080  61.076  127.241 1.00 50.38  ? 273 ASN A O   1 
ATOM   939  C  CB  . ASN A 1 127 ? 55.913  58.533  126.734 1.00 56.68  ? 273 ASN A CB  1 
ATOM   940  C  CG  . ASN A 1 127 ? 57.061  58.081  125.860 1.00 60.71  ? 273 ASN A CG  1 
ATOM   941  O  OD1 . ASN A 1 127 ? 58.220  58.102  126.278 1.00 61.47  ? 273 ASN A OD1 1 
ATOM   942  N  ND2 . ASN A 1 127 ? 56.745  57.663  124.640 1.00 62.64  ? 273 ASN A ND2 1 
ATOM   943  N  N   . LYS A 1 128 ? 58.366  60.156  128.840 1.00 54.57  ? 274 LYS A N   1 
ATOM   944  C  CA  . LYS A 1 128 ? 59.292  61.280  128.898 1.00 57.24  ? 274 LYS A CA  1 
ATOM   945  C  C   . LYS A 1 128 ? 59.861  61.599  127.518 1.00 57.29  ? 274 LYS A C   1 
ATOM   946  O  O   . LYS A 1 128 ? 60.067  62.762  127.175 1.00 57.16  ? 274 LYS A O   1 
ATOM   947  C  CB  . LYS A 1 128 ? 60.423  60.986  129.882 1.00 62.37  ? 274 LYS A CB  1 
ATOM   948  C  CG  . LYS A 1 128 ? 60.884  62.196  130.671 1.00 66.77  ? 274 LYS A CG  1 
ATOM   949  C  CD  . LYS A 1 128 ? 61.951  61.815  131.685 1.00 72.67  ? 274 LYS A CD  1 
ATOM   950  C  CE  . LYS A 1 128 ? 62.240  62.967  132.644 1.00 75.72  ? 274 LYS A CE  1 
ATOM   951  N  NZ  . LYS A 1 128 ? 62.546  64.234  131.922 1.00 75.36  ? 274 LYS A NZ  1 
ATOM   952  N  N   . VAL A 1 129 ? 60.106  60.559  126.730 1.00 59.39  ? 275 VAL A N   1 
ATOM   953  C  CA  . VAL A 1 129 ? 60.654  60.723  125.389 1.00 61.70  ? 275 VAL A CA  1 
ATOM   954  C  C   . VAL A 1 129 ? 59.658  61.411  124.465 1.00 61.84  ? 275 VAL A C   1 
ATOM   955  O  O   . VAL A 1 129 ? 59.893  62.526  123.996 1.00 62.67  ? 275 VAL A O   1 
ATOM   956  C  CB  . VAL A 1 129 ? 61.045  59.367  124.775 1.00 64.19  ? 275 VAL A CB  1 
ATOM   957  C  CG1 . VAL A 1 129 ? 61.520  59.549  123.340 1.00 64.31  ? 275 VAL A CG1 1 
ATOM   958  C  CG2 . VAL A 1 129 ? 62.115  58.688  125.622 1.00 65.60  ? 275 VAL A CG2 1 
ATOM   959  N  N   . GLN A 1 130 ? 58.547  60.733  124.204 1.00 59.97  ? 276 GLN A N   1 
ATOM   960  C  CA  . GLN A 1 130 ? 57.491  61.271  123.359 1.00 58.75  ? 276 GLN A CA  1 
ATOM   961  C  C   . GLN A 1 130 ? 57.089  62.676  123.791 1.00 60.22  ? 276 GLN A C   1 
ATOM   962  O  O   . GLN A 1 130 ? 57.008  63.588  122.970 1.00 59.24  ? 276 GLN A O   1 
ATOM   963  C  CB  . GLN A 1 130 ? 56.269  60.356  123.408 1.00 60.28  ? 276 GLN A CB  1 
ATOM   964  C  CG  . GLN A 1 130 ? 55.066  60.870  122.641 1.00 61.46  ? 276 GLN A CG  1 
ATOM   965  C  CD  . GLN A 1 130 ? 53.794  60.127  123.000 1.00 64.44  ? 276 GLN A CD  1 
ATOM   966  O  OE1 . GLN A 1 130 ? 53.406  60.064  124.169 1.00 64.72  ? 276 GLN A OE1 1 
ATOM   967  N  NE2 . GLN A 1 130 ? 53.136  59.559  121.995 1.00 66.27  ? 276 GLN A NE2 1 
ATOM   968  N  N   . SER A 1 131 ? 56.836  62.841  125.086 1.00 61.18  ? 277 SER A N   1 
ATOM   969  C  CA  . SER A 1 131 ? 56.334  64.104  125.623 1.00 61.98  ? 277 SER A CA  1 
ATOM   970  C  C   . SER A 1 131 ? 57.183  65.306  125.225 1.00 56.54  ? 277 SER A C   1 
ATOM   971  O  O   . SER A 1 131 ? 56.666  66.407  125.069 1.00 55.32  ? 277 SER A O   1 
ATOM   972  C  CB  . SER A 1 131 ? 56.206  64.031  127.146 1.00 68.18  ? 277 SER A CB  1 
ATOM   973  O  OG  . SER A 1 131 ? 55.221  63.082  127.524 1.00 71.07  ? 277 SER A OG  1 
ATOM   974  N  N   . ALA A 1 132 ? 58.482  65.087  125.058 1.00 56.69  ? 278 ALA A N   1 
ATOM   975  C  CA  . ALA A 1 132 ? 59.402  66.152  124.665 1.00 56.90  ? 278 ALA A CA  1 
ATOM   976  C  C   . ALA A 1 132 ? 58.856  67.020  123.531 1.00 54.87  ? 278 ALA A C   1 
ATOM   977  O  O   . ALA A 1 132 ? 59.028  68.241  123.527 1.00 56.73  ? 278 ALA A O   1 
ATOM   978  C  CB  . ALA A 1 132 ? 60.749  65.561  124.270 1.00 57.29  ? 278 ALA A CB  1 
ATOM   979  N  N   . ARG A 1 133 ? 58.193  66.382  122.573 1.00 50.68  ? 279 ARG A N   1 
ATOM   980  C  CA  . ARG A 1 133 ? 57.748  67.062  121.364 1.00 49.34  ? 279 ARG A CA  1 
ATOM   981  C  C   . ARG A 1 133 ? 56.315  67.573  121.462 1.00 42.97  ? 279 ARG A C   1 
ATOM   982  O  O   . ARG A 1 133 ? 55.728  67.997  120.465 1.00 45.60  ? 279 ARG A O   1 
ATOM   983  C  CB  . ARG A 1 133 ? 57.887  66.130  120.158 1.00 55.29  ? 279 ARG A CB  1 
ATOM   984  C  CG  . ARG A 1 133 ? 56.982  64.912  120.206 1.00 59.34  ? 279 ARG A CG  1 
ATOM   985  C  CD  . ARG A 1 133 ? 57.365  63.894  119.146 1.00 65.64  ? 279 ARG A CD  1 
ATOM   986  N  NE  . ARG A 1 133 ? 56.391  62.810  119.071 1.00 71.88  ? 279 ARG A NE  1 
ATOM   987  C  CZ  . ARG A 1 133 ? 56.480  61.777  118.241 1.00 77.90  ? 279 ARG A CZ  1 
ATOM   988  N  NH1 . ARG A 1 133 ? 55.538  60.840  118.245 1.00 79.09  ? 279 ARG A NH1 1 
ATOM   989  N  NH2 . ARG A 1 133 ? 57.508  61.677  117.408 1.00 81.22  ? 279 ARG A NH2 1 
ATOM   990  N  N   . PHE A 1 134 ? 55.748  67.534  122.660 1.00 34.52  ? 280 PHE A N   1 
ATOM   991  C  CA  . PHE A 1 134 ? 54.394  68.035  122.850 1.00 33.47  ? 280 PHE A CA  1 
ATOM   992  C  C   . PHE A 1 134 ? 54.378  69.335  123.651 1.00 33.69  ? 280 PHE A C   1 
ATOM   993  O  O   . PHE A 1 134 ? 53.371  70.043  123.687 1.00 31.95  ? 280 PHE A O   1 
ATOM   994  C  CB  . PHE A 1 134 ? 53.506  66.970  123.493 1.00 33.57  ? 280 PHE A CB  1 
ATOM   995  C  CG  . PHE A 1 134 ? 53.209  65.803  122.589 1.00 36.81  ? 280 PHE A CG  1 
ATOM   996  C  CD1 . PHE A 1 134 ? 53.077  65.988  121.222 1.00 35.25  ? 280 PHE A CD1 1 
ATOM   997  C  CD2 . PHE A 1 134 ? 53.046  64.525  123.107 1.00 37.76  ? 280 PHE A CD2 1 
ATOM   998  C  CE1 . PHE A 1 134 ? 52.802  64.921  120.387 1.00 37.76  ? 280 PHE A CE1 1 
ATOM   999  C  CE2 . PHE A 1 134 ? 52.767  63.455  122.275 1.00 36.66  ? 280 PHE A CE2 1 
ATOM   1000 C  CZ  . PHE A 1 134 ? 52.645  63.654  120.916 1.00 37.41  ? 280 PHE A CZ  1 
ATOM   1001 N  N   . TRP A 1 135 ? 55.501  69.643  124.289 1.00 33.85  ? 281 TRP A N   1 
ATOM   1002 C  CA  . TRP A 1 135 ? 55.655  70.907  124.991 1.00 32.09  ? 281 TRP A CA  1 
ATOM   1003 C  C   . TRP A 1 135 ? 55.918  72.035  124.003 1.00 34.92  ? 281 TRP A C   1 
ATOM   1004 O  O   . TRP A 1 135 ? 56.555  71.829  122.969 1.00 35.67  ? 281 TRP A O   1 
ATOM   1005 C  CB  . TRP A 1 135 ? 56.828  70.838  125.968 1.00 33.09  ? 281 TRP A CB  1 
ATOM   1006 C  CG  . TRP A 1 135 ? 56.614  69.941  127.134 1.00 31.88  ? 281 TRP A CG  1 
ATOM   1007 C  CD1 . TRP A 1 135 ? 57.069  68.662  127.280 1.00 29.92  ? 281 TRP A CD1 1 
ATOM   1008 C  CD2 . TRP A 1 135 ? 55.899  70.254  128.335 1.00 31.35  ? 281 TRP A CD2 1 
ATOM   1009 N  NE1 . TRP A 1 135 ? 56.679  68.159  128.497 1.00 33.13  ? 281 TRP A NE1 1 
ATOM   1010 C  CE2 . TRP A 1 135 ? 55.961  69.118  129.165 1.00 33.77  ? 281 TRP A CE2 1 
ATOM   1011 C  CE3 . TRP A 1 135 ? 55.213  71.384  128.789 1.00 34.14  ? 281 TRP A CE3 1 
ATOM   1012 C  CZ2 . TRP A 1 135 ? 55.360  69.078  130.421 1.00 33.79  ? 281 TRP A CZ2 1 
ATOM   1013 C  CZ3 . TRP A 1 135 ? 54.617  71.343  130.037 1.00 33.41  ? 281 TRP A CZ3 1 
ATOM   1014 C  CH2 . TRP A 1 135 ? 54.694  70.198  130.838 1.00 33.51  ? 281 TRP A CH2 1 
ATOM   1015 N  N   . ILE A 1 136 ? 55.421  73.226  124.325 1.00 36.31  ? 282 ILE A N   1 
ATOM   1016 C  CA  . ILE A 1 136 ? 55.830  74.435  123.629 1.00 36.21  ? 282 ILE A CA  1 
ATOM   1017 C  C   . ILE A 1 136 ? 57.334  74.549  123.824 1.00 40.85  ? 282 ILE A C   1 
ATOM   1018 O  O   . ILE A 1 136 ? 57.850  74.180  124.876 1.00 40.80  ? 282 ILE A O   1 
ATOM   1019 C  CB  . ILE A 1 136 ? 55.128  75.674  124.215 1.00 35.50  ? 282 ILE A CB  1 
ATOM   1020 C  CG1 . ILE A 1 136 ? 53.638  75.655  123.873 1.00 32.18  ? 282 ILE A CG1 1 
ATOM   1021 C  CG2 . ILE A 1 136 ? 55.751  76.959  123.697 1.00 36.47  ? 282 ILE A CG2 1 
ATOM   1022 C  CD1 . ILE A 1 136 ? 52.851  76.741  124.566 1.00 29.54  ? 282 ILE A CD1 1 
ATOM   1023 N  N   . PRO A 1 137 ? 58.051  75.032  122.802 1.00 47.15  ? 283 PRO A N   1 
ATOM   1024 C  CA  . PRO A 1 137 ? 59.502  75.178  122.949 1.00 49.03  ? 283 PRO A CA  1 
ATOM   1025 C  C   . PRO A 1 137 ? 59.842  76.015  124.177 1.00 49.38  ? 283 PRO A C   1 
ATOM   1026 O  O   . PRO A 1 137 ? 59.413  77.164  124.270 1.00 47.95  ? 283 PRO A O   1 
ATOM   1027 C  CB  . PRO A 1 137 ? 59.905  75.930  121.679 1.00 51.10  ? 283 PRO A CB  1 
ATOM   1028 C  CG  . PRO A 1 137 ? 58.833  75.605  120.689 1.00 51.69  ? 283 PRO A CG  1 
ATOM   1029 C  CD  . PRO A 1 137 ? 57.571  75.481  121.483 1.00 49.02  ? 283 PRO A CD  1 
ATOM   1030 N  N   . GLY A 1 138 ? 60.596  75.447  125.111 1.00 51.10  ? 284 GLY A N   1 
ATOM   1031 C  CA  . GLY A 1 138 ? 60.995  76.183  126.297 1.00 52.67  ? 284 GLY A CA  1 
ATOM   1032 C  C   . GLY A 1 138 ? 60.266  75.736  127.548 1.00 54.50  ? 284 GLY A C   1 
ATOM   1033 O  O   . GLY A 1 138 ? 60.720  75.996  128.660 1.00 57.69  ? 284 GLY A O   1 
ATOM   1034 N  N   . GLU A 1 139 ? 59.126  75.074  127.367 1.00 50.97  ? 285 GLU A N   1 
ATOM   1035 C  CA  . GLU A 1 139 ? 58.382  74.497  128.482 1.00 45.11  ? 285 GLU A CA  1 
ATOM   1036 C  C   . GLU A 1 139 ? 58.829  73.053  128.662 1.00 40.38  ? 285 GLU A C   1 
ATOM   1037 O  O   . GLU A 1 139 ? 59.317  72.439  127.713 1.00 41.00  ? 285 GLU A O   1 
ATOM   1038 C  CB  . GLU A 1 139 ? 56.879  74.538  128.202 1.00 44.97  ? 285 GLU A CB  1 
ATOM   1039 C  CG  . GLU A 1 139 ? 56.370  75.873  127.679 1.00 48.11  ? 285 GLU A CG  1 
ATOM   1040 C  CD  . GLU A 1 139 ? 56.560  77.017  128.665 1.00 53.11  ? 285 GLU A CD  1 
ATOM   1041 O  OE1 . GLU A 1 139 ? 56.400  76.807  129.890 1.00 52.05  ? 285 GLU A OE1 1 
ATOM   1042 O  OE2 . GLU A 1 139 ? 56.859  78.139  128.204 1.00 56.45  ? 285 GLU A OE2 1 
ATOM   1043 N  N   . PRO A 1 140 ? 58.674  72.502  129.878 1.00 39.25  ? 286 PRO A N   1 
ATOM   1044 C  CA  . PRO A 1 140 ? 58.167  73.178  131.079 1.00 39.71  ? 286 PRO A CA  1 
ATOM   1045 C  C   . PRO A 1 140 ? 59.209  74.149  131.629 1.00 40.45  ? 286 PRO A C   1 
ATOM   1046 O  O   . PRO A 1 140 ? 60.384  73.796  131.713 1.00 37.86  ? 286 PRO A O   1 
ATOM   1047 C  CB  . PRO A 1 140 ? 57.957  72.027  132.075 1.00 37.86  ? 286 PRO A CB  1 
ATOM   1048 C  CG  . PRO A 1 140 ? 58.075  70.763  131.272 1.00 40.08  ? 286 PRO A CG  1 
ATOM   1049 C  CD  . PRO A 1 140 ? 58.980  71.086  130.139 1.00 39.96  ? 286 PRO A CD  1 
ATOM   1050 N  N   . ASN A 1 141 ? 58.785  75.356  131.992 1.00 45.01  ? 287 ASN A N   1 
ATOM   1051 C  CA  . ASN A 1 141 ? 59.727  76.377  132.443 1.00 47.77  ? 287 ASN A CA  1 
ATOM   1052 C  C   . ASN A 1 141 ? 59.576  76.743  133.914 1.00 47.03  ? 287 ASN A C   1 
ATOM   1053 O  O   . ASN A 1 141 ? 60.410  77.455  134.472 1.00 50.76  ? 287 ASN A O   1 
ATOM   1054 C  CB  . ASN A 1 141 ? 59.648  77.629  131.558 1.00 49.35  ? 287 ASN A CB  1 
ATOM   1055 C  CG  . ASN A 1 141 ? 58.416  78.475  131.835 1.00 48.30  ? 287 ASN A CG  1 
ATOM   1056 O  OD1 . ASN A 1 141 ? 57.461  78.024  132.468 1.00 50.01  ? 287 ASN A OD1 1 
ATOM   1057 N  ND2 . ASN A 1 141 ? 58.435  79.712  131.352 1.00 46.01  ? 287 ASN A ND2 1 
ATOM   1058 N  N   . ASN A 1 142 ? 58.510  76.249  134.536 1.00 46.21  ? 288 ASN A N   1 
ATOM   1059 C  CA  . ASN A 1 142 ? 58.287  76.448  135.964 1.00 49.95  ? 288 ASN A CA  1 
ATOM   1060 C  C   . ASN A 1 142 ? 58.511  77.898  136.394 1.00 52.77  ? 288 ASN A C   1 
ATOM   1061 O  O   . ASN A 1 142 ? 59.257  78.178  137.333 1.00 51.68  ? 288 ASN A O   1 
ATOM   1062 C  CB  . ASN A 1 142 ? 59.173  75.504  136.783 1.00 51.78  ? 288 ASN A CB  1 
ATOM   1063 C  CG  . ASN A 1 142 ? 58.615  75.238  138.171 1.00 55.46  ? 288 ASN A CG  1 
ATOM   1064 O  OD1 . ASN A 1 142 ? 57.415  75.394  138.411 1.00 55.24  ? 288 ASN A OD1 1 
ATOM   1065 N  ND2 . ASN A 1 142 ? 59.484  74.828  139.093 1.00 57.11  ? 288 ASN A ND2 1 
ATOM   1066 N  N   . ALA A 1 143 ? 57.862  78.817  135.688 1.00 56.82  ? 289 ALA A N   1 
ATOM   1067 C  CA  . ALA A 1 143 ? 57.953  80.233  136.011 1.00 56.10  ? 289 ALA A CA  1 
ATOM   1068 C  C   . ALA A 1 143 ? 57.404  80.491  137.406 1.00 58.92  ? 289 ALA A C   1 
ATOM   1069 O  O   . ALA A 1 143 ? 56.193  80.422  137.632 1.00 57.28  ? 289 ALA A O   1 
ATOM   1070 C  CB  . ALA A 1 143 ? 57.205  81.057  134.986 1.00 54.69  ? 289 ALA A CB  1 
ATOM   1071 N  N   . GLY A 1 144 ? 58.307  80.784  138.337 1.00 62.50  ? 290 GLY A N   1 
ATOM   1072 C  CA  . GLY A 1 144 ? 57.932  81.064  139.709 1.00 62.81  ? 290 GLY A CA  1 
ATOM   1073 C  C   . GLY A 1 144 ? 57.994  79.841  140.605 1.00 63.65  ? 290 GLY A C   1 
ATOM   1074 O  O   . GLY A 1 144 ? 57.509  79.880  141.739 1.00 62.92  ? 290 GLY A O   1 
ATOM   1075 N  N   . ASN A 1 145 ? 58.593  78.759  140.107 1.00 62.90  ? 291 ASN A N   1 
ATOM   1076 C  CA  . ASN A 1 145 ? 58.634  77.506  140.853 1.00 63.87  ? 291 ASN A CA  1 
ATOM   1077 C  C   . ASN A 1 145 ? 57.228  77.162  141.317 1.00 62.06  ? 291 ASN A C   1 
ATOM   1078 O  O   . ASN A 1 145 ? 57.036  76.551  142.367 1.00 64.07  ? 291 ASN A O   1 
ATOM   1079 C  CB  . ASN A 1 145 ? 59.563  77.630  142.064 1.00 69.36  ? 291 ASN A CB  1 
ATOM   1080 C  CG  . ASN A 1 145 ? 60.781  76.733  141.961 1.00 71.92  ? 291 ASN A CG  1 
ATOM   1081 O  OD1 . ASN A 1 145 ? 61.147  76.054  142.921 1.00 72.83  ? 291 ASN A OD1 1 
ATOM   1082 N  ND2 . ASN A 1 145 ? 61.414  76.723  140.794 1.00 72.59  ? 291 ASN A ND2 1 
ATOM   1083 N  N   . ASN A 1 146 ? 56.252  77.563  140.511 1.00 58.79  ? 292 ASN A N   1 
ATOM   1084 C  CA  . ASN A 1 146 ? 54.853  77.576  140.906 1.00 56.09  ? 292 ASN A CA  1 
ATOM   1085 C  C   . ASN A 1 146 ? 54.008  76.660  140.026 1.00 52.14  ? 292 ASN A C   1 
ATOM   1086 O  O   . ASN A 1 146 ? 52.930  76.211  140.422 1.00 51.53  ? 292 ASN A O   1 
ATOM   1087 C  CB  . ASN A 1 146 ? 54.325  79.007  140.780 1.00 56.41  ? 292 ASN A CB  1 
ATOM   1088 C  CG  . ASN A 1 146 ? 53.054  79.234  141.564 1.00 59.16  ? 292 ASN A CG  1 
ATOM   1089 O  OD1 . ASN A 1 146 ? 52.655  78.397  142.372 1.00 61.52  ? 292 ASN A OD1 1 
ATOM   1090 N  ND2 . ASN A 1 146 ? 52.413  80.378  141.339 1.00 58.60  ? 292 ASN A ND2 1 
ATOM   1091 N  N   . GLU A 1 147 ? 54.511  76.392  138.827 1.00 46.99  ? 293 GLU A N   1 
ATOM   1092 C  CA  . GLU A 1 147 ? 53.717  75.760  137.782 1.00 45.21  ? 293 GLU A CA  1 
ATOM   1093 C  C   . GLU A 1 147 ? 53.757  74.241  137.882 1.00 43.88  ? 293 GLU A C   1 
ATOM   1094 O  O   . GLU A 1 147 ? 54.647  73.594  137.333 1.00 46.42  ? 293 GLU A O   1 
ATOM   1095 C  CB  . GLU A 1 147 ? 54.209  76.229  136.413 1.00 44.34  ? 293 GLU A CB  1 
ATOM   1096 C  CG  . GLU A 1 147 ? 54.709  77.670  136.433 1.00 45.92  ? 293 GLU A CG  1 
ATOM   1097 C  CD  . GLU A 1 147 ? 54.610  78.361  135.087 1.00 46.01  ? 293 GLU A CD  1 
ATOM   1098 O  OE1 . GLU A 1 147 ? 55.310  77.940  134.138 1.00 46.83  ? 293 GLU A OE1 1 
ATOM   1099 O  OE2 . GLU A 1 147 ? 53.832  79.335  134.984 1.00 46.50  ? 293 GLU A OE2 1 
ATOM   1100 N  N   . HIS A 1 148 ? 52.786  73.676  138.590 1.00 39.50  ? 294 HIS A N   1 
ATOM   1101 C  CA  . HIS A 1 148 ? 52.749  72.237  138.789 1.00 43.64  ? 294 HIS A CA  1 
ATOM   1102 C  C   . HIS A 1 148 ? 51.648  71.549  137.985 1.00 38.75  ? 294 HIS A C   1 
ATOM   1103 O  O   . HIS A 1 148 ? 51.264  70.424  138.299 1.00 41.11  ? 294 HIS A O   1 
ATOM   1104 C  CB  . HIS A 1 148 ? 52.600  71.911  140.275 1.00 50.14  ? 294 HIS A CB  1 
ATOM   1105 C  CG  . HIS A 1 148 ? 53.732  72.411  141.117 1.00 55.86  ? 294 HIS A CG  1 
ATOM   1106 N  ND1 . HIS A 1 148 ? 55.018  72.533  140.638 1.00 56.97  ? 294 HIS A ND1 1 
ATOM   1107 C  CD2 . HIS A 1 148 ? 53.773  72.810  142.410 1.00 57.65  ? 294 HIS A CD2 1 
ATOM   1108 C  CE1 . HIS A 1 148 ? 55.802  72.991  141.597 1.00 58.81  ? 294 HIS A CE1 1 
ATOM   1109 N  NE2 . HIS A 1 148 ? 55.071  73.167  142.683 1.00 59.57  ? 294 HIS A NE2 1 
ATOM   1110 N  N   . CYS A 1 149 ? 51.150  72.222  136.949 1.00 33.50  ? 295 CYS A N   1 
ATOM   1111 C  CA  . CYS A 1 149 ? 50.078  71.676  136.117 1.00 33.74  ? 295 CYS A CA  1 
ATOM   1112 C  C   . CYS A 1 149 ? 50.251  72.049  134.646 1.00 33.83  ? 295 CYS A C   1 
ATOM   1113 O  O   . CYS A 1 149 ? 50.932  73.019  134.319 1.00 35.02  ? 295 CYS A O   1 
ATOM   1114 C  CB  . CYS A 1 149 ? 48.710  72.144  136.616 1.00 34.51  ? 295 CYS A CB  1 
ATOM   1115 S  SG  . CYS A 1 149 ? 48.222  71.476  138.218 1.00 47.98  ? 295 CYS A SG  1 
ATOM   1116 N  N   . GLY A 1 150 ? 49.624  71.279  133.762 1.00 30.40  ? 296 GLY A N   1 
ATOM   1117 C  CA  . GLY A 1 150 ? 49.801  71.469  132.334 1.00 27.97  ? 296 GLY A CA  1 
ATOM   1118 C  C   . GLY A 1 150 ? 48.515  71.771  131.587 1.00 27.63  ? 296 GLY A C   1 
ATOM   1119 O  O   . GLY A 1 150 ? 47.448  71.265  131.931 1.00 28.62  ? 296 GLY A O   1 
ATOM   1120 N  N   . ASN A 1 151 ? 48.614  72.605  130.557 1.00 25.93  ? 297 ASN A N   1 
ATOM   1121 C  CA  . ASN A 1 151 ? 47.453  72.944  129.740 1.00 25.84  ? 297 ASN A CA  1 
ATOM   1122 C  C   . ASN A 1 151 ? 47.798  72.964  128.256 1.00 28.32  ? 297 ASN A C   1 
ATOM   1123 O  O   . ASN A 1 151 ? 48.961  73.104  127.884 1.00 32.59  ? 297 ASN A O   1 
ATOM   1124 C  CB  . ASN A 1 151 ? 46.835  74.283  130.182 1.00 20.89  ? 297 ASN A CB  1 
ATOM   1125 C  CG  . ASN A 1 151 ? 47.782  75.468  130.000 1.00 20.64  ? 297 ASN A CG  1 
ATOM   1126 O  OD1 . ASN A 1 151 ? 48.546  75.535  129.035 1.00 24.09  ? 297 ASN A OD1 1 
ATOM   1127 N  ND2 . ASN A 1 151 ? 47.721  76.416  130.929 1.00 19.54  ? 297 ASN A ND2 1 
ATOM   1128 N  N   . ILE A 1 152 ? 46.786  72.794  127.414 1.00 29.19  ? 298 ILE A N   1 
ATOM   1129 C  CA  . ILE A 1 152 ? 46.951  72.984  125.979 1.00 28.33  ? 298 ILE A CA  1 
ATOM   1130 C  C   . ILE A 1 152 ? 46.832  74.471  125.673 1.00 29.84  ? 298 ILE A C   1 
ATOM   1131 O  O   . ILE A 1 152 ? 45.861  75.124  126.052 1.00 27.21  ? 298 ILE A O   1 
ATOM   1132 C  CB  . ILE A 1 152 ? 45.913  72.190  125.174 1.00 27.07  ? 298 ILE A CB  1 
ATOM   1133 C  CG1 . ILE A 1 152 ? 46.508  70.851  124.743 1.00 30.03  ? 298 ILE A CG1 1 
ATOM   1134 C  CG2 . ILE A 1 152 ? 45.469  72.974  123.953 1.00 31.45  ? 298 ILE A CG2 1 
ATOM   1135 C  CD1 . ILE A 1 152 ? 45.638  70.082  123.769 1.00 32.40  ? 298 ILE A CD1 1 
ATOM   1136 N  N   . LYS A 1 153 ? 47.834  75.012  124.998 1.00 31.31  ? 299 LYS A N   1 
ATOM   1137 C  CA  . LYS A 1 153 ? 47.900  76.449  124.834 1.00 31.45  ? 299 LYS A CA  1 
ATOM   1138 C  C   . LYS A 1 153 ? 48.069  76.865  123.382 1.00 34.77  ? 299 LYS A C   1 
ATOM   1139 O  O   . LYS A 1 153 ? 47.231  77.581  122.837 1.00 35.85  ? 299 LYS A O   1 
ATOM   1140 C  CB  . LYS A 1 153 ? 49.041  77.020  125.674 1.00 25.21  ? 299 LYS A CB  1 
ATOM   1141 C  CG  . LYS A 1 153 ? 49.166  78.507  125.554 1.00 24.22  ? 299 LYS A CG  1 
ATOM   1142 C  CD  . LYS A 1 153 ? 50.244  79.032  126.476 1.00 30.20  ? 299 LYS A CD  1 
ATOM   1143 C  CE  . LYS A 1 153 ? 50.414  80.525  126.300 1.00 33.04  ? 299 LYS A CE  1 
ATOM   1144 N  NZ  . LYS A 1 153 ? 51.636  80.983  127.012 1.00 42.99  ? 299 LYS A NZ  1 
ATOM   1145 N  N   . ALA A 1 154 ? 49.162  76.419  122.772 1.00 30.88  ? 300 ALA A N   1 
ATOM   1146 C  CA  . ALA A 1 154 ? 49.487  76.781  121.403 1.00 30.90  ? 300 ALA A CA  1 
ATOM   1147 C  C   . ALA A 1 154 ? 48.774  75.862  120.409 1.00 37.37  ? 300 ALA A C   1 
ATOM   1148 O  O   . ALA A 1 154 ? 48.648  74.663  120.655 1.00 40.35  ? 300 ALA A O   1 
ATOM   1149 C  CB  . ALA A 1 154 ? 50.993  76.729  121.200 1.00 26.93  ? 300 ALA A CB  1 
ATOM   1150 N  N   . PRO A 1 155 ? 48.299  76.428  119.284 1.00 39.51  ? 301 PRO A N   1 
ATOM   1151 C  CA  . PRO A 1 155 ? 47.643  75.683  118.198 1.00 39.26  ? 301 PRO A CA  1 
ATOM   1152 C  C   . PRO A 1 155 ? 48.652  74.900  117.364 1.00 40.92  ? 301 PRO A C   1 
ATOM   1153 O  O   . PRO A 1 155 ? 48.815  75.174  116.176 1.00 46.16  ? 301 PRO A O   1 
ATOM   1154 C  CB  . PRO A 1 155 ? 47.020  76.789  117.327 1.00 39.13  ? 301 PRO A CB  1 
ATOM   1155 C  CG  . PRO A 1 155 ? 47.161  78.069  118.110 1.00 41.11  ? 301 PRO A CG  1 
ATOM   1156 C  CD  . PRO A 1 155 ? 48.345  77.872  119.005 1.00 39.67  ? 301 PRO A CD  1 
ATOM   1157 N  N   . SER A 1 156 ? 49.320  73.934  117.980 1.00 37.93  ? 302 SER A N   1 
ATOM   1158 C  CA  . SER A 1 156 ? 50.334  73.148  117.295 1.00 35.70  ? 302 SER A CA  1 
ATOM   1159 C  C   . SER A 1 156 ? 50.561  71.853  118.065 1.00 37.08  ? 302 SER A C   1 
ATOM   1160 O  O   . SER A 1 156 ? 50.048  71.691  119.173 1.00 36.52  ? 302 SER A O   1 
ATOM   1161 C  CB  . SER A 1 156 ? 51.628  73.958  117.180 1.00 35.61  ? 302 SER A CB  1 
ATOM   1162 O  OG  . SER A 1 156 ? 52.761  73.221  117.602 1.00 35.54  ? 302 SER A OG  1 
ATOM   1163 N  N   . LEU A 1 157 ? 51.305  70.921  117.477 1.00 37.46  ? 303 LEU A N   1 
ATOM   1164 C  CA  . LEU A 1 157 ? 51.665  69.698  118.185 1.00 38.75  ? 303 LEU A CA  1 
ATOM   1165 C  C   . LEU A 1 157 ? 52.507  70.027  119.411 1.00 37.64  ? 303 LEU A C   1 
ATOM   1166 O  O   . LEU A 1 157 ? 52.426  69.347  120.430 1.00 35.61  ? 303 LEU A O   1 
ATOM   1167 C  CB  . LEU A 1 157 ? 52.404  68.722  117.266 1.00 42.91  ? 303 LEU A CB  1 
ATOM   1168 C  CG  . LEU A 1 157 ? 51.521  67.881  116.338 1.00 46.26  ? 303 LEU A CG  1 
ATOM   1169 C  CD1 . LEU A 1 157 ? 52.350  67.169  115.273 1.00 49.80  ? 303 LEU A CD1 1 
ATOM   1170 C  CD2 . LEU A 1 157 ? 50.694  66.882  117.141 1.00 42.93  ? 303 LEU A CD2 1 
ATOM   1171 N  N   . GLN A 1 158 ? 53.322  71.071  119.303 1.00 41.37  ? 304 GLN A N   1 
ATOM   1172 C  CA  . GLN A 1 158 ? 54.036  71.601  120.459 1.00 41.03  ? 304 GLN A CA  1 
ATOM   1173 C  C   . GLN A 1 158 ? 53.113  72.579  121.167 1.00 37.78  ? 304 GLN A C   1 
ATOM   1174 O  O   . GLN A 1 158 ? 53.205  73.790  120.964 1.00 38.51  ? 304 GLN A O   1 
ATOM   1175 C  CB  . GLN A 1 158 ? 55.320  72.302  120.024 1.00 44.94  ? 304 GLN A CB  1 
ATOM   1176 C  CG  . GLN A 1 158 ? 56.210  71.447  119.141 1.00 51.37  ? 304 GLN A CG  1 
ATOM   1177 C  CD  . GLN A 1 158 ? 57.682  71.730  119.356 1.00 60.78  ? 304 GLN A CD  1 
ATOM   1178 O  OE1 . GLN A 1 158 ? 58.232  72.684  118.804 1.00 64.98  ? 304 GLN A OE1 1 
ATOM   1179 N  NE2 . GLN A 1 158 ? 58.330  70.900  120.166 1.00 63.92  ? 304 GLN A NE2 1 
ATOM   1180 N  N   . ALA A 1 159 ? 52.226  72.044  122.000 1.00 34.43  ? 305 ALA A N   1 
ATOM   1181 C  CA  . ALA A 1 159 ? 51.110  72.820  122.534 1.00 32.93  ? 305 ALA A CA  1 
ATOM   1182 C  C   . ALA A 1 159 ? 51.130  73.057  124.043 1.00 34.39  ? 305 ALA A C   1 
ATOM   1183 O  O   . ALA A 1 159 ? 50.490  73.990  124.525 1.00 34.86  ? 305 ALA A O   1 
ATOM   1184 C  CB  . ALA A 1 159 ? 49.793  72.163  122.139 1.00 29.04  ? 305 ALA A CB  1 
ATOM   1185 N  N   . TRP A 1 160 ? 51.837  72.211  124.790 1.00 34.48  ? 306 TRP A N   1 
ATOM   1186 C  CA  . TRP A 1 160 ? 51.728  72.228  126.254 1.00 33.98  ? 306 TRP A CA  1 
ATOM   1187 C  C   . TRP A 1 160 ? 52.463  73.381  126.930 1.00 30.51  ? 306 TRP A C   1 
ATOM   1188 O  O   . TRP A 1 160 ? 53.598  73.707  126.583 1.00 27.96  ? 306 TRP A O   1 
ATOM   1189 C  CB  . TRP A 1 160 ? 52.228  70.920  126.875 1.00 33.81  ? 306 TRP A CB  1 
ATOM   1190 C  CG  . TRP A 1 160 ? 51.550  69.671  126.395 1.00 34.97  ? 306 TRP A CG  1 
ATOM   1191 C  CD1 . TRP A 1 160 ? 50.372  69.574  125.710 1.00 33.44  ? 306 TRP A CD1 1 
ATOM   1192 C  CD2 . TRP A 1 160 ? 52.018  68.331  126.583 1.00 35.28  ? 306 TRP A CD2 1 
ATOM   1193 N  NE1 . TRP A 1 160 ? 50.086  68.255  125.450 1.00 33.22  ? 306 TRP A NE1 1 
ATOM   1194 C  CE2 . TRP A 1 160 ? 51.080  67.472  125.978 1.00 34.11  ? 306 TRP A CE2 1 
ATOM   1195 C  CE3 . TRP A 1 160 ? 53.143  67.775  127.200 1.00 35.65  ? 306 TRP A CE3 1 
ATOM   1196 C  CZ2 . TRP A 1 160 ? 51.230  66.087  125.978 1.00 35.45  ? 306 TRP A CZ2 1 
ATOM   1197 C  CZ3 . TRP A 1 160 ? 53.292  66.403  127.195 1.00 38.19  ? 306 TRP A CZ3 1 
ATOM   1198 C  CH2 . TRP A 1 160 ? 52.343  65.573  126.586 1.00 37.42  ? 306 TRP A CH2 1 
ATOM   1199 N  N   . ASN A 1 161 ? 51.805  73.977  127.916 1.00 28.66  ? 307 ASN A N   1 
ATOM   1200 C  CA  . ASN A 1 161 ? 52.449  74.924  128.807 1.00 33.82  ? 307 ASN A CA  1 
ATOM   1201 C  C   . ASN A 1 161 ? 52.246  74.500  130.254 1.00 33.33  ? 307 ASN A C   1 
ATOM   1202 O  O   . ASN A 1 161 ? 51.176  74.015  130.610 1.00 31.48  ? 307 ASN A O   1 
ATOM   1203 C  CB  . ASN A 1 161 ? 51.886  76.332  128.620 1.00 31.29  ? 307 ASN A CB  1 
ATOM   1204 C  CG  . ASN A 1 161 ? 52.458  77.309  129.623 1.00 36.53  ? 307 ASN A CG  1 
ATOM   1205 O  OD1 . ASN A 1 161 ? 53.664  77.312  129.879 1.00 39.01  ? 307 ASN A OD1 1 
ATOM   1206 N  ND2 . ASN A 1 161 ? 51.598  78.128  130.215 1.00 36.61  ? 307 ASN A ND2 1 
ATOM   1207 N  N   . ASP A 1 162 ? 53.261  74.677  131.093 1.00 31.38  ? 308 ASP A N   1 
ATOM   1208 C  CA  . ASP A 1 162 ? 53.051  74.467  132.520 1.00 27.22  ? 308 ASP A CA  1 
ATOM   1209 C  C   . ASP A 1 162 ? 52.688  75.787  133.179 1.00 28.43  ? 308 ASP A C   1 
ATOM   1210 O  O   . ASP A 1 162 ? 53.276  76.835  132.887 1.00 24.25  ? 308 ASP A O   1 
ATOM   1211 C  CB  . ASP A 1 162 ? 54.239  73.777  133.207 1.00 30.30  ? 308 ASP A CB  1 
ATOM   1212 C  CG  . ASP A 1 162 ? 55.524  74.574  133.122 1.00 32.20  ? 308 ASP A CG  1 
ATOM   1213 O  OD1 . ASP A 1 162 ? 55.623  75.463  132.262 1.00 35.47  ? 308 ASP A OD1 1 
ATOM   1214 O  OD2 . ASP A 1 162 ? 56.451  74.290  133.906 1.00 33.24  ? 308 ASP A OD2 1 
ATOM   1215 N  N   . ALA A 1 163 ? 51.693  75.724  134.056 1.00 29.67  ? 309 ALA A N   1 
ATOM   1216 C  CA  . ALA A 1 163 ? 51.107  76.906  134.657 1.00 26.39  ? 309 ALA A CA  1 
ATOM   1217 C  C   . ALA A 1 163 ? 50.763  76.586  136.104 1.00 31.98  ? 309 ALA A C   1 
ATOM   1218 O  O   . ALA A 1 163 ? 50.665  75.416  136.470 1.00 33.91  ? 309 ALA A O   1 
ATOM   1219 C  CB  . ALA A 1 163 ? 49.847  77.309  133.883 1.00 18.76  ? 309 ALA A CB  1 
ATOM   1220 N  N   . PRO A 1 164 ? 50.594  77.624  136.940 1.00 32.46  ? 310 PRO A N   1 
ATOM   1221 C  CA  . PRO A 1 164 ? 50.201  77.417  138.340 1.00 34.42  ? 310 PRO A CA  1 
ATOM   1222 C  C   . PRO A 1 164 ? 48.813  76.794  138.437 1.00 33.65  ? 310 PRO A C   1 
ATOM   1223 O  O   . PRO A 1 164 ? 47.896  77.228  137.738 1.00 29.83  ? 310 PRO A O   1 
ATOM   1224 C  CB  . PRO A 1 164 ? 50.191  78.840  138.913 1.00 34.88  ? 310 PRO A CB  1 
ATOM   1225 C  CG  . PRO A 1 164 ? 51.139  79.603  138.043 1.00 33.46  ? 310 PRO A CG  1 
ATOM   1226 C  CD  . PRO A 1 164 ? 50.930  79.030  136.664 1.00 30.73  ? 310 PRO A CD  1 
ATOM   1227 N  N   . CYS A 1 165 ? 48.669  75.799  139.307 1.00 34.25  ? 311 CYS A N   1 
ATOM   1228 C  CA  . CYS A 1 165 ? 47.457  74.985  139.373 1.00 34.08  ? 311 CYS A CA  1 
ATOM   1229 C  C   . CYS A 1 165 ? 46.209  75.746  139.830 1.00 37.46  ? 311 CYS A C   1 
ATOM   1230 O  O   . CYS A 1 165 ? 45.086  75.259  139.665 1.00 35.27  ? 311 CYS A O   1 
ATOM   1231 C  CB  . CYS A 1 165 ? 47.689  73.765  140.280 1.00 36.82  ? 311 CYS A CB  1 
ATOM   1232 S  SG  . CYS A 1 165 ? 48.996  72.623  139.726 1.00 69.74  ? 311 CYS A SG  1 
ATOM   1233 N  N   . ASP A 1 166 ? 46.402  76.928  140.412 1.00 39.97  ? 312 ASP A N   1 
ATOM   1234 C  CA  . ASP A 1 166 ? 45.275  77.739  140.886 1.00 42.47  ? 312 ASP A CA  1 
ATOM   1235 C  C   . ASP A 1 166 ? 44.761  78.738  139.843 1.00 41.00  ? 312 ASP A C   1 
ATOM   1236 O  O   . ASP A 1 166 ? 43.792  79.465  140.087 1.00 42.87  ? 312 ASP A O   1 
ATOM   1237 C  CB  . ASP A 1 166 ? 45.622  78.466  142.191 1.00 45.24  ? 312 ASP A CB  1 
ATOM   1238 C  CG  . ASP A 1 166 ? 46.620  79.589  141.990 1.00 45.82  ? 312 ASP A CG  1 
ATOM   1239 O  OD1 . ASP A 1 166 ? 47.503  79.462  141.115 1.00 40.92  ? 312 ASP A OD1 1 
ATOM   1240 O  OD2 . ASP A 1 166 ? 46.524  80.605  142.715 1.00 53.70  ? 312 ASP A OD2 1 
ATOM   1241 N  N   . LYS A 1 167 ? 45.414  78.783  138.686 1.00 36.29  ? 313 LYS A N   1 
ATOM   1242 C  CA  . LYS A 1 167 ? 44.890  79.544  137.559 1.00 36.28  ? 313 LYS A CA  1 
ATOM   1243 C  C   . LYS A 1 167 ? 43.590  78.892  137.090 1.00 34.89  ? 313 LYS A C   1 
ATOM   1244 O  O   . LYS A 1 167 ? 43.444  77.672  137.164 1.00 31.66  ? 313 LYS A O   1 
ATOM   1245 C  CB  . LYS A 1 167 ? 45.902  79.573  136.413 1.00 38.87  ? 313 LYS A CB  1 
ATOM   1246 C  CG  . LYS A 1 167 ? 47.028  80.581  136.580 1.00 46.95  ? 313 LYS A CG  1 
ATOM   1247 C  CD  . LYS A 1 167 ? 46.505  82.007  136.490 1.00 52.92  ? 313 LYS A CD  1 
ATOM   1248 C  CE  . LYS A 1 167 ? 47.480  82.907  135.743 1.00 56.57  ? 313 LYS A CE  1 
ATOM   1249 N  NZ  . LYS A 1 167 ? 48.829  82.922  136.373 1.00 57.11  ? 313 LYS A NZ  1 
ATOM   1250 N  N   . THR A 1 168 ? 42.647  79.700  136.615 1.00 35.16  ? 314 THR A N   1 
ATOM   1251 C  CA  . THR A 1 168 ? 41.394  79.165  136.095 1.00 36.45  ? 314 THR A CA  1 
ATOM   1252 C  C   . THR A 1 168 ? 41.363  79.158  134.569 1.00 34.96  ? 314 THR A C   1 
ATOM   1253 O  O   . THR A 1 168 ? 41.457  80.207  133.932 1.00 33.94  ? 314 THR A O   1 
ATOM   1254 C  CB  . THR A 1 168 ? 40.187  79.951  136.615 1.00 37.78  ? 314 THR A CB  1 
ATOM   1255 O  OG1 . THR A 1 168 ? 40.263  81.302  136.151 1.00 41.11  ? 314 THR A OG1 1 
ATOM   1256 C  CG2 . THR A 1 168 ? 40.172  79.942  138.127 1.00 38.36  ? 314 THR A CG2 1 
ATOM   1257 N  N   . PHE A 1 169 ? 41.242  77.964  133.995 1.00 34.27  ? 315 PHE A N   1 
ATOM   1258 C  CA  . PHE A 1 169 ? 41.101  77.800  132.550 1.00 29.27  ? 315 PHE A CA  1 
ATOM   1259 C  C   . PHE A 1 169 ? 39.933  76.880  132.251 1.00 29.97  ? 315 PHE A C   1 
ATOM   1260 O  O   . PHE A 1 169 ? 39.418  76.202  133.144 1.00 28.32  ? 315 PHE A O   1 
ATOM   1261 C  CB  . PHE A 1 169 ? 42.359  77.192  131.932 1.00 27.10  ? 315 PHE A CB  1 
ATOM   1262 C  CG  . PHE A 1 169 ? 43.575  78.065  132.028 1.00 33.09  ? 315 PHE A CG  1 
ATOM   1263 C  CD1 . PHE A 1 169 ? 43.708  79.185  131.224 1.00 35.81  ? 315 PHE A CD1 1 
ATOM   1264 C  CD2 . PHE A 1 169 ? 44.600  77.751  132.906 1.00 34.60  ? 315 PHE A CD2 1 
ATOM   1265 C  CE1 . PHE A 1 169 ? 44.834  79.989  131.307 1.00 35.17  ? 315 PHE A CE1 1 
ATOM   1266 C  CE2 . PHE A 1 169 ? 45.728  78.551  132.991 1.00 35.91  ? 315 PHE A CE2 1 
ATOM   1267 C  CZ  . PHE A 1 169 ? 45.844  79.669  132.191 1.00 34.63  ? 315 PHE A CZ  1 
ATOM   1268 N  N   . LEU A 1 170 ? 39.512  76.863  130.990 1.00 28.64  ? 316 LEU A N   1 
ATOM   1269 C  CA  . LEU A 1 170 ? 38.608  75.828  130.522 1.00 23.32  ? 316 LEU A CA  1 
ATOM   1270 C  C   . LEU A 1 170 ? 39.404  74.537  130.586 1.00 24.69  ? 316 LEU A C   1 
ATOM   1271 O  O   . LEU A 1 170 ? 40.633  74.566  130.648 1.00 25.45  ? 316 LEU A O   1 
ATOM   1272 C  CB  . LEU A 1 170 ? 38.192  76.098  129.086 1.00 22.90  ? 316 LEU A CB  1 
ATOM   1273 C  CG  . LEU A 1 170 ? 37.568  77.462  128.814 1.00 22.35  ? 316 LEU A CG  1 
ATOM   1274 C  CD1 . LEU A 1 170 ? 37.505  77.690  127.320 1.00 20.59  ? 316 LEU A CD1 1 
ATOM   1275 C  CD2 . LEU A 1 170 ? 36.190  77.557  129.441 1.00 22.61  ? 316 LEU A CD2 1 
ATOM   1276 N  N   . PHE A 1 171 ? 38.724  73.401  130.563 1.00 23.12  ? 317 PHE A N   1 
ATOM   1277 C  CA  . PHE A 1 171 ? 39.421  72.141  130.744 1.00 23.16  ? 317 PHE A CA  1 
ATOM   1278 C  C   . PHE A 1 171 ? 38.836  71.053  129.863 1.00 24.69  ? 317 PHE A C   1 
ATOM   1279 O  O   . PHE A 1 171 ? 37.698  71.156  129.386 1.00 23.12  ? 317 PHE A O   1 
ATOM   1280 C  CB  . PHE A 1 171 ? 39.366  71.715  132.212 1.00 22.03  ? 317 PHE A CB  1 
ATOM   1281 C  CG  . PHE A 1 171 ? 37.976  71.673  132.768 1.00 21.41  ? 317 PHE A CG  1 
ATOM   1282 C  CD1 . PHE A 1 171 ? 37.193  70.543  132.621 1.00 24.17  ? 317 PHE A CD1 1 
ATOM   1283 C  CD2 . PHE A 1 171 ? 37.446  72.771  133.422 1.00 16.61  ? 317 PHE A CD2 1 
ATOM   1284 C  CE1 . PHE A 1 171 ? 35.908  70.508  133.120 1.00 26.43  ? 317 PHE A CE1 1 
ATOM   1285 C  CE2 . PHE A 1 171 ? 36.166  72.738  133.927 1.00 17.96  ? 317 PHE A CE2 1 
ATOM   1286 C  CZ  . PHE A 1 171 ? 35.394  71.608  133.776 1.00 21.29  ? 317 PHE A CZ  1 
ATOM   1287 N  N   . ILE A 1 172 ? 39.627  70.006  129.662 1.00 21.52  ? 318 ILE A N   1 
ATOM   1288 C  CA  . ILE A 1 172 ? 39.227  68.898  128.812 1.00 18.87  ? 318 ILE A CA  1 
ATOM   1289 C  C   . ILE A 1 172 ? 39.177  67.596  129.580 1.00 23.16  ? 318 ILE A C   1 
ATOM   1290 O  O   . ILE A 1 172 ? 40.200  67.117  130.071 1.00 22.81  ? 318 ILE A O   1 
ATOM   1291 C  CB  . ILE A 1 172 ? 40.188  68.734  127.631 1.00 15.67  ? 318 ILE A CB  1 
ATOM   1292 C  CG1 . ILE A 1 172 ? 40.217  70.018  126.803 1.00 17.10  ? 318 ILE A CG1 1 
ATOM   1293 C  CG2 . ILE A 1 172 ? 39.777  67.537  126.773 1.00 13.77  ? 318 ILE A CG2 1 
ATOM   1294 C  CD1 . ILE A 1 172 ? 41.308  70.040  125.754 1.00 20.87  ? 318 ILE A CD1 1 
ATOM   1295 N  N   . CYS A 1 173 ? 37.977  67.029  129.678 1.00 28.33  ? 319 CYS A N   1 
ATOM   1296 C  CA  . CYS A 1 173 ? 37.783  65.708  130.272 1.00 26.94  ? 319 CYS A CA  1 
ATOM   1297 C  C   . CYS A 1 173 ? 37.892  64.626  129.200 1.00 28.44  ? 319 CYS A C   1 
ATOM   1298 O  O   . CYS A 1 173 ? 37.701  64.895  128.007 1.00 28.08  ? 319 CYS A O   1 
ATOM   1299 C  CB  . CYS A 1 173 ? 36.412  65.625  130.941 1.00 25.10  ? 319 CYS A CB  1 
ATOM   1300 S  SG  . CYS A 1 173 ? 36.134  66.840  132.251 1.00 42.41  ? 319 CYS A SG  1 
ATOM   1301 N  N   . LYS A 1 174 ? 38.196  63.405  129.627 1.00 23.56  ? 320 LYS A N   1 
ATOM   1302 C  CA  . LYS A 1 174 ? 38.286  62.277  128.709 1.00 24.50  ? 320 LYS A CA  1 
ATOM   1303 C  C   . LYS A 1 174 ? 37.826  60.974  129.379 1.00 26.47  ? 320 LYS A C   1 
ATOM   1304 O  O   . LYS A 1 174 ? 38.173  60.703  130.527 1.00 20.36  ? 320 LYS A O   1 
ATOM   1305 C  CB  . LYS A 1 174 ? 39.714  62.136  128.187 1.00 22.20  ? 320 LYS A CB  1 
ATOM   1306 C  CG  . LYS A 1 174 ? 39.921  60.953  127.260 1.00 22.88  ? 320 LYS A CG  1 
ATOM   1307 C  CD  . LYS A 1 174 ? 41.190  60.209  127.628 1.00 24.84  ? 320 LYS A CD  1 
ATOM   1308 C  CE  . LYS A 1 174 ? 41.964  59.805  126.399 1.00 26.36  ? 320 LYS A CE  1 
ATOM   1309 N  NZ  . LYS A 1 174 ? 43.421  59.993  126.626 1.00 28.36  ? 320 LYS A NZ  1 
ATOM   1310 N  N   . ARG A 1 175 ? 37.020  60.187  128.673 1.00 26.59  ? 321 ARG A N   1 
ATOM   1311 C  CA  . ARG A 1 175 ? 36.611  58.882  129.182 1.00 25.83  ? 321 ARG A CA  1 
ATOM   1312 C  C   . ARG A 1 175 ? 36.404  57.896  128.037 1.00 29.36  ? 321 ARG A C   1 
ATOM   1313 O  O   . ARG A 1 175 ? 35.936  58.275  126.963 1.00 31.93  ? 321 ARG A O   1 
ATOM   1314 C  CB  . ARG A 1 175 ? 35.359  58.983  130.062 1.00 23.34  ? 321 ARG A CB  1 
ATOM   1315 C  CG  . ARG A 1 175 ? 34.095  59.404  129.322 1.00 26.34  ? 321 ARG A CG  1 
ATOM   1316 C  CD  . ARG A 1 175 ? 32.867  59.234  130.208 1.00 26.38  ? 321 ARG A CD  1 
ATOM   1317 N  NE  . ARG A 1 175 ? 31.628  59.542  129.503 1.00 26.96  ? 321 ARG A NE  1 
ATOM   1318 C  CZ  . ARG A 1 175 ? 30.875  58.636  128.887 1.00 33.54  ? 321 ARG A CZ  1 
ATOM   1319 N  NH1 . ARG A 1 175 ? 31.233  57.355  128.890 1.00 32.72  ? 321 ARG A NH1 1 
ATOM   1320 N  NH2 . ARG A 1 175 ? 29.760  59.007  128.267 1.00 34.64  ? 321 ARG A NH2 1 
ATOM   1321 N  N   . PRO A 1 176 ? 36.759  56.621  128.266 1.00 25.27  ? 322 PRO A N   1 
ATOM   1322 C  CA  . PRO A 1 176 ? 36.729  55.603  127.211 1.00 25.28  ? 322 PRO A CA  1 
ATOM   1323 C  C   . PRO A 1 176 ? 35.310  55.362  126.739 1.00 25.29  ? 322 PRO A C   1 
ATOM   1324 O  O   . PRO A 1 176 ? 34.399  55.324  127.563 1.00 27.20  ? 322 PRO A O   1 
ATOM   1325 C  CB  . PRO A 1 176 ? 37.229  54.337  127.924 1.00 24.65  ? 322 PRO A CB  1 
ATOM   1326 C  CG  . PRO A 1 176 ? 37.831  54.813  129.211 1.00 25.96  ? 322 PRO A CG  1 
ATOM   1327 C  CD  . PRO A 1 176 ? 37.097  56.047  129.576 1.00 23.15  ? 322 PRO A CD  1 
ATOM   1328 N  N   . TYR A 1 177 ? 35.115  55.201  125.437 1.00 25.45  ? 323 TYR A N   1 
ATOM   1329 C  CA  . TYR A 1 177 ? 33.843  54.688  124.961 1.00 27.82  ? 323 TYR A CA  1 
ATOM   1330 C  C   . TYR A 1 177 ? 33.817  53.195  125.240 1.00 30.79  ? 323 TYR A C   1 
ATOM   1331 O  O   . TYR A 1 177 ? 34.599  52.438  124.670 1.00 31.50  ? 323 TYR A O   1 
ATOM   1332 C  CB  . TYR A 1 177 ? 33.645  54.950  123.468 1.00 28.60  ? 323 TYR A CB  1 
ATOM   1333 C  CG  . TYR A 1 177 ? 32.555  54.095  122.850 1.00 30.11  ? 323 TYR A CG  1 
ATOM   1334 C  CD1 . TYR A 1 177 ? 31.357  53.871  123.518 1.00 28.58  ? 323 TYR A CD1 1 
ATOM   1335 C  CD2 . TYR A 1 177 ? 32.726  53.513  121.599 1.00 32.94  ? 323 TYR A CD2 1 
ATOM   1336 C  CE1 . TYR A 1 177 ? 30.360  53.089  122.962 1.00 27.83  ? 323 TYR A CE1 1 
ATOM   1337 C  CE2 . TYR A 1 177 ? 31.734  52.725  121.032 1.00 32.12  ? 323 TYR A CE2 1 
ATOM   1338 C  CZ  . TYR A 1 177 ? 30.554  52.518  121.719 1.00 30.32  ? 323 TYR A CZ  1 
ATOM   1339 O  OH  . TYR A 1 177 ? 29.566  51.739  121.161 1.00 33.46  ? 323 TYR A OH  1 
ATOM   1340 N  N   . VAL A 1 178 ? 32.936  52.785  126.145 1.00 33.10  ? 324 VAL A N   1 
ATOM   1341 C  CA  . VAL A 1 178 ? 32.689  51.373  126.382 1.00 38.09  ? 324 VAL A CA  1 
ATOM   1342 C  C   . VAL A 1 178 ? 31.278  51.023  125.915 1.00 42.27  ? 324 VAL A C   1 
ATOM   1343 O  O   . VAL A 1 178 ? 30.291  51.461  126.510 1.00 44.09  ? 324 VAL A O   1 
ATOM   1344 C  CB  . VAL A 1 178 ? 32.889  50.990  127.860 1.00 42.51  ? 324 VAL A CB  1 
ATOM   1345 C  CG1 . VAL A 1 178 ? 32.179  51.977  128.774 1.00 45.91  ? 324 VAL A CG1 1 
ATOM   1346 C  CG2 . VAL A 1 178 ? 32.406  49.573  128.105 1.00 43.39  ? 324 VAL A CG2 1 
ATOM   1347 N  N   . PRO A 1 179 ? 31.184  50.243  124.828 1.00 41.76  ? 325 PRO A N   1 
ATOM   1348 C  CA  . PRO A 1 179 ? 29.918  49.893  124.174 1.00 43.59  ? 325 PRO A CA  1 
ATOM   1349 C  C   . PRO A 1 179 ? 28.909  49.277  125.136 1.00 51.68  ? 325 PRO A C   1 
ATOM   1350 O  O   . PRO A 1 179 ? 29.283  48.499  126.014 1.00 56.15  ? 325 PRO A O   1 
ATOM   1351 C  CB  . PRO A 1 179 ? 30.343  48.867  123.124 1.00 40.93  ? 325 PRO A CB  1 
ATOM   1352 C  CG  . PRO A 1 179 ? 31.764  49.206  122.831 1.00 40.07  ? 325 PRO A CG  1 
ATOM   1353 C  CD  . PRO A 1 179 ? 32.343  49.650  124.140 1.00 39.35  ? 325 PRO A CD  1 
ATOM   1354 N  N   . SER A 1 180 ? 27.639  49.626  124.958 1.00 54.41  ? 326 SER A N   1 
ATOM   1355 C  CA  . SER A 1 180 ? 26.573  49.142  125.829 1.00 59.44  ? 326 SER A CA  1 
ATOM   1356 C  C   . SER A 1 180 ? 26.170  47.695  125.524 1.00 62.39  ? 326 SER A C   1 
ATOM   1357 O  O   . SER A 1 180 ? 25.401  47.095  126.280 1.00 63.14  ? 326 SER A O   1 
ATOM   1358 C  CB  . SER A 1 180 ? 25.348  50.057  125.727 1.00 60.83  ? 326 SER A CB  1 
ATOM   1359 O  OG  . SER A 1 180 ? 24.708  49.920  124.468 1.00 62.30  ? 326 SER A OG  1 
ATOM   1360 N  N   . GLU A 1 181 ? 26.695  47.150  124.426 1.00 65.81  ? 327 GLU A N   1 
ATOM   1361 C  CA  . GLU A 1 181 ? 26.349  45.805  123.943 1.00 73.46  ? 327 GLU A CA  1 
ATOM   1362 C  C   . GLU A 1 181 ? 25.437  45.012  124.881 1.00 76.74  ? 327 GLU A C   1 
ATOM   1363 O  O   . GLU A 1 181 ? 24.252  44.826  124.600 1.00 77.92  ? 327 GLU A O   1 
ATOM   1364 C  CB  . GLU A 1 181 ? 27.610  44.987  123.626 1.00 75.20  ? 327 GLU A CB  1 
ATOM   1365 C  CG  . GLU A 1 181 ? 28.359  45.439  122.378 1.00 76.53  ? 327 GLU A CG  1 
ATOM   1366 C  CD  . GLU A 1 181 ? 29.487  44.494  121.991 1.00 79.65  ? 327 GLU A CD  1 
ATOM   1367 O  OE1 . GLU A 1 181 ? 29.300  43.257  122.083 1.00 79.83  ? 327 GLU A OE1 1 
ATOM   1368 O  OE2 . GLU A 1 181 ? 30.561  44.992  121.585 1.00 78.67  ? 327 GLU A OE2 1 
ATOM   1369 N  N   . LEU B 1 21  ? 12.224  27.931  104.949 1.00 83.34  ? 167 LEU B N   1 
ATOM   1370 C  CA  . LEU B 1 21  ? 11.254  28.270  103.917 1.00 88.52  ? 167 LEU B CA  1 
ATOM   1371 C  C   . LEU B 1 21  ? 10.829  29.728  104.073 1.00 93.99  ? 167 LEU B C   1 
ATOM   1372 O  O   . LEU B 1 21  ? 11.432  30.473  104.846 1.00 93.63  ? 167 LEU B O   1 
ATOM   1373 C  CB  . LEU B 1 21  ? 10.037  27.341  104.005 1.00 90.20  ? 167 LEU B CB  1 
ATOM   1374 C  CG  . LEU B 1 21  ? 9.248   27.067  102.720 1.00 90.96  ? 167 LEU B CG  1 
ATOM   1375 C  CD1 . LEU B 1 21  ? 10.145  26.446  101.659 1.00 92.17  ? 167 LEU B CD1 1 
ATOM   1376 C  CD2 . LEU B 1 21  ? 8.050   26.170  103.000 1.00 90.90  ? 167 LEU B CD2 1 
ATOM   1377 N  N   . ASN B 1 22  ? 9.795   30.129  103.337 1.00 99.04  ? 168 ASN B N   1 
ATOM   1378 C  CA  . ASN B 1 22  ? 9.257   31.486  103.420 1.00 100.96 ? 168 ASN B CA  1 
ATOM   1379 C  C   . ASN B 1 22  ? 9.174   31.974  104.860 1.00 100.53 ? 168 ASN B C   1 
ATOM   1380 O  O   . ASN B 1 22  ? 9.377   33.154  105.147 1.00 98.79  ? 168 ASN B O   1 
ATOM   1381 C  CB  . ASN B 1 22  ? 7.866   31.548  102.784 1.00 103.57 ? 168 ASN B CB  1 
ATOM   1382 C  CG  . ASN B 1 22  ? 7.890   31.281  101.293 1.00 104.72 ? 168 ASN B CG  1 
ATOM   1383 O  OD1 . ASN B 1 22  ? 8.925   31.418  100.641 1.00 103.94 ? 168 ASN B OD1 1 
ATOM   1384 N  ND2 . ASN B 1 22  ? 6.741   30.904  100.742 1.00 106.38 ? 168 ASN B ND2 1 
ATOM   1385 N  N   . THR B 1 23  ? 8.860   31.043  105.754 1.00 101.42 ? 169 THR B N   1 
ATOM   1386 C  CA  . THR B 1 23  ? 8.762   31.314  107.180 1.00 100.23 ? 169 THR B CA  1 
ATOM   1387 C  C   . THR B 1 23  ? 9.905   32.192  107.676 1.00 95.56  ? 169 THR B C   1 
ATOM   1388 O  O   . THR B 1 23  ? 9.681   33.253  108.257 1.00 95.97  ? 169 THR B O   1 
ATOM   1389 C  CB  . THR B 1 23  ? 8.768   29.998  107.980 1.00 103.38 ? 169 THR B CB  1 
ATOM   1390 O  OG1 . THR B 1 23  ? 9.979   29.279  107.710 1.00 103.70 ? 169 THR B OG1 1 
ATOM   1391 C  CG2 . THR B 1 23  ? 7.574   29.130  107.593 1.00 104.43 ? 169 THR B CG2 1 
ATOM   1392 N  N   . LYS B 1 24  ? 11.132  31.745  107.434 1.00 91.17  ? 170 LYS B N   1 
ATOM   1393 C  CA  . LYS B 1 24  ? 12.310  32.423  107.958 1.00 86.87  ? 170 LYS B CA  1 
ATOM   1394 C  C   . LYS B 1 24  ? 12.780  33.542  107.037 1.00 83.79  ? 170 LYS B C   1 
ATOM   1395 O  O   . LYS B 1 24  ? 13.657  34.326  107.396 1.00 81.56  ? 170 LYS B O   1 
ATOM   1396 C  CB  . LYS B 1 24  ? 13.441  31.419  108.172 1.00 87.07  ? 170 LYS B CB  1 
ATOM   1397 C  CG  . LYS B 1 24  ? 14.476  31.855  109.189 1.00 86.23  ? 170 LYS B CG  1 
ATOM   1398 C  CD  . LYS B 1 24  ? 15.571  30.814  109.306 1.00 85.56  ? 170 LYS B CD  1 
ATOM   1399 C  CE  . LYS B 1 24  ? 16.485  31.094  110.480 1.00 82.87  ? 170 LYS B CE  1 
ATOM   1400 N  NZ  . LYS B 1 24  ? 17.635  30.156  110.477 1.00 81.51  ? 170 LYS B NZ  1 
ATOM   1401 N  N   . ILE B 1 25  ? 12.196  33.610  105.846 1.00 84.06  ? 171 ILE B N   1 
ATOM   1402 C  CA  . ILE B 1 25  ? 12.531  34.662  104.893 1.00 82.05  ? 171 ILE B CA  1 
ATOM   1403 C  C   . ILE B 1 25  ? 11.878  35.983  105.283 1.00 77.87  ? 171 ILE B C   1 
ATOM   1404 O  O   . ILE B 1 25  ? 12.526  37.028  105.286 1.00 75.66  ? 171 ILE B O   1 
ATOM   1405 C  CB  . ILE B 1 25  ? 12.128  34.280  103.455 1.00 84.19  ? 171 ILE B CB  1 
ATOM   1406 C  CG1 . ILE B 1 25  ? 13.374  33.983  102.624 1.00 82.52  ? 171 ILE B CG1 1 
ATOM   1407 C  CG2 . ILE B 1 25  ? 11.322  35.394  102.798 1.00 85.85  ? 171 ILE B CG2 1 
ATOM   1408 C  CD1 . ILE B 1 25  ? 14.271  35.176  102.440 1.00 79.77  ? 171 ILE B CD1 1 
ATOM   1409 N  N   . ARG B 1 26  ? 10.594  35.932  105.619 1.00 75.95  ? 172 ARG B N   1 
ATOM   1410 C  CA  . ARG B 1 26  ? 9.878   37.129  106.029 1.00 74.03  ? 172 ARG B CA  1 
ATOM   1411 C  C   . ARG B 1 26  ? 10.402  37.600  107.380 1.00 67.86  ? 172 ARG B C   1 
ATOM   1412 O  O   . ARG B 1 26  ? 10.100  38.705  107.830 1.00 65.26  ? 172 ARG B O   1 
ATOM   1413 C  CB  . ARG B 1 26  ? 8.374   36.865  106.071 1.00 76.60  ? 172 ARG B CB  1 
ATOM   1414 C  CG  . ARG B 1 26  ? 7.826   36.404  104.734 1.00 79.64  ? 172 ARG B CG  1 
ATOM   1415 C  CD  . ARG B 1 26  ? 6.315   36.446  104.693 1.00 84.96  ? 172 ARG B CD  1 
ATOM   1416 N  NE  . ARG B 1 26  ? 5.825   36.119  103.359 1.00 91.52  ? 172 ARG B NE  1 
ATOM   1417 C  CZ  . ARG B 1 26  ? 5.712   34.879  102.893 1.00 97.94  ? 172 ARG B CZ  1 
ATOM   1418 N  NH1 . ARG B 1 26  ? 6.053   33.851  103.658 1.00 100.06 ? 172 ARG B NH1 1 
ATOM   1419 N  NH2 . ARG B 1 26  ? 5.261   34.663  101.664 1.00 99.20  ? 172 ARG B NH2 1 
ATOM   1420 N  N   . ALA B 1 27  ? 11.199  36.745  108.013 1.00 64.16  ? 173 ALA B N   1 
ATOM   1421 C  CA  . ALA B 1 27  ? 11.860  37.083  109.262 1.00 62.29  ? 173 ALA B CA  1 
ATOM   1422 C  C   . ALA B 1 27  ? 13.006  38.048  108.980 1.00 57.99  ? 173 ALA B C   1 
ATOM   1423 O  O   . ALA B 1 27  ? 13.110  39.113  109.595 1.00 52.96  ? 173 ALA B O   1 
ATOM   1424 C  CB  . ALA B 1 27  ? 12.377  35.826  109.939 1.00 63.41  ? 173 ALA B CB  1 
ATOM   1425 N  N   . LEU B 1 28  ? 13.863  37.666  108.040 1.00 56.57  ? 174 LEU B N   1 
ATOM   1426 C  CA  . LEU B 1 28  ? 14.925  38.545  107.589 1.00 55.46  ? 174 LEU B CA  1 
ATOM   1427 C  C   . LEU B 1 28  ? 14.311  39.824  107.040 1.00 55.58  ? 174 LEU B C   1 
ATOM   1428 O  O   . LEU B 1 28  ? 14.807  40.919  107.303 1.00 54.60  ? 174 LEU B O   1 
ATOM   1429 C  CB  . LEU B 1 28  ? 15.781  37.858  106.527 1.00 57.73  ? 174 LEU B CB  1 
ATOM   1430 C  CG  . LEU B 1 28  ? 16.566  36.629  106.996 1.00 60.39  ? 174 LEU B CG  1 
ATOM   1431 C  CD1 . LEU B 1 28  ? 17.460  36.095  105.881 1.00 61.40  ? 174 LEU B CD1 1 
ATOM   1432 C  CD2 . LEU B 1 28  ? 17.389  36.960  108.233 1.00 57.93  ? 174 LEU B CD2 1 
ATOM   1433 N  N   . GLN B 1 29  ? 13.220  39.677  106.290 1.00 54.12  ? 175 GLN B N   1 
ATOM   1434 C  CA  . GLN B 1 29  ? 12.505  40.825  105.742 1.00 56.08  ? 175 GLN B CA  1 
ATOM   1435 C  C   . GLN B 1 29  ? 12.143  41.810  106.850 1.00 54.18  ? 175 GLN B C   1 
ATOM   1436 O  O   . GLN B 1 29  ? 12.445  43.001  106.761 1.00 50.74  ? 175 GLN B O   1 
ATOM   1437 C  CB  . GLN B 1 29  ? 11.239  40.376  105.000 1.00 60.41  ? 175 GLN B CB  1 
ATOM   1438 C  CG  . GLN B 1 29  ? 10.458  41.524  104.355 1.00 64.20  ? 175 GLN B CG  1 
ATOM   1439 C  CD  . GLN B 1 29  ? 9.205   41.063  103.616 1.00 69.93  ? 175 GLN B CD  1 
ATOM   1440 O  OE1 . GLN B 1 29  ? 8.954   39.864  103.463 1.00 71.67  ? 175 GLN B OE1 1 
ATOM   1441 N  NE2 . GLN B 1 29  ? 8.413   42.024  103.150 1.00 70.81  ? 175 GLN B NE2 1 
ATOM   1442 N  N   . GLY B 1 30  ? 11.503  41.298  107.897 1.00 53.66  ? 176 GLY B N   1 
ATOM   1443 C  CA  . GLY B 1 30  ? 11.091  42.114  109.024 1.00 50.05  ? 176 GLY B CA  1 
ATOM   1444 C  C   . GLY B 1 30  ? 12.244  42.806  109.723 1.00 46.39  ? 176 GLY B C   1 
ATOM   1445 O  O   . GLY B 1 30  ? 12.275  44.032  109.809 1.00 46.75  ? 176 GLY B O   1 
ATOM   1446 N  N   . SER B 1 31  ? 13.196  42.027  110.225 1.00 44.55  ? 177 SER B N   1 
ATOM   1447 C  CA  . SER B 1 31  ? 14.314  42.599  110.968 1.00 47.70  ? 177 SER B CA  1 
ATOM   1448 C  C   . SER B 1 31  ? 15.033  43.658  110.134 1.00 47.12  ? 177 SER B C   1 
ATOM   1449 O  O   . SER B 1 31  ? 15.566  44.638  110.664 1.00 45.91  ? 177 SER B O   1 
ATOM   1450 C  CB  . SER B 1 31  ? 15.295  41.507  111.394 1.00 49.90  ? 177 SER B CB  1 
ATOM   1451 O  OG  . SER B 1 31  ? 15.992  40.991  110.277 1.00 54.54  ? 177 SER B OG  1 
ATOM   1452 N  N   . LEU B 1 32  ? 15.034  43.450  108.823 1.00 45.76  ? 178 LEU B N   1 
ATOM   1453 C  CA  . LEU B 1 32  ? 15.692  44.357  107.899 1.00 44.27  ? 178 LEU B CA  1 
ATOM   1454 C  C   . LEU B 1 32  ? 14.969  45.699  107.813 1.00 46.40  ? 178 LEU B C   1 
ATOM   1455 O  O   . LEU B 1 32  ? 15.604  46.752  107.845 1.00 45.14  ? 178 LEU B O   1 
ATOM   1456 C  CB  . LEU B 1 32  ? 15.787  43.716  106.517 1.00 45.28  ? 178 LEU B CB  1 
ATOM   1457 C  CG  . LEU B 1 32  ? 16.782  44.337  105.542 1.00 48.66  ? 178 LEU B CG  1 
ATOM   1458 C  CD1 . LEU B 1 32  ? 18.116  44.580  106.229 1.00 50.91  ? 178 LEU B CD1 1 
ATOM   1459 C  CD2 . LEU B 1 32  ? 16.956  43.438  104.331 1.00 48.82  ? 178 LEU B CD2 1 
ATOM   1460 N  N   . GLU B 1 33  ? 13.644  45.666  107.702 1.00 49.50  ? 179 GLU B N   1 
ATOM   1461 C  CA  . GLU B 1 33  ? 12.872  46.905  107.661 1.00 53.62  ? 179 GLU B CA  1 
ATOM   1462 C  C   . GLU B 1 33  ? 12.916  47.630  109.011 1.00 52.74  ? 179 GLU B C   1 
ATOM   1463 O  O   . GLU B 1 33  ? 12.788  48.854  109.074 1.00 50.00  ? 179 GLU B O   1 
ATOM   1464 C  CB  . GLU B 1 33  ? 11.431  46.663  107.181 1.00 56.43  ? 179 GLU B CB  1 
ATOM   1465 C  CG  . GLU B 1 33  ? 10.749  45.441  107.771 1.00 63.22  ? 179 GLU B CG  1 
ATOM   1466 C  CD  . GLU B 1 33  ? 9.475   45.053  107.029 1.00 71.63  ? 179 GLU B CD  1 
ATOM   1467 O  OE1 . GLU B 1 33  ? 8.490   44.678  107.702 1.00 75.49  ? 179 GLU B OE1 1 
ATOM   1468 O  OE2 . GLU B 1 33  ? 9.454   45.119  105.779 1.00 72.49  ? 179 GLU B OE2 1 
ATOM   1469 N  N   . ASN B 1 34  ? 13.120  46.868  110.081 1.00 53.00  ? 180 ASN B N   1 
ATOM   1470 C  CA  . ASN B 1 34  ? 13.271  47.436  111.417 1.00 52.33  ? 180 ASN B CA  1 
ATOM   1471 C  C   . ASN B 1 34  ? 14.563  48.237  111.568 1.00 49.40  ? 180 ASN B C   1 
ATOM   1472 O  O   . ASN B 1 34  ? 14.571  49.312  112.168 1.00 47.94  ? 180 ASN B O   1 
ATOM   1473 C  CB  . ASN B 1 34  ? 13.210  46.341  112.481 1.00 57.08  ? 180 ASN B CB  1 
ATOM   1474 C  CG  . ASN B 1 34  ? 11.796  45.850  112.734 1.00 65.10  ? 180 ASN B CG  1 
ATOM   1475 O  OD1 . ASN B 1 34  ? 10.822  46.462  112.291 1.00 67.89  ? 180 ASN B OD1 1 
ATOM   1476 N  ND2 . ASN B 1 34  ? 11.677  44.739  113.456 1.00 66.66  ? 180 ASN B ND2 1 
ATOM   1477 N  N   . MET B 1 35  ? 15.655  47.709  111.028 1.00 47.68  ? 181 MET B N   1 
ATOM   1478 C  CA  . MET B 1 35  ? 16.922  48.428  111.061 1.00 47.56  ? 181 MET B CA  1 
ATOM   1479 C  C   . MET B 1 35  ? 16.847  49.684  110.198 1.00 46.35  ? 181 MET B C   1 
ATOM   1480 O  O   . MET B 1 35  ? 17.316  50.747  110.595 1.00 43.94  ? 181 MET B O   1 
ATOM   1481 C  CB  . MET B 1 35  ? 18.075  47.526  110.622 1.00 47.26  ? 181 MET B CB  1 
ATOM   1482 C  CG  . MET B 1 35  ? 18.586  46.611  111.726 1.00 47.71  ? 181 MET B CG  1 
ATOM   1483 S  SD  . MET B 1 35  ? 20.006  45.618  111.225 1.00 90.38  ? 181 MET B SD  1 
ATOM   1484 C  CE  . MET B 1 35  ? 19.266  44.586  109.961 1.00 40.71  ? 181 MET B CE  1 
ATOM   1485 N  N   . SER B 1 36  ? 16.247  49.553  109.021 1.00 43.38  ? 182 SER B N   1 
ATOM   1486 C  CA  . SER B 1 36  ? 16.029  50.692  108.140 1.00 42.33  ? 182 SER B CA  1 
ATOM   1487 C  C   . SER B 1 36  ? 15.371  51.840  108.900 1.00 41.91  ? 182 SER B C   1 
ATOM   1488 O  O   . SER B 1 36  ? 15.783  52.996  108.790 1.00 40.92  ? 182 SER B O   1 
ATOM   1489 C  CB  . SER B 1 36  ? 15.154  50.278  106.956 1.00 43.92  ? 182 SER B CB  1 
ATOM   1490 O  OG  . SER B 1 36  ? 14.467  51.388  106.409 1.00 44.54  ? 182 SER B OG  1 
ATOM   1491 N  N   . LYS B 1 37  ? 14.344  51.514  109.675 1.00 40.91  ? 183 LYS B N   1 
ATOM   1492 C  CA  . LYS B 1 37  ? 13.649  52.517  110.463 1.00 40.59  ? 183 LYS B CA  1 
ATOM   1493 C  C   . LYS B 1 37  ? 14.570  53.081  111.537 1.00 36.34  ? 183 LYS B C   1 
ATOM   1494 O  O   . LYS B 1 37  ? 14.569  54.278  111.805 1.00 34.25  ? 183 LYS B O   1 
ATOM   1495 C  CB  . LYS B 1 37  ? 12.389  51.924  111.090 1.00 42.95  ? 183 LYS B CB  1 
ATOM   1496 C  CG  . LYS B 1 37  ? 11.372  51.461  110.062 1.00 49.31  ? 183 LYS B CG  1 
ATOM   1497 C  CD  . LYS B 1 37  ? 10.070  51.042  110.710 1.00 53.10  ? 183 LYS B CD  1 
ATOM   1498 C  CE  . LYS B 1 37  ? 9.033   50.691  109.659 1.00 56.39  ? 183 LYS B CE  1 
ATOM   1499 N  NZ  . LYS B 1 37  ? 7.697   50.425  110.263 1.00 57.50  ? 183 LYS B NZ  1 
ATOM   1500 N  N   . LEU B 1 38  ? 15.359  52.205  112.143 1.00 34.58  ? 184 LEU B N   1 
ATOM   1501 C  CA  . LEU B 1 38  ? 16.286  52.609  113.185 1.00 35.53  ? 184 LEU B CA  1 
ATOM   1502 C  C   . LEU B 1 38  ? 17.358  53.515  112.599 1.00 34.38  ? 184 LEU B C   1 
ATOM   1503 O  O   . LEU B 1 38  ? 17.730  54.518  113.195 1.00 35.11  ? 184 LEU B O   1 
ATOM   1504 C  CB  . LEU B 1 38  ? 16.915  51.379  113.837 1.00 38.52  ? 184 LEU B CB  1 
ATOM   1505 C  CG  . LEU B 1 38  ? 17.989  51.622  114.893 1.00 43.15  ? 184 LEU B CG  1 
ATOM   1506 C  CD1 . LEU B 1 38  ? 17.539  52.685  115.881 1.00 45.85  ? 184 LEU B CD1 1 
ATOM   1507 C  CD2 . LEU B 1 38  ? 18.327  50.317  115.607 1.00 45.08  ? 184 LEU B CD2 1 
ATOM   1508 N  N   . LEU B 1 39  ? 17.832  53.165  111.412 1.00 36.59  ? 185 LEU B N   1 
ATOM   1509 C  CA  . LEU B 1 39  ? 18.869  53.937  110.745 1.00 38.92  ? 185 LEU B CA  1 
ATOM   1510 C  C   . LEU B 1 39  ? 18.355  55.303  110.291 1.00 38.94  ? 185 LEU B C   1 
ATOM   1511 O  O   . LEU B 1 39  ? 19.062  56.308  110.394 1.00 37.89  ? 185 LEU B O   1 
ATOM   1512 C  CB  . LEU B 1 39  ? 19.425  53.161  109.553 1.00 37.84  ? 185 LEU B CB  1 
ATOM   1513 C  CG  . LEU B 1 39  ? 20.652  53.789  108.901 1.00 40.17  ? 185 LEU B CG  1 
ATOM   1514 C  CD1 . LEU B 1 39  ? 21.686  54.132  109.962 1.00 42.30  ? 185 LEU B CD1 1 
ATOM   1515 C  CD2 . LEU B 1 39  ? 21.235  52.859  107.857 1.00 43.24  ? 185 LEU B CD2 1 
ATOM   1516 N  N   . LYS B 1 40  ? 17.127  55.333  109.783 1.00 35.88  ? 186 LYS B N   1 
ATOM   1517 C  CA  . LYS B 1 40  ? 16.499  56.586  109.390 1.00 38.58  ? 186 LYS B CA  1 
ATOM   1518 C  C   . LYS B 1 40  ? 16.407  57.524  110.589 1.00 37.19  ? 186 LYS B C   1 
ATOM   1519 O  O   . LYS B 1 40  ? 16.701  58.717  110.494 1.00 33.59  ? 186 LYS B O   1 
ATOM   1520 C  CB  . LYS B 1 40  ? 15.097  56.336  108.835 1.00 43.87  ? 186 LYS B CB  1 
ATOM   1521 C  CG  . LYS B 1 40  ? 14.326  57.613  108.549 1.00 52.93  ? 186 LYS B CG  1 
ATOM   1522 C  CD  . LYS B 1 40  ? 12.820  57.389  108.598 1.00 63.73  ? 186 LYS B CD  1 
ATOM   1523 C  CE  . LYS B 1 40  ? 12.370  56.325  107.605 1.00 69.50  ? 186 LYS B CE  1 
ATOM   1524 N  NZ  . LYS B 1 40  ? 10.884  56.176  107.590 1.00 74.18  ? 186 LYS B NZ  1 
ATOM   1525 N  N   . ARG B 1 41  ? 15.990  56.964  111.718 1.00 38.38  ? 187 ARG B N   1 
ATOM   1526 C  CA  . ARG B 1 41  ? 15.805  57.720  112.945 1.00 40.53  ? 187 ARG B CA  1 
ATOM   1527 C  C   . ARG B 1 41  ? 17.127  58.307  113.442 1.00 36.29  ? 187 ARG B C   1 
ATOM   1528 O  O   . ARG B 1 41  ? 17.171  59.452  113.894 1.00 36.75  ? 187 ARG B O   1 
ATOM   1529 C  CB  . ARG B 1 41  ? 15.166  56.821  114.004 1.00 48.64  ? 187 ARG B CB  1 
ATOM   1530 C  CG  . ARG B 1 41  ? 15.046  57.422  115.387 1.00 57.97  ? 187 ARG B CG  1 
ATOM   1531 C  CD  . ARG B 1 41  ? 14.231  56.505  116.285 1.00 68.04  ? 187 ARG B CD  1 
ATOM   1532 N  NE  . ARG B 1 41  ? 14.262  56.927  117.682 1.00 77.70  ? 187 ARG B NE  1 
ATOM   1533 C  CZ  . ARG B 1 41  ? 13.624  56.299  118.666 1.00 86.36  ? 187 ARG B CZ  1 
ATOM   1534 N  NH1 . ARG B 1 41  ? 12.898  55.219  118.408 1.00 88.02  ? 187 ARG B NH1 1 
ATOM   1535 N  NH2 . ARG B 1 41  ? 13.710  56.754  119.910 1.00 89.51  ? 187 ARG B NH2 1 
ATOM   1536 N  N   . GLN B 1 42  ? 18.203  57.533  113.343 1.00 30.74  ? 188 GLN B N   1 
ATOM   1537 C  CA  . GLN B 1 42  ? 19.518  58.019  113.744 1.00 29.80  ? 188 GLN B CA  1 
ATOM   1538 C  C   . GLN B 1 42  ? 19.973  59.145  112.822 1.00 29.17  ? 188 GLN B C   1 
ATOM   1539 O  O   . GLN B 1 42  ? 20.629  60.096  113.253 1.00 26.47  ? 188 GLN B O   1 
ATOM   1540 C  CB  . GLN B 1 42  ? 20.545  56.883  113.765 1.00 29.14  ? 188 GLN B CB  1 
ATOM   1541 C  CG  . GLN B 1 42  ? 20.255  55.827  114.822 1.00 35.75  ? 188 GLN B CG  1 
ATOM   1542 C  CD  . GLN B 1 42  ? 21.406  54.852  115.018 1.00 43.16  ? 188 GLN B CD  1 
ATOM   1543 O  OE1 . GLN B 1 42  ? 22.498  55.044  114.483 1.00 47.98  ? 188 GLN B OE1 1 
ATOM   1544 N  NE2 . GLN B 1 42  ? 21.166  53.804  115.800 1.00 42.61  ? 188 GLN B NE2 1 
ATOM   1545 N  N   . ASN B 1 43  ? 19.614  59.041  111.550 1.00 29.77  ? 189 ASN B N   1 
ATOM   1546 C  CA  . ASN B 1 43  ? 19.929  60.101  110.604 1.00 31.63  ? 189 ASN B CA  1 
ATOM   1547 C  C   . ASN B 1 43  ? 19.209  61.414  110.923 1.00 29.99  ? 189 ASN B C   1 
ATOM   1548 O  O   . ASN B 1 43  ? 19.805  62.484  110.839 1.00 33.55  ? 189 ASN B O   1 
ATOM   1549 C  CB  . ASN B 1 43  ? 19.614  59.672  109.174 1.00 32.28  ? 189 ASN B CB  1 
ATOM   1550 C  CG  . ASN B 1 43  ? 20.132  60.662  108.157 1.00 37.27  ? 189 ASN B CG  1 
ATOM   1551 O  OD1 . ASN B 1 43  ? 21.329  60.953  108.117 1.00 43.61  ? 189 ASN B OD1 1 
ATOM   1552 N  ND2 . ASN B 1 43  ? 19.236  61.201  107.342 1.00 34.11  ? 189 ASN B ND2 1 
ATOM   1553 N  N   . ASP B 1 44  ? 17.928  61.329  111.274 1.00 24.52  ? 190 ASP B N   1 
ATOM   1554 C  CA  . ASP B 1 44  ? 17.161  62.511  111.646 1.00 27.40  ? 190 ASP B CA  1 
ATOM   1555 C  C   . ASP B 1 44  ? 17.875  63.254  112.767 1.00 28.73  ? 190 ASP B C   1 
ATOM   1556 O  O   . ASP B 1 44  ? 18.030  64.473  112.718 1.00 28.87  ? 190 ASP B O   1 
ATOM   1557 C  CB  . ASP B 1 44  ? 15.752  62.130  112.111 1.00 33.14  ? 190 ASP B CB  1 
ATOM   1558 C  CG  . ASP B 1 44  ? 14.873  61.621  110.979 1.00 39.44  ? 190 ASP B CG  1 
ATOM   1559 O  OD1 . ASP B 1 44  ? 15.278  61.748  109.807 1.00 41.74  ? 190 ASP B OD1 1 
ATOM   1560 O  OD2 . ASP B 1 44  ? 13.773  61.098  111.264 1.00 40.90  ? 190 ASP B OD2 1 
ATOM   1561 N  N   . ILE B 1 45  ? 18.308  62.504  113.774 1.00 25.62  ? 191 ILE B N   1 
ATOM   1562 C  CA  . ILE B 1 45  ? 18.987  63.077  114.926 1.00 26.02  ? 191 ILE B CA  1 
ATOM   1563 C  C   . ILE B 1 45  ? 20.325  63.663  114.518 1.00 25.32  ? 191 ILE B C   1 
ATOM   1564 O  O   . ILE B 1 45  ? 20.658  64.788  114.886 1.00 29.79  ? 191 ILE B O   1 
ATOM   1565 C  CB  . ILE B 1 45  ? 19.213  62.025  116.025 1.00 24.93  ? 191 ILE B CB  1 
ATOM   1566 C  CG1 . ILE B 1 45  ? 17.878  61.602  116.633 1.00 29.32  ? 191 ILE B CG1 1 
ATOM   1567 C  CG2 . ILE B 1 45  ? 20.136  62.569  117.105 1.00 21.32  ? 191 ILE B CG2 1 
ATOM   1568 C  CD1 . ILE B 1 45  ? 17.994  60.437  117.598 1.00 31.26  ? 191 ILE B CD1 1 
ATOM   1569 N  N   . LEU B 1 46  ? 21.090  62.893  113.753 1.00 25.08  ? 192 LEU B N   1 
ATOM   1570 C  CA  . LEU B 1 46  ? 22.389  63.340  113.278 1.00 24.70  ? 192 LEU B CA  1 
ATOM   1571 C  C   . LEU B 1 46  ? 22.278  64.653  112.515 1.00 31.50  ? 192 LEU B C   1 
ATOM   1572 O  O   . LEU B 1 46  ? 23.102  65.549  112.700 1.00 35.53  ? 192 LEU B O   1 
ATOM   1573 C  CB  . LEU B 1 46  ? 23.030  62.272  112.392 1.00 24.84  ? 192 LEU B CB  1 
ATOM   1574 C  CG  . LEU B 1 46  ? 24.412  62.614  111.832 1.00 24.29  ? 192 LEU B CG  1 
ATOM   1575 C  CD1 . LEU B 1 46  ? 25.396  62.915  112.953 1.00 24.04  ? 192 LEU B CD1 1 
ATOM   1576 C  CD2 . LEU B 1 46  ? 24.928  61.486  110.947 1.00 24.36  ? 192 LEU B CD2 1 
ATOM   1577 N  N   . GLN B 1 47  ? 21.256  64.769  111.668 1.00 30.81  ? 193 GLN B N   1 
ATOM   1578 C  CA  . GLN B 1 47  ? 21.086  65.957  110.833 1.00 33.57  ? 193 GLN B CA  1 
ATOM   1579 C  C   . GLN B 1 47  ? 20.888  67.215  111.671 1.00 33.30  ? 193 GLN B C   1 
ATOM   1580 O  O   . GLN B 1 47  ? 21.432  68.266  111.352 1.00 35.71  ? 193 GLN B O   1 
ATOM   1581 C  CB  . GLN B 1 47  ? 19.913  65.792  109.856 1.00 41.23  ? 193 GLN B CB  1 
ATOM   1582 C  CG  . GLN B 1 47  ? 20.090  64.676  108.828 1.00 46.23  ? 193 GLN B CG  1 
ATOM   1583 C  CD  . GLN B 1 47  ? 21.369  64.813  108.022 1.00 50.24  ? 193 GLN B CD  1 
ATOM   1584 O  OE1 . GLN B 1 47  ? 21.614  65.847  107.402 1.00 55.77  ? 193 GLN B OE1 1 
ATOM   1585 N  NE2 . GLN B 1 47  ? 22.193  63.768  108.029 1.00 46.66  ? 193 GLN B NE2 1 
ATOM   1586 N  N   . VAL B 1 48  ? 20.106  67.108  112.740 1.00 30.03  ? 194 VAL B N   1 
ATOM   1587 C  CA  . VAL B 1 48  ? 19.830  68.259  113.594 1.00 28.41  ? 194 VAL B CA  1 
ATOM   1588 C  C   . VAL B 1 48  ? 20.991  68.557  114.538 1.00 27.16  ? 194 VAL B C   1 
ATOM   1589 O  O   . VAL B 1 48  ? 21.357  69.710  114.748 1.00 25.53  ? 194 VAL B O   1 
ATOM   1590 C  CB  . VAL B 1 48  ? 18.543  68.065  114.409 1.00 26.30  ? 194 VAL B CB  1 
ATOM   1591 C  CG1 . VAL B 1 48  ? 18.338  69.236  115.341 1.00 23.28  ? 194 VAL B CG1 1 
ATOM   1592 C  CG2 . VAL B 1 48  ? 17.344  67.918  113.466 1.00 26.84  ? 194 VAL B CG2 1 
ATOM   1593 N  N   . VAL B 1 49  ? 21.573  67.505  115.097 1.00 29.70  ? 195 VAL B N   1 
ATOM   1594 C  CA  . VAL B 1 49  ? 22.736  67.647  115.956 1.00 29.06  ? 195 VAL B CA  1 
ATOM   1595 C  C   . VAL B 1 49  ? 23.905  68.239  115.175 1.00 29.56  ? 195 VAL B C   1 
ATOM   1596 O  O   . VAL B 1 49  ? 24.749  68.928  115.742 1.00 24.84  ? 195 VAL B O   1 
ATOM   1597 C  CB  . VAL B 1 49  ? 23.115  66.293  116.582 1.00 26.77  ? 195 VAL B CB  1 
ATOM   1598 C  CG1 . VAL B 1 49  ? 24.514  66.342  117.197 1.00 24.69  ? 195 VAL B CG1 1 
ATOM   1599 C  CG2 . VAL B 1 49  ? 22.076  65.906  117.613 1.00 18.93  ? 195 VAL B CG2 1 
ATOM   1600 N  N   . SER B 1 50  ? 23.930  67.980  113.867 1.00 31.26  ? 196 SER B N   1 
ATOM   1601 C  CA  . SER B 1 50  ? 24.950  68.529  112.972 1.00 33.38  ? 196 SER B CA  1 
ATOM   1602 C  C   . SER B 1 50  ? 24.780  70.035  112.730 1.00 32.80  ? 196 SER B C   1 
ATOM   1603 O  O   . SER B 1 50  ? 25.632  70.675  112.103 1.00 28.28  ? 196 SER B O   1 
ATOM   1604 C  CB  . SER B 1 50  ? 24.919  67.802  111.621 1.00 36.62  ? 196 SER B CB  1 
ATOM   1605 O  OG  . SER B 1 50  ? 25.348  66.458  111.741 1.00 39.62  ? 196 SER B OG  1 
ATOM   1606 N  N   . GLN B 1 51  ? 23.672  70.592  113.206 1.00 31.95  ? 197 GLN B N   1 
ATOM   1607 C  CA  . GLN B 1 51  ? 23.425  72.022  113.074 1.00 37.87  ? 197 GLN B CA  1 
ATOM   1608 C  C   . GLN B 1 51  ? 23.558  72.719  114.420 1.00 35.89  ? 197 GLN B C   1 
ATOM   1609 O  O   . GLN B 1 51  ? 23.052  73.823  114.610 1.00 32.28  ? 197 GLN B O   1 
ATOM   1610 C  CB  . GLN B 1 51  ? 22.046  72.281  112.461 1.00 42.80  ? 197 GLN B CB  1 
ATOM   1611 C  CG  . GLN B 1 51  ? 21.891  71.690  111.067 1.00 47.08  ? 197 GLN B CG  1 
ATOM   1612 C  CD  . GLN B 1 51  ? 20.467  71.755  110.556 1.00 53.27  ? 197 GLN B CD  1 
ATOM   1613 O  OE1 . GLN B 1 51  ? 19.630  72.472  111.105 1.00 57.43  ? 197 GLN B OE1 1 
ATOM   1614 N  NE2 . GLN B 1 51  ? 20.185  71.004  109.497 1.00 53.43  ? 197 GLN B NE2 1 
ATOM   1615 N  N   . GLY B 1 52  ? 24.236  72.054  115.353 1.00 36.40  ? 198 GLY B N   1 
ATOM   1616 C  CA  . GLY B 1 52  ? 24.578  72.650  116.630 1.00 33.84  ? 198 GLY B CA  1 
ATOM   1617 C  C   . GLY B 1 52  ? 23.520  72.480  117.696 1.00 33.71  ? 198 GLY B C   1 
ATOM   1618 O  O   . GLY B 1 52  ? 23.544  73.167  118.712 1.00 34.87  ? 198 GLY B O   1 
ATOM   1619 N  N   . TRP B 1 53  ? 22.586  71.567  117.470 1.00 24.53  ? 199 TRP B N   1 
ATOM   1620 C  CA  . TRP B 1 53  ? 21.577  71.272  118.477 1.00 21.37  ? 199 TRP B CA  1 
ATOM   1621 C  C   . TRP B 1 53  ? 21.979  70.040  119.270 1.00 21.19  ? 199 TRP B C   1 
ATOM   1622 O  O   . TRP B 1 53  ? 22.904  69.325  118.889 1.00 22.73  ? 199 TRP B O   1 
ATOM   1623 C  CB  . TRP B 1 53  ? 20.200  71.077  117.841 1.00 21.08  ? 199 TRP B CB  1 
ATOM   1624 C  CG  . TRP B 1 53  ? 19.591  72.357  117.356 1.00 23.42  ? 199 TRP B CG  1 
ATOM   1625 C  CD1 . TRP B 1 53  ? 20.119  73.219  116.440 1.00 25.08  ? 199 TRP B CD1 1 
ATOM   1626 C  CD2 . TRP B 1 53  ? 18.336  72.922  117.761 1.00 21.28  ? 199 TRP B CD2 1 
ATOM   1627 N  NE1 . TRP B 1 53  ? 19.269  74.285  116.247 1.00 23.94  ? 199 TRP B NE1 1 
ATOM   1628 C  CE2 . TRP B 1 53  ? 18.168  74.125  117.045 1.00 22.62  ? 199 TRP B CE2 1 
ATOM   1629 C  CE3 . TRP B 1 53  ? 17.340  72.527  118.659 1.00 20.97  ? 199 TRP B CE3 1 
ATOM   1630 C  CZ2 . TRP B 1 53  ? 17.046  74.933  117.197 1.00 25.34  ? 199 TRP B CZ2 1 
ATOM   1631 C  CZ3 . TRP B 1 53  ? 16.228  73.331  118.813 1.00 25.66  ? 199 TRP B CZ3 1 
ATOM   1632 C  CH2 . TRP B 1 53  ? 16.087  74.521  118.082 1.00 27.05  ? 199 TRP B CH2 1 
ATOM   1633 N  N   . LYS B 1 54  ? 21.297  69.828  120.391 1.00 18.09  ? 200 LYS B N   1 
ATOM   1634 C  CA  . LYS B 1 54  ? 21.509  68.672  121.235 1.00 20.77  ? 200 LYS B CA  1 
ATOM   1635 C  C   . LYS B 1 54  ? 20.253  67.827  121.129 1.00 25.87  ? 200 LYS B C   1 
ATOM   1636 O  O   . LYS B 1 54  ? 19.214  68.310  120.670 1.00 21.60  ? 200 LYS B O   1 
ATOM   1637 C  CB  . LYS B 1 54  ? 21.692  69.108  122.687 1.00 25.73  ? 200 LYS B CB  1 
ATOM   1638 C  CG  . LYS B 1 54  ? 22.675  70.253  122.907 1.00 28.62  ? 200 LYS B CG  1 
ATOM   1639 C  CD  . LYS B 1 54  ? 24.120  69.819  122.746 1.00 30.66  ? 200 LYS B CD  1 
ATOM   1640 C  CE  . LYS B 1 54  ? 25.080  70.897  123.271 1.00 30.90  ? 200 LYS B CE  1 
ATOM   1641 N  NZ  . LYS B 1 54  ? 25.201  72.096  122.386 1.00 29.25  ? 200 LYS B NZ  1 
ATOM   1642 N  N   . TYR B 1 55  ? 20.336  66.572  121.558 1.00 28.35  ? 201 TYR B N   1 
ATOM   1643 C  CA  . TYR B 1 55  ? 19.172  65.693  121.547 1.00 28.67  ? 201 TYR B CA  1 
ATOM   1644 C  C   . TYR B 1 55  ? 19.100  64.851  122.812 1.00 28.81  ? 201 TYR B C   1 
ATOM   1645 O  O   . TYR B 1 55  ? 20.115  64.341  123.281 1.00 30.73  ? 201 TYR B O   1 
ATOM   1646 C  CB  . TYR B 1 55  ? 19.201  64.761  120.336 1.00 27.87  ? 201 TYR B CB  1 
ATOM   1647 C  CG  . TYR B 1 55  ? 18.156  63.674  120.423 1.00 28.85  ? 201 TYR B CG  1 
ATOM   1648 C  CD1 . TYR B 1 55  ? 16.834  63.933  120.076 1.00 28.18  ? 201 TYR B CD1 1 
ATOM   1649 C  CD2 . TYR B 1 55  ? 18.481  62.397  120.869 1.00 28.58  ? 201 TYR B CD2 1 
ATOM   1650 C  CE1 . TYR B 1 55  ? 15.868  62.958  120.159 1.00 30.99  ? 201 TYR B CE1 1 
ATOM   1651 C  CE2 . TYR B 1 55  ? 17.515  61.405  120.958 1.00 31.28  ? 201 TYR B CE2 1 
ATOM   1652 C  CZ  . TYR B 1 55  ? 16.209  61.694  120.597 1.00 35.16  ? 201 TYR B CZ  1 
ATOM   1653 O  OH  . TYR B 1 55  ? 15.229  60.732  120.678 1.00 37.77  ? 201 TYR B OH  1 
ATOM   1654 N  N   . PHE B 1 56  ? 17.894  64.689  123.345 1.00 24.43  ? 202 PHE B N   1 
ATOM   1655 C  CA  . PHE B 1 56  ? 17.687  63.865  124.529 1.00 22.84  ? 202 PHE B CA  1 
ATOM   1656 C  C   . PHE B 1 56  ? 16.244  63.395  124.646 1.00 25.82  ? 202 PHE B C   1 
ATOM   1657 O  O   . PHE B 1 56  ? 15.324  64.204  124.754 1.00 27.68  ? 202 PHE B O   1 
ATOM   1658 C  CB  . PHE B 1 56  ? 18.086  64.624  125.797 1.00 21.63  ? 202 PHE B CB  1 
ATOM   1659 C  CG  . PHE B 1 56  ? 17.935  63.815  127.059 1.00 23.57  ? 202 PHE B CG  1 
ATOM   1660 C  CD1 . PHE B 1 56  ? 18.815  62.785  127.347 1.00 26.80  ? 202 PHE B CD1 1 
ATOM   1661 C  CD2 . PHE B 1 56  ? 16.917  64.089  127.959 1.00 24.58  ? 202 PHE B CD2 1 
ATOM   1662 C  CE1 . PHE B 1 56  ? 18.684  62.041  128.513 1.00 29.18  ? 202 PHE B CE1 1 
ATOM   1663 C  CE2 . PHE B 1 56  ? 16.779  63.350  129.123 1.00 27.11  ? 202 PHE B CE2 1 
ATOM   1664 C  CZ  . PHE B 1 56  ? 17.665  62.326  129.400 1.00 28.66  ? 202 PHE B CZ  1 
ATOM   1665 N  N   . LYS B 1 57  ? 16.058  62.079  124.622 1.00 29.11  ? 203 LYS B N   1 
ATOM   1666 C  CA  . LYS B 1 57  ? 14.746  61.474  124.824 1.00 32.68  ? 203 LYS B CA  1 
ATOM   1667 C  C   . LYS B 1 57  ? 13.610  62.141  124.040 1.00 30.56  ? 203 LYS B C   1 
ATOM   1668 O  O   . LYS B 1 57  ? 12.680  62.685  124.629 1.00 32.20  ? 203 LYS B O   1 
ATOM   1669 C  CB  . LYS B 1 57  ? 14.398  61.435  126.316 1.00 36.45  ? 203 LYS B CB  1 
ATOM   1670 C  CG  . LYS B 1 57  ? 15.225  60.457  127.136 1.00 40.93  ? 203 LYS B CG  1 
ATOM   1671 C  CD  . LYS B 1 57  ? 14.623  60.278  128.528 1.00 45.74  ? 203 LYS B CD  1 
ATOM   1672 C  CE  . LYS B 1 57  ? 15.346  59.194  129.319 1.00 49.07  ? 203 LYS B CE  1 
ATOM   1673 N  NZ  . LYS B 1 57  ? 14.661  58.875  130.607 1.00 50.30  ? 203 LYS B NZ  1 
ATOM   1674 N  N   . GLY B 1 58  ? 13.685  62.090  122.715 1.00 29.32  ? 204 GLY B N   1 
ATOM   1675 C  CA  . GLY B 1 58  ? 12.575  62.514  121.880 1.00 31.85  ? 204 GLY B CA  1 
ATOM   1676 C  C   . GLY B 1 58  ? 12.409  64.014  121.756 1.00 33.15  ? 204 GLY B C   1 
ATOM   1677 O  O   . GLY B 1 58  ? 11.370  64.489  121.306 1.00 33.56  ? 204 GLY B O   1 
ATOM   1678 N  N   . ASN B 1 59  ? 13.432  64.762  122.154 1.00 31.37  ? 205 ASN B N   1 
ATOM   1679 C  CA  . ASN B 1 59  ? 13.396  66.213  122.050 1.00 29.59  ? 205 ASN B CA  1 
ATOM   1680 C  C   . ASN B 1 59  ? 14.731  66.799  121.607 1.00 29.54  ? 205 ASN B C   1 
ATOM   1681 O  O   . ASN B 1 59  ? 15.793  66.292  121.964 1.00 29.93  ? 205 ASN B O   1 
ATOM   1682 C  CB  . ASN B 1 59  ? 12.954  66.839  123.372 1.00 29.58  ? 205 ASN B CB  1 
ATOM   1683 C  CG  . ASN B 1 59  ? 11.458  66.733  123.599 1.00 31.99  ? 205 ASN B CG  1 
ATOM   1684 O  OD1 . ASN B 1 59  ? 10.668  67.389  122.919 1.00 32.19  ? 205 ASN B OD1 1 
ATOM   1685 N  ND2 . ASN B 1 59  ? 11.060  65.910  124.563 1.00 32.48  ? 205 ASN B ND2 1 
ATOM   1686 N  N   . PHE B 1 60  ? 14.662  67.860  120.807 1.00 29.01  ? 206 PHE B N   1 
ATOM   1687 C  CA  . PHE B 1 60  ? 15.847  68.579  120.366 1.00 22.48  ? 206 PHE B CA  1 
ATOM   1688 C  C   . PHE B 1 60  ? 15.994  69.830  121.217 1.00 24.88  ? 206 PHE B C   1 
ATOM   1689 O  O   . PHE B 1 60  ? 15.001  70.452  121.600 1.00 24.90  ? 206 PHE B O   1 
ATOM   1690 C  CB  . PHE B 1 60  ? 15.745  68.963  118.891 1.00 24.62  ? 206 PHE B CB  1 
ATOM   1691 C  CG  . PHE B 1 60  ? 15.872  67.800  117.936 1.00 26.14  ? 206 PHE B CG  1 
ATOM   1692 C  CD1 . PHE B 1 60  ? 17.025  67.026  117.906 1.00 24.38  ? 206 PHE B CD1 1 
ATOM   1693 C  CD2 . PHE B 1 60  ? 14.849  67.504  117.041 1.00 25.46  ? 206 PHE B CD2 1 
ATOM   1694 C  CE1 . PHE B 1 60  ? 17.144  65.966  117.013 1.00 25.98  ? 206 PHE B CE1 1 
ATOM   1695 C  CE2 . PHE B 1 60  ? 14.964  66.447  116.142 1.00 24.20  ? 206 PHE B CE2 1 
ATOM   1696 C  CZ  . PHE B 1 60  ? 16.112  65.677  116.131 1.00 23.43  ? 206 PHE B CZ  1 
ATOM   1697 N  N   . TYR B 1 61  ? 17.236  70.190  121.516 1.00 22.71  ? 207 TYR B N   1 
ATOM   1698 C  CA  . TYR B 1 61  ? 17.517  71.280  122.438 1.00 21.27  ? 207 TYR B CA  1 
ATOM   1699 C  C   . TYR B 1 61  ? 18.544  72.211  121.843 1.00 20.55  ? 207 TYR B C   1 
ATOM   1700 O  O   . TYR B 1 61  ? 19.478  71.772  121.178 1.00 25.81  ? 207 TYR B O   1 
ATOM   1701 C  CB  . TYR B 1 61  ? 18.043  70.734  123.770 1.00 19.08  ? 207 TYR B CB  1 
ATOM   1702 C  CG  . TYR B 1 61  ? 17.026  69.932  124.538 1.00 21.26  ? 207 TYR B CG  1 
ATOM   1703 C  CD1 . TYR B 1 61  ? 16.201  70.541  125.472 1.00 20.73  ? 207 TYR B CD1 1 
ATOM   1704 C  CD2 . TYR B 1 61  ? 16.878  68.566  124.319 1.00 22.78  ? 207 TYR B CD2 1 
ATOM   1705 C  CE1 . TYR B 1 61  ? 15.261  69.813  126.177 1.00 22.78  ? 207 TYR B CE1 1 
ATOM   1706 C  CE2 . TYR B 1 61  ? 15.944  67.829  125.017 1.00 21.25  ? 207 TYR B CE2 1 
ATOM   1707 C  CZ  . TYR B 1 61  ? 15.136  68.456  125.945 1.00 24.43  ? 207 TYR B CZ  1 
ATOM   1708 O  OH  . TYR B 1 61  ? 14.199  67.728  126.643 1.00 25.16  ? 207 TYR B OH  1 
ATOM   1709 N  N   . TYR B 1 62  ? 18.384  73.502  122.084 1.00 15.87  ? 208 TYR B N   1 
ATOM   1710 C  CA  . TYR B 1 62  ? 19.390  74.434  121.623 1.00 19.15  ? 208 TYR B CA  1 
ATOM   1711 C  C   . TYR B 1 62  ? 19.955  75.258  122.775 1.00 22.50  ? 208 TYR B C   1 
ATOM   1712 O  O   . TYR B 1 62  ? 19.239  76.027  123.411 1.00 22.89  ? 208 TYR B O   1 
ATOM   1713 C  CB  . TYR B 1 62  ? 18.825  75.345  120.542 1.00 20.36  ? 208 TYR B CB  1 
ATOM   1714 C  CG  . TYR B 1 62  ? 19.844  76.310  119.995 1.00 22.45  ? 208 TYR B CG  1 
ATOM   1715 C  CD1 . TYR B 1 62  ? 20.767  75.898  119.050 1.00 24.84  ? 208 TYR B CD1 1 
ATOM   1716 C  CD2 . TYR B 1 62  ? 19.894  77.630  120.432 1.00 25.97  ? 208 TYR B CD2 1 
ATOM   1717 C  CE1 . TYR B 1 62  ? 21.700  76.767  118.537 1.00 29.63  ? 208 TYR B CE1 1 
ATOM   1718 C  CE2 . TYR B 1 62  ? 20.831  78.516  119.917 1.00 30.22  ? 208 TYR B CE2 1 
ATOM   1719 C  CZ  . TYR B 1 62  ? 21.729  78.073  118.966 1.00 30.08  ? 208 TYR B CZ  1 
ATOM   1720 O  OH  . TYR B 1 62  ? 22.671  78.920  118.439 1.00 27.10  ? 208 TYR B OH  1 
ATOM   1721 N  N   . PHE B 1 63  ? 21.245  75.080  123.036 1.00 24.98  ? 209 PHE B N   1 
ATOM   1722 C  CA  . PHE B 1 63  ? 21.954  75.843  124.054 1.00 19.39  ? 209 PHE B CA  1 
ATOM   1723 C  C   . PHE B 1 63  ? 22.679  76.978  123.357 1.00 20.93  ? 209 PHE B C   1 
ATOM   1724 O  O   . PHE B 1 63  ? 23.655  76.753  122.644 1.00 26.33  ? 209 PHE B O   1 
ATOM   1725 C  CB  . PHE B 1 63  ? 22.972  74.956  124.763 1.00 22.22  ? 209 PHE B CB  1 
ATOM   1726 C  CG  . PHE B 1 63  ? 22.359  73.907  125.648 1.00 22.29  ? 209 PHE B CG  1 
ATOM   1727 C  CD1 . PHE B 1 63  ? 22.472  73.994  127.029 1.00 22.29  ? 209 PHE B CD1 1 
ATOM   1728 C  CD2 . PHE B 1 63  ? 21.681  72.832  125.106 1.00 22.41  ? 209 PHE B CD2 1 
ATOM   1729 C  CE1 . PHE B 1 63  ? 21.917  73.031  127.850 1.00 21.29  ? 209 PHE B CE1 1 
ATOM   1730 C  CE2 . PHE B 1 63  ? 21.118  71.862  125.927 1.00 23.16  ? 209 PHE B CE2 1 
ATOM   1731 C  CZ  . PHE B 1 63  ? 21.237  71.966  127.300 1.00 20.93  ? 209 PHE B CZ  1 
ATOM   1732 N  N   . SER B 1 64  ? 22.209  78.199  123.570 1.00 20.65  ? 210 SER B N   1 
ATOM   1733 C  CA  . SER B 1 64  ? 22.675  79.336  122.782 1.00 25.63  ? 210 SER B CA  1 
ATOM   1734 C  C   . SER B 1 64  ? 24.120  79.740  123.074 1.00 29.58  ? 210 SER B C   1 
ATOM   1735 O  O   . SER B 1 64  ? 24.646  79.479  124.157 1.00 26.78  ? 210 SER B O   1 
ATOM   1736 C  CB  . SER B 1 64  ? 21.757  80.533  122.997 1.00 22.67  ? 210 SER B CB  1 
ATOM   1737 O  OG  . SER B 1 64  ? 22.007  81.139  124.252 1.00 23.03  ? 210 SER B OG  1 
ATOM   1738 N  N   . LEU B 1 65  ? 24.755  80.373  122.090 1.00 29.18  ? 211 LEU B N   1 
ATOM   1739 C  CA  . LEU B 1 65  ? 26.092  80.922  122.260 1.00 26.38  ? 211 LEU B CA  1 
ATOM   1740 C  C   . LEU B 1 65  ? 25.981  82.406  122.540 1.00 28.96  ? 211 LEU B C   1 
ATOM   1741 O  O   . LEU B 1 65  ? 26.962  83.053  122.904 1.00 29.45  ? 211 LEU B O   1 
ATOM   1742 C  CB  . LEU B 1 65  ? 26.934  80.699  121.007 1.00 27.37  ? 211 LEU B CB  1 
ATOM   1743 C  CG  . LEU B 1 65  ? 27.256  79.241  120.681 1.00 29.90  ? 211 LEU B CG  1 
ATOM   1744 C  CD1 . LEU B 1 65  ? 28.086  79.162  119.413 1.00 34.60  ? 211 LEU B CD1 1 
ATOM   1745 C  CD2 . LEU B 1 65  ? 27.979  78.573  121.846 1.00 28.25  ? 211 LEU B CD2 1 
ATOM   1746 N  N   . ILE B 1 66  ? 24.775  82.937  122.363 1.00 27.16  ? 212 ILE B N   1 
ATOM   1747 C  CA  . ILE B 1 66  ? 24.512  84.352  122.574 1.00 26.33  ? 212 ILE B CA  1 
ATOM   1748 C  C   . ILE B 1 66  ? 23.532  84.527  123.726 1.00 25.54  ? 212 ILE B C   1 
ATOM   1749 O  O   . ILE B 1 66  ? 22.558  83.778  123.835 1.00 27.61  ? 212 ILE B O   1 
ATOM   1750 C  CB  . ILE B 1 66  ? 23.951  85.020  121.290 1.00 32.51  ? 212 ILE B CB  1 
ATOM   1751 C  CG1 . ILE B 1 66  ? 24.131  86.535  121.339 1.00 34.43  ? 212 ILE B CG1 1 
ATOM   1752 C  CG2 . ILE B 1 66  ? 22.487  84.658  121.076 1.00 32.41  ? 212 ILE B CG2 1 
ATOM   1753 C  CD1 . ILE B 1 66  ? 23.552  87.252  120.132 1.00 37.46  ? 212 ILE B CD1 1 
ATOM   1754 N  N   . PRO B 1 67  ? 23.804  85.497  124.614 1.00 23.23  ? 213 PRO B N   1 
ATOM   1755 C  CA  . PRO B 1 67  ? 22.904  85.791  125.732 1.00 21.62  ? 213 PRO B CA  1 
ATOM   1756 C  C   . PRO B 1 67  ? 21.817  86.777  125.328 1.00 22.05  ? 213 PRO B C   1 
ATOM   1757 O  O   . PRO B 1 67  ? 22.077  87.672  124.526 1.00 24.07  ? 213 PRO B O   1 
ATOM   1758 C  CB  . PRO B 1 67  ? 23.836  86.444  126.756 1.00 18.96  ? 213 PRO B CB  1 
ATOM   1759 C  CG  . PRO B 1 67  ? 24.865  87.118  125.936 1.00 22.47  ? 213 PRO B CG  1 
ATOM   1760 C  CD  . PRO B 1 67  ? 25.044  86.291  124.682 1.00 22.64  ? 213 PRO B CD  1 
ATOM   1761 N  N   . LYS B 1 68  ? 20.621  86.618  125.887 1.00 23.30  ? 214 LYS B N   1 
ATOM   1762 C  CA  . LYS B 1 68  ? 19.526  87.545  125.624 1.00 26.77  ? 214 LYS B CA  1 
ATOM   1763 C  C   . LYS B 1 68  ? 18.639  87.708  126.849 1.00 24.78  ? 214 LYS B C   1 
ATOM   1764 O  O   . LYS B 1 68  ? 18.733  86.939  127.798 1.00 25.70  ? 214 LYS B O   1 
ATOM   1765 C  CB  . LYS B 1 68  ? 18.683  87.063  124.440 1.00 27.50  ? 214 LYS B CB  1 
ATOM   1766 C  CG  . LYS B 1 68  ? 19.335  87.253  123.082 1.00 28.71  ? 214 LYS B CG  1 
ATOM   1767 C  CD  . LYS B 1 68  ? 18.538  86.528  121.998 1.00 34.28  ? 214 LYS B CD  1 
ATOM   1768 C  CE  . LYS B 1 68  ? 19.080  86.807  120.606 1.00 38.25  ? 214 LYS B CE  1 
ATOM   1769 N  NZ  . LYS B 1 68  ? 18.909  88.237  120.220 1.00 44.88  ? 214 LYS B NZ  1 
ATOM   1770 N  N   . THR B 1 69  ? 17.777  88.718  126.829 1.00 24.40  ? 215 THR B N   1 
ATOM   1771 C  CA  . THR B 1 69  ? 16.752  88.846  127.851 1.00 26.44  ? 215 THR B CA  1 
ATOM   1772 C  C   . THR B 1 69  ? 15.802  87.682  127.646 1.00 24.54  ? 215 THR B C   1 
ATOM   1773 O  O   . THR B 1 69  ? 15.810  87.064  126.584 1.00 25.18  ? 215 THR B O   1 
ATOM   1774 C  CB  . THR B 1 69  ? 15.967  90.159  127.710 1.00 28.43  ? 215 THR B CB  1 
ATOM   1775 O  OG1 . THR B 1 69  ? 15.127  90.088  126.551 1.00 28.23  ? 215 THR B OG1 1 
ATOM   1776 C  CG2 . THR B 1 69  ? 16.920  91.340  127.582 1.00 26.25  ? 215 THR B CG2 1 
ATOM   1777 N  N   . TRP B 1 70  ? 14.986  87.375  128.648 1.00 27.13  ? 216 TRP B N   1 
ATOM   1778 C  CA  . TRP B 1 70  ? 14.063  86.252  128.532 1.00 27.02  ? 216 TRP B CA  1 
ATOM   1779 C  C   . TRP B 1 70  ? 13.187  86.403  127.292 1.00 29.38  ? 216 TRP B C   1 
ATOM   1780 O  O   . TRP B 1 70  ? 13.091  85.487  126.474 1.00 28.26  ? 216 TRP B O   1 
ATOM   1781 C  CB  . TRP B 1 70  ? 13.186  86.132  129.776 1.00 22.70  ? 216 TRP B CB  1 
ATOM   1782 C  CG  . TRP B 1 70  ? 12.430  84.829  129.865 1.00 25.83  ? 216 TRP B CG  1 
ATOM   1783 C  CD1 . TRP B 1 70  ? 12.887  83.648  130.382 1.00 26.37  ? 216 TRP B CD1 1 
ATOM   1784 C  CD2 . TRP B 1 70  ? 11.080  84.584  129.445 1.00 30.70  ? 216 TRP B CD2 1 
ATOM   1785 N  NE1 . TRP B 1 70  ? 11.908  82.688  130.308 1.00 25.97  ? 216 TRP B NE1 1 
ATOM   1786 C  CE2 . TRP B 1 70  ? 10.791  83.234  129.734 1.00 29.76  ? 216 TRP B CE2 1 
ATOM   1787 C  CE3 . TRP B 1 70  ? 10.091  85.372  128.844 1.00 33.91  ? 216 TRP B CE3 1 
ATOM   1788 C  CZ2 . TRP B 1 70  ? 9.556   82.654  129.440 1.00 34.48  ? 216 TRP B CZ2 1 
ATOM   1789 C  CZ3 . TRP B 1 70  ? 8.865   84.797  128.556 1.00 32.36  ? 216 TRP B CZ3 1 
ATOM   1790 C  CH2 . TRP B 1 70  ? 8.609   83.450  128.853 1.00 36.75  ? 216 TRP B CH2 1 
ATOM   1791 N  N   . TYR B 1 71  ? 12.560  87.567  127.154 1.00 31.50  ? 217 TYR B N   1 
ATOM   1792 C  CA  . TYR B 1 71  ? 11.640  87.816  126.048 1.00 33.36  ? 217 TYR B CA  1 
ATOM   1793 C  C   . TYR B 1 71  ? 12.288  87.611  124.690 1.00 27.73  ? 217 TYR B C   1 
ATOM   1794 O  O   . TYR B 1 71  ? 11.700  86.991  123.806 1.00 29.65  ? 217 TYR B O   1 
ATOM   1795 C  CB  . TYR B 1 71  ? 11.063  89.230  126.136 1.00 43.42  ? 217 TYR B CB  1 
ATOM   1796 C  CG  . TYR B 1 71  ? 10.340  89.497  127.434 1.00 49.19  ? 217 TYR B CG  1 
ATOM   1797 C  CD1 . TYR B 1 71  ? 9.084   88.953  127.672 1.00 49.74  ? 217 TYR B CD1 1 
ATOM   1798 C  CD2 . TYR B 1 71  ? 10.913  90.288  128.422 1.00 51.50  ? 217 TYR B CD2 1 
ATOM   1799 C  CE1 . TYR B 1 71  ? 8.417   89.190  128.856 1.00 50.41  ? 217 TYR B CE1 1 
ATOM   1800 C  CE2 . TYR B 1 71  ? 10.253  90.531  129.608 1.00 53.50  ? 217 TYR B CE2 1 
ATOM   1801 C  CZ  . TYR B 1 71  ? 9.004   89.979  129.821 1.00 53.63  ? 217 TYR B CZ  1 
ATOM   1802 O  OH  . TYR B 1 71  ? 8.338   90.215  131.005 1.00 56.38  ? 217 TYR B OH  1 
ATOM   1803 N  N   . SER B 1 72  ? 13.495  88.143  124.522 1.00 26.60  ? 218 SER B N   1 
ATOM   1804 C  CA  . SER B 1 72  ? 14.178  88.055  123.237 1.00 34.10  ? 218 SER B CA  1 
ATOM   1805 C  C   . SER B 1 72  ? 14.650  86.636  122.985 1.00 35.23  ? 218 SER B C   1 
ATOM   1806 O  O   . SER B 1 72  ? 14.783  86.212  121.834 1.00 32.89  ? 218 SER B O   1 
ATOM   1807 C  CB  . SER B 1 72  ? 15.359  89.026  123.165 1.00 36.32  ? 218 SER B CB  1 
ATOM   1808 O  OG  . SER B 1 72  ? 14.911  90.366  123.073 1.00 41.69  ? 218 SER B OG  1 
ATOM   1809 N  N   . ALA B 1 73  ? 14.910  85.909  124.070 1.00 31.27  ? 219 ALA B N   1 
ATOM   1810 C  CA  . ALA B 1 73  ? 15.292  84.515  123.969 1.00 23.63  ? 219 ALA B CA  1 
ATOM   1811 C  C   . ALA B 1 73  ? 14.115  83.702  123.437 1.00 29.33  ? 219 ALA B C   1 
ATOM   1812 O  O   . ALA B 1 73  ? 14.285  82.871  122.549 1.00 32.07  ? 219 ALA B O   1 
ATOM   1813 C  CB  . ALA B 1 73  ? 15.748  83.986  125.310 1.00 16.66  ? 219 ALA B CB  1 
ATOM   1814 N  N   . GLU B 1 74  ? 12.922  83.947  123.970 1.00 30.86  ? 220 GLU B N   1 
ATOM   1815 C  CA  . GLU B 1 74  ? 11.737  83.233  123.495 1.00 34.15  ? 220 GLU B CA  1 
ATOM   1816 C  C   . GLU B 1 74  ? 11.445  83.512  122.018 1.00 35.07  ? 220 GLU B C   1 
ATOM   1817 O  O   . GLU B 1 74  ? 11.165  82.593  121.260 1.00 34.16  ? 220 GLU B O   1 
ATOM   1818 C  CB  . GLU B 1 74  ? 10.506  83.566  124.338 1.00 33.66  ? 220 GLU B CB  1 
ATOM   1819 C  CG  . GLU B 1 74  ? 9.204   83.019  123.756 1.00 36.84  ? 220 GLU B CG  1 
ATOM   1820 C  CD  . GLU B 1 74  ? 9.124   81.498  123.789 1.00 39.27  ? 220 GLU B CD  1 
ATOM   1821 O  OE1 . GLU B 1 74  ? 10.104  80.845  124.210 1.00 40.28  ? 220 GLU B OE1 1 
ATOM   1822 O  OE2 . GLU B 1 74  ? 8.072   80.954  123.398 1.00 38.62  ? 220 GLU B OE2 1 
ATOM   1823 N  N   . GLN B 1 75  ? 11.504  84.780  121.617 1.00 34.90  ? 221 GLN B N   1 
ATOM   1824 C  CA  . GLN B 1 75  ? 11.279  85.140  120.223 1.00 36.82  ? 221 GLN B CA  1 
ATOM   1825 C  C   . GLN B 1 75  ? 12.247  84.357  119.355 1.00 35.79  ? 221 GLN B C   1 
ATOM   1826 O  O   . GLN B 1 75  ? 11.886  83.863  118.284 1.00 36.53  ? 221 GLN B O   1 
ATOM   1827 C  CB  . GLN B 1 75  ? 11.482  86.643  119.994 1.00 40.82  ? 221 GLN B CB  1 
ATOM   1828 C  CG  . GLN B 1 75  ? 10.459  87.540  120.679 1.00 49.67  ? 221 GLN B CG  1 
ATOM   1829 C  CD  . GLN B 1 75  ? 10.771  89.021  120.503 1.00 61.48  ? 221 GLN B CD  1 
ATOM   1830 O  OE1 . GLN B 1 75  ? 11.653  89.393  119.726 1.00 65.68  ? 221 GLN B OE1 1 
ATOM   1831 N  NE2 . GLN B 1 75  ? 10.047  89.872  121.228 1.00 63.20  ? 221 GLN B NE2 1 
ATOM   1832 N  N   . PHE B 1 76  ? 13.483  84.252  119.833 1.00 31.12  ? 222 PHE B N   1 
ATOM   1833 C  CA  . PHE B 1 76  ? 14.539  83.545  119.125 1.00 27.46  ? 222 PHE B CA  1 
ATOM   1834 C  C   . PHE B 1 76  ? 14.165  82.074  118.952 1.00 28.78  ? 222 PHE B C   1 
ATOM   1835 O  O   . PHE B 1 76  ? 14.334  81.507  117.879 1.00 32.40  ? 222 PHE B O   1 
ATOM   1836 C  CB  . PHE B 1 76  ? 15.854  83.689  119.892 1.00 29.82  ? 222 PHE B CB  1 
ATOM   1837 C  CG  . PHE B 1 76  ? 17.014  82.951  119.280 1.00 30.96  ? 222 PHE B CG  1 
ATOM   1838 C  CD1 . PHE B 1 76  ? 18.027  83.641  118.638 1.00 34.04  ? 222 PHE B CD1 1 
ATOM   1839 C  CD2 . PHE B 1 76  ? 17.106  81.569  119.370 1.00 28.54  ? 222 PHE B CD2 1 
ATOM   1840 C  CE1 . PHE B 1 76  ? 19.107  82.967  118.083 1.00 37.50  ? 222 PHE B CE1 1 
ATOM   1841 C  CE2 . PHE B 1 76  ? 18.181  80.887  118.814 1.00 32.22  ? 222 PHE B CE2 1 
ATOM   1842 C  CZ  . PHE B 1 76  ? 19.182  81.586  118.171 1.00 35.78  ? 222 PHE B CZ  1 
ATOM   1843 N  N   . CYS B 1 77  ? 13.651  81.456  120.008 1.00 27.96  ? 223 CYS B N   1 
ATOM   1844 C  CA  . CYS B 1 77  ? 13.225  80.064  119.919 1.00 26.15  ? 223 CYS B CA  1 
ATOM   1845 C  C   . CYS B 1 77  ? 12.038  79.917  118.960 1.00 29.20  ? 223 CYS B C   1 
ATOM   1846 O  O   . CYS B 1 77  ? 12.026  79.025  118.116 1.00 28.88  ? 223 CYS B O   1 
ATOM   1847 C  CB  . CYS B 1 77  ? 12.895  79.509  121.304 1.00 19.31  ? 223 CYS B CB  1 
ATOM   1848 S  SG  . CYS B 1 77  ? 14.313  79.543  122.470 1.00 29.80  ? 223 CYS B SG  1 
ATOM   1849 N  N   . VAL B 1 78  ? 11.053  80.799  119.081 1.00 28.69  ? 224 VAL B N   1 
ATOM   1850 C  CA  . VAL B 1 78  ? 9.897   80.779  118.187 1.00 32.16  ? 224 VAL B CA  1 
ATOM   1851 C  C   . VAL B 1 78  ? 10.308  80.819  116.712 1.00 34.64  ? 224 VAL B C   1 
ATOM   1852 O  O   . VAL B 1 78  ? 9.777   80.075  115.886 1.00 40.11  ? 224 VAL B O   1 
ATOM   1853 C  CB  . VAL B 1 78  ? 8.936   81.945  118.487 1.00 32.21  ? 224 VAL B CB  1 
ATOM   1854 C  CG1 . VAL B 1 78  ? 7.861   82.039  117.413 1.00 29.42  ? 224 VAL B CG1 1 
ATOM   1855 C  CG2 . VAL B 1 78  ? 8.315   81.774  119.873 1.00 27.39  ? 224 VAL B CG2 1 
ATOM   1856 N  N   . SER B 1 79  ? 11.266  81.681  116.389 1.00 31.33  ? 225 SER B N   1 
ATOM   1857 C  CA  . SER B 1 79  ? 11.771  81.786  115.027 1.00 29.80  ? 225 SER B CA  1 
ATOM   1858 C  C   . SER B 1 79  ? 12.503  80.522  114.578 1.00 30.69  ? 225 SER B C   1 
ATOM   1859 O  O   . SER B 1 79  ? 12.824  80.367  113.398 1.00 31.94  ? 225 SER B O   1 
ATOM   1860 C  CB  . SER B 1 79  ? 12.700  82.990  114.893 1.00 33.46  ? 225 SER B CB  1 
ATOM   1861 O  OG  . SER B 1 79  ? 13.980  82.703  115.431 1.00 38.04  ? 225 SER B OG  1 
ATOM   1862 N  N   . ARG B 1 80  ? 12.793  79.629  115.516 1.00 29.80  ? 226 ARG B N   1 
ATOM   1863 C  CA  . ARG B 1 80  ? 13.404  78.350  115.167 1.00 30.40  ? 226 ARG B CA  1 
ATOM   1864 C  C   . ARG B 1 80  ? 12.408  77.221  115.395 1.00 30.06  ? 226 ARG B C   1 
ATOM   1865 O  O   . ARG B 1 80  ? 12.795  76.074  115.611 1.00 34.80  ? 226 ARG B O   1 
ATOM   1866 C  CB  . ARG B 1 80  ? 14.671  78.102  115.980 1.00 30.08  ? 226 ARG B CB  1 
ATOM   1867 C  CG  . ARG B 1 80  ? 15.642  79.269  116.004 1.00 35.63  ? 226 ARG B CG  1 
ATOM   1868 C  CD  . ARG B 1 80  ? 16.385  79.386  114.699 1.00 43.75  ? 226 ARG B CD  1 
ATOM   1869 N  NE  . ARG B 1 80  ? 17.789  79.733  114.903 1.00 47.27  ? 226 ARG B NE  1 
ATOM   1870 C  CZ  . ARG B 1 80  ? 18.282  80.959  114.768 1.00 48.18  ? 226 ARG B CZ  1 
ATOM   1871 N  NH1 . ARG B 1 80  ? 17.484  81.961  114.430 1.00 48.78  ? 226 ARG B NH1 1 
ATOM   1872 N  NH2 . ARG B 1 80  ? 19.572  81.182  114.966 1.00 48.67  ? 226 ARG B NH2 1 
ATOM   1873 N  N   . ASN B 1 81  ? 11.126  77.565  115.355 1.00 28.91  ? 227 ASN B N   1 
ATOM   1874 C  CA  A ASN B 1 81  ? 10.058  76.592  115.532 0.50 32.04  ? 227 ASN B CA  1 
ATOM   1875 C  CA  B ASN B 1 81  ? 10.057  76.587  115.528 0.50 32.05  ? 227 ASN B CA  1 
ATOM   1876 C  C   . ASN B 1 81  ? 10.224  75.777  116.807 1.00 35.38  ? 227 ASN B C   1 
ATOM   1877 O  O   . ASN B 1 81  ? 10.137  74.549  116.790 1.00 41.50  ? 227 ASN B O   1 
ATOM   1878 C  CB  A ASN B 1 81  ? 9.979   75.683  114.309 0.50 32.89  ? 227 ASN B CB  1 
ATOM   1879 C  CB  B ASN B 1 81  ? 9.981   75.650  114.321 0.50 32.86  ? 227 ASN B CB  1 
ATOM   1880 C  CG  A ASN B 1 81  ? 9.871   76.468  113.017 0.50 31.88  ? 227 ASN B CG  1 
ATOM   1881 C  CG  B ASN B 1 81  ? 8.634   74.960  114.203 0.50 35.82  ? 227 ASN B CG  1 
ATOM   1882 O  OD1 A ASN B 1 81  ? 9.042   77.371  112.895 0.50 28.20  ? 227 ASN B OD1 1 
ATOM   1883 O  OD1 B ASN B 1 81  ? 7.625   75.455  114.706 0.50 37.13  ? 227 ASN B OD1 1 
ATOM   1884 N  ND2 A ASN B 1 81  ? 10.718  76.137  112.048 0.50 32.26  ? 227 ASN B ND2 1 
ATOM   1885 N  ND2 B ASN B 1 81  ? 8.610   73.814  113.527 0.50 38.01  ? 227 ASN B ND2 1 
ATOM   1886 N  N   . SER B 1 82  ? 10.465  76.478  117.911 1.00 36.98  ? 228 SER B N   1 
ATOM   1887 C  CA  . SER B 1 82  ? 10.643  75.858  119.218 1.00 36.91  ? 228 SER B CA  1 
ATOM   1888 C  C   . SER B 1 82  ? 10.272  76.856  120.306 1.00 37.92  ? 228 SER B C   1 
ATOM   1889 O  O   . SER B 1 82  ? 9.838   77.970  120.013 1.00 41.09  ? 228 SER B O   1 
ATOM   1890 C  CB  . SER B 1 82  ? 12.093  75.401  119.407 1.00 35.25  ? 228 SER B CB  1 
ATOM   1891 O  OG  . SER B 1 82  ? 12.967  76.511  119.554 1.00 33.84  ? 228 SER B OG  1 
ATOM   1892 N  N   . HIS B 1 83  ? 10.451  76.450  121.559 1.00 34.82  ? 229 HIS B N   1 
ATOM   1893 C  CA  . HIS B 1 83  ? 10.175  77.308  122.700 1.00 33.30  ? 229 HIS B CA  1 
ATOM   1894 C  C   . HIS B 1 83  ? 11.276  77.181  123.740 1.00 33.61  ? 229 HIS B C   1 
ATOM   1895 O  O   . HIS B 1 83  ? 11.978  76.168  123.787 1.00 31.42  ? 229 HIS B O   1 
ATOM   1896 C  CB  . HIS B 1 83  ? 8.851   76.925  123.350 1.00 32.19  ? 229 HIS B CB  1 
ATOM   1897 C  CG  . HIS B 1 83  ? 7.652   77.285  122.536 1.00 37.18  ? 229 HIS B CG  1 
ATOM   1898 N  ND1 . HIS B 1 83  ? 7.050   78.522  122.610 1.00 37.80  ? 229 HIS B ND1 1 
ATOM   1899 C  CD2 . HIS B 1 83  ? 6.935   76.569  121.639 1.00 37.02  ? 229 HIS B CD2 1 
ATOM   1900 C  CE1 . HIS B 1 83  ? 6.018   78.555  121.788 1.00 39.65  ? 229 HIS B CE1 1 
ATOM   1901 N  NE2 . HIS B 1 83  ? 5.926   77.383  121.186 1.00 40.08  ? 229 HIS B NE2 1 
ATOM   1902 N  N   . LEU B 1 84  ? 11.429  78.206  124.575 1.00 27.46  ? 230 LEU B N   1 
ATOM   1903 C  CA  . LEU B 1 84  ? 12.296  78.072  125.730 1.00 23.17  ? 230 LEU B CA  1 
ATOM   1904 C  C   . LEU B 1 84  ? 11.877  76.776  126.402 1.00 25.35  ? 230 LEU B C   1 
ATOM   1905 O  O   . LEU B 1 84  ? 10.683  76.475  126.508 1.00 25.27  ? 230 LEU B O   1 
ATOM   1906 C  CB  . LEU B 1 84  ? 12.140  79.257  126.678 1.00 22.46  ? 230 LEU B CB  1 
ATOM   1907 C  CG  . LEU B 1 84  ? 12.972  80.489  126.309 1.00 24.40  ? 230 LEU B CG  1 
ATOM   1908 C  CD1 . LEU B 1 84  ? 12.575  81.681  127.163 1.00 22.38  ? 230 LEU B CD1 1 
ATOM   1909 C  CD2 . LEU B 1 84  ? 14.473  80.207  126.430 1.00 24.26  ? 230 LEU B CD2 1 
ATOM   1910 N  N   . THR B 1 85  ? 12.855  75.987  126.827 1.00 20.42  ? 231 THR B N   1 
ATOM   1911 C  CA  . THR B 1 85  ? 12.562  74.625  127.242 1.00 19.25  ? 231 THR B CA  1 
ATOM   1912 C  C   . THR B 1 85  ? 11.676  74.560  128.479 1.00 21.22  ? 231 THR B C   1 
ATOM   1913 O  O   . THR B 1 85  ? 11.788  75.391  129.382 1.00 24.51  ? 231 THR B O   1 
ATOM   1914 C  CB  . THR B 1 85  ? 13.854  73.830  127.511 1.00 25.78  ? 231 THR B CB  1 
ATOM   1915 O  OG1 . THR B 1 85  ? 13.527  72.451  127.711 1.00 26.60  ? 231 THR B OG1 1 
ATOM   1916 C  CG2 . THR B 1 85  ? 14.578  74.372  128.753 1.00 26.99  ? 231 THR B CG2 1 
ATOM   1917 N  N   . SER B 1 86  ? 10.787  73.571  128.503 1.00 21.80  ? 232 SER B N   1 
ATOM   1918 C  CA  . SER B 1 86  ? 10.108  73.171  129.732 1.00 23.35  ? 232 SER B CA  1 
ATOM   1919 C  C   . SER B 1 86  ? 10.908  72.027  130.359 1.00 20.22  ? 232 SER B C   1 
ATOM   1920 O  O   . SER B 1 86  ? 11.851  71.521  129.755 1.00 21.56  ? 232 SER B O   1 
ATOM   1921 C  CB  . SER B 1 86  ? 8.672   72.721  129.439 1.00 27.67  ? 232 SER B CB  1 
ATOM   1922 O  OG  . SER B 1 86  ? 8.644   71.654  128.509 1.00 23.01  ? 232 SER B OG  1 
ATOM   1923 N  N   . VAL B 1 87  ? 10.544  71.630  131.570 1.00 21.94  ? 233 VAL B N   1 
ATOM   1924 C  CA  . VAL B 1 87  ? 11.194  70.505  132.236 1.00 27.62  ? 233 VAL B CA  1 
ATOM   1925 C  C   . VAL B 1 87  ? 10.120  69.578  132.795 1.00 30.93  ? 233 VAL B C   1 
ATOM   1926 O  O   . VAL B 1 87  ? 9.373   69.954  133.692 1.00 33.48  ? 233 VAL B O   1 
ATOM   1927 C  CB  . VAL B 1 87  ? 12.118  70.966  133.385 1.00 27.06  ? 233 VAL B CB  1 
ATOM   1928 C  CG1 . VAL B 1 87  ? 12.823  69.770  134.005 1.00 23.31  ? 233 VAL B CG1 1 
ATOM   1929 C  CG2 . VAL B 1 87  ? 13.126  71.994  132.884 1.00 24.26  ? 233 VAL B CG2 1 
ATOM   1930 N  N   . THR B 1 88  ? 10.040  68.366  132.262 1.00 33.55  ? 234 THR B N   1 
ATOM   1931 C  CA  . THR B 1 88  ? 8.921   67.491  132.580 1.00 35.58  ? 234 THR B CA  1 
ATOM   1932 C  C   . THR B 1 88  ? 9.328   66.297  133.438 1.00 39.63  ? 234 THR B C   1 
ATOM   1933 O  O   . THR B 1 88  ? 8.473   65.576  133.956 1.00 42.44  ? 234 THR B O   1 
ATOM   1934 C  CB  . THR B 1 88  ? 8.214   67.008  131.297 1.00 34.77  ? 234 THR B CB  1 
ATOM   1935 O  OG1 . THR B 1 88  ? 9.155   66.325  130.461 1.00 38.72  ? 234 THR B OG1 1 
ATOM   1936 C  CG2 . THR B 1 88  ? 7.643   68.191  130.530 1.00 31.39  ? 234 THR B CG2 1 
ATOM   1937 N  N   . SER B 1 89  ? 10.631  66.093  133.597 1.00 38.01  ? 235 SER B N   1 
ATOM   1938 C  CA  . SER B 1 89  ? 11.120  64.966  134.383 1.00 38.67  ? 235 SER B CA  1 
ATOM   1939 C  C   . SER B 1 89  ? 12.491  65.241  134.986 1.00 37.74  ? 235 SER B C   1 
ATOM   1940 O  O   . SER B 1 89  ? 13.257  66.060  134.472 1.00 35.47  ? 235 SER B O   1 
ATOM   1941 C  CB  . SER B 1 89  ? 11.166  63.695  133.531 1.00 35.94  ? 235 SER B CB  1 
ATOM   1942 O  OG  . SER B 1 89  ? 12.115  63.820  132.487 1.00 35.11  ? 235 SER B OG  1 
ATOM   1943 N  N   . GLU B 1 90  ? 12.781  64.558  136.087 1.00 37.39  ? 236 GLU B N   1 
ATOM   1944 C  CA  . GLU B 1 90  ? 14.079  64.646  136.734 1.00 42.17  ? 236 GLU B CA  1 
ATOM   1945 C  C   . GLU B 1 90  ? 15.160  64.307  135.723 1.00 39.68  ? 236 GLU B C   1 
ATOM   1946 O  O   . GLU B 1 90  ? 16.238  64.909  135.714 1.00 37.36  ? 236 GLU B O   1 
ATOM   1947 C  CB  . GLU B 1 90  ? 14.138  63.671  137.910 1.00 50.26  ? 236 GLU B CB  1 
ATOM   1948 C  CG  . GLU B 1 90  ? 15.517  63.504  138.524 1.00 58.72  ? 236 GLU B CG  1 
ATOM   1949 C  CD  . GLU B 1 90  ? 15.499  62.611  139.752 1.00 68.24  ? 236 GLU B CD  1 
ATOM   1950 O  OE1 . GLU B 1 90  ? 16.429  61.790  139.909 1.00 72.14  ? 236 GLU B OE1 1 
ATOM   1951 O  OE2 . GLU B 1 90  ? 14.550  62.724  140.558 1.00 70.52  ? 236 GLU B OE2 1 
ATOM   1952 N  N   . SER B 1 91  ? 14.847  63.334  134.872 1.00 36.97  ? 237 SER B N   1 
ATOM   1953 C  CA  . SER B 1 91  ? 15.734  62.892  133.805 1.00 37.23  ? 237 SER B CA  1 
ATOM   1954 C  C   . SER B 1 91  ? 16.067  64.038  132.860 1.00 29.65  ? 237 SER B C   1 
ATOM   1955 O  O   . SER B 1 91  ? 17.219  64.218  132.466 1.00 27.65  ? 237 SER B O   1 
ATOM   1956 C  CB  . SER B 1 91  ? 15.079  61.746  133.027 1.00 41.51  ? 237 SER B CB  1 
ATOM   1957 O  OG  . SER B 1 91  ? 15.735  61.521  131.794 1.00 42.68  ? 237 SER B OG  1 
ATOM   1958 N  N   . GLU B 1 92  ? 15.049  64.806  132.496 1.00 27.05  ? 238 GLU B N   1 
ATOM   1959 C  CA  . GLU B 1 92  ? 15.241  65.980  131.653 1.00 27.94  ? 238 GLU B CA  1 
ATOM   1960 C  C   . GLU B 1 92  ? 16.026  67.056  132.396 1.00 25.04  ? 238 GLU B C   1 
ATOM   1961 O  O   . GLU B 1 92  ? 16.935  67.666  131.841 1.00 23.56  ? 238 GLU B O   1 
ATOM   1962 C  CB  . GLU B 1 92  ? 13.893  66.537  131.204 1.00 28.80  ? 238 GLU B CB  1 
ATOM   1963 C  CG  . GLU B 1 92  ? 14.006  67.727  130.284 1.00 29.07  ? 238 GLU B CG  1 
ATOM   1964 C  CD  . GLU B 1 92  ? 12.679  68.099  129.655 1.00 31.13  ? 238 GLU B CD  1 
ATOM   1965 O  OE1 . GLU B 1 92  ? 11.630  67.716  130.211 1.00 31.94  ? 238 GLU B OE1 1 
ATOM   1966 O  OE2 . GLU B 1 92  ? 12.685  68.777  128.605 1.00 31.77  ? 238 GLU B OE2 1 
ATOM   1967 N  N   . GLN B 1 93  ? 15.669  67.269  133.659 1.00 24.66  ? 239 GLN B N   1 
ATOM   1968 C  CA  . GLN B 1 93  ? 16.350  68.235  134.514 1.00 21.11  ? 239 GLN B CA  1 
ATOM   1969 C  C   . GLN B 1 93  ? 17.831  67.921  134.636 1.00 24.74  ? 239 GLN B C   1 
ATOM   1970 O  O   . GLN B 1 93  ? 18.671  68.824  134.671 1.00 24.47  ? 239 GLN B O   1 
ATOM   1971 C  CB  . GLN B 1 93  ? 15.725  68.244  135.905 1.00 22.09  ? 239 GLN B CB  1 
ATOM   1972 C  CG  . GLN B 1 93  ? 16.462  69.133  136.899 1.00 28.48  ? 239 GLN B CG  1 
ATOM   1973 C  CD  . GLN B 1 93  ? 16.186  70.614  136.685 1.00 29.36  ? 239 GLN B CD  1 
ATOM   1974 O  OE1 . GLN B 1 93  ? 15.616  71.015  135.668 1.00 30.38  ? 239 GLN B OE1 1 
ATOM   1975 N  NE2 . GLN B 1 93  ? 16.588  71.432  137.649 1.00 31.39  ? 239 GLN B NE2 1 
ATOM   1976 N  N   . GLU B 1 94  ? 18.148  66.633  134.715 1.00 27.71  ? 240 GLU B N   1 
ATOM   1977 C  CA  . GLU B 1 94  ? 19.534  66.202  134.821 1.00 28.78  ? 240 GLU B CA  1 
ATOM   1978 C  C   . GLU B 1 94  ? 20.280  66.445  133.516 1.00 28.96  ? 240 GLU B C   1 
ATOM   1979 O  O   . GLU B 1 94  ? 21.406  66.939  133.521 1.00 29.83  ? 240 GLU B O   1 
ATOM   1980 C  CB  . GLU B 1 94  ? 19.623  64.725  135.202 1.00 31.26  ? 240 GLU B CB  1 
ATOM   1981 C  CG  . GLU B 1 94  ? 21.049  64.208  135.230 1.00 38.25  ? 240 GLU B CG  1 
ATOM   1982 C  CD  . GLU B 1 94  ? 21.133  62.733  135.565 1.00 47.76  ? 240 GLU B CD  1 
ATOM   1983 O  OE1 . GLU B 1 94  ? 20.174  61.991  135.260 1.00 49.90  ? 240 GLU B OE1 1 
ATOM   1984 O  OE2 . GLU B 1 94  ? 22.166  62.316  136.128 1.00 51.08  ? 240 GLU B OE2 1 
ATOM   1985 N  N   . PHE B 1 95  ? 19.661  66.085  132.397 1.00 26.72  ? 241 PHE B N   1 
ATOM   1986 C  CA  . PHE B 1 95  ? 20.281  66.344  131.108 1.00 25.37  ? 241 PHE B CA  1 
ATOM   1987 C  C   . PHE B 1 95  ? 20.581  67.832  130.983 1.00 23.74  ? 241 PHE B C   1 
ATOM   1988 O  O   . PHE B 1 95  ? 21.650  68.222  130.518 1.00 27.11  ? 241 PHE B O   1 
ATOM   1989 C  CB  . PHE B 1 95  ? 19.389  65.889  129.945 1.00 23.59  ? 241 PHE B CB  1 
ATOM   1990 C  CG  . PHE B 1 95  ? 19.739  66.536  128.635 1.00 21.56  ? 241 PHE B CG  1 
ATOM   1991 C  CD1 . PHE B 1 95  ? 20.847  66.121  127.916 1.00 24.12  ? 241 PHE B CD1 1 
ATOM   1992 C  CD2 . PHE B 1 95  ? 18.975  67.576  128.132 1.00 22.13  ? 241 PHE B CD2 1 
ATOM   1993 C  CE1 . PHE B 1 95  ? 21.178  66.725  126.711 1.00 27.19  ? 241 PHE B CE1 1 
ATOM   1994 C  CE2 . PHE B 1 95  ? 19.302  68.183  126.928 1.00 22.55  ? 241 PHE B CE2 1 
ATOM   1995 C  CZ  . PHE B 1 95  ? 20.405  67.760  126.220 1.00 24.03  ? 241 PHE B CZ  1 
ATOM   1996 N  N   . LEU B 1 96  ? 19.636  68.662  131.411 1.00 21.12  ? 242 LEU B N   1 
ATOM   1997 C  CA  . LEU B 1 96  ? 19.773  70.106  131.239 1.00 21.49  ? 242 LEU B CA  1 
ATOM   1998 C  C   . LEU B 1 96  ? 20.870  70.691  132.131 1.00 22.18  ? 242 LEU B C   1 
ATOM   1999 O  O   . LEU B 1 96  ? 21.708  71.456  131.660 1.00 18.66  ? 242 LEU B O   1 
ATOM   2000 C  CB  . LEU B 1 96  ? 18.437  70.822  131.478 1.00 18.44  ? 242 LEU B CB  1 
ATOM   2001 C  CG  . LEU B 1 96  ? 17.313  70.475  130.496 1.00 22.32  ? 242 LEU B CG  1 
ATOM   2002 C  CD1 . LEU B 1 96  ? 15.972  71.046  130.940 1.00 21.99  ? 242 LEU B CD1 1 
ATOM   2003 C  CD2 . LEU B 1 96  ? 17.666  70.951  129.097 1.00 21.71  ? 242 LEU B CD2 1 
ATOM   2004 N  N   . TYR B 1 97  ? 20.880  70.329  133.410 1.00 22.42  ? 243 TYR B N   1 
ATOM   2005 C  CA  . TYR B 1 97  ? 21.880  70.904  134.302 1.00 26.68  ? 243 TYR B CA  1 
ATOM   2006 C  C   . TYR B 1 97  ? 23.285  70.428  133.936 1.00 30.06  ? 243 TYR B C   1 
ATOM   2007 O  O   . TYR B 1 97  ? 24.239  71.200  133.997 1.00 34.50  ? 243 TYR B O   1 
ATOM   2008 C  CB  . TYR B 1 97  ? 21.531  70.694  135.790 1.00 24.65  ? 243 TYR B CB  1 
ATOM   2009 C  CG  . TYR B 1 97  ? 22.126  69.478  136.483 1.00 25.34  ? 243 TYR B CG  1 
ATOM   2010 C  CD1 . TYR B 1 97  ? 23.493  69.387  136.734 1.00 21.94  ? 243 TYR B CD1 1 
ATOM   2011 C  CD2 . TYR B 1 97  ? 21.308  68.452  136.944 1.00 27.40  ? 243 TYR B CD2 1 
ATOM   2012 C  CE1 . TYR B 1 97  ? 24.029  68.291  137.384 1.00 25.80  ? 243 TYR B CE1 1 
ATOM   2013 C  CE2 . TYR B 1 97  ? 21.835  67.355  137.597 1.00 29.58  ? 243 TYR B CE2 1 
ATOM   2014 C  CZ  . TYR B 1 97  ? 23.196  67.279  137.817 1.00 31.18  ? 243 TYR B CZ  1 
ATOM   2015 O  OH  . TYR B 1 97  ? 23.722  66.182  138.466 1.00 36.50  ? 243 TYR B OH  1 
ATOM   2016 N  N   . LYS B 1 98  ? 23.400  69.171  133.518 1.00 26.43  ? 244 LYS B N   1 
ATOM   2017 C  CA  . LYS B 1 98  ? 24.693  68.621  133.119 1.00 27.08  ? 244 LYS B CA  1 
ATOM   2018 C  C   . LYS B 1 98  ? 25.217  69.326  131.875 1.00 25.49  ? 244 LYS B C   1 
ATOM   2019 O  O   . LYS B 1 98  ? 26.366  69.781  131.843 1.00 24.79  ? 244 LYS B O   1 
ATOM   2020 C  CB  . LYS B 1 98  ? 24.584  67.116  132.863 1.00 29.31  ? 244 LYS B CB  1 
ATOM   2021 C  CG  . LYS B 1 98  ? 24.267  66.285  134.100 1.00 34.86  ? 244 LYS B CG  1 
ATOM   2022 C  CD  . LYS B 1 98  ? 25.515  65.631  134.671 1.00 42.71  ? 244 LYS B CD  1 
ATOM   2023 C  CE  . LYS B 1 98  ? 25.185  64.799  135.903 1.00 51.35  ? 244 LYS B CE  1 
ATOM   2024 N  NZ  . LYS B 1 98  ? 26.346  63.971  136.333 1.00 57.00  ? 244 LYS B NZ  1 
ATOM   2025 N  N   . THR B 1 99  ? 24.366  69.416  130.857 1.00 16.90  ? 245 THR B N   1 
ATOM   2026 C  CA  . THR B 1 99  ? 24.742  70.044  129.594 1.00 20.40  ? 245 THR B CA  1 
ATOM   2027 C  C   . THR B 1 99  ? 25.035  71.555  129.750 1.00 21.02  ? 245 THR B C   1 
ATOM   2028 O  O   . THR B 1 99  ? 25.910  72.097  129.078 1.00 22.01  ? 245 THR B O   1 
ATOM   2029 C  CB  . THR B 1 99  ? 23.668  69.797  128.507 1.00 24.57  ? 245 THR B CB  1 
ATOM   2030 O  OG1 . THR B 1 99  ? 23.298  68.410  128.501 1.00 26.18  ? 245 THR B OG1 1 
ATOM   2031 C  CG2 . THR B 1 99  ? 24.187  70.191  127.127 1.00 23.75  ? 245 THR B CG2 1 
ATOM   2032 N  N   . ALA B 1 100 ? 24.322  72.223  130.651 1.00 16.90  ? 246 ALA B N   1 
ATOM   2033 C  CA  . ALA B 1 100 ? 24.571  73.637  130.907 1.00 17.47  ? 246 ALA B CA  1 
ATOM   2034 C  C   . ALA B 1 100 ? 26.027  73.838  131.319 1.00 24.06  ? 246 ALA B C   1 
ATOM   2035 O  O   . ALA B 1 100 ? 26.632  74.875  131.038 1.00 23.31  ? 246 ALA B O   1 
ATOM   2036 C  CB  . ALA B 1 100 ? 23.641  74.153  131.982 1.00 16.37  ? 246 ALA B CB  1 
ATOM   2037 N  N   . GLY B 1 101 ? 26.577  72.832  131.993 1.00 24.30  ? 247 GLY B N   1 
ATOM   2038 C  CA  . GLY B 1 101 ? 27.981  72.811  132.345 1.00 25.23  ? 247 GLY B CA  1 
ATOM   2039 C  C   . GLY B 1 101 ? 28.458  74.041  133.084 1.00 28.50  ? 247 GLY B C   1 
ATOM   2040 O  O   . GLY B 1 101 ? 29.499  74.594  132.750 1.00 29.09  ? 247 GLY B O   1 
ATOM   2041 N  N   . GLY B 1 102 ? 27.698  74.470  134.085 1.00 30.68  ? 248 GLY B N   1 
ATOM   2042 C  CA  . GLY B 1 102 ? 28.113  75.573  134.934 1.00 32.26  ? 248 GLY B CA  1 
ATOM   2043 C  C   . GLY B 1 102 ? 27.643  76.950  134.500 1.00 31.80  ? 248 GLY B C   1 
ATOM   2044 O  O   . GLY B 1 102 ? 27.719  77.899  135.272 1.00 35.10  ? 248 GLY B O   1 
ATOM   2045 N  N   . LEU B 1 103 ? 27.159  77.078  133.270 1.00 27.14  ? 249 LEU B N   1 
ATOM   2046 C  CA  . LEU B 1 103 ? 26.673  78.376  132.813 1.00 25.16  ? 249 LEU B CA  1 
ATOM   2047 C  C   . LEU B 1 103 ? 25.197  78.549  133.125 1.00 22.91  ? 249 LEU B C   1 
ATOM   2048 O  O   . LEU B 1 103 ? 24.478  77.579  133.347 1.00 25.47  ? 249 LEU B O   1 
ATOM   2049 C  CB  . LEU B 1 103 ? 26.911  78.558  131.317 1.00 25.67  ? 249 LEU B CB  1 
ATOM   2050 C  CG  . LEU B 1 103 ? 28.363  78.407  130.874 1.00 28.69  ? 249 LEU B CG  1 
ATOM   2051 C  CD1 . LEU B 1 103 ? 28.483  78.643  129.376 1.00 27.26  ? 249 LEU B CD1 1 
ATOM   2052 C  CD2 . LEU B 1 103 ? 29.239  79.375  131.655 1.00 30.44  ? 249 LEU B CD2 1 
ATOM   2053 N  N   . ILE B 1 104 ? 24.743  79.793  133.129 1.00 25.13  ? 250 ILE B N   1 
ATOM   2054 C  CA  . ILE B 1 104 ? 23.350  80.077  133.427 1.00 24.67  ? 250 ILE B CA  1 
ATOM   2055 C  C   . ILE B 1 104 ? 22.538  80.148  132.135 1.00 24.42  ? 250 ILE B C   1 
ATOM   2056 O  O   . ILE B 1 104 ? 22.957  80.784  131.173 1.00 28.20  ? 250 ILE B O   1 
ATOM   2057 C  CB  . ILE B 1 104 ? 23.212  81.387  134.225 1.00 20.40  ? 250 ILE B CB  1 
ATOM   2058 C  CG1 . ILE B 1 104 ? 23.961  81.275  135.559 1.00 19.13  ? 250 ILE B CG1 1 
ATOM   2059 C  CG2 . ILE B 1 104 ? 21.751  81.702  134.455 1.00 20.67  ? 250 ILE B CG2 1 
ATOM   2060 C  CD1 . ILE B 1 104 ? 24.212  82.618  136.263 1.00 15.56  ? 250 ILE B CD1 1 
ATOM   2061 N  N   . TYR B 1 105 ? 21.386  79.484  132.116 1.00 18.50  ? 251 TYR B N   1 
ATOM   2062 C  CA  . TYR B 1 105 ? 20.534  79.465  130.928 1.00 21.15  ? 251 TYR B CA  1 
ATOM   2063 C  C   . TYR B 1 105 ? 19.074  79.765  131.247 1.00 18.98  ? 251 TYR B C   1 
ATOM   2064 O  O   . TYR B 1 105 ? 18.458  79.080  132.054 1.00 17.44  ? 251 TYR B O   1 
ATOM   2065 C  CB  . TYR B 1 105 ? 20.594  78.101  130.226 1.00 23.81  ? 251 TYR B CB  1 
ATOM   2066 C  CG  . TYR B 1 105 ? 21.894  77.792  129.520 1.00 23.46  ? 251 TYR B CG  1 
ATOM   2067 C  CD1 . TYR B 1 105 ? 22.044  78.027  128.157 1.00 21.31  ? 251 TYR B CD1 1 
ATOM   2068 C  CD2 . TYR B 1 105 ? 22.968  77.253  130.212 1.00 24.15  ? 251 TYR B CD2 1 
ATOM   2069 C  CE1 . TYR B 1 105 ? 23.235  77.742  127.510 1.00 20.78  ? 251 TYR B CE1 1 
ATOM   2070 C  CE2 . TYR B 1 105 ? 24.156  76.965  129.576 1.00 22.90  ? 251 TYR B CE2 1 
ATOM   2071 C  CZ  . TYR B 1 105 ? 24.286  77.210  128.229 1.00 23.87  ? 251 TYR B CZ  1 
ATOM   2072 O  OH  . TYR B 1 105 ? 25.480  76.921  127.608 1.00 27.59  ? 251 TYR B OH  1 
ATOM   2073 N  N   . TRP B 1 106 ? 18.518  80.782  130.599 1.00 18.72  ? 252 TRP B N   1 
ATOM   2074 C  CA  . TRP B 1 106 ? 17.077  80.986  130.621 1.00 15.15  ? 252 TRP B CA  1 
ATOM   2075 C  C   . TRP B 1 106 ? 16.383  79.681  130.236 1.00 13.97  ? 252 TRP B C   1 
ATOM   2076 O  O   . TRP B 1 106 ? 16.831  78.982  129.322 1.00 13.71  ? 252 TRP B O   1 
ATOM   2077 C  CB  . TRP B 1 106 ? 16.674  82.054  129.596 1.00 12.35  ? 252 TRP B CB  1 
ATOM   2078 C  CG  . TRP B 1 106 ? 16.849  83.477  130.028 1.00 16.23  ? 252 TRP B CG  1 
ATOM   2079 C  CD1 . TRP B 1 106 ? 17.432  84.485  129.311 1.00 18.40  ? 252 TRP B CD1 1 
ATOM   2080 C  CD2 . TRP B 1 106 ? 16.413  84.065  131.261 1.00 17.37  ? 252 TRP B CD2 1 
ATOM   2081 N  NE1 . TRP B 1 106 ? 17.385  85.660  130.021 1.00 20.20  ? 252 TRP B NE1 1 
ATOM   2082 C  CE2 . TRP B 1 106 ? 16.767  85.428  131.221 1.00 17.33  ? 252 TRP B CE2 1 
ATOM   2083 C  CE3 . TRP B 1 106 ? 15.759  83.570  132.393 1.00 22.34  ? 252 TRP B CE3 1 
ATOM   2084 C  CZ2 . TRP B 1 106 ? 16.498  86.299  132.271 1.00 22.05  ? 252 TRP B CZ2 1 
ATOM   2085 C  CZ3 . TRP B 1 106 ? 15.491  84.440  133.438 1.00 25.96  ? 252 TRP B CZ3 1 
ATOM   2086 C  CH2 . TRP B 1 106 ? 15.861  85.788  133.370 1.00 26.06  ? 252 TRP B CH2 1 
ATOM   2087 N  N   . ILE B 1 107 ? 15.288  79.361  130.914 1.00 15.57  ? 253 ILE B N   1 
ATOM   2088 C  CA  . ILE B 1 107 ? 14.397  78.292  130.464 1.00 21.32  ? 253 ILE B CA  1 
ATOM   2089 C  C   . ILE B 1 107 ? 12.971  78.836  130.389 1.00 23.13  ? 253 ILE B C   1 
ATOM   2090 O  O   . ILE B 1 107 ? 12.739  80.019  130.668 1.00 20.42  ? 253 ILE B O   1 
ATOM   2091 C  CB  . ILE B 1 107 ? 14.439  77.052  131.392 1.00 24.59  ? 253 ILE B CB  1 
ATOM   2092 C  CG1 . ILE B 1 107 ? 13.954  77.404  132.795 1.00 25.21  ? 253 ILE B CG1 1 
ATOM   2093 C  CG2 . ILE B 1 107 ? 15.837  76.471  131.444 1.00 25.38  ? 253 ILE B CG2 1 
ATOM   2094 C  CD1 . ILE B 1 107 ? 13.967  76.220  133.750 1.00 29.30  ? 253 ILE B CD1 1 
ATOM   2095 N  N   . GLY B 1 108 ? 12.019  77.969  130.051 1.00 18.83  ? 254 GLY B N   1 
ATOM   2096 C  CA  . GLY B 1 108 ? 10.660  78.399  129.776 1.00 24.36  ? 254 GLY B CA  1 
ATOM   2097 C  C   . GLY B 1 108 ? 9.801   78.775  130.967 1.00 30.25  ? 254 GLY B C   1 
ATOM   2098 O  O   . GLY B 1 108 ? 8.579   78.833  130.845 1.00 33.07  ? 254 GLY B O   1 
ATOM   2099 N  N   . LEU B 1 109 ? 10.429  79.032  132.113 1.00 30.92  ? 255 LEU B N   1 
ATOM   2100 C  CA  . LEU B 1 109 ? 9.700   79.385  133.331 1.00 30.51  ? 255 LEU B CA  1 
ATOM   2101 C  C   . LEU B 1 109 ? 9.349   80.863  133.381 1.00 32.52  ? 255 LEU B C   1 
ATOM   2102 O  O   . LEU B 1 109 ? 10.221  81.721  133.256 1.00 30.97  ? 255 LEU B O   1 
ATOM   2103 C  CB  . LEU B 1 109 ? 10.519  79.033  134.575 1.00 32.49  ? 255 LEU B CB  1 
ATOM   2104 C  CG  . LEU B 1 109 ? 10.308  77.674  135.238 1.00 33.04  ? 255 LEU B CG  1 
ATOM   2105 C  CD1 . LEU B 1 109 ? 11.420  77.422  136.229 1.00 35.17  ? 255 LEU B CD1 1 
ATOM   2106 C  CD2 . LEU B 1 109 ? 8.952   77.607  135.918 1.00 31.36  ? 255 LEU B CD2 1 
ATOM   2107 N  N   . THR B 1 110 ? 8.072   81.157  133.590 1.00 36.75  ? 256 THR B N   1 
ATOM   2108 C  CA  . THR B 1 110 ? 7.618   82.534  133.719 1.00 38.58  ? 256 THR B CA  1 
ATOM   2109 C  C   . THR B 1 110 ? 6.366   82.568  134.580 1.00 39.32  ? 256 THR B C   1 
ATOM   2110 O  O   . THR B 1 110 ? 5.629   81.586  134.640 1.00 42.45  ? 256 THR B O   1 
ATOM   2111 C  CB  . THR B 1 110 ? 7.307   83.147  132.343 1.00 45.15  ? 256 THR B CB  1 
ATOM   2112 O  OG1 . THR B 1 110 ? 7.169   84.568  132.469 1.00 51.52  ? 256 THR B OG1 1 
ATOM   2113 C  CG2 . THR B 1 110 ? 6.025   82.552  131.768 1.00 43.78  ? 256 THR B CG2 1 
ATOM   2114 N  N   . LYS B 1 111 ? 6.125   83.689  135.253 1.00 39.69  ? 257 LYS B N   1 
ATOM   2115 C  CA  . LYS B 1 111 ? 4.925   83.827  136.072 1.00 45.86  ? 257 LYS B CA  1 
ATOM   2116 C  C   . LYS B 1 111 ? 3.719   84.283  135.255 1.00 55.85  ? 257 LYS B C   1 
ATOM   2117 O  O   . LYS B 1 111 ? 3.865   84.924  134.216 1.00 53.83  ? 257 LYS B O   1 
ATOM   2118 C  CB  . LYS B 1 111 ? 5.157   84.789  137.233 1.00 44.44  ? 257 LYS B CB  1 
ATOM   2119 C  CG  . LYS B 1 111 ? 6.045   84.240  138.337 1.00 42.35  ? 257 LYS B CG  1 
ATOM   2120 C  CD  . LYS B 1 111 ? 5.592   84.775  139.688 1.00 46.59  ? 257 LYS B CD  1 
ATOM   2121 C  CE  . LYS B 1 111 ? 6.731   84.857  140.691 1.00 45.89  ? 257 LYS B CE  1 
ATOM   2122 N  NZ  . LYS B 1 111 ? 7.627   86.017  140.429 1.00 45.81  ? 257 LYS B NZ  1 
ATOM   2123 N  N   . ALA B 1 112 ? 2.527   83.945  135.738 1.00 66.63  ? 258 ALA B N   1 
ATOM   2124 C  CA  . ALA B 1 112 ? 1.282   84.298  135.063 1.00 73.97  ? 258 ALA B CA  1 
ATOM   2125 C  C   . ALA B 1 112 ? 0.096   84.214  136.026 1.00 82.00  ? 258 ALA B C   1 
ATOM   2126 O  O   . ALA B 1 112 ? -0.444  83.132  136.268 1.00 84.21  ? 258 ALA B O   1 
ATOM   2127 C  CB  . ALA B 1 112 ? 1.058   83.392  133.860 1.00 72.22  ? 258 ALA B CB  1 
ATOM   2128 N  N   . GLY B 1 113 ? -0.299  85.359  136.576 1.00 85.86  ? 259 GLY B N   1 
ATOM   2129 C  CA  . GLY B 1 113 ? -1.408  85.417  137.511 1.00 87.18  ? 259 GLY B CA  1 
ATOM   2130 C  C   . GLY B 1 113 ? -1.882  86.834  137.766 1.00 87.43  ? 259 GLY B C   1 
ATOM   2131 O  O   . GLY B 1 113 ? -1.455  87.478  138.724 1.00 87.26  ? 259 GLY B O   1 
ATOM   2132 N  N   . GLY B 1 116 ? 0.392   85.495  140.931 1.00 53.47  ? 262 GLY B N   1 
ATOM   2133 C  CA  . GLY B 1 116 ? 1.388   85.194  139.918 1.00 54.60  ? 262 GLY B CA  1 
ATOM   2134 C  C   . GLY B 1 116 ? 1.912   83.773  140.025 1.00 57.63  ? 262 GLY B C   1 
ATOM   2135 O  O   . GLY B 1 116 ? 2.887   83.510  140.732 1.00 58.46  ? 262 GLY B O   1 
ATOM   2136 N  N   . ASP B 1 117 ? 1.263   82.850  139.321 1.00 56.24  ? 263 ASP B N   1 
ATOM   2137 C  CA  . ASP B 1 117 ? 1.665   81.445  139.348 1.00 53.77  ? 263 ASP B CA  1 
ATOM   2138 C  C   . ASP B 1 117 ? 2.689   81.124  138.262 1.00 44.21  ? 263 ASP B C   1 
ATOM   2139 O  O   . ASP B 1 117 ? 2.623   81.655  137.155 1.00 44.46  ? 263 ASP B O   1 
ATOM   2140 C  CB  . ASP B 1 117 ? 0.443   80.536  139.181 1.00 61.75  ? 263 ASP B CB  1 
ATOM   2141 C  CG  . ASP B 1 117 ? -0.501  80.599  140.366 1.00 67.32  ? 263 ASP B CG  1 
ATOM   2142 O  OD1 . ASP B 1 117 ? -0.020  80.492  141.514 1.00 67.18  ? 263 ASP B OD1 1 
ATOM   2143 O  OD2 . ASP B 1 117 ? -1.724  80.746  140.148 1.00 70.55  ? 263 ASP B OD2 1 
ATOM   2144 N  N   . TRP B 1 118 ? 3.629   80.243  138.582 1.00 35.78  ? 264 TRP B N   1 
ATOM   2145 C  CA  . TRP B 1 118 ? 4.601   79.776  137.602 1.00 32.86  ? 264 TRP B CA  1 
ATOM   2146 C  C   . TRP B 1 118 ? 3.960   78.933  136.500 1.00 35.48  ? 264 TRP B C   1 
ATOM   2147 O  O   . TRP B 1 118 ? 3.014   78.182  136.743 1.00 38.15  ? 264 TRP B O   1 
ATOM   2148 C  CB  . TRP B 1 118 ? 5.702   78.975  138.288 1.00 28.16  ? 264 TRP B CB  1 
ATOM   2149 C  CG  . TRP B 1 118 ? 6.529   79.808  139.199 1.00 28.36  ? 264 TRP B CG  1 
ATOM   2150 C  CD1 . TRP B 1 118 ? 6.443   79.868  140.558 1.00 26.04  ? 264 TRP B CD1 1 
ATOM   2151 C  CD2 . TRP B 1 118 ? 7.563   80.720  138.819 1.00 28.42  ? 264 TRP B CD2 1 
ATOM   2152 N  NE1 . TRP B 1 118 ? 7.366   80.757  141.049 1.00 30.33  ? 264 TRP B NE1 1 
ATOM   2153 C  CE2 . TRP B 1 118 ? 8.068   81.294  140.002 1.00 27.67  ? 264 TRP B CE2 1 
ATOM   2154 C  CE3 . TRP B 1 118 ? 8.116   81.105  137.593 1.00 31.64  ? 264 TRP B CE3 1 
ATOM   2155 C  CZ2 . TRP B 1 118 ? 9.097   82.235  139.997 1.00 24.07  ? 264 TRP B CZ2 1 
ATOM   2156 C  CZ3 . TRP B 1 118 ? 9.141   82.039  137.588 1.00 28.73  ? 264 TRP B CZ3 1 
ATOM   2157 C  CH2 . TRP B 1 118 ? 9.618   82.593  138.783 1.00 24.95  ? 264 TRP B CH2 1 
ATOM   2158 N  N   . SER B 1 119 ? 4.490   79.058  135.286 1.00 33.68  ? 265 SER B N   1 
ATOM   2159 C  CA  . SER B 1 119 ? 3.987   78.298  134.149 1.00 33.73  ? 265 SER B CA  1 
ATOM   2160 C  C   . SER B 1 119 ? 5.085   78.106  133.118 1.00 35.72  ? 265 SER B C   1 
ATOM   2161 O  O   . SER B 1 119 ? 6.089   78.815  133.138 1.00 38.03  ? 265 SER B O   1 
ATOM   2162 C  CB  . SER B 1 119 ? 2.784   79.001  133.518 1.00 30.89  ? 265 SER B CB  1 
ATOM   2163 O  OG  . SER B 1 119 ? 3.171   80.210  132.889 1.00 34.89  ? 265 SER B OG  1 
ATOM   2164 N  N   . TRP B 1 120 ? 4.897   77.139  132.226 1.00 33.84  ? 266 TRP B N   1 
ATOM   2165 C  CA  . TRP B 1 120 ? 5.839   76.914  131.138 1.00 30.85  ? 266 TRP B CA  1 
ATOM   2166 C  C   . TRP B 1 120 ? 5.356   77.626  129.878 1.00 34.88  ? 266 TRP B C   1 
ATOM   2167 O  O   . TRP B 1 120 ? 4.191   77.513  129.498 1.00 38.10  ? 266 TRP B O   1 
ATOM   2168 C  CB  . TRP B 1 120 ? 6.018   75.421  130.871 1.00 28.46  ? 266 TRP B CB  1 
ATOM   2169 C  CG  . TRP B 1 120 ? 6.602   74.656  132.021 1.00 29.63  ? 266 TRP B CG  1 
ATOM   2170 C  CD1 . TRP B 1 120 ? 5.947   73.786  132.842 1.00 31.09  ? 266 TRP B CD1 1 
ATOM   2171 C  CD2 . TRP B 1 120 ? 7.962   74.688  132.477 1.00 28.25  ? 266 TRP B CD2 1 
ATOM   2172 N  NE1 . TRP B 1 120 ? 6.812   73.273  133.781 1.00 28.40  ? 266 TRP B NE1 1 
ATOM   2173 C  CE2 . TRP B 1 120 ? 8.056   73.810  133.577 1.00 27.11  ? 266 TRP B CE2 1 
ATOM   2174 C  CE3 . TRP B 1 120 ? 9.108   75.372  132.061 1.00 28.11  ? 266 TRP B CE3 1 
ATOM   2175 C  CZ2 . TRP B 1 120 ? 9.248   73.598  134.264 1.00 27.45  ? 266 TRP B CZ2 1 
ATOM   2176 C  CZ3 . TRP B 1 120 ? 10.293  75.159  132.745 1.00 28.28  ? 266 TRP B CZ3 1 
ATOM   2177 C  CH2 . TRP B 1 120 ? 10.353  74.282  133.837 1.00 27.42  ? 266 TRP B CH2 1 
ATOM   2178 N  N   . VAL B 1 121 ? 6.253   78.360  129.230 1.00 36.00  ? 267 VAL B N   1 
ATOM   2179 C  CA  . VAL B 1 121 ? 5.864   79.186  128.095 1.00 38.93  ? 267 VAL B CA  1 
ATOM   2180 C  C   . VAL B 1 121 ? 5.396   78.337  126.915 1.00 39.65  ? 267 VAL B C   1 
ATOM   2181 O  O   . VAL B 1 121 ? 4.702   78.829  126.030 1.00 39.61  ? 267 VAL B O   1 
ATOM   2182 C  CB  . VAL B 1 121 ? 6.996   80.129  127.648 1.00 35.34  ? 267 VAL B CB  1 
ATOM   2183 C  CG1 . VAL B 1 121 ? 8.130   79.337  127.022 1.00 32.53  ? 267 VAL B CG1 1 
ATOM   2184 C  CG2 . VAL B 1 121 ? 6.458   81.178  126.671 1.00 35.38  ? 267 VAL B CG2 1 
ATOM   2185 N  N   . ASP B 1 122 ? 5.772   77.063  126.905 1.00 38.96  ? 268 ASP B N   1 
ATOM   2186 C  CA  . ASP B 1 122 ? 5.321   76.172  125.842 1.00 38.83  ? 268 ASP B CA  1 
ATOM   2187 C  C   . ASP B 1 122 ? 3.999   75.514  126.220 1.00 39.09  ? 268 ASP B C   1 
ATOM   2188 O  O   . ASP B 1 122 ? 3.578   74.541  125.605 1.00 36.51  ? 268 ASP B O   1 
ATOM   2189 C  CB  . ASP B 1 122 ? 6.394   75.135  125.472 1.00 34.51  ? 268 ASP B CB  1 
ATOM   2190 C  CG  . ASP B 1 122 ? 6.688   74.156  126.588 1.00 34.45  ? 268 ASP B CG  1 
ATOM   2191 O  OD1 . ASP B 1 122 ? 5.856   74.005  127.502 1.00 31.90  ? 268 ASP B OD1 1 
ATOM   2192 O  OD2 . ASP B 1 122 ? 7.761   73.521  126.542 1.00 38.87  ? 268 ASP B OD2 1 
ATOM   2193 N  N   . ASP B 1 123 ? 3.355   76.062  127.247 1.00 42.12  ? 269 ASP B N   1 
ATOM   2194 C  CA  . ASP B 1 123 ? 2.038   75.602  127.677 1.00 46.17  ? 269 ASP B CA  1 
ATOM   2195 C  C   . ASP B 1 123 ? 2.027   74.199  128.284 1.00 44.50  ? 269 ASP B C   1 
ATOM   2196 O  O   . ASP B 1 123 ? 0.962   73.652  128.561 1.00 46.14  ? 269 ASP B O   1 
ATOM   2197 C  CB  . ASP B 1 123 ? 1.031   75.699  126.529 1.00 51.60  ? 269 ASP B CB  1 
ATOM   2198 C  CG  . ASP B 1 123 ? 0.749   77.132  126.132 1.00 58.41  ? 269 ASP B CG  1 
ATOM   2199 O  OD1 . ASP B 1 123 ? 0.865   78.021  127.003 1.00 57.14  ? 269 ASP B OD1 1 
ATOM   2200 O  OD2 . ASP B 1 123 ? 0.412   77.371  124.952 1.00 63.61  ? 269 ASP B OD2 1 
ATOM   2201 N  N   . THR B 1 124 ? 3.205   73.616  128.485 1.00 41.98  ? 270 THR B N   1 
ATOM   2202 C  CA  . THR B 1 124 ? 3.294   72.400  129.277 1.00 44.42  ? 270 THR B CA  1 
ATOM   2203 C  C   . THR B 1 124 ? 2.710   72.723  130.643 1.00 45.12  ? 270 THR B C   1 
ATOM   2204 O  O   . THR B 1 124 ? 3.076   73.730  131.251 1.00 43.94  ? 270 THR B O   1 
ATOM   2205 C  CB  . THR B 1 124 ? 4.754   71.927  129.464 1.00 43.91  ? 270 THR B CB  1 
ATOM   2206 O  OG1 . THR B 1 124 ? 5.299   71.518  128.204 1.00 44.71  ? 270 THR B OG1 1 
ATOM   2207 C  CG2 . THR B 1 124 ? 4.812   70.755  130.429 1.00 40.31  ? 270 THR B CG2 1 
ATOM   2208 N  N   . PRO B 1 125 ? 1.780   71.886  131.124 1.00 47.23  ? 271 PRO B N   1 
ATOM   2209 C  CA  . PRO B 1 125 ? 1.178   72.113  132.443 1.00 49.20  ? 271 PRO B CA  1 
ATOM   2210 C  C   . PRO B 1 125 ? 2.242   72.126  133.538 1.00 50.19  ? 271 PRO B C   1 
ATOM   2211 O  O   . PRO B 1 125 ? 3.025   71.180  133.643 1.00 53.67  ? 271 PRO B O   1 
ATOM   2212 C  CB  . PRO B 1 125 ? 0.253   70.905  132.614 1.00 49.39  ? 271 PRO B CB  1 
ATOM   2213 C  CG  . PRO B 1 125 ? -0.055  70.470  131.226 1.00 48.67  ? 271 PRO B CG  1 
ATOM   2214 C  CD  . PRO B 1 125 ? 1.195   70.721  130.441 1.00 47.79  ? 271 PRO B CD  1 
ATOM   2215 N  N   . PHE B 1 126 ? 2.275   73.192  134.332 1.00 47.52  ? 272 PHE B N   1 
ATOM   2216 C  CA  . PHE B 1 126 ? 3.267   73.322  135.394 1.00 44.10  ? 272 PHE B CA  1 
ATOM   2217 C  C   . PHE B 1 126 ? 2.838   72.568  136.642 1.00 45.49  ? 272 PHE B C   1 
ATOM   2218 O  O   . PHE B 1 126 ? 1.777   72.836  137.208 1.00 44.89  ? 272 PHE B O   1 
ATOM   2219 C  CB  . PHE B 1 126 ? 3.519   74.793  135.732 1.00 40.08  ? 272 PHE B CB  1 
ATOM   2220 C  CG  . PHE B 1 126 ? 4.595   75.004  136.764 1.00 36.85  ? 272 PHE B CG  1 
ATOM   2221 C  CD1 . PHE B 1 126 ? 5.934   74.988  136.404 1.00 31.71  ? 272 PHE B CD1 1 
ATOM   2222 C  CD2 . PHE B 1 126 ? 4.267   75.224  138.094 1.00 34.82  ? 272 PHE B CD2 1 
ATOM   2223 C  CE1 . PHE B 1 126 ? 6.923   75.183  137.349 1.00 32.80  ? 272 PHE B CE1 1 
ATOM   2224 C  CE2 . PHE B 1 126 ? 5.252   75.421  139.042 1.00 32.62  ? 272 PHE B CE2 1 
ATOM   2225 C  CZ  . PHE B 1 126 ? 6.581   75.402  138.670 1.00 31.68  ? 272 PHE B CZ  1 
ATOM   2226 N  N   . ASN B 1 127 ? 3.674   71.625  137.063 1.00 48.70  ? 273 ASN B N   1 
ATOM   2227 C  CA  . ASN B 1 127 ? 3.409   70.814  138.248 1.00 50.24  ? 273 ASN B CA  1 
ATOM   2228 C  C   . ASN B 1 127 ? 4.125   71.358  139.485 1.00 46.80  ? 273 ASN B C   1 
ATOM   2229 O  O   . ASN B 1 127 ? 5.320   71.133  139.664 1.00 45.68  ? 273 ASN B O   1 
ATOM   2230 C  CB  . ASN B 1 127 ? 3.825   69.363  137.986 1.00 54.54  ? 273 ASN B CB  1 
ATOM   2231 C  CG  . ASN B 1 127 ? 3.656   68.474  139.203 1.00 60.91  ? 273 ASN B CG  1 
ATOM   2232 O  OD1 . ASN B 1 127 ? 3.265   68.932  140.279 1.00 63.64  ? 273 ASN B OD1 1 
ATOM   2233 N  ND2 . ASN B 1 127 ? 3.951   67.189  139.037 1.00 62.26  ? 273 ASN B ND2 1 
ATOM   2234 N  N   . LYS B 1 128 ? 3.384   72.069  140.332 1.00 47.93  ? 274 LYS B N   1 
ATOM   2235 C  CA  . LYS B 1 128 ? 3.944   72.692  141.529 1.00 50.41  ? 274 LYS B CA  1 
ATOM   2236 C  C   . LYS B 1 128 ? 4.742   71.701  142.368 1.00 49.67  ? 274 LYS B C   1 
ATOM   2237 O  O   . LYS B 1 128 ? 5.832   72.009  142.845 1.00 47.19  ? 274 LYS B O   1 
ATOM   2238 C  CB  . LYS B 1 128 ? 2.826   73.291  142.383 1.00 56.52  ? 274 LYS B CB  1 
ATOM   2239 C  CG  . LYS B 1 128 ? 1.901   74.230  141.630 1.00 62.52  ? 274 LYS B CG  1 
ATOM   2240 C  CD  . LYS B 1 128 ? 0.779   74.742  142.529 1.00 67.78  ? 274 LYS B CD  1 
ATOM   2241 C  CE  . LYS B 1 128 ? 0.970   76.209  142.892 1.00 70.55  ? 274 LYS B CE  1 
ATOM   2242 N  NZ  . LYS B 1 128 ? 2.208   76.446  143.688 1.00 72.64  ? 274 LYS B NZ  1 
ATOM   2243 N  N   . VAL B 1 129 ? 4.189   70.506  142.534 1.00 52.85  ? 275 VAL B N   1 
ATOM   2244 C  CA  . VAL B 1 129 ? 4.776   69.481  143.388 1.00 54.54  ? 275 VAL B CA  1 
ATOM   2245 C  C   . VAL B 1 129 ? 6.103   68.938  142.869 1.00 50.00  ? 275 VAL B C   1 
ATOM   2246 O  O   . VAL B 1 129 ? 7.098   68.917  143.592 1.00 49.45  ? 275 VAL B O   1 
ATOM   2247 C  CB  . VAL B 1 129 ? 3.805   68.304  143.578 1.00 61.18  ? 275 VAL B CB  1 
ATOM   2248 C  CG1 . VAL B 1 129 ? 4.429   67.243  144.476 1.00 63.89  ? 275 VAL B CG1 1 
ATOM   2249 C  CG2 . VAL B 1 129 ? 2.483   68.800  144.158 1.00 62.19  ? 275 VAL B CG2 1 
ATOM   2250 N  N   . GLN B 1 130 ? 6.118   68.485  141.622 1.00 48.75  ? 276 GLN B N   1 
ATOM   2251 C  CA  . GLN B 1 130 ? 7.346   67.959  141.039 1.00 51.01  ? 276 GLN B CA  1 
ATOM   2252 C  C   . GLN B 1 130 ? 8.392   69.061  140.974 1.00 49.70  ? 276 GLN B C   1 
ATOM   2253 O  O   . GLN B 1 130 ? 9.569   68.834  141.250 1.00 51.64  ? 276 GLN B O   1 
ATOM   2254 C  CB  . GLN B 1 130 ? 7.089   67.391  139.639 1.00 54.88  ? 276 GLN B CB  1 
ATOM   2255 C  CG  . GLN B 1 130 ? 8.318   66.781  138.969 1.00 57.91  ? 276 GLN B CG  1 
ATOM   2256 C  CD  . GLN B 1 130 ? 8.107   66.494  137.485 1.00 60.92  ? 276 GLN B CD  1 
ATOM   2257 O  OE1 . GLN B 1 130 ? 7.861   67.406  136.692 1.00 59.72  ? 276 GLN B OE1 1 
ATOM   2258 N  NE2 . GLN B 1 130 ? 8.210   65.223  137.104 1.00 61.68  ? 276 GLN B NE2 1 
ATOM   2259 N  N   . SER B 1 131 ? 7.948   70.262  140.623 1.00 48.16  ? 277 SER B N   1 
ATOM   2260 C  CA  . SER B 1 131 ? 8.848   71.393  140.444 1.00 46.79  ? 277 SER B CA  1 
ATOM   2261 C  C   . SER B 1 131 ? 9.457   71.871  141.752 1.00 41.98  ? 277 SER B C   1 
ATOM   2262 O  O   . SER B 1 131 ? 10.505  72.512  141.751 1.00 41.30  ? 277 SER B O   1 
ATOM   2263 C  CB  . SER B 1 131 ? 8.120   72.543  139.755 1.00 52.90  ? 277 SER B CB  1 
ATOM   2264 O  OG  . SER B 1 131 ? 7.683   72.148  138.467 1.00 61.50  ? 277 SER B OG  1 
ATOM   2265 N  N   . ALA B 1 132 ? 8.803   71.566  142.867 1.00 39.30  ? 278 ALA B N   1 
ATOM   2266 C  CA  . ALA B 1 132 ? 9.327   71.967  144.167 1.00 40.97  ? 278 ALA B CA  1 
ATOM   2267 C  C   . ALA B 1 132 ? 10.771  71.496  144.336 1.00 42.95  ? 278 ALA B C   1 
ATOM   2268 O  O   . ALA B 1 132 ? 11.582  72.156  144.986 1.00 44.96  ? 278 ALA B O   1 
ATOM   2269 C  CB  . ALA B 1 132 ? 8.448   71.418  145.292 1.00 38.09  ? 278 ALA B CB  1 
ATOM   2270 N  N   . ARG B 1 133 ? 11.087  70.355  143.731 1.00 38.38  ? 279 ARG B N   1 
ATOM   2271 C  CA  . ARG B 1 133 ? 12.393  69.727  143.893 1.00 37.93  ? 279 ARG B CA  1 
ATOM   2272 C  C   . ARG B 1 133 ? 13.474  70.322  142.993 1.00 35.33  ? 279 ARG B C   1 
ATOM   2273 O  O   . ARG B 1 133 ? 14.657  70.036  143.172 1.00 35.16  ? 279 ARG B O   1 
ATOM   2274 C  CB  . ARG B 1 133 ? 12.281  68.228  143.612 1.00 42.70  ? 279 ARG B CB  1 
ATOM   2275 C  CG  . ARG B 1 133 ? 11.073  67.569  144.261 1.00 49.65  ? 279 ARG B CG  1 
ATOM   2276 C  CD  . ARG B 1 133 ? 11.102  66.047  144.126 1.00 53.91  ? 279 ARG B CD  1 
ATOM   2277 N  NE  . ARG B 1 133 ? 11.045  65.589  142.738 1.00 55.37  ? 279 ARG B NE  1 
ATOM   2278 C  CZ  . ARG B 1 133 ? 12.040  64.965  142.115 1.00 60.67  ? 279 ARG B CZ  1 
ATOM   2279 N  NH1 . ARG B 1 133 ? 11.899  64.581  140.853 1.00 63.16  ? 279 ARG B NH1 1 
ATOM   2280 N  NH2 . ARG B 1 133 ? 13.178  64.718  142.754 1.00 61.60  ? 279 ARG B NH2 1 
ATOM   2281 N  N   . PHE B 1 134 ? 13.072  71.142  142.024 1.00 28.50  ? 280 PHE B N   1 
ATOM   2282 C  CA  . PHE B 1 134 ? 13.998  71.580  140.986 1.00 26.62  ? 280 PHE B CA  1 
ATOM   2283 C  C   . PHE B 1 134 ? 14.588  72.967  141.222 1.00 24.89  ? 280 PHE B C   1 
ATOM   2284 O  O   . PHE B 1 134 ? 15.525  73.381  140.535 1.00 25.52  ? 280 PHE B O   1 
ATOM   2285 C  CB  . PHE B 1 134 ? 13.325  71.516  139.618 1.00 31.70  ? 280 PHE B CB  1 
ATOM   2286 C  CG  . PHE B 1 134 ? 13.042  70.120  139.151 1.00 30.44  ? 280 PHE B CG  1 
ATOM   2287 C  CD1 . PHE B 1 134 ? 13.794  69.058  139.617 1.00 32.27  ? 280 PHE B CD1 1 
ATOM   2288 C  CD2 . PHE B 1 134 ? 12.038  69.875  138.230 1.00 31.28  ? 280 PHE B CD2 1 
ATOM   2289 C  CE1 . PHE B 1 134 ? 13.544  67.772  139.183 1.00 37.43  ? 280 PHE B CE1 1 
ATOM   2290 C  CE2 . PHE B 1 134 ? 11.780  68.589  137.787 1.00 34.76  ? 280 PHE B CE2 1 
ATOM   2291 C  CZ  . PHE B 1 134 ? 12.534  67.536  138.261 1.00 36.85  ? 280 PHE B CZ  1 
ATOM   2292 N  N   . TRP B 1 135 ? 14.029  73.683  142.190 1.00 25.06  ? 281 TRP B N   1 
ATOM   2293 C  CA  . TRP B 1 135 ? 14.536  74.994  142.568 1.00 22.76  ? 281 TRP B CA  1 
ATOM   2294 C  C   . TRP B 1 135 ? 15.794  74.887  143.427 1.00 22.69  ? 281 TRP B C   1 
ATOM   2295 O  O   . TRP B 1 135 ? 15.931  73.970  144.234 1.00 26.25  ? 281 TRP B O   1 
ATOM   2296 C  CB  . TRP B 1 135 ? 13.481  75.757  143.360 1.00 22.46  ? 281 TRP B CB  1 
ATOM   2297 C  CG  . TRP B 1 135 ? 12.271  76.158  142.583 1.00 24.86  ? 281 TRP B CG  1 
ATOM   2298 C  CD1 . TRP B 1 135 ? 11.048  75.554  142.605 1.00 26.61  ? 281 TRP B CD1 1 
ATOM   2299 C  CD2 . TRP B 1 135 ? 12.155  77.268  141.684 1.00 22.68  ? 281 TRP B CD2 1 
ATOM   2300 N  NE1 . TRP B 1 135 ? 10.180  76.213  141.773 1.00 28.04  ? 281 TRP B NE1 1 
ATOM   2301 C  CE2 . TRP B 1 135 ? 10.832  77.270  141.194 1.00 24.45  ? 281 TRP B CE2 1 
ATOM   2302 C  CE3 . TRP B 1 135 ? 13.040  78.260  141.244 1.00 23.93  ? 281 TRP B CE3 1 
ATOM   2303 C  CZ2 . TRP B 1 135 ? 10.370  78.226  140.288 1.00 24.45  ? 281 TRP B CZ2 1 
ATOM   2304 C  CZ3 . TRP B 1 135 ? 12.583  79.211  140.346 1.00 22.12  ? 281 TRP B CZ3 1 
ATOM   2305 C  CH2 . TRP B 1 135 ? 11.257  79.186  139.876 1.00 24.30  ? 281 TRP B CH2 1 
ATOM   2306 N  N   . ILE B 1 136 ? 16.709  75.832  143.252 1.00 21.73  ? 282 ILE B N   1 
ATOM   2307 C  CA  . ILE B 1 136 ? 17.790  76.029  144.210 1.00 25.09  ? 282 ILE B CA  1 
ATOM   2308 C  C   . ILE B 1 136 ? 17.176  76.211  145.598 1.00 25.29  ? 282 ILE B C   1 
ATOM   2309 O  O   . ILE B 1 136 ? 16.115  76.818  145.732 1.00 25.66  ? 282 ILE B O   1 
ATOM   2310 C  CB  . ILE B 1 136 ? 18.629  77.268  143.837 1.00 25.94  ? 282 ILE B CB  1 
ATOM   2311 C  CG1 . ILE B 1 136 ? 19.425  76.998  142.557 1.00 26.59  ? 282 ILE B CG1 1 
ATOM   2312 C  CG2 . ILE B 1 136 ? 19.550  77.676  144.976 1.00 22.43  ? 282 ILE B CG2 1 
ATOM   2313 C  CD1 . ILE B 1 136 ? 20.070  78.227  141.976 1.00 28.15  ? 282 ILE B CD1 1 
ATOM   2314 N  N   . PRO B 1 137 ? 17.824  75.670  146.640 1.00 26.40  ? 283 PRO B N   1 
ATOM   2315 C  CA  . PRO B 1 137 ? 17.276  75.883  147.983 1.00 28.04  ? 283 PRO B CA  1 
ATOM   2316 C  C   . PRO B 1 137 ? 17.222  77.376  148.325 1.00 28.32  ? 283 PRO B C   1 
ATOM   2317 O  O   . PRO B 1 137 ? 18.227  78.079  148.216 1.00 26.30  ? 283 PRO B O   1 
ATOM   2318 C  CB  . PRO B 1 137 ? 18.278  75.155  148.884 1.00 27.79  ? 283 PRO B CB  1 
ATOM   2319 C  CG  . PRO B 1 137 ? 18.922  74.138  147.991 1.00 24.13  ? 283 PRO B CG  1 
ATOM   2320 C  CD  . PRO B 1 137 ? 19.021  74.813  146.660 1.00 26.37  ? 283 PRO B CD  1 
ATOM   2321 N  N   . GLY B 1 138 ? 16.049  77.856  148.717 1.00 25.91  ? 284 GLY B N   1 
ATOM   2322 C  CA  . GLY B 1 138 ? 15.879  79.266  149.002 1.00 26.53  ? 284 GLY B CA  1 
ATOM   2323 C  C   . GLY B 1 138 ? 15.292  80.067  147.846 1.00 25.91  ? 284 GLY B C   1 
ATOM   2324 O  O   . GLY B 1 138 ? 14.995  81.251  148.015 1.00 26.78  ? 284 GLY B O   1 
ATOM   2325 N  N   . GLU B 1 139 ? 15.136  79.433  146.681 1.00 24.40  ? 285 GLU B N   1 
ATOM   2326 C  CA  . GLU B 1 139 ? 14.450  80.039  145.527 1.00 25.77  ? 285 GLU B CA  1 
ATOM   2327 C  C   . GLU B 1 139 ? 13.114  79.329  145.266 1.00 27.29  ? 285 GLU B C   1 
ATOM   2328 O  O   . GLU B 1 139 ? 12.985  78.147  145.561 1.00 30.43  ? 285 GLU B O   1 
ATOM   2329 C  CB  . GLU B 1 139 ? 15.324  79.958  144.272 1.00 25.43  ? 285 GLU B CB  1 
ATOM   2330 C  CG  . GLU B 1 139 ? 16.779  80.381  144.465 1.00 28.11  ? 285 GLU B CG  1 
ATOM   2331 C  CD  . GLU B 1 139 ? 16.975  81.890  144.590 1.00 29.39  ? 285 GLU B CD  1 
ATOM   2332 O  OE1 . GLU B 1 139 ? 16.007  82.661  144.393 1.00 29.18  ? 285 GLU B OE1 1 
ATOM   2333 O  OE2 . GLU B 1 139 ? 18.117  82.306  144.881 1.00 31.11  ? 285 GLU B OE2 1 
ATOM   2334 N  N   . PRO B 1 140 ? 12.118  80.039  144.695 1.00 29.13  ? 286 PRO B N   1 
ATOM   2335 C  CA  . PRO B 1 140 ? 12.164  81.416  144.183 1.00 26.77  ? 286 PRO B CA  1 
ATOM   2336 C  C   . PRO B 1 140 ? 12.087  82.427  145.311 1.00 30.70  ? 286 PRO B C   1 
ATOM   2337 O  O   . PRO B 1 140 ? 11.142  82.395  146.100 1.00 31.65  ? 286 PRO B O   1 
ATOM   2338 C  CB  . PRO B 1 140 ? 10.882  81.530  143.335 1.00 24.58  ? 286 PRO B CB  1 
ATOM   2339 C  CG  . PRO B 1 140 ? 10.201  80.201  143.404 1.00 24.46  ? 286 PRO B CG  1 
ATOM   2340 C  CD  . PRO B 1 140 ? 10.764  79.473  144.581 1.00 25.26  ? 286 PRO B CD  1 
ATOM   2341 N  N   . ASN B 1 141 ? 13.059  83.326  145.383 1.00 34.88  ? 287 ASN B N   1 
ATOM   2342 C  CA  . ASN B 1 141 ? 13.068  84.320  146.448 1.00 33.11  ? 287 ASN B CA  1 
ATOM   2343 C  C   . ASN B 1 141 ? 12.481  85.661  146.015 1.00 31.07  ? 287 ASN B C   1 
ATOM   2344 O  O   . ASN B 1 141 ? 12.331  86.567  146.837 1.00 28.51  ? 287 ASN B O   1 
ATOM   2345 C  CB  . ASN B 1 141 ? 14.475  84.500  147.022 1.00 30.10  ? 287 ASN B CB  1 
ATOM   2346 C  CG  . ASN B 1 141 ? 15.439  85.101  146.026 1.00 29.79  ? 287 ASN B CG  1 
ATOM   2347 O  OD1 . ASN B 1 141 ? 15.154  85.168  144.833 1.00 25.97  ? 287 ASN B OD1 1 
ATOM   2348 N  ND2 . ASN B 1 141 ? 16.596  85.540  146.514 1.00 33.46  ? 287 ASN B ND2 1 
ATOM   2349 N  N   . ASN B 1 142 ? 12.137  85.774  144.733 1.00 31.01  ? 288 ASN B N   1 
ATOM   2350 C  CA  . ASN B 1 142 ? 11.528  86.990  144.205 1.00 29.98  ? 288 ASN B CA  1 
ATOM   2351 C  C   . ASN B 1 142 ? 12.277  88.218  144.689 1.00 31.06  ? 288 ASN B C   1 
ATOM   2352 O  O   . ASN B 1 142 ? 11.668  89.180  145.156 1.00 34.14  ? 288 ASN B O   1 
ATOM   2353 C  CB  . ASN B 1 142 ? 10.053  87.079  144.619 1.00 30.44  ? 288 ASN B CB  1 
ATOM   2354 C  CG  . ASN B 1 142 ? 9.269   88.112  143.811 1.00 31.84  ? 288 ASN B CG  1 
ATOM   2355 O  OD1 . ASN B 1 142 ? 9.727   88.593  142.772 1.00 32.81  ? 288 ASN B OD1 1 
ATOM   2356 N  ND2 . ASN B 1 142 ? 8.076   88.452  144.290 1.00 31.07  ? 288 ASN B ND2 1 
ATOM   2357 N  N   . ALA B 1 143 ? 13.603  88.174  144.598 1.00 30.26  ? 289 ALA B N   1 
ATOM   2358 C  CA  . ALA B 1 143 ? 14.440  89.280  145.053 1.00 29.87  ? 289 ALA B CA  1 
ATOM   2359 C  C   . ALA B 1 143 ? 14.101  90.576  144.315 1.00 34.81  ? 289 ALA B C   1 
ATOM   2360 O  O   . ALA B 1 143 ? 14.038  90.605  143.088 1.00 37.29  ? 289 ALA B O   1 
ATOM   2361 C  CB  . ALA B 1 143 ? 15.907  88.934  144.872 1.00 27.41  ? 289 ALA B CB  1 
ATOM   2362 N  N   . GLY B 1 144 ? 13.888  91.649  145.066 1.00 39.65  ? 290 GLY B N   1 
ATOM   2363 C  CA  . GLY B 1 144 ? 13.521  92.923  144.476 1.00 45.02  ? 290 GLY B CA  1 
ATOM   2364 C  C   . GLY B 1 144 ? 12.084  92.908  143.989 1.00 47.02  ? 290 GLY B C   1 
ATOM   2365 O  O   . GLY B 1 144 ? 11.620  93.851  143.344 1.00 47.49  ? 290 GLY B O   1 
ATOM   2366 N  N   . ASN B 1 145 ? 11.385  91.822  144.301 1.00 46.27  ? 291 ASN B N   1 
ATOM   2367 C  CA  . ASN B 1 145 ? 9.980   91.661  143.941 1.00 48.31  ? 291 ASN B CA  1 
ATOM   2368 C  C   . ASN B 1 145 ? 9.725   91.747  142.438 1.00 43.30  ? 291 ASN B C   1 
ATOM   2369 O  O   . ASN B 1 145 ? 8.593   91.954  142.000 1.00 44.69  ? 291 ASN B O   1 
ATOM   2370 C  CB  . ASN B 1 145 ? 9.112   92.680  144.685 1.00 53.75  ? 291 ASN B CB  1 
ATOM   2371 C  CG  . ASN B 1 145 ? 7.792   92.094  145.129 1.00 59.95  ? 291 ASN B CG  1 
ATOM   2372 O  OD1 . ASN B 1 145 ? 7.706   91.459  146.183 1.00 60.59  ? 291 ASN B OD1 1 
ATOM   2373 N  ND2 . ASN B 1 145 ? 6.754   92.292  144.323 1.00 62.48  ? 291 ASN B ND2 1 
ATOM   2374 N  N   . ASN B 1 146 ? 10.785  91.572  141.657 1.00 38.66  ? 292 ASN B N   1 
ATOM   2375 C  CA  . ASN B 1 146 ? 10.707  91.679  140.208 1.00 40.29  ? 292 ASN B CA  1 
ATOM   2376 C  C   . ASN B 1 146 ? 11.360  90.484  139.504 1.00 37.03  ? 292 ASN B C   1 
ATOM   2377 O  O   . ASN B 1 146 ? 11.995  90.640  138.466 1.00 40.20  ? 292 ASN B O   1 
ATOM   2378 C  CB  . ASN B 1 146 ? 11.374  92.986  139.763 1.00 46.67  ? 292 ASN B CB  1 
ATOM   2379 C  CG  . ASN B 1 146 ? 11.138  93.303  138.301 1.00 52.60  ? 292 ASN B CG  1 
ATOM   2380 O  OD1 . ASN B 1 146 ? 10.031  93.146  137.786 1.00 58.36  ? 292 ASN B OD1 1 
ATOM   2381 N  ND2 . ASN B 1 146 ? 12.183  93.767  137.623 1.00 53.31  ? 292 ASN B ND2 1 
ATOM   2382 N  N   . GLU B 1 147 ? 11.217  89.290  140.072 1.00 32.74  ? 293 GLU B N   1 
ATOM   2383 C  CA  . GLU B 1 147 ? 11.829  88.105  139.479 1.00 28.57  ? 293 GLU B CA  1 
ATOM   2384 C  C   . GLU B 1 147 ? 10.752  87.167  138.961 1.00 31.01  ? 293 GLU B C   1 
ATOM   2385 O  O   . GLU B 1 147 ? 10.278  86.291  139.684 1.00 34.31  ? 293 GLU B O   1 
ATOM   2386 C  CB  . GLU B 1 147 ? 12.760  87.400  140.475 1.00 27.08  ? 293 GLU B CB  1 
ATOM   2387 C  CG  . GLU B 1 147 ? 13.926  88.275  140.944 1.00 28.90  ? 293 GLU B CG  1 
ATOM   2388 C  CD  . GLU B 1 147 ? 15.094  87.488  141.546 1.00 32.31  ? 293 GLU B CD  1 
ATOM   2389 O  OE1 . GLU B 1 147 ? 14.867  86.472  142.243 1.00 33.17  ? 293 GLU B OE1 1 
ATOM   2390 O  OE2 . GLU B 1 147 ? 16.254  87.902  141.326 1.00 34.01  ? 293 GLU B OE2 1 
ATOM   2391 N  N   . HIS B 1 148 ? 10.376  87.356  137.697 1.00 31.34  ? 294 HIS B N   1 
ATOM   2392 C  CA  . HIS B 1 148 ? 9.245   86.634  137.118 1.00 32.61  ? 294 HIS B CA  1 
ATOM   2393 C  C   . HIS B 1 148 ? 9.618   85.622  136.039 1.00 29.32  ? 294 HIS B C   1 
ATOM   2394 O  O   . HIS B 1 148 ? 8.742   85.065  135.385 1.00 32.69  ? 294 HIS B O   1 
ATOM   2395 C  CB  . HIS B 1 148 ? 8.203   87.618  136.581 1.00 34.11  ? 294 HIS B CB  1 
ATOM   2396 C  CG  . HIS B 1 148 ? 7.837   88.688  137.557 1.00 37.98  ? 294 HIS B CG  1 
ATOM   2397 N  ND1 . HIS B 1 148 ? 7.674   88.440  138.903 1.00 43.44  ? 294 HIS B ND1 1 
ATOM   2398 C  CD2 . HIS B 1 148 ? 7.611   90.011  137.387 1.00 39.86  ? 294 HIS B CD2 1 
ATOM   2399 C  CE1 . HIS B 1 148 ? 7.362   89.565  139.520 1.00 46.36  ? 294 HIS B CE1 1 
ATOM   2400 N  NE2 . HIS B 1 148 ? 7.316   90.534  138.622 1.00 44.40  ? 294 HIS B NE2 1 
ATOM   2401 N  N   . CYS B 1 149 ? 10.910  85.381  135.855 1.00 24.72  ? 295 CYS B N   1 
ATOM   2402 C  CA  . CYS B 1 149 ? 11.364  84.380  134.898 1.00 24.72  ? 295 CYS B CA  1 
ATOM   2403 C  C   . CYS B 1 149 ? 12.336  83.433  135.574 1.00 29.73  ? 295 CYS B C   1 
ATOM   2404 O  O   . CYS B 1 149 ? 12.905  83.759  136.615 1.00 29.57  ? 295 CYS B O   1 
ATOM   2405 C  CB  . CYS B 1 149 ? 12.023  85.031  133.683 1.00 25.36  ? 295 CYS B CB  1 
ATOM   2406 S  SG  . CYS B 1 149 ? 10.880  86.003  132.669 1.00 35.58  ? 295 CYS B SG  1 
ATOM   2407 N  N   . GLY B 1 150 ? 12.521  82.262  134.978 1.00 27.27  ? 296 GLY B N   1 
ATOM   2408 C  CA  . GLY B 1 150 ? 13.329  81.230  135.587 1.00 28.05  ? 296 GLY B CA  1 
ATOM   2409 C  C   . GLY B 1 150 ? 14.459  80.792  134.686 1.00 27.78  ? 296 GLY B C   1 
ATOM   2410 O  O   . GLY B 1 150 ? 14.299  80.698  133.469 1.00 27.52  ? 296 GLY B O   1 
ATOM   2411 N  N   . ASN B 1 151 ? 15.614  80.542  135.292 1.00 23.35  ? 297 ASN B N   1 
ATOM   2412 C  CA  . ASN B 1 151 ? 16.756  80.012  134.564 1.00 18.76  ? 297 ASN B CA  1 
ATOM   2413 C  C   . ASN B 1 151 ? 17.402  78.847  135.307 1.00 23.52  ? 297 ASN B C   1 
ATOM   2414 O  O   . ASN B 1 151 ? 17.125  78.620  136.484 1.00 22.33  ? 297 ASN B O   1 
ATOM   2415 C  CB  . ASN B 1 151 ? 17.783  81.112  134.290 1.00 19.80  ? 297 ASN B CB  1 
ATOM   2416 C  CG  . ASN B 1 151 ? 18.381  81.689  135.557 1.00 27.67  ? 297 ASN B CG  1 
ATOM   2417 O  OD1 . ASN B 1 151 ? 18.710  80.959  136.495 1.00 24.94  ? 297 ASN B OD1 1 
ATOM   2418 N  ND2 . ASN B 1 151 ? 18.542  83.010  135.585 1.00 30.45  ? 297 ASN B ND2 1 
ATOM   2419 N  N   . ILE B 1 152 ? 18.264  78.116  134.609 1.00 24.19  ? 298 ILE B N   1 
ATOM   2420 C  CA  . ILE B 1 152 ? 19.040  77.048  135.213 1.00 25.28  ? 298 ILE B CA  1 
ATOM   2421 C  C   . ILE B 1 152 ? 20.391  77.593  135.638 1.00 24.50  ? 298 ILE B C   1 
ATOM   2422 O  O   . ILE B 1 152 ? 21.133  78.122  134.815 1.00 26.88  ? 298 ILE B O   1 
ATOM   2423 C  CB  . ILE B 1 152 ? 19.257  75.885  134.228 1.00 30.48  ? 298 ILE B CB  1 
ATOM   2424 C  CG1 . ILE B 1 152 ? 17.986  75.047  134.111 1.00 34.41  ? 298 ILE B CG1 1 
ATOM   2425 C  CG2 . ILE B 1 152 ? 20.407  75.010  134.688 1.00 33.64  ? 298 ILE B CG2 1 
ATOM   2426 C  CD1 . ILE B 1 152 ? 18.197  73.735  133.402 1.00 37.47  ? 298 ILE B CD1 1 
ATOM   2427 N  N   . LYS B 1 153 ? 20.714  77.447  136.919 1.00 23.85  ? 299 LYS B N   1 
ATOM   2428 C  CA  . LYS B 1 153 ? 21.886  78.100  137.491 1.00 23.42  ? 299 LYS B CA  1 
ATOM   2429 C  C   . LYS B 1 153 ? 22.851  77.141  138.202 1.00 25.67  ? 299 LYS B C   1 
ATOM   2430 O  O   . LYS B 1 153 ? 24.032  77.090  137.873 1.00 32.02  ? 299 LYS B O   1 
ATOM   2431 C  CB  . LYS B 1 153 ? 21.432  79.201  138.452 1.00 25.84  ? 299 LYS B CB  1 
ATOM   2432 C  CG  . LYS B 1 153 ? 22.550  79.992  139.094 1.00 26.40  ? 299 LYS B CG  1 
ATOM   2433 C  CD  . LYS B 1 153 ? 21.962  81.055  139.999 1.00 29.49  ? 299 LYS B CD  1 
ATOM   2434 C  CE  . LYS B 1 153 ? 23.031  81.971  140.555 1.00 32.01  ? 299 LYS B CE  1 
ATOM   2435 N  NZ  . LYS B 1 153 ? 22.403  83.009  141.408 1.00 39.66  ? 299 LYS B NZ  1 
ATOM   2436 N  N   . ALA B 1 154 ? 22.351  76.383  139.171 1.00 18.68  ? 300 ALA B N   1 
ATOM   2437 C  CA  . ALA B 1 154 ? 23.212  75.528  139.979 1.00 25.52  ? 300 ALA B CA  1 
ATOM   2438 C  C   . ALA B 1 154 ? 23.477  74.179  139.311 1.00 30.41  ? 300 ALA B C   1 
ATOM   2439 O  O   . ALA B 1 154 ? 22.589  73.612  138.681 1.00 27.24  ? 300 ALA B O   1 
ATOM   2440 C  CB  . ALA B 1 154 ? 22.615  75.337  141.379 1.00 24.04  ? 300 ALA B CB  1 
ATOM   2441 N  N   . PRO B 1 155 ? 24.708  73.653  139.463 1.00 35.21  ? 301 PRO B N   1 
ATOM   2442 C  CA  . PRO B 1 155 ? 25.100  72.390  138.827 1.00 34.56  ? 301 PRO B CA  1 
ATOM   2443 C  C   . PRO B 1 155 ? 24.543  71.190  139.586 1.00 36.52  ? 301 PRO B C   1 
ATOM   2444 O  O   . PRO B 1 155 ? 25.310  70.364  140.079 1.00 39.33  ? 301 PRO B O   1 
ATOM   2445 C  CB  . PRO B 1 155 ? 26.635  72.395  138.928 1.00 36.58  ? 301 PRO B CB  1 
ATOM   2446 C  CG  . PRO B 1 155 ? 27.014  73.716  139.606 1.00 38.87  ? 301 PRO B CG  1 
ATOM   2447 C  CD  . PRO B 1 155 ? 25.787  74.198  140.303 1.00 36.67  ? 301 PRO B CD  1 
ATOM   2448 N  N   . SER B 1 156 ? 23.222  71.103  139.687 1.00 35.80  ? 302 SER B N   1 
ATOM   2449 C  CA  . SER B 1 156 ? 22.583  69.978  140.358 1.00 36.15  ? 302 SER B CA  1 
ATOM   2450 C  C   . SER B 1 156 ? 21.099  69.942  140.023 1.00 38.48  ? 302 SER B C   1 
ATOM   2451 O  O   . SER B 1 156 ? 20.596  70.833  139.344 1.00 40.35  ? 302 SER B O   1 
ATOM   2452 C  CB  . SER B 1 156 ? 22.773  70.079  141.869 1.00 37.70  ? 302 SER B CB  1 
ATOM   2453 O  OG  . SER B 1 156 ? 21.540  70.337  142.518 1.00 37.38  ? 302 SER B OG  1 
ATOM   2454 N  N   . LEU B 1 157 ? 20.404  68.913  140.501 1.00 38.71  ? 303 LEU B N   1 
ATOM   2455 C  CA  . LEU B 1 157 ? 18.969  68.776  140.264 1.00 36.38  ? 303 LEU B CA  1 
ATOM   2456 C  C   . LEU B 1 157 ? 18.194  69.977  140.796 1.00 35.13  ? 303 LEU B C   1 
ATOM   2457 O  O   . LEU B 1 157 ? 17.184  70.386  140.218 1.00 36.07  ? 303 LEU B O   1 
ATOM   2458 C  CB  . LEU B 1 157 ? 18.436  67.470  140.863 1.00 36.19  ? 303 LEU B CB  1 
ATOM   2459 C  CG  . LEU B 1 157 ? 18.547  66.253  139.937 1.00 38.83  ? 303 LEU B CG  1 
ATOM   2460 C  CD1 . LEU B 1 157 ? 18.279  64.942  140.677 1.00 41.23  ? 303 LEU B CD1 1 
ATOM   2461 C  CD2 . LEU B 1 157 ? 17.613  66.406  138.747 1.00 33.41  ? 303 LEU B CD2 1 
ATOM   2462 N  N   . GLN B 1 158 ? 18.672  70.539  141.901 1.00 32.54  ? 304 GLN B N   1 
ATOM   2463 C  CA  . GLN B 1 158 ? 18.140  71.802  142.397 1.00 32.27  ? 304 GLN B CA  1 
ATOM   2464 C  C   . GLN B 1 158 ? 18.855  72.949  141.685 1.00 28.30  ? 304 GLN B C   1 
ATOM   2465 O  O   . GLN B 1 158 ? 19.789  73.541  142.227 1.00 28.20  ? 304 GLN B O   1 
ATOM   2466 C  CB  . GLN B 1 158 ? 18.330  71.898  143.909 1.00 35.98  ? 304 GLN B CB  1 
ATOM   2467 C  CG  . GLN B 1 158 ? 17.642  70.780  144.686 1.00 39.85  ? 304 GLN B CG  1 
ATOM   2468 C  CD  . GLN B 1 158 ? 17.850  70.893  146.194 1.00 44.47  ? 304 GLN B CD  1 
ATOM   2469 O  OE1 . GLN B 1 158 ? 18.980  70.841  146.689 1.00 43.83  ? 304 GLN B OE1 1 
ATOM   2470 N  NE2 . GLN B 1 158 ? 16.752  71.044  146.931 1.00 44.86  ? 304 GLN B NE2 1 
ATOM   2471 N  N   . ALA B 1 159 ? 18.410  73.259  140.469 1.00 22.82  ? 305 ALA B N   1 
ATOM   2472 C  CA  . ALA B 1 159 ? 19.170  74.143  139.589 1.00 18.65  ? 305 ALA B CA  1 
ATOM   2473 C  C   . ALA B 1 159 ? 18.543  75.505  139.329 1.00 22.06  ? 305 ALA B C   1 
ATOM   2474 O  O   . ALA B 1 159 ? 19.262  76.462  139.037 1.00 23.86  ? 305 ALA B O   1 
ATOM   2475 C  CB  . ALA B 1 159 ? 19.454  73.445  138.258 1.00 15.22  ? 305 ALA B CB  1 
ATOM   2476 N  N   . TRP B 1 160 ? 17.216  75.595  139.403 1.00 21.47  ? 306 TRP B N   1 
ATOM   2477 C  CA  . TRP B 1 160 ? 16.522  76.817  138.979 1.00 19.23  ? 306 TRP B CA  1 
ATOM   2478 C  C   . TRP B 1 160 ? 16.681  77.995  139.944 1.00 21.60  ? 306 TRP B C   1 
ATOM   2479 O  O   . TRP B 1 160 ? 16.622  77.842  141.166 1.00 21.24  ? 306 TRP B O   1 
ATOM   2480 C  CB  . TRP B 1 160 ? 15.019  76.584  138.789 1.00 17.79  ? 306 TRP B CB  1 
ATOM   2481 C  CG  . TRP B 1 160 ? 14.633  75.449  137.902 1.00 16.95  ? 306 TRP B CG  1 
ATOM   2482 C  CD1 . TRP B 1 160 ? 15.424  74.788  137.010 1.00 16.55  ? 306 TRP B CD1 1 
ATOM   2483 C  CD2 . TRP B 1 160 ? 13.342  74.837  137.829 1.00 18.95  ? 306 TRP B CD2 1 
ATOM   2484 N  NE1 . TRP B 1 160 ? 14.704  73.794  136.390 1.00 19.17  ? 306 TRP B NE1 1 
ATOM   2485 C  CE2 . TRP B 1 160 ? 13.422  73.808  136.872 1.00 19.57  ? 306 TRP B CE2 1 
ATOM   2486 C  CE3 . TRP B 1 160 ? 12.125  75.060  138.483 1.00 22.97  ? 306 TRP B CE3 1 
ATOM   2487 C  CZ2 . TRP B 1 160 ? 12.330  73.007  136.546 1.00 22.48  ? 306 TRP B CZ2 1 
ATOM   2488 C  CZ3 . TRP B 1 160 ? 11.041  74.263  138.161 1.00 26.36  ? 306 TRP B CZ3 1 
ATOM   2489 C  CH2 . TRP B 1 160 ? 11.152  73.246  137.201 1.00 25.38  ? 306 TRP B CH2 1 
ATOM   2490 N  N   . ASN B 1 161 ? 16.857  79.175  139.366 1.00 20.70  ? 307 ASN B N   1 
ATOM   2491 C  CA  . ASN B 1 161 ? 16.740  80.429  140.090 1.00 23.55  ? 307 ASN B CA  1 
ATOM   2492 C  C   . ASN B 1 161 ? 15.745  81.341  139.372 1.00 30.96  ? 307 ASN B C   1 
ATOM   2493 O  O   . ASN B 1 161 ? 15.682  81.357  138.140 1.00 31.85  ? 307 ASN B O   1 
ATOM   2494 C  CB  . ASN B 1 161 ? 18.096  81.122  140.181 1.00 20.52  ? 307 ASN B CB  1 
ATOM   2495 C  CG  . ASN B 1 161 ? 18.000  82.499  140.796 1.00 22.54  ? 307 ASN B CG  1 
ATOM   2496 O  OD1 . ASN B 1 161 ? 17.300  82.697  141.789 1.00 22.12  ? 307 ASN B OD1 1 
ATOM   2497 N  ND2 . ASN B 1 161 ? 18.703  83.461  140.210 1.00 23.33  ? 307 ASN B ND2 1 
ATOM   2498 N  N   . ASP B 1 162 ? 14.958  82.091  140.134 1.00 28.82  ? 308 ASP B N   1 
ATOM   2499 C  CA  . ASP B 1 162 ? 14.107  83.098  139.532 1.00 23.73  ? 308 ASP B CA  1 
ATOM   2500 C  C   . ASP B 1 162 ? 14.886  84.410  139.472 1.00 27.78  ? 308 ASP B C   1 
ATOM   2501 O  O   . ASP B 1 162 ? 15.584  84.782  140.426 1.00 27.97  ? 308 ASP B O   1 
ATOM   2502 C  CB  . ASP B 1 162 ? 12.787  83.250  140.297 1.00 26.56  ? 308 ASP B CB  1 
ATOM   2503 C  CG  . ASP B 1 162 ? 12.984  83.723  141.729 1.00 29.05  ? 308 ASP B CG  1 
ATOM   2504 O  OD1 . ASP B 1 162 ? 14.050  83.442  142.311 1.00 29.71  ? 308 ASP B OD1 1 
ATOM   2505 O  OD2 . ASP B 1 162 ? 12.066  84.367  142.279 1.00 30.68  ? 308 ASP B OD2 1 
ATOM   2506 N  N   . ALA B 1 163 ? 14.779  85.085  138.332 1.00 29.82  ? 309 ALA B N   1 
ATOM   2507 C  CA  . ALA B 1 163 ? 15.535  86.296  138.056 1.00 26.93  ? 309 ALA B CA  1 
ATOM   2508 C  C   . ALA B 1 163 ? 14.657  87.265  137.280 1.00 26.79  ? 309 ALA B C   1 
ATOM   2509 O  O   . ALA B 1 163 ? 13.626  86.867  136.746 1.00 29.42  ? 309 ALA B O   1 
ATOM   2510 C  CB  . ALA B 1 163 ? 16.784  85.962  137.260 1.00 22.49  ? 309 ALA B CB  1 
ATOM   2511 N  N   . PRO B 1 164 ? 15.058  88.542  137.218 1.00 24.71  ? 310 PRO B N   1 
ATOM   2512 C  CA  . PRO B 1 164 ? 14.261  89.527  136.473 1.00 24.00  ? 310 PRO B CA  1 
ATOM   2513 C  C   . PRO B 1 164 ? 14.263  89.216  134.985 1.00 25.19  ? 310 PRO B C   1 
ATOM   2514 O  O   . PRO B 1 164 ? 15.325  88.975  134.404 1.00 25.56  ? 310 PRO B O   1 
ATOM   2515 C  CB  . PRO B 1 164 ? 14.989  90.849  136.745 1.00 23.63  ? 310 PRO B CB  1 
ATOM   2516 C  CG  . PRO B 1 164 ? 15.785  90.595  138.018 1.00 23.59  ? 310 PRO B CG  1 
ATOM   2517 C  CD  . PRO B 1 164 ? 16.201  89.161  137.912 1.00 21.82  ? 310 PRO B CD  1 
ATOM   2518 N  N   . CYS B 1 165 ? 13.081  89.226  134.376 1.00 23.17  ? 311 CYS B N   1 
ATOM   2519 C  CA  . CYS B 1 165 ? 12.942  88.882  132.967 1.00 24.09  ? 311 CYS B CA  1 
ATOM   2520 C  C   . CYS B 1 165 ? 13.874  89.652  132.036 1.00 22.96  ? 311 CYS B C   1 
ATOM   2521 O  O   . CYS B 1 165 ? 14.156  89.204  130.928 1.00 25.93  ? 311 CYS B O   1 
ATOM   2522 C  CB  . CYS B 1 165 ? 11.489  89.054  132.524 1.00 31.94  ? 311 CYS B CB  1 
ATOM   2523 S  SG  . CYS B 1 165 ? 10.364  87.873  133.300 1.00 54.63  ? 311 CYS B SG  1 
ATOM   2524 N  N   . ASP B 1 166 ? 14.367  90.797  132.493 1.00 27.48  ? 312 ASP B N   1 
ATOM   2525 C  CA  . ASP B 1 166 ? 15.185  91.668  131.656 1.00 32.65  ? 312 ASP B CA  1 
ATOM   2526 C  C   . ASP B 1 166 ? 16.682  91.346  131.703 1.00 31.56  ? 312 ASP B C   1 
ATOM   2527 O  O   . ASP B 1 166 ? 17.470  91.938  130.957 1.00 31.92  ? 312 ASP B O   1 
ATOM   2528 C  CB  . ASP B 1 166 ? 14.960  93.125  132.054 1.00 44.86  ? 312 ASP B CB  1 
ATOM   2529 C  CG  . ASP B 1 166 ? 15.448  93.423  133.458 1.00 53.31  ? 312 ASP B CG  1 
ATOM   2530 O  OD1 . ASP B 1 166 ? 16.640  93.775  133.602 1.00 59.26  ? 312 ASP B OD1 1 
ATOM   2531 O  OD2 . ASP B 1 166 ? 14.646  93.297  134.413 1.00 51.26  ? 312 ASP B OD2 1 
ATOM   2532 N  N   . LYS B 1 167 ? 17.080  90.430  132.584 1.00 29.38  ? 313 LYS B N   1 
ATOM   2533 C  CA  . LYS B 1 167 ? 18.483  90.030  132.670 1.00 30.58  ? 313 LYS B CA  1 
ATOM   2534 C  C   . LYS B 1 167 ? 18.859  89.329  131.382 1.00 27.65  ? 313 LYS B C   1 
ATOM   2535 O  O   . LYS B 1 167 ? 18.021  88.686  130.763 1.00 32.00  ? 313 LYS B O   1 
ATOM   2536 C  CB  . LYS B 1 167 ? 18.716  89.085  133.855 1.00 31.96  ? 313 LYS B CB  1 
ATOM   2537 C  CG  . LYS B 1 167 ? 19.092  89.769  135.147 1.00 39.61  ? 313 LYS B CG  1 
ATOM   2538 C  CD  . LYS B 1 167 ? 20.538  90.236  135.125 1.00 49.73  ? 313 LYS B CD  1 
ATOM   2539 C  CE  . LYS B 1 167 ? 20.661  91.656  135.665 1.00 54.86  ? 313 LYS B CE  1 
ATOM   2540 N  NZ  . LYS B 1 167 ? 19.998  92.650  134.767 1.00 56.96  ? 313 LYS B NZ  1 
ATOM   2541 N  N   . THR B 1 168 ? 20.113  89.442  130.968 1.00 28.93  ? 314 THR B N   1 
ATOM   2542 C  CA  . THR B 1 168 ? 20.533  88.754  129.754 1.00 32.98  ? 314 THR B CA  1 
ATOM   2543 C  C   . THR B 1 168 ? 21.416  87.542  130.064 1.00 27.65  ? 314 THR B C   1 
ATOM   2544 O  O   . THR B 1 168 ? 22.527  87.681  130.578 1.00 22.87  ? 314 THR B O   1 
ATOM   2545 C  CB  . THR B 1 168 ? 21.213  89.705  128.743 1.00 38.00  ? 314 THR B CB  1 
ATOM   2546 O  OG1 . THR B 1 168 ? 22.497  90.099  129.227 1.00 41.53  ? 314 THR B OG1 1 
ATOM   2547 C  CG2 . THR B 1 168 ? 20.365  90.943  128.528 1.00 41.16  ? 314 THR B CG2 1 
ATOM   2548 N  N   . PHE B 1 169 ? 20.890  86.356  129.752 1.00 25.23  ? 315 PHE B N   1 
ATOM   2549 C  CA  . PHE B 1 169 ? 21.585  85.089  129.959 1.00 26.64  ? 315 PHE B CA  1 
ATOM   2550 C  C   . PHE B 1 169 ? 21.541  84.257  128.687 1.00 31.22  ? 315 PHE B C   1 
ATOM   2551 O  O   . PHE B 1 169 ? 20.705  84.489  127.815 1.00 30.84  ? 315 PHE B O   1 
ATOM   2552 C  CB  . PHE B 1 169 ? 20.901  84.269  131.056 1.00 26.05  ? 315 PHE B CB  1 
ATOM   2553 C  CG  . PHE B 1 169 ? 20.975  84.877  132.427 1.00 26.89  ? 315 PHE B CG  1 
ATOM   2554 C  CD1 . PHE B 1 169 ? 22.201  85.067  133.057 1.00 26.60  ? 315 PHE B CD1 1 
ATOM   2555 C  CD2 . PHE B 1 169 ? 19.813  85.225  133.107 1.00 28.29  ? 315 PHE B CD2 1 
ATOM   2556 C  CE1 . PHE B 1 169 ? 22.269  85.616  134.337 1.00 26.33  ? 315 PHE B CE1 1 
ATOM   2557 C  CE2 . PHE B 1 169 ? 19.873  85.775  134.390 1.00 30.18  ? 315 PHE B CE2 1 
ATOM   2558 C  CZ  . PHE B 1 169 ? 21.105  85.970  135.003 1.00 26.00  ? 315 PHE B CZ  1 
ATOM   2559 N  N   . LEU B 1 170 ? 22.422  83.267  128.593 1.00 27.84  ? 316 LEU B N   1 
ATOM   2560 C  CA  . LEU B 1 170 ? 22.271  82.247  127.573 1.00 24.36  ? 316 LEU B CA  1 
ATOM   2561 C  C   . LEU B 1 170 ? 20.900  81.619  127.773 1.00 22.09  ? 316 LEU B C   1 
ATOM   2562 O  O   . LEU B 1 170 ? 20.242  81.866  128.781 1.00 24.58  ? 316 LEU B O   1 
ATOM   2563 C  CB  . LEU B 1 170 ? 23.365  81.197  127.706 1.00 22.48  ? 316 LEU B CB  1 
ATOM   2564 C  CG  . LEU B 1 170 ? 24.766  81.754  127.475 1.00 24.78  ? 316 LEU B CG  1 
ATOM   2565 C  CD1 . LEU B 1 170 ? 25.836  80.711  127.785 1.00 26.31  ? 316 LEU B CD1 1 
ATOM   2566 C  CD2 . LEU B 1 170 ? 24.874  82.249  126.044 1.00 19.72  ? 316 LEU B CD2 1 
ATOM   2567 N  N   . PHE B 1 171 ? 20.457  80.807  126.824 1.00 19.86  ? 317 PHE B N   1 
ATOM   2568 C  CA  . PHE B 1 171 ? 19.113  80.252  126.919 1.00 20.04  ? 317 PHE B CA  1 
ATOM   2569 C  C   . PHE B 1 171 ? 19.024  78.905  126.231 1.00 22.14  ? 317 PHE B C   1 
ATOM   2570 O  O   . PHE B 1 171 ? 19.887  78.548  125.431 1.00 22.42  ? 317 PHE B O   1 
ATOM   2571 C  CB  . PHE B 1 171 ? 18.099  81.227  126.318 1.00 20.88  ? 317 PHE B CB  1 
ATOM   2572 C  CG  . PHE B 1 171 ? 18.424  81.625  124.914 1.00 22.61  ? 317 PHE B CG  1 
ATOM   2573 C  CD1 . PHE B 1 171 ? 17.947  80.886  123.844 1.00 25.06  ? 317 PHE B CD1 1 
ATOM   2574 C  CD2 . PHE B 1 171 ? 19.230  82.715  124.663 1.00 20.52  ? 317 PHE B CD2 1 
ATOM   2575 C  CE1 . PHE B 1 171 ? 18.257  81.243  122.549 1.00 24.60  ? 317 PHE B CE1 1 
ATOM   2576 C  CE2 . PHE B 1 171 ? 19.541  83.078  123.372 1.00 23.84  ? 317 PHE B CE2 1 
ATOM   2577 C  CZ  . PHE B 1 171 ? 19.057  82.341  122.314 1.00 24.43  ? 317 PHE B CZ  1 
ATOM   2578 N  N   . ILE B 1 172 ? 17.977  78.156  126.555 1.00 25.49  ? 318 ILE B N   1 
ATOM   2579 C  CA  . ILE B 1 172 ? 17.785  76.834  125.981 1.00 24.50  ? 318 ILE B CA  1 
ATOM   2580 C  C   . ILE B 1 172 ? 16.422  76.687  125.315 1.00 23.89  ? 318 ILE B C   1 
ATOM   2581 O  O   . ILE B 1 172 ? 15.381  76.848  125.959 1.00 21.75  ? 318 ILE B O   1 
ATOM   2582 C  CB  . ILE B 1 172 ? 17.920  75.746  127.045 1.00 23.19  ? 318 ILE B CB  1 
ATOM   2583 C  CG1 . ILE B 1 172 ? 19.269  75.872  127.763 1.00 23.49  ? 318 ILE B CG1 1 
ATOM   2584 C  CG2 . ILE B 1 172 ? 17.761  74.377  126.403 1.00 18.67  ? 318 ILE B CG2 1 
ATOM   2585 C  CD1 . ILE B 1 172 ? 19.308  75.218  129.135 1.00 20.92  ? 318 ILE B CD1 1 
ATOM   2586 N  N   . CYS B 1 173 ? 16.444  76.378  124.021 1.00 21.29  ? 319 CYS B N   1 
ATOM   2587 C  CA  . CYS B 1 173 ? 15.232  76.091  123.267 1.00 23.16  ? 319 CYS B CA  1 
ATOM   2588 C  C   . CYS B 1 173 ? 14.980  74.596  123.240 1.00 23.50  ? 319 CYS B C   1 
ATOM   2589 O  O   . CYS B 1 173 ? 15.920  73.798  123.284 1.00 19.77  ? 319 CYS B O   1 
ATOM   2590 C  CB  . CYS B 1 173 ? 15.367  76.585  121.827 1.00 25.45  ? 319 CYS B CB  1 
ATOM   2591 S  SG  . CYS B 1 173 ? 15.750  78.337  121.695 1.00 35.12  ? 319 CYS B SG  1 
ATOM   2592 N  N   . LYS B 1 174 ? 13.708  74.229  123.141 1.00 24.72  ? 320 LYS B N   1 
ATOM   2593 C  CA  . LYS B 1 174 ? 13.294  72.838  123.051 1.00 26.34  ? 320 LYS B CA  1 
ATOM   2594 C  C   . LYS B 1 174 ? 12.241  72.666  121.951 1.00 30.77  ? 320 LYS B C   1 
ATOM   2595 O  O   . LYS B 1 174 ? 11.304  73.462  121.857 1.00 29.56  ? 320 LYS B O   1 
ATOM   2596 C  CB  . LYS B 1 174 ? 12.712  72.396  124.395 1.00 25.80  ? 320 LYS B CB  1 
ATOM   2597 C  CG  . LYS B 1 174 ? 12.231  70.949  124.466 1.00 27.29  ? 320 LYS B CG  1 
ATOM   2598 C  CD  . LYS B 1 174 ? 11.121  70.837  125.507 1.00 27.18  ? 320 LYS B CD  1 
ATOM   2599 C  CE  . LYS B 1 174 ? 11.162  69.537  126.266 1.00 29.96  ? 320 LYS B CE  1 
ATOM   2600 N  NZ  . LYS B 1 174 ? 10.224  69.589  127.416 1.00 33.41  ? 320 LYS B NZ  1 
ATOM   2601 N  N   . ARG B 1 175 ? 12.401  71.632  121.123 1.00 32.43  ? 321 ARG B N   1 
ATOM   2602 C  CA  . ARG B 1 175 ? 11.368  71.228  120.163 1.00 31.41  ? 321 ARG B CA  1 
ATOM   2603 C  C   . ARG B 1 175 ? 11.358  69.706  119.972 1.00 34.91  ? 321 ARG B C   1 
ATOM   2604 O  O   . ARG B 1 175 ? 12.410  69.063  119.963 1.00 29.10  ? 321 ARG B O   1 
ATOM   2605 C  CB  . ARG B 1 175 ? 11.532  71.938  118.811 1.00 27.66  ? 321 ARG B CB  1 
ATOM   2606 C  CG  . ARG B 1 175 ? 12.791  71.561  118.039 1.00 29.26  ? 321 ARG B CG  1 
ATOM   2607 C  CD  . ARG B 1 175 ? 12.777  72.114  116.619 1.00 34.80  ? 321 ARG B CD  1 
ATOM   2608 N  NE  . ARG B 1 175 ? 13.098  71.068  115.649 1.00 45.29  ? 321 ARG B NE  1 
ATOM   2609 C  CZ  . ARG B 1 175 ? 14.271  70.944  115.037 1.00 46.83  ? 321 ARG B CZ  1 
ATOM   2610 N  NH1 . ARG B 1 175 ? 15.244  71.817  115.270 1.00 49.32  ? 321 ARG B NH1 1 
ATOM   2611 N  NH2 . ARG B 1 175 ? 14.465  69.954  114.181 1.00 43.64  ? 321 ARG B NH2 1 
ATOM   2612 N  N   . PRO B 1 176 ? 10.158  69.130  119.809 1.00 39.95  ? 322 PRO B N   1 
ATOM   2613 C  CA  . PRO B 1 176 ? 9.973   67.679  119.705 1.00 38.27  ? 322 PRO B CA  1 
ATOM   2614 C  C   . PRO B 1 176 ? 10.669  67.095  118.486 1.00 36.89  ? 322 PRO B C   1 
ATOM   2615 O  O   . PRO B 1 176 ? 10.648  67.701  117.416 1.00 37.80  ? 322 PRO B O   1 
ATOM   2616 C  CB  . PRO B 1 176 ? 8.457   67.531  119.534 1.00 41.69  ? 322 PRO B CB  1 
ATOM   2617 C  CG  . PRO B 1 176 ? 7.877   68.804  120.033 1.00 45.16  ? 322 PRO B CG  1 
ATOM   2618 C  CD  . PRO B 1 176 ? 8.883   69.859  119.714 1.00 42.76  ? 322 PRO B CD  1 
ATOM   2619 N  N   . TYR B 1 177 ? 11.283  65.929  118.648 1.00 33.18  ? 323 TYR B N   1 
ATOM   2620 C  CA  . TYR B 1 177 ? 11.739  65.172  117.494 1.00 34.64  ? 323 TYR B CA  1 
ATOM   2621 C  C   . TYR B 1 177 ? 10.535  64.540  116.792 1.00 39.01  ? 323 TYR B C   1 
ATOM   2622 O  O   . TYR B 1 177 ? 9.688   63.918  117.432 1.00 41.05  ? 323 TYR B O   1 
ATOM   2623 C  CB  . TYR B 1 177 ? 12.734  64.087  117.905 1.00 33.42  ? 323 TYR B CB  1 
ATOM   2624 C  CG  . TYR B 1 177 ? 12.953  63.045  116.837 1.00 35.73  ? 323 TYR B CG  1 
ATOM   2625 C  CD1 . TYR B 1 177 ? 13.172  63.414  115.514 1.00 35.38  ? 323 TYR B CD1 1 
ATOM   2626 C  CD2 . TYR B 1 177 ? 12.946  61.694  117.146 1.00 37.40  ? 323 TYR B CD2 1 
ATOM   2627 C  CE1 . TYR B 1 177 ? 13.370  62.468  114.533 1.00 36.66  ? 323 TYR B CE1 1 
ATOM   2628 C  CE2 . TYR B 1 177 ? 13.146  60.736  116.165 1.00 38.89  ? 323 TYR B CE2 1 
ATOM   2629 C  CZ  . TYR B 1 177 ? 13.358  61.130  114.861 1.00 38.35  ? 323 TYR B CZ  1 
ATOM   2630 O  OH  . TYR B 1 177 ? 13.561  60.183  113.878 1.00 36.68  ? 323 TYR B OH  1 
ATOM   2631 N  N   . VAL B 1 178 ? 10.453  64.716  115.480 1.00 39.58  ? 324 VAL B N   1 
ATOM   2632 C  CA  . VAL B 1 178 ? 9.406   64.071  114.698 1.00 50.65  ? 324 VAL B CA  1 
ATOM   2633 C  C   . VAL B 1 178 ? 9.964   63.535  113.373 1.00 57.45  ? 324 VAL B C   1 
ATOM   2634 O  O   . VAL B 1 178 ? 10.467  64.299  112.546 1.00 59.97  ? 324 VAL B O   1 
ATOM   2635 C  CB  . VAL B 1 178 ? 8.201   65.020  114.467 1.00 68.60  ? 324 VAL B CB  1 
ATOM   2636 C  CG1 . VAL B 1 178 ? 8.664   66.357  113.888 1.00 67.93  ? 324 VAL B CG1 1 
ATOM   2637 C  CG2 . VAL B 1 178 ? 7.156   64.360  113.576 1.00 69.54  ? 324 VAL B CG2 1 
ATOM   2638 N  N   . PRO B 1 179 ? 9.906   62.206  113.186 1.00 60.29  ? 325 PRO B N   1 
ATOM   2639 C  CA  . PRO B 1 179 ? 10.437  61.550  111.983 1.00 64.06  ? 325 PRO B CA  1 
ATOM   2640 C  C   . PRO B 1 179 ? 9.561   61.798  110.759 1.00 68.63  ? 325 PRO B C   1 
ATOM   2641 O  O   . PRO B 1 179 ? 9.510   60.942  109.875 1.00 73.66  ? 325 PRO B O   1 
ATOM   2642 C  CB  . PRO B 1 179 ? 10.413  60.061  112.352 1.00 63.57  ? 325 PRO B CB  1 
ATOM   2643 C  CG  . PRO B 1 179 ? 10.263  60.021  113.846 1.00 61.05  ? 325 PRO B CG  1 
ATOM   2644 C  CD  . PRO B 1 179 ? 9.456   61.229  114.189 1.00 60.24  ? 325 PRO B CD  1 
ATOM   2645 N  N   . LEU C 1 21  ? 11.105  33.292  92.370  1.00 82.15  ? 167 LEU C N   1 
ATOM   2646 C  CA  . LEU C 1 21  ? 11.241  32.434  93.542  1.00 88.21  ? 167 LEU C CA  1 
ATOM   2647 C  C   . LEU C 1 21  ? 12.507  32.777  94.326  1.00 89.76  ? 167 LEU C C   1 
ATOM   2648 O  O   . LEU C 1 21  ? 12.507  32.811  95.558  1.00 86.48  ? 167 LEU C O   1 
ATOM   2649 C  CB  . LEU C 1 21  ? 11.255  30.961  93.124  1.00 92.52  ? 167 LEU C CB  1 
ATOM   2650 C  CG  . LEU C 1 21  ? 11.387  29.929  94.247  1.00 94.42  ? 167 LEU C CG  1 
ATOM   2651 C  CD1 . LEU C 1 21  ? 10.481  30.286  95.416  1.00 94.38  ? 167 LEU C CD1 1 
ATOM   2652 C  CD2 . LEU C 1 21  ? 11.086  28.528  93.733  1.00 94.85  ? 167 LEU C CD2 1 
ATOM   2653 N  N   . ASN C 1 22  ? 13.586  33.029  93.592  1.00 91.67  ? 168 ASN C N   1 
ATOM   2654 C  CA  . ASN C 1 22  ? 14.858  33.421  94.180  1.00 88.44  ? 168 ASN C CA  1 
ATOM   2655 C  C   . ASN C 1 22  ? 15.009  34.940  94.151  1.00 84.76  ? 168 ASN C C   1 
ATOM   2656 O  O   . ASN C 1 22  ? 15.921  35.498  94.761  1.00 82.36  ? 168 ASN C O   1 
ATOM   2657 C  CB  . ASN C 1 22  ? 16.006  32.759  93.414  1.00 90.07  ? 168 ASN C CB  1 
ATOM   2658 C  CG  . ASN C 1 22  ? 17.358  33.022  94.039  1.00 91.01  ? 168 ASN C CG  1 
ATOM   2659 O  OD1 . ASN C 1 22  ? 17.465  33.256  95.242  1.00 92.07  ? 168 ASN C OD1 1 
ATOM   2660 N  ND2 . ASN C 1 22  ? 18.404  32.978  93.222  1.00 90.92  ? 168 ASN C ND2 1 
ATOM   2661 N  N   . THR C 1 23  ? 14.103  35.602  93.436  1.00 83.58  ? 169 THR C N   1 
ATOM   2662 C  CA  . THR C 1 23  ? 14.134  37.056  93.302  1.00 78.22  ? 169 THR C CA  1 
ATOM   2663 C  C   . THR C 1 23  ? 14.022  37.711  94.669  1.00 76.64  ? 169 THR C C   1 
ATOM   2664 O  O   . THR C 1 23  ? 14.350  38.886  94.840  1.00 76.07  ? 169 THR C O   1 
ATOM   2665 C  CB  . THR C 1 23  ? 12.991  37.575  92.399  1.00 73.82  ? 169 THR C CB  1 
ATOM   2666 O  OG1 . THR C 1 23  ? 11.774  37.665  93.154  1.00 69.93  ? 169 THR C OG1 1 
ATOM   2667 C  CG2 . THR C 1 23  ? 12.785  36.649  91.212  1.00 75.18  ? 169 THR C CG2 1 
ATOM   2668 N  N   . LYS C 1 24  ? 13.552  36.937  95.639  1.00 77.00  ? 170 LYS C N   1 
ATOM   2669 C  CA  . LYS C 1 24  ? 13.371  37.423  96.997  1.00 77.87  ? 170 LYS C CA  1 
ATOM   2670 C  C   . LYS C 1 24  ? 14.716  37.681  97.667  1.00 74.81  ? 170 LYS C C   1 
ATOM   2671 O  O   . LYS C 1 24  ? 14.948  38.757  98.213  1.00 74.42  ? 170 LYS C O   1 
ATOM   2672 C  CB  . LYS C 1 24  ? 12.562  36.411  97.805  1.00 84.55  ? 170 LYS C CB  1 
ATOM   2673 C  CG  . LYS C 1 24  ? 11.303  36.977  98.432  1.00 87.77  ? 170 LYS C CG  1 
ATOM   2674 C  CD  . LYS C 1 24  ? 10.299  35.871  98.725  1.00 92.53  ? 170 LYS C CD  1 
ATOM   2675 C  CE  . LYS C 1 24  ? 9.849   35.181  97.441  1.00 94.00  ? 170 LYS C CE  1 
ATOM   2676 N  NZ  . LYS C 1 24  ? 8.779   34.179  97.695  1.00 96.08  ? 170 LYS C NZ  1 
ATOM   2677 N  N   . ILE C 1 25  ? 15.597  36.688  97.622  1.00 73.80  ? 171 ILE C N   1 
ATOM   2678 C  CA  . ILE C 1 25  ? 16.930  36.814  98.202  1.00 71.02  ? 171 ILE C CA  1 
ATOM   2679 C  C   . ILE C 1 25  ? 17.687  37.985  97.587  1.00 70.54  ? 171 ILE C C   1 
ATOM   2680 O  O   . ILE C 1 25  ? 18.308  38.782  98.294  1.00 69.16  ? 171 ILE C O   1 
ATOM   2681 C  CB  . ILE C 1 25  ? 17.751  35.522  98.018  1.00 68.94  ? 171 ILE C CB  1 
ATOM   2682 C  CG1 . ILE C 1 25  ? 17.477  34.550  99.167  1.00 70.98  ? 171 ILE C CG1 1 
ATOM   2683 C  CG2 . ILE C 1 25  ? 19.239  35.835  97.948  1.00 65.97  ? 171 ILE C CG2 1 
ATOM   2684 C  CD1 . ILE C 1 25  ? 18.003  35.023  100.505 1.00 71.57  ? 171 ILE C CD1 1 
ATOM   2685 N  N   . ARG C 1 26  ? 17.626  38.081  96.264  1.00 68.92  ? 172 ARG C N   1 
ATOM   2686 C  CA  . ARG C 1 26  ? 18.311  39.139  95.538  1.00 69.99  ? 172 ARG C CA  1 
ATOM   2687 C  C   . ARG C 1 26  ? 17.923  40.501  96.099  1.00 62.50  ? 172 ARG C C   1 
ATOM   2688 O  O   . ARG C 1 26  ? 18.768  41.381  96.264  1.00 58.68  ? 172 ARG C O   1 
ATOM   2689 C  CB  . ARG C 1 26  ? 17.963  39.064  94.048  1.00 78.30  ? 172 ARG C CB  1 
ATOM   2690 C  CG  . ARG C 1 26  ? 17.985  37.648  93.475  1.00 87.11  ? 172 ARG C CG  1 
ATOM   2691 C  CD  . ARG C 1 26  ? 17.320  37.587  92.104  1.00 94.00  ? 172 ARG C CD  1 
ATOM   2692 N  NE  . ARG C 1 26  ? 16.852  36.240  91.777  1.00 99.63  ? 172 ARG C NE  1 
ATOM   2693 C  CZ  . ARG C 1 26  ? 16.118  35.940  90.708  1.00 103.14 ? 172 ARG C CZ  1 
ATOM   2694 N  NH1 . ARG C 1 26  ? 15.765  36.890  89.853  1.00 102.29 ? 172 ARG C NH1 1 
ATOM   2695 N  NH2 . ARG C 1 26  ? 15.735  34.687  90.494  1.00 105.89 ? 172 ARG C NH2 1 
ATOM   2696 N  N   . ALA C 1 27  ? 16.638  40.664  96.399  1.00 59.52  ? 173 ALA C N   1 
ATOM   2697 C  CA  . ALA C 1 27  ? 16.113  41.937  96.879  1.00 56.16  ? 173 ALA C CA  1 
ATOM   2698 C  C   . ALA C 1 27  ? 16.555  42.231  98.310  1.00 54.72  ? 173 ALA C C   1 
ATOM   2699 O  O   . ALA C 1 27  ? 16.835  43.382  98.658  1.00 51.97  ? 173 ALA C O   1 
ATOM   2700 C  CB  . ALA C 1 27  ? 14.595  41.959  96.773  1.00 55.55  ? 173 ALA C CB  1 
ATOM   2701 N  N   . LEU C 1 28  ? 16.611  41.193  99.139  1.00 53.03  ? 174 LEU C N   1 
ATOM   2702 C  CA  . LEU C 1 28  ? 17.105  41.352  100.501 1.00 52.40  ? 174 LEU C CA  1 
ATOM   2703 C  C   . LEU C 1 28  ? 18.532  41.876  100.467 1.00 51.52  ? 174 LEU C C   1 
ATOM   2704 O  O   . LEU C 1 28  ? 18.825  42.936  101.018 1.00 50.96  ? 174 LEU C O   1 
ATOM   2705 C  CB  . LEU C 1 28  ? 17.050  40.033  101.273 1.00 53.17  ? 174 LEU C CB  1 
ATOM   2706 C  CG  . LEU C 1 28  ? 15.660  39.494  101.613 1.00 55.97  ? 174 LEU C CG  1 
ATOM   2707 C  CD1 . LEU C 1 28  ? 15.757  38.059  102.101 1.00 60.47  ? 174 LEU C CD1 1 
ATOM   2708 C  CD2 . LEU C 1 28  ? 14.964  40.370  102.641 1.00 52.07  ? 174 LEU C CD2 1 
ATOM   2709 N  N   . GLN C 1 29  ? 19.417  41.131  99.817  1.00 50.09  ? 175 GLN C N   1 
ATOM   2710 C  CA  . GLN C 1 29  ? 20.797  41.564  99.682  1.00 50.71  ? 175 GLN C CA  1 
ATOM   2711 C  C   . GLN C 1 29  ? 20.832  43.026  99.269  1.00 47.30  ? 175 GLN C C   1 
ATOM   2712 O  O   . GLN C 1 29  ? 21.680  43.789  99.728  1.00 45.51  ? 175 GLN C O   1 
ATOM   2713 C  CB  . GLN C 1 29  ? 21.530  40.700  98.658  1.00 54.07  ? 175 GLN C CB  1 
ATOM   2714 C  CG  . GLN C 1 29  ? 21.755  39.269  99.119  1.00 59.27  ? 175 GLN C CG  1 
ATOM   2715 C  CD  . GLN C 1 29  ? 22.095  38.332  97.975  1.00 59.69  ? 175 GLN C CD  1 
ATOM   2716 O  OE1 . GLN C 1 29  ? 21.686  38.552  96.831  1.00 55.69  ? 175 GLN C OE1 1 
ATOM   2717 N  NE2 . GLN C 1 29  ? 22.844  37.275  98.280  1.00 60.11  ? 175 GLN C NE2 1 
ATOM   2718 N  N   . GLY C 1 30  ? 19.885  43.410  98.418  1.00 47.07  ? 176 GLY C N   1 
ATOM   2719 C  CA  . GLY C 1 30  ? 19.807  44.760  97.889  1.00 46.57  ? 176 GLY C CA  1 
ATOM   2720 C  C   . GLY C 1 30  ? 19.463  45.816  98.923  1.00 47.33  ? 176 GLY C C   1 
ATOM   2721 O  O   . GLY C 1 30  ? 20.076  46.885  98.960  1.00 45.29  ? 176 GLY C O   1 
ATOM   2722 N  N   . SER C 1 31  ? 18.470  45.530  99.757  1.00 47.27  ? 177 SER C N   1 
ATOM   2723 C  CA  . SER C 1 31  ? 18.104  46.447  100.825 1.00 46.81  ? 177 SER C CA  1 
ATOM   2724 C  C   . SER C 1 31  ? 19.268  46.556  101.800 1.00 45.14  ? 177 SER C C   1 
ATOM   2725 O  O   . SER C 1 31  ? 19.655  47.649  102.196 1.00 47.83  ? 177 SER C O   1 
ATOM   2726 C  CB  . SER C 1 31  ? 16.849  45.963  101.548 1.00 51.19  ? 177 SER C CB  1 
ATOM   2727 O  OG  . SER C 1 31  ? 15.807  45.694  100.625 1.00 56.15  ? 177 SER C OG  1 
ATOM   2728 N  N   . LEU C 1 32  ? 19.829  45.410  102.164 1.00 43.53  ? 178 LEU C N   1 
ATOM   2729 C  CA  . LEU C 1 32  ? 20.970  45.355  103.063 1.00 42.12  ? 178 LEU C CA  1 
ATOM   2730 C  C   . LEU C 1 32  ? 22.137  46.176  102.525 1.00 42.48  ? 178 LEU C C   1 
ATOM   2731 O  O   . LEU C 1 32  ? 22.837  46.840  103.287 1.00 43.07  ? 178 LEU C O   1 
ATOM   2732 C  CB  . LEU C 1 32  ? 21.396  43.904  103.285 1.00 39.89  ? 178 LEU C CB  1 
ATOM   2733 C  CG  . LEU C 1 32  ? 22.694  43.676  104.063 1.00 41.77  ? 178 LEU C CG  1 
ATOM   2734 C  CD1 . LEU C 1 32  ? 22.644  44.357  105.420 1.00 38.28  ? 178 LEU C CD1 1 
ATOM   2735 C  CD2 . LEU C 1 32  ? 22.953  42.189  104.221 1.00 44.11  ? 178 LEU C CD2 1 
ATOM   2736 N  N   . GLU C 1 33  ? 22.336  46.136  101.211 1.00 43.00  ? 179 GLU C N   1 
ATOM   2737 C  CA  . GLU C 1 33  ? 23.425  46.881  100.583 1.00 45.26  ? 179 GLU C CA  1 
ATOM   2738 C  C   . GLU C 1 33  ? 23.175  48.382  100.627 1.00 40.83  ? 179 GLU C C   1 
ATOM   2739 O  O   . GLU C 1 33  ? 24.103  49.161  100.846 1.00 36.31  ? 179 GLU C O   1 
ATOM   2740 C  CB  . GLU C 1 33  ? 23.654  46.418  99.141  1.00 51.64  ? 179 GLU C CB  1 
ATOM   2741 C  CG  . GLU C 1 33  ? 24.343  45.057  99.030  1.00 62.20  ? 179 GLU C CG  1 
ATOM   2742 C  CD  . GLU C 1 33  ? 24.260  44.460  97.631  1.00 69.39  ? 179 GLU C CD  1 
ATOM   2743 O  OE1 . GLU C 1 33  ? 23.723  45.132  96.722  1.00 71.40  ? 179 GLU C OE1 1 
ATOM   2744 O  OE2 . GLU C 1 33  ? 24.728  43.316  97.442  1.00 71.75  ? 179 GLU C OE2 1 
ATOM   2745 N  N   . ASN C 1 34  ? 21.925  48.782  100.410 1.00 39.51  ? 180 ASN C N   1 
ATOM   2746 C  CA  . ASN C 1 34  ? 21.551  50.189  100.501 1.00 42.02  ? 180 ASN C CA  1 
ATOM   2747 C  C   . ASN C 1 34  ? 21.610  50.671  101.946 1.00 37.74  ? 180 ASN C C   1 
ATOM   2748 O  O   . ASN C 1 34  ? 22.021  51.796  102.216 1.00 36.54  ? 180 ASN C O   1 
ATOM   2749 C  CB  . ASN C 1 34  ? 20.155  50.431  99.917  1.00 48.92  ? 180 ASN C CB  1 
ATOM   2750 C  CG  . ASN C 1 34  ? 20.085  50.145  98.426  1.00 56.26  ? 180 ASN C CG  1 
ATOM   2751 O  OD1 . ASN C 1 34  ? 20.885  49.377  97.892  1.00 62.44  ? 180 ASN C OD1 1 
ATOM   2752 N  ND2 . ASN C 1 34  ? 19.123  50.760  97.748  1.00 54.99  ? 180 ASN C ND2 1 
ATOM   2753 N  N   . MET C 1 35  ? 21.183  49.814  102.869 1.00 34.80  ? 181 MET C N   1 
ATOM   2754 C  CA  . MET C 1 35  ? 21.327  50.088  104.290 1.00 31.87  ? 181 MET C CA  1 
ATOM   2755 C  C   . MET C 1 35  ? 22.795  50.308  104.612 1.00 29.36  ? 181 MET C C   1 
ATOM   2756 O  O   . MET C 1 35  ? 23.155  51.254  105.304 1.00 23.66  ? 181 MET C O   1 
ATOM   2757 C  CB  . MET C 1 35  ? 20.788  48.928  105.124 1.00 34.20  ? 181 MET C CB  1 
ATOM   2758 C  CG  . MET C 1 35  ? 19.335  49.072  105.560 1.00 35.56  ? 181 MET C CG  1 
ATOM   2759 S  SD  . MET C 1 35  ? 18.900  47.876  106.840 1.00 126.32 ? 181 MET C SD  1 
ATOM   2760 C  CE  . MET C 1 35  ? 20.203  48.161  108.038 1.00 32.85  ? 181 MET C CE  1 
ATOM   2761 N  N   . SER C 1 36  ? 23.644  49.432  104.093 1.00 33.56  ? 182 SER C N   1 
ATOM   2762 C  CA  . SER C 1 36  ? 25.077  49.528  104.336 1.00 37.20  ? 182 SER C CA  1 
ATOM   2763 C  C   . SER C 1 36  ? 25.642  50.862  103.868 1.00 38.23  ? 182 SER C C   1 
ATOM   2764 O  O   . SER C 1 36  ? 26.477  51.464  104.544 1.00 37.70  ? 182 SER C O   1 
ATOM   2765 C  CB  . SER C 1 36  ? 25.803  48.385  103.636 1.00 41.37  ? 182 SER C CB  1 
ATOM   2766 O  OG  . SER C 1 36  ? 27.150  48.732  103.391 1.00 44.59  ? 182 SER C OG  1 
ATOM   2767 N  N   . LYS C 1 37  ? 25.177  51.319  102.708 1.00 38.07  ? 183 LYS C N   1 
ATOM   2768 C  CA  . LYS C 1 37  ? 25.645  52.571  102.129 1.00 38.61  ? 183 LYS C CA  1 
ATOM   2769 C  C   . LYS C 1 37  ? 25.261  53.774  102.989 1.00 34.54  ? 183 LYS C C   1 
ATOM   2770 O  O   . LYS C 1 37  ? 26.044  54.707  103.148 1.00 33.69  ? 183 LYS C O   1 
ATOM   2771 C  CB  . LYS C 1 37  ? 25.099  52.748  100.709 1.00 45.18  ? 183 LYS C CB  1 
ATOM   2772 C  CG  . LYS C 1 37  ? 25.789  51.902  99.642  1.00 49.73  ? 183 LYS C CG  1 
ATOM   2773 C  CD  . LYS C 1 37  ? 25.388  52.371  98.238  1.00 53.93  ? 183 LYS C CD  1 
ATOM   2774 C  CE  . LYS C 1 37  ? 26.200  51.670  97.147  1.00 57.78  ? 183 LYS C CE  1 
ATOM   2775 N  NZ  . LYS C 1 37  ? 26.101  52.369  95.828  1.00 59.12  ? 183 LYS C NZ  1 
ATOM   2776 N  N   . LEU C 1 38  ? 24.049  53.756  103.532 1.00 32.60  ? 184 LEU C N   1 
ATOM   2777 C  CA  . LEU C 1 38  ? 23.586  54.841  104.390 1.00 32.00  ? 184 LEU C CA  1 
ATOM   2778 C  C   . LEU C 1 38  ? 24.325  54.850  105.733 1.00 30.74  ? 184 LEU C C   1 
ATOM   2779 O  O   . LEU C 1 38  ? 24.670  55.910  106.246 1.00 28.49  ? 184 LEU C O   1 
ATOM   2780 C  CB  . LEU C 1 38  ? 22.074  54.750  104.603 1.00 34.44  ? 184 LEU C CB  1 
ATOM   2781 C  CG  . LEU C 1 38  ? 21.254  54.777  103.309 1.00 44.13  ? 184 LEU C CG  1 
ATOM   2782 C  CD1 . LEU C 1 38  ? 19.796  54.404  103.564 1.00 44.93  ? 184 LEU C CD1 1 
ATOM   2783 C  CD2 . LEU C 1 38  ? 21.361  56.136  102.608 1.00 43.85  ? 184 LEU C CD2 1 
ATOM   2784 N  N   . LEU C 1 39  ? 24.572  53.670  106.297 1.00 28.76  ? 185 LEU C N   1 
ATOM   2785 C  CA  . LEU C 1 39  ? 25.314  53.583  107.550 1.00 28.62  ? 185 LEU C CA  1 
ATOM   2786 C  C   . LEU C 1 39  ? 26.709  54.145  107.346 1.00 28.04  ? 185 LEU C C   1 
ATOM   2787 O  O   . LEU C 1 39  ? 27.258  54.812  108.223 1.00 33.72  ? 185 LEU C O   1 
ATOM   2788 C  CB  . LEU C 1 39  ? 25.380  52.142  108.071 1.00 28.18  ? 185 LEU C CB  1 
ATOM   2789 C  CG  . LEU C 1 39  ? 26.227  51.939  109.332 1.00 33.08  ? 185 LEU C CG  1 
ATOM   2790 C  CD1 . LEU C 1 39  ? 25.791  52.889  110.428 1.00 34.21  ? 185 LEU C CD1 1 
ATOM   2791 C  CD2 . LEU C 1 39  ? 26.183  50.490  109.823 1.00 32.45  ? 185 LEU C CD2 1 
ATOM   2792 N  N   . LYS C 1 40  ? 27.273  53.893  106.172 1.00 25.68  ? 186 LYS C N   1 
ATOM   2793 C  CA  . LYS C 1 40  ? 28.605  54.391  105.872 1.00 32.53  ? 186 LYS C CA  1 
ATOM   2794 C  C   . LYS C 1 40  ? 28.616  55.919  105.832 1.00 34.55  ? 186 LYS C C   1 
ATOM   2795 O  O   . LYS C 1 40  ? 29.529  56.554  106.347 1.00 33.01  ? 186 LYS C O   1 
ATOM   2796 C  CB  . LYS C 1 40  ? 29.124  53.811  104.553 1.00 38.18  ? 186 LYS C CB  1 
ATOM   2797 C  CG  . LYS C 1 40  ? 30.594  54.097  104.313 1.00 47.35  ? 186 LYS C CG  1 
ATOM   2798 C  CD  . LYS C 1 40  ? 31.396  53.795  105.574 1.00 55.90  ? 186 LYS C CD  1 
ATOM   2799 C  CE  . LYS C 1 40  ? 32.741  54.510  105.580 1.00 61.08  ? 186 LYS C CE  1 
ATOM   2800 N  NZ  . LYS C 1 40  ? 33.327  54.562  106.954 1.00 62.08  ? 186 LYS C NZ  1 
ATOM   2801 N  N   . ARG C 1 41  ? 27.591  56.507  105.226 1.00 36.85  ? 187 ARG C N   1 
ATOM   2802 C  CA  . ARG C 1 41  ? 27.511  57.960  105.128 1.00 38.88  ? 187 ARG C CA  1 
ATOM   2803 C  C   . ARG C 1 41  ? 27.333  58.587  106.513 1.00 37.44  ? 187 ARG C C   1 
ATOM   2804 O  O   . ARG C 1 41  ? 28.093  59.469  106.903 1.00 36.01  ? 187 ARG C O   1 
ATOM   2805 C  CB  . ARG C 1 41  ? 26.380  58.383  104.183 1.00 35.72  ? 187 ARG C CB  1 
ATOM   2806 C  CG  . ARG C 1 41  ? 26.301  59.880  103.951 1.00 40.76  ? 187 ARG C CG  1 
ATOM   2807 C  CD  . ARG C 1 41  ? 25.170  60.242  103.000 1.00 48.00  ? 187 ARG C CD  1 
ATOM   2808 N  NE  . ARG C 1 41  ? 25.172  61.668  102.684 1.00 55.56  ? 187 ARG C NE  1 
ATOM   2809 C  CZ  . ARG C 1 41  ? 25.834  62.211  101.665 1.00 57.54  ? 187 ARG C CZ  1 
ATOM   2810 N  NH1 . ARG C 1 41  ? 26.553  61.448  100.851 1.00 56.80  ? 187 ARG C NH1 1 
ATOM   2811 N  NH2 . ARG C 1 41  ? 25.781  63.522  101.461 1.00 57.59  ? 187 ARG C NH2 1 
ATOM   2812 N  N   . GLN C 1 42  ? 26.332  58.119  107.253 1.00 38.73  ? 188 GLN C N   1 
ATOM   2813 C  CA  . GLN C 1 42  ? 26.084  58.612  108.603 1.00 35.88  ? 188 GLN C CA  1 
ATOM   2814 C  C   . GLN C 1 42  ? 27.336  58.510  109.461 1.00 31.93  ? 188 GLN C C   1 
ATOM   2815 O  O   . GLN C 1 42  ? 27.675  59.441  110.188 1.00 32.69  ? 188 GLN C O   1 
ATOM   2816 C  CB  . GLN C 1 42  ? 24.931  57.853  109.255 1.00 36.17  ? 188 GLN C CB  1 
ATOM   2817 C  CG  . GLN C 1 42  ? 23.645  57.926  108.458 1.00 43.22  ? 188 GLN C CG  1 
ATOM   2818 C  CD  . GLN C 1 42  ? 22.474  57.303  109.185 1.00 46.38  ? 188 GLN C CD  1 
ATOM   2819 O  OE1 . GLN C 1 42  ? 22.492  57.162  110.407 1.00 47.28  ? 188 GLN C OE1 1 
ATOM   2820 N  NE2 . GLN C 1 42  ? 21.442  56.932  108.434 1.00 44.90  ? 188 GLN C NE2 1 
ATOM   2821 N  N   . ASN C 1 43  ? 28.025  57.380  109.369 1.00 30.76  ? 189 ASN C N   1 
ATOM   2822 C  CA  . ASN C 1 43  ? 29.245  57.182  110.134 1.00 33.84  ? 189 ASN C CA  1 
ATOM   2823 C  C   . ASN C 1 43  ? 30.309  58.221  109.795 1.00 33.22  ? 189 ASN C C   1 
ATOM   2824 O  O   . ASN C 1 43  ? 30.940  58.789  110.691 1.00 33.23  ? 189 ASN C O   1 
ATOM   2825 C  CB  . ASN C 1 43  ? 29.804  55.776  109.916 1.00 40.22  ? 189 ASN C CB  1 
ATOM   2826 C  CG  . ASN C 1 43  ? 31.058  55.519  110.732 1.00 47.52  ? 189 ASN C CG  1 
ATOM   2827 O  OD1 . ASN C 1 43  ? 31.055  55.661  111.955 1.00 46.89  ? 189 ASN C OD1 1 
ATOM   2828 N  ND2 . ASN C 1 43  ? 32.139  55.143  110.057 1.00 52.09  ? 189 ASN C ND2 1 
ATOM   2829 N  N   . ASP C 1 44  ? 30.506  58.469  108.503 1.00 28.94  ? 190 ASP C N   1 
ATOM   2830 C  CA  . ASP C 1 44  ? 31.523  59.412  108.056 1.00 31.65  ? 190 ASP C CA  1 
ATOM   2831 C  C   . ASP C 1 44  ? 31.222  60.819  108.561 1.00 34.12  ? 190 ASP C C   1 
ATOM   2832 O  O   . ASP C 1 44  ? 32.122  61.560  108.954 1.00 30.50  ? 190 ASP C O   1 
ATOM   2833 C  CB  . ASP C 1 44  ? 31.614  59.423  106.531 1.00 35.37  ? 190 ASP C CB  1 
ATOM   2834 C  CG  . ASP C 1 44  ? 32.325  58.200  105.977 1.00 42.11  ? 190 ASP C CG  1 
ATOM   2835 O  OD1 . ASP C 1 44  ? 32.948  57.470  106.774 1.00 46.96  ? 190 ASP C OD1 1 
ATOM   2836 O  OD2 . ASP C 1 44  ? 32.270  57.978  104.745 1.00 40.52  ? 190 ASP C OD2 1 
ATOM   2837 N  N   . ILE C 1 45  ? 29.944  61.175  108.532 1.00 31.70  ? 191 ILE C N   1 
ATOM   2838 C  CA  . ILE C 1 45  ? 29.490  62.476  108.980 1.00 27.19  ? 191 ILE C CA  1 
ATOM   2839 C  C   . ILE C 1 45  ? 29.620  62.588  110.491 1.00 24.92  ? 191 ILE C C   1 
ATOM   2840 O  O   . ILE C 1 45  ? 30.010  63.629  111.016 1.00 26.39  ? 191 ILE C O   1 
ATOM   2841 C  CB  . ILE C 1 45  ? 28.027  62.696  108.581 1.00 24.97  ? 191 ILE C CB  1 
ATOM   2842 C  CG1 . ILE C 1 45  ? 27.867  62.523  107.068 1.00 26.80  ? 191 ILE C CG1 1 
ATOM   2843 C  CG2 . ILE C 1 45  ? 27.545  64.061  109.048 1.00 23.59  ? 191 ILE C CG2 1 
ATOM   2844 C  CD1 . ILE C 1 45  ? 26.446  62.741  106.574 1.00 28.62  ? 191 ILE C CD1 1 
ATOM   2845 N  N   . LEU C 1 46  ? 29.297  61.502  111.182 1.00 26.83  ? 192 LEU C N   1 
ATOM   2846 C  CA  . LEU C 1 46  ? 29.373  61.458  112.636 1.00 29.98  ? 192 LEU C CA  1 
ATOM   2847 C  C   . LEU C 1 46  ? 30.799  61.620  113.174 1.00 32.53  ? 192 LEU C C   1 
ATOM   2848 O  O   . LEU C 1 46  ? 31.013  62.298  114.178 1.00 31.37  ? 192 LEU C O   1 
ATOM   2849 C  CB  . LEU C 1 46  ? 28.766  60.158  113.166 1.00 28.88  ? 192 LEU C CB  1 
ATOM   2850 C  CG  . LEU C 1 46  ? 28.722  60.073  114.693 1.00 29.71  ? 192 LEU C CG  1 
ATOM   2851 C  CD1 . LEU C 1 46  ? 27.988  61.275  115.265 1.00 32.42  ? 192 LEU C CD1 1 
ATOM   2852 C  CD2 . LEU C 1 46  ? 28.084  58.779  115.162 1.00 30.11  ? 192 LEU C CD2 1 
ATOM   2853 N  N   . GLN C 1 47  ? 31.769  60.995  112.516 1.00 34.48  ? 193 GLN C N   1 
ATOM   2854 C  CA  . GLN C 1 47  ? 33.152  61.071  112.977 1.00 37.81  ? 193 GLN C CA  1 
ATOM   2855 C  C   . GLN C 1 47  ? 33.652  62.508  112.896 1.00 32.69  ? 193 GLN C C   1 
ATOM   2856 O  O   . GLN C 1 47  ? 34.496  62.932  113.681 1.00 30.84  ? 193 GLN C O   1 
ATOM   2857 C  CB  . GLN C 1 47  ? 34.060  60.152  112.153 1.00 43.89  ? 193 GLN C CB  1 
ATOM   2858 C  CG  . GLN C 1 47  ? 33.624  58.690  112.119 1.00 53.52  ? 193 GLN C CG  1 
ATOM   2859 C  CD  . GLN C 1 47  ? 33.816  57.972  113.445 1.00 61.75  ? 193 GLN C CD  1 
ATOM   2860 O  OE1 . GLN C 1 47  ? 34.228  58.573  114.439 1.00 65.51  ? 193 GLN C OE1 1 
ATOM   2861 N  NE2 . GLN C 1 47  ? 33.522  56.675  113.462 1.00 64.57  ? 193 GLN C NE2 1 
ATOM   2862 N  N   . VAL C 1 48  ? 33.117  63.255  111.940 1.00 29.99  ? 194 VAL C N   1 
ATOM   2863 C  CA  . VAL C 1 48  ? 33.527  64.639  111.736 1.00 29.99  ? 194 VAL C CA  1 
ATOM   2864 C  C   . VAL C 1 48  ? 32.786  65.595  112.674 1.00 28.20  ? 194 VAL C C   1 
ATOM   2865 O  O   . VAL C 1 48  ? 33.397  66.440  113.326 1.00 27.51  ? 194 VAL C O   1 
ATOM   2866 C  CB  . VAL C 1 48  ? 33.298  65.065  110.280 1.00 29.72  ? 194 VAL C CB  1 
ATOM   2867 C  CG1 . VAL C 1 48  ? 33.538  66.557  110.124 1.00 20.07  ? 194 VAL C CG1 1 
ATOM   2868 C  CG2 . VAL C 1 48  ? 34.188  64.240  109.342 1.00 22.74  ? 194 VAL C CG2 1 
ATOM   2869 N  N   . VAL C 1 49  ? 31.466  65.462  112.731 1.00 24.71  ? 195 VAL C N   1 
ATOM   2870 C  CA  . VAL C 1 49  ? 30.668  66.235  113.666 1.00 24.13  ? 195 VAL C CA  1 
ATOM   2871 C  C   . VAL C 1 49  ? 31.124  65.975  115.108 1.00 26.14  ? 195 VAL C C   1 
ATOM   2872 O  O   . VAL C 1 49  ? 31.054  66.860  115.956 1.00 28.74  ? 195 VAL C O   1 
ATOM   2873 C  CB  . VAL C 1 49  ? 29.162  65.926  113.492 1.00 24.94  ? 195 VAL C CB  1 
ATOM   2874 C  CG1 . VAL C 1 49  ? 28.373  66.378  114.701 1.00 26.38  ? 195 VAL C CG1 1 
ATOM   2875 C  CG2 . VAL C 1 49  ? 28.634  66.597  112.237 1.00 27.23  ? 195 VAL C CG2 1 
ATOM   2876 N  N   . SER C 1 50  ? 31.608  64.764  115.370 1.00 26.47  ? 196 SER C N   1 
ATOM   2877 C  CA  . SER C 1 50  ? 32.128  64.396  116.688 1.00 26.67  ? 196 SER C CA  1 
ATOM   2878 C  C   . SER C 1 50  ? 33.345  65.221  117.089 1.00 31.18  ? 196 SER C C   1 
ATOM   2879 O  O   . SER C 1 50  ? 33.730  65.242  118.262 1.00 32.41  ? 196 SER C O   1 
ATOM   2880 C  CB  . SER C 1 50  ? 32.492  62.911  116.738 1.00 21.62  ? 196 SER C CB  1 
ATOM   2881 O  OG  . SER C 1 50  ? 31.348  62.119  116.991 1.00 24.58  ? 196 SER C OG  1 
ATOM   2882 N  N   . GLN C 1 51  ? 33.950  65.897  116.118 1.00 27.63  ? 197 GLN C N   1 
ATOM   2883 C  CA  . GLN C 1 51  ? 35.165  66.660  116.385 1.00 28.35  ? 197 GLN C CA  1 
ATOM   2884 C  C   . GLN C 1 51  ? 34.929  68.169  116.374 1.00 28.36  ? 197 GLN C C   1 
ATOM   2885 O  O   . GLN C 1 51  ? 35.848  68.955  116.136 1.00 27.91  ? 197 GLN C O   1 
ATOM   2886 C  CB  . GLN C 1 51  ? 36.283  66.246  115.426 1.00 28.50  ? 197 GLN C CB  1 
ATOM   2887 C  CG  . GLN C 1 51  ? 36.625  64.776  115.554 1.00 32.10  ? 197 GLN C CG  1 
ATOM   2888 C  CD  . GLN C 1 51  ? 37.631  64.311  114.532 1.00 37.82  ? 197 GLN C CD  1 
ATOM   2889 O  OE1 . GLN C 1 51  ? 38.704  64.893  114.391 1.00 42.51  ? 197 GLN C OE1 1 
ATOM   2890 N  NE2 . GLN C 1 51  ? 37.296  63.243  113.820 1.00 37.94  ? 197 GLN C NE2 1 
ATOM   2891 N  N   . GLY C 1 52  ? 33.691  68.563  116.656 1.00 28.94  ? 198 GLY C N   1 
ATOM   2892 C  CA  . GLY C 1 52  ? 33.354  69.965  116.812 1.00 31.96  ? 198 GLY C CA  1 
ATOM   2893 C  C   . GLY C 1 52  ? 33.026  70.675  115.513 1.00 31.42  ? 198 GLY C C   1 
ATOM   2894 O  O   . GLY C 1 52  ? 32.957  71.902  115.463 1.00 32.00  ? 198 GLY C O   1 
ATOM   2895 N  N   . TRP C 1 53  ? 32.828  69.904  114.452 1.00 28.06  ? 199 TRP C N   1 
ATOM   2896 C  CA  . TRP C 1 53  ? 32.431  70.482  113.177 1.00 26.51  ? 199 TRP C CA  1 
ATOM   2897 C  C   . TRP C 1 53  ? 30.922  70.363  112.982 1.00 26.88  ? 199 TRP C C   1 
ATOM   2898 O  O   . TRP C 1 53  ? 30.257  69.584  113.664 1.00 24.84  ? 199 TRP C O   1 
ATOM   2899 C  CB  . TRP C 1 53  ? 33.199  69.826  112.025 1.00 28.70  ? 199 TRP C CB  1 
ATOM   2900 C  CG  . TRP C 1 53  ? 34.609  70.335  111.890 1.00 30.56  ? 199 TRP C CG  1 
ATOM   2901 C  CD1 . TRP C 1 53  ? 35.618  70.217  112.807 1.00 33.40  ? 199 TRP C CD1 1 
ATOM   2902 C  CD2 . TRP C 1 53  ? 35.167  71.040  110.771 1.00 30.46  ? 199 TRP C CD2 1 
ATOM   2903 N  NE1 . TRP C 1 53  ? 36.764  70.808  112.330 1.00 34.22  ? 199 TRP C NE1 1 
ATOM   2904 C  CE2 . TRP C 1 53  ? 36.514  71.321  111.084 1.00 33.01  ? 199 TRP C CE2 1 
ATOM   2905 C  CE3 . TRP C 1 53  ? 34.658  71.464  109.540 1.00 24.90  ? 199 TRP C CE3 1 
ATOM   2906 C  CZ2 . TRP C 1 53  ? 37.357  72.002  110.210 1.00 32.91  ? 199 TRP C CZ2 1 
ATOM   2907 C  CZ3 . TRP C 1 53  ? 35.497  72.140  108.673 1.00 28.36  ? 199 TRP C CZ3 1 
ATOM   2908 C  CH2 . TRP C 1 53  ? 36.832  72.404  109.012 1.00 30.38  ? 199 TRP C CH2 1 
ATOM   2909 N  N   . LYS C 1 54  ? 30.381  71.159  112.065 1.00 29.48  ? 200 LYS C N   1 
ATOM   2910 C  CA  . LYS C 1 54  ? 28.970  71.081  111.720 1.00 29.43  ? 200 LYS C CA  1 
ATOM   2911 C  C   . LYS C 1 54  ? 28.849  70.418  110.358 1.00 29.95  ? 200 LYS C C   1 
ATOM   2912 O  O   . LYS C 1 54  ? 29.845  70.237  109.665 1.00 31.15  ? 200 LYS C O   1 
ATOM   2913 C  CB  . LYS C 1 54  ? 28.348  72.476  111.678 1.00 32.44  ? 200 LYS C CB  1 
ATOM   2914 C  CG  . LYS C 1 54  ? 28.595  73.326  112.920 1.00 34.13  ? 200 LYS C CG  1 
ATOM   2915 C  CD  . LYS C 1 54  ? 27.754  72.882  114.093 1.00 34.72  ? 200 LYS C CD  1 
ATOM   2916 C  CE  . LYS C 1 54  ? 27.792  73.918  115.203 1.00 43.16  ? 200 LYS C CE  1 
ATOM   2917 N  NZ  . LYS C 1 54  ? 29.185  74.205  115.659 1.00 47.74  ? 200 LYS C NZ  1 
ATOM   2918 N  N   . TYR C 1 55  ? 27.633  70.055  109.971 1.00 28.86  ? 201 TYR C N   1 
ATOM   2919 C  CA  . TYR C 1 55  ? 27.418  69.447  108.664 1.00 26.14  ? 201 TYR C CA  1 
ATOM   2920 C  C   . TYR C 1 55  ? 26.086  69.855  108.029 1.00 26.19  ? 201 TYR C C   1 
ATOM   2921 O  O   . TYR C 1 55  ? 25.045  69.868  108.691 1.00 26.34  ? 201 TYR C O   1 
ATOM   2922 C  CB  . TYR C 1 55  ? 27.503  67.920  108.748 1.00 22.54  ? 201 TYR C CB  1 
ATOM   2923 C  CG  . TYR C 1 55  ? 27.013  67.265  107.482 1.00 25.82  ? 201 TYR C CG  1 
ATOM   2924 C  CD1 . TYR C 1 55  ? 27.865  67.064  106.405 1.00 28.36  ? 201 TYR C CD1 1 
ATOM   2925 C  CD2 . TYR C 1 55  ? 25.685  66.895  107.344 1.00 26.77  ? 201 TYR C CD2 1 
ATOM   2926 C  CE1 . TYR C 1 55  ? 27.412  66.487  105.238 1.00 27.14  ? 201 TYR C CE1 1 
ATOM   2927 C  CE2 . TYR C 1 55  ? 25.223  66.322  106.183 1.00 29.75  ? 201 TYR C CE2 1 
ATOM   2928 C  CZ  . TYR C 1 55  ? 26.087  66.119  105.135 1.00 30.72  ? 201 TYR C CZ  1 
ATOM   2929 O  OH  . TYR C 1 55  ? 25.615  65.545  103.981 1.00 33.43  ? 201 TYR C OH  1 
ATOM   2930 N  N   . PHE C 1 56  ? 26.114  70.167  106.738 1.00 26.83  ? 202 PHE C N   1 
ATOM   2931 C  CA  . PHE C 1 56  ? 24.890  70.531  106.035 1.00 31.33  ? 202 PHE C CA  1 
ATOM   2932 C  C   . PHE C 1 56  ? 24.961  70.284  104.532 1.00 32.29  ? 202 PHE C C   1 
ATOM   2933 O  O   . PHE C 1 56  ? 25.813  70.840  103.842 1.00 25.22  ? 202 PHE C O   1 
ATOM   2934 C  CB  . PHE C 1 56  ? 24.525  71.989  106.306 1.00 33.83  ? 202 PHE C CB  1 
ATOM   2935 C  CG  . PHE C 1 56  ? 23.257  72.431  105.627 1.00 35.79  ? 202 PHE C CG  1 
ATOM   2936 C  CD1 . PHE C 1 56  ? 22.020  72.184  106.208 1.00 34.57  ? 202 PHE C CD1 1 
ATOM   2937 C  CD2 . PHE C 1 56  ? 23.301  73.100  104.411 1.00 34.38  ? 202 PHE C CD2 1 
ATOM   2938 C  CE1 . PHE C 1 56  ? 20.852  72.593  105.587 1.00 33.07  ? 202 PHE C CE1 1 
ATOM   2939 C  CE2 . PHE C 1 56  ? 22.138  73.512  103.790 1.00 34.98  ? 202 PHE C CE2 1 
ATOM   2940 C  CZ  . PHE C 1 56  ? 20.913  73.257  104.378 1.00 32.88  ? 202 PHE C CZ  1 
ATOM   2941 N  N   . LYS C 1 57  ? 24.050  69.441  104.049 1.00 37.27  ? 203 LYS C N   1 
ATOM   2942 C  CA  . LYS C 1 57  ? 23.899  69.140  102.626 1.00 36.92  ? 203 LYS C CA  1 
ATOM   2943 C  C   . LYS C 1 57  ? 25.216  69.011  101.880 1.00 29.86  ? 203 LYS C C   1 
ATOM   2944 O  O   . LYS C 1 57  ? 25.523  69.812  100.998 1.00 31.16  ? 203 LYS C O   1 
ATOM   2945 C  CB  . LYS C 1 57  ? 22.995  70.174  101.943 1.00 44.24  ? 203 LYS C CB  1 
ATOM   2946 C  CG  . LYS C 1 57  ? 21.560  70.129  102.445 1.00 50.20  ? 203 LYS C CG  1 
ATOM   2947 C  CD  . LYS C 1 57  ? 20.655  71.117  101.727 1.00 54.82  ? 203 LYS C CD  1 
ATOM   2948 C  CE  . LYS C 1 57  ? 19.254  71.089  102.333 1.00 56.98  ? 203 LYS C CE  1 
ATOM   2949 N  NZ  . LYS C 1 57  ? 18.345  72.103  101.733 1.00 58.97  ? 203 LYS C NZ  1 
ATOM   2950 N  N   . GLY C 1 58  ? 25.985  67.991  102.233 1.00 25.26  ? 204 GLY C N   1 
ATOM   2951 C  CA  . GLY C 1 58  ? 27.216  67.688  101.530 1.00 25.35  ? 204 GLY C CA  1 
ATOM   2952 C  C   . GLY C 1 58  ? 28.459  68.431  101.985 1.00 25.36  ? 204 GLY C C   1 
ATOM   2953 O  O   . GLY C 1 58  ? 29.541  68.191  101.456 1.00 28.50  ? 204 GLY C O   1 
ATOM   2954 N  N   . ASN C 1 59  ? 28.328  69.327  102.958 1.00 25.97  ? 205 ASN C N   1 
ATOM   2955 C  CA  . ASN C 1 59  ? 29.486  70.113  103.400 1.00 25.47  ? 205 ASN C CA  1 
ATOM   2956 C  C   . ASN C 1 59  ? 29.724  70.124  104.906 1.00 26.28  ? 205 ASN C C   1 
ATOM   2957 O  O   . ASN C 1 59  ? 28.783  70.068  105.698 1.00 28.69  ? 205 ASN C O   1 
ATOM   2958 C  CB  . ASN C 1 59  ? 29.393  71.551  102.888 1.00 23.28  ? 205 ASN C CB  1 
ATOM   2959 C  CG  . ASN C 1 59  ? 29.603  71.650  101.391 1.00 31.18  ? 205 ASN C CG  1 
ATOM   2960 O  OD1 . ASN C 1 59  ? 30.715  71.457  100.896 1.00 35.61  ? 205 ASN C OD1 1 
ATOM   2961 N  ND2 . ASN C 1 59  ? 28.535  71.955  100.659 1.00 28.78  ? 205 ASN C ND2 1 
ATOM   2962 N  N   . PHE C 1 60  ? 30.994  70.201  105.287 1.00 25.86  ? 206 PHE C N   1 
ATOM   2963 C  CA  . PHE C 1 60  ? 31.365  70.355  106.682 1.00 28.05  ? 206 PHE C CA  1 
ATOM   2964 C  C   . PHE C 1 60  ? 31.730  71.807  106.964 1.00 25.30  ? 206 PHE C C   1 
ATOM   2965 O  O   . PHE C 1 60  ? 32.482  72.417  106.206 1.00 26.21  ? 206 PHE C O   1 
ATOM   2966 C  CB  . PHE C 1 60  ? 32.553  69.457  107.035 1.00 31.09  ? 206 PHE C CB  1 
ATOM   2967 C  CG  . PHE C 1 60  ? 32.250  67.987  106.985 1.00 29.70  ? 206 PHE C CG  1 
ATOM   2968 C  CD1 . PHE C 1 60  ? 31.283  67.435  107.809 1.00 31.69  ? 206 PHE C CD1 1 
ATOM   2969 C  CD2 . PHE C 1 60  ? 32.957  67.149  106.136 1.00 25.80  ? 206 PHE C CD2 1 
ATOM   2970 C  CE1 . PHE C 1 60  ? 31.014  66.072  107.772 1.00 31.14  ? 206 PHE C CE1 1 
ATOM   2971 C  CE2 . PHE C 1 60  ? 32.697  65.793  106.095 1.00 25.20  ? 206 PHE C CE2 1 
ATOM   2972 C  CZ  . PHE C 1 60  ? 31.723  65.252  106.908 1.00 28.79  ? 206 PHE C CZ  1 
ATOM   2973 N  N   . TYR C 1 61  ? 31.206  72.343  108.065 1.00 23.66  ? 207 TYR C N   1 
ATOM   2974 C  CA  . TYR C 1 61  ? 31.455  73.725  108.466 1.00 25.24  ? 207 TYR C CA  1 
ATOM   2975 C  C   . TYR C 1 61  ? 32.078  73.819  109.857 1.00 28.83  ? 207 TYR C C   1 
ATOM   2976 O  O   . TYR C 1 61  ? 31.682  73.107  110.782 1.00 30.02  ? 207 TYR C O   1 
ATOM   2977 C  CB  . TYR C 1 61  ? 30.152  74.523  108.463 1.00 23.72  ? 207 TYR C CB  1 
ATOM   2978 C  CG  . TYR C 1 61  ? 29.429  74.523  107.140 1.00 31.27  ? 207 TYR C CG  1 
ATOM   2979 C  CD1 . TYR C 1 61  ? 29.496  75.622  106.291 1.00 34.65  ? 207 TYR C CD1 1 
ATOM   2980 C  CD2 . TYR C 1 61  ? 28.678  73.427  106.739 1.00 26.87  ? 207 TYR C CD2 1 
ATOM   2981 C  CE1 . TYR C 1 61  ? 28.835  75.623  105.076 1.00 33.08  ? 207 TYR C CE1 1 
ATOM   2982 C  CE2 . TYR C 1 61  ? 28.015  73.419  105.528 1.00 28.57  ? 207 TYR C CE2 1 
ATOM   2983 C  CZ  . TYR C 1 61  ? 28.097  74.520  104.704 1.00 25.91  ? 207 TYR C CZ  1 
ATOM   2984 O  OH  . TYR C 1 61  ? 27.438  74.523  103.506 1.00 24.77  ? 207 TYR C OH  1 
ATOM   2985 N  N   . TYR C 1 62  ? 33.035  74.725  110.009 1.00 28.62  ? 208 TYR C N   1 
ATOM   2986 C  CA  . TYR C 1 62  ? 33.620  74.996  111.312 1.00 25.25  ? 208 TYR C CA  1 
ATOM   2987 C  C   . TYR C 1 62  ? 33.315  76.421  111.776 1.00 25.54  ? 208 TYR C C   1 
ATOM   2988 O  O   . TYR C 1 62  ? 33.638  77.386  111.094 1.00 27.69  ? 208 TYR C O   1 
ATOM   2989 C  CB  . TYR C 1 62  ? 35.130  74.758  111.275 1.00 27.14  ? 208 TYR C CB  1 
ATOM   2990 C  CG  . TYR C 1 62  ? 35.833  75.033  112.594 1.00 26.66  ? 208 TYR C CG  1 
ATOM   2991 C  CD1 . TYR C 1 62  ? 35.823  74.093  113.617 1.00 24.28  ? 208 TYR C CD1 1 
ATOM   2992 C  CD2 . TYR C 1 62  ? 36.510  76.225  112.808 1.00 25.52  ? 208 TYR C CD2 1 
ATOM   2993 C  CE1 . TYR C 1 62  ? 36.463  74.328  114.813 1.00 26.18  ? 208 TYR C CE1 1 
ATOM   2994 C  CE2 . TYR C 1 62  ? 37.158  76.476  114.012 1.00 28.74  ? 208 TYR C CE2 1 
ATOM   2995 C  CZ  . TYR C 1 62  ? 37.128  75.520  115.007 1.00 30.33  ? 208 TYR C CZ  1 
ATOM   2996 O  OH  . TYR C 1 62  ? 37.762  75.752  116.197 1.00 33.83  ? 208 TYR C OH  1 
ATOM   2997 N  N   . PHE C 1 63  ? 32.690  76.549  112.940 1.00 27.75  ? 209 PHE C N   1 
ATOM   2998 C  CA  . PHE C 1 63  ? 32.432  77.859  113.526 1.00 24.49  ? 209 PHE C CA  1 
ATOM   2999 C  C   . PHE C 1 63  ? 33.442  78.147  114.634 1.00 28.44  ? 209 PHE C C   1 
ATOM   3000 O  O   . PHE C 1 63  ? 33.376  77.555  115.709 1.00 31.95  ? 209 PHE C O   1 
ATOM   3001 C  CB  . PHE C 1 63  ? 31.012  77.916  114.072 1.00 23.33  ? 209 PHE C CB  1 
ATOM   3002 C  CG  . PHE C 1 63  ? 29.958  77.862  113.008 1.00 23.26  ? 209 PHE C CG  1 
ATOM   3003 C  CD1 . PHE C 1 63  ? 29.128  78.949  112.784 1.00 24.69  ? 209 PHE C CD1 1 
ATOM   3004 C  CD2 . PHE C 1 63  ? 29.809  76.733  112.215 1.00 21.77  ? 209 PHE C CD2 1 
ATOM   3005 C  CE1 . PHE C 1 63  ? 28.148  78.906  111.800 1.00 26.09  ? 209 PHE C CE1 1 
ATOM   3006 C  CE2 . PHE C 1 63  ? 28.837  76.688  111.228 1.00 25.90  ? 209 PHE C CE2 1 
ATOM   3007 C  CZ  . PHE C 1 63  ? 28.007  77.778  111.018 1.00 24.97  ? 209 PHE C CZ  1 
ATOM   3008 N  N   . SER C 1 64  ? 34.375  79.059  114.371 1.00 26.48  ? 210 SER C N   1 
ATOM   3009 C  CA  . SER C 1 64  ? 35.514  79.255  115.264 1.00 26.74  ? 210 SER C CA  1 
ATOM   3010 C  C   . SER C 1 64  ? 35.111  79.698  116.659 1.00 28.75  ? 210 SER C C   1 
ATOM   3011 O  O   . SER C 1 64  ? 33.968  80.085  116.904 1.00 29.03  ? 210 SER C O   1 
ATOM   3012 C  CB  . SER C 1 64  ? 36.509  80.259  114.684 1.00 26.77  ? 210 SER C CB  1 
ATOM   3013 O  OG  . SER C 1 64  ? 35.998  81.575  114.762 1.00 32.41  ? 210 SER C OG  1 
ATOM   3014 N  N   . LEU C 1 65  ? 36.077  79.636  117.567 1.00 30.86  ? 211 LEU C N   1 
ATOM   3015 C  CA  . LEU C 1 65  ? 35.876  80.027  118.952 1.00 31.00  ? 211 LEU C CA  1 
ATOM   3016 C  C   . LEU C 1 65  ? 36.725  81.255  119.248 1.00 30.19  ? 211 LEU C C   1 
ATOM   3017 O  O   . LEU C 1 65  ? 36.507  81.951  120.234 1.00 32.92  ? 211 LEU C O   1 
ATOM   3018 C  CB  . LEU C 1 65  ? 36.278  78.883  119.886 1.00 33.54  ? 211 LEU C CB  1 
ATOM   3019 C  CG  . LEU C 1 65  ? 35.594  77.537  119.632 1.00 37.20  ? 211 LEU C CG  1 
ATOM   3020 C  CD1 . LEU C 1 65  ? 36.122  76.451  120.579 1.00 39.11  ? 211 LEU C CD1 1 
ATOM   3021 C  CD2 . LEU C 1 65  ? 34.080  77.678  119.750 1.00 36.41  ? 211 LEU C CD2 1 
ATOM   3022 N  N   . ILE C 1 66  ? 37.696  81.506  118.380 1.00 27.29  ? 212 ILE C N   1 
ATOM   3023 C  CA  . ILE C 1 66  ? 38.615  82.618  118.538 1.00 31.60  ? 212 ILE C CA  1 
ATOM   3024 C  C   . ILE C 1 66  ? 38.516  83.532  117.309 1.00 32.56  ? 212 ILE C C   1 
ATOM   3025 O  O   . ILE C 1 66  ? 38.392  83.056  116.181 1.00 31.98  ? 212 ILE C O   1 
ATOM   3026 C  CB  . ILE C 1 66  ? 40.056  82.097  118.753 1.00 35.33  ? 212 ILE C CB  1 
ATOM   3027 C  CG1 . ILE C 1 66  ? 41.014  83.234  119.088 1.00 46.11  ? 212 ILE C CG1 1 
ATOM   3028 C  CG2 . ILE C 1 66  ? 40.542  81.316  117.539 1.00 31.10  ? 212 ILE C CG2 1 
ATOM   3029 C  CD1 . ILE C 1 66  ? 42.421  82.757  119.384 1.00 52.37  ? 212 ILE C CD1 1 
ATOM   3030 N  N   . PRO C 1 67  ? 38.536  84.854  117.524 1.00 31.97  ? 213 PRO C N   1 
ATOM   3031 C  CA  . PRO C 1 67  ? 38.390  85.780  116.394 1.00 27.63  ? 213 PRO C CA  1 
ATOM   3032 C  C   . PRO C 1 67  ? 39.703  85.945  115.635 1.00 28.07  ? 213 PRO C C   1 
ATOM   3033 O  O   . PRO C 1 67  ? 40.778  85.792  116.213 1.00 34.40  ? 213 PRO C O   1 
ATOM   3034 C  CB  . PRO C 1 67  ? 38.018  87.110  117.064 1.00 30.49  ? 213 PRO C CB  1 
ATOM   3035 C  CG  . PRO C 1 67  ? 37.890  86.820  118.551 1.00 34.54  ? 213 PRO C CG  1 
ATOM   3036 C  CD  . PRO C 1 67  ? 38.651  85.561  118.807 1.00 34.34  ? 213 PRO C CD  1 
ATOM   3037 N  N   . LYS C 1 68  ? 39.616  86.247  114.347 1.00 21.47  ? 214 LYS C N   1 
ATOM   3038 C  CA  . LYS C 1 68  ? 40.807  86.538  113.559 1.00 23.34  ? 214 LYS C CA  1 
ATOM   3039 C  C   . LYS C 1 68  ? 40.487  87.597  112.507 1.00 28.52  ? 214 LYS C C   1 
ATOM   3040 O  O   . LYS C 1 68  ? 39.322  87.943  112.300 1.00 32.83  ? 214 LYS C O   1 
ATOM   3041 C  CB  . LYS C 1 68  ? 41.353  85.264  112.898 1.00 21.99  ? 214 LYS C CB  1 
ATOM   3042 C  CG  . LYS C 1 68  ? 42.046  84.278  113.862 1.00 21.19  ? 214 LYS C CG  1 
ATOM   3043 C  CD  . LYS C 1 68  ? 42.525  83.028  113.129 1.00 23.51  ? 214 LYS C CD  1 
ATOM   3044 C  CE  . LYS C 1 68  ? 43.104  81.984  114.084 1.00 25.24  ? 214 LYS C CE  1 
ATOM   3045 N  NZ  . LYS C 1 68  ? 44.324  82.483  114.783 1.00 26.31  ? 214 LYS C NZ  1 
ATOM   3046 N  N   . THR C 1 69  ? 41.519  88.125  111.859 1.00 25.53  ? 215 THR C N   1 
ATOM   3047 C  CA  . THR C 1 69  ? 41.309  88.976  110.702 1.00 26.22  ? 215 THR C CA  1 
ATOM   3048 C  C   . THR C 1 69  ? 40.864  88.069  109.564 1.00 26.93  ? 215 THR C C   1 
ATOM   3049 O  O   . THR C 1 69  ? 41.035  86.850  109.640 1.00 24.06  ? 215 THR C O   1 
ATOM   3050 C  CB  . THR C 1 69  ? 42.591  89.693  110.293 1.00 26.14  ? 215 THR C CB  1 
ATOM   3051 O  OG1 . THR C 1 69  ? 43.590  88.717  109.982 1.00 24.71  ? 215 THR C OG1 1 
ATOM   3052 C  CG2 . THR C 1 69  ? 43.086  90.598  111.431 1.00 27.38  ? 215 THR C CG2 1 
ATOM   3053 N  N   . TRP C 1 70  ? 40.299  88.650  108.511 1.00 22.84  ? 216 TRP C N   1 
ATOM   3054 C  CA  . TRP C 1 70  ? 39.781  87.841  107.411 1.00 25.03  ? 216 TRP C CA  1 
ATOM   3055 C  C   . TRP C 1 70  ? 40.846  86.887  106.878 1.00 25.99  ? 216 TRP C C   1 
ATOM   3056 O  O   . TRP C 1 70  ? 40.607  85.686  106.755 1.00 28.95  ? 216 TRP C O   1 
ATOM   3057 C  CB  . TRP C 1 70  ? 39.231  88.721  106.287 1.00 22.65  ? 216 TRP C CB  1 
ATOM   3058 C  CG  . TRP C 1 70  ? 38.532  87.951  105.192 1.00 22.28  ? 216 TRP C CG  1 
ATOM   3059 C  CD1 . TRP C 1 70  ? 37.196  87.679  105.103 1.00 21.64  ? 216 TRP C CD1 1 
ATOM   3060 C  CD2 . TRP C 1 70  ? 39.137  87.367  104.033 1.00 19.31  ? 216 TRP C CD2 1 
ATOM   3061 N  NE1 . TRP C 1 70  ? 36.935  86.960  103.962 1.00 21.40  ? 216 TRP C NE1 1 
ATOM   3062 C  CE2 . TRP C 1 70  ? 38.110  86.760  103.287 1.00 21.56  ? 216 TRP C CE2 1 
ATOM   3063 C  CE3 . TRP C 1 70  ? 40.446  87.301  103.553 1.00 21.59  ? 216 TRP C CE3 1 
ATOM   3064 C  CZ2 . TRP C 1 70  ? 38.352  86.096  102.093 1.00 25.47  ? 216 TRP C CZ2 1 
ATOM   3065 C  CZ3 . TRP C 1 70  ? 40.684  86.646  102.368 1.00 24.07  ? 216 TRP C CZ3 1 
ATOM   3066 C  CH2 . TRP C 1 70  ? 39.643  86.050  101.650 1.00 27.49  ? 216 TRP C CH2 1 
ATOM   3067 N  N   . TYR C 1 71  ? 42.029  87.417  106.590 1.00 23.11  ? 217 TYR C N   1 
ATOM   3068 C  CA  . TYR C 1 71  ? 43.094  86.604  106.014 1.00 24.39  ? 217 TYR C CA  1 
ATOM   3069 C  C   . TYR C 1 71  ? 43.700  85.567  106.970 1.00 31.96  ? 217 TYR C C   1 
ATOM   3070 O  O   . TYR C 1 71  ? 44.019  84.452  106.556 1.00 34.84  ? 217 TYR C O   1 
ATOM   3071 C  CB  . TYR C 1 71  ? 44.198  87.470  105.403 1.00 24.16  ? 217 TYR C CB  1 
ATOM   3072 C  CG  . TYR C 1 71  ? 45.258  86.634  104.729 1.00 25.32  ? 217 TYR C CG  1 
ATOM   3073 C  CD1 . TYR C 1 71  ? 44.958  85.906  103.577 1.00 24.07  ? 217 TYR C CD1 1 
ATOM   3074 C  CD2 . TYR C 1 71  ? 46.549  86.546  105.250 1.00 21.38  ? 217 TYR C CD2 1 
ATOM   3075 C  CE1 . TYR C 1 71  ? 45.909  85.126  102.955 1.00 23.61  ? 217 TYR C CE1 1 
ATOM   3076 C  CE2 . TYR C 1 71  ? 47.512  85.766  104.635 1.00 21.78  ? 217 TYR C CE2 1 
ATOM   3077 C  CZ  . TYR C 1 71  ? 47.182  85.055  103.486 1.00 26.15  ? 217 TYR C CZ  1 
ATOM   3078 O  OH  . TYR C 1 71  ? 48.124  84.278  102.856 1.00 28.06  ? 217 TYR C OH  1 
ATOM   3079 N  N   . SER C 1 72  ? 43.875  85.929  108.237 1.00 31.26  ? 218 SER C N   1 
ATOM   3080 C  CA  . SER C 1 72  ? 44.391  84.973  109.203 1.00 27.90  ? 218 SER C CA  1 
ATOM   3081 C  C   . SER C 1 72  ? 43.378  83.847  109.375 1.00 28.03  ? 218 SER C C   1 
ATOM   3082 O  O   . SER C 1 72  ? 43.743  82.684  109.543 1.00 32.55  ? 218 SER C O   1 
ATOM   3083 C  CB  . SER C 1 72  ? 44.692  85.649  110.545 1.00 29.70  ? 218 SER C CB  1 
ATOM   3084 O  OG  . SER C 1 72  ? 45.807  86.518  110.439 1.00 33.38  ? 218 SER C OG  1 
ATOM   3085 N  N   . ALA C 1 73  ? 42.100  84.200  109.330 1.00 24.67  ? 219 ALA C N   1 
ATOM   3086 C  CA  . ALA C 1 73  ? 41.034  83.209  109.373 1.00 23.57  ? 219 ALA C CA  1 
ATOM   3087 C  C   . ALA C 1 73  ? 41.127  82.275  108.164 1.00 30.62  ? 219 ALA C C   1 
ATOM   3088 O  O   . ALA C 1 73  ? 41.076  81.052  108.304 1.00 33.65  ? 219 ALA C O   1 
ATOM   3089 C  CB  . ALA C 1 73  ? 39.684  83.895  109.409 1.00 21.38  ? 219 ALA C CB  1 
ATOM   3090 N  N   . GLU C 1 74  ? 41.263  82.857  106.976 1.00 30.13  ? 220 GLU C N   1 
ATOM   3091 C  CA  . GLU C 1 74  ? 41.418  82.066  105.763 1.00 28.60  ? 220 GLU C CA  1 
ATOM   3092 C  C   . GLU C 1 74  ? 42.617  81.145  105.887 1.00 29.22  ? 220 GLU C C   1 
ATOM   3093 O  O   . GLU C 1 74  ? 42.521  79.950  105.590 1.00 30.30  ? 220 GLU C O   1 
ATOM   3094 C  CB  . GLU C 1 74  ? 41.565  82.970  104.532 1.00 29.63  ? 220 GLU C CB  1 
ATOM   3095 C  CG  . GLU C 1 74  ? 42.063  82.262  103.268 1.00 29.69  ? 220 GLU C CG  1 
ATOM   3096 C  CD  . GLU C 1 74  ? 41.118  81.181  102.753 1.00 30.22  ? 220 GLU C CD  1 
ATOM   3097 O  OE1 . GLU C 1 74  ? 40.049  80.957  103.359 1.00 26.91  ? 220 GLU C OE1 1 
ATOM   3098 O  OE2 . GLU C 1 74  ? 41.455  80.548  101.731 1.00 32.99  ? 220 GLU C OE2 1 
ATOM   3099 N  N   . GLN C 1 75  ? 43.744  81.704  106.327 1.00 27.04  ? 221 GLN C N   1 
ATOM   3100 C  CA  . GLN C 1 75  ? 44.965  80.926  106.521 1.00 30.62  ? 221 GLN C CA  1 
ATOM   3101 C  C   . GLN C 1 75  ? 44.728  79.775  107.492 1.00 28.76  ? 221 GLN C C   1 
ATOM   3102 O  O   . GLN C 1 75  ? 45.230  78.667  107.301 1.00 29.68  ? 221 GLN C O   1 
ATOM   3103 C  CB  . GLN C 1 75  ? 46.107  81.816  107.020 1.00 34.38  ? 221 GLN C CB  1 
ATOM   3104 C  CG  . GLN C 1 75  ? 47.243  81.967  106.023 1.00 39.62  ? 221 GLN C CG  1 
ATOM   3105 C  CD  . GLN C 1 75  ? 48.341  82.890  106.513 1.00 46.86  ? 221 GLN C CD  1 
ATOM   3106 O  OE1 . GLN C 1 75  ? 48.162  83.633  107.478 1.00 50.92  ? 221 GLN C OE1 1 
ATOM   3107 N  NE2 . GLN C 1 75  ? 49.488  82.849  105.845 1.00 47.99  ? 221 GLN C NE2 1 
ATOM   3108 N  N   . PHE C 1 76  ? 43.959  80.052  108.538 1.00 25.33  ? 222 PHE C N   1 
ATOM   3109 C  CA  . PHE C 1 76  ? 43.564  79.024  109.483 1.00 23.56  ? 222 PHE C CA  1 
ATOM   3110 C  C   . PHE C 1 76  ? 42.702  77.968  108.794 1.00 28.69  ? 222 PHE C C   1 
ATOM   3111 O  O   . PHE C 1 76  ? 42.989  76.773  108.881 1.00 31.01  ? 222 PHE C O   1 
ATOM   3112 C  CB  . PHE C 1 76  ? 42.790  79.646  110.638 1.00 23.78  ? 222 PHE C CB  1 
ATOM   3113 C  CG  . PHE C 1 76  ? 42.300  78.650  111.634 1.00 30.23  ? 222 PHE C CG  1 
ATOM   3114 C  CD1 . PHE C 1 76  ? 43.046  78.363  112.765 1.00 37.96  ? 222 PHE C CD1 1 
ATOM   3115 C  CD2 . PHE C 1 76  ? 41.098  77.984  111.439 1.00 34.83  ? 222 PHE C CD2 1 
ATOM   3116 C  CE1 . PHE C 1 76  ? 42.597  77.434  113.693 1.00 40.90  ? 222 PHE C CE1 1 
ATOM   3117 C  CE2 . PHE C 1 76  ? 40.642  77.055  112.361 1.00 36.93  ? 222 PHE C CE2 1 
ATOM   3118 C  CZ  . PHE C 1 76  ? 41.393  76.779  113.488 1.00 40.54  ? 222 PHE C CZ  1 
ATOM   3119 N  N   . CYS C 1 77  ? 41.644  78.411  108.113 1.00 25.36  ? 223 CYS C N   1 
ATOM   3120 C  CA  . CYS C 1 77  ? 40.760  77.493  107.400 1.00 22.48  ? 223 CYS C CA  1 
ATOM   3121 C  C   . CYS C 1 77  ? 41.544  76.567  106.476 1.00 23.36  ? 223 CYS C C   1 
ATOM   3122 O  O   . CYS C 1 77  ? 41.302  75.359  106.439 1.00 26.71  ? 223 CYS C O   1 
ATOM   3123 C  CB  . CYS C 1 77  ? 39.707  78.260  106.601 1.00 18.91  ? 223 CYS C CB  1 
ATOM   3124 S  SG  . CYS C 1 77  ? 38.416  78.989  107.611 1.00 24.16  ? 223 CYS C SG  1 
ATOM   3125 N  N   . VAL C 1 78  ? 42.487  77.136  105.733 1.00 21.10  ? 224 VAL C N   1 
ATOM   3126 C  CA  . VAL C 1 78  ? 43.331  76.340  104.856 1.00 22.54  ? 224 VAL C CA  1 
ATOM   3127 C  C   . VAL C 1 78  ? 44.122  75.285  105.648 1.00 31.45  ? 224 VAL C C   1 
ATOM   3128 O  O   . VAL C 1 78  ? 44.246  74.135  105.207 1.00 32.77  ? 224 VAL C O   1 
ATOM   3129 C  CB  . VAL C 1 78  ? 44.278  77.223  104.020 1.00 21.76  ? 224 VAL C CB  1 
ATOM   3130 C  CG1 . VAL C 1 78  ? 45.331  76.385  103.332 1.00 21.01  ? 224 VAL C CG1 1 
ATOM   3131 C  CG2 . VAL C 1 78  ? 43.489  78.016  102.990 1.00 23.38  ? 224 VAL C CG2 1 
ATOM   3132 N  N   . SER C 1 79  ? 44.635  75.657  106.820 1.00 27.68  ? 225 SER C N   1 
ATOM   3133 C  CA  . SER C 1 79  ? 45.387  74.694  107.625 1.00 29.88  ? 225 SER C CA  1 
ATOM   3134 C  C   . SER C 1 79  ? 44.501  73.538  108.102 1.00 30.01  ? 225 SER C C   1 
ATOM   3135 O  O   . SER C 1 79  ? 45.004  72.498  108.529 1.00 30.87  ? 225 SER C O   1 
ATOM   3136 C  CB  . SER C 1 79  ? 46.102  75.372  108.806 1.00 28.13  ? 225 SER C CB  1 
ATOM   3137 O  OG  . SER C 1 79  ? 45.190  75.777  109.810 1.00 27.58  ? 225 SER C OG  1 
ATOM   3138 N  N   . ARG C 1 80  ? 43.185  73.723  108.024 1.00 29.01  ? 226 ARG C N   1 
ATOM   3139 C  CA  . ARG C 1 80  ? 42.239  72.657  108.358 1.00 28.32  ? 226 ARG C CA  1 
ATOM   3140 C  C   . ARG C 1 80  ? 41.585  72.074  107.102 1.00 29.63  ? 226 ARG C C   1 
ATOM   3141 O  O   . ARG C 1 80  ? 40.464  71.567  107.153 1.00 29.99  ? 226 ARG C O   1 
ATOM   3142 C  CB  . ARG C 1 80  ? 41.158  73.154  109.321 1.00 30.41  ? 226 ARG C CB  1 
ATOM   3143 C  CG  . ARG C 1 80  ? 41.677  73.806  110.605 1.00 37.94  ? 226 ARG C CG  1 
ATOM   3144 C  CD  . ARG C 1 80  ? 42.163  72.788  111.627 1.00 45.70  ? 226 ARG C CD  1 
ATOM   3145 N  NE  . ARG C 1 80  ? 42.317  73.369  112.964 1.00 51.62  ? 226 ARG C NE  1 
ATOM   3146 C  CZ  . ARG C 1 80  ? 43.424  73.967  113.398 1.00 52.54  ? 226 ARG C CZ  1 
ATOM   3147 N  NH1 . ARG C 1 80  ? 44.481  74.073  112.599 1.00 52.03  ? 226 ARG C NH1 1 
ATOM   3148 N  NH2 . ARG C 1 80  ? 43.474  74.460  114.629 1.00 50.33  ? 226 ARG C NH2 1 
ATOM   3149 N  N   . ASN C 1 81  ? 42.290  72.154  105.977 1.00 29.89  ? 227 ASN C N   1 
ATOM   3150 C  CA  . ASN C 1 81  ? 41.834  71.547  104.727 1.00 30.32  ? 227 ASN C CA  1 
ATOM   3151 C  C   . ASN C 1 81  ? 40.488  72.097  104.261 1.00 29.01  ? 227 ASN C C   1 
ATOM   3152 O  O   . ASN C 1 81  ? 39.637  71.355  103.777 1.00 22.72  ? 227 ASN C O   1 
ATOM   3153 C  CB  . ASN C 1 81  ? 41.753  70.024  104.862 1.00 32.01  ? 227 ASN C CB  1 
ATOM   3154 C  CG  . ASN C 1 81  ? 41.571  69.331  103.521 1.00 39.76  ? 227 ASN C CG  1 
ATOM   3155 O  OD1 . ASN C 1 81  ? 42.146  69.749  102.515 1.00 39.85  ? 227 ASN C OD1 1 
ATOM   3156 N  ND2 . ASN C 1 81  ? 40.770  68.265  103.501 1.00 40.47  ? 227 ASN C ND2 1 
ATOM   3157 N  N   . SER C 1 82  ? 40.296  73.400  104.422 1.00 31.23  ? 228 SER C N   1 
ATOM   3158 C  CA  . SER C 1 82  ? 39.048  74.023  104.024 1.00 31.46  ? 228 SER C CA  1 
ATOM   3159 C  C   . SER C 1 82  ? 39.267  75.480  103.620 1.00 29.04  ? 228 SER C C   1 
ATOM   3160 O  O   . SER C 1 82  ? 40.399  75.914  103.397 1.00 28.34  ? 228 SER C O   1 
ATOM   3161 C  CB  . SER C 1 82  ? 38.030  73.936  105.160 1.00 34.57  ? 228 SER C CB  1 
ATOM   3162 O  OG  . SER C 1 82  ? 38.307  74.901  106.155 1.00 33.09  ? 228 SER C OG  1 
ATOM   3163 N  N   . HIS C 1 83  ? 38.171  76.222  103.506 1.00 28.72  ? 229 HIS C N   1 
ATOM   3164 C  CA  . HIS C 1 83  ? 38.215  77.640  103.165 1.00 26.13  ? 229 HIS C CA  1 
ATOM   3165 C  C   . HIS C 1 83  ? 37.153  78.354  103.960 1.00 25.06  ? 229 HIS C C   1 
ATOM   3166 O  O   . HIS C 1 83  ? 36.188  77.733  104.398 1.00 26.97  ? 229 HIS C O   1 
ATOM   3167 C  CB  . HIS C 1 83  ? 37.898  77.855  101.690 1.00 28.38  ? 229 HIS C CB  1 
ATOM   3168 C  CG  . HIS C 1 83  ? 38.983  77.417  100.763 1.00 32.61  ? 229 HIS C CG  1 
ATOM   3169 N  ND1 . HIS C 1 83  ? 40.109  78.177  100.525 1.00 35.52  ? 229 HIS C ND1 1 
ATOM   3170 C  CD2 . HIS C 1 83  ? 39.105  76.308  99.997  1.00 33.30  ? 229 HIS C CD2 1 
ATOM   3171 C  CE1 . HIS C 1 83  ? 40.885  77.546  99.662  1.00 37.49  ? 229 HIS C CE1 1 
ATOM   3172 N  NE2 . HIS C 1 83  ? 40.299  76.410  99.325  1.00 36.28  ? 229 HIS C NE2 1 
ATOM   3173 N  N   . LEU C 1 84  ? 37.309  79.661  104.132 1.00 22.15  ? 230 LEU C N   1 
ATOM   3174 C  CA  . LEU C 1 84  ? 36.201  80.457  104.616 1.00 20.44  ? 230 LEU C CA  1 
ATOM   3175 C  C   . LEU C 1 84  ? 35.008  80.105  103.733 1.00 23.17  ? 230 LEU C C   1 
ATOM   3176 O  O   . LEU C 1 84  ? 35.141  80.002  102.514 1.00 24.54  ? 230 LEU C O   1 
ATOM   3177 C  CB  . LEU C 1 84  ? 36.529  81.947  104.539 1.00 21.14  ? 230 LEU C CB  1 
ATOM   3178 C  CG  . LEU C 1 84  ? 37.619  82.446  105.494 1.00 22.65  ? 230 LEU C CG  1 
ATOM   3179 C  CD1 . LEU C 1 84  ? 37.858  83.939  105.325 1.00 20.66  ? 230 LEU C CD1 1 
ATOM   3180 C  CD2 . LEU C 1 84  ? 37.249  82.128  106.934 1.00 19.72  ? 230 LEU C CD2 1 
ATOM   3181 N  N   . THR C 1 85  ? 33.850  79.895  104.345 1.00 23.52  ? 231 THR C N   1 
ATOM   3182 C  CA  . THR C 1 85  ? 32.694  79.377  103.615 1.00 26.74  ? 231 THR C CA  1 
ATOM   3183 C  C   . THR C 1 85  ? 32.174  80.286  102.499 1.00 27.51  ? 231 THR C C   1 
ATOM   3184 O  O   . THR C 1 85  ? 32.083  81.506  102.650 1.00 27.64  ? 231 THR C O   1 
ATOM   3185 C  CB  . THR C 1 85  ? 31.526  79.044  104.559 1.00 25.37  ? 231 THR C CB  1 
ATOM   3186 O  OG1 . THR C 1 85  ? 30.502  78.360  103.830 1.00 25.82  ? 231 THR C OG1 1 
ATOM   3187 C  CG2 . THR C 1 85  ? 30.952  80.313  105.178 1.00 20.89  ? 231 THR C CG2 1 
ATOM   3188 N  N   . SER C 1 86  ? 31.839  79.675  101.372 1.00 27.13  ? 232 SER C N   1 
ATOM   3189 C  CA  . SER C 1 86  ? 31.076  80.359  100.342 1.00 29.62  ? 232 SER C CA  1 
ATOM   3190 C  C   . SER C 1 86  ? 29.595  80.110  100.595 1.00 29.98  ? 232 SER C C   1 
ATOM   3191 O  O   . SER C 1 86  ? 29.222  79.264  101.411 1.00 33.44  ? 232 SER C O   1 
ATOM   3192 C  CB  . SER C 1 86  ? 31.472  79.859  98.953  1.00 33.49  ? 232 SER C CB  1 
ATOM   3193 O  OG  . SER C 1 86  ? 31.365  78.448  98.866  1.00 35.27  ? 232 SER C OG  1 
ATOM   3194 N  N   . VAL C 1 87  ? 28.748  80.864  99.911  1.00 29.45  ? 233 VAL C N   1 
ATOM   3195 C  CA  . VAL C 1 87  ? 27.310  80.645  99.982  1.00 29.20  ? 233 VAL C CA  1 
ATOM   3196 C  C   . VAL C 1 87  ? 26.785  80.504  98.565  1.00 28.30  ? 233 VAL C C   1 
ATOM   3197 O  O   . VAL C 1 87  ? 26.914  81.419  97.754  1.00 31.53  ? 233 VAL C O   1 
ATOM   3198 C  CB  . VAL C 1 87  ? 26.593  81.801  100.685 1.00 31.90  ? 233 VAL C CB  1 
ATOM   3199 C  CG1 . VAL C 1 87  ? 25.149  81.415  100.982 1.00 33.13  ? 233 VAL C CG1 1 
ATOM   3200 C  CG2 . VAL C 1 87  ? 27.332  82.173  101.969 1.00 27.63  ? 233 VAL C CG2 1 
ATOM   3201 N  N   . THR C 1 88  ? 26.194  79.353  98.277  1.00 26.49  ? 234 THR C N   1 
ATOM   3202 C  CA  . THR C 1 88  ? 25.880  78.966  96.912  1.00 31.22  ? 234 THR C CA  1 
ATOM   3203 C  C   . THR C 1 88  ? 24.385  78.762  96.712  1.00 33.40  ? 234 THR C C   1 
ATOM   3204 O  O   . THR C 1 88  ? 23.939  78.429  95.619  1.00 32.78  ? 234 THR C O   1 
ATOM   3205 C  CB  . THR C 1 88  ? 26.575  77.645  96.572  1.00 32.60  ? 234 THR C CB  1 
ATOM   3206 O  OG1 . THR C 1 88  ? 26.012  76.608  97.381  1.00 35.25  ? 234 THR C OG1 1 
ATOM   3207 C  CG2 . THR C 1 88  ? 28.072  77.736  96.867  1.00 35.84  ? 234 THR C CG2 1 
ATOM   3208 N  N   . SER C 1 89  ? 23.610  78.947  97.770  1.00 34.93  ? 235 SER C N   1 
ATOM   3209 C  CA  . SER C 1 89  ? 22.181  78.693  97.687  1.00 37.26  ? 235 SER C CA  1 
ATOM   3210 C  C   . SER C 1 89  ? 21.467  79.333  98.856  1.00 35.58  ? 235 SER C C   1 
ATOM   3211 O  O   . SER C 1 89  ? 22.086  79.684  99.862  1.00 32.42  ? 235 SER C O   1 
ATOM   3212 C  CB  . SER C 1 89  ? 21.910  77.187  97.691  1.00 43.31  ? 235 SER C CB  1 
ATOM   3213 O  OG  . SER C 1 89  ? 22.338  76.596  98.913  1.00 42.98  ? 235 SER C OG  1 
ATOM   3214 N  N   . GLU C 1 90  ? 20.156  79.472  98.725  1.00 35.01  ? 236 GLU C N   1 
ATOM   3215 C  CA  . GLU C 1 90  ? 19.353  80.050  99.783  1.00 35.78  ? 236 GLU C CA  1 
ATOM   3216 C  C   . GLU C 1 90  ? 19.320  79.150  101.015 1.00 35.62  ? 236 GLU C C   1 
ATOM   3217 O  O   . GLU C 1 90  ? 19.339  79.636  102.146 1.00 36.19  ? 236 GLU C O   1 
ATOM   3218 C  CB  . GLU C 1 90  ? 17.938  80.316  99.285  1.00 38.24  ? 236 GLU C CB  1 
ATOM   3219 C  CG  . GLU C 1 90  ? 17.022  80.888  100.338 1.00 42.21  ? 236 GLU C CG  1 
ATOM   3220 C  CD  . GLU C 1 90  ? 16.088  81.929  99.769  1.00 49.77  ? 236 GLU C CD  1 
ATOM   3221 O  OE1 . GLU C 1 90  ? 14.919  81.983  100.203 1.00 51.19  ? 236 GLU C OE1 1 
ATOM   3222 O  OE2 . GLU C 1 90  ? 16.527  82.692  98.882  1.00 54.02  ? 236 GLU C OE2 1 
ATOM   3223 N  N   . SER C 1 91  ? 19.269  77.839  100.802 1.00 32.40  ? 237 SER C N   1 
ATOM   3224 C  CA  . SER C 1 91  ? 19.247  76.921  101.935 1.00 33.35  ? 237 SER C CA  1 
ATOM   3225 C  C   . SER C 1 91  ? 20.556  77.014  102.715 1.00 28.82  ? 237 SER C C   1 
ATOM   3226 O  O   . SER C 1 91  ? 20.546  76.992  103.940 1.00 26.83  ? 237 SER C O   1 
ATOM   3227 C  CB  . SER C 1 91  ? 18.949  75.473  101.506 1.00 33.50  ? 237 SER C CB  1 
ATOM   3228 O  OG  . SER C 1 91  ? 19.953  74.965  100.644 1.00 38.32  ? 237 SER C OG  1 
ATOM   3229 N  N   . GLU C 1 92  ? 21.677  77.136  102.009 1.00 27.81  ? 238 GLU C N   1 
ATOM   3230 C  CA  . GLU C 1 92  ? 22.962  77.280  102.683 1.00 30.42  ? 238 GLU C CA  1 
ATOM   3231 C  C   . GLU C 1 92  ? 23.042  78.602  103.450 1.00 32.88  ? 238 GLU C C   1 
ATOM   3232 O  O   . GLU C 1 92  ? 23.519  78.644  104.584 1.00 33.19  ? 238 GLU C O   1 
ATOM   3233 C  CB  . GLU C 1 92  ? 24.133  77.148  101.706 1.00 30.15  ? 238 GLU C CB  1 
ATOM   3234 C  CG  . GLU C 1 92  ? 25.487  77.064  102.406 1.00 29.86  ? 238 GLU C CG  1 
ATOM   3235 C  CD  . GLU C 1 92  ? 26.640  76.893  101.443 1.00 32.17  ? 238 GLU C CD  1 
ATOM   3236 O  OE1 . GLU C 1 92  ? 26.401  76.879  100.221 1.00 32.49  ? 238 GLU C OE1 1 
ATOM   3237 O  OE2 . GLU C 1 92  ? 27.790  76.780  101.910 1.00 32.19  ? 238 GLU C OE2 1 
ATOM   3238 N  N   . GLN C 1 93  ? 22.571  79.682  102.834 1.00 34.94  ? 239 GLN C N   1 
ATOM   3239 C  CA  . GLN C 1 93  ? 22.521  80.971  103.516 1.00 32.36  ? 239 GLN C CA  1 
ATOM   3240 C  C   . GLN C 1 93  ? 21.727  80.840  104.812 1.00 28.98  ? 239 GLN C C   1 
ATOM   3241 O  O   . GLN C 1 93  ? 22.159  81.296  105.869 1.00 28.08  ? 239 GLN C O   1 
ATOM   3242 C  CB  . GLN C 1 93  ? 21.909  82.052  102.608 1.00 31.46  ? 239 GLN C CB  1 
ATOM   3243 C  CG  . GLN C 1 93  ? 21.622  83.391  103.301 1.00 30.37  ? 239 GLN C CG  1 
ATOM   3244 C  CD  . GLN C 1 93  ? 22.876  84.214  103.581 1.00 32.05  ? 239 GLN C CD  1 
ATOM   3245 O  OE1 . GLN C 1 93  ? 23.993  83.701  103.545 1.00 28.45  ? 239 GLN C OE1 1 
ATOM   3246 N  NE2 . GLN C 1 93  ? 22.691  85.504  103.852 1.00 34.41  ? 239 GLN C NE2 1 
ATOM   3247 N  N   . GLU C 1 94  ? 20.567  80.201  104.728 1.00 30.88  ? 240 GLU C N   1 
ATOM   3248 C  CA  . GLU C 1 94  ? 19.714  80.032  105.897 1.00 34.05  ? 240 GLU C CA  1 
ATOM   3249 C  C   . GLU C 1 94  ? 20.371  79.162  106.973 1.00 36.09  ? 240 GLU C C   1 
ATOM   3250 O  O   . GLU C 1 94  ? 20.246  79.446  108.159 1.00 39.08  ? 240 GLU C O   1 
ATOM   3251 C  CB  . GLU C 1 94  ? 18.358  79.451  105.496 1.00 38.24  ? 240 GLU C CB  1 
ATOM   3252 C  CG  . GLU C 1 94  ? 17.461  79.133  106.677 1.00 47.77  ? 240 GLU C CG  1 
ATOM   3253 C  CD  . GLU C 1 94  ? 16.098  78.621  106.257 1.00 57.35  ? 240 GLU C CD  1 
ATOM   3254 O  OE1 . GLU C 1 94  ? 15.617  79.016  105.173 1.00 61.35  ? 240 GLU C OE1 1 
ATOM   3255 O  OE2 . GLU C 1 94  ? 15.502  77.829  107.018 1.00 60.85  ? 240 GLU C OE2 1 
ATOM   3256 N  N   . PHE C 1 95  ? 21.058  78.100  106.560 1.00 34.79  ? 241 PHE C N   1 
ATOM   3257 C  CA  . PHE C 1 95  ? 21.787  77.268  107.510 1.00 31.85  ? 241 PHE C CA  1 
ATOM   3258 C  C   . PHE C 1 95  ? 22.864  78.089  108.208 1.00 31.35  ? 241 PHE C C   1 
ATOM   3259 O  O   . PHE C 1 95  ? 23.061  77.968  109.411 1.00 34.00  ? 241 PHE C O   1 
ATOM   3260 C  CB  . PHE C 1 95  ? 22.410  76.043  106.829 1.00 28.47  ? 241 PHE C CB  1 
ATOM   3261 C  CG  . PHE C 1 95  ? 23.610  75.481  107.564 1.00 28.39  ? 241 PHE C CG  1 
ATOM   3262 C  CD1 . PHE C 1 95  ? 23.447  74.643  108.653 1.00 31.51  ? 241 PHE C CD1 1 
ATOM   3263 C  CD2 . PHE C 1 95  ? 24.898  75.795  107.160 1.00 27.07  ? 241 PHE C CD2 1 
ATOM   3264 C  CE1 . PHE C 1 95  ? 24.547  74.129  109.326 1.00 32.42  ? 241 PHE C CE1 1 
ATOM   3265 C  CE2 . PHE C 1 95  ? 26.000  75.287  107.823 1.00 26.69  ? 241 PHE C CE2 1 
ATOM   3266 C  CZ  . PHE C 1 95  ? 25.826  74.454  108.909 1.00 28.72  ? 241 PHE C CZ  1 
ATOM   3267 N  N   . LEU C 1 96  ? 23.549  78.938  107.448 1.00 29.84  ? 242 LEU C N   1 
ATOM   3268 C  CA  . LEU C 1 96  ? 24.653  79.725  107.992 1.00 28.07  ? 242 LEU C CA  1 
ATOM   3269 C  C   . LEU C 1 96  ? 24.210  80.794  108.988 1.00 31.04  ? 242 LEU C C   1 
ATOM   3270 O  O   . LEU C 1 96  ? 24.771  80.897  110.085 1.00 28.79  ? 242 LEU C O   1 
ATOM   3271 C  CB  . LEU C 1 96  ? 25.461  80.364  106.868 1.00 24.45  ? 242 LEU C CB  1 
ATOM   3272 C  CG  . LEU C 1 96  ? 26.277  79.407  106.002 1.00 27.06  ? 242 LEU C CG  1 
ATOM   3273 C  CD1 . LEU C 1 96  ? 26.883  80.161  104.835 1.00 26.44  ? 242 LEU C CD1 1 
ATOM   3274 C  CD2 . LEU C 1 96  ? 27.357  78.728  106.828 1.00 24.54  ? 242 LEU C CD2 1 
ATOM   3275 N  N   . TYR C 1 97  ? 23.217  81.597  108.613 1.00 29.14  ? 243 TYR C N   1 
ATOM   3276 C  CA  . TYR C 1 97  ? 22.788  82.674  109.495 1.00 29.65  ? 243 TYR C CA  1 
ATOM   3277 C  C   . TYR C 1 97  ? 22.080  82.113  110.727 1.00 30.83  ? 243 TYR C C   1 
ATOM   3278 O  O   . TYR C 1 97  ? 22.163  82.686  111.811 1.00 27.54  ? 243 TYR C O   1 
ATOM   3279 C  CB  . TYR C 1 97  ? 21.938  83.720  108.755 1.00 31.83  ? 243 TYR C CB  1 
ATOM   3280 C  CG  . TYR C 1 97  ? 20.447  83.474  108.770 1.00 32.65  ? 243 TYR C CG  1 
ATOM   3281 C  CD1 . TYR C 1 97  ? 19.699  83.689  109.920 1.00 31.47  ? 243 TYR C CD1 1 
ATOM   3282 C  CD2 . TYR C 1 97  ? 19.783  83.055  107.627 1.00 37.97  ? 243 TYR C CD2 1 
ATOM   3283 C  CE1 . TYR C 1 97  ? 18.337  83.473  109.937 1.00 35.41  ? 243 TYR C CE1 1 
ATOM   3284 C  CE2 . TYR C 1 97  ? 18.420  82.838  107.633 1.00 41.43  ? 243 TYR C CE2 1 
ATOM   3285 C  CZ  . TYR C 1 97  ? 17.702  83.049  108.791 1.00 41.63  ? 243 TYR C CZ  1 
ATOM   3286 O  OH  . TYR C 1 97  ? 16.344  82.833  108.802 1.00 45.50  ? 243 TYR C OH  1 
ATOM   3287 N  N   . LYS C 1 98  ? 21.405  80.978  110.570 1.00 33.56  ? 244 LYS C N   1 
ATOM   3288 C  CA  . LYS C 1 98  ? 20.782  80.321  111.719 1.00 33.95  ? 244 LYS C CA  1 
ATOM   3289 C  C   . LYS C 1 98  ? 21.795  79.665  112.666 1.00 31.99  ? 244 LYS C C   1 
ATOM   3290 O  O   . LYS C 1 98  ? 21.717  79.828  113.889 1.00 26.88  ? 244 LYS C O   1 
ATOM   3291 C  CB  . LYS C 1 98  ? 19.718  79.318  111.277 1.00 34.67  ? 244 LYS C CB  1 
ATOM   3292 C  CG  . LYS C 1 98  ? 18.432  79.987  110.825 1.00 40.71  ? 244 LYS C CG  1 
ATOM   3293 C  CD  . LYS C 1 98  ? 17.274  79.006  110.737 1.00 46.99  ? 244 LYS C CD  1 
ATOM   3294 C  CE  . LYS C 1 98  ? 15.948  79.742  110.570 1.00 49.59  ? 244 LYS C CE  1 
ATOM   3295 N  NZ  . LYS C 1 98  ? 14.780  78.820  110.655 1.00 53.00  ? 244 LYS C NZ  1 
ATOM   3296 N  N   . THR C 1 99  ? 22.748  78.928  112.112 1.00 28.15  ? 245 THR C N   1 
ATOM   3297 C  CA  . THR C 1 99  ? 23.772  78.327  112.957 1.00 27.78  ? 245 THR C CA  1 
ATOM   3298 C  C   . THR C 1 99  ? 24.642  79.404  113.615 1.00 29.06  ? 245 THR C C   1 
ATOM   3299 O  O   . THR C 1 99  ? 25.064  79.252  114.763 1.00 28.74  ? 245 THR C O   1 
ATOM   3300 C  CB  . THR C 1 99  ? 24.640  77.335  112.179 1.00 28.25  ? 245 THR C CB  1 
ATOM   3301 O  OG1 . THR C 1 99  ? 23.798  76.341  111.578 1.00 29.04  ? 245 THR C OG1 1 
ATOM   3302 C  CG2 . THR C 1 99  ? 25.625  76.657  113.116 1.00 27.14  ? 245 THR C CG2 1 
ATOM   3303 N  N   . ALA C 1 100 ? 24.893  80.494  112.890 1.00 27.97  ? 246 ALA C N   1 
ATOM   3304 C  CA  . ALA C 1 100 ? 25.676  81.616  113.420 1.00 27.99  ? 246 ALA C CA  1 
ATOM   3305 C  C   . ALA C 1 100 ? 25.112  82.110  114.753 1.00 27.12  ? 246 ALA C C   1 
ATOM   3306 O  O   . ALA C 1 100 ? 25.854  82.538  115.633 1.00 31.00  ? 246 ALA C O   1 
ATOM   3307 C  CB  . ALA C 1 100 ? 25.735  82.749  112.409 1.00 28.77  ? 246 ALA C CB  1 
ATOM   3308 N  N   . GLY C 1 101 ? 23.793  82.053  114.887 1.00 26.40  ? 247 GLY C N   1 
ATOM   3309 C  CA  . GLY C 1 101 ? 23.143  82.245  116.169 1.00 28.96  ? 247 GLY C CA  1 
ATOM   3310 C  C   . GLY C 1 101 ? 23.337  83.598  116.818 1.00 33.56  ? 247 GLY C C   1 
ATOM   3311 O  O   . GLY C 1 101 ? 23.511  83.683  118.034 1.00 32.19  ? 247 GLY C O   1 
ATOM   3312 N  N   . GLY C 1 102 ? 23.298  84.659  116.016 1.00 33.95  ? 248 GLY C N   1 
ATOM   3313 C  CA  . GLY C 1 102 ? 23.405  86.007  116.548 1.00 34.89  ? 248 GLY C CA  1 
ATOM   3314 C  C   . GLY C 1 102 ? 24.829  86.525  116.686 1.00 35.40  ? 248 GLY C C   1 
ATOM   3315 O  O   . GLY C 1 102 ? 25.039  87.718  116.926 1.00 38.86  ? 248 GLY C O   1 
ATOM   3316 N  N   . LEU C 1 103 ? 25.809  85.634  116.549 1.00 28.87  ? 249 LEU C N   1 
ATOM   3317 C  CA  . LEU C 1 103 ? 27.206  86.048  116.552 1.00 29.28  ? 249 LEU C CA  1 
ATOM   3318 C  C   . LEU C 1 103 ? 27.660  86.407  115.134 1.00 36.17  ? 249 LEU C C   1 
ATOM   3319 O  O   . LEU C 1 103 ? 27.064  85.966  114.149 1.00 42.46  ? 249 LEU C O   1 
ATOM   3320 C  CB  . LEU C 1 103 ? 28.097  84.964  117.159 1.00 27.84  ? 249 LEU C CB  1 
ATOM   3321 C  CG  . LEU C 1 103 ? 27.835  84.596  118.627 1.00 30.47  ? 249 LEU C CG  1 
ATOM   3322 C  CD1 . LEU C 1 103 ? 28.785  83.503  119.095 1.00 25.68  ? 249 LEU C CD1 1 
ATOM   3323 C  CD2 . LEU C 1 103 ? 27.954  85.821  119.528 1.00 29.31  ? 249 LEU C CD2 1 
ATOM   3324 N  N   . ILE C 1 104 ? 28.709  87.216  115.032 1.00 35.80  ? 250 ILE C N   1 
ATOM   3325 C  CA  . ILE C 1 104 ? 29.197  87.664  113.730 1.00 33.14  ? 250 ILE C CA  1 
ATOM   3326 C  C   . ILE C 1 104 ? 30.369  86.818  113.251 1.00 31.84  ? 250 ILE C C   1 
ATOM   3327 O  O   . ILE C 1 104 ? 31.325  86.584  113.994 1.00 34.36  ? 250 ILE C O   1 
ATOM   3328 C  CB  . ILE C 1 104 ? 29.644  89.132  113.772 1.00 32.03  ? 250 ILE C CB  1 
ATOM   3329 C  CG1 . ILE C 1 104 ? 28.521  90.022  114.309 1.00 33.23  ? 250 ILE C CG1 1 
ATOM   3330 C  CG2 . ILE C 1 104 ? 30.085  89.585  112.392 1.00 30.15  ? 250 ILE C CG2 1 
ATOM   3331 C  CD1 . ILE C 1 104 ? 28.900  91.508  114.426 1.00 31.03  ? 250 ILE C CD1 1 
ATOM   3332 N  N   . TYR C 1 105 ? 30.302  86.370  112.002 1.00 26.30  ? 251 TYR C N   1 
ATOM   3333 C  CA  . TYR C 1 105 ? 31.336  85.502  111.467 1.00 23.83  ? 251 TYR C CA  1 
ATOM   3334 C  C   . TYR C 1 105 ? 31.828  85.957  110.105 1.00 25.80  ? 251 TYR C C   1 
ATOM   3335 O  O   . TYR C 1 105 ? 31.030  86.163  109.191 1.00 29.77  ? 251 TYR C O   1 
ATOM   3336 C  CB  . TYR C 1 105 ? 30.803  84.076  111.320 1.00 25.95  ? 251 TYR C CB  1 
ATOM   3337 C  CG  . TYR C 1 105 ? 30.491  83.359  112.606 1.00 26.39  ? 251 TYR C CG  1 
ATOM   3338 C  CD1 . TYR C 1 105 ? 31.410  82.488  113.170 1.00 28.33  ? 251 TYR C CD1 1 
ATOM   3339 C  CD2 . TYR C 1 105 ? 29.269  83.526  113.242 1.00 25.59  ? 251 TYR C CD2 1 
ATOM   3340 C  CE1 . TYR C 1 105 ? 31.131  81.811  114.343 1.00 29.02  ? 251 TYR C CE1 1 
ATOM   3341 C  CE2 . TYR C 1 105 ? 28.979  82.849  114.417 1.00 26.89  ? 251 TYR C CE2 1 
ATOM   3342 C  CZ  . TYR C 1 105 ? 29.918  81.995  114.962 1.00 29.50  ? 251 TYR C CZ  1 
ATOM   3343 O  OH  . TYR C 1 105 ? 29.648  81.316  116.129 1.00 33.13  ? 251 TYR C OH  1 
ATOM   3344 N  N   . TRP C 1 106 ? 33.145  86.081  109.962 1.00 22.05  ? 252 TRP C N   1 
ATOM   3345 C  CA  . TRP C 1 106 ? 33.755  86.204  108.649 1.00 22.90  ? 252 TRP C CA  1 
ATOM   3346 C  C   . TRP C 1 106 ? 33.313  85.046  107.753 1.00 28.40  ? 252 TRP C C   1 
ATOM   3347 O  O   . TRP C 1 106 ? 33.202  83.898  108.201 1.00 27.31  ? 252 TRP C O   1 
ATOM   3348 C  CB  . TRP C 1 106 ? 35.278  86.149  108.750 1.00 26.24  ? 252 TRP C CB  1 
ATOM   3349 C  CG  . TRP C 1 106 ? 35.954  87.438  109.105 1.00 26.68  ? 252 TRP C CG  1 
ATOM   3350 C  CD1 . TRP C 1 106 ? 36.896  87.627  110.074 1.00 25.23  ? 252 TRP C CD1 1 
ATOM   3351 C  CD2 . TRP C 1 106 ? 35.760  88.711  108.478 1.00 28.52  ? 252 TRP C CD2 1 
ATOM   3352 N  NE1 . TRP C 1 106 ? 37.298  88.943  110.095 1.00 25.23  ? 252 TRP C NE1 1 
ATOM   3353 C  CE2 . TRP C 1 106 ? 36.612  89.630  109.126 1.00 27.79  ? 252 TRP C CE2 1 
ATOM   3354 C  CE3 . TRP C 1 106 ? 34.945  89.166  107.434 1.00 29.01  ? 252 TRP C CE3 1 
ATOM   3355 C  CZ2 . TRP C 1 106 ? 36.673  90.975  108.764 1.00 24.99  ? 252 TRP C CZ2 1 
ATOM   3356 C  CZ3 . TRP C 1 106 ? 35.008  90.498  107.077 1.00 28.43  ? 252 TRP C CZ3 1 
ATOM   3357 C  CH2 . TRP C 1 106 ? 35.865  91.388  107.743 1.00 27.42  ? 252 TRP C CH2 1 
ATOM   3358 N  N   . ILE C 1 107 ? 33.082  85.342  106.480 1.00 27.55  ? 253 ILE C N   1 
ATOM   3359 C  CA  . ILE C 1 107 ? 32.912  84.287  105.490 1.00 28.38  ? 253 ILE C CA  1 
ATOM   3360 C  C   . ILE C 1 107 ? 33.850  84.532  104.317 1.00 28.34  ? 253 ILE C C   1 
ATOM   3361 O  O   . ILE C 1 107 ? 34.655  85.467  104.347 1.00 28.13  ? 253 ILE C O   1 
ATOM   3362 C  CB  . ILE C 1 107 ? 31.451  84.146  105.031 1.00 23.22  ? 253 ILE C CB  1 
ATOM   3363 C  CG1 . ILE C 1 107 ? 30.988  85.398  104.294 1.00 22.44  ? 253 ILE C CG1 1 
ATOM   3364 C  CG2 . ILE C 1 107 ? 30.550  83.873  106.235 1.00 19.25  ? 253 ILE C CG2 1 
ATOM   3365 C  CD1 . ILE C 1 107 ? 29.503  85.383  103.978 1.00 23.16  ? 253 ILE C CD1 1 
ATOM   3366 N  N   . GLY C 1 108 ? 33.760  83.689  103.294 1.00 26.91  ? 254 GLY C N   1 
ATOM   3367 C  CA  . GLY C 1 108 ? 34.676  83.769  102.171 1.00 26.39  ? 254 GLY C CA  1 
ATOM   3368 C  C   . GLY C 1 108 ? 34.458  84.965  101.258 1.00 26.35  ? 254 GLY C C   1 
ATOM   3369 O  O   . GLY C 1 108 ? 34.981  84.989  100.143 1.00 29.56  ? 254 GLY C O   1 
ATOM   3370 N  N   . LEU C 1 109 ? 33.698  85.953  101.727 1.00 21.48  ? 255 LEU C N   1 
ATOM   3371 C  CA  . LEU C 1 109 ? 33.387  87.144  100.937 1.00 21.88  ? 255 LEU C CA  1 
ATOM   3372 C  C   . LEU C 1 109 ? 34.546  88.123  100.902 1.00 25.68  ? 255 LEU C C   1 
ATOM   3373 O  O   . LEU C 1 109 ? 34.978  88.622  101.938 1.00 30.03  ? 255 LEU C O   1 
ATOM   3374 C  CB  . LEU C 1 109 ? 32.170  87.860  101.514 1.00 23.74  ? 255 LEU C CB  1 
ATOM   3375 C  CG  . LEU C 1 109 ? 30.840  87.708  100.792 1.00 29.65  ? 255 LEU C CG  1 
ATOM   3376 C  CD1 . LEU C 1 109 ? 29.802  88.576  101.472 1.00 31.07  ? 255 LEU C CD1 1 
ATOM   3377 C  CD2 . LEU C 1 109 ? 30.987  88.074  99.322  1.00 28.01  ? 255 LEU C CD2 1 
ATOM   3378 N  N   . THR C 1 110 ? 35.041  88.423  99.710  1.00 28.57  ? 256 THR C N   1 
ATOM   3379 C  CA  . THR C 1 110 ? 36.135  89.376  99.597  1.00 27.98  ? 256 THR C CA  1 
ATOM   3380 C  C   . THR C 1 110 ? 36.209  89.986  98.195  1.00 28.36  ? 256 THR C C   1 
ATOM   3381 O  O   . THR C 1 110 ? 35.905  89.330  97.198  1.00 27.60  ? 256 THR C O   1 
ATOM   3382 C  CB  . THR C 1 110 ? 37.482  88.717  99.982  1.00 24.48  ? 256 THR C CB  1 
ATOM   3383 O  OG1 . THR C 1 110 ? 38.497  89.721  100.124 1.00 20.50  ? 256 THR C OG1 1 
ATOM   3384 C  CG2 . THR C 1 110 ? 37.901  87.681  98.932  1.00 15.77  ? 256 THR C CG2 1 
ATOM   3385 N  N   . LYS C 1 111 ? 36.599  91.253  98.129  1.00 27.29  ? 257 LYS C N   1 
ATOM   3386 C  CA  . LYS C 1 111 ? 36.769  91.914  96.845  1.00 31.39  ? 257 LYS C CA  1 
ATOM   3387 C  C   . LYS C 1 111 ? 38.033  91.433  96.157  1.00 41.40  ? 257 LYS C C   1 
ATOM   3388 O  O   . LYS C 1 111 ? 39.080  91.268  96.790  1.00 43.45  ? 257 LYS C O   1 
ATOM   3389 C  CB  . LYS C 1 111 ? 36.817  93.432  97.002  1.00 24.33  ? 257 LYS C CB  1 
ATOM   3390 C  CG  . LYS C 1 111 ? 35.491  94.063  97.377  1.00 26.55  ? 257 LYS C CG  1 
ATOM   3391 C  CD  . LYS C 1 111 ? 35.635  95.578  97.488  1.00 28.46  ? 257 LYS C CD  1 
ATOM   3392 C  CE  . LYS C 1 111 ? 34.419  96.206  98.143  1.00 33.76  ? 257 LYS C CE  1 
ATOM   3393 N  NZ  . LYS C 1 111 ? 34.780  97.411  98.942  1.00 33.88  ? 257 LYS C NZ  1 
ATOM   3394 N  N   . ALA C 1 112 ? 37.925  91.215  94.853  1.00 46.48  ? 258 ALA C N   1 
ATOM   3395 C  CA  . ALA C 1 112 ? 39.065  90.821  94.048  1.00 56.68  ? 258 ALA C CA  1 
ATOM   3396 C  C   . ALA C 1 112 ? 39.002  91.530  92.705  1.00 67.47  ? 258 ALA C C   1 
ATOM   3397 O  O   . ALA C 1 112 ? 37.984  92.134  92.360  1.00 71.32  ? 258 ALA C O   1 
ATOM   3398 C  CB  . ALA C 1 112 ? 39.089  89.311  93.857  1.00 57.07  ? 258 ALA C CB  1 
ATOM   3399 N  N   . GLY C 1 113 ? 40.096  91.460  91.955  1.00 72.28  ? 259 GLY C N   1 
ATOM   3400 C  CA  . GLY C 1 113 ? 40.163  92.074  90.643  1.00 74.00  ? 259 GLY C CA  1 
ATOM   3401 C  C   . GLY C 1 113 ? 40.382  93.573  90.700  1.00 75.43  ? 259 GLY C C   1 
ATOM   3402 O  O   . GLY C 1 113 ? 40.506  94.158  91.779  1.00 76.17  ? 259 GLY C O   1 
ATOM   3403 N  N   . MET C 1 114 ? 40.429  94.194  89.526  1.00 75.23  ? 260 MET C N   1 
ATOM   3404 C  CA  . MET C 1 114 ? 40.611  95.635  89.426  1.00 73.94  ? 260 MET C CA  1 
ATOM   3405 C  C   . MET C 1 114 ? 39.263  96.344  89.432  1.00 74.40  ? 260 MET C C   1 
ATOM   3406 O  O   . MET C 1 114 ? 39.188  97.557  89.234  1.00 76.04  ? 260 MET C O   1 
ATOM   3407 C  CB  . MET C 1 114 ? 41.375  95.982  88.149  1.00 71.87  ? 260 MET C CB  1 
ATOM   3408 C  CG  . MET C 1 114 ? 42.654  95.191  87.966  1.00 68.98  ? 260 MET C CG  1 
ATOM   3409 S  SD  . MET C 1 114 ? 43.579  95.717  86.519  1.00 103.49 ? 260 MET C SD  1 
ATOM   3410 C  CE  . MET C 1 114 ? 43.839  97.449  86.898  1.00 113.52 ? 260 MET C CE  1 
ATOM   3411 N  N   . GLU C 1 115 ? 38.201  95.579  89.667  1.00 72.44  ? 261 GLU C N   1 
ATOM   3412 C  CA  . GLU C 1 115 ? 36.842  96.110  89.637  1.00 71.63  ? 261 GLU C CA  1 
ATOM   3413 C  C   . GLU C 1 115 ? 36.239  96.241  91.035  1.00 67.32  ? 261 GLU C C   1 
ATOM   3414 O  O   . GLU C 1 115 ? 35.198  96.877  91.216  1.00 65.80  ? 261 GLU C O   1 
ATOM   3415 C  CB  . GLU C 1 115 ? 35.950  95.208  88.781  1.00 75.81  ? 261 GLU C CB  1 
ATOM   3416 C  CG  . GLU C 1 115 ? 36.455  94.979  87.363  1.00 79.31  ? 261 GLU C CG  1 
ATOM   3417 C  CD  . GLU C 1 115 ? 36.115  96.123  86.424  1.00 81.73  ? 261 GLU C CD  1 
ATOM   3418 O  OE1 . GLU C 1 115 ? 35.135  95.989  85.659  1.00 83.19  ? 261 GLU C OE1 1 
ATOM   3419 O  OE2 . GLU C 1 115 ? 36.824  97.153  86.449  1.00 81.08  ? 261 GLU C OE2 1 
ATOM   3420 N  N   . GLY C 1 116 ? 36.891  95.634  92.022  1.00 63.72  ? 262 GLY C N   1 
ATOM   3421 C  CA  . GLY C 1 116 ? 36.335  95.575  93.360  1.00 59.09  ? 262 GLY C CA  1 
ATOM   3422 C  C   . GLY C 1 116 ? 35.089  94.707  93.383  1.00 52.65  ? 262 GLY C C   1 
ATOM   3423 O  O   . GLY C 1 116 ? 34.191  94.900  94.205  1.00 50.85  ? 262 GLY C O   1 
ATOM   3424 N  N   . ASP C 1 117 ? 35.021  93.752  92.462  1.00 48.46  ? 263 ASP C N   1 
ATOM   3425 C  CA  . ASP C 1 117 ? 33.912  92.813  92.454  1.00 45.53  ? 263 ASP C CA  1 
ATOM   3426 C  C   . ASP C 1 117 ? 34.067  91.839  93.602  1.00 42.84  ? 263 ASP C C   1 
ATOM   3427 O  O   . ASP C 1 117 ? 35.179  91.448  93.962  1.00 39.88  ? 263 ASP C O   1 
ATOM   3428 C  CB  . ASP C 1 117 ? 33.838  92.044  91.138  1.00 47.01  ? 263 ASP C CB  1 
ATOM   3429 C  CG  . ASP C 1 117 ? 33.280  92.881  90.006  1.00 51.50  ? 263 ASP C CG  1 
ATOM   3430 O  OD1 . ASP C 1 117 ? 32.305  93.632  90.235  1.00 53.99  ? 263 ASP C OD1 1 
ATOM   3431 O  OD2 . ASP C 1 117 ? 33.818  92.781  88.886  1.00 51.31  ? 263 ASP C OD2 1 
ATOM   3432 N  N   . TRP C 1 118 ? 32.938  91.453  94.174  1.00 39.20  ? 264 TRP C N   1 
ATOM   3433 C  CA  . TRP C 1 118 ? 32.938  90.491  95.249  1.00 34.27  ? 264 TRP C CA  1 
ATOM   3434 C  C   . TRP C 1 118 ? 33.251  89.120  94.694  1.00 32.53  ? 264 TRP C C   1 
ATOM   3435 O  O   . TRP C 1 118 ? 33.012  88.849  93.517  1.00 35.58  ? 264 TRP C O   1 
ATOM   3436 C  CB  . TRP C 1 118 ? 31.603  90.519  95.989  1.00 33.44  ? 264 TRP C CB  1 
ATOM   3437 C  CG  . TRP C 1 118 ? 31.452  91.777  96.797  1.00 33.79  ? 264 TRP C CG  1 
ATOM   3438 C  CD1 . TRP C 1 118 ? 30.781  92.907  96.435  1.00 33.06  ? 264 TRP C CD1 1 
ATOM   3439 C  CD2 . TRP C 1 118 ? 32.018  92.042  98.092  1.00 32.04  ? 264 TRP C CD2 1 
ATOM   3440 N  NE1 . TRP C 1 118 ? 30.879  93.854  97.430  1.00 35.28  ? 264 TRP C NE1 1 
ATOM   3441 C  CE2 . TRP C 1 118 ? 31.635  93.350  98.455  1.00 31.50  ? 264 TRP C CE2 1 
ATOM   3442 C  CE3 . TRP C 1 118 ? 32.807  91.298  98.979  1.00 31.57  ? 264 TRP C CE3 1 
ATOM   3443 C  CZ2 . TRP C 1 118 ? 32.009  93.931  99.670  1.00 32.65  ? 264 TRP C CZ2 1 
ATOM   3444 C  CZ3 . TRP C 1 118 ? 33.180  91.877  100.190 1.00 28.46  ? 264 TRP C CZ3 1 
ATOM   3445 C  CH2 . TRP C 1 118 ? 32.782  93.181  100.520 1.00 30.22  ? 264 TRP C CH2 1 
ATOM   3446 N  N   . SER C 1 119 ? 33.811  88.269  95.545  1.00 27.15  ? 265 SER C N   1 
ATOM   3447 C  CA  . SER C 1 119 ? 34.215  86.935  95.143  1.00 31.01  ? 265 SER C CA  1 
ATOM   3448 C  C   . SER C 1 119 ? 34.220  86.013  96.351  1.00 30.52  ? 265 SER C C   1 
ATOM   3449 O  O   . SER C 1 119 ? 34.142  86.469  97.492  1.00 29.20  ? 265 SER C O   1 
ATOM   3450 C  CB  . SER C 1 119 ? 35.613  86.973  94.531  1.00 33.72  ? 265 SER C CB  1 
ATOM   3451 O  OG  . SER C 1 119 ? 36.569  87.395  95.496  1.00 34.21  ? 265 SER C OG  1 
ATOM   3452 N  N   . TRP C 1 120 ? 34.301  84.713  96.090  1.00 29.12  ? 266 TRP C N   1 
ATOM   3453 C  CA  . TRP C 1 120 ? 34.505  83.730  97.141  1.00 28.39  ? 266 TRP C CA  1 
ATOM   3454 C  C   . TRP C 1 120 ? 35.956  83.307  97.105  1.00 29.24  ? 266 TRP C C   1 
ATOM   3455 O  O   . TRP C 1 120 ? 36.497  83.055  96.029  1.00 28.51  ? 266 TRP C O   1 
ATOM   3456 C  CB  . TRP C 1 120 ? 33.607  82.519  96.927  1.00 23.31  ? 266 TRP C CB  1 
ATOM   3457 C  CG  . TRP C 1 120 ? 32.166  82.862  97.000  1.00 25.07  ? 266 TRP C CG  1 
ATOM   3458 C  CD1 . TRP C 1 120 ? 31.250  82.789  95.988  1.00 24.39  ? 266 TRP C CD1 1 
ATOM   3459 C  CD2 . TRP C 1 120 ? 31.464  83.360  98.144  1.00 23.32  ? 266 TRP C CD2 1 
ATOM   3460 N  NE1 . TRP C 1 120 ? 30.017  83.197  96.437  1.00 23.34  ? 266 TRP C NE1 1 
ATOM   3461 C  CE2 . TRP C 1 120 ? 30.120  83.551  97.756  1.00 21.75  ? 266 TRP C CE2 1 
ATOM   3462 C  CE3 . TRP C 1 120 ? 31.836  83.646  99.462  1.00 21.06  ? 266 TRP C CE3 1 
ATOM   3463 C  CZ2 . TRP C 1 120 ? 29.152  84.016  98.635  1.00 20.42  ? 266 TRP C CZ2 1 
ATOM   3464 C  CZ3 . TRP C 1 120 ? 30.878  84.107  100.333 1.00 22.58  ? 266 TRP C CZ3 1 
ATOM   3465 C  CH2 . TRP C 1 120 ? 29.550  84.290  99.920  1.00 26.60  ? 266 TRP C CH2 1 
ATOM   3466 N  N   . VAL C 1 121 ? 36.592  83.239  98.271  1.00 26.10  ? 267 VAL C N   1 
ATOM   3467 C  CA  . VAL C 1 121 ? 38.001  82.877  98.314  1.00 25.32  ? 267 VAL C CA  1 
ATOM   3468 C  C   . VAL C 1 121 ? 38.195  81.419  97.900  1.00 30.27  ? 267 VAL C C   1 
ATOM   3469 O  O   . VAL C 1 121 ? 39.254  81.045  97.391  1.00 33.81  ? 267 VAL C O   1 
ATOM   3470 C  CB  . VAL C 1 121 ? 38.655  83.179  99.697  1.00 21.37  ? 267 VAL C CB  1 
ATOM   3471 C  CG1 . VAL C 1 121 ? 37.957  82.414  100.822 1.00 17.93  ? 267 VAL C CG1 1 
ATOM   3472 C  CG2 . VAL C 1 121 ? 40.150  82.857  99.665  1.00 20.16  ? 267 VAL C CG2 1 
ATOM   3473 N  N   . ASP C 1 122 ? 37.164  80.600  98.095  1.00 29.44  ? 268 ASP C N   1 
ATOM   3474 C  CA  . ASP C 1 122 ? 37.243  79.195  97.702  1.00 31.38  ? 268 ASP C CA  1 
ATOM   3475 C  C   . ASP C 1 122 ? 37.011  79.046  96.195  1.00 35.12  ? 268 ASP C C   1 
ATOM   3476 O  O   . ASP C 1 122 ? 36.999  77.934  95.664  1.00 31.40  ? 268 ASP C O   1 
ATOM   3477 C  CB  . ASP C 1 122 ? 36.268  78.323  98.509  1.00 32.66  ? 268 ASP C CB  1 
ATOM   3478 C  CG  . ASP C 1 122 ? 34.819  78.485  98.062  1.00 36.06  ? 268 ASP C CG  1 
ATOM   3479 O  OD1 . ASP C 1 122 ? 34.557  79.291  97.145  1.00 33.17  ? 268 ASP C OD1 1 
ATOM   3480 O  OD2 . ASP C 1 122 ? 33.938  77.801  98.630  1.00 36.02  ? 268 ASP C OD2 1 
ATOM   3481 N  N   . ASP C 1 123 ? 36.824  80.181  95.523  1.00 37.13  ? 269 ASP C N   1 
ATOM   3482 C  CA  . ASP C 1 123 ? 36.702  80.240  94.063  1.00 42.60  ? 269 ASP C CA  1 
ATOM   3483 C  C   . ASP C 1 123 ? 35.354  79.801  93.477  1.00 41.00  ? 269 ASP C C   1 
ATOM   3484 O  O   . ASP C 1 123 ? 35.260  79.526  92.282  1.00 44.25  ? 269 ASP C O   1 
ATOM   3485 C  CB  . ASP C 1 123 ? 37.856  79.498  93.381  1.00 51.70  ? 269 ASP C CB  1 
ATOM   3486 C  CG  . ASP C 1 123 ? 39.142  80.300  93.384  1.00 59.78  ? 269 ASP C CG  1 
ATOM   3487 O  OD1 . ASP C 1 123 ? 39.065  81.541  93.511  1.00 63.00  ? 269 ASP C OD1 1 
ATOM   3488 O  OD2 . ASP C 1 123 ? 40.228  79.694  93.261  1.00 61.86  ? 269 ASP C OD2 1 
ATOM   3489 N  N   . THR C 1 124 ? 34.316  79.742  94.302  1.00 35.68  ? 270 THR C N   1 
ATOM   3490 C  CA  . THR C 1 124 ? 32.966  79.605  93.775  1.00 36.01  ? 270 THR C CA  1 
ATOM   3491 C  C   . THR C 1 124 ? 32.629  80.893  93.034  1.00 35.11  ? 270 THR C C   1 
ATOM   3492 O  O   . THR C 1 124 ? 32.851  81.985  93.566  1.00 37.27  ? 270 THR C O   1 
ATOM   3493 C  CB  . THR C 1 124 ? 31.928  79.404  94.892  1.00 38.28  ? 270 THR C CB  1 
ATOM   3494 O  OG1 . THR C 1 124 ? 32.253  78.237  95.660  1.00 38.53  ? 270 THR C OG1 1 
ATOM   3495 C  CG2 . THR C 1 124 ? 30.527  79.254  94.297  1.00 37.72  ? 270 THR C CG2 1 
ATOM   3496 N  N   . PRO C 1 125 ? 32.112  80.779  91.799  1.00 31.03  ? 271 PRO C N   1 
ATOM   3497 C  CA  . PRO C 1 125 ? 31.695  81.987  91.078  1.00 26.46  ? 271 PRO C CA  1 
ATOM   3498 C  C   . PRO C 1 125 ? 30.681  82.769  91.906  1.00 27.12  ? 271 PRO C C   1 
ATOM   3499 O  O   . PRO C 1 125 ? 29.770  82.177  92.482  1.00 31.18  ? 271 PRO C O   1 
ATOM   3500 C  CB  . PRO C 1 125 ? 31.043  81.429  89.810  1.00 25.51  ? 271 PRO C CB  1 
ATOM   3501 C  CG  . PRO C 1 125 ? 31.719  80.123  89.590  1.00 25.36  ? 271 PRO C CG  1 
ATOM   3502 C  CD  . PRO C 1 125 ? 31.989  79.567  90.968  1.00 28.78  ? 271 PRO C CD  1 
ATOM   3503 N  N   . PHE C 1 126 ? 30.853  84.082  91.989  1.00 25.15  ? 272 PHE C N   1 
ATOM   3504 C  CA  . PHE C 1 126 ? 29.965  84.892  92.805  1.00 25.40  ? 272 PHE C CA  1 
ATOM   3505 C  C   . PHE C 1 126 ? 28.663  85.155  92.067  1.00 29.70  ? 272 PHE C C   1 
ATOM   3506 O  O   . PHE C 1 126 ? 28.662  85.754  90.991  1.00 31.30  ? 272 PHE C O   1 
ATOM   3507 C  CB  . PHE C 1 126 ? 30.638  86.206  93.184  1.00 26.83  ? 272 PHE C CB  1 
ATOM   3508 C  CG  . PHE C 1 126 ? 29.832  87.044  94.137  1.00 28.62  ? 272 PHE C CG  1 
ATOM   3509 C  CD1 . PHE C 1 126 ? 29.726  86.689  95.476  1.00 27.50  ? 272 PHE C CD1 1 
ATOM   3510 C  CD2 . PHE C 1 126 ? 29.194  88.196  93.700  1.00 24.44  ? 272 PHE C CD2 1 
ATOM   3511 C  CE1 . PHE C 1 126 ? 28.986  87.460  96.357  1.00 25.35  ? 272 PHE C CE1 1 
ATOM   3512 C  CE2 . PHE C 1 126 ? 28.457  88.971  94.572  1.00 23.95  ? 272 PHE C CE2 1 
ATOM   3513 C  CZ  . PHE C 1 126 ? 28.351  88.605  95.906  1.00 25.20  ? 272 PHE C CZ  1 
ATOM   3514 N  N   . ASN C 1 127 ? 27.557  84.697  92.646  1.00 34.15  ? 273 ASN C N   1 
ATOM   3515 C  CA  . ASN C 1 127 ? 26.238  84.885  92.041  1.00 36.42  ? 273 ASN C CA  1 
ATOM   3516 C  C   . ASN C 1 127 ? 25.604  86.238  92.390  1.00 35.19  ? 273 ASN C C   1 
ATOM   3517 O  O   . ASN C 1 127 ? 24.844  86.349  93.351  1.00 35.62  ? 273 ASN C O   1 
ATOM   3518 C  CB  . ASN C 1 127 ? 25.302  83.735  92.434  1.00 33.94  ? 273 ASN C CB  1 
ATOM   3519 C  CG  . ASN C 1 127 ? 24.015  83.719  91.612  1.00 30.55  ? 273 ASN C CG  1 
ATOM   3520 O  OD1 . ASN C 1 127 ? 23.579  84.747  91.093  1.00 29.17  ? 273 ASN C OD1 1 
ATOM   3521 N  ND2 . ASN C 1 127 ? 23.402  82.551  91.501  1.00 24.59  ? 273 ASN C ND2 1 
ATOM   3522 N  N   . LYS C 1 128 ? 25.921  87.257  91.596  1.00 34.61  ? 274 LYS C N   1 
ATOM   3523 C  CA  . LYS C 1 128 ? 25.391  88.607  91.787  1.00 38.72  ? 274 LYS C CA  1 
ATOM   3524 C  C   . LYS C 1 128 ? 23.860  88.614  91.897  1.00 39.56  ? 274 LYS C C   1 
ATOM   3525 O  O   . LYS C 1 128 ? 23.303  89.183  92.838  1.00 39.31  ? 274 LYS C O   1 
ATOM   3526 C  CB  . LYS C 1 128 ? 25.838  89.512  90.630  1.00 42.87  ? 274 LYS C CB  1 
ATOM   3527 C  CG  . LYS C 1 128 ? 26.323  90.907  91.023  1.00 43.36  ? 274 LYS C CG  1 
ATOM   3528 C  CD  . LYS C 1 128 ? 27.657  91.218  90.344  1.00 44.29  ? 274 LYS C CD  1 
ATOM   3529 C  CE  . LYS C 1 128 ? 28.082  92.672  90.515  1.00 45.61  ? 274 LYS C CE  1 
ATOM   3530 N  NZ  . LYS C 1 128 ? 27.322  93.608  89.631  1.00 50.25  ? 274 LYS C NZ  1 
ATOM   3531 N  N   . VAL C 1 129 ? 23.185  87.981  90.938  1.00 36.87  ? 275 VAL C N   1 
ATOM   3532 C  CA  . VAL C 1 129 ? 21.721  87.973  90.909  1.00 32.43  ? 275 VAL C CA  1 
ATOM   3533 C  C   . VAL C 1 129 ? 21.124  87.477  92.224  1.00 32.42  ? 275 VAL C C   1 
ATOM   3534 O  O   . VAL C 1 129 ? 20.288  88.148  92.830  1.00 32.40  ? 275 VAL C O   1 
ATOM   3535 C  CB  . VAL C 1 129 ? 21.166  87.120  89.741  1.00 33.33  ? 275 VAL C CB  1 
ATOM   3536 C  CG1 . VAL C 1 129 ? 19.639  87.148  89.733  1.00 32.00  ? 275 VAL C CG1 1 
ATOM   3537 C  CG2 . VAL C 1 129 ? 21.717  87.611  88.410  1.00 32.84  ? 275 VAL C CG2 1 
ATOM   3538 N  N   . GLN C 1 130 ? 21.569  86.306  92.665  1.00 33.22  ? 276 GLN C N   1 
ATOM   3539 C  CA  . GLN C 1 130 ? 20.998  85.656  93.837  1.00 37.23  ? 276 GLN C CA  1 
ATOM   3540 C  C   . GLN C 1 130 ? 21.468  86.292  95.145  1.00 37.60  ? 276 GLN C C   1 
ATOM   3541 O  O   . GLN C 1 130 ? 20.729  86.317  96.125  1.00 38.63  ? 276 GLN C O   1 
ATOM   3542 C  CB  . GLN C 1 130 ? 21.330  84.161  93.832  1.00 39.75  ? 276 GLN C CB  1 
ATOM   3543 C  CG  . GLN C 1 130 ? 20.713  83.387  94.988  1.00 45.46  ? 276 GLN C CG  1 
ATOM   3544 C  CD  . GLN C 1 130 ? 21.154  81.935  95.022  1.00 47.28  ? 276 GLN C CD  1 
ATOM   3545 O  OE1 . GLN C 1 130 ? 22.348  81.637  95.079  1.00 44.19  ? 276 GLN C OE1 1 
ATOM   3546 N  NE2 . GLN C 1 130 ? 20.186  81.022  94.989  1.00 51.07  ? 276 GLN C NE2 1 
ATOM   3547 N  N   . SER C 1 131 ? 22.695  86.806  95.150  1.00 35.47  ? 277 SER C N   1 
ATOM   3548 C  CA  . SER C 1 131 ? 23.289  87.392  96.352  1.00 36.34  ? 277 SER C CA  1 
ATOM   3549 C  C   . SER C 1 131 ? 22.542  88.617  96.846  1.00 37.87  ? 277 SER C C   1 
ATOM   3550 O  O   . SER C 1 131 ? 22.597  88.945  98.030  1.00 39.50  ? 277 SER C O   1 
ATOM   3551 C  CB  . SER C 1 131 ? 24.747  87.776  96.099  1.00 36.90  ? 277 SER C CB  1 
ATOM   3552 O  OG  . SER C 1 131 ? 25.557  86.621  96.005  1.00 43.06  ? 277 SER C OG  1 
ATOM   3553 N  N   . ALA C 1 132 ? 21.862  89.298  95.930  1.00 38.55  ? 278 ALA C N   1 
ATOM   3554 C  CA  . ALA C 1 132 ? 21.137  90.523  96.256  1.00 37.07  ? 278 ALA C CA  1 
ATOM   3555 C  C   . ALA C 1 132 ? 20.254  90.392  97.507  1.00 36.34  ? 278 ALA C C   1 
ATOM   3556 O  O   . ALA C 1 132 ? 20.139  91.330  98.294  1.00 41.90  ? 278 ALA C O   1 
ATOM   3557 C  CB  . ALA C 1 132 ? 20.314  90.980  95.058  1.00 34.64  ? 278 ALA C CB  1 
ATOM   3558 N  N   . ARG C 1 133 ? 19.649  89.223  97.692  1.00 31.54  ? 279 ARG C N   1 
ATOM   3559 C  CA  . ARG C 1 133 ? 18.766  88.983  98.824  1.00 29.88  ? 279 ARG C CA  1 
ATOM   3560 C  C   . ARG C 1 133 ? 19.530  88.641  100.104 1.00 33.41  ? 279 ARG C C   1 
ATOM   3561 O  O   . ARG C 1 133 ? 18.926  88.478  101.167 1.00 35.21  ? 279 ARG C O   1 
ATOM   3562 C  CB  . ARG C 1 133 ? 17.833  87.819  98.515  1.00 32.61  ? 279 ARG C CB  1 
ATOM   3563 C  CG  . ARG C 1 133 ? 17.247  87.810  97.117  1.00 41.45  ? 279 ARG C CG  1 
ATOM   3564 C  CD  . ARG C 1 133 ? 16.389  86.577  96.972  1.00 46.40  ? 279 ARG C CD  1 
ATOM   3565 N  NE  . ARG C 1 133 ? 15.633  86.345  98.198  1.00 45.98  ? 279 ARG C NE  1 
ATOM   3566 C  CZ  . ARG C 1 133 ? 14.973  85.227  98.471  1.00 51.90  ? 279 ARG C CZ  1 
ATOM   3567 N  NH1 . ARG C 1 133 ? 14.311  85.103  99.615  1.00 50.82  ? 279 ARG C NH1 1 
ATOM   3568 N  NH2 . ARG C 1 133 ? 14.976  84.230  97.597  1.00 58.22  ? 279 ARG C NH2 1 
ATOM   3569 N  N   . PHE C 1 134 ? 20.848  88.504  100.000 1.00 30.60  ? 280 PHE C N   1 
ATOM   3570 C  CA  . PHE C 1 134 ? 21.642  88.017  101.123 1.00 30.32  ? 280 PHE C CA  1 
ATOM   3571 C  C   . PHE C 1 134 ? 22.339  89.134  101.901 1.00 31.75  ? 280 PHE C C   1 
ATOM   3572 O  O   . PHE C 1 134 ? 22.866  88.907  102.991 1.00 33.96  ? 280 PHE C O   1 
ATOM   3573 C  CB  . PHE C 1 134 ? 22.651  86.961  100.652 1.00 32.13  ? 280 PHE C CB  1 
ATOM   3574 C  CG  . PHE C 1 134 ? 22.009  85.734  100.046 1.00 33.41  ? 280 PHE C CG  1 
ATOM   3575 C  CD1 . PHE C 1 134 ? 20.685  85.416  100.319 1.00 33.96  ? 280 PHE C CD1 1 
ATOM   3576 C  CD2 . PHE C 1 134 ? 22.729  84.899  99.209  1.00 32.37  ? 280 PHE C CD2 1 
ATOM   3577 C  CE1 . PHE C 1 134 ? 20.088  84.289  99.761  1.00 32.69  ? 280 PHE C CE1 1 
ATOM   3578 C  CE2 . PHE C 1 134 ? 22.137  83.766  98.651  1.00 30.96  ? 280 PHE C CE2 1 
ATOM   3579 C  CZ  . PHE C 1 134 ? 20.815  83.466  98.927  1.00 30.31  ? 280 PHE C CZ  1 
ATOM   3580 N  N   . TRP C 1 135 ? 22.331  90.340  101.341 1.00 33.80  ? 281 TRP C N   1 
ATOM   3581 C  CA  . TRP C 1 135 ? 22.922  91.500  102.001 1.00 35.49  ? 281 TRP C CA  1 
ATOM   3582 C  C   . TRP C 1 135 ? 21.962  92.127  103.004 1.00 37.52  ? 281 TRP C C   1 
ATOM   3583 O  O   . TRP C 1 135 ? 20.749  92.113  102.803 1.00 41.17  ? 281 TRP C O   1 
ATOM   3584 C  CB  . TRP C 1 135 ? 23.313  92.568  100.969 1.00 33.07  ? 281 TRP C CB  1 
ATOM   3585 C  CG  . TRP C 1 135 ? 24.528  92.239  100.150 1.00 30.55  ? 281 TRP C CG  1 
ATOM   3586 C  CD1 . TRP C 1 135 ? 24.555  91.842  98.849  1.00 29.14  ? 281 TRP C CD1 1 
ATOM   3587 C  CD2 . TRP C 1 135 ? 25.897  92.286  100.582 1.00 29.57  ? 281 TRP C CD2 1 
ATOM   3588 N  NE1 . TRP C 1 135 ? 25.851  91.636  98.441  1.00 29.96  ? 281 TRP C NE1 1 
ATOM   3589 C  CE2 . TRP C 1 135 ? 26.694  91.899  99.487  1.00 29.11  ? 281 TRP C CE2 1 
ATOM   3590 C  CE3 . TRP C 1 135 ? 26.522  92.610  101.788 1.00 27.53  ? 281 TRP C CE3 1 
ATOM   3591 C  CZ2 . TRP C 1 135 ? 28.081  91.830  99.561  1.00 31.04  ? 281 TRP C CZ2 1 
ATOM   3592 C  CZ3 . TRP C 1 135 ? 27.903  92.539  101.861 1.00 31.09  ? 281 TRP C CZ3 1 
ATOM   3593 C  CH2 . TRP C 1 135 ? 28.666  92.154  100.756 1.00 32.61  ? 281 TRP C CH2 1 
ATOM   3594 N  N   . ILE C 1 136 ? 22.510  92.680  104.081 1.00 35.66  ? 282 ILE C N   1 
ATOM   3595 C  CA  . ILE C 1 136 ? 21.746  93.562  104.951 1.00 33.42  ? 282 ILE C CA  1 
ATOM   3596 C  C   . ILE C 1 136 ? 21.312  94.760  104.111 1.00 36.06  ? 282 ILE C C   1 
ATOM   3597 O  O   . ILE C 1 136 ? 22.129  95.351  103.402 1.00 38.36  ? 282 ILE C O   1 
ATOM   3598 C  CB  . ILE C 1 136 ? 22.596  94.060  106.138 1.00 33.00  ? 282 ILE C CB  1 
ATOM   3599 C  CG1 . ILE C 1 136 ? 23.066  92.891  107.008 1.00 33.41  ? 282 ILE C CG1 1 
ATOM   3600 C  CG2 . ILE C 1 136 ? 21.816  95.046  106.987 1.00 32.57  ? 282 ILE C CG2 1 
ATOM   3601 C  CD1 . ILE C 1 136 ? 23.997  93.315  108.128 1.00 30.84  ? 282 ILE C CD1 1 
ATOM   3602 N  N   . PRO C 1 137 ? 20.022  95.117  104.170 1.00 35.77  ? 283 PRO C N   1 
ATOM   3603 C  CA  . PRO C 1 137 ? 19.560  96.270  103.387 1.00 38.05  ? 283 PRO C CA  1 
ATOM   3604 C  C   . PRO C 1 137 ? 20.453  97.491  103.608 1.00 39.38  ? 283 PRO C C   1 
ATOM   3605 O  O   . PRO C 1 137 ? 20.623  97.928  104.744 1.00 42.00  ? 283 PRO C O   1 
ATOM   3606 C  CB  . PRO C 1 137 ? 18.155  96.523  103.932 1.00 37.02  ? 283 PRO C CB  1 
ATOM   3607 C  CG  . PRO C 1 137 ? 17.702  95.174  104.438 1.00 35.99  ? 283 PRO C CG  1 
ATOM   3608 C  CD  . PRO C 1 137 ? 18.939  94.490  104.951 1.00 33.42  ? 283 PRO C CD  1 
ATOM   3609 N  N   . GLY C 1 138 ? 21.024  98.022  102.532 1.00 36.26  ? 284 GLY C N   1 
ATOM   3610 C  CA  . GLY C 1 138 ? 21.911  99.166  102.628 1.00 31.74  ? 284 GLY C CA  1 
ATOM   3611 C  C   . GLY C 1 138 ? 23.371  98.789  102.465 1.00 29.67  ? 284 GLY C C   1 
ATOM   3612 O  O   . GLY C 1 138 ? 24.215  99.649  102.213 1.00 29.20  ? 284 GLY C O   1 
ATOM   3613 N  N   . GLU C 1 139 ? 23.668  97.500  102.617 1.00 27.14  ? 285 GLU C N   1 
ATOM   3614 C  CA  . GLU C 1 139 ? 25.016  96.987  102.406 1.00 27.13  ? 285 GLU C CA  1 
ATOM   3615 C  C   . GLU C 1 139 ? 25.122  96.359  101.022 1.00 30.16  ? 285 GLU C C   1 
ATOM   3616 O  O   . GLU C 1 139 ? 24.114  95.931  100.453 1.00 31.35  ? 285 GLU C O   1 
ATOM   3617 C  CB  . GLU C 1 139 ? 25.353  95.932  103.457 1.00 30.52  ? 285 GLU C CB  1 
ATOM   3618 C  CG  . GLU C 1 139 ? 25.028  96.335  104.871 1.00 33.68  ? 285 GLU C CG  1 
ATOM   3619 C  CD  . GLU C 1 139 ? 25.910  97.448  105.389 1.00 39.43  ? 285 GLU C CD  1 
ATOM   3620 O  OE1 . GLU C 1 139 ? 27.046  97.621  104.891 1.00 40.11  ? 285 GLU C OE1 1 
ATOM   3621 O  OE2 . GLU C 1 139 ? 25.465  98.148  106.320 1.00 44.87  ? 285 GLU C OE2 1 
ATOM   3622 N  N   . PRO C 1 140 ? 26.347  96.297  100.473 1.00 32.13  ? 286 PRO C N   1 
ATOM   3623 C  CA  . PRO C 1 140 ? 27.571  96.815  101.091 1.00 34.33  ? 286 PRO C CA  1 
ATOM   3624 C  C   . PRO C 1 140 ? 27.665  98.319  100.898 1.00 38.49  ? 286 PRO C C   1 
ATOM   3625 O  O   . PRO C 1 140 ? 27.478  98.804  99.781  1.00 38.17  ? 286 PRO C O   1 
ATOM   3626 C  CB  . PRO C 1 140 ? 28.693  96.135  100.293 1.00 31.56  ? 286 PRO C CB  1 
ATOM   3627 C  CG  . PRO C 1 140 ? 28.018  95.229  99.308  1.00 33.55  ? 286 PRO C CG  1 
ATOM   3628 C  CD  . PRO C 1 140 ? 26.619  95.709  99.155  1.00 30.21  ? 286 PRO C CD  1 
ATOM   3629 N  N   . ASN C 1 141 ? 27.953  99.043  101.972 1.00 39.88  ? 287 ASN C N   1 
ATOM   3630 C  CA  . ASN C 1 141 ? 28.053  100.491 101.911 1.00 41.05  ? 287 ASN C CA  1 
ATOM   3631 C  C   . ASN C 1 141 ? 29.501  100.948 101.915 1.00 40.16  ? 287 ASN C C   1 
ATOM   3632 O  O   . ASN C 1 141 ? 29.781  102.146 101.903 1.00 38.58  ? 287 ASN C O   1 
ATOM   3633 C  CB  . ASN C 1 141 ? 27.311  101.124 103.084 1.00 43.61  ? 287 ASN C CB  1 
ATOM   3634 C  CG  . ASN C 1 141 ? 27.889  100.718 104.425 1.00 44.14  ? 287 ASN C CG  1 
ATOM   3635 O  OD1 . ASN C 1 141 ? 28.769  99.856  104.505 1.00 43.36  ? 287 ASN C OD1 1 
ATOM   3636 N  ND2 . ASN C 1 141 ? 27.392  101.338 105.490 1.00 43.44  ? 287 ASN C ND2 1 
ATOM   3637 N  N   . ASN C 1 142 ? 30.416  99.985  101.947 1.00 40.21  ? 288 ASN C N   1 
ATOM   3638 C  CA  . ASN C 1 142 ? 31.843  100.274 101.872 1.00 40.20  ? 288 ASN C CA  1 
ATOM   3639 C  C   . ASN C 1 142 ? 32.238  101.468 102.736 1.00 39.11  ? 288 ASN C C   1 
ATOM   3640 O  O   . ASN C 1 142 ? 32.868  102.410 102.255 1.00 39.54  ? 288 ASN C O   1 
ATOM   3641 C  CB  . ASN C 1 142 ? 32.245  100.523 100.415 1.00 40.46  ? 288 ASN C CB  1 
ATOM   3642 C  CG  . ASN C 1 142 ? 33.746  100.610 100.230 1.00 40.39  ? 288 ASN C CG  1 
ATOM   3643 O  OD1 . ASN C 1 142 ? 34.516  100.315 101.145 1.00 38.86  ? 288 ASN C OD1 1 
ATOM   3644 N  ND2 . ASN C 1 142 ? 34.170  101.016 99.039  1.00 38.63  ? 288 ASN C ND2 1 
ATOM   3645 N  N   . ALA C 1 143 ? 31.868  101.427 104.012 1.00 36.87  ? 289 ALA C N   1 
ATOM   3646 C  CA  . ALA C 1 143 ? 32.113  102.553 104.911 1.00 40.78  ? 289 ALA C CA  1 
ATOM   3647 C  C   . ALA C 1 143 ? 33.598  102.896 105.074 1.00 43.57  ? 289 ALA C C   1 
ATOM   3648 O  O   . ALA C 1 143 ? 34.431  102.020 105.307 1.00 42.48  ? 289 ALA C O   1 
ATOM   3649 C  CB  . ALA C 1 143 ? 31.462  102.309 106.267 1.00 39.79  ? 289 ALA C CB  1 
ATOM   3650 N  N   . GLY C 1 144 ? 33.914  104.184 104.953 1.00 46.24  ? 290 GLY C N   1 
ATOM   3651 C  CA  . GLY C 1 144 ? 35.279  104.665 105.084 1.00 41.84  ? 290 GLY C CA  1 
ATOM   3652 C  C   . GLY C 1 144 ? 36.100  104.307 103.862 1.00 41.17  ? 290 GLY C C   1 
ATOM   3653 O  O   . GLY C 1 144 ? 37.320  104.497 103.846 1.00 43.50  ? 290 GLY C O   1 
ATOM   3654 N  N   . ASN C 1 145 ? 35.422  103.796 102.836 1.00 38.53  ? 291 ASN C N   1 
ATOM   3655 C  CA  . ASN C 1 145 ? 36.088  103.268 101.645 1.00 39.39  ? 291 ASN C CA  1 
ATOM   3656 C  C   . ASN C 1 145 ? 37.121  102.207 102.007 1.00 34.18  ? 291 ASN C C   1 
ATOM   3657 O  O   . ASN C 1 145 ? 38.143  102.075 101.339 1.00 33.49  ? 291 ASN C O   1 
ATOM   3658 C  CB  . ASN C 1 145 ? 36.754  104.389 100.839 1.00 43.99  ? 291 ASN C CB  1 
ATOM   3659 C  CG  . ASN C 1 145 ? 35.796  105.063 99.866  1.00 48.47  ? 291 ASN C CG  1 
ATOM   3660 O  OD1 . ASN C 1 145 ? 34.950  105.868 100.263 1.00 48.44  ? 291 ASN C OD1 1 
ATOM   3661 N  ND2 . ASN C 1 145 ? 35.931  104.739 98.580  1.00 47.90  ? 291 ASN C ND2 1 
ATOM   3662 N  N   . ASN C 1 146 ? 36.842  101.454 103.067 1.00 30.98  ? 292 ASN C N   1 
ATOM   3663 C  CA  . ASN C 1 146 ? 37.803  100.498 103.602 1.00 34.13  ? 292 ASN C CA  1 
ATOM   3664 C  C   . ASN C 1 146 ? 37.146  99.178  104.008 1.00 31.42  ? 292 ASN C C   1 
ATOM   3665 O  O   . ASN C 1 146 ? 37.595  98.522  104.941 1.00 35.64  ? 292 ASN C O   1 
ATOM   3666 C  CB  . ASN C 1 146 ? 38.531  101.121 104.800 1.00 34.48  ? 292 ASN C CB  1 
ATOM   3667 C  CG  . ASN C 1 146 ? 39.688  100.271 105.301 1.00 39.31  ? 292 ASN C CG  1 
ATOM   3668 O  OD1 . ASN C 1 146 ? 40.426  99.670  104.520 1.00 41.75  ? 292 ASN C OD1 1 
ATOM   3669 N  ND2 . ASN C 1 146 ? 39.858  100.230 106.617 1.00 41.32  ? 292 ASN C ND2 1 
ATOM   3670 N  N   . GLU C 1 147 ? 36.083  98.794  103.306 1.00 28.11  ? 293 GLU C N   1 
ATOM   3671 C  CA  . GLU C 1 147 ? 35.349  97.573  103.635 1.00 28.98  ? 293 GLU C CA  1 
ATOM   3672 C  C   . GLU C 1 147 ? 35.342  96.580  102.472 1.00 31.66  ? 293 GLU C C   1 
ATOM   3673 O  O   . GLU C 1 147 ? 34.392  96.528  101.692 1.00 31.86  ? 293 GLU C O   1 
ATOM   3674 C  CB  . GLU C 1 147 ? 33.919  97.900  104.078 1.00 29.44  ? 293 GLU C CB  1 
ATOM   3675 C  CG  . GLU C 1 147 ? 33.849  98.832  105.290 1.00 27.27  ? 293 GLU C CG  1 
ATOM   3676 C  CD  . GLU C 1 147 ? 32.542  98.719  106.055 1.00 31.54  ? 293 GLU C CD  1 
ATOM   3677 O  OE1 . GLU C 1 147 ? 31.467  98.661  105.425 1.00 34.28  ? 293 GLU C OE1 1 
ATOM   3678 O  OE2 . GLU C 1 147 ? 32.591  98.681  107.300 1.00 37.03  ? 293 GLU C OE2 1 
ATOM   3679 N  N   . HIS C 1 148 ? 36.402  95.779  102.389 1.00 27.98  ? 294 HIS C N   1 
ATOM   3680 C  CA  . HIS C 1 148 ? 36.643  94.912  101.243 1.00 24.48  ? 294 HIS C CA  1 
ATOM   3681 C  C   . HIS C 1 148 ? 36.524  93.417  101.548 1.00 21.28  ? 294 HIS C C   1 
ATOM   3682 O  O   . HIS C 1 148 ? 37.005  92.589  100.783 1.00 18.24  ? 294 HIS C O   1 
ATOM   3683 C  CB  . HIS C 1 148 ? 38.024  95.209  100.662 1.00 26.86  ? 294 HIS C CB  1 
ATOM   3684 C  CG  . HIS C 1 148 ? 38.318  96.671  100.541 1.00 30.31  ? 294 HIS C CG  1 
ATOM   3685 N  ND1 . HIS C 1 148 ? 37.445  97.556  99.944  1.00 32.12  ? 294 HIS C ND1 1 
ATOM   3686 C  CD2 . HIS C 1 148 ? 39.386  97.404  100.934 1.00 33.00  ? 294 HIS C CD2 1 
ATOM   3687 C  CE1 . HIS C 1 148 ? 37.960  98.772  99.981  1.00 32.61  ? 294 HIS C CE1 1 
ATOM   3688 N  NE2 . HIS C 1 148 ? 39.138  98.707  100.575 1.00 35.11  ? 294 HIS C NE2 1 
ATOM   3689 N  N   . CYS C 1 149 ? 35.889  93.083  102.665 1.00 21.52  ? 295 CYS C N   1 
ATOM   3690 C  CA  . CYS C 1 149 ? 35.595  91.697  103.013 1.00 20.65  ? 295 CYS C CA  1 
ATOM   3691 C  C   . CYS C 1 149 ? 34.194  91.617  103.591 1.00 22.77  ? 295 CYS C C   1 
ATOM   3692 O  O   . CYS C 1 149 ? 33.623  92.629  103.995 1.00 23.83  ? 295 CYS C O   1 
ATOM   3693 C  CB  . CYS C 1 149 ? 36.603  91.151  104.027 1.00 21.63  ? 295 CYS C CB  1 
ATOM   3694 S  SG  . CYS C 1 149 ? 38.245  90.842  103.360 1.00 32.41  ? 295 CYS C SG  1 
ATOM   3695 N  N   . GLY C 1 150 ? 33.639  90.411  103.634 1.00 22.20  ? 296 GLY C N   1 
ATOM   3696 C  CA  . GLY C 1 150 ? 32.256  90.245  104.034 1.00 20.30  ? 296 GLY C CA  1 
ATOM   3697 C  C   . GLY C 1 150 ? 32.076  89.287  105.190 1.00 25.48  ? 296 GLY C C   1 
ATOM   3698 O  O   . GLY C 1 150 ? 32.770  88.269  105.294 1.00 27.52  ? 296 GLY C O   1 
ATOM   3699 N  N   . ASN C 1 151 ? 31.136  89.618  106.066 1.00 24.74  ? 297 ASN C N   1 
ATOM   3700 C  CA  . ASN C 1 151 ? 30.795  88.733  107.159 1.00 28.06  ? 297 ASN C CA  1 
ATOM   3701 C  C   . ASN C 1 151 ? 29.293  88.520  107.281 1.00 28.65  ? 297 ASN C C   1 
ATOM   3702 O  O   . ASN C 1 151 ? 28.491  89.256  106.692 1.00 28.76  ? 297 ASN C O   1 
ATOM   3703 C  CB  . ASN C 1 151 ? 31.378  89.253  108.477 1.00 30.05  ? 297 ASN C CB  1 
ATOM   3704 C  CG  . ASN C 1 151 ? 30.772  90.570  108.905 1.00 30.27  ? 297 ASN C CG  1 
ATOM   3705 O  OD1 . ASN C 1 151 ? 29.578  90.803  108.727 1.00 29.87  ? 297 ASN C OD1 1 
ATOM   3706 N  ND2 . ASN C 1 151 ? 31.593  91.436  109.492 1.00 31.32  ? 297 ASN C ND2 1 
ATOM   3707 N  N   . ILE C 1 152 ? 28.930  87.493  108.040 1.00 25.73  ? 298 ILE C N   1 
ATOM   3708 C  CA  . ILE C 1 152 ? 27.548  87.238  108.405 1.00 29.08  ? 298 ILE C CA  1 
ATOM   3709 C  C   . ILE C 1 152 ? 27.249  87.926  109.735 1.00 28.95  ? 298 ILE C C   1 
ATOM   3710 O  O   . ILE C 1 152 ? 27.934  87.700  110.733 1.00 22.76  ? 298 ILE C O   1 
ATOM   3711 C  CB  . ILE C 1 152 ? 27.275  85.728  108.496 1.00 31.06  ? 298 ILE C CB  1 
ATOM   3712 C  CG1 . ILE C 1 152 ? 27.266  85.128  107.090 1.00 33.92  ? 298 ILE C CG1 1 
ATOM   3713 C  CG2 . ILE C 1 152 ? 25.957  85.462  109.204 1.00 31.50  ? 298 ILE C CG2 1 
ATOM   3714 C  CD1 . ILE C 1 152 ? 27.110  83.624  107.060 1.00 37.30  ? 298 ILE C CD1 1 
ATOM   3715 N  N   . LYS C 1 153 ? 26.226  88.774  109.739 1.00 33.83  ? 299 LYS C N   1 
ATOM   3716 C  CA  . LYS C 1 153 ? 25.977  89.671  110.860 1.00 32.40  ? 299 LYS C CA  1 
ATOM   3717 C  C   . LYS C 1 153 ? 24.544  89.560  111.362 1.00 34.36  ? 299 LYS C C   1 
ATOM   3718 O  O   . LYS C 1 153 ? 24.306  89.147  112.496 1.00 36.54  ? 299 LYS C O   1 
ATOM   3719 C  CB  . LYS C 1 153 ? 26.285  91.116  110.443 1.00 28.99  ? 299 LYS C CB  1 
ATOM   3720 C  CG  . LYS C 1 153 ? 26.335  92.133  111.582 1.00 31.20  ? 299 LYS C CG  1 
ATOM   3721 C  CD  . LYS C 1 153 ? 26.615  93.538  111.047 1.00 31.05  ? 299 LYS C CD  1 
ATOM   3722 C  CE  . LYS C 1 153 ? 26.502  94.601  112.137 1.00 37.53  ? 299 LYS C CE  1 
ATOM   3723 N  NZ  . LYS C 1 153 ? 27.657  94.589  113.092 1.00 41.49  ? 299 LYS C NZ  1 
ATOM   3724 N  N   . ALA C 1 154 ? 23.591  89.923  110.511 1.00 34.30  ? 300 ALA C N   1 
ATOM   3725 C  CA  . ALA C 1 154 ? 22.184  89.950  110.898 1.00 31.80  ? 300 ALA C CA  1 
ATOM   3726 C  C   . ALA C 1 154 ? 21.568  88.554  110.916 1.00 32.50  ? 300 ALA C C   1 
ATOM   3727 O  O   . ALA C 1 154 ? 21.922  87.704  110.099 1.00 30.59  ? 300 ALA C O   1 
ATOM   3728 C  CB  . ALA C 1 154 ? 21.392  90.878  109.968 1.00 27.74  ? 300 ALA C CB  1 
ATOM   3729 N  N   . PRO C 1 155 ? 20.636  88.319  111.853 1.00 35.22  ? 301 PRO C N   1 
ATOM   3730 C  CA  . PRO C 1 155 ? 19.948  87.035  112.015 1.00 37.21  ? 301 PRO C CA  1 
ATOM   3731 C  C   . PRO C 1 155 ? 18.778  86.926  111.044 1.00 36.06  ? 301 PRO C C   1 
ATOM   3732 O  O   . PRO C 1 155 ? 17.644  86.687  111.455 1.00 39.14  ? 301 PRO C O   1 
ATOM   3733 C  CB  . PRO C 1 155 ? 19.408  87.099  113.454 1.00 36.00  ? 301 PRO C CB  1 
ATOM   3734 C  CG  . PRO C 1 155 ? 19.836  88.442  114.005 1.00 36.74  ? 301 PRO C CG  1 
ATOM   3735 C  CD  . PRO C 1 155 ? 20.166  89.304  112.835 1.00 34.98  ? 301 PRO C CD  1 
ATOM   3736 N  N   . SER C 1 156 ? 19.060  87.111  109.763 1.00 34.03  ? 302 SER C N   1 
ATOM   3737 C  CA  . SER C 1 156 ? 18.035  87.082  108.736 1.00 39.44  ? 302 SER C CA  1 
ATOM   3738 C  C   . SER C 1 156 ? 18.662  86.538  107.461 1.00 37.34  ? 302 SER C C   1 
ATOM   3739 O  O   . SER C 1 156 ? 19.888  86.439  107.370 1.00 34.40  ? 302 SER C O   1 
ATOM   3740 C  CB  . SER C 1 156 ? 17.490  88.500  108.512 1.00 43.93  ? 302 SER C CB  1 
ATOM   3741 O  OG  . SER C 1 156 ? 16.923  88.655  107.220 1.00 47.88  ? 302 SER C OG  1 
ATOM   3742 N  N   . LEU C 1 157 ? 17.834  86.173  106.485 1.00 35.70  ? 303 LEU C N   1 
ATOM   3743 C  CA  . LEU C 1 157 ? 18.349  85.831  105.164 1.00 37.54  ? 303 LEU C CA  1 
ATOM   3744 C  C   . LEU C 1 157 ? 19.249  86.969  104.681 1.00 37.12  ? 303 LEU C C   1 
ATOM   3745 O  O   . LEU C 1 157 ? 20.306  86.739  104.086 1.00 33.87  ? 303 LEU C O   1 
ATOM   3746 C  CB  . LEU C 1 157 ? 17.208  85.606  104.170 1.00 39.12  ? 303 LEU C CB  1 
ATOM   3747 C  CG  . LEU C 1 157 ? 17.035  84.207  103.568 1.00 42.54  ? 303 LEU C CG  1 
ATOM   3748 C  CD1 . LEU C 1 157 ? 16.830  84.314  102.062 1.00 45.88  ? 303 LEU C CD1 1 
ATOM   3749 C  CD2 . LEU C 1 157 ? 18.209  83.287  103.882 1.00 39.10  ? 303 LEU C CD2 1 
ATOM   3750 N  N   . GLN C 1 158 ? 18.814  88.199  104.938 1.00 34.37  ? 304 GLN C N   1 
ATOM   3751 C  CA  A GLN C 1 158 ? 19.614  89.371  104.618 0.50 33.50  ? 304 GLN C CA  1 
ATOM   3752 C  CA  B GLN C 1 158 ? 19.608  89.378  104.627 0.50 33.50  ? 304 GLN C CA  1 
ATOM   3753 C  C   . GLN C 1 158 ? 20.640  89.576  105.730 1.00 33.91  ? 304 GLN C C   1 
ATOM   3754 O  O   . GLN C 1 158 ? 20.437  90.375  106.645 1.00 36.72  ? 304 GLN C O   1 
ATOM   3755 C  CB  A GLN C 1 158 ? 18.717  90.600  104.428 0.50 33.22  ? 304 GLN C CB  1 
ATOM   3756 C  CB  B GLN C 1 158 ? 18.709  90.611  104.498 0.50 33.30  ? 304 GLN C CB  1 
ATOM   3757 C  CG  A GLN C 1 158 ? 17.712  90.440  103.282 0.50 33.57  ? 304 GLN C CG  1 
ATOM   3758 C  CG  B GLN C 1 158 ? 17.770  90.586  103.291 0.50 33.73  ? 304 GLN C CG  1 
ATOM   3759 C  CD  A GLN C 1 158 ? 16.926  91.707  102.986 0.50 33.99  ? 304 GLN C CD  1 
ATOM   3760 C  CD  B GLN C 1 158 ? 16.601  89.627  103.454 0.50 35.38  ? 304 GLN C CD  1 
ATOM   3761 O  OE1 A GLN C 1 158 ? 16.190  92.209  103.835 0.50 36.22  ? 304 GLN C OE1 1 
ATOM   3762 O  OE1 B GLN C 1 158 ? 15.935  89.610  104.490 0.50 37.68  ? 304 GLN C OE1 1 
ATOM   3763 N  NE2 A GLN C 1 158 ? 17.074  92.225  101.770 0.50 30.73  ? 304 GLN C NE2 1 
ATOM   3764 N  NE2 B GLN C 1 158 ? 16.340  88.831  102.421 0.50 36.02  ? 304 GLN C NE2 1 
ATOM   3765 N  N   . ALA C 1 159 ? 21.746  88.842  105.637 1.00 30.04  ? 305 ALA C N   1 
ATOM   3766 C  CA  . ALA C 1 159 ? 22.680  88.723  106.757 1.00 29.75  ? 305 ALA C CA  1 
ATOM   3767 C  C   . ALA C 1 159 ? 24.037  89.388  106.577 1.00 31.14  ? 305 ALA C C   1 
ATOM   3768 O  O   . ALA C 1 159 ? 24.677  89.751  107.563 1.00 29.07  ? 305 ALA C O   1 
ATOM   3769 C  CB  . ALA C 1 159 ? 22.878  87.256  107.102 1.00 27.26  ? 305 ALA C CB  1 
ATOM   3770 N  N   . TRP C 1 160 ? 24.478  89.546  105.331 1.00 29.68  ? 306 TRP C N   1 
ATOM   3771 C  CA  . TRP C 1 160 ? 25.852  89.969  105.074 1.00 28.81  ? 306 TRP C CA  1 
ATOM   3772 C  C   . TRP C 1 160 ? 26.132  91.449  105.341 1.00 32.02  ? 306 TRP C C   1 
ATOM   3773 O  O   . TRP C 1 160 ? 25.273  92.310  105.148 1.00 30.60  ? 306 TRP C O   1 
ATOM   3774 C  CB  . TRP C 1 160 ? 26.254  89.650  103.638 1.00 28.03  ? 306 TRP C CB  1 
ATOM   3775 C  CG  . TRP C 1 160 ? 26.149  88.210  103.256 1.00 27.65  ? 306 TRP C CG  1 
ATOM   3776 C  CD1 . TRP C 1 160 ? 25.952  87.142  104.084 1.00 26.87  ? 306 TRP C CD1 1 
ATOM   3777 C  CD2 . TRP C 1 160 ? 26.242  87.680  101.930 1.00 28.65  ? 306 TRP C CD2 1 
ATOM   3778 N  NE1 . TRP C 1 160 ? 25.912  85.976  103.351 1.00 29.49  ? 306 TRP C NE1 1 
ATOM   3779 C  CE2 . TRP C 1 160 ? 26.090  86.284  102.025 1.00 30.57  ? 306 TRP C CE2 1 
ATOM   3780 C  CE3 . TRP C 1 160 ? 26.439  88.254  100.671 1.00 30.70  ? 306 TRP C CE3 1 
ATOM   3781 C  CZ2 . TRP C 1 160 ? 26.131  85.454  100.907 1.00 33.75  ? 306 TRP C CZ2 1 
ATOM   3782 C  CZ3 . TRP C 1 160 ? 26.477  87.427  99.561  1.00 34.24  ? 306 TRP C CZ3 1 
ATOM   3783 C  CH2 . TRP C 1 160 ? 26.325  86.044  99.687  1.00 32.90  ? 306 TRP C CH2 1 
ATOM   3784 N  N   . ASN C 1 161 ? 27.351  91.735  105.782 1.00 33.91  ? 307 ASN C N   1 
ATOM   3785 C  CA  . ASN C 1 161 ? 27.834  93.106  105.860 1.00 35.18  ? 307 ASN C CA  1 
ATOM   3786 C  C   . ASN C 1 161 ? 29.254  93.167  105.336 1.00 36.15  ? 307 ASN C C   1 
ATOM   3787 O  O   . ASN C 1 161 ? 30.035  92.232  105.536 1.00 35.27  ? 307 ASN C O   1 
ATOM   3788 C  CB  . ASN C 1 161 ? 27.807  93.629  107.302 1.00 31.73  ? 307 ASN C CB  1 
ATOM   3789 C  CG  . ASN C 1 161 ? 28.387  95.038  107.425 1.00 32.55  ? 307 ASN C CG  1 
ATOM   3790 O  OD1 . ASN C 1 161 ? 28.109  95.909  106.596 1.00 34.87  ? 307 ASN C OD1 1 
ATOM   3791 N  ND2 . ASN C 1 161 ? 29.199  95.264  108.461 1.00 26.50  ? 307 ASN C ND2 1 
ATOM   3792 N  N   . ASP C 1 162 ? 29.595  94.258  104.660 1.00 33.08  ? 308 ASP C N   1 
ATOM   3793 C  CA  . ASP C 1 162 ? 30.990  94.493  104.341 1.00 29.86  ? 308 ASP C CA  1 
ATOM   3794 C  C   . ASP C 1 162 ? 31.649  95.266  105.480 1.00 31.76  ? 308 ASP C C   1 
ATOM   3795 O  O   . ASP C 1 162 ? 31.080  96.231  106.009 1.00 38.19  ? 308 ASP C O   1 
ATOM   3796 C  CB  . ASP C 1 162 ? 31.164  95.202  102.999 1.00 27.69  ? 308 ASP C CB  1 
ATOM   3797 C  CG  . ASP C 1 162 ? 30.490  96.554  102.955 1.00 31.75  ? 308 ASP C CG  1 
ATOM   3798 O  OD1 . ASP C 1 162 ? 29.599  96.807  103.784 1.00 30.86  ? 308 ASP C OD1 1 
ATOM   3799 O  OD2 . ASP C 1 162 ? 30.845  97.360  102.072 1.00 33.21  ? 308 ASP C OD2 1 
ATOM   3800 N  N   . ALA C 1 163 ? 32.839  94.805  105.855 1.00 27.20  ? 309 ALA C N   1 
ATOM   3801 C  CA  . ALA C 1 163 ? 33.611  95.355  106.959 1.00 27.05  ? 309 ALA C CA  1 
ATOM   3802 C  C   . ALA C 1 163 ? 35.095  95.312  106.599 1.00 29.41  ? 309 ALA C C   1 
ATOM   3803 O  O   . ALA C 1 163 ? 35.494  94.583  105.691 1.00 29.40  ? 309 ALA C O   1 
ATOM   3804 C  CB  . ALA C 1 163 ? 33.348  94.558  108.233 1.00 22.12  ? 309 ALA C CB  1 
ATOM   3805 N  N   . PRO C 1 164 ? 35.919  96.103  107.300 1.00 33.05  ? 310 PRO C N   1 
ATOM   3806 C  CA  . PRO C 1 164 ? 37.356  96.115  107.004 1.00 32.25  ? 310 PRO C CA  1 
ATOM   3807 C  C   . PRO C 1 164 ? 37.981  94.750  107.251 1.00 27.10  ? 310 PRO C C   1 
ATOM   3808 O  O   . PRO C 1 164 ? 37.736  94.151  108.289 1.00 29.27  ? 310 PRO C O   1 
ATOM   3809 C  CB  . PRO C 1 164 ? 37.911  97.137  107.998 1.00 30.99  ? 310 PRO C CB  1 
ATOM   3810 C  CG  . PRO C 1 164 ? 36.747  98.019  108.318 1.00 32.85  ? 310 PRO C CG  1 
ATOM   3811 C  CD  . PRO C 1 164 ? 35.551  97.114  108.304 1.00 33.80  ? 310 PRO C CD  1 
ATOM   3812 N  N   . CYS C 1 165 ? 38.785  94.287  106.300 1.00 22.11  ? 311 CYS C N   1 
ATOM   3813 C  CA  . CYS C 1 165 ? 39.420  92.977  106.356 1.00 25.33  ? 311 CYS C CA  1 
ATOM   3814 C  C   . CYS C 1 165 ? 40.356  92.786  107.549 1.00 31.56  ? 311 CYS C C   1 
ATOM   3815 O  O   . CYS C 1 165 ? 40.724  91.663  107.879 1.00 32.55  ? 311 CYS C O   1 
ATOM   3816 C  CB  . CYS C 1 165 ? 40.190  92.724  105.062 1.00 25.60  ? 311 CYS C CB  1 
ATOM   3817 S  SG  . CYS C 1 165 ? 39.113  92.662  103.599 1.00 58.63  ? 311 CYS C SG  1 
ATOM   3818 N  N   . ASP C 1 166 ? 40.736  93.881  108.194 1.00 33.58  ? 312 ASP C N   1 
ATOM   3819 C  CA  . ASP C 1 166 ? 41.703  93.817  109.280 1.00 37.83  ? 312 ASP C CA  1 
ATOM   3820 C  C   . ASP C 1 166 ? 41.030  93.743  110.647 1.00 35.72  ? 312 ASP C C   1 
ATOM   3821 O  O   . ASP C 1 166 ? 41.696  93.581  111.665 1.00 37.36  ? 312 ASP C O   1 
ATOM   3822 C  CB  . ASP C 1 166 ? 42.651  95.013  109.201 1.00 43.30  ? 312 ASP C CB  1 
ATOM   3823 C  CG  . ASP C 1 166 ? 43.338  95.111  107.855 1.00 46.01  ? 312 ASP C CG  1 
ATOM   3824 O  OD1 . ASP C 1 166 ? 43.831  94.072  107.374 1.00 48.22  ? 312 ASP C OD1 1 
ATOM   3825 O  OD2 . ASP C 1 166 ? 43.382  96.216  107.276 1.00 48.13  ? 312 ASP C OD2 1 
ATOM   3826 N  N   . LYS C 1 167 ? 39.707  93.860  110.664 1.00 36.33  ? 313 LYS C N   1 
ATOM   3827 C  CA  . LYS C 1 167 ? 38.948  93.684  111.896 1.00 38.48  ? 313 LYS C CA  1 
ATOM   3828 C  C   . LYS C 1 167 ? 38.851  92.204  112.258 1.00 34.15  ? 313 LYS C C   1 
ATOM   3829 O  O   . LYS C 1 167 ? 38.807  91.343  111.381 1.00 36.43  ? 313 LYS C O   1 
ATOM   3830 C  CB  . LYS C 1 167 ? 37.549  94.293  111.769 1.00 44.59  ? 313 LYS C CB  1 
ATOM   3831 C  CG  . LYS C 1 167 ? 37.533  95.814  111.747 1.00 54.16  ? 313 LYS C CG  1 
ATOM   3832 C  CD  . LYS C 1 167 ? 38.395  96.399  112.864 1.00 61.24  ? 313 LYS C CD  1 
ATOM   3833 C  CE  . LYS C 1 167 ? 38.114  97.886  113.063 1.00 66.42  ? 313 LYS C CE  1 
ATOM   3834 N  NZ  . LYS C 1 167 ? 38.111  98.657  111.783 1.00 66.73  ? 313 LYS C NZ  1 
ATOM   3835 N  N   . THR C 1 168 ? 38.816  91.913  113.552 1.00 31.61  ? 314 THR C N   1 
ATOM   3836 C  CA  . THR C 1 168 ? 38.791  90.534  114.012 1.00 29.10  ? 314 THR C CA  1 
ATOM   3837 C  C   . THR C 1 168 ? 37.368  90.064  114.280 1.00 28.05  ? 314 THR C C   1 
ATOM   3838 O  O   . THR C 1 168 ? 36.571  90.770  114.892 1.00 30.06  ? 314 THR C O   1 
ATOM   3839 C  CB  . THR C 1 168 ? 39.662  90.341  115.278 1.00 30.64  ? 314 THR C CB  1 
ATOM   3840 O  OG1 . THR C 1 168 ? 39.086  91.063  116.374 1.00 33.69  ? 314 THR C OG1 1 
ATOM   3841 C  CG2 . THR C 1 168 ? 41.075  90.843  115.030 1.00 26.50  ? 314 THR C CG2 1 
ATOM   3842 N  N   . PHE C 1 169 ? 37.052  88.869  113.797 1.00 28.11  ? 315 PHE C N   1 
ATOM   3843 C  CA  . PHE C 1 169 ? 35.754  88.261  114.039 1.00 27.50  ? 315 PHE C CA  1 
ATOM   3844 C  C   . PHE C 1 169 ? 35.919  86.752  114.164 1.00 26.25  ? 315 PHE C C   1 
ATOM   3845 O  O   . PHE C 1 169 ? 36.937  86.193  113.766 1.00 22.92  ? 315 PHE C O   1 
ATOM   3846 C  CB  . PHE C 1 169 ? 34.788  88.551  112.881 1.00 27.93  ? 315 PHE C CB  1 
ATOM   3847 C  CG  . PHE C 1 169 ? 34.320  89.977  112.806 1.00 32.15  ? 315 PHE C CG  1 
ATOM   3848 C  CD1 . PHE C 1 169 ? 33.392  90.468  113.711 1.00 34.66  ? 315 PHE C CD1 1 
ATOM   3849 C  CD2 . PHE C 1 169 ? 34.783  90.817  111.810 1.00 31.65  ? 315 PHE C CD2 1 
ATOM   3850 C  CE1 . PHE C 1 169 ? 32.946  91.773  113.632 1.00 34.83  ? 315 PHE C CE1 1 
ATOM   3851 C  CE2 . PHE C 1 169 ? 34.342  92.128  111.726 1.00 32.91  ? 315 PHE C CE2 1 
ATOM   3852 C  CZ  . PHE C 1 169 ? 33.423  92.605  112.636 1.00 34.85  ? 315 PHE C CZ  1 
ATOM   3853 N  N   . LEU C 1 170 ? 34.912  86.092  114.716 1.00 27.28  ? 316 LEU C N   1 
ATOM   3854 C  CA  . LEU C 1 170 ? 34.827  84.657  114.572 1.00 30.78  ? 316 LEU C CA  1 
ATOM   3855 C  C   . LEU C 1 170 ? 34.637  84.402  113.088 1.00 34.34  ? 316 LEU C C   1 
ATOM   3856 O  O   . LEU C 1 170 ? 34.212  85.290  112.356 1.00 32.66  ? 316 LEU C O   1 
ATOM   3857 C  CB  . LEU C 1 170 ? 33.645  84.113  115.351 1.00 31.14  ? 316 LEU C CB  1 
ATOM   3858 C  CG  . LEU C 1 170 ? 33.697  84.407  116.845 1.00 25.50  ? 316 LEU C CG  1 
ATOM   3859 C  CD1 . LEU C 1 170 ? 32.411  83.929  117.499 1.00 26.53  ? 316 LEU C CD1 1 
ATOM   3860 C  CD2 . LEU C 1 170 ? 34.923  83.736  117.469 1.00 25.18  ? 316 LEU C CD2 1 
ATOM   3861 N  N   . PHE C 1 171 ? 34.960  83.195  112.642 1.00 31.83  ? 317 PHE C N   1 
ATOM   3862 C  CA  . PHE C 1 171 ? 34.895  82.880  111.229 1.00 28.09  ? 317 PHE C CA  1 
ATOM   3863 C  C   . PHE C 1 171 ? 34.324  81.481  111.015 1.00 29.75  ? 317 PHE C C   1 
ATOM   3864 O  O   . PHE C 1 171 ? 34.259  80.670  111.948 1.00 30.28  ? 317 PHE C O   1 
ATOM   3865 C  CB  . PHE C 1 171 ? 36.283  82.988  110.598 1.00 26.03  ? 317 PHE C CB  1 
ATOM   3866 C  CG  . PHE C 1 171 ? 37.335  82.154  111.291 1.00 26.29  ? 317 PHE C CG  1 
ATOM   3867 C  CD1 . PHE C 1 171 ? 37.569  80.845  110.899 1.00 24.34  ? 317 PHE C CD1 1 
ATOM   3868 C  CD2 . PHE C 1 171 ? 38.093  82.685  112.328 1.00 26.55  ? 317 PHE C CD2 1 
ATOM   3869 C  CE1 . PHE C 1 171 ? 38.536  80.073  111.526 1.00 26.21  ? 317 PHE C CE1 1 
ATOM   3870 C  CE2 . PHE C 1 171 ? 39.066  81.924  112.962 1.00 27.30  ? 317 PHE C CE2 1 
ATOM   3871 C  CZ  . PHE C 1 171 ? 39.288  80.614  112.564 1.00 30.23  ? 317 PHE C CZ  1 
ATOM   3872 N  N   . ILE C 1 172 ? 33.912  81.211  109.781 1.00 23.40  ? 318 ILE C N   1 
ATOM   3873 C  CA  . ILE C 1 172 ? 33.324  79.930  109.426 1.00 25.15  ? 318 ILE C CA  1 
ATOM   3874 C  C   . ILE C 1 172 ? 34.091  79.285  108.283 1.00 26.78  ? 318 ILE C C   1 
ATOM   3875 O  O   . ILE C 1 172 ? 34.213  79.871  107.212 1.00 25.50  ? 318 ILE C O   1 
ATOM   3876 C  CB  . ILE C 1 172 ? 31.856  80.094  108.997 1.00 23.48  ? 318 ILE C CB  1 
ATOM   3877 C  CG1 . ILE C 1 172 ? 31.022  80.566  110.185 1.00 16.86  ? 318 ILE C CG1 1 
ATOM   3878 C  CG2 . ILE C 1 172 ? 31.312  78.777  108.423 1.00 22.62  ? 318 ILE C CG2 1 
ATOM   3879 C  CD1 . ILE C 1 172 ? 29.680  81.116  109.806 1.00 18.67  ? 318 ILE C CD1 1 
ATOM   3880 N  N   . CYS C 1 173 ? 34.615  78.085  108.520 1.00 26.30  ? 319 CYS C N   1 
ATOM   3881 C  CA  . CYS C 1 173 ? 35.292  77.331  107.473 1.00 24.85  ? 319 CYS C CA  1 
ATOM   3882 C  C   . CYS C 1 173 ? 34.305  76.364  106.838 1.00 28.79  ? 319 CYS C C   1 
ATOM   3883 O  O   . CYS C 1 173 ? 33.287  76.011  107.439 1.00 28.72  ? 319 CYS C O   1 
ATOM   3884 C  CB  . CYS C 1 173 ? 36.480  76.547  108.036 1.00 26.70  ? 319 CYS C CB  1 
ATOM   3885 S  SG  . CYS C 1 173 ? 37.752  77.534  108.881 1.00 35.78  ? 319 CYS C SG  1 
ATOM   3886 N  N   . LYS C 1 174 ? 34.618  75.934  105.623 1.00 28.31  ? 320 LYS C N   1 
ATOM   3887 C  CA  . LYS C 1 174 ? 33.775  75.007  104.896 1.00 26.03  ? 320 LYS C CA  1 
ATOM   3888 C  C   . LYS C 1 174 ? 34.656  74.069  104.090 1.00 26.80  ? 320 LYS C C   1 
ATOM   3889 O  O   . LYS C 1 174 ? 35.602  74.501  103.433 1.00 30.30  ? 320 LYS C O   1 
ATOM   3890 C  CB  . LYS C 1 174 ? 32.843  75.780  103.966 1.00 29.21  ? 320 LYS C CB  1 
ATOM   3891 C  CG  . LYS C 1 174 ? 32.009  74.924  103.024 1.00 31.99  ? 320 LYS C CG  1 
ATOM   3892 C  CD  . LYS C 1 174 ? 31.511  75.796  101.887 1.00 37.79  ? 320 LYS C CD  1 
ATOM   3893 C  CE  . LYS C 1 174 ? 30.263  75.246  101.242 1.00 41.28  ? 320 LYS C CE  1 
ATOM   3894 N  NZ  . LYS C 1 174 ? 29.687  76.264  100.320 1.00 39.88  ? 320 LYS C NZ  1 
ATOM   3895 N  N   . ARG C 1 175 ? 34.365  72.778  104.159 1.00 25.96  ? 321 ARG C N   1 
ATOM   3896 C  CA  . ARG C 1 175 ? 34.986  71.834  103.241 1.00 29.16  ? 321 ARG C CA  1 
ATOM   3897 C  C   . ARG C 1 175 ? 33.983  70.752  102.852 1.00 29.78  ? 321 ARG C C   1 
ATOM   3898 O  O   . ARG C 1 175 ? 33.090  70.410  103.630 1.00 30.35  ? 321 ARG C O   1 
ATOM   3899 C  CB  . ARG C 1 175 ? 36.266  71.234  103.834 1.00 29.04  ? 321 ARG C CB  1 
ATOM   3900 C  CG  . ARG C 1 175 ? 36.042  70.227  104.933 1.00 27.56  ? 321 ARG C CG  1 
ATOM   3901 C  CD  . ARG C 1 175 ? 37.352  69.900  105.630 1.00 33.29  ? 321 ARG C CD  1 
ATOM   3902 N  NE  . ARG C 1 175 ? 37.376  68.519  106.089 1.00 40.22  ? 321 ARG C NE  1 
ATOM   3903 C  CZ  . ARG C 1 175 ? 36.537  68.023  106.990 1.00 46.76  ? 321 ARG C CZ  1 
ATOM   3904 N  NH1 . ARG C 1 175 ? 35.612  68.801  107.530 1.00 55.58  ? 321 ARG C NH1 1 
ATOM   3905 N  NH2 . ARG C 1 175 ? 36.619  66.750  107.351 1.00 42.21  ? 321 ARG C NH2 1 
ATOM   3906 N  N   . PRO C 1 176 ? 34.115  70.222  101.633 1.00 31.21  ? 322 PRO C N   1 
ATOM   3907 C  CA  . PRO C 1 176 ? 33.140  69.240  101.148 1.00 32.61  ? 322 PRO C CA  1 
ATOM   3908 C  C   . PRO C 1 176 ? 33.296  67.856  101.792 1.00 32.46  ? 322 PRO C C   1 
ATOM   3909 O  O   . PRO C 1 176 ? 34.407  67.402  102.062 1.00 31.42  ? 322 PRO C O   1 
ATOM   3910 C  CB  . PRO C 1 176 ? 33.447  69.171  99.648  1.00 29.38  ? 322 PRO C CB  1 
ATOM   3911 C  CG  . PRO C 1 176 ? 34.903  69.507  99.561  1.00 29.53  ? 322 PRO C CG  1 
ATOM   3912 C  CD  . PRO C 1 176 ? 35.106  70.577  100.602 1.00 27.71  ? 322 PRO C CD  1 
ATOM   3913 N  N   . TYR C 1 177 ? 32.171  67.195  102.035 1.00 34.96  ? 323 TYR C N   1 
ATOM   3914 C  CA  . TYR C 1 177 ? 32.192  65.796  102.427 1.00 39.20  ? 323 TYR C CA  1 
ATOM   3915 C  C   . TYR C 1 177 ? 32.659  64.944  101.253 1.00 45.00  ? 323 TYR C C   1 
ATOM   3916 O  O   . TYR C 1 177 ? 32.077  64.995  100.172 1.00 45.37  ? 323 TYR C O   1 
ATOM   3917 C  CB  . TYR C 1 177 ? 30.808  65.346  102.880 1.00 37.60  ? 323 TYR C CB  1 
ATOM   3918 C  CG  . TYR C 1 177 ? 30.679  63.848  103.024 1.00 40.47  ? 323 TYR C CG  1 
ATOM   3919 C  CD1 . TYR C 1 177 ? 31.661  63.104  103.665 1.00 40.29  ? 323 TYR C CD1 1 
ATOM   3920 C  CD2 . TYR C 1 177 ? 29.572  63.176  102.523 1.00 44.44  ? 323 TYR C CD2 1 
ATOM   3921 C  CE1 . TYR C 1 177 ? 31.544  61.733  103.801 1.00 39.48  ? 323 TYR C CE1 1 
ATOM   3922 C  CE2 . TYR C 1 177 ? 29.446  61.801  102.653 1.00 42.28  ? 323 TYR C CE2 1 
ATOM   3923 C  CZ  . TYR C 1 177 ? 30.434  61.086  103.290 1.00 40.06  ? 323 TYR C CZ  1 
ATOM   3924 O  OH  . TYR C 1 177 ? 30.313  59.721  103.420 1.00 38.51  ? 323 TYR C OH  1 
ATOM   3925 N  N   . VAL C 1 178 ? 33.714  64.163  101.468 1.00 50.94  ? 324 VAL C N   1 
ATOM   3926 C  CA  . VAL C 1 178 ? 34.274  63.329  100.409 1.00 57.51  ? 324 VAL C CA  1 
ATOM   3927 C  C   . VAL C 1 178 ? 34.599  61.909  100.879 1.00 59.49  ? 324 VAL C C   1 
ATOM   3928 O  O   . VAL C 1 178 ? 35.489  61.703  101.709 1.00 60.40  ? 324 VAL C O   1 
ATOM   3929 C  CB  . VAL C 1 178 ? 35.534  63.968  99.785  1.00 60.11  ? 324 VAL C CB  1 
ATOM   3930 C  CG1 . VAL C 1 178 ? 36.521  64.370  100.868 1.00 63.41  ? 324 VAL C CG1 1 
ATOM   3931 C  CG2 . VAL C 1 178 ? 36.179  63.011  98.794  1.00 59.18  ? 324 VAL C CG2 1 
ATOM   3932 N  N   . PRO C 1 179 ? 33.862  60.924  100.349 1.00 57.73  ? 325 PRO C N   1 
ATOM   3933 C  CA  . PRO C 1 179 ? 34.100  59.504  100.625 1.00 59.34  ? 325 PRO C CA  1 
ATOM   3934 C  C   . PRO C 1 179 ? 35.418  59.022  100.016 1.00 63.77  ? 325 PRO C C   1 
ATOM   3935 O  O   . PRO C 1 179 ? 36.370  58.754  100.753 1.00 65.87  ? 325 PRO C O   1 
ATOM   3936 C  CB  . PRO C 1 179 ? 32.917  58.812  99.936  1.00 57.37  ? 325 PRO C CB  1 
ATOM   3937 C  CG  . PRO C 1 179 ? 31.877  59.876  99.780  1.00 56.08  ? 325 PRO C CG  1 
ATOM   3938 C  CD  . PRO C 1 179 ? 32.645  61.137  99.549  1.00 56.12  ? 325 PRO C CD  1 
ATOM   3939 N  N   . ALA D 1 20  ? 1.034   64.887  131.071 1.00 111.79 ? 166 ALA D N   1 
ATOM   3940 C  CA  . ALA D 1 20  ? 1.734   65.797  130.172 1.00 107.24 ? 166 ALA D CA  1 
ATOM   3941 C  C   . ALA D 1 20  ? 1.728   65.284  128.734 1.00 100.66 ? 166 ALA D C   1 
ATOM   3942 O  O   . ALA D 1 20  ? 2.780   65.158  128.110 1.00 95.78  ? 166 ALA D O   1 
ATOM   3943 C  CB  . ALA D 1 20  ? 3.162   66.023  130.650 1.00 107.71 ? 166 ALA D CB  1 
ATOM   3944 N  N   . LEU D 1 21  ? 0.536   64.992  128.217 1.00 101.74 ? 167 LEU D N   1 
ATOM   3945 C  CA  . LEU D 1 21  ? 0.374   64.521  126.841 1.00 96.11  ? 167 LEU D CA  1 
ATOM   3946 C  C   . LEU D 1 21  ? 0.599   65.660  125.862 1.00 94.16  ? 167 LEU D C   1 
ATOM   3947 O  O   . LEU D 1 21  ? 0.652   65.449  124.651 1.00 89.13  ? 167 LEU D O   1 
ATOM   3948 C  CB  . LEU D 1 21  ? -1.026  63.944  126.632 1.00 95.58  ? 167 LEU D CB  1 
ATOM   3949 C  CG  . LEU D 1 21  ? -1.148  62.659  125.810 1.00 94.25  ? 167 LEU D CG  1 
ATOM   3950 C  CD1 . LEU D 1 21  ? -2.605  62.252  125.664 1.00 94.66  ? 167 LEU D CD1 1 
ATOM   3951 C  CD2 . LEU D 1 21  ? -0.510  62.817  124.448 1.00 90.34  ? 167 LEU D CD2 1 
ATOM   3952 N  N   . ASN D 1 22  ? 0.718   66.871  126.396 1.00 99.32  ? 168 ASN D N   1 
ATOM   3953 C  CA  . ASN D 1 22  ? 1.007   68.047  125.586 1.00 98.71  ? 168 ASN D CA  1 
ATOM   3954 C  C   . ASN D 1 22  ? 2.152   67.777  124.621 1.00 94.94  ? 168 ASN D C   1 
ATOM   3955 O  O   . ASN D 1 22  ? 2.194   68.323  123.523 1.00 89.19  ? 168 ASN D O   1 
ATOM   3956 C  CB  . ASN D 1 22  ? 1.352   69.241  126.481 1.00 103.12 ? 168 ASN D CB  1 
ATOM   3957 C  CG  . ASN D 1 22  ? 0.390   70.400  126.306 1.00 104.75 ? 168 ASN D CG  1 
ATOM   3958 O  OD1 . ASN D 1 22  ? -0.240  70.845  127.265 1.00 109.66 ? 168 ASN D OD1 1 
ATOM   3959 N  ND2 . ASN D 1 22  ? 0.268   70.893  125.078 1.00 101.60 ? 168 ASN D ND2 1 
ATOM   3960 N  N   . THR D 1 23  ? 3.079   66.926  125.047 1.00 98.56  ? 169 THR D N   1 
ATOM   3961 C  CA  . THR D 1 23  ? 4.247   66.574  124.249 1.00 97.63  ? 169 THR D CA  1 
ATOM   3962 C  C   . THR D 1 23  ? 3.869   65.992  122.889 1.00 90.88  ? 169 THR D C   1 
ATOM   3963 O  O   . THR D 1 23  ? 4.511   66.285  121.881 1.00 86.88  ? 169 THR D O   1 
ATOM   3964 C  CB  . THR D 1 23  ? 5.140   65.560  124.995 1.00 104.36 ? 169 THR D CB  1 
ATOM   3965 O  OG1 . THR D 1 23  ? 4.340   64.457  125.443 1.00 109.15 ? 169 THR D OG1 1 
ATOM   3966 C  CG2 . THR D 1 23  ? 5.803   66.215  126.201 1.00 107.29 ? 169 THR D CG2 1 
ATOM   3967 N  N   . LYS D 1 24  ? 2.824   65.170  122.868 1.00 89.75  ? 170 LYS D N   1 
ATOM   3968 C  CA  . LYS D 1 24  ? 2.410   64.467  121.656 1.00 85.45  ? 170 LYS D CA  1 
ATOM   3969 C  C   . LYS D 1 24  ? 1.639   65.393  120.719 1.00 80.55  ? 170 LYS D C   1 
ATOM   3970 O  O   . LYS D 1 24  ? 1.904   65.440  119.517 1.00 74.16  ? 170 LYS D O   1 
ATOM   3971 C  CB  . LYS D 1 24  ? 1.555   63.255  122.027 1.00 90.56  ? 170 LYS D CB  1 
ATOM   3972 C  CG  . LYS D 1 24  ? 1.560   62.109  121.025 1.00 91.05  ? 170 LYS D CG  1 
ATOM   3973 C  CD  . LYS D 1 24  ? 0.843   60.895  121.617 1.00 96.72  ? 170 LYS D CD  1 
ATOM   3974 C  CE  . LYS D 1 24  ? 0.831   59.704  120.666 1.00 96.39  ? 170 LYS D CE  1 
ATOM   3975 N  NZ  . LYS D 1 24  ? 0.083   58.540  121.233 1.00 98.71  ? 170 LYS D NZ  1 
ATOM   3976 N  N   . ILE D 1 25  ? 0.683   66.128  121.278 1.00 82.97  ? 171 ILE D N   1 
ATOM   3977 C  CA  . ILE D 1 25  ? -0.088  67.103  120.512 1.00 81.28  ? 171 ILE D CA  1 
ATOM   3978 C  C   . ILE D 1 25  ? 0.799   68.237  119.994 1.00 78.76  ? 171 ILE D C   1 
ATOM   3979 O  O   . ILE D 1 25  ? 0.658   68.680  118.852 1.00 77.67  ? 171 ILE D O   1 
ATOM   3980 C  CB  . ILE D 1 25  ? -1.246  67.683  121.349 1.00 85.48  ? 171 ILE D CB  1 
ATOM   3981 C  CG1 . ILE D 1 25  ? -1.521  69.135  120.954 1.00 84.94  ? 171 ILE D CG1 1 
ATOM   3982 C  CG2 . ILE D 1 25  ? -0.926  67.595  122.833 1.00 91.59  ? 171 ILE D CG2 1 
ATOM   3983 C  CD1 . ILE D 1 25  ? -2.524  69.827  121.852 1.00 90.40  ? 171 ILE D CD1 1 
ATOM   3984 N  N   . ARG D 1 26  ? 1.712   68.697  120.845 1.00 76.18  ? 172 ARG D N   1 
ATOM   3985 C  CA  . ARG D 1 26  ? 2.688   69.716  120.478 1.00 72.98  ? 172 ARG D CA  1 
ATOM   3986 C  C   . ARG D 1 26  ? 3.510   69.299  119.266 1.00 68.57  ? 172 ARG D C   1 
ATOM   3987 O  O   . ARG D 1 26  ? 3.806   70.116  118.393 1.00 66.28  ? 172 ARG D O   1 
ATOM   3988 C  CB  . ARG D 1 26  ? 3.623   69.981  121.654 1.00 79.14  ? 172 ARG D CB  1 
ATOM   3989 C  CG  . ARG D 1 26  ? 4.934   70.644  121.286 1.00 80.14  ? 172 ARG D CG  1 
ATOM   3990 C  CD  . ARG D 1 26  ? 5.892   70.596  122.461 1.00 87.83  ? 172 ARG D CD  1 
ATOM   3991 N  NE  . ARG D 1 26  ? 5.176   70.522  123.733 1.00 94.99  ? 172 ARG D NE  1 
ATOM   3992 C  CZ  . ARG D 1 26  ? 4.536   71.545  124.291 1.00 96.89  ? 172 ARG D CZ  1 
ATOM   3993 N  NH1 . ARG D 1 26  ? 4.514   72.724  123.684 1.00 96.25  ? 172 ARG D NH1 1 
ATOM   3994 N  NH2 . ARG D 1 26  ? 3.909   71.385  125.449 1.00 98.67  ? 172 ARG D NH2 1 
ATOM   3995 N  N   . ALA D 1 27  ? 3.885   68.025  119.220 1.00 66.38  ? 173 ALA D N   1 
ATOM   3996 C  CA  . ALA D 1 27  ? 4.686   67.506  118.118 1.00 62.03  ? 173 ALA D CA  1 
ATOM   3997 C  C   . ALA D 1 27  ? 3.923   67.548  116.791 1.00 61.77  ? 173 ALA D C   1 
ATOM   3998 O  O   . ALA D 1 27  ? 4.480   67.918  115.756 1.00 58.80  ? 173 ALA D O   1 
ATOM   3999 C  CB  . ALA D 1 27  ? 5.154   66.093  118.424 1.00 59.51  ? 173 ALA D CB  1 
ATOM   4000 N  N   . LEU D 1 28  ? 2.649   67.167  116.826 1.00 64.67  ? 174 LEU D N   1 
ATOM   4001 C  CA  . LEU D 1 28  ? 1.801   67.221  115.640 1.00 64.24  ? 174 LEU D CA  1 
ATOM   4002 C  C   . LEU D 1 28  ? 1.653   68.660  115.163 1.00 66.07  ? 174 LEU D C   1 
ATOM   4003 O  O   . LEU D 1 28  ? 1.798   68.954  113.977 1.00 63.58  ? 174 LEU D O   1 
ATOM   4004 C  CB  . LEU D 1 28  ? 0.427   66.617  115.937 1.00 63.09  ? 174 LEU D CB  1 
ATOM   4005 C  CG  . LEU D 1 28  ? 0.277   65.122  115.654 1.00 60.82  ? 174 LEU D CG  1 
ATOM   4006 C  CD1 . LEU D 1 28  ? 1.627   64.413  115.675 1.00 61.27  ? 174 LEU D CD1 1 
ATOM   4007 C  CD2 . LEU D 1 28  ? -0.694  64.487  116.634 1.00 61.16  ? 174 LEU D CD2 1 
ATOM   4008 N  N   . GLN D 1 29  ? 1.362   69.548  116.105 1.00 71.67  ? 175 GLN D N   1 
ATOM   4009 C  CA  . GLN D 1 29  ? 1.271   70.975  115.834 1.00 75.51  ? 175 GLN D CA  1 
ATOM   4010 C  C   . GLN D 1 29  ? 2.481   71.444  115.026 1.00 73.11  ? 175 GLN D C   1 
ATOM   4011 O  O   . GLN D 1 29  ? 2.340   72.157  114.030 1.00 69.85  ? 175 GLN D O   1 
ATOM   4012 C  CB  . GLN D 1 29  ? 1.175   71.740  117.158 1.00 83.46  ? 175 GLN D CB  1 
ATOM   4013 C  CG  . GLN D 1 29  ? 1.019   73.247  117.033 1.00 87.15  ? 175 GLN D CG  1 
ATOM   4014 C  CD  . GLN D 1 29  ? 0.759   73.913  118.377 1.00 93.20  ? 175 GLN D CD  1 
ATOM   4015 O  OE1 . GLN D 1 29  ? 0.232   73.290  119.301 1.00 95.47  ? 175 GLN D OE1 1 
ATOM   4016 N  NE2 . GLN D 1 29  ? 1.124   75.187  118.489 1.00 94.61  ? 175 GLN D NE2 1 
ATOM   4017 N  N   . GLY D 1 30  ? 3.667   71.020  115.452 1.00 73.99  ? 176 GLY D N   1 
ATOM   4018 C  CA  . GLY D 1 30  ? 4.905   71.426  114.815 1.00 72.46  ? 176 GLY D CA  1 
ATOM   4019 C  C   . GLY D 1 30  ? 5.103   70.852  113.426 1.00 72.00  ? 176 GLY D C   1 
ATOM   4020 O  O   . GLY D 1 30  ? 5.319   71.593  112.467 1.00 69.61  ? 176 GLY D O   1 
ATOM   4021 N  N   . SER D 1 31  ? 5.032   69.530  113.310 1.00 72.97  ? 177 SER D N   1 
ATOM   4022 C  CA  . SER D 1 31  ? 5.322   68.869  112.042 1.00 70.72  ? 177 SER D CA  1 
ATOM   4023 C  C   . SER D 1 31  ? 4.285   69.184  110.961 1.00 69.51  ? 177 SER D C   1 
ATOM   4024 O  O   . SER D 1 31  ? 4.504   68.897  109.783 1.00 66.72  ? 177 SER D O   1 
ATOM   4025 C  CB  . SER D 1 31  ? 5.477   67.357  112.231 1.00 71.88  ? 177 SER D CB  1 
ATOM   4026 O  OG  . SER D 1 31  ? 4.277   66.774  112.697 1.00 74.96  ? 177 SER D OG  1 
ATOM   4027 N  N   . LEU D 1 32  ? 3.163   69.777  111.362 1.00 69.14  ? 178 LEU D N   1 
ATOM   4028 C  CA  . LEU D 1 32  ? 2.189   70.283  110.401 1.00 65.17  ? 178 LEU D CA  1 
ATOM   4029 C  C   . LEU D 1 32  ? 2.672   71.611  109.831 1.00 67.16  ? 178 LEU D C   1 
ATOM   4030 O  O   . LEU D 1 32  ? 2.466   71.907  108.654 1.00 66.04  ? 178 LEU D O   1 
ATOM   4031 C  CB  . LEU D 1 32  ? 0.820   70.470  111.052 1.00 64.51  ? 178 LEU D CB  1 
ATOM   4032 C  CG  . LEU D 1 32  ? -0.235  71.103  110.143 1.00 63.11  ? 178 LEU D CG  1 
ATOM   4033 C  CD1 . LEU D 1 32  ? -0.526  70.187  108.972 1.00 61.59  ? 178 LEU D CD1 1 
ATOM   4034 C  CD2 . LEU D 1 32  ? -1.510  71.408  110.906 1.00 65.83  ? 178 LEU D CD2 1 
ATOM   4035 N  N   . GLU D 1 33  ? 3.314   72.409  110.677 1.00 71.75  ? 179 GLU D N   1 
ATOM   4036 C  CA  . GLU D 1 33  ? 3.885   73.681  110.255 1.00 73.87  ? 179 GLU D CA  1 
ATOM   4037 C  C   . GLU D 1 33  ? 4.966   73.467  109.201 1.00 68.72  ? 179 GLU D C   1 
ATOM   4038 O  O   . GLU D 1 33  ? 5.073   74.234  108.245 1.00 67.38  ? 179 GLU D O   1 
ATOM   4039 C  CB  . GLU D 1 33  ? 4.460   74.439  111.455 1.00 81.40  ? 179 GLU D CB  1 
ATOM   4040 C  CG  . GLU D 1 33  ? 5.193   75.719  111.086 1.00 87.13  ? 179 GLU D CG  1 
ATOM   4041 C  CD  . GLU D 1 33  ? 5.748   76.445  112.295 1.00 94.95  ? 179 GLU D CD  1 
ATOM   4042 O  OE1 . GLU D 1 33  ? 5.435   76.035  113.433 1.00 98.85  ? 179 GLU D OE1 1 
ATOM   4043 O  OE2 . GLU D 1 33  ? 6.497   77.428  112.105 1.00 96.91  ? 179 GLU D OE2 1 
ATOM   4044 N  N   . ASN D 1 34  ? 5.764   72.419  109.379 1.00 66.06  ? 180 ASN D N   1 
ATOM   4045 C  CA  . ASN D 1 34  ? 6.823   72.104  108.429 1.00 64.75  ? 180 ASN D CA  1 
ATOM   4046 C  C   . ASN D 1 34  ? 6.287   71.514  107.132 1.00 62.32  ? 180 ASN D C   1 
ATOM   4047 O  O   . ASN D 1 34  ? 6.853   71.740  106.065 1.00 61.71  ? 180 ASN D O   1 
ATOM   4048 C  CB  . ASN D 1 34  ? 7.864   71.183  109.062 1.00 68.47  ? 180 ASN D CB  1 
ATOM   4049 C  CG  . ASN D 1 34  ? 8.671   71.884  110.137 1.00 76.87  ? 180 ASN D CG  1 
ATOM   4050 O  OD1 . ASN D 1 34  ? 8.997   73.068  110.011 1.00 78.89  ? 180 ASN D OD1 1 
ATOM   4051 N  ND2 . ASN D 1 34  ? 8.994   71.159  111.205 1.00 79.79  ? 180 ASN D ND2 1 
ATOM   4052 N  N   . MET D 1 35  ? 5.195   70.760  107.230 1.00 61.30  ? 181 MET D N   1 
ATOM   4053 C  CA  . MET D 1 35  ? 4.508   70.255  106.047 1.00 58.86  ? 181 MET D CA  1 
ATOM   4054 C  C   . MET D 1 35  ? 4.057   71.425  105.181 1.00 55.10  ? 181 MET D C   1 
ATOM   4055 O  O   . MET D 1 35  ? 4.108   71.360  103.956 1.00 50.14  ? 181 MET D O   1 
ATOM   4056 C  CB  . MET D 1 35  ? 3.293   69.413  106.441 1.00 62.22  ? 181 MET D CB  1 
ATOM   4057 C  CG  . MET D 1 35  ? 3.609   68.077  107.095 1.00 63.68  ? 181 MET D CG  1 
ATOM   4058 S  SD  . MET D 1 35  ? 3.653   66.691  105.941 1.00 94.89  ? 181 MET D SD  1 
ATOM   4059 C  CE  . MET D 1 35  ? 5.361   66.748  105.405 1.00 97.50  ? 181 MET D CE  1 
ATOM   4060 N  N   . SER D 1 36  ? 3.615   72.496  105.831 1.00 58.65  ? 182 SER D N   1 
ATOM   4061 C  CA  . SER D 1 36  ? 3.207   73.706  105.128 1.00 61.22  ? 182 SER D CA  1 
ATOM   4062 C  C   . SER D 1 36  ? 4.388   74.420  104.471 1.00 59.55  ? 182 SER D C   1 
ATOM   4063 O  O   . SER D 1 36  ? 4.253   74.960  103.372 1.00 56.54  ? 182 SER D O   1 
ATOM   4064 C  CB  . SER D 1 36  ? 2.470   74.657  106.073 1.00 64.78  ? 182 SER D CB  1 
ATOM   4065 O  OG  . SER D 1 36  ? 1.217   74.115  106.456 1.00 64.81  ? 182 SER D OG  1 
ATOM   4066 N  N   . LYS D 1 37  ? 5.538   74.428  105.144 1.00 58.94  ? 183 LYS D N   1 
ATOM   4067 C  CA  . LYS D 1 37  ? 6.749   74.996  104.560 1.00 58.21  ? 183 LYS D CA  1 
ATOM   4068 C  C   . LYS D 1 37  ? 7.021   74.298  103.234 1.00 54.15  ? 183 LYS D C   1 
ATOM   4069 O  O   . LYS D 1 37  ? 7.191   74.945  102.198 1.00 51.51  ? 183 LYS D O   1 
ATOM   4070 C  CB  . LYS D 1 37  ? 7.962   74.799  105.475 1.00 62.03  ? 183 LYS D CB  1 
ATOM   4071 C  CG  . LYS D 1 37  ? 7.721   75.042  106.957 1.00 68.59  ? 183 LYS D CG  1 
ATOM   4072 C  CD  . LYS D 1 37  ? 7.924   76.497  107.361 1.00 70.34  ? 183 LYS D CD  1 
ATOM   4073 C  CE  . LYS D 1 37  ? 7.913   76.634  108.885 1.00 71.51  ? 183 LYS D CE  1 
ATOM   4074 N  NZ  . LYS D 1 37  ? 8.008   78.046  109.354 1.00 70.82  ? 183 LYS D NZ  1 
ATOM   4075 N  N   . LEU D 1 38  ? 7.055   72.968  103.284 1.00 50.98  ? 184 LEU D N   1 
ATOM   4076 C  CA  . LEU D 1 38  ? 7.410   72.147  102.130 1.00 46.89  ? 184 LEU D CA  1 
ATOM   4077 C  C   . LEU D 1 38  ? 6.351   72.188  101.035 1.00 41.45  ? 184 LEU D C   1 
ATOM   4078 O  O   . LEU D 1 38  ? 6.670   72.067  99.855  1.00 39.42  ? 184 LEU D O   1 
ATOM   4079 C  CB  . LEU D 1 38  ? 7.650   70.699  102.561 1.00 45.43  ? 184 LEU D CB  1 
ATOM   4080 C  CG  . LEU D 1 38  ? 8.744   70.491  103.607 1.00 51.42  ? 184 LEU D CG  1 
ATOM   4081 C  CD1 . LEU D 1 38  ? 8.648   69.102  104.237 1.00 51.02  ? 184 LEU D CD1 1 
ATOM   4082 C  CD2 . LEU D 1 38  ? 10.121  70.731  103.002 1.00 51.27  ? 184 LEU D CD2 1 
ATOM   4083 N  N   . LEU D 1 39  ? 5.094   72.351  101.432 1.00 41.13  ? 185 LEU D N   1 
ATOM   4084 C  CA  . LEU D 1 39  ? 3.996   72.420  100.478 1.00 43.63  ? 185 LEU D CA  1 
ATOM   4085 C  C   . LEU D 1 39  ? 4.049   73.730  99.709  1.00 45.29  ? 185 LEU D C   1 
ATOM   4086 O  O   . LEU D 1 39  ? 3.949   73.743  98.483  1.00 44.51  ? 185 LEU D O   1 
ATOM   4087 C  CB  . LEU D 1 39  ? 2.652   72.299  101.192 1.00 47.10  ? 185 LEU D CB  1 
ATOM   4088 C  CG  . LEU D 1 39  ? 1.471   71.966  100.281 1.00 50.44  ? 185 LEU D CG  1 
ATOM   4089 C  CD1 . LEU D 1 39  ? 1.606   70.548  99.749  1.00 49.39  ? 185 LEU D CD1 1 
ATOM   4090 C  CD2 . LEU D 1 39  ? 0.151   72.135  101.014 1.00 53.02  ? 185 LEU D CD2 1 
ATOM   4091 N  N   . LYS D 1 40  ? 4.195   74.830  100.442 1.00 48.88  ? 186 LYS D N   1 
ATOM   4092 C  CA  . LYS D 1 40  ? 4.307   76.149  99.836  1.00 52.92  ? 186 LYS D CA  1 
ATOM   4093 C  C   . LYS D 1 40  ? 5.417   76.130  98.803  1.00 52.85  ? 186 LYS D C   1 
ATOM   4094 O  O   . LYS D 1 40  ? 5.230   76.564  97.664  1.00 53.77  ? 186 LYS D O   1 
ATOM   4095 C  CB  . LYS D 1 40  ? 4.613   77.209  100.895 1.00 58.37  ? 186 LYS D CB  1 
ATOM   4096 C  CG  . LYS D 1 40  ? 5.103   78.531  100.318 1.00 64.12  ? 186 LYS D CG  1 
ATOM   4097 C  CD  . LYS D 1 40  ? 5.738   79.410  101.385 1.00 69.95  ? 186 LYS D CD  1 
ATOM   4098 C  CE  . LYS D 1 40  ? 5.079   80.782  101.430 1.00 73.98  ? 186 LYS D CE  1 
ATOM   4099 N  NZ  . LYS D 1 40  ? 5.745   81.700  102.398 1.00 76.26  ? 186 LYS D NZ  1 
ATOM   4100 N  N   . ARG D 1 41  ? 6.572   75.615  99.210  1.00 48.91  ? 187 ARG D N   1 
ATOM   4101 C  CA  . ARG D 1 41  ? 7.726   75.537  98.327  1.00 46.91  ? 187 ARG D CA  1 
ATOM   4102 C  C   . ARG D 1 41  ? 7.464   74.633  97.125  1.00 42.77  ? 187 ARG D C   1 
ATOM   4103 O  O   . ARG D 1 41  ? 7.882   74.931  96.010  1.00 42.79  ? 187 ARG D O   1 
ATOM   4104 C  CB  . ARG D 1 41  ? 8.956   75.050  99.091  1.00 47.28  ? 187 ARG D CB  1 
ATOM   4105 C  CG  . ARG D 1 41  ? 10.156  74.809  98.202  1.00 50.01  ? 187 ARG D CG  1 
ATOM   4106 C  CD  . ARG D 1 41  ? 11.424  74.597  99.012  1.00 57.04  ? 187 ARG D CD  1 
ATOM   4107 N  NE  . ARG D 1 41  ? 12.600  74.599  98.148  1.00 60.49  ? 187 ARG D NE  1 
ATOM   4108 C  CZ  . ARG D 1 41  ? 12.977  73.562  97.408  1.00 62.99  ? 187 ARG D CZ  1 
ATOM   4109 N  NH1 . ARG D 1 41  ? 12.271  72.440  97.431  1.00 62.44  ? 187 ARG D NH1 1 
ATOM   4110 N  NH2 . ARG D 1 41  ? 14.059  73.644  96.645  1.00 64.57  ? 187 ARG D NH2 1 
ATOM   4111 N  N   . GLN D 1 42  ? 6.772   73.526  97.349  1.00 41.20  ? 188 GLN D N   1 
ATOM   4112 C  CA  . GLN D 1 42  ? 6.486   72.604  96.258  1.00 40.47  ? 188 GLN D CA  1 
ATOM   4113 C  C   . GLN D 1 42  ? 5.506   73.227  95.267  1.00 36.34  ? 188 GLN D C   1 
ATOM   4114 O  O   . GLN D 1 42  ? 5.638   73.054  94.059  1.00 36.08  ? 188 GLN D O   1 
ATOM   4115 C  CB  . GLN D 1 42  ? 5.940   71.280  96.790  1.00 41.28  ? 188 GLN D CB  1 
ATOM   4116 C  CG  . GLN D 1 42  ? 6.039   70.146  95.792  1.00 47.58  ? 188 GLN D CG  1 
ATOM   4117 C  CD  . GLN D 1 42  ? 5.430   68.859  96.307  1.00 53.26  ? 188 GLN D CD  1 
ATOM   4118 O  OE1 . GLN D 1 42  ? 6.099   68.060  96.963  1.00 54.70  ? 188 GLN D OE1 1 
ATOM   4119 N  NE2 . GLN D 1 42  ? 4.151   68.651  96.011  1.00 53.95  ? 188 GLN D NE2 1 
ATOM   4120 N  N   . ASN D 1 43  ? 4.522   73.955  95.780  1.00 32.02  ? 189 ASN D N   1 
ATOM   4121 C  CA  . ASN D 1 43  ? 3.557   74.606  94.913  1.00 31.46  ? 189 ASN D CA  1 
ATOM   4122 C  C   . ASN D 1 43  ? 4.201   75.747  94.134  1.00 31.68  ? 189 ASN D C   1 
ATOM   4123 O  O   . ASN D 1 43  ? 3.867   75.981  92.976  1.00 32.35  ? 189 ASN D O   1 
ATOM   4124 C  CB  . ASN D 1 43  ? 2.367   75.117  95.718  1.00 37.71  ? 189 ASN D CB  1 
ATOM   4125 C  CG  . ASN D 1 43  ? 1.310   75.748  94.845  1.00 44.06  ? 189 ASN D CG  1 
ATOM   4126 O  OD1 . ASN D 1 43  ? 0.771   75.106  93.942  1.00 47.26  ? 189 ASN D OD1 1 
ATOM   4127 N  ND2 . ASN D 1 43  ? 1.010   77.016  95.103  1.00 45.10  ? 189 ASN D ND2 1 
ATOM   4128 N  N   . ASP D 1 44  ? 5.128   76.453  94.776  1.00 33.50  ? 190 ASP D N   1 
ATOM   4129 C  CA  . ASP D 1 44  ? 5.886   77.507  94.109  1.00 36.92  ? 190 ASP D CA  1 
ATOM   4130 C  C   . ASP D 1 44  ? 6.540   76.952  92.846  1.00 35.83  ? 190 ASP D C   1 
ATOM   4131 O  O   . ASP D 1 44  ? 6.408   77.515  91.764  1.00 37.00  ? 190 ASP D O   1 
ATOM   4132 C  CB  . ASP D 1 44  ? 6.967   78.082  95.036  1.00 36.81  ? 190 ASP D CB  1 
ATOM   4133 C  CG  . ASP D 1 44  ? 6.412   79.072  96.053  1.00 43.32  ? 190 ASP D CG  1 
ATOM   4134 O  OD1 . ASP D 1 44  ? 5.190   79.332  96.029  1.00 47.02  ? 190 ASP D OD1 1 
ATOM   4135 O  OD2 . ASP D 1 44  ? 7.201   79.596  96.876  1.00 43.04  ? 190 ASP D OD2 1 
ATOM   4136 N  N   . ILE D 1 45  ? 7.245   75.839  93.002  1.00 31.49  ? 191 ILE D N   1 
ATOM   4137 C  CA  . ILE D 1 45  ? 7.986   75.236  91.905  1.00 29.50  ? 191 ILE D CA  1 
ATOM   4138 C  C   . ILE D 1 45  ? 7.063   74.608  90.864  1.00 30.87  ? 191 ILE D C   1 
ATOM   4139 O  O   . ILE D 1 45  ? 7.320   74.695  89.666  1.00 33.31  ? 191 ILE D O   1 
ATOM   4140 C  CB  . ILE D 1 45  ? 8.960   74.181  92.431  1.00 27.07  ? 191 ILE D CB  1 
ATOM   4141 C  CG1 . ILE D 1 45  ? 9.992   74.843  93.350  1.00 28.71  ? 191 ILE D CG1 1 
ATOM   4142 C  CG2 . ILE D 1 45  ? 9.631   73.446  91.281  1.00 24.72  ? 191 ILE D CG2 1 
ATOM   4143 C  CD1 . ILE D 1 45  ? 10.715  73.862  94.246  1.00 28.72  ? 191 ILE D CD1 1 
ATOM   4144 N  N   . LEU D 1 46  ? 5.991   73.975  91.328  1.00 29.13  ? 192 LEU D N   1 
ATOM   4145 C  CA  . LEU D 1 46  ? 5.035   73.344  90.429  1.00 32.00  ? 192 LEU D CA  1 
ATOM   4146 C  C   . LEU D 1 46  ? 4.356   74.376  89.530  1.00 34.69  ? 192 LEU D C   1 
ATOM   4147 O  O   . LEU D 1 46  ? 4.190   74.150  88.333  1.00 32.24  ? 192 LEU D O   1 
ATOM   4148 C  CB  . LEU D 1 46  ? 3.984   72.549  91.212  1.00 28.93  ? 192 LEU D CB  1 
ATOM   4149 C  CG  . LEU D 1 46  ? 2.937   71.851  90.339  1.00 31.88  ? 192 LEU D CG  1 
ATOM   4150 C  CD1 . LEU D 1 46  ? 3.597   70.833  89.417  1.00 32.60  ? 192 LEU D CD1 1 
ATOM   4151 C  CD2 . LEU D 1 46  ? 1.852   71.194  91.178  1.00 33.16  ? 192 LEU D CD2 1 
ATOM   4152 N  N   . GLN D 1 47  ? 3.974   75.510  90.107  1.00 39.48  ? 193 GLN D N   1 
ATOM   4153 C  CA  . GLN D 1 47  ? 3.305   76.564  89.347  1.00 43.64  ? 193 GLN D CA  1 
ATOM   4154 C  C   . GLN D 1 47  ? 4.170   77.093  88.199  1.00 39.89  ? 193 GLN D C   1 
ATOM   4155 O  O   . GLN D 1 47  ? 3.652   77.493  87.155  1.00 41.13  ? 193 GLN D O   1 
ATOM   4156 C  CB  . GLN D 1 47  ? 2.871   77.705  90.272  1.00 49.63  ? 193 GLN D CB  1 
ATOM   4157 C  CG  . GLN D 1 47  ? 1.761   77.328  91.249  1.00 57.87  ? 193 GLN D CG  1 
ATOM   4158 C  CD  . GLN D 1 47  ? 0.469   76.928  90.550  1.00 67.05  ? 193 GLN D CD  1 
ATOM   4159 O  OE1 . GLN D 1 47  ? -0.481  77.711  90.480  1.00 70.99  ? 193 GLN D OE1 1 
ATOM   4160 N  NE2 . GLN D 1 47  ? 0.428   75.706  90.028  1.00 68.00  ? 193 GLN D NE2 1 
ATOM   4161 N  N   . VAL D 1 48  ? 5.486   77.082  88.391  1.00 31.31  ? 194 VAL D N   1 
ATOM   4162 C  CA  . VAL D 1 48  ? 6.411   77.526  87.355  1.00 27.62  ? 194 VAL D CA  1 
ATOM   4163 C  C   . VAL D 1 48  ? 6.664   76.431  86.317  1.00 25.46  ? 194 VAL D C   1 
ATOM   4164 O  O   . VAL D 1 48  ? 6.659   76.680  85.110  1.00 23.48  ? 194 VAL D O   1 
ATOM   4165 C  CB  . VAL D 1 48  ? 7.748   77.990  87.963  1.00 29.41  ? 194 VAL D CB  1 
ATOM   4166 C  CG1 . VAL D 1 48  ? 8.823   78.089  86.892  1.00 23.34  ? 194 VAL D CG1 1 
ATOM   4167 C  CG2 . VAL D 1 48  ? 7.560   79.322  88.693  1.00 30.53  ? 194 VAL D CG2 1 
ATOM   4168 N  N   . VAL D 1 49  ? 6.884   75.213  86.789  1.00 24.72  ? 195 VAL D N   1 
ATOM   4169 C  CA  . VAL D 1 49  ? 7.080   74.088  85.886  1.00 27.61  ? 195 VAL D CA  1 
ATOM   4170 C  C   . VAL D 1 49  ? 5.803   73.826  85.073  1.00 30.18  ? 195 VAL D C   1 
ATOM   4171 O  O   . VAL D 1 49  ? 5.856   73.285  83.971  1.00 34.17  ? 195 VAL D O   1 
ATOM   4172 C  CB  . VAL D 1 49  ? 7.510   72.825  86.653  1.00 27.26  ? 195 VAL D CB  1 
ATOM   4173 C  CG1 . VAL D 1 49  ? 7.660   71.661  85.700  1.00 32.33  ? 195 VAL D CG1 1 
ATOM   4174 C  CG2 . VAL D 1 49  ? 8.822   73.079  87.407  1.00 20.31  ? 195 VAL D CG2 1 
ATOM   4175 N  N   . SER D 1 50  ? 4.660   74.235  85.615  1.00 27.74  ? 196 SER D N   1 
ATOM   4176 C  CA  . SER D 1 50  ? 3.383   74.091  84.921  1.00 30.53  ? 196 SER D CA  1 
ATOM   4177 C  C   . SER D 1 50  ? 3.221   75.116  83.802  1.00 33.54  ? 196 SER D C   1 
ATOM   4178 O  O   . SER D 1 50  ? 2.256   75.066  83.045  1.00 33.55  ? 196 SER D O   1 
ATOM   4179 C  CB  . SER D 1 50  ? 2.219   74.237  85.900  1.00 30.60  ? 196 SER D CB  1 
ATOM   4180 O  OG  . SER D 1 50  ? 2.140   73.120  86.761  1.00 32.13  ? 196 SER D OG  1 
ATOM   4181 N  N   . GLN D 1 51  ? 4.159   76.051  83.711  1.00 32.50  ? 197 GLN D N   1 
ATOM   4182 C  CA  . GLN D 1 51  ? 4.074   77.101  82.709  1.00 38.92  ? 197 GLN D CA  1 
ATOM   4183 C  C   . GLN D 1 51  ? 5.216   77.011  81.709  1.00 40.62  ? 197 GLN D C   1 
ATOM   4184 O  O   . GLN D 1 51  ? 5.545   77.991  81.039  1.00 43.59  ? 197 GLN D O   1 
ATOM   4185 C  CB  . GLN D 1 51  ? 4.008   78.483  83.370  1.00 44.40  ? 197 GLN D CB  1 
ATOM   4186 C  CG  . GLN D 1 51  ? 2.643   78.783  83.994  1.00 49.22  ? 197 GLN D CG  1 
ATOM   4187 C  CD  . GLN D 1 51  ? 2.690   79.872  85.053  1.00 53.89  ? 197 GLN D CD  1 
ATOM   4188 O  OE1 . GLN D 1 51  ? 3.760   80.365  85.411  1.00 58.04  ? 197 GLN D OE1 1 
ATOM   4189 N  NE2 . GLN D 1 51  ? 1.523   80.245  85.567  1.00 54.19  ? 197 GLN D NE2 1 
ATOM   4190 N  N   . GLY D 1 52  ? 5.812   75.825  81.617  1.00 39.63  ? 198 GLY D N   1 
ATOM   4191 C  CA  . GLY D 1 52  ? 6.813   75.537  80.605  1.00 40.61  ? 198 GLY D CA  1 
ATOM   4192 C  C   . GLY D 1 52  ? 8.260   75.762  81.003  1.00 40.60  ? 198 GLY D C   1 
ATOM   4193 O  O   . GLY D 1 52  ? 9.155   75.620  80.173  1.00 40.92  ? 198 GLY D O   1 
ATOM   4194 N  N   . TRP D 1 53  ? 8.499   76.117  82.262  1.00 29.79  ? 199 TRP D N   1 
ATOM   4195 C  CA  . TRP D 1 53  ? 9.862   76.329  82.744  1.00 27.21  ? 199 TRP D CA  1 
ATOM   4196 C  C   . TRP D 1 53  ? 10.393  75.078  83.422  1.00 29.05  ? 199 TRP D C   1 
ATOM   4197 O  O   . TRP D 1 53  ? 9.633   74.201  83.816  1.00 33.10  ? 199 TRP D O   1 
ATOM   4198 C  CB  . TRP D 1 53  ? 9.923   77.514  83.718  1.00 24.74  ? 199 TRP D CB  1 
ATOM   4199 C  CG  . TRP D 1 53  ? 9.817   78.856  83.051  1.00 29.70  ? 199 TRP D CG  1 
ATOM   4200 C  CD1 . TRP D 1 53  ? 8.764   79.330  82.320  1.00 32.38  ? 199 TRP D CD1 1 
ATOM   4201 C  CD2 . TRP D 1 53  ? 10.801  79.898  83.057  1.00 27.96  ? 199 TRP D CD2 1 
ATOM   4202 N  NE1 . TRP D 1 53  ? 9.035   80.598  81.867  1.00 31.69  ? 199 TRP D NE1 1 
ATOM   4203 C  CE2 . TRP D 1 53  ? 10.278  80.970  82.308  1.00 29.15  ? 199 TRP D CE2 1 
ATOM   4204 C  CE3 . TRP D 1 53  ? 12.074  80.027  83.622  1.00 27.09  ? 199 TRP D CE3 1 
ATOM   4205 C  CZ2 . TRP D 1 53  ? 10.981  82.155  82.112  1.00 28.70  ? 199 TRP D CZ2 1 
ATOM   4206 C  CZ3 . TRP D 1 53  ? 12.769  81.204  83.426  1.00 29.61  ? 199 TRP D CZ3 1 
ATOM   4207 C  CH2 . TRP D 1 53  ? 12.223  82.252  82.677  1.00 28.22  ? 199 TRP D CH2 1 
ATOM   4208 N  N   . LYS D 1 54  ? 11.707  75.000  83.558  1.00 32.76  ? 200 LYS D N   1 
ATOM   4209 C  CA  . LYS D 1 54  ? 12.330  73.893  84.264  1.00 29.83  ? 200 LYS D CA  1 
ATOM   4210 C  C   . LYS D 1 54  ? 12.896  74.352  85.603  1.00 33.56  ? 200 LYS D C   1 
ATOM   4211 O  O   . LYS D 1 54  ? 12.950  75.553  85.887  1.00 33.60  ? 200 LYS D O   1 
ATOM   4212 C  CB  . LYS D 1 54  ? 13.396  73.239  83.390  1.00 27.39  ? 200 LYS D CB  1 
ATOM   4213 C  CG  . LYS D 1 54  ? 12.785  72.338  82.320  1.00 27.20  ? 200 LYS D CG  1 
ATOM   4214 C  CD  . LYS D 1 54  ? 13.652  72.198  81.095  1.00 25.49  ? 200 LYS D CD  1 
ATOM   4215 C  CE  . LYS D 1 54  ? 12.853  71.572  79.967  1.00 30.43  ? 200 LYS D CE  1 
ATOM   4216 N  NZ  . LYS D 1 54  ? 11.629  72.360  79.626  1.00 32.05  ? 200 LYS D NZ  1 
ATOM   4217 N  N   . TYR D 1 55  ? 13.285  73.391  86.435  1.00 33.47  ? 201 TYR D N   1 
ATOM   4218 C  CA  . TYR D 1 55  ? 13.817  73.700  87.754  1.00 32.27  ? 201 TYR D CA  1 
ATOM   4219 C  C   . TYR D 1 55  ? 15.008  72.833  88.128  1.00 33.39  ? 201 TYR D C   1 
ATOM   4220 O  O   . TYR D 1 55  ? 15.002  71.618  87.919  1.00 35.75  ? 201 TYR D O   1 
ATOM   4221 C  CB  . TYR D 1 55  ? 12.748  73.551  88.832  1.00 33.96  ? 201 TYR D CB  1 
ATOM   4222 C  CG  . TYR D 1 55  ? 13.313  73.748  90.217  1.00 36.20  ? 201 TYR D CG  1 
ATOM   4223 C  CD1 . TYR D 1 55  ? 13.589  75.022  90.695  1.00 38.63  ? 201 TYR D CD1 1 
ATOM   4224 C  CD2 . TYR D 1 55  ? 13.597  72.663  91.037  1.00 36.32  ? 201 TYR D CD2 1 
ATOM   4225 C  CE1 . TYR D 1 55  ? 14.116  75.215  91.952  1.00 37.78  ? 201 TYR D CE1 1 
ATOM   4226 C  CE2 . TYR D 1 55  ? 14.127  72.846  92.299  1.00 37.18  ? 201 TYR D CE2 1 
ATOM   4227 C  CZ  . TYR D 1 55  ? 14.384  74.126  92.752  1.00 39.40  ? 201 TYR D CZ  1 
ATOM   4228 O  OH  . TYR D 1 55  ? 14.912  74.323  94.010  1.00 42.30  ? 201 TYR D OH  1 
ATOM   4229 N  N   . PHE D 1 56  ? 16.023  73.465  88.702  1.00 29.81  ? 202 PHE D N   1 
ATOM   4230 C  CA  . PHE D 1 56  ? 17.196  72.744  89.167  1.00 28.94  ? 202 PHE D CA  1 
ATOM   4231 C  C   . PHE D 1 56  ? 17.916  73.537  90.244  1.00 29.93  ? 202 PHE D C   1 
ATOM   4232 O  O   . PHE D 1 56  ? 18.226  74.715  90.053  1.00 27.27  ? 202 PHE D O   1 
ATOM   4233 C  CB  . PHE D 1 56  ? 18.142  72.455  88.005  1.00 25.82  ? 202 PHE D CB  1 
ATOM   4234 C  CG  . PHE D 1 56  ? 19.382  71.696  88.398  1.00 30.55  ? 202 PHE D CG  1 
ATOM   4235 C  CD1 . PHE D 1 56  ? 19.337  70.323  88.599  1.00 32.92  ? 202 PHE D CD1 1 
ATOM   4236 C  CD2 . PHE D 1 56  ? 20.596  72.351  88.551  1.00 29.81  ? 202 PHE D CD2 1 
ATOM   4237 C  CE1 . PHE D 1 56  ? 20.476  69.622  88.952  1.00 32.98  ? 202 PHE D CE1 1 
ATOM   4238 C  CE2 . PHE D 1 56  ? 21.738  71.655  88.907  1.00 28.98  ? 202 PHE D CE2 1 
ATOM   4239 C  CZ  . PHE D 1 56  ? 21.679  70.291  89.106  1.00 33.04  ? 202 PHE D CZ  1 
ATOM   4240 N  N   . LYS D 1 57  ? 18.155  72.884  91.379  1.00 33.19  ? 203 LYS D N   1 
ATOM   4241 C  CA  . LYS D 1 57  ? 18.979  73.428  92.457  1.00 33.86  ? 203 LYS D CA  1 
ATOM   4242 C  C   . LYS D 1 57  ? 18.746  74.903  92.772  1.00 31.13  ? 203 LYS D C   1 
ATOM   4243 O  O   . LYS D 1 57  ? 19.681  75.703  92.732  1.00 31.27  ? 203 LYS D O   1 
ATOM   4244 C  CB  . LYS D 1 57  ? 20.466  73.202  92.156  1.00 38.27  ? 203 LYS D CB  1 
ATOM   4245 C  CG  . LYS D 1 57  ? 21.002  71.833  92.574  1.00 42.81  ? 203 LYS D CG  1 
ATOM   4246 C  CD  . LYS D 1 57  ? 22.531  71.829  92.563  1.00 48.86  ? 203 LYS D CD  1 
ATOM   4247 C  CE  . LYS D 1 57  ? 23.095  70.575  93.216  1.00 56.45  ? 203 LYS D CE  1 
ATOM   4248 N  NZ  . LYS D 1 57  ? 24.568  70.674  93.420  1.00 59.97  ? 203 LYS D NZ  1 
ATOM   4249 N  N   . GLY D 1 58  ? 17.506  75.261  93.089  1.00 27.89  ? 204 GLY D N   1 
ATOM   4250 C  CA  . GLY D 1 58  ? 17.200  76.613  93.523  1.00 25.52  ? 204 GLY D CA  1 
ATOM   4251 C  C   . GLY D 1 58  ? 17.096  77.643  92.413  1.00 30.82  ? 204 GLY D C   1 
ATOM   4252 O  O   . GLY D 1 58  ? 17.016  78.843  92.684  1.00 32.43  ? 204 GLY D O   1 
ATOM   4253 N  N   . ASN D 1 59  ? 17.096  77.184  91.163  1.00 29.71  ? 205 ASN D N   1 
ATOM   4254 C  CA  . ASN D 1 59  ? 16.974  78.088  90.025  1.00 29.40  ? 205 ASN D CA  1 
ATOM   4255 C  C   . ASN D 1 59  ? 15.959  77.618  88.984  1.00 29.91  ? 205 ASN D C   1 
ATOM   4256 O  O   . ASN D 1 59  ? 15.779  76.416  88.767  1.00 27.68  ? 205 ASN D O   1 
ATOM   4257 C  CB  . ASN D 1 59  ? 18.335  78.306  89.363  1.00 30.68  ? 205 ASN D CB  1 
ATOM   4258 C  CG  . ASN D 1 59  ? 19.257  79.181  90.195  1.00 34.27  ? 205 ASN D CG  1 
ATOM   4259 O  OD1 . ASN D 1 59  ? 19.050  80.390  90.308  1.00 33.13  ? 205 ASN D OD1 1 
ATOM   4260 N  ND2 . ASN D 1 59  ? 20.283  78.571  90.778  1.00 33.88  ? 205 ASN D ND2 1 
ATOM   4261 N  N   . PHE D 1 60  ? 15.295  78.575  88.346  1.00 27.72  ? 206 PHE D N   1 
ATOM   4262 C  CA  . PHE D 1 60  ? 14.392  78.264  87.247  1.00 25.33  ? 206 PHE D CA  1 
ATOM   4263 C  C   . PHE D 1 60  ? 15.096  78.474  85.917  1.00 25.32  ? 206 PHE D C   1 
ATOM   4264 O  O   . PHE D 1 60  ? 15.917  79.377  85.783  1.00 29.43  ? 206 PHE D O   1 
ATOM   4265 C  CB  . PHE D 1 60  ? 13.141  79.127  87.312  1.00 26.41  ? 206 PHE D CB  1 
ATOM   4266 C  CG  . PHE D 1 60  ? 12.234  78.789  88.455  1.00 28.55  ? 206 PHE D CG  1 
ATOM   4267 C  CD1 . PHE D 1 60  ? 11.767  77.494  88.620  1.00 27.44  ? 206 PHE D CD1 1 
ATOM   4268 C  CD2 . PHE D 1 60  ? 11.839  79.766  89.360  1.00 28.45  ? 206 PHE D CD2 1 
ATOM   4269 C  CE1 . PHE D 1 60  ? 10.921  77.173  89.673  1.00 25.37  ? 206 PHE D CE1 1 
ATOM   4270 C  CE2 . PHE D 1 60  ? 10.994  79.452  90.411  1.00 29.79  ? 206 PHE D CE2 1 
ATOM   4271 C  CZ  . PHE D 1 60  ? 10.535  78.146  90.567  1.00 23.84  ? 206 PHE D CZ  1 
ATOM   4272 N  N   . TYR D 1 61  ? 14.793  77.626  84.940  1.00 22.67  ? 207 TYR D N   1 
ATOM   4273 C  CA  . TYR D 1 61  ? 15.404  77.752  83.625  1.00 23.53  ? 207 TYR D CA  1 
ATOM   4274 C  C   . TYR D 1 61  ? 14.342  77.646  82.541  1.00 29.51  ? 207 TYR D C   1 
ATOM   4275 O  O   . TYR D 1 61  ? 13.422  76.834  82.640  1.00 28.82  ? 207 TYR D O   1 
ATOM   4276 C  CB  . TYR D 1 61  ? 16.445  76.660  83.400  1.00 20.02  ? 207 TYR D CB  1 
ATOM   4277 C  CG  . TYR D 1 61  ? 17.611  76.655  84.365  1.00 22.23  ? 207 TYR D CG  1 
ATOM   4278 C  CD1 . TYR D 1 61  ? 18.822  77.237  84.023  1.00 23.27  ? 207 TYR D CD1 1 
ATOM   4279 C  CD2 . TYR D 1 61  ? 17.504  76.046  85.608  1.00 19.65  ? 207 TYR D CD2 1 
ATOM   4280 C  CE1 . TYR D 1 61  ? 19.895  77.220  84.898  1.00 27.27  ? 207 TYR D CE1 1 
ATOM   4281 C  CE2 . TYR D 1 61  ? 18.563  76.022  86.485  1.00 23.04  ? 207 TYR D CE2 1 
ATOM   4282 C  CZ  . TYR D 1 61  ? 19.757  76.612  86.131  1.00 27.59  ? 207 TYR D CZ  1 
ATOM   4283 O  OH  . TYR D 1 61  ? 20.817  76.588  87.011  1.00 23.89  ? 207 TYR D OH  1 
ATOM   4284 N  N   . TYR D 1 62  ? 14.478  78.470  81.509  1.00 28.34  ? 208 TYR D N   1 
ATOM   4285 C  CA  . TYR D 1 62  ? 13.603  78.402  80.346  1.00 28.61  ? 208 TYR D CA  1 
ATOM   4286 C  C   . TYR D 1 62  ? 14.414  77.971  79.136  1.00 24.55  ? 208 TYR D C   1 
ATOM   4287 O  O   . TYR D 1 62  ? 15.380  78.636  78.764  1.00 28.90  ? 208 TYR D O   1 
ATOM   4288 C  CB  . TYR D 1 62  ? 12.963  79.769  80.083  1.00 32.83  ? 208 TYR D CB  1 
ATOM   4289 C  CG  . TYR D 1 62  ? 12.015  79.790  78.906  1.00 30.97  ? 208 TYR D CG  1 
ATOM   4290 C  CD1 . TYR D 1 62  ? 10.748  79.230  79.002  1.00 32.66  ? 208 TYR D CD1 1 
ATOM   4291 C  CD2 . TYR D 1 62  ? 12.383  80.378  77.700  1.00 31.94  ? 208 TYR D CD2 1 
ATOM   4292 C  CE1 . TYR D 1 62  ? 9.874   79.244  77.929  1.00 36.32  ? 208 TYR D CE1 1 
ATOM   4293 C  CE2 . TYR D 1 62  ? 11.513  80.396  76.618  1.00 33.90  ? 208 TYR D CE2 1 
ATOM   4294 C  CZ  . TYR D 1 62  ? 10.261  79.827  76.739  1.00 35.52  ? 208 TYR D CZ  1 
ATOM   4295 O  OH  . TYR D 1 62  ? 9.392   79.841  75.673  1.00 33.93  ? 208 TYR D OH  1 
ATOM   4296 N  N   . PHE D 1 63  ? 14.039  76.845  78.537  1.00 21.84  ? 209 PHE D N   1 
ATOM   4297 C  CA  . PHE D 1 63  ? 14.646  76.409  77.284  1.00 24.09  ? 209 PHE D CA  1 
ATOM   4298 C  C   . PHE D 1 63  ? 13.734  76.820  76.131  1.00 23.21  ? 209 PHE D C   1 
ATOM   4299 O  O   . PHE D 1 63  ? 12.612  76.330  76.011  1.00 23.78  ? 209 PHE D O   1 
ATOM   4300 C  CB  . PHE D 1 63  ? 14.892  74.900  77.293  1.00 21.59  ? 209 PHE D CB  1 
ATOM   4301 C  CG  . PHE D 1 63  ? 15.986  74.477  78.235  1.00 22.74  ? 209 PHE D CG  1 
ATOM   4302 C  CD1 . PHE D 1 63  ? 17.150  73.895  77.756  1.00 21.25  ? 209 PHE D CD1 1 
ATOM   4303 C  CD2 . PHE D 1 63  ? 15.857  74.677  79.601  1.00 24.22  ? 209 PHE D CD2 1 
ATOM   4304 C  CE1 . PHE D 1 63  ? 18.162  73.514  78.626  1.00 22.79  ? 209 PHE D CE1 1 
ATOM   4305 C  CE2 . PHE D 1 63  ? 16.864  74.295  80.476  1.00 23.71  ? 209 PHE D CE2 1 
ATOM   4306 C  CZ  . PHE D 1 63  ? 18.018  73.717  79.988  1.00 21.76  ? 209 PHE D CZ  1 
ATOM   4307 N  N   . SER D 1 64  ? 14.214  77.737  75.298  1.00 24.07  ? 210 SER D N   1 
ATOM   4308 C  CA  . SER D 1 64  ? 13.349  78.409  74.333  1.00 24.00  ? 210 SER D CA  1 
ATOM   4309 C  C   . SER D 1 64  ? 12.820  77.466  73.257  1.00 25.44  ? 210 SER D C   1 
ATOM   4310 O  O   . SER D 1 64  ? 13.438  76.446  72.952  1.00 25.88  ? 210 SER D O   1 
ATOM   4311 C  CB  . SER D 1 64  ? 14.068  79.604  73.698  1.00 22.23  ? 210 SER D CB  1 
ATOM   4312 O  OG  . SER D 1 64  ? 14.886  79.205  72.609  1.00 22.60  ? 210 SER D OG  1 
ATOM   4313 N  N   . LEU D 1 65  ? 11.667  77.810  72.689  1.00 28.65  ? 211 LEU D N   1 
ATOM   4314 C  CA  . LEU D 1 65  ? 11.095  77.029  71.593  1.00 26.52  ? 211 LEU D CA  1 
ATOM   4315 C  C   . LEU D 1 65  ? 11.386  77.704  70.259  1.00 30.29  ? 211 LEU D C   1 
ATOM   4316 O  O   . LEU D 1 65  ? 11.250  77.097  69.201  1.00 35.06  ? 211 LEU D O   1 
ATOM   4317 C  CB  . LEU D 1 65  ? 9.589   76.875  71.771  1.00 23.78  ? 211 LEU D CB  1 
ATOM   4318 C  CG  . LEU D 1 65  ? 9.117   76.319  73.110  1.00 29.12  ? 211 LEU D CG  1 
ATOM   4319 C  CD1 . LEU D 1 65  ? 7.601   76.325  73.146  1.00 28.55  ? 211 LEU D CD1 1 
ATOM   4320 C  CD2 . LEU D 1 65  ? 9.673   74.908  73.354  1.00 27.79  ? 211 LEU D CD2 1 
ATOM   4321 N  N   . ILE D 1 66  ? 11.775  78.973  70.320  1.00 29.70  ? 212 ILE D N   1 
ATOM   4322 C  CA  . ILE D 1 66  ? 12.094  79.738  69.125  1.00 25.76  ? 212 ILE D CA  1 
ATOM   4323 C  C   . ILE D 1 66  ? 13.542  80.213  69.181  1.00 25.50  ? 212 ILE D C   1 
ATOM   4324 O  O   . ILE D 1 66  ? 14.043  80.558  70.247  1.00 27.48  ? 212 ILE D O   1 
ATOM   4325 C  CB  . ILE D 1 66  ? 11.158  80.951  68.973  1.00 27.28  ? 212 ILE D CB  1 
ATOM   4326 C  CG1 . ILE D 1 66  ? 11.103  81.417  67.522  1.00 29.98  ? 212 ILE D CG1 1 
ATOM   4327 C  CG2 . ILE D 1 66  ? 11.593  82.096  69.868  1.00 25.30  ? 212 ILE D CG2 1 
ATOM   4328 C  CD1 . ILE D 1 66  ? 10.308  82.691  67.343  1.00 37.35  ? 212 ILE D CD1 1 
ATOM   4329 N  N   . PRO D 1 67  ? 14.227  80.217  68.029  1.00 27.26  ? 213 PRO D N   1 
ATOM   4330 C  CA  . PRO D 1 67  ? 15.620  80.674  67.991  1.00 26.78  ? 213 PRO D CA  1 
ATOM   4331 C  C   . PRO D 1 67  ? 15.717  82.194  67.856  1.00 30.12  ? 213 PRO D C   1 
ATOM   4332 O  O   . PRO D 1 67  ? 14.892  82.818  67.183  1.00 29.23  ? 213 PRO D O   1 
ATOM   4333 C  CB  . PRO D 1 67  ? 16.182  80.005  66.728  1.00 25.11  ? 213 PRO D CB  1 
ATOM   4334 C  CG  . PRO D 1 67  ? 15.052  79.126  66.180  1.00 28.82  ? 213 PRO D CG  1 
ATOM   4335 C  CD  . PRO D 1 67  ? 13.789  79.680  66.731  1.00 26.29  ? 213 PRO D CD  1 
ATOM   4336 N  N   . LYS D 1 68  ? 16.717  82.780  68.505  1.00 29.24  ? 214 LYS D N   1 
ATOM   4337 C  CA  . LYS D 1 68  ? 16.945  84.219  68.433  1.00 26.69  ? 214 LYS D CA  1 
ATOM   4338 C  C   . LYS D 1 68  ? 18.436  84.494  68.384  1.00 24.99  ? 214 LYS D C   1 
ATOM   4339 O  O   . LYS D 1 68  ? 19.250  83.636  68.743  1.00 26.50  ? 214 LYS D O   1 
ATOM   4340 C  CB  . LYS D 1 68  ? 16.327  84.932  69.639  1.00 24.51  ? 214 LYS D CB  1 
ATOM   4341 C  CG  . LYS D 1 68  ? 14.802  84.972  69.640  1.00 24.93  ? 214 LYS D CG  1 
ATOM   4342 C  CD  . LYS D 1 68  ? 14.272  85.704  70.868  1.00 24.85  ? 214 LYS D CD  1 
ATOM   4343 C  CE  . LYS D 1 68  ? 12.750  85.681  70.936  1.00 25.09  ? 214 LYS D CE  1 
ATOM   4344 N  NZ  . LYS D 1 68  ? 12.138  86.525  69.873  1.00 33.21  ? 214 LYS D NZ  1 
ATOM   4345 N  N   . THR D 1 69  ? 18.793  85.685  67.920  1.00 23.80  ? 215 THR D N   1 
ATOM   4346 C  CA  . THR D 1 69  ? 20.167  86.140  68.002  1.00 22.82  ? 215 THR D CA  1 
ATOM   4347 C  C   . THR D 1 69  ? 20.493  86.204  69.476  1.00 19.18  ? 215 THR D C   1 
ATOM   4348 O  O   . THR D 1 69  ? 19.592  86.185  70.310  1.00 22.27  ? 215 THR D O   1 
ATOM   4349 C  CB  . THR D 1 69  ? 20.337  87.533  67.394  1.00 28.86  ? 215 THR D CB  1 
ATOM   4350 O  OG1 . THR D 1 69  ? 19.472  88.453  68.069  1.00 32.84  ? 215 THR D OG1 1 
ATOM   4351 C  CG2 . THR D 1 69  ? 19.997  87.511  65.910  1.00 27.87  ? 215 THR D CG2 1 
ATOM   4352 N  N   . TRP D 1 70  ? 21.772  86.266  69.810  1.00 17.80  ? 216 TRP D N   1 
ATOM   4353 C  CA  . TRP D 1 70  ? 22.147  86.261  71.214  1.00 20.90  ? 216 TRP D CA  1 
ATOM   4354 C  C   . TRP D 1 70  ? 21.531  87.479  71.901  1.00 22.17  ? 216 TRP D C   1 
ATOM   4355 O  O   . TRP D 1 70  ? 20.994  87.379  73.004  1.00 23.97  ? 216 TRP D O   1 
ATOM   4356 C  CB  . TRP D 1 70  ? 23.668  86.243  71.364  1.00 19.27  ? 216 TRP D CB  1 
ATOM   4357 C  CG  . TRP D 1 70  ? 24.129  86.079  72.768  1.00 26.89  ? 216 TRP D CG  1 
ATOM   4358 C  CD1 . TRP D 1 70  ? 24.489  84.913  73.386  1.00 27.36  ? 216 TRP D CD1 1 
ATOM   4359 C  CD2 . TRP D 1 70  ? 24.292  87.116  73.742  1.00 29.30  ? 216 TRP D CD2 1 
ATOM   4360 N  NE1 . TRP D 1 70  ? 24.865  85.164  74.684  1.00 27.45  ? 216 TRP D NE1 1 
ATOM   4361 C  CE2 . TRP D 1 70  ? 24.752  86.508  74.927  1.00 30.41  ? 216 TRP D CE2 1 
ATOM   4362 C  CE3 . TRP D 1 70  ? 24.092  88.501  73.727  1.00 31.07  ? 216 TRP D CE3 1 
ATOM   4363 C  CZ2 . TRP D 1 70  ? 25.018  87.236  76.084  1.00 31.40  ? 216 TRP D CZ2 1 
ATOM   4364 C  CZ3 . TRP D 1 70  ? 24.355  89.223  74.878  1.00 32.03  ? 216 TRP D CZ3 1 
ATOM   4365 C  CH2 . TRP D 1 70  ? 24.814  88.589  76.040  1.00 30.82  ? 216 TRP D CH2 1 
ATOM   4366 N  N   . TYR D 1 71  ? 21.582  88.618  71.219  1.00 23.34  ? 217 TYR D N   1 
ATOM   4367 C  CA  A TYR D 1 71  ? 21.084  89.873  71.769  0.50 28.41  ? 217 TYR D CA  1 
ATOM   4368 C  CA  B TYR D 1 71  ? 21.083  89.872  71.772  0.50 28.40  ? 217 TYR D CA  1 
ATOM   4369 C  C   . TYR D 1 71  ? 19.571  89.850  71.996  1.00 28.41  ? 217 TYR D C   1 
ATOM   4370 O  O   . TYR D 1 71  ? 19.090  90.249  73.057  1.00 29.71  ? 217 TYR D O   1 
ATOM   4371 C  CB  A TYR D 1 71  ? 21.472  91.047  70.865  0.50 31.62  ? 217 TYR D CB  1 
ATOM   4372 C  CB  B TYR D 1 71  ? 21.481  91.052  70.878  0.50 31.61  ? 217 TYR D CB  1 
ATOM   4373 C  CG  A TYR D 1 71  ? 21.102  92.400  71.428  0.50 36.22  ? 217 TYR D CG  1 
ATOM   4374 C  CG  B TYR D 1 71  ? 22.977  91.207  70.714  0.50 32.79  ? 217 TYR D CG  1 
ATOM   4375 C  CD1 A TYR D 1 71  ? 21.909  93.027  72.370  0.50 40.00  ? 217 TYR D CD1 1 
ATOM   4376 C  CD1 B TYR D 1 71  ? 23.746  91.805  71.707  0.50 33.36  ? 217 TYR D CD1 1 
ATOM   4377 C  CD2 A TYR D 1 71  ? 19.948  93.052  71.017  0.50 39.97  ? 217 TYR D CD2 1 
ATOM   4378 C  CD2 B TYR D 1 71  ? 23.621  90.755  69.570  0.50 34.65  ? 217 TYR D CD2 1 
ATOM   4379 C  CE1 A TYR D 1 71  ? 21.575  94.261  72.888  0.50 42.31  ? 217 TYR D CE1 1 
ATOM   4380 C  CE1 B TYR D 1 71  ? 25.112  91.945  71.567  0.50 34.06  ? 217 TYR D CE1 1 
ATOM   4381 C  CE2 A TYR D 1 71  ? 19.607  94.288  71.528  0.50 42.93  ? 217 TYR D CE2 1 
ATOM   4382 C  CE2 B TYR D 1 71  ? 24.990  90.895  69.420  0.50 36.30  ? 217 TYR D CE2 1 
ATOM   4383 C  CZ  A TYR D 1 71  ? 20.423  94.888  72.463  0.50 44.92  ? 217 TYR D CZ  1 
ATOM   4384 C  CZ  B TYR D 1 71  ? 25.730  91.490  70.422  0.50 36.49  ? 217 TYR D CZ  1 
ATOM   4385 O  OH  A TYR D 1 71  ? 20.085  96.120  72.974  0.50 49.32  ? 217 TYR D OH  1 
ATOM   4386 O  OH  B TYR D 1 71  ? 27.093  91.631  70.278  0.50 39.01  ? 217 TYR D OH  1 
ATOM   4387 N  N   . SER D 1 72  ? 18.820  89.385  71.002  1.00 25.84  ? 218 SER D N   1 
ATOM   4388 C  CA  . SER D 1 72  ? 17.367  89.292  71.158  1.00 27.95  ? 218 SER D CA  1 
ATOM   4389 C  C   . SER D 1 72  ? 17.016  88.278  72.237  1.00 25.39  ? 218 SER D C   1 
ATOM   4390 O  O   . SER D 1 72  ? 16.024  88.433  72.949  1.00 28.62  ? 218 SER D O   1 
ATOM   4391 C  CB  . SER D 1 72  ? 16.688  88.879  69.853  1.00 29.41  ? 218 SER D CB  1 
ATOM   4392 O  OG  . SER D 1 72  ? 16.998  89.789  68.825  1.00 41.07  ? 218 SER D OG  1 
ATOM   4393 N  N   . ALA D 1 73  ? 17.825  87.229  72.344  1.00 19.90  ? 219 ALA D N   1 
ATOM   4394 C  CA  . ALA D 1 73  ? 17.605  86.209  73.364  1.00 20.86  ? 219 ALA D CA  1 
ATOM   4395 C  C   . ALA D 1 73  ? 17.764  86.807  74.769  1.00 20.17  ? 219 ALA D C   1 
ATOM   4396 O  O   . ALA D 1 73  ? 16.904  86.625  75.630  1.00 21.50  ? 219 ALA D O   1 
ATOM   4397 C  CB  . ALA D 1 73  ? 18.543  85.015  73.153  1.00 18.41  ? 219 ALA D CB  1 
ATOM   4398 N  N   . GLU D 1 74  ? 18.843  87.549  74.995  1.00 21.78  ? 220 GLU D N   1 
ATOM   4399 C  CA  . GLU D 1 74  ? 19.010  88.221  76.279  1.00 25.07  ? 220 GLU D CA  1 
ATOM   4400 C  C   . GLU D 1 74  ? 17.838  89.150  76.568  1.00 25.29  ? 220 GLU D C   1 
ATOM   4401 O  O   . GLU D 1 74  ? 17.349  89.207  77.695  1.00 26.81  ? 220 GLU D O   1 
ATOM   4402 C  CB  . GLU D 1 74  ? 20.325  88.998  76.341  1.00 28.57  ? 220 GLU D CB  1 
ATOM   4403 C  CG  . GLU D 1 74  ? 20.459  89.884  77.580  1.00 31.38  ? 220 GLU D CG  1 
ATOM   4404 C  CD  . GLU D 1 74  ? 20.404  89.107  78.896  1.00 34.24  ? 220 GLU D CD  1 
ATOM   4405 O  OE1 . GLU D 1 74  ? 20.603  87.876  78.889  1.00 33.51  ? 220 GLU D OE1 1 
ATOM   4406 O  OE2 . GLU D 1 74  ? 20.169  89.736  79.948  1.00 39.60  ? 220 GLU D OE2 1 
ATOM   4407 N  N   . GLN D 1 75  ? 17.388  89.872  75.546  1.00 27.98  ? 221 GLN D N   1 
ATOM   4408 C  CA  . GLN D 1 75  ? 16.234  90.759  75.690  1.00 32.41  ? 221 GLN D CA  1 
ATOM   4409 C  C   . GLN D 1 75  ? 14.987  89.990  76.108  1.00 29.28  ? 221 GLN D C   1 
ATOM   4410 O  O   . GLN D 1 75  ? 14.203  90.467  76.929  1.00 30.89  ? 221 GLN D O   1 
ATOM   4411 C  CB  . GLN D 1 75  ? 15.961  91.534  74.393  1.00 38.43  ? 221 GLN D CB  1 
ATOM   4412 C  CG  . GLN D 1 75  ? 16.942  92.663  74.121  1.00 45.93  ? 221 GLN D CG  1 
ATOM   4413 C  CD  . GLN D 1 75  ? 16.599  93.440  72.864  1.00 59.98  ? 221 GLN D CD  1 
ATOM   4414 O  OE1 . GLN D 1 75  ? 16.141  92.872  71.868  1.00 61.64  ? 221 GLN D OE1 1 
ATOM   4415 N  NE2 . GLN D 1 75  ? 16.822  94.750  72.902  1.00 67.89  ? 221 GLN D NE2 1 
ATOM   4416 N  N   . PHE D 1 76  ? 14.802  88.803  75.539  1.00 25.96  ? 222 PHE D N   1 
ATOM   4417 C  CA  . PHE D 1 76  ? 13.676  87.960  75.916  1.00 26.72  ? 222 PHE D CA  1 
ATOM   4418 C  C   . PHE D 1 76  ? 13.778  87.558  77.384  1.00 29.49  ? 222 PHE D C   1 
ATOM   4419 O  O   . PHE D 1 76  ? 12.820  87.710  78.142  1.00 33.65  ? 222 PHE D O   1 
ATOM   4420 C  CB  . PHE D 1 76  ? 13.606  86.720  75.026  1.00 28.37  ? 222 PHE D CB  1 
ATOM   4421 C  CG  . PHE D 1 76  ? 12.488  85.773  75.382  1.00 34.28  ? 222 PHE D CG  1 
ATOM   4422 C  CD1 . PHE D 1 76  ? 11.269  85.837  74.722  1.00 39.38  ? 222 PHE D CD1 1 
ATOM   4423 C  CD2 . PHE D 1 76  ? 12.662  84.806  76.363  1.00 34.26  ? 222 PHE D CD2 1 
ATOM   4424 C  CE1 . PHE D 1 76  ? 10.243  84.959  75.042  1.00 40.90  ? 222 PHE D CE1 1 
ATOM   4425 C  CE2 . PHE D 1 76  ? 11.642  83.930  76.689  1.00 34.69  ? 222 PHE D CE2 1 
ATOM   4426 C  CZ  . PHE D 1 76  ? 10.432  84.004  76.029  1.00 38.45  ? 222 PHE D CZ  1 
ATOM   4427 N  N   . CYS D 1 77  ? 14.938  87.038  77.778  1.00 26.25  ? 223 CYS D N   1 
ATOM   4428 C  CA  . CYS D 1 77  ? 15.166  86.670  79.174  1.00 28.63  ? 223 CYS D CA  1 
ATOM   4429 C  C   . CYS D 1 77  ? 14.847  87.838  80.104  1.00 27.31  ? 223 CYS D C   1 
ATOM   4430 O  O   . CYS D 1 77  ? 14.156  87.672  81.105  1.00 29.44  ? 223 CYS D O   1 
ATOM   4431 C  CB  . CYS D 1 77  ? 16.608  86.189  79.395  1.00 26.12  ? 223 CYS D CB  1 
ATOM   4432 S  SG  . CYS D 1 77  ? 17.006  84.642  78.554  1.00 27.63  ? 223 CYS D SG  1 
ATOM   4433 N  N   . VAL D 1 78  ? 15.334  89.025  79.766  1.00 26.99  ? 224 VAL D N   1 
ATOM   4434 C  CA  . VAL D 1 78  ? 15.069  90.186  80.606  1.00 27.38  ? 224 VAL D CA  1 
ATOM   4435 C  C   . VAL D 1 78  ? 13.574  90.522  80.683  1.00 33.20  ? 224 VAL D C   1 
ATOM   4436 O  O   . VAL D 1 78  ? 13.092  90.976  81.721  1.00 39.82  ? 224 VAL D O   1 
ATOM   4437 C  CB  . VAL D 1 78  ? 15.910  91.408  80.180  1.00 30.93  ? 224 VAL D CB  1 
ATOM   4438 C  CG1 . VAL D 1 78  ? 15.409  92.672  80.867  1.00 31.12  ? 224 VAL D CG1 1 
ATOM   4439 C  CG2 . VAL D 1 78  ? 17.390  91.172  80.510  1.00 29.54  ? 224 VAL D CG2 1 
ATOM   4440 N  N   . SER D 1 79  ? 12.835  90.280  79.604  1.00 31.21  ? 225 SER D N   1 
ATOM   4441 C  CA  . SER D 1 79  ? 11.390  90.525  79.607  1.00 29.40  ? 225 SER D CA  1 
ATOM   4442 C  C   . SER D 1 79  ? 10.673  89.564  80.560  1.00 33.83  ? 225 SER D C   1 
ATOM   4443 O  O   . SER D 1 79  ? 9.565   89.836  81.013  1.00 35.85  ? 225 SER D O   1 
ATOM   4444 C  CB  . SER D 1 79  ? 10.806  90.401  78.192  1.00 28.00  ? 225 SER D CB  1 
ATOM   4445 O  OG  . SER D 1 79  ? 10.381  89.072  77.918  1.00 30.70  ? 225 SER D OG  1 
ATOM   4446 N  N   . ARG D 1 80  ? 11.314  88.438  80.859  1.00 35.99  ? 226 ARG D N   1 
ATOM   4447 C  CA  . ARG D 1 80  ? 10.737  87.448  81.761  1.00 36.72  ? 226 ARG D CA  1 
ATOM   4448 C  C   . ARG D 1 80  ? 11.474  87.425  83.100  1.00 33.76  ? 226 ARG D C   1 
ATOM   4449 O  O   . ARG D 1 80  ? 11.571  86.388  83.753  1.00 32.20  ? 226 ARG D O   1 
ATOM   4450 C  CB  . ARG D 1 80  ? 10.772  86.063  81.120  1.00 41.40  ? 226 ARG D CB  1 
ATOM   4451 C  CG  . ARG D 1 80  ? 10.169  86.010  79.728  1.00 47.34  ? 226 ARG D CG  1 
ATOM   4452 C  CD  . ARG D 1 80  ? 8.662   86.207  79.755  1.00 51.20  ? 226 ARG D CD  1 
ATOM   4453 N  NE  . ARG D 1 80  ? 7.984   85.132  79.038  1.00 53.60  ? 226 ARG D NE  1 
ATOM   4454 C  CZ  . ARG D 1 80  ? 7.814   85.107  77.722  1.00 53.22  ? 226 ARG D CZ  1 
ATOM   4455 N  NH1 . ARG D 1 80  ? 8.266   86.105  76.977  1.00 56.46  ? 226 ARG D NH1 1 
ATOM   4456 N  NH2 . ARG D 1 80  ? 7.192   84.087  77.150  1.00 49.36  ? 226 ARG D NH2 1 
ATOM   4457 N  N   . ASN D 1 81  ? 12.007  88.577  83.488  1.00 34.80  ? 227 ASN D N   1 
ATOM   4458 C  CA  . ASN D 1 81  ? 12.676  88.730  84.771  1.00 38.69  ? 227 ASN D CA  1 
ATOM   4459 C  C   . ASN D 1 81  ? 13.850  87.765  84.952  1.00 33.59  ? 227 ASN D C   1 
ATOM   4460 O  O   . ASN D 1 81  ? 13.972  87.110  85.988  1.00 31.02  ? 227 ASN D O   1 
ATOM   4461 C  CB  . ASN D 1 81  ? 11.663  88.572  85.911  1.00 46.07  ? 227 ASN D CB  1 
ATOM   4462 C  CG  . ASN D 1 81  ? 12.253  88.904  87.270  1.00 54.73  ? 227 ASN D CG  1 
ATOM   4463 O  OD1 . ASN D 1 81  ? 12.946  89.911  87.435  1.00 55.99  ? 227 ASN D OD1 1 
ATOM   4464 N  ND2 . ASN D 1 81  ? 11.973  88.056  88.256  1.00 57.64  ? 227 ASN D ND2 1 
ATOM   4465 N  N   . SER D 1 82  ? 14.718  87.685  83.947  1.00 27.39  ? 228 SER D N   1 
ATOM   4466 C  CA  . SER D 1 82  ? 15.840  86.756  84.006  1.00 28.04  ? 228 SER D CA  1 
ATOM   4467 C  C   . SER D 1 82  ? 16.976  87.125  83.055  1.00 27.99  ? 228 SER D C   1 
ATOM   4468 O  O   . SER D 1 82  ? 16.985  88.207  82.465  1.00 29.06  ? 228 SER D O   1 
ATOM   4469 C  CB  . SER D 1 82  ? 15.363  85.322  83.745  1.00 34.77  ? 228 SER D CB  1 
ATOM   4470 O  OG  . SER D 1 82  ? 14.764  85.205  82.469  1.00 38.07  ? 228 SER D OG  1 
ATOM   4471 N  N   . HIS D 1 83  ? 17.942  86.223  82.925  1.00 25.36  ? 229 HIS D N   1 
ATOM   4472 C  CA  . HIS D 1 83  ? 19.083  86.444  82.051  1.00 26.95  ? 229 HIS D CA  1 
ATOM   4473 C  C   . HIS D 1 83  ? 19.430  85.163  81.323  1.00 25.64  ? 229 HIS D C   1 
ATOM   4474 O  O   . HIS D 1 83  ? 19.109  84.076  81.794  1.00 29.97  ? 229 HIS D O   1 
ATOM   4475 C  CB  . HIS D 1 83  ? 20.302  86.886  82.866  1.00 32.62  ? 229 HIS D CB  1 
ATOM   4476 C  CG  . HIS D 1 83  ? 20.158  88.238  83.485  1.00 36.83  ? 229 HIS D CG  1 
ATOM   4477 N  ND1 . HIS D 1 83  ? 20.299  89.403  82.764  1.00 34.24  ? 229 HIS D ND1 1 
ATOM   4478 C  CD2 . HIS D 1 83  ? 19.892  88.611  84.759  1.00 39.80  ? 229 HIS D CD2 1 
ATOM   4479 C  CE1 . HIS D 1 83  ? 20.121  90.438  83.566  1.00 36.68  ? 229 HIS D CE1 1 
ATOM   4480 N  NE2 . HIS D 1 83  ? 19.873  89.985  84.782  1.00 40.27  ? 229 HIS D NE2 1 
ATOM   4481 N  N   . LEU D 1 84  ? 20.096  85.281  80.180  1.00 20.65  ? 230 LEU D N   1 
ATOM   4482 C  CA  . LEU D 1 84  ? 20.706  84.105  79.590  1.00 21.27  ? 230 LEU D CA  1 
ATOM   4483 C  C   . LEU D 1 84  ? 21.570  83.485  80.683  1.00 24.56  ? 230 LEU D C   1 
ATOM   4484 O  O   . LEU D 1 84  ? 22.290  84.190  81.391  1.00 24.75  ? 230 LEU D O   1 
ATOM   4485 C  CB  . LEU D 1 84  ? 21.543  84.471  78.373  1.00 14.52  ? 230 LEU D CB  1 
ATOM   4486 C  CG  . LEU D 1 84  ? 20.712  84.704  77.112  1.00 20.54  ? 230 LEU D CG  1 
ATOM   4487 C  CD1 . LEU D 1 84  ? 21.481  85.524  76.073  1.00 19.67  ? 230 LEU D CD1 1 
ATOM   4488 C  CD2 . LEU D 1 84  ? 20.199  83.367  76.533  1.00 18.14  ? 230 LEU D CD2 1 
ATOM   4489 N  N   . THR D 1 85  ? 21.484  82.169  80.823  1.00 24.05  ? 231 THR D N   1 
ATOM   4490 C  CA  . THR D 1 85  ? 22.058  81.483  81.973  1.00 24.00  ? 231 THR D CA  1 
ATOM   4491 C  C   . THR D 1 85  ? 23.583  81.571  82.076  1.00 23.29  ? 231 THR D C   1 
ATOM   4492 O  O   . THR D 1 85  ? 24.292  81.558  81.076  1.00 23.42  ? 231 THR D O   1 
ATOM   4493 C  CB  . THR D 1 85  ? 21.653  80.005  81.979  1.00 23.55  ? 231 THR D CB  1 
ATOM   4494 O  OG1 . THR D 1 85  ? 22.016  79.412  83.230  1.00 23.20  ? 231 THR D OG1 1 
ATOM   4495 C  CG2 . THR D 1 85  ? 22.334  79.262  80.843  1.00 21.82  ? 231 THR D CG2 1 
ATOM   4496 N  N   . SER D 1 86  ? 24.080  81.664  83.302  1.00 21.59  ? 232 SER D N   1 
ATOM   4497 C  CA  . SER D 1 86  ? 25.499  81.468  83.556  1.00 22.78  ? 232 SER D CA  1 
ATOM   4498 C  C   . SER D 1 86  ? 25.688  80.016  83.973  1.00 26.27  ? 232 SER D C   1 
ATOM   4499 O  O   . SER D 1 86  ? 24.708  79.309  84.211  1.00 25.78  ? 232 SER D O   1 
ATOM   4500 C  CB  . SER D 1 86  ? 25.980  82.403  84.661  1.00 24.30  ? 232 SER D CB  1 
ATOM   4501 O  OG  . SER D 1 86  ? 25.181  82.260  85.819  1.00 24.14  ? 232 SER D OG  1 
ATOM   4502 N  N   . VAL D 1 87  ? 26.936  79.563  84.045  1.00 27.69  ? 233 VAL D N   1 
ATOM   4503 C  CA  . VAL D 1 87  ? 27.224  78.209  84.515  1.00 31.46  ? 233 VAL D CA  1 
ATOM   4504 C  C   . VAL D 1 87  ? 28.279  78.247  85.621  1.00 38.21  ? 233 VAL D C   1 
ATOM   4505 O  O   . VAL D 1 87  ? 29.433  78.597  85.373  1.00 43.40  ? 233 VAL D O   1 
ATOM   4506 C  CB  . VAL D 1 87  ? 27.701  77.303  83.374  1.00 31.37  ? 233 VAL D CB  1 
ATOM   4507 C  CG1 . VAL D 1 87  ? 27.921  75.890  83.880  1.00 29.53  ? 233 VAL D CG1 1 
ATOM   4508 C  CG2 . VAL D 1 87  ? 26.689  77.305  82.246  1.00 33.97  ? 233 VAL D CG2 1 
ATOM   4509 N  N   . THR D 1 88  ? 27.881  77.879  86.835  1.00 34.49  ? 234 THR D N   1 
ATOM   4510 C  CA  . THR D 1 88  ? 28.716  78.109  88.009  1.00 38.14  ? 234 THR D CA  1 
ATOM   4511 C  C   . THR D 1 88  ? 29.154  76.839  88.755  1.00 42.06  ? 234 THR D C   1 
ATOM   4512 O  O   . THR D 1 88  ? 29.760  76.920  89.820  1.00 45.84  ? 234 THR D O   1 
ATOM   4513 C  CB  . THR D 1 88  ? 28.013  79.057  88.997  1.00 38.00  ? 234 THR D CB  1 
ATOM   4514 O  OG1 . THR D 1 88  ? 26.833  78.425  89.509  1.00 38.01  ? 234 THR D OG1 1 
ATOM   4515 C  CG2 . THR D 1 88  ? 27.624  80.358  88.303  1.00 37.54  ? 234 THR D CG2 1 
ATOM   4516 N  N   . SER D 1 89  ? 28.848  75.672  88.203  1.00 41.56  ? 235 SER D N   1 
ATOM   4517 C  CA  . SER D 1 89  ? 29.297  74.415  88.790  1.00 38.44  ? 235 SER D CA  1 
ATOM   4518 C  C   . SER D 1 89  ? 29.156  73.294  87.778  1.00 38.29  ? 235 SER D C   1 
ATOM   4519 O  O   . SER D 1 89  ? 28.389  73.411  86.822  1.00 36.60  ? 235 SER D O   1 
ATOM   4520 C  CB  . SER D 1 89  ? 28.494  74.081  90.049  1.00 36.04  ? 235 SER D CB  1 
ATOM   4521 O  OG  . SER D 1 89  ? 27.142  73.777  89.737  1.00 33.15  ? 235 SER D OG  1 
ATOM   4522 N  N   . GLU D 1 90  ? 29.900  72.210  87.988  1.00 37.35  ? 236 GLU D N   1 
ATOM   4523 C  CA  . GLU D 1 90  ? 29.810  71.057  87.106  1.00 34.94  ? 236 GLU D CA  1 
ATOM   4524 C  C   . GLU D 1 90  ? 28.386  70.538  87.072  1.00 27.81  ? 236 GLU D C   1 
ATOM   4525 O  O   . GLU D 1 90  ? 27.880  70.167  86.020  1.00 28.16  ? 236 GLU D O   1 
ATOM   4526 C  CB  . GLU D 1 90  ? 30.757  69.940  87.549  1.00 42.15  ? 236 GLU D CB  1 
ATOM   4527 C  CG  . GLU D 1 90  ? 32.228  70.240  87.314  1.00 50.32  ? 236 GLU D CG  1 
ATOM   4528 C  CD  . GLU D 1 90  ? 33.075  68.980  87.182  1.00 57.05  ? 236 GLU D CD  1 
ATOM   4529 O  OE1 . GLU D 1 90  ? 32.592  67.883  87.551  1.00 53.93  ? 236 GLU D OE1 1 
ATOM   4530 O  OE2 . GLU D 1 90  ? 34.226  69.092  86.704  1.00 60.89  ? 236 GLU D OE2 1 
ATOM   4531 N  N   . SER D 1 91  ? 27.737  70.514  88.228  1.00 28.09  ? 237 SER D N   1 
ATOM   4532 C  CA  . SER D 1 91  ? 26.384  69.991  88.305  1.00 32.76  ? 237 SER D CA  1 
ATOM   4533 C  C   . SER D 1 91  ? 25.426  70.853  87.488  1.00 31.93  ? 237 SER D C   1 
ATOM   4534 O  O   . SER D 1 91  ? 24.524  70.335  86.834  1.00 31.41  ? 237 SER D O   1 
ATOM   4535 C  CB  . SER D 1 91  ? 25.914  69.871  89.758  1.00 34.39  ? 237 SER D CB  1 
ATOM   4536 O  OG  . SER D 1 91  ? 25.615  71.138  90.303  1.00 42.13  ? 237 SER D OG  1 
ATOM   4537 N  N   . GLU D 1 92  ? 25.620  72.166  87.516  1.00 31.84  ? 238 GLU D N   1 
ATOM   4538 C  CA  . GLU D 1 92  ? 24.789  73.041  86.699  1.00 34.03  ? 238 GLU D CA  1 
ATOM   4539 C  C   . GLU D 1 92  ? 25.052  72.799  85.212  1.00 31.52  ? 238 GLU D C   1 
ATOM   4540 O  O   . GLU D 1 92  ? 24.122  72.633  84.429  1.00 31.52  ? 238 GLU D O   1 
ATOM   4541 C  CB  . GLU D 1 92  ? 25.002  74.512  87.055  1.00 32.96  ? 238 GLU D CB  1 
ATOM   4542 C  CG  . GLU D 1 92  ? 24.090  75.437  86.268  1.00 32.86  ? 238 GLU D CG  1 
ATOM   4543 C  CD  . GLU D 1 92  ? 24.159  76.886  86.721  1.00 32.78  ? 238 GLU D CD  1 
ATOM   4544 O  OE1 . GLU D 1 92  ? 25.258  77.357  87.097  1.00 32.63  ? 238 GLU D OE1 1 
ATOM   4545 O  OE2 . GLU D 1 92  ? 23.105  77.558  86.682  1.00 29.16  ? 238 GLU D OE2 1 
ATOM   4546 N  N   . GLN D 1 93  ? 26.327  72.765  84.838  1.00 28.74  ? 239 GLN D N   1 
ATOM   4547 C  CA  . GLN D 1 93  ? 26.719  72.495  83.462  1.00 27.07  ? 239 GLN D CA  1 
ATOM   4548 C  C   . GLN D 1 93  ? 26.109  71.193  82.969  1.00 28.86  ? 239 GLN D C   1 
ATOM   4549 O  O   . GLN D 1 93  ? 25.627  71.115  81.841  1.00 28.26  ? 239 GLN D O   1 
ATOM   4550 C  CB  . GLN D 1 93  ? 28.242  72.432  83.341  1.00 25.55  ? 239 GLN D CB  1 
ATOM   4551 C  CG  . GLN D 1 93  ? 28.759  72.009  81.966  1.00 25.04  ? 239 GLN D CG  1 
ATOM   4552 C  CD  . GLN D 1 93  ? 28.727  73.138  80.948  1.00 30.74  ? 239 GLN D CD  1 
ATOM   4553 O  OE1 . GLN D 1 93  ? 27.920  74.060  81.057  1.00 33.20  ? 239 GLN D OE1 1 
ATOM   4554 N  NE2 . GLN D 1 93  ? 29.609  73.070  79.952  1.00 30.61  ? 239 GLN D NE2 1 
ATOM   4555 N  N   . GLU D 1 94  ? 26.143  70.176  83.827  1.00 28.13  ? 240 GLU D N   1 
ATOM   4556 C  CA  . GLU D 1 94  ? 25.645  68.850  83.500  1.00 23.86  ? 240 GLU D CA  1 
ATOM   4557 C  C   . GLU D 1 94  ? 24.142  68.846  83.285  1.00 23.06  ? 240 GLU D C   1 
ATOM   4558 O  O   . GLU D 1 94  ? 23.634  68.250  82.333  1.00 27.28  ? 240 GLU D O   1 
ATOM   4559 C  CB  . GLU D 1 94  ? 25.970  67.873  84.624  1.00 27.56  ? 240 GLU D CB  1 
ATOM   4560 C  CG  . GLU D 1 94  ? 25.435  66.487  84.365  1.00 35.85  ? 240 GLU D CG  1 
ATOM   4561 C  CD  . GLU D 1 94  ? 25.398  65.624  85.606  1.00 44.52  ? 240 GLU D CD  1 
ATOM   4562 O  OE1 . GLU D 1 94  ? 25.805  66.099  86.689  1.00 49.65  ? 240 GLU D OE1 1 
ATOM   4563 O  OE2 . GLU D 1 94  ? 24.945  64.466  85.493  1.00 44.06  ? 240 GLU D OE2 1 
ATOM   4564 N  N   . PHE D 1 95  ? 23.426  69.477  84.201  1.00 17.42  ? 241 PHE D N   1 
ATOM   4565 C  CA  . PHE D 1 95  ? 21.993  69.603  84.062  1.00 20.16  ? 241 PHE D CA  1 
ATOM   4566 C  C   . PHE D 1 95  ? 21.671  70.293  82.738  1.00 25.79  ? 241 PHE D C   1 
ATOM   4567 O  O   . PHE D 1 95  ? 20.727  69.916  82.041  1.00 28.25  ? 241 PHE D O   1 
ATOM   4568 C  CB  . PHE D 1 95  ? 21.407  70.403  85.221  1.00 17.19  ? 241 PHE D CB  1 
ATOM   4569 C  CG  . PHE D 1 95  ? 20.091  71.065  84.895  1.00 22.99  ? 241 PHE D CG  1 
ATOM   4570 C  CD1 . PHE D 1 95  ? 18.903  70.345  84.931  1.00 27.44  ? 241 PHE D CD1 1 
ATOM   4571 C  CD2 . PHE D 1 95  ? 20.040  72.404  84.547  1.00 21.82  ? 241 PHE D CD2 1 
ATOM   4572 C  CE1 . PHE D 1 95  ? 17.689  70.954  84.627  1.00 25.51  ? 241 PHE D CE1 1 
ATOM   4573 C  CE2 . PHE D 1 95  ? 18.829  73.013  84.242  1.00 23.28  ? 241 PHE D CE2 1 
ATOM   4574 C  CZ  . PHE D 1 95  ? 17.656  72.287  84.283  1.00 20.98  ? 241 PHE D CZ  1 
ATOM   4575 N  N   . LEU D 1 96  ? 22.470  71.296  82.393  1.00 24.18  ? 242 LEU D N   1 
ATOM   4576 C  CA  . LEU D 1 96  ? 22.205  72.107  81.212  1.00 24.66  ? 242 LEU D CA  1 
ATOM   4577 C  C   . LEU D 1 96  ? 22.414  71.334  79.910  1.00 26.07  ? 242 LEU D C   1 
ATOM   4578 O  O   . LEU D 1 96  ? 21.544  71.342  79.045  1.00 25.36  ? 242 LEU D O   1 
ATOM   4579 C  CB  . LEU D 1 96  ? 23.041  73.389  81.222  1.00 19.02  ? 242 LEU D CB  1 
ATOM   4580 C  CG  . LEU D 1 96  ? 22.642  74.448  82.252  1.00 25.01  ? 242 LEU D CG  1 
ATOM   4581 C  CD1 . LEU D 1 96  ? 23.551  75.676  82.175  1.00 23.83  ? 242 LEU D CD1 1 
ATOM   4582 C  CD2 . LEU D 1 96  ? 21.198  74.856  82.049  1.00 27.27  ? 242 LEU D CD2 1 
ATOM   4583 N  N   . TYR D 1 97  ? 23.551  70.660  79.765  1.00 22.18  ? 243 TYR D N   1 
ATOM   4584 C  CA  . TYR D 1 97  ? 23.808  69.953  78.515  1.00 24.28  ? 243 TYR D CA  1 
ATOM   4585 C  C   . TYR D 1 97  ? 22.892  68.741  78.341  1.00 29.20  ? 243 TYR D C   1 
ATOM   4586 O  O   . TYR D 1 97  ? 22.488  68.423  77.225  1.00 35.99  ? 243 TYR D O   1 
ATOM   4587 C  CB  . TYR D 1 97  ? 25.282  69.576  78.357  1.00 25.38  ? 243 TYR D CB  1 
ATOM   4588 C  CG  . TYR D 1 97  ? 25.694  68.266  78.995  1.00 34.37  ? 243 TYR D CG  1 
ATOM   4589 C  CD1 . TYR D 1 97  ? 25.271  67.050  78.473  1.00 36.73  ? 243 TYR D CD1 1 
ATOM   4590 C  CD2 . TYR D 1 97  ? 26.544  68.243  80.095  1.00 38.44  ? 243 TYR D CD2 1 
ATOM   4591 C  CE1 . TYR D 1 97  ? 25.659  65.850  79.044  1.00 35.45  ? 243 TYR D CE1 1 
ATOM   4592 C  CE2 . TYR D 1 97  ? 26.940  67.047  80.668  1.00 38.03  ? 243 TYR D CE2 1 
ATOM   4593 C  CZ  . TYR D 1 97  ? 26.493  65.856  80.138  1.00 36.01  ? 243 TYR D CZ  1 
ATOM   4594 O  OH  . TYR D 1 97  ? 26.883  64.664  80.705  1.00 40.96  ? 243 TYR D OH  1 
ATOM   4595 N  N   . LYS D 1 98  ? 22.559  68.070  79.439  1.00 24.72  ? 244 LYS D N   1 
ATOM   4596 C  CA  . LYS D 1 98  ? 21.632  66.948  79.367  1.00 23.59  ? 244 LYS D CA  1 
ATOM   4597 C  C   . LYS D 1 98  ? 20.231  67.412  78.995  1.00 26.27  ? 244 LYS D C   1 
ATOM   4598 O  O   . LYS D 1 98  ? 19.556  66.780  78.181  1.00 26.90  ? 244 LYS D O   1 
ATOM   4599 C  CB  . LYS D 1 98  ? 21.598  66.169  80.681  1.00 22.54  ? 244 LYS D CB  1 
ATOM   4600 C  CG  . LYS D 1 98  ? 22.889  65.428  80.971  1.00 29.43  ? 244 LYS D CG  1 
ATOM   4601 C  CD  . LYS D 1 98  ? 22.724  64.437  82.104  1.00 34.54  ? 244 LYS D CD  1 
ATOM   4602 C  CE  . LYS D 1 98  ? 23.908  63.474  82.154  1.00 40.34  ? 244 LYS D CE  1 
ATOM   4603 N  NZ  . LYS D 1 98  ? 23.585  62.244  82.933  1.00 44.53  ? 244 LYS D NZ  1 
ATOM   4604 N  N   . THR D 1 99  ? 19.788  68.513  79.594  1.00 23.95  ? 245 THR D N   1 
ATOM   4605 C  CA  . THR D 1 99  ? 18.453  69.015  79.305  1.00 25.16  ? 245 THR D CA  1 
ATOM   4606 C  C   . THR D 1 99  ? 18.377  69.615  77.899  1.00 25.12  ? 245 THR D C   1 
ATOM   4607 O  O   . THR D 1 99  ? 17.309  69.660  77.299  1.00 29.86  ? 245 THR D O   1 
ATOM   4608 C  CB  . THR D 1 99  ? 17.981  70.026  80.353  1.00 24.08  ? 245 THR D CB  1 
ATOM   4609 O  OG1 . THR D 1 99  ? 18.116  69.451  81.658  1.00 24.40  ? 245 THR D OG1 1 
ATOM   4610 C  CG2 . THR D 1 99  ? 16.526  70.376  80.127  1.00 23.29  ? 245 THR D CG2 1 
ATOM   4611 N  N   . ALA D 1 100 ? 19.514  70.057  77.372  1.00 20.97  ? 246 ALA D N   1 
ATOM   4612 C  CA  . ALA D 1 100 ? 19.570  70.589  76.016  1.00 23.63  ? 246 ALA D CA  1 
ATOM   4613 C  C   . ALA D 1 100 ? 19.181  69.489  75.017  1.00 32.55  ? 246 ALA D C   1 
ATOM   4614 O  O   . ALA D 1 100 ? 18.647  69.763  73.938  1.00 27.88  ? 246 ALA D O   1 
ATOM   4615 C  CB  . ALA D 1 100 ? 20.954  71.119  75.718  1.00 19.19  ? 246 ALA D CB  1 
ATOM   4616 N  N   . GLY D 1 101 ? 19.456  68.241  75.391  1.00 31.26  ? 247 GLY D N   1 
ATOM   4617 C  CA  . GLY D 1 101 ? 19.019  67.091  74.625  1.00 28.28  ? 247 GLY D CA  1 
ATOM   4618 C  C   . GLY D 1 101 ? 19.548  67.035  73.208  1.00 28.92  ? 247 GLY D C   1 
ATOM   4619 O  O   . GLY D 1 101 ? 18.873  66.529  72.316  1.00 28.66  ? 247 GLY D O   1 
ATOM   4620 N  N   . GLY D 1 102 ? 20.753  67.551  72.994  1.00 27.23  ? 248 GLY D N   1 
ATOM   4621 C  CA  . GLY D 1 102 ? 21.360  67.513  71.675  1.00 27.93  ? 248 GLY D CA  1 
ATOM   4622 C  C   . GLY D 1 102 ? 21.037  68.716  70.803  1.00 29.72  ? 248 GLY D C   1 
ATOM   4623 O  O   . GLY D 1 102 ? 21.522  68.819  69.675  1.00 29.63  ? 248 GLY D O   1 
ATOM   4624 N  N   . LEU D 1 103 ? 20.208  69.620  71.317  1.00 27.05  ? 249 LEU D N   1 
ATOM   4625 C  CA  . LEU D 1 103 ? 19.961  70.889  70.640  1.00 27.85  ? 249 LEU D CA  1 
ATOM   4626 C  C   . LEU D 1 103 ? 20.943  71.953  71.134  1.00 27.19  ? 249 LEU D C   1 
ATOM   4627 O  O   . LEU D 1 103 ? 21.407  71.902  72.274  1.00 28.65  ? 249 LEU D O   1 
ATOM   4628 C  CB  . LEU D 1 103 ? 18.517  71.350  70.857  1.00 24.47  ? 249 LEU D CB  1 
ATOM   4629 C  CG  . LEU D 1 103 ? 17.432  70.470  70.227  1.00 22.94  ? 249 LEU D CG  1 
ATOM   4630 C  CD1 . LEU D 1 103 ? 16.040  70.973  70.584  1.00 21.56  ? 249 LEU D CD1 1 
ATOM   4631 C  CD2 . LEU D 1 103 ? 17.604  70.401  68.714  1.00 19.26  ? 249 LEU D CD2 1 
ATOM   4632 N  N   . ILE D 1 104 ? 21.263  72.905  70.265  1.00 28.22  ? 250 ILE D N   1 
ATOM   4633 C  CA  . ILE D 1 104 ? 22.167  73.996  70.602  1.00 27.51  ? 250 ILE D CA  1 
ATOM   4634 C  C   . ILE D 1 104 ? 21.396  75.156  71.215  1.00 30.54  ? 250 ILE D C   1 
ATOM   4635 O  O   . ILE D 1 104 ? 20.416  75.627  70.638  1.00 34.45  ? 250 ILE D O   1 
ATOM   4636 C  CB  . ILE D 1 104 ? 22.899  74.498  69.351  1.00 29.22  ? 250 ILE D CB  1 
ATOM   4637 C  CG1 . ILE D 1 104 ? 23.660  73.347  68.695  1.00 30.05  ? 250 ILE D CG1 1 
ATOM   4638 C  CG2 . ILE D 1 104 ? 23.835  75.652  69.697  1.00 29.51  ? 250 ILE D CG2 1 
ATOM   4639 C  CD1 . ILE D 1 104 ? 24.405  73.735  67.446  1.00 30.71  ? 250 ILE D CD1 1 
ATOM   4640 N  N   . TYR D 1 105 ? 21.825  75.610  72.390  1.00 31.08  ? 251 TYR D N   1 
ATOM   4641 C  CA  . TYR D 1 105 ? 21.192  76.761  73.030  1.00 26.70  ? 251 TYR D CA  1 
ATOM   4642 C  C   . TYR D 1 105 ? 22.214  77.830  73.363  1.00 30.26  ? 251 TYR D C   1 
ATOM   4643 O  O   . TYR D 1 105 ? 23.274  77.536  73.923  1.00 29.70  ? 251 TYR D O   1 
ATOM   4644 C  CB  . TYR D 1 105 ? 20.498  76.371  74.331  1.00 20.94  ? 251 TYR D CB  1 
ATOM   4645 C  CG  . TYR D 1 105 ? 19.317  75.448  74.193  1.00 20.15  ? 251 TYR D CG  1 
ATOM   4646 C  CD1 . TYR D 1 105 ? 18.024  75.940  74.242  1.00 19.58  ? 251 TYR D CD1 1 
ATOM   4647 C  CD2 . TYR D 1 105 ? 19.493  74.079  74.036  1.00 19.51  ? 251 TYR D CD2 1 
ATOM   4648 C  CE1 . TYR D 1 105 ? 16.933  75.100  74.122  1.00 17.30  ? 251 TYR D CE1 1 
ATOM   4649 C  CE2 . TYR D 1 105 ? 18.408  73.232  73.913  1.00 19.34  ? 251 TYR D CE2 1 
ATOM   4650 C  CZ  . TYR D 1 105 ? 17.130  73.750  73.961  1.00 20.06  ? 251 TYR D CZ  1 
ATOM   4651 O  OH  . TYR D 1 105 ? 16.042  72.916  73.847  1.00 25.15  ? 251 TYR D OH  1 
ATOM   4652 N  N   . TRP D 1 106 ? 21.881  79.068  73.018  1.00 25.25  ? 252 TRP D N   1 
ATOM   4653 C  CA  . TRP D 1 106 ? 22.612  80.223  73.501  1.00 23.99  ? 252 TRP D CA  1 
ATOM   4654 C  C   . TRP D 1 106 ? 22.644  80.199  75.024  1.00 23.61  ? 252 TRP D C   1 
ATOM   4655 O  O   . TRP D 1 106 ? 21.634  79.911  75.663  1.00 21.38  ? 252 TRP D O   1 
ATOM   4656 C  CB  . TRP D 1 106 ? 21.885  81.499  73.091  1.00 19.94  ? 252 TRP D CB  1 
ATOM   4657 C  CG  . TRP D 1 106 ? 22.186  82.030  71.729  1.00 20.78  ? 252 TRP D CG  1 
ATOM   4658 C  CD1 . TRP D 1 106 ? 21.281  82.506  70.818  1.00 17.87  ? 252 TRP D CD1 1 
ATOM   4659 C  CD2 . TRP D 1 106 ? 23.478  82.200  71.135  1.00 21.28  ? 252 TRP D CD2 1 
ATOM   4660 N  NE1 . TRP D 1 106 ? 21.929  82.951  69.697  1.00 19.03  ? 252 TRP D NE1 1 
ATOM   4661 C  CE2 . TRP D 1 106 ? 23.277  82.771  69.860  1.00 20.54  ? 252 TRP D CE2 1 
ATOM   4662 C  CE3 . TRP D 1 106 ? 24.782  81.919  71.550  1.00 21.28  ? 252 TRP D CE3 1 
ATOM   4663 C  CZ2 . TRP D 1 106 ? 24.331  83.061  68.999  1.00 20.82  ? 252 TRP D CZ2 1 
ATOM   4664 C  CZ3 . TRP D 1 106 ? 25.826  82.210  70.693  1.00 22.16  ? 252 TRP D CZ3 1 
ATOM   4665 C  CH2 . TRP D 1 106 ? 25.594  82.776  69.432  1.00 22.66  ? 252 TRP D CH2 1 
ATOM   4666 N  N   . ILE D 1 107 ? 23.790  80.524  75.607  1.00 22.37  ? 253 ILE D N   1 
ATOM   4667 C  CA  . ILE D 1 107 ? 23.842  80.807  77.033  1.00 23.99  ? 253 ILE D CA  1 
ATOM   4668 C  C   . ILE D 1 107 ? 24.479  82.179  77.236  1.00 25.90  ? 253 ILE D C   1 
ATOM   4669 O  O   . ILE D 1 107 ? 24.774  82.882  76.263  1.00 22.73  ? 253 ILE D O   1 
ATOM   4670 C  CB  . ILE D 1 107 ? 24.612  79.732  77.836  1.00 23.68  ? 253 ILE D CB  1 
ATOM   4671 C  CG1 . ILE D 1 107 ? 26.087  79.703  77.436  1.00 25.26  ? 253 ILE D CG1 1 
ATOM   4672 C  CG2 . ILE D 1 107 ? 23.981  78.361  77.664  1.00 20.37  ? 253 ILE D CG2 1 
ATOM   4673 C  CD1 . ILE D 1 107 ? 26.893  78.697  78.241  1.00 24.88  ? 253 ILE D CD1 1 
ATOM   4674 N  N   . GLY D 1 108 ? 24.708  82.545  78.494  1.00 23.26  ? 254 GLY D N   1 
ATOM   4675 C  CA  . GLY D 1 108 ? 25.097  83.903  78.842  1.00 28.61  ? 254 GLY D CA  1 
ATOM   4676 C  C   . GLY D 1 108 ? 26.522  84.316  78.529  1.00 31.94  ? 254 GLY D C   1 
ATOM   4677 O  O   . GLY D 1 108 ? 26.943  85.408  78.898  1.00 36.10  ? 254 GLY D O   1 
ATOM   4678 N  N   . LEU D 1 109 ? 27.267  83.457  77.843  1.00 30.42  ? 255 LEU D N   1 
ATOM   4679 C  CA  . LEU D 1 109 ? 28.640  83.770  77.470  1.00 29.47  ? 255 LEU D CA  1 
ATOM   4680 C  C   . LEU D 1 109 ? 28.727  84.848  76.389  1.00 35.12  ? 255 LEU D C   1 
ATOM   4681 O  O   . LEU D 1 109 ? 28.090  84.740  75.336  1.00 35.11  ? 255 LEU D O   1 
ATOM   4682 C  CB  . LEU D 1 109 ? 29.346  82.512  76.970  1.00 27.35  ? 255 LEU D CB  1 
ATOM   4683 C  CG  . LEU D 1 109 ? 29.914  81.543  77.994  1.00 27.88  ? 255 LEU D CG  1 
ATOM   4684 C  CD1 . LEU D 1 109 ? 30.588  80.396  77.267  1.00 22.60  ? 255 LEU D CD1 1 
ATOM   4685 C  CD2 . LEU D 1 109 ? 30.898  82.259  78.930  1.00 28.50  ? 255 LEU D CD2 1 
ATOM   4686 N  N   . THR D 1 110 ? 29.537  85.872  76.644  1.00 36.97  ? 256 THR D N   1 
ATOM   4687 C  CA  . THR D 1 110 ? 29.797  86.912  75.652  1.00 35.55  ? 256 THR D CA  1 
ATOM   4688 C  C   . THR D 1 110 ? 31.148  87.574  75.907  1.00 37.38  ? 256 THR D C   1 
ATOM   4689 O  O   . THR D 1 110 ? 31.675  87.513  77.017  1.00 37.61  ? 256 THR D O   1 
ATOM   4690 C  CB  . THR D 1 110 ? 28.691  87.977  75.654  1.00 35.50  ? 256 THR D CB  1 
ATOM   4691 O  OG1 . THR D 1 110 ? 28.917  88.906  74.589  1.00 40.19  ? 256 THR D OG1 1 
ATOM   4692 C  CG2 . THR D 1 110 ? 28.672  88.722  76.976  1.00 36.06  ? 256 THR D CG2 1 
ATOM   4693 N  N   . LYS D 1 111 ? 31.717  88.191  74.876  1.00 39.49  ? 257 LYS D N   1 
ATOM   4694 C  CA  . LYS D 1 111 ? 32.976  88.915  75.031  1.00 47.80  ? 257 LYS D CA  1 
ATOM   4695 C  C   . LYS D 1 111 ? 32.728  90.414  75.191  1.00 53.48  ? 257 LYS D C   1 
ATOM   4696 O  O   . LYS D 1 111 ? 32.213  91.064  74.284  1.00 55.45  ? 257 LYS D O   1 
ATOM   4697 C  CB  . LYS D 1 111 ? 33.912  88.654  73.846  1.00 49.98  ? 257 LYS D CB  1 
ATOM   4698 C  CG  . LYS D 1 111 ? 34.237  87.184  73.626  1.00 50.73  ? 257 LYS D CG  1 
ATOM   4699 C  CD  . LYS D 1 111 ? 35.335  86.980  72.589  1.00 50.54  ? 257 LYS D CD  1 
ATOM   4700 C  CE  . LYS D 1 111 ? 36.718  87.167  73.196  1.00 51.00  ? 257 LYS D CE  1 
ATOM   4701 N  NZ  . LYS D 1 111 ? 37.703  86.185  72.650  1.00 51.57  ? 257 LYS D NZ  1 
ATOM   4702 N  N   . ALA D 1 112 ? 33.095  90.954  76.350  1.00 59.48  ? 258 ALA D N   1 
ATOM   4703 C  CA  . ALA D 1 112 ? 32.877  92.369  76.646  1.00 64.36  ? 258 ALA D CA  1 
ATOM   4704 C  C   . ALA D 1 112 ? 34.190  93.131  76.813  1.00 65.47  ? 258 ALA D C   1 
ATOM   4705 O  O   . ALA D 1 112 ? 34.870  93.005  77.833  1.00 64.72  ? 258 ALA D O   1 
ATOM   4706 C  CB  . ALA D 1 112 ? 32.013  92.523  77.892  1.00 64.02  ? 258 ALA D CB  1 
ATOM   4707 N  N   . GLY D 1 116 ? 38.387  93.336  76.130  1.00 64.28  ? 262 GLY D N   1 
ATOM   4708 C  CA  . GLY D 1 116 ? 37.233  92.550  75.726  1.00 63.22  ? 262 GLY D CA  1 
ATOM   4709 C  C   . GLY D 1 116 ? 37.418  91.050  75.907  1.00 63.71  ? 262 GLY D C   1 
ATOM   4710 O  O   . GLY D 1 116 ? 37.923  90.367  75.016  1.00 61.89  ? 262 GLY D O   1 
ATOM   4711 N  N   . ASP D 1 117 ? 37.001  90.531  77.061  1.00 61.37  ? 263 ASP D N   1 
ATOM   4712 C  CA  . ASP D 1 117 ? 37.171  89.113  77.368  1.00 54.75  ? 263 ASP D CA  1 
ATOM   4713 C  C   . ASP D 1 117 ? 35.846  88.399  77.590  1.00 47.66  ? 263 ASP D C   1 
ATOM   4714 O  O   . ASP D 1 117 ? 34.787  89.025  77.616  1.00 43.93  ? 263 ASP D O   1 
ATOM   4715 C  CB  . ASP D 1 117 ? 38.041  88.939  78.610  1.00 57.12  ? 263 ASP D CB  1 
ATOM   4716 C  CG  . ASP D 1 117 ? 39.492  89.261  78.352  1.00 63.39  ? 263 ASP D CG  1 
ATOM   4717 O  OD1 . ASP D 1 117 ? 39.883  89.324  77.166  1.00 65.09  ? 263 ASP D OD1 1 
ATOM   4718 O  OD2 . ASP D 1 117 ? 40.242  89.445  79.335  1.00 65.97  ? 263 ASP D OD2 1 
ATOM   4719 N  N   . TRP D 1 118 ? 35.918  87.081  77.759  1.00 42.21  ? 264 TRP D N   1 
ATOM   4720 C  CA  . TRP D 1 118 ? 34.735  86.286  78.054  1.00 38.54  ? 264 TRP D CA  1 
ATOM   4721 C  C   . TRP D 1 118 ? 34.149  86.691  79.398  1.00 41.55  ? 264 TRP D C   1 
ATOM   4722 O  O   . TRP D 1 118 ? 34.878  86.958  80.353  1.00 44.78  ? 264 TRP D O   1 
ATOM   4723 C  CB  . TRP D 1 118 ? 35.055  84.789  78.031  1.00 33.28  ? 264 TRP D CB  1 
ATOM   4724 C  CG  . TRP D 1 118 ? 35.239  84.258  76.638  1.00 37.84  ? 264 TRP D CG  1 
ATOM   4725 C  CD1 . TRP D 1 118 ? 36.405  83.839  76.064  1.00 37.97  ? 264 TRP D CD1 1 
ATOM   4726 C  CD2 . TRP D 1 118 ? 34.223  84.112  75.634  1.00 35.80  ? 264 TRP D CD2 1 
ATOM   4727 N  NE1 . TRP D 1 118 ? 36.176  83.434  74.772  1.00 39.05  ? 264 TRP D NE1 1 
ATOM   4728 C  CE2 . TRP D 1 118 ? 34.845  83.592  74.483  1.00 37.51  ? 264 TRP D CE2 1 
ATOM   4729 C  CE3 . TRP D 1 118 ? 32.847  84.365  75.602  1.00 33.34  ? 264 TRP D CE3 1 
ATOM   4730 C  CZ2 . TRP D 1 118 ? 34.140  83.323  73.308  1.00 34.36  ? 264 TRP D CZ2 1 
ATOM   4731 C  CZ3 . TRP D 1 118 ? 32.148  84.097  74.435  1.00 33.20  ? 264 TRP D CZ3 1 
ATOM   4732 C  CH2 . TRP D 1 118 ? 32.796  83.582  73.305  1.00 32.86  ? 264 TRP D CH2 1 
ATOM   4733 N  N   . SER D 1 119 ? 32.823  86.742  79.458  1.00 39.00  ? 265 SER D N   1 
ATOM   4734 C  CA  . SER D 1 119 ? 32.124  87.168  80.657  1.00 40.25  ? 265 SER D CA  1 
ATOM   4735 C  C   . SER D 1 119 ? 30.670  86.712  80.597  1.00 39.72  ? 265 SER D C   1 
ATOM   4736 O  O   . SER D 1 119 ? 30.180  86.336  79.535  1.00 39.60  ? 265 SER D O   1 
ATOM   4737 C  CB  . SER D 1 119 ? 32.197  88.686  80.794  1.00 41.01  ? 265 SER D CB  1 
ATOM   4738 O  OG  . SER D 1 119 ? 31.579  89.321  79.692  1.00 44.70  ? 265 SER D OG  1 
ATOM   4739 N  N   . TRP D 1 120 ? 29.994  86.737  81.744  1.00 35.40  ? 266 TRP D N   1 
ATOM   4740 C  CA  . TRP D 1 120 ? 28.584  86.371  81.829  1.00 31.67  ? 266 TRP D CA  1 
ATOM   4741 C  C   . TRP D 1 120 ? 27.712  87.614  81.807  1.00 33.34  ? 266 TRP D C   1 
ATOM   4742 O  O   . TRP D 1 120 ? 27.998  88.599  82.496  1.00 33.10  ? 266 TRP D O   1 
ATOM   4743 C  CB  . TRP D 1 120 ? 28.305  85.590  83.112  1.00 29.10  ? 266 TRP D CB  1 
ATOM   4744 C  CG  . TRP D 1 120 ? 29.061  84.321  83.204  1.00 33.40  ? 266 TRP D CG  1 
ATOM   4745 C  CD1 . TRP D 1 120 ? 30.130  84.059  84.010  1.00 34.51  ? 266 TRP D CD1 1 
ATOM   4746 C  CD2 . TRP D 1 120 ? 28.821  83.129  82.448  1.00 35.32  ? 266 TRP D CD2 1 
ATOM   4747 N  NE1 . TRP D 1 120 ? 30.567  82.772  83.806  1.00 39.61  ? 266 TRP D NE1 1 
ATOM   4748 C  CE2 . TRP D 1 120 ? 29.781  82.179  82.853  1.00 36.40  ? 266 TRP D CE2 1 
ATOM   4749 C  CE3 . TRP D 1 120 ? 27.883  82.770  81.470  1.00 36.62  ? 266 TRP D CE3 1 
ATOM   4750 C  CZ2 . TRP D 1 120 ? 29.832  80.894  82.317  1.00 36.21  ? 266 TRP D CZ2 1 
ATOM   4751 C  CZ3 . TRP D 1 120 ? 27.934  81.490  80.936  1.00 36.18  ? 266 TRP D CZ3 1 
ATOM   4752 C  CH2 . TRP D 1 120 ? 28.902  80.568  81.361  1.00 36.71  ? 266 TRP D CH2 1 
ATOM   4753 N  N   . VAL D 1 121 ? 26.634  87.562  81.034  1.00 28.46  ? 267 VAL D N   1 
ATOM   4754 C  CA  . VAL D 1 121 ? 25.762  88.719  80.906  1.00 29.12  ? 267 VAL D CA  1 
ATOM   4755 C  C   . VAL D 1 121 ? 25.007  88.980  82.204  1.00 26.35  ? 267 VAL D C   1 
ATOM   4756 O  O   . VAL D 1 121 ? 24.543  90.096  82.433  1.00 29.65  ? 267 VAL D O   1 
ATOM   4757 C  CB  . VAL D 1 121 ? 24.770  88.576  79.727  1.00 29.64  ? 267 VAL D CB  1 
ATOM   4758 C  CG1 . VAL D 1 121 ? 23.755  87.474  80.004  1.00 22.63  ? 267 VAL D CG1 1 
ATOM   4759 C  CG2 . VAL D 1 121 ? 24.065  89.910  79.459  1.00 31.71  ? 267 VAL D CG2 1 
ATOM   4760 N  N   . ASP D 1 122 ? 24.887  87.962  83.055  1.00 22.97  ? 268 ASP D N   1 
ATOM   4761 C  CA  . ASP D 1 122 ? 24.245  88.154  84.362  1.00 25.65  ? 268 ASP D CA  1 
ATOM   4762 C  C   . ASP D 1 122 ? 25.202  88.703  85.432  1.00 27.81  ? 268 ASP D C   1 
ATOM   4763 O  O   . ASP D 1 122 ? 24.866  88.731  86.615  1.00 31.99  ? 268 ASP D O   1 
ATOM   4764 C  CB  . ASP D 1 122 ? 23.569  86.871  84.857  1.00 26.15  ? 268 ASP D CB  1 
ATOM   4765 C  CG  . ASP D 1 122 ? 24.564  85.819  85.318  1.00 30.68  ? 268 ASP D CG  1 
ATOM   4766 O  OD1 . ASP D 1 122 ? 25.781  86.101  85.324  1.00 32.74  ? 268 ASP D OD1 1 
ATOM   4767 O  OD2 . ASP D 1 122 ? 24.129  84.701  85.669  1.00 28.50  ? 268 ASP D OD2 1 
ATOM   4768 N  N   . ASP D 1 123 ? 26.392  89.121  85.010  1.00 30.21  ? 269 ASP D N   1 
ATOM   4769 C  CA  . ASP D 1 123 ? 27.351  89.778  85.904  1.00 42.12  ? 269 ASP D CA  1 
ATOM   4770 C  C   . ASP D 1 123 ? 28.126  88.837  86.826  1.00 43.34  ? 269 ASP D C   1 
ATOM   4771 O  O   . ASP D 1 123 ? 28.907  89.295  87.665  1.00 45.15  ? 269 ASP D O   1 
ATOM   4772 C  CB  . ASP D 1 123 ? 26.670  90.858  86.743  1.00 50.88  ? 269 ASP D CB  1 
ATOM   4773 C  CG  . ASP D 1 123 ? 26.492  92.154  85.990  1.00 58.17  ? 269 ASP D CG  1 
ATOM   4774 O  OD1 . ASP D 1 123 ? 27.116  92.310  84.918  1.00 57.31  ? 269 ASP D OD1 1 
ATOM   4775 O  OD2 . ASP D 1 123 ? 25.734  93.020  86.479  1.00 63.61  ? 269 ASP D OD2 1 
ATOM   4776 N  N   . THR D 1 124 ? 27.906  87.533  86.687  1.00 34.87  ? 270 THR D N   1 
ATOM   4777 C  CA  . THR D 1 124 ? 28.753  86.572  87.372  1.00 32.91  ? 270 THR D CA  1 
ATOM   4778 C  C   . THR D 1 124 ? 30.173  86.747  86.848  1.00 37.33  ? 270 THR D C   1 
ATOM   4779 O  O   . THR D 1 124 ? 30.400  86.732  85.635  1.00 37.57  ? 270 THR D O   1 
ATOM   4780 C  CB  . THR D 1 124 ? 28.300  85.115  87.134  1.00 29.12  ? 270 THR D CB  1 
ATOM   4781 O  OG1 . THR D 1 124 ? 26.951  84.941  87.587  1.00 25.80  ? 270 THR D OG1 1 
ATOM   4782 C  CG2 . THR D 1 124 ? 29.215  84.140  87.882  1.00 28.96  ? 270 THR D CG2 1 
ATOM   4783 N  N   . PRO D 1 125 ? 31.138  86.941  87.756  1.00 39.86  ? 271 PRO D N   1 
ATOM   4784 C  CA  . PRO D 1 125 ? 32.530  87.038  87.308  1.00 41.99  ? 271 PRO D CA  1 
ATOM   4785 C  C   . PRO D 1 125 ? 32.953  85.763  86.590  1.00 45.05  ? 271 PRO D C   1 
ATOM   4786 O  O   . PRO D 1 125 ? 32.553  84.666  86.986  1.00 45.62  ? 271 PRO D O   1 
ATOM   4787 C  CB  . PRO D 1 125 ? 33.305  87.212  88.614  1.00 43.42  ? 271 PRO D CB  1 
ATOM   4788 C  CG  . PRO D 1 125 ? 32.316  87.847  89.544  1.00 43.75  ? 271 PRO D CG  1 
ATOM   4789 C  CD  . PRO D 1 125 ? 31.000  87.207  89.198  1.00 41.70  ? 271 PRO D CD  1 
ATOM   4790 N  N   . PHE D 1 126 ? 33.740  85.913  85.532  1.00 47.64  ? 272 PHE D N   1 
ATOM   4791 C  CA  . PHE D 1 126 ? 34.142  84.777  84.711  1.00 46.91  ? 272 PHE D CA  1 
ATOM   4792 C  C   . PHE D 1 126 ? 35.597  84.405  84.972  1.00 45.98  ? 272 PHE D C   1 
ATOM   4793 O  O   . PHE D 1 126 ? 36.505  85.200  84.731  1.00 45.83  ? 272 PHE D O   1 
ATOM   4794 C  CB  . PHE D 1 126 ? 33.934  85.096  83.222  1.00 42.90  ? 272 PHE D CB  1 
ATOM   4795 C  CG  . PHE D 1 126 ? 34.334  83.979  82.297  1.00 39.36  ? 272 PHE D CG  1 
ATOM   4796 C  CD1 . PHE D 1 126 ? 33.384  83.107  81.789  1.00 35.61  ? 272 PHE D CD1 1 
ATOM   4797 C  CD2 . PHE D 1 126 ? 35.661  83.803  81.935  1.00 36.82  ? 272 PHE D CD2 1 
ATOM   4798 C  CE1 . PHE D 1 126 ? 33.751  82.082  80.942  1.00 33.71  ? 272 PHE D CE1 1 
ATOM   4799 C  CE2 . PHE D 1 126 ? 36.035  82.781  81.092  1.00 35.37  ? 272 PHE D CE2 1 
ATOM   4800 C  CZ  . PHE D 1 126 ? 35.077  81.919  80.590  1.00 36.41  ? 272 PHE D CZ  1 
ATOM   4801 N  N   . ASN D 1 127 ? 35.817  83.191  85.459  1.00 47.08  ? 273 ASN D N   1 
ATOM   4802 C  CA  . ASN D 1 127 ? 37.175  82.715  85.668  1.00 51.60  ? 273 ASN D CA  1 
ATOM   4803 C  C   . ASN D 1 127 ? 37.640  81.802  84.543  1.00 45.12  ? 273 ASN D C   1 
ATOM   4804 O  O   . ASN D 1 127 ? 37.113  80.705  84.360  1.00 41.91  ? 273 ASN D O   1 
ATOM   4805 C  CB  . ASN D 1 127 ? 37.317  82.009  87.016  1.00 58.97  ? 273 ASN D CB  1 
ATOM   4806 C  CG  . ASN D 1 127 ? 38.755  81.662  87.333  1.00 66.14  ? 273 ASN D CG  1 
ATOM   4807 O  OD1 . ASN D 1 127 ? 39.286  80.665  86.843  1.00 68.34  ? 273 ASN D OD1 1 
ATOM   4808 N  ND2 . ASN D 1 127 ? 39.402  82.495  88.143  1.00 69.17  ? 273 ASN D ND2 1 
ATOM   4809 N  N   . LYS D 1 128 ? 38.635  82.269  83.800  1.00 46.73  ? 274 LYS D N   1 
ATOM   4810 C  CA  . LYS D 1 128 ? 39.149  81.548  82.644  1.00 53.49  ? 274 LYS D CA  1 
ATOM   4811 C  C   . LYS D 1 128 ? 39.574  80.128  83.014  1.00 54.06  ? 274 LYS D C   1 
ATOM   4812 O  O   . LYS D 1 128 ? 39.161  79.153  82.382  1.00 54.41  ? 274 LYS D O   1 
ATOM   4813 C  CB  . LYS D 1 128 ? 40.329  82.313  82.043  1.00 59.08  ? 274 LYS D CB  1 
ATOM   4814 C  CG  . LYS D 1 128 ? 40.649  81.954  80.602  1.00 64.02  ? 274 LYS D CG  1 
ATOM   4815 C  CD  . LYS D 1 128 ? 40.502  83.168  79.692  1.00 67.28  ? 274 LYS D CD  1 
ATOM   4816 C  CE  . LYS D 1 128 ? 40.908  82.841  78.262  1.00 68.81  ? 274 LYS D CE  1 
ATOM   4817 N  NZ  . LYS D 1 128 ? 42.317  82.361  78.182  1.00 68.92  ? 274 LYS D NZ  1 
ATOM   4818 N  N   . VAL D 1 129 ? 40.397  80.022  84.050  1.00 53.44  ? 275 VAL D N   1 
ATOM   4819 C  CA  . VAL D 1 129 ? 40.948  78.741  84.476  1.00 54.37  ? 275 VAL D CA  1 
ATOM   4820 C  C   . VAL D 1 129 ? 39.874  77.733  84.894  1.00 51.58  ? 275 VAL D C   1 
ATOM   4821 O  O   . VAL D 1 129 ? 39.919  76.565  84.500  1.00 49.76  ? 275 VAL D O   1 
ATOM   4822 C  CB  . VAL D 1 129 ? 41.953  78.941  85.621  1.00 60.54  ? 275 VAL D CB  1 
ATOM   4823 C  CG1 . VAL D 1 129 ? 42.440  77.600  86.149  1.00 64.45  ? 275 VAL D CG1 1 
ATOM   4824 C  CG2 . VAL D 1 129 ? 43.119  79.806  85.147  1.00 60.70  ? 275 VAL D CG2 1 
ATOM   4825 N  N   . GLN D 1 130 ? 38.908  78.188  85.686  1.00 53.69  ? 276 GLN D N   1 
ATOM   4826 C  CA  . GLN D 1 130 ? 37.819  77.330  86.150  1.00 57.54  ? 276 GLN D CA  1 
ATOM   4827 C  C   . GLN D 1 130 ? 36.956  76.815  85.000  1.00 54.01  ? 276 GLN D C   1 
ATOM   4828 O  O   . GLN D 1 130 ? 36.554  75.653  84.990  1.00 50.75  ? 276 GLN D O   1 
ATOM   4829 C  CB  . GLN D 1 130 ? 36.928  78.082  87.144  1.00 63.61  ? 276 GLN D CB  1 
ATOM   4830 C  CG  . GLN D 1 130 ? 37.658  78.644  88.351  1.00 70.56  ? 276 GLN D CG  1 
ATOM   4831 C  CD  . GLN D 1 130 ? 38.003  77.582  89.377  1.00 76.19  ? 276 GLN D CD  1 
ATOM   4832 O  OE1 . GLN D 1 130 ? 37.119  76.903  89.904  1.00 78.50  ? 276 GLN D OE1 1 
ATOM   4833 N  NE2 . GLN D 1 130 ? 39.292  77.439  89.674  1.00 75.93  ? 276 GLN D NE2 1 
ATOM   4834 N  N   . SER D 1 131 ? 36.671  77.689  84.038  1.00 54.02  ? 277 SER D N   1 
ATOM   4835 C  CA  . SER D 1 131 ? 35.738  77.372  82.960  1.00 51.24  ? 277 SER D CA  1 
ATOM   4836 C  C   . SER D 1 131 ? 36.372  76.578  81.824  1.00 51.04  ? 277 SER D C   1 
ATOM   4837 O  O   . SER D 1 131 ? 35.666  76.010  80.988  1.00 50.47  ? 277 SER D O   1 
ATOM   4838 C  CB  . SER D 1 131 ? 35.121  78.655  82.402  1.00 50.76  ? 277 SER D CB  1 
ATOM   4839 O  OG  . SER D 1 131 ? 34.398  79.347  83.400  1.00 51.54  ? 277 SER D OG  1 
ATOM   4840 N  N   . ALA D 1 132 ? 37.700  76.542  81.800  1.00 50.50  ? 278 ALA D N   1 
ATOM   4841 C  CA  . ALA D 1 132 ? 38.442  75.946  80.691  1.00 51.06  ? 278 ALA D CA  1 
ATOM   4842 C  C   . ALA D 1 132 ? 37.878  74.602  80.237  1.00 53.17  ? 278 ALA D C   1 
ATOM   4843 O  O   . ALA D 1 132 ? 37.778  74.332  79.036  1.00 54.55  ? 278 ALA D O   1 
ATOM   4844 C  CB  . ALA D 1 132 ? 39.919  75.812  81.050  1.00 50.60  ? 278 ALA D CB  1 
ATOM   4845 N  N   . ARG D 1 133 ? 37.501  73.769  81.199  1.00 52.96  ? 279 ARG D N   1 
ATOM   4846 C  CA  . ARG D 1 133 ? 37.087  72.404  80.901  1.00 52.69  ? 279 ARG D CA  1 
ATOM   4847 C  C   . ARG D 1 133 ? 35.652  72.300  80.387  1.00 47.53  ? 279 ARG D C   1 
ATOM   4848 O  O   . ARG D 1 133 ? 35.223  71.231  79.951  1.00 46.54  ? 279 ARG D O   1 
ATOM   4849 C  CB  . ARG D 1 133 ? 37.267  71.518  82.133  1.00 57.89  ? 279 ARG D CB  1 
ATOM   4850 C  CG  . ARG D 1 133 ? 36.393  71.910  83.304  1.00 62.20  ? 279 ARG D CG  1 
ATOM   4851 C  CD  . ARG D 1 133 ? 36.633  70.999  84.493  1.00 68.97  ? 279 ARG D CD  1 
ATOM   4852 N  NE  . ARG D 1 133 ? 35.766  71.339  85.616  1.00 74.44  ? 279 ARG D NE  1 
ATOM   4853 C  CZ  . ARG D 1 133 ? 35.996  72.339  86.461  1.00 78.36  ? 279 ARG D CZ  1 
ATOM   4854 N  NH1 . ARG D 1 133 ? 35.152  72.577  87.457  1.00 79.06  ? 279 ARG D NH1 1 
ATOM   4855 N  NH2 . ARG D 1 133 ? 37.069  73.104  86.310  1.00 79.77  ? 279 ARG D NH2 1 
ATOM   4856 N  N   . PHE D 1 134 ? 34.908  73.399  80.437  1.00 43.78  ? 280 PHE D N   1 
ATOM   4857 C  CA  . PHE D 1 134 ? 33.521  73.378  79.967  1.00 40.99  ? 280 PHE D CA  1 
ATOM   4858 C  C   . PHE D 1 134 ? 33.396  73.683  78.474  1.00 36.78  ? 280 PHE D C   1 
ATOM   4859 O  O   . PHE D 1 134 ? 32.295  73.675  77.923  1.00 39.05  ? 280 PHE D O   1 
ATOM   4860 C  CB  . PHE D 1 134 ? 32.643  74.334  80.779  1.00 40.69  ? 280 PHE D CB  1 
ATOM   4861 C  CG  . PHE D 1 134 ? 32.499  73.950  82.225  1.00 38.93  ? 280 PHE D CG  1 
ATOM   4862 C  CD1 . PHE D 1 134 ? 32.426  72.615  82.600  1.00 40.85  ? 280 PHE D CD1 1 
ATOM   4863 C  CD2 . PHE D 1 134 ? 32.419  74.921  83.210  1.00 35.62  ? 280 PHE D CD2 1 
ATOM   4864 C  CE1 . PHE D 1 134 ? 32.288  72.254  83.939  1.00 39.63  ? 280 PHE D CE1 1 
ATOM   4865 C  CE2 . PHE D 1 134 ? 32.279  74.571  84.541  1.00 37.58  ? 280 PHE D CE2 1 
ATOM   4866 C  CZ  . PHE D 1 134 ? 32.212  73.233  84.908  1.00 37.59  ? 280 PHE D CZ  1 
ATOM   4867 N  N   . TRP D 1 135 ? 34.526  73.936  77.823  1.00 34.50  ? 281 TRP D N   1 
ATOM   4868 C  CA  . TRP D 1 135 ? 34.538  74.213  76.389  1.00 37.71  ? 281 TRP D CA  1 
ATOM   4869 C  C   . TRP D 1 135 ? 34.640  72.931  75.576  1.00 40.47  ? 281 TRP D C   1 
ATOM   4870 O  O   . TRP D 1 135 ? 35.184  71.932  76.040  1.00 43.37  ? 281 TRP D O   1 
ATOM   4871 C  CB  . TRP D 1 135 ? 35.724  75.110  76.022  1.00 39.27  ? 281 TRP D CB  1 
ATOM   4872 C  CG  . TRP D 1 135 ? 35.596  76.537  76.455  1.00 38.92  ? 281 TRP D CG  1 
ATOM   4873 C  CD1 . TRP D 1 135 ? 36.184  77.122  77.540  1.00 38.96  ? 281 TRP D CD1 1 
ATOM   4874 C  CD2 . TRP D 1 135 ? 34.843  77.566  75.803  1.00 39.82  ? 281 TRP D CD2 1 
ATOM   4875 N  NE1 . TRP D 1 135 ? 35.840  78.454  77.606  1.00 38.33  ? 281 TRP D NE1 1 
ATOM   4876 C  CE2 . TRP D 1 135 ? 35.016  78.751  76.552  1.00 39.91  ? 281 TRP D CE2 1 
ATOM   4877 C  CE3 . TRP D 1 135 ? 34.036  77.602  74.661  1.00 39.54  ? 281 TRP D CE3 1 
ATOM   4878 C  CZ2 . TRP D 1 135 ? 34.409  79.955  76.196  1.00 38.42  ? 281 TRP D CZ2 1 
ATOM   4879 C  CZ3 . TRP D 1 135 ? 33.436  78.800  74.308  1.00 38.85  ? 281 TRP D CZ3 1 
ATOM   4880 C  CH2 . TRP D 1 135 ? 33.627  79.959  75.072  1.00 38.16  ? 281 TRP D CH2 1 
ATOM   4881 N  N   . ILE D 1 136 ? 34.114  72.959  74.358  1.00 41.51  ? 282 ILE D N   1 
ATOM   4882 C  CA  . ILE D 1 136 ? 34.428  71.915  73.400  1.00 40.90  ? 282 ILE D CA  1 
ATOM   4883 C  C   . ILE D 1 136 ? 35.929  72.013  73.178  1.00 43.69  ? 282 ILE D C   1 
ATOM   4884 O  O   . ILE D 1 136 ? 36.448  73.107  72.965  1.00 42.94  ? 282 ILE D O   1 
ATOM   4885 C  CB  . ILE D 1 136 ? 33.696  72.127  72.063  1.00 38.02  ? 282 ILE D CB  1 
ATOM   4886 C  CG1 . ILE D 1 136 ? 32.189  71.946  72.238  1.00 38.87  ? 282 ILE D CG1 1 
ATOM   4887 C  CG2 . ILE D 1 136 ? 34.215  71.165  71.008  1.00 37.70  ? 282 ILE D CG2 1 
ATOM   4888 C  CD1 . ILE D 1 136 ? 31.392  72.194  70.959  1.00 37.50  ? 282 ILE D CD1 1 
ATOM   4889 N  N   . PRO D 1 137 ? 36.644  70.879  73.250  1.00 46.71  ? 283 PRO D N   1 
ATOM   4890 C  CA  . PRO D 1 137 ? 38.097  70.962  73.076  1.00 47.71  ? 283 PRO D CA  1 
ATOM   4891 C  C   . PRO D 1 137 ? 38.412  71.692  71.780  1.00 48.09  ? 283 PRO D C   1 
ATOM   4892 O  O   . PRO D 1 137 ? 37.871  71.322  70.736  1.00 46.61  ? 283 PRO D O   1 
ATOM   4893 C  CB  . PRO D 1 137 ? 38.525  69.495  72.975  1.00 47.05  ? 283 PRO D CB  1 
ATOM   4894 C  CG  . PRO D 1 137 ? 37.449  68.736  73.662  1.00 46.88  ? 283 PRO D CG  1 
ATOM   4895 C  CD  . PRO D 1 137 ? 36.177  69.490  73.389  1.00 46.80  ? 283 PRO D CD  1 
ATOM   4896 N  N   . GLY D 1 138 ? 39.252  72.720  71.852  1.00 47.30  ? 284 GLY D N   1 
ATOM   4897 C  CA  . GLY D 1 138 ? 39.571  73.518  70.684  1.00 47.14  ? 284 GLY D CA  1 
ATOM   4898 C  C   . GLY D 1 138 ? 38.699  74.756  70.554  1.00 49.08  ? 284 GLY D C   1 
ATOM   4899 O  O   . GLY D 1 138 ? 38.780  75.485  69.563  1.00 52.59  ? 284 GLY D O   1 
ATOM   4900 N  N   . GLU D 1 139 ? 37.853  74.989  71.552  1.00 44.32  ? 285 GLU D N   1 
ATOM   4901 C  CA  . GLU D 1 139 ? 37.066  76.213  71.619  1.00 41.84  ? 285 GLU D CA  1 
ATOM   4902 C  C   . GLU D 1 139 ? 37.502  76.993  72.851  1.00 42.26  ? 285 GLU D C   1 
ATOM   4903 O  O   . GLU D 1 139 ? 37.907  76.395  73.848  1.00 41.82  ? 285 GLU D O   1 
ATOM   4904 C  CB  . GLU D 1 139 ? 35.574  75.888  71.699  1.00 41.01  ? 285 GLU D CB  1 
ATOM   4905 C  CG  . GLU D 1 139 ? 35.047  75.078  70.528  1.00 40.64  ? 285 GLU D CG  1 
ATOM   4906 C  CD  . GLU D 1 139 ? 34.990  75.871  69.234  1.00 43.63  ? 285 GLU D CD  1 
ATOM   4907 O  OE1 . GLU D 1 139 ? 34.697  77.087  69.279  1.00 45.18  ? 285 GLU D OE1 1 
ATOM   4908 O  OE2 . GLU D 1 139 ? 35.228  75.271  68.165  1.00 44.30  ? 285 GLU D OE2 1 
ATOM   4909 N  N   . PRO D 1 140 ? 37.411  78.332  72.801  1.00 43.96  ? 286 PRO D N   1 
ATOM   4910 C  CA  . PRO D 1 140 ? 36.862  79.158  71.717  1.00 44.61  ? 286 PRO D CA  1 
ATOM   4911 C  C   . PRO D 1 140 ? 37.864  79.376  70.593  1.00 46.99  ? 286 PRO D C   1 
ATOM   4912 O  O   . PRO D 1 140 ? 38.989  79.801  70.853  1.00 51.30  ? 286 PRO D O   1 
ATOM   4913 C  CB  . PRO D 1 140 ? 36.591  80.508  72.401  1.00 44.62  ? 286 PRO D CB  1 
ATOM   4914 C  CG  . PRO D 1 140 ? 36.919  80.309  73.876  1.00 44.31  ? 286 PRO D CG  1 
ATOM   4915 C  CD  . PRO D 1 140 ? 37.858  79.157  73.933  1.00 42.44  ? 286 PRO D CD  1 
ATOM   4916 N  N   . ASN D 1 141 ? 37.450  79.116  69.357  1.00 43.46  ? 287 ASN D N   1 
ATOM   4917 C  CA  . ASN D 1 141 ? 38.333  79.274  68.209  1.00 43.99  ? 287 ASN D CA  1 
ATOM   4918 C  C   . ASN D 1 141 ? 38.195  80.632  67.519  1.00 42.24  ? 287 ASN D C   1 
ATOM   4919 O  O   . ASN D 1 141 ? 39.046  81.015  66.718  1.00 43.44  ? 287 ASN D O   1 
ATOM   4920 C  CB  . ASN D 1 141 ? 38.088  78.152  67.199  1.00 49.37  ? 287 ASN D CB  1 
ATOM   4921 C  CG  . ASN D 1 141 ? 36.692  78.199  66.602  1.00 51.77  ? 287 ASN D CG  1 
ATOM   4922 O  OD1 . ASN D 1 141 ? 35.821  78.922  67.086  1.00 51.17  ? 287 ASN D OD1 1 
ATOM   4923 N  ND2 . ASN D 1 141 ? 36.473  77.425  65.544  1.00 52.42  ? 287 ASN D ND2 1 
ATOM   4924 N  N   . ASN D 1 142 ? 37.120  81.349  67.828  1.00 42.35  ? 288 ASN D N   1 
ATOM   4925 C  CA  . ASN D 1 142 ? 36.833  82.635  67.193  1.00 42.72  ? 288 ASN D CA  1 
ATOM   4926 C  C   . ASN D 1 142 ? 36.955  82.586  65.671  1.00 43.81  ? 288 ASN D C   1 
ATOM   4927 O  O   . ASN D 1 142 ? 37.643  83.418  65.067  1.00 42.93  ? 288 ASN D O   1 
ATOM   4928 C  CB  . ASN D 1 142 ? 37.732  83.741  67.753  1.00 43.12  ? 288 ASN D CB  1 
ATOM   4929 C  CG  . ASN D 1 142 ? 37.170  85.130  67.501  1.00 45.99  ? 288 ASN D CG  1 
ATOM   4930 O  OD1 . ASN D 1 142 ? 35.964  85.302  67.318  1.00 44.17  ? 288 ASN D OD1 1 
ATOM   4931 N  ND2 . ASN D 1 142 ? 38.042  86.128  67.496  1.00 50.06  ? 288 ASN D ND2 1 
ATOM   4932 N  N   . ALA D 1 143 ? 36.289  81.604  65.063  1.00 40.55  ? 289 ALA D N   1 
ATOM   4933 C  CA  . ALA D 1 143 ? 36.285  81.440  63.612  1.00 37.04  ? 289 ALA D CA  1 
ATOM   4934 C  C   . ALA D 1 143 ? 35.540  82.594  62.939  1.00 38.84  ? 289 ALA D C   1 
ATOM   4935 O  O   . ALA D 1 143 ? 34.396  82.893  63.284  1.00 36.99  ? 289 ALA D O   1 
ATOM   4936 C  CB  . ALA D 1 143 ? 35.655  80.097  63.229  1.00 33.45  ? 289 ALA D CB  1 
ATOM   4937 N  N   . GLY D 1 144 ? 36.193  83.233  61.973  1.00 42.68  ? 290 GLY D N   1 
ATOM   4938 C  CA  . GLY D 1 144 ? 35.654  84.430  61.352  1.00 44.54  ? 290 GLY D CA  1 
ATOM   4939 C  C   . GLY D 1 144 ? 35.998  85.661  62.173  1.00 46.91  ? 290 GLY D C   1 
ATOM   4940 O  O   . GLY D 1 144 ? 35.675  86.785  61.791  1.00 49.36  ? 290 GLY D O   1 
ATOM   4941 N  N   . ASN D 1 145 ? 36.665  85.438  63.303  1.00 45.51  ? 291 ASN D N   1 
ATOM   4942 C  CA  . ASN D 1 145 ? 37.050  86.509  64.224  1.00 48.18  ? 291 ASN D CA  1 
ATOM   4943 C  C   . ASN D 1 145 ? 35.872  87.375  64.642  1.00 46.27  ? 291 ASN D C   1 
ATOM   4944 O  O   . ASN D 1 145 ? 36.028  88.572  64.884  1.00 42.16  ? 291 ASN D O   1 
ATOM   4945 C  CB  . ASN D 1 145 ? 38.149  87.394  63.624  1.00 49.39  ? 291 ASN D CB  1 
ATOM   4946 C  CG  . ASN D 1 145 ? 38.982  88.090  64.689  1.00 48.41  ? 291 ASN D CG  1 
ATOM   4947 O  OD1 . ASN D 1 145 ? 39.728  87.442  65.424  1.00 50.11  ? 291 ASN D OD1 1 
ATOM   4948 N  ND2 . ASN D 1 145 ? 38.864  89.413  64.774  1.00 43.95  ? 291 ASN D ND2 1 
ATOM   4949 N  N   . ASN D 1 146 ? 34.697  86.763  64.731  1.00 48.22  ? 292 ASN D N   1 
ATOM   4950 C  CA  . ASN D 1 146 ? 33.482  87.492  65.058  1.00 50.76  ? 292 ASN D CA  1 
ATOM   4951 C  C   . ASN D 1 146 ? 32.596  86.710  66.019  1.00 48.57  ? 292 ASN D C   1 
ATOM   4952 O  O   . ASN D 1 146 ? 31.441  87.070  66.246  1.00 49.94  ? 292 ASN D O   1 
ATOM   4953 C  CB  . ASN D 1 146 ? 32.709  87.821  63.777  1.00 55.83  ? 292 ASN D CB  1 
ATOM   4954 C  CG  . ASN D 1 146 ? 31.673  88.907  63.984  1.00 60.78  ? 292 ASN D CG  1 
ATOM   4955 O  OD1 . ASN D 1 146 ? 31.928  89.910  64.657  1.00 61.93  ? 292 ASN D OD1 1 
ATOM   4956 N  ND2 . ASN D 1 146 ? 30.496  88.718  63.396  1.00 62.60  ? 292 ASN D ND2 1 
ATOM   4957 N  N   . GLU D 1 147 ? 33.140  85.637  66.583  1.00 46.16  ? 293 GLU D N   1 
ATOM   4958 C  CA  . GLU D 1 147 ? 32.387  84.803  67.513  1.00 46.60  ? 293 GLU D CA  1 
ATOM   4959 C  C   . GLU D 1 147 ? 32.496  85.351  68.940  1.00 45.18  ? 293 GLU D C   1 
ATOM   4960 O  O   . GLU D 1 147 ? 33.370  84.951  69.712  1.00 45.11  ? 293 GLU D O   1 
ATOM   4961 C  CB  . GLU D 1 147 ? 32.858  83.348  67.431  1.00 49.55  ? 293 GLU D CB  1 
ATOM   4962 C  CG  . GLU D 1 147 ? 32.985  82.849  65.999  1.00 55.79  ? 293 GLU D CG  1 
ATOM   4963 C  CD  . GLU D 1 147 ? 32.968  81.335  65.875  1.00 62.26  ? 293 GLU D CD  1 
ATOM   4964 O  OE1 . GLU D 1 147 ? 33.556  80.639  66.735  1.00 64.19  ? 293 GLU D OE1 1 
ATOM   4965 O  OE2 . GLU D 1 147 ? 32.365  80.840  64.899  1.00 65.69  ? 293 GLU D OE2 1 
ATOM   4966 N  N   . HIS D 1 148 ? 31.595  86.272  69.272  1.00 42.63  ? 294 HIS D N   1 
ATOM   4967 C  CA  . HIS D 1 148 ? 31.622  86.980  70.547  1.00 40.24  ? 294 HIS D CA  1 
ATOM   4968 C  C   . HIS D 1 148 ? 30.629  86.417  71.557  1.00 33.30  ? 294 HIS D C   1 
ATOM   4969 O  O   . HIS D 1 148 ? 30.416  87.007  72.612  1.00 35.20  ? 294 HIS D O   1 
ATOM   4970 C  CB  . HIS D 1 148 ? 31.319  88.465  70.336  1.00 48.32  ? 294 HIS D CB  1 
ATOM   4971 C  CG  . HIS D 1 148 ? 32.313  89.173  69.471  1.00 58.93  ? 294 HIS D CG  1 
ATOM   4972 N  ND1 . HIS D 1 148 ? 32.124  89.358  68.117  1.00 64.03  ? 294 HIS D ND1 1 
ATOM   4973 C  CD2 . HIS D 1 148 ? 33.501  89.752  69.767  1.00 63.55  ? 294 HIS D CD2 1 
ATOM   4974 C  CE1 . HIS D 1 148 ? 33.156  90.014  67.617  1.00 66.99  ? 294 HIS D CE1 1 
ATOM   4975 N  NE2 . HIS D 1 148 ? 34.005  90.265  68.597  1.00 67.78  ? 294 HIS D NE2 1 
ATOM   4976 N  N   . CYS D 1 149 ? 30.013  85.285  71.230  1.00 27.67  ? 295 CYS D N   1 
ATOM   4977 C  CA  . CYS D 1 149 ? 29.028  84.672  72.115  1.00 23.05  ? 295 CYS D CA  1 
ATOM   4978 C  C   . CYS D 1 149 ? 29.206  83.169  72.200  1.00 25.04  ? 295 CYS D C   1 
ATOM   4979 O  O   . CYS D 1 149 ? 29.822  82.560  71.329  1.00 27.42  ? 295 CYS D O   1 
ATOM   4980 C  CB  . CYS D 1 149 ? 27.608  85.009  71.668  1.00 23.18  ? 295 CYS D CB  1 
ATOM   4981 S  SG  . CYS D 1 149 ? 27.255  86.777  71.728  1.00 32.57  ? 295 CYS D SG  1 
ATOM   4982 N  N   . GLY D 1 150 ? 28.661  82.578  73.258  1.00 25.60  ? 296 GLY D N   1 
ATOM   4983 C  CA  . GLY D 1 150 ? 28.807  81.157  73.497  1.00 24.53  ? 296 GLY D CA  1 
ATOM   4984 C  C   . GLY D 1 150 ? 27.476  80.446  73.638  1.00 22.12  ? 296 GLY D C   1 
ATOM   4985 O  O   . GLY D 1 150 ? 26.500  81.019  74.107  1.00 24.81  ? 296 GLY D O   1 
ATOM   4986 N  N   . ASN D 1 151 ? 27.442  79.187  73.224  1.00 21.48  ? 297 ASN D N   1 
ATOM   4987 C  CA  . ASN D 1 151 ? 26.245  78.375  73.364  1.00 26.81  ? 297 ASN D CA  1 
ATOM   4988 C  C   . ASN D 1 151 ? 26.600  76.993  73.876  1.00 27.57  ? 297 ASN D C   1 
ATOM   4989 O  O   . ASN D 1 151 ? 27.774  76.615  73.907  1.00 27.88  ? 297 ASN D O   1 
ATOM   4990 C  CB  . ASN D 1 151 ? 25.499  78.267  72.022  1.00 24.72  ? 297 ASN D CB  1 
ATOM   4991 C  CG  . ASN D 1 151 ? 26.380  77.754  70.904  1.00 25.50  ? 297 ASN D CG  1 
ATOM   4992 O  OD1 . ASN D 1 151 ? 27.129  76.794  71.076  1.00 27.24  ? 297 ASN D OD1 1 
ATOM   4993 N  ND2 . ASN D 1 151 ? 26.289  78.390  69.743  1.00 28.37  ? 297 ASN D ND2 1 
ATOM   4994 N  N   . ILE D 1 152 ? 25.583  76.249  74.292  1.00 27.81  ? 298 ILE D N   1 
ATOM   4995 C  CA  . ILE D 1 152 ? 25.759  74.837  74.597  1.00 28.28  ? 298 ILE D CA  1 
ATOM   4996 C  C   . ILE D 1 152 ? 25.509  74.021  73.340  1.00 29.71  ? 298 ILE D C   1 
ATOM   4997 O  O   . ILE D 1 152 ? 24.407  74.021  72.783  1.00 34.68  ? 298 ILE D O   1 
ATOM   4998 C  CB  . ILE D 1 152 ? 24.854  74.374  75.747  1.00 30.83  ? 298 ILE D CB  1 
ATOM   4999 C  CG1 . ILE D 1 152 ? 25.418  74.885  77.072  1.00 35.87  ? 298 ILE D CG1 1 
ATOM   5000 C  CG2 . ILE D 1 152 ? 24.774  72.858  75.791  1.00 31.21  ? 298 ILE D CG2 1 
ATOM   5001 C  CD1 . ILE D 1 152 ? 24.692  74.371  78.290  1.00 36.73  ? 298 ILE D CD1 1 
ATOM   5002 N  N   . LYS D 1 153 ? 26.555  73.343  72.886  1.00 29.89  ? 299 LYS D N   1 
ATOM   5003 C  CA  . LYS D 1 153 ? 26.512  72.614  71.629  1.00 28.88  ? 299 LYS D CA  1 
ATOM   5004 C  C   . LYS D 1 153 ? 26.688  71.106  71.816  1.00 33.37  ? 299 LYS D C   1 
ATOM   5005 O  O   . LYS D 1 153 ? 25.791  70.327  71.503  1.00 35.70  ? 299 LYS D O   1 
ATOM   5006 C  CB  . LYS D 1 153 ? 27.591  73.153  70.696  1.00 27.64  ? 299 LYS D CB  1 
ATOM   5007 C  CG  . LYS D 1 153 ? 27.739  72.398  69.396  1.00 30.23  ? 299 LYS D CG  1 
ATOM   5008 C  CD  . LYS D 1 153 ? 28.730  73.115  68.492  1.00 33.76  ? 299 LYS D CD  1 
ATOM   5009 C  CE  . LYS D 1 153 ? 29.159  72.236  67.331  1.00 38.48  ? 299 LYS D CE  1 
ATOM   5010 N  NZ  . LYS D 1 153 ? 30.139  72.925  66.441  1.00 40.96  ? 299 LYS D NZ  1 
ATOM   5011 N  N   . ALA D 1 154 ? 27.846  70.702  72.328  1.00 32.71  ? 300 ALA D N   1 
ATOM   5012 C  CA  . ALA D 1 154 ? 28.179  69.287  72.443  1.00 36.52  ? 300 ALA D CA  1 
ATOM   5013 C  C   . ALA D 1 154 ? 27.532  68.653  73.673  1.00 38.69  ? 300 ALA D C   1 
ATOM   5014 O  O   . ALA D 1 154 ? 27.523  69.252  74.749  1.00 36.12  ? 300 ALA D O   1 
ATOM   5015 C  CB  . ALA D 1 154 ? 29.688  69.103  72.476  1.00 38.20  ? 300 ALA D CB  1 
ATOM   5016 N  N   . PRO D 1 155 ? 26.984  67.437  73.510  1.00 37.91  ? 301 PRO D N   1 
ATOM   5017 C  CA  . PRO D 1 155 ? 26.313  66.720  74.600  1.00 40.25  ? 301 PRO D CA  1 
ATOM   5018 C  C   . PRO D 1 155 ? 27.301  66.134  75.603  1.00 43.02  ? 301 PRO D C   1 
ATOM   5019 O  O   . PRO D 1 155 ? 27.465  64.916  75.661  1.00 43.82  ? 301 PRO D O   1 
ATOM   5020 C  CB  . PRO D 1 155 ? 25.572  65.594  73.870  1.00 40.25  ? 301 PRO D CB  1 
ATOM   5021 C  CG  . PRO D 1 155 ? 26.392  65.349  72.644  1.00 39.72  ? 301 PRO D CG  1 
ATOM   5022 C  CD  . PRO D 1 155 ? 26.887  66.710  72.231  1.00 38.83  ? 301 PRO D CD  1 
ATOM   5023 N  N   . SER D 1 156 ? 27.948  66.997  76.381  1.00 42.64  ? 302 SER D N   1 
ATOM   5024 C  CA  . SER D 1 156 ? 28.875  66.559  77.416  1.00 41.13  ? 302 SER D CA  1 
ATOM   5025 C  C   . SER D 1 156 ? 29.362  67.755  78.219  1.00 43.70  ? 302 SER D C   1 
ATOM   5026 O  O   . SER D 1 156 ? 29.031  68.897  77.902  1.00 46.66  ? 302 SER D O   1 
ATOM   5027 C  CB  . SER D 1 156 ? 30.069  65.836  76.801  1.00 41.36  ? 302 SER D CB  1 
ATOM   5028 O  OG  . SER D 1 156 ? 31.235  66.633  76.900  1.00 43.07  ? 302 SER D OG  1 
ATOM   5029 N  N   . LEU D 1 157 ? 30.149  67.493  79.258  1.00 39.61  ? 303 LEU D N   1 
ATOM   5030 C  CA  . LEU D 1 157 ? 30.694  68.559  80.092  1.00 35.42  ? 303 LEU D CA  1 
ATOM   5031 C  C   . LEU D 1 157 ? 31.547  69.522  79.285  1.00 34.83  ? 303 LEU D C   1 
ATOM   5032 O  O   . LEU D 1 157 ? 31.671  70.696  79.630  1.00 33.85  ? 303 LEU D O   1 
ATOM   5033 C  CB  . LEU D 1 157 ? 31.527  67.982  81.232  1.00 35.56  ? 303 LEU D CB  1 
ATOM   5034 C  CG  . LEU D 1 157 ? 30.742  67.365  82.385  1.00 36.72  ? 303 LEU D CG  1 
ATOM   5035 C  CD1 . LEU D 1 157 ? 31.709  66.785  83.407  1.00 36.66  ? 303 LEU D CD1 1 
ATOM   5036 C  CD2 . LEU D 1 157 ? 29.809  68.396  83.020  1.00 31.01  ? 303 LEU D CD2 1 
ATOM   5037 N  N   . GLN D 1 158 ? 32.165  69.010  78.228  1.00 36.13  ? 304 GLN D N   1 
ATOM   5038 C  CA  . GLN D 1 158 ? 32.886  69.852  77.288  1.00 36.42  ? 304 GLN D CA  1 
ATOM   5039 C  C   . GLN D 1 158 ? 31.885  70.293  76.220  1.00 30.83  ? 304 GLN D C   1 
ATOM   5040 O  O   . GLN D 1 158 ? 31.867  69.758  75.116  1.00 29.31  ? 304 GLN D O   1 
ATOM   5041 C  CB  . GLN D 1 158 ? 34.058  69.084  76.668  1.00 40.96  ? 304 GLN D CB  1 
ATOM   5042 C  CG  . GLN D 1 158 ? 35.266  68.912  77.591  1.00 45.13  ? 304 GLN D CG  1 
ATOM   5043 C  CD  . GLN D 1 158 ? 34.978  68.015  78.787  1.00 51.83  ? 304 GLN D CD  1 
ATOM   5044 O  OE1 . GLN D 1 158 ? 34.414  66.928  78.643  1.00 54.43  ? 304 GLN D OE1 1 
ATOM   5045 N  NE2 . GLN D 1 158 ? 35.372  68.466  79.973  1.00 53.14  ? 304 GLN D NE2 1 
ATOM   5046 N  N   . ALA D 1 159 ? 31.044  71.266  76.566  1.00 29.54  ? 305 ALA D N   1 
ATOM   5047 C  CA  . ALA D 1 159 ? 29.860  71.571  75.762  1.00 30.33  ? 305 ALA D CA  1 
ATOM   5048 C  C   . ALA D 1 159 ? 29.920  72.867  74.952  1.00 31.88  ? 305 ALA D C   1 
ATOM   5049 O  O   . ALA D 1 159 ? 29.329  72.960  73.876  1.00 31.19  ? 305 ALA D O   1 
ATOM   5050 C  CB  . ALA D 1 159 ? 28.628  71.574  76.647  1.00 28.97  ? 305 ALA D CB  1 
ATOM   5051 N  N   . TRP D 1 160 ? 30.623  73.866  75.472  1.00 33.67  ? 306 TRP D N   1 
ATOM   5052 C  CA  . TRP D 1 160 ? 30.559  75.207  74.907  1.00 33.42  ? 306 TRP D CA  1 
ATOM   5053 C  C   . TRP D 1 160 ? 31.229  75.370  73.551  1.00 35.97  ? 306 TRP D C   1 
ATOM   5054 O  O   . TRP D 1 160 ? 32.304  74.828  73.292  1.00 37.22  ? 306 TRP D O   1 
ATOM   5055 C  CB  . TRP D 1 160 ? 31.143  76.235  75.874  1.00 32.88  ? 306 TRP D CB  1 
ATOM   5056 C  CG  . TRP D 1 160 ? 30.484  76.252  77.210  1.00 29.88  ? 306 TRP D CG  1 
ATOM   5057 C  CD1 . TRP D 1 160 ? 29.305  75.657  77.554  1.00 29.05  ? 306 TRP D CD1 1 
ATOM   5058 C  CD2 . TRP D 1 160 ? 30.969  76.900  78.389  1.00 29.01  ? 306 TRP D CD2 1 
ATOM   5059 N  NE1 . TRP D 1 160 ? 29.025  75.896  78.875  1.00 30.64  ? 306 TRP D NE1 1 
ATOM   5060 C  CE2 . TRP D 1 160 ? 30.034  76.655  79.412  1.00 31.94  ? 306 TRP D CE2 1 
ATOM   5061 C  CE3 . TRP D 1 160 ? 32.107  77.661  78.679  1.00 29.61  ? 306 TRP D CE3 1 
ATOM   5062 C  CZ2 . TRP D 1 160 ? 30.202  77.145  80.709  1.00 33.40  ? 306 TRP D CZ2 1 
ATOM   5063 C  CZ3 . TRP D 1 160 ? 32.271  78.149  79.962  1.00 32.00  ? 306 TRP D CZ3 1 
ATOM   5064 C  CH2 . TRP D 1 160 ? 31.325  77.887  80.963  1.00 34.03  ? 306 TRP D CH2 1 
ATOM   5065 N  N   . ASN D 1 161 ? 30.569  76.136  72.693  1.00 35.48  ? 307 ASN D N   1 
ATOM   5066 C  CA  . ASN D 1 161 ? 31.160  76.613  71.454  1.00 35.38  ? 307 ASN D CA  1 
ATOM   5067 C  C   . ASN D 1 161 ? 30.961  78.124  71.381  1.00 33.96  ? 307 ASN D C   1 
ATOM   5068 O  O   . ASN D 1 161 ? 29.944  78.644  71.850  1.00 30.04  ? 307 ASN D O   1 
ATOM   5069 C  CB  . ASN D 1 161 ? 30.514  75.924  70.244  1.00 32.78  ? 307 ASN D CB  1 
ATOM   5070 C  CG  . ASN D 1 161 ? 31.001  76.490  68.913  1.00 35.82  ? 307 ASN D CG  1 
ATOM   5071 O  OD1 . ASN D 1 161 ? 32.191  76.771  68.734  1.00 38.05  ? 307 ASN D OD1 1 
ATOM   5072 N  ND2 . ASN D 1 161 ? 30.077  76.658  67.972  1.00 32.81  ? 307 ASN D ND2 1 
ATOM   5073 N  N   . ASP D 1 162 ? 31.935  78.832  70.820  1.00 34.99  ? 308 ASP D N   1 
ATOM   5074 C  CA  . ASP D 1 162 ? 31.747  80.249  70.546  1.00 34.39  ? 308 ASP D CA  1 
ATOM   5075 C  C   . ASP D 1 162 ? 31.272  80.452  69.105  1.00 31.28  ? 308 ASP D C   1 
ATOM   5076 O  O   . ASP D 1 162 ? 31.756  79.795  68.183  1.00 32.02  ? 308 ASP D O   1 
ATOM   5077 C  CB  . ASP D 1 162 ? 33.016  81.056  70.833  1.00 37.67  ? 308 ASP D CB  1 
ATOM   5078 C  CG  . ASP D 1 162 ? 34.180  80.639  69.971  1.00 41.93  ? 308 ASP D CG  1 
ATOM   5079 O  OD1 . ASP D 1 162 ? 34.233  79.456  69.575  1.00 44.28  ? 308 ASP D OD1 1 
ATOM   5080 O  OD2 . ASP D 1 162 ? 35.046  81.494  69.698  1.00 42.40  ? 308 ASP D OD2 1 
ATOM   5081 N  N   . ALA D 1 163 ? 30.314  81.358  68.927  1.00 27.37  ? 309 ALA D N   1 
ATOM   5082 C  CA  . ALA D 1 163 ? 29.686  81.585  67.630  1.00 24.28  ? 309 ALA D CA  1 
ATOM   5083 C  C   . ALA D 1 163 ? 29.289  83.056  67.481  1.00 25.11  ? 309 ALA D C   1 
ATOM   5084 O  O   . ALA D 1 163 ? 29.108  83.752  68.476  1.00 28.05  ? 309 ALA D O   1 
ATOM   5085 C  CB  . ALA D 1 163 ? 28.463  80.677  67.481  1.00 23.07  ? 309 ALA D CB  1 
ATOM   5086 N  N   . PRO D 1 164 ? 29.157  83.535  66.234  1.00 28.56  ? 310 PRO D N   1 
ATOM   5087 C  CA  . PRO D 1 164 ? 28.776  84.933  65.995  1.00 29.52  ? 310 PRO D CA  1 
ATOM   5088 C  C   . PRO D 1 164 ? 27.436  85.256  66.645  1.00 29.38  ? 310 PRO D C   1 
ATOM   5089 O  O   . PRO D 1 164 ? 26.485  84.483  66.492  1.00 31.55  ? 310 PRO D O   1 
ATOM   5090 C  CB  . PRO D 1 164 ? 28.659  85.008  64.468  1.00 33.04  ? 310 PRO D CB  1 
ATOM   5091 C  CG  . PRO D 1 164 ? 29.502  83.879  63.965  1.00 31.60  ? 310 PRO D CG  1 
ATOM   5092 C  CD  . PRO D 1 164 ? 29.352  82.791  64.978  1.00 26.46  ? 310 PRO D CD  1 
ATOM   5093 N  N   . CYS D 1 165 ? 27.367  86.384  67.352  1.00 26.34  ? 311 CYS D N   1 
ATOM   5094 C  CA  . CYS D 1 165 ? 26.178  86.751  68.122  1.00 25.98  ? 311 CYS D CA  1 
ATOM   5095 C  C   . CYS D 1 165 ? 24.922  86.914  67.264  1.00 29.05  ? 311 CYS D C   1 
ATOM   5096 O  O   . CYS D 1 165 ? 23.811  86.982  67.790  1.00 29.12  ? 311 CYS D O   1 
ATOM   5097 C  CB  . CYS D 1 165 ? 26.425  88.030  68.928  1.00 26.62  ? 311 CYS D CB  1 
ATOM   5098 S  SG  . CYS D 1 165 ? 27.796  87.914  70.122  1.00 51.99  ? 311 CYS D SG  1 
ATOM   5099 N  N   . ASP D 1 166 ? 25.093  86.975  65.948  1.00 31.99  ? 312 ASP D N   1 
ATOM   5100 C  CA  . ASP D 1 166 ? 23.943  87.147  65.064  1.00 35.76  ? 312 ASP D CA  1 
ATOM   5101 C  C   . ASP D 1 166 ? 23.409  85.822  64.522  1.00 35.09  ? 312 ASP D C   1 
ATOM   5102 O  O   . ASP D 1 166 ? 22.458  85.805  63.745  1.00 34.77  ? 312 ASP D O   1 
ATOM   5103 C  CB  . ASP D 1 166 ? 24.237  88.140  63.928  1.00 39.18  ? 312 ASP D CB  1 
ATOM   5104 C  CG  . ASP D 1 166 ? 25.284  87.636  62.950  1.00 42.88  ? 312 ASP D CG  1 
ATOM   5105 O  OD1 . ASP D 1 166 ? 25.810  86.515  63.134  1.00 42.40  ? 312 ASP D OD1 1 
ATOM   5106 O  OD2 . ASP D 1 166 ? 25.580  88.375  61.985  1.00 44.01  ? 312 ASP D OD2 1 
ATOM   5107 N  N   . LYS D 1 167 ? 24.020  84.714  64.929  1.00 32.72  ? 313 LYS D N   1 
ATOM   5108 C  CA  . LYS D 1 167 ? 23.446  83.412  64.630  1.00 28.29  ? 313 LYS D CA  1 
ATOM   5109 C  C   . LYS D 1 167 ? 22.154  83.321  65.420  1.00 24.11  ? 313 LYS D C   1 
ATOM   5110 O  O   . LYS D 1 167 ? 22.054  83.875  66.514  1.00 27.30  ? 313 LYS D O   1 
ATOM   5111 C  CB  . LYS D 1 167 ? 24.382  82.279  65.058  1.00 28.93  ? 313 LYS D CB  1 
ATOM   5112 C  CG  . LYS D 1 167 ? 25.721  82.215  64.329  1.00 31.10  ? 313 LYS D CG  1 
ATOM   5113 C  CD  . LYS D 1 167 ? 25.560  81.807  62.876  1.00 34.77  ? 313 LYS D CD  1 
ATOM   5114 C  CE  . LYS D 1 167 ? 26.907  81.461  62.257  1.00 39.85  ? 313 LYS D CE  1 
ATOM   5115 N  NZ  . LYS D 1 167 ? 26.844  81.357  60.773  1.00 41.27  ? 313 LYS D NZ  1 
ATOM   5116 N  N   . THR D 1 168 ? 21.162  82.626  64.881  1.00 23.74  ? 314 THR D N   1 
ATOM   5117 C  CA  . THR D 1 168 ? 19.927  82.400  65.625  1.00 21.77  ? 314 THR D CA  1 
ATOM   5118 C  C   . THR D 1 168 ? 19.860  80.963  66.140  1.00 21.42  ? 314 THR D C   1 
ATOM   5119 O  O   . THR D 1 168 ? 19.801  80.010  65.362  1.00 22.39  ? 314 THR D O   1 
ATOM   5120 C  CB  . THR D 1 168 ? 18.667  82.720  64.785  1.00 23.29  ? 314 THR D CB  1 
ATOM   5121 O  OG1 . THR D 1 168 ? 18.543  81.772  63.715  1.00 29.71  ? 314 THR D OG1 1 
ATOM   5122 C  CG2 . THR D 1 168 ? 18.772  84.113  64.202  1.00 26.67  ? 314 THR D CG2 1 
ATOM   5123 N  N   . PHE D 1 169 ? 19.888  80.825  67.460  1.00 18.11  ? 315 PHE D N   1 
ATOM   5124 C  CA  . PHE D 1 169 ? 19.813  79.532  68.119  1.00 22.38  ? 315 PHE D CA  1 
ATOM   5125 C  C   . PHE D 1 169 ? 18.732  79.610  69.176  1.00 22.44  ? 315 PHE D C   1 
ATOM   5126 O  O   . PHE D 1 169 ? 18.364  80.700  69.604  1.00 24.27  ? 315 PHE D O   1 
ATOM   5127 C  CB  . PHE D 1 169 ? 21.137  79.210  68.825  1.00 23.86  ? 315 PHE D CB  1 
ATOM   5128 C  CG  . PHE D 1 169 ? 22.276  78.871  67.897  1.00 22.94  ? 315 PHE D CG  1 
ATOM   5129 C  CD1 . PHE D 1 169 ? 22.269  77.693  67.166  1.00 20.43  ? 315 PHE D CD1 1 
ATOM   5130 C  CD2 . PHE D 1 169 ? 23.373  79.712  67.792  1.00 22.65  ? 315 PHE D CD2 1 
ATOM   5131 C  CE1 . PHE D 1 169 ? 23.326  77.369  66.331  1.00 17.54  ? 315 PHE D CE1 1 
ATOM   5132 C  CE2 . PHE D 1 169 ? 24.430  79.397  66.956  1.00 21.95  ? 315 PHE D CE2 1 
ATOM   5133 C  CZ  . PHE D 1 169 ? 24.407  78.221  66.225  1.00 20.12  ? 315 PHE D CZ  1 
ATOM   5134 N  N   . LEU D 1 170 ? 18.235  78.459  69.614  1.00 20.23  ? 316 LEU D N   1 
ATOM   5135 C  CA  . LEU D 1 170 ? 17.424  78.420  70.820  1.00 18.42  ? 316 LEU D CA  1 
ATOM   5136 C  C   . LEU D 1 170 ? 18.281  78.942  71.982  1.00 21.62  ? 316 LEU D C   1 
ATOM   5137 O  O   . LEU D 1 170 ? 19.500  79.079  71.855  1.00 19.56  ? 316 LEU D O   1 
ATOM   5138 C  CB  . LEU D 1 170 ? 16.967  76.996  71.103  1.00 17.03  ? 316 LEU D CB  1 
ATOM   5139 C  CG  . LEU D 1 170 ? 16.225  76.289  69.976  1.00 19.42  ? 316 LEU D CG  1 
ATOM   5140 C  CD1 . LEU D 1 170 ? 16.159  74.783  70.265  1.00 16.28  ? 316 LEU D CD1 1 
ATOM   5141 C  CD2 . LEU D 1 170 ? 14.834  76.893  69.807  1.00 15.31  ? 316 LEU D CD2 1 
ATOM   5142 N  N   . PHE D 1 171 ? 17.657  79.230  73.116  1.00 19.19  ? 317 PHE D N   1 
ATOM   5143 C  CA  . PHE D 1 171 ? 18.380  79.868  74.207  1.00 21.80  ? 317 PHE D CA  1 
ATOM   5144 C  C   . PHE D 1 171 ? 17.855  79.432  75.564  1.00 23.88  ? 317 PHE D C   1 
ATOM   5145 O  O   . PHE D 1 171 ? 16.747  78.890  75.672  1.00 20.17  ? 317 PHE D O   1 
ATOM   5146 C  CB  . PHE D 1 171 ? 18.338  81.398  74.075  1.00 20.51  ? 317 PHE D CB  1 
ATOM   5147 C  CG  . PHE D 1 171 ? 16.948  81.969  74.039  1.00 18.48  ? 317 PHE D CG  1 
ATOM   5148 C  CD1 . PHE D 1 171 ? 16.302  82.325  75.207  1.00 20.03  ? 317 PHE D CD1 1 
ATOM   5149 C  CD2 . PHE D 1 171 ? 16.287  82.145  72.834  1.00 18.36  ? 317 PHE D CD2 1 
ATOM   5150 C  CE1 . PHE D 1 171 ? 15.021  82.853  75.178  1.00 23.76  ? 317 PHE D CE1 1 
ATOM   5151 C  CE2 . PHE D 1 171 ? 15.006  82.674  72.795  1.00 19.48  ? 317 PHE D CE2 1 
ATOM   5152 C  CZ  . PHE D 1 171 ? 14.370  83.024  73.968  1.00 22.17  ? 317 PHE D CZ  1 
ATOM   5153 N  N   . ILE D 1 172 ? 18.667  79.668  76.593  1.00 19.58  ? 318 ILE D N   1 
ATOM   5154 C  CA  . ILE D 1 172 ? 18.345  79.225  77.943  1.00 15.90  ? 318 ILE D CA  1 
ATOM   5155 C  C   . ILE D 1 172 ? 18.363  80.387  78.917  1.00 16.95  ? 318 ILE D C   1 
ATOM   5156 O  O   . ILE D 1 172 ? 19.419  80.967  79.179  1.00 19.00  ? 318 ILE D O   1 
ATOM   5157 C  CB  . ILE D 1 172 ? 19.347  78.157  78.439  1.00 13.06  ? 318 ILE D CB  1 
ATOM   5158 C  CG1 . ILE D 1 172 ? 19.219  76.875  77.610  1.00 13.01  ? 318 ILE D CG1 1 
ATOM   5159 C  CG2 . ILE D 1 172 ? 19.118  77.871  79.919  1.00 14.14  ? 318 ILE D CG2 1 
ATOM   5160 C  CD1 . ILE D 1 172 ? 20.398  75.936  77.729  1.00 14.05  ? 318 ILE D CD1 1 
ATOM   5161 N  N   . CYS D 1 173 ? 17.193  80.721  79.455  1.00 19.39  ? 319 CYS D N   1 
ATOM   5162 C  CA  . CYS D 1 173 ? 17.085  81.747  80.490  1.00 25.54  ? 319 CYS D CA  1 
ATOM   5163 C  C   . CYS D 1 173 ? 17.246  81.125  81.874  1.00 29.94  ? 319 CYS D C   1 
ATOM   5164 O  O   . CYS D 1 173 ? 16.939  79.943  82.075  1.00 31.65  ? 319 CYS D O   1 
ATOM   5165 C  CB  . CYS D 1 173 ? 15.726  82.447  80.409  1.00 26.33  ? 319 CYS D CB  1 
ATOM   5166 S  SG  . CYS D 1 173 ? 15.445  83.370  78.876  1.00 33.48  ? 319 CYS D SG  1 
ATOM   5167 N  N   . LYS D 1 174 ? 17.722  81.920  82.828  1.00 27.51  ? 320 LYS D N   1 
ATOM   5168 C  CA  . LYS D 1 174 ? 17.786  81.479  84.218  1.00 29.18  ? 320 LYS D CA  1 
ATOM   5169 C  C   . LYS D 1 174 ? 17.334  82.578  85.181  1.00 31.82  ? 320 LYS D C   1 
ATOM   5170 O  O   . LYS D 1 174 ? 17.607  83.754  84.956  1.00 29.27  ? 320 LYS D O   1 
ATOM   5171 C  CB  . LYS D 1 174 ? 19.201  81.024  84.594  1.00 25.32  ? 320 LYS D CB  1 
ATOM   5172 C  CG  . LYS D 1 174 ? 19.258  80.382  85.980  1.00 28.72  ? 320 LYS D CG  1 
ATOM   5173 C  CD  . LYS D 1 174 ? 20.473  80.805  86.789  1.00 30.60  ? 320 LYS D CD  1 
ATOM   5174 C  CE  . LYS D 1 174 ? 21.761  80.266  86.205  1.00 32.99  ? 320 LYS D CE  1 
ATOM   5175 N  NZ  . LYS D 1 174 ? 22.904  80.405  87.159  1.00 36.16  ? 320 LYS D NZ  1 
ATOM   5176 N  N   . ARG D 1 175 ? 16.635  82.184  86.244  1.00 32.76  ? 321 ARG D N   1 
ATOM   5177 C  CA  . ARG D 1 175 ? 16.307  83.089  87.344  1.00 34.56  ? 321 ARG D CA  1 
ATOM   5178 C  C   . ARG D 1 175 ? 16.217  82.318  88.650  1.00 35.95  ? 321 ARG D C   1 
ATOM   5179 O  O   . ARG D 1 175 ? 15.734  81.184  88.678  1.00 35.33  ? 321 ARG D O   1 
ATOM   5180 C  CB  . ARG D 1 175 ? 14.997  83.843  87.099  1.00 33.73  ? 321 ARG D CB  1 
ATOM   5181 C  CG  . ARG D 1 175 ? 13.829  82.963  86.700  1.00 37.33  ? 321 ARG D CG  1 
ATOM   5182 C  CD  . ARG D 1 175 ? 12.543  83.769  86.630  1.00 40.64  ? 321 ARG D CD  1 
ATOM   5183 N  NE  . ARG D 1 175 ? 11.892  83.811  87.933  1.00 46.93  ? 321 ARG D NE  1 
ATOM   5184 C  CZ  . ARG D 1 175 ? 10.794  83.130  88.239  1.00 47.73  ? 321 ARG D CZ  1 
ATOM   5185 N  NH1 . ARG D 1 175 ? 10.209  82.369  87.328  1.00 48.76  ? 321 ARG D NH1 1 
ATOM   5186 N  NH2 . ARG D 1 175 ? 10.276  83.219  89.453  1.00 49.90  ? 321 ARG D NH2 1 
ATOM   5187 N  N   . PRO D 1 176 ? 16.683  82.936  89.742  1.00 33.01  ? 322 PRO D N   1 
ATOM   5188 C  CA  . PRO D 1 176 ? 16.642  82.294  91.055  1.00 32.50  ? 322 PRO D CA  1 
ATOM   5189 C  C   . PRO D 1 176 ? 15.213  82.000  91.470  1.00 29.13  ? 322 PRO D C   1 
ATOM   5190 O  O   . PRO D 1 176 ? 14.319  82.800  91.202  1.00 27.93  ? 322 PRO D O   1 
ATOM   5191 C  CB  . PRO D 1 176 ? 17.227  83.364  91.988  1.00 36.77  ? 322 PRO D CB  1 
ATOM   5192 C  CG  . PRO D 1 176 ? 17.984  84.292  91.102  1.00 37.74  ? 322 PRO D CG  1 
ATOM   5193 C  CD  . PRO D 1 176 ? 17.272  84.285  89.794  1.00 34.43  ? 322 PRO D CD  1 
ATOM   5194 N  N   . TYR D 1 177 ? 14.998  80.864  92.119  1.00 27.63  ? 323 TYR D N   1 
ATOM   5195 C  CA  . TYR D 1 177 ? 13.721  80.620  92.766  1.00 31.53  ? 323 TYR D CA  1 
ATOM   5196 C  C   . TYR D 1 177 ? 13.683  81.444  94.043  1.00 37.02  ? 323 TYR D C   1 
ATOM   5197 O  O   . TYR D 1 177 ? 14.525  81.269  94.923  1.00 42.38  ? 323 TYR D O   1 
ATOM   5198 C  CB  . TYR D 1 177 ? 13.530  79.134  93.084  1.00 30.24  ? 323 TYR D CB  1 
ATOM   5199 C  CG  . TYR D 1 177 ? 12.472  78.872  94.139  1.00 31.07  ? 323 TYR D CG  1 
ATOM   5200 C  CD1 . TYR D 1 177 ? 11.237  79.506  94.078  1.00 29.48  ? 323 TYR D CD1 1 
ATOM   5201 C  CD2 . TYR D 1 177 ? 12.706  77.990  95.194  1.00 28.77  ? 323 TYR D CD2 1 
ATOM   5202 C  CE1 . TYR D 1 177 ? 10.271  79.282  95.034  1.00 30.41  ? 323 TYR D CE1 1 
ATOM   5203 C  CE2 . TYR D 1 177 ? 11.737  77.750  96.158  1.00 25.72  ? 323 TYR D CE2 1 
ATOM   5204 C  CZ  . TYR D 1 177 ? 10.519  78.402  96.071  1.00 30.55  ? 323 TYR D CZ  1 
ATOM   5205 O  OH  . TYR D 1 177 ? 9.536   78.188  97.014  1.00 34.00  ? 323 TYR D OH  1 
ATOM   5206 N  N   . VAL D 1 178 ? 12.719  82.355  94.133  1.00 37.38  ? 324 VAL D N   1 
ATOM   5207 C  CA  . VAL D 1 178 ? 12.572  83.199  95.314  1.00 37.43  ? 324 VAL D CA  1 
ATOM   5208 C  C   . VAL D 1 178 ? 11.239  82.926  95.999  1.00 43.53  ? 324 VAL D C   1 
ATOM   5209 O  O   . VAL D 1 178 ? 10.195  83.377  95.525  1.00 45.56  ? 324 VAL D O   1 
ATOM   5210 C  CB  . VAL D 1 178 ? 12.675  84.695  94.959  1.00 35.07  ? 324 VAL D CB  1 
ATOM   5211 C  CG1 . VAL D 1 178 ? 12.345  85.561  96.175  1.00 36.62  ? 324 VAL D CG1 1 
ATOM   5212 C  CG2 . VAL D 1 178 ? 14.067  85.019  94.422  1.00 29.41  ? 324 VAL D CG2 1 
ATOM   5213 N  N   . PRO D 1 179 ? 11.277  82.188  97.124  1.00 45.44  ? 325 PRO D N   1 
ATOM   5214 C  CA  . PRO D 1 179 ? 10.102  81.723  97.874  1.00 48.14  ? 325 PRO D CA  1 
ATOM   5215 C  C   . PRO D 1 179 ? 9.106   82.837  98.192  1.00 56.62  ? 325 PRO D C   1 
ATOM   5216 O  O   . PRO D 1 179 ? 9.495   84.000  98.332  1.00 56.78  ? 325 PRO D O   1 
ATOM   5217 C  CB  . PRO D 1 179 ? 10.710  81.183  99.172  1.00 43.20  ? 325 PRO D CB  1 
ATOM   5218 C  CG  . PRO D 1 179 ? 12.085  80.787  98.806  1.00 40.48  ? 325 PRO D CG  1 
ATOM   5219 C  CD  . PRO D 1 179 ? 12.535  81.793  97.782  1.00 42.57  ? 325 PRO D CD  1 
ATOM   5220 N  N   . SER D 1 180 ? 7.832   82.472  98.311  1.00 62.14  ? 326 SER D N   1 
ATOM   5221 C  CA  . SER D 1 180 ? 6.775   83.435  98.604  1.00 66.59  ? 326 SER D CA  1 
ATOM   5222 C  C   . SER D 1 180 ? 6.489   83.533  100.101 1.00 68.31  ? 326 SER D C   1 
ATOM   5223 O  O   . SER D 1 180 ? 6.026   84.566  100.589 1.00 70.44  ? 326 SER D O   1 
ATOM   5224 C  CB  . SER D 1 180 ? 5.499   83.068  97.841  1.00 67.19  ? 326 SER D CB  1 
ATOM   5225 O  OG  . SER D 1 180 ? 5.197   81.691  97.979  1.00 66.00  ? 326 SER D OG  1 
ATOM   5226 N  N   . LEU E 1 21  ? -9.521  71.511  126.924 1.00 120.17 ? 167 LEU E N   1 
ATOM   5227 C  CA  . LEU E 1 21  ? -8.383  71.233  126.054 1.00 118.57 ? 167 LEU E CA  1 
ATOM   5228 C  C   . LEU E 1 21  ? -8.804  70.903  124.630 1.00 122.06 ? 167 LEU E C   1 
ATOM   5229 O  O   . LEU E 1 21  ? -8.242  71.432  123.673 1.00 119.94 ? 167 LEU E O   1 
ATOM   5230 C  CB  . LEU E 1 21  ? -7.560  70.065  126.595 1.00 113.97 ? 167 LEU E CB  1 
ATOM   5231 C  CG  . LEU E 1 21  ? -6.768  69.336  125.504 1.00 109.14 ? 167 LEU E CG  1 
ATOM   5232 C  CD1 . LEU E 1 21  ? -5.621  70.200  124.989 1.00 106.65 ? 167 LEU E CD1 1 
ATOM   5233 C  CD2 . LEU E 1 21  ? -6.256  67.993  125.997 1.00 106.69 ? 167 LEU E CD2 1 
ATOM   5234 N  N   . ASN E 1 22  ? -9.787  70.014  124.504 1.00 127.33 ? 168 ASN E N   1 
ATOM   5235 C  CA  . ASN E 1 22  ? -10.195 69.474  123.209 1.00 129.75 ? 168 ASN E CA  1 
ATOM   5236 C  C   . ASN E 1 22  ? -10.588 70.539  122.190 1.00 129.91 ? 168 ASN E C   1 
ATOM   5237 O  O   . ASN E 1 22  ? -11.022 70.225  121.083 1.00 130.16 ? 168 ASN E O   1 
ATOM   5238 C  CB  . ASN E 1 22  ? -11.321 68.451  123.383 1.00 134.42 ? 168 ASN E CB  1 
ATOM   5239 C  CG  . ASN E 1 22  ? -10.899 67.257  124.220 1.00 135.78 ? 168 ASN E CG  1 
ATOM   5240 O  OD1 . ASN E 1 22  ? -9.773  67.198  124.718 1.00 134.27 ? 168 ASN E OD1 1 
ATOM   5241 N  ND2 . ASN E 1 22  ? -11.802 66.297  124.381 1.00 138.34 ? 168 ASN E ND2 1 
ATOM   5242 N  N   . THR E 1 23  ? -10.442 71.800  122.581 1.00 129.69 ? 169 THR E N   1 
ATOM   5243 C  CA  . THR E 1 23  ? -10.566 72.913  121.654 1.00 129.33 ? 169 THR E CA  1 
ATOM   5244 C  C   . THR E 1 23  ? -9.344  72.939  120.741 1.00 124.63 ? 169 THR E C   1 
ATOM   5245 O  O   . THR E 1 23  ? -9.432  73.334  119.580 1.00 124.09 ? 169 THR E O   1 
ATOM   5246 C  CB  . THR E 1 23  ? -10.671 74.249  122.404 1.00 131.63 ? 169 THR E CB  1 
ATOM   5247 O  OG1 . THR E 1 23  ? -9.790  74.229  123.536 1.00 130.55 ? 169 THR E OG1 1 
ATOM   5248 C  CG2 . THR E 1 23  ? -12.094 74.476  122.890 1.00 134.97 ? 169 THR E CG2 1 
ATOM   5249 N  N   . LYS E 1 24  ? -8.206  72.510  121.280 1.00 121.26 ? 170 LYS E N   1 
ATOM   5250 C  CA  . LYS E 1 24  ? -6.964  72.417  120.517 1.00 116.74 ? 170 LYS E CA  1 
ATOM   5251 C  C   . LYS E 1 24  ? -7.047  71.341  119.437 1.00 113.79 ? 170 LYS E C   1 
ATOM   5252 O  O   . LYS E 1 24  ? -6.871  71.619  118.252 1.00 112.49 ? 170 LYS E O   1 
ATOM   5253 C  CB  . LYS E 1 24  ? -5.782  72.113  121.445 1.00 114.64 ? 170 LYS E CB  1 
ATOM   5254 C  CG  . LYS E 1 24  ? -5.169  73.323  122.136 1.00 113.59 ? 170 LYS E CG  1 
ATOM   5255 C  CD  . LYS E 1 24  ? -3.875  72.935  122.844 1.00 109.79 ? 170 LYS E CD  1 
ATOM   5256 C  CE  . LYS E 1 24  ? -3.019  74.148  123.166 1.00 107.88 ? 170 LYS E CE  1 
ATOM   5257 N  NZ  . LYS E 1 24  ? -1.673  73.752  123.668 1.00 104.92 ? 170 LYS E NZ  1 
ATOM   5258 N  N   . ILE E 1 25  ? -7.305  70.108  119.865 1.00 112.57 ? 171 ILE E N   1 
ATOM   5259 C  CA  . ILE E 1 25  ? -7.396  68.966  118.961 1.00 110.22 ? 171 ILE E CA  1 
ATOM   5260 C  C   . ILE E 1 25  ? -8.383  69.239  117.835 1.00 112.25 ? 171 ILE E C   1 
ATOM   5261 O  O   . ILE E 1 25  ? -8.160  68.858  116.687 1.00 112.18 ? 171 ILE E O   1 
ATOM   5262 C  CB  . ILE E 1 25  ? -7.848  67.691  119.706 1.00 108.77 ? 171 ILE E CB  1 
ATOM   5263 C  CG1 . ILE E 1 25  ? -6.888  67.357  120.852 1.00 106.43 ? 171 ILE E CG1 1 
ATOM   5264 C  CG2 . ILE E 1 25  ? -7.967  66.521  118.741 1.00 107.92 ? 171 ILE E CG2 1 
ATOM   5265 C  CD1 . ILE E 1 25  ? -7.102  68.185  122.106 1.00 106.75 ? 171 ILE E CD1 1 
ATOM   5266 N  N   . ARG E 1 26  ? -9.477  69.906  118.182 1.00 114.58 ? 172 ARG E N   1 
ATOM   5267 C  CA  . ARG E 1 26  ? -10.547 70.207  117.240 1.00 116.58 ? 172 ARG E CA  1 
ATOM   5268 C  C   . ARG E 1 26  ? -10.038 71.039  116.063 1.00 112.77 ? 172 ARG E C   1 
ATOM   5269 O  O   . ARG E 1 26  ? -10.665 71.082  115.004 1.00 113.73 ? 172 ARG E O   1 
ATOM   5270 C  CB  . ARG E 1 26  ? -11.673 70.944  117.970 1.00 121.46 ? 172 ARG E CB  1 
ATOM   5271 C  CG  . ARG E 1 26  ? -13.034 70.876  117.303 1.00 126.34 ? 172 ARG E CG  1 
ATOM   5272 C  CD  . ARG E 1 26  ? -14.128 70.702  118.350 1.00 130.56 ? 172 ARG E CD  1 
ATOM   5273 N  NE  . ARG E 1 26  ? -13.931 71.577  119.504 1.00 131.40 ? 172 ARG E NE  1 
ATOM   5274 C  CZ  . ARG E 1 26  ? -14.642 72.674  119.745 1.00 134.26 ? 172 ARG E CZ  1 
ATOM   5275 N  NH1 . ARG E 1 26  ? -15.610 73.037  118.915 1.00 137.27 ? 172 ARG E NH1 1 
ATOM   5276 N  NH2 . ARG E 1 26  ? -14.389 73.407  120.822 1.00 133.88 ? 172 ARG E NH2 1 
ATOM   5277 N  N   . ALA E 1 27  ? -8.893  71.689  116.252 1.00 108.16 ? 173 ALA E N   1 
ATOM   5278 C  CA  . ALA E 1 27  ? -8.320  72.557  115.228 1.00 104.49 ? 173 ALA E CA  1 
ATOM   5279 C  C   . ALA E 1 27  ? -7.296  71.834  114.355 1.00 99.65  ? 173 ALA E C   1 
ATOM   5280 O  O   . ALA E 1 27  ? -7.124  72.171  113.184 1.00 99.80  ? 173 ALA E O   1 
ATOM   5281 C  CB  . ALA E 1 27  ? -7.698  73.792  115.865 1.00 103.88 ? 173 ALA E CB  1 
ATOM   5282 N  N   . LEU E 1 28  ? -6.610  70.848  114.928 1.00 94.18  ? 174 LEU E N   1 
ATOM   5283 C  CA  . LEU E 1 28  ? -5.666  70.048  114.157 1.00 88.06  ? 174 LEU E CA  1 
ATOM   5284 C  C   . LEU E 1 28  ? -6.383  69.241  113.083 1.00 88.05  ? 174 LEU E C   1 
ATOM   5285 O  O   . LEU E 1 28  ? -5.930  69.177  111.942 1.00 87.62  ? 174 LEU E O   1 
ATOM   5286 C  CB  . LEU E 1 28  ? -4.857  69.119  115.061 1.00 84.03  ? 174 LEU E CB  1 
ATOM   5287 C  CG  . LEU E 1 28  ? -3.602  69.733  115.677 1.00 81.06  ? 174 LEU E CG  1 
ATOM   5288 C  CD1 . LEU E 1 28  ? -2.682  68.636  116.186 1.00 79.73  ? 174 LEU E CD1 1 
ATOM   5289 C  CD2 . LEU E 1 28  ? -2.881  70.602  114.659 1.00 79.64  ? 174 LEU E CD2 1 
ATOM   5290 N  N   . GLN E 1 29  ? -7.502  68.627  113.457 1.00 89.02  ? 175 GLN E N   1 
ATOM   5291 C  CA  . GLN E 1 29  ? -8.335  67.903  112.505 1.00 89.94  ? 175 GLN E CA  1 
ATOM   5292 C  C   . GLN E 1 29  ? -8.654  68.789  111.307 1.00 91.62  ? 175 GLN E C   1 
ATOM   5293 O  O   . GLN E 1 29  ? -8.743  68.314  110.175 1.00 91.92  ? 175 GLN E O   1 
ATOM   5294 C  CB  . GLN E 1 29  ? -9.641  67.456  113.165 1.00 91.27  ? 175 GLN E CB  1 
ATOM   5295 C  CG  . GLN E 1 29  ? -9.480  66.437  114.277 1.00 90.23  ? 175 GLN E CG  1 
ATOM   5296 C  CD  . GLN E 1 29  ? -10.795 66.132  114.976 1.00 93.72  ? 175 GLN E CD  1 
ATOM   5297 O  OE1 . GLN E 1 29  ? -11.517 67.040  115.391 1.00 94.29  ? 175 GLN E OE1 1 
ATOM   5298 N  NE2 . GLN E 1 29  ? -11.108 64.848  115.115 1.00 95.27  ? 175 GLN E NE2 1 
ATOM   5299 N  N   . GLY E 1 30  ? -8.824  70.081  111.569 1.00 92.67  ? 176 GLY E N   1 
ATOM   5300 C  CA  . GLY E 1 30  ? -9.185  71.037  110.538 1.00 93.48  ? 176 GLY E CA  1 
ATOM   5301 C  C   . GLY E 1 30  ? -8.029  71.415  109.634 1.00 91.73  ? 176 GLY E C   1 
ATOM   5302 O  O   . GLY E 1 30  ? -8.118  71.287  108.413 1.00 92.15  ? 176 GLY E O   1 
ATOM   5303 N  N   . SER E 1 31  ? -6.939  71.884  110.232 1.00 89.57  ? 177 SER E N   1 
ATOM   5304 C  CA  . SER E 1 31  ? -5.765  72.282  109.463 1.00 87.80  ? 177 SER E CA  1 
ATOM   5305 C  C   . SER E 1 31  ? -5.086  71.082  108.806 1.00 85.01  ? 177 SER E C   1 
ATOM   5306 O  O   . SER E 1 31  ? -4.081  71.233  108.111 1.00 86.01  ? 177 SER E O   1 
ATOM   5307 C  CB  . SER E 1 31  ? -4.775  73.043  110.346 1.00 88.21  ? 177 SER E CB  1 
ATOM   5308 O  OG  . SER E 1 31  ? -4.492  72.322  111.531 1.00 89.26  ? 177 SER E OG  1 
ATOM   5309 N  N   . LEU E 1 32  ? -5.643  69.894  109.021 1.00 80.93  ? 178 LEU E N   1 
ATOM   5310 C  CA  . LEU E 1 32  ? -5.109  68.680  108.415 1.00 74.57  ? 178 LEU E CA  1 
ATOM   5311 C  C   . LEU E 1 32  ? -5.822  68.346  107.109 1.00 72.17  ? 178 LEU E C   1 
ATOM   5312 O  O   . LEU E 1 32  ? -5.179  68.119  106.087 1.00 68.75  ? 178 LEU E O   1 
ATOM   5313 C  CB  . LEU E 1 32  ? -5.206  67.501  109.380 1.00 72.76  ? 178 LEU E CB  1 
ATOM   5314 C  CG  . LEU E 1 32  ? -3.940  66.651  109.430 1.00 69.84  ? 178 LEU E CG  1 
ATOM   5315 C  CD1 . LEU E 1 32  ? -2.798  67.463  110.025 1.00 66.59  ? 178 LEU E CD1 1 
ATOM   5316 C  CD2 . LEU E 1 32  ? -4.178  65.380  110.223 1.00 71.07  ? 178 LEU E CD2 1 
ATOM   5317 N  N   . GLU E 1 33  ? -7.150  68.306  107.145 1.00 76.10  ? 179 GLU E N   1 
ATOM   5318 C  CA  . GLU E 1 33  ? -7.919  68.127  105.920 1.00 81.34  ? 179 GLU E CA  1 
ATOM   5319 C  C   . GLU E 1 33  ? -7.789  69.378  105.058 1.00 82.61  ? 179 GLU E C   1 
ATOM   5320 O  O   . GLU E 1 33  ? -8.222  69.406  103.908 1.00 83.68  ? 179 GLU E O   1 
ATOM   5321 C  CB  . GLU E 1 33  ? -9.385  67.807  106.219 1.00 86.31  ? 179 GLU E CB  1 
ATOM   5322 C  CG  . GLU E 1 33  ? -10.022 68.692  107.272 1.00 91.02  ? 179 GLU E CG  1 
ATOM   5323 C  CD  . GLU E 1 33  ? -11.515 68.450  107.398 1.00 97.26  ? 179 GLU E CD  1 
ATOM   5324 O  OE1 . GLU E 1 33  ? -12.216 68.523  106.366 1.00 100.81 ? 179 GLU E OE1 1 
ATOM   5325 O  OE2 . GLU E 1 33  ? -11.986 68.190  108.527 1.00 97.32  ? 179 GLU E OE2 1 
ATOM   5326 N  N   . ASN E 1 34  ? -7.190  70.414  105.637 1.00 82.88  ? 180 ASN E N   1 
ATOM   5327 C  CA  . ASN E 1 34  ? -6.761  71.582  104.883 1.00 82.35  ? 180 ASN E CA  1 
ATOM   5328 C  C   . ASN E 1 34  ? -5.657  71.167  103.930 1.00 76.96  ? 180 ASN E C   1 
ATOM   5329 O  O   . ASN E 1 34  ? -5.720  71.427  102.728 1.00 77.36  ? 180 ASN E O   1 
ATOM   5330 C  CB  . ASN E 1 34  ? -6.222  72.654  105.830 1.00 84.73  ? 180 ASN E CB  1 
ATOM   5331 C  CG  . ASN E 1 34  ? -7.128  73.863  105.922 1.00 89.86  ? 180 ASN E CG  1 
ATOM   5332 O  OD1 . ASN E 1 34  ? -7.960  74.101  105.044 1.00 93.51  ? 180 ASN E OD1 1 
ATOM   5333 N  ND2 . ASN E 1 34  ? -6.967  74.641  106.987 1.00 89.51  ? 180 ASN E ND2 1 
ATOM   5334 N  N   . MET E 1 35  ? -4.643  70.512  104.488 1.00 70.02  ? 181 MET E N   1 
ATOM   5335 C  CA  . MET E 1 35  ? -3.497  70.046  103.721 1.00 63.84  ? 181 MET E CA  1 
ATOM   5336 C  C   . MET E 1 35  ? -3.826  68.856  102.829 1.00 62.30  ? 181 MET E C   1 
ATOM   5337 O  O   . MET E 1 35  ? -3.265  68.720  101.743 1.00 62.44  ? 181 MET E O   1 
ATOM   5338 C  CB  . MET E 1 35  ? -2.344  69.680  104.651 1.00 59.30  ? 181 MET E CB  1 
ATOM   5339 C  CG  . MET E 1 35  ? -1.392  70.819  104.927 1.00 57.59  ? 181 MET E CG  1 
ATOM   5340 S  SD  . MET E 1 35  ? 0.107   70.196  105.697 1.00 91.54  ? 181 MET E SD  1 
ATOM   5341 C  CE  . MET E 1 35  ? 0.303   68.638  104.832 1.00 67.22  ? 181 MET E CE  1 
ATOM   5342 N  N   . SER E 1 36  ? -4.723  67.990  103.291 1.00 59.49  ? 182 SER E N   1 
ATOM   5343 C  CA  . SER E 1 36  ? -5.129  66.834  102.502 1.00 58.09  ? 182 SER E CA  1 
ATOM   5344 C  C   . SER E 1 36  ? -5.714  67.270  101.161 1.00 57.90  ? 182 SER E C   1 
ATOM   5345 O  O   . SER E 1 36  ? -5.384  66.708  100.116 1.00 55.40  ? 182 SER E O   1 
ATOM   5346 C  CB  . SER E 1 36  ? -6.141  65.985  103.267 1.00 60.92  ? 182 SER E CB  1 
ATOM   5347 O  OG  . SER E 1 36  ? -5.682  64.650  103.385 1.00 62.94  ? 182 SER E OG  1 
ATOM   5348 N  N   . LYS E 1 37  ? -6.580  68.277  101.198 1.00 59.98  ? 183 LYS E N   1 
ATOM   5349 C  CA  . LYS E 1 37  ? -7.178  68.811  99.981  1.00 61.53  ? 183 LYS E CA  1 
ATOM   5350 C  C   . LYS E 1 37  ? -6.124  69.499  99.117  1.00 59.22  ? 183 LYS E C   1 
ATOM   5351 O  O   . LYS E 1 37  ? -6.137  69.368  97.893  1.00 59.81  ? 183 LYS E O   1 
ATOM   5352 C  CB  . LYS E 1 37  ? -8.323  69.768  100.316 1.00 63.82  ? 183 LYS E CB  1 
ATOM   5353 C  CG  . LYS E 1 37  ? -9.449  69.114  101.099 1.00 69.16  ? 183 LYS E CG  1 
ATOM   5354 C  CD  . LYS E 1 37  ? -10.488 70.132  101.537 1.00 75.24  ? 183 LYS E CD  1 
ATOM   5355 C  CE  . LYS E 1 37  ? -11.531 69.501  102.445 1.00 78.85  ? 183 LYS E CE  1 
ATOM   5356 N  NZ  . LYS E 1 37  ? -12.564 70.488  102.861 1.00 82.91  ? 183 LYS E NZ  1 
ATOM   5357 N  N   . LEU E 1 38  ? -5.207  70.220  99.756  1.00 56.55  ? 184 LEU E N   1 
ATOM   5358 C  CA  . LEU E 1 38  ? -4.123  70.884  99.031  1.00 55.21  ? 184 LEU E CA  1 
ATOM   5359 C  C   . LEU E 1 38  ? -3.187  69.882  98.360  1.00 51.77  ? 184 LEU E C   1 
ATOM   5360 O  O   . LEU E 1 38  ? -2.708  70.114  97.249  1.00 51.80  ? 184 LEU E O   1 
ATOM   5361 C  CB  . LEU E 1 38  ? -3.321  71.805  99.954  1.00 56.70  ? 184 LEU E CB  1 
ATOM   5362 C  CG  . LEU E 1 38  ? -3.984  73.118  100.377 1.00 61.94  ? 184 LEU E CG  1 
ATOM   5363 C  CD1 . LEU E 1 38  ? -3.024  73.960  101.207 1.00 59.78  ? 184 LEU E CD1 1 
ATOM   5364 C  CD2 . LEU E 1 38  ? -4.466  73.897  99.161  1.00 64.79  ? 184 LEU E CD2 1 
ATOM   5365 N  N   . LEU E 1 39  ? -2.930  68.770  99.038  1.00 49.43  ? 185 LEU E N   1 
ATOM   5366 C  CA  . LEU E 1 39  ? -2.026  67.752  98.520  1.00 48.52  ? 185 LEU E CA  1 
ATOM   5367 C  C   . LEU E 1 39  ? -2.643  67.043  97.309  1.00 47.79  ? 185 LEU E C   1 
ATOM   5368 O  O   . LEU E 1 39  ? -1.958  66.784  96.319  1.00 46.97  ? 185 LEU E O   1 
ATOM   5369 C  CB  . LEU E 1 39  ? -1.666  66.754  99.622  1.00 50.99  ? 185 LEU E CB  1 
ATOM   5370 C  CG  . LEU E 1 39  ? -0.233  66.220  99.644  1.00 53.83  ? 185 LEU E CG  1 
ATOM   5371 C  CD1 . LEU E 1 39  ? 0.738   67.301  99.230  1.00 55.59  ? 185 LEU E CD1 1 
ATOM   5372 C  CD2 . LEU E 1 39  ? 0.119   65.688  101.023 1.00 52.99  ? 185 LEU E CD2 1 
ATOM   5373 N  N   . LYS E 1 40  ? -3.938  66.743  97.387  1.00 48.13  ? 186 LYS E N   1 
ATOM   5374 C  CA  . LYS E 1 40  ? -4.647  66.134  96.259  1.00 52.37  ? 186 LYS E CA  1 
ATOM   5375 C  C   . LYS E 1 40  ? -4.682  67.062  95.045  1.00 50.75  ? 186 LYS E C   1 
ATOM   5376 O  O   . LYS E 1 40  ? -4.459  66.626  93.916  1.00 46.46  ? 186 LYS E O   1 
ATOM   5377 C  CB  . LYS E 1 40  ? -6.059  65.704  96.663  1.00 58.42  ? 186 LYS E CB  1 
ATOM   5378 C  CG  . LYS E 1 40  ? -6.082  64.369  97.395  1.00 65.64  ? 186 LYS E CG  1 
ATOM   5379 C  CD  . LYS E 1 40  ? -7.378  64.137  98.162  1.00 71.33  ? 186 LYS E CD  1 
ATOM   5380 C  CE  . LYS E 1 40  ? -7.288  62.863  98.999  1.00 72.56  ? 186 LYS E CE  1 
ATOM   5381 N  NZ  . LYS E 1 40  ? -8.515  62.612  99.806  1.00 75.14  ? 186 LYS E NZ  1 
ATOM   5382 N  N   . ARG E 1 41  ? -4.960  68.340  95.287  1.00 52.87  ? 187 ARG E N   1 
ATOM   5383 C  CA  . ARG E 1 41  ? -4.864  69.354  94.247  1.00 52.84  ? 187 ARG E CA  1 
ATOM   5384 C  C   . ARG E 1 41  ? -3.525  69.244  93.529  1.00 49.58  ? 187 ARG E C   1 
ATOM   5385 O  O   . ARG E 1 41  ? -3.476  69.107  92.304  1.00 48.05  ? 187 ARG E O   1 
ATOM   5386 C  CB  . ARG E 1 41  ? -5.017  70.757  94.840  1.00 57.31  ? 187 ARG E CB  1 
ATOM   5387 C  CG  . ARG E 1 41  ? -4.766  71.877  93.837  1.00 62.46  ? 187 ARG E CG  1 
ATOM   5388 C  CD  . ARG E 1 41  ? -4.888  73.256  94.473  1.00 68.08  ? 187 ARG E CD  1 
ATOM   5389 N  NE  . ARG E 1 41  ? -4.696  74.325  93.495  1.00 71.98  ? 187 ARG E NE  1 
ATOM   5390 C  CZ  . ARG E 1 41  ? -3.538  74.941  93.270  1.00 72.68  ? 187 ARG E CZ  1 
ATOM   5391 N  NH1 . ARG E 1 41  ? -2.455  74.602  93.959  1.00 70.32  ? 187 ARG E NH1 1 
ATOM   5392 N  NH2 . ARG E 1 41  ? -3.462  75.903  92.357  1.00 74.59  ? 187 ARG E NH2 1 
ATOM   5393 N  N   . GLN E 1 42  ? -2.441  69.300  94.297  1.00 47.45  ? 188 GLN E N   1 
ATOM   5394 C  CA  . GLN E 1 42  ? -1.101  69.250  93.723  1.00 46.85  ? 188 GLN E CA  1 
ATOM   5395 C  C   . GLN E 1 42  ? -0.835  67.946  92.987  1.00 45.01  ? 188 GLN E C   1 
ATOM   5396 O  O   . GLN E 1 42  ? -0.203  67.940  91.932  1.00 42.75  ? 188 GLN E O   1 
ATOM   5397 C  CB  . GLN E 1 42  ? -0.038  69.471  94.793  1.00 49.48  ? 188 GLN E CB  1 
ATOM   5398 C  CG  . GLN E 1 42  ? 0.101   70.914  95.223  1.00 55.95  ? 188 GLN E CG  1 
ATOM   5399 C  CD  . GLN E 1 42  ? 1.434   71.181  95.881  1.00 59.46  ? 188 GLN E CD  1 
ATOM   5400 O  OE1 . GLN E 1 42  ? 2.478   70.740  95.397  1.00 57.52  ? 188 GLN E OE1 1 
ATOM   5401 N  NE2 . GLN E 1 42  ? 1.409   71.908  96.991  1.00 62.76  ? 188 GLN E NE2 1 
ATOM   5402 N  N   . ASN E 1 43  ? -1.308  66.840  93.548  1.00 46.53  ? 189 ASN E N   1 
ATOM   5403 C  CA  . ASN E 1 43  ? -1.151  65.555  92.887  1.00 44.26  ? 189 ASN E CA  1 
ATOM   5404 C  C   . ASN E 1 43  ? -1.910  65.557  91.559  1.00 41.21  ? 189 ASN E C   1 
ATOM   5405 O  O   . ASN E 1 43  ? -1.371  65.163  90.525  1.00 38.29  ? 189 ASN E O   1 
ATOM   5406 C  CB  . ASN E 1 43  ? -1.615  64.412  93.792  1.00 47.77  ? 189 ASN E CB  1 
ATOM   5407 C  CG  . ASN E 1 43  ? -0.928  63.095  93.465  1.00 51.36  ? 189 ASN E CG  1 
ATOM   5408 O  OD1 . ASN E 1 43  ? 0.282   62.945  93.657  1.00 49.72  ? 189 ASN E OD1 1 
ATOM   5409 N  ND2 . ASN E 1 43  ? -1.699  62.132  92.963  1.00 52.30  ? 189 ASN E ND2 1 
ATOM   5410 N  N   . ASP E 1 44  ? -3.157  66.020  91.591  1.00 41.00  ? 190 ASP E N   1 
ATOM   5411 C  CA  . ASP E 1 44  ? -3.958  66.132  90.376  1.00 42.69  ? 190 ASP E CA  1 
ATOM   5412 C  C   . ASP E 1 44  ? -3.193  66.909  89.315  1.00 40.92  ? 190 ASP E C   1 
ATOM   5413 O  O   . ASP E 1 44  ? -3.014  66.437  88.194  1.00 43.82  ? 190 ASP E O   1 
ATOM   5414 C  CB  . ASP E 1 44  ? -5.296  66.818  90.665  1.00 45.88  ? 190 ASP E CB  1 
ATOM   5415 C  CG  . ASP E 1 44  ? -6.287  65.898  91.351  1.00 53.44  ? 190 ASP E CG  1 
ATOM   5416 O  OD1 . ASP E 1 44  ? -6.129  64.664  91.233  1.00 56.88  ? 190 ASP E OD1 1 
ATOM   5417 O  OD2 . ASP E 1 44  ? -7.224  66.405  92.006  1.00 56.52  ? 190 ASP E OD2 1 
ATOM   5418 N  N   . ILE E 1 45  ? -2.733  68.099  89.683  1.00 39.60  ? 191 ILE E N   1 
ATOM   5419 C  CA  . ILE E 1 45  ? -2.000  68.960  88.765  1.00 37.86  ? 191 ILE E CA  1 
ATOM   5420 C  C   . ILE E 1 45  ? -0.694  68.332  88.285  1.00 35.47  ? 191 ILE E C   1 
ATOM   5421 O  O   . ILE E 1 45  ? -0.357  68.425  87.105  1.00 37.27  ? 191 ILE E O   1 
ATOM   5422 C  CB  . ILE E 1 45  ? -1.727  70.342  89.388  1.00 38.40  ? 191 ILE E CB  1 
ATOM   5423 C  CG1 . ILE E 1 45  ? -3.048  71.090  89.587  1.00 43.51  ? 191 ILE E CG1 1 
ATOM   5424 C  CG2 . ILE E 1 45  ? -0.790  71.159  88.505  1.00 34.36  ? 191 ILE E CG2 1 
ATOM   5425 C  CD1 . ILE E 1 45  ? -2.897  72.461  90.208  1.00 45.09  ? 191 ILE E CD1 1 
ATOM   5426 N  N   . LEU E 1 46  ? 0.027   67.680  89.193  1.00 32.99  ? 192 LEU E N   1 
ATOM   5427 C  CA  . LEU E 1 46  ? 1.318   67.080  88.859  1.00 29.44  ? 192 LEU E CA  1 
ATOM   5428 C  C   . LEU E 1 46  ? 1.193   65.929  87.863  1.00 31.40  ? 192 LEU E C   1 
ATOM   5429 O  O   . LEU E 1 46  ? 2.028   65.780  86.970  1.00 33.39  ? 192 LEU E O   1 
ATOM   5430 C  CB  . LEU E 1 46  ? 2.029   66.597  90.121  1.00 31.26  ? 192 LEU E CB  1 
ATOM   5431 C  CG  . LEU E 1 46  ? 3.420   66.009  89.903  1.00 31.19  ? 192 LEU E CG  1 
ATOM   5432 C  CD1 . LEU E 1 46  ? 4.305   67.017  89.194  1.00 28.56  ? 192 LEU E CD1 1 
ATOM   5433 C  CD2 . LEU E 1 46  ? 4.029   65.601  91.232  1.00 32.62  ? 192 LEU E CD2 1 
ATOM   5434 N  N   . GLN E 1 47  ? 0.153   65.114  88.023  1.00 32.65  ? 193 GLN E N   1 
ATOM   5435 C  CA  . GLN E 1 47  ? -0.068  63.973  87.141  1.00 37.50  ? 193 GLN E CA  1 
ATOM   5436 C  C   . GLN E 1 47  ? -0.180  64.398  85.681  1.00 37.32  ? 193 GLN E C   1 
ATOM   5437 O  O   . GLN E 1 47  ? 0.323   63.720  84.791  1.00 38.51  ? 193 GLN E O   1 
ATOM   5438 C  CB  . GLN E 1 47  ? -1.337  63.214  87.534  1.00 47.53  ? 193 GLN E CB  1 
ATOM   5439 C  CG  . GLN E 1 47  ? -1.252  62.427  88.830  1.00 56.87  ? 193 GLN E CG  1 
ATOM   5440 C  CD  . GLN E 1 47  ? -2.530  61.652  89.109  1.00 68.56  ? 193 GLN E CD  1 
ATOM   5441 O  OE1 . GLN E 1 47  ? -2.847  61.344  90.259  1.00 74.05  ? 193 GLN E OE1 1 
ATOM   5442 N  NE2 . GLN E 1 47  ? -3.276  61.341  88.051  1.00 71.73  ? 193 GLN E NE2 1 
ATOM   5443 N  N   . VAL E 1 48  ? -0.851  65.516  85.433  1.00 33.55  ? 194 VAL E N   1 
ATOM   5444 C  CA  . VAL E 1 48  ? -1.067  65.952  84.063  1.00 34.18  ? 194 VAL E CA  1 
ATOM   5445 C  C   . VAL E 1 48  ? 0.124   66.746  83.534  1.00 31.15  ? 194 VAL E C   1 
ATOM   5446 O  O   . VAL E 1 48  ? 0.422   66.708  82.338  1.00 31.57  ? 194 VAL E O   1 
ATOM   5447 C  CB  . VAL E 1 48  ? -2.379  66.747  83.908  1.00 35.90  ? 194 VAL E CB  1 
ATOM   5448 C  CG1 . VAL E 1 48  ? -2.710  66.924  82.441  1.00 40.60  ? 194 VAL E CG1 1 
ATOM   5449 C  CG2 . VAL E 1 48  ? -3.516  66.023  84.613  1.00 28.79  ? 194 VAL E CG2 1 
ATOM   5450 N  N   . VAL E 1 49  ? 0.814   67.460  84.418  1.00 30.24  ? 195 VAL E N   1 
ATOM   5451 C  CA  . VAL E 1 49  ? 2.058   68.115  84.020  1.00 30.24  ? 195 VAL E CA  1 
ATOM   5452 C  C   . VAL E 1 49  ? 3.100   67.057  83.670  1.00 32.71  ? 195 VAL E C   1 
ATOM   5453 O  O   . VAL E 1 49  ? 3.903   67.237  82.753  1.00 37.32  ? 195 VAL E O   1 
ATOM   5454 C  CB  . VAL E 1 49  ? 2.619   69.018  85.125  1.00 30.74  ? 195 VAL E CB  1 
ATOM   5455 C  CG1 . VAL E 1 49  ? 3.987   69.546  84.721  1.00 31.06  ? 195 VAL E CG1 1 
ATOM   5456 C  CG2 . VAL E 1 49  ? 1.655   70.160  85.418  1.00 31.66  ? 195 VAL E CG2 1 
ATOM   5457 N  N   . SER E 1 50  ? 3.071   65.946  84.400  1.00 32.32  ? 196 SER E N   1 
ATOM   5458 C  CA  . SER E 1 50  ? 3.990   64.841  84.152  1.00 37.02  ? 196 SER E CA  1 
ATOM   5459 C  C   . SER E 1 50  ? 3.675   64.136  82.837  1.00 40.57  ? 196 SER E C   1 
ATOM   5460 O  O   . SER E 1 50  ? 4.453   63.311  82.368  1.00 40.57  ? 196 SER E O   1 
ATOM   5461 C  CB  . SER E 1 50  ? 3.933   63.830  85.299  1.00 36.20  ? 196 SER E CB  1 
ATOM   5462 O  OG  . SER E 1 50  ? 4.344   64.429  86.512  1.00 37.57  ? 196 SER E OG  1 
ATOM   5463 N  N   . GLN E 1 51  ? 2.529   64.457  82.249  1.00 40.87  ? 197 GLN E N   1 
ATOM   5464 C  CA  . GLN E 1 51  ? 2.128   63.837  80.992  1.00 42.09  ? 197 GLN E CA  1 
ATOM   5465 C  C   . GLN E 1 51  ? 2.332   64.773  79.803  1.00 40.45  ? 197 GLN E C   1 
ATOM   5466 O  O   . GLN E 1 51  ? 1.900   64.476  78.687  1.00 38.99  ? 197 GLN E O   1 
ATOM   5467 C  CB  . GLN E 1 51  ? 0.673   63.371  81.060  1.00 46.00  ? 197 GLN E CB  1 
ATOM   5468 C  CG  . GLN E 1 51  ? 0.437   62.187  81.984  1.00 47.90  ? 197 GLN E CG  1 
ATOM   5469 C  CD  . GLN E 1 51  ? -1.033  61.830  82.095  1.00 52.81  ? 197 GLN E CD  1 
ATOM   5470 O  OE1 . GLN E 1 51  ? -1.868  62.370  81.369  1.00 57.01  ? 197 GLN E OE1 1 
ATOM   5471 N  NE2 . GLN E 1 51  ? -1.358  60.925  83.011  1.00 53.70  ? 197 GLN E NE2 1 
ATOM   5472 N  N   . GLY E 1 52  ? 2.985   65.906  80.052  1.00 40.19  ? 198 GLY E N   1 
ATOM   5473 C  CA  . GLY E 1 52  ? 3.319   66.849  78.999  1.00 37.37  ? 198 GLY E CA  1 
ATOM   5474 C  C   . GLY E 1 52  ? 2.374   68.029  78.857  1.00 35.34  ? 198 GLY E C   1 
ATOM   5475 O  O   . GLY E 1 52  ? 2.560   68.867  77.982  1.00 35.38  ? 198 GLY E O   1 
ATOM   5476 N  N   . TRP E 1 53  ? 1.357   68.102  79.709  1.00 32.25  ? 199 TRP E N   1 
ATOM   5477 C  CA  . TRP E 1 53  ? 0.431   69.228  79.670  1.00 32.33  ? 199 TRP E CA  1 
ATOM   5478 C  C   . TRP E 1 53  ? 0.913   70.365  80.575  1.00 35.39  ? 199 TRP E C   1 
ATOM   5479 O  O   . TRP E 1 53  ? 1.875   70.206  81.327  1.00 34.78  ? 199 TRP E O   1 
ATOM   5480 C  CB  . TRP E 1 53  ? -0.979  68.787  80.071  1.00 34.23  ? 199 TRP E CB  1 
ATOM   5481 C  CG  . TRP E 1 53  ? -1.641  67.866  79.073  1.00 38.94  ? 199 TRP E CG  1 
ATOM   5482 C  CD1 . TRP E 1 53  ? -1.153  66.679  78.600  1.00 40.59  ? 199 TRP E CD1 1 
ATOM   5483 C  CD2 . TRP E 1 53  ? -2.920  68.052  78.443  1.00 36.87  ? 199 TRP E CD2 1 
ATOM   5484 N  NE1 . TRP E 1 53  ? -2.042  66.122  77.713  1.00 41.70  ? 199 TRP E NE1 1 
ATOM   5485 C  CE2 . TRP E 1 53  ? -3.134  66.943  77.598  1.00 39.51  ? 199 TRP E CE2 1 
ATOM   5486 C  CE3 . TRP E 1 53  ? -3.899  69.047  78.508  1.00 35.49  ? 199 TRP E CE3 1 
ATOM   5487 C  CZ2 . TRP E 1 53  ? -4.291  66.803  76.825  1.00 37.15  ? 199 TRP E CZ2 1 
ATOM   5488 C  CZ3 . TRP E 1 53  ? -5.046  68.906  77.740  1.00 36.27  ? 199 TRP E CZ3 1 
ATOM   5489 C  CH2 . TRP E 1 53  ? -5.231  67.793  76.911  1.00 36.52  ? 199 TRP E CH2 1 
ATOM   5490 N  N   . LYS E 1 54  ? 0.245   71.512  80.486  1.00 35.47  ? 200 LYS E N   1 
ATOM   5491 C  CA  . LYS E 1 54  ? 0.563   72.658  81.328  1.00 32.38  ? 200 LYS E CA  1 
ATOM   5492 C  C   . LYS E 1 54  ? -0.651  72.983  82.183  1.00 36.22  ? 200 LYS E C   1 
ATOM   5493 O  O   . LYS E 1 54  ? -1.771  72.596  81.852  1.00 40.77  ? 200 LYS E O   1 
ATOM   5494 C  CB  . LYS E 1 54  ? 0.927   73.873  80.473  1.00 30.56  ? 200 LYS E CB  1 
ATOM   5495 C  CG  . LYS E 1 54  ? 1.831   73.567  79.289  1.00 31.94  ? 200 LYS E CG  1 
ATOM   5496 C  CD  . LYS E 1 54  ? 3.270   73.938  79.564  1.00 35.38  ? 200 LYS E CD  1 
ATOM   5497 C  CE  . LYS E 1 54  ? 4.123   73.775  78.316  1.00 38.68  ? 200 LYS E CE  1 
ATOM   5498 N  NZ  . LYS E 1 54  ? 4.173   72.366  77.838  1.00 40.02  ? 200 LYS E NZ  1 
ATOM   5499 N  N   . TYR E 1 55  ? -0.432  73.688  83.286  1.00 36.56  ? 201 TYR E N   1 
ATOM   5500 C  CA  . TYR E 1 55  ? -1.539  74.120  84.131  1.00 36.87  ? 201 TYR E CA  1 
ATOM   5501 C  C   . TYR E 1 55  ? -1.508  75.625  84.343  1.00 34.41  ? 201 TYR E C   1 
ATOM   5502 O  O   . TYR E 1 55  ? -0.437  76.219  84.472  1.00 36.09  ? 201 TYR E O   1 
ATOM   5503 C  CB  . TYR E 1 55  ? -1.510  73.423  85.494  1.00 34.62  ? 201 TYR E CB  1 
ATOM   5504 C  CG  . TYR E 1 55  ? -2.498  74.035  86.464  1.00 36.24  ? 201 TYR E CG  1 
ATOM   5505 C  CD1 . TYR E 1 55  ? -3.840  73.672  86.443  1.00 39.91  ? 201 TYR E CD1 1 
ATOM   5506 C  CD2 . TYR E 1 55  ? -2.099  75.002  87.375  1.00 35.49  ? 201 TYR E CD2 1 
ATOM   5507 C  CE1 . TYR E 1 55  ? -4.752  74.243  87.317  1.00 41.48  ? 201 TYR E CE1 1 
ATOM   5508 C  CE2 . TYR E 1 55  ? -3.002  75.576  88.253  1.00 37.70  ? 201 TYR E CE2 1 
ATOM   5509 C  CZ  . TYR E 1 55  ? -4.325  75.195  88.221  1.00 41.08  ? 201 TYR E CZ  1 
ATOM   5510 O  OH  . TYR E 1 55  ? -5.220  75.769  89.097  1.00 44.11  ? 201 TYR E OH  1 
ATOM   5511 N  N   . PHE E 1 56  ? -2.687  76.232  84.392  1.00 30.05  ? 202 PHE E N   1 
ATOM   5512 C  CA  . PHE E 1 56  ? -2.798  77.652  84.701  1.00 37.12  ? 202 PHE E CA  1 
ATOM   5513 C  C   . PHE E 1 56  ? -4.206  78.037  85.136  1.00 42.75  ? 202 PHE E C   1 
ATOM   5514 O  O   . PHE E 1 56  ? -5.153  77.953  84.352  1.00 40.35  ? 202 PHE E O   1 
ATOM   5515 C  CB  . PHE E 1 56  ? -2.372  78.515  83.511  1.00 39.40  ? 202 PHE E CB  1 
ATOM   5516 C  CG  . PHE E 1 56  ? -2.615  79.984  83.716  1.00 40.04  ? 202 PHE E CG  1 
ATOM   5517 C  CD1 . PHE E 1 56  ? -1.778  80.731  84.532  1.00 41.20  ? 202 PHE E CD1 1 
ATOM   5518 C  CD2 . PHE E 1 56  ? -3.684  80.613  83.104  1.00 40.81  ? 202 PHE E CD2 1 
ATOM   5519 C  CE1 . PHE E 1 56  ? -1.999  82.080  84.728  1.00 40.63  ? 202 PHE E CE1 1 
ATOM   5520 C  CE2 . PHE E 1 56  ? -3.912  81.961  83.293  1.00 42.70  ? 202 PHE E CE2 1 
ATOM   5521 C  CZ  . PHE E 1 56  ? -3.067  82.696  84.106  1.00 44.58  ? 202 PHE E CZ  1 
ATOM   5522 N  N   . LYS E 1 57  ? -4.327  78.458  86.392  1.00 48.58  ? 203 LYS E N   1 
ATOM   5523 C  CA  . LYS E 1 57  ? -5.596  78.927  86.949  1.00 53.01  ? 203 LYS E CA  1 
ATOM   5524 C  C   . LYS E 1 57  ? -6.809  78.106  86.515  1.00 50.77  ? 203 LYS E C   1 
ATOM   5525 O  O   . LYS E 1 57  ? -7.619  78.557  85.706  1.00 51.06  ? 203 LYS E O   1 
ATOM   5526 C  CB  . LYS E 1 57  ? -5.809  80.410  86.627  1.00 57.90  ? 203 LYS E CB  1 
ATOM   5527 C  CG  . LYS E 1 57  ? -4.895  81.333  87.418  1.00 62.85  ? 203 LYS E CG  1 
ATOM   5528 C  CD  . LYS E 1 57  ? -5.009  82.775  86.958  1.00 66.54  ? 203 LYS E CD  1 
ATOM   5529 C  CE  . LYS E 1 57  ? -4.048  83.662  87.739  1.00 70.30  ? 203 LYS E CE  1 
ATOM   5530 N  NZ  . LYS E 1 57  ? -3.863  84.992  87.095  1.00 71.87  ? 203 LYS E NZ  1 
ATOM   5531 N  N   . GLY E 1 58  ? -6.921  76.898  87.057  1.00 47.83  ? 204 GLY E N   1 
ATOM   5532 C  CA  . GLY E 1 58  ? -8.116  76.094  86.887  1.00 47.16  ? 204 GLY E CA  1 
ATOM   5533 C  C   . GLY E 1 58  ? -8.200  75.290  85.604  1.00 46.53  ? 204 GLY E C   1 
ATOM   5534 O  O   . GLY E 1 58  ? -9.115  74.487  85.435  1.00 48.61  ? 204 GLY E O   1 
ATOM   5535 N  N   . ASN E 1 59  ? -7.250  75.489  84.699  1.00 43.80  ? 205 ASN E N   1 
ATOM   5536 C  CA  . ASN E 1 59  ? -7.299  74.807  83.411  1.00 40.31  ? 205 ASN E CA  1 
ATOM   5537 C  C   . ASN E 1 59  ? -6.009  74.088  83.045  1.00 38.94  ? 205 ASN E C   1 
ATOM   5538 O  O   . ASN E 1 59  ? -4.914  74.521  83.409  1.00 37.94  ? 205 ASN E O   1 
ATOM   5539 C  CB  . ASN E 1 59  ? -7.663  75.787  82.291  1.00 37.22  ? 205 ASN E CB  1 
ATOM   5540 C  CG  . ASN E 1 59  ? -9.073  76.318  82.416  1.00 40.77  ? 205 ASN E CG  1 
ATOM   5541 O  OD1 . ASN E 1 59  ? -10.040 75.567  82.316  1.00 41.29  ? 205 ASN E OD1 1 
ATOM   5542 N  ND2 . ASN E 1 59  ? -9.197  77.625  82.626  1.00 42.69  ? 205 ASN E ND2 1 
ATOM   5543 N  N   . PHE E 1 60  ? -6.159  72.988  82.316  1.00 37.43  ? 206 PHE E N   1 
ATOM   5544 C  CA  . PHE E 1 60  ? -5.028  72.298  81.723  1.00 36.72  ? 206 PHE E CA  1 
ATOM   5545 C  C   . PHE E 1 60  ? -4.905  72.703  80.261  1.00 36.25  ? 206 PHE E C   1 
ATOM   5546 O  O   . PHE E 1 60  ? -5.907  72.822  79.552  1.00 37.74  ? 206 PHE E O   1 
ATOM   5547 C  CB  . PHE E 1 60  ? -5.206  70.784  81.822  1.00 37.66  ? 206 PHE E CB  1 
ATOM   5548 C  CG  . PHE E 1 60  ? -5.106  70.252  83.216  1.00 39.14  ? 206 PHE E CG  1 
ATOM   5549 C  CD1 . PHE E 1 60  ? -3.959  70.454  83.968  1.00 38.82  ? 206 PHE E CD1 1 
ATOM   5550 C  CD2 . PHE E 1 60  ? -6.149  69.528  83.771  1.00 42.66  ? 206 PHE E CD2 1 
ATOM   5551 C  CE1 . PHE E 1 60  ? -3.856  69.956  85.251  1.00 42.35  ? 206 PHE E CE1 1 
ATOM   5552 C  CE2 . PHE E 1 60  ? -6.053  69.023  85.057  1.00 45.77  ? 206 PHE E CE2 1 
ATOM   5553 C  CZ  . PHE E 1 60  ? -4.903  69.238  85.798  1.00 45.11  ? 206 PHE E CZ  1 
ATOM   5554 N  N   . TYR E 1 61  ? -3.677  72.916  79.808  1.00 33.93  ? 207 TYR E N   1 
ATOM   5555 C  CA  . TYR E 1 61  ? -3.453  73.283  78.415  1.00 33.60  ? 207 TYR E CA  1 
ATOM   5556 C  C   . TYR E 1 61  ? -2.466  72.331  77.759  1.00 32.71  ? 207 TYR E C   1 
ATOM   5557 O  O   . TYR E 1 61  ? -1.538  71.835  78.403  1.00 34.61  ? 207 TYR E O   1 
ATOM   5558 C  CB  . TYR E 1 61  ? -2.935  74.722  78.305  1.00 31.07  ? 207 TYR E CB  1 
ATOM   5559 C  CG  . TYR E 1 61  ? -3.883  75.770  78.840  1.00 33.15  ? 207 TYR E CG  1 
ATOM   5560 C  CD1 . TYR E 1 61  ? -4.760  76.441  77.994  1.00 34.28  ? 207 TYR E CD1 1 
ATOM   5561 C  CD2 . TYR E 1 61  ? -3.899  76.095  80.193  1.00 33.33  ? 207 TYR E CD2 1 
ATOM   5562 C  CE1 . TYR E 1 61  ? -5.626  77.401  78.483  1.00 35.71  ? 207 TYR E CE1 1 
ATOM   5563 C  CE2 . TYR E 1 61  ? -4.763  77.053  80.688  1.00 33.93  ? 207 TYR E CE2 1 
ATOM   5564 C  CZ  . TYR E 1 61  ? -5.624  77.703  79.832  1.00 35.54  ? 207 TYR E CZ  1 
ATOM   5565 O  OH  . TYR E 1 61  ? -6.486  78.660  80.323  1.00 37.07  ? 207 TYR E OH  1 
ATOM   5566 N  N   . TYR E 1 62  ? -2.664  72.086  76.471  1.00 31.56  ? 208 TYR E N   1 
ATOM   5567 C  CA  . TYR E 1 62  ? -1.742  71.253  75.721  1.00 29.54  ? 208 TYR E CA  1 
ATOM   5568 C  C   . TYR E 1 62  ? -1.192  72.002  74.517  1.00 31.37  ? 208 TYR E C   1 
ATOM   5569 O  O   . TYR E 1 62  ? -1.928  72.325  73.580  1.00 33.32  ? 208 TYR E O   1 
ATOM   5570 C  CB  . TYR E 1 62  ? -2.421  69.954  75.286  1.00 35.03  ? 208 TYR E CB  1 
ATOM   5571 C  CG  . TYR E 1 62  ? -1.480  68.990  74.607  1.00 36.15  ? 208 TYR E CG  1 
ATOM   5572 C  CD1 . TYR E 1 62  ? -0.522  68.300  75.335  1.00 37.54  ? 208 TYR E CD1 1 
ATOM   5573 C  CD2 . TYR E 1 62  ? -1.546  68.772  73.236  1.00 36.15  ? 208 TYR E CD2 1 
ATOM   5574 C  CE1 . TYR E 1 62  ? 0.345   67.417  74.717  1.00 39.03  ? 208 TYR E CE1 1 
ATOM   5575 C  CE2 . TYR E 1 62  ? -0.685  67.890  72.609  1.00 37.21  ? 208 TYR E CE2 1 
ATOM   5576 C  CZ  . TYR E 1 62  ? 0.258   67.215  73.354  1.00 39.99  ? 208 TYR E CZ  1 
ATOM   5577 O  OH  . TYR E 1 62  ? 1.118   66.335  72.740  1.00 43.43  ? 208 TYR E OH  1 
ATOM   5578 N  N   . PHE E 1 63  ? 0.104   72.294  74.557  1.00 30.79  ? 209 PHE E N   1 
ATOM   5579 C  CA  . PHE E 1 63  ? 0.782   72.940  73.442  1.00 29.15  ? 209 PHE E CA  1 
ATOM   5580 C  C   . PHE E 1 63  ? 1.426   71.852  72.604  1.00 34.60  ? 209 PHE E C   1 
ATOM   5581 O  O   . PHE E 1 63  ? 2.350   71.174  73.056  1.00 38.93  ? 209 PHE E O   1 
ATOM   5582 C  CB  . PHE E 1 63  ? 1.839   73.923  73.944  1.00 26.32  ? 209 PHE E CB  1 
ATOM   5583 C  CG  . PHE E 1 63  ? 1.273   75.076  74.727  1.00 27.27  ? 209 PHE E CG  1 
ATOM   5584 C  CD1 . PHE E 1 63  ? 1.346   76.371  74.233  1.00 27.14  ? 209 PHE E CD1 1 
ATOM   5585 C  CD2 . PHE E 1 63  ? 0.661   74.866  75.951  1.00 26.31  ? 209 PHE E CD2 1 
ATOM   5586 C  CE1 . PHE E 1 63  ? 0.824   77.434  74.947  1.00 25.73  ? 209 PHE E CE1 1 
ATOM   5587 C  CE2 . PHE E 1 63  ? 0.136   75.927  76.668  1.00 27.33  ? 209 PHE E CE2 1 
ATOM   5588 C  CZ  . PHE E 1 63  ? 0.217   77.211  76.164  1.00 25.73  ? 209 PHE E CZ  1 
ATOM   5589 N  N   . SER E 1 64  ? 0.928   71.679  71.383  1.00 33.01  ? 210 SER E N   1 
ATOM   5590 C  CA  . SER E 1 64  ? 1.294   70.526  70.573  1.00 28.75  ? 210 SER E CA  1 
ATOM   5591 C  C   . SER E 1 64  ? 2.729   70.590  70.062  1.00 29.26  ? 210 SER E C   1 
ATOM   5592 O  O   . SER E 1 64  ? 3.366   71.641  70.086  1.00 31.89  ? 210 SER E O   1 
ATOM   5593 C  CB  . SER E 1 64  ? 0.321   70.370  69.401  1.00 28.46  ? 210 SER E CB  1 
ATOM   5594 O  OG  . SER E 1 64  ? 0.660   71.242  68.342  1.00 25.92  ? 210 SER E OG  1 
ATOM   5595 N  N   . LEU E 1 65  ? 3.228   69.446  69.610  1.00 32.90  ? 211 LEU E N   1 
ATOM   5596 C  CA  . LEU E 1 65  ? 4.557   69.343  69.025  1.00 35.27  ? 211 LEU E CA  1 
ATOM   5597 C  C   . LEU E 1 65  ? 4.400   68.990  67.557  1.00 40.48  ? 211 LEU E C   1 
ATOM   5598 O  O   . LEU E 1 65  ? 5.351   69.072  66.776  1.00 46.06  ? 211 LEU E O   1 
ATOM   5599 C  CB  . LEU E 1 65  ? 5.371   68.260  69.734  1.00 38.37  ? 211 LEU E CB  1 
ATOM   5600 C  CG  . LEU E 1 65  ? 5.754   68.507  71.199  1.00 40.88  ? 211 LEU E CG  1 
ATOM   5601 C  CD1 . LEU E 1 65  ? 6.372   67.265  71.812  1.00 42.64  ? 211 LEU E CD1 1 
ATOM   5602 C  CD2 . LEU E 1 65  ? 6.703   69.693  71.331  1.00 40.69  ? 211 LEU E CD2 1 
ATOM   5603 N  N   . ILE E 1 66  ? 3.188   68.588  67.191  1.00 34.60  ? 212 ILE E N   1 
ATOM   5604 C  CA  . ILE E 1 66  ? 2.868   68.263  65.811  1.00 34.88  ? 212 ILE E CA  1 
ATOM   5605 C  C   . ILE E 1 66  ? 1.917   69.321  65.247  1.00 35.71  ? 212 ILE E C   1 
ATOM   5606 O  O   . ILE E 1 66  ? 0.954   69.701  65.907  1.00 36.60  ? 212 ILE E O   1 
ATOM   5607 C  CB  . ILE E 1 66  ? 2.226   66.858  65.713  1.00 37.65  ? 212 ILE E CB  1 
ATOM   5608 C  CG1 . ILE E 1 66  ? 2.301   66.314  64.288  1.00 40.24  ? 212 ILE E CG1 1 
ATOM   5609 C  CG2 . ILE E 1 66  ? 0.790   66.881  66.210  1.00 37.22  ? 212 ILE E CG2 1 
ATOM   5610 C  CD1 . ILE E 1 66  ? 1.647   64.952  64.129  1.00 43.89  ? 212 ILE E CD1 1 
ATOM   5611 N  N   . PRO E 1 67  ? 2.198   69.819  64.034  1.00 36.62  ? 213 PRO E N   1 
ATOM   5612 C  CA  . PRO E 1 67  ? 1.334   70.811  63.382  1.00 35.27  ? 213 PRO E CA  1 
ATOM   5613 C  C   . PRO E 1 67  ? 0.139   70.152  62.697  1.00 36.75  ? 213 PRO E C   1 
ATOM   5614 O  O   . PRO E 1 67  ? 0.272   69.036  62.206  1.00 39.46  ? 213 PRO E O   1 
ATOM   5615 C  CB  . PRO E 1 67  ? 2.251   71.436  62.320  1.00 35.11  ? 213 PRO E CB  1 
ATOM   5616 C  CG  . PRO E 1 67  ? 3.632   70.882  62.586  1.00 39.27  ? 213 PRO E CG  1 
ATOM   5617 C  CD  . PRO E 1 67  ? 3.425   69.575  63.263  1.00 38.90  ? 213 PRO E CD  1 
ATOM   5618 N  N   . LYS E 1 68  ? -1.003  70.833  62.662  1.00 36.68  ? 214 LYS E N   1 
ATOM   5619 C  CA  . LYS E 1 68  ? -2.188  70.324  61.968  1.00 37.30  ? 214 LYS E CA  1 
ATOM   5620 C  C   . LYS E 1 68  ? -3.025  71.466  61.415  1.00 35.51  ? 214 LYS E C   1 
ATOM   5621 O  O   . LYS E 1 68  ? -2.816  72.623  61.783  1.00 32.46  ? 214 LYS E O   1 
ATOM   5622 C  CB  . LYS E 1 68  ? -3.051  69.482  62.907  1.00 39.89  ? 214 LYS E CB  1 
ATOM   5623 C  CG  . LYS E 1 68  ? -2.409  68.176  63.353  1.00 41.33  ? 214 LYS E CG  1 
ATOM   5624 C  CD  . LYS E 1 68  ? -3.353  67.366  64.216  1.00 42.46  ? 214 LYS E CD  1 
ATOM   5625 C  CE  . LYS E 1 68  ? -2.682  66.086  64.686  1.00 48.17  ? 214 LYS E CE  1 
ATOM   5626 N  NZ  . LYS E 1 68  ? -2.203  65.262  63.539  1.00 51.11  ? 214 LYS E NZ  1 
ATOM   5627 N  N   . THR E 1 69  ? -3.967  71.141  60.528  1.00 26.93  ? 215 THR E N   1 
ATOM   5628 C  CA  . THR E 1 69  ? -4.947  72.122  60.082  1.00 31.92  ? 215 THR E CA  1 
ATOM   5629 C  C   . THR E 1 69  ? -5.827  72.440  61.273  1.00 31.52  ? 215 THR E C   1 
ATOM   5630 O  O   . THR E 1 69  ? -5.883  71.663  62.224  1.00 31.42  ? 215 THR E O   1 
ATOM   5631 C  CB  . THR E 1 69  ? -5.846  71.600  58.936  1.00 34.66  ? 215 THR E CB  1 
ATOM   5632 O  OG1 . THR E 1 69  ? -6.546  70.428  59.372  1.00 34.47  ? 215 THR E OG1 1 
ATOM   5633 C  CG2 . THR E 1 69  ? -5.020  71.274  57.698  1.00 34.83  ? 215 THR E CG2 1 
ATOM   5634 N  N   . TRP E 1 70  ? -6.521  73.572  61.219  1.00 30.65  ? 216 TRP E N   1 
ATOM   5635 C  CA  . TRP E 1 70  ? -7.335  74.005  62.342  1.00 31.23  ? 216 TRP E CA  1 
ATOM   5636 C  C   . TRP E 1 70  ? -8.269  72.896  62.800  1.00 36.16  ? 216 TRP E C   1 
ATOM   5637 O  O   . TRP E 1 70  ? -8.314  72.564  63.983  1.00 38.91  ? 216 TRP E O   1 
ATOM   5638 C  CB  . TRP E 1 70  ? -8.132  75.260  61.988  1.00 29.31  ? 216 TRP E CB  1 
ATOM   5639 C  CG  . TRP E 1 70  ? -8.934  75.800  63.135  1.00 24.78  ? 216 TRP E CG  1 
ATOM   5640 C  CD1 . TRP E 1 70  ? -8.530  76.721  64.056  1.00 25.38  ? 216 TRP E CD1 1 
ATOM   5641 C  CD2 . TRP E 1 70  ? -10.281 75.452  63.482  1.00 29.76  ? 216 TRP E CD2 1 
ATOM   5642 N  NE1 . TRP E 1 70  ? -9.539  76.968  64.955  1.00 24.07  ? 216 TRP E NE1 1 
ATOM   5643 C  CE2 . TRP E 1 70  ? -10.626 76.202  64.623  1.00 29.74  ? 216 TRP E CE2 1 
ATOM   5644 C  CE3 . TRP E 1 70  ? -11.229 74.579  62.936  1.00 30.98  ? 216 TRP E CE3 1 
ATOM   5645 C  CZ2 . TRP E 1 70  ? -11.876 76.105  65.229  1.00 33.07  ? 216 TRP E CZ2 1 
ATOM   5646 C  CZ3 . TRP E 1 70  ? -12.470 74.484  63.538  1.00 29.91  ? 216 TRP E CZ3 1 
ATOM   5647 C  CH2 . TRP E 1 70  ? -12.783 75.242  64.673  1.00 35.57  ? 216 TRP E CH2 1 
ATOM   5648 N  N   . TYR E 1 71  ? -8.997  72.305  61.859  1.00 35.92  ? 217 TYR E N   1 
ATOM   5649 C  CA  . TYR E 1 71  ? -10.005 71.313  62.212  1.00 36.38  ? 217 TYR E CA  1 
ATOM   5650 C  C   . TYR E 1 71  ? -9.438  69.972  62.680  1.00 32.52  ? 217 TYR E C   1 
ATOM   5651 O  O   . TYR E 1 71  ? -9.971  69.363  63.607  1.00 32.37  ? 217 TYR E O   1 
ATOM   5652 C  CB  . TYR E 1 71  ? -10.979 71.099  61.059  1.00 42.60  ? 217 TYR E CB  1 
ATOM   5653 C  CG  . TYR E 1 71  ? -12.048 70.079  61.360  1.00 51.21  ? 217 TYR E CG  1 
ATOM   5654 C  CD1 . TYR E 1 71  ? -13.109 70.384  62.201  1.00 54.36  ? 217 TYR E CD1 1 
ATOM   5655 C  CD2 . TYR E 1 71  ? -11.999 68.811  60.796  1.00 57.72  ? 217 TYR E CD2 1 
ATOM   5656 C  CE1 . TYR E 1 71  ? -14.092 69.450  62.476  1.00 59.95  ? 217 TYR E CE1 1 
ATOM   5657 C  CE2 . TYR E 1 71  ? -12.978 67.874  61.061  1.00 61.78  ? 217 TYR E CE2 1 
ATOM   5658 C  CZ  . TYR E 1 71  ? -14.021 68.198  61.903  1.00 64.64  ? 217 TYR E CZ  1 
ATOM   5659 O  OH  . TYR E 1 71  ? -14.999 67.263  62.168  1.00 72.34  ? 217 TYR E OH  1 
ATOM   5660 N  N   . SER E 1 72  ? -8.378  69.499  62.032  1.00 30.15  ? 218 SER E N   1 
ATOM   5661 C  CA  . SER E 1 72  ? -7.724  68.272  62.478  1.00 35.80  ? 218 SER E CA  1 
ATOM   5662 C  C   . SER E 1 72  ? -7.211  68.437  63.904  1.00 37.65  ? 218 SER E C   1 
ATOM   5663 O  O   . SER E 1 72  ? -7.344  67.535  64.731  1.00 43.31  ? 218 SER E O   1 
ATOM   5664 C  CB  . SER E 1 72  ? -6.579  67.880  61.543  1.00 38.84  ? 218 SER E CB  1 
ATOM   5665 O  OG  . SER E 1 72  ? -7.072  67.194  60.405  1.00 44.60  ? 218 SER E OG  1 
ATOM   5666 N  N   . ALA E 1 73  ? -6.627  69.596  64.185  1.00 32.67  ? 219 ALA E N   1 
ATOM   5667 C  CA  . ALA E 1 73  ? -6.203  69.921  65.534  1.00 35.50  ? 219 ALA E CA  1 
ATOM   5668 C  C   . ALA E 1 73  ? -7.387  69.826  66.490  1.00 38.90  ? 219 ALA E C   1 
ATOM   5669 O  O   . ALA E 1 73  ? -7.286  69.229  67.564  1.00 40.45  ? 219 ALA E O   1 
ATOM   5670 C  CB  . ALA E 1 73  ? -5.584  71.311  65.581  1.00 31.62  ? 219 ALA E CB  1 
ATOM   5671 N  N   . GLU E 1 74  ? -8.514  70.405  66.094  1.00 37.29  ? 220 GLU E N   1 
ATOM   5672 C  CA  . GLU E 1 74  ? -9.694  70.400  66.952  1.00 39.09  ? 220 GLU E CA  1 
ATOM   5673 C  C   . GLU E 1 74  ? -10.145 68.981  67.294  1.00 38.55  ? 220 GLU E C   1 
ATOM   5674 O  O   . GLU E 1 74  ? -10.594 68.718  68.410  1.00 41.71  ? 220 GLU E O   1 
ATOM   5675 C  CB  . GLU E 1 74  ? -10.835 71.209  66.324  1.00 39.74  ? 220 GLU E CB  1 
ATOM   5676 C  CG  . GLU E 1 74  ? -12.208 70.981  66.953  1.00 41.36  ? 220 GLU E CG  1 
ATOM   5677 C  CD  . GLU E 1 74  ? -12.302 71.418  68.409  1.00 43.32  ? 220 GLU E CD  1 
ATOM   5678 O  OE1 . GLU E 1 74  ? -11.278 71.837  68.994  1.00 42.15  ? 220 GLU E OE1 1 
ATOM   5679 O  OE2 . GLU E 1 74  ? -13.417 71.337  68.972  1.00 44.91  ? 220 GLU E OE2 1 
ATOM   5680 N  N   . GLN E 1 75  ? -10.009 68.065  66.344  1.00 35.30  ? 221 GLN E N   1 
ATOM   5681 C  CA  . GLN E 1 75  ? -10.364 66.676  66.601  1.00 38.37  ? 221 GLN E CA  1 
ATOM   5682 C  C   . GLN E 1 75  ? -9.369  66.019  67.554  1.00 41.52  ? 221 GLN E C   1 
ATOM   5683 O  O   . GLN E 1 75  ? -9.763  65.287  68.461  1.00 45.35  ? 221 GLN E O   1 
ATOM   5684 C  CB  . GLN E 1 75  ? -10.475 65.893  65.297  1.00 40.87  ? 221 GLN E CB  1 
ATOM   5685 C  CG  . GLN E 1 75  ? -11.737 66.226  64.517  1.00 46.84  ? 221 GLN E CG  1 
ATOM   5686 C  CD  . GLN E 1 75  ? -11.690 65.712  63.098  1.00 54.01  ? 221 GLN E CD  1 
ATOM   5687 O  OE1 . GLN E 1 75  ? -10.627 65.670  62.473  1.00 55.36  ? 221 GLN E OE1 1 
ATOM   5688 N  NE2 . GLN E 1 75  ? -12.846 65.320  62.574  1.00 57.89  ? 221 GLN E NE2 1 
ATOM   5689 N  N   . PHE E 1 76  ? -8.082  66.290  67.355  1.00 36.75  ? 222 PHE E N   1 
ATOM   5690 C  CA  . PHE E 1 76  ? -7.065  65.770  68.258  1.00 35.23  ? 222 PHE E CA  1 
ATOM   5691 C  C   . PHE E 1 76  ? -7.388  66.210  69.678  1.00 33.42  ? 222 PHE E C   1 
ATOM   5692 O  O   . PHE E 1 76  ? -7.328  65.413  70.610  1.00 34.97  ? 222 PHE E O   1 
ATOM   5693 C  CB  . PHE E 1 76  ? -5.673  66.243  67.843  1.00 36.46  ? 222 PHE E CB  1 
ATOM   5694 C  CG  . PHE E 1 76  ? -4.594  65.945  68.855  1.00 41.98  ? 222 PHE E CG  1 
ATOM   5695 C  CD1 . PHE E 1 76  ? -3.658  64.950  68.620  1.00 46.77  ? 222 PHE E CD1 1 
ATOM   5696 C  CD2 . PHE E 1 76  ? -4.504  66.672  70.035  1.00 39.43  ? 222 PHE E CD2 1 
ATOM   5697 C  CE1 . PHE E 1 76  ? -2.656  64.686  69.546  1.00 46.18  ? 222 PHE E CE1 1 
ATOM   5698 C  CE2 . PHE E 1 76  ? -3.509  66.413  70.957  1.00 38.62  ? 222 PHE E CE2 1 
ATOM   5699 C  CZ  . PHE E 1 76  ? -2.585  65.421  70.714  1.00 40.50  ? 222 PHE E CZ  1 
ATOM   5700 N  N   . CYS E 1 77  ? -7.738  67.482  69.835  1.00 32.64  ? 223 CYS E N   1 
ATOM   5701 C  CA  . CYS E 1 77  ? -8.126  68.010  71.137  1.00 33.88  ? 223 CYS E CA  1 
ATOM   5702 C  C   . CYS E 1 77  ? -9.329  67.244  71.667  1.00 38.08  ? 223 CYS E C   1 
ATOM   5703 O  O   . CYS E 1 77  ? -9.319  66.759  72.800  1.00 36.70  ? 223 CYS E O   1 
ATOM   5704 C  CB  . CYS E 1 77  ? -8.444  69.508  71.053  1.00 30.41  ? 223 CYS E CB  1 
ATOM   5705 S  SG  . CYS E 1 77  ? -7.011  70.581  70.823  1.00 39.98  ? 223 CYS E SG  1 
ATOM   5706 N  N   . VAL E 1 78  ? -10.364 67.135  70.837  1.00 40.03  ? 224 VAL E N   1 
ATOM   5707 C  CA  . VAL E 1 78  ? -11.580 66.425  71.217  1.00 37.19  ? 224 VAL E CA  1 
ATOM   5708 C  C   . VAL E 1 78  ? -11.285 64.993  71.658  1.00 40.34  ? 224 VAL E C   1 
ATOM   5709 O  O   . VAL E 1 78  ? -11.924 64.470  72.574  1.00 42.89  ? 224 VAL E O   1 
ATOM   5710 C  CB  . VAL E 1 78  ? -12.608 66.422  70.074  1.00 36.53  ? 224 VAL E CB  1 
ATOM   5711 C  CG1 . VAL E 1 78  ? -13.705 65.408  70.349  1.00 36.23  ? 224 VAL E CG1 1 
ATOM   5712 C  CG2 . VAL E 1 78  ? -13.191 67.821  69.891  1.00 31.49  ? 224 VAL E CG2 1 
ATOM   5713 N  N   . SER E 1 79  ? -10.305 64.369  71.012  1.00 40.54  ? 225 SER E N   1 
ATOM   5714 C  CA  . SER E 1 79  ? -9.888  63.018  71.380  1.00 44.91  ? 225 SER E CA  1 
ATOM   5715 C  C   . SER E 1 79  ? -9.075  63.001  72.684  1.00 46.60  ? 225 SER E C   1 
ATOM   5716 O  O   . SER E 1 79  ? -8.775  61.936  73.222  1.00 48.89  ? 225 SER E O   1 
ATOM   5717 C  CB  . SER E 1 79  ? -9.075  62.383  70.250  1.00 46.29  ? 225 SER E CB  1 
ATOM   5718 O  OG  . SER E 1 79  ? -7.692  62.673  70.394  1.00 47.57  ? 225 SER E OG  1 
ATOM   5719 N  N   . ARG E 1 80  ? -8.710  64.178  73.182  1.00 45.09  ? 226 ARG E N   1 
ATOM   5720 C  CA  . ARG E 1 80  ? -8.023  64.283  74.467  1.00 44.55  ? 226 ARG E CA  1 
ATOM   5721 C  C   . ARG E 1 80  ? -8.936  64.946  75.499  1.00 46.12  ? 226 ARG E C   1 
ATOM   5722 O  O   . ARG E 1 80  ? -8.468  65.543  76.472  1.00 42.99  ? 226 ARG E O   1 
ATOM   5723 C  CB  . ARG E 1 80  ? -6.719  65.071  74.330  1.00 44.21  ? 226 ARG E CB  1 
ATOM   5724 C  CG  . ARG E 1 80  ? -5.697  64.467  73.374  1.00 48.52  ? 226 ARG E CG  1 
ATOM   5725 C  CD  . ARG E 1 80  ? -5.134  63.146  73.882  1.00 55.49  ? 226 ARG E CD  1 
ATOM   5726 N  NE  . ARG E 1 80  ? -3.778  62.915  73.386  1.00 60.69  ? 226 ARG E NE  1 
ATOM   5727 C  CZ  . ARG E 1 80  ? -3.491  62.376  72.205  1.00 65.76  ? 226 ARG E CZ  1 
ATOM   5728 N  NH1 . ARG E 1 80  ? -4.464  62.005  71.385  1.00 70.88  ? 226 ARG E NH1 1 
ATOM   5729 N  NH2 . ARG E 1 80  ? -2.229  62.209  71.840  1.00 65.11  ? 226 ARG E NH2 1 
ATOM   5730 N  N   . ASN E 1 81  ? -10.243 64.844  75.268  1.00 49.61  ? 227 ASN E N   1 
ATOM   5731 C  CA  . ASN E 1 81  ? -11.248 65.371  76.189  1.00 54.09  ? 227 ASN E CA  1 
ATOM   5732 C  C   . ASN E 1 81  ? -11.180 66.884  76.370  1.00 49.97  ? 227 ASN E C   1 
ATOM   5733 O  O   . ASN E 1 81  ? -11.446 67.403  77.455  1.00 48.47  ? 227 ASN E O   1 
ATOM   5734 C  CB  . ASN E 1 81  ? -11.157 64.673  77.549  1.00 63.62  ? 227 ASN E CB  1 
ATOM   5735 C  CG  . ASN E 1 81  ? -12.475 64.054  77.975  1.00 73.88  ? 227 ASN E CG  1 
ATOM   5736 O  OD1 . ASN E 1 81  ? -13.545 64.459  77.513  1.00 77.08  ? 227 ASN E OD1 1 
ATOM   5737 N  ND2 . ASN E 1 81  ? -12.406 63.064  78.860  1.00 77.47  ? 227 ASN E ND2 1 
ATOM   5738 N  N   . SER E 1 82  ? -10.832 67.587  75.299  1.00 47.34  ? 228 SER E N   1 
ATOM   5739 C  CA  . SER E 1 82  ? -10.723 69.037  75.350  1.00 47.68  ? 228 SER E CA  1 
ATOM   5740 C  C   . SER E 1 82  ? -11.082 69.678  74.012  1.00 46.21  ? 228 SER E C   1 
ATOM   5741 O  O   . SER E 1 82  ? -11.499 69.000  73.072  1.00 47.29  ? 228 SER E O   1 
ATOM   5742 C  CB  . SER E 1 82  ? -9.308  69.448  75.763  1.00 45.68  ? 228 SER E CB  1 
ATOM   5743 O  OG  . SER E 1 82  ? -8.355  68.981  74.826  1.00 45.65  ? 228 SER E OG  1 
ATOM   5744 N  N   . HIS E 1 83  ? -10.921 70.993  73.942  1.00 42.88  ? 229 HIS E N   1 
ATOM   5745 C  CA  . HIS E 1 83  ? -11.119 71.725  72.703  1.00 41.08  ? 229 HIS E CA  1 
ATOM   5746 C  C   . HIS E 1 83  ? -9.932  72.634  72.479  1.00 40.41  ? 229 HIS E C   1 
ATOM   5747 O  O   . HIS E 1 83  ? -9.142  72.867  73.396  1.00 38.16  ? 229 HIS E O   1 
ATOM   5748 C  CB  . HIS E 1 83  ? -12.379 72.579  72.779  1.00 41.77  ? 229 HIS E CB  1 
ATOM   5749 C  CG  . HIS E 1 83  ? -13.647 71.790  72.789  1.00 47.34  ? 229 HIS E CG  1 
ATOM   5750 N  ND1 . HIS E 1 83  ? -14.087 71.077  71.695  1.00 49.28  ? 229 HIS E ND1 1 
ATOM   5751 C  CD2 . HIS E 1 83  ? -14.583 71.619  73.751  1.00 52.24  ? 229 HIS E CD2 1 
ATOM   5752 C  CE1 . HIS E 1 83  ? -15.233 70.489  71.987  1.00 53.96  ? 229 HIS E CE1 1 
ATOM   5753 N  NE2 . HIS E 1 83  ? -15.557 70.803  73.229  1.00 56.16  ? 229 HIS E NE2 1 
ATOM   5754 N  N   . LEU E 1 84  ? -9.801  73.147  71.259  1.00 39.27  ? 230 LEU E N   1 
ATOM   5755 C  CA  . LEU E 1 84  ? -8.858  74.222  71.016  1.00 33.83  ? 230 LEU E CA  1 
ATOM   5756 C  C   . LEU E 1 84  ? -9.216  75.323  71.996  1.00 32.41  ? 230 LEU E C   1 
ATOM   5757 O  O   . LEU E 1 84  ? -10.392 75.642  72.174  1.00 32.53  ? 230 LEU E O   1 
ATOM   5758 C  CB  . LEU E 1 84  ? -8.953  74.728  69.582  1.00 33.04  ? 230 LEU E CB  1 
ATOM   5759 C  CG  . LEU E 1 84  ? -8.317  73.845  68.509  1.00 31.79  ? 230 LEU E CG  1 
ATOM   5760 C  CD1 . LEU E 1 84  ? -8.623  74.398  67.119  1.00 30.55  ? 230 LEU E CD1 1 
ATOM   5761 C  CD2 . LEU E 1 84  ? -6.816  73.730  68.734  1.00 25.83  ? 230 LEU E CD2 1 
ATOM   5762 N  N   . THR E 1 85  ? -8.206  75.894  72.639  1.00 28.23  ? 231 THR E N   1 
ATOM   5763 C  CA  . THR E 1 85  ? -8.436  76.803  73.753  1.00 30.49  ? 231 THR E CA  1 
ATOM   5764 C  C   . THR E 1 85  ? -9.234  78.051  73.380  1.00 30.77  ? 231 THR E C   1 
ATOM   5765 O  O   . THR E 1 85  ? -9.109  78.581  72.278  1.00 33.58  ? 231 THR E O   1 
ATOM   5766 C  CB  . THR E 1 85  ? -7.106  77.238  74.405  1.00 29.79  ? 231 THR E CB  1 
ATOM   5767 O  OG1 . THR E 1 85  ? -7.379  77.939  75.624  1.00 30.10  ? 231 THR E OG1 1 
ATOM   5768 C  CG2 . THR E 1 85  ? -6.311  78.140  73.460  1.00 26.16  ? 231 THR E CG2 1 
ATOM   5769 N  N   . SER E 1 86  ? -10.066 78.506  74.310  1.00 31.20  ? 232 SER E N   1 
ATOM   5770 C  CA  . SER E 1 86  ? -10.684 79.816  74.193  1.00 33.81  ? 232 SER E CA  1 
ATOM   5771 C  C   . SER E 1 86  ? -9.839  80.789  74.999  1.00 34.15  ? 232 SER E C   1 
ATOM   5772 O  O   . SER E 1 86  ? -8.900  80.375  75.681  1.00 33.01  ? 232 SER E O   1 
ATOM   5773 C  CB  . SER E 1 86  ? -12.120 79.793  74.714  1.00 34.12  ? 232 SER E CB  1 
ATOM   5774 O  OG  . SER E 1 86  ? -12.165 79.446  76.086  1.00 36.07  ? 232 SER E OG  1 
ATOM   5775 N  N   . VAL E 1 87  ? -10.151 82.079  74.903  1.00 36.19  ? 233 VAL E N   1 
ATOM   5776 C  CA  . VAL E 1 87  ? -9.488  83.088  75.732  1.00 39.93  ? 233 VAL E CA  1 
ATOM   5777 C  C   . VAL E 1 87  ? -10.528 83.967  76.425  1.00 45.15  ? 233 VAL E C   1 
ATOM   5778 O  O   . VAL E 1 87  ? -11.419 84.537  75.781  1.00 44.20  ? 233 VAL E O   1 
ATOM   5779 C  CB  . VAL E 1 87  ? -8.504  83.967  74.933  1.00 36.17  ? 233 VAL E CB  1 
ATOM   5780 C  CG1 . VAL E 1 87  ? -7.641  84.777  75.890  1.00 34.76  ? 233 VAL E CG1 1 
ATOM   5781 C  CG2 . VAL E 1 87  ? -7.630  83.112  74.022  1.00 31.39  ? 233 VAL E CG2 1 
ATOM   5782 N  N   . THR E 1 88  ? -10.405 84.076  77.743  1.00 48.41  ? 234 THR E N   1 
ATOM   5783 C  CA  . THR E 1 88  ? -11.464 84.658  78.552  1.00 54.54  ? 234 THR E CA  1 
ATOM   5784 C  C   . THR E 1 88  ? -10.991 85.813  79.437  1.00 57.78  ? 234 THR E C   1 
ATOM   5785 O  O   . THR E 1 88  ? -11.768 86.359  80.221  1.00 60.27  ? 234 THR E O   1 
ATOM   5786 C  CB  . THR E 1 88  ? -12.132 83.577  79.423  1.00 57.38  ? 234 THR E CB  1 
ATOM   5787 O  OG1 . THR E 1 88  ? -11.138 82.928  80.224  1.00 58.62  ? 234 THR E OG1 1 
ATOM   5788 C  CG2 . THR E 1 88  ? -12.807 82.534  78.542  1.00 58.34  ? 234 THR E CG2 1 
ATOM   5789 N  N   . SER E 1 89  ? -9.725  86.192  79.301  1.00 56.33  ? 235 SER E N   1 
ATOM   5790 C  CA  . SER E 1 89  ? -9.162  87.254  80.126  1.00 56.15  ? 235 SER E CA  1 
ATOM   5791 C  C   . SER E 1 89  ? -7.742  87.602  79.704  1.00 55.29  ? 235 SER E C   1 
ATOM   5792 O  O   . SER E 1 89  ? -7.082  86.822  79.017  1.00 55.11  ? 235 SER E O   1 
ATOM   5793 C  CB  . SER E 1 89  ? -9.171  86.833  81.592  1.00 54.85  ? 235 SER E CB  1 
ATOM   5794 O  OG  . SER E 1 89  ? -8.548  85.571  81.747  1.00 55.94  ? 235 SER E OG  1 
ATOM   5795 N  N   . GLU E 1 90  ? -7.273  88.773  80.123  1.00 54.64  ? 236 GLU E N   1 
ATOM   5796 C  CA  . GLU E 1 90  ? -5.907  89.197  79.836  1.00 53.05  ? 236 GLU E CA  1 
ATOM   5797 C  C   . GLU E 1 90  ? -4.871  88.231  80.400  1.00 45.39  ? 236 GLU E C   1 
ATOM   5798 O  O   . GLU E 1 90  ? -3.859  87.958  79.756  1.00 41.95  ? 236 GLU E O   1 
ATOM   5799 C  CB  . GLU E 1 90  ? -5.645  90.605  80.374  1.00 58.91  ? 236 GLU E CB  1 
ATOM   5800 C  CG  . GLU E 1 90  ? -6.341  91.698  79.586  1.00 65.29  ? 236 GLU E CG  1 
ATOM   5801 C  CD  . GLU E 1 90  ? -5.738  93.071  79.823  1.00 71.17  ? 236 GLU E CD  1 
ATOM   5802 O  OE1 . GLU E 1 90  ? -5.031  93.252  80.841  1.00 71.21  ? 236 GLU E OE1 1 
ATOM   5803 O  OE2 . GLU E 1 90  ? -5.975  93.969  78.984  1.00 72.24  ? 236 GLU E OE2 1 
ATOM   5804 N  N   . SER E 1 91  ? -5.122  87.719  81.602  1.00 44.01  ? 237 SER E N   1 
ATOM   5805 C  CA  . SER E 1 91  ? -4.173  86.823  82.256  1.00 45.30  ? 237 SER E CA  1 
ATOM   5806 C  C   . SER E 1 91  ? -4.020  85.509  81.490  1.00 40.29  ? 237 SER E C   1 
ATOM   5807 O  O   . SER E 1 91  ? -2.904  85.025  81.308  1.00 39.87  ? 237 SER E O   1 
ATOM   5808 C  CB  . SER E 1 91  ? -4.560  86.567  83.718  1.00 51.06  ? 237 SER E CB  1 
ATOM   5809 O  OG  . SER E 1 91  ? -5.782  85.856  83.819  1.00 56.05  ? 237 SER E OG  1 
ATOM   5810 N  N   . GLU E 1 92  ? -5.138  84.941  81.038  1.00 37.81  ? 238 GLU E N   1 
ATOM   5811 C  CA  . GLU E 1 92  ? -5.099  83.744  80.198  1.00 35.48  ? 238 GLU E CA  1 
ATOM   5812 C  C   . GLU E 1 92  ? -4.403  84.058  78.881  1.00 34.34  ? 238 GLU E C   1 
ATOM   5813 O  O   . GLU E 1 92  ? -3.563  83.290  78.411  1.00 32.17  ? 238 GLU E O   1 
ATOM   5814 C  CB  . GLU E 1 92  ? -6.506  83.198  79.934  1.00 35.06  ? 238 GLU E CB  1 
ATOM   5815 C  CG  . GLU E 1 92  ? -6.527  81.948  79.062  1.00 35.55  ? 238 GLU E CG  1 
ATOM   5816 C  CD  . GLU E 1 92  ? -7.915  81.332  78.928  1.00 40.98  ? 238 GLU E CD  1 
ATOM   5817 O  OE1 . GLU E 1 92  ? -8.914  82.050  79.136  1.00 43.29  ? 238 GLU E OE1 1 
ATOM   5818 O  OE2 . GLU E 1 92  ? -8.007  80.125  78.608  1.00 40.82  ? 238 GLU E OE2 1 
ATOM   5819 N  N   . GLN E 1 93  ? -4.758  85.194  78.290  1.00 34.54  ? 239 GLN E N   1 
ATOM   5820 C  CA  . GLN E 1 93  ? -4.106  85.653  77.067  1.00 32.79  ? 239 GLN E CA  1 
ATOM   5821 C  C   . GLN E 1 93  ? -2.597  85.825  77.293  1.00 32.16  ? 239 GLN E C   1 
ATOM   5822 O  O   . GLN E 1 93  ? -1.789  85.450  76.446  1.00 30.29  ? 239 GLN E O   1 
ATOM   5823 C  CB  . GLN E 1 93  ? -4.741  86.962  76.576  1.00 30.89  ? 239 GLN E CB  1 
ATOM   5824 C  CG  . GLN E 1 93  ? -4.089  87.575  75.341  1.00 30.83  ? 239 GLN E CG  1 
ATOM   5825 C  CD  . GLN E 1 93  ? -4.410  86.818  74.064  1.00 38.15  ? 239 GLN E CD  1 
ATOM   5826 O  OE1 . GLN E 1 93  ? -5.004  85.741  74.098  1.00 41.01  ? 239 GLN E OE1 1 
ATOM   5827 N  NE2 . GLN E 1 93  ? -4.021  87.385  72.926  1.00 40.03  ? 239 GLN E NE2 1 
ATOM   5828 N  N   . GLU E 1 94  ? -2.220  86.388  78.438  1.00 32.86  ? 240 GLU E N   1 
ATOM   5829 C  CA  . GLU E 1 94  ? -0.808  86.568  78.758  1.00 35.26  ? 240 GLU E CA  1 
ATOM   5830 C  C   . GLU E 1 94  ? -0.103  85.228  78.901  1.00 31.25  ? 240 GLU E C   1 
ATOM   5831 O  O   . GLU E 1 94  ? 0.967   85.017  78.335  1.00 32.23  ? 240 GLU E O   1 
ATOM   5832 C  CB  . GLU E 1 94  ? -0.620  87.380  80.043  1.00 41.63  ? 240 GLU E CB  1 
ATOM   5833 C  CG  . GLU E 1 94  ? 0.827   87.376  80.537  1.00 46.57  ? 240 GLU E CG  1 
ATOM   5834 C  CD  . GLU E 1 94  ? 1.019   88.118  81.848  1.00 52.50  ? 240 GLU E CD  1 
ATOM   5835 O  OE1 . GLU E 1 94  ? 1.028   87.461  82.910  1.00 56.33  ? 240 GLU E OE1 1 
ATOM   5836 O  OE2 . GLU E 1 94  ? 1.173   89.356  81.815  1.00 53.12  ? 240 GLU E OE2 1 
ATOM   5837 N  N   . PHE E 1 95  ? -0.701  84.332  79.678  1.00 30.74  ? 241 PHE E N   1 
ATOM   5838 C  CA  . PHE E 1 95  ? -0.173  82.981  79.835  1.00 31.82  ? 241 PHE E CA  1 
ATOM   5839 C  C   . PHE E 1 95  ? 0.047   82.310  78.483  1.00 35.02  ? 241 PHE E C   1 
ATOM   5840 O  O   . PHE E 1 95  ? 1.130   81.790  78.198  1.00 37.46  ? 241 PHE E O   1 
ATOM   5841 C  CB  . PHE E 1 95  ? -1.131  82.134  80.669  1.00 30.18  ? 241 PHE E CB  1 
ATOM   5842 C  CG  . PHE E 1 95  ? -0.895  80.660  80.543  1.00 33.01  ? 241 PHE E CG  1 
ATOM   5843 C  CD1 . PHE E 1 95  ? 0.228   80.074  81.106  1.00 33.06  ? 241 PHE E CD1 1 
ATOM   5844 C  CD2 . PHE E 1 95  ? -1.794  79.857  79.858  1.00 34.50  ? 241 PHE E CD2 1 
ATOM   5845 C  CE1 . PHE E 1 95  ? 0.450   78.717  80.990  1.00 33.35  ? 241 PHE E CE1 1 
ATOM   5846 C  CE2 . PHE E 1 95  ? -1.578  78.496  79.740  1.00 33.84  ? 241 PHE E CE2 1 
ATOM   5847 C  CZ  . PHE E 1 95  ? -0.455  77.925  80.308  1.00 32.85  ? 241 PHE E CZ  1 
ATOM   5848 N  N   . LEU E 1 96  ? -0.990  82.326  77.654  1.00 31.12  ? 242 LEU E N   1 
ATOM   5849 C  CA  . LEU E 1 96  ? -0.930  81.678  76.351  1.00 29.01  ? 242 LEU E CA  1 
ATOM   5850 C  C   . LEU E 1 96  ? 0.194   82.230  75.483  1.00 28.05  ? 242 LEU E C   1 
ATOM   5851 O  O   . LEU E 1 96  ? 1.009   81.465  74.973  1.00 27.14  ? 242 LEU E O   1 
ATOM   5852 C  CB  . LEU E 1 96  ? -2.276  81.790  75.624  1.00 26.37  ? 242 LEU E CB  1 
ATOM   5853 C  CG  . LEU E 1 96  ? -3.407  80.943  76.209  1.00 24.74  ? 242 LEU E CG  1 
ATOM   5854 C  CD1 . LEU E 1 96  ? -4.719  81.238  75.511  1.00 26.15  ? 242 LEU E CD1 1 
ATOM   5855 C  CD2 . LEU E 1 96  ? -3.063  79.479  76.097  1.00 25.82  ? 242 LEU E CD2 1 
ATOM   5856 N  N   . TYR E 1 97  ? 0.253   83.549  75.311  1.00 26.72  ? 243 TYR E N   1 
ATOM   5857 C  CA  . TYR E 1 97  ? 1.263   84.106  74.412  1.00 26.82  ? 243 TYR E CA  1 
ATOM   5858 C  C   . TYR E 1 97  ? 2.676   83.897  74.954  1.00 29.89  ? 243 TYR E C   1 
ATOM   5859 O  O   . TYR E 1 97  ? 3.595   83.578  74.200  1.00 30.64  ? 243 TYR E O   1 
ATOM   5860 C  CB  . TYR E 1 97  ? 0.971   85.572  74.020  1.00 25.45  ? 243 TYR E CB  1 
ATOM   5861 C  CG  . TYR E 1 97  ? 1.615   86.665  74.865  1.00 27.85  ? 243 TYR E CG  1 
ATOM   5862 C  CD1 . TYR E 1 97  ? 2.998   86.840  74.890  1.00 30.24  ? 243 TYR E CD1 1 
ATOM   5863 C  CD2 . TYR E 1 97  ? 0.835   87.554  75.595  1.00 28.52  ? 243 TYR E CD2 1 
ATOM   5864 C  CE1 . TYR E 1 97  ? 3.586   87.845  75.654  1.00 32.28  ? 243 TYR E CE1 1 
ATOM   5865 C  CE2 . TYR E 1 97  ? 1.411   88.567  76.354  1.00 33.08  ? 243 TYR E CE2 1 
ATOM   5866 C  CZ  . TYR E 1 97  ? 2.786   88.705  76.379  1.00 35.90  ? 243 TYR E CZ  1 
ATOM   5867 O  OH  . TYR E 1 97  ? 3.363   89.705  77.129  1.00 43.86  ? 243 TYR E OH  1 
ATOM   5868 N  N   . LYS E 1 98  ? 2.840   84.045  76.263  1.00 31.04  ? 244 LYS E N   1 
ATOM   5869 C  CA  . LYS E 1 98  ? 4.144   83.822  76.877  1.00 34.19  ? 244 LYS E CA  1 
ATOM   5870 C  C   . LYS E 1 98  ? 4.575   82.366  76.754  1.00 27.83  ? 244 LYS E C   1 
ATOM   5871 O  O   . LYS E 1 98  ? 5.713   82.081  76.389  1.00 24.77  ? 244 LYS E O   1 
ATOM   5872 C  CB  . LYS E 1 98  ? 4.156   84.276  78.339  1.00 36.35  ? 244 LYS E CB  1 
ATOM   5873 C  CG  . LYS E 1 98  ? 4.095   85.788  78.497  1.00 38.87  ? 244 LYS E CG  1 
ATOM   5874 C  CD  . LYS E 1 98  ? 4.533   86.222  79.885  1.00 43.41  ? 244 LYS E CD  1 
ATOM   5875 C  CE  . LYS E 1 98  ? 4.726   87.728  79.952  1.00 46.65  ? 244 LYS E CE  1 
ATOM   5876 N  NZ  . LYS E 1 98  ? 5.088   88.172  81.324  1.00 50.05  ? 244 LYS E NZ  1 
ATOM   5877 N  N   . THR E 1 99  ? 3.659   81.446  77.037  1.00 26.38  ? 245 THR E N   1 
ATOM   5878 C  CA  . THR E 1 99  ? 3.971   80.026  76.944  1.00 25.45  ? 245 THR E CA  1 
ATOM   5879 C  C   . THR E 1 99  ? 4.169   79.592  75.487  1.00 28.40  ? 245 THR E C   1 
ATOM   5880 O  O   . THR E 1 99  ? 4.949   78.681  75.199  1.00 29.01  ? 245 THR E O   1 
ATOM   5881 C  CB  . THR E 1 99  ? 2.886   79.164  77.614  1.00 27.29  ? 245 THR E CB  1 
ATOM   5882 O  OG1 . THR E 1 99  ? 2.693   79.602  78.960  1.00 30.83  ? 245 THR E OG1 1 
ATOM   5883 C  CG2 . THR E 1 99  ? 3.290   77.696  77.630  1.00 25.41  ? 245 THR E CG2 1 
ATOM   5884 N  N   . ALA E 1 100 ? 3.469   80.251  74.569  1.00 28.39  ? 246 ALA E N   1 
ATOM   5885 C  CA  . ALA E 1 100 ? 3.621   79.963  73.144  1.00 29.99  ? 246 ALA E CA  1 
ATOM   5886 C  C   . ALA E 1 100 ? 5.069   80.191  72.707  1.00 32.04  ? 246 ALA E C   1 
ATOM   5887 O  O   . ALA E 1 100 ? 5.543   79.570  71.759  1.00 28.86  ? 246 ALA E O   1 
ATOM   5888 C  CB  . ALA E 1 100 ? 2.664   80.818  72.316  1.00 30.29  ? 246 ALA E CB  1 
ATOM   5889 N  N   . GLY E 1 101 ? 5.760   81.092  73.402  1.00 31.68  ? 247 GLY E N   1 
ATOM   5890 C  CA  . GLY E 1 101 ? 7.191   81.261  73.230  1.00 28.89  ? 247 GLY E CA  1 
ATOM   5891 C  C   . GLY E 1 101 ? 7.660   81.601  71.829  1.00 28.62  ? 247 GLY E C   1 
ATOM   5892 O  O   . GLY E 1 101 ? 8.768   81.230  71.438  1.00 26.11  ? 247 GLY E O   1 
ATOM   5893 N  N   . GLY E 1 102 ? 6.826   82.305  71.069  1.00 29.24  ? 248 GLY E N   1 
ATOM   5894 C  CA  . GLY E 1 102 ? 7.231   82.792  69.761  1.00 29.49  ? 248 GLY E CA  1 
ATOM   5895 C  C   . GLY E 1 102 ? 6.870   81.873  68.606  1.00 31.51  ? 248 GLY E C   1 
ATOM   5896 O  O   . GLY E 1 102 ? 7.153   82.181  67.449  1.00 33.61  ? 248 GLY E O   1 
ATOM   5897 N  N   . LEU E 1 103 ? 6.254   80.739  68.916  1.00 29.81  ? 249 LEU E N   1 
ATOM   5898 C  CA  . LEU E 1 103 ? 5.753   79.846  67.880  1.00 32.59  ? 249 LEU E CA  1 
ATOM   5899 C  C   . LEU E 1 103 ? 4.278   80.138  67.644  1.00 32.49  ? 249 LEU E C   1 
ATOM   5900 O  O   . LEU E 1 103 ? 3.613   80.720  68.500  1.00 31.02  ? 249 LEU E O   1 
ATOM   5901 C  CB  . LEU E 1 103 ? 5.950   78.381  68.278  1.00 34.16  ? 249 LEU E CB  1 
ATOM   5902 C  CG  . LEU E 1 103 ? 7.402   77.939  68.451  1.00 34.17  ? 249 LEU E CG  1 
ATOM   5903 C  CD1 . LEU E 1 103 ? 7.496   76.434  68.641  1.00 30.38  ? 249 LEU E CD1 1 
ATOM   5904 C  CD2 . LEU E 1 103 ? 8.209   78.375  67.244  1.00 35.51  ? 249 LEU E CD2 1 
ATOM   5905 N  N   . ILE E 1 104 ? 3.768   79.736  66.485  1.00 32.18  ? 250 ILE E N   1 
ATOM   5906 C  CA  . ILE E 1 104 ? 2.375   79.990  66.140  1.00 31.20  ? 250 ILE E CA  1 
ATOM   5907 C  C   . ILE E 1 104 ? 1.493   78.794  66.460  1.00 29.76  ? 250 ILE E C   1 
ATOM   5908 O  O   . ILE E 1 104 ? 1.753   77.681  66.007  1.00 33.44  ? 250 ILE E O   1 
ATOM   5909 C  CB  . ILE E 1 104 ? 2.225   80.366  64.651  1.00 34.32  ? 250 ILE E CB  1 
ATOM   5910 C  CG1 . ILE E 1 104 ? 2.955   81.680  64.370  1.00 35.01  ? 250 ILE E CG1 1 
ATOM   5911 C  CG2 . ILE E 1 104 ? 0.758   80.505  64.278  1.00 36.79  ? 250 ILE E CG2 1 
ATOM   5912 C  CD1 . ILE E 1 104 ? 3.115   81.997  62.906  1.00 35.62  ? 250 ILE E CD1 1 
ATOM   5913 N  N   . TYR E 1 105 ? 0.449   79.032  67.248  1.00 30.15  ? 251 TYR E N   1 
ATOM   5914 C  CA  . TYR E 1 105 ? -0.485  77.982  67.640  1.00 26.80  ? 251 TYR E CA  1 
ATOM   5915 C  C   . TYR E 1 105 ? -1.914  78.331  67.241  1.00 26.90  ? 251 TYR E C   1 
ATOM   5916 O  O   . TYR E 1 105 ? -2.376  79.442  67.509  1.00 24.10  ? 251 TYR E O   1 
ATOM   5917 C  CB  . TYR E 1 105 ? -0.455  77.776  69.157  1.00 24.76  ? 251 TYR E CB  1 
ATOM   5918 C  CG  . TYR E 1 105 ? 0.841   77.226  69.710  1.00 27.55  ? 251 TYR E CG  1 
ATOM   5919 C  CD1 . TYR E 1 105 ? 0.985   75.871  69.985  1.00 23.43  ? 251 TYR E CD1 1 
ATOM   5920 C  CD2 . TYR E 1 105 ? 1.910   78.068  69.984  1.00 27.76  ? 251 TYR E CD2 1 
ATOM   5921 C  CE1 . TYR E 1 105 ? 2.165   75.373  70.507  1.00 24.59  ? 251 TYR E CE1 1 
ATOM   5922 C  CE2 . TYR E 1 105 ? 3.086   77.580  70.500  1.00 27.09  ? 251 TYR E CE2 1 
ATOM   5923 C  CZ  . TYR E 1 105 ? 3.210   76.235  70.759  1.00 25.47  ? 251 TYR E CZ  1 
ATOM   5924 O  OH  . TYR E 1 105 ? 4.394   75.765  71.272  1.00 26.32  ? 251 TYR E OH  1 
ATOM   5925 N  N   . TRP E 1 106 ? -2.612  77.386  66.612  1.00 27.13  ? 252 TRP E N   1 
ATOM   5926 C  CA  . TRP E 1 106 ? -4.051  77.518  66.401  1.00 27.54  ? 252 TRP E CA  1 
ATOM   5927 C  C   . TRP E 1 106 ? -4.696  77.605  67.769  1.00 29.47  ? 252 TRP E C   1 
ATOM   5928 O  O   . TRP E 1 106 ? -4.295  76.886  68.695  1.00 28.76  ? 252 TRP E O   1 
ATOM   5929 C  CB  . TRP E 1 106 ? -4.644  76.287  65.694  1.00 27.27  ? 252 TRP E CB  1 
ATOM   5930 C  CG  . TRP E 1 106 ? -4.442  76.183  64.204  1.00 30.27  ? 252 TRP E CG  1 
ATOM   5931 C  CD1 . TRP E 1 106 ? -3.874  75.137  63.526  1.00 31.47  ? 252 TRP E CD1 1 
ATOM   5932 C  CD2 . TRP E 1 106 ? -4.836  77.137  63.208  1.00 32.29  ? 252 TRP E CD2 1 
ATOM   5933 N  NE1 . TRP E 1 106 ? -3.880  75.388  62.175  1.00 34.30  ? 252 TRP E NE1 1 
ATOM   5934 C  CE2 . TRP E 1 106 ? -4.463  76.608  61.952  1.00 33.35  ? 252 TRP E CE2 1 
ATOM   5935 C  CE3 . TRP E 1 106 ? -5.459  78.390  63.254  1.00 32.73  ? 252 TRP E CE3 1 
ATOM   5936 C  CZ2 . TRP E 1 106 ? -4.693  77.289  60.756  1.00 34.90  ? 252 TRP E CZ2 1 
ATOM   5937 C  CZ3 . TRP E 1 106 ? -5.686  79.065  62.063  1.00 33.43  ? 252 TRP E CZ3 1 
ATOM   5938 C  CH2 . TRP E 1 106 ? -5.304  78.513  60.832  1.00 34.89  ? 252 TRP E CH2 1 
ATOM   5939 N  N   . ILE E 1 107 ? -5.692  78.476  67.902  1.00 29.04  ? 253 ILE E N   1 
ATOM   5940 C  CA  . ILE E 1 107 ? -6.562  78.457  69.075  1.00 28.80  ? 253 ILE E CA  1 
ATOM   5941 C  C   . ILE E 1 107 ? -8.013  78.249  68.622  1.00 32.01  ? 253 ILE E C   1 
ATOM   5942 O  O   . ILE E 1 107 ? -8.257  77.948  67.454  1.00 31.61  ? 253 ILE E O   1 
ATOM   5943 C  CB  . ILE E 1 107 ? -6.401  79.720  69.946  1.00 28.93  ? 253 ILE E CB  1 
ATOM   5944 C  CG1 . ILE E 1 107 ? -6.789  80.982  69.174  1.00 28.22  ? 253 ILE E CG1 1 
ATOM   5945 C  CG2 . ILE E 1 107 ? -4.964  79.838  70.442  1.00 31.29  ? 253 ILE E CG2 1 
ATOM   5946 C  CD1 . ILE E 1 107 ? -6.767  82.246  70.045  1.00 24.03  ? 253 ILE E CD1 1 
ATOM   5947 N  N   . GLY E 1 108 ? -8.967  78.398  69.536  1.00 33.52  ? 254 GLY E N   1 
ATOM   5948 C  CA  . GLY E 1 108 ? -10.355 78.072  69.248  1.00 36.46  ? 254 GLY E CA  1 
ATOM   5949 C  C   . GLY E 1 108 ? -11.122 79.037  68.356  1.00 36.45  ? 254 GLY E C   1 
ATOM   5950 O  O   . GLY E 1 108 ? -12.324 78.873  68.160  1.00 34.88  ? 254 GLY E O   1 
ATOM   5951 N  N   . LEU E 1 109 ? -10.434 80.039  67.817  1.00 36.69  ? 255 LEU E N   1 
ATOM   5952 C  CA  . LEU E 1 109 ? -11.065 81.066  66.989  1.00 36.56  ? 255 LEU E CA  1 
ATOM   5953 C  C   . LEU E 1 109 ? -11.550 80.522  65.655  1.00 36.01  ? 255 LEU E C   1 
ATOM   5954 O  O   . LEU E 1 109 ? -10.759 79.967  64.893  1.00 34.36  ? 255 LEU E O   1 
ATOM   5955 C  CB  . LEU E 1 109 ? -10.073 82.193  66.709  1.00 36.77  ? 255 LEU E CB  1 
ATOM   5956 C  CG  . LEU E 1 109 ? -9.829  83.206  67.818  1.00 37.76  ? 255 LEU E CG  1 
ATOM   5957 C  CD1 . LEU E 1 109 ? -8.541  83.979  67.554  1.00 37.15  ? 255 LEU E CD1 1 
ATOM   5958 C  CD2 . LEU E 1 109 ? -11.028 84.136  67.928  1.00 39.01  ? 255 LEU E CD2 1 
ATOM   5959 N  N   . THR E 1 110 ? -12.836 80.705  65.361  1.00 36.39  ? 256 THR E N   1 
ATOM   5960 C  CA  . THR E 1 110 ? -13.390 80.278  64.073  1.00 39.82  ? 256 THR E CA  1 
ATOM   5961 C  C   . THR E 1 110 ? -14.446 81.238  63.516  1.00 39.05  ? 256 THR E C   1 
ATOM   5962 O  O   . THR E 1 110 ? -15.331 81.690  64.239  1.00 39.58  ? 256 THR E O   1 
ATOM   5963 C  CB  . THR E 1 110 ? -13.985 78.856  64.146  1.00 39.96  ? 256 THR E CB  1 
ATOM   5964 O  OG1 . THR E 1 110 ? -14.380 78.439  62.837  1.00 39.15  ? 256 THR E OG1 1 
ATOM   5965 C  CG2 . THR E 1 110 ? -15.192 78.821  65.075  1.00 41.48  ? 256 THR E CG2 1 
ATOM   5966 N  N   . LYS E 1 111 ? -14.348 81.542  62.225  1.00 41.39  ? 257 LYS E N   1 
ATOM   5967 C  CA  . LYS E 1 111 ? -15.307 82.431  61.571  1.00 46.29  ? 257 LYS E CA  1 
ATOM   5968 C  C   . LYS E 1 111 ? -16.189 81.666  60.588  1.00 48.24  ? 257 LYS E C   1 
ATOM   5969 O  O   . LYS E 1 111 ? -15.696 81.065  59.631  1.00 48.58  ? 257 LYS E O   1 
ATOM   5970 C  CB  . LYS E 1 111 ? -14.583 83.569  60.847  1.00 48.21  ? 257 LYS E CB  1 
ATOM   5971 C  CG  . LYS E 1 111 ? -15.509 84.490  60.072  1.00 51.32  ? 257 LYS E CG  1 
ATOM   5972 C  CD  . LYS E 1 111 ? -14.809 85.077  58.857  1.00 54.98  ? 257 LYS E CD  1 
ATOM   5973 C  CE  . LYS E 1 111 ? -14.055 86.345  59.195  1.00 56.57  ? 257 LYS E CE  1 
ATOM   5974 N  NZ  . LYS E 1 111 ? -14.991 87.487  59.381  1.00 61.56  ? 257 LYS E NZ  1 
ATOM   5975 N  N   . ALA E 1 112 ? -17.495 81.692  60.824  1.00 50.11  ? 258 ALA E N   1 
ATOM   5976 C  CA  . ALA E 1 112 ? -18.430 80.957  59.978  1.00 53.14  ? 258 ALA E CA  1 
ATOM   5977 C  C   . ALA E 1 112 ? -19.012 81.847  58.883  1.00 57.86  ? 258 ALA E C   1 
ATOM   5978 O  O   . ALA E 1 112 ? -19.738 82.802  59.168  1.00 56.65  ? 258 ALA E O   1 
ATOM   5979 C  CB  . ALA E 1 112 ? -19.546 80.348  60.820  1.00 52.76  ? 258 ALA E CB  1 
ATOM   5980 N  N   . GLY E 1 113 ? -18.695 81.526  57.632  1.00 62.76  ? 259 GLY E N   1 
ATOM   5981 C  CA  . GLY E 1 113 ? -19.152 82.317  56.505  1.00 68.95  ? 259 GLY E CA  1 
ATOM   5982 C  C   . GLY E 1 113 ? -18.251 83.514  56.270  1.00 74.35  ? 259 GLY E C   1 
ATOM   5983 O  O   . GLY E 1 113 ? -17.544 83.957  57.177  1.00 72.70  ? 259 GLY E O   1 
ATOM   5984 N  N   . MET E 1 114 ? -18.273 84.041  55.051  1.00 79.80  ? 260 MET E N   1 
ATOM   5985 C  CA  . MET E 1 114 ? -17.392 85.146  54.691  1.00 84.00  ? 260 MET E CA  1 
ATOM   5986 C  C   . MET E 1 114 ? -17.719 86.402  55.494  1.00 83.39  ? 260 MET E C   1 
ATOM   5987 O  O   . MET E 1 114 ? -16.863 87.267  55.691  1.00 83.63  ? 260 MET E O   1 
ATOM   5988 C  CB  . MET E 1 114 ? -17.491 85.440  53.193  1.00 88.96  ? 260 MET E CB  1 
ATOM   5989 C  CG  . MET E 1 114 ? -16.252 86.099  52.606  1.00 91.54  ? 260 MET E CG  1 
ATOM   5990 S  SD  . MET E 1 114 ? -15.119 84.902  51.875  1.00 134.98 ? 260 MET E SD  1 
ATOM   5991 C  CE  . MET E 1 114 ? -16.138 84.254  50.552  1.00 104.41 ? 260 MET E CE  1 
ATOM   5992 N  N   . GLU E 1 115 ? -18.964 86.492  55.955  1.00 82.10  ? 261 GLU E N   1 
ATOM   5993 C  CA  . GLU E 1 115 ? -19.435 87.651  56.707  1.00 80.39  ? 261 GLU E CA  1 
ATOM   5994 C  C   . GLU E 1 115 ? -19.544 87.342  58.194  1.00 74.09  ? 261 GLU E C   1 
ATOM   5995 O  O   . GLU E 1 115 ? -19.385 88.228  59.033  1.00 72.31  ? 261 GLU E O   1 
ATOM   5996 C  CB  . GLU E 1 115 ? -20.805 88.093  56.186  1.00 85.38  ? 261 GLU E CB  1 
ATOM   5997 C  CG  . GLU E 1 115 ? -20.776 88.821  54.851  1.00 89.10  ? 261 GLU E CG  1 
ATOM   5998 C  CD  . GLU E 1 115 ? -20.504 90.308  55.000  1.00 91.50  ? 261 GLU E CD  1 
ATOM   5999 O  OE1 . GLU E 1 115 ? -21.386 91.114  54.630  1.00 92.50  ? 261 GLU E OE1 1 
ATOM   6000 O  OE2 . GLU E 1 115 ? -19.413 90.672  55.490  1.00 91.41  ? 261 GLU E OE2 1 
ATOM   6001 N  N   . GLY E 1 116 ? -19.818 86.078  58.501  1.00 69.60  ? 262 GLY E N   1 
ATOM   6002 C  CA  . GLY E 1 116 ? -20.108 85.632  59.855  1.00 65.25  ? 262 GLY E CA  1 
ATOM   6003 C  C   . GLY E 1 116 ? -19.228 86.155  60.977  1.00 56.47  ? 262 GLY E C   1 
ATOM   6004 O  O   . GLY E 1 116 ? -18.141 86.689  60.746  1.00 49.23  ? 262 GLY E O   1 
ATOM   6005 N  N   . ASP E 1 117 ? -19.715 85.991  62.204  1.00 57.03  ? 263 ASP E N   1 
ATOM   6006 C  CA  . ASP E 1 117 ? -19.012 86.461  63.394  1.00 58.35  ? 263 ASP E CA  1 
ATOM   6007 C  C   . ASP E 1 117 ? -17.945 85.471  63.843  1.00 52.11  ? 263 ASP E C   1 
ATOM   6008 O  O   . ASP E 1 117 ? -17.948 84.307  63.438  1.00 49.70  ? 263 ASP E O   1 
ATOM   6009 C  CB  . ASP E 1 117 ? -19.999 86.695  64.543  1.00 65.26  ? 263 ASP E CB  1 
ATOM   6010 C  CG  . ASP E 1 117 ? -20.909 87.888  64.302  1.00 71.10  ? 263 ASP E CG  1 
ATOM   6011 O  OD1 . ASP E 1 117 ? -20.396 89.027  64.247  1.00 72.40  ? 263 ASP E OD1 1 
ATOM   6012 O  OD2 . ASP E 1 117 ? -22.137 87.689  64.181  1.00 73.41  ? 263 ASP E OD2 1 
ATOM   6013 N  N   . TRP E 1 118 ? -17.030 85.940  64.683  1.00 46.49  ? 264 TRP E N   1 
ATOM   6014 C  CA  . TRP E 1 118 ? -16.031 85.059  65.269  1.00 45.04  ? 264 TRP E CA  1 
ATOM   6015 C  C   . TRP E 1 118 ? -16.598 84.359  66.497  1.00 45.51  ? 264 TRP E C   1 
ATOM   6016 O  O   . TRP E 1 118 ? -17.330 84.963  67.282  1.00 49.54  ? 264 TRP E O   1 
ATOM   6017 C  CB  . TRP E 1 118 ? -14.769 85.839  65.631  1.00 43.00  ? 264 TRP E CB  1 
ATOM   6018 C  CG  . TRP E 1 118 ? -13.942 86.208  64.441  1.00 41.31  ? 264 TRP E CG  1 
ATOM   6019 C  CD1 . TRP E 1 118 ? -13.961 87.392  63.763  1.00 42.63  ? 264 TRP E CD1 1 
ATOM   6020 C  CD2 . TRP E 1 118 ? -12.972 85.386  63.783  1.00 36.32  ? 264 TRP E CD2 1 
ATOM   6021 N  NE1 . TRP E 1 118 ? -13.060 87.359  62.728  1.00 37.93  ? 264 TRP E NE1 1 
ATOM   6022 C  CE2 . TRP E 1 118 ? -12.439 86.139  62.719  1.00 33.21  ? 264 TRP E CE2 1 
ATOM   6023 C  CE3 . TRP E 1 118 ? -12.499 84.088  63.994  1.00 35.94  ? 264 TRP E CE3 1 
ATOM   6024 C  CZ2 . TRP E 1 118 ? -11.461 85.638  61.867  1.00 33.15  ? 264 TRP E CZ2 1 
ATOM   6025 C  CZ3 . TRP E 1 118 ? -11.529 83.590  63.145  1.00 37.03  ? 264 TRP E CZ3 1 
ATOM   6026 C  CH2 . TRP E 1 118 ? -11.018 84.365  62.096  1.00 36.65  ? 264 TRP E CH2 1 
ATOM   6027 N  N   . SER E 1 119 ? -16.267 83.081  66.656  1.00 39.40  ? 265 SER E N   1 
ATOM   6028 C  CA  . SER E 1 119 ? -16.733 82.318  67.809  1.00 40.83  ? 265 SER E CA  1 
ATOM   6029 C  C   . SER E 1 119 ? -15.631 81.426  68.388  1.00 40.31  ? 265 SER E C   1 
ATOM   6030 O  O   . SER E 1 119 ? -14.602 81.194  67.748  1.00 37.56  ? 265 SER E O   1 
ATOM   6031 C  CB  . SER E 1 119 ? -17.953 81.472  67.436  1.00 41.39  ? 265 SER E CB  1 
ATOM   6032 O  OG  . SER E 1 119 ? -17.607 80.454  66.510  1.00 40.20  ? 265 SER E OG  1 
ATOM   6033 N  N   . TRP E 1 120 ? -15.849 80.943  69.608  1.00 41.17  ? 266 TRP E N   1 
ATOM   6034 C  CA  . TRP E 1 120 ? -14.966 79.946  70.206  1.00 41.35  ? 266 TRP E CA  1 
ATOM   6035 C  C   . TRP E 1 120 ? -15.513 78.560  69.924  1.00 39.56  ? 266 TRP E C   1 
ATOM   6036 O  O   . TRP E 1 120 ? -16.721 78.334  69.998  1.00 39.65  ? 266 TRP E O   1 
ATOM   6037 C  CB  . TRP E 1 120 ? -14.835 80.156  71.715  1.00 39.66  ? 266 TRP E CB  1 
ATOM   6038 C  CG  . TRP E 1 120 ? -14.128 81.415  72.062  1.00 39.49  ? 266 TRP E CG  1 
ATOM   6039 C  CD1 . TRP E 1 120 ? -14.658 82.515  72.669  1.00 40.07  ? 266 TRP E CD1 1 
ATOM   6040 C  CD2 . TRP E 1 120 ? -12.757 81.720  71.801  1.00 36.85  ? 266 TRP E CD2 1 
ATOM   6041 N  NE1 . TRP E 1 120 ? -13.699 83.483  72.809  1.00 40.53  ? 266 TRP E NE1 1 
ATOM   6042 C  CE2 . TRP E 1 120 ? -12.521 83.020  72.284  1.00 38.19  ? 266 TRP E CE2 1 
ATOM   6043 C  CE3 . TRP E 1 120 ? -11.705 81.018  71.206  1.00 33.27  ? 266 TRP E CE3 1 
ATOM   6044 C  CZ2 . TRP E 1 120 ? -11.272 83.635  72.196  1.00 34.34  ? 266 TRP E CZ2 1 
ATOM   6045 C  CZ3 . TRP E 1 120 ? -10.470 81.627  71.118  1.00 31.58  ? 266 TRP E CZ3 1 
ATOM   6046 C  CH2 . TRP E 1 120 ? -10.262 82.924  71.610  1.00 29.41  ? 266 TRP E CH2 1 
ATOM   6047 N  N   . VAL E 1 121 ? -14.626 77.631  69.596  1.00 39.31  ? 267 VAL E N   1 
ATOM   6048 C  CA  . VAL E 1 121 ? -15.062 76.276  69.301  1.00 41.59  ? 267 VAL E CA  1 
ATOM   6049 C  C   . VAL E 1 121 ? -15.586 75.589  70.563  1.00 45.58  ? 267 VAL E C   1 
ATOM   6050 O  O   . VAL E 1 121 ? -16.547 74.823  70.501  1.00 47.70  ? 267 VAL E O   1 
ATOM   6051 C  CB  . VAL E 1 121 ? -13.955 75.439  68.623  1.00 40.09  ? 267 VAL E CB  1 
ATOM   6052 C  CG1 . VAL E 1 121 ? -12.824 75.134  69.598  1.00 37.58  ? 267 VAL E CG1 1 
ATOM   6053 C  CG2 . VAL E 1 121 ? -14.542 74.153  68.047  1.00 42.24  ? 267 VAL E CG2 1 
ATOM   6054 N  N   . ASP E 1 122 ? -14.974 75.881  71.709  1.00 44.99  ? 268 ASP E N   1 
ATOM   6055 C  CA  . ASP E 1 122 ? -15.421 75.272  72.962  1.00 48.06  ? 268 ASP E CA  1 
ATOM   6056 C  C   . ASP E 1 122 ? -16.751 75.866  73.431  1.00 51.31  ? 268 ASP E C   1 
ATOM   6057 O  O   . ASP E 1 122 ? -17.265 75.516  74.492  1.00 52.70  ? 268 ASP E O   1 
ATOM   6058 C  CB  . ASP E 1 122 ? -14.337 75.340  74.052  1.00 47.00  ? 268 ASP E CB  1 
ATOM   6059 C  CG  . ASP E 1 122 ? -14.026 76.760  74.500  1.00 49.73  ? 268 ASP E CG  1 
ATOM   6060 O  OD1 . ASP E 1 122 ? -14.798 77.690  74.181  1.00 51.93  ? 268 ASP E OD1 1 
ATOM   6061 O  OD2 . ASP E 1 122 ? -12.999 76.942  75.189  1.00 50.00  ? 268 ASP E OD2 1 
ATOM   6062 N  N   . ASP E 1 123 ? -17.300 76.757  72.612  1.00 55.26  ? 269 ASP E N   1 
ATOM   6063 C  CA  . ASP E 1 123 ? -18.607 77.368  72.852  1.00 59.04  ? 269 ASP E CA  1 
ATOM   6064 C  C   . ASP E 1 123 ? -18.644 78.393  73.987  1.00 58.06  ? 269 ASP E C   1 
ATOM   6065 O  O   . ASP E 1 123 ? -19.717 78.826  74.407  1.00 56.51  ? 269 ASP E O   1 
ATOM   6066 C  CB  . ASP E 1 123 ? -19.694 76.304  73.025  1.00 63.14  ? 269 ASP E CB  1 
ATOM   6067 C  CG  . ASP E 1 123 ? -20.381 75.970  71.718  1.00 67.65  ? 269 ASP E CG  1 
ATOM   6068 O  OD1 . ASP E 1 123 ? -20.780 76.914  71.000  1.00 67.60  ? 269 ASP E OD1 1 
ATOM   6069 O  OD2 . ASP E 1 123 ? -20.519 74.769  71.407  1.00 71.05  ? 269 ASP E OD2 1 
ATOM   6070 N  N   . THR E 1 124 ? -17.470 78.778  74.477  1.00 57.47  ? 270 THR E N   1 
ATOM   6071 C  CA  . THR E 1 124 ? -17.363 79.941  75.341  1.00 58.88  ? 270 THR E CA  1 
ATOM   6072 C  C   . THR E 1 124 ? -17.933 81.132  74.582  1.00 61.90  ? 270 THR E C   1 
ATOM   6073 O  O   . THR E 1 124 ? -17.682 81.282  73.386  1.00 59.82  ? 270 THR E O   1 
ATOM   6074 C  CB  . THR E 1 124 ? -15.893 80.246  75.700  1.00 54.63  ? 270 THR E CB  1 
ATOM   6075 O  OG1 . THR E 1 124 ? -15.403 79.257  76.612  1.00 54.98  ? 270 THR E OG1 1 
ATOM   6076 C  CG2 . THR E 1 124 ? -15.767 81.619  76.337  1.00 51.34  ? 270 THR E CG2 1 
ATOM   6077 N  N   . PRO E 1 125 ? -18.720 81.976  75.264  1.00 66.94  ? 271 PRO E N   1 
ATOM   6078 C  CA  . PRO E 1 125 ? -19.211 83.204  74.630  1.00 66.69  ? 271 PRO E CA  1 
ATOM   6079 C  C   . PRO E 1 125 ? -18.052 84.063  74.141  1.00 65.28  ? 271 PRO E C   1 
ATOM   6080 O  O   . PRO E 1 125 ? -17.056 84.222  74.848  1.00 64.65  ? 271 PRO E O   1 
ATOM   6081 C  CB  . PRO E 1 125 ? -19.945 83.911  75.768  1.00 69.85  ? 271 PRO E CB  1 
ATOM   6082 C  CG  . PRO E 1 125 ? -20.373 82.812  76.674  1.00 71.86  ? 271 PRO E CG  1 
ATOM   6083 C  CD  . PRO E 1 125 ? -19.281 81.785  76.613  1.00 70.08  ? 271 PRO E CD  1 
ATOM   6084 N  N   . PHE E 1 126 ? -18.186 84.602  72.935  1.00 65.52  ? 272 PHE E N   1 
ATOM   6085 C  CA  . PHE E 1 126 ? -17.148 85.439  72.352  1.00 62.36  ? 272 PHE E CA  1 
ATOM   6086 C  C   . PHE E 1 126 ? -17.422 86.901  72.659  1.00 61.57  ? 272 PHE E C   1 
ATOM   6087 O  O   . PHE E 1 126 ? -18.383 87.479  72.150  1.00 62.19  ? 272 PHE E O   1 
ATOM   6088 C  CB  . PHE E 1 126 ? -17.073 85.226  70.838  1.00 61.97  ? 272 PHE E CB  1 
ATOM   6089 C  CG  . PHE E 1 126 ? -15.933 85.954  70.174  1.00 60.54  ? 272 PHE E CG  1 
ATOM   6090 C  CD1 . PHE E 1 126 ? -14.693 85.349  70.036  1.00 59.39  ? 272 PHE E CD1 1 
ATOM   6091 C  CD2 . PHE E 1 126 ? -16.103 87.239  69.682  1.00 58.52  ? 272 PHE E CD2 1 
ATOM   6092 C  CE1 . PHE E 1 126 ? -13.644 86.016  69.425  1.00 57.32  ? 272 PHE E CE1 1 
ATOM   6093 C  CE2 . PHE E 1 126 ? -15.058 87.908  69.071  1.00 55.82  ? 272 PHE E CE2 1 
ATOM   6094 C  CZ  . PHE E 1 126 ? -13.828 87.297  68.944  1.00 55.63  ? 272 PHE E CZ  1 
ATOM   6095 N  N   . ASN E 1 127 ? -16.581 87.493  73.499  1.00 61.93  ? 273 ASN E N   1 
ATOM   6096 C  CA  . ASN E 1 127 ? -16.700 88.911  73.816  1.00 63.15  ? 273 ASN E CA  1 
ATOM   6097 C  C   . ASN E 1 127 ? -16.174 89.765  72.668  1.00 60.48  ? 273 ASN E C   1 
ATOM   6098 O  O   . ASN E 1 127 ? -14.967 89.952  72.516  1.00 57.74  ? 273 ASN E O   1 
ATOM   6099 C  CB  . ASN E 1 127 ? -15.964 89.244  75.114  1.00 63.89  ? 273 ASN E CB  1 
ATOM   6100 C  CG  . ASN E 1 127 ? -16.176 90.682  75.548  1.00 67.80  ? 273 ASN E CG  1 
ATOM   6101 O  OD1 . ASN E 1 127 ? -16.543 91.540  74.744  1.00 68.02  ? 273 ASN E OD1 1 
ATOM   6102 N  ND2 . ASN E 1 127 ? -15.944 90.954  76.827  1.00 69.41  ? 273 ASN E ND2 1 
ATOM   6103 N  N   . LYS E 1 128 ? -17.090 90.285  71.862  1.00 60.41  ? 274 LYS E N   1 
ATOM   6104 C  CA  . LYS E 1 128 ? -16.715 90.998  70.651  1.00 60.58  ? 274 LYS E CA  1 
ATOM   6105 C  C   . LYS E 1 128 ? -15.788 92.185  70.928  1.00 62.33  ? 274 LYS E C   1 
ATOM   6106 O  O   . LYS E 1 128 ? -14.834 92.420  70.189  1.00 61.91  ? 274 LYS E O   1 
ATOM   6107 C  CB  . LYS E 1 128 ? -17.969 91.441  69.891  1.00 61.11  ? 274 LYS E CB  1 
ATOM   6108 C  CG  . LYS E 1 128 ? -17.789 91.502  68.382  1.00 60.82  ? 274 LYS E CG  1 
ATOM   6109 C  CD  . LYS E 1 128 ? -19.128 91.464  67.657  1.00 61.17  ? 274 LYS E CD  1 
ATOM   6110 C  CE  . LYS E 1 128 ? -19.863 90.158  67.920  1.00 61.40  ? 274 LYS E CE  1 
ATOM   6111 N  NZ  . LYS E 1 128 ? -21.192 90.121  67.241  1.00 64.32  ? 274 LYS E NZ  1 
ATOM   6112 N  N   . VAL E 1 129 ? -16.052 92.922  72.000  1.00 64.89  ? 275 VAL E N   1 
ATOM   6113 C  CA  . VAL E 1 129 ? -15.293 94.141  72.268  1.00 67.08  ? 275 VAL E CA  1 
ATOM   6114 C  C   . VAL E 1 129 ? -14.000 93.914  73.061  1.00 67.87  ? 275 VAL E C   1 
ATOM   6115 O  O   . VAL E 1 129 ? -12.979 94.551  72.790  1.00 66.83  ? 275 VAL E O   1 
ATOM   6116 C  CB  . VAL E 1 129 ? -16.160 95.208  72.961  1.00 69.60  ? 275 VAL E CB  1 
ATOM   6117 C  CG1 . VAL E 1 129 ? -15.329 96.443  73.269  1.00 70.63  ? 275 VAL E CG1 1 
ATOM   6118 C  CG2 . VAL E 1 129 ? -17.352 95.567  72.081  1.00 68.77  ? 275 VAL E CG2 1 
ATOM   6119 N  N   . GLN E 1 130 ? -14.041 93.016  74.041  1.00 68.28  ? 276 GLN E N   1 
ATOM   6120 C  CA  . GLN E 1 130 ? -12.839 92.676  74.793  1.00 68.07  ? 276 GLN E CA  1 
ATOM   6121 C  C   . GLN E 1 130 ? -11.793 92.076  73.864  1.00 66.03  ? 276 GLN E C   1 
ATOM   6122 O  O   . GLN E 1 130 ? -10.605 92.395  73.947  1.00 63.90  ? 276 GLN E O   1 
ATOM   6123 C  CB  . GLN E 1 130 ? -13.157 91.672  75.899  1.00 68.64  ? 276 GLN E CB  1 
ATOM   6124 C  CG  . GLN E 1 130 ? -11.926 91.156  76.628  1.00 69.62  ? 276 GLN E CG  1 
ATOM   6125 C  CD  . GLN E 1 130 ? -12.067 89.712  77.071  1.00 70.70  ? 276 GLN E CD  1 
ATOM   6126 O  OE1 . GLN E 1 130 ? -12.687 88.898  76.386  1.00 71.31  ? 276 GLN E OE1 1 
ATOM   6127 N  NE2 . GLN E 1 130 ? -11.482 89.385  78.218  1.00 70.60  ? 276 GLN E NE2 1 
ATOM   6128 N  N   . SER E 1 131 ? -12.256 91.208  72.971  1.00 66.12  ? 277 SER E N   1 
ATOM   6129 C  CA  . SER E 1 131 ? -11.376 90.419  72.121  1.00 62.57  ? 277 SER E CA  1 
ATOM   6130 C  C   . SER E 1 131 ? -10.768 91.225  70.974  1.00 60.10  ? 277 SER E C   1 
ATOM   6131 O  O   . SER E 1 131 ? -9.986  90.695  70.186  1.00 63.14  ? 277 SER E O   1 
ATOM   6132 C  CB  . SER E 1 131 ? -12.128 89.202  71.572  1.00 61.71  ? 277 SER E CB  1 
ATOM   6133 O  OG  . SER E 1 131 ? -12.673 88.422  72.625  1.00 61.59  ? 277 SER E OG  1 
ATOM   6134 N  N   . ALA E 1 132 ? -11.120 92.501  70.879  1.00 53.52  ? 278 ALA E N   1 
ATOM   6135 C  CA  . ALA E 1 132 ? -10.564 93.346  69.828  1.00 52.01  ? 278 ALA E CA  1 
ATOM   6136 C  C   . ALA E 1 132 ? -9.142  93.819  70.144  1.00 52.36  ? 278 ALA E C   1 
ATOM   6137 O  O   . ALA E 1 132 ? -8.373  94.144  69.241  1.00 53.39  ? 278 ALA E O   1 
ATOM   6138 C  CB  . ALA E 1 132 ? -11.477 94.530  69.556  1.00 51.89  ? 278 ALA E CB  1 
ATOM   6139 N  N   . ARG E 1 133 ? -8.790  93.857  71.423  1.00 54.50  ? 279 ARG E N   1 
ATOM   6140 C  CA  . ARG E 1 133 ? -7.450  94.282  71.814  1.00 56.29  ? 279 ARG E CA  1 
ATOM   6141 C  C   . ARG E 1 133 ? -6.458  93.116  71.843  1.00 50.25  ? 279 ARG E C   1 
ATOM   6142 O  O   . ARG E 1 133 ? -5.280  93.299  72.155  1.00 46.79  ? 279 ARG E O   1 
ATOM   6143 C  CB  . ARG E 1 133 ? -7.479  95.010  73.160  1.00 62.79  ? 279 ARG E CB  1 
ATOM   6144 C  CG  . ARG E 1 133 ? -7.896  94.159  74.346  1.00 68.31  ? 279 ARG E CG  1 
ATOM   6145 C  CD  . ARG E 1 133 ? -7.321  94.747  75.623  1.00 75.43  ? 279 ARG E CD  1 
ATOM   6146 N  NE  . ARG E 1 133 ? -5.876  94.922  75.503  1.00 81.34  ? 279 ARG E NE  1 
ATOM   6147 C  CZ  . ARG E 1 133 ? -5.125  95.622  76.348  1.00 87.45  ? 279 ARG E CZ  1 
ATOM   6148 N  NH1 . ARG E 1 133 ? -3.817  95.719  76.147  1.00 88.19  ? 279 ARG E NH1 1 
ATOM   6149 N  NH2 . ARG E 1 133 ? -5.679  96.229  77.390  1.00 91.06  ? 279 ARG E NH2 1 
ATOM   6150 N  N   . PHE E 1 134 ? -6.942  91.924  71.499  1.00 47.25  ? 280 PHE E N   1 
ATOM   6151 C  CA  . PHE E 1 134 ? -6.114  90.719  71.495  1.00 43.95  ? 280 PHE E CA  1 
ATOM   6152 C  C   . PHE E 1 134 ? -5.630  90.337  70.095  1.00 41.84  ? 280 PHE E C   1 
ATOM   6153 O  O   . PHE E 1 134 ? -4.810  89.430  69.941  1.00 39.56  ? 280 PHE E O   1 
ATOM   6154 C  CB  . PHE E 1 134 ? -6.865  89.538  72.114  1.00 43.58  ? 280 PHE E CB  1 
ATOM   6155 C  CG  . PHE E 1 134 ? -7.161  89.701  73.578  1.00 42.01  ? 280 PHE E CG  1 
ATOM   6156 C  CD1 . PHE E 1 134 ? -6.289  90.391  74.403  1.00 43.29  ? 280 PHE E CD1 1 
ATOM   6157 C  CD2 . PHE E 1 134 ? -8.306  89.146  74.129  1.00 40.84  ? 280 PHE E CD2 1 
ATOM   6158 C  CE1 . PHE E 1 134 ? -6.559  90.537  75.756  1.00 44.65  ? 280 PHE E CE1 1 
ATOM   6159 C  CE2 . PHE E 1 134 ? -8.581  89.283  75.475  1.00 42.97  ? 280 PHE E CE2 1 
ATOM   6160 C  CZ  . PHE E 1 134 ? -7.707  89.982  76.292  1.00 43.89  ? 280 PHE E CZ  1 
ATOM   6161 N  N   . TRP E 1 135 ? -6.148  91.015  69.076  1.00 39.42  ? 281 TRP E N   1 
ATOM   6162 C  CA  . TRP E 1 135 ? -5.670  90.800  67.719  1.00 36.25  ? 281 TRP E CA  1 
ATOM   6163 C  C   . TRP E 1 135 ? -4.386  91.582  67.502  1.00 38.47  ? 281 TRP E C   1 
ATOM   6164 O  O   . TRP E 1 135 ? -4.192  92.646  68.088  1.00 42.78  ? 281 TRP E O   1 
ATOM   6165 C  CB  . TRP E 1 135 ? -6.701  91.271  66.692  1.00 36.08  ? 281 TRP E CB  1 
ATOM   6166 C  CG  . TRP E 1 135 ? -7.982  90.504  66.673  1.00 35.91  ? 281 TRP E CG  1 
ATOM   6167 C  CD1 . TRP E 1 135 ? -9.134  90.821  67.329  1.00 36.26  ? 281 TRP E CD1 1 
ATOM   6168 C  CD2 . TRP E 1 135 ? -8.258  89.302  65.936  1.00 35.55  ? 281 TRP E CD2 1 
ATOM   6169 N  NE1 . TRP E 1 135 ? -10.108 89.890  67.054  1.00 37.68  ? 281 TRP E NE1 1 
ATOM   6170 C  CE2 . TRP E 1 135 ? -9.598  88.949  66.199  1.00 34.43  ? 281 TRP E CE2 1 
ATOM   6171 C  CE3 . TRP E 1 135 ? -7.502  88.491  65.083  1.00 37.01  ? 281 TRP E CE3 1 
ATOM   6172 C  CZ2 . TRP E 1 135 ? -10.198 87.813  65.645  1.00 32.24  ? 281 TRP E CZ2 1 
ATOM   6173 C  CZ3 . TRP E 1 135 ? -8.103  87.361  64.528  1.00 36.35  ? 281 TRP E CZ3 1 
ATOM   6174 C  CH2 . TRP E 1 135 ? -9.436  87.037  64.813  1.00 31.32  ? 281 TRP E CH2 1 
ATOM   6175 N  N   . ILE E 1 136 ? -3.507  91.054  66.659  1.00 36.76  ? 282 ILE E N   1 
ATOM   6176 C  CA  . ILE E 1 136 ? -2.395  91.843  66.160  1.00 37.41  ? 282 ILE E CA  1 
ATOM   6177 C  C   . ILE E 1 136 ? -3.004  93.044  65.443  1.00 43.64  ? 282 ILE E C   1 
ATOM   6178 O  O   . ILE E 1 136 ? -3.937  92.885  64.659  1.00 44.37  ? 282 ILE E O   1 
ATOM   6179 C  CB  . ILE E 1 136 ? -1.536  91.028  65.186  1.00 36.65  ? 282 ILE E CB  1 
ATOM   6180 C  CG1 . ILE E 1 136 ? -0.785  89.924  65.938  1.00 33.98  ? 282 ILE E CG1 1 
ATOM   6181 C  CG2 . ILE E 1 136 ? -0.563  91.925  64.436  1.00 37.85  ? 282 ILE E CG2 1 
ATOM   6182 C  CD1 . ILE E 1 136 ? -0.164  88.871  65.026  1.00 29.48  ? 282 ILE E CD1 1 
ATOM   6183 N  N   . PRO E 1 137 ? -2.500  94.255  65.731  1.00 49.79  ? 283 PRO E N   1 
ATOM   6184 C  CA  . PRO E 1 137 ? -3.072  95.462  65.123  1.00 52.20  ? 283 PRO E CA  1 
ATOM   6185 C  C   . PRO E 1 137 ? -3.234  95.295  63.620  1.00 53.70  ? 283 PRO E C   1 
ATOM   6186 O  O   . PRO E 1 137 ? -2.252  95.013  62.932  1.00 53.62  ? 283 PRO E O   1 
ATOM   6187 C  CB  . PRO E 1 137 ? -2.022  96.534  65.423  1.00 53.25  ? 283 PRO E CB  1 
ATOM   6188 C  CG  . PRO E 1 137 ? -1.370  96.072  66.678  1.00 51.98  ? 283 PRO E CG  1 
ATOM   6189 C  CD  . PRO E 1 137 ? -1.361  94.564  66.615  1.00 50.76  ? 283 PRO E CD  1 
ATOM   6190 N  N   . GLY E 1 138 ? -4.458  95.451  63.123  1.00 53.71  ? 284 GLY E N   1 
ATOM   6191 C  CA  . GLY E 1 138 ? -4.724  95.298  61.705  1.00 53.32  ? 284 GLY E CA  1 
ATOM   6192 C  C   . GLY E 1 138 ? -5.353  93.963  61.352  1.00 53.43  ? 284 GLY E C   1 
ATOM   6193 O  O   . GLY E 1 138 ? -5.725  93.728  60.202  1.00 54.52  ? 284 GLY E O   1 
ATOM   6194 N  N   . GLU E 1 139 ? -5.464  93.082  62.342  1.00 51.75  ? 285 GLU E N   1 
ATOM   6195 C  CA  . GLU E 1 139 ? -6.146  91.805  62.163  1.00 49.09  ? 285 GLU E CA  1 
ATOM   6196 C  C   . GLU E 1 139 ? -7.520  91.870  62.832  1.00 46.66  ? 285 GLU E C   1 
ATOM   6197 O  O   . GLU E 1 139 ? -7.713  92.645  63.770  1.00 48.43  ? 285 GLU E O   1 
ATOM   6198 C  CB  . GLU E 1 139 ? -5.311  90.661  62.753  1.00 47.12  ? 285 GLU E CB  1 
ATOM   6199 C  CG  . GLU E 1 139 ? -3.896  90.544  62.182  1.00 50.30  ? 285 GLU E CG  1 
ATOM   6200 C  CD  . GLU E 1 139 ? -3.856  90.095  60.720  1.00 56.99  ? 285 GLU E CD  1 
ATOM   6201 O  OE1 . GLU E 1 139 ? -4.600  89.163  60.331  1.00 60.01  ? 285 GLU E OE1 1 
ATOM   6202 O  OE2 . GLU E 1 139 ? -3.053  90.666  59.956  1.00 59.25  ? 285 GLU E OE2 1 
ATOM   6203 N  N   . PRO E 1 140 ? -8.485  91.064  62.352  1.00 46.81  ? 286 PRO E N   1 
ATOM   6204 C  CA  . PRO E 1 140 ? -8.369  90.109  61.241  1.00 45.05  ? 286 PRO E CA  1 
ATOM   6205 C  C   . PRO E 1 140 ? -8.351  90.822  59.898  1.00 46.00  ? 286 PRO E C   1 
ATOM   6206 O  O   . PRO E 1 140 ? -9.215  91.662  59.654  1.00 48.57  ? 286 PRO E O   1 
ATOM   6207 C  CB  . PRO E 1 140 ? -9.660  89.280  61.344  1.00 43.65  ? 286 PRO E CB  1 
ATOM   6208 C  CG  . PRO E 1 140 ? -10.318 89.681  62.626  1.00 44.31  ? 286 PRO E CG  1 
ATOM   6209 C  CD  . PRO E 1 140 ? -9.837  91.057  62.933  1.00 45.95  ? 286 PRO E CD  1 
ATOM   6210 N  N   . ASN E 1 141 ? -7.396  90.485  59.037  1.00 47.15  ? 287 ASN E N   1 
ATOM   6211 C  CA  . ASN E 1 141 ? -7.289  91.123  57.726  1.00 48.88  ? 287 ASN E CA  1 
ATOM   6212 C  C   . ASN E 1 141 ? -7.944  90.319  56.602  1.00 43.38  ? 287 ASN E C   1 
ATOM   6213 O  O   . ASN E 1 141 ? -8.003  90.774  55.461  1.00 40.10  ? 287 ASN E O   1 
ATOM   6214 C  CB  . ASN E 1 141 ? -5.822  91.392  57.379  1.00 51.18  ? 287 ASN E CB  1 
ATOM   6215 C  CG  . ASN E 1 141 ? -5.041  90.115  57.117  1.00 53.35  ? 287 ASN E CG  1 
ATOM   6216 O  OD1 . ASN E 1 141 ? -5.512  89.010  57.396  1.00 54.02  ? 287 ASN E OD1 1 
ATOM   6217 N  ND2 . ASN E 1 141 ? -3.838  90.264  56.576  1.00 54.30  ? 287 ASN E ND2 1 
ATOM   6218 N  N   . ASN E 1 142 ? -8.423  89.124  56.936  1.00 40.01  ? 288 ASN E N   1 
ATOM   6219 C  CA  . ASN E 1 142 ? -9.049  88.228  55.970  1.00 42.63  ? 288 ASN E CA  1 
ATOM   6220 C  C   . ASN E 1 142 ? -8.271  88.165  54.662  1.00 45.58  ? 288 ASN E C   1 
ATOM   6221 O  O   . ASN E 1 142 ? -8.852  88.238  53.581  1.00 45.68  ? 288 ASN E O   1 
ATOM   6222 C  CB  . ASN E 1 142 ? -10.503 88.637  55.712  1.00 46.84  ? 288 ASN E CB  1 
ATOM   6223 C  CG  . ASN E 1 142 ? -11.359 87.479  55.224  1.00 51.32  ? 288 ASN E CG  1 
ATOM   6224 O  OD1 . ASN E 1 142 ? -10.854 86.390  54.940  1.00 54.03  ? 288 ASN E OD1 1 
ATOM   6225 N  ND2 . ASN E 1 142 ? -12.662 87.707  55.130  1.00 51.72  ? 288 ASN E ND2 1 
ATOM   6226 N  N   . ALA E 1 143 ? -6.953  88.036  54.771  1.00 48.52  ? 289 ALA E N   1 
ATOM   6227 C  CA  . ALA E 1 143 ? -6.082  87.972  53.603  1.00 50.34  ? 289 ALA E CA  1 
ATOM   6228 C  C   . ALA E 1 143 ? -6.557  86.917  52.607  1.00 54.71  ? 289 ALA E C   1 
ATOM   6229 O  O   . ALA E 1 143 ? -6.665  85.737  52.940  1.00 57.99  ? 289 ALA E O   1 
ATOM   6230 C  CB  . ALA E 1 143 ? -4.648  87.700  54.029  1.00 49.65  ? 289 ALA E CB  1 
ATOM   6231 N  N   . GLY E 1 144 ? -6.842  87.353  51.384  1.00 55.94  ? 290 GLY E N   1 
ATOM   6232 C  CA  . GLY E 1 144 ? -7.307  86.462  50.338  1.00 55.50  ? 290 GLY E CA  1 
ATOM   6233 C  C   . GLY E 1 144 ? -8.758  86.069  50.518  1.00 56.40  ? 290 GLY E C   1 
ATOM   6234 O  O   . GLY E 1 144 ? -9.268  85.203  49.808  1.00 58.54  ? 290 GLY E O   1 
ATOM   6235 N  N   . ASN E 1 145 ? -9.427  86.716  51.467  1.00 56.22  ? 291 ASN E N   1 
ATOM   6236 C  CA  . ASN E 1 145 ? -10.790 86.349  51.837  1.00 57.50  ? 291 ASN E CA  1 
ATOM   6237 C  C   . ASN E 1 145 ? -10.926 84.856  52.105  1.00 53.62  ? 291 ASN E C   1 
ATOM   6238 O  O   . ASN E 1 145 ? -11.998 84.276  51.935  1.00 52.71  ? 291 ASN E O   1 
ATOM   6239 C  CB  . ASN E 1 145 ? -11.794 86.806  50.776  1.00 65.55  ? 291 ASN E CB  1 
ATOM   6240 C  CG  . ASN E 1 145 ? -12.356 88.186  51.064  1.00 71.72  ? 291 ASN E CG  1 
ATOM   6241 O  OD1 . ASN E 1 145 ? -13.526 88.328  51.425  1.00 75.78  ? 291 ASN E OD1 1 
ATOM   6242 N  ND2 . ASN E 1 145 ? -11.522 89.211  50.914  1.00 71.15  ? 291 ASN E ND2 1 
ATOM   6243 N  N   . ASN E 1 146 ? -9.828  84.239  52.526  1.00 51.99  ? 292 ASN E N   1 
ATOM   6244 C  CA  . ASN E 1 146 ? -9.824  82.820  52.848  1.00 51.44  ? 292 ASN E CA  1 
ATOM   6245 C  C   . ASN E 1 146 ? -9.176  82.549  54.196  1.00 46.42  ? 292 ASN E C   1 
ATOM   6246 O  O   . ASN E 1 146 ? -8.475  81.554  54.367  1.00 47.75  ? 292 ASN E O   1 
ATOM   6247 C  CB  . ASN E 1 146 ? -9.105  82.022  51.762  1.00 57.46  ? 292 ASN E CB  1 
ATOM   6248 C  CG  . ASN E 1 146 ? -9.139  80.530  52.021  1.00 62.91  ? 292 ASN E CG  1 
ATOM   6249 O  OD1 . ASN E 1 146 ? -10.156 79.989  52.460  1.00 64.62  ? 292 ASN E OD1 1 
ATOM   6250 N  ND2 . ASN E 1 146 ? -8.023  79.856  51.759  1.00 65.72  ? 292 ASN E ND2 1 
ATOM   6251 N  N   . GLU E 1 147 ? -9.404  83.441  55.151  1.00 44.06  ? 293 GLU E N   1 
ATOM   6252 C  CA  . GLU E 1 147 ? -8.872  83.259  56.496  1.00 42.03  ? 293 GLU E CA  1 
ATOM   6253 C  C   . GLU E 1 147 ? -10.012 83.232  57.502  1.00 41.74  ? 293 GLU E C   1 
ATOM   6254 O  O   . GLU E 1 147 ? -10.461 84.273  57.972  1.00 42.75  ? 293 GLU E O   1 
ATOM   6255 C  CB  . GLU E 1 147 ? -7.862  84.357  56.842  1.00 41.00  ? 293 GLU E CB  1 
ATOM   6256 C  CG  . GLU E 1 147 ? -6.644  84.362  55.934  1.00 43.45  ? 293 GLU E CG  1 
ATOM   6257 C  CD  . GLU E 1 147 ? -5.520  85.263  56.426  1.00 45.50  ? 293 GLU E CD  1 
ATOM   6258 O  OE1 . GLU E 1 147 ? -5.793  86.306  57.065  1.00 42.80  ? 293 GLU E OE1 1 
ATOM   6259 O  OE2 . GLU E 1 147 ? -4.349  84.918  56.157  1.00 47.44  ? 293 GLU E OE2 1 
ATOM   6260 N  N   . HIS E 1 148 ? -10.479 82.032  57.827  1.00 41.52  ? 294 HIS E N   1 
ATOM   6261 C  CA  . HIS E 1 148 ? -11.623 81.887  58.716  1.00 42.91  ? 294 HIS E CA  1 
ATOM   6262 C  C   . HIS E 1 148 ? -11.276 81.171  60.020  1.00 39.86  ? 294 HIS E C   1 
ATOM   6263 O  O   . HIS E 1 148 ? -12.162 80.752  60.764  1.00 43.36  ? 294 HIS E O   1 
ATOM   6264 C  CB  . HIS E 1 148 ? -12.766 81.182  57.984  1.00 45.23  ? 294 HIS E CB  1 
ATOM   6265 C  CG  . HIS E 1 148 ? -13.215 81.904  56.754  1.00 49.68  ? 294 HIS E CG  1 
ATOM   6266 N  ND1 . HIS E 1 148 ? -12.671 81.666  55.510  1.00 53.85  ? 294 HIS E ND1 1 
ATOM   6267 C  CD2 . HIS E 1 148 ? -14.140 82.877  56.579  1.00 50.54  ? 294 HIS E CD2 1 
ATOM   6268 C  CE1 . HIS E 1 148 ? -13.248 82.453  54.621  1.00 54.28  ? 294 HIS E CE1 1 
ATOM   6269 N  NE2 . HIS E 1 148 ? -14.144 83.197  55.244  1.00 53.29  ? 294 HIS E NE2 1 
ATOM   6270 N  N   . CYS E 1 149 ? -9.981  81.043  60.292  1.00 35.20  ? 295 CYS E N   1 
ATOM   6271 C  CA  . CYS E 1 149 ? -9.509  80.467  61.545  1.00 35.11  ? 295 CYS E CA  1 
ATOM   6272 C  C   . CYS E 1 149 ? -8.437  81.350  62.158  1.00 38.60  ? 295 CYS E C   1 
ATOM   6273 O  O   . CYS E 1 149 ? -7.708  82.045  61.447  1.00 41.35  ? 295 CYS E O   1 
ATOM   6274 C  CB  . CYS E 1 149 ? -8.973  79.053  61.329  1.00 36.86  ? 295 CYS E CB  1 
ATOM   6275 S  SG  . CYS E 1 149 ? -10.231 77.899  60.754  1.00 48.29  ? 295 CYS E SG  1 
ATOM   6276 N  N   . GLY E 1 150 ? -8.345  81.323  63.482  1.00 36.82  ? 296 GLY E N   1 
ATOM   6277 C  CA  . GLY E 1 150 ? -7.427  82.194  64.184  1.00 36.32  ? 296 GLY E CA  1 
ATOM   6278 C  C   . GLY E 1 150 ? -6.372  81.453  64.977  1.00 33.56  ? 296 GLY E C   1 
ATOM   6279 O  O   . GLY E 1 150 ? -6.601  80.348  65.461  1.00 32.16  ? 296 GLY E O   1 
ATOM   6280 N  N   . ASN E 1 151 ? -5.210  82.079  65.112  1.00 31.51  ? 297 ASN E N   1 
ATOM   6281 C  CA  . ASN E 1 151 ? -4.121  81.505  65.879  1.00 30.25  ? 297 ASN E CA  1 
ATOM   6282 C  C   . ASN E 1 151 ? -3.406  82.549  66.731  1.00 31.66  ? 297 ASN E C   1 
ATOM   6283 O  O   . ASN E 1 151 ? -3.544  83.753  66.501  1.00 28.72  ? 297 ASN E O   1 
ATOM   6284 C  CB  . ASN E 1 151 ? -3.132  80.796  64.951  1.00 29.83  ? 297 ASN E CB  1 
ATOM   6285 C  CG  . ASN E 1 151 ? -2.507  81.728  63.929  1.00 30.59  ? 297 ASN E CG  1 
ATOM   6286 O  OD1 . ASN E 1 151 ? -2.198  82.883  64.225  1.00 32.87  ? 297 ASN E OD1 1 
ATOM   6287 N  ND2 . ASN E 1 151 ? -2.304  81.221  62.717  1.00 30.73  ? 297 ASN E ND2 1 
ATOM   6288 N  N   . ILE E 1 152 ? -2.665  82.081  67.732  1.00 34.54  ? 298 ILE E N   1 
ATOM   6289 C  CA  . ILE E 1 152 ? -1.780  82.950  68.497  1.00 34.85  ? 298 ILE E CA  1 
ATOM   6290 C  C   . ILE E 1 152 ? -0.463  83.057  67.748  1.00 35.03  ? 298 ILE E C   1 
ATOM   6291 O  O   . ILE E 1 152 ? 0.129   82.041  67.361  1.00 34.16  ? 298 ILE E O   1 
ATOM   6292 C  CB  . ILE E 1 152 ? -1.539  82.429  69.919  1.00 36.71  ? 298 ILE E CB  1 
ATOM   6293 C  CG1 . ILE E 1 152 ? -2.706  82.823  70.818  1.00 38.15  ? 298 ILE E CG1 1 
ATOM   6294 C  CG2 . ILE E 1 152 ? -0.245  82.998  70.490  1.00 38.84  ? 298 ILE E CG2 1 
ATOM   6295 C  CD1 . ILE E 1 152 ? -2.359  82.812  72.284  1.00 42.85  ? 298 ILE E CD1 1 
ATOM   6296 N  N   . LYS E 1 153 ? -0.011  84.290  67.545  1.00 33.19  ? 299 LYS E N   1 
ATOM   6297 C  CA  . LYS E 1 153 ? 1.088   84.545  66.623  1.00 35.20  ? 299 LYS E CA  1 
ATOM   6298 C  C   . LYS E 1 153 ? 2.146   85.496  67.184  1.00 35.15  ? 299 LYS E C   1 
ATOM   6299 O  O   . LYS E 1 153 ? 3.331   85.173  67.199  1.00 35.11  ? 299 LYS E O   1 
ATOM   6300 C  CB  . LYS E 1 153 ? 0.535   85.096  65.302  1.00 33.70  ? 299 LYS E CB  1 
ATOM   6301 C  CG  . LYS E 1 153 ? 1.580   85.311  64.218  1.00 35.02  ? 299 LYS E CG  1 
ATOM   6302 C  CD  . LYS E 1 153 ? 0.935   85.808  62.932  1.00 39.60  ? 299 LYS E CD  1 
ATOM   6303 C  CE  . LYS E 1 153 ? 1.878   85.689  61.746  1.00 43.66  ? 299 LYS E CE  1 
ATOM   6304 N  NZ  . LYS E 1 153 ? 3.138   86.445  61.965  1.00 47.35  ? 299 LYS E NZ  1 
ATOM   6305 N  N   . ALA E 1 154 ? 1.713   86.674  67.620  1.00 32.69  ? 300 ALA E N   1 
ATOM   6306 C  CA  . ALA E 1 154 ? 2.627   87.686  68.133  1.00 34.84  ? 300 ALA E CA  1 
ATOM   6307 C  C   . ALA E 1 154 ? 2.908   87.470  69.616  1.00 36.98  ? 300 ALA E C   1 
ATOM   6308 O  O   . ALA E 1 154 ? 2.039   87.000  70.351  1.00 36.71  ? 300 ALA E O   1 
ATOM   6309 C  CB  . ALA E 1 154 ? 2.059   89.087  67.894  1.00 31.59  ? 300 ALA E CB  1 
ATOM   6310 N  N   . PRO E 1 155 ? 4.133   87.805  70.053  1.00 40.00  ? 301 PRO E N   1 
ATOM   6311 C  CA  . PRO E 1 155 ? 4.552   87.720  71.459  1.00 41.42  ? 301 PRO E CA  1 
ATOM   6312 C  C   . PRO E 1 155 ? 4.062   88.924  72.253  1.00 37.96  ? 301 PRO E C   1 
ATOM   6313 O  O   . PRO E 1 155 ? 4.884   89.679  72.771  1.00 39.78  ? 301 PRO E O   1 
ATOM   6314 C  CB  . PRO E 1 155 ? 6.087   87.765  71.383  1.00 42.02  ? 301 PRO E CB  1 
ATOM   6315 C  CG  . PRO E 1 155 ? 6.439   87.691  69.923  1.00 43.99  ? 301 PRO E CG  1 
ATOM   6316 C  CD  . PRO E 1 155 ? 5.246   88.199  69.177  1.00 41.76  ? 301 PRO E CD  1 
ATOM   6317 N  N   . SER E 1 156 ? 2.748   89.094  72.351  1.00 34.13  ? 302 SER E N   1 
ATOM   6318 C  CA  . SER E 1 156 ? 2.172   90.254  73.021  1.00 38.14  ? 302 SER E CA  1 
ATOM   6319 C  C   . SER E 1 156 ? 0.691   90.021  73.283  1.00 37.86  ? 302 SER E C   1 
ATOM   6320 O  O   . SER E 1 156 ? 0.123   89.026  72.823  1.00 31.96  ? 302 SER E O   1 
ATOM   6321 C  CB  . SER E 1 156 ? 2.367   91.506  72.158  1.00 43.28  ? 302 SER E CB  1 
ATOM   6322 O  OG  . SER E 1 156 ? 1.358   92.471  72.394  1.00 46.60  ? 302 SER E OG  1 
ATOM   6323 N  N   . LEU E 1 157 ? 0.070   90.925  74.033  1.00 40.02  ? 303 LEU E N   1 
ATOM   6324 C  CA  . LEU E 1 157 ? -1.372  90.865  74.225  1.00 42.84  ? 303 LEU E CA  1 
ATOM   6325 C  C   . LEU E 1 157 ? -2.082  91.028  72.884  1.00 45.02  ? 303 LEU E C   1 
ATOM   6326 O  O   . LEU E 1 157 ? -3.169  90.489  72.679  1.00 47.14  ? 303 LEU E O   1 
ATOM   6327 C  CB  . LEU E 1 157 ? -1.842  91.919  75.227  1.00 44.81  ? 303 LEU E CB  1 
ATOM   6328 C  CG  . LEU E 1 157 ? -1.692  91.526  76.697  1.00 48.24  ? 303 LEU E CG  1 
ATOM   6329 C  CD1 . LEU E 1 157 ? -2.246  92.613  77.603  1.00 51.73  ? 303 LEU E CD1 1 
ATOM   6330 C  CD2 . LEU E 1 157 ? -2.395  90.204  76.961  1.00 48.17  ? 303 LEU E CD2 1 
ATOM   6331 N  N   . GLN E 1 158 ? -1.462  91.771  71.973  1.00 43.93  ? 304 GLN E N   1 
ATOM   6332 C  CA  . GLN E 1 158 ? -1.949  91.847  70.602  1.00 46.13  ? 304 GLN E CA  1 
ATOM   6333 C  C   . GLN E 1 158 ? -1.326  90.702  69.811  1.00 42.77  ? 304 GLN E C   1 
ATOM   6334 O  O   . GLN E 1 158 ? -0.316  90.883  69.126  1.00 41.10  ? 304 GLN E O   1 
ATOM   6335 C  CB  . GLN E 1 158 ? -1.605  93.197  69.971  1.00 50.17  ? 304 GLN E CB  1 
ATOM   6336 C  CG  . GLN E 1 158 ? -2.400  94.371  70.532  1.00 55.08  ? 304 GLN E CG  1 
ATOM   6337 C  CD  . GLN E 1 158 ? -1.842  94.888  71.843  1.00 63.51  ? 304 GLN E CD  1 
ATOM   6338 O  OE1 . GLN E 1 158 ? -2.549  94.954  72.851  1.00 66.97  ? 304 GLN E OE1 1 
ATOM   6339 N  NE2 . GLN E 1 158 ? -0.565  95.263  71.838  1.00 66.00  ? 304 GLN E NE2 1 
ATOM   6340 N  N   . ALA E 1 159 ? -1.943  89.526  69.909  1.00 37.87  ? 305 ALA E N   1 
ATOM   6341 C  CA  . ALA E 1 159 ? -1.306  88.283  69.485  1.00 35.15  ? 305 ALA E CA  1 
ATOM   6342 C  C   . ALA E 1 159 ? -2.002  87.523  68.352  1.00 35.02  ? 305 ALA E C   1 
ATOM   6343 O  O   . ALA E 1 159 ? -1.349  86.767  67.635  1.00 35.80  ? 305 ALA E O   1 
ATOM   6344 C  CB  . ALA E 1 159 ? -1.126  87.364  70.685  1.00 33.24  ? 305 ALA E CB  1 
ATOM   6345 N  N   . TRP E 1 160 ? -3.312  87.706  68.193  1.00 32.87  ? 306 TRP E N   1 
ATOM   6346 C  CA  . TRP E 1 160 ? -4.078  86.879  67.247  1.00 29.74  ? 306 TRP E CA  1 
ATOM   6347 C  C   . TRP E 1 160 ? -3.875  87.244  65.780  1.00 30.97  ? 306 TRP E C   1 
ATOM   6348 O  O   . TRP E 1 160 ? -3.772  88.418  65.427  1.00 30.61  ? 306 TRP E O   1 
ATOM   6349 C  CB  . TRP E 1 160 ? -5.578  86.911  67.555  1.00 27.62  ? 306 TRP E CB  1 
ATOM   6350 C  CG  . TRP E 1 160 ? -5.961  86.420  68.916  1.00 30.05  ? 306 TRP E CG  1 
ATOM   6351 C  CD1 . TRP E 1 160 ? -5.185  85.705  69.788  1.00 32.00  ? 306 TRP E CD1 1 
ATOM   6352 C  CD2 . TRP E 1 160 ? -7.226  86.605  69.564  1.00 32.24  ? 306 TRP E CD2 1 
ATOM   6353 N  NE1 . TRP E 1 160 ? -5.889  85.441  70.943  1.00 32.30  ? 306 TRP E NE1 1 
ATOM   6354 C  CE2 . TRP E 1 160 ? -7.144  85.982  70.830  1.00 33.02  ? 306 TRP E CE2 1 
ATOM   6355 C  CE3 . TRP E 1 160 ? -8.418  87.242  69.200  1.00 32.97  ? 306 TRP E CE3 1 
ATOM   6356 C  CZ2 . TRP E 1 160 ? -8.209  85.976  71.729  1.00 34.69  ? 306 TRP E CZ2 1 
ATOM   6357 C  CZ3 . TRP E 1 160 ? -9.477  87.233  70.094  1.00 33.82  ? 306 TRP E CZ3 1 
ATOM   6358 C  CH2 . TRP E 1 160 ? -9.365  86.604  71.343  1.00 36.71  ? 306 TRP E CH2 1 
ATOM   6359 N  N   . ASN E 1 161 ? -3.824  86.216  64.937  1.00 33.48  ? 307 ASN E N   1 
ATOM   6360 C  CA  . ASN E 1 161 ? -3.887  86.378  63.490  1.00 32.96  ? 307 ASN E CA  1 
ATOM   6361 C  C   . ASN E 1 161 ? -4.922  85.420  62.921  1.00 35.08  ? 307 ASN E C   1 
ATOM   6362 O  O   . ASN E 1 161 ? -5.078  84.307  63.421  1.00 34.07  ? 307 ASN E O   1 
ATOM   6363 C  CB  . ASN E 1 161 ? -2.530  86.102  62.838  1.00 28.94  ? 307 ASN E CB  1 
ATOM   6364 C  CG  . ASN E 1 161 ? -2.559  86.293  61.327  1.00 31.80  ? 307 ASN E CG  1 
ATOM   6365 O  OD1 . ASN E 1 161 ? -3.164  87.239  60.820  1.00 32.11  ? 307 ASN E OD1 1 
ATOM   6366 N  ND2 . ASN E 1 161 ? -1.900  85.393  60.600  1.00 32.59  ? 307 ASN E ND2 1 
ATOM   6367 N  N   . ASP E 1 162 ? -5.645  85.860  61.896  1.00 34.04  ? 308 ASP E N   1 
ATOM   6368 C  CA  . ASP E 1 162 ? -6.518  84.962  61.157  1.00 35.46  ? 308 ASP E CA  1 
ATOM   6369 C  C   . ASP E 1 162 ? -5.731  84.377  59.995  1.00 34.93  ? 308 ASP E C   1 
ATOM   6370 O  O   . ASP E 1 162 ? -4.934  85.070  59.354  1.00 34.86  ? 308 ASP E O   1 
ATOM   6371 C  CB  . ASP E 1 162 ? -7.783  85.674  60.664  1.00 37.72  ? 308 ASP E CB  1 
ATOM   6372 C  CG  . ASP E 1 162 ? -7.479  86.898  59.821  1.00 40.22  ? 308 ASP E CG  1 
ATOM   6373 O  OD1 . ASP E 1 162 ? -6.396  87.490  59.995  1.00 41.83  ? 308 ASP E OD1 1 
ATOM   6374 O  OD2 . ASP E 1 162 ? -8.333  87.277  58.993  1.00 39.85  ? 308 ASP E OD2 1 
ATOM   6375 N  N   . ALA E 1 163 ? -5.942  83.092  59.743  1.00 34.76  ? 309 ALA E N   1 
ATOM   6376 C  CA  . ALA E 1 163 ? -5.186  82.374  58.735  1.00 36.81  ? 309 ALA E CA  1 
ATOM   6377 C  C   . ALA E 1 163 ? -6.124  81.408  58.039  1.00 41.59  ? 309 ALA E C   1 
ATOM   6378 O  O   . ALA E 1 163 ? -7.193  81.099  58.561  1.00 43.66  ? 309 ALA E O   1 
ATOM   6379 C  CB  . ALA E 1 163 ? -4.028  81.622  59.384  1.00 35.27  ? 309 ALA E CB  1 
ATOM   6380 N  N   . PRO E 1 164 ? -5.738  80.938  56.846  1.00 43.65  ? 310 PRO E N   1 
ATOM   6381 C  CA  . PRO E 1 164 ? -6.560  79.945  56.145  1.00 41.57  ? 310 PRO E CA  1 
ATOM   6382 C  C   . PRO E 1 164 ? -6.685  78.661  56.966  1.00 39.44  ? 310 PRO E C   1 
ATOM   6383 O  O   . PRO E 1 164 ? -5.686  78.097  57.415  1.00 35.78  ? 310 PRO E O   1 
ATOM   6384 C  CB  . PRO E 1 164 ? -5.784  79.702  54.847  1.00 40.70  ? 310 PRO E CB  1 
ATOM   6385 C  CG  . PRO E 1 164 ? -4.988  80.960  54.642  1.00 41.86  ? 310 PRO E CG  1 
ATOM   6386 C  CD  . PRO E 1 164 ? -4.592  81.385  56.036  1.00 44.11  ? 310 PRO E CD  1 
ATOM   6387 N  N   . CYS E 1 165 ? -7.922  78.220  57.158  1.00 39.18  ? 311 CYS E N   1 
ATOM   6388 C  CA  . CYS E 1 165 ? -8.240  77.087  58.015  1.00 38.60  ? 311 CYS E CA  1 
ATOM   6389 C  C   . CYS E 1 165 ? -7.450  75.821  57.691  1.00 41.19  ? 311 CYS E C   1 
ATOM   6390 O  O   . CYS E 1 165 ? -7.365  74.909  58.515  1.00 40.57  ? 311 CYS E O   1 
ATOM   6391 C  CB  . CYS E 1 165 ? -9.743  76.796  57.959  1.00 39.30  ? 311 CYS E CB  1 
ATOM   6392 S  SG  . CYS E 1 165 ? -10.771 78.033  58.794  1.00 74.42  ? 311 CYS E SG  1 
ATOM   6393 N  N   . ASP E 1 166 ? -6.871  75.773  56.498  1.00 41.48  ? 312 ASP E N   1 
ATOM   6394 C  CA  . ASP E 1 166 ? -6.165  74.586  56.037  1.00 45.20  ? 312 ASP E CA  1 
ATOM   6395 C  C   . ASP E 1 166 ? -4.654  74.713  56.191  1.00 43.15  ? 312 ASP E C   1 
ATOM   6396 O  O   . ASP E 1 166 ? -3.907  73.811  55.817  1.00 44.94  ? 312 ASP E O   1 
ATOM   6397 C  CB  . ASP E 1 166 ? -6.530  74.280  54.582  1.00 55.14  ? 312 ASP E CB  1 
ATOM   6398 C  CG  . ASP E 1 166 ? -6.462  75.508  53.698  1.00 64.45  ? 312 ASP E CG  1 
ATOM   6399 O  OD1 . ASP E 1 166 ? -7.391  76.346  53.762  1.00 67.47  ? 312 ASP E OD1 1 
ATOM   6400 O  OD2 . ASP E 1 166 ? -5.477  75.634  52.940  1.00 68.27  ? 312 ASP E OD2 1 
ATOM   6401 N  N   . LYS E 1 167 ? -4.204  75.836  56.735  1.00 43.08  ? 313 LYS E N   1 
ATOM   6402 C  CA  . LYS E 1 167 ? -2.800  75.986  57.083  1.00 45.02  ? 313 LYS E CA  1 
ATOM   6403 C  C   . LYS E 1 167 ? -2.497  75.009  58.206  1.00 41.83  ? 313 LYS E C   1 
ATOM   6404 O  O   . LYS E 1 167 ? -3.393  74.618  58.953  1.00 42.12  ? 313 LYS E O   1 
ATOM   6405 C  CB  . LYS E 1 167 ? -2.505  77.418  57.537  1.00 50.42  ? 313 LYS E CB  1 
ATOM   6406 C  CG  . LYS E 1 167 ? -1.870  78.324  56.479  1.00 58.05  ? 313 LYS E CG  1 
ATOM   6407 C  CD  . LYS E 1 167 ? -0.357  78.118  56.393  1.00 63.10  ? 313 LYS E CD  1 
ATOM   6408 C  CE  . LYS E 1 167 ? 0.348   79.312  55.748  1.00 64.20  ? 313 LYS E CE  1 
ATOM   6409 N  NZ  . LYS E 1 167 ? -0.115  79.576  54.353  1.00 64.73  ? 313 LYS E NZ  1 
ATOM   6410 N  N   . THR E 1 168 ? -1.240  74.603  58.325  1.00 40.20  ? 314 THR E N   1 
ATOM   6411 C  CA  . THR E 1 168 ? -0.848  73.708  59.406  1.00 37.01  ? 314 THR E CA  1 
ATOM   6412 C  C   . THR E 1 168 ? -0.003  74.437  60.447  1.00 37.37  ? 314 THR E C   1 
ATOM   6413 O  O   . THR E 1 168 ? 1.065   74.971  60.137  1.00 37.32  ? 314 THR E O   1 
ATOM   6414 C  CB  . THR E 1 168 ? -0.069  72.489  58.888  1.00 37.34  ? 314 THR E CB  1 
ATOM   6415 O  OG1 . THR E 1 168 ? 1.159   72.921  58.291  1.00 37.94  ? 314 THR E OG1 1 
ATOM   6416 C  CG2 . THR E 1 168 ? -0.890  71.720  57.857  1.00 41.38  ? 314 THR E CG2 1 
ATOM   6417 N  N   . PHE E 1 169 ? -0.489  74.453  61.683  1.00 36.74  ? 315 PHE E N   1 
ATOM   6418 C  CA  . PHE E 1 169 ? 0.242   75.056  62.792  1.00 35.03  ? 315 PHE E CA  1 
ATOM   6419 C  C   . PHE E 1 169 ? 0.176   74.151  64.015  1.00 33.87  ? 315 PHE E C   1 
ATOM   6420 O  O   . PHE E 1 169 ? -0.703  73.296  64.105  1.00 32.75  ? 315 PHE E O   1 
ATOM   6421 C  CB  . PHE E 1 169 ? -0.368  76.410  63.161  1.00 32.29  ? 315 PHE E CB  1 
ATOM   6422 C  CG  . PHE E 1 169 ? -0.243  77.458  62.092  1.00 31.05  ? 315 PHE E CG  1 
ATOM   6423 C  CD1 . PHE E 1 169 ? 0.969   78.086  61.856  1.00 31.18  ? 315 PHE E CD1 1 
ATOM   6424 C  CD2 . PHE E 1 169 ? -1.350  77.841  61.348  1.00 32.74  ? 315 PHE E CD2 1 
ATOM   6425 C  CE1 . PHE E 1 169 ? 1.080   79.069  60.884  1.00 34.45  ? 315 PHE E CE1 1 
ATOM   6426 C  CE2 . PHE E 1 169 ? -1.247  78.820  60.372  1.00 34.05  ? 315 PHE E CE2 1 
ATOM   6427 C  CZ  . PHE E 1 169 ? -0.031  79.436  60.139  1.00 35.35  ? 315 PHE E CZ  1 
ATOM   6428 N  N   . LEU E 1 170 ? 1.099   74.340  64.957  1.00 31.82  ? 316 LEU E N   1 
ATOM   6429 C  CA  . LEU E 1 170 ? 0.939   73.752  66.283  1.00 31.58  ? 316 LEU E CA  1 
ATOM   6430 C  C   . LEU E 1 170 ? -0.376  74.273  66.838  1.00 27.89  ? 316 LEU E C   1 
ATOM   6431 O  O   . LEU E 1 170 ? -0.888  75.286  66.363  1.00 27.10  ? 316 LEU E O   1 
ATOM   6432 C  CB  . LEU E 1 170 ? 2.084   74.155  67.219  1.00 30.92  ? 316 LEU E CB  1 
ATOM   6433 C  CG  . LEU E 1 170 ? 3.502   73.813  66.774  1.00 31.08  ? 316 LEU E CG  1 
ATOM   6434 C  CD1 . LEU E 1 170 ? 4.507   74.240  67.838  1.00 29.88  ? 316 LEU E CD1 1 
ATOM   6435 C  CD2 . LEU E 1 170 ? 3.618   72.327  66.477  1.00 35.56  ? 316 LEU E CD2 1 
ATOM   6436 N  N   . PHE E 1 171 ? -0.928  73.595  67.838  1.00 25.86  ? 317 PHE E N   1 
ATOM   6437 C  CA  . PHE E 1 171 ? -2.220  74.001  68.383  1.00 27.83  ? 317 PHE E CA  1 
ATOM   6438 C  C   . PHE E 1 171 ? -2.262  73.911  69.905  1.00 28.66  ? 317 PHE E C   1 
ATOM   6439 O  O   . PHE E 1 171 ? -1.462  73.205  70.520  1.00 34.62  ? 317 PHE E O   1 
ATOM   6440 C  CB  . PHE E 1 171 ? -3.342  73.156  67.770  1.00 28.22  ? 317 PHE E CB  1 
ATOM   6441 C  CG  . PHE E 1 171 ? -3.140  71.684  67.936  1.00 28.50  ? 317 PHE E CG  1 
ATOM   6442 C  CD1 . PHE E 1 171 ? -3.661  71.020  69.034  1.00 31.65  ? 317 PHE E CD1 1 
ATOM   6443 C  CD2 . PHE E 1 171 ? -2.412  70.965  67.006  1.00 27.18  ? 317 PHE E CD2 1 
ATOM   6444 C  CE1 . PHE E 1 171 ? -3.470  69.665  69.191  1.00 30.81  ? 317 PHE E CE1 1 
ATOM   6445 C  CE2 . PHE E 1 171 ? -2.220  69.607  67.157  1.00 26.82  ? 317 PHE E CE2 1 
ATOM   6446 C  CZ  . PHE E 1 171 ? -2.748  68.958  68.250  1.00 29.44  ? 317 PHE E CZ  1 
ATOM   6447 N  N   . ILE E 1 172 ? -3.208  74.628  70.503  1.00 26.81  ? 318 ILE E N   1 
ATOM   6448 C  CA  . ILE E 1 172 ? -3.364  74.639  71.948  1.00 25.10  ? 318 ILE E CA  1 
ATOM   6449 C  C   . ILE E 1 172 ? -4.720  74.103  72.385  1.00 30.10  ? 318 ILE E C   1 
ATOM   6450 O  O   . ILE E 1 172 ? -5.765  74.674  72.059  1.00 27.12  ? 318 ILE E O   1 
ATOM   6451 C  CB  . ILE E 1 172 ? -3.190  76.046  72.527  1.00 22.15  ? 318 ILE E CB  1 
ATOM   6452 C  CG1 . ILE E 1 172 ? -1.849  76.634  72.090  1.00 23.36  ? 318 ILE E CG1 1 
ATOM   6453 C  CG2 . ILE E 1 172 ? -3.295  75.990  74.041  1.00 24.74  ? 318 ILE E CG2 1 
ATOM   6454 C  CD1 . ILE E 1 172 ? -1.625  78.077  72.541  1.00 23.74  ? 318 ILE E CD1 1 
ATOM   6455 N  N   . CYS E 1 173 ? -4.687  72.997  73.126  1.00 34.89  ? 319 CYS E N   1 
ATOM   6456 C  CA  . CYS E 1 173 ? -5.888  72.404  73.693  1.00 36.18  ? 319 CYS E CA  1 
ATOM   6457 C  C   . CYS E 1 173 ? -6.112  72.963  75.089  1.00 38.48  ? 319 CYS E C   1 
ATOM   6458 O  O   . CYS E 1 173 ? -5.168  73.381  75.766  1.00 36.55  ? 319 CYS E O   1 
ATOM   6459 C  CB  . CYS E 1 173 ? -5.758  70.880  73.772  1.00 38.62  ? 319 CYS E CB  1 
ATOM   6460 S  SG  . CYS E 1 173 ? -5.584  70.025  72.193  1.00 41.43  ? 319 CYS E SG  1 
ATOM   6461 N  N   . LYS E 1 174 ? -7.368  72.956  75.519  1.00 39.80  ? 320 LYS E N   1 
ATOM   6462 C  CA  . LYS E 1 174 ? -7.720  73.408  76.853  1.00 40.56  ? 320 LYS E CA  1 
ATOM   6463 C  C   . LYS E 1 174 ? -8.838  72.555  77.433  1.00 43.30  ? 320 LYS E C   1 
ATOM   6464 O  O   . LYS E 1 174 ? -9.879  72.365  76.802  1.00 47.77  ? 320 LYS E O   1 
ATOM   6465 C  CB  . LYS E 1 174 ? -8.145  74.873  76.822  1.00 41.95  ? 320 LYS E CB  1 
ATOM   6466 C  CG  . LYS E 1 174 ? -8.689  75.401  78.142  1.00 46.99  ? 320 LYS E CG  1 
ATOM   6467 C  CD  . LYS E 1 174 ? -9.161  76.840  77.991  1.00 50.56  ? 320 LYS E CD  1 
ATOM   6468 C  CE  . LYS E 1 174 ? -9.922  77.315  79.212  1.00 52.79  ? 320 LYS E CE  1 
ATOM   6469 N  NZ  . LYS E 1 174 ? -10.507 78.662  78.974  1.00 53.15  ? 320 LYS E NZ  1 
ATOM   6470 N  N   . ARG E 1 175 ? -8.610  72.035  78.633  1.00 41.98  ? 321 ARG E N   1 
ATOM   6471 C  CA  . ARG E 1 175 ? -9.649  71.331  79.376  1.00 44.61  ? 321 ARG E CA  1 
ATOM   6472 C  C   . ARG E 1 175 ? -9.581  71.697  80.851  1.00 44.82  ? 321 ARG E C   1 
ATOM   6473 O  O   . ARG E 1 175 ? -8.496  71.770  81.432  1.00 44.62  ? 321 ARG E O   1 
ATOM   6474 C  CB  . ARG E 1 175 ? -9.534  69.817  79.202  1.00 45.24  ? 321 ARG E CB  1 
ATOM   6475 C  CG  . ARG E 1 175 ? -8.137  69.264  79.387  1.00 45.98  ? 321 ARG E CG  1 
ATOM   6476 C  CD  . ARG E 1 175 ? -8.182  67.762  79.582  1.00 50.15  ? 321 ARG E CD  1 
ATOM   6477 N  NE  . ARG E 1 175 ? -8.390  67.423  80.983  1.00 57.32  ? 321 ARG E NE  1 
ATOM   6478 C  CZ  . ARG E 1 175 ? -7.519  66.744  81.723  1.00 60.71  ? 321 ARG E CZ  1 
ATOM   6479 N  NH1 . ARG E 1 175 ? -6.385  66.311  81.188  1.00 60.41  ? 321 ARG E NH1 1 
ATOM   6480 N  NH2 . ARG E 1 175 ? -7.788  66.490  82.995  1.00 63.75  ? 321 ARG E NH2 1 
ATOM   6481 N  N   . PRO E 1 176 ? -10.750 71.915  81.464  1.00 45.71  ? 322 PRO E N   1 
ATOM   6482 C  CA  . PRO E 1 176 ? -10.859 72.374  82.851  1.00 48.61  ? 322 PRO E CA  1 
ATOM   6483 C  C   . PRO E 1 176 ? -10.273 71.368  83.829  1.00 48.38  ? 322 PRO E C   1 
ATOM   6484 O  O   . PRO E 1 176 ? -10.436 70.161  83.650  1.00 48.35  ? 322 PRO E O   1 
ATOM   6485 C  CB  . PRO E 1 176 ? -12.374 72.463  83.075  1.00 51.80  ? 322 PRO E CB  1 
ATOM   6486 C  CG  . PRO E 1 176 ? -12.982 72.443  81.715  1.00 51.03  ? 322 PRO E CG  1 
ATOM   6487 C  CD  . PRO E 1 176 ? -12.065 71.618  80.880  1.00 47.94  ? 322 PRO E CD  1 
ATOM   6488 N  N   . TYR E 1 177 ? -9.594  71.860  84.855  1.00 49.27  ? 323 TYR E N   1 
ATOM   6489 C  CA  . TYR E 1 177 ? -9.184  70.994  85.942  1.00 52.83  ? 323 TYR E CA  1 
ATOM   6490 C  C   . TYR E 1 177 ? -10.356 70.793  86.892  1.00 57.13  ? 323 TYR E C   1 
ATOM   6491 O  O   . TYR E 1 177 ? -10.889 71.753  87.449  1.00 55.57  ? 323 TYR E O   1 
ATOM   6492 C  CB  . TYR E 1 177 ? -7.986  71.570  86.699  1.00 54.04  ? 323 TYR E CB  1 
ATOM   6493 C  CG  . TYR E 1 177 ? -7.833  70.978  88.086  1.00 58.45  ? 323 TYR E CG  1 
ATOM   6494 C  CD1 . TYR E 1 177 ? -7.578  69.622  88.259  1.00 61.00  ? 323 TYR E CD1 1 
ATOM   6495 C  CD2 . TYR E 1 177 ? -7.958  71.770  89.222  1.00 59.61  ? 323 TYR E CD2 1 
ATOM   6496 C  CE1 . TYR E 1 177 ? -7.448  69.072  89.520  1.00 62.59  ? 323 TYR E CE1 1 
ATOM   6497 C  CE2 . TYR E 1 177 ? -7.828  71.227  90.489  1.00 62.14  ? 323 TYR E CE2 1 
ATOM   6498 C  CZ  . TYR E 1 177 ? -7.572  69.878  90.631  1.00 63.20  ? 323 TYR E CZ  1 
ATOM   6499 O  OH  . TYR E 1 177 ? -7.441  69.330  91.884  1.00 65.22  ? 323 TYR E OH  1 
ATOM   6500 N  N   . VAL E 1 178 ? -10.766 69.542  87.062  1.00 64.95  ? 324 VAL E N   1 
ATOM   6501 C  CA  . VAL E 1 178 ? -11.780 69.202  88.055  1.00 73.81  ? 324 VAL E CA  1 
ATOM   6502 C  C   . VAL E 1 178 ? -11.243 68.138  89.018  1.00 78.05  ? 324 VAL E C   1 
ATOM   6503 O  O   . VAL E 1 178 ? -10.801 67.070  88.593  1.00 80.30  ? 324 VAL E O   1 
ATOM   6504 C  CB  . VAL E 1 178 ? -13.109 68.751  87.396  1.00 74.81  ? 324 VAL E CB  1 
ATOM   6505 C  CG1 . VAL E 1 178 ? -12.857 67.673  86.349  1.00 72.95  ? 324 VAL E CG1 1 
ATOM   6506 C  CG2 . VAL E 1 178 ? -14.107 68.284  88.454  1.00 76.94  ? 324 VAL E CG2 1 
ATOM   6507 N  N   . PRO E 1 179 ? -11.261 68.443  90.323  1.00 79.73  ? 325 PRO E N   1 
ATOM   6508 C  CA  . PRO E 1 179 ? -10.707 67.573  91.369  1.00 81.95  ? 325 PRO E CA  1 
ATOM   6509 C  C   . PRO E 1 179 ? -11.232 66.137  91.321  1.00 83.46  ? 325 PRO E C   1 
ATOM   6510 O  O   . PRO E 1 179 ? -12.425 65.911  91.095  1.00 83.88  ? 325 PRO E O   1 
ATOM   6511 C  CB  . PRO E 1 179 ? -11.163 68.255  92.661  1.00 83.28  ? 325 PRO E CB  1 
ATOM   6512 C  CG  . PRO E 1 179 ? -11.305 69.686  92.293  1.00 81.41  ? 325 PRO E CG  1 
ATOM   6513 C  CD  . PRO E 1 179 ? -11.800 69.697  90.876  1.00 80.13  ? 325 PRO E CD  1 
ATOM   6514 N  N   . SER E 1 180 ? -10.335 65.180  91.541  1.00 82.06  ? 326 SER E N   1 
ATOM   6515 C  CA  . SER E 1 180 ? -10.694 63.767  91.566  1.00 81.72  ? 326 SER E CA  1 
ATOM   6516 C  C   . SER E 1 180 ? -11.300 63.373  92.908  1.00 82.47  ? 326 SER E C   1 
ATOM   6517 O  O   . SER E 1 180 ? -12.521 63.299  93.051  1.00 84.54  ? 326 SER E O   1 
ATOM   6518 C  CB  . SER E 1 180 ? -9.467  62.904  91.273  1.00 81.13  ? 326 SER E CB  1 
ATOM   6519 O  OG  . SER E 1 180 ? -8.410  63.195  92.172  1.00 80.56  ? 326 SER E OG  1 
ATOM   6520 N  N   . SER F 1 19  ? -7.978  57.736  126.539 1.00 119.28 ? 165 SER F N   1 
ATOM   6521 C  CA  . SER F 1 19  ? -8.206  56.492  125.813 1.00 120.36 ? 165 SER F CA  1 
ATOM   6522 C  C   . SER F 1 19  ? -8.830  56.759  124.446 1.00 118.38 ? 165 SER F C   1 
ATOM   6523 O  O   . SER F 1 19  ? -8.193  56.560  123.412 1.00 115.53 ? 165 SER F O   1 
ATOM   6524 C  CB  . SER F 1 19  ? -9.093  55.549  126.627 1.00 123.46 ? 165 SER F CB  1 
ATOM   6525 O  OG  . SER F 1 19  ? -10.326 56.164  126.957 1.00 124.30 ? 165 SER F OG  1 
ATOM   6526 N  N   . ALA F 1 20  ? -10.083 57.203  124.448 1.00 119.29 ? 166 ALA F N   1 
ATOM   6527 C  CA  . ALA F 1 20  ? -10.748 57.607  123.217 1.00 117.16 ? 166 ALA F CA  1 
ATOM   6528 C  C   . ALA F 1 20  ? -10.203 58.960  122.781 1.00 117.73 ? 166 ALA F C   1 
ATOM   6529 O  O   . ALA F 1 20  ? -10.264 59.321  121.607 1.00 115.17 ? 166 ALA F O   1 
ATOM   6530 C  CB  . ALA F 1 20  ? -12.248 57.678  123.420 1.00 117.30 ? 166 ALA F CB  1 
ATOM   6531 N  N   . LEU F 1 21  ? -9.676  59.707  123.745 1.00 121.73 ? 167 LEU F N   1 
ATOM   6532 C  CA  . LEU F 1 21  ? -9.001  60.964  123.461 1.00 122.53 ? 167 LEU F CA  1 
ATOM   6533 C  C   . LEU F 1 21  ? -7.600  60.654  122.946 1.00 122.11 ? 167 LEU F C   1 
ATOM   6534 O  O   . LEU F 1 21  ? -6.942  61.503  122.345 1.00 121.75 ? 167 LEU F O   1 
ATOM   6535 C  CB  . LEU F 1 21  ? -8.938  61.833  124.720 1.00 125.88 ? 167 LEU F CB  1 
ATOM   6536 C  CG  . LEU F 1 21  ? -8.416  63.268  124.589 1.00 125.13 ? 167 LEU F CG  1 
ATOM   6537 C  CD1 . LEU F 1 21  ? -9.138  64.010  123.475 1.00 122.59 ? 167 LEU F CD1 1 
ATOM   6538 C  CD2 . LEU F 1 21  ? -8.556  64.011  125.913 1.00 127.64 ? 167 LEU F CD2 1 
ATOM   6539 N  N   . ASN F 1 22  ? -7.154  59.423  123.185 1.00 121.75 ? 168 ASN F N   1 
ATOM   6540 C  CA  . ASN F 1 22  ? -5.862  58.953  122.695 1.00 117.99 ? 168 ASN F CA  1 
ATOM   6541 C  C   . ASN F 1 22  ? -5.948  58.419  121.272 1.00 111.87 ? 168 ASN F C   1 
ATOM   6542 O  O   . ASN F 1 22  ? -4.950  58.382  120.554 1.00 110.77 ? 168 ASN F O   1 
ATOM   6543 C  CB  . ASN F 1 22  ? -5.297  57.869  123.615 1.00 120.61 ? 168 ASN F CB  1 
ATOM   6544 C  CG  . ASN F 1 22  ? -4.717  58.434  124.894 1.00 123.02 ? 168 ASN F CG  1 
ATOM   6545 O  OD1 . ASN F 1 22  ? -3.865  59.323  124.863 1.00 122.20 ? 168 ASN F OD1 1 
ATOM   6546 N  ND2 . ASN F 1 22  ? -5.170  57.913  126.029 1.00 125.77 ? 168 ASN F ND2 1 
ATOM   6547 N  N   . THR F 1 23  ? -7.143  57.996  120.872 1.00 108.09 ? 169 THR F N   1 
ATOM   6548 C  CA  . THR F 1 23  ? -7.352  57.466  119.530 1.00 103.21 ? 169 THR F CA  1 
ATOM   6549 C  C   . THR F 1 23  ? -7.482  58.598  118.517 1.00 97.10  ? 169 THR F C   1 
ATOM   6550 O  O   . THR F 1 23  ? -7.243  58.405  117.326 1.00 95.97  ? 169 THR F O   1 
ATOM   6551 C  CB  . THR F 1 23  ? -8.596  56.560  119.459 1.00 105.37 ? 169 THR F CB  1 
ATOM   6552 O  OG1 . THR F 1 23  ? -9.778  57.345  119.655 1.00 106.69 ? 169 THR F OG1 1 
ATOM   6553 C  CG2 . THR F 1 23  ? -8.528  55.472  120.523 1.00 107.91 ? 169 THR F CG2 1 
ATOM   6554 N  N   . LYS F 1 24  ? -7.863  59.778  118.995 1.00 94.20  ? 170 LYS F N   1 
ATOM   6555 C  CA  . LYS F 1 24  ? -7.908  60.963  118.147 1.00 90.11  ? 170 LYS F CA  1 
ATOM   6556 C  C   . LYS F 1 24  ? -6.494  61.400  117.782 1.00 85.54  ? 170 LYS F C   1 
ATOM   6557 O  O   . LYS F 1 24  ? -6.269  61.992  116.727 1.00 84.76  ? 170 LYS F O   1 
ATOM   6558 C  CB  . LYS F 1 24  ? -8.644  62.108  118.848 1.00 94.40  ? 170 LYS F CB  1 
ATOM   6559 C  CG  . LYS F 1 24  ? -10.142 61.895  118.999 1.00 98.63  ? 170 LYS F CG  1 
ATOM   6560 C  CD  . LYS F 1 24  ? -10.800 63.089  119.677 1.00 102.64 ? 170 LYS F CD  1 
ATOM   6561 C  CE  . LYS F 1 24  ? -12.306 62.906  119.791 1.00 104.71 ? 170 LYS F CE  1 
ATOM   6562 N  NZ  . LYS F 1 24  ? -12.948 64.026  120.537 1.00 106.92 ? 170 LYS F NZ  1 
ATOM   6563 N  N   . ILE F 1 25  ? -5.545  61.100  118.665 1.00 82.42  ? 171 ILE F N   1 
ATOM   6564 C  CA  . ILE F 1 25  ? -4.144  61.455  118.453 1.00 76.44  ? 171 ILE F CA  1 
ATOM   6565 C  C   . ILE F 1 25  ? -3.449  60.455  117.533 1.00 71.08  ? 171 ILE F C   1 
ATOM   6566 O  O   . ILE F 1 25  ? -2.689  60.839  116.643 1.00 65.80  ? 171 ILE F O   1 
ATOM   6567 C  CB  . ILE F 1 25  ? -3.376  61.533  119.790 1.00 77.65  ? 171 ILE F CB  1 
ATOM   6568 C  CG1 . ILE F 1 25  ? -4.033  62.548  120.725 1.00 79.77  ? 171 ILE F CG1 1 
ATOM   6569 C  CG2 . ILE F 1 25  ? -1.916  61.890  119.551 1.00 74.19  ? 171 ILE F CG2 1 
ATOM   6570 C  CD1 . ILE F 1 25  ? -3.304  62.720  122.043 1.00 84.37  ? 171 ILE F CD1 1 
ATOM   6571 N  N   . ARG F 1 26  ? -3.708  59.171  117.759 1.00 72.63  ? 172 ARG F N   1 
ATOM   6572 C  CA  . ARG F 1 26  ? -3.178  58.120  116.901 1.00 70.48  ? 172 ARG F CA  1 
ATOM   6573 C  C   . ARG F 1 26  ? -3.585  58.381  115.454 1.00 62.48  ? 172 ARG F C   1 
ATOM   6574 O  O   . ARG F 1 26  ? -2.778  58.231  114.535 1.00 58.95  ? 172 ARG F O   1 
ATOM   6575 C  CB  . ARG F 1 26  ? -3.691  56.753  117.365 1.00 75.17  ? 172 ARG F CB  1 
ATOM   6576 C  CG  . ARG F 1 26  ? -3.064  55.555  116.661 1.00 77.06  ? 172 ARG F CG  1 
ATOM   6577 C  CD  . ARG F 1 26  ? -3.264  54.280  117.473 1.00 80.16  ? 172 ARG F CD  1 
ATOM   6578 N  NE  . ARG F 1 26  ? -2.855  54.466  118.863 1.00 84.58  ? 172 ARG F NE  1 
ATOM   6579 C  CZ  . ARG F 1 26  ? -3.694  54.510  119.895 1.00 88.68  ? 172 ARG F CZ  1 
ATOM   6580 N  NH1 . ARG F 1 26  ? -5.000  54.360  119.704 1.00 87.38  ? 172 ARG F NH1 1 
ATOM   6581 N  NH2 . ARG F 1 26  ? -3.224  54.691  121.123 1.00 92.42  ? 172 ARG F NH2 1 
ATOM   6582 N  N   . ALA F 1 27  ? -4.838  58.789  115.267 1.00 60.00  ? 173 ALA F N   1 
ATOM   6583 C  CA  . ALA F 1 27  ? -5.394  59.026  113.938 1.00 58.07  ? 173 ALA F CA  1 
ATOM   6584 C  C   . ALA F 1 27  ? -4.830  60.287  113.291 1.00 57.55  ? 173 ALA F C   1 
ATOM   6585 O  O   . ALA F 1 27  ? -4.548  60.303  112.092 1.00 55.47  ? 173 ALA F O   1 
ATOM   6586 C  CB  . ALA F 1 27  ? -6.919  59.090  113.998 1.00 56.81  ? 173 ALA F CB  1 
ATOM   6587 N  N   . LEU F 1 28  ? -4.674  61.348  114.077 1.00 61.23  ? 174 LEU F N   1 
ATOM   6588 C  CA  . LEU F 1 28  ? -4.043  62.559  113.564 1.00 62.22  ? 174 LEU F CA  1 
ATOM   6589 C  C   . LEU F 1 28  ? -2.582  62.276  113.227 1.00 60.44  ? 174 LEU F C   1 
ATOM   6590 O  O   . LEU F 1 28  ? -2.065  62.761  112.219 1.00 58.75  ? 174 LEU F O   1 
ATOM   6591 C  CB  . LEU F 1 28  ? -4.167  63.722  114.554 1.00 65.28  ? 174 LEU F CB  1 
ATOM   6592 C  CG  . LEU F 1 28  ? -5.543  64.393  114.639 1.00 66.80  ? 174 LEU F CG  1 
ATOM   6593 C  CD1 . LEU F 1 28  ? -5.491  65.622  115.537 1.00 68.43  ? 174 LEU F CD1 1 
ATOM   6594 C  CD2 . LEU F 1 28  ? -6.051  64.769  113.252 1.00 64.46  ? 174 LEU F CD2 1 
ATOM   6595 N  N   . GLN F 1 29  ? -1.935  61.468  114.065 1.00 59.32  ? 175 GLN F N   1 
ATOM   6596 C  CA  . GLN F 1 29  ? -0.555  61.043  113.846 1.00 59.73  ? 175 GLN F CA  1 
ATOM   6597 C  C   . GLN F 1 29  ? -0.373  60.322  112.510 1.00 57.70  ? 175 GLN F C   1 
ATOM   6598 O  O   . GLN F 1 29  ? 0.499   60.677  111.716 1.00 53.99  ? 175 GLN F O   1 
ATOM   6599 C  CB  . GLN F 1 29  ? -0.107  60.124  114.982 1.00 63.92  ? 175 GLN F CB  1 
ATOM   6600 C  CG  . GLN F 1 29  ? 1.055   60.651  115.797 1.00 68.12  ? 175 GLN F CG  1 
ATOM   6601 C  CD  . GLN F 1 29  ? 1.206   59.922  117.120 1.00 74.36  ? 175 GLN F CD  1 
ATOM   6602 O  OE1 . GLN F 1 29  ? 2.028   60.295  117.959 1.00 75.98  ? 175 GLN F OE1 1 
ATOM   6603 N  NE2 . GLN F 1 29  ? 0.404   58.878  117.315 1.00 76.79  ? 175 GLN F NE2 1 
ATOM   6604 N  N   . GLY F 1 30  ? -1.194  59.303  112.273 1.00 60.65  ? 176 GLY F N   1 
ATOM   6605 C  CA  . GLY F 1 30  ? -1.115  58.521  111.049 1.00 60.76  ? 176 GLY F CA  1 
ATOM   6606 C  C   . GLY F 1 30  ? -1.379  59.332  109.791 1.00 60.34  ? 176 GLY F C   1 
ATOM   6607 O  O   . GLY F 1 30  ? -0.657  59.210  108.799 1.00 57.80  ? 176 GLY F O   1 
ATOM   6608 N  N   . SER F 1 31  ? -2.420  60.158  109.833 1.00 61.20  ? 177 SER F N   1 
ATOM   6609 C  CA  . SER F 1 31  ? -2.747  61.043  108.722 1.00 62.12  ? 177 SER F CA  1 
ATOM   6610 C  C   . SER F 1 31  ? -1.553  61.928  108.365 1.00 61.32  ? 177 SER F C   1 
ATOM   6611 O  O   . SER F 1 31  ? -1.352  62.277  107.203 1.00 59.39  ? 177 SER F O   1 
ATOM   6612 C  CB  . SER F 1 31  ? -3.965  61.905  109.069 1.00 65.16  ? 177 SER F CB  1 
ATOM   6613 O  OG  . SER F 1 31  ? -4.368  62.695  107.964 1.00 67.13  ? 177 SER F OG  1 
ATOM   6614 N  N   . LEU F 1 32  ? -0.759  62.282  109.370 1.00 63.98  ? 178 LEU F N   1 
ATOM   6615 C  CA  . LEU F 1 32  ? 0.416   63.121  109.152 1.00 64.45  ? 178 LEU F CA  1 
ATOM   6616 C  C   . LEU F 1 32  ? 1.535   62.395  108.418 1.00 63.15  ? 178 LEU F C   1 
ATOM   6617 O  O   . LEU F 1 32  ? 2.062   62.910  107.431 1.00 62.30  ? 178 LEU F O   1 
ATOM   6618 C  CB  . LEU F 1 32  ? 0.946   63.693  110.468 1.00 66.77  ? 178 LEU F CB  1 
ATOM   6619 C  CG  . LEU F 1 32  ? 0.531   65.134  110.761 1.00 67.80  ? 178 LEU F CG  1 
ATOM   6620 C  CD1 . LEU F 1 32  ? 1.628   65.844  111.531 1.00 70.95  ? 178 LEU F CD1 1 
ATOM   6621 C  CD2 . LEU F 1 32  ? 0.231   65.875  109.469 1.00 65.33  ? 178 LEU F CD2 1 
ATOM   6622 N  N   . GLU F 1 33  ? 1.909   61.212  108.901 1.00 62.97  ? 179 GLU F N   1 
ATOM   6623 C  CA  . GLU F 1 33  ? 2.975   60.452  108.256 1.00 63.32  ? 179 GLU F CA  1 
ATOM   6624 C  C   . GLU F 1 33  ? 2.560   60.065  106.841 1.00 59.02  ? 179 GLU F C   1 
ATOM   6625 O  O   . GLU F 1 33  ? 3.395   60.003  105.940 1.00 55.77  ? 179 GLU F O   1 
ATOM   6626 C  CB  . GLU F 1 33  ? 3.363   59.215  109.069 1.00 69.87  ? 179 GLU F CB  1 
ATOM   6627 C  CG  . GLU F 1 33  ? 4.582   58.467  108.520 1.00 75.68  ? 179 GLU F CG  1 
ATOM   6628 C  CD  . GLU F 1 33  ? 5.878   59.266  108.618 1.00 80.91  ? 179 GLU F CD  1 
ATOM   6629 O  OE1 . GLU F 1 33  ? 6.584   59.139  109.643 1.00 83.79  ? 179 GLU F OE1 1 
ATOM   6630 O  OE2 . GLU F 1 33  ? 6.201   60.012  107.667 1.00 80.47  ? 179 GLU F OE2 1 
ATOM   6631 N  N   . ASN F 1 34  ? 1.268   59.813  106.649 1.00 57.71  ? 180 ASN F N   1 
ATOM   6632 C  CA  . ASN F 1 34  ? 0.733   59.575  105.314 1.00 55.72  ? 180 ASN F CA  1 
ATOM   6633 C  C   . ASN F 1 34  ? 0.992   60.767  104.404 1.00 55.43  ? 180 ASN F C   1 
ATOM   6634 O  O   . ASN F 1 34  ? 1.616   60.633  103.353 1.00 54.87  ? 180 ASN F O   1 
ATOM   6635 C  CB  . ASN F 1 34  ? -0.771  59.289  105.366 1.00 55.94  ? 180 ASN F CB  1 
ATOM   6636 C  CG  . ASN F 1 34  ? -1.085  57.811  105.496 1.00 56.52  ? 180 ASN F CG  1 
ATOM   6637 O  OD1 . ASN F 1 34  ? -0.183  56.973  105.562 1.00 57.46  ? 180 ASN F OD1 1 
ATOM   6638 N  ND2 . ASN F 1 34  ? -2.372  57.482  105.530 1.00 54.96  ? 180 ASN F ND2 1 
ATOM   6639 N  N   . MET F 1 35  ? 0.513   61.936  104.818 1.00 55.14  ? 181 MET F N   1 
ATOM   6640 C  CA  . MET F 1 35  ? 0.657   63.145  104.017 1.00 53.94  ? 181 MET F CA  1 
ATOM   6641 C  C   . MET F 1 35  ? 2.124   63.512  103.811 1.00 50.07  ? 181 MET F C   1 
ATOM   6642 O  O   . MET F 1 35  ? 2.480   64.164  102.823 1.00 45.70  ? 181 MET F O   1 
ATOM   6643 C  CB  . MET F 1 35  ? -0.114  64.308  104.646 1.00 55.21  ? 181 MET F CB  1 
ATOM   6644 C  CG  . MET F 1 35  ? -1.614  64.059  104.735 1.00 56.08  ? 181 MET F CG  1 
ATOM   6645 S  SD  . MET F 1 35  ? -2.566  65.558  105.034 1.00 89.42  ? 181 MET F SD  1 
ATOM   6646 C  CE  . MET F 1 35  ? -1.775  66.174  106.516 1.00 82.07  ? 181 MET F CE  1 
ATOM   6647 N  N   . SER F 1 36  ? 2.970   63.071  104.737 1.00 47.16  ? 182 SER F N   1 
ATOM   6648 C  CA  . SER F 1 36  ? 4.404   63.309  104.643 1.00 47.85  ? 182 SER F CA  1 
ATOM   6649 C  C   . SER F 1 36  ? 5.057   62.413  103.593 1.00 47.26  ? 182 SER F C   1 
ATOM   6650 O  O   . SER F 1 36  ? 5.917   62.860  102.834 1.00 46.45  ? 182 SER F O   1 
ATOM   6651 C  CB  . SER F 1 36  ? 5.077   63.110  106.002 1.00 49.31  ? 182 SER F CB  1 
ATOM   6652 O  OG  . SER F 1 36  ? 6.485   63.204  105.881 1.00 52.09  ? 182 SER F OG  1 
ATOM   6653 N  N   . LYS F 1 37  ? 4.651   61.148  103.555 1.00 50.17  ? 183 LYS F N   1 
ATOM   6654 C  CA  . LYS F 1 37  ? 5.161   60.219  102.550 1.00 52.43  ? 183 LYS F CA  1 
ATOM   6655 C  C   . LYS F 1 37  ? 4.737   60.668  101.150 1.00 48.72  ? 183 LYS F C   1 
ATOM   6656 O  O   . LYS F 1 37  ? 5.534   60.643  100.215 1.00 48.54  ? 183 LYS F O   1 
ATOM   6657 C  CB  . LYS F 1 37  ? 4.659   58.791  102.811 1.00 55.87  ? 183 LYS F CB  1 
ATOM   6658 C  CG  . LYS F 1 37  ? 4.909   58.246  104.219 1.00 60.50  ? 183 LYS F CG  1 
ATOM   6659 C  CD  . LYS F 1 37  ? 6.373   57.905  104.487 1.00 64.09  ? 183 LYS F CD  1 
ATOM   6660 C  CE  . LYS F 1 37  ? 6.521   57.245  105.861 1.00 69.55  ? 183 LYS F CE  1 
ATOM   6661 N  NZ  . LYS F 1 37  ? 7.926   56.878  106.205 1.00 71.68  ? 183 LYS F NZ  1 
ATOM   6662 N  N   . LEU F 1 38  ? 3.480   61.081  101.012 1.00 46.58  ? 184 LEU F N   1 
ATOM   6663 C  CA  . LEU F 1 38  ? 2.950   61.494  99.715  1.00 46.66  ? 184 LEU F CA  1 
ATOM   6664 C  C   . LEU F 1 38  ? 3.611   62.778  99.233  1.00 44.28  ? 184 LEU F C   1 
ATOM   6665 O  O   . LEU F 1 38  ? 3.849   62.954  98.038  1.00 43.66  ? 184 LEU F O   1 
ATOM   6666 C  CB  . LEU F 1 38  ? 1.427   61.653  99.765  1.00 48.27  ? 184 LEU F CB  1 
ATOM   6667 C  CG  . LEU F 1 38  ? 0.724   62.074  98.468  1.00 52.01  ? 184 LEU F CG  1 
ATOM   6668 C  CD1 . LEU F 1 38  ? 1.348   61.432  97.234  1.00 49.00  ? 184 LEU F CD1 1 
ATOM   6669 C  CD2 . LEU F 1 38  ? -0.764  61.755  98.542  1.00 55.53  ? 184 LEU F CD2 1 
ATOM   6670 N  N   . LEU F 1 39  ? 3.912   63.673  100.165 1.00 43.17  ? 185 LEU F N   1 
ATOM   6671 C  CA  . LEU F 1 39  ? 4.623   64.897  99.824  1.00 43.87  ? 185 LEU F CA  1 
ATOM   6672 C  C   . LEU F 1 39  ? 6.024   64.574  99.307  1.00 46.32  ? 185 LEU F C   1 
ATOM   6673 O  O   . LEU F 1 39  ? 6.506   65.198  98.362  1.00 48.41  ? 185 LEU F O   1 
ATOM   6674 C  CB  . LEU F 1 39  ? 4.707   65.824  101.034 1.00 43.71  ? 185 LEU F CB  1 
ATOM   6675 C  CG  . LEU F 1 39  ? 5.308   67.201  100.773 1.00 45.79  ? 185 LEU F CG  1 
ATOM   6676 C  CD1 . LEU F 1 39  ? 4.315   68.063  100.015 1.00 46.16  ? 185 LEU F CD1 1 
ATOM   6677 C  CD2 . LEU F 1 39  ? 5.700   67.864  102.080 1.00 50.08  ? 185 LEU F CD2 1 
ATOM   6678 N  N   . LYS F 1 40  ? 6.667   63.587  99.926  1.00 47.19  ? 186 LYS F N   1 
ATOM   6679 C  CA  . LYS F 1 40  ? 8.003   63.160  99.518  1.00 46.14  ? 186 LYS F CA  1 
ATOM   6680 C  C   . LYS F 1 40  ? 8.003   62.506  98.132  1.00 40.07  ? 186 LYS F C   1 
ATOM   6681 O  O   . LYS F 1 40  ? 8.901   62.752  97.331  1.00 35.10  ? 186 LYS F O   1 
ATOM   6682 C  CB  . LYS F 1 40  ? 8.630   62.229  100.571 1.00 51.30  ? 186 LYS F CB  1 
ATOM   6683 C  CG  . LYS F 1 40  ? 9.088   62.954  101.842 1.00 56.27  ? 186 LYS F CG  1 
ATOM   6684 C  CD  . LYS F 1 40  ? 9.615   62.001  102.923 1.00 59.55  ? 186 LYS F CD  1 
ATOM   6685 C  CE  . LYS F 1 40  ? 8.483   61.301  103.665 1.00 61.55  ? 186 LYS F CE  1 
ATOM   6686 N  NZ  . LYS F 1 40  ? 8.926   60.717  104.965 1.00 64.84  ? 186 LYS F NZ  1 
ATOM   6687 N  N   . ARG F 1 41  ? 7.000   61.677  97.851  1.00 40.56  ? 187 ARG F N   1 
ATOM   6688 C  CA  . ARG F 1 41  ? 6.882   61.079  96.526  1.00 42.39  ? 187 ARG F CA  1 
ATOM   6689 C  C   . ARG F 1 41  ? 6.685   62.170  95.478  1.00 40.09  ? 187 ARG F C   1 
ATOM   6690 O  O   . ARG F 1 41  ? 7.392   62.207  94.474  1.00 39.57  ? 187 ARG F O   1 
ATOM   6691 C  CB  . ARG F 1 41  ? 5.732   60.067  96.455  1.00 47.75  ? 187 ARG F CB  1 
ATOM   6692 C  CG  . ARG F 1 41  ? 5.461   59.570  95.031  1.00 51.64  ? 187 ARG F CG  1 
ATOM   6693 C  CD  . ARG F 1 41  ? 4.535   58.365  94.987  1.00 58.30  ? 187 ARG F CD  1 
ATOM   6694 N  NE  . ARG F 1 41  ? 3.142   58.712  95.262  1.00 65.78  ? 187 ARG F NE  1 
ATOM   6695 C  CZ  . ARG F 1 41  ? 2.224   58.944  94.326  1.00 69.48  ? 187 ARG F CZ  1 
ATOM   6696 N  NH1 . ARG F 1 41  ? 2.546   58.872  93.041  1.00 69.31  ? 187 ARG F NH1 1 
ATOM   6697 N  NH2 . ARG F 1 41  ? 0.980   59.248  94.676  1.00 70.81  ? 187 ARG F NH2 1 
ATOM   6698 N  N   . GLN F 1 42  ? 5.723   63.057  95.723  1.00 39.24  ? 188 GLN F N   1 
ATOM   6699 C  CA  . GLN F 1 42  ? 5.439   64.160  94.811  1.00 39.77  ? 188 GLN F CA  1 
ATOM   6700 C  C   . GLN F 1 42  ? 6.699   64.968  94.521  1.00 39.06  ? 188 GLN F C   1 
ATOM   6701 O  O   . GLN F 1 42  ? 6.964   65.346  93.379  1.00 35.90  ? 188 GLN F O   1 
ATOM   6702 C  CB  . GLN F 1 42  ? 4.355   65.067  95.389  1.00 41.97  ? 188 GLN F CB  1 
ATOM   6703 C  CG  . GLN F 1 42  ? 2.970   64.451  95.392  1.00 50.40  ? 188 GLN F CG  1 
ATOM   6704 C  CD  . GLN F 1 42  ? 1.919   65.402  95.927  1.00 58.59  ? 188 GLN F CD  1 
ATOM   6705 O  OE1 . GLN F 1 42  ? 2.232   66.519  96.336  1.00 62.72  ? 188 GLN F OE1 1 
ATOM   6706 N  NE2 . GLN F 1 42  ? 0.665   64.964  95.931  1.00 59.54  ? 188 GLN F NE2 1 
ATOM   6707 N  N   . ASN F 1 43  ? 7.480   65.227  95.562  1.00 41.02  ? 189 ASN F N   1 
ATOM   6708 C  CA  . ASN F 1 43  ? 8.725   65.960  95.394  1.00 39.57  ? 189 ASN F CA  1 
ATOM   6709 C  C   . ASN F 1 43  ? 9.712   65.199  94.514  1.00 37.47  ? 189 ASN F C   1 
ATOM   6710 O  O   . ASN F 1 43  ? 10.277  65.762  93.575  1.00 39.20  ? 189 ASN F O   1 
ATOM   6711 C  CB  . ASN F 1 43  ? 9.356   66.280  96.747  1.00 42.71  ? 189 ASN F CB  1 
ATOM   6712 C  CG  . ASN F 1 43  ? 10.332  67.428  96.667  1.00 48.17  ? 189 ASN F CG  1 
ATOM   6713 O  OD1 . ASN F 1 43  ? 9.944   68.568  96.396  1.00 52.78  ? 189 ASN F OD1 1 
ATOM   6714 N  ND2 . ASN F 1 43  ? 11.610  67.138  96.889  1.00 47.80  ? 189 ASN F ND2 1 
ATOM   6715 N  N   . ASP F 1 44  ? 9.913   63.920  94.819  1.00 34.17  ? 190 ASP F N   1 
ATOM   6716 C  CA  . ASP F 1 44  ? 10.747  63.066  93.984  1.00 36.21  ? 190 ASP F CA  1 
ATOM   6717 C  C   . ASP F 1 44  ? 10.375  63.260  92.517  1.00 35.42  ? 190 ASP F C   1 
ATOM   6718 O  O   . ASP F 1 44  ? 11.209  63.643  91.703  1.00 35.99  ? 190 ASP F O   1 
ATOM   6719 C  CB  . ASP F 1 44  ? 10.575  61.592  94.367  1.00 37.65  ? 190 ASP F CB  1 
ATOM   6720 C  CG  . ASP F 1 44  ? 11.296  61.227  95.654  1.00 41.73  ? 190 ASP F CG  1 
ATOM   6721 O  OD1 . ASP F 1 44  ? 11.970  62.106  96.236  1.00 39.93  ? 190 ASP F OD1 1 
ATOM   6722 O  OD2 . ASP F 1 44  ? 11.188  60.052  96.079  1.00 43.39  ? 190 ASP F OD2 1 
ATOM   6723 N  N   . ILE F 1 45  ? 9.110   62.998  92.201  1.00 33.87  ? 191 ILE F N   1 
ATOM   6724 C  CA  . ILE F 1 45  ? 8.586   63.112  90.844  1.00 33.75  ? 191 ILE F CA  1 
ATOM   6725 C  C   . ILE F 1 45  ? 8.778   64.507  90.263  1.00 33.08  ? 191 ILE F C   1 
ATOM   6726 O  O   . ILE F 1 45  ? 9.236   64.657  89.130  1.00 36.13  ? 191 ILE F O   1 
ATOM   6727 C  CB  . ILE F 1 45  ? 7.082   62.772  90.808  1.00 37.16  ? 191 ILE F CB  1 
ATOM   6728 C  CG1 . ILE F 1 45  ? 6.859   61.307  91.188  1.00 41.10  ? 191 ILE F CG1 1 
ATOM   6729 C  CG2 . ILE F 1 45  ? 6.491   63.064  89.441  1.00 26.11  ? 191 ILE F CG2 1 
ATOM   6730 C  CD1 . ILE F 1 45  ? 5.402   60.917  91.247  1.00 42.32  ? 191 ILE F CD1 1 
ATOM   6731 N  N   . LEU F 1 46  ? 8.423   65.525  91.040  1.00 30.96  ? 192 LEU F N   1 
ATOM   6732 C  CA  . LEU F 1 46  ? 8.518   66.904  90.573  1.00 33.72  ? 192 LEU F CA  1 
ATOM   6733 C  C   . LEU F 1 46  ? 9.950   67.273  90.216  1.00 33.73  ? 192 LEU F C   1 
ATOM   6734 O  O   . LEU F 1 46  ? 10.194  67.990  89.242  1.00 31.77  ? 192 LEU F O   1 
ATOM   6735 C  CB  . LEU F 1 46  ? 7.975   67.876  91.623  1.00 35.55  ? 192 LEU F CB  1 
ATOM   6736 C  CG  . LEU F 1 46  ? 8.054   69.362  91.251  1.00 37.11  ? 192 LEU F CG  1 
ATOM   6737 C  CD1 . LEU F 1 46  ? 7.364   69.640  89.919  1.00 36.44  ? 192 LEU F CD1 1 
ATOM   6738 C  CD2 . LEU F 1 46  ? 7.456   70.218  92.351  1.00 37.10  ? 192 LEU F CD2 1 
ATOM   6739 N  N   . GLN F 1 47  ? 10.894  66.777  91.010  1.00 32.20  ? 193 GLN F N   1 
ATOM   6740 C  CA  . GLN F 1 47  ? 12.306  67.051  90.792  1.00 36.36  ? 193 GLN F CA  1 
ATOM   6741 C  C   . GLN F 1 47  ? 12.762  66.522  89.434  1.00 36.31  ? 193 GLN F C   1 
ATOM   6742 O  O   . GLN F 1 47  ? 13.650  67.091  88.808  1.00 39.48  ? 193 GLN F O   1 
ATOM   6743 C  CB  . GLN F 1 47  ? 13.143  66.438  91.917  1.00 46.75  ? 193 GLN F CB  1 
ATOM   6744 C  CG  . GLN F 1 47  ? 14.576  66.930  91.977  1.00 59.25  ? 193 GLN F CG  1 
ATOM   6745 C  CD  . GLN F 1 47  ? 15.331  66.379  93.177  1.00 71.00  ? 193 GLN F CD  1 
ATOM   6746 O  OE1 . GLN F 1 47  ? 14.772  65.645  93.995  1.00 75.63  ? 193 GLN F OE1 1 
ATOM   6747 N  NE2 . GLN F 1 47  ? 16.609  66.731  93.287  1.00 73.11  ? 193 GLN F NE2 1 
ATOM   6748 N  N   . VAL F 1 48  ? 12.148  65.435  88.976  1.00 35.26  ? 194 VAL F N   1 
ATOM   6749 C  CA  . VAL F 1 48  ? 12.497  64.853  87.682  1.00 34.59  ? 194 VAL F CA  1 
ATOM   6750 C  C   . VAL F 1 48  ? 11.683  65.458  86.529  1.00 30.62  ? 194 VAL F C   1 
ATOM   6751 O  O   . VAL F 1 48  ? 12.228  65.765  85.471  1.00 28.86  ? 194 VAL F O   1 
ATOM   6752 C  CB  . VAL F 1 48  ? 12.347  63.317  87.692  1.00 36.19  ? 194 VAL F CB  1 
ATOM   6753 C  CG1 . VAL F 1 48  ? 12.581  62.745  86.303  1.00 35.33  ? 194 VAL F CG1 1 
ATOM   6754 C  CG2 . VAL F 1 48  ? 13.313  62.700  88.692  1.00 36.71  ? 194 VAL F CG2 1 
ATOM   6755 N  N   . VAL F 1 49  ? 10.380  65.622  86.730  1.00 27.93  ? 195 VAL F N   1 
ATOM   6756 C  CA  . VAL F 1 49  ? 9.551   66.308  85.746  1.00 30.17  ? 195 VAL F CA  1 
ATOM   6757 C  C   . VAL F 1 49  ? 10.142  67.690  85.468  1.00 35.29  ? 195 VAL F C   1 
ATOM   6758 O  O   . VAL F 1 49  ? 10.098  68.182  84.342  1.00 36.51  ? 195 VAL F O   1 
ATOM   6759 C  CB  . VAL F 1 49  ? 8.103   66.465  86.246  1.00 24.30  ? 195 VAL F CB  1 
ATOM   6760 C  CG1 . VAL F 1 49  ? 7.274   67.239  85.241  1.00 24.80  ? 195 VAL F CG1 1 
ATOM   6761 C  CG2 . VAL F 1 49  ? 7.488   65.103  86.515  1.00 32.27  ? 195 VAL F CG2 1 
ATOM   6762 N  N   . SER F 1 50  ? 10.712  68.295  86.510  1.00 35.95  ? 196 SER F N   1 
ATOM   6763 C  CA  . SER F 1 50  ? 11.328  69.619  86.433  1.00 35.14  ? 196 SER F CA  1 
ATOM   6764 C  C   . SER F 1 50  ? 12.462  69.699  85.425  1.00 33.29  ? 196 SER F C   1 
ATOM   6765 O  O   . SER F 1 50  ? 12.859  70.790  85.013  1.00 34.32  ? 196 SER F O   1 
ATOM   6766 C  CB  . SER F 1 50  ? 11.874  70.038  87.802  1.00 25.13  ? 196 SER F CB  1 
ATOM   6767 O  OG  . SER F 1 50  ? 10.822  70.425  88.661  1.00 31.66  ? 196 SER F OG  1 
ATOM   6768 N  N   . GLN F 1 51  ? 12.994  68.545  85.047  1.00 30.99  ? 197 GLN F N   1 
ATOM   6769 C  CA  . GLN F 1 51  ? 14.135  68.501  84.146  1.00 34.52  ? 197 GLN F CA  1 
ATOM   6770 C  C   . GLN F 1 51  ? 13.749  67.920  82.792  1.00 35.91  ? 197 GLN F C   1 
ATOM   6771 O  O   . GLN F 1 51  ? 14.566  67.290  82.118  1.00 37.89  ? 197 GLN F O   1 
ATOM   6772 C  CB  . GLN F 1 51  ? 15.269  67.700  84.783  1.00 37.70  ? 197 GLN F CB  1 
ATOM   6773 C  CG  . GLN F 1 51  ? 15.513  68.076  86.231  1.00 41.28  ? 197 GLN F CG  1 
ATOM   6774 C  CD  . GLN F 1 51  ? 16.671  67.320  86.846  1.00 48.56  ? 197 GLN F CD  1 
ATOM   6775 O  OE1 . GLN F 1 51  ? 17.472  66.707  86.140  1.00 52.04  ? 197 GLN F OE1 1 
ATOM   6776 N  NE2 . GLN F 1 51  ? 16.771  67.364  88.172  1.00 48.40  ? 197 GLN F NE2 1 
ATOM   6777 N  N   . GLY F 1 52  ? 12.491  68.130  82.409  1.00 35.11  ? 198 GLY F N   1 
ATOM   6778 C  CA  . GLY F 1 52  ? 12.018  67.771  81.087  1.00 34.86  ? 198 GLY F CA  1 
ATOM   6779 C  C   . GLY F 1 52  ? 11.652  66.311  80.896  1.00 39.61  ? 198 GLY F C   1 
ATOM   6780 O  O   . GLY F 1 52  ? 11.390  65.875  79.774  1.00 41.57  ? 198 GLY F O   1 
ATOM   6781 N  N   . TRP F 1 53  ? 11.642  65.546  81.982  1.00 30.45  ? 199 TRP F N   1 
ATOM   6782 C  CA  . TRP F 1 53  ? 11.188  64.165  81.910  1.00 27.12  ? 199 TRP F CA  1 
ATOM   6783 C  C   . TRP F 1 53  ? 9.714   64.111  82.239  1.00 27.33  ? 199 TRP F C   1 
ATOM   6784 O  O   . TRP F 1 53  ? 9.161   65.049  82.802  1.00 26.28  ? 199 TRP F O   1 
ATOM   6785 C  CB  . TRP F 1 53  ? 11.967  63.267  82.873  1.00 27.27  ? 199 TRP F CB  1 
ATOM   6786 C  CG  . TRP F 1 53  ? 13.326  62.898  82.374  1.00 26.44  ? 199 TRP F CG  1 
ATOM   6787 C  CD1 . TRP F 1 53  ? 14.383  63.737  82.178  1.00 26.94  ? 199 TRP F CD1 1 
ATOM   6788 C  CD2 . TRP F 1 53  ? 13.780  61.589  82.016  1.00 26.20  ? 199 TRP F CD2 1 
ATOM   6789 N  NE1 . TRP F 1 53  ? 15.467  63.032  81.711  1.00 27.82  ? 199 TRP F NE1 1 
ATOM   6790 C  CE2 . TRP F 1 53  ? 15.123  61.711  81.604  1.00 27.02  ? 199 TRP F CE2 1 
ATOM   6791 C  CE3 . TRP F 1 53  ? 13.182  60.325  81.997  1.00 24.84  ? 199 TRP F CE3 1 
ATOM   6792 C  CZ2 . TRP F 1 53  ? 15.878  60.617  81.181  1.00 25.84  ? 199 TRP F CZ2 1 
ATOM   6793 C  CZ3 . TRP F 1 53  ? 13.935  59.242  81.578  1.00 23.22  ? 199 TRP F CZ3 1 
ATOM   6794 C  CH2 . TRP F 1 53  ? 15.268  59.395  81.179  1.00 20.47  ? 199 TRP F CH2 1 
ATOM   6795 N  N   . LYS F 1 54  ? 9.079   63.006  81.881  1.00 28.12  ? 200 LYS F N   1 
ATOM   6796 C  CA  . LYS F 1 54  ? 7.683   62.799  82.213  1.00 32.49  ? 200 LYS F CA  1 
ATOM   6797 C  C   . LYS F 1 54  ? 7.571   61.568  83.104  1.00 36.78  ? 200 LYS F C   1 
ATOM   6798 O  O   . LYS F 1 54  ? 8.521   60.796  83.223  1.00 40.96  ? 200 LYS F O   1 
ATOM   6799 C  CB  . LYS F 1 54  ? 6.867   62.679  80.929  1.00 37.15  ? 200 LYS F CB  1 
ATOM   6800 C  CG  . LYS F 1 54  ? 7.124   63.868  80.006  1.00 39.59  ? 200 LYS F CG  1 
ATOM   6801 C  CD  . LYS F 1 54  ? 6.430   63.746  78.665  1.00 40.09  ? 200 LYS F CD  1 
ATOM   6802 C  CE  . LYS F 1 54  ? 7.044   64.716  77.664  1.00 38.23  ? 200 LYS F CE  1 
ATOM   6803 N  NZ  . LYS F 1 54  ? 7.378   66.032  78.281  1.00 42.49  ? 200 LYS F NZ  1 
ATOM   6804 N  N   . TYR F 1 55  ? 6.435   61.399  83.765  1.00 34.69  ? 201 TYR F N   1 
ATOM   6805 C  CA  . TYR F 1 55  ? 6.290   60.295  84.701  1.00 33.93  ? 201 TYR F CA  1 
ATOM   6806 C  C   . TYR F 1 55  ? 4.944   59.609  84.542  1.00 34.29  ? 201 TYR F C   1 
ATOM   6807 O  O   . TYR F 1 55  ? 3.916   60.268  84.369  1.00 34.11  ? 201 TYR F O   1 
ATOM   6808 C  CB  . TYR F 1 55  ? 6.464   60.782  86.141  1.00 36.02  ? 201 TYR F CB  1 
ATOM   6809 C  CG  . TYR F 1 55  ? 6.035   59.769  87.178  1.00 37.83  ? 201 TYR F CG  1 
ATOM   6810 C  CD1 . TYR F 1 55  ? 6.949   58.883  87.735  1.00 38.10  ? 201 TYR F CD1 1 
ATOM   6811 C  CD2 . TYR F 1 55  ? 4.709   59.691  87.592  1.00 40.95  ? 201 TYR F CD2 1 
ATOM   6812 C  CE1 . TYR F 1 55  ? 6.557   57.949  88.679  1.00 42.19  ? 201 TYR F CE1 1 
ATOM   6813 C  CE2 . TYR F 1 55  ? 4.306   58.759  88.536  1.00 43.91  ? 201 TYR F CE2 1 
ATOM   6814 C  CZ  . TYR F 1 55  ? 5.234   57.890  89.076  1.00 45.86  ? 201 TYR F CZ  1 
ATOM   6815 O  OH  . TYR F 1 55  ? 4.837   56.965  90.018  1.00 49.31  ? 201 TYR F OH  1 
ATOM   6816 N  N   . PHE F 1 56  ? 4.959   58.282  84.601  1.00 33.78  ? 202 PHE F N   1 
ATOM   6817 C  CA  . PHE F 1 56  ? 3.736   57.498  84.514  1.00 34.66  ? 202 PHE F CA  1 
ATOM   6818 C  C   . PHE F 1 56  ? 3.873   56.181  85.260  1.00 37.75  ? 202 PHE F C   1 
ATOM   6819 O  O   . PHE F 1 56  ? 4.811   55.419  85.033  1.00 39.09  ? 202 PHE F O   1 
ATOM   6820 C  CB  . PHE F 1 56  ? 3.358   57.239  83.056  1.00 38.32  ? 202 PHE F CB  1 
ATOM   6821 C  CG  . PHE F 1 56  ? 2.111   56.413  82.892  1.00 43.54  ? 202 PHE F CG  1 
ATOM   6822 C  CD1 . PHE F 1 56  ? 0.856   56.988  83.038  1.00 44.66  ? 202 PHE F CD1 1 
ATOM   6823 C  CD2 . PHE F 1 56  ? 2.190   55.063  82.588  1.00 44.72  ? 202 PHE F CD2 1 
ATOM   6824 C  CE1 . PHE F 1 56  ? -0.296  56.232  82.885  1.00 44.52  ? 202 PHE F CE1 1 
ATOM   6825 C  CE2 . PHE F 1 56  ? 1.040   54.303  82.432  1.00 47.17  ? 202 PHE F CE2 1 
ATOM   6826 C  CZ  . PHE F 1 56  ? -0.203  54.890  82.581  1.00 46.21  ? 202 PHE F CZ  1 
ATOM   6827 N  N   . LYS F 1 57  ? 2.930   55.935  86.162  1.00 39.33  ? 203 LYS F N   1 
ATOM   6828 C  CA  . LYS F 1 57  ? 2.846   54.686  86.912  1.00 41.01  ? 203 LYS F CA  1 
ATOM   6829 C  C   . LYS F 1 57  ? 4.198   54.030  87.206  1.00 40.63  ? 203 LYS F C   1 
ATOM   6830 O  O   . LYS F 1 57  ? 4.485   52.935  86.717  1.00 40.93  ? 203 LYS F O   1 
ATOM   6831 C  CB  . LYS F 1 57  ? 1.908   53.702  86.203  1.00 43.56  ? 203 LYS F CB  1 
ATOM   6832 C  CG  . LYS F 1 57  ? 0.488   54.232  86.011  1.00 48.28  ? 203 LYS F CG  1 
ATOM   6833 C  CD  . LYS F 1 57  ? -0.458  53.137  85.518  1.00 54.98  ? 203 LYS F CD  1 
ATOM   6834 C  CE  . LYS F 1 57  ? -1.897  53.636  85.422  1.00 58.67  ? 203 LYS F CE  1 
ATOM   6835 N  NZ  . LYS F 1 57  ? -2.853  52.551  85.041  1.00 61.54  ? 203 LYS F NZ  1 
ATOM   6836 N  N   . GLY F 1 58  ? 5.019   54.710  88.004  1.00 37.30  ? 204 GLY F N   1 
ATOM   6837 C  CA  . GLY F 1 58  ? 6.259   54.143  88.511  1.00 37.49  ? 204 GLY F CA  1 
ATOM   6838 C  C   . GLY F 1 58  ? 7.507   54.333  87.667  1.00 38.11  ? 204 GLY F C   1 
ATOM   6839 O  O   . GLY F 1 58  ? 8.591   53.892  88.054  1.00 40.38  ? 204 GLY F O   1 
ATOM   6840 N  N   . ASN F 1 59  ? 7.368   54.981  86.516  1.00 36.08  ? 205 ASN F N   1 
ATOM   6841 C  CA  . ASN F 1 59  ? 8.509   55.180  85.635  1.00 32.23  ? 205 ASN F CA  1 
ATOM   6842 C  C   . ASN F 1 59  ? 8.596   56.584  85.062  1.00 33.88  ? 205 ASN F C   1 
ATOM   6843 O  O   . ASN F 1 59  ? 7.585   57.212  84.762  1.00 34.59  ? 205 ASN F O   1 
ATOM   6844 C  CB  . ASN F 1 59  ? 8.496   54.165  84.495  1.00 31.38  ? 205 ASN F CB  1 
ATOM   6845 C  CG  . ASN F 1 59  ? 8.620   52.739  84.986  1.00 33.98  ? 205 ASN F CG  1 
ATOM   6846 O  OD1 . ASN F 1 59  ? 9.707   52.280  85.338  1.00 35.58  ? 205 ASN F OD1 1 
ATOM   6847 N  ND2 . ASN F 1 59  ? 7.501   52.031  85.017  1.00 33.29  ? 205 ASN F ND2 1 
ATOM   6848 N  N   . PHE F 1 60  ? 9.822   57.069  84.921  1.00 30.75  ? 206 PHE F N   1 
ATOM   6849 C  CA  . PHE F 1 60  ? 10.065  58.313  84.232  1.00 30.14  ? 206 PHE F CA  1 
ATOM   6850 C  C   . PHE F 1 60  ? 10.323  57.996  82.768  1.00 32.84  ? 206 PHE F C   1 
ATOM   6851 O  O   . PHE F 1 60  ? 10.925  56.970  82.443  1.00 35.18  ? 206 PHE F O   1 
ATOM   6852 C  CB  . PHE F 1 60  ? 11.259  59.049  84.838  1.00 31.31  ? 206 PHE F CB  1 
ATOM   6853 C  CG  . PHE F 1 60  ? 11.095  59.388  86.296  1.00 30.81  ? 206 PHE F CG  1 
ATOM   6854 C  CD1 . PHE F 1 60  ? 10.240  60.402  86.696  1.00 33.01  ? 206 PHE F CD1 1 
ATOM   6855 C  CD2 . PHE F 1 60  ? 11.817  58.707  87.265  1.00 30.68  ? 206 PHE F CD2 1 
ATOM   6856 C  CE1 . PHE F 1 60  ? 10.096  60.724  88.036  1.00 34.08  ? 206 PHE F CE1 1 
ATOM   6857 C  CE2 . PHE F 1 60  ? 11.682  59.026  88.609  1.00 33.19  ? 206 PHE F CE2 1 
ATOM   6858 C  CZ  . PHE F 1 60  ? 10.818  60.034  88.995  1.00 34.56  ? 206 PHE F CZ  1 
ATOM   6859 N  N   . TYR F 1 61  ? 9.850   58.874  81.889  1.00 30.05  ? 207 TYR F N   1 
ATOM   6860 C  CA  . TYR F 1 61  ? 10.036  58.704  80.457  1.00 29.27  ? 207 TYR F CA  1 
ATOM   6861 C  C   . TYR F 1 61  ? 10.646  59.957  79.858  1.00 31.63  ? 207 TYR F C   1 
ATOM   6862 O  O   . TYR F 1 61  ? 10.408  61.065  80.333  1.00 37.38  ? 207 TYR F O   1 
ATOM   6863 C  CB  . TYR F 1 61  ? 8.702   58.384  79.782  1.00 28.13  ? 207 TYR F CB  1 
ATOM   6864 C  CG  . TYR F 1 61  ? 8.067   57.108  80.293  1.00 26.70  ? 207 TYR F CG  1 
ATOM   6865 C  CD1 . TYR F 1 61  ? 8.208   55.915  79.605  1.00 26.98  ? 207 TYR F CD1 1 
ATOM   6866 C  CD2 . TYR F 1 61  ? 7.340   57.100  81.477  1.00 28.66  ? 207 TYR F CD2 1 
ATOM   6867 C  CE1 . TYR F 1 61  ? 7.631   54.753  80.073  1.00 32.87  ? 207 TYR F CE1 1 
ATOM   6868 C  CE2 . TYR F 1 61  ? 6.760   55.945  81.956  1.00 28.29  ? 207 TYR F CE2 1 
ATOM   6869 C  CZ  . TYR F 1 61  ? 6.909   54.773  81.254  1.00 33.79  ? 207 TYR F CZ  1 
ATOM   6870 O  OH  . TYR F 1 61  ? 6.334   53.619  81.732  1.00 37.42  ? 207 TYR F OH  1 
ATOM   6871 N  N   . TYR F 1 62  ? 11.450  59.781  78.820  1.00 32.21  ? 208 TYR F N   1 
ATOM   6872 C  CA  . TYR F 1 62  ? 12.019  60.919  78.116  1.00 34.14  ? 208 TYR F CA  1 
ATOM   6873 C  C   . TYR F 1 62  ? 11.656  60.845  76.643  1.00 34.29  ? 208 TYR F C   1 
ATOM   6874 O  O   . TYR F 1 62  ? 12.084  59.935  75.932  1.00 34.48  ? 208 TYR F O   1 
ATOM   6875 C  CB  . TYR F 1 62  ? 13.539  60.969  78.295  1.00 34.61  ? 208 TYR F CB  1 
ATOM   6876 C  CG  . TYR F 1 62  ? 14.210  62.154  77.621  1.00 37.28  ? 208 TYR F CG  1 
ATOM   6877 C  CD1 . TYR F 1 62  ? 14.235  63.404  78.229  1.00 35.62  ? 208 TYR F CD1 1 
ATOM   6878 C  CD2 . TYR F 1 62  ? 14.830  62.019  76.382  1.00 38.70  ? 208 TYR F CD2 1 
ATOM   6879 C  CE1 . TYR F 1 62  ? 14.850  64.484  77.627  1.00 35.49  ? 208 TYR F CE1 1 
ATOM   6880 C  CE2 . TYR F 1 62  ? 15.452  63.100  75.769  1.00 39.37  ? 208 TYR F CE2 1 
ATOM   6881 C  CZ  . TYR F 1 62  ? 15.457  64.327  76.399  1.00 38.66  ? 208 TYR F CZ  1 
ATOM   6882 O  OH  . TYR F 1 62  ? 16.070  65.402  75.803  1.00 38.49  ? 208 TYR F OH  1 
ATOM   6883 N  N   . PHE F 1 63  ? 10.845  61.798  76.198  1.00 35.03  ? 209 PHE F N   1 
ATOM   6884 C  CA  . PHE F 1 63  ? 10.504  61.925  74.788  1.00 30.94  ? 209 PHE F CA  1 
ATOM   6885 C  C   . PHE F 1 63  ? 11.466  62.913  74.150  1.00 32.13  ? 209 PHE F C   1 
ATOM   6886 O  O   . PHE F 1 63  ? 11.323  64.119  74.314  1.00 37.43  ? 209 PHE F O   1 
ATOM   6887 C  CB  . PHE F 1 63  ? 9.065   62.405  74.636  1.00 28.56  ? 209 PHE F CB  1 
ATOM   6888 C  CG  . PHE F 1 63  ? 8.042   61.378  75.034  1.00 30.85  ? 209 PHE F CG  1 
ATOM   6889 C  CD1 . PHE F 1 63  ? 7.199   60.819  74.088  1.00 32.50  ? 209 PHE F CD1 1 
ATOM   6890 C  CD2 . PHE F 1 63  ? 7.928   60.965  76.351  1.00 29.67  ? 209 PHE F CD2 1 
ATOM   6891 C  CE1 . PHE F 1 63  ? 6.256   59.874  74.448  1.00 35.81  ? 209 PHE F CE1 1 
ATOM   6892 C  CE2 . PHE F 1 63  ? 6.989   60.017  76.719  1.00 29.49  ? 209 PHE F CE2 1 
ATOM   6893 C  CZ  . PHE F 1 63  ? 6.154   59.469  75.765  1.00 34.17  ? 209 PHE F CZ  1 
ATOM   6894 N  N   . SER F 1 64  ? 12.447  62.392  73.421  1.00 28.18  ? 210 SER F N   1 
ATOM   6895 C  CA  . SER F 1 64  ? 13.540  63.205  72.902  1.00 30.55  ? 210 SER F CA  1 
ATOM   6896 C  C   . SER F 1 64  ? 13.093  64.335  71.968  1.00 34.47  ? 210 SER F C   1 
ATOM   6897 O  O   . SER F 1 64  ? 11.973  64.332  71.442  1.00 35.48  ? 210 SER F O   1 
ATOM   6898 C  CB  . SER F 1 64  ? 14.549  62.326  72.175  1.00 31.55  ? 210 SER F CB  1 
ATOM   6899 O  OG  . SER F 1 64  ? 14.082  62.009  70.876  1.00 37.39  ? 210 SER F OG  1 
ATOM   6900 N  N   . LEU F 1 65  ? 13.994  65.294  71.767  1.00 30.82  ? 211 LEU F N   1 
ATOM   6901 C  CA  . LEU F 1 65  ? 13.761  66.420  70.872  1.00 33.70  ? 211 LEU F CA  1 
ATOM   6902 C  C   . LEU F 1 65  ? 14.598  66.278  69.617  1.00 33.14  ? 211 LEU F C   1 
ATOM   6903 O  O   . LEU F 1 65  ? 14.394  66.994  68.643  1.00 39.06  ? 211 LEU F O   1 
ATOM   6904 C  CB  . LEU F 1 65  ? 14.115  67.733  71.569  1.00 35.98  ? 211 LEU F CB  1 
ATOM   6905 C  CG  . LEU F 1 65  ? 13.235  68.053  72.777  1.00 37.86  ? 211 LEU F CG  1 
ATOM   6906 C  CD1 . LEU F 1 65  ? 13.861  69.142  73.648  1.00 36.31  ? 211 LEU F CD1 1 
ATOM   6907 C  CD2 . LEU F 1 65  ? 11.823  68.429  72.313  1.00 38.16  ? 211 LEU F CD2 1 
ATOM   6908 N  N   . ILE F 1 66  ? 15.547  65.352  69.648  1.00 32.56  ? 212 ILE F N   1 
ATOM   6909 C  CA  . ILE F 1 66  ? 16.423  65.108  68.510  1.00 31.82  ? 212 ILE F CA  1 
ATOM   6910 C  C   . ILE F 1 66  ? 16.299  63.652  68.052  1.00 31.12  ? 212 ILE F C   1 
ATOM   6911 O  O   . ILE F 1 66  ? 16.222  62.750  68.882  1.00 36.78  ? 212 ILE F O   1 
ATOM   6912 C  CB  . ILE F 1 66  ? 17.885  65.454  68.875  1.00 33.64  ? 212 ILE F CB  1 
ATOM   6913 C  CG1 . ILE F 1 66  ? 18.807  65.302  67.670  1.00 40.02  ? 212 ILE F CG1 1 
ATOM   6914 C  CG2 . ILE F 1 66  ? 18.370  64.596  70.026  1.00 32.84  ? 212 ILE F CG2 1 
ATOM   6915 C  CD1 . ILE F 1 66  ? 20.257  65.644  67.972  1.00 43.20  ? 212 ILE F CD1 1 
ATOM   6916 N  N   . PRO F 1 67  ? 16.254  63.420  66.726  1.00 30.98  ? 213 PRO F N   1 
ATOM   6917 C  CA  . PRO F 1 67  ? 16.148  62.080  66.121  1.00 27.01  ? 213 PRO F CA  1 
ATOM   6918 C  C   . PRO F 1 67  ? 17.483  61.338  66.003  1.00 27.22  ? 213 PRO F C   1 
ATOM   6919 O  O   . PRO F 1 67  ? 18.508  61.953  65.721  1.00 32.42  ? 213 PRO F O   1 
ATOM   6920 C  CB  . PRO F 1 67  ? 15.609  62.366  64.708  1.00 29.39  ? 213 PRO F CB  1 
ATOM   6921 C  CG  . PRO F 1 67  ? 15.262  63.847  64.682  1.00 33.32  ? 213 PRO F CG  1 
ATOM   6922 C  CD  . PRO F 1 67  ? 16.131  64.484  65.716  1.00 32.07  ? 213 PRO F CD  1 
ATOM   6923 N  N   . LYS F 1 68  ? 17.460  60.024  66.208  1.00 24.78  ? 214 LYS F N   1 
ATOM   6924 C  CA  . LYS F 1 68  ? 18.656  59.195  66.078  1.00 27.21  ? 214 LYS F CA  1 
ATOM   6925 C  C   . LYS F 1 68  ? 18.307  57.809  65.527  1.00 32.13  ? 214 LYS F C   1 
ATOM   6926 O  O   . LYS F 1 68  ? 17.142  57.411  65.499  1.00 33.80  ? 214 LYS F O   1 
ATOM   6927 C  CB  . LYS F 1 68  ? 19.348  59.027  67.434  1.00 26.68  ? 214 LYS F CB  1 
ATOM   6928 C  CG  . LYS F 1 68  ? 19.937  60.305  68.029  1.00 28.86  ? 214 LYS F CG  1 
ATOM   6929 C  CD  . LYS F 1 68  ? 20.566  60.017  69.390  1.00 33.17  ? 214 LYS F CD  1 
ATOM   6930 C  CE  . LYS F 1 68  ? 21.056  61.288  70.074  1.00 33.31  ? 214 LYS F CE  1 
ATOM   6931 N  NZ  . LYS F 1 68  ? 22.197  61.913  69.355  1.00 31.49  ? 214 LYS F NZ  1 
ATOM   6932 N  N   . THR F 1 69  ? 19.323  57.071  65.092  1.00 28.61  ? 215 THR F N   1 
ATOM   6933 C  CA  . THR F 1 69  ? 19.138  55.661  64.796  1.00 29.51  ? 215 THR F CA  1 
ATOM   6934 C  C   . THR F 1 69  ? 18.785  54.937  66.092  1.00 30.91  ? 215 THR F C   1 
ATOM   6935 O  O   . THR F 1 69  ? 19.053  55.438  67.184  1.00 34.00  ? 215 THR F O   1 
ATOM   6936 C  CB  . THR F 1 69  ? 20.408  55.036  64.208  1.00 28.99  ? 215 THR F CB  1 
ATOM   6937 O  OG1 . THR F 1 69  ? 21.475  55.132  65.164  1.00 27.11  ? 215 THR F OG1 1 
ATOM   6938 C  CG2 . THR F 1 69  ? 20.804  55.747  62.919  1.00 26.02  ? 215 THR F CG2 1 
ATOM   6939 N  N   . TRP F 1 70  ? 18.188  53.757  65.972  1.00 26.84  ? 216 TRP F N   1 
ATOM   6940 C  CA  . TRP F 1 70  ? 17.767  53.005  67.145  1.00 24.92  ? 216 TRP F CA  1 
ATOM   6941 C  C   . TRP F 1 70  ? 18.912  52.836  68.143  1.00 22.29  ? 216 TRP F C   1 
ATOM   6942 O  O   . TRP F 1 70  ? 18.748  53.078  69.336  1.00 20.26  ? 216 TRP F O   1 
ATOM   6943 C  CB  . TRP F 1 70  ? 17.209  51.641  66.733  1.00 25.40  ? 216 TRP F CB  1 
ATOM   6944 C  CG  . TRP F 1 70  ? 16.639  50.853  67.863  1.00 26.96  ? 216 TRP F CG  1 
ATOM   6945 C  CD1 . TRP F 1 70  ? 15.328  50.777  68.225  1.00 25.97  ? 216 TRP F CD1 1 
ATOM   6946 C  CD2 . TRP F 1 70  ? 17.361  50.024  68.790  1.00 23.74  ? 216 TRP F CD2 1 
ATOM   6947 N  NE1 . TRP F 1 70  ? 15.185  49.953  69.316  1.00 22.93  ? 216 TRP F NE1 1 
ATOM   6948 C  CE2 . TRP F 1 70  ? 16.418  49.481  69.684  1.00 23.86  ? 216 TRP F CE2 1 
ATOM   6949 C  CE3 . TRP F 1 70  ? 18.710  49.695  68.949  1.00 24.98  ? 216 TRP F CE3 1 
ATOM   6950 C  CZ2 . TRP F 1 70  ? 16.780  48.615  70.720  1.00 28.11  ? 216 TRP F CZ2 1 
ATOM   6951 C  CZ3 . TRP F 1 70  ? 19.072  48.841  69.985  1.00 28.89  ? 216 TRP F CZ3 1 
ATOM   6952 C  CH2 . TRP F 1 70  ? 18.110  48.311  70.855  1.00 29.53  ? 216 TRP F CH2 1 
ATOM   6953 N  N   . TYR F 1 71  ? 20.080  52.439  67.660  1.00 26.78  ? 217 TYR F N   1 
ATOM   6954 C  CA  . TYR F 1 71  ? 21.179  52.154  68.573  1.00 26.87  ? 217 TYR F CA  1 
ATOM   6955 C  C   . TYR F 1 71  ? 21.782  53.414  69.171  1.00 31.08  ? 217 TYR F C   1 
ATOM   6956 O  O   . TYR F 1 71  ? 22.136  53.435  70.348  1.00 35.57  ? 217 TYR F O   1 
ATOM   6957 C  CB  . TYR F 1 71  ? 22.270  51.319  67.911  1.00 27.43  ? 217 TYR F CB  1 
ATOM   6958 C  CG  . TYR F 1 71  ? 23.438  51.094  68.839  1.00 22.78  ? 217 TYR F CG  1 
ATOM   6959 C  CD1 . TYR F 1 71  ? 23.303  50.292  69.958  1.00 17.74  ? 217 TYR F CD1 1 
ATOM   6960 C  CD2 . TYR F 1 71  ? 24.663  51.706  68.612  1.00 25.96  ? 217 TYR F CD2 1 
ATOM   6961 C  CE1 . TYR F 1 71  ? 24.354  50.094  70.823  1.00 28.41  ? 217 TYR F CE1 1 
ATOM   6962 C  CE2 . TYR F 1 71  ? 25.728  51.510  69.473  1.00 26.56  ? 217 TYR F CE2 1 
ATOM   6963 C  CZ  . TYR F 1 71  ? 25.565  50.705  70.579  1.00 28.37  ? 217 TYR F CZ  1 
ATOM   6964 O  OH  . TYR F 1 71  ? 26.610  50.497  71.451  1.00 32.98  ? 217 TYR F OH  1 
ATOM   6965 N  N   . SER F 1 72  ? 21.905  54.461  68.363  1.00 32.17  ? 218 SER F N   1 
ATOM   6966 C  CA  . SER F 1 72  ? 22.399  55.734  68.869  1.00 31.24  ? 218 SER F CA  1 
ATOM   6967 C  C   . SER F 1 72  ? 21.445  56.259  69.924  1.00 29.71  ? 218 SER F C   1 
ATOM   6968 O  O   . SER F 1 72  ? 21.855  56.922  70.868  1.00 28.45  ? 218 SER F O   1 
ATOM   6969 C  CB  . SER F 1 72  ? 22.551  56.754  67.744  1.00 32.51  ? 218 SER F CB  1 
ATOM   6970 O  OG  . SER F 1 72  ? 23.748  56.535  67.023  1.00 36.16  ? 218 SER F OG  1 
ATOM   6971 N  N   . ALA F 1 73  ? 20.165  55.961  69.750  1.00 31.63  ? 219 ALA F N   1 
ATOM   6972 C  CA  . ALA F 1 73  ? 19.161  56.352  70.723  1.00 30.44  ? 219 ALA F CA  1 
ATOM   6973 C  C   . ALA F 1 73  ? 19.357  55.585  72.035  1.00 32.54  ? 219 ALA F C   1 
ATOM   6974 O  O   . ALA F 1 73  ? 19.367  56.181  73.112  1.00 34.44  ? 219 ALA F O   1 
ATOM   6975 C  CB  . ALA F 1 73  ? 17.761  56.126  70.161  1.00 25.41  ? 219 ALA F CB  1 
ATOM   6976 N  N   . GLU F 1 74  ? 19.518  54.268  71.941  1.00 31.32  ? 220 GLU F N   1 
ATOM   6977 C  CA  . GLU F 1 74  ? 19.767  53.443  73.124  1.00 33.34  ? 220 GLU F CA  1 
ATOM   6978 C  C   . GLU F 1 74  ? 21.012  53.909  73.892  1.00 37.74  ? 220 GLU F C   1 
ATOM   6979 O  O   . GLU F 1 74  ? 21.013  53.955  75.123  1.00 37.59  ? 220 GLU F O   1 
ATOM   6980 C  CB  . GLU F 1 74  ? 19.891  51.965  72.733  1.00 32.43  ? 220 GLU F CB  1 
ATOM   6981 C  CG  . GLU F 1 74  ? 20.428  51.045  73.831  1.00 30.21  ? 220 GLU F CG  1 
ATOM   6982 C  CD  . GLU F 1 74  ? 19.519  50.948  75.048  1.00 32.60  ? 220 GLU F CD  1 
ATOM   6983 O  OE1 . GLU F 1 74  ? 18.479  51.639  75.094  1.00 35.91  ? 220 GLU F OE1 1 
ATOM   6984 O  OE2 . GLU F 1 74  ? 19.846  50.171  75.969  1.00 33.37  ? 220 GLU F OE2 1 
ATOM   6985 N  N   . GLN F 1 75  ? 22.069  54.256  73.164  1.00 39.05  ? 221 GLN F N   1 
ATOM   6986 C  CA  . GLN F 1 75  ? 23.278  54.773  73.791  1.00 41.04  ? 221 GLN F CA  1 
ATOM   6987 C  C   . GLN F 1 75  ? 22.990  56.068  74.536  1.00 40.58  ? 221 GLN F C   1 
ATOM   6988 O  O   . GLN F 1 75  ? 23.523  56.311  75.617  1.00 40.58  ? 221 GLN F O   1 
ATOM   6989 C  CB  . GLN F 1 75  ? 24.353  55.028  72.745  1.00 41.28  ? 221 GLN F CB  1 
ATOM   6990 C  CG  . GLN F 1 75  ? 25.223  53.839  72.453  1.00 41.65  ? 221 GLN F CG  1 
ATOM   6991 C  CD  . GLN F 1 75  ? 26.462  54.237  71.689  1.00 45.24  ? 221 GLN F CD  1 
ATOM   6992 O  OE1 . GLN F 1 75  ? 26.444  55.200  70.920  1.00 45.46  ? 221 GLN F OE1 1 
ATOM   6993 N  NE2 . GLN F 1 75  ? 27.549  53.508  71.900  1.00 47.08  ? 221 GLN F NE2 1 
ATOM   6994 N  N   . PHE F 1 76  ? 22.154  56.903  73.933  1.00 38.29  ? 222 PHE F N   1 
ATOM   6995 C  CA  . PHE F 1 76  ? 21.715  58.145  74.554  1.00 33.61  ? 222 PHE F CA  1 
ATOM   6996 C  C   . PHE F 1 76  ? 21.011  57.834  75.864  1.00 31.55  ? 222 PHE F C   1 
ATOM   6997 O  O   . PHE F 1 76  ? 21.313  58.425  76.897  1.00 34.49  ? 222 PHE F O   1 
ATOM   6998 C  CB  . PHE F 1 76  ? 20.758  58.870  73.613  1.00 31.33  ? 222 PHE F CB  1 
ATOM   6999 C  CG  . PHE F 1 76  ? 20.232  60.163  74.150  1.00 32.69  ? 222 PHE F CG  1 
ATOM   7000 C  CD1 . PHE F 1 76  ? 20.749  61.370  73.708  1.00 36.60  ? 222 PHE F CD1 1 
ATOM   7001 C  CD2 . PHE F 1 76  ? 19.208  60.179  75.080  1.00 32.96  ? 222 PHE F CD2 1 
ATOM   7002 C  CE1 . PHE F 1 76  ? 20.263  62.567  74.192  1.00 38.44  ? 222 PHE F CE1 1 
ATOM   7003 C  CE2 . PHE F 1 76  ? 18.715  61.377  75.570  1.00 35.93  ? 222 PHE F CE2 1 
ATOM   7004 C  CZ  . PHE F 1 76  ? 19.244  62.571  75.126  1.00 38.37  ? 222 PHE F CZ  1 
ATOM   7005 N  N   . CYS F 1 77  ? 20.063  56.904  75.810  1.00 27.27  ? 223 CYS F N   1 
ATOM   7006 C  CA  . CYS F 1 77  ? 19.295  56.528  76.984  1.00 27.56  ? 223 CYS F CA  1 
ATOM   7007 C  C   . CYS F 1 77  ? 20.190  55.983  78.098  1.00 31.01  ? 223 CYS F C   1 
ATOM   7008 O  O   . CYS F 1 77  ? 19.978  56.282  79.274  1.00 30.59  ? 223 CYS F O   1 
ATOM   7009 C  CB  . CYS F 1 77  ? 18.229  55.497  76.612  1.00 26.53  ? 223 CYS F CB  1 
ATOM   7010 S  SG  . CYS F 1 77  ? 16.894  56.161  75.596  1.00 35.44  ? 223 CYS F SG  1 
ATOM   7011 N  N   . VAL F 1 78  ? 21.178  55.175  77.723  1.00 29.57  ? 224 VAL F N   1 
ATOM   7012 C  CA  . VAL F 1 78  ? 22.081  54.573  78.697  1.00 29.41  ? 224 VAL F CA  1 
ATOM   7013 C  C   . VAL F 1 78  ? 22.906  55.651  79.404  1.00 33.22  ? 224 VAL F C   1 
ATOM   7014 O  O   . VAL F 1 78  ? 23.087  55.609  80.624  1.00 32.09  ? 224 VAL F O   1 
ATOM   7015 C  CB  . VAL F 1 78  ? 23.009  53.513  78.054  1.00 28.99  ? 224 VAL F CB  1 
ATOM   7016 C  CG1 . VAL F 1 78  ? 24.165  53.159  78.996  1.00 28.92  ? 224 VAL F CG1 1 
ATOM   7017 C  CG2 . VAL F 1 78  ? 22.217  52.263  77.689  1.00 25.95  ? 224 VAL F CG2 1 
ATOM   7018 N  N   . SER F 1 79  ? 23.379  56.628  78.636  1.00 31.73  ? 225 SER F N   1 
ATOM   7019 C  CA  . SER F 1 79  ? 24.139  57.735  79.195  1.00 30.86  ? 225 SER F CA  1 
ATOM   7020 C  C   . SER F 1 79  ? 23.287  58.574  80.148  1.00 29.83  ? 225 SER F C   1 
ATOM   7021 O  O   . SER F 1 79  ? 23.788  59.492  80.789  1.00 32.12  ? 225 SER F O   1 
ATOM   7022 C  CB  . SER F 1 79  ? 24.684  58.618  78.077  1.00 35.64  ? 225 SER F CB  1 
ATOM   7023 O  OG  . SER F 1 79  ? 23.694  59.534  77.639  1.00 38.95  ? 225 SER F OG  1 
ATOM   7024 N  N   . ARG F 1 80  ? 21.996  58.267  80.227  1.00 31.11  ? 226 ARG F N   1 
ATOM   7025 C  CA  . ARG F 1 80  ? 21.104  58.934  81.173  1.00 29.95  ? 226 ARG F CA  1 
ATOM   7026 C  C   . ARG F 1 80  ? 20.464  57.913  82.114  1.00 27.65  ? 226 ARG F C   1 
ATOM   7027 O  O   . ARG F 1 80  ? 19.328  58.091  82.554  1.00 30.10  ? 226 ARG F O   1 
ATOM   7028 C  CB  . ARG F 1 80  ? 20.001  59.715  80.451  1.00 35.95  ? 226 ARG F CB  1 
ATOM   7029 C  CG  . ARG F 1 80  ? 20.447  60.495  79.222  1.00 43.26  ? 226 ARG F CG  1 
ATOM   7030 C  CD  . ARG F 1 80  ? 21.306  61.691  79.575  1.00 52.20  ? 226 ARG F CD  1 
ATOM   7031 N  NE  . ARG F 1 80  ? 20.851  62.895  78.883  1.00 57.05  ? 226 ARG F NE  1 
ATOM   7032 C  CZ  . ARG F 1 80  ? 21.249  63.261  77.669  1.00 58.54  ? 226 ARG F CZ  1 
ATOM   7033 N  NH1 . ARG F 1 80  ? 22.120  62.519  76.998  1.00 61.37  ? 226 ARG F NH1 1 
ATOM   7034 N  NH2 . ARG F 1 80  ? 20.776  64.373  77.127  1.00 58.48  ? 226 ARG F NH2 1 
ATOM   7035 N  N   . ASN F 1 81  ? 21.189  56.836  82.404  1.00 24.74  ? 227 ASN F N   1 
ATOM   7036 C  CA  . ASN F 1 81  ? 20.728  55.827  83.355  1.00 28.72  ? 227 ASN F CA  1 
ATOM   7037 C  C   . ASN F 1 81  ? 19.354  55.236  83.023  1.00 29.35  ? 227 ASN F C   1 
ATOM   7038 O  O   . ASN F 1 81  ? 18.558  54.939  83.916  1.00 30.37  ? 227 ASN F O   1 
ATOM   7039 C  CB  . ASN F 1 81  ? 20.714  56.400  84.773  1.00 30.66  ? 227 ASN F CB  1 
ATOM   7040 C  CG  . ASN F 1 81  ? 20.669  55.323  85.830  1.00 40.07  ? 227 ASN F CG  1 
ATOM   7041 O  OD1 . ASN F 1 81  ? 21.231  54.239  85.656  1.00 43.56  ? 227 ASN F OD1 1 
ATOM   7042 N  ND2 . ASN F 1 81  ? 19.996  55.610  86.937  1.00 43.59  ? 227 ASN F ND2 1 
ATOM   7043 N  N   . SER F 1 82  ? 19.081  55.055  81.739  1.00 29.98  ? 228 SER F N   1 
ATOM   7044 C  CA  . SER F 1 82  ? 17.778  54.554  81.319  1.00 32.07  ? 228 SER F CA  1 
ATOM   7045 C  C   . SER F 1 82  ? 17.916  53.566  80.170  1.00 29.36  ? 228 SER F C   1 
ATOM   7046 O  O   . SER F 1 82  ? 19.018  53.154  79.822  1.00 31.43  ? 228 SER F O   1 
ATOM   7047 C  CB  . SER F 1 82  ? 16.893  55.726  80.893  1.00 30.57  ? 228 SER F CB  1 
ATOM   7048 O  OG  . SER F 1 82  ? 17.466  56.389  79.777  1.00 33.97  ? 228 SER F OG  1 
ATOM   7049 N  N   . HIS F 1 83  ? 16.789  53.191  79.582  1.00 28.13  ? 229 HIS F N   1 
ATOM   7050 C  CA  . HIS F 1 83  ? 16.791  52.350  78.390  1.00 31.67  ? 229 HIS F CA  1 
ATOM   7051 C  C   . HIS F 1 83  ? 15.683  52.788  77.451  1.00 32.66  ? 229 HIS F C   1 
ATOM   7052 O  O   . HIS F 1 83  ? 14.680  53.347  77.891  1.00 36.96  ? 229 HIS F O   1 
ATOM   7053 C  CB  . HIS F 1 83  ? 16.575  50.883  78.753  1.00 30.08  ? 229 HIS F CB  1 
ATOM   7054 C  CG  . HIS F 1 83  ? 17.800  50.201  79.276  1.00 36.50  ? 229 HIS F CG  1 
ATOM   7055 N  ND1 . HIS F 1 83  ? 18.906  49.955  78.492  1.00 36.77  ? 229 HIS F ND1 1 
ATOM   7056 C  CD2 . HIS F 1 83  ? 18.085  49.697  80.500  1.00 36.19  ? 229 HIS F CD2 1 
ATOM   7057 C  CE1 . HIS F 1 83  ? 19.823  49.334  79.211  1.00 37.17  ? 229 HIS F CE1 1 
ATOM   7058 N  NE2 . HIS F 1 83  ? 19.350  49.166  80.433  1.00 38.48  ? 229 HIS F NE2 1 
ATOM   7059 N  N   . LEU F 1 84  ? 15.853  52.542  76.159  1.00 28.44  ? 230 LEU F N   1 
ATOM   7060 C  CA  . LEU F 1 84  ? 14.740  52.747  75.251  1.00 28.84  ? 230 LEU F CA  1 
ATOM   7061 C  C   . LEU F 1 84  ? 13.558  52.035  75.888  1.00 30.64  ? 230 LEU F C   1 
ATOM   7062 O  O   . LEU F 1 84  ? 13.698  50.923  76.391  1.00 29.97  ? 230 LEU F O   1 
ATOM   7063 C  CB  . LEU F 1 84  ? 15.047  52.196  73.861  1.00 23.46  ? 230 LEU F CB  1 
ATOM   7064 C  CG  . LEU F 1 84  ? 15.979  53.080  73.028  1.00 20.47  ? 230 LEU F CG  1 
ATOM   7065 C  CD1 . LEU F 1 84  ? 16.178  52.490  71.639  1.00 23.00  ? 230 LEU F CD1 1 
ATOM   7066 C  CD2 . LEU F 1 84  ? 15.421  54.492  72.932  1.00 19.37  ? 230 LEU F CD2 1 
ATOM   7067 N  N   . THR F 1 85  ? 12.407  52.693  75.907  1.00 30.09  ? 231 THR F N   1 
ATOM   7068 C  CA  . THR F 1 85  ? 11.290  52.202  76.694  1.00 33.10  ? 231 THR F CA  1 
ATOM   7069 C  C   . THR F 1 85  ? 10.827  50.806  76.272  1.00 34.53  ? 231 THR F C   1 
ATOM   7070 O  O   . THR F 1 85  ? 10.850  50.463  75.089  1.00 34.18  ? 231 THR F O   1 
ATOM   7071 C  CB  . THR F 1 85  ? 10.098  53.179  76.657  1.00 32.84  ? 231 THR F CB  1 
ATOM   7072 O  OG1 . THR F 1 85  ? 9.099   52.749  77.589  1.00 37.14  ? 231 THR F OG1 1 
ATOM   7073 C  CG2 . THR F 1 85  ? 9.496   53.239  75.262  1.00 26.59  ? 231 THR F CG2 1 
ATOM   7074 N  N   . SER F 1 86  ? 10.433  50.002  77.255  1.00 32.20  ? 232 SER F N   1 
ATOM   7075 C  CA  . SER F 1 86  ? 9.734   48.753  76.990  1.00 34.08  ? 232 SER F CA  1 
ATOM   7076 C  C   . SER F 1 86  ? 8.249   49.000  77.238  1.00 32.77  ? 232 SER F C   1 
ATOM   7077 O  O   . SER F 1 86  ? 7.880   49.993  77.860  1.00 32.34  ? 232 SER F O   1 
ATOM   7078 C  CB  . SER F 1 86  ? 10.261  47.623  77.887  1.00 35.28  ? 232 SER F CB  1 
ATOM   7079 O  OG  . SER F 1 86  ? 10.125  47.936  79.266  1.00 34.20  ? 232 SER F OG  1 
ATOM   7080 N  N   . VAL F 1 87  ? 7.395   48.115  76.742  1.00 33.33  ? 233 VAL F N   1 
ATOM   7081 C  CA  . VAL F 1 87  ? 5.962   48.268  76.959  1.00 37.20  ? 233 VAL F CA  1 
ATOM   7082 C  C   . VAL F 1 87  ? 5.418   47.020  77.644  1.00 45.14  ? 233 VAL F C   1 
ATOM   7083 O  O   . VAL F 1 87  ? 5.601   45.907  77.154  1.00 49.33  ? 233 VAL F O   1 
ATOM   7084 C  CB  . VAL F 1 87  ? 5.208   48.526  75.644  1.00 35.51  ? 233 VAL F CB  1 
ATOM   7085 C  CG1 . VAL F 1 87  ? 3.817   49.061  75.936  1.00 38.99  ? 233 VAL F CG1 1 
ATOM   7086 C  CG2 . VAL F 1 87  ? 5.978   49.511  74.776  1.00 29.52  ? 233 VAL F CG2 1 
ATOM   7087 N  N   . THR F 1 88  ? 4.753   47.207  78.778  1.00 46.03  ? 234 THR F N   1 
ATOM   7088 C  CA  . THR F 1 88  ? 4.423   46.091  79.654  1.00 47.02  ? 234 THR F CA  1 
ATOM   7089 C  C   . THR F 1 88  ? 2.950   46.027  80.065  1.00 48.82  ? 234 THR F C   1 
ATOM   7090 O  O   . THR F 1 88  ? 2.567   45.186  80.877  1.00 48.55  ? 234 THR F O   1 
ATOM   7091 C  CB  . THR F 1 88  ? 5.290   46.132  80.921  1.00 50.66  ? 234 THR F CB  1 
ATOM   7092 O  OG1 . THR F 1 88  ? 5.008   47.333  81.651  1.00 53.69  ? 234 THR F OG1 1 
ATOM   7093 C  CG2 . THR F 1 88  ? 6.766   46.109  80.555  1.00 50.36  ? 234 THR F CG2 1 
ATOM   7094 N  N   . SER F 1 89  ? 2.124   46.905  79.505  1.00 49.54  ? 235 SER F N   1 
ATOM   7095 C  CA  . SER F 1 89  ? 0.701   46.911  79.832  1.00 48.75  ? 235 SER F CA  1 
ATOM   7096 C  C   . SER F 1 89  ? -0.078  47.774  78.857  1.00 47.51  ? 235 SER F C   1 
ATOM   7097 O  O   . SER F 1 89  ? 0.488   48.652  78.211  1.00 46.39  ? 235 SER F O   1 
ATOM   7098 C  CB  . SER F 1 89  ? 0.477   47.415  81.259  1.00 48.91  ? 235 SER F CB  1 
ATOM   7099 O  OG  . SER F 1 89  ? 0.985   48.731  81.422  1.00 50.46  ? 235 SER F OG  1 
ATOM   7100 N  N   . GLU F 1 90  ? -1.379  47.522  78.755  1.00 49.81  ? 236 GLU F N   1 
ATOM   7101 C  CA  . GLU F 1 90  ? -2.239  48.349  77.922  1.00 54.72  ? 236 GLU F CA  1 
ATOM   7102 C  C   . GLU F 1 90  ? -2.134  49.808  78.340  1.00 50.99  ? 236 GLU F C   1 
ATOM   7103 O  O   . GLU F 1 90  ? -2.014  50.692  77.497  1.00 47.97  ? 236 GLU F O   1 
ATOM   7104 C  CB  . GLU F 1 90  ? -3.697  47.892  78.002  1.00 61.77  ? 236 GLU F CB  1 
ATOM   7105 C  CG  . GLU F 1 90  ? -4.037  46.713  77.102  1.00 69.55  ? 236 GLU F CG  1 
ATOM   7106 C  CD  . GLU F 1 90  ? -5.400  46.858  76.437  1.00 74.52  ? 236 GLU F CD  1 
ATOM   7107 O  OE1 . GLU F 1 90  ? -6.096  47.862  76.703  1.00 76.80  ? 236 GLU F OE1 1 
ATOM   7108 O  OE2 . GLU F 1 90  ? -5.773  45.971  75.641  1.00 75.07  ? 236 GLU F OE2 1 
ATOM   7109 N  N   . SER F 1 91  ? -2.173  50.052  79.647  1.00 51.78  ? 237 SER F N   1 
ATOM   7110 C  CA  . SER F 1 91  ? -2.165  51.416  80.168  1.00 53.29  ? 237 SER F CA  1 
ATOM   7111 C  C   . SER F 1 91  ? -0.862  52.151  79.860  1.00 52.75  ? 237 SER F C   1 
ATOM   7112 O  O   . SER F 1 91  ? -0.878  53.344  79.549  1.00 55.09  ? 237 SER F O   1 
ATOM   7113 C  CB  . SER F 1 91  ? -2.446  51.434  81.672  1.00 54.97  ? 237 SER F CB  1 
ATOM   7114 O  OG  . SER F 1 91  ? -1.410  50.796  82.390  1.00 58.92  ? 237 SER F OG  1 
ATOM   7115 N  N   . GLU F 1 92  ? 0.263   51.446  79.948  1.00 49.79  ? 238 GLU F N   1 
ATOM   7116 C  CA  . GLU F 1 92  ? 1.543   52.048  79.590  1.00 46.83  ? 238 GLU F CA  1 
ATOM   7117 C  C   . GLU F 1 92  ? 1.601   52.314  78.089  1.00 45.10  ? 238 GLU F C   1 
ATOM   7118 O  O   . GLU F 1 92  ? 2.077   53.361  77.654  1.00 46.07  ? 238 GLU F O   1 
ATOM   7119 C  CB  . GLU F 1 92  ? 2.721   51.173  80.023  1.00 43.08  ? 238 GLU F CB  1 
ATOM   7120 C  CG  . GLU F 1 92  ? 4.070   51.780  79.672  1.00 41.70  ? 238 GLU F CG  1 
ATOM   7121 C  CD  . GLU F 1 92  ? 5.241   50.901  80.069  1.00 47.28  ? 238 GLU F CD  1 
ATOM   7122 O  OE1 . GLU F 1 92  ? 5.048   49.679  80.250  1.00 49.78  ? 238 GLU F OE1 1 
ATOM   7123 O  OE2 . GLU F 1 92  ? 6.365   51.435  80.193  1.00 46.38  ? 238 GLU F OE2 1 
ATOM   7124 N  N   . GLN F 1 93  ? 1.114   51.359  77.303  1.00 43.55  ? 239 GLN F N   1 
ATOM   7125 C  CA  . GLN F 1 93  ? 1.006   51.526  75.856  1.00 43.31  ? 239 GLN F CA  1 
ATOM   7126 C  C   . GLN F 1 93  ? 0.124   52.722  75.515  1.00 43.34  ? 239 GLN F C   1 
ATOM   7127 O  O   . GLN F 1 93  ? 0.372   53.438  74.543  1.00 43.29  ? 239 GLN F O   1 
ATOM   7128 C  CB  . GLN F 1 93  ? 0.418   50.261  75.224  1.00 44.86  ? 239 GLN F CB  1 
ATOM   7129 C  CG  . GLN F 1 93  ? 0.118   50.374  73.737  1.00 44.11  ? 239 GLN F CG  1 
ATOM   7130 C  CD  . GLN F 1 93  ? 1.345   50.182  72.866  1.00 42.75  ? 239 GLN F CD  1 
ATOM   7131 O  OE1 . GLN F 1 93  ? 2.479   50.186  73.353  1.00 41.65  ? 239 GLN F OE1 1 
ATOM   7132 N  NE2 . GLN F 1 93  ? 1.123   50.009  71.565  1.00 40.45  ? 239 GLN F NE2 1 
ATOM   7133 N  N   . GLU F 1 94  ? -0.912  52.927  76.320  1.00 43.23  ? 240 GLU F N   1 
ATOM   7134 C  CA  . GLU F 1 94  ? -1.836  54.031  76.115  1.00 42.08  ? 240 GLU F CA  1 
ATOM   7135 C  C   . GLU F 1 94  ? -1.170  55.346  76.488  1.00 41.04  ? 240 GLU F C   1 
ATOM   7136 O  O   . GLU F 1 94  ? -1.358  56.361  75.818  1.00 40.43  ? 240 GLU F O   1 
ATOM   7137 C  CB  . GLU F 1 94  ? -3.102  53.835  76.950  1.00 48.23  ? 240 GLU F CB  1 
ATOM   7138 C  CG  . GLU F 1 94  ? -4.147  54.923  76.745  1.00 55.75  ? 240 GLU F CG  1 
ATOM   7139 C  CD  . GLU F 1 94  ? -5.350  54.761  77.656  1.00 63.15  ? 240 GLU F CD  1 
ATOM   7140 O  OE1 . GLU F 1 94  ? -5.166  54.361  78.825  1.00 63.95  ? 240 GLU F OE1 1 
ATOM   7141 O  OE2 . GLU F 1 94  ? -6.480  55.042  77.202  1.00 67.73  ? 240 GLU F OE2 1 
ATOM   7142 N  N   . PHE F 1 95  ? -0.394  55.329  77.566  1.00 37.08  ? 241 PHE F N   1 
ATOM   7143 C  CA  . PHE F 1 95  ? 0.316   56.528  77.987  1.00 36.94  ? 241 PHE F CA  1 
ATOM   7144 C  C   . PHE F 1 95  ? 1.297   56.972  76.914  1.00 33.15  ? 241 PHE F C   1 
ATOM   7145 O  O   . PHE F 1 95  ? 1.475   58.164  76.681  1.00 35.22  ? 241 PHE F O   1 
ATOM   7146 C  CB  . PHE F 1 95  ? 1.066   56.293  79.300  1.00 36.86  ? 241 PHE F CB  1 
ATOM   7147 C  CG  . PHE F 1 95  ? 2.151   57.297  79.559  1.00 37.49  ? 241 PHE F CG  1 
ATOM   7148 C  CD1 . PHE F 1 95  ? 1.842   58.572  80.000  1.00 38.88  ? 241 PHE F CD1 1 
ATOM   7149 C  CD2 . PHE F 1 95  ? 3.480   56.968  79.356  1.00 39.97  ? 241 PHE F CD2 1 
ATOM   7150 C  CE1 . PHE F 1 95  ? 2.843   59.501  80.238  1.00 37.79  ? 241 PHE F CE1 1 
ATOM   7151 C  CE2 . PHE F 1 95  ? 4.483   57.889  79.592  1.00 39.92  ? 241 PHE F CE2 1 
ATOM   7152 C  CZ  . PHE F 1 95  ? 4.163   59.159  80.032  1.00 39.17  ? 241 PHE F CZ  1 
ATOM   7153 N  N   . LEU F 1 96  ? 1.925   56.004  76.258  1.00 31.07  ? 242 LEU F N   1 
ATOM   7154 C  CA  . LEU F 1 96  ? 3.003   56.295  75.323  1.00 31.08  ? 242 LEU F CA  1 
ATOM   7155 C  C   . LEU F 1 96  ? 2.519   56.884  74.000  1.00 32.72  ? 242 LEU F C   1 
ATOM   7156 O  O   . LEU F 1 96  ? 3.014   57.923  73.576  1.00 29.43  ? 242 LEU F O   1 
ATOM   7157 C  CB  . LEU F 1 96  ? 3.861   55.054  75.081  1.00 34.24  ? 242 LEU F CB  1 
ATOM   7158 C  CG  . LEU F 1 96  ? 4.664   54.555  76.290  1.00 36.21  ? 242 LEU F CG  1 
ATOM   7159 C  CD1 . LEU F 1 96  ? 5.406   53.269  75.950  1.00 33.68  ? 242 LEU F CD1 1 
ATOM   7160 C  CD2 . LEU F 1 96  ? 5.627   55.628  76.786  1.00 31.61  ? 242 LEU F CD2 1 
ATOM   7161 N  N   . TYR F 1 97  ? 1.563   56.230  73.345  1.00 35.55  ? 243 TYR F N   1 
ATOM   7162 C  CA  . TYR F 1 97  ? 1.081   56.732  72.065  1.00 37.40  ? 243 TYR F CA  1 
ATOM   7163 C  C   . TYR F 1 97  ? 0.305   58.034  72.233  1.00 37.60  ? 243 TYR F C   1 
ATOM   7164 O  O   . TYR F 1 97  ? 0.257   58.850  71.317  1.00 41.09  ? 243 TYR F O   1 
ATOM   7165 C  CB  . TYR F 1 97  ? 0.242   55.690  71.320  1.00 42.62  ? 243 TYR F CB  1 
ATOM   7166 C  CG  . TYR F 1 97  ? -1.221  55.662  71.694  1.00 45.83  ? 243 TYR F CG  1 
ATOM   7167 C  CD1 . TYR F 1 97  ? -2.125  56.543  71.113  1.00 49.82  ? 243 TYR F CD1 1 
ATOM   7168 C  CD2 . TYR F 1 97  ? -1.703  54.735  72.608  1.00 48.94  ? 243 TYR F CD2 1 
ATOM   7169 C  CE1 . TYR F 1 97  ? -3.467  56.511  71.448  1.00 53.78  ? 243 TYR F CE1 1 
ATOM   7170 C  CE2 . TYR F 1 97  ? -3.040  54.693  72.947  1.00 51.88  ? 243 TYR F CE2 1 
ATOM   7171 C  CZ  . TYR F 1 97  ? -3.919  55.581  72.365  1.00 55.71  ? 243 TYR F CZ  1 
ATOM   7172 O  OH  . TYR F 1 97  ? -5.252  55.539  72.707  1.00 57.30  ? 243 TYR F OH  1 
ATOM   7173 N  N   . LYS F 1 98  ? -0.304  58.225  73.399  1.00 35.60  ? 244 LYS F N   1 
ATOM   7174 C  CA  . LYS F 1 98  ? -0.959  59.491  73.707  1.00 38.32  ? 244 LYS F CA  1 
ATOM   7175 C  C   . LYS F 1 98  ? 0.075   60.609  73.730  1.00 41.49  ? 244 LYS F C   1 
ATOM   7176 O  O   . LYS F 1 98  ? 0.001   61.562  72.954  1.00 41.68  ? 244 LYS F O   1 
ATOM   7177 C  CB  . LYS F 1 98  ? -1.658  59.425  75.065  1.00 39.95  ? 244 LYS F CB  1 
ATOM   7178 C  CG  . LYS F 1 98  ? -2.967  58.658  75.076  1.00 44.68  ? 244 LYS F CG  1 
ATOM   7179 C  CD  . LYS F 1 98  ? -4.060  59.409  74.344  1.00 49.71  ? 244 LYS F CD  1 
ATOM   7180 C  CE  . LYS F 1 98  ? -5.403  58.714  74.508  1.00 51.68  ? 244 LYS F CE  1 
ATOM   7181 N  NZ  . LYS F 1 98  ? -6.508  59.501  73.895  1.00 52.77  ? 244 LYS F NZ  1 
ATOM   7182 N  N   . THR F 1 99  ? 1.048   60.474  74.626  1.00 39.47  ? 245 THR F N   1 
ATOM   7183 C  CA  . THR F 1 99  ? 2.089   61.478  74.798  1.00 40.22  ? 245 THR F CA  1 
ATOM   7184 C  C   . THR F 1 99  ? 2.898   61.711  73.525  1.00 39.33  ? 245 THR F C   1 
ATOM   7185 O  O   . THR F 1 99  ? 3.471   62.784  73.334  1.00 40.48  ? 245 THR F O   1 
ATOM   7186 C  CB  . THR F 1 99  ? 3.052   61.079  75.924  1.00 39.49  ? 245 THR F CB  1 
ATOM   7187 O  OG1 . THR F 1 99  ? 2.299   60.633  77.059  1.00 41.00  ? 245 THR F OG1 1 
ATOM   7188 C  CG2 . THR F 1 99  ? 3.932   62.257  76.315  1.00 34.58  ? 245 THR F CG2 1 
ATOM   7189 N  N   . ALA F 1 100 ? 2.954   60.701  72.663  1.00 36.33  ? 246 ALA F N   1 
ATOM   7190 C  CA  . ALA F 1 100 ? 3.697   60.810  71.414  1.00 35.56  ? 246 ALA F CA  1 
ATOM   7191 C  C   . ALA F 1 100 ? 3.031   61.823  70.484  1.00 39.08  ? 246 ALA F C   1 
ATOM   7192 O  O   . ALA F 1 100 ? 3.677   62.396  69.603  1.00 39.12  ? 246 ALA F O   1 
ATOM   7193 C  CB  . ALA F 1 100 ? 3.807   59.455  70.744  1.00 32.47  ? 246 ALA F CB  1 
ATOM   7194 N  N   . GLY F 1 101 ? 1.734   62.031  70.690  1.00 42.94  ? 247 GLY F N   1 
ATOM   7195 C  CA  . GLY F 1 101 ? 0.994   63.062  69.986  1.00 49.61  ? 247 GLY F CA  1 
ATOM   7196 C  C   . GLY F 1 101 ? 1.126   63.029  68.476  1.00 52.20  ? 247 GLY F C   1 
ATOM   7197 O  O   . GLY F 1 101 ? 1.171   64.074  67.828  1.00 55.09  ? 247 GLY F O   1 
ATOM   7198 N  N   . GLY F 1 102 ? 1.192   61.830  67.912  1.00 52.39  ? 248 GLY F N   1 
ATOM   7199 C  CA  . GLY F 1 102 ? 1.225   61.678  66.470  1.00 51.95  ? 248 GLY F CA  1 
ATOM   7200 C  C   . GLY F 1 102 ? 2.627   61.609  65.902  1.00 48.76  ? 248 GLY F C   1 
ATOM   7201 O  O   . GLY F 1 102 ? 2.818   61.222  64.747  1.00 48.29  ? 248 GLY F O   1 
ATOM   7202 N  N   . LEU F 1 103 ? 3.608   61.992  66.712  1.00 45.65  ? 249 LEU F N   1 
ATOM   7203 C  CA  . LEU F 1 103 ? 5.007   61.881  66.319  1.00 40.15  ? 249 LEU F CA  1 
ATOM   7204 C  C   . LEU F 1 103 ? 5.473   60.443  66.473  1.00 38.07  ? 249 LEU F C   1 
ATOM   7205 O  O   . LEU F 1 103 ? 4.932   59.691  67.282  1.00 37.03  ? 249 LEU F O   1 
ATOM   7206 C  CB  . LEU F 1 103 ? 5.878   62.817  67.156  1.00 38.08  ? 249 LEU F CB  1 
ATOM   7207 C  CG  . LEU F 1 103 ? 5.542   64.298  66.979  1.00 36.10  ? 249 LEU F CG  1 
ATOM   7208 C  CD1 . LEU F 1 103 ? 6.652   65.161  67.543  1.00 29.37  ? 249 LEU F CD1 1 
ATOM   7209 C  CD2 . LEU F 1 103 ? 5.307   64.607  65.504  1.00 35.29  ? 249 LEU F CD2 1 
ATOM   7210 N  N   . ILE F 1 104 ? 6.479   60.066  65.695  1.00 38.10  ? 250 ILE F N   1 
ATOM   7211 C  CA  . ILE F 1 104 ? 6.996   58.703  65.714  1.00 34.78  ? 250 ILE F CA  1 
ATOM   7212 C  C   . ILE F 1 104 ? 8.272   58.605  66.543  1.00 35.11  ? 250 ILE F C   1 
ATOM   7213 O  O   . ILE F 1 104 ? 9.198   59.399  66.368  1.00 35.86  ? 250 ILE F O   1 
ATOM   7214 C  CB  . ILE F 1 104 ? 7.268   58.209  64.290  1.00 31.69  ? 250 ILE F CB  1 
ATOM   7215 C  CG1 . ILE F 1 104 ? 5.996   58.349  63.443  1.00 35.86  ? 250 ILE F CG1 1 
ATOM   7216 C  CG2 . ILE F 1 104 ? 7.765   56.773  64.307  1.00 26.74  ? 250 ILE F CG2 1 
ATOM   7217 C  CD1 . ILE F 1 104 ? 6.204   58.088  61.963  1.00 34.47  ? 250 ILE F CD1 1 
ATOM   7218 N  N   . TYR F 1 105 ? 8.312   57.627  67.446  1.00 33.33  ? 251 TYR F N   1 
ATOM   7219 C  CA  . TYR F 1 105 ? 9.437   57.464  68.359  1.00 32.48  ? 251 TYR F CA  1 
ATOM   7220 C  C   . TYR F 1 105 ? 9.919   56.017  68.389  1.00 30.38  ? 251 TYR F C   1 
ATOM   7221 O  O   . TYR F 1 105 ? 9.122   55.100  68.537  1.00 28.49  ? 251 TYR F O   1 
ATOM   7222 C  CB  . TYR F 1 105 ? 9.044   57.857  69.790  1.00 31.47  ? 251 TYR F CB  1 
ATOM   7223 C  CG  . TYR F 1 105 ? 8.690   59.310  70.016  1.00 29.67  ? 251 TYR F CG  1 
ATOM   7224 C  CD1 . TYR F 1 105 ? 9.594   60.178  70.610  1.00 30.56  ? 251 TYR F CD1 1 
ATOM   7225 C  CD2 . TYR F 1 105 ? 7.440   59.807  69.667  1.00 31.23  ? 251 TYR F CD2 1 
ATOM   7226 C  CE1 . TYR F 1 105 ? 9.273   61.510  70.836  1.00 29.10  ? 251 TYR F CE1 1 
ATOM   7227 C  CE2 . TYR F 1 105 ? 7.108   61.136  69.888  1.00 31.89  ? 251 TYR F CE2 1 
ATOM   7228 C  CZ  . TYR F 1 105 ? 8.029   61.979  70.472  1.00 30.31  ? 251 TYR F CZ  1 
ATOM   7229 O  OH  . TYR F 1 105 ? 7.709   63.295  70.695  1.00 31.01  ? 251 TYR F OH  1 
ATOM   7230 N  N   . TRP F 1 106 ? 11.226  55.819  68.263  1.00 28.56  ? 252 TRP F N   1 
ATOM   7231 C  CA  . TRP F 1 106 ? 11.822  54.525  68.553  1.00 29.55  ? 252 TRP F CA  1 
ATOM   7232 C  C   . TRP F 1 106 ? 11.435  54.078  69.966  1.00 32.17  ? 252 TRP F C   1 
ATOM   7233 O  O   . TRP F 1 106 ? 11.372  54.890  70.887  1.00 32.95  ? 252 TRP F O   1 
ATOM   7234 C  CB  . TRP F 1 106 ? 13.345  54.631  68.510  1.00 30.03  ? 252 TRP F CB  1 
ATOM   7235 C  CG  . TRP F 1 106 ? 14.012  54.562  67.151  1.00 31.92  ? 252 TRP F CG  1 
ATOM   7236 C  CD1 . TRP F 1 106 ? 14.982  55.406  66.674  1.00 31.01  ? 252 TRP F CD1 1 
ATOM   7237 C  CD2 . TRP F 1 106 ? 13.800  53.582  66.126  1.00 30.81  ? 252 TRP F CD2 1 
ATOM   7238 N  NE1 . TRP F 1 106 ? 15.375  55.014  65.421  1.00 30.88  ? 252 TRP F NE1 1 
ATOM   7239 C  CE2 . TRP F 1 106 ? 14.668  53.897  65.061  1.00 30.95  ? 252 TRP F CE2 1 
ATOM   7240 C  CE3 . TRP F 1 106 ? 12.960  52.470  66.004  1.00 35.94  ? 252 TRP F CE3 1 
ATOM   7241 C  CZ2 . TRP F 1 106 ? 14.715  53.142  63.885  1.00 32.65  ? 252 TRP F CZ2 1 
ATOM   7242 C  CZ3 . TRP F 1 106 ? 13.010  51.721  64.835  1.00 35.51  ? 252 TRP F CZ3 1 
ATOM   7243 C  CH2 . TRP F 1 106 ? 13.879  52.064  63.791  1.00 33.28  ? 252 TRP F CH2 1 
ATOM   7244 N  N   . ILE F 1 107 ? 11.184  52.789  70.154  1.00 31.93  ? 253 ILE F N   1 
ATOM   7245 C  CA  . ILE F 1 107 ? 11.107  52.254  71.511  1.00 30.11  ? 253 ILE F CA  1 
ATOM   7246 C  C   . ILE F 1 107 ? 12.098  51.107  71.635  1.00 30.43  ? 253 ILE F C   1 
ATOM   7247 O  O   . ILE F 1 107 ? 12.830  50.821  70.690  1.00 30.92  ? 253 ILE F O   1 
ATOM   7248 C  CB  . ILE F 1 107 ? 9.685   51.807  71.895  1.00 30.85  ? 253 ILE F CB  1 
ATOM   7249 C  CG1 . ILE F 1 107 ? 9.179   50.725  70.943  1.00 32.11  ? 253 ILE F CG1 1 
ATOM   7250 C  CG2 . ILE F 1 107 ? 8.738   52.992  71.887  1.00 30.50  ? 253 ILE F CG2 1 
ATOM   7251 C  CD1 . ILE F 1 107 ? 7.816   50.195  71.320  1.00 32.34  ? 253 ILE F CD1 1 
ATOM   7252 N  N   . GLY F 1 108 ? 12.123  50.454  72.791  1.00 35.09  ? 254 GLY F N   1 
ATOM   7253 C  CA  . GLY F 1 108 ? 13.125  49.434  73.069  1.00 35.68  ? 254 GLY F CA  1 
ATOM   7254 C  C   . GLY F 1 108 ? 12.973  48.111  72.329  1.00 36.38  ? 254 GLY F C   1 
ATOM   7255 O  O   . GLY F 1 108 ? 13.545  47.104  72.751  1.00 37.84  ? 254 GLY F O   1 
ATOM   7256 N  N   . LEU F 1 109 ? 12.219  48.107  71.229  1.00 33.16  ? 255 LEU F N   1 
ATOM   7257 C  CA  . LEU F 1 109 ? 11.985  46.888  70.445  1.00 33.38  ? 255 LEU F CA  1 
ATOM   7258 C  C   . LEU F 1 109 ? 13.123  46.598  69.480  1.00 33.76  ? 255 LEU F C   1 
ATOM   7259 O  O   . LEU F 1 109 ? 13.475  47.438  68.659  1.00 36.58  ? 255 LEU F O   1 
ATOM   7260 C  CB  . LEU F 1 109 ? 10.694  47.007  69.631  1.00 32.57  ? 255 LEU F CB  1 
ATOM   7261 C  CG  . LEU F 1 109 ? 9.377   46.556  70.253  1.00 36.63  ? 255 LEU F CG  1 
ATOM   7262 C  CD1 . LEU F 1 109 ? 8.206   47.069  69.432  1.00 40.02  ? 255 LEU F CD1 1 
ATOM   7263 C  CD2 . LEU F 1 109 ? 9.334   45.048  70.347  1.00 38.27  ? 255 LEU F CD2 1 
ATOM   7264 N  N   . THR F 1 110 ? 13.689  45.403  69.559  1.00 34.30  ? 256 THR F N   1 
ATOM   7265 C  CA  . THR F 1 110 ? 14.683  45.006  68.574  1.00 36.88  ? 256 THR F CA  1 
ATOM   7266 C  C   . THR F 1 110 ? 14.778  43.492  68.415  1.00 37.72  ? 256 THR F C   1 
ATOM   7267 O  O   . THR F 1 110 ? 14.443  42.735  69.329  1.00 36.34  ? 256 THR F O   1 
ATOM   7268 C  CB  . THR F 1 110 ? 16.073  45.591  68.899  1.00 36.70  ? 256 THR F CB  1 
ATOM   7269 O  OG1 . THR F 1 110 ? 16.948  45.387  67.784  1.00 39.53  ? 256 THR F OG1 1 
ATOM   7270 C  CG2 . THR F 1 110 ? 16.666  44.926  70.135  1.00 34.01  ? 256 THR F CG2 1 
ATOM   7271 N  N   . LYS F 1 111 ? 15.221  43.055  67.240  1.00 40.24  ? 257 LYS F N   1 
ATOM   7272 C  CA  . LYS F 1 111 ? 15.478  41.638  67.010  1.00 44.05  ? 257 LYS F CA  1 
ATOM   7273 C  C   . LYS F 1 111 ? 16.828  41.243  67.587  1.00 46.44  ? 257 LYS F C   1 
ATOM   7274 O  O   . LYS F 1 111 ? 17.839  41.906  67.348  1.00 44.52  ? 257 LYS F O   1 
ATOM   7275 C  CB  . LYS F 1 111 ? 15.444  41.303  65.518  1.00 44.49  ? 257 LYS F CB  1 
ATOM   7276 C  CG  . LYS F 1 111 ? 14.058  41.328  64.894  1.00 45.31  ? 257 LYS F CG  1 
ATOM   7277 C  CD  . LYS F 1 111 ? 14.106  40.820  63.462  1.00 48.45  ? 257 LYS F CD  1 
ATOM   7278 C  CE  . LYS F 1 111 ? 12.739  40.894  62.794  1.00 51.72  ? 257 LYS F CE  1 
ATOM   7279 N  NZ  . LYS F 1 111 ? 12.762  41.755  61.579  1.00 50.93  ? 257 LYS F NZ  1 
ATOM   7280 N  N   . ALA F 1 112 ? 16.833  40.165  68.359  1.00 51.30  ? 258 ALA F N   1 
ATOM   7281 C  CA  . ALA F 1 112 ? 18.068  39.585  68.857  1.00 57.43  ? 258 ALA F CA  1 
ATOM   7282 C  C   . ALA F 1 112 ? 17.920  38.069  68.895  1.00 67.40  ? 258 ALA F C   1 
ATOM   7283 O  O   . ALA F 1 112 ? 16.858  37.545  69.237  1.00 70.33  ? 258 ALA F O   1 
ATOM   7284 C  CB  . ALA F 1 112 ? 18.398  40.130  70.231  1.00 56.52  ? 258 ALA F CB  1 
ATOM   7285 N  N   . GLY F 1 113 ? 18.985  37.366  68.527  1.00 71.64  ? 259 GLY F N   1 
ATOM   7286 C  CA  . GLY F 1 113 ? 18.958  35.917  68.482  1.00 75.66  ? 259 GLY F CA  1 
ATOM   7287 C  C   . GLY F 1 113 ? 19.235  35.406  67.084  1.00 79.26  ? 259 GLY F C   1 
ATOM   7288 O  O   . GLY F 1 113 ? 19.375  36.192  66.144  1.00 79.39  ? 259 GLY F O   1 
ATOM   7289 N  N   . MET F 1 114 ? 19.310  34.086  66.945  1.00 80.68  ? 260 MET F N   1 
ATOM   7290 C  CA  . MET F 1 114 ? 19.611  33.467  65.661  1.00 81.55  ? 260 MET F CA  1 
ATOM   7291 C  C   . MET F 1 114 ? 18.386  33.357  64.764  1.00 84.65  ? 260 MET F C   1 
ATOM   7292 O  O   . MET F 1 114 ? 18.489  32.896  63.626  1.00 85.65  ? 260 MET F O   1 
ATOM   7293 C  CB  . MET F 1 114 ? 20.218  32.077  65.863  1.00 81.57  ? 260 MET F CB  1 
ATOM   7294 C  CG  . MET F 1 114 ? 21.693  32.083  66.201  1.00 79.40  ? 260 MET F CG  1 
ATOM   7295 S  SD  . MET F 1 114 ? 22.520  30.662  65.472  1.00 97.31  ? 260 MET F SD  1 
ATOM   7296 C  CE  . MET F 1 114 ? 21.982  30.804  63.769  1.00 125.37 ? 260 MET F CE  1 
ATOM   7297 N  N   . GLU F 1 115 ? 17.233  33.781  65.274  1.00 87.50  ? 261 GLU F N   1 
ATOM   7298 C  CA  . GLU F 1 115 ? 15.972  33.608  64.557  1.00 92.32  ? 261 GLU F CA  1 
ATOM   7299 C  C   . GLU F 1 115 ? 15.187  34.909  64.397  1.00 89.31  ? 261 GLU F C   1 
ATOM   7300 O  O   . GLU F 1 115 ? 14.074  34.910  63.867  1.00 91.04  ? 261 GLU F O   1 
ATOM   7301 C  CB  . GLU F 1 115 ? 15.108  32.562  65.264  1.00 98.08  ? 261 GLU F CB  1 
ATOM   7302 C  CG  . GLU F 1 115 ? 15.805  31.226  65.470  1.00 104.01 ? 261 GLU F CG  1 
ATOM   7303 C  CD  . GLU F 1 115 ? 15.017  30.289  66.361  1.00 108.61 ? 261 GLU F CD  1 
ATOM   7304 O  OE1 . GLU F 1 115 ? 14.098  30.766  67.059  1.00 108.82 ? 261 GLU F OE1 1 
ATOM   7305 O  OE2 . GLU F 1 115 ? 15.321  29.077  66.365  1.00 111.71 ? 261 GLU F OE2 1 
ATOM   7306 N  N   . GLY F 1 116 ? 15.765  36.014  64.853  1.00 83.02  ? 262 GLY F N   1 
ATOM   7307 C  CA  . GLY F 1 116 ? 15.096  37.297  64.768  1.00 77.54  ? 262 GLY F CA  1 
ATOM   7308 C  C   . GLY F 1 116 ? 13.875  37.367  65.665  1.00 74.83  ? 262 GLY F C   1 
ATOM   7309 O  O   . GLY F 1 116 ? 12.789  37.747  65.226  1.00 75.93  ? 262 GLY F O   1 
ATOM   7310 N  N   . ASP F 1 117 ? 14.052  36.987  66.925  1.00 72.65  ? 263 ASP F N   1 
ATOM   7311 C  CA  . ASP F 1 117 ? 12.990  37.107  67.915  1.00 70.57  ? 263 ASP F CA  1 
ATOM   7312 C  C   . ASP F 1 117 ? 12.939  38.531  68.447  1.00 65.67  ? 263 ASP F C   1 
ATOM   7313 O  O   . ASP F 1 117 ? 13.968  39.112  68.791  1.00 64.81  ? 263 ASP F O   1 
ATOM   7314 C  CB  . ASP F 1 117 ? 13.223  36.144  69.079  1.00 73.71  ? 263 ASP F CB  1 
ATOM   7315 C  CG  . ASP F 1 117 ? 12.974  34.700  68.703  1.00 80.56  ? 263 ASP F CG  1 
ATOM   7316 O  OD1 . ASP F 1 117 ? 12.246  34.452  67.718  1.00 83.70  ? 263 ASP F OD1 1 
ATOM   7317 O  OD2 . ASP F 1 117 ? 13.502  33.810  69.403  1.00 81.86  ? 263 ASP F OD2 1 
ATOM   7318 N  N   . TRP F 1 118 ? 11.737  39.090  68.517  1.00 61.56  ? 264 TRP F N   1 
ATOM   7319 C  CA  . TRP F 1 118 ? 11.554  40.420  69.075  1.00 57.42  ? 264 TRP F CA  1 
ATOM   7320 C  C   . TRP F 1 118 ? 11.833  40.414  70.573  1.00 57.40  ? 264 TRP F C   1 
ATOM   7321 O  O   . TRP F 1 118 ? 11.387  39.515  71.286  1.00 60.54  ? 264 TRP F O   1 
ATOM   7322 C  CB  . TRP F 1 118 ? 10.139  40.920  68.798  1.00 55.23  ? 264 TRP F CB  1 
ATOM   7323 C  CG  . TRP F 1 118 ? 9.935   41.325  67.376  1.00 55.84  ? 264 TRP F CG  1 
ATOM   7324 C  CD1 . TRP F 1 118 ? 9.220   40.659  66.423  1.00 55.32  ? 264 TRP F CD1 1 
ATOM   7325 C  CD2 . TRP F 1 118 ? 10.465  42.492  66.739  1.00 52.06  ? 264 TRP F CD2 1 
ATOM   7326 N  NE1 . TRP F 1 118 ? 9.268   41.344  65.231  1.00 53.46  ? 264 TRP F NE1 1 
ATOM   7327 C  CE2 . TRP F 1 118 ? 10.028  42.472  65.399  1.00 52.03  ? 264 TRP F CE2 1 
ATOM   7328 C  CE3 . TRP F 1 118 ? 11.270  43.550  67.171  1.00 46.35  ? 264 TRP F CE3 1 
ATOM   7329 C  CZ2 . TRP F 1 118 ? 10.367  43.468  64.490  1.00 51.20  ? 264 TRP F CZ2 1 
ATOM   7330 C  CZ3 . TRP F 1 118 ? 11.604  44.534  66.269  1.00 45.72  ? 264 TRP F CZ3 1 
ATOM   7331 C  CH2 . TRP F 1 118 ? 11.152  44.490  64.944  1.00 48.20  ? 264 TRP F CH2 1 
ATOM   7332 N  N   . SER F 1 119 ? 12.575  41.413  71.045  1.00 50.77  ? 265 SER F N   1 
ATOM   7333 C  CA  . SER F 1 119 ? 12.921  41.507  72.460  1.00 49.10  ? 265 SER F CA  1 
ATOM   7334 C  C   . SER F 1 119 ? 12.944  42.955  72.929  1.00 49.01  ? 265 SER F C   1 
ATOM   7335 O  O   . SER F 1 119 ? 12.874  43.878  72.122  1.00 51.43  ? 265 SER F O   1 
ATOM   7336 C  CB  . SER F 1 119 ? 14.288  40.865  72.730  1.00 46.54  ? 265 SER F CB  1 
ATOM   7337 O  OG  . SER F 1 119 ? 15.335  41.616  72.134  1.00 43.12  ? 265 SER F OG  1 
ATOM   7338 N  N   . TRP F 1 120 ? 13.042  43.142  74.241  1.00 46.46  ? 266 TRP F N   1 
ATOM   7339 C  CA  . TRP F 1 120 ? 13.225  44.461  74.825  1.00 39.40  ? 266 TRP F CA  1 
ATOM   7340 C  C   . TRP F 1 120 ? 14.688  44.642  75.208  1.00 36.50  ? 266 TRP F C   1 
ATOM   7341 O  O   . TRP F 1 120 ? 15.300  43.738  75.783  1.00 35.19  ? 266 TRP F O   1 
ATOM   7342 C  CB  . TRP F 1 120 ? 12.335  44.626  76.055  1.00 38.97  ? 266 TRP F CB  1 
ATOM   7343 C  CG  . TRP F 1 120 ? 10.879  44.546  75.740  1.00 42.47  ? 266 TRP F CG  1 
ATOM   7344 C  CD1 . TRP F 1 120 ? 10.022  43.544  76.079  1.00 46.31  ? 266 TRP F CD1 1 
ATOM   7345 C  CD2 . TRP F 1 120 ? 10.109  45.502  75.004  1.00 41.84  ? 266 TRP F CD2 1 
ATOM   7346 N  NE1 . TRP F 1 120 ? 8.761   43.819  75.607  1.00 47.91  ? 266 TRP F NE1 1 
ATOM   7347 C  CE2 . TRP F 1 120 ? 8.788   45.016  74.943  1.00 45.19  ? 266 TRP F CE2 1 
ATOM   7348 C  CE3 . TRP F 1 120 ? 10.406  46.723  74.393  1.00 41.59  ? 266 TRP F CE3 1 
ATOM   7349 C  CZ2 . TRP F 1 120 ? 7.765   45.709  74.296  1.00 45.66  ? 266 TRP F CZ2 1 
ATOM   7350 C  CZ3 . TRP F 1 120 ? 9.389   47.411  73.752  1.00 41.53  ? 266 TRP F CZ3 1 
ATOM   7351 C  CH2 . TRP F 1 120 ? 8.085   46.902  73.709  1.00 43.24  ? 266 TRP F CH2 1 
ATOM   7352 N  N   . VAL F 1 121 ? 15.251  45.804  74.889  1.00 31.57  ? 267 VAL F N   1 
ATOM   7353 C  CA  . VAL F 1 121 ? 16.659  46.057  75.186  1.00 33.01  ? 267 VAL F CA  1 
ATOM   7354 C  C   . VAL F 1 121 ? 16.899  46.178  76.696  1.00 36.51  ? 267 VAL F C   1 
ATOM   7355 O  O   . VAL F 1 121 ? 17.963  45.797  77.198  1.00 38.89  ? 267 VAL F O   1 
ATOM   7356 C  CB  . VAL F 1 121 ? 17.198  47.311  74.445  1.00 39.26  ? 267 VAL F CB  1 
ATOM   7357 C  CG1 . VAL F 1 121 ? 16.654  48.591  75.069  1.00 37.64  ? 267 VAL F CG1 1 
ATOM   7358 C  CG2 . VAL F 1 121 ? 18.724  47.320  74.446  1.00 35.73  ? 267 VAL F CG2 1 
ATOM   7359 N  N   . ASP F 1 122 ? 15.906  46.688  77.421  1.00 35.45  ? 268 ASP F N   1 
ATOM   7360 C  CA  . ASP F 1 122 ? 16.026  46.804  78.870  1.00 40.31  ? 268 ASP F CA  1 
ATOM   7361 C  C   . ASP F 1 122 ? 15.900  45.440  79.555  1.00 41.95  ? 268 ASP F C   1 
ATOM   7362 O  O   . ASP F 1 122 ? 15.816  45.359  80.776  1.00 40.11  ? 268 ASP F O   1 
ATOM   7363 C  CB  . ASP F 1 122 ? 15.011  47.803  79.437  1.00 39.21  ? 268 ASP F CB  1 
ATOM   7364 C  CG  . ASP F 1 122 ? 13.586  47.294  79.375  1.00 42.54  ? 268 ASP F CG  1 
ATOM   7365 O  OD1 . ASP F 1 122 ? 13.363  46.186  78.845  1.00 44.51  ? 268 ASP F OD1 1 
ATOM   7366 O  OD2 . ASP F 1 122 ? 12.684  48.006  79.862  1.00 42.13  ? 268 ASP F OD2 1 
ATOM   7367 N  N   . ASP F 1 123 ? 15.878  44.381  78.748  1.00 45.80  ? 269 ASP F N   1 
ATOM   7368 C  CA  . ASP F 1 123 ? 15.860  42.997  79.236  1.00 50.13  ? 269 ASP F CA  1 
ATOM   7369 C  C   . ASP F 1 123 ? 14.535  42.532  79.847  1.00 47.75  ? 269 ASP F C   1 
ATOM   7370 O  O   . ASP F 1 123 ? 14.463  41.461  80.446  1.00 47.09  ? 269 ASP F O   1 
ATOM   7371 C  CB  . ASP F 1 123 ? 17.029  42.730  80.196  1.00 56.08  ? 269 ASP F CB  1 
ATOM   7372 C  CG  . ASP F 1 123 ? 18.349  42.537  79.468  1.00 61.65  ? 269 ASP F CG  1 
ATOM   7373 O  OD1 . ASP F 1 123 ? 18.321  42.119  78.289  1.00 62.72  ? 269 ASP F OD1 1 
ATOM   7374 O  OD2 . ASP F 1 123 ? 19.414  42.799  80.071  1.00 64.71  ? 269 ASP F OD2 1 
ATOM   7375 N  N   . THR F 1 124 ? 13.490  43.333  79.692  1.00 47.22  ? 270 THR F N   1 
ATOM   7376 C  CA  . THR F 1 124 ? 12.144  42.895  80.038  1.00 49.56  ? 270 THR F CA  1 
ATOM   7377 C  C   . THR F 1 124 ? 11.766  41.715  79.143  1.00 49.51  ? 270 THR F C   1 
ATOM   7378 O  O   . THR F 1 124 ? 11.818  41.821  77.920  1.00 47.66  ? 270 THR F O   1 
ATOM   7379 C  CB  . THR F 1 124 ? 11.116  44.039  79.855  1.00 51.54  ? 270 THR F CB  1 
ATOM   7380 O  OG1 . THR F 1 124 ? 11.389  45.090  80.794  1.00 49.57  ? 270 THR F OG1 1 
ATOM   7381 C  CG2 . THR F 1 124 ? 9.693   43.533  80.063  1.00 52.91  ? 270 THR F CG2 1 
ATOM   7382 N  N   . PRO F 1 125 ? 11.417  40.568  79.748  1.00 52.97  ? 271 PRO F N   1 
ATOM   7383 C  CA  . PRO F 1 125 ? 10.995  39.429  78.926  1.00 52.74  ? 271 PRO F CA  1 
ATOM   7384 C  C   . PRO F 1 125 ? 9.863   39.827  77.988  1.00 50.30  ? 271 PRO F C   1 
ATOM   7385 O  O   . PRO F 1 125 ? 8.875   40.423  78.421  1.00 50.11  ? 271 PRO F O   1 
ATOM   7386 C  CB  . PRO F 1 125 ? 10.504  38.416  79.963  1.00 55.38  ? 271 PRO F CB  1 
ATOM   7387 C  CG  . PRO F 1 125 ? 11.317  38.721  81.181  1.00 56.02  ? 271 PRO F CG  1 
ATOM   7388 C  CD  . PRO F 1 125 ? 11.488  40.222  81.180  1.00 53.77  ? 271 PRO F CD  1 
ATOM   7389 N  N   . PHE F 1 126 ? 10.018  39.507  76.709  1.00 48.36  ? 272 PHE F N   1 
ATOM   7390 C  CA  . PHE F 1 126 ? 9.026   39.866  75.708  1.00 48.58  ? 272 PHE F CA  1 
ATOM   7391 C  C   . PHE F 1 126 ? 7.874   38.864  75.668  1.00 54.14  ? 272 PHE F C   1 
ATOM   7392 O  O   . PHE F 1 126 ? 8.082   37.658  75.502  1.00 55.37  ? 272 PHE F O   1 
ATOM   7393 C  CB  . PHE F 1 126 ? 9.684   39.972  74.335  1.00 48.24  ? 272 PHE F CB  1 
ATOM   7394 C  CG  . PHE F 1 126 ? 8.740   40.369  73.240  1.00 50.03  ? 272 PHE F CG  1 
ATOM   7395 C  CD1 . PHE F 1 126 ? 8.477   41.705  72.983  1.00 47.39  ? 272 PHE F CD1 1 
ATOM   7396 C  CD2 . PHE F 1 126 ? 8.119   39.405  72.460  1.00 50.77  ? 272 PHE F CD2 1 
ATOM   7397 C  CE1 . PHE F 1 126 ? 7.610   42.074  71.970  1.00 47.07  ? 272 PHE F CE1 1 
ATOM   7398 C  CE2 . PHE F 1 126 ? 7.252   39.766  71.447  1.00 51.17  ? 272 PHE F CE2 1 
ATOM   7399 C  CZ  . PHE F 1 126 ? 6.996   41.101  71.202  1.00 49.64  ? 272 PHE F CZ  1 
ATOM   7400 N  N   . ASN F 1 127 ? 6.659   39.375  75.829  1.00 57.61  ? 273 ASN F N   1 
ATOM   7401 C  CA  . ASN F 1 127 ? 5.466   38.541  75.790  1.00 63.45  ? 273 ASN F CA  1 
ATOM   7402 C  C   . ASN F 1 127 ? 4.834   38.587  74.409  1.00 62.66  ? 273 ASN F C   1 
ATOM   7403 O  O   . ASN F 1 127 ? 4.236   39.589  74.026  1.00 59.51  ? 273 ASN F O   1 
ATOM   7404 C  CB  . ASN F 1 127 ? 4.462   38.998  76.848  1.00 67.88  ? 273 ASN F CB  1 
ATOM   7405 C  CG  . ASN F 1 127 ? 3.259   38.083  76.946  1.00 73.38  ? 273 ASN F CG  1 
ATOM   7406 O  OD1 . ASN F 1 127 ? 2.726   37.625  75.935  1.00 76.00  ? 273 ASN F OD1 1 
ATOM   7407 N  ND2 . ASN F 1 127 ? 2.820   37.816  78.170  1.00 75.08  ? 273 ASN F ND2 1 
ATOM   7408 N  N   . LYS F 1 128 ? 4.971   37.496  73.664  1.00 67.68  ? 274 LYS F N   1 
ATOM   7409 C  CA  . LYS F 1 128 ? 4.494   37.454  72.289  1.00 71.34  ? 274 LYS F CA  1 
ATOM   7410 C  C   . LYS F 1 128 ? 2.976   37.541  72.221  1.00 72.07  ? 274 LYS F C   1 
ATOM   7411 O  O   . LYS F 1 128 ? 2.424   38.214  71.352  1.00 70.83  ? 274 LYS F O   1 
ATOM   7412 C  CB  . LYS F 1 128 ? 4.993   36.193  71.585  1.00 75.97  ? 274 LYS F CB  1 
ATOM   7413 C  CG  . LYS F 1 128 ? 5.544   36.450  70.195  1.00 80.68  ? 274 LYS F CG  1 
ATOM   7414 C  CD  . LYS F 1 128 ? 6.753   35.570  69.913  1.00 88.06  ? 274 LYS F CD  1 
ATOM   7415 C  CE  . LYS F 1 128 ? 7.391   35.915  68.575  1.00 91.91  ? 274 LYS F CE  1 
ATOM   7416 N  NZ  . LYS F 1 128 ? 6.465   35.658  67.435  1.00 94.05  ? 274 LYS F NZ  1 
ATOM   7417 N  N   . VAL F 1 129 ? 2.304   36.864  73.147  1.00 75.09  ? 275 VAL F N   1 
ATOM   7418 C  CA  . VAL F 1 129 ? 0.846   36.867  73.180  1.00 78.70  ? 275 VAL F CA  1 
ATOM   7419 C  C   . VAL F 1 129 ? 0.294   38.266  73.446  1.00 77.36  ? 275 VAL F C   1 
ATOM   7420 O  O   . VAL F 1 129 ? -0.592  38.737  72.730  1.00 77.63  ? 275 VAL F O   1 
ATOM   7421 C  CB  . VAL F 1 129 ? 0.295   35.884  74.231  1.00 80.22  ? 275 VAL F CB  1 
ATOM   7422 C  CG1 . VAL F 1 129 ? -1.223  35.974  74.294  1.00 80.98  ? 275 VAL F CG1 1 
ATOM   7423 C  CG2 . VAL F 1 129 ? 0.741   34.463  73.911  1.00 81.15  ? 275 VAL F CG2 1 
ATOM   7424 N  N   . GLN F 1 130 ? 0.819   38.925  74.476  1.00 74.73  ? 276 GLN F N   1 
ATOM   7425 C  CA  . GLN F 1 130 ? 0.404   40.286  74.797  1.00 73.21  ? 276 GLN F CA  1 
ATOM   7426 C  C   . GLN F 1 130 ? 0.706   41.241  73.650  1.00 69.33  ? 276 GLN F C   1 
ATOM   7427 O  O   . GLN F 1 130 ? -0.159  41.994  73.208  1.00 67.12  ? 276 GLN F O   1 
ATOM   7428 C  CB  . GLN F 1 130 ? 1.113   40.793  76.056  1.00 73.32  ? 276 GLN F CB  1 
ATOM   7429 C  CG  . GLN F 1 130 ? 0.841   42.270  76.343  1.00 72.63  ? 276 GLN F CG  1 
ATOM   7430 C  CD  . GLN F 1 130 ? 1.906   42.920  77.210  1.00 71.32  ? 276 GLN F CD  1 
ATOM   7431 O  OE1 . GLN F 1 130 ? 3.073   43.012  76.822  1.00 70.45  ? 276 GLN F OE1 1 
ATOM   7432 N  NE2 . GLN F 1 130 ? 1.504   43.389  78.386  1.00 70.19  ? 276 GLN F NE2 1 
ATOM   7433 N  N   . SER F 1 131 ? 1.947   41.203  73.177  1.00 68.33  ? 277 SER F N   1 
ATOM   7434 C  CA  . SER F 1 131 ? 2.423   42.161  72.189  1.00 67.36  ? 277 SER F CA  1 
ATOM   7435 C  C   . SER F 1 131 ? 1.675   42.060  70.870  1.00 66.63  ? 277 SER F C   1 
ATOM   7436 O  O   . SER F 1 131 ? 1.684   42.998  70.073  1.00 65.96  ? 277 SER F O   1 
ATOM   7437 C  CB  . SER F 1 131 ? 3.922   41.983  71.955  1.00 68.62  ? 277 SER F CB  1 
ATOM   7438 O  OG  . SER F 1 131 ? 4.657   42.310  73.121  1.00 70.94  ? 277 SER F OG  1 
ATOM   7439 N  N   . ALA F 1 132 ? 1.029   40.922  70.645  1.00 66.42  ? 278 ALA F N   1 
ATOM   7440 C  CA  . ALA F 1 132 ? 0.328   40.681  69.391  1.00 67.25  ? 278 ALA F CA  1 
ATOM   7441 C  C   . ALA F 1 132 ? -0.654  41.801  69.054  1.00 65.27  ? 278 ALA F C   1 
ATOM   7442 O  O   . ALA F 1 132 ? -0.771  42.202  67.898  1.00 66.07  ? 278 ALA F O   1 
ATOM   7443 C  CB  . ALA F 1 132 ? -0.385  39.335  69.427  1.00 69.45  ? 278 ALA F CB  1 
ATOM   7444 N  N   . ARG F 1 133 ? -1.354  42.309  70.062  1.00 63.26  ? 279 ARG F N   1 
ATOM   7445 C  CA  . ARG F 1 133 ? -2.365  43.332  69.824  1.00 65.93  ? 279 ARG F CA  1 
ATOM   7446 C  C   . ARG F 1 133 ? -1.798  44.753  69.866  1.00 60.53  ? 279 ARG F C   1 
ATOM   7447 O  O   . ARG F 1 133 ? -2.552  45.725  69.816  1.00 61.04  ? 279 ARG F O   1 
ATOM   7448 C  CB  . ARG F 1 133 ? -3.521  43.189  70.817  1.00 73.51  ? 279 ARG F CB  1 
ATOM   7449 C  CG  . ARG F 1 133 ? -3.143  43.473  72.257  1.00 77.67  ? 279 ARG F CG  1 
ATOM   7450 C  CD  . ARG F 1 133 ? -4.311  43.233  73.200  1.00 84.30  ? 279 ARG F CD  1 
ATOM   7451 N  NE  . ARG F 1 133 ? -3.948  43.532  74.582  1.00 89.04  ? 279 ARG F NE  1 
ATOM   7452 C  CZ  . ARG F 1 133 ? -3.320  42.683  75.390  1.00 93.77  ? 279 ARG F CZ  1 
ATOM   7453 N  NH1 . ARG F 1 133 ? -3.025  43.040  76.635  1.00 93.64  ? 279 ARG F NH1 1 
ATOM   7454 N  NH2 . ARG F 1 133 ? -2.985  41.476  74.954  1.00 96.88  ? 279 ARG F NH2 1 
ATOM   7455 N  N   . PHE F 1 134 ? -0.474  44.869  69.946  1.00 54.91  ? 280 PHE F N   1 
ATOM   7456 C  CA  . PHE F 1 134 ? 0.178   46.176  70.032  1.00 53.39  ? 280 PHE F CA  1 
ATOM   7457 C  C   . PHE F 1 134 ? 0.824   46.643  68.723  1.00 54.92  ? 280 PHE F C   1 
ATOM   7458 O  O   . PHE F 1 134 ? 1.301   47.777  68.635  1.00 56.55  ? 280 PHE F O   1 
ATOM   7459 C  CB  . PHE F 1 134 ? 1.212   46.204  71.164  1.00 50.34  ? 280 PHE F CB  1 
ATOM   7460 C  CG  . PHE F 1 134 ? 0.609   46.301  72.539  1.00 49.01  ? 280 PHE F CG  1 
ATOM   7461 C  CD1 . PHE F 1 134 ? -0.612  46.924  72.733  1.00 48.02  ? 280 PHE F CD1 1 
ATOM   7462 C  CD2 . PHE F 1 134 ? 1.273   45.785  73.641  1.00 48.61  ? 280 PHE F CD2 1 
ATOM   7463 C  CE1 . PHE F 1 134 ? -1.167  47.017  73.998  1.00 46.34  ? 280 PHE F CE1 1 
ATOM   7464 C  CE2 . PHE F 1 134 ? 0.724   45.878  74.908  1.00 46.20  ? 280 PHE F CE2 1 
ATOM   7465 C  CZ  . PHE F 1 134 ? -0.498  46.493  75.086  1.00 45.25  ? 280 PHE F CZ  1 
ATOM   7466 N  N   . TRP F 1 135 ? 0.844   45.776  67.715  1.00 53.78  ? 281 TRP F N   1 
ATOM   7467 C  CA  . TRP F 1 135 ? 1.371   46.150  66.403  1.00 53.34  ? 281 TRP F CA  1 
ATOM   7468 C  C   . TRP F 1 135 ? 0.291   46.795  65.534  1.00 52.60  ? 281 TRP F C   1 
ATOM   7469 O  O   . TRP F 1 135 ? -0.901  46.584  65.750  1.00 54.85  ? 281 TRP F O   1 
ATOM   7470 C  CB  . TRP F 1 135 ? 1.945   44.927  65.670  1.00 53.17  ? 281 TRP F CB  1 
ATOM   7471 C  CG  . TRP F 1 135 ? 3.198   44.351  66.279  1.00 52.59  ? 281 TRP F CG  1 
ATOM   7472 C  CD1 . TRP F 1 135 ? 3.271   43.374  67.227  1.00 53.78  ? 281 TRP F CD1 1 
ATOM   7473 C  CD2 . TRP F 1 135 ? 4.554   44.709  65.968  1.00 51.46  ? 281 TRP F CD2 1 
ATOM   7474 N  NE1 . TRP F 1 135 ? 4.585   43.104  67.530  1.00 54.42  ? 281 TRP F NE1 1 
ATOM   7475 C  CE2 . TRP F 1 135 ? 5.392   43.911  66.773  1.00 52.50  ? 281 TRP F CE2 1 
ATOM   7476 C  CE3 . TRP F 1 135 ? 5.140   45.629  65.093  1.00 51.25  ? 281 TRP F CE3 1 
ATOM   7477 C  CZ2 . TRP F 1 135 ? 6.782   44.005  66.729  1.00 50.22  ? 281 TRP F CZ2 1 
ATOM   7478 C  CZ3 . TRP F 1 135 ? 6.522   45.720  65.051  1.00 49.27  ? 281 TRP F CZ3 1 
ATOM   7479 C  CH2 . TRP F 1 135 ? 7.326   44.912  65.863  1.00 48.66  ? 281 TRP F CH2 1 
ATOM   7480 N  N   . ILE F 1 136 ? 0.715   47.588  64.555  1.00 49.66  ? 282 ILE F N   1 
ATOM   7481 C  CA  . ILE F 1 136 ? -0.190  48.061  63.518  1.00 49.61  ? 282 ILE F CA  1 
ATOM   7482 C  C   . ILE F 1 136 ? -0.538  46.860  62.645  1.00 53.25  ? 282 ILE F C   1 
ATOM   7483 O  O   . ILE F 1 136 ? 0.356   46.122  62.226  1.00 53.61  ? 282 ILE F O   1 
ATOM   7484 C  CB  . ILE F 1 136 ? 0.464   49.153  62.651  1.00 46.66  ? 282 ILE F CB  1 
ATOM   7485 C  CG1 . ILE F 1 136 ? 0.811   50.380  63.501  1.00 45.85  ? 282 ILE F CG1 1 
ATOM   7486 C  CG2 . ILE F 1 136 ? -0.451  49.541  61.504  1.00 43.50  ? 282 ILE F CG2 1 
ATOM   7487 C  CD1 . ILE F 1 136 ? 1.607   51.435  62.759  1.00 44.79  ? 282 ILE F CD1 1 
ATOM   7488 N  N   . PRO F 1 137 ? -1.837  46.647  62.383  1.00 52.45  ? 283 PRO F N   1 
ATOM   7489 C  CA  . PRO F 1 137 ? -2.278  45.456  61.648  1.00 55.62  ? 283 PRO F CA  1 
ATOM   7490 C  C   . PRO F 1 137 ? -1.420  45.213  60.412  1.00 59.99  ? 283 PRO F C   1 
ATOM   7491 O  O   . PRO F 1 137 ? -1.352  46.074  59.534  1.00 61.38  ? 283 PRO F O   1 
ATOM   7492 C  CB  . PRO F 1 137 ? -3.711  45.810  61.247  1.00 54.73  ? 283 PRO F CB  1 
ATOM   7493 C  CG  . PRO F 1 137 ? -4.174  46.727  62.324  1.00 52.66  ? 283 PRO F CG  1 
ATOM   7494 C  CD  . PRO F 1 137 ? -2.963  47.527  62.739  1.00 50.92  ? 283 PRO F CD  1 
ATOM   7495 N  N   . GLY F 1 138 ? -0.756  44.061  60.362  1.00 61.71  ? 284 GLY F N   1 
ATOM   7496 C  CA  . GLY F 1 138 ? 0.086   43.723  59.230  1.00 65.19  ? 284 GLY F CA  1 
ATOM   7497 C  C   . GLY F 1 138 ? 1.565   43.854  59.535  1.00 65.95  ? 284 GLY F C   1 
ATOM   7498 O  O   . GLY F 1 138 ? 2.412   43.491  58.716  1.00 67.72  ? 284 GLY F O   1 
ATOM   7499 N  N   . GLU F 1 139 ? 1.875   44.380  60.716  1.00 62.88  ? 285 GLU F N   1 
ATOM   7500 C  CA  . GLU F 1 139 ? 3.259   44.502  61.161  1.00 59.79  ? 285 GLU F CA  1 
ATOM   7501 C  C   . GLU F 1 139 ? 3.573   43.394  62.163  1.00 61.14  ? 285 GLU F C   1 
ATOM   7502 O  O   . GLU F 1 139 ? 2.679   42.913  62.860  1.00 62.33  ? 285 GLU F O   1 
ATOM   7503 C  CB  . GLU F 1 139 ? 3.500   45.873  61.800  1.00 56.50  ? 285 GLU F CB  1 
ATOM   7504 C  CG  . GLU F 1 139 ? 3.033   47.052  60.957  1.00 54.41  ? 285 GLU F CG  1 
ATOM   7505 C  CD  . GLU F 1 139 ? 3.820   47.215  59.670  1.00 57.01  ? 285 GLU F CD  1 
ATOM   7506 O  OE1 . GLU F 1 139 ? 5.008   46.825  59.632  1.00 57.01  ? 285 GLU F OE1 1 
ATOM   7507 O  OE2 . GLU F 1 139 ? 3.248   47.747  58.695  1.00 60.27  ? 285 GLU F OE2 1 
ATOM   7508 N  N   . PRO F 1 140 ? 4.846   42.979  62.235  1.00 60.97  ? 286 PRO F N   1 
ATOM   7509 C  CA  . PRO F 1 140 ? 5.940   43.487  61.404  1.00 61.17  ? 286 PRO F CA  1 
ATOM   7510 C  C   . PRO F 1 140 ? 5.862   42.917  59.993  1.00 65.11  ? 286 PRO F C   1 
ATOM   7511 O  O   . PRO F 1 140 ? 5.653   41.713  59.835  1.00 67.56  ? 286 PRO F O   1 
ATOM   7512 C  CB  . PRO F 1 140 ? 7.195   42.948  62.108  1.00 60.17  ? 286 PRO F CB  1 
ATOM   7513 C  CG  . PRO F 1 140 ? 6.732   42.430  63.437  1.00 60.18  ? 286 PRO F CG  1 
ATOM   7514 C  CD  . PRO F 1 140 ? 5.326   41.996  63.217  1.00 60.85  ? 286 PRO F CD  1 
ATOM   7515 N  N   . ASN F 1 141 ? 6.021   43.765  58.984  1.00 64.64  ? 287 ASN F N   1 
ATOM   7516 C  CA  . ASN F 1 141 ? 6.030   43.294  57.603  1.00 65.75  ? 287 ASN F CA  1 
ATOM   7517 C  C   . ASN F 1 141 ? 7.453   43.049  57.111  1.00 62.49  ? 287 ASN F C   1 
ATOM   7518 O  O   . ASN F 1 141 ? 7.662   42.587  55.989  1.00 63.81  ? 287 ASN F O   1 
ATOM   7519 C  CB  . ASN F 1 141 ? 5.298   44.273  56.679  1.00 67.40  ? 287 ASN F CB  1 
ATOM   7520 C  CG  . ASN F 1 141 ? 5.926   45.657  56.669  1.00 66.31  ? 287 ASN F CG  1 
ATOM   7521 O  OD1 . ASN F 1 141 ? 6.807   45.961  57.472  1.00 64.68  ? 287 ASN F OD1 1 
ATOM   7522 N  ND2 . ASN F 1 141 ? 5.465   46.506  55.757  1.00 66.19  ? 287 ASN F ND2 1 
ATOM   7523 N  N   . ASN F 1 142 ? 8.423   43.356  57.968  1.00 56.09  ? 288 ASN F N   1 
ATOM   7524 C  CA  . ASN F 1 142 ? 9.834   43.169  57.653  1.00 53.46  ? 288 ASN F CA  1 
ATOM   7525 C  C   . ASN F 1 142 ? 10.163  43.578  56.225  1.00 54.69  ? 288 ASN F C   1 
ATOM   7526 O  O   . ASN F 1 142 ? 10.813  42.836  55.492  1.00 56.77  ? 288 ASN F O   1 
ATOM   7527 C  CB  . ASN F 1 142 ? 10.261  41.720  57.892  1.00 54.46  ? 288 ASN F CB  1 
ATOM   7528 C  CG  . ASN F 1 142 ? 11.769  41.571  57.990  1.00 59.40  ? 288 ASN F CG  1 
ATOM   7529 O  OD1 . ASN F 1 142 ? 12.487  42.553  58.190  1.00 61.43  ? 288 ASN F OD1 1 
ATOM   7530 N  ND2 . ASN F 1 142 ? 12.257  40.342  57.854  1.00 59.52  ? 288 ASN F ND2 1 
ATOM   7531 N  N   . ALA F 1 143 ? 9.703   44.763  55.837  1.00 53.95  ? 289 ALA F N   1 
ATOM   7532 C  CA  . ALA F 1 143 ? 9.929   45.277  54.492  1.00 55.90  ? 289 ALA F CA  1 
ATOM   7533 C  C   . ALA F 1 143 ? 11.406  45.243  54.116  1.00 57.04  ? 289 ALA F C   1 
ATOM   7534 O  O   . ALA F 1 143 ? 12.264  45.712  54.869  1.00 57.90  ? 289 ALA F O   1 
ATOM   7535 C  CB  . ALA F 1 143 ? 9.379   46.691  54.370  1.00 57.19  ? 289 ALA F CB  1 
ATOM   7536 N  N   . GLY F 1 144 ? 11.693  44.681  52.945  1.00 57.06  ? 290 GLY F N   1 
ATOM   7537 C  CA  . GLY F 1 144 ? 13.053  44.575  52.448  1.00 57.60  ? 290 GLY F CA  1 
ATOM   7538 C  C   . GLY F 1 144 ? 13.901  43.605  53.247  1.00 58.77  ? 290 GLY F C   1 
ATOM   7539 O  O   . GLY F 1 144 ? 15.124  43.573  53.099  1.00 55.69  ? 290 GLY F O   1 
ATOM   7540 N  N   . ASN F 1 145 ? 13.247  42.804  54.085  1.00 62.17  ? 291 ASN F N   1 
ATOM   7541 C  CA  . ASN F 1 145 ? 13.944  41.929  55.024  1.00 63.69  ? 291 ASN F CA  1 
ATOM   7542 C  C   . ASN F 1 145 ? 14.968  42.708  55.837  1.00 58.71  ? 291 ASN F C   1 
ATOM   7543 O  O   . ASN F 1 145 ? 16.066  42.218  56.099  1.00 55.05  ? 291 ASN F O   1 
ATOM   7544 C  CB  . ASN F 1 145 ? 14.628  40.764  54.296  1.00 69.72  ? 291 ASN F CB  1 
ATOM   7545 C  CG  . ASN F 1 145 ? 13.657  39.667  53.899  1.00 76.67  ? 291 ASN F CG  1 
ATOM   7546 O  OD1 . ASN F 1 145 ? 13.710  38.556  54.429  1.00 79.27  ? 291 ASN F OD1 1 
ATOM   7547 N  ND2 . ASN F 1 145 ? 12.765  39.973  52.960  1.00 79.61  ? 291 ASN F ND2 1 
ATOM   7548 N  N   . ASN F 1 146 ? 14.604  43.924  56.235  1.00 58.37  ? 292 ASN F N   1 
ATOM   7549 C  CA  . ASN F 1 146 ? 15.547  44.809  56.909  1.00 56.16  ? 292 ASN F CA  1 
ATOM   7550 C  C   . ASN F 1 146 ? 14.912  45.717  57.961  1.00 53.72  ? 292 ASN F C   1 
ATOM   7551 O  O   . ASN F 1 146 ? 15.398  46.818  58.212  1.00 56.85  ? 292 ASN F O   1 
ATOM   7552 C  CB  . ASN F 1 146 ? 16.298  45.651  55.874  1.00 59.46  ? 292 ASN F CB  1 
ATOM   7553 C  CG  . ASN F 1 146 ? 17.434  46.453  56.483  1.00 63.66  ? 292 ASN F CG  1 
ATOM   7554 O  OD1 . ASN F 1 146 ? 18.037  46.048  57.479  1.00 66.04  ? 292 ASN F OD1 1 
ATOM   7555 N  ND2 . ASN F 1 146 ? 17.732  47.599  55.882  1.00 63.13  ? 292 ASN F ND2 1 
ATOM   7556 N  N   . GLU F 1 147 ? 13.827  45.262  58.577  1.00 48.94  ? 293 GLU F N   1 
ATOM   7557 C  CA  . GLU F 1 147 ? 13.194  46.030  59.643  1.00 44.22  ? 293 GLU F CA  1 
ATOM   7558 C  C   . GLU F 1 147 ? 13.326  45.278  60.960  1.00 46.66  ? 293 GLU F C   1 
ATOM   7559 O  O   . GLU F 1 147 ? 12.472  44.462  61.309  1.00 46.43  ? 293 GLU F O   1 
ATOM   7560 C  CB  . GLU F 1 147 ? 11.727  46.318  59.319  1.00 44.02  ? 293 GLU F CB  1 
ATOM   7561 C  CG  . GLU F 1 147 ? 11.525  47.153  58.056  1.00 44.64  ? 293 GLU F CG  1 
ATOM   7562 C  CD  . GLU F 1 147 ? 10.105  47.682  57.920  1.00 48.16  ? 293 GLU F CD  1 
ATOM   7563 O  OE1 . GLU F 1 147 ? 9.184   47.081  58.514  1.00 45.51  ? 293 GLU F OE1 1 
ATOM   7564 O  OE2 . GLU F 1 147 ? 9.907   48.698  57.217  1.00 50.63  ? 293 GLU F OE2 1 
ATOM   7565 N  N   . HIS F 1 148 ? 14.404  45.562  61.688  1.00 44.64  ? 294 HIS F N   1 
ATOM   7566 C  CA  . HIS F 1 148 ? 14.762  44.773  62.858  1.00 42.36  ? 294 HIS F CA  1 
ATOM   7567 C  C   . HIS F 1 148 ? 14.643  45.544  64.171  1.00 41.96  ? 294 HIS F C   1 
ATOM   7568 O  O   . HIS F 1 148 ? 15.079  45.067  65.217  1.00 41.67  ? 294 HIS F O   1 
ATOM   7569 C  CB  . HIS F 1 148 ? 16.173  44.207  62.701  1.00 43.72  ? 294 HIS F CB  1 
ATOM   7570 C  CG  . HIS F 1 148 ? 16.409  43.530  61.387  1.00 48.82  ? 294 HIS F CG  1 
ATOM   7571 N  ND1 . HIS F 1 148 ? 15.510  42.642  60.837  1.00 52.54  ? 294 HIS F ND1 1 
ATOM   7572 C  CD2 . HIS F 1 148 ? 17.446  43.602  60.519  1.00 51.09  ? 294 HIS F CD2 1 
ATOM   7573 C  CE1 . HIS F 1 148 ? 15.979  42.201  59.683  1.00 52.29  ? 294 HIS F CE1 1 
ATOM   7574 N  NE2 . HIS F 1 148 ? 17.153  42.767  59.467  1.00 51.73  ? 294 HIS F NE2 1 
ATOM   7575 N  N   . CYS F 1 149 ? 14.060  46.736  64.116  1.00 41.59  ? 295 CYS F N   1 
ATOM   7576 C  CA  . CYS F 1 149 ? 13.759  47.485  65.328  1.00 36.96  ? 295 CYS F CA  1 
ATOM   7577 C  C   . CYS F 1 149 ? 12.328  47.996  65.253  1.00 37.38  ? 295 CYS F C   1 
ATOM   7578 O  O   . CYS F 1 149 ? 11.733  48.029  64.173  1.00 37.49  ? 295 CYS F O   1 
ATOM   7579 C  CB  . CYS F 1 149 ? 14.734  48.648  65.509  1.00 39.69  ? 295 CYS F CB  1 
ATOM   7580 S  SG  . CYS F 1 149 ? 16.466  48.162  65.725  1.00 39.92  ? 295 CYS F SG  1 
ATOM   7581 N  N   . GLY F 1 150 ? 11.780  48.396  66.398  1.00 36.63  ? 296 GLY F N   1 
ATOM   7582 C  CA  . GLY F 1 150 ? 10.403  48.856  66.461  1.00 37.24  ? 296 GLY F CA  1 
ATOM   7583 C  C   . GLY F 1 150 ? 10.234  50.254  67.029  1.00 37.50  ? 296 GLY F C   1 
ATOM   7584 O  O   . GLY F 1 150 ? 10.977  50.676  67.917  1.00 38.16  ? 296 GLY F O   1 
ATOM   7585 N  N   . ASN F 1 151 ? 9.248   50.975  66.506  1.00 38.73  ? 297 ASN F N   1 
ATOM   7586 C  CA  . ASN F 1 151 ? 8.928   52.314  66.983  1.00 39.47  ? 297 ASN F CA  1 
ATOM   7587 C  C   . ASN F 1 151 ? 7.426   52.475  67.194  1.00 40.37  ? 297 ASN F C   1 
ATOM   7588 O  O   . ASN F 1 151 ? 6.639   51.608  66.802  1.00 36.63  ? 297 ASN F O   1 
ATOM   7589 C  CB  . ASN F 1 151 ? 9.437   53.373  66.001  1.00 39.90  ? 297 ASN F CB  1 
ATOM   7590 C  CG  . ASN F 1 151 ? 8.835   53.225  64.605  1.00 41.83  ? 297 ASN F CG  1 
ATOM   7591 O  OD1 . ASN F 1 151 ? 7.653   52.906  64.445  1.00 39.41  ? 297 ASN F OD1 1 
ATOM   7592 N  ND2 . ASN F 1 151 ? 9.650   53.471  63.589  1.00 43.61  ? 297 ASN F ND2 1 
ATOM   7593 N  N   . ILE F 1 152 ? 7.028   53.581  67.816  1.00 41.22  ? 298 ILE F N   1 
ATOM   7594 C  CA  . ILE F 1 152 ? 5.611   53.890  67.948  1.00 44.77  ? 298 ILE F CA  1 
ATOM   7595 C  C   . ILE F 1 152 ? 5.174   54.833  66.833  1.00 46.42  ? 298 ILE F C   1 
ATOM   7596 O  O   . ILE F 1 152 ? 5.831   55.840  66.567  1.00 48.25  ? 298 ILE F O   1 
ATOM   7597 C  CB  . ILE F 1 152 ? 5.278   54.491  69.316  1.00 45.82  ? 298 ILE F CB  1 
ATOM   7598 C  CG1 . ILE F 1 152 ? 5.606   53.488  70.419  1.00 44.42  ? 298 ILE F CG1 1 
ATOM   7599 C  CG2 . ILE F 1 152 ? 3.811   54.866  69.384  1.00 48.43  ? 298 ILE F CG2 1 
ATOM   7600 C  CD1 . ILE F 1 152 ? 4.884   53.761  71.716  1.00 44.00  ? 298 ILE F CD1 1 
ATOM   7601 N  N   . LYS F 1 153 ? 4.063   54.496  66.187  1.00 46.31  ? 299 LYS F N   1 
ATOM   7602 C  CA  . LYS F 1 153 ? 3.635   55.192  64.981  1.00 49.10  ? 299 LYS F CA  1 
ATOM   7603 C  C   . LYS F 1 153 ? 2.169   55.603  65.067  1.00 50.14  ? 299 LYS F C   1 
ATOM   7604 O  O   . LYS F 1 153 ? 1.853   56.740  65.407  1.00 53.66  ? 299 LYS F O   1 
ATOM   7605 C  CB  . LYS F 1 153 ? 3.854   54.292  63.766  1.00 50.96  ? 299 LYS F CB  1 
ATOM   7606 C  CG  . LYS F 1 153 ? 3.778   55.001  62.430  1.00 56.17  ? 299 LYS F CG  1 
ATOM   7607 C  CD  . LYS F 1 153 ? 4.104   54.038  61.303  1.00 59.86  ? 299 LYS F CD  1 
ATOM   7608 C  CE  . LYS F 1 153 ? 4.382   54.772  60.005  1.00 60.87  ? 299 LYS F CE  1 
ATOM   7609 N  NZ  . LYS F 1 153 ? 4.933   53.846  58.977  1.00 62.33  ? 299 LYS F NZ  1 
ATOM   7610 N  N   . ALA F 1 154 ? 1.279   54.667  64.758  1.00 49.47  ? 300 ALA F N   1 
ATOM   7611 C  CA  . ALA F 1 154 ? -0.157  54.922  64.784  1.00 49.22  ? 300 ALA F CA  1 
ATOM   7612 C  C   . ALA F 1 154 ? -0.635  55.441  66.144  1.00 51.25  ? 300 ALA F C   1 
ATOM   7613 O  O   . ALA F 1 154 ? -0.119  55.042  67.183  1.00 49.07  ? 300 ALA F O   1 
ATOM   7614 C  CB  . ALA F 1 154 ? -0.914  53.659  64.398  1.00 48.18  ? 300 ALA F CB  1 
ATOM   7615 N  N   . PRO F 1 155 ? -1.630  56.340  66.137  1.00 57.88  ? 301 PRO F N   1 
ATOM   7616 C  CA  . PRO F 1 155 ? -2.192  56.884  67.378  1.00 58.82  ? 301 PRO F CA  1 
ATOM   7617 C  C   . PRO F 1 155 ? -3.275  55.976  67.957  1.00 60.51  ? 301 PRO F C   1 
ATOM   7618 O  O   . PRO F 1 155 ? -4.407  56.415  68.161  1.00 63.55  ? 301 PRO F O   1 
ATOM   7619 C  CB  . PRO F 1 155 ? -2.820  58.214  66.932  1.00 58.61  ? 301 PRO F CB  1 
ATOM   7620 C  CG  . PRO F 1 155 ? -2.416  58.405  65.487  1.00 59.61  ? 301 PRO F CG  1 
ATOM   7621 C  CD  . PRO F 1 155 ? -2.164  57.032  64.955  1.00 59.30  ? 301 PRO F CD  1 
ATOM   7622 N  N   . SER F 1 156 ? -2.935  54.720  68.210  1.00 57.08  ? 302 SER F N   1 
ATOM   7623 C  CA  . SER F 1 156 ? -3.859  53.811  68.871  1.00 57.13  ? 302 SER F CA  1 
ATOM   7624 C  C   . SER F 1 156 ? -3.068  52.725  69.585  1.00 56.18  ? 302 SER F C   1 
ATOM   7625 O  O   . SER F 1 156 ? -1.839  52.704  69.523  1.00 53.68  ? 302 SER F O   1 
ATOM   7626 C  CB  . SER F 1 156 ? -4.831  53.190  67.866  1.00 59.14  ? 302 SER F CB  1 
ATOM   7627 O  OG  . SER F 1 156 ? -4.224  52.128  67.150  1.00 59.84  ? 302 SER F OG  1 
ATOM   7628 N  N   . LEU F 1 157 ? -3.769  51.826  70.266  1.00 57.45  ? 303 LEU F N   1 
ATOM   7629 C  CA  . LEU F 1 157 ? -3.104  50.720  70.942  1.00 54.90  ? 303 LEU F CA  1 
ATOM   7630 C  C   . LEU F 1 157 ? -2.389  49.840  69.925  1.00 57.39  ? 303 LEU F C   1 
ATOM   7631 O  O   . LEU F 1 157 ? -1.461  49.107  70.265  1.00 60.44  ? 303 LEU F O   1 
ATOM   7632 C  CB  . LEU F 1 157 ? -4.095  49.914  71.780  1.00 54.40  ? 303 LEU F CB  1 
ATOM   7633 C  CG  . LEU F 1 157 ? -4.504  50.579  73.099  1.00 55.59  ? 303 LEU F CG  1 
ATOM   7634 C  CD1 . LEU F 1 157 ? -5.725  49.905  73.703  1.00 58.99  ? 303 LEU F CD1 1 
ATOM   7635 C  CD2 . LEU F 1 157 ? -3.347  50.589  74.095  1.00 53.39  ? 303 LEU F CD2 1 
ATOM   7636 N  N   . GLN F 1 158 ? -2.823  49.924  68.674  1.00 57.44  ? 304 GLN F N   1 
ATOM   7637 C  CA  . GLN F 1 158 ? -2.113  49.290  67.575  1.00 58.60  ? 304 GLN F CA  1 
ATOM   7638 C  C   . GLN F 1 158 ? -1.171  50.321  66.984  1.00 55.74  ? 304 GLN F C   1 
ATOM   7639 O  O   . GLN F 1 158 ? -1.449  50.900  65.931  1.00 56.54  ? 304 GLN F O   1 
ATOM   7640 C  CB  . GLN F 1 158 ? -3.090  48.817  66.507  1.00 63.81  ? 304 GLN F CB  1 
ATOM   7641 C  CG  . GLN F 1 158 ? -4.066  47.764  66.977  1.00 68.93  ? 304 GLN F CG  1 
ATOM   7642 C  CD  . GLN F 1 158 ? -5.198  47.571  65.993  1.00 77.03  ? 304 GLN F CD  1 
ATOM   7643 O  OE1 . GLN F 1 158 ? -5.896  48.524  65.641  1.00 79.47  ? 304 GLN F OE1 1 
ATOM   7644 N  NE2 . GLN F 1 158 ? -5.384  46.338  65.537  1.00 79.75  ? 304 GLN F NE2 1 
ATOM   7645 N  N   . ALA F 1 159 ? -0.056  50.547  67.671  1.00 52.12  ? 305 ALA F N   1 
ATOM   7646 C  CA  . ALA F 1 159 ? 0.834   51.655  67.346  1.00 46.94  ? 305 ALA F CA  1 
ATOM   7647 C  C   . ALA F 1 159 ? 2.161   51.220  66.740  1.00 46.97  ? 305 ALA F C   1 
ATOM   7648 O  O   . ALA F 1 159 ? 2.795   51.991  66.029  1.00 51.42  ? 305 ALA F O   1 
ATOM   7649 C  CB  . ALA F 1 159 ? 1.079   52.507  68.584  1.00 43.76  ? 305 ALA F CB  1 
ATOM   7650 N  N   . TRP F 1 160 ? 2.583   49.990  67.011  1.00 46.03  ? 306 TRP F N   1 
ATOM   7651 C  CA  . TRP F 1 160 ? 3.930   49.567  66.635  1.00 46.09  ? 306 TRP F CA  1 
ATOM   7652 C  C   . TRP F 1 160 ? 4.144   49.362  65.144  1.00 47.13  ? 306 TRP F C   1 
ATOM   7653 O  O   . TRP F 1 160 ? 3.268   48.875  64.433  1.00 52.11  ? 306 TRP F O   1 
ATOM   7654 C  CB  . TRP F 1 160 ? 4.341   48.293  67.373  1.00 45.60  ? 306 TRP F CB  1 
ATOM   7655 C  CG  . TRP F 1 160 ? 4.400   48.441  68.851  1.00 42.42  ? 306 TRP F CG  1 
ATOM   7656 C  CD1 . TRP F 1 160 ? 4.292   49.595  69.564  1.00 39.79  ? 306 TRP F CD1 1 
ATOM   7657 C  CD2 . TRP F 1 160 ? 4.583   47.393  69.807  1.00 40.42  ? 306 TRP F CD2 1 
ATOM   7658 N  NE1 . TRP F 1 160 ? 4.387   49.330  70.909  1.00 36.67  ? 306 TRP F NE1 1 
ATOM   7659 C  CE2 . TRP F 1 160 ? 4.571   47.985  71.083  1.00 35.58  ? 306 TRP F CE2 1 
ATOM   7660 C  CE3 . TRP F 1 160 ? 4.751   46.008  69.706  1.00 42.38  ? 306 TRP F CE3 1 
ATOM   7661 C  CZ2 . TRP F 1 160 ? 4.722   47.244  72.250  1.00 37.71  ? 306 TRP F CZ2 1 
ATOM   7662 C  CZ3 . TRP F 1 160 ? 4.902   45.273  70.866  1.00 41.48  ? 306 TRP F CZ3 1 
ATOM   7663 C  CH2 . TRP F 1 160 ? 4.885   45.892  72.122  1.00 39.92  ? 306 TRP F CH2 1 
ATOM   7664 N  N   . ASN F 1 161 ? 5.335   49.735  64.691  1.00 44.19  ? 307 ASN F N   1 
ATOM   7665 C  CA  . ASN F 1 161 ? 5.788   49.450  63.341  1.00 43.62  ? 307 ASN F CA  1 
ATOM   7666 C  C   . ASN F 1 161 ? 7.252   49.050  63.400  1.00 40.66  ? 307 ASN F C   1 
ATOM   7667 O  O   . ASN F 1 161 ? 8.020   49.614  64.182  1.00 38.37  ? 307 ASN F O   1 
ATOM   7668 C  CB  . ASN F 1 161 ? 5.617   50.678  62.442  1.00 44.12  ? 307 ASN F CB  1 
ATOM   7669 C  CG  . ASN F 1 161 ? 6.192   50.470  61.047  1.00 45.64  ? 307 ASN F CG  1 
ATOM   7670 O  OD1 . ASN F 1 161 ? 6.044   49.402  60.448  1.00 45.56  ? 307 ASN F OD1 1 
ATOM   7671 N  ND2 . ASN F 1 161 ? 6.849   51.497  60.523  1.00 46.47  ? 307 ASN F ND2 1 
ATOM   7672 N  N   . ASP F 1 162 ? 7.633   48.064  62.595  1.00 37.27  ? 308 ASP F N   1 
ATOM   7673 C  CA  . ASP F 1 162 ? 9.033   47.693  62.483  1.00 37.56  ? 308 ASP F CA  1 
ATOM   7674 C  C   . ASP F 1 162 ? 9.660   48.489  61.351  1.00 39.84  ? 308 ASP F C   1 
ATOM   7675 O  O   . ASP F 1 162 ? 9.059   48.653  60.287  1.00 40.95  ? 308 ASP F O   1 
ATOM   7676 C  CB  . ASP F 1 162 ? 9.204   46.188  62.257  1.00 40.62  ? 308 ASP F CB  1 
ATOM   7677 C  CG  . ASP F 1 162 ? 8.501   45.693  61.004  1.00 44.85  ? 308 ASP F CG  1 
ATOM   7678 O  OD1 . ASP F 1 162 ? 7.512   46.324  60.574  1.00 42.83  ? 308 ASP F OD1 1 
ATOM   7679 O  OD2 . ASP F 1 162 ? 8.933   44.658  60.455  1.00 49.85  ? 308 ASP F OD2 1 
ATOM   7680 N  N   . ALA F 1 163 ? 10.861  49.000  61.592  1.00 37.14  ? 309 ALA F N   1 
ATOM   7681 C  CA  . ALA F 1 163 ? 11.544  49.832  60.618  1.00 34.10  ? 309 ALA F CA  1 
ATOM   7682 C  C   . ALA F 1 163 ? 13.028  49.537  60.677  1.00 34.48  ? 309 ALA F C   1 
ATOM   7683 O  O   . ALA F 1 163 ? 13.498  48.897  61.619  1.00 32.95  ? 309 ALA F O   1 
ATOM   7684 C  CB  . ALA F 1 163 ? 11.280  51.306  60.911  1.00 32.33  ? 309 ALA F CB  1 
ATOM   7685 N  N   . PRO F 1 164 ? 13.777  49.995  59.667  1.00 37.69  ? 310 PRO F N   1 
ATOM   7686 C  CA  . PRO F 1 164 ? 15.230  49.801  59.677  1.00 36.63  ? 310 PRO F CA  1 
ATOM   7687 C  C   . PRO F 1 164 ? 15.882  50.493  60.874  1.00 34.02  ? 310 PRO F C   1 
ATOM   7688 O  O   . PRO F 1 164 ? 15.675  51.688  61.099  1.00 33.31  ? 310 PRO F O   1 
ATOM   7689 C  CB  . PRO F 1 164 ? 15.680  50.452  58.366  1.00 38.47  ? 310 PRO F CB  1 
ATOM   7690 C  CG  . PRO F 1 164 ? 14.461  50.420  57.487  1.00 42.20  ? 310 PRO F CG  1 
ATOM   7691 C  CD  . PRO F 1 164 ? 13.303  50.612  58.416  1.00 40.78  ? 310 PRO F CD  1 
ATOM   7692 N  N   . CYS F 1 165 ? 16.660  49.728  61.634  1.00 31.39  ? 311 CYS F N   1 
ATOM   7693 C  CA  . CYS F 1 165 ? 17.363  50.231  62.807  1.00 26.84  ? 311 CYS F CA  1 
ATOM   7694 C  C   . CYS F 1 165 ? 18.159  51.484  62.489  1.00 28.35  ? 311 CYS F C   1 
ATOM   7695 O  O   . CYS F 1 165 ? 18.362  52.338  63.349  1.00 26.98  ? 311 CYS F O   1 
ATOM   7696 C  CB  . CYS F 1 165 ? 18.302  49.153  63.355  1.00 30.88  ? 311 CYS F CB  1 
ATOM   7697 S  SG  . CYS F 1 165 ? 17.431  47.709  63.990  1.00 58.61  ? 311 CYS F SG  1 
ATOM   7698 N  N   . ASP F 1 166 ? 18.596  51.594  61.243  1.00 33.67  ? 312 ASP F N   1 
ATOM   7699 C  CA  . ASP F 1 166 ? 19.410  52.723  60.818  1.00 36.13  ? 312 ASP F CA  1 
ATOM   7700 C  C   . ASP F 1 166 ? 18.577  53.943  60.418  1.00 35.68  ? 312 ASP F C   1 
ATOM   7701 O  O   . ASP F 1 166 ? 19.129  54.968  60.019  1.00 36.13  ? 312 ASP F O   1 
ATOM   7702 C  CB  . ASP F 1 166 ? 20.328  52.296  59.675  1.00 40.06  ? 312 ASP F CB  1 
ATOM   7703 C  CG  . ASP F 1 166 ? 21.192  51.109  60.045  1.00 43.63  ? 312 ASP F CG  1 
ATOM   7704 O  OD1 . ASP F 1 166 ? 21.745  51.116  61.162  1.00 41.52  ? 312 ASP F OD1 1 
ATOM   7705 O  OD2 . ASP F 1 166 ? 21.314  50.170  59.229  1.00 47.38  ? 312 ASP F OD2 1 
ATOM   7706 N  N   . LYS F 1 167 ? 17.255  53.831  60.528  1.00 31.31  ? 313 LYS F N   1 
ATOM   7707 C  CA  . LYS F 1 167 ? 16.380  54.976  60.307  1.00 32.43  ? 313 LYS F CA  1 
ATOM   7708 C  C   . LYS F 1 167 ? 16.446  55.893  61.536  1.00 33.79  ? 313 LYS F C   1 
ATOM   7709 O  O   . LYS F 1 167 ? 16.655  55.430  62.658  1.00 35.98  ? 313 LYS F O   1 
ATOM   7710 C  CB  . LYS F 1 167 ? 14.940  54.518  60.041  1.00 36.50  ? 313 LYS F CB  1 
ATOM   7711 C  CG  . LYS F 1 167 ? 14.355  54.955  58.689  1.00 47.49  ? 313 LYS F CG  1 
ATOM   7712 C  CD  . LYS F 1 167 ? 13.657  56.317  58.793  1.00 54.23  ? 313 LYS F CD  1 
ATOM   7713 C  CE  . LYS F 1 167 ? 12.779  56.634  57.575  1.00 56.72  ? 313 LYS F CE  1 
ATOM   7714 N  NZ  . LYS F 1 167 ? 13.557  57.091  56.384  1.00 58.37  ? 313 LYS F NZ  1 
ATOM   7715 N  N   . THR F 1 168 ? 16.290  57.193  61.324  1.00 32.69  ? 314 THR F N   1 
ATOM   7716 C  CA  . THR F 1 168 ? 16.341  58.142  62.427  1.00 32.03  ? 314 THR F CA  1 
ATOM   7717 C  C   . THR F 1 168 ? 14.947  58.595  62.842  1.00 33.70  ? 314 THR F C   1 
ATOM   7718 O  O   . THR F 1 168 ? 14.151  59.036  62.014  1.00 34.87  ? 314 THR F O   1 
ATOM   7719 C  CB  . THR F 1 168 ? 17.201  59.383  62.095  1.00 33.27  ? 314 THR F CB  1 
ATOM   7720 O  OG1 . THR F 1 168 ? 16.616  60.099  61.002  1.00 36.14  ? 314 THR F OG1 1 
ATOM   7721 C  CG2 . THR F 1 168 ? 18.635  58.980  61.746  1.00 29.38  ? 314 THR F CG2 1 
ATOM   7722 N  N   . PHE F 1 169 ? 14.657  58.476  64.132  1.00 31.43  ? 315 PHE F N   1 
ATOM   7723 C  CA  . PHE F 1 169 ? 13.400  58.956  64.679  1.00 29.69  ? 315 PHE F CA  1 
ATOM   7724 C  C   . PHE F 1 169 ? 13.650  59.579  66.044  1.00 30.50  ? 315 PHE F C   1 
ATOM   7725 O  O   . PHE F 1 169 ? 14.700  59.358  66.653  1.00 31.06  ? 315 PHE F O   1 
ATOM   7726 C  CB  . PHE F 1 169 ? 12.400  57.808  64.831  1.00 26.09  ? 315 PHE F CB  1 
ATOM   7727 C  CG  . PHE F 1 169 ? 12.042  57.131  63.543  1.00 28.66  ? 315 PHE F CG  1 
ATOM   7728 C  CD1 . PHE F 1 169 ? 11.208  57.752  62.627  1.00 33.75  ? 315 PHE F CD1 1 
ATOM   7729 C  CD2 . PHE F 1 169 ? 12.517  55.861  63.258  1.00 33.00  ? 315 PHE F CD2 1 
ATOM   7730 C  CE1 . PHE F 1 169 ? 10.864  57.125  61.438  1.00 33.37  ? 315 PHE F CE1 1 
ATOM   7731 C  CE2 . PHE F 1 169 ? 12.180  55.226  62.075  1.00 33.22  ? 315 PHE F CE2 1 
ATOM   7732 C  CZ  . PHE F 1 169 ? 11.350  55.862  61.165  1.00 34.78  ? 315 PHE F CZ  1 
ATOM   7733 N  N   . LEU F 1 170 ? 12.690  60.361  66.526  1.00 27.19  ? 316 LEU F N   1 
ATOM   7734 C  CA  . LEU F 1 170 ? 12.677  60.732  67.928  1.00 26.05  ? 316 LEU F CA  1 
ATOM   7735 C  C   . LEU F 1 170 ? 12.639  59.412  68.702  1.00 30.54  ? 316 LEU F C   1 
ATOM   7736 O  O   . LEU F 1 170 ? 12.324  58.365  68.130  1.00 28.62  ? 316 LEU F O   1 
ATOM   7737 C  CB  . LEU F 1 170 ? 11.453  61.589  68.240  1.00 25.45  ? 316 LEU F CB  1 
ATOM   7738 C  CG  . LEU F 1 170 ? 11.425  62.935  67.513  1.00 28.95  ? 316 LEU F CG  1 
ATOM   7739 C  CD1 . LEU F 1 170 ? 10.132  63.693  67.792  1.00 29.20  ? 316 LEU F CD1 1 
ATOM   7740 C  CD2 . LEU F 1 170 ? 12.635  63.767  67.914  1.00 27.89  ? 316 LEU F CD2 1 
ATOM   7741 N  N   . PHE F 1 171 ? 12.978  59.439  69.985  1.00 30.15  ? 317 PHE F N   1 
ATOM   7742 C  CA  . PHE F 1 171 ? 13.019  58.197  70.750  1.00 28.46  ? 317 PHE F CA  1 
ATOM   7743 C  C   . PHE F 1 171 ? 12.534  58.405  72.168  1.00 30.57  ? 317 PHE F C   1 
ATOM   7744 O  O   . PHE F 1 171 ? 12.545  59.527  72.677  1.00 34.05  ? 317 PHE F O   1 
ATOM   7745 C  CB  . PHE F 1 171 ? 14.428  57.599  70.748  1.00 27.12  ? 317 PHE F CB  1 
ATOM   7746 C  CG  . PHE F 1 171 ? 15.488  58.535  71.265  1.00 29.70  ? 317 PHE F CG  1 
ATOM   7747 C  CD1 . PHE F 1 171 ? 15.807  58.569  72.611  1.00 30.32  ? 317 PHE F CD1 1 
ATOM   7748 C  CD2 . PHE F 1 171 ? 16.166  59.378  70.402  1.00 31.55  ? 317 PHE F CD2 1 
ATOM   7749 C  CE1 . PHE F 1 171 ? 16.784  59.430  73.085  1.00 33.86  ? 317 PHE F CE1 1 
ATOM   7750 C  CE2 . PHE F 1 171 ? 17.142  60.238  70.869  1.00 33.65  ? 317 PHE F CE2 1 
ATOM   7751 C  CZ  . PHE F 1 171 ? 17.450  60.267  72.210  1.00 33.02  ? 317 PHE F CZ  1 
ATOM   7752 N  N   . ILE F 1 172 ? 12.108  57.317  72.802  1.00 28.32  ? 318 ILE F N   1 
ATOM   7753 C  CA  . ILE F 1 172 ? 11.595  57.371  74.166  1.00 26.30  ? 318 ILE F CA  1 
ATOM   7754 C  C   . ILE F 1 172 ? 12.454  56.550  75.122  1.00 28.59  ? 318 ILE F C   1 
ATOM   7755 O  O   . ILE F 1 172 ? 12.543  55.329  74.986  1.00 31.33  ? 318 ILE F O   1 
ATOM   7756 C  CB  . ILE F 1 172 ? 10.143  56.871  74.234  1.00 23.50  ? 318 ILE F CB  1 
ATOM   7757 C  CG1 . ILE F 1 172 ? 9.237   57.760  73.377  1.00 23.55  ? 318 ILE F CG1 1 
ATOM   7758 C  CG2 . ILE F 1 172 ? 9.658   56.856  75.663  1.00 23.17  ? 318 ILE F CG2 1 
ATOM   7759 C  CD1 . ILE F 1 172 ? 7.814   57.238  73.230  1.00 24.08  ? 318 ILE F CD1 1 
ATOM   7760 N  N   . CYS F 1 173 ? 13.096  57.232  76.072  1.00 26.08  ? 319 CYS F N   1 
ATOM   7761 C  CA  . CYS F 1 173 ? 13.851  56.579  77.143  1.00 26.95  ? 319 CYS F CA  1 
ATOM   7762 C  C   . CYS F 1 173 ? 12.934  56.292  78.314  1.00 27.33  ? 319 CYS F C   1 
ATOM   7763 O  O   . CYS F 1 173 ? 11.981  57.028  78.564  1.00 28.38  ? 319 CYS F O   1 
ATOM   7764 C  CB  . CYS F 1 173 ? 14.981  57.475  77.659  1.00 27.51  ? 319 CYS F CB  1 
ATOM   7765 S  SG  . CYS F 1 173 ? 16.270  57.880  76.486  1.00 40.10  ? 319 CYS F SG  1 
ATOM   7766 N  N   . LYS F 1 174 ? 13.243  55.236  79.052  1.00 27.71  ? 320 LYS F N   1 
ATOM   7767 C  CA  . LYS F 1 174 ? 12.492  54.897  80.251  1.00 30.41  ? 320 LYS F CA  1 
ATOM   7768 C  C   . LYS F 1 174 ? 13.439  54.478  81.369  1.00 34.30  ? 320 LYS F C   1 
ATOM   7769 O  O   . LYS F 1 174 ? 14.436  53.803  81.123  1.00 37.70  ? 320 LYS F O   1 
ATOM   7770 C  CB  . LYS F 1 174 ? 11.511  53.774  79.938  1.00 30.23  ? 320 LYS F CB  1 
ATOM   7771 C  CG  . LYS F 1 174 ? 10.919  53.075  81.134  1.00 33.23  ? 320 LYS F CG  1 
ATOM   7772 C  CD  . LYS F 1 174 ? 9.917   52.040  80.648  1.00 37.23  ? 320 LYS F CD  1 
ATOM   7773 C  CE  . LYS F 1 174 ? 9.627   50.975  81.683  1.00 38.23  ? 320 LYS F CE  1 
ATOM   7774 N  NZ  . LYS F 1 174 ? 8.705   49.959  81.106  1.00 40.04  ? 320 LYS F NZ  1 
ATOM   7775 N  N   . ARG F 1 175 ? 13.129  54.902  82.590  1.00 33.83  ? 321 ARG F N   1 
ATOM   7776 C  CA  . ARG F 1 175 ? 13.850  54.456  83.778  1.00 33.35  ? 321 ARG F CA  1 
ATOM   7777 C  C   . ARG F 1 175 ? 12.884  54.400  84.955  1.00 35.18  ? 321 ARG F C   1 
ATOM   7778 O  O   . ARG F 1 175 ? 11.983  55.235  85.068  1.00 36.16  ? 321 ARG F O   1 
ATOM   7779 C  CB  . ARG F 1 175 ? 15.035  55.375  84.095  1.00 34.45  ? 321 ARG F CB  1 
ATOM   7780 C  CG  . ARG F 1 175 ? 14.656  56.810  84.440  1.00 35.22  ? 321 ARG F CG  1 
ATOM   7781 C  CD  . ARG F 1 175 ? 15.879  57.620  84.858  1.00 39.21  ? 321 ARG F CD  1 
ATOM   7782 N  NE  . ARG F 1 175 ? 15.778  58.081  86.240  1.00 47.22  ? 321 ARG F NE  1 
ATOM   7783 C  CZ  . ARG F 1 175 ? 15.697  59.357  86.600  1.00 51.08  ? 321 ARG F CZ  1 
ATOM   7784 N  NH1 . ARG F 1 175 ? 15.719  60.310  85.678  1.00 54.23  ? 321 ARG F NH1 1 
ATOM   7785 N  NH2 . ARG F 1 175 ? 15.603  59.682  87.882  1.00 50.38  ? 321 ARG F NH2 1 
ATOM   7786 N  N   . PRO F 1 176 ? 13.052  53.400  85.827  1.00 36.40  ? 322 PRO F N   1 
ATOM   7787 C  CA  . PRO F 1 176 ? 12.142  53.215  86.962  1.00 35.87  ? 322 PRO F CA  1 
ATOM   7788 C  C   . PRO F 1 176 ? 12.262  54.335  87.988  1.00 32.87  ? 322 PRO F C   1 
ATOM   7789 O  O   . PRO F 1 176 ? 13.344  54.890  88.185  1.00 27.46  ? 322 PRO F O   1 
ATOM   7790 C  CB  . PRO F 1 176 ? 12.616  51.896  87.581  1.00 36.86  ? 322 PRO F CB  1 
ATOM   7791 C  CG  . PRO F 1 176 ? 13.380  51.210  86.496  1.00 38.71  ? 322 PRO F CG  1 
ATOM   7792 C  CD  . PRO F 1 176 ? 14.027  52.304  85.714  1.00 37.92  ? 322 PRO F CD  1 
ATOM   7793 N  N   . TYR F 1 177 ? 11.152  54.667  88.633  1.00 36.82  ? 323 TYR F N   1 
ATOM   7794 C  CA  . TYR F 1 177 ? 11.195  55.572  89.766  1.00 42.76  ? 323 TYR F CA  1 
ATOM   7795 C  C   . TYR F 1 177 ? 11.477  54.793  91.044  1.00 49.77  ? 323 TYR F C   1 
ATOM   7796 O  O   . TYR F 1 177 ? 10.710  53.908  91.425  1.00 53.10  ? 323 TYR F O   1 
ATOM   7797 C  CB  . TYR F 1 177 ? 9.882   56.342  89.905  1.00 42.77  ? 323 TYR F CB  1 
ATOM   7798 C  CG  . TYR F 1 177 ? 9.702   56.969  91.268  1.00 41.06  ? 323 TYR F CG  1 
ATOM   7799 C  CD1 . TYR F 1 177 ? 10.702  57.753  91.832  1.00 38.28  ? 323 TYR F CD1 1 
ATOM   7800 C  CD2 . TYR F 1 177 ? 8.534   56.779  91.991  1.00 41.03  ? 323 TYR F CD2 1 
ATOM   7801 C  CE1 . TYR F 1 177 ? 10.543  58.328  93.079  1.00 37.74  ? 323 TYR F CE1 1 
ATOM   7802 C  CE2 . TYR F 1 177 ? 8.366   57.349  93.237  1.00 42.59  ? 323 TYR F CE2 1 
ATOM   7803 C  CZ  . TYR F 1 177 ? 9.373   58.121  93.777  1.00 40.26  ? 323 TYR F CZ  1 
ATOM   7804 O  OH  . TYR F 1 177 ? 9.202   58.688  95.019  1.00 41.71  ? 323 TYR F OH  1 
ATOM   7805 N  N   . VAL F 1 178 ? 12.590  55.114  91.693  1.00 54.02  ? 324 VAL F N   1 
ATOM   7806 C  CA  . VAL F 1 178 ? 12.899  54.554  93.005  1.00 59.04  ? 324 VAL F CA  1 
ATOM   7807 C  C   . VAL F 1 178 ? 13.132  55.685  94.007  1.00 59.66  ? 324 VAL F C   1 
ATOM   7808 O  O   . VAL F 1 178 ? 13.993  56.543  93.802  1.00 59.40  ? 324 VAL F O   1 
ATOM   7809 C  CB  . VAL F 1 178 ? 14.105  53.586  92.959  1.00 62.13  ? 324 VAL F CB  1 
ATOM   7810 C  CG1 . VAL F 1 178 ? 13.797  52.406  92.046  1.00 62.57  ? 324 VAL F CG1 1 
ATOM   7811 C  CG2 . VAL F 1 178 ? 15.364  54.307  92.503  1.00 61.68  ? 324 VAL F CG2 1 
ATOM   7812 N  N   . PRO F 1 179 ? 12.342  55.697  95.089  1.00 58.37  ? 325 PRO F N   1 
ATOM   7813 C  CA  . PRO F 1 179 ? 12.311  56.790  96.064  1.00 61.62  ? 325 PRO F CA  1 
ATOM   7814 C  C   . PRO F 1 179 ? 13.668  57.071  96.689  1.00 68.08  ? 325 PRO F C   1 
ATOM   7815 O  O   . PRO F 1 179 ? 14.590  56.262  96.579  1.00 67.94  ? 325 PRO F O   1 
ATOM   7816 C  CB  . PRO F 1 179 ? 11.343  56.276  97.128  1.00 62.66  ? 325 PRO F CB  1 
ATOM   7817 C  CG  . PRO F 1 179 ? 10.475  55.312  96.408  1.00 61.19  ? 325 PRO F CG  1 
ATOM   7818 C  CD  . PRO F 1 179 ? 11.367  54.645  95.413  1.00 58.85  ? 325 PRO F CD  1 
ATOM   7819 N  N   . SER F 1 180 ? 13.773  58.224  97.343  1.00 74.34  ? 326 SER F N   1 
ATOM   7820 C  CA  . SER F 1 180 ? 15.007  58.644  97.997  1.00 78.37  ? 326 SER F CA  1 
ATOM   7821 C  C   . SER F 1 180 ? 15.019  58.255  99.475  1.00 79.36  ? 326 SER F C   1 
ATOM   7822 O  O   . SER F 1 180 ? 14.453  57.232  99.865  1.00 79.80  ? 326 SER F O   1 
ATOM   7823 C  CB  . SER F 1 180 ? 15.185  60.155  97.851  1.00 79.75  ? 326 SER F CB  1 
ATOM   7824 O  OG  . SER F 1 180 ? 14.005  60.843  98.234  1.00 80.52  ? 326 SER F OG  1 
HETATM 7825 CA CA  . CA  G 2 .   ? 55.174  77.714  131.745 1.00 41.51  ? 400 CA  A CA  1 
HETATM 7826 CA CA  . CA  H 2 .   ? 16.077  84.451  142.780 1.00 27.30  ? 400 CA  B CA  1 
HETATM 7827 CA CA  . CA  I 2 .   ? 29.275  97.880  105.810 1.00 33.73  ? 400 CA  C CA  1 
HETATM 7828 CA CA  . CA  J 2 .   ? 33.568  78.374  67.559  1.00 43.89  ? 400 CA  D CA  1 
HETATM 7829 CA CA  . CA  K 2 .   ? -4.408  87.350  58.744  1.00 38.71  ? 400 CA  E CA  1 
HETATM 7830 CA CA  . CA  L 2 .   ? 7.021   47.880  58.895  1.00 47.41  ? 400 CA  F CA  1 
HETATM 7831 O  O   . HOH M 3 .   ? 53.535  79.403  132.234 1.00 35.49  ? 1   HOH A O   1 
HETATM 7832 O  O   . HOH M 3 .   ? 55.567  79.542  130.210 1.00 36.30  ? 2   HOH A O   1 
HETATM 7833 O  O   . HOH M 3 .   ? 45.171  62.447  132.688 1.00 17.44  ? 14  HOH A O   1 
HETATM 7834 O  O   . HOH M 3 .   ? 36.947  73.455  122.163 1.00 23.72  ? 18  HOH A O   1 
HETATM 7835 O  O   . HOH M 3 .   ? 35.615  61.209  115.596 1.00 36.64  ? 34  HOH A O   1 
HETATM 7836 O  O   . HOH M 3 .   ? 28.107  70.745  128.422 1.00 30.52  ? 38  HOH A O   1 
HETATM 7837 O  O   . HOH M 3 .   ? 30.787  54.575  127.055 1.00 33.73  ? 46  HOH A O   1 
HETATM 7838 O  O   . HOH M 3 .   ? 44.290  75.255  119.759 1.00 26.23  ? 60  HOH A O   1 
HETATM 7839 O  O   . HOH M 3 .   ? 28.267  56.671  127.620 1.00 33.19  ? 65  HOH A O   1 
HETATM 7840 O  O   . HOH M 3 .   ? 34.804  75.428  125.243 1.00 28.79  ? 66  HOH A O   1 
HETATM 7841 O  O   . HOH M 3 .   ? 41.088  56.526  127.709 1.00 46.48  ? 68  HOH A O   1 
HETATM 7842 O  O   . HOH M 3 .   ? 29.918  61.458  131.513 1.00 30.27  ? 72  HOH A O   1 
HETATM 7843 O  O   . HOH M 3 .   ? 29.871  72.752  136.630 1.00 32.96  ? 73  HOH A O   1 
HETATM 7844 O  O   . HOH M 3 .   ? 27.762  66.401  130.744 1.00 41.26  ? 74  HOH A O   1 
HETATM 7845 O  O   . HOH M 3 .   ? 18.527  60.316  124.607 1.00 33.86  ? 79  HOH A O   1 
HETATM 7846 O  O   . HOH M 3 .   ? 44.516  82.455  143.605 1.00 42.10  ? 100 HOH A O   1 
HETATM 7847 O  O   . HOH M 3 .   ? 53.459  63.506  139.230 1.00 31.15  ? 111 HOH A O   1 
HETATM 7848 O  O   . HOH M 3 .   ? 39.465  58.799  131.828 1.00 34.22  ? 112 HOH A O   1 
HETATM 7849 O  O   . HOH M 3 .   ? 54.600  76.116  119.621 1.00 31.17  ? 117 HOH A O   1 
HETATM 7850 O  O   . HOH M 3 .   ? 37.264  59.079  115.420 1.00 33.80  ? 123 HOH A O   1 
HETATM 7851 O  O   . HOH M 3 .   ? 41.093  58.955  121.280 1.00 29.72  ? 131 HOH A O   1 
HETATM 7852 O  O   . HOH M 3 .   ? 56.946  72.967  136.108 1.00 34.46  ? 329 HOH A O   1 
HETATM 7853 O  O   . HOH M 3 .   ? 31.538  71.883  124.906 1.00 34.80  ? 330 HOH A O   1 
HETATM 7854 O  O   . HOH M 3 .   ? 40.405  69.776  111.398 1.00 40.61  ? 331 HOH A O   1 
HETATM 7855 O  O   . HOH M 3 .   ? 41.940  80.810  126.083 1.00 31.96  ? 332 HOH A O   1 
HETATM 7856 O  O   . HOH M 3 .   ? 32.344  79.418  127.647 1.00 31.96  ? 333 HOH A O   1 
HETATM 7857 O  O   . HOH M 3 .   ? 49.047  79.006  130.104 1.00 44.71  ? 334 HOH A O   1 
HETATM 7858 O  O   . HOH M 3 .   ? 30.157  70.595  120.916 1.00 39.94  ? 335 HOH A O   1 
HETATM 7859 O  O   . HOH M 3 .   ? 25.962  37.099  115.694 1.00 48.84  ? 336 HOH A O   1 
HETATM 7860 O  O   . HOH M 3 .   ? 44.945  76.573  121.805 1.00 35.82  ? 337 HOH A O   1 
HETATM 7861 O  O   . HOH M 3 .   ? 25.806  56.227  124.907 1.00 27.09  ? 338 HOH A O   1 
HETATM 7862 O  O   . HOH M 3 .   ? 49.526  68.283  113.548 1.00 49.37  ? 339 HOH A O   1 
HETATM 7863 O  O   . HOH M 3 .   ? 25.323  39.612  103.515 1.00 47.23  ? 340 HOH A O   1 
HETATM 7864 O  O   . HOH M 3 .   ? 28.952  71.349  125.766 1.00 34.32  ? 341 HOH A O   1 
HETATM 7865 O  O   . HOH M 3 .   ? 49.857  57.983  137.077 1.00 46.80  ? 342 HOH A O   1 
HETATM 7866 O  O   . HOH M 3 .   ? 52.085  71.357  114.548 1.00 50.60  ? 343 HOH A O   1 
HETATM 7867 O  O   . HOH M 3 .   ? 31.251  46.899  125.584 1.00 45.35  ? 344 HOH A O   1 
HETATM 7868 O  O   . HOH M 3 .   ? 36.483  54.698  116.253 1.00 44.53  ? 345 HOH A O   1 
HETATM 7869 O  O   . HOH M 3 .   ? 52.797  60.343  127.895 1.00 40.98  ? 346 HOH A O   1 
HETATM 7870 O  O   . HOH M 3 .   ? 27.822  71.411  135.592 1.00 27.74  ? 347 HOH A O   1 
HETATM 7871 O  O   . HOH M 3 .   ? 33.301  55.487  129.874 1.00 35.72  ? 348 HOH A O   1 
HETATM 7872 O  O   . HOH M 3 .   ? 56.787  74.801  117.542 1.00 50.33  ? 349 HOH A O   1 
HETATM 7873 O  O   . HOH M 3 .   ? 49.391  58.839  116.321 1.00 37.40  ? 350 HOH A O   1 
HETATM 7874 O  O   . HOH M 3 .   ? 27.871  47.358  119.044 1.00 34.80  ? 351 HOH A O   1 
HETATM 7875 O  O   . HOH M 3 .   ? 34.381  73.013  121.490 1.00 28.34  ? 352 HOH A O   1 
HETATM 7876 O  O   . HOH M 3 .   ? 30.799  53.980  114.581 1.00 45.65  ? 353 HOH A O   1 
HETATM 7877 O  O   . HOH M 3 .   ? 61.035  72.118  140.523 1.00 55.49  ? 354 HOH A O   1 
HETATM 7878 O  O   . HOH M 3 .   ? 41.602  62.544  140.602 1.00 45.91  ? 355 HOH A O   1 
HETATM 7879 O  O   . HOH M 3 .   ? 28.244  60.462  136.223 1.00 56.27  ? 356 HOH A O   1 
HETATM 7880 O  O   . HOH M 3 .   ? 28.965  52.070  113.585 1.00 35.93  ? 357 HOH A O   1 
HETATM 7881 O  O   . HOH M 3 .   ? 18.938  35.633  112.783 1.00 41.31  ? 358 HOH A O   1 
HETATM 7882 O  O   . HOH M 3 .   ? 44.210  63.494  114.873 1.00 50.56  ? 359 HOH A O   1 
HETATM 7883 O  O   . HOH M 3 .   ? 54.171  79.120  127.144 1.00 45.16  ? 360 HOH A O   1 
HETATM 7884 O  O   . HOH M 3 .   ? 23.498  38.164  116.795 1.00 51.40  ? 361 HOH A O   1 
HETATM 7885 O  O   . HOH M 3 .   ? 36.391  57.133  135.859 1.00 50.59  ? 362 HOH A O   1 
HETATM 7886 O  O   . HOH M 3 .   ? 45.227  56.122  128.155 1.00 35.66  ? 363 HOH A O   1 
HETATM 7887 O  O   . HOH M 3 .   ? 47.939  73.327  112.501 1.00 47.87  ? 364 HOH A O   1 
HETATM 7888 O  O   . HOH M 3 .   ? 41.525  58.156  130.274 1.00 49.60  ? 365 HOH A O   1 
HETATM 7889 O  O   . HOH M 3 .   ? 32.624  69.455  124.653 1.00 31.48  ? 366 HOH A O   1 
HETATM 7890 O  O   . HOH M 3 .   ? 51.973  58.667  118.109 1.00 53.52  ? 367 HOH A O   1 
HETATM 7891 O  O   . HOH M 3 .   ? 28.171  63.728  131.450 1.00 35.78  ? 368 HOH A O   1 
HETATM 7892 O  O   . HOH M 3 .   ? 61.936  78.244  137.894 1.00 57.41  ? 369 HOH A O   1 
HETATM 7893 O  O   . HOH M 3 .   ? 47.579  54.252  128.236 1.00 41.79  ? 370 HOH A O   1 
HETATM 7894 O  O   . HOH M 3 .   ? 37.493  57.335  132.865 1.00 40.60  ? 371 HOH A O   1 
HETATM 7895 O  O   . HOH M 3 .   ? 42.832  69.409  110.209 1.00 44.16  ? 374 HOH A O   1 
HETATM 7896 O  O   . HOH M 3 .   ? 36.410  59.303  137.419 1.00 53.12  ? 375 HOH A O   1 
HETATM 7897 O  O   . HOH M 3 .   ? 39.401  80.745  127.007 1.00 47.17  ? 377 HOH A O   1 
HETATM 7898 O  O   . HOH M 3 .   ? 40.794  78.985  129.178 1.00 22.15  ? 378 HOH A O   1 
HETATM 7899 O  O   . HOH M 3 .   ? 43.337  82.649  136.341 1.00 39.49  ? 405 HOH A O   1 
HETATM 7900 O  O   . HOH N 3 .   ? 18.128  84.645  144.049 1.00 27.16  ? 3   HOH B O   1 
HETATM 7901 O  O   . HOH N 3 .   ? 17.758  86.061  142.079 1.00 31.35  ? 4   HOH B O   1 
HETATM 7902 O  O   . HOH N 3 .   ? 24.717  75.636  135.358 1.00 20.43  ? 15  HOH B O   1 
HETATM 7903 O  O   . HOH N 3 .   ? 8.526   76.178  127.839 1.00 22.66  ? 17  HOH B O   1 
HETATM 7904 O  O   . HOH N 3 .   ? 13.506  65.149  126.419 1.00 28.06  ? 20  HOH B O   1 
HETATM 7905 O  O   . HOH N 3 .   ? 31.507  73.161  131.432 1.00 25.14  ? 21  HOH B O   1 
HETATM 7906 O  O   . HOH N 3 .   ? 24.503  83.043  130.833 1.00 22.59  ? 27  HOH B O   1 
HETATM 7907 O  O   . HOH N 3 .   ? 26.608  77.726  125.432 1.00 25.26  ? 30  HOH B O   1 
HETATM 7908 O  O   . HOH N 3 .   ? 23.129  73.829  121.439 1.00 23.08  ? 39  HOH B O   1 
HETATM 7909 O  O   . HOH N 3 .   ? 21.580  73.743  144.305 1.00 28.74  ? 40  HOH B O   1 
HETATM 7910 O  O   . HOH N 3 .   ? 25.437  73.134  135.335 1.00 24.23  ? 44  HOH B O   1 
HETATM 7911 O  O   . HOH N 3 .   ? 19.349  62.678  132.669 1.00 32.25  ? 51  HOH B O   1 
HETATM 7912 O  O   . HOH N 3 .   ? 28.823  81.475  124.170 1.00 35.80  ? 58  HOH B O   1 
HETATM 7913 O  O   . HOH N 3 .   ? 16.444  65.799  110.944 1.00 40.53  ? 59  HOH B O   1 
HETATM 7914 O  O   . HOH N 3 .   ? 9.403   84.766  142.447 1.00 34.51  ? 62  HOH B O   1 
HETATM 7915 O  O   . HOH N 3 .   ? 20.418  84.156  137.897 1.00 31.60  ? 67  HOH B O   1 
HETATM 7916 O  O   . HOH N 3 .   ? 14.798  74.577  114.341 1.00 28.85  ? 83  HOH B O   1 
HETATM 7917 O  O   . HOH N 3 .   ? 25.654  74.269  127.178 1.00 29.41  ? 90  HOH B O   1 
HETATM 7918 O  O   . HOH N 3 .   ? 20.117  81.696  143.235 1.00 27.80  ? 92  HOH B O   1 
HETATM 7919 O  O   . HOH N 3 .   ? 7.402   75.697  142.148 1.00 41.85  ? 98  HOH B O   1 
HETATM 7920 O  O   . HOH N 3 .   ? 26.106  78.420  138.759 1.00 40.73  ? 99  HOH B O   1 
HETATM 7921 O  O   . HOH N 3 .   ? 28.444  80.494  135.198 1.00 35.28  ? 102 HOH B O   1 
HETATM 7922 O  O   . HOH N 3 .   ? 26.829  81.942  132.837 1.00 42.82  ? 103 HOH B O   1 
HETATM 7923 O  O   . HOH N 3 .   ? 10.846  90.133  135.560 1.00 45.07  ? 104 HOH B O   1 
HETATM 7924 O  O   . HOH N 3 .   ? 20.927  77.987  148.194 1.00 34.69  ? 105 HOH B O   1 
HETATM 7925 O  O   . HOH N 3 .   ? 22.542  91.134  132.314 1.00 44.84  ? 106 HOH B O   1 
HETATM 7926 O  O   . HOH N 3 .   ? 15.626  87.527  119.619 1.00 38.57  ? 109 HOH B O   1 
HETATM 7927 O  O   . HOH N 3 .   ? 16.705  60.723  107.942 1.00 38.05  ? 115 HOH B O   1 
HETATM 7928 O  O   . HOH N 3 .   ? 25.994  70.041  118.183 1.00 40.34  ? 118 HOH B O   1 
HETATM 7929 O  O   . HOH N 3 .   ? 13.375  68.204  112.417 1.00 39.76  ? 122 HOH B O   1 
HETATM 7930 O  O   . HOH N 3 .   ? 14.397  94.139  139.221 1.00 49.16  ? 125 HOH B O   1 
HETATM 7931 O  O   . HOH N 3 .   ? 7.726   86.125  121.077 1.00 49.02  ? 126 HOH B O   1 
HETATM 7932 O  O   . HOH N 3 .   ? 2.544   87.948  136.319 1.00 50.13  ? 130 HOH B O   1 
HETATM 7933 O  O   . HOH N 3 .   ? 12.617  73.732  112.516 1.00 45.35  ? 134 HOH B O   1 
HETATM 7934 O  O   . HOH N 3 .   ? 26.736  73.357  124.877 1.00 26.91  ? 136 HOH B O   1 
HETATM 7935 O  O   . HOH N 3 .   ? 20.896  61.909  123.824 1.00 42.90  ? 143 HOH B O   1 
HETATM 7936 O  O   . HOH N 3 .   ? 14.027  76.150  149.207 1.00 29.08  ? 329 HOH B O   1 
HETATM 7937 O  O   . HOH N 3 .   ? 2.417   80.658  130.254 1.00 42.87  ? 330 HOH B O   1 
HETATM 7938 O  O   . HOH N 3 .   ? 21.656  64.041  138.457 1.00 64.06  ? 331 HOH B O   1 
HETATM 7939 O  O   . HOH N 3 .   ? 23.446  81.337  119.908 1.00 34.60  ? 332 HOH B O   1 
HETATM 7940 O  O   . HOH N 3 .   ? 20.571  83.968  114.837 1.00 42.69  ? 333 HOH B O   1 
HETATM 7941 O  O   . HOH N 3 .   ? 17.229  90.511  141.366 1.00 37.91  ? 334 HOH B O   1 
HETATM 7942 O  O   . HOH N 3 .   ? 5.850   82.619  122.969 1.00 33.28  ? 335 HOH B O   1 
HETATM 7943 O  O   . HOH N 3 .   ? 4.060   88.606  138.463 1.00 47.19  ? 336 HOH B O   1 
HETATM 7944 O  O   . HOH N 3 .   ? -2.377  85.132  140.970 1.00 53.10  ? 337 HOH B O   1 
HETATM 7945 O  O   . HOH N 3 .   ? 10.093  85.313  116.685 1.00 38.04  ? 338 HOH B O   1 
HETATM 7946 O  O   . HOH N 3 .   ? 26.058  84.887  133.315 1.00 43.23  ? 339 HOH B O   1 
HETATM 7947 O  O   . HOH N 3 .   ? 6.806   82.477  143.326 1.00 41.03  ? 340 HOH B O   1 
HETATM 7948 O  O   . HOH N 3 .   ? 25.336  78.129  141.547 1.00 38.38  ? 341 HOH B O   1 
HETATM 7949 O  O   . HOH N 3 .   ? 28.311  85.287  123.097 1.00 36.49  ? 342 HOH B O   1 
HETATM 7950 O  O   . HOH N 3 .   ? 5.083   68.900  127.249 1.00 61.77  ? 343 HOH B O   1 
HETATM 7951 O  O   . HOH N 3 .   ? 8.749   46.189  114.379 1.00 53.26  ? 344 HOH B O   1 
HETATM 7952 O  O   . HOH N 3 .   ? 15.599  63.849  143.769 1.00 56.11  ? 345 HOH B O   1 
HETATM 7953 O  O   . HOH N 3 .   ? 12.602  91.567  123.552 1.00 55.05  ? 346 HOH B O   1 
HETATM 7954 O  O   . HOH N 3 .   ? 2.014   76.178  132.155 1.00 34.92  ? 347 HOH B O   1 
HETATM 7955 O  O   . HOH N 3 .   ? 2.892   77.905  123.227 1.00 47.83  ? 348 HOH B O   1 
HETATM 7956 O  O   . HOH N 3 .   ? 9.317   80.678  147.515 1.00 49.13  ? 349 HOH B O   1 
HETATM 7957 O  O   . HOH N 3 .   ? 10.443  62.615  136.916 1.00 35.04  ? 350 HOH B O   1 
HETATM 7958 O  O   . HOH N 3 .   ? 8.396   86.920  123.575 1.00 42.95  ? 351 HOH B O   1 
HETATM 7959 O  O   . HOH N 3 .   ? 19.420  77.025  114.565 1.00 27.03  ? 352 HOH B O   1 
HETATM 7960 O  O   . HOH N 3 .   ? 31.248  78.095  123.996 1.00 42.11  ? 353 HOH B O   1 
HETATM 7961 O  O   . HOH N 3 .   ? 25.573  66.221  129.177 1.00 39.18  ? 354 HOH B O   1 
HETATM 7962 O  O   . HOH N 3 .   ? 14.199  72.905  145.677 1.00 43.26  ? 355 HOH B O   1 
HETATM 7963 O  O   . HOH N 3 .   ? 13.700  92.266  126.050 1.00 30.22  ? 356 HOH B O   1 
HETATM 7964 O  O   . HOH N 3 .   ? 22.196  80.916  144.601 1.00 35.28  ? 357 HOH B O   1 
HETATM 7965 O  O   . HOH N 3 .   ? 30.538  81.173  122.409 1.00 44.85  ? 358 HOH B O   1 
HETATM 7966 O  O   . HOH N 3 .   ? 8.411   76.275  145.093 1.00 36.20  ? 359 HOH B O   1 
HETATM 7967 O  O   . HOH N 3 .   ? 9.357   43.789  112.083 1.00 58.65  ? 360 HOH B O   1 
HETATM 7968 O  O   . HOH N 3 .   ? 29.278  79.168  125.264 1.00 33.03  ? 361 HOH B O   1 
HETATM 7969 O  O   . HOH N 3 .   ? 23.174  76.350  144.751 1.00 44.19  ? 362 HOH B O   1 
HETATM 7970 O  O   . HOH N 3 .   ? 10.477  78.231  148.360 1.00 40.92  ? 363 HOH B O   1 
HETATM 7971 O  O   . HOH N 3 .   ? 17.779  93.543  136.033 1.00 49.48  ? 364 HOH B O   1 
HETATM 7972 O  O   . HOH N 3 .   ? 8.611   83.822  145.189 1.00 51.35  ? 365 HOH B O   1 
HETATM 7973 O  O   . HOH N 3 .   ? 8.406   73.058  122.181 1.00 37.05  ? 366 HOH B O   1 
HETATM 7974 O  O   . HOH N 3 .   ? 17.383  93.880  138.978 1.00 41.91  ? 368 HOH B O   1 
HETATM 7975 O  O   . HOH N 3 .   ? 20.124  92.836  130.695 1.00 51.04  ? 387 HOH B O   1 
HETATM 7976 O  O   . HOH N 3 .   ? 17.613  95.596  131.208 1.00 54.42  ? 396 HOH B O   1 
HETATM 7977 O  O   . HOH O 3 .   ? 30.333  98.323  107.875 1.00 31.25  ? 5   HOH C O   1 
HETATM 7978 O  O   . HOH O 3 .   ? 27.769  98.903  107.309 1.00 38.67  ? 6   HOH C O   1 
HETATM 7979 O  O   . HOH O 3 .   ? 22.499  84.803  113.222 1.00 28.25  ? 22  HOH C O   1 
HETATM 7980 O  O   . HOH O 3 .   ? 26.121  72.736  102.197 1.00 29.34  ? 23  HOH C O   1 
HETATM 7981 O  O   . HOH O 3 .   ? 24.540  86.350  113.428 1.00 31.72  ? 29  HOH C O   1 
HETATM 7982 O  O   . HOH O 3 .   ? 38.459  69.335  115.605 1.00 26.69  ? 31  HOH C O   1 
HETATM 7983 O  O   . HOH O 3 .   ? 31.457  80.174  117.790 1.00 19.68  ? 37  HOH C O   1 
HETATM 7984 O  O   . HOH O 3 .   ? 34.212  84.014  93.238  1.00 32.43  ? 41  HOH C O   1 
HETATM 7985 O  O   . HOH O 3 .   ? 46.287  82.085  110.381 1.00 37.29  ? 48  HOH C O   1 
HETATM 7986 O  O   . HOH O 3 .   ? 32.520  87.805  116.281 1.00 24.48  ? 49  HOH C O   1 
HETATM 7987 O  O   . HOH O 3 .   ? 35.679  64.338  103.809 1.00 32.65  ? 53  HOH C O   1 
HETATM 7988 O  O   . HOH O 3 .   ? 18.454  76.399  97.676  1.00 36.58  ? 55  HOH C O   1 
HETATM 7989 O  O   . HOH O 3 .   ? 42.140  74.626  101.482 1.00 39.62  ? 56  HOH C O   1 
HETATM 7990 O  O   . HOH O 3 .   ? 18.824  92.325  107.766 1.00 35.96  ? 63  HOH C O   1 
HETATM 7991 O  O   . HOH O 3 .   ? 38.419  78.188  116.895 1.00 24.81  ? 70  HOH C O   1 
HETATM 7992 O  O   . HOH O 3 .   ? 31.982  97.353  99.815  1.00 38.70  ? 76  HOH C O   1 
HETATM 7993 O  O   . HOH O 3 .   ? 27.644  82.705  94.873  1.00 39.49  ? 80  HOH C O   1 
HETATM 7994 O  O   . HOH O 3 .   ? 29.208  88.549  117.522 1.00 28.99  ? 81  HOH C O   1 
HETATM 7995 O  O   . HOH O 3 .   ? 18.889  78.633  96.194  1.00 29.09  ? 86  HOH C O   1 
HETATM 7996 O  O   . HOH O 3 .   ? 37.036  67.827  102.229 1.00 39.33  ? 93  HOH C O   1 
HETATM 7997 O  O   . HOH O 3 .   ? 43.682  76.067  116.934 1.00 48.10  ? 97  HOH C O   1 
HETATM 7998 O  O   . HOH O 3 .   ? 42.723  90.115  106.652 1.00 27.85  ? 108 HOH C O   1 
HETATM 7999 O  O   . HOH O 3 .   ? 35.053  81.153  99.851  1.00 27.37  ? 110 HOH C O   1 
HETATM 8000 O  O   . HOH O 3 .   ? 32.539  75.663  117.187 1.00 38.49  ? 121 HOH C O   1 
HETATM 8001 O  O   . HOH O 3 .   ? 37.254  73.550  117.722 1.00 32.09  ? 129 HOH C O   1 
HETATM 8002 O  O   . HOH O 3 .   ? 39.280  69.425  108.708 1.00 31.34  ? 133 HOH C O   1 
HETATM 8003 O  O   . HOH O 3 .   ? 21.908  79.515  93.120  1.00 46.95  ? 144 HOH C O   1 
HETATM 8004 O  O   . HOH O 3 .   ? 20.924  82.278  90.566  1.00 31.91  ? 329 HOH C O   1 
HETATM 8005 O  O   . HOH O 3 .   ? 19.586  93.342  100.477 1.00 46.77  ? 330 HOH C O   1 
HETATM 8006 O  O   . HOH O 3 .   ? 47.129  79.476  111.073 1.00 40.34  ? 331 HOH C O   1 
HETATM 8007 O  O   . HOH O 3 .   ? 26.142  96.258  108.678 1.00 40.78  ? 332 HOH C O   1 
HETATM 8008 O  O   . HOH O 3 .   ? 27.237  46.462  101.585 1.00 44.09  ? 333 HOH C O   1 
HETATM 8009 O  O   . HOH O 3 .   ? 17.272  73.138  104.404 1.00 47.98  ? 334 HOH C O   1 
HETATM 8010 O  O   . HOH O 3 .   ? 32.063  74.346  114.702 1.00 25.75  ? 335 HOH C O   1 
HETATM 8011 O  O   . HOH O 3 .   ? 36.098  74.705  100.343 1.00 45.70  ? 336 HOH C O   1 
HETATM 8012 O  O   . HOH O 3 .   ? 23.226  64.710  103.475 1.00 65.49  ? 337 HOH C O   1 
HETATM 8013 O  O   . HOH O 3 .   ? 39.337  71.375  113.806 1.00 35.88  ? 338 HOH C O   1 
HETATM 8014 O  O   . HOH O 3 .   ? 22.799  98.909  106.858 1.00 53.13  ? 339 HOH C O   1 
HETATM 8015 O  O   . HOH O 3 .   ? 27.917  80.189  92.831  1.00 40.07  ? 340 HOH C O   1 
HETATM 8016 O  O   . HOH O 3 .   ? 39.443  96.116  104.016 1.00 33.12  ? 341 HOH C O   1 
HETATM 8017 O  O   . HOH O 3 .   ? 29.407  65.038  99.348  1.00 46.87  ? 342 HOH C O   1 
HETATM 8018 O  O   . HOH O 3 .   ? 37.424  83.618  122.154 1.00 29.23  ? 343 HOH C O   1 
HETATM 8019 O  O   . HOH O 3 .   ? 22.839  89.311  117.011 1.00 47.72  ? 344 HOH C O   1 
HETATM 8020 O  O   . HOH O 3 .   ? 18.589  75.537  105.455 1.00 36.84  ? 345 HOH C O   1 
HETATM 8021 O  O   . HOH O 3 .   ? 22.653  91.104  119.134 1.00 41.33  ? 346 HOH C O   1 
HETATM 8022 O  O   . HOH O 3 .   ? 34.657  60.604  108.942 1.00 46.85  ? 347 HOH C O   1 
HETATM 8023 O  O   . HOH O 3 .   ? 26.033  90.775  95.442  1.00 43.42  ? 348 HOH C O   1 
HETATM 8024 O  O   . HOH O 3 .   ? 15.561  90.768  99.776  1.00 48.41  ? 349 HOH C O   1 
HETATM 8025 O  O   . HOH O 3 .   ? 21.950  68.341  105.417 1.00 37.97  ? 350 HOH C O   1 
HETATM 8026 O  O   . HOH O 3 .   ? 37.975  101.564 107.772 1.00 56.29  ? 351 HOH C O   1 
HETATM 8027 O  O   . HOH O 3 .   ? 29.562  69.783  116.464 1.00 36.92  ? 352 HOH C O   1 
HETATM 8028 O  O   . HOH O 3 .   ? 34.382  73.450  118.283 1.00 50.28  ? 353 HOH C O   1 
HETATM 8029 O  O   . HOH O 3 .   ? 48.383  77.889  106.461 1.00 35.94  ? 354 HOH C O   1 
HETATM 8030 O  O   . HOH O 3 .   ? 41.582  74.501  97.437  1.00 53.22  ? 355 HOH C O   1 
HETATM 8031 O  O   . HOH O 3 .   ? 37.119  107.068 102.307 1.00 38.00  ? 356 HOH C O   1 
HETATM 8032 O  O   . HOH O 3 .   ? 37.027  66.451  104.836 1.00 39.78  ? 357 HOH C O   1 
HETATM 8033 O  O   . HOH O 3 .   ? 28.436  76.900  116.738 1.00 33.67  ? 358 HOH C O   1 
HETATM 8034 O  O   . HOH O 3 .   ? 41.261  67.641  107.817 1.00 43.99  ? 359 HOH C O   1 
HETATM 8035 O  O   . HOH O 3 .   ? 30.851  77.536  117.899 1.00 37.68  ? 360 HOH C O   1 
HETATM 8036 O  O   . HOH O 3 .   ? 30.743  75.466  119.811 1.00 46.95  ? 361 HOH C O   1 
HETATM 8037 O  O   . HOH O 3 .   ? 48.508  78.860  108.695 1.00 49.08  ? 362 HOH C O   1 
HETATM 8038 O  O   . HOH O 3 .   ? 34.645  88.070  91.446  1.00 44.18  ? 363 HOH C O   1 
HETATM 8039 O  O   . HOH O 3 .   ? 40.046  67.370  114.477 1.00 48.43  ? 364 HOH C O   1 
HETATM 8040 O  O   . HOH O 3 .   ? 25.719  83.917  96.339  1.00 42.71  ? 365 HOH C O   1 
HETATM 8041 O  O   . HOH O 3 .   ? 19.686  94.433  109.689 1.00 46.93  ? 369 HOH C O   1 
HETATM 8042 O  O   . HOH O 3 .   ? 36.398  63.838  106.322 1.00 55.84  ? 371 HOH C O   1 
HETATM 8043 O  O   . HOH O 3 .   ? 23.780  56.325  112.352 1.00 36.13  ? 379 HOH C O   1 
HETATM 8044 O  O   . HOH O 3 .   ? 41.052  93.464  94.718  1.00 44.52  ? 380 HOH C O   1 
HETATM 8045 O  O   . HOH O 3 .   ? 40.816  96.579  106.906 1.00 40.00  ? 382 HOH C O   1 
HETATM 8046 O  O   . HOH O 3 .   ? 27.752  79.411  115.649 1.00 34.19  ? 383 HOH C O   1 
HETATM 8047 O  O   . HOH O 3 .   ? 47.913  84.881  110.157 1.00 59.30  ? 385 HOH C O   1 
HETATM 8048 O  O   . HOH O 3 .   ? 14.782  81.719  106.789 1.00 45.74  ? 407 HOH C O   1 
HETATM 8049 O  O   . HOH P 3 .   ? 31.996  78.460  65.694  1.00 46.38  ? 7   HOH D O   1 
HETATM 8050 O  O   . HOH P 3 .   ? 33.517  76.253  66.427  1.00 56.86  ? 8   HOH D O   1 
HETATM 8051 O  O   . HOH P 3 .   ? 24.606  85.100  82.366  1.00 27.77  ? 13  HOH D O   1 
HETATM 8052 O  O   . HOH P 3 .   ? 19.431  76.090  68.156  1.00 21.04  ? 16  HOH D O   1 
HETATM 8053 O  O   . HOH P 3 .   ? 20.956  87.751  62.516  1.00 29.44  ? 25  HOH D O   1 
HETATM 8054 O  O   . HOH P 3 .   ? 23.295  70.230  72.759  1.00 31.84  ? 28  HOH D O   1 
HETATM 8055 O  O   . HOH P 3 .   ? 10.480  80.266  73.366  1.00 24.38  ? 33  HOH D O   1 
HETATM 8056 O  O   . HOH P 3 .   ? 7.319   78.559  76.436  1.00 24.07  ? 35  HOH D O   1 
HETATM 8057 O  O   . HOH P 3 .   ? 13.527  73.642  73.190  1.00 25.33  ? 36  HOH D O   1 
HETATM 8058 O  O   . HOH P 3 .   ? 21.900  83.926  84.658  1.00 28.85  ? 43  HOH D O   1 
HETATM 8059 O  O   . HOH P 3 .   ? 20.601  76.033  89.778  1.00 35.93  ? 45  HOH D O   1 
HETATM 8060 O  O   . HOH P 3 .   ? 27.421  76.719  66.919  1.00 31.92  ? 52  HOH D O   1 
HETATM 8061 O  O   . HOH P 3 .   ? 15.393  69.390  89.644  1.00 31.38  ? 54  HOH D O   1 
HETATM 8062 O  O   . HOH P 3 .   ? 23.790  67.703  87.609  1.00 33.47  ? 64  HOH D O   1 
HETATM 8063 O  O   . HOH P 3 .   ? 25.423  86.892  88.566  1.00 35.35  ? 75  HOH D O   1 
HETATM 8064 O  O   . HOH P 3 .   ? 32.426  73.311  68.088  1.00 26.58  ? 77  HOH D O   1 
HETATM 8065 O  O   . HOH P 3 .   ? 28.036  74.650  65.556  1.00 43.12  ? 78  HOH D O   1 
HETATM 8066 O  O   . HOH P 3 .   ? 28.718  71.037  91.234  1.00 32.14  ? 85  HOH D O   1 
HETATM 8067 O  O   . HOH P 3 .   ? 19.373  85.471  86.430  1.00 38.13  ? 87  HOH D O   1 
HETATM 8068 O  O   . HOH P 3 .   ? 7.393   82.426  79.706  1.00 44.62  ? 91  HOH D O   1 
HETATM 8069 O  O   . HOH P 3 .   ? 16.611  65.273  73.058  1.00 39.21  ? 101 HOH D O   1 
HETATM 8070 O  O   . HOH P 3 .   ? 10.479  82.677  92.267  1.00 34.40  ? 107 HOH D O   1 
HETATM 8071 O  O   . HOH P 3 .   ? 16.951  70.355  91.733  1.00 34.48  ? 114 HOH D O   1 
HETATM 8072 O  O   . HOH P 3 .   ? 9.220   85.548  71.336  1.00 28.98  ? 119 HOH D O   1 
HETATM 8073 O  O   . HOH P 3 .   ? 14.175  93.493  77.298  1.00 38.12  ? 124 HOH D O   1 
HETATM 8074 O  O   . HOH P 3 .   ? 7.685   82.493  90.206  1.00 42.39  ? 128 HOH D O   1 
HETATM 8075 O  O   . HOH P 3 .   ? 11.662  75.179  79.512  1.00 32.10  ? 132 HOH D O   1 
HETATM 8076 O  O   . HOH P 3 .   ? 13.477  84.993  90.503  1.00 34.89  ? 135 HOH D O   1 
HETATM 8077 O  O   . HOH P 3 .   ? 7.523   83.953  82.615  1.00 41.61  ? 139 HOH D O   1 
HETATM 8078 O  O   . HOH P 3 .   ? 5.627   72.365  81.316  1.00 43.22  ? 140 HOH D O   1 
HETATM 8079 O  O   . HOH P 3 .   ? 3.258   62.667  134.421 1.00 43.12  ? 146 HOH D O   1 
HETATM 8080 O  O   . HOH P 3 .   ? 39.135  82.973  71.078  1.00 54.63  ? 329 HOH D O   1 
HETATM 8081 O  O   . HOH P 3 .   ? 15.490  67.662  77.298  1.00 38.09  ? 330 HOH D O   1 
HETATM 8082 O  O   . HOH P 3 .   ? 16.520  90.393  83.916  1.00 42.63  ? 331 HOH D O   1 
HETATM 8083 O  O   . HOH P 3 .   ? 22.981  67.987  74.571  1.00 29.04  ? 332 HOH D O   1 
HETATM 8084 O  O   . HOH P 3 .   ? 24.261  90.922  61.247  1.00 46.18  ? 333 HOH D O   1 
HETATM 8085 O  O   . HOH P 3 .   ? 13.457  89.352  72.194  1.00 42.50  ? 334 HOH D O   1 
HETATM 8086 O  O   . HOH P 3 .   ? 8.662   81.915  85.127  1.00 49.39  ? 335 HOH D O   1 
HETATM 8087 O  O   . HOH P 3 .   ? 29.531  90.789  68.710  1.00 36.70  ? 336 HOH D O   1 
HETATM 8088 O  O   . HOH P 3 .   ? -1.162  78.027  93.322  1.00 44.86  ? 337 HOH D O   1 
HETATM 8089 O  O   . HOH P 3 .   ? 37.998  79.306  79.601  1.00 41.28  ? 338 HOH D O   1 
HETATM 8090 O  O   . HOH P 3 .   ? 23.630  95.124  69.760  1.00 59.44  ? 339 HOH D O   1 
HETATM 8091 O  O   . HOH P 3 .   ? 19.752  91.229  67.296  1.00 37.68  ? 340 HOH D O   1 
HETATM 8092 O  O   . HOH P 3 .   ? 13.307  84.576  65.734  1.00 47.09  ? 341 HOH D O   1 
HETATM 8093 O  O   . HOH P 3 .   ? 4.764   85.264  102.936 1.00 62.45  ? 342 HOH D O   1 
HETATM 8094 O  O   . HOH P 3 .   ? 25.250  68.843  69.088  1.00 35.47  ? 343 HOH D O   1 
HETATM 8095 O  O   . HOH P 3 .   ? 26.623  72.306  65.540  1.00 56.07  ? 344 HOH D O   1 
HETATM 8096 O  O   . HOH P 3 .   ? 17.393  82.681  95.495  1.00 53.01  ? 345 HOH D O   1 
HETATM 8097 O  O   . HOH P 3 .   ? 21.628  93.877  68.618  1.00 52.01  ? 346 HOH D O   1 
HETATM 8098 O  O   . HOH P 3 .   ? 11.545  89.710  74.006  1.00 38.72  ? 347 HOH D O   1 
HETATM 8099 O  O   . HOH P 3 .   ? 16.813  72.094  94.913  1.00 64.69  ? 348 HOH D O   1 
HETATM 8100 O  O   . HOH P 3 .   ? 26.942  84.432  60.937  1.00 45.93  ? 349 HOH D O   1 
HETATM 8101 O  O   . HOH P 3 .   ? 10.244  74.635  76.732  1.00 39.14  ? 350 HOH D O   1 
HETATM 8102 O  O   . HOH P 3 .   ? 40.852  76.879  69.460  1.00 33.17  ? 351 HOH D O   1 
HETATM 8103 O  O   . HOH P 3 .   ? 16.441  79.723  95.976  1.00 45.82  ? 352 HOH D O   1 
HETATM 8104 O  O   . HOH P 3 .   ? 3.206   84.067  101.194 1.00 54.64  ? 353 HOH D O   1 
HETATM 8105 O  O   . HOH P 3 .   ? 0.715   63.638  134.936 1.00 50.04  ? 354 HOH D O   1 
HETATM 8106 O  O   . HOH P 3 .   ? 37.784  86.217  80.757  1.00 51.40  ? 355 HOH D O   1 
HETATM 8107 O  O   . HOH P 3 .   ? 19.002  74.365  95.914  1.00 31.42  ? 356 HOH D O   1 
HETATM 8108 O  O   . HOH P 3 .   ? 20.233  72.775  67.313  1.00 35.67  ? 357 HOH D O   1 
HETATM 8109 O  O   . HOH P 3 .   ? -2.132  63.899  135.037 1.00 43.91  ? 358 HOH D O   1 
HETATM 8110 O  O   . HOH P 3 .   ? 9.771   71.697  70.948  1.00 36.05  ? 359 HOH D O   1 
HETATM 8111 O  O   . HOH P 3 .   ? 13.106  71.304  76.945  1.00 27.74  ? 360 HOH D O   1 
HETATM 8112 O  O   . HOH P 3 .   ? 27.520  88.569  65.002  1.00 47.77  ? 361 HOH D O   1 
HETATM 8113 O  O   . HOH P 3 .   ? 20.710  77.557  94.428  1.00 43.03  ? 362 HOH D O   1 
HETATM 8114 O  O   . HOH P 3 .   ? 7.674   86.809  101.292 1.00 55.22  ? 363 HOH D O   1 
HETATM 8115 O  O   . HOH P 3 .   ? 8.497   72.072  81.939  1.00 34.50  ? 364 HOH D O   1 
HETATM 8116 O  O   . HOH P 3 .   ? 11.830  72.469  74.814  1.00 42.65  ? 365 HOH D O   1 
HETATM 8117 O  O   . HOH P 3 .   ? 16.965  87.332  66.680  1.00 39.20  ? 366 HOH D O   1 
HETATM 8118 O  O   . HOH P 3 .   ? 1.207   73.044  123.230 1.00 67.68  ? 367 HOH D O   1 
HETATM 8119 O  O   . HOH P 3 .   ? 28.732  78.642  65.316  1.00 40.61  ? 368 HOH D O   1 
HETATM 8120 O  O   . HOH P 3 .   ? 0.636   62.372  131.796 1.00 52.10  ? 369 HOH D O   1 
HETATM 8121 O  O   . HOH P 3 .   ? 31.436  75.151  64.932  1.00 55.60  ? 370 HOH D O   1 
HETATM 8122 O  O   . HOH P 3 .   ? 41.115  82.480  85.972  1.00 41.82  ? 371 HOH D O   1 
HETATM 8123 O  O   . HOH P 3 .   ? 23.058  75.415  90.953  1.00 42.88  ? 372 HOH D O   1 
HETATM 8124 O  O   . HOH P 3 .   ? 16.852  94.032  77.249  1.00 36.27  ? 373 HOH D O   1 
HETATM 8125 O  O   . HOH P 3 .   ? 31.206  88.476  83.760  1.00 38.21  ? 374 HOH D O   1 
HETATM 8126 O  O   . HOH P 3 .   ? 15.788  71.244  75.968  1.00 37.56  ? 381 HOH D O   1 
HETATM 8127 O  O   . HOH P 3 .   ? 9.741   84.803  84.541  1.00 42.48  ? 389 HOH D O   1 
HETATM 8128 O  O   . HOH P 3 .   ? 29.296  88.570  67.114  1.00 53.38  ? 392 HOH D O   1 
HETATM 8129 O  O   . HOH P 3 .   ? 6.413   80.569  85.163  1.00 54.00  ? 395 HOH D O   1 
HETATM 8130 O  O   . HOH P 3 .   ? 33.200  68.213  73.435  1.00 58.07  ? 397 HOH D O   1 
HETATM 8131 O  O   . HOH P 3 .   ? 35.926  83.769  70.251  1.00 41.14  ? 398 HOH D O   1 
HETATM 8132 O  O   . HOH P 3 .   ? 36.479  90.705  62.922  1.00 48.47  ? 402 HOH D O   1 
HETATM 8133 O  O   . HOH P 3 .   ? 12.519  72.677  70.697  1.00 27.79  ? 403 HOH D O   1 
HETATM 8134 O  O   . HOH Q 3 .   ? -2.688  86.179  57.570  1.00 53.08  ? 9   HOH E O   1 
HETATM 8135 O  O   . HOH Q 3 .   ? -2.486  88.754  58.405  1.00 32.67  ? 10  HOH E O   1 
HETATM 8136 O  O   . HOH Q 3 .   ? -6.808  79.410  82.822  1.00 28.75  ? 19  HOH E O   1 
HETATM 8137 O  O   . HOH Q 3 .   ? 5.395   73.220  71.075  1.00 32.13  ? 24  HOH E O   1 
HETATM 8138 O  O   . HOH Q 3 .   ? 0.528   77.613  87.015  1.00 35.18  ? 26  HOH E O   1 
HETATM 8139 O  O   . HOH Q 3 .   ? -9.393  72.883  58.962  1.00 36.98  ? 42  HOH E O   1 
HETATM 8140 O  O   . HOH Q 3 .   ? 7.101   84.912  73.328  1.00 22.50  ? 47  HOH E O   1 
HETATM 8141 O  O   . HOH Q 3 .   ? -10.894 86.703  58.770  1.00 35.35  ? 50  HOH E O   1 
HETATM 8142 O  O   . HOH Q 3 .   ? -1.899  79.130  88.086  1.00 31.67  ? 57  HOH E O   1 
HETATM 8143 O  O   . HOH Q 3 .   ? 2.032   70.851  76.284  1.00 21.25  ? 69  HOH E O   1 
HETATM 8144 O  O   . HOH Q 3 .   ? -0.972  85.619  83.411  1.00 44.51  ? 71  HOH E O   1 
HETATM 8145 O  O   . HOH Q 3 .   ? 5.640   79.085  64.593  1.00 34.35  ? 89  HOH E O   1 
HETATM 8146 O  O   . HOH Q 3 .   ? -20.196 83.266  70.474  1.00 46.11  ? 113 HOH E O   1 
HETATM 8147 O  O   . HOH Q 3 .   ? -0.509  83.012  61.118  1.00 34.87  ? 116 HOH E O   1 
HETATM 8148 O  O   . HOH Q 3 .   ? -7.854  82.424  83.374  1.00 58.91  ? 138 HOH E O   1 
HETATM 8149 O  O   . HOH Q 3 .   ? 2.292   89.958  61.445  1.00 43.93  ? 141 HOH E O   1 
HETATM 8150 O  O   . HOH Q 3 .   ? -9.729  79.533  55.629  1.00 40.69  ? 145 HOH E O   1 
HETATM 8151 O  O   . HOH Q 3 .   ? 1.834   83.113  59.977  1.00 50.44  ? 329 HOH E O   1 
HETATM 8152 O  O   . HOH Q 3 .   ? 4.064   83.302  69.278  1.00 25.55  ? 330 HOH E O   1 
HETATM 8153 O  O   . HOH Q 3 .   ? 4.636   76.207  73.838  1.00 33.17  ? 331 HOH E O   1 
HETATM 8154 O  O   . HOH Q 3 .   ? -9.590  75.906  129.575 1.00 64.59  ? 332 HOH E O   1 
HETATM 8155 O  O   . HOH Q 3 .   ? 4.432   69.944  80.889  1.00 46.50  ? 333 HOH E O   1 
HETATM 8156 O  O   . HOH Q 3 .   ? -0.486  88.613  61.180  1.00 41.16  ? 334 HOH E O   1 
HETATM 8157 O  O   . HOH Q 3 .   ? -18.746 81.683  64.012  1.00 54.18  ? 335 HOH E O   1 
HETATM 8158 O  O   . HOH Q 3 .   ? 7.656   70.196  67.639  1.00 43.74  ? 336 HOH E O   1 
HETATM 8159 O  O   . HOH Q 3 .   ? 3.264   76.306  64.100  1.00 28.22  ? 337 HOH E O   1 
HETATM 8160 O  O   . HOH Q 3 .   ? -4.312  62.073  84.895  1.00 52.91  ? 338 HOH E O   1 
HETATM 8161 O  O   . HOH Q 3 .   ? -10.898 82.849  48.617  1.00 54.10  ? 339 HOH E O   1 
HETATM 8162 O  O   . HOH Q 3 .   ? -4.481  64.117  100.251 1.00 51.92  ? 340 HOH E O   1 
HETATM 8163 O  O   . HOH Q 3 .   ? 1.996   66.889  69.735  1.00 40.80  ? 341 HOH E O   1 
HETATM 8164 O  O   . HOH Q 3 .   ? -6.818  64.304  84.645  1.00 38.00  ? 342 HOH E O   1 
HETATM 8165 O  O   . HOH Q 3 .   ? -4.685  62.553  92.797  1.00 53.66  ? 343 HOH E O   1 
HETATM 8166 O  O   . HOH Q 3 .   ? 4.564   70.652  74.701  1.00 57.68  ? 344 HOH E O   1 
HETATM 8167 O  O   . HOH Q 3 .   ? 5.489   85.204  65.596  1.00 43.53  ? 345 HOH E O   1 
HETATM 8168 O  O   . HOH Q 3 .   ? -10.971 73.561  128.311 1.00 60.19  ? 346 HOH E O   1 
HETATM 8169 O  O   . HOH Q 3 .   ? -18.017 87.998  66.738  1.00 55.67  ? 347 HOH E O   1 
HETATM 8170 O  O   . HOH Q 3 .   ? 5.751   74.245  75.318  1.00 29.98  ? 348 HOH E O   1 
HETATM 8171 O  O   . HOH Q 3 .   ? 6.320   72.483  73.617  1.00 33.29  ? 349 HOH E O   1 
HETATM 8172 O  O   . HOH Q 3 .   ? 7.674   72.729  69.820  1.00 36.14  ? 350 HOH E O   1 
HETATM 8173 O  O   . HOH Q 3 .   ? -18.509 81.461  70.629  1.00 41.69  ? 351 HOH E O   1 
HETATM 8174 O  O   . HOH Q 3 .   ? -4.000  78.327  90.750  1.00 40.18  ? 352 HOH E O   1 
HETATM 8175 O  O   . HOH Q 3 .   ? -12.583 75.269  80.453  1.00 48.00  ? 353 HOH E O   1 
HETATM 8176 O  O   . HOH Q 3 .   ? -10.087 71.390  130.073 1.00 67.29  ? 354 HOH E O   1 
HETATM 8177 O  O   . HOH Q 3 .   ? -6.818  64.747  78.438  1.00 45.92  ? 357 HOH E O   1 
HETATM 8178 O  O   . HOH Q 3 .   ? -2.506  60.491  69.143  1.00 48.25  ? 359 HOH E O   1 
HETATM 8179 O  O   . HOH Q 3 .   ? -11.279 73.470  132.300 1.00 54.88  ? 372 HOH E O   1 
HETATM 8180 O  O   . HOH Q 3 .   ? -0.948  81.627  88.580  1.00 56.08  ? 373 HOH E O   1 
HETATM 8181 O  O   . HOH Q 3 .   ? -11.060 75.157  75.374  1.00 49.92  ? 386 HOH E O   1 
HETATM 8182 O  O   . HOH Q 3 .   ? -23.000 86.101  61.346  1.00 76.73  ? 388 HOH E O   1 
HETATM 8183 O  O   . HOH Q 3 .   ? 4.625   84.155  71.867  1.00 38.70  ? 390 HOH E O   1 
HETATM 8184 O  O   . HOH Q 3 .   ? -12.386 77.324  71.640  1.00 47.26  ? 394 HOH E O   1 
HETATM 8185 O  O   . HOH Q 3 .   ? 0.563   94.763  74.948  1.00 65.48  ? 404 HOH E O   1 
HETATM 8186 O  O   . HOH R 3 .   ? 7.786   50.083  58.406  1.00 44.62  ? 11  HOH F O   1 
HETATM 8187 O  O   . HOH R 3 .   ? 5.265   48.929  57.650  1.00 48.05  ? 12  HOH F O   1 
HETATM 8188 O  O   . HOH R 3 .   ? 9.540   65.096  71.254  1.00 32.15  ? 32  HOH F O   1 
HETATM 8189 O  O   . HOH R 3 .   ? 22.131  48.930  75.612  1.00 30.89  ? 61  HOH F O   1 
HETATM 8190 O  O   . HOH R 3 .   ? 22.431  52.302  63.629  1.00 34.79  ? 82  HOH F O   1 
HETATM 8191 O  O   . HOH R 3 .   ? 23.559  49.113  58.109  1.00 35.77  ? 84  HOH F O   1 
HETATM 8192 O  O   . HOH R 3 .   ? 10.553  61.060  64.669  1.00 26.04  ? 88  HOH F O   1 
HETATM 8193 O  O   . HOH R 3 .   ? 14.248  57.379  90.561  1.00 41.75  ? 94  HOH F O   1 
HETATM 8194 O  O   . HOH R 3 .   ? 24.321  58.054  70.992  1.00 36.58  ? 95  HOH F O   1 
HETATM 8195 O  O   . HOH R 3 .   ? 21.724  58.401  64.971  1.00 35.11  ? 96  HOH F O   1 
HETATM 8196 O  O   . HOH R 3 .   ? 6.585   65.721  74.736  1.00 34.22  ? 120 HOH F O   1 
HETATM 8197 O  O   . HOH R 3 .   ? 11.448  50.228  55.781  1.00 44.37  ? 127 HOH F O   1 
HETATM 8198 O  O   . HOH R 3 .   ? 13.293  48.185  76.498  1.00 29.00  ? 137 HOH F O   1 
HETATM 8199 O  O   . HOH R 3 .   ? 17.974  59.887  84.167  1.00 42.18  ? 142 HOH F O   1 
HETATM 8200 O  O   . HOH R 3 .   ? 8.152   67.490  81.749  1.00 38.91  ? 329 HOH F O   1 
HETATM 8201 O  O   . HOH R 3 .   ? 3.590   50.919  59.085  1.00 37.47  ? 330 HOH F O   1 
HETATM 8202 O  O   . HOH R 3 .   ? 11.998  64.405  97.442  1.00 46.32  ? 331 HOH F O   1 
HETATM 8203 O  O   . HOH R 3 .   ? 15.251  51.072  82.138  1.00 39.70  ? 332 HOH F O   1 
HETATM 8204 O  O   . HOH R 3 .   ? 17.882  64.513  80.494  1.00 38.64  ? 333 HOH F O   1 
HETATM 8205 O  O   . HOH R 3 .   ? 10.434  35.329  65.445  1.00 55.29  ? 334 HOH F O   1 
HETATM 8206 O  O   . HOH R 3 .   ? 9.026   65.979  73.664  1.00 30.89  ? 335 HOH F O   1 
HETATM 8207 O  O   . HOH R 3 .   ? 18.687  66.959  90.991  1.00 52.77  ? 336 HOH F O   1 
HETATM 8208 O  O   . HOH R 3 .   ? 22.293  65.350  74.864  1.00 33.00  ? 337 HOH F O   1 
HETATM 8209 O  O   . HOH R 3 .   ? 25.915  58.961  74.148  1.00 50.59  ? 338 HOH F O   1 
HETATM 8210 O  O   . HOH R 3 .   ? 2.060   58.641  67.324  1.00 37.38  ? 339 HOH F O   1 
HETATM 8211 O  O   . HOH R 3 .   ? 0.090   59.545  68.827  1.00 40.52  ? 340 HOH F O   1 
HETATM 8212 O  O   . HOH R 3 .   ? -2.279  45.235  80.214  1.00 50.59  ? 341 HOH F O   1 
HETATM 8213 O  O   . HOH R 3 .   ? 20.879  46.930  57.760  1.00 38.09  ? 342 HOH F O   1 
HETATM 8214 O  O   . HOH R 3 .   ? 25.866  47.586  73.545  1.00 59.08  ? 343 HOH F O   1 
HETATM 8215 O  O   . HOH R 3 .   ? 26.089  56.609  68.635  1.00 27.88  ? 344 HOH F O   1 
HETATM 8216 O  O   . HOH R 3 .   ? 7.762   53.981  60.975  1.00 40.21  ? 345 HOH F O   1 
HETATM 8217 O  O   . HOH R 3 .   ? 15.909  68.260  66.509  1.00 40.10  ? 346 HOH F O   1 
HETATM 8218 O  O   . HOH R 3 .   ? 13.067  49.854  82.106  1.00 41.18  ? 347 HOH F O   1 
HETATM 8219 O  O   . HOH R 3 .   ? 6.023   42.549  76.648  1.00 57.34  ? 348 HOH F O   1 
HETATM 8220 O  O   . HOH R 3 .   ? 24.346  61.045  72.828  1.00 42.71  ? 349 HOH F O   1 
HETATM 8221 O  O   . HOH R 3 .   ? 20.496  51.445  64.934  1.00 31.67  ? 350 HOH F O   1 
HETATM 8222 O  O   . HOH R 3 .   ? 19.044  62.590  83.016  1.00 35.73  ? 351 HOH F O   1 
HETATM 8223 O  O   . HOH R 3 .   ? 17.389  47.267  60.038  1.00 47.09  ? 352 HOH F O   1 
HETATM 8224 O  O   . HOH R 3 .   ? 23.437  53.017  82.295  1.00 53.41  ? 353 HOH F O   1 
HETATM 8225 O  O   . HOH R 3 .   ? 12.416  68.188  77.515  1.00 44.38  ? 354 HOH F O   1 
HETATM 8226 O  O   . HOH R 3 .   ? 10.778  66.354  76.061  1.00 36.10  ? 355 HOH F O   1 
HETATM 8227 O  O   . HOH R 3 .   ? 9.476   63.841  64.290  1.00 34.72  ? 356 HOH F O   1 
HETATM 8228 O  O   . HOH R 3 .   ? 22.671  64.100  71.730  1.00 33.82  ? 357 HOH F O   1 
HETATM 8229 O  O   . HOH R 3 .   ? 15.543  58.566  58.544  1.00 45.55  ? 358 HOH F O   1 
HETATM 8230 O  O   . HOH R 3 .   ? 24.099  64.800  69.643  1.00 41.52  ? 370 HOH F O   1 
HETATM 8231 O  O   . HOH R 3 .   ? 7.430   62.028  63.426  1.00 39.62  ? 376 HOH F O   1 
HETATM 8232 O  O   . HOH R 3 .   ? 9.612   69.627  82.148  1.00 52.37  ? 384 HOH F O   1 
HETATM 8233 O  O   . HOH R 3 .   ? 4.793   52.957  83.842  1.00 37.95  ? 391 HOH F O   1 
HETATM 8234 O  O   . HOH R 3 .   ? 13.329  50.655  78.963  1.00 47.83  ? 393 HOH F O   1 
HETATM 8235 O  O   . HOH R 3 .   ? 4.984   64.575  72.115  1.00 66.87  ? 399 HOH F O   1 
HETATM 8236 O  O   . HOH R 3 .   ? 13.404  40.778  75.874  1.00 56.01  ? 401 HOH F O   1 
HETATM 8237 O  O   . HOH R 3 .   ? 17.287  52.988  85.729  1.00 42.28  ? 406 HOH F O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . SER A 13  ? 0.9512 0.6673 0.7543 0.0564  -0.0762 -0.1382 159 SER A N   
2    C  CA  . SER A 13  ? 1.0298 0.6942 0.7925 0.0542  -0.0691 -0.1399 159 SER A CA  
3    C  C   . SER A 13  ? 1.0687 0.7007 0.8211 0.0366  -0.0485 -0.1399 159 SER A C   
4    O  O   . SER A 13  ? 1.0542 0.6918 0.8054 0.0356  -0.0450 -0.1344 159 SER A O   
5    C  CB  . SER A 13  ? 1.0777 0.7267 0.7984 0.0732  -0.0832 -0.1364 159 SER A CB  
6    O  OG  . SER A 13  ? 1.1489 0.7379 0.8208 0.0717  -0.0768 -0.1368 159 SER A OG  
7    N  N   . ASP A 14  ? 1.0934 0.6911 0.8372 0.0216  -0.0338 -0.1472 160 ASP A N   
8    C  CA  . ASP A 14  ? 1.1206 0.6891 0.8577 0.0003  -0.0108 -0.1508 160 ASP A CA  
9    C  C   . ASP A 14  ? 1.1346 0.6576 0.8182 0.0026  -0.0065 -0.1425 160 ASP A C   
10   O  O   . ASP A 14  ? 1.1371 0.6499 0.8203 -0.0111 0.0091  -0.1422 160 ASP A O   
11   C  CB  . ASP A 14  ? 1.1723 0.7120 0.9080 -0.0187 0.0057  -0.1633 160 ASP A CB  
12   C  CG  . ASP A 14  ? 1.1654 0.7520 0.9608 -0.0235 0.0045  -0.1755 160 ASP A CG  
13   O  OD1 . ASP A 14  ? 1.1314 0.7580 0.9706 -0.0271 0.0056  -0.1794 160 ASP A OD1 
14   O  OD2 . ASP A 14  ? 1.1903 0.7721 0.9873 -0.0224 0.0010  -0.1821 160 ASP A OD2 
15   N  N   . LEU A 15  ? 1.1054 0.6011 0.7435 0.0211  -0.0215 -0.1373 161 LEU A N   
16   C  CA  . LEU A 15  ? 1.0890 0.5390 0.6721 0.0284  -0.0222 -0.1311 161 LEU A CA  
17   C  C   . LEU A 15  ? 0.9921 0.4826 0.5935 0.0406  -0.0317 -0.1247 161 LEU A C   
18   O  O   . LEU A 15  ? 0.9069 0.3770 0.4888 0.0367  -0.0233 -0.1206 161 LEU A O   
19   C  CB  . LEU A 15  ? 1.1304 0.5369 0.6580 0.0473  -0.0386 -0.1312 161 LEU A CB  
20   C  CG  . LEU A 15  ? 1.1812 0.5219 0.6373 0.0566  -0.0412 -0.1277 161 LEU A CG  
21   C  CD1 . LEU A 15  ? 1.2428 0.5228 0.6648 0.0305  -0.0144 -0.1276 161 LEU A CD1 
22   C  CD2 . LEU A 15  ? 1.1899 0.4927 0.5961 0.0787  -0.0623 -0.1308 161 LEU A CD2 
23   N  N   . GLU A 16  ? 0.9634 0.5097 0.6007 0.0540  -0.0481 -0.1244 162 GLU A N   
24   C  CA  . GLU A 16  ? 0.9751 0.5625 0.6312 0.0632  -0.0560 -0.1200 162 GLU A CA  
25   C  C   . GLU A 16  ? 0.9728 0.5852 0.6677 0.0460  -0.0415 -0.1176 162 GLU A C   
26   O  O   . GLU A 16  ? 0.9280 0.5491 0.6222 0.0475  -0.0402 -0.1130 162 GLU A O   
27   C  CB  . GLU A 16  ? 0.9532 0.5900 0.6333 0.0784  -0.0749 -0.1221 162 GLU A CB  
28   C  CG  . GLU A 16  ? 1.0278 0.6489 0.6712 0.0998  -0.0928 -0.1268 162 GLU A CG  
29   C  CD  . GLU A 16  ? 1.0479 0.7154 0.7169 0.1104  -0.1083 -0.1318 162 GLU A CD  
30   O  OE1 . GLU A 16  ? 1.0350 0.7394 0.7454 0.1005  -0.1048 -0.1304 162 GLU A OE1 
31   O  OE2 . GLU A 16  ? 1.0497 0.7151 0.6954 0.1293  -0.1248 -0.1384 162 GLU A OE2 
32   N  N   . LYS A 17  ? 0.9903 0.6146 0.7192 0.0307  -0.0319 -0.1228 163 LYS A N   
33   C  CA  . LYS A 17  ? 0.9745 0.6221 0.7417 0.0157  -0.0201 -0.1244 163 LYS A CA  
34   C  C   . LYS A 17  ? 0.9732 0.5839 0.7172 0.0027  -0.0020 -0.1235 163 LYS A C   
35   O  O   . LYS A 17  ? 0.9627 0.5908 0.7255 -0.0030 0.0036  -0.1214 163 LYS A O   
36   C  CB  . LYS A 17  ? 1.0090 0.6732 0.8154 0.0037  -0.0145 -0.1350 163 LYS A CB  
37   C  CG  . LYS A 17  ? 1.0312 0.7343 0.8652 0.0152  -0.0318 -0.1363 163 LYS A CG  
38   C  CD  . LYS A 17  ? 1.0552 0.7697 0.9252 0.0047  -0.0267 -0.1495 163 LYS A CD  
39   C  CE  . LYS A 17  ? 1.0703 0.8123 0.9577 0.0170  -0.0440 -0.1511 163 LYS A CE  
40   N  NZ  . LYS A 17  ? 1.0789 0.8284 0.9987 0.0085  -0.0397 -0.1661 163 LYS A NZ  
41   N  N   . ALA A 18  ? 0.9834 0.5399 0.6833 -0.0027 0.0072  -0.1253 164 ALA A N   
42   C  CA  . ALA A 18  ? 1.0341 0.5459 0.7015 -0.0163 0.0255  -0.1247 164 ALA A CA  
43   C  C   . ALA A 18  ? 1.0210 0.5245 0.6588 -0.0008 0.0165  -0.1147 164 ALA A C   
44   O  O   . ALA A 18  ? 1.0018 0.5046 0.6427 -0.0088 0.0269  -0.1123 164 ALA A O   
45   C  CB  . ALA A 18  ? 1.1083 0.5556 0.7261 -0.0263 0.0371  -0.1291 164 ALA A CB  
46   N  N   . SER A 19  ? 1.0165 0.5158 0.6275 0.0219  -0.0033 -0.1112 165 SER A N   
47   C  CA  . SER A 19  ? 1.0095 0.5062 0.5950 0.0398  -0.0149 -0.1058 165 SER A CA  
48   C  C   . SER A 19  ? 0.9190 0.4717 0.5502 0.0394  -0.0163 -0.1023 165 SER A C   
49   O  O   . SER A 19  ? 0.9177 0.4630 0.5418 0.0361  -0.0090 -0.0986 165 SER A O   
50   C  CB  . SER A 19  ? 1.0109 0.5085 0.5730 0.0650  -0.0381 -0.1080 165 SER A CB  
51   O  OG  . SER A 19  ? 1.1062 0.5410 0.6140 0.0684  -0.0391 -0.1107 165 SER A OG  
52   N  N   . ALA A 20  ? 0.8514 0.4565 0.5258 0.0424  -0.0257 -0.1035 166 ALA A N   
53   C  CA  . ALA A 20  ? 0.7760 0.4302 0.4897 0.0410  -0.0280 -0.1004 166 ALA A CA  
54   C  C   . ALA A 20  ? 0.7859 0.4376 0.5185 0.0230  -0.0109 -0.0993 166 ALA A C   
55   O  O   . ALA A 20  ? 0.7332 0.3881 0.4626 0.0236  -0.0083 -0.0949 166 ALA A O   
56   C  CB  . ALA A 20  ? 0.7228 0.4205 0.4738 0.0422  -0.0375 -0.1027 166 ALA A CB  
57   N  N   . LEU A 21  ? 0.8175 0.4656 0.5715 0.0072  0.0004  -0.1055 167 LEU A N   
58   C  CA  . LEU A 21  ? 0.8056 0.4549 0.5821 -0.0107 0.0168  -0.1093 167 LEU A CA  
59   C  C   . LEU A 21  ? 0.8588 0.4716 0.6002 -0.0148 0.0285  -0.1050 167 LEU A C   
60   O  O   . LEU A 21  ? 0.8260 0.4534 0.5836 -0.0198 0.0337  -0.1031 167 LEU A O   
61   C  CB  . LEU A 21  ? 0.8045 0.4436 0.5976 -0.0277 0.0300  -0.1215 167 LEU A CB  
62   C  CG  . LEU A 21  ? 0.8114 0.4495 0.6257 -0.0480 0.0493  -0.1303 167 LEU A CG  
63   C  CD1 . LEU A 21  ? 0.7769 0.4638 0.6386 -0.0457 0.0412  -0.1317 167 LEU A CD1 
64   C  CD2 . LEU A 21  ? 0.8529 0.4772 0.6785 -0.0666 0.0651  -0.1464 167 LEU A CD2 
65   N  N   . ASN A 22  ? 0.9439 0.5058 0.6341 -0.0119 0.0316  -0.1039 168 ASN A N   
66   C  CA  . ASN A 22  ? 0.9965 0.5142 0.6441 -0.0149 0.0420  -0.1001 168 ASN A CA  
67   C  C   . ASN A 22  ? 0.9535 0.4876 0.5943 0.0025  0.0295  -0.0923 168 ASN A C   
68   O  O   . ASN A 22  ? 0.9316 0.4647 0.5746 -0.0038 0.0385  -0.0896 168 ASN A O   
69   C  CB  . ASN A 22  ? 1.0979 0.5484 0.6828 -0.0139 0.0456  -0.1010 168 ASN A CB  
70   C  CG  . ASN A 22  ? 1.1994 0.6118 0.7740 -0.0413 0.0710  -0.1089 168 ASN A CG  
71   O  OD1 . ASN A 22  ? 1.2914 0.6378 0.8066 -0.0476 0.0815  -0.1086 168 ASN A OD1 
72   N  ND2 . ASN A 22  ? 1.1682 0.6204 0.7985 -0.0581 0.0810  -0.1181 168 ASN A ND2 
73   N  N   . THR A 23  ? 0.9504 0.5015 0.5843 0.0236  0.0094  -0.0905 169 THR A N   
74   C  CA  . THR A 23  ? 0.9445 0.5164 0.5749 0.0400  -0.0026 -0.0869 169 THR A CA  
75   C  C   . THR A 23  ? 0.8994 0.5194 0.5774 0.0316  0.0011  -0.0839 169 THR A C   
76   O  O   . THR A 23  ? 0.8812 0.5062 0.5553 0.0354  0.0014  -0.0805 169 THR A O   
77   C  CB  . THR A 23  ? 0.9231 0.5165 0.5480 0.0617  -0.0239 -0.0903 169 THR A CB  
78   O  OG1 . THR A 23  ? 0.9753 0.6174 0.6451 0.0576  -0.0287 -0.0914 169 THR A OG1 
79   C  CG2 . THR A 23  ? 0.8719 0.4164 0.4493 0.0718  -0.0303 -0.0943 169 THR A CG2 
80   N  N   . LYS A 24  ? 0.8990 0.5514 0.6195 0.0209  0.0029  -0.0859 170 LYS A N   
81   C  CA  . LYS A 24  ? 0.8770 0.5688 0.6387 0.0134  0.0044  -0.0840 170 LYS A CA  
82   C  C   . LYS A 24  ? 0.8513 0.5283 0.6193 -0.0019 0.0212  -0.0848 170 LYS A C   
83   O  O   . LYS A 24  ? 0.8158 0.5113 0.5984 -0.0030 0.0219  -0.0813 170 LYS A O   
84   C  CB  . LYS A 24  ? 0.8645 0.5888 0.6642 0.0090  -0.0013 -0.0878 170 LYS A CB  
85   C  CG  . LYS A 24  ? 0.9150 0.6668 0.7168 0.0222  -0.0179 -0.0865 170 LYS A CG  
86   C  CD  . LYS A 24  ? 0.9463 0.7226 0.7801 0.0177  -0.0234 -0.0901 170 LYS A CD  
87   C  CE  . LYS A 24  ? 0.9495 0.7510 0.7824 0.0283  -0.0380 -0.0893 170 LYS A CE  
88   N  NZ  . LYS A 24  ? 0.9457 0.7657 0.8046 0.0248  -0.0442 -0.0925 170 LYS A NZ  
89   N  N   . ILE A 25  ? 0.8303 0.4741 0.5871 -0.0151 0.0358  -0.0905 171 ILE A N   
90   C  CA  . ILE A 25  ? 0.8137 0.4420 0.5742 -0.0321 0.0543  -0.0941 171 ILE A CA  
91   C  C   . ILE A 25  ? 0.7978 0.3945 0.5178 -0.0270 0.0584  -0.0871 171 ILE A C   
92   O  O   . ILE A 25  ? 0.7683 0.3731 0.5006 -0.0335 0.0658  -0.0860 171 ILE A O   
93   C  CB  . ILE A 25  ? 0.8340 0.4341 0.5909 -0.0510 0.0718  -0.1052 171 ILE A CB  
94   C  CG1 . ILE A 25  ? 0.8574 0.4985 0.6694 -0.0596 0.0709  -0.1166 171 ILE A CG1 
95   C  CG2 . ILE A 25  ? 0.8227 0.3897 0.5608 -0.0684 0.0936  -0.1087 171 ILE A CG2 
96   C  CD1 . ILE A 25  ? 0.9014 0.5231 0.7181 -0.0798 0.0891  -0.1319 171 ILE A CD1 
97   N  N   . ARG A 26  ? 0.8329 0.3926 0.5039 -0.0137 0.0519  -0.0834 172 ARG A N   
98   C  CA  . ARG A 26  ? 0.9045 0.4332 0.5335 -0.0035 0.0510  -0.0780 172 ARG A CA  
99   C  C   . ARG A 26  ? 0.8730 0.4476 0.5290 0.0079  0.0396  -0.0734 172 ARG A C   
100  O  O   . ARG A 26  ? 0.8860 0.4537 0.5337 0.0079  0.0445  -0.0703 172 ARG A O   
101  C  CB  . ARG A 26  ? 1.0167 0.5030 0.5905 0.0146  0.0392  -0.0776 172 ARG A CB  
102  C  CG  . ARG A 26  ? 1.1984 0.6177 0.7233 0.0031  0.0526  -0.0805 172 ARG A CG  
103  C  CD  . ARG A 26  ? 1.3390 0.7214 0.8147 0.0231  0.0362  -0.0816 172 ARG A CD  
104  N  NE  . ARG A 26  ? 1.3878 0.7977 0.8905 0.0242  0.0283  -0.0853 172 ARG A NE  
105  C  CZ  . ARG A 26  ? 1.4808 0.8676 0.9508 0.0403  0.0134  -0.0879 172 ARG A CZ  
106  N  NH1 . ARG A 26  ? 1.5670 0.9008 0.9742 0.0582  0.0031  -0.0882 172 ARG A NH1 
107  N  NH2 . ARG A 26  ? 1.4674 0.8825 0.9658 0.0400  0.0074  -0.0913 172 ARG A NH2 
108  N  N   . ALA A 27  ? 0.8504 0.4703 0.5373 0.0163  0.0253  -0.0736 173 ALA A N   
109  C  CA  . ALA A 27  ? 0.8260 0.4883 0.5357 0.0248  0.0154  -0.0706 173 ALA A CA  
110  C  C   . ALA A 27  ? 0.8373 0.5205 0.5810 0.0105  0.0251  -0.0685 173 ALA A C   
111  O  O   . ALA A 27  ? 0.8581 0.5465 0.5998 0.0135  0.0259  -0.0650 173 ALA A O   
112  C  CB  . ALA A 27  ? 0.7834 0.4848 0.5151 0.0322  0.0011  -0.0724 173 ALA A CB  
113  N  N   . LEU A 28  ? 0.7928 0.4883 0.5681 -0.0037 0.0311  -0.0723 174 LEU A N   
114  C  CA  . LEU A 28  ? 0.7566 0.4708 0.5652 -0.0162 0.0386  -0.0740 174 LEU A CA  
115  C  C   . LEU A 28  ? 0.7636 0.4490 0.5537 -0.0238 0.0536  -0.0736 174 LEU A C   
116  O  O   . LEU A 28  ? 0.7429 0.4440 0.5487 -0.0260 0.0554  -0.0715 174 LEU A O   
117  C  CB  . LEU A 28  ? 0.7603 0.4864 0.6021 -0.0286 0.0425  -0.0833 174 LEU A CB  
118  C  CG  . LEU A 28  ? 0.7557 0.5152 0.6235 -0.0226 0.0269  -0.0841 174 LEU A CG  
119  C  CD1 . LEU A 28  ? 0.7633 0.5324 0.6639 -0.0332 0.0300  -0.0963 174 LEU A CD1 
120  C  CD2 . LEU A 28  ? 0.7114 0.4995 0.5932 -0.0171 0.0164  -0.0779 174 LEU A CD2 
121  N  N   . GLN A 29  ? 0.7688 0.4089 0.5224 -0.0284 0.0647  -0.0759 175 GLN A N   
122  C  CA  . GLN A 29  ? 0.8553 0.4594 0.5812 -0.0362 0.0800  -0.0754 175 GLN A CA  
123  C  C   . GLN A 29  ? 0.8172 0.4193 0.5211 -0.0197 0.0710  -0.0671 175 GLN A C   
124  O  O   . GLN A 29  ? 0.8020 0.4060 0.5108 -0.0242 0.0779  -0.0653 175 GLN A O   
125  C  CB  . GLN A 29  ? 0.9921 0.5380 0.6704 -0.0438 0.0925  -0.0787 175 GLN A CB  
126  C  CG  . GLN A 29  ? 1.0928 0.6359 0.7917 -0.0662 0.1086  -0.0905 175 GLN A CG  
127  C  CD  . GLN A 29  ? 1.2434 0.7218 0.8883 -0.0777 0.1246  -0.0940 175 GLN A CD  
128  O  OE1 . GLN A 29  ? 1.3169 0.7700 0.9531 -0.0997 0.1470  -0.1017 175 GLN A OE1 
129  N  NE2 . GLN A 29  ? 1.2935 0.7424 0.8990 -0.0636 0.1134  -0.0895 175 GLN A NE2 
130  N  N   . GLY A 30  ? 0.7938 0.3944 0.4754 -0.0003 0.0552  -0.0641 176 GLY A N   
131  C  CA  . GLY A 30  ? 0.7713 0.3764 0.4363 0.0172  0.0448  -0.0604 176 GLY A CA  
132  C  C   . GLY A 30  ? 0.7298 0.3835 0.4369 0.0153  0.0418  -0.0576 176 GLY A C   
133  O  O   . GLY A 30  ? 0.7183 0.3696 0.4199 0.0175  0.0447  -0.0550 176 GLY A O   
134  N  N   . SER A 31  ? 0.6930 0.3873 0.4388 0.0112  0.0355  -0.0583 177 SER A N   
135  C  CA  . SER A 31  ? 0.6787 0.4137 0.4592 0.0087  0.0313  -0.0558 177 SER A CA  
136  C  C   . SER A 31  ? 0.6855 0.4203 0.4860 -0.0053 0.0431  -0.0556 177 SER A C   
137  O  O   . SER A 31  ? 0.6658 0.4141 0.4741 -0.0039 0.0426  -0.0524 177 SER A O   
138  C  CB  . SER A 31  ? 0.6528 0.4207 0.4616 0.0067  0.0217  -0.0570 177 SER A CB  
139  O  OG  . SER A 31  ? 0.6792 0.4553 0.4733 0.0193  0.0106  -0.0583 177 SER A OG  
140  N  N   . LEU A 32  ? 0.7105 0.4325 0.5211 -0.0192 0.0539  -0.0613 178 LEU A N   
141  C  CA  . LEU A 32  ? 0.7545 0.4802 0.5881 -0.0333 0.0655  -0.0657 178 LEU A CA  
142  C  C   . LEU A 32  ? 0.7935 0.4948 0.6016 -0.0332 0.0752  -0.0621 178 LEU A C   
143  O  O   . LEU A 32  ? 0.7674 0.4831 0.5952 -0.0383 0.0788  -0.0624 178 LEU A O   
144  C  CB  . LEU A 32  ? 0.7960 0.5095 0.6407 -0.0491 0.0779  -0.0769 178 LEU A CB  
145  C  CG  . LEU A 32  ? 0.8439 0.5932 0.7373 -0.0560 0.0728  -0.0864 178 LEU A CG  
146  C  CD1 . LEU A 32  ? 0.8578 0.6337 0.7628 -0.0435 0.0530  -0.0808 178 LEU A CD1 
147  C  CD2 . LEU A 32  ? 0.8837 0.6234 0.7886 -0.0706 0.0850  -0.1010 178 LEU A CD2 
148  N  N   . GLU A 33  ? 0.8359 0.4975 0.5977 -0.0262 0.0782  -0.0594 179 GLU A N   
149  C  CA  . GLU A 33  ? 0.8933 0.5229 0.6215 -0.0238 0.0861  -0.0563 179 GLU A CA  
150  C  C   . GLU A 33  ? 0.7867 0.4385 0.5159 -0.0069 0.0730  -0.0503 179 GLU A C   
151  O  O   . GLU A 33  ? 0.7376 0.3874 0.4653 -0.0075 0.0779  -0.0481 179 GLU A O   
152  C  CB  . GLU A 33  ? 1.0303 0.6018 0.7007 -0.0201 0.0912  -0.0565 179 GLU A CB  
153  C  CG  . GLU A 33  ? 1.1375 0.6806 0.8013 -0.0406 0.1083  -0.0638 179 GLU A CG  
154  C  CD  . GLU A 33  ? 1.2689 0.7497 0.8696 -0.0363 0.1109  -0.0634 179 GLU A CD  
155  O  OE1 . GLU A 33  ? 1.3347 0.7901 0.8939 -0.0162 0.0994  -0.0583 179 GLU A OE1 
156  O  OE2 . GLU A 33  ? 1.2982 0.7539 0.8893 -0.0525 0.1238  -0.0696 179 GLU A OE2 
157  N  N   . ASN A 34  ? 0.7450 0.4195 0.4775 0.0070  0.0572  -0.0493 180 ASN A N   
158  C  CA  . ASN A 34  ? 0.7500 0.4528 0.4890 0.0203  0.0457  -0.0471 180 ASN A CA  
159  C  C   . ASN A 34  ? 0.7029 0.4426 0.4829 0.0107  0.0467  -0.0446 180 ASN A C   
160  O  O   . ASN A 34  ? 0.7687 0.5182 0.5508 0.0150  0.0458  -0.0424 180 ASN A O   
161  C  CB  . ASN A 34  ? 0.7853 0.5093 0.5240 0.0327  0.0310  -0.0500 180 ASN A CB  
162  C  CG  . ASN A 34  ? 0.8350 0.5943 0.5852 0.0424  0.0215  -0.0514 180 ASN A CG  
163  O  OD1 . ASN A 34  ? 0.8639 0.6151 0.5960 0.0536  0.0198  -0.0532 180 ASN A OD1 
164  N  ND2 . ASN A 34  ? 0.8030 0.6000 0.5812 0.0375  0.0156  -0.0517 180 ASN A ND2 
165  N  N   . MET A 35  ? 0.6162 0.3741 0.4271 -0.0011 0.0471  -0.0461 181 MET A N   
166  C  CA  . MET A 35  ? 0.5982 0.3858 0.4446 -0.0089 0.0450  -0.0452 181 MET A CA  
167  C  C   . MET A 35  ? 0.6020 0.3802 0.4537 -0.0164 0.0561  -0.0457 181 MET A C   
168  O  O   . MET A 35  ? 0.6157 0.4122 0.4821 -0.0159 0.0531  -0.0430 181 MET A O   
169  C  CB  . MET A 35  ? 0.5999 0.4007 0.4733 -0.0179 0.0420  -0.0498 181 MET A CB  
170  C  CG  . MET A 35  ? 0.5934 0.4217 0.4974 -0.0220 0.0340  -0.0498 181 MET A CG  
171  S  SD  . MET A 35  ? 1.2094 1.0589 1.1161 -0.0171 0.0179  -0.0471 181 MET A SD  
172  C  CE  . MET A 35  ? 0.8306 0.6786 0.7066 -0.0055 0.0169  -0.0433 181 MET A CE  
173  N  N   . SER A 36  ? 0.5923 0.3407 0.4306 -0.0247 0.0698  -0.0500 182 SER A N   
174  C  CA  . SER A 36  ? 0.6565 0.3928 0.4965 -0.0343 0.0832  -0.0525 182 SER A CA  
175  C  C   . SER A 36  ? 0.6600 0.3883 0.4775 -0.0230 0.0816  -0.0456 182 SER A C   
176  O  O   . SER A 36  ? 0.5958 0.3364 0.4290 -0.0260 0.0842  -0.0449 182 SER A O   
177  C  CB  . SER A 36  ? 0.7293 0.4272 0.5469 -0.0466 0.1005  -0.0591 182 SER A CB  
178  O  OG  . SER A 36  ? 0.8041 0.4909 0.6239 -0.0593 0.1160  -0.0639 182 SER A OG  
179  N  N   . LYS A 37  ? 0.7000 0.4084 0.4813 -0.0086 0.0760  -0.0424 183 LYS A N   
180  C  CA  . LYS A 37  ? 0.6790 0.3806 0.4373 0.0062  0.0713  -0.0389 183 LYS A CA  
181  C  C   . LYS A 37  ? 0.6189 0.3649 0.4085 0.0106  0.0611  -0.0365 183 LYS A C   
182  O  O   . LYS A 37  ? 0.6481 0.3984 0.4393 0.0134  0.0626  -0.0346 183 LYS A O   
183  C  CB  . LYS A 37  ? 0.7576 0.4364 0.4768 0.0233  0.0624  -0.0403 183 LYS A CB  
184  C  CG  . LYS A 37  ? 0.8465 0.5092 0.5339 0.0419  0.0564  -0.0409 183 LYS A CG  
185  C  CD  . LYS A 37  ? 0.9345 0.5581 0.5738 0.0580  0.0490  -0.0452 183 LYS A CD  
186  C  CE  . LYS A 37  ? 0.9943 0.6251 0.6164 0.0828  0.0335  -0.0513 183 LYS A CE  
187  N  NZ  . LYS A 37  ? 1.0252 0.6505 0.6416 0.0871  0.0368  -0.0499 183 LYS A NZ  
188  N  N   . LEU A 38  ? 0.5260 0.3020 0.3376 0.0100  0.0515  -0.0369 184 LEU A N   
189  C  CA  . LEU A 38  ? 0.5301 0.3426 0.3652 0.0111  0.0430  -0.0350 184 LEU A CA  
190  C  C   . LEU A 38  ? 0.5088 0.3354 0.3735 -0.0006 0.0459  -0.0332 184 LEU A C   
191  O  O   . LEU A 38  ? 0.5332 0.3787 0.4084 0.0007  0.0418  -0.0308 184 LEU A O   
192  C  CB  . LEU A 38  ? 0.5684 0.4026 0.4117 0.0117  0.0331  -0.0365 184 LEU A CB  
193  C  CG  . LEU A 38  ? 0.6342 0.4617 0.4524 0.0246  0.0278  -0.0410 184 LEU A CG  
194  C  CD1 . LEU A 38  ? 0.6451 0.4934 0.4737 0.0219  0.0202  -0.0430 184 LEU A CD1 
195  C  CD2 . LEU A 38  ? 0.6406 0.4764 0.4455 0.0382  0.0237  -0.0451 184 LEU A CD2 
196  N  N   . LEU A 39  ? 0.4591 0.2774 0.3378 -0.0118 0.0524  -0.0363 185 LEU A N   
197  C  CA  . LEU A 39  ? 0.4906 0.3222 0.3982 -0.0210 0.0538  -0.0384 185 LEU A CA  
198  C  C   . LEU A 39  ? 0.5194 0.3403 0.4196 -0.0208 0.0630  -0.0372 185 LEU A C   
199  O  O   . LEU A 39  ? 0.5551 0.3920 0.4740 -0.0226 0.0605  -0.0364 185 LEU A O   
200  C  CB  . LEU A 39  ? 0.5242 0.3535 0.4518 -0.0325 0.0584  -0.0472 185 LEU A CB  
201  C  CG  . LEU A 39  ? 0.5990 0.4419 0.5402 -0.0327 0.0469  -0.0496 185 LEU A CG  
202  C  CD1 . LEU A 39  ? 0.6236 0.4650 0.5858 -0.0428 0.0520  -0.0619 185 LEU A CD1 
203  C  CD2 . LEU A 39  ? 0.5547 0.4195 0.5105 -0.0300 0.0324  -0.0462 185 LEU A CD2 
204  N  N   . LYS A 40  ? 0.5158 0.3058 0.3849 -0.0181 0.0731  -0.0372 186 LYS A N   
205  C  CA  . LYS A 40  ? 0.5468 0.3194 0.4001 -0.0165 0.0820  -0.0358 186 LYS A CA  
206  C  C   . LYS A 40  ? 0.4378 0.2264 0.2878 -0.0032 0.0726  -0.0306 186 LYS A C   
207  O  O   . LYS A 40  ? 0.4882 0.2825 0.3465 -0.0038 0.0753  -0.0293 186 LYS A O   
208  C  CB  . LYS A 40  ? 0.6984 0.4251 0.5079 -0.0150 0.0929  -0.0367 186 LYS A CB  
209  C  CG  . LYS A 40  ? 0.7944 0.4996 0.6042 -0.0335 0.1094  -0.0439 186 LYS A CG  
210  C  CD  . LYS A 40  ? 0.9059 0.5561 0.6616 -0.0329 0.1202  -0.0438 186 LYS A CD  
211  C  CE  . LYS A 40  ? 0.9257 0.5515 0.6779 -0.0557 0.1412  -0.0529 186 LYS A CE  
212  N  NZ  . LYS A 40  ? 0.8708 0.5191 0.6563 -0.0668 0.1412  -0.0609 186 LYS A NZ  
213  N  N   . ARG A 41  ? 0.4468 0.2445 0.2863 0.0082  0.0622  -0.0295 187 ARG A N   
214  C  CA  . ARG A 41  ? 0.5273 0.3454 0.3672 0.0191  0.0542  -0.0285 187 ARG A CA  
215  C  C   . ARG A 41  ? 0.5631 0.4125 0.4363 0.0105  0.0498  -0.0262 187 ARG A C   
216  O  O   . ARG A 41  ? 0.5963 0.4562 0.4756 0.0130  0.0493  -0.0247 187 ARG A O   
217  C  CB  . ARG A 41  ? 0.5836 0.4110 0.4103 0.0305  0.0447  -0.0323 187 ARG A CB  
218  C  CG  . ARG A 41  ? 0.6648 0.5231 0.5008 0.0370  0.0376  -0.0351 187 ARG A CG  
219  C  CD  . ARG A 41  ? 0.7571 0.6319 0.5860 0.0452  0.0293  -0.0428 187 ARG A CD  
220  N  NE  . ARG A 41  ? 0.8179 0.7267 0.6600 0.0457  0.0253  -0.0482 187 ARG A NE  
221  C  CZ  . ARG A 41  ? 0.9011 0.8196 0.7353 0.0593  0.0224  -0.0575 187 ARG A CZ  
222  N  NH1 . ARG A 41  ? 0.9304 0.8229 0.7395 0.0761  0.0208  -0.0614 187 ARG A NH1 
223  N  NH2 . ARG A 41  ? 0.9047 0.8566 0.7536 0.0560  0.0209  -0.0643 187 ARG A NH2 
224  N  N   . GLN A 42  ? 0.5549 0.4158 0.4463 0.0014  0.0455  -0.0262 188 GLN A N   
225  C  CA  . GLN A 42  ? 0.5458 0.4274 0.4622 -0.0063 0.0391  -0.0246 188 GLN A CA  
226  C  C   . GLN A 42  ? 0.5039 0.3829 0.4346 -0.0106 0.0445  -0.0249 188 GLN A C   
227  O  O   . GLN A 42  ? 0.4900 0.3819 0.4303 -0.0105 0.0407  -0.0227 188 GLN A O   
228  C  CB  . GLN A 42  ? 0.6188 0.5038 0.5485 -0.0138 0.0331  -0.0265 188 GLN A CB  
229  C  CG  . GLN A 42  ? 0.6967 0.5874 0.6148 -0.0113 0.0269  -0.0262 188 GLN A CG  
230  C  CD  . GLN A 42  ? 0.7438 0.6511 0.6638 -0.0145 0.0182  -0.0239 188 GLN A CD  
231  O  OE1 . GLN A 42  ? 0.7283 0.6379 0.6605 -0.0204 0.0121  -0.0226 188 GLN A OE1 
232  N  NE2 . GLN A 42  ? 0.7966 0.7141 0.7024 -0.0110 0.0173  -0.0252 188 GLN A NE2 
233  N  N   . ASN A 43  ? 0.5057 0.3678 0.4372 -0.0158 0.0543  -0.0291 189 ASN A N   
234  C  CA  . ASN A 43  ? 0.4870 0.3487 0.4341 -0.0220 0.0610  -0.0324 189 ASN A CA  
235  C  C   . ASN A 43  ? 0.4301 0.2868 0.3640 -0.0151 0.0656  -0.0283 189 ASN A C   
236  O  O   . ASN A 43  ? 0.3931 0.2615 0.3444 -0.0174 0.0647  -0.0286 189 ASN A O   
237  C  CB  . ASN A 43  ? 0.5490 0.3938 0.4981 -0.0321 0.0738  -0.0408 189 ASN A CB  
238  C  CG  . ASN A 43  ? 0.6538 0.5096 0.6317 -0.0417 0.0781  -0.0496 189 ASN A CG  
239  O  OD1 . ASN A 43  ? 0.7022 0.5806 0.7079 -0.0422 0.0661  -0.0531 189 ASN A OD1 
240  N  ND2 . ASN A 43  ? 0.6750 0.5126 0.6438 -0.0492 0.0948  -0.0547 189 ASN A ND2 
241  N  N   . ASP A 44  ? 0.4112 0.2497 0.3137 -0.0053 0.0689  -0.0257 190 ASP A N   
242  C  CA  . ASP A 44  ? 0.4198 0.2514 0.3065 0.0042  0.0714  -0.0233 190 ASP A CA  
243  C  C   . ASP A 44  ? 0.3844 0.2463 0.2897 0.0078  0.0615  -0.0208 190 ASP A C   
244  O  O   . ASP A 44  ? 0.4231 0.2917 0.3394 0.0072  0.0630  -0.0198 190 ASP A O   
245  C  CB  . ASP A 44  ? 0.4253 0.2342 0.2740 0.0185  0.0708  -0.0237 190 ASP A CB  
246  C  CG  . ASP A 44  ? 0.5031 0.2709 0.3217 0.0155  0.0815  -0.0254 190 ASP A CG  
247  O  OD1 . ASP A 44  ? 0.5036 0.2582 0.3274 0.0020  0.0937  -0.0271 190 ASP A OD1 
248  O  OD2 . ASP A 44  ? 0.5714 0.3193 0.3598 0.0260  0.0778  -0.0267 190 ASP A OD2 
249  N  N   . ILE A 45  ? 0.3619 0.2406 0.2687 0.0104  0.0524  -0.0206 191 ILE A N   
250  C  CA  . ILE A 45  ? 0.4022 0.3062 0.3206 0.0110  0.0448  -0.0194 191 ILE A CA  
251  C  C   . ILE A 45  ? 0.3985 0.3132 0.3419 0.0004  0.0409  -0.0170 191 ILE A C   
252  O  O   . ILE A 45  ? 0.4427 0.3687 0.3943 0.0006  0.0385  -0.0155 191 ILE A O   
253  C  CB  . ILE A 45  ? 0.4093 0.3270 0.3217 0.0121  0.0383  -0.0218 191 ILE A CB  
254  C  CG1 . ILE A 45  ? 0.4202 0.3316 0.3094 0.0262  0.0391  -0.0276 191 ILE A CG1 
255  C  CG2 . ILE A 45  ? 0.4457 0.3863 0.3679 0.0072  0.0331  -0.0217 191 ILE A CG2 
256  C  CD1 . ILE A 45  ? 0.3981 0.3230 0.2819 0.0270  0.0338  -0.0330 191 ILE A CD1 
257  N  N   . LEU A 46  ? 0.3390 0.2495 0.2941 -0.0077 0.0390  -0.0184 192 LEU A N   
258  C  CA  . LEU A 46  ? 0.3624 0.2813 0.3395 -0.0148 0.0312  -0.0193 192 LEU A CA  
259  C  C   . LEU A 46  ? 0.3634 0.2831 0.3544 -0.0153 0.0359  -0.0212 192 LEU A C   
260  O  O   . LEU A 46  ? 0.3144 0.2439 0.3173 -0.0163 0.0285  -0.0202 192 LEU A O   
261  C  CB  . LEU A 46  ? 0.3536 0.2684 0.3414 -0.0207 0.0271  -0.0243 192 LEU A CB  
262  C  CG  . LEU A 46  ? 0.3724 0.2932 0.3812 -0.0249 0.0147  -0.0289 192 LEU A CG  
263  C  CD1 . LEU A 46  ? 0.3219 0.2456 0.3210 -0.0249 0.0021  -0.0230 192 LEU A CD1 
264  C  CD2 . LEU A 46  ? 0.3254 0.2430 0.3455 -0.0283 0.0108  -0.0374 192 LEU A CD2 
265  N  N   . GLN A 47  ? 0.3880 0.2946 0.3743 -0.0154 0.0484  -0.0243 193 GLN A N   
266  C  CA  . GLN A 47  ? 0.4391 0.3453 0.4371 -0.0178 0.0554  -0.0276 193 GLN A CA  
267  C  C   . GLN A 47  ? 0.4140 0.3276 0.4078 -0.0105 0.0532  -0.0220 193 GLN A C   
268  O  O   . GLN A 47  ? 0.4806 0.4041 0.4922 -0.0122 0.0508  -0.0235 193 GLN A O   
269  C  CB  . GLN A 47  ? 0.5664 0.4498 0.5494 -0.0211 0.0720  -0.0316 193 GLN A CB  
270  C  CG  . GLN A 47  ? 0.7113 0.5870 0.6992 -0.0305 0.0768  -0.0393 193 GLN A CG  
271  C  CD  . GLN A 47  ? 0.7827 0.6789 0.8073 -0.0383 0.0694  -0.0498 193 GLN A CD  
272  O  OE1 . GLN A 47  ? 0.8174 0.7211 0.8620 -0.0444 0.0744  -0.0589 193 GLN A OE1 
273  N  NE2 . GLN A 47  ? 0.7850 0.6901 0.8177 -0.0372 0.0565  -0.0502 193 GLN A NE2 
274  N  N   . VAL A 48  ? 0.3632 0.2739 0.3350 -0.0015 0.0534  -0.0175 194 VAL A N   
275  C  CA  . VAL A 48  ? 0.3457 0.2653 0.3141 0.0062  0.0519  -0.0148 194 VAL A CA  
276  C  C   . VAL A 48  ? 0.3418 0.2818 0.3238 0.0027  0.0407  -0.0127 194 VAL A C   
277  O  O   . VAL A 48  ? 0.3828 0.3320 0.3750 0.0032  0.0382  -0.0115 194 VAL A O   
278  C  CB  . VAL A 48  ? 0.3755 0.2871 0.3171 0.0188  0.0545  -0.0154 194 VAL A CB  
279  C  CG1 . VAL A 48  ? 0.3645 0.2919 0.3073 0.0270  0.0512  -0.0158 194 VAL A CG1 
280  C  CG2 . VAL A 48  ? 0.3534 0.2343 0.2718 0.0232  0.0651  -0.0168 194 VAL A CG2 
281  N  N   . VAL A 49  ? 0.3398 0.2834 0.3185 -0.0017 0.0343  -0.0123 195 VAL A N   
282  C  CA  . VAL A 49  ? 0.3462 0.3000 0.3295 -0.0079 0.0244  -0.0102 195 VAL A CA  
283  C  C   . VAL A 49  ? 0.3574 0.3093 0.3589 -0.0130 0.0164  -0.0106 195 VAL A C   
284  O  O   . VAL A 49  ? 0.4039 0.3600 0.4082 -0.0152 0.0092  -0.0087 195 VAL A O   
285  C  CB  . VAL A 49  ? 0.3314 0.2845 0.3030 -0.0129 0.0198  -0.0102 195 VAL A CB  
286  C  CG1 . VAL A 49  ? 0.3775 0.3307 0.3466 -0.0217 0.0097  -0.0079 195 VAL A CG1 
287  C  CG2 . VAL A 49  ? 0.3323 0.2934 0.2886 -0.0074 0.0254  -0.0132 195 VAL A CG2 
288  N  N   . SER A 50  ? 0.3283 0.2741 0.3421 -0.0147 0.0174  -0.0152 196 SER A N   
289  C  CA  . SER A 50  ? 0.3858 0.3338 0.4212 -0.0174 0.0089  -0.0207 196 SER A CA  
290  C  C   . SER A 50  ? 0.4237 0.3786 0.4709 -0.0147 0.0127  -0.0214 196 SER A C   
291  O  O   . SER A 50  ? 0.4149 0.3748 0.4824 -0.0158 0.0059  -0.0280 196 SER A O   
292  C  CB  . SER A 50  ? 0.3980 0.3429 0.4477 -0.0206 0.0120  -0.0301 196 SER A CB  
293  O  OG  . SER A 50  ? 0.4193 0.3585 0.4618 -0.0225 0.0055  -0.0307 196 SER A OG  
294  N  N   . GLN A 51  ? 0.4246 0.3807 0.4598 -0.0100 0.0224  -0.0163 197 GLN A N   
295  C  CA  . GLN A 51  ? 0.4356 0.3966 0.4795 -0.0066 0.0272  -0.0168 197 GLN A CA  
296  C  C   . GLN A 51  ? 0.4241 0.3933 0.4604 -0.0023 0.0240  -0.0112 197 GLN A C   
297  O  O   . GLN A 51  ? 0.4735 0.4460 0.5101 0.0034  0.0300  -0.0105 197 GLN A O   
298  C  CB  . GLN A 51  ? 0.5064 0.4566 0.5413 -0.0039 0.0432  -0.0187 197 GLN A CB  
299  C  CG  . GLN A 51  ? 0.6247 0.5669 0.6684 -0.0116 0.0500  -0.0268 197 GLN A CG  
300  C  CD  . GLN A 51  ? 0.7111 0.6329 0.7350 -0.0115 0.0673  -0.0279 197 GLN A CD  
301  O  OE1 . GLN A 51  ? 0.7939 0.7056 0.7954 -0.0027 0.0718  -0.0225 197 GLN A OE1 
302  N  NE2 . GLN A 51  ? 0.6657 0.5791 0.6955 -0.0214 0.0768  -0.0367 197 GLN A NE2 
303  N  N   . GLY A 52  ? 0.3806 0.3517 0.4083 -0.0060 0.0152  -0.0083 198 GLY A N   
304  C  CA  . GLY A 52  ? 0.4131 0.3923 0.4347 -0.0061 0.0125  -0.0054 198 GLY A CA  
305  C  C   . GLY A 52  ? 0.4407 0.4279 0.4483 -0.0011 0.0211  -0.0065 198 GLY A C   
306  O  O   . GLY A 52  ? 0.4521 0.4502 0.4573 -0.0009 0.0215  -0.0074 198 GLY A O   
307  N  N   . TRP A 53  ? 0.4031 0.3426 0.3982 -0.0392 -0.0046 -0.0149 199 TRP A N   
308  C  CA  . TRP A 53  ? 0.3870 0.3170 0.3684 -0.0384 -0.0053 -0.0165 199 TRP A CA  
309  C  C   . TRP A 53  ? 0.3710 0.3037 0.3486 -0.0383 -0.0117 -0.0187 199 TRP A C   
310  O  O   . TRP A 53  ? 0.3903 0.3305 0.3742 -0.0400 -0.0160 -0.0195 199 TRP A O   
311  C  CB  . TRP A 53  ? 0.4584 0.3794 0.4365 -0.0414 -0.0020 -0.0175 199 TRP A CB  
312  C  CG  . TRP A 53  ? 0.4539 0.3672 0.4278 -0.0404 0.0049  -0.0153 199 TRP A CG  
313  C  CD1 . TRP A 53  ? 0.4462 0.3625 0.4277 -0.0407 0.0104  -0.0133 199 TRP A CD1 
314  C  CD2 . TRP A 53  ? 0.4527 0.3536 0.4131 -0.0386 0.0068  -0.0150 199 TRP A CD2 
315  N  NE1 . TRP A 53  ? 0.4740 0.3795 0.4454 -0.0396 0.0163  -0.0119 199 TRP A NE1 
316  C  CE2 . TRP A 53  ? 0.4916 0.3875 0.4495 -0.0381 0.0135  -0.0128 199 TRP A CE2 
317  C  CE3 . TRP A 53  ? 0.4143 0.3076 0.3644 -0.0370 0.0034  -0.0166 199 TRP A CE3 
318  C  CZ2 . TRP A 53  ? 0.4643 0.3474 0.4078 -0.0361 0.0160  -0.0118 199 TRP A CZ2 
319  C  CZ3 . TRP A 53  ? 0.3905 0.2721 0.3287 -0.0347 0.0054  -0.0156 199 TRP A CZ3 
320  C  CH2 . TRP A 53  ? 0.4406 0.3168 0.3745 -0.0342 0.0112  -0.0131 199 TRP A CH2 
321  N  N   . LYS A 54  ? 0.3322 0.2586 0.2994 -0.0363 -0.0123 -0.0200 200 LYS A N   
322  C  CA  . LYS A 54  ? 0.3627 0.2899 0.3248 -0.0362 -0.0166 -0.0225 200 LYS A CA  
323  C  C   . LYS A 54  ? 0.3912 0.3111 0.3487 -0.0384 -0.0171 -0.0260 200 LYS A C   
324  O  O   . LYS A 54  ? 0.4155 0.3283 0.3721 -0.0392 -0.0141 -0.0257 200 LYS A O   
325  C  CB  . LYS A 54  ? 0.4040 0.3308 0.3604 -0.0325 -0.0164 -0.0219 200 LYS A CB  
326  C  CG  . LYS A 54  ? 0.4894 0.4236 0.4491 -0.0309 -0.0177 -0.0192 200 LYS A CG  
327  C  CD  . LYS A 54  ? 0.5851 0.5181 0.5426 -0.0276 -0.0151 -0.0175 200 LYS A CD  
328  C  CE  . LYS A 54  ? 0.6296 0.5641 0.5934 -0.0263 -0.0119 -0.0146 200 LYS A CE  
329  N  NZ  . LYS A 54  ? 0.6368 0.5787 0.6087 -0.0263 -0.0135 -0.0119 200 LYS A NZ  
330  N  N   . TYR A 55  ? 0.3642 0.2848 0.3180 -0.0393 -0.0207 -0.0292 201 TYR A N   
331  C  CA  . TYR A 55  ? 0.3994 0.3125 0.3490 -0.0411 -0.0211 -0.0330 201 TYR A CA  
332  C  C   . TYR A 55  ? 0.3813 0.2924 0.3231 -0.0391 -0.0225 -0.0361 201 TYR A C   
333  O  O   . TYR A 55  ? 0.4327 0.3490 0.3719 -0.0388 -0.0247 -0.0366 201 TYR A O   
334  C  CB  . TYR A 55  ? 0.4313 0.3461 0.3862 -0.0460 -0.0236 -0.0355 201 TYR A CB  
335  C  CG  . TYR A 55  ? 0.4121 0.3183 0.3623 -0.0478 -0.0240 -0.0400 201 TYR A CG  
336  C  CD1 . TYR A 55  ? 0.4404 0.3367 0.3901 -0.0483 -0.0204 -0.0396 201 TYR A CD1 
337  C  CD2 . TYR A 55  ? 0.3966 0.3031 0.3414 -0.0486 -0.0275 -0.0445 201 TYR A CD2 
338  C  CE1 . TYR A 55  ? 0.4287 0.3159 0.3744 -0.0495 -0.0206 -0.0436 201 TYR A CE1 
339  C  CE2 . TYR A 55  ? 0.4201 0.3180 0.3609 -0.0500 -0.0273 -0.0491 201 TYR A CE2 
340  C  CZ  . TYR A 55  ? 0.4660 0.3544 0.4081 -0.0504 -0.0239 -0.0486 201 TYR A CZ  
341  O  OH  . TYR A 55  ? 0.5180 0.3968 0.4566 -0.0514 -0.0236 -0.0530 201 TYR A OH  
342  N  N   . PHE A 56  ? 0.3185 0.2213 0.2563 -0.0376 -0.0208 -0.0382 202 PHE A N   
343  C  CA  . PHE A 56  ? 0.3588 0.2595 0.2911 -0.0357 -0.0209 -0.0417 202 PHE A CA  
344  C  C   . PHE A 56  ? 0.3925 0.2835 0.3229 -0.0352 -0.0200 -0.0449 202 PHE A C   
345  O  O   . PHE A 56  ? 0.4085 0.2943 0.3395 -0.0327 -0.0187 -0.0433 202 PHE A O   
346  C  CB  . PHE A 56  ? 0.3999 0.3034 0.3316 -0.0318 -0.0190 -0.0399 202 PHE A CB  
347  C  CG  . PHE A 56  ? 0.4259 0.3279 0.3538 -0.0299 -0.0177 -0.0436 202 PHE A CG  
348  C  CD1 . PHE A 56  ? 0.4515 0.3560 0.3739 -0.0311 -0.0180 -0.0456 202 PHE A CD1 
349  C  CD2 . PHE A 56  ? 0.4171 0.3149 0.3467 -0.0267 -0.0160 -0.0452 202 PHE A CD2 
350  C  CE1 . PHE A 56  ? 0.4791 0.3816 0.3976 -0.0295 -0.0153 -0.0492 202 PHE A CE1 
351  C  CE2 . PHE A 56  ? 0.4266 0.3238 0.3551 -0.0249 -0.0139 -0.0490 202 PHE A CE2 
352  C  CZ  . PHE A 56  ? 0.4892 0.3885 0.4120 -0.0265 -0.0127 -0.0510 202 PHE A CZ  
353  N  N   . LYS A 57  ? 0.4372 0.3253 0.3646 -0.0373 -0.0211 -0.0496 203 LYS A N   
354  C  CA  . LYS A 57  ? 0.4391 0.3175 0.3648 -0.0364 -0.0201 -0.0534 203 LYS A CA  
355  C  C   . LYS A 57  ? 0.4565 0.3266 0.3844 -0.0359 -0.0192 -0.0508 203 LYS A C   
356  O  O   . LYS A 57  ? 0.4433 0.3081 0.3705 -0.0316 -0.0183 -0.0501 203 LYS A O   
357  C  CB  . LYS A 57  ? 0.4804 0.3583 0.4043 -0.0318 -0.0182 -0.0556 203 LYS A CB  
358  C  CG  . LYS A 57  ? 0.5782 0.4612 0.4973 -0.0324 -0.0176 -0.0586 203 LYS A CG  
359  C  CD  . LYS A 57  ? 0.6503 0.5319 0.5693 -0.0284 -0.0141 -0.0615 203 LYS A CD  
360  C  CE  . LYS A 57  ? 0.6891 0.5730 0.6007 -0.0294 -0.0121 -0.0650 203 LYS A CE  
361  N  NZ  . LYS A 57  ? 0.6911 0.5741 0.6041 -0.0259 -0.0071 -0.0682 203 LYS A NZ  
362  N  N   . GLY A 58  ? 0.4297 0.2984 0.3602 -0.0402 -0.0193 -0.0495 204 GLY A N   
363  C  CA  . GLY A 58  ? 0.4234 0.2819 0.3541 -0.0405 -0.0173 -0.0470 204 GLY A CA  
364  C  C   . GLY A 58  ? 0.4688 0.3272 0.3990 -0.0382 -0.0156 -0.0413 204 GLY A C   
365  O  O   . GLY A 58  ? 0.5316 0.3799 0.4591 -0.0377 -0.0136 -0.0386 204 GLY A O   
366  N  N   . ASN A 59  ? 0.4250 0.2933 0.3567 -0.0367 -0.0161 -0.0393 205 ASN A N   
367  C  CA  . ASN A 59  ? 0.3930 0.2613 0.3238 -0.0347 -0.0145 -0.0346 205 ASN A CA  
368  C  C   . ASN A 59  ? 0.3935 0.2726 0.3295 -0.0367 -0.0138 -0.0324 205 ASN A C   
369  O  O   . ASN A 59  ? 0.3849 0.2729 0.3237 -0.0372 -0.0158 -0.0339 205 ASN A O   
370  C  CB  . ASN A 59  ? 0.3707 0.2381 0.2981 -0.0290 -0.0158 -0.0345 205 ASN A CB  
371  C  CG  . ASN A 59  ? 0.4011 0.2571 0.3240 -0.0258 -0.0167 -0.0353 205 ASN A CG  
372  O  OD1 . ASN A 59  ? 0.4256 0.2718 0.3438 -0.0256 -0.0155 -0.0325 205 ASN A OD1 
373  N  ND2 . ASN A 59  ? 0.3772 0.2337 0.3014 -0.0228 -0.0185 -0.0391 205 ASN A ND2 
374  N  N   . PHE A 60  ? 0.3659 0.2433 0.3027 -0.0374 -0.0107 -0.0287 206 PHE A N   
375  C  CA  . PHE A 60  ? 0.3342 0.2210 0.2766 -0.0381 -0.0095 -0.0263 206 PHE A CA  
376  C  C   . PHE A 60  ? 0.3814 0.2684 0.3196 -0.0335 -0.0091 -0.0245 206 PHE A C   
377  O  O   . PHE A 60  ? 0.3892 0.2676 0.3202 -0.0306 -0.0088 -0.0239 206 PHE A O   
378  C  CB  . PHE A 60  ? 0.3516 0.2371 0.2988 -0.0417 -0.0052 -0.0239 206 PHE A CB  
379  C  CG  . PHE A 60  ? 0.3891 0.2756 0.3433 -0.0470 -0.0057 -0.0263 206 PHE A CG  
380  C  CD1 . PHE A 60  ? 0.3583 0.2560 0.3208 -0.0493 -0.0096 -0.0285 206 PHE A CD1 
381  C  CD2 . PHE A 60  ? 0.4044 0.2799 0.3565 -0.0497 -0.0026 -0.0263 206 PHE A CD2 
382  C  CE1 . PHE A 60  ? 0.3793 0.2783 0.3487 -0.0545 -0.0111 -0.0315 206 PHE A CE1 
383  C  CE2 . PHE A 60  ? 0.3977 0.2740 0.3576 -0.0552 -0.0031 -0.0291 206 PHE A CE2 
384  C  CZ  . PHE A 60  ? 0.3634 0.2520 0.3324 -0.0577 -0.0076 -0.0321 206 PHE A CZ  
385  N  N   . TYR A 61  ? 0.3621 0.2584 0.3048 -0.0327 -0.0095 -0.0237 207 TYR A N   
386  C  CA  . TYR A 61  ? 0.3888 0.2858 0.3291 -0.0291 -0.0089 -0.0225 207 TYR A CA  
387  C  C   . TYR A 61  ? 0.4045 0.3072 0.3502 -0.0296 -0.0061 -0.0198 207 TYR A C   
388  O  O   . TYR A 61  ? 0.4027 0.3129 0.3559 -0.0317 -0.0064 -0.0192 207 TYR A O   
389  C  CB  . TYR A 61  ? 0.3706 0.2724 0.3113 -0.0271 -0.0116 -0.0245 207 TYR A CB  
390  C  CG  . TYR A 61  ? 0.3788 0.2760 0.3160 -0.0260 -0.0137 -0.0277 207 TYR A CG  
391  C  CD1 . TYR A 61  ? 0.3511 0.2444 0.2856 -0.0224 -0.0148 -0.0290 207 TYR A CD1 
392  C  CD2 . TYR A 61  ? 0.3845 0.2813 0.3218 -0.0284 -0.0150 -0.0300 207 TYR A CD2 
393  C  CE1 . TYR A 61  ? 0.3744 0.2641 0.3078 -0.0209 -0.0165 -0.0322 207 TYR A CE1 
394  C  CE2 . TYR A 61  ? 0.3734 0.2655 0.3080 -0.0271 -0.0162 -0.0333 207 TYR A CE2 
395  C  CZ  . TYR A 61  ? 0.3727 0.2615 0.3060 -0.0231 -0.0168 -0.0342 207 TYR A CZ  
396  O  OH  . TYR A 61  ? 0.3752 0.2600 0.3079 -0.0213 -0.0179 -0.0377 207 TYR A OH  
397  N  N   . TYR A 62  ? 0.3943 0.2933 0.3363 -0.0273 -0.0037 -0.0186 208 TYR A N   
398  C  CA  . TYR A 62  ? 0.3846 0.2881 0.3317 -0.0271 -0.0004 -0.0165 208 TYR A CA  
399  C  C   . TYR A 62  ? 0.4053 0.3107 0.3515 -0.0239 -0.0011 -0.0169 208 TYR A C   
400  O  O   . TYR A 62  ? 0.4202 0.3194 0.3595 -0.0217 -0.0015 -0.0181 208 TYR A O   
401  C  CB  . TYR A 62  ? 0.3932 0.2898 0.3367 -0.0278 0.0049  -0.0148 208 TYR A CB  
402  C  CG  . TYR A 62  ? 0.4099 0.3114 0.3601 -0.0275 0.0094  -0.0131 208 TYR A CG  
403  C  CD1 . TYR A 62  ? 0.3510 0.2619 0.3140 -0.0296 0.0102  -0.0121 208 TYR A CD1 
404  C  CD2 . TYR A 62  ? 0.4214 0.3180 0.3656 -0.0250 0.0124  -0.0130 208 TYR A CD2 
405  C  CE1 . TYR A 62  ? 0.3830 0.2985 0.3540 -0.0288 0.0144  -0.0106 208 TYR A CE1 
406  C  CE2 . TYR A 62  ? 0.3800 0.2804 0.3308 -0.0245 0.0172  -0.0119 208 TYR A CE2 
407  C  CZ  . TYR A 62  ? 0.3997 0.3097 0.3645 -0.0262 0.0184  -0.0105 208 TYR A CZ  
408  O  OH  . TYR A 62  ? 0.4324 0.3464 0.4055 -0.0251 0.0232  -0.0094 208 TYR A OH  
409  N  N   . PHE A 63  ? 0.4005 0.3140 0.3539 -0.0237 -0.0017 -0.0159 209 PHE A N   
410  C  CA  . PHE A 63  ? 0.3648 0.2798 0.3191 -0.0213 -0.0013 -0.0160 209 PHE A CA  
411  C  C   . PHE A 63  ? 0.3757 0.2912 0.3337 -0.0205 0.0029  -0.0141 209 PHE A C   
412  O  O   . PHE A 63  ? 0.4207 0.3424 0.3869 -0.0210 0.0041  -0.0119 209 PHE A O   
413  C  CB  . PHE A 63  ? 0.3367 0.2582 0.2949 -0.0212 -0.0037 -0.0154 209 PHE A CB  
414  C  CG  . PHE A 63  ? 0.3784 0.2988 0.3325 -0.0215 -0.0066 -0.0178 209 PHE A CG  
415  C  CD1 . PHE A 63  ? 0.3783 0.2983 0.3315 -0.0200 -0.0067 -0.0193 209 PHE A CD1 
416  C  CD2 . PHE A 63  ? 0.3831 0.3025 0.3352 -0.0235 -0.0086 -0.0190 209 PHE A CD2 
417  C  CE1 . PHE A 63  ? 0.3641 0.2833 0.3149 -0.0202 -0.0083 -0.0220 209 PHE A CE1 
418  C  CE2 . PHE A 63  ? 0.3941 0.3119 0.3426 -0.0235 -0.0106 -0.0218 209 PHE A CE2 
419  C  CZ  . PHE A 63  ? 0.4036 0.3215 0.3516 -0.0217 -0.0103 -0.0232 209 PHE A CZ  
420  N  N   . SER A 64  ? 0.3595 0.2685 0.3117 -0.0190 0.0050  -0.0154 210 SER A N   
421  C  CA  . SER A 64  ? 0.3958 0.3031 0.3495 -0.0184 0.0102  -0.0144 210 SER A CA  
422  C  C   . SER A 64  ? 0.3689 0.2820 0.3317 -0.0169 0.0118  -0.0130 210 SER A C   
423  O  O   . SER A 64  ? 0.3624 0.2786 0.3276 -0.0161 0.0091  -0.0129 210 SER A O   
424  C  CB  . SER A 64  ? 0.3812 0.2787 0.3237 -0.0170 0.0115  -0.0167 210 SER A CB  
425  O  OG  . SER A 64  ? 0.3527 0.2499 0.2949 -0.0152 0.0093  -0.0190 210 SER A OG  
426  N  N   . LEU A 65  ? 0.3620 0.2757 0.3297 -0.0164 0.0169  -0.0117 211 LEU A N   
427  C  CA  . LEU A 65  ? 0.4046 0.3227 0.3817 -0.0144 0.0190  -0.0101 211 LEU A CA  
428  C  C   . LEU A 65  ? 0.4204 0.3315 0.3931 -0.0126 0.0234  -0.0122 211 LEU A C   
429  O  O   . LEU A 65  ? 0.4244 0.3365 0.4031 -0.0107 0.0252  -0.0116 211 LEU A O   
430  C  CB  . LEU A 65  ? 0.3851 0.3100 0.3738 -0.0148 0.0217  -0.0075 211 LEU A CB  
431  C  CG  . LEU A 65  ? 0.3892 0.3214 0.3832 -0.0170 0.0170  -0.0061 211 LEU A CG  
432  C  CD1 . LEU A 65  ? 0.4415 0.3798 0.4479 -0.0181 0.0203  -0.0048 211 LEU A CD1 
433  C  CD2 . LEU A 65  ? 0.3252 0.2630 0.3221 -0.0157 0.0113  -0.0043 211 LEU A CD2 
434  N  N   . ILE A 66  ? 0.3819 0.2848 0.3431 -0.0132 0.0247  -0.0148 212 ILE A N   
435  C  CA  . ILE A 66  ? 0.4483 0.3430 0.4024 -0.0118 0.0285  -0.0177 212 ILE A CA  
436  C  C   . ILE A 66  ? 0.4551 0.3432 0.3973 -0.0116 0.0234  -0.0213 212 ILE A C   
437  O  O   . ILE A 66  ? 0.4476 0.3344 0.3837 -0.0126 0.0194  -0.0213 212 ILE A O   
438  C  CB  . ILE A 66  ? 0.5289 0.4186 0.4785 -0.0122 0.0356  -0.0175 212 ILE A CB  
439  C  CG1 . ILE A 66  ? 0.6056 0.4860 0.5462 -0.0105 0.0402  -0.0209 212 ILE A CG1 
440  C  CG2 . ILE A 66  ? 0.5537 0.4390 0.4933 -0.0142 0.0342  -0.0170 212 ILE A CG2 
441  C  CD1 . ILE A 66  ? 0.6506 0.5242 0.5841 -0.0110 0.0484  -0.0209 212 ILE A CD1 
442  N  N   . PRO A 67  ? 0.4676 0.3518 0.4079 -0.0104 0.0232  -0.0246 213 PRO A N   
443  C  CA  . PRO A 67  ? 0.4331 0.3126 0.3650 -0.0102 0.0174  -0.0287 213 PRO A CA  
444  C  C   . PRO A 67  ? 0.4489 0.3179 0.3645 -0.0095 0.0175  -0.0312 213 PRO A C   
445  O  O   . PRO A 67  ? 0.4635 0.3274 0.3741 -0.0091 0.0238  -0.0312 213 PRO A O   
446  C  CB  . PRO A 67  ? 0.4434 0.3228 0.3814 -0.0095 0.0178  -0.0315 213 PRO A CB  
447  C  CG  . PRO A 67  ? 0.5057 0.3895 0.4548 -0.0090 0.0236  -0.0280 213 PRO A CG  
448  C  CD  . PRO A 67  ? 0.5086 0.3932 0.4564 -0.0091 0.0278  -0.0249 213 PRO A CD  
449  N  N   . LYS A 68  ? 0.3868 0.2523 0.2939 -0.0091 0.0108  -0.0333 214 LYS A N   
450  C  CA  . LYS A 68  ? 0.4054 0.2595 0.2944 -0.0078 0.0094  -0.0356 214 LYS A CA  
451  C  C   . LYS A 68  ? 0.4024 0.2542 0.2867 -0.0065 0.0001  -0.0400 214 LYS A C   
452  O  O   . LYS A 68  ? 0.3385 0.1981 0.2344 -0.0069 -0.0045 -0.0409 214 LYS A O   
453  C  CB  . LYS A 68  ? 0.4257 0.2756 0.3061 -0.0083 0.0117  -0.0315 214 LYS A CB  
454  C  CG  . LYS A 68  ? 0.4715 0.3225 0.3558 -0.0097 0.0213  -0.0281 214 LYS A CG  
455  C  CD  . LYS A 68  ? 0.5600 0.4026 0.4319 -0.0104 0.0250  -0.0252 214 LYS A CD  
456  C  CE  . LYS A 68  ? 0.6323 0.4758 0.5093 -0.0119 0.0358  -0.0227 214 LYS A CE  
457  N  NZ  . LYS A 68  ? 0.6877 0.5292 0.5646 -0.0106 0.0408  -0.0256 214 LYS A NZ  
458  N  N   . THR A 69  ? 0.4286 0.2696 0.2959 -0.0047 -0.0026 -0.0431 215 THR A N   
459  C  CA  . THR A 69  ? 0.4083 0.2469 0.2704 -0.0029 -0.0130 -0.0472 215 THR A CA  
460  C  C   . THR A 69  ? 0.4153 0.2552 0.2768 -0.0022 -0.0168 -0.0436 215 THR A C   
461  O  O   . THR A 69  ? 0.4463 0.2861 0.3071 -0.0034 -0.0112 -0.0385 215 THR A O   
462  C  CB  . THR A 69  ? 0.6067 0.4321 0.4474 -0.0007 -0.0162 -0.0509 215 THR A CB  
463  O  OG1 . THR A 69  ? 0.6383 0.4535 0.4614 0.0001  -0.0117 -0.0464 215 THR A OG1 
464  C  CG2 . THR A 69  ? 0.5394 0.3619 0.3793 -0.0014 -0.0120 -0.0554 215 THR A CG2 
465  N  N   . TRP A 70  ? 0.4423 0.2834 0.3052 -0.0003 -0.0262 -0.0465 216 TRP A N   
466  C  CA  . TRP A 70  ? 0.4841 0.3257 0.3470 0.0009  -0.0302 -0.0437 216 TRP A CA  
467  C  C   . TRP A 70  ? 0.5398 0.3687 0.3829 0.0023  -0.0284 -0.0395 216 TRP A C   
468  O  O   . TRP A 70  ? 0.5567 0.3856 0.4010 0.0010  -0.0244 -0.0348 216 TRP A O   
469  C  CB  . TRP A 70  ? 0.4994 0.3438 0.3674 0.0035  -0.0410 -0.0482 216 TRP A CB  
470  C  CG  . TRP A 70  ? 0.4839 0.3309 0.3570 0.0048  -0.0443 -0.0459 216 TRP A CG  
471  C  CD1 . TRP A 70  ? 0.4439 0.3019 0.3350 0.0033  -0.0435 -0.0461 216 TRP A CD1 
472  C  CD2 . TRP A 70  ? 0.4600 0.2972 0.3191 0.0078  -0.0483 -0.0430 216 TRP A CD2 
473  N  NE1 . TRP A 70  ? 0.4173 0.2734 0.3073 0.0053  -0.0468 -0.0441 216 TRP A NE1 
474  C  CE2 . TRP A 70  ? 0.4871 0.3304 0.3581 0.0081  -0.0499 -0.0420 216 TRP A CE2 
475  C  CE3 . TRP A 70  ? 0.4888 0.3114 0.3253 0.0105  -0.0503 -0.0411 216 TRP A CE3 
476  C  CZ2 . TRP A 70  ? 0.4794 0.3149 0.3421 0.0111  -0.0536 -0.0393 216 TRP A CZ2 
477  C  CZ3 . TRP A 70  ? 0.4905 0.3049 0.3177 0.0134  -0.0540 -0.0376 216 TRP A CZ3 
478  C  CH2 . TRP A 70  ? 0.4631 0.2840 0.3041 0.0137  -0.0557 -0.0368 216 TRP A CH2 
479  N  N   . TYR A 71  ? 0.5464 0.3636 0.3705 0.0046  -0.0311 -0.0412 217 TYR A N   
480  C  CA  A TYR A 71  ? 0.5738 0.3766 0.3763 0.0061  -0.0290 -0.0369 217 TYR A CA  
481  C  CA  B TYR A 71  ? 0.5738 0.3766 0.3763 0.0061  -0.0289 -0.0369 217 TYR A CA  
482  C  C   . TYR A 71  ? 0.5651 0.3662 0.3666 0.0027  -0.0161 -0.0322 217 TYR A C   
483  O  O   . TYR A 71  ? 0.6194 0.4141 0.4137 0.0022  -0.0122 -0.0273 217 TYR A O   
484  C  CB  A TYR A 71  ? 0.6027 0.3922 0.3825 0.0094  -0.0344 -0.0400 217 TYR A CB  
485  C  CB  B TYR A 71  ? 0.6103 0.3996 0.3898 0.0093  -0.0338 -0.0398 217 TYR A CB  
486  C  CG  A TYR A 71  ? 0.6103 0.4008 0.3906 0.0133  -0.0487 -0.0443 217 TYR A CG  
487  C  CG  B TYR A 71  ? 0.6670 0.4394 0.4215 0.0104  -0.0290 -0.0347 217 TYR A CG  
488  C  CD1 A TYR A 71  ? 0.6582 0.4418 0.4296 0.0170  -0.0558 -0.0414 217 TYR A CD1 
489  C  CD1 B TYR A 71  ? 0.6996 0.4636 0.4436 0.0133  -0.0341 -0.0308 217 TYR A CD1 
490  C  CD2 A TYR A 71  ? 0.5651 0.3636 0.3566 0.0133  -0.0550 -0.0514 217 TYR A CD2 
491  C  CD2 B TYR A 71  ? 0.6932 0.4574 0.4348 0.0087  -0.0184 -0.0337 217 TYR A CD2 
492  C  CE1 A TYR A 71  ? 0.6600 0.4456 0.4343 0.0211  -0.0694 -0.0455 217 TYR A CE1 
493  C  CE1 B TYR A 71  ? 0.7367 0.4838 0.4571 0.0141  -0.0288 -0.0255 217 TYR A CE1 
494  C  CE2 A TYR A 71  ? 0.5808 0.3817 0.3759 0.0167  -0.0682 -0.0558 217 TYR A CE2 
495  C  CE2 B TYR A 71  ? 0.7207 0.4686 0.4390 0.0094  -0.0125 -0.0288 217 TYR A CE2 
496  C  CZ  A TYR A 71  ? 0.6425 0.4375 0.4294 0.0209  -0.0757 -0.0529 217 TYR A CZ  
497  C  CZ  B TYR A 71  ? 0.7627 0.5017 0.4701 0.0119  -0.0176 -0.0245 217 TYR A CZ  
498  O  OH  A TYR A 71  ? 0.6715 0.4697 0.4640 0.0249  -0.0894 -0.0575 217 TYR A OH  
499  O  OH  B TYR A 71  ? 0.8390 0.5602 0.5223 0.0125  -0.0109 -0.0191 217 TYR A OH  
500  N  N   . SER A 72  ? 0.5393 0.3463 0.3494 0.0004  -0.0095 -0.0340 218 SER A N   
501  C  CA  . SER A 72  ? 0.5402 0.3470 0.3522 -0.0024 0.0025  -0.0302 218 SER A CA  
502  C  C   . SER A 72  ? 0.5344 0.3531 0.3659 -0.0051 0.0049  -0.0268 218 SER A C   
503  O  O   . SER A 72  ? 0.5521 0.3702 0.3851 -0.0074 0.0127  -0.0229 218 SER A O   
504  C  CB  . SER A 72  ? 0.5934 0.4024 0.4091 -0.0032 0.0082  -0.0334 218 SER A CB  
505  O  OG  . SER A 72  ? 0.6682 0.4760 0.4850 -0.0052 0.0200  -0.0301 218 SER A OG  
506  N  N   . ALA A 73  ? 0.4770 0.3064 0.3232 -0.0050 -0.0016 -0.0288 219 ALA A N   
507  C  CA  . ALA A 73  ? 0.4741 0.3139 0.3363 -0.0073 -0.0006 -0.0262 219 ALA A CA  
508  C  C   . ALA A 73  ? 0.5055 0.3389 0.3603 -0.0072 -0.0019 -0.0230 219 ALA A C   
509  O  O   . ALA A 73  ? 0.4948 0.3298 0.3544 -0.0099 0.0036  -0.0197 219 ALA A O   
510  C  CB  . ALA A 73  ? 0.4331 0.2835 0.3097 -0.0069 -0.0066 -0.0292 219 ALA A CB  
511  N  N   . GLU A 74  ? 0.5135 0.3394 0.3575 -0.0040 -0.0095 -0.0243 220 GLU A N   
512  C  CA  . GLU A 74  ? 0.5162 0.3337 0.3517 -0.0032 -0.0111 -0.0211 220 GLU A CA  
513  C  C   . GLU A 74  ? 0.5669 0.3736 0.3899 -0.0051 -0.0022 -0.0168 220 GLU A C   
514  O  O   . GLU A 74  ? 0.5987 0.4033 0.4237 -0.0073 0.0015  -0.0134 220 GLU A O   
515  C  CB  . GLU A 74  ? 0.5145 0.3240 0.3385 0.0015  -0.0211 -0.0230 220 GLU A CB  
516  C  CG  . GLU A 74  ? 0.5349 0.3308 0.3444 0.0034  -0.0223 -0.0189 220 GLU A CG  
517  C  CD  . GLU A 74  ? 0.5697 0.3703 0.3915 0.0018  -0.0221 -0.0172 220 GLU A CD  
518  O  OE1 . GLU A 74  ? 0.5555 0.3701 0.3959 -0.0002 -0.0222 -0.0196 220 GLU A OE1 
519  O  OE2 . GLU A 74  ? 0.5744 0.3636 0.3862 0.0027  -0.0217 -0.0136 220 GLU A OE2 
520  N  N   . GLN A 75  ? 0.5497 0.3492 0.3601 -0.0045 0.0019  -0.0173 221 GLN A N   
521  C  CA  . GLN A 75  ? 0.5902 0.3787 0.3880 -0.0063 0.0121  -0.0135 221 GLN A CA  
522  C  C   . GLN A 75  ? 0.5676 0.3655 0.3829 -0.0110 0.0211  -0.0112 221 GLN A C   
523  O  O   . GLN A 75  ? 0.5369 0.3287 0.3493 -0.0135 0.0275  -0.0074 221 GLN A O   
524  C  CB  . GLN A 75  ? 0.6859 0.4667 0.4692 -0.0049 0.0158  -0.0155 221 GLN A CB  
525  C  CG  . GLN A 75  ? 0.8162 0.5806 0.5733 -0.0006 0.0096  -0.0160 221 GLN A CG  
526  C  CD  . GLN A 75  ? 0.9408 0.6974 0.6825 0.0006  0.0133  -0.0189 221 GLN A CD  
527  O  OE1 . GLN A 75  ? 0.9728 0.7389 0.7262 -0.0002 0.0142  -0.0231 221 GLN A OE1 
528  N  NE2 . GLN A 75  ? 1.0034 0.7415 0.7176 0.0026  0.0156  -0.0168 221 GLN A NE2 
529  N  N   . PHE A 76  ? 0.5986 0.4111 0.4323 -0.0123 0.0214  -0.0136 222 PHE A N   
530  C  CA  . PHE A 76  ? 0.6121 0.4353 0.4639 -0.0162 0.0280  -0.0119 222 PHE A CA  
531  C  C   . PHE A 76  ? 0.5894 0.4157 0.4491 -0.0184 0.0252  -0.0100 222 PHE A C   
532  O  O   . PHE A 76  ? 0.6179 0.4441 0.4829 -0.0219 0.0316  -0.0075 222 PHE A O   
533  C  CB  . PHE A 76  ? 0.6163 0.4537 0.4850 -0.0162 0.0265  -0.0144 222 PHE A CB  
534  C  CG  . PHE A 76  ? 0.6353 0.4850 0.5235 -0.0194 0.0304  -0.0128 222 PHE A CG  
535  C  CD1 . PHE A 76  ? 0.6939 0.5457 0.5887 -0.0210 0.0396  -0.0116 222 PHE A CD1 
536  C  CD2 . PHE A 76  ? 0.6408 0.4998 0.5407 -0.0206 0.0247  -0.0128 222 PHE A CD2 
537  C  CE1 . PHE A 76  ? 0.7328 0.5968 0.6470 -0.0236 0.0418  -0.0103 222 PHE A CE1 
538  C  CE2 . PHE A 76  ? 0.6600 0.5301 0.5767 -0.0233 0.0269  -0.0116 222 PHE A CE2 
539  C  CZ  . PHE A 76  ? 0.7041 0.5771 0.6285 -0.0248 0.0348  -0.0103 222 PHE A CZ  
540  N  N   . CYS A 77  ? 0.5554 0.3846 0.4167 -0.0164 0.0160  -0.0118 223 CYS A N   
541  C  CA  . CYS A 77  ? 0.5010 0.3323 0.3687 -0.0180 0.0130  -0.0110 223 CYS A CA  
542  C  C   . CYS A 77  ? 0.5025 0.3198 0.3582 -0.0191 0.0171  -0.0075 223 CYS A C   
543  O  O   . CYS A 77  ? 0.4849 0.3039 0.3487 -0.0231 0.0214  -0.0059 223 CYS A O   
544  C  CB  . CYS A 77  ? 0.4701 0.3035 0.3383 -0.0148 0.0033  -0.0137 223 CYS A CB  
545  S  SG  . CYS A 77  ? 0.4908 0.3408 0.3757 -0.0145 -0.0005 -0.0173 223 CYS A SG  
546  N  N   . VAL A 78  ? 0.5282 0.3313 0.3644 -0.0157 0.0156  -0.0065 224 VAL A N   
547  C  CA  . VAL A 78  ? 0.5441 0.3311 0.3655 -0.0163 0.0199  -0.0024 224 VAL A CA  
548  C  C   . VAL A 78  ? 0.6096 0.3960 0.4357 -0.0214 0.0321  0.0002  224 VAL A C   
549  O  O   . VAL A 78  ? 0.6233 0.4034 0.4498 -0.0246 0.0366  0.0030  224 VAL A O   
550  C  CB  . VAL A 78  ? 0.5186 0.2897 0.3155 -0.0115 0.0171  -0.0013 224 VAL A CB  
551  C  CG1 . VAL A 78  ? 0.4989 0.2515 0.2783 -0.0123 0.0238  0.0039  224 VAL A CG1 
552  C  CG2 . VAL A 78  ? 0.5131 0.2847 0.3080 -0.0064 0.0044  -0.0039 224 VAL A CG2 
553  N  N   . SER A 79  ? 0.6108 0.4041 0.4423 -0.0224 0.0376  -0.0010 225 SER A N   
554  C  CA  . SER A 79  ? 0.6104 0.4051 0.4497 -0.0269 0.0495  0.0009  225 SER A CA  
555  C  C   . SER A 79  ? 0.5684 0.3768 0.4313 -0.0316 0.0498  0.0004  225 SER A C   
556  O  O   . SER A 79  ? 0.6228 0.4314 0.4940 -0.0361 0.0585  0.0021  225 SER A O   
557  C  CB  . SER A 79  ? 0.5900 0.3902 0.4320 -0.0261 0.0546  -0.0009 225 SER A CB  
558  O  OG  . SER A 79  ? 0.5498 0.3684 0.4142 -0.0270 0.0515  -0.0035 225 SER A OG  
559  N  N   . ARG A 80  ? 0.4459 0.2658 0.3197 -0.0305 0.0404  -0.0022 226 ARG A N   
560  C  CA  . ARG A 80  ? 0.4682 0.3002 0.3615 -0.0345 0.0389  -0.0033 226 ARG A CA  
561  C  C   . ARG A 80  ? 0.4996 0.3251 0.3886 -0.0347 0.0334  -0.0032 226 ARG A C   
562  O  O   . ARG A 80  ? 0.4808 0.3156 0.3814 -0.0360 0.0279  -0.0055 226 ARG A O   
563  C  CB  . ARG A 80  ? 0.4898 0.3383 0.3974 -0.0333 0.0332  -0.0061 226 ARG A CB  
564  C  CG  . ARG A 80  ? 0.5466 0.4003 0.4577 -0.0319 0.0377  -0.0063 226 ARG A CG  
565  C  CD  . ARG A 80  ? 0.6132 0.4724 0.5379 -0.0357 0.0467  -0.0051 226 ARG A CD  
566  N  NE  . ARG A 80  ? 0.6617 0.5354 0.6026 -0.0350 0.0460  -0.0062 226 ARG A NE  
567  C  CZ  . ARG A 80  ? 0.7060 0.5805 0.6479 -0.0331 0.0517  -0.0063 226 ARG A CZ  
568  N  NH1 . ARG A 80  ? 0.7971 0.6587 0.7237 -0.0322 0.0588  -0.0056 226 ARG A NH1 
569  N  NH2 . ARG A 80  ? 0.6563 0.5435 0.6137 -0.0320 0.0504  -0.0070 226 ARG A NH2 
570  N  N   . ASN A 81  ? 0.4959 0.3044 0.3669 -0.0331 0.0350  -0.0006 227 ASN A N   
571  C  CA  . ASN A 81  ? 0.4994 0.2987 0.3648 -0.0327 0.0308  0.0000  227 ASN A CA  
572  C  C   . ASN A 81  ? 0.4666 0.2732 0.3365 -0.0295 0.0202  -0.0035 227 ASN A C   
573  O  O   . ASN A 81  ? 0.5241 0.3316 0.4006 -0.0311 0.0174  -0.0048 227 ASN A O   
574  C  CB  . ASN A 81  ? 0.5811 0.3799 0.4574 -0.0390 0.0366  0.0008  227 ASN A CB  
575  C  CG  . ASN A 81  ? 0.6444 0.4303 0.5134 -0.0388 0.0341  0.0018  227 ASN A CG  
576  O  OD1 . ASN A 81  ? 0.6606 0.4312 0.5111 -0.0344 0.0325  0.0045  227 ASN A OD1 
577  N  ND2 . ASN A 81  ? 0.6278 0.4192 0.5109 -0.0432 0.0333  -0.0005 227 ASN A ND2 
578  N  N   . SER A 82  ? 0.3802 0.1916 0.2471 -0.0251 0.0149  -0.0053 228 SER A N   
579  C  CA  . SER A 82  ? 0.3667 0.1846 0.2382 -0.0220 0.0059  -0.0087 228 SER A CA  
580  C  C   . SER A 82  ? 0.4281 0.2423 0.2890 -0.0163 0.0002  -0.0097 228 SER A C   
581  O  O   . SER A 82  ? 0.4433 0.2466 0.2893 -0.0143 0.0021  -0.0075 228 SER A O   
582  C  CB  . SER A 82  ? 0.4414 0.2766 0.3303 -0.0244 0.0048  -0.0116 228 SER A CB  
583  O  OG  . SER A 82  ? 0.4609 0.3029 0.3552 -0.0263 0.0099  -0.0108 228 SER A OG  
584  N  N   . HIS A 83  ? 0.4290 0.2522 0.2977 -0.0139 -0.0065 -0.0133 229 HIS A N   
585  C  CA  . HIS A 83  ? 0.4554 0.2779 0.3184 -0.0090 -0.0128 -0.0154 229 HIS A CA  
586  C  C   . HIS A 83  ? 0.4451 0.2826 0.3224 -0.0093 -0.0151 -0.0191 229 HIS A C   
587  O  O   . HIS A 83  ? 0.4920 0.3387 0.3811 -0.0121 -0.0136 -0.0199 229 HIS A O   
588  C  CB  . HIS A 83  ? 0.4878 0.3024 0.3453 -0.0046 -0.0199 -0.0160 229 HIS A CB  
589  C  CG  . HIS A 83  ? 0.5360 0.3333 0.3770 -0.0032 -0.0186 -0.0118 229 HIS A CG  
590  N  ND1 . HIS A 83  ? 0.5153 0.3009 0.3384 -0.0001 -0.0196 -0.0097 229 HIS A ND1 
591  C  CD2 . HIS A 83  ? 0.5513 0.3397 0.3898 -0.0045 -0.0162 -0.0092 229 HIS A CD2 
592  C  CE1 . HIS A 83  ? 0.5856 0.3554 0.3951 0.0007  -0.0175 -0.0054 229 HIS A CE1 
593  N  NE2 . HIS A 83  ? 0.5745 0.3457 0.3939 -0.0021 -0.0153 -0.0050 229 HIS A NE2 
594  N  N   . LEU A 84  ? 0.4236 0.2628 0.2990 -0.0063 -0.0189 -0.0214 230 LEU A N   
595  C  CA  . LEU A 84  ? 0.4036 0.2552 0.2923 -0.0062 -0.0215 -0.0251 230 LEU A CA  
596  C  C   . LEU A 84  ? 0.4406 0.2956 0.3372 -0.0056 -0.0248 -0.0268 230 LEU A C   
597  O  O   . LEU A 84  ? 0.4425 0.2898 0.3336 -0.0027 -0.0288 -0.0268 230 LEU A O   
598  C  CB  . LEU A 84  ? 0.3902 0.2412 0.2760 -0.0029 -0.0265 -0.0281 230 LEU A CB  
599  C  CG  . LEU A 84  ? 0.4117 0.2621 0.2931 -0.0039 -0.0225 -0.0279 230 LEU A CG  
600  C  CD1 . LEU A 84  ? 0.3923 0.2403 0.2692 -0.0007 -0.0285 -0.0318 230 LEU A CD1 
601  C  CD2 . LEU A 84  ? 0.3700 0.2315 0.2647 -0.0072 -0.0173 -0.0278 230 LEU A CD2 
602  N  N   . THR A 85  ? 0.3882 0.2538 0.2967 -0.0080 -0.0229 -0.0281 231 THR A N   
603  C  CA  . THR A 85  ? 0.3257 0.1940 0.2406 -0.0081 -0.0243 -0.0299 231 THR A CA  
604  C  C   . THR A 85  ? 0.3275 0.1960 0.2461 -0.0040 -0.0298 -0.0335 231 THR A C   
605  O  O   . THR A 85  ? 0.3673 0.2396 0.2896 -0.0021 -0.0324 -0.0358 231 THR A O   
606  C  CB  . THR A 85  ? 0.3276 0.2063 0.2519 -0.0114 -0.0210 -0.0305 231 THR A CB  
607  O  OG1 . THR A 85  ? 0.3979 0.2768 0.3251 -0.0119 -0.0216 -0.0323 231 THR A OG1 
608  C  CG2 . THR A 85  ? 0.3148 0.2014 0.2465 -0.0104 -0.0215 -0.0328 231 THR A CG2 
609  N  N   . SER A 86  ? 0.3368 0.2012 0.2557 -0.0026 -0.0315 -0.0343 232 SER A N   
610  C  CA  . SER A 86  ? 0.3629 0.2292 0.2891 0.0013  -0.0360 -0.0382 232 SER A CA  
611  C  C   . SER A 86  ? 0.3665 0.2420 0.3035 -0.0008 -0.0326 -0.0411 232 SER A C   
612  O  O   . SER A 86  ? 0.3243 0.2024 0.2605 -0.0049 -0.0281 -0.0397 232 SER A O   
613  C  CB  . SER A 86  ? 0.3835 0.2388 0.3037 0.0047  -0.0394 -0.0373 232 SER A CB  
614  O  OG  . SER A 86  ? 0.3945 0.2455 0.3115 0.0013  -0.0351 -0.0355 232 SER A OG  
615  N  N   . VAL A 87  ? 0.3745 0.2547 0.3215 0.0019  -0.0346 -0.0452 233 VAL A N   
616  C  CA  . VAL A 87  ? 0.3648 0.2518 0.3203 0.0003  -0.0305 -0.0482 233 VAL A CA  
617  C  C   . VAL A 87  ? 0.3777 0.2611 0.3376 0.0037  -0.0322 -0.0514 233 VAL A C   
618  O  O   . VAL A 87  ? 0.4501 0.3345 0.4176 0.0081  -0.0365 -0.0541 233 VAL A O   
619  C  CB  . VAL A 87  ? 0.3734 0.2703 0.3393 -0.0002 -0.0286 -0.0507 233 VAL A CB  
620  C  CG1 . VAL A 87  ? 0.3793 0.2815 0.3506 -0.0023 -0.0229 -0.0530 233 VAL A CG1 
621  C  CG2 . VAL A 87  ? 0.3608 0.2597 0.3227 -0.0028 -0.0274 -0.0476 233 VAL A CG2 
622  N  N   . THR A 88  ? 0.3806 0.2601 0.3366 0.0018  -0.0293 -0.0515 234 THR A N   
623  C  CA  . THR A 88  ? 0.4551 0.3287 0.4137 0.0051  -0.0305 -0.0542 234 THR A CA  
624  C  C   . THR A 88  ? 0.4815 0.3605 0.4483 0.0046  -0.0258 -0.0592 234 THR A C   
625  O  O   . THR A 88  ? 0.5016 0.3771 0.4735 0.0080  -0.0262 -0.0625 234 THR A O   
626  C  CB  . THR A 88  ? 0.5069 0.3691 0.4550 0.0037  -0.0307 -0.0514 234 THR A CB  
627  O  OG1 . THR A 88  ? 0.5541 0.4183 0.4980 -0.0021 -0.0261 -0.0509 234 THR A OG1 
628  C  CG2 . THR A 88  ? 0.5026 0.3575 0.4415 0.0048  -0.0344 -0.0465 234 THR A CG2 
629  N  N   . SER A 89  ? 0.4705 0.3570 0.4377 0.0007  -0.0210 -0.0595 235 SER A N   
630  C  CA  . SER A 89  ? 0.4431 0.3336 0.4150 -0.0002 -0.0153 -0.0639 235 SER A CA  
631  C  C   . SER A 89  ? 0.4045 0.3037 0.3783 -0.0032 -0.0108 -0.0634 235 SER A C   
632  O  O   . SER A 89  ? 0.3169 0.2185 0.2874 -0.0051 -0.0120 -0.0595 235 SER A O   
633  C  CB  . SER A 89  ? 0.4676 0.3519 0.4301 -0.0032 -0.0131 -0.0647 235 SER A CB  
634  O  OG  . SER A 89  ? 0.4612 0.3472 0.4149 -0.0079 -0.0125 -0.0611 235 SER A OG  
635  N  N   . GLU A 90  ? 0.4724 0.3751 0.4509 -0.0034 -0.0049 -0.0673 236 GLU A N   
636  C  CA  . GLU A 90  ? 0.5233 0.4320 0.5014 -0.0064 0.0006  -0.0664 236 GLU A CA  
637  C  C   . GLU A 90  ? 0.4945 0.4015 0.4587 -0.0104 0.0009  -0.0624 236 GLU A C   
638  O  O   . GLU A 90  ? 0.4402 0.3509 0.4025 -0.0123 0.0017  -0.0587 236 GLU A O   
639  C  CB  . GLU A 90  ? 0.5980 0.5086 0.5808 -0.0061 0.0083  -0.0713 236 GLU A CB  
640  C  CG  . GLU A 90  ? 0.6816 0.5977 0.6826 -0.0028 0.0098  -0.0752 236 GLU A CG  
641  C  CD  . GLU A 90  ? 0.7776 0.6982 0.7836 -0.0044 0.0197  -0.0779 236 GLU A CD  
642  O  OE1 . GLU A 90  ? 0.8144 0.7320 0.8070 -0.0075 0.0251  -0.0768 236 GLU A OE1 
643  O  OE2 . GLU A 90  ? 0.7960 0.7227 0.8192 -0.0026 0.0221  -0.0811 236 GLU A OE2 
644  N  N   . SER A 91  ? 0.4913 0.3927 0.4467 -0.0117 -0.0001 -0.0633 237 SER A N   
645  C  CA  . SER A 91  ? 0.4781 0.3788 0.4218 -0.0155 -0.0009 -0.0603 237 SER A CA  
646  C  C   . SER A 91  ? 0.4466 0.3489 0.3901 -0.0164 -0.0052 -0.0549 237 SER A C   
647  O  O   . SER A 91  ? 0.4554 0.3611 0.3947 -0.0186 -0.0049 -0.0514 237 SER A O   
648  C  CB  . SER A 91  ? 0.4674 0.3617 0.4036 -0.0171 -0.0021 -0.0631 237 SER A CB  
649  O  OG  . SER A 91  ? 0.6001 0.4889 0.5388 -0.0158 -0.0063 -0.0629 237 SER A OG  
650  N  N   . GLU A 92  ? 0.4059 0.3051 0.3532 -0.0144 -0.0091 -0.0542 238 GLU A N   
651  C  CA  . GLU A 92  ? 0.3901 0.2898 0.3364 -0.0150 -0.0122 -0.0496 238 GLU A CA  
652  C  C   . GLU A 92  ? 0.3963 0.3018 0.3478 -0.0142 -0.0110 -0.0478 238 GLU A C   
653  O  O   . GLU A 92  ? 0.4205 0.3284 0.3698 -0.0158 -0.0111 -0.0440 238 GLU A O   
654  C  CB  . GLU A 92  ? 0.3770 0.2698 0.3232 -0.0128 -0.0160 -0.0491 238 GLU A CB  
655  C  CG  . GLU A 92  ? 0.3913 0.2832 0.3346 -0.0134 -0.0181 -0.0446 238 GLU A CG  
656  C  CD  . GLU A 92  ? 0.4390 0.3219 0.3787 -0.0115 -0.0211 -0.0434 238 GLU A CD  
657  O  OE1 . GLU A 92  ? 0.4616 0.3406 0.4038 -0.0077 -0.0234 -0.0457 238 GLU A OE1 
658  O  OE2 . GLU A 92  ? 0.4569 0.3366 0.3915 -0.0135 -0.0211 -0.0399 238 GLU A OE2 
659  N  N   . GLN A 93  ? 0.3353 0.2433 0.2951 -0.0117 -0.0098 -0.0509 239 GLN A N   
660  C  CA  . GLN A 93  ? 0.3550 0.2683 0.3213 -0.0116 -0.0080 -0.0501 239 GLN A CA  
661  C  C   . GLN A 93  ? 0.4327 0.3492 0.3947 -0.0146 -0.0034 -0.0475 239 GLN A C   
662  O  O   . GLN A 93  ? 0.4033 0.3219 0.3653 -0.0155 -0.0032 -0.0442 239 GLN A O   
663  C  CB  . GLN A 93  ? 0.3405 0.2569 0.3187 -0.0092 -0.0065 -0.0548 239 GLN A CB  
664  C  CG  . GLN A 93  ? 0.4191 0.3410 0.4061 -0.0096 -0.0044 -0.0549 239 GLN A CG  
665  C  CD  . GLN A 93  ? 0.4490 0.3706 0.4385 -0.0081 -0.0102 -0.0541 239 GLN A CD  
666  O  OE1 . GLN A 93  ? 0.4610 0.3776 0.4425 -0.0073 -0.0148 -0.0519 239 GLN A OE1 
667  N  NE2 . GLN A 93  ? 0.4258 0.3520 0.4261 -0.0080 -0.0095 -0.0561 239 GLN A NE2 
668  N  N   . GLU A 94  ? 0.4186 0.3345 0.3760 -0.0157 0.0002  -0.0491 240 GLU A N   
669  C  CA  . GLU A 94  ? 0.4661 0.3835 0.4167 -0.0180 0.0040  -0.0464 240 GLU A CA  
670  C  C   . GLU A 94  ? 0.4307 0.3479 0.3739 -0.0197 0.0003  -0.0418 240 GLU A C   
671  O  O   . GLU A 94  ? 0.4177 0.3369 0.3592 -0.0204 0.0015  -0.0379 240 GLU A O   
672  C  CB  . GLU A 94  ? 0.5420 0.4573 0.4863 -0.0187 0.0081  -0.0495 240 GLU A CB  
673  C  CG  . GLU A 94  ? 0.6366 0.5515 0.5693 -0.0208 0.0105  -0.0463 240 GLU A CG  
674  C  CD  . GLU A 94  ? 0.7334 0.6451 0.6577 -0.0214 0.0154  -0.0499 240 GLU A CD  
675  O  OE1 . GLU A 94  ? 0.7764 0.6874 0.7072 -0.0201 0.0193  -0.0547 240 GLU A OE1 
676  O  OE2 . GLU A 94  ? 0.7560 0.6656 0.6670 -0.0229 0.0153  -0.0479 240 GLU A OE2 
677  N  N   . PHE A 95  ? 0.3822 0.2966 0.3219 -0.0202 -0.0038 -0.0423 241 PHE A N   
678  C  CA  . PHE A 95  ? 0.3331 0.2484 0.2691 -0.0219 -0.0071 -0.0384 241 PHE A CA  
679  C  C   . PHE A 95  ? 0.3598 0.2771 0.3009 -0.0211 -0.0077 -0.0350 241 PHE A C   
680  O  O   . PHE A 95  ? 0.4014 0.3213 0.3416 -0.0219 -0.0081 -0.0311 241 PHE A O   
681  C  CB  . PHE A 95  ? 0.2954 0.2069 0.2295 -0.0230 -0.0106 -0.0399 241 PHE A CB  
682  C  CG  . PHE A 95  ? 0.3462 0.2587 0.2810 -0.0245 -0.0132 -0.0363 241 PHE A CG  
683  C  CD1 . PHE A 95  ? 0.3796 0.2959 0.3120 -0.0266 -0.0147 -0.0340 241 PHE A CD1 
684  C  CD2 . PHE A 95  ? 0.3503 0.2599 0.2881 -0.0235 -0.0140 -0.0352 241 PHE A CD2 
685  C  CE1 . PHE A 95  ? 0.3560 0.2743 0.2919 -0.0278 -0.0164 -0.0310 241 PHE A CE1 
686  C  CE2 . PHE A 95  ? 0.3555 0.2659 0.2944 -0.0250 -0.0149 -0.0320 241 PHE A CE2 
687  C  CZ  . PHE A 95  ? 0.3373 0.2526 0.2766 -0.0272 -0.0158 -0.0301 241 PHE A CZ  
688  N  N   . LEU A 96  ? 0.3599 0.2755 0.3063 -0.0192 -0.0082 -0.0366 242 LEU A N   
689  C  CA  . LEU A 96  ? 0.3655 0.2817 0.3153 -0.0183 -0.0089 -0.0343 242 LEU A CA  
690  C  C   . LEU A 96  ? 0.3863 0.3060 0.3398 -0.0182 -0.0057 -0.0327 242 LEU A C   
691  O  O   . LEU A 96  ? 0.3371 0.2579 0.2906 -0.0186 -0.0054 -0.0293 242 LEU A O   
692  C  CB  . LEU A 96  ? 0.3146 0.2274 0.2674 -0.0159 -0.0114 -0.0369 242 LEU A CB  
693  C  CG  . LEU A 96  ? 0.2993 0.2063 0.2474 -0.0156 -0.0144 -0.0370 242 LEU A CG  
694  C  CD1 . LEU A 96  ? 0.3518 0.2547 0.3016 -0.0124 -0.0175 -0.0394 242 LEU A CD1 
695  C  CD2 . LEU A 96  ? 0.3061 0.2118 0.2503 -0.0172 -0.0145 -0.0331 242 LEU A CD2 
696  N  N   . TYR A 97  ? 0.3898 0.3108 0.3472 -0.0178 -0.0027 -0.0352 243 TYR A N   
697  C  CA  . TYR A 97  ? 0.3773 0.3005 0.3390 -0.0181 0.0012  -0.0337 243 TYR A CA  
698  C  C   . TYR A 97  ? 0.4219 0.3455 0.3769 -0.0194 0.0034  -0.0292 243 TYR A C   
699  O  O   . TYR A 97  ? 0.4588 0.3828 0.4151 -0.0193 0.0047  -0.0258 243 TYR A O   
700  C  CB  . TYR A 97  ? 0.3603 0.2850 0.3302 -0.0178 0.0048  -0.0377 243 TYR A CB  
701  C  CG  . TYR A 97  ? 0.3873 0.3120 0.3540 -0.0188 0.0102  -0.0383 243 TYR A CG  
702  C  CD1 . TYR A 97  ? 0.3859 0.3101 0.3483 -0.0201 0.0152  -0.0346 243 TYR A CD1 
703  C  CD2 . TYR A 97  ? 0.4114 0.3359 0.3790 -0.0181 0.0109  -0.0427 243 TYR A CD2 
704  C  CE1 . TYR A 97  ? 0.3994 0.3221 0.3563 -0.0210 0.0208  -0.0350 243 TYR A CE1 
705  C  CE2 . TYR A 97  ? 0.4467 0.3703 0.4102 -0.0191 0.0168  -0.0438 243 TYR A CE2 
706  C  CZ  . TYR A 97  ? 0.4655 0.3880 0.4227 -0.0206 0.0219  -0.0399 243 TYR A CZ  
707  O  OH  . TYR A 97  ? 0.4775 0.3977 0.4278 -0.0214 0.0284  -0.0407 243 TYR A OH  
708  N  N   . LYS A 98  ? 0.4226 0.3456 0.3701 -0.0201 0.0033  -0.0294 244 LYS A N   
709  C  CA  . LYS A 98  ? 0.4190 0.3421 0.3585 -0.0208 0.0037  -0.0252 244 LYS A CA  
710  C  C   . LYS A 98  ? 0.4021 0.3269 0.3417 -0.0207 -0.0005 -0.0214 244 LYS A C   
711  O  O   . LYS A 98  ? 0.4315 0.3570 0.3696 -0.0202 -0.0001 -0.0170 244 LYS A O   
712  C  CB  . LYS A 98  ? 0.4120 0.3335 0.3419 -0.0218 0.0036  -0.0270 244 LYS A CB  
713  C  CG  . LYS A 98  ? 0.4957 0.4152 0.4237 -0.0218 0.0101  -0.0294 244 LYS A CG  
714  C  CD  . LYS A 98  ? 0.5520 0.4687 0.4681 -0.0227 0.0105  -0.0315 244 LYS A CD  
715  C  CE  . LYS A 98  ? 0.5833 0.4973 0.4960 -0.0228 0.0188  -0.0329 244 LYS A CE  
716  N  NZ  . LYS A 98  ? 0.6153 0.5255 0.5155 -0.0235 0.0201  -0.0363 244 LYS A NZ  
717  N  N   . THR A 99  ? 0.3652 0.2902 0.3068 -0.0211 -0.0041 -0.0230 245 THR A N   
718  C  CA  . THR A 99  ? 0.3695 0.2965 0.3128 -0.0213 -0.0070 -0.0199 245 THR A CA  
719  C  C   . THR A 99  ? 0.4005 0.3275 0.3500 -0.0200 -0.0051 -0.0180 245 THR A C   
720  O  O   . THR A 99  ? 0.3785 0.3075 0.3306 -0.0196 -0.0057 -0.0148 245 THR A O   
721  C  CB  . THR A 99  ? 0.3578 0.2840 0.3010 -0.0226 -0.0102 -0.0220 245 THR A CB  
722  O  OG1 . THR A 99  ? 0.3919 0.3174 0.3294 -0.0240 -0.0118 -0.0245 245 THR A OG1 
723  C  CG2 . THR A 99  ? 0.3152 0.2443 0.2619 -0.0233 -0.0121 -0.0190 245 THR A CG2 
724  N  N   . ALA A 100 ? 0.4250 0.3500 0.3777 -0.0192 -0.0030 -0.0206 246 ALA A N   
725  C  CA  . ALA A 100 ? 0.4231 0.3472 0.3809 -0.0182 -0.0014 -0.0200 246 ALA A CA  
726  C  C   . ALA A 100 ? 0.4445 0.3695 0.4036 -0.0177 0.0014  -0.0159 246 ALA A C   
727  O  O   . ALA A 100 ? 0.4915 0.4158 0.4546 -0.0169 0.0027  -0.0144 246 ALA A O   
728  C  CB  . ALA A 100 ? 0.3601 0.2825 0.3218 -0.0177 -0.0006 -0.0243 246 ALA A CB  
729  N  N   . GLY A 101 ? 0.4308 0.3564 0.3858 -0.0181 0.0026  -0.0140 247 GLY A N   
730  C  CA  . GLY A 101 ? 0.4255 0.3505 0.3794 -0.0171 0.0046  -0.0091 247 GLY A CA  
731  C  C   . GLY A 101 ? 0.4013 0.3236 0.3609 -0.0167 0.0093  -0.0086 247 GLY A C   
732  O  O   . GLY A 101 ? 0.3708 0.2916 0.3311 -0.0154 0.0110  -0.0041 247 GLY A O   
733  N  N   . GLY A 102 ? 0.4060 0.3274 0.3704 -0.0176 0.0111  -0.0133 248 GLY A N   
734  C  CA  . GLY A 102 ? 0.4117 0.3307 0.3831 -0.0180 0.0154  -0.0140 248 GLY A CA  
735  C  C   . GLY A 102 ? 0.4231 0.3413 0.3999 -0.0174 0.0138  -0.0163 248 GLY A C   
736  O  O   . GLY A 102 ? 0.4508 0.3668 0.4341 -0.0179 0.0165  -0.0183 248 GLY A O   
737  N  N   . LEU A 103 ? 0.3577 0.2771 0.3315 -0.0165 0.0099  -0.0162 249 LEU A N   
738  C  CA  . LEU A 103 ? 0.3537 0.2712 0.3298 -0.0159 0.0088  -0.0185 249 LEU A CA  
739  C  C   . LEU A 103 ? 0.4007 0.3177 0.3767 -0.0162 0.0057  -0.0241 249 LEU A C   
740  O  O   . LEU A 103 ? 0.3655 0.2842 0.3398 -0.0166 0.0038  -0.0256 249 LEU A O   
741  C  CB  . LEU A 103 ? 0.3109 0.2292 0.2841 -0.0148 0.0075  -0.0156 249 LEU A CB  
742  C  CG  . LEU A 103 ? 0.3229 0.2428 0.2975 -0.0137 0.0090  -0.0099 249 LEU A CG  
743  C  CD1 . LEU A 103 ? 0.3073 0.2286 0.2833 -0.0126 0.0085  -0.0082 249 LEU A CD1 
744  C  CD2 . LEU A 103 ? 0.3451 0.2617 0.3239 -0.0131 0.0131  -0.0084 249 LEU A CD2 
745  N  N   . ILE A 104 ? 0.4141 0.3281 0.3914 -0.0158 0.0049  -0.0273 250 ILE A N   
746  C  CA  . ILE A 104 ? 0.3471 0.2597 0.3232 -0.0154 0.0006  -0.0324 250 ILE A CA  
747  C  C   . ILE A 104 ? 0.3434 0.2530 0.3107 -0.0143 -0.0022 -0.0318 250 ILE A C   
748  O  O   . ILE A 104 ? 0.3742 0.2812 0.3382 -0.0139 -0.0004 -0.0300 250 ILE A O   
749  C  CB  . ILE A 104 ? 0.3503 0.2604 0.3314 -0.0156 0.0003  -0.0369 250 ILE A CB  
750  C  CG1 . ILE A 104 ? 0.3425 0.2548 0.3338 -0.0173 0.0043  -0.0374 250 ILE A CG1 
751  C  CG2 . ILE A 104 ? 0.3893 0.2983 0.3689 -0.0146 -0.0058 -0.0423 250 ILE A CG2 
752  C  CD1 . ILE A 104 ? 0.3917 0.3016 0.3900 -0.0182 0.0046  -0.0422 250 ILE A CD1 
753  N  N   . TYR A 105 ? 0.3133 0.2228 0.2771 -0.0138 -0.0059 -0.0332 251 TYR A N   
754  C  CA  . TYR A 105 ? 0.2991 0.2045 0.2540 -0.0131 -0.0079 -0.0322 251 TYR A CA  
755  C  C   . TYR A 105 ? 0.3396 0.2410 0.2904 -0.0113 -0.0133 -0.0361 251 TYR A C   
756  O  O   . TYR A 105 ? 0.3294 0.2335 0.2854 -0.0108 -0.0159 -0.0387 251 TYR A O   
757  C  CB  . TYR A 105 ? 0.2595 0.1673 0.2129 -0.0141 -0.0075 -0.0292 251 TYR A CB  
758  C  CG  . TYR A 105 ? 0.2421 0.1536 0.1980 -0.0152 -0.0039 -0.0250 251 TYR A CG  
759  C  CD1 . TYR A 105 ? 0.2651 0.1756 0.2184 -0.0156 -0.0024 -0.0223 251 TYR A CD1 
760  C  CD2 . TYR A 105 ? 0.2746 0.1904 0.2355 -0.0158 -0.0021 -0.0236 251 TYR A CD2 
761  C  CE1 . TYR A 105 ? 0.3172 0.2322 0.2749 -0.0162 -0.0002 -0.0188 251 TYR A CE1 
762  C  CE2 . TYR A 105 ? 0.3243 0.2432 0.2868 -0.0162 -0.0002 -0.0195 251 TYR A CE2 
763  C  CZ  . TYR A 105 ? 0.3441 0.2632 0.3058 -0.0162 0.0001  -0.0172 251 TYR A CZ  
764  O  OH  . TYR A 105 ? 0.4145 0.3377 0.3799 -0.0161 0.0010  -0.0134 251 TYR A OH  
765  N  N   . TRP A 106 ? 0.3233 0.2179 0.2646 -0.0101 -0.0147 -0.0363 252 TRP A N   
766  C  CA  . TRP A 106 ? 0.3456 0.2346 0.2797 -0.0078 -0.0206 -0.0387 252 TRP A CA  
767  C  C   . TRP A 106 ? 0.4034 0.2920 0.3357 -0.0077 -0.0217 -0.0368 252 TRP A C   
768  O  O   . TRP A 106 ? 0.3964 0.2859 0.3277 -0.0095 -0.0179 -0.0332 252 TRP A O   
769  C  CB  . TRP A 106 ? 0.3399 0.2196 0.2601 -0.0068 -0.0203 -0.0379 252 TRP A CB  
770  C  CG  . TRP A 106 ? 0.3943 0.2707 0.3115 -0.0061 -0.0212 -0.0413 252 TRP A CG  
771  C  CD1 . TRP A 106 ? 0.4172 0.2892 0.3282 -0.0067 -0.0163 -0.0404 252 TRP A CD1 
772  C  CD2 . TRP A 106 ? 0.3697 0.2465 0.2901 -0.0047 -0.0275 -0.0469 252 TRP A CD2 
773  N  NE1 . TRP A 106 ? 0.4529 0.3217 0.3615 -0.0058 -0.0190 -0.0452 252 TRP A NE1 
774  C  CE2 . TRP A 106 ? 0.4272 0.2991 0.3418 -0.0047 -0.0263 -0.0493 252 TRP A CE2 
775  C  CE3 . TRP A 106 ? 0.3216 0.2027 0.2505 -0.0034 -0.0339 -0.0506 252 TRP A CE3 
776  C  CZ2 . TRP A 106 ? 0.3779 0.2490 0.2944 -0.0039 -0.0321 -0.0555 252 TRP A CZ2 
777  C  CZ3 . TRP A 106 ? 0.3337 0.2152 0.2664 -0.0025 -0.0396 -0.0565 252 TRP A CZ3 
778  C  CH2 . TRP A 106 ? 0.3081 0.1845 0.2343 -0.0029 -0.0390 -0.0590 252 TRP A CH2 
779  N  N   . ILE A 107 ? 0.4264 0.3136 0.3591 -0.0053 -0.0273 -0.0395 253 ILE A N   
780  C  CA  . ILE A 107 ? 0.3793 0.2632 0.3082 -0.0045 -0.0288 -0.0380 253 ILE A CA  
781  C  C   . ILE A 107 ? 0.3970 0.2718 0.3159 -0.0008 -0.0350 -0.0388 253 ILE A C   
782  O  O   . ILE A 107 ? 0.4037 0.2744 0.3164 0.0008  -0.0380 -0.0403 253 ILE A O   
783  C  CB  . ILE A 107 ? 0.3735 0.2644 0.3136 -0.0048 -0.0288 -0.0399 253 ILE A CB  
784  C  CG1 . ILE A 107 ? 0.3647 0.2601 0.3149 -0.0027 -0.0329 -0.0448 253 ILE A CG1 
785  C  CG2 . ILE A 107 ? 0.3496 0.2472 0.2952 -0.0082 -0.0228 -0.0380 253 ILE A CG2 
786  C  CD1 . ILE A 107 ? 0.3537 0.2554 0.3151 -0.0029 -0.0315 -0.0471 253 ILE A CD1 
787  N  N   . GLY A 108 ? 0.3722 0.2428 0.2884 0.0007  -0.0372 -0.0379 254 GLY A N   
788  C  CA  . GLY A 108 ? 0.3975 0.2573 0.3019 0.0046  -0.0428 -0.0372 254 GLY A CA  
789  C  C   . GLY A 108 ? 0.4303 0.2913 0.3394 0.0091  -0.0515 -0.0416 254 GLY A C   
790  O  O   . GLY A 108 ? 0.5243 0.3764 0.4242 0.0132  -0.0576 -0.0411 254 GLY A O   
791  N  N   . LEU A 109 ? 0.4512 0.3228 0.3749 0.0083  -0.0522 -0.0460 255 LEU A N   
792  C  CA  . LEU A 109 ? 0.4614 0.3364 0.3937 0.0120  -0.0604 -0.0511 255 LEU A CA  
793  C  C   . LEU A 109 ? 0.5065 0.3749 0.4272 0.0143  -0.0668 -0.0524 255 LEU A C   
794  O  O   . LEU A 109 ? 0.5269 0.3950 0.4431 0.0117  -0.0634 -0.0525 255 LEU A O   
795  C  CB  . LEU A 109 ? 0.4378 0.3257 0.3897 0.0096  -0.0578 -0.0554 255 LEU A CB  
796  C  CG  . LEU A 109 ? 0.4847 0.3798 0.4503 0.0090  -0.0541 -0.0564 255 LEU A CG  
797  C  CD1 . LEU A 109 ? 0.4751 0.3814 0.4580 0.0062  -0.0501 -0.0602 255 LEU A CD1 
798  C  CD2 . LEU A 109 ? 0.5178 0.4109 0.4872 0.0140  -0.0611 -0.0585 255 LEU A CD2 
799  N  N   . THR A 110 ? 0.4355 0.2980 0.3509 0.0196  -0.0763 -0.0536 256 THR A N   
800  C  CA  . THR A 110 ? 0.4805 0.3349 0.3815 0.0225  -0.0838 -0.0550 256 THR A CA  
801  C  C   . THR A 110 ? 0.5147 0.3706 0.4222 0.0282  -0.0967 -0.0596 256 THR A C   
802  O  O   . THR A 110 ? 0.5197 0.3750 0.4322 0.0319  -0.1004 -0.0587 256 THR A O   
803  C  CB  . THR A 110 ? 0.5014 0.3398 0.3767 0.0234  -0.0816 -0.0488 256 THR A CB  
804  O  OG1 . THR A 110 ? 0.5013 0.3308 0.3598 0.0258  -0.0878 -0.0502 256 THR A OG1 
805  C  CG2 . THR A 110 ? 0.4892 0.3198 0.3591 0.0272  -0.0845 -0.0450 256 THR A CG2 
806  N  N   . LYS A 111 ? 0.5315 0.3895 0.4401 0.0290  -0.1037 -0.0648 257 LYS A N   
807  C  CA  . LYS A 111 ? 0.5663 0.4276 0.4836 0.0342  -0.1172 -0.0702 257 LYS A CA  
808  C  C   . LYS A 111 ? 0.6004 0.4471 0.4922 0.0390  -0.1271 -0.0693 257 LYS A C   
809  O  O   . LYS A 111 ? 0.6141 0.4535 0.4888 0.0367  -0.1244 -0.0688 257 LYS A O   
810  C  CB  . LYS A 111 ? 0.5777 0.4532 0.5178 0.0313  -0.1187 -0.0781 257 LYS A CB  
811  C  CG  . LYS A 111 ? 0.6202 0.5038 0.5780 0.0359  -0.1318 -0.0850 257 LYS A CG  
812  C  CD  . LYS A 111 ? 0.6533 0.5491 0.6314 0.0317  -0.1323 -0.0929 257 LYS A CD  
813  C  CE  . LYS A 111 ? 0.6855 0.5946 0.6919 0.0344  -0.1411 -0.1001 257 LYS A CE  
814  N  NZ  . LYS A 111 ? 0.7519 0.6564 0.7512 0.0414  -0.1585 -0.1032 257 LYS A NZ  
815  N  N   . ALA A 112 ? 0.6505 0.4922 0.5387 0.0458  -0.1382 -0.0688 258 ALA A N   
816  C  CA  . ALA A 112 ? 0.6824 0.5090 0.5444 0.0513  -0.1491 -0.0675 258 ALA A CA  
817  C  C   . ALA A 112 ? 0.7048 0.5362 0.5703 0.0522  -0.1604 -0.0758 258 ALA A C   
818  O  O   . ALA A 112 ? 0.7235 0.5582 0.5971 0.0579  -0.1748 -0.0801 258 ALA A O   
819  C  CB  . ALA A 112 ? 0.6418 0.4608 0.4993 0.0590  -0.1581 -0.0640 258 ALA A CB  
820  N  N   . GLY A 113 ? 0.7266 0.5584 0.5870 0.0467  -0.1542 -0.0783 259 GLY A N   
821  C  CA  . GLY A 113 ? 0.7301 0.5653 0.5927 0.0466  -0.1638 -0.0867 259 GLY A CA  
822  C  C   . GLY A 113 ? 0.7044 0.5582 0.6019 0.0465  -0.1709 -0.0949 259 GLY A C   
823  O  O   . GLY A 113 ? 0.6796 0.5450 0.6008 0.0451  -0.1650 -0.0941 259 GLY A O   
824  N  N   . MET A 114 ? 0.7013 0.5580 0.6021 0.0477  -0.1835 -0.1032 260 MET A N   
825  C  CA  . MET A 114 ? 0.6613 0.5361 0.5969 0.0474  -0.1910 -0.1119 260 MET A CA  
826  C  C   . MET A 114 ? 0.6413 0.5214 0.5911 0.0539  -0.1987 -0.1104 260 MET A C   
827  O  O   . MET A 114 ? 0.6854 0.5533 0.6146 0.0610  -0.2078 -0.1059 260 MET A O   
828  C  CB  . MET A 114 ? 0.6699 0.5449 0.6035 0.0484  -0.2058 -0.1212 260 MET A CB  
829  C  CG  . MET A 114 ? 0.6825 0.5523 0.6040 0.0421  -0.1988 -0.1243 260 MET A CG  
830  S  SD  . MET A 114 ? 1.1074 0.9733 1.0193 0.0442  -0.2180 -0.1354 260 MET A SD  
831  C  CE  . MET A 114 ? 0.4651 0.3547 0.4245 0.0441  -0.2291 -0.1458 260 MET A CE  
832  N  N   . GLU A 115 ? 0.5974 0.4946 0.5819 0.0517  -0.1944 -0.1140 261 GLU A N   
833  C  CA  . GLU A 115 ? 0.6293 0.5336 0.6325 0.0577  -0.2009 -0.1140 261 GLU A CA  
834  C  C   . GLU A 115 ? 0.6765 0.5692 0.6623 0.0615  -0.1951 -0.1040 261 GLU A C   
835  O  O   . GLU A 115 ? 0.6997 0.5962 0.6991 0.0669  -0.1992 -0.1032 261 GLU A O   
836  C  CB  . GLU A 115 ? 0.6387 0.5448 0.6461 0.0650  -0.2222 -0.1203 261 GLU A CB  
837  C  CG  . GLU A 115 ? 0.6646 0.5876 0.7022 0.0615  -0.2283 -0.1319 261 GLU A CG  
838  C  CD  . GLU A 115 ? 0.7367 0.6624 0.7795 0.0688  -0.2509 -0.1387 261 GLU A CD  
839  O  OE1 . GLU A 115 ? 0.7613 0.6767 0.7870 0.0775  -0.2619 -0.1340 261 GLU A OE1 
840  O  OE2 . GLU A 115 ? 0.7439 0.6817 0.8082 0.0657  -0.2580 -0.1489 261 GLU A OE2 
841  N  N   . GLY A 116 ? 0.6708 0.5493 0.6280 0.0587  -0.1854 -0.0966 262 GLY A N   
842  C  CA  . GLY A 116 ? 0.7062 0.5735 0.6480 0.0609  -0.1786 -0.0875 262 GLY A CA  
843  C  C   . GLY A 116 ? 0.6780 0.5564 0.6427 0.0571  -0.1655 -0.0865 262 GLY A C   
844  O  O   . GLY A 116 ? 0.7040 0.5958 0.6897 0.0512  -0.1580 -0.0910 262 GLY A O   
845  N  N   . ASP A 117 ? 0.6253 0.4971 0.5852 0.0604  -0.1626 -0.0806 263 ASP A N   
846  C  CA  . ASP A 117 ? 0.6420 0.5219 0.6192 0.0568  -0.1498 -0.0795 263 ASP A CA  
847  C  C   . ASP A 117 ? 0.5618 0.4372 0.5254 0.0494  -0.1349 -0.0744 263 ASP A C   
848  O  O   . ASP A 117 ? 0.5623 0.4264 0.5018 0.0479  -0.1339 -0.0707 263 ASP A O   
849  C  CB  . ASP A 117 ? 0.7201 0.5941 0.6978 0.0630  -0.1522 -0.0759 263 ASP A CB  
850  C  CG  . ASP A 117 ? 0.7998 0.6855 0.8051 0.0689  -0.1620 -0.0822 263 ASP A CG  
851  O  OD1 . ASP A 117 ? 0.8220 0.7234 0.8549 0.0656  -0.1557 -0.0876 263 ASP A OD1 
852  O  OD2 . ASP A 117 ? 0.8364 0.7153 0.8359 0.0771  -0.1757 -0.0818 263 ASP A OD2 
853  N  N   . TRP A 118 ? 0.4866 0.3709 0.4658 0.0449  -0.1235 -0.0746 264 TRP A N   
854  C  CA  . TRP A 118 ? 0.4459 0.3269 0.4142 0.0385  -0.1103 -0.0697 264 TRP A CA  
855  C  C   . TRP A 118 ? 0.4983 0.3677 0.4521 0.0400  -0.1065 -0.0631 264 TRP A C   
856  O  O   . TRP A 118 ? 0.5453 0.4144 0.5072 0.0443  -0.1093 -0.0634 264 TRP A O   
857  C  CB  . TRP A 118 ? 0.3727 0.2676 0.3622 0.0329  -0.1002 -0.0728 264 TRP A CB  
858  C  CG  . TRP A 118 ? 0.3689 0.2722 0.3679 0.0292  -0.1002 -0.0776 264 TRP A CG  
859  C  CD1 . TRP A 118 ? 0.3847 0.2996 0.4063 0.0298  -0.1053 -0.0848 264 TRP A CD1 
860  C  CD2 . TRP A 118 ? 0.3958 0.2962 0.3834 0.0242  -0.0946 -0.0759 264 TRP A CD2 
861  N  NE1 . TRP A 118 ? 0.4632 0.3818 0.4873 0.0252  -0.1032 -0.0877 264 TRP A NE1 
862  C  CE2 . TRP A 118 ? 0.4121 0.3216 0.4152 0.0220  -0.0967 -0.0822 264 TRP A CE2 
863  C  CE3 . TRP A 118 ? 0.3816 0.2727 0.3489 0.0215  -0.0878 -0.0698 264 TRP A CE3 
864  C  CZ2 . TRP A 118 ? 0.3188 0.2275 0.3166 0.0174  -0.0921 -0.0825 264 TRP A CZ2 
865  C  CZ3 . TRP A 118 ? 0.3664 0.2576 0.3293 0.0173  -0.0834 -0.0701 264 TRP A CZ3 
866  C  CH2 . TRP A 118 ? 0.3477 0.2471 0.3251 0.0154  -0.0856 -0.0764 264 TRP A CH2 
867  N  N   . SER A 119 ? 0.4578 0.3174 0.3913 0.0366  -0.1000 -0.0575 265 SER A N   
868  C  CA  . SER A 119 ? 0.4744 0.3228 0.3950 0.0368  -0.0952 -0.0514 265 SER A CA  
869  C  C   . SER A 119 ? 0.4749 0.3220 0.3874 0.0300  -0.0833 -0.0476 265 SER A C   
870  O  O   . SER A 119 ? 0.4812 0.3342 0.3952 0.0258  -0.0795 -0.0488 265 SER A O   
871  C  CB  . SER A 119 ? 0.5052 0.3370 0.4041 0.0425  -0.1031 -0.0473 265 SER A CB  
872  O  OG  . SER A 119 ? 0.5533 0.3766 0.4318 0.0405  -0.1019 -0.0446 265 SER A OG  
873  N  N   . TRP A 120 ? 0.4670 0.3067 0.3726 0.0288  -0.0779 -0.0431 266 TRP A N   
874  C  CA  . TRP A 120 ? 0.4821 0.3206 0.3812 0.0226  -0.0677 -0.0394 266 TRP A CA  
875  C  C   . TRP A 120 ? 0.5051 0.3286 0.3818 0.0227  -0.0664 -0.0339 266 TRP A C   
876  O  O   . TRP A 120 ? 0.5027 0.3135 0.3678 0.0268  -0.0704 -0.0309 266 TRP A O   
877  C  CB  . TRP A 120 ? 0.4543 0.2944 0.3609 0.0204  -0.0619 -0.0388 266 TRP A CB  
878  C  CG  . TRP A 120 ? 0.4338 0.2877 0.3603 0.0194  -0.0603 -0.0438 266 TRP A CG  
879  C  CD1 . TRP A 120 ? 0.4165 0.2732 0.3549 0.0228  -0.0629 -0.0471 266 TRP A CD1 
880  C  CD2 . TRP A 120 ? 0.3832 0.2491 0.3195 0.0149  -0.0550 -0.0459 266 TRP A CD2 
881  N  NE1 . TRP A 120 ? 0.4358 0.3055 0.3903 0.0203  -0.0587 -0.0512 266 TRP A NE1 
882  C  CE2 . TRP A 120 ? 0.4136 0.2887 0.3664 0.0154  -0.0540 -0.0503 266 TRP A CE2 
883  C  CE3 . TRP A 120 ? 0.3451 0.2141 0.2777 0.0107  -0.0506 -0.0443 266 TRP A CE3 
884  C  CZ2 . TRP A 120 ? 0.3555 0.2417 0.3194 0.0117  -0.0485 -0.0526 266 TRP A CZ2 
885  C  CZ3 . TRP A 120 ? 0.3385 0.2188 0.2830 0.0073  -0.0459 -0.0466 266 TRP A CZ3 
886  C  CH2 . TRP A 120 ? 0.3043 0.1926 0.2634 0.0078  -0.0449 -0.0505 266 TRP A CH2 
887  N  N   . VAL A 121 ? 0.5085 0.3327 0.3791 0.0183  -0.0602 -0.0323 267 VAL A N   
888  C  CA  . VAL A 121 ? 0.5495 0.3596 0.3990 0.0179  -0.0574 -0.0274 267 VAL A CA  
889  C  C   . VAL A 121 ? 0.5585 0.3591 0.4016 0.0160  -0.0514 -0.0225 267 VAL A C   
890  O  O   . VAL A 121 ? 0.5946 0.3807 0.4196 0.0166  -0.0494 -0.0179 267 VAL A O   
891  C  CB  . VAL A 121 ? 0.5106 0.3243 0.3573 0.0136  -0.0508 -0.0273 267 VAL A CB  
892  C  CG1 . VAL A 121 ? 0.5002 0.3209 0.3564 0.0078  -0.0412 -0.0256 267 VAL A CG1 
893  C  CG2 . VAL A 121 ? 0.4758 0.2743 0.2993 0.0149  -0.0498 -0.0238 267 VAL A CG2 
894  N  N   . ASP A 122 ? 0.5487 0.3568 0.4061 0.0135  -0.0482 -0.0235 268 ASP A N   
895  C  CA  . ASP A 122 ? 0.5711 0.3706 0.4245 0.0112  -0.0431 -0.0198 268 ASP A CA  
896  C  C   . ASP A 122 ? 0.5731 0.3641 0.4255 0.0163  -0.0489 -0.0197 268 ASP A C   
897  O  O   . ASP A 122 ? 0.4901 0.2743 0.3421 0.0147  -0.0453 -0.0177 268 ASP A O   
898  C  CB  . ASP A 122 ? 0.5709 0.3812 0.4377 0.0051  -0.0361 -0.0211 268 ASP A CB  
899  C  CG  . ASP A 122 ? 0.5905 0.4113 0.4732 0.0058  -0.0387 -0.0257 268 ASP A CG  
900  O  OD1 . ASP A 122 ? 0.5640 0.3839 0.4496 0.0111  -0.0453 -0.0280 268 ASP A OD1 
901  O  OD2 . ASP A 122 ? 0.6260 0.4560 0.5183 0.0014  -0.0342 -0.0272 268 ASP A OD2 
902  N  N   . ASP A 123 ? 0.6408 0.4325 0.4941 0.0224  -0.0581 -0.0221 269 ASP A N   
903  C  CA  . ASP A 123 ? 0.6933 0.4764 0.5454 0.0289  -0.0653 -0.0218 269 ASP A CA  
904  C  C   . ASP A 123 ? 0.6589 0.4505 0.5299 0.0293  -0.0653 -0.0259 269 ASP A C   
905  O  O   . ASP A 123 ? 0.6886 0.4736 0.5612 0.0348  -0.0705 -0.0261 269 ASP A O   
906  C  CB  . ASP A 123 ? 0.7772 0.5401 0.6100 0.0300  -0.0632 -0.0152 269 ASP A CB  
907  C  CG  . ASP A 123 ? 0.8913 0.6423 0.7024 0.0326  -0.0661 -0.0114 269 ASP A CG  
908  O  OD1 . ASP A 123 ? 0.8983 0.6544 0.7093 0.0364  -0.0742 -0.0144 269 ASP A OD1 
909  O  OD2 . ASP A 123 ? 0.9767 0.7127 0.7706 0.0307  -0.0601 -0.0056 269 ASP A OD2 
910  N  N   . THR A 124 ? 0.6103 0.4154 0.4946 0.0239  -0.0592 -0.0292 270 THR A N   
911  C  CA  . THR A 124 ? 0.5545 0.3689 0.4561 0.0242  -0.0587 -0.0340 270 THR A CA  
912  C  C   . THR A 124 ? 0.5607 0.3806 0.4724 0.0308  -0.0674 -0.0380 270 THR A C   
913  O  O   . THR A 124 ? 0.5423 0.3681 0.4549 0.0318  -0.0715 -0.0395 270 THR A O   
914  C  CB  . THR A 124 ? 0.5013 0.3302 0.4135 0.0180  -0.0522 -0.0369 270 THR A CB  
915  O  OG1 . THR A 124 ? 0.5334 0.3586 0.4389 0.0121  -0.0451 -0.0338 270 THR A OG1 
916  C  CG2 . THR A 124 ? 0.4473 0.2853 0.3758 0.0188  -0.0513 -0.0423 270 THR A CG2 
917  N  N   . PRO A 125 ? 0.5903 0.4083 0.5108 0.0354  -0.0703 -0.0403 271 PRO A N   
918  C  CA  . PRO A 125 ? 0.5948 0.4191 0.5282 0.0421  -0.0789 -0.0445 271 PRO A CA  
919  C  C   . PRO A 125 ? 0.5534 0.3958 0.5042 0.0391  -0.0766 -0.0502 271 PRO A C   
920  O  O   . PRO A 125 ? 0.5329 0.3824 0.4903 0.0338  -0.0682 -0.0519 271 PRO A O   
921  C  CB  . PRO A 125 ? 0.6502 0.4699 0.5920 0.0463  -0.0793 -0.0461 271 PRO A CB  
922  C  CG  . PRO A 125 ? 0.6468 0.4518 0.5734 0.0432  -0.0735 -0.0411 271 PRO A CG  
923  C  CD  . PRO A 125 ? 0.6121 0.4216 0.5320 0.0349  -0.0660 -0.0394 271 PRO A CD  
924  N  N   . PHE A 126 ? 0.5499 0.3990 0.5075 0.0423  -0.0840 -0.0530 272 PHE A N   
925  C  CA  . PHE A 126 ? 0.5479 0.4132 0.5226 0.0392  -0.0815 -0.0583 272 PHE A CA  
926  C  C   . PHE A 126 ? 0.5863 0.4614 0.5840 0.0425  -0.0819 -0.0642 272 PHE A C   
927  O  O   . PHE A 126 ? 0.6250 0.5005 0.6315 0.0491  -0.0908 -0.0666 272 PHE A O   
928  C  CB  . PHE A 126 ? 0.5319 0.4004 0.5046 0.0401  -0.0886 -0.0594 272 PHE A CB  
929  C  CG  . PHE A 126 ? 0.4983 0.3815 0.4864 0.0356  -0.0845 -0.0640 272 PHE A CG  
930  C  CD1 . PHE A 126 ? 0.4919 0.3769 0.4732 0.0290  -0.0762 -0.0619 272 PHE A CD1 
931  C  CD2 . PHE A 126 ? 0.5125 0.4075 0.5228 0.0380  -0.0885 -0.0704 272 PHE A CD2 
932  C  CE1 . PHE A 126 ? 0.5023 0.3991 0.4969 0.0250  -0.0720 -0.0654 272 PHE A CE1 
933  C  CE2 . PHE A 126 ? 0.4998 0.4071 0.5243 0.0334  -0.0836 -0.0744 272 PHE A CE2 
934  C  CZ  . PHE A 126 ? 0.4991 0.4065 0.5148 0.0270  -0.0753 -0.0716 272 PHE A CZ  
935  N  N   . ASN A 127 ? 0.6415 0.5242 0.6489 0.0379  -0.0721 -0.0667 273 ASN A N   
936  C  CA  . ASN A 127 ? 0.7112 0.6030 0.7402 0.0404  -0.0701 -0.0726 273 ASN A CA  
937  C  C   . ASN A 127 ? 0.6867 0.5932 0.7348 0.0395  -0.0707 -0.0779 273 ASN A C   
938  O  O   . ASN A 127 ? 0.6494 0.5633 0.7014 0.0336  -0.0624 -0.0789 273 ASN A O   
939  C  CB  . ASN A 127 ? 0.7442 0.6362 0.7733 0.0362  -0.0588 -0.0733 273 ASN A CB  
940  C  CG  . ASN A 127 ? 0.7860 0.6851 0.8355 0.0392  -0.0555 -0.0795 273 ASN A CG  
941  O  OD1 . ASN A 127 ? 0.7879 0.6931 0.8544 0.0445  -0.0616 -0.0834 273 ASN A OD1 
942  N  ND2 . ASN A 127 ? 0.8112 0.7094 0.8595 0.0359  -0.0459 -0.0809 273 ASN A ND2 
943  N  N   . LYS A 128 ? 0.7010 0.6112 0.7613 0.0454  -0.0809 -0.0811 274 LYS A N   
944  C  CA  . LYS A 128 ? 0.7236 0.6476 0.8037 0.0445  -0.0829 -0.0866 274 LYS A CA  
945  C  C   . LYS A 128 ? 0.7137 0.6492 0.8138 0.0410  -0.0715 -0.0914 274 LYS A C   
946  O  O   . LYS A 128 ? 0.7058 0.6506 0.8156 0.0362  -0.0666 -0.0939 274 LYS A O   
947  C  CB  . LYS A 128 ? 0.7835 0.7101 0.8761 0.0522  -0.0966 -0.0902 274 LYS A CB  
948  C  CG  . LYS A 128 ? 0.8342 0.7686 0.9341 0.0512  -0.1040 -0.0936 274 LYS A CG  
949  C  CD  . LYS A 128 ? 0.9048 0.8411 1.0154 0.0594  -0.1196 -0.0971 274 LYS A CD  
950  C  CE  . LYS A 128 ? 0.9412 0.8824 1.0534 0.0582  -0.1287 -0.1003 274 LYS A CE  
951  N  NZ  . LYS A 128 ? 0.9257 0.8807 1.0570 0.0510  -0.1200 -0.1054 274 LYS A NZ  
952  N  N   . VAL A 129 ? 0.7391 0.6728 0.8445 0.0434  -0.0666 -0.0927 275 VAL A N   
953  C  CA  . VAL A 129 ? 0.7599 0.7026 0.8819 0.0405  -0.0547 -0.0973 275 VAL A CA  
954  C  C   . VAL A 129 ? 0.7666 0.7081 0.8749 0.0325  -0.0432 -0.0943 275 VAL A C   
955  O  O   . VAL A 129 ? 0.7713 0.7214 0.8884 0.0279  -0.0370 -0.0961 275 VAL A O   
956  C  CB  . VAL A 129 ? 0.7908 0.7296 0.9184 0.0451  -0.0518 -0.0995 275 VAL A CB  
957  C  CG1 . VAL A 129 ? 0.7852 0.7317 0.9264 0.0417  -0.0379 -0.1042 275 VAL A CG1 
958  C  CG2 . VAL A 129 ? 0.8027 0.7433 0.9466 0.0540  -0.0634 -0.1026 275 VAL A CG2 
959  N  N   . GLN A 130 ? 0.7535 0.6841 0.8408 0.0310  -0.0406 -0.0895 276 GLN A N   
960  C  CA  . GLN A 130 ? 0.7436 0.6723 0.8163 0.0241  -0.0315 -0.0862 276 GLN A CA  
961  C  C   . GLN A 130 ? 0.7619 0.6947 0.8314 0.0199  -0.0322 -0.0839 276 GLN A C   
962  O  O   . GLN A 130 ? 0.7469 0.6850 0.8188 0.0150  -0.0239 -0.0842 276 GLN A O   
963  C  CB  . GLN A 130 ? 0.7743 0.6906 0.8254 0.0234  -0.0323 -0.0813 276 GLN A CB  
964  C  CG  . GLN A 130 ? 0.7949 0.7093 0.8309 0.0168  -0.0251 -0.0777 276 GLN A CG  
965  C  CD  . GLN A 130 ? 0.8428 0.7461 0.8595 0.0157  -0.0277 -0.0727 276 GLN A CD  
966  O  OE1 . GLN A 130 ? 0.8505 0.7487 0.8599 0.0174  -0.0348 -0.0693 276 GLN A OE1 
967  N  NE2 . GLN A 130 ? 0.8701 0.7695 0.8785 0.0127  -0.0219 -0.0726 276 GLN A NE2 
968  N  N   . SER A 131 ? 0.7776 0.7068 0.8403 0.0219  -0.0419 -0.0815 277 SER A N   
969  C  CA  . SER A 131 ? 0.7890 0.7199 0.8461 0.0182  -0.0429 -0.0792 277 SER A CA  
970  C  C   . SER A 131 ? 0.7101 0.6524 0.7858 0.0155  -0.0387 -0.0836 277 SER A C   
971  O  O   . SER A 131 ? 0.6956 0.6394 0.7670 0.0108  -0.0344 -0.0816 277 SER A O   
972  C  CB  . SER A 131 ? 0.8722 0.7974 0.9209 0.0218  -0.0545 -0.0775 277 SER A CB  
973  O  OG  . SER A 131 ? 0.9194 0.8326 0.9484 0.0230  -0.0564 -0.0724 277 SER A OG  
974  N  N   . ALA A 132 ? 0.7022 0.6523 0.7995 0.0185  -0.0396 -0.0895 278 ALA A N   
975  C  CA  . ALA A 132 ? 0.6941 0.6554 0.8123 0.0157  -0.0347 -0.0943 278 ALA A CA  
976  C  C   . ALA A 132 ? 0.6699 0.6319 0.7829 0.0091  -0.0219 -0.0918 278 ALA A C   
977  O  O   . ALA A 132 ? 0.6896 0.6563 0.8098 0.0053  -0.0188 -0.0927 278 ALA A O   
978  C  CB  . ALA A 132 ? 0.6882 0.6576 0.8308 0.0194  -0.0338 -0.1008 278 ALA A CB  
979  N  N   . ARG A 133 ? 0.6230 0.5795 0.7230 0.0080  -0.0149 -0.0889 279 ARG A N   
980  C  CA  . ARG A 133 ? 0.6081 0.5645 0.7020 0.0026  -0.0030 -0.0866 279 ARG A CA  
981  C  C   . ARG A 133 ? 0.5369 0.4866 0.6091 -0.0006 -0.0033 -0.0799 279 ARG A C   
982  O  O   . ARG A 133 ? 0.5740 0.5217 0.6369 -0.0043 0.0049  -0.0768 279 ARG A O   
983  C  CB  . ARG A 133 ? 0.6849 0.6393 0.7766 0.0031  0.0050  -0.0880 279 ARG A CB  
984  C  CG  . ARG A 133 ? 0.7452 0.6905 0.8189 0.0051  0.0010  -0.0851 279 ARG A CG  
985  C  CD  . ARG A 133 ? 0.8252 0.7686 0.9003 0.0064  0.0078  -0.0885 279 ARG A CD  
986  N  NE  . ARG A 133 ? 0.9133 0.8473 0.9704 0.0072  0.0049  -0.0859 279 ARG A NE  
987  C  CZ  . ARG A 133 ? 0.9920 0.9217 1.0459 0.0082  0.0095  -0.0886 279 ARG A CZ  
988  N  NH1 . ARG A 133 ? 1.0155 0.9362 1.0536 0.0083  0.0063  -0.0863 279 ARG A NH1 
989  N  NH2 . ARG A 133 ? 1.0283 0.9624 1.0953 0.0090  0.0177  -0.0939 279 ARG A NH2 
990  N  N   . PHE A 134 ? 0.4340 0.3798 0.4980 0.0011  -0.0127 -0.0775 280 PHE A N   
991  C  CA  . PHE A 134 ? 0.4285 0.3688 0.4746 -0.0017 -0.0128 -0.0716 280 PHE A CA  
992  C  C   . PHE A 134 ? 0.4294 0.3717 0.4789 -0.0033 -0.0152 -0.0714 280 PHE A C   
993  O  O   . PHE A 134 ? 0.4121 0.3512 0.4504 -0.0060 -0.0133 -0.0669 280 PHE A O   
994  C  CB  . PHE A 134 ? 0.4376 0.3697 0.4683 0.0007  -0.0191 -0.0685 280 PHE A CB  
995  C  CG  . PHE A 134 ? 0.4820 0.4103 0.5062 0.0010  -0.0157 -0.0681 280 PHE A CG  
996  C  CD1 . PHE A 134 ? 0.4623 0.3922 0.4847 -0.0021 -0.0068 -0.0679 280 PHE A CD1 
997  C  CD2 . PHE A 134 ? 0.4982 0.4201 0.5165 0.0044  -0.0212 -0.0678 280 PHE A CD2 
998  C  CE1 . PHE A 134 ? 0.4979 0.4237 0.5133 -0.0019 -0.0040 -0.0684 280 PHE A CE1 
999  C  CE2 . PHE A 134 ? 0.4875 0.4051 0.5002 0.0044  -0.0179 -0.0681 280 PHE A CE2 
1000 C  CZ  . PHE A 134 ? 0.4967 0.4166 0.5080 0.0011  -0.0095 -0.0688 280 PHE A CZ  
1001 N  N   . TRP A 135 ? 0.4241 0.3721 0.4901 -0.0017 -0.0196 -0.0766 281 TRP A N   
1002 C  CA  . TRP A 135 ? 0.3991 0.3494 0.4707 -0.0037 -0.0216 -0.0779 281 TRP A CA  
1003 C  C   . TRP A 135 ? 0.4305 0.3850 0.5114 -0.0084 -0.0111 -0.0781 281 TRP A C   
1004 O  O   . TRP A 135 ? 0.4355 0.3940 0.5259 -0.0093 -0.0037 -0.0799 281 TRP A O   
1005 C  CB  . TRP A 135 ? 0.4048 0.3601 0.4922 -0.0005 -0.0308 -0.0842 281 TRP A CB  
1006 C  CG  . TRP A 135 ? 0.3950 0.3445 0.4716 0.0045  -0.0422 -0.0836 281 TRP A CG  
1007 C  CD1 . TRP A 135 ? 0.3700 0.3185 0.4484 0.0095  -0.0475 -0.0849 281 TRP A CD1 
1008 C  CD2 . TRP A 135 ? 0.3957 0.3384 0.4571 0.0052  -0.0492 -0.0814 281 TRP A CD2 
1009 N  NE1 . TRP A 135 ? 0.4179 0.3586 0.4821 0.0132  -0.0576 -0.0830 281 TRP A NE1 
1010 C  CE2 . TRP A 135 ? 0.4310 0.3681 0.4841 0.0105  -0.0585 -0.0810 281 TRP A CE2 
1011 C  CE3 . TRP A 135 ? 0.4346 0.3744 0.4880 0.0020  -0.0479 -0.0798 281 TRP A CE3 
1012 C  CZ2 . TRP A 135 ? 0.4400 0.3683 0.4756 0.0125  -0.0660 -0.0788 281 TRP A CZ2 
1013 C  CZ3 . TRP A 135 ? 0.4334 0.3653 0.4707 0.0040  -0.0552 -0.0783 281 TRP A CZ3 
1014 C  CH2 . TRP A 135 ? 0.4398 0.3658 0.4676 0.0091  -0.0640 -0.0777 281 TRP A CH2 
1015 N  N   . ILE A 136 ? 0.4498 0.4025 0.5272 -0.0113 -0.0099 -0.0761 282 ILE A N   
1016 C  CA  . ILE A 136 ? 0.4438 0.3997 0.5323 -0.0156 -0.0009 -0.0768 282 ILE A CA  
1017 C  C   . ILE A 136 ? 0.4915 0.4561 0.6047 -0.0155 -0.0022 -0.0845 282 ILE A C   
1018 O  O   . ILE A 136 ? 0.4878 0.4549 0.6076 -0.0124 -0.0126 -0.0890 282 ILE A O   
1019 C  CB  . ILE A 136 ? 0.4381 0.3900 0.5205 -0.0180 -0.0013 -0.0744 282 ILE A CB  
1020 C  CG1 . ILE A 136 ? 0.4055 0.3503 0.4668 -0.0182 0.0012  -0.0668 282 ILE A CG1 
1021 C  CG2 . ILE A 136 ? 0.4447 0.3993 0.5416 -0.0223 0.0070  -0.0762 282 ILE A CG2 
1022 C  CD1 . ILE A 136 ? 0.3758 0.3160 0.4307 -0.0195 0.0003  -0.0645 282 ILE A CD1 
1023 N  N   . PRO A 137 ? 0.5652 0.5340 0.6922 -0.0187 0.0084  -0.0861 283 PRO A N   
1024 C  CA  . PRO A 137 ? 0.5768 0.5552 0.7310 -0.0191 0.0081  -0.0940 283 PRO A CA  
1025 C  C   . PRO A 137 ? 0.5770 0.5578 0.7413 -0.0199 -0.0006 -0.0985 283 PRO A C   
1026 O  O   . PRO A 137 ? 0.5613 0.5384 0.7223 -0.0237 0.0028  -0.0967 283 PRO A O   
1027 C  CB  . PRO A 137 ? 0.5997 0.5793 0.7627 -0.0240 0.0233  -0.0932 283 PRO A CB  
1028 C  CG  . PRO A 137 ? 0.6177 0.5892 0.7569 -0.0242 0.0301  -0.0855 283 PRO A CG  
1029 C  CD  . PRO A 137 ? 0.5931 0.5579 0.7114 -0.0221 0.0210  -0.0808 283 PRO A CD  
1030 N  N   . GLY A 138 ? 0.5930 0.5795 0.7691 -0.0161 -0.0121 -0.1046 284 GLY A N   
1031 C  CA  . GLY A 138 ? 0.6090 0.5979 0.7942 -0.0166 -0.0218 -0.1100 284 GLY A CA  
1032 C  C   . GLY A 138 ? 0.6413 0.6233 0.8063 -0.0124 -0.0349 -0.1083 284 GLY A C   
1033 O  O   . GLY A 138 ? 0.6791 0.6630 0.8500 -0.0110 -0.0459 -0.1137 284 GLY A O   
1034 N  N   . GLU A 139 ? 0.6074 0.5809 0.7482 -0.0104 -0.0335 -0.1010 285 GLU A N   
1035 C  CA  . GLU A 139 ? 0.5428 0.5084 0.6629 -0.0063 -0.0441 -0.0986 285 GLU A CA  
1036 C  C   . GLU A 139 ? 0.4822 0.4491 0.6030 -0.0005 -0.0513 -0.0995 285 GLU A C   
1037 O  O   . GLU A 139 ? 0.4849 0.4565 0.6163 0.0000  -0.0456 -0.1000 285 GLU A O   
1038 C  CB  . GLU A 139 ? 0.5523 0.5084 0.6480 -0.0076 -0.0382 -0.0903 285 GLU A CB  
1039 C  CG  . GLU A 139 ? 0.5926 0.5473 0.6881 -0.0129 -0.0286 -0.0879 285 GLU A CG  
1040 C  CD  . GLU A 139 ? 0.6547 0.6086 0.7546 -0.0147 -0.0332 -0.0923 285 GLU A CD  
1041 O  OE1 . GLU A 139 ? 0.6459 0.5957 0.7361 -0.0119 -0.0434 -0.0942 285 GLU A OE1 
1042 O  OE2 . GLU A 139 ? 0.6922 0.6484 0.8042 -0.0192 -0.0261 -0.0939 285 GLU A OE2 
1043 N  N   . PRO A 140 ? 0.4737 0.4351 0.5824 0.0041  -0.0636 -0.0997 286 PRO A N   
1044 C  CA  . PRO A 140 ? 0.4864 0.4413 0.5812 0.0039  -0.0706 -0.0999 286 PRO A CA  
1045 C  C   . PRO A 140 ? 0.4867 0.4490 0.6011 0.0023  -0.0764 -0.1083 286 PRO A C   
1046 O  O   . PRO A 140 ? 0.4444 0.4153 0.5789 0.0048  -0.0828 -0.1142 286 PRO A O   
1047 C  CB  . PRO A 140 ? 0.4712 0.4182 0.5490 0.0102  -0.0818 -0.0980 286 PRO A CB  
1048 C  CG  . PRO A 140 ? 0.4982 0.4462 0.5786 0.0130  -0.0788 -0.0953 286 PRO A CG  
1049 C  CD  . PRO A 140 ? 0.4841 0.4439 0.5902 0.0103  -0.0710 -0.0994 286 PRO A CD  
1050 N  N   . ASN A 141 ? 0.5470 0.5061 0.6570 -0.0018 -0.0742 -0.1091 287 ASN A N   
1051 C  CA  . ASN A 141 ? 0.5732 0.5390 0.7027 -0.0045 -0.0787 -0.1176 287 ASN A CA  
1052 C  C   . ASN A 141 ? 0.5707 0.5298 0.6865 -0.0027 -0.0909 -0.1211 287 ASN A C   
1053 O  O   . ASN A 141 ? 0.6113 0.5755 0.7421 -0.0042 -0.0978 -0.1293 287 ASN A O   
1054 C  CB  . ASN A 141 ? 0.5884 0.5569 0.7297 -0.0115 -0.0655 -0.1175 287 ASN A CB  
1055 C  CG  . ASN A 141 ? 0.5854 0.5434 0.7063 -0.0141 -0.0606 -0.1130 287 ASN A CG  
1056 O  OD1 . ASN A 141 ? 0.6181 0.5670 0.7150 -0.0111 -0.0643 -0.1085 287 ASN A OD1 
1057 N  ND2 . ASN A 141 ? 0.5527 0.5115 0.6839 -0.0196 -0.0517 -0.1140 287 ASN A ND2 
1058 N  N   . ASN A 142 ? 0.5738 0.5211 0.6610 0.0003  -0.0932 -0.1153 288 ASN A N   
1059 C  CA  . ASN A 142 ? 0.6300 0.5686 0.6991 0.0027  -0.1042 -0.1179 288 ASN A CA  
1060 C  C   . ASN A 142 ? 0.6629 0.6023 0.7397 -0.0021 -0.1045 -0.1247 288 ASN A C   
1061 O  O   . ASN A 142 ? 0.6473 0.5879 0.7283 -0.0008 -0.1167 -0.1325 288 ASN A O   
1062 C  CB  . ASN A 142 ? 0.6525 0.5925 0.7226 0.0091  -0.1199 -0.1218 288 ASN A CB  
1063 C  CG  . ASN A 142 ? 0.7135 0.6399 0.7538 0.0132  -0.1300 -0.1206 288 ASN A CG  
1064 O  OD1 . ASN A 142 ? 0.7222 0.6375 0.7391 0.0120  -0.1234 -0.1150 288 ASN A OD1 
1065 N  ND2 . ASN A 142 ? 0.7341 0.6610 0.7750 0.0183  -0.1459 -0.1259 288 ASN A ND2 
1066 N  N   . ALA A 143 ? 0.7141 0.6522 0.7926 -0.0074 -0.0913 -0.1218 289 ALA A N   
1067 C  CA  . ALA A 143 ? 0.7032 0.6402 0.7883 -0.0122 -0.0895 -0.1275 289 ALA A CA  
1068 C  C   . ALA A 143 ? 0.7507 0.6761 0.8118 -0.0102 -0.0977 -0.1297 289 ALA A C   
1069 O  O   . ALA A 143 ? 0.7412 0.6562 0.7789 -0.0093 -0.0924 -0.1233 289 ALA A O   
1070 C  CB  . ALA A 143 ? 0.6850 0.6205 0.7726 -0.0172 -0.0737 -0.1221 289 ALA A CB  
1071 N  N   . GLY A 144 ? 0.7934 0.7207 0.8607 -0.0096 -0.1105 -0.1391 290 GLY A N   
1072 C  CA  . GLY A 144 ? 0.8090 0.7248 0.8528 -0.0076 -0.1192 -0.1426 290 GLY A CA  
1073 C  C   . GLY A 144 ? 0.8282 0.7384 0.8517 -0.0005 -0.1321 -0.1411 290 GLY A C   
1074 O  O   . GLY A 144 ? 0.8317 0.7296 0.8291 0.0019  -0.1381 -0.1420 290 GLY A O   
1075 N  N   . ASN A 145 ? 0.8125 0.7305 0.8471 0.0031  -0.1359 -0.1387 291 ASN A N   
1076 C  CA  . ASN A 145 ? 0.8331 0.7449 0.8487 0.0104  -0.1473 -0.1358 291 ASN A CA  
1077 C  C   . ASN A 145 ? 0.8270 0.7228 0.8081 0.0120  -0.1412 -0.1275 291 ASN A C   
1078 O  O   . ASN A 145 ? 0.8645 0.7492 0.8207 0.0170  -0.1503 -0.1263 291 ASN A O   
1079 C  CB  . ASN A 145 ? 0.9034 0.8146 0.9175 0.0137  -0.1658 -0.1451 291 ASN A CB  
1080 C  CG  . ASN A 145 ? 0.9257 0.8476 0.9593 0.0187  -0.1780 -0.1481 291 ASN A CG  
1081 O  OD1 . ASN A 145 ? 0.9436 0.8601 0.9633 0.0252  -0.1933 -0.1495 291 ASN A OD1 
1082 N  ND2 . ASN A 145 ? 0.9186 0.8554 0.9843 0.0160  -0.1713 -0.1491 291 ASN A ND2 
1083 N  N   . ASN A 146 ? 0.7861 0.6810 0.7666 0.0077  -0.1255 -0.1217 292 ASN A N   
1084 C  CA  . ASN A 146 ? 0.7656 0.6471 0.7185 0.0077  -0.1176 -0.1151 292 ASN A CA  
1085 C  C   . ASN A 146 ? 0.7171 0.5981 0.6657 0.0082  -0.1075 -0.1051 292 ASN A C   
1086 O  O   . ASN A 146 ? 0.7208 0.5909 0.6462 0.0096  -0.1031 -0.0989 292 ASN A O   
1087 C  CB  . ASN A 146 ? 0.7688 0.6491 0.7253 0.0020  -0.1081 -0.1177 292 ASN A CB  
1088 C  CG  . ASN A 146 ? 0.8180 0.6837 0.7461 0.0024  -0.1027 -0.1142 292 ASN A CG  
1089 O  OD1 . ASN A 146 ? 0.8594 0.7149 0.7634 0.0067  -0.1071 -0.1109 292 ASN A OD1 
1090 N  ND2 . ASN A 146 ? 0.8105 0.6746 0.7415 -0.0018 -0.0925 -0.1148 292 ASN A ND2 
1091 N  N   . GLU A 147 ? 0.6403 0.5332 0.6119 0.0069  -0.1035 -0.1040 293 GLU A N   
1092 C  CA  . GLU A 147 ? 0.6176 0.5115 0.5886 0.0060  -0.0926 -0.0957 293 GLU A CA  
1093 C  C   . GLU A 147 ? 0.6051 0.4956 0.5667 0.0111  -0.0977 -0.0912 293 GLU A C   
1094 O  O   . GLU A 147 ? 0.6292 0.5277 0.6068 0.0130  -0.1014 -0.0927 293 GLU A O   
1095 C  CB  . GLU A 147 ? 0.5936 0.5002 0.5911 0.0020  -0.0849 -0.0966 293 GLU A CB  
1096 C  CG  . GLU A 147 ? 0.6069 0.5180 0.6196 -0.0024 -0.0836 -0.1034 293 GLU A CG  
1097 C  CD  . GLU A 147 ? 0.6001 0.5182 0.6300 -0.0073 -0.0710 -0.1012 293 GLU A CD  
1098 O  OE1 . GLU A 147 ? 0.6016 0.5288 0.6489 -0.0076 -0.0688 -0.1013 293 GLU A OE1 
1099 O  OE2 . GLU A 147 ? 0.6092 0.5230 0.6346 -0.0105 -0.0631 -0.0994 293 GLU A OE2 
1100 N  N   . HIS A 148 ? 0.5623 0.4402 0.4982 0.0132  -0.0970 -0.0859 294 HIS A N   
1101 C  CA  . HIS A 148 ? 0.6206 0.4925 0.5451 0.0180  -0.1014 -0.0812 294 HIS A CA  
1102 C  C   . HIS A 148 ? 0.5612 0.4308 0.4804 0.0163  -0.0902 -0.0732 294 HIS A C   
1103 O  O   . HIS A 148 ? 0.5988 0.4597 0.5033 0.0193  -0.0915 -0.0683 294 HIS A O   
1104 C  CB  . HIS A 148 ? 0.7165 0.5741 0.6146 0.0223  -0.1101 -0.0810 294 HIS A CB  
1105 C  CG  . HIS A 148 ? 0.7872 0.6465 0.6888 0.0247  -0.1237 -0.0893 294 HIS A CG  
1106 N  ND1 . HIS A 148 ? 0.7878 0.6606 0.7161 0.0253  -0.1307 -0.0955 294 HIS A ND1 
1107 C  CD2 . HIS A 148 ? 0.8197 0.6690 0.7019 0.0268  -0.1318 -0.0928 294 HIS A CD2 
1108 C  CE1 . HIS A 148 ? 0.8119 0.6838 0.7387 0.0275  -0.1433 -0.1026 294 HIS A CE1 
1109 N  NE2 . HIS A 148 ? 0.8361 0.6934 0.7339 0.0285  -0.1446 -0.1012 294 HIS A NE2 
1110 N  N   . CYS A 149 ? 0.4883 0.3652 0.4194 0.0114  -0.0797 -0.0719 295 CYS A N   
1111 C  CA  . CYS A 149 ? 0.4928 0.3687 0.4203 0.0094  -0.0698 -0.0650 295 CYS A CA  
1112 C  C   . CYS A 149 ? 0.4833 0.3710 0.4312 0.0059  -0.0626 -0.0652 295 CYS A C   
1113 O  O   . CYS A 149 ? 0.4907 0.3861 0.4539 0.0038  -0.0623 -0.0697 295 CYS A O   
1114 C  CB  . CYS A 149 ? 0.5108 0.3785 0.4218 0.0073  -0.0627 -0.0612 295 CYS A CB  
1115 S  SG  . CYS A 149 ? 0.6966 0.5476 0.5788 0.0111  -0.0674 -0.0590 295 CYS A SG  
1116 N  N   . GLY A 150 ? 0.4397 0.3281 0.3871 0.0049  -0.0567 -0.0602 296 GLY A N   
1117 C  CA  . GLY A 150 ? 0.4006 0.2985 0.3638 0.0021  -0.0503 -0.0600 296 GLY A CA  
1118 C  C   . GLY A 150 ? 0.3975 0.2954 0.3567 -0.0013 -0.0410 -0.0548 296 GLY A C   
1119 O  O   . GLY A 150 ? 0.4167 0.3080 0.3625 -0.0013 -0.0391 -0.0505 296 GLY A O   
1120 N  N   . ASN A 151 ? 0.3697 0.2748 0.3408 -0.0043 -0.0352 -0.0551 297 ASN A N   
1121 C  CA  . ASN A 151 ? 0.3692 0.2750 0.3376 -0.0071 -0.0275 -0.0501 297 ASN A CA  
1122 C  C   . ASN A 151 ? 0.3948 0.3075 0.3737 -0.0089 -0.0227 -0.0496 297 ASN A C   
1123 O  O   . ASN A 151 ? 0.4433 0.3609 0.4341 -0.0088 -0.0233 -0.0536 297 ASN A O   
1124 C  CB  . ASN A 151 ? 0.3076 0.2117 0.2743 -0.0087 -0.0241 -0.0496 297 ASN A CB  
1125 C  CG  . ASN A 151 ? 0.2986 0.2071 0.2784 -0.0101 -0.0234 -0.0539 297 ASN A CG  
1126 O  OD1 . ASN A 151 ? 0.3364 0.2509 0.3280 -0.0113 -0.0213 -0.0552 297 ASN A OD1 
1127 N  ND2 . ASN A 151 ? 0.2865 0.1915 0.2643 -0.0104 -0.0244 -0.0564 297 ASN A ND2 
1128 N  N   . ILE A 152 ? 0.4073 0.3203 0.3817 -0.0105 -0.0178 -0.0450 298 ILE A N   
1129 C  CA  . ILE A 152 ? 0.3926 0.3106 0.3733 -0.0124 -0.0127 -0.0439 298 ILE A CA  
1130 C  C   . ILE A 152 ? 0.4095 0.3291 0.3952 -0.0143 -0.0080 -0.0428 298 ILE A C   
1131 O  O   . ILE A 152 ? 0.3787 0.2958 0.3595 -0.0146 -0.0066 -0.0399 298 ILE A O   
1132 C  CB  . ILE A 152 ? 0.3794 0.2967 0.3524 -0.0132 -0.0108 -0.0398 298 ILE A CB  
1133 C  CG1 . ILE A 152 ? 0.4169 0.3342 0.3900 -0.0121 -0.0127 -0.0419 298 ILE A CG1 
1134 C  CG2 . ILE A 152 ? 0.4335 0.3538 0.4078 -0.0152 -0.0052 -0.0366 298 ILE A CG2 
1135 C  CD1 . ILE A 152 ? 0.4492 0.3661 0.4160 -0.0134 -0.0108 -0.0391 298 ILE A CD1 
1136 N  N   . LYS A 153 ? 0.4234 0.3468 0.4195 -0.0154 -0.0048 -0.0452 299 LYS A N   
1137 C  CA  . LYS A 153 ? 0.4231 0.3467 0.4251 -0.0173 -0.0003 -0.0446 299 LYS A CA  
1138 C  C   . LYS A 153 ? 0.4636 0.3890 0.4686 -0.0192 0.0068  -0.0419 299 LYS A C   
1139 O  O   . LYS A 153 ? 0.4794 0.4028 0.4798 -0.0199 0.0107  -0.0370 299 LYS A O   
1140 C  CB  . LYS A 153 ? 0.3401 0.2649 0.3530 -0.0175 -0.0030 -0.0507 299 LYS A CB  
1141 C  CG  . LYS A 153 ? 0.3254 0.2494 0.3455 -0.0199 0.0021  -0.0508 299 LYS A CG  
1142 C  CD  . LYS A 153 ? 0.3969 0.3223 0.4283 -0.0205 -0.0017 -0.0578 299 LYS A CD  
1143 C  CE  . LYS A 153 ? 0.4305 0.3544 0.4704 -0.0234 0.0041  -0.0583 299 LYS A CE  
1144 N  NZ  . LYS A 153 ? 0.5509 0.4775 0.6052 -0.0248 0.0005  -0.0663 299 LYS A NZ  
1145 N  N   . ALA A 154 ? 0.4106 0.3395 0.4232 -0.0196 0.0087  -0.0452 300 ALA A N   
1146 C  CA  . ALA A 154 ? 0.4101 0.3396 0.4245 -0.0215 0.0165  -0.0432 300 ALA A CA  
1147 C  C   . ALA A 154 ? 0.4965 0.4249 0.4986 -0.0209 0.0173  -0.0396 300 ALA A C   
1148 O  O   . ALA A 154 ? 0.5353 0.4643 0.5335 -0.0194 0.0126  -0.0412 300 ALA A O   
1149 C  CB  . ALA A 154 ? 0.3534 0.2872 0.3827 -0.0225 0.0193  -0.0489 300 ALA A CB  
1150 N  N   . PRO A 155 ? 0.5266 0.4526 0.5220 -0.0220 0.0230  -0.0347 301 PRO A N   
1151 C  CA  . PRO A 155 ? 0.5281 0.4527 0.5108 -0.0218 0.0236  -0.0315 301 PRO A CA  
1152 C  C   . PRO A 155 ? 0.5481 0.4739 0.5325 -0.0222 0.0276  -0.0353 301 PRO A C   
1153 O  O   . PRO A 155 ? 0.6173 0.5407 0.5960 -0.0233 0.0342  -0.0332 301 PRO A O   
1154 C  CB  . PRO A 155 ? 0.5300 0.4510 0.5059 -0.0225 0.0284  -0.0253 301 PRO A CB  
1155 C  CG  . PRO A 155 ? 0.5523 0.4723 0.5373 -0.0230 0.0298  -0.0248 301 PRO A CG  
1156 C  CD  . PRO A 155 ? 0.5284 0.4519 0.5271 -0.0236 0.0287  -0.0317 301 PRO A CD  
1157 N  N   . SER A 156 ? 0.5070 0.4357 0.4985 -0.0211 0.0240  -0.0407 302 SER A N   
1158 C  CA  . SER A 156 ? 0.4769 0.4071 0.4726 -0.0210 0.0279  -0.0450 302 SER A CA  
1159 C  C   . SER A 156 ? 0.4926 0.4244 0.4916 -0.0186 0.0210  -0.0493 302 SER A C   
1160 O  O   . SER A 156 ? 0.4860 0.4174 0.4842 -0.0173 0.0139  -0.0488 302 SER A O   
1161 C  CB  . SER A 156 ? 0.4696 0.4027 0.4806 -0.0224 0.0347  -0.0482 302 SER A CB  
1162 O  OG  . SER A 156 ? 0.4625 0.4003 0.4876 -0.0210 0.0332  -0.0548 302 SER A OG  
1163 N  N   . LEU A 157 ? 0.4963 0.4289 0.4981 -0.0178 0.0236  -0.0533 303 LEU A N   
1164 C  CA  . LEU A 157 ? 0.5109 0.4441 0.5173 -0.0149 0.0175  -0.0574 303 LEU A CA  
1165 C  C   . LEU A 157 ? 0.4903 0.4276 0.5121 -0.0133 0.0128  -0.0608 303 LEU A C   
1166 O  O   . LEU A 157 ? 0.4650 0.4012 0.4869 -0.0106 0.0049  -0.0619 303 LEU A O   
1167 C  CB  . LEU A 157 ? 0.5629 0.4961 0.5713 -0.0141 0.0222  -0.0616 303 LEU A CB  
1168 C  CG  . LEU A 157 ? 0.6129 0.5407 0.6043 -0.0147 0.0231  -0.0600 303 LEU A CG  
1169 C  CD1 . LEU A 157 ? 0.6575 0.5846 0.6503 -0.0144 0.0302  -0.0646 303 LEU A CD1 
1170 C  CD2 . LEU A 157 ? 0.5738 0.4983 0.5589 -0.0132 0.0144  -0.0592 303 LEU A CD2 
1171 N  N   . GLN A 158 ? 0.5320 0.4734 0.5663 -0.0149 0.0176  -0.0625 304 GLN A N   
1172 C  CA  . GLN A 158 ? 0.5215 0.4671 0.5704 -0.0140 0.0125  -0.0660 304 GLN A CA  
1173 C  C   . GLN A 158 ? 0.4838 0.4264 0.5251 -0.0154 0.0095  -0.0619 304 GLN A C   
1174 O  O   . GLN A 158 ? 0.4914 0.4347 0.5371 -0.0181 0.0144  -0.0608 304 GLN A O   
1175 C  CB  . GLN A 158 ? 0.5627 0.5143 0.6307 -0.0158 0.0194  -0.0703 304 GLN A CB  
1176 C  CG  . GLN A 158 ? 0.6405 0.5949 0.7165 -0.0148 0.0251  -0.0743 304 GLN A CG  
1177 C  CD  . GLN A 158 ? 0.7482 0.7111 0.8500 -0.0147 0.0270  -0.0811 304 GLN A CD  
1178 O  OE1 . GLN A 158 ? 0.7972 0.7627 0.9092 -0.0183 0.0359  -0.0819 304 GLN A OE1 
1179 N  NE2 . GLN A 158 ? 0.7829 0.7498 0.8960 -0.0106 0.0184  -0.0859 304 GLN A NE2 
1180 N  N   . ALA A 159 ? 0.4465 0.3852 0.4765 -0.0135 0.0021  -0.0597 305 ALA A N   
1181 C  CA  . ALA A 159 ? 0.4319 0.3670 0.4522 -0.0146 0.0006  -0.0552 305 ALA A CA  
1182 C  C   . ALA A 159 ? 0.4505 0.3842 0.4718 -0.0130 -0.0070 -0.0571 305 ALA A C   
1183 O  O   . ALA A 159 ? 0.4585 0.3900 0.4759 -0.0142 -0.0068 -0.0549 305 ALA A O   
1184 C  CB  . ALA A 159 ? 0.3894 0.3202 0.3937 -0.0146 0.0003  -0.0502 305 ALA A CB  
1185 N  N   . TRP A 160 ? 0.4500 0.3845 0.4757 -0.0100 -0.0138 -0.0611 306 TRP A N   
1186 C  CA  . TRP A 160 ? 0.4462 0.3773 0.4676 -0.0078 -0.0220 -0.0623 306 TRP A CA  
1187 C  C   . TRP A 160 ? 0.3975 0.3316 0.4300 -0.0087 -0.0241 -0.0667 306 TRP A C   
1188 O  O   . TRP A 160 ? 0.3576 0.2980 0.4069 -0.0095 -0.0228 -0.0713 306 TRP A O   
1189 C  CB  . TRP A 160 ? 0.4450 0.3743 0.4654 -0.0036 -0.0297 -0.0646 306 TRP A CB  
1190 C  CG  . TRP A 160 ? 0.4646 0.3896 0.4743 -0.0026 -0.0286 -0.0611 306 TRP A CG  
1191 C  CD1 . TRP A 160 ? 0.4497 0.3720 0.4487 -0.0050 -0.0235 -0.0563 306 TRP A CD1 
1192 C  CD2 . TRP A 160 ? 0.4693 0.3920 0.4790 0.0012  -0.0334 -0.0627 306 TRP A CD2 
1193 N  NE1 . TRP A 160 ? 0.4504 0.3688 0.4429 -0.0036 -0.0245 -0.0552 306 TRP A NE1 
1194 C  CE2 . TRP A 160 ? 0.4598 0.3777 0.4584 0.0003  -0.0302 -0.0588 306 TRP A CE2 
1195 C  CE3 . TRP A 160 ? 0.4705 0.3945 0.4894 0.0055  -0.0405 -0.0670 306 TRP A CE3 
1196 C  CZ2 . TRP A 160 ? 0.4793 0.3928 0.4750 0.0032  -0.0329 -0.0592 306 TRP A CZ2 
1197 C  CZ3 . TRP A 160 ? 0.5051 0.4248 0.5211 0.0090  -0.0435 -0.0669 306 TRP A CZ3 
1198 C  CH2 . TRP A 160 ? 0.5012 0.4152 0.5055 0.0077  -0.0393 -0.0630 306 TRP A CH2 
1199 N  N   . ASN A 161 ? 0.3788 0.3079 0.4021 -0.0088 -0.0272 -0.0656 307 ASN A N   
1200 C  CA  . ASN A 161 ? 0.4413 0.3715 0.4723 -0.0093 -0.0313 -0.0707 307 ASN A CA  
1201 C  C   . ASN A 161 ? 0.4412 0.3652 0.4599 -0.0060 -0.0407 -0.0719 307 ASN A C   
1202 O  O   . ASN A 161 ? 0.4258 0.3428 0.4276 -0.0049 -0.0407 -0.0672 307 ASN A O   
1203 C  CB  . ASN A 161 ? 0.4097 0.3384 0.4409 -0.0129 -0.0248 -0.0690 307 ASN A CB  
1204 C  CG  . ASN A 161 ? 0.4740 0.4024 0.5117 -0.0137 -0.0292 -0.0748 307 ASN A CG  
1205 O  OD1 . ASN A 161 ? 0.4988 0.4326 0.5509 -0.0133 -0.0341 -0.0811 307 ASN A OD1 
1206 N  ND2 . ASN A 161 ? 0.4802 0.4025 0.5082 -0.0146 -0.0279 -0.0732 307 ASN A ND2 
1207 N  N   . ASP A 162 ? 0.4132 0.3392 0.4399 -0.0044 -0.0489 -0.0782 308 ASP A N   
1208 C  CA  . ASP A 162 ? 0.3679 0.2863 0.3799 -0.0013 -0.0579 -0.0793 308 ASP A CA  
1209 C  C   . ASP A 162 ? 0.3856 0.3005 0.3939 -0.0039 -0.0568 -0.0814 308 ASP A C   
1210 O  O   . ASP A 162 ? 0.3259 0.2461 0.3496 -0.0070 -0.0544 -0.0856 308 ASP A O   
1211 C  CB  . ASP A 162 ? 0.4041 0.3248 0.4226 0.0030  -0.0696 -0.0847 308 ASP A CB  
1212 C  CG  . ASP A 162 ? 0.4170 0.3474 0.4590 0.0014  -0.0725 -0.0925 308 ASP A CG  
1213 O  OD1 . ASP A 162 ? 0.4522 0.3881 0.5075 -0.0032 -0.0637 -0.0932 308 ASP A OD1 
1214 O  OD2 . ASP A 162 ? 0.4276 0.3601 0.4753 0.0047  -0.0838 -0.0980 308 ASP A OD2 
1215 N  N   . ALA A 163 ? 0.4114 0.3166 0.3993 -0.0026 -0.0577 -0.0784 309 ALA A N   
1216 C  CA  . ALA A 163 ? 0.3737 0.2738 0.3551 -0.0048 -0.0549 -0.0796 309 ALA A CA  
1217 C  C   . ALA A 163 ? 0.4551 0.3446 0.4154 -0.0016 -0.0619 -0.0805 309 ALA A C   
1218 O  O   . ALA A 163 ? 0.4848 0.3699 0.4335 0.0018  -0.0664 -0.0778 309 ALA A O   
1219 C  CB  . ALA A 163 ? 0.2787 0.1775 0.2564 -0.0073 -0.0436 -0.0731 309 ALA A CB  
1220 N  N   . PRO A 164 ? 0.4649 0.3491 0.4193 -0.0028 -0.0625 -0.0844 310 PRO A N   
1221 C  CA  . PRO A 164 ? 0.5013 0.3738 0.4326 0.0000  -0.0679 -0.0854 310 PRO A CA  
1222 C  C   . PRO A 164 ? 0.5004 0.3649 0.4134 0.0008  -0.0607 -0.0775 310 PRO A C   
1223 O  O   . PRO A 164 ? 0.4501 0.3165 0.3669 -0.0018 -0.0505 -0.0733 310 PRO A O   
1224 C  CB  . PRO A 164 ? 0.5080 0.3774 0.4398 -0.0025 -0.0668 -0.0913 310 PRO A CB  
1225 C  CG  . PRO A 164 ? 0.4775 0.3582 0.4357 -0.0058 -0.0661 -0.0957 310 PRO A CG  
1226 C  CD  . PRO A 164 ? 0.4367 0.3251 0.4060 -0.0067 -0.0589 -0.0891 310 PRO A CD  
1227 N  N   . CYS A 165 ? 0.5174 0.3729 0.4112 0.0045  -0.0660 -0.0756 311 CYS A N   
1228 C  CA  . CYS A 165 ? 0.5228 0.3709 0.4011 0.0051  -0.0593 -0.0681 311 CYS A CA  
1229 C  C   . CYS A 165 ? 0.5718 0.4129 0.4388 0.0032  -0.0499 -0.0664 311 CYS A C   
1230 O  O   . CYS A 165 ? 0.5474 0.3853 0.4075 0.0025  -0.0420 -0.0602 311 CYS A O   
1231 C  CB  . CYS A 165 ? 0.5672 0.4053 0.4266 0.0096  -0.0671 -0.0664 311 CYS A CB  
1232 S  SG  . CYS A 165 ? 0.9773 0.8226 0.8499 0.0129  -0.0773 -0.0672 311 CYS A SG  
1233 N  N   . ASP A 166 ? 0.6046 0.4435 0.4708 0.0022  -0.0506 -0.0721 312 ASP A N   
1234 C  CA  . ASP A 166 ? 0.6417 0.4737 0.4982 0.0008  -0.0413 -0.0715 312 ASP A CA  
1235 C  C   . ASP A 166 ? 0.6140 0.4545 0.4895 -0.0026 -0.0321 -0.0702 312 ASP A C   
1236 O  O   . ASP A 166 ? 0.6404 0.4766 0.5118 -0.0035 -0.0238 -0.0694 312 ASP A O   
1237 C  CB  . ASP A 166 ? 0.6851 0.5071 0.5267 0.0019  -0.0463 -0.0786 312 ASP A CB  
1238 C  CG  . ASP A 166 ? 0.6845 0.5132 0.5431 -0.0001 -0.0511 -0.0864 312 ASP A CG  
1239 O  OD1 . ASP A 166 ? 0.6121 0.4520 0.4906 -0.0010 -0.0553 -0.0873 312 ASP A OD1 
1240 O  OD2 . ASP A 166 ? 0.7887 0.6109 0.6408 -0.0010 -0.0501 -0.0920 312 ASP A OD2 
1241 N  N   . LYS A 167 ? 0.5437 0.3956 0.4394 -0.0041 -0.0334 -0.0699 313 LYS A N   
1242 C  CA  . LYS A 167 ? 0.5360 0.3950 0.4476 -0.0067 -0.0249 -0.0669 313 LYS A CA  
1243 C  C   . LYS A 167 ? 0.5197 0.3789 0.4272 -0.0067 -0.0175 -0.0592 313 LYS A C   
1244 O  O   . LYS A 167 ? 0.4819 0.3396 0.3814 -0.0053 -0.0197 -0.0560 313 LYS A O   
1245 C  CB  . LYS A 167 ? 0.5586 0.4285 0.4899 -0.0082 -0.0274 -0.0679 313 LYS A CB  
1246 C  CG  . LYS A 167 ? 0.6563 0.5284 0.5992 -0.0098 -0.0315 -0.0754 313 LYS A CG  
1247 C  CD  . LYS A 167 ? 0.7310 0.6008 0.6791 -0.0121 -0.0239 -0.0764 313 LYS A CD  
1248 C  CE  . LYS A 167 ? 0.7681 0.6445 0.7366 -0.0151 -0.0234 -0.0801 313 LYS A CE  
1249 N  NZ  . LYS A 167 ? 0.7728 0.6507 0.7465 -0.0154 -0.0332 -0.0885 313 LYS A NZ  
1250 N  N   . THR A 168 ? 0.5204 0.3814 0.4343 -0.0080 -0.0090 -0.0564 314 THR A N   
1251 C  CA  . THR A 168 ? 0.5361 0.3990 0.4497 -0.0081 -0.0026 -0.0496 314 THR A CA  
1252 C  C   . THR A 168 ? 0.5086 0.3818 0.4379 -0.0095 -0.0008 -0.0456 314 THR A C   
1253 O  O   . THR A 168 ? 0.4908 0.3676 0.4313 -0.0105 0.0020  -0.0458 314 THR A O   
1254 C  CB  . THR A 168 ? 0.5559 0.4140 0.4658 -0.0079 0.0057  -0.0486 314 THR A CB  
1255 O  OG1 . THR A 168 ? 0.5930 0.4537 0.5152 -0.0087 0.0088  -0.0502 314 THR A OG1 
1256 C  CG2 . THR A 168 ? 0.5731 0.4196 0.4646 -0.0066 0.0050  -0.0526 314 THR A CG2 
1257 N  N   . PHE A 169 ? 0.4989 0.3757 0.4276 -0.0095 -0.0025 -0.0420 315 PHE A N   
1258 C  CA  . PHE A 169 ? 0.4289 0.3143 0.3691 -0.0107 -0.0009 -0.0381 315 PHE A CA  
1259 C  C   . PHE A 169 ? 0.4384 0.3250 0.3755 -0.0109 0.0018  -0.0331 315 PHE A C   
1260 O  O   . PHE A 169 ? 0.4229 0.3036 0.3495 -0.0104 0.0024  -0.0326 315 PHE A O   
1261 C  CB  . PHE A 169 ? 0.3982 0.2879 0.3434 -0.0109 -0.0064 -0.0401 315 PHE A CB  
1262 C  CG  . PHE A 169 ? 0.4713 0.3620 0.4239 -0.0113 -0.0090 -0.0454 315 PHE A CG  
1263 C  CD1 . PHE A 169 ? 0.5009 0.3952 0.4647 -0.0128 -0.0049 -0.0450 315 PHE A CD1 
1264 C  CD2 . PHE A 169 ? 0.4926 0.3804 0.4416 -0.0101 -0.0158 -0.0506 315 PHE A CD2 
1265 C  CE1 . PHE A 169 ? 0.4896 0.3847 0.4620 -0.0139 -0.0065 -0.0501 315 PHE A CE1 
1266 C  CE2 . PHE A 169 ? 0.5054 0.3952 0.4638 -0.0109 -0.0186 -0.0562 315 PHE A CE2 
1267 C  CZ  . PHE A 169 ? 0.4838 0.3774 0.4546 -0.0132 -0.0134 -0.0561 315 PHE A CZ  
1268 N  N   . LEU A 170 ? 0.4162 0.3098 0.3620 -0.0119 0.0035  -0.0294 316 LEU A N   
1269 C  CA  . LEU A 170 ? 0.3482 0.2445 0.2932 -0.0127 0.0043  -0.0256 316 LEU A CA  
1270 C  C   . LEU A 170 ? 0.3682 0.2626 0.3075 -0.0126 -0.0006 -0.0272 316 LEU A C   
1271 O  O   . LEU A 170 ? 0.3778 0.2716 0.3175 -0.0119 -0.0046 -0.0306 316 LEU A O   
1272 C  CB  . LEU A 170 ? 0.3372 0.2412 0.2916 -0.0135 0.0054  -0.0222 316 LEU A CB  
1273 C  CG  . LEU A 170 ? 0.3272 0.2332 0.2888 -0.0127 0.0094  -0.0202 316 LEU A CG  
1274 C  CD1 . LEU A 170 ? 0.3007 0.2129 0.2688 -0.0130 0.0088  -0.0170 316 LEU A CD1 
1275 C  CD2 . LEU A 170 ? 0.3306 0.2359 0.2926 -0.0122 0.0136  -0.0182 316 LEU A CD2 
1276 N  N   . PHE A 171 ? 0.3499 0.2433 0.2854 -0.0134 -0.0003 -0.0249 317 PHE A N   
1277 C  CA  . PHE A 171 ? 0.3538 0.2433 0.2830 -0.0130 -0.0047 -0.0261 317 PHE A CA  
1278 C  C   . PHE A 171 ? 0.3714 0.2640 0.3029 -0.0148 -0.0045 -0.0237 317 PHE A C   
1279 O  O   . PHE A 171 ? 0.3485 0.2451 0.2847 -0.0165 -0.0011 -0.0210 317 PHE A O   
1280 C  CB  . PHE A 171 ? 0.3471 0.2265 0.2634 -0.0116 -0.0050 -0.0267 317 PHE A CB  
1281 C  CG  . PHE A 171 ? 0.3416 0.2177 0.2540 -0.0129 0.0013  -0.0237 317 PHE A CG  
1282 C  CD1 . PHE A 171 ? 0.3776 0.2522 0.2886 -0.0146 0.0033  -0.0209 317 PHE A CD1 
1283 C  CD2 . PHE A 171 ? 0.2817 0.1562 0.1933 -0.0125 0.0058  -0.0241 317 PHE A CD2 
1284 C  CE1 . PHE A 171 ? 0.4073 0.2797 0.3173 -0.0162 0.0100  -0.0184 317 PHE A CE1 
1285 C  CE2 . PHE A 171 ? 0.3002 0.1722 0.2101 -0.0135 0.0126  -0.0217 317 PHE A CE2 
1286 C  CZ  . PHE A 171 ? 0.3425 0.2140 0.2522 -0.0155 0.0149  -0.0188 317 PHE A CZ  
1287 N  N   . ILE A 172 ? 0.3327 0.2232 0.2617 -0.0142 -0.0084 -0.0251 318 ILE A N   
1288 C  CA  . ILE A 172 ? 0.2981 0.1903 0.2287 -0.0160 -0.0087 -0.0239 318 ILE A CA  
1289 C  C   . ILE A 172 ? 0.3583 0.2415 0.2802 -0.0157 -0.0097 -0.0234 318 ILE A C   
1290 O  O   . ILE A 172 ? 0.3573 0.2352 0.2742 -0.0132 -0.0137 -0.0253 318 ILE A O   
1291 C  CB  . ILE A 172 ? 0.2540 0.1513 0.1902 -0.0158 -0.0114 -0.0261 318 ILE A CB  
1292 C  CG1 . ILE A 172 ? 0.2672 0.1719 0.2106 -0.0162 -0.0096 -0.0257 318 ILE A CG1 
1293 C  CG2 . ILE A 172 ? 0.2297 0.1276 0.1661 -0.0177 -0.0118 -0.0257 318 ILE A CG2 
1294 C  CD1 . ILE A 172 ? 0.3122 0.2207 0.2601 -0.0159 -0.0107 -0.0280 318 ILE A CD1 
1295 N  N   . CYS A 173 ? 0.4247 0.3062 0.3457 -0.0182 -0.0061 -0.0208 319 CYS A N   
1296 C  CA  . CYS A 173 ? 0.4128 0.2848 0.3259 -0.0187 -0.0058 -0.0197 319 CYS A CA  
1297 C  C   . CYS A 173 ? 0.4298 0.3035 0.3472 -0.0203 -0.0079 -0.0207 319 CYS A C   
1298 O  O   . CYS A 173 ? 0.4195 0.3022 0.3452 -0.0220 -0.0084 -0.0217 319 CYS A O   
1299 C  CB  . CYS A 173 ? 0.3913 0.2599 0.3025 -0.0212 0.0004  -0.0167 319 CYS A CB  
1300 S  SG  . CYS A 173 ? 0.6140 0.4789 0.5186 -0.0194 0.0045  -0.0160 319 CYS A SG  
1301 N  N   . LYS A 174 ? 0.3735 0.2377 0.2840 -0.0197 -0.0091 -0.0205 320 LYS A N   
1302 C  CA  . LYS A 174 ? 0.3844 0.2483 0.2982 -0.0212 -0.0106 -0.0220 320 LYS A CA  
1303 C  C   . LYS A 174 ? 0.4157 0.2674 0.3224 -0.0225 -0.0085 -0.0199 320 LYS A C   
1304 O  O   . LYS A 174 ? 0.3454 0.1865 0.2416 -0.0197 -0.0087 -0.0181 320 LYS A O   
1305 C  CB  . LYS A 174 ? 0.3544 0.2196 0.2695 -0.0178 -0.0154 -0.0253 320 LYS A CB  
1306 C  CG  . LYS A 174 ? 0.3628 0.2263 0.2804 -0.0189 -0.0166 -0.0275 320 LYS A CG  
1307 C  CD  . LYS A 174 ? 0.3911 0.2473 0.3053 -0.0145 -0.0204 -0.0292 320 LYS A CD  
1308 C  CE  . LYS A 174 ? 0.4068 0.2674 0.3275 -0.0139 -0.0218 -0.0334 320 LYS A CE  
1309 N  NZ  . LYS A 174 ? 0.4310 0.2923 0.3544 -0.0089 -0.0255 -0.0359 320 LYS A NZ  
1310 N  N   . ARG A 175 ? 0.4152 0.2679 0.3272 -0.0267 -0.0066 -0.0203 321 ARG A N   
1311 C  CA  . ARG A 175 ? 0.4113 0.2519 0.3182 -0.0285 -0.0041 -0.0186 321 ARG A CA  
1312 C  C   . ARG A 175 ? 0.4533 0.2953 0.3669 -0.0318 -0.0051 -0.0216 321 ARG A C   
1313 O  O   . ARG A 175 ? 0.4792 0.3324 0.4018 -0.0346 -0.0060 -0.0239 321 ARG A O   
1314 C  CB  . ARG A 175 ? 0.3816 0.2184 0.2868 -0.0317 0.0026  -0.0150 321 ARG A CB  
1315 C  CG  . ARG A 175 ? 0.4111 0.2600 0.3298 -0.0368 0.0055  -0.0157 321 ARG A CG  
1316 C  CD  . ARG A 175 ? 0.4131 0.2571 0.3322 -0.0403 0.0134  -0.0125 321 ARG A CD  
1317 N  NE  . ARG A 175 ? 0.4110 0.2674 0.3459 -0.0451 0.0155  -0.0135 321 ARG A NE  
1318 C  CZ  . ARG A 175 ? 0.4907 0.3485 0.4350 -0.0502 0.0163  -0.0151 321 ARG A CZ  
1319 N  NH1 . ARG A 175 ? 0.4860 0.3326 0.4248 -0.0514 0.0160  -0.0157 321 ARG A NH1 
1320 N  NH2 . ARG A 175 ? 0.4954 0.3656 0.4551 -0.0541 0.0169  -0.0163 321 ARG A NH2 
1321 N  N   . PRO A 176 ? 0.4074 0.2371 0.3157 -0.0313 -0.0053 -0.0216 322 PRO A N   
1322 C  CA  . PRO A 176 ? 0.4061 0.2351 0.3195 -0.0340 -0.0065 -0.0253 322 PRO A CA  
1323 C  C   . PRO A 176 ? 0.4018 0.2353 0.3237 -0.0409 -0.0031 -0.0259 322 PRO A C   
1324 O  O   . PRO A 176 ? 0.4274 0.2570 0.3491 -0.0436 0.0019  -0.0225 322 PRO A O   
1325 C  CB  . PRO A 176 ? 0.4066 0.2185 0.3116 -0.0318 -0.0060 -0.0238 322 PRO A CB  
1326 C  CG  . PRO A 176 ? 0.4288 0.2343 0.3233 -0.0265 -0.0068 -0.0198 322 PRO A CG  
1327 C  CD  . PRO A 176 ? 0.3897 0.2040 0.2858 -0.0282 -0.0041 -0.0179 322 PRO A CD  
1328 N  N   . TYR A 177 ? 0.3987 0.2402 0.3281 -0.0438 -0.0058 -0.0304 323 TYR A N   
1329 C  CA  . TYR A 177 ? 0.4249 0.2692 0.3630 -0.0505 -0.0040 -0.0320 323 TYR A CA  
1330 C  C   . TYR A 177 ? 0.4683 0.2977 0.4037 -0.0528 -0.0016 -0.0327 323 TYR A C   
1331 O  O   . TYR A 177 ? 0.4801 0.3040 0.4126 -0.0512 -0.0042 -0.0362 323 TYR A O   
1332 C  CB  . TYR A 177 ? 0.4286 0.2849 0.3733 -0.0527 -0.0087 -0.0370 323 TYR A CB  
1333 C  CG  . TYR A 177 ? 0.4445 0.3017 0.3977 -0.0596 -0.0088 -0.0405 323 TYR A CG  
1334 C  CD1 . TYR A 177 ? 0.4228 0.2793 0.3839 -0.0644 -0.0043 -0.0382 323 TYR A CD1 
1335 C  CD2 . TYR A 177 ? 0.4797 0.3383 0.4335 -0.0615 -0.0130 -0.0465 323 TYR A CD2 
1336 C  CE1 . TYR A 177 ? 0.4094 0.2674 0.3808 -0.0712 -0.0046 -0.0420 323 TYR A CE1 
1337 C  CE2 . TYR A 177 ? 0.4664 0.3257 0.4283 -0.0681 -0.0140 -0.0505 323 TYR A CE2 
1338 C  CZ  . TYR A 177 ? 0.4403 0.2998 0.4120 -0.0730 -0.0100 -0.0483 323 TYR A CZ  
1339 O  OH  . TYR A 177 ? 0.4761 0.3371 0.4583 -0.0801 -0.0112 -0.0530 323 TYR A OH  
1340 N  N   . VAL A 178 ? 0.4996 0.3219 0.4361 -0.0563 0.0042  -0.0292 324 VAL A N   
1341 C  CA  . VAL A 178 ? 0.5679 0.3757 0.5035 -0.0597 0.0077  -0.0295 324 VAL A CA  
1342 C  C   . VAL A 178 ? 0.6143 0.4278 0.5639 -0.0681 0.0103  -0.0320 324 VAL A C   
1343 O  O   . VAL A 178 ? 0.6339 0.4515 0.5898 -0.0712 0.0153  -0.0290 324 VAL A O   
1344 C  CB  . VAL A 178 ? 0.6334 0.4245 0.5572 -0.0570 0.0131  -0.0231 324 VAL A CB  
1345 C  CG1 . VAL A 178 ? 0.6751 0.4708 0.5985 -0.0575 0.0180  -0.0184 324 VAL A CG1 
1346 C  CG2 . VAL A 178 ? 0.6497 0.4253 0.5738 -0.0617 0.0182  -0.0226 324 VAL A CG2 
1347 N  N   . PRO A 179 ? 0.6056 0.4199 0.5611 -0.0718 0.0069  -0.0381 325 PRO A N   
1348 C  CA  . PRO A 179 ? 0.6214 0.4430 0.5919 -0.0799 0.0070  -0.0423 325 PRO A CA  
1349 C  C   . PRO A 179 ? 0.7246 0.5376 0.7013 -0.0856 0.0157  -0.0390 325 PRO A C   
1350 O  O   . PRO A 179 ? 0.7902 0.5856 0.7576 -0.0844 0.0211  -0.0352 325 PRO A O   
1351 C  CB  . PRO A 179 ? 0.5897 0.4060 0.5595 -0.0817 0.0028  -0.0492 325 PRO A CB  
1352 C  CG  . PRO A 179 ? 0.5832 0.3983 0.5407 -0.0739 -0.0014 -0.0495 325 PRO A CG  
1353 C  CD  . PRO A 179 ? 0.5796 0.3878 0.5279 -0.0681 0.0023  -0.0421 325 PRO A CD  
1354 N  N   . SER A 180 ? 0.7497 0.5751 0.7426 -0.0915 0.0171  -0.0403 326 SER A N   
1355 C  CA  . SER A 180 ? 0.8124 0.6318 0.8143 -0.0977 0.0266  -0.0375 326 SER A CA  
1356 C  C   . SER A 180 ? 0.8510 0.6596 0.8598 -0.1048 0.0288  -0.0417 326 SER A C   
1357 O  O   . SER A 180 ? 0.8613 0.6612 0.8765 -0.1103 0.0380  -0.0392 326 SER A O   
1358 C  CB  . SER A 180 ? 0.8178 0.6557 0.8379 -0.1013 0.0274  -0.0379 326 SER A CB  
1359 O  OG  . SER A 180 ? 0.8266 0.6781 0.8624 -0.1063 0.0198  -0.0452 326 SER A OG  
1360 N  N   . GLU A 181 ? 0.8950 0.7034 0.9022 -0.1049 0.0212  -0.0482 327 GLU A N   
1361 C  CA  . GLU A 181 ? 0.9926 0.7916 1.0069 -0.1119 0.0219  -0.0539 327 GLU A CA  
1362 C  C   . GLU A 181 ? 1.0351 0.8225 1.0580 -0.1189 0.0329  -0.0508 327 GLU A C   
1363 O  O   . GLU A 181 ? 1.0407 0.8366 1.0833 -0.1272 0.0344  -0.0547 327 GLU A O   
1364 C  CB  . GLU A 181 ? 1.0249 0.8086 1.0239 -0.1073 0.0191  -0.0559 327 GLU A CB  
1365 C  CG  . GLU A 181 ? 1.0398 0.8341 1.0340 -0.1031 0.0089  -0.0618 327 GLU A CG  
1366 C  CD  . GLU A 181 ? 1.0882 0.8675 1.0708 -0.0996 0.0072  -0.0652 327 GLU A CD  
1367 O  OE1 . GLU A 181 ? 1.0946 0.8590 1.0796 -0.1041 0.0111  -0.0675 327 GLU A OE1 
1368 O  OE2 . GLU A 181 ? 1.0782 0.8606 1.0504 -0.0924 0.0026  -0.0657 327 GLU A OE2 
1369 N  N   . LEU B 21  ? 0.8079 0.9138 1.4450 -0.0868 -0.1827 -0.1687 167 LEU B N   
1370 C  CA  . LEU B 21  ? 0.8680 0.9762 1.5191 -0.0797 -0.2001 -0.1785 167 LEU B CA  
1371 C  C   . LEU B 21  ? 0.9380 1.0555 1.5775 -0.0771 -0.1873 -0.1733 167 LEU B C   
1372 O  O   . LEU B 21  ? 0.9409 1.0607 1.5559 -0.0795 -0.1668 -0.1638 167 LEU B O   
1373 C  CB  . LEU B 21  ? 0.8694 0.9818 1.5761 -0.0863 -0.2130 -0.1783 167 LEU B CB  
1374 C  CG  . LEU B 21  ? 0.8744 0.9834 1.5983 -0.0785 -0.2400 -0.1930 167 LEU B CG  
1375 C  CD1 . LEU B 21  ? 0.9044 0.9982 1.5995 -0.0688 -0.2583 -0.2077 167 LEU B CD1 
1376 C  CD2 . LEU B 21  ? 0.8522 0.9668 1.6346 -0.0873 -0.2504 -0.1900 167 LEU B CD2 
1377 N  N   . ASN B 22  ? 0.9948 1.1167 1.6515 -0.0719 -0.2001 -0.1798 168 ASN B N   
1378 C  CA  . ASN B 22  ? 1.0188 1.1492 1.6678 -0.0687 -0.1903 -0.1757 168 ASN B CA  
1379 C  C   . ASN B 22  ? 1.0080 1.1480 1.6635 -0.0774 -0.1650 -0.1594 168 ASN B C   
1380 O  O   . ASN B 22  ? 0.9939 1.1362 1.6235 -0.0746 -0.1511 -0.1546 168 ASN B O   
1381 C  CB  . ASN B 22  ? 1.0378 1.1751 1.7223 -0.0656 -0.2062 -0.1818 168 ASN B CB  
1382 C  CG  . ASN B 22  ? 1.0591 1.1868 1.7329 -0.0546 -0.2315 -0.1987 168 ASN B CG  
1383 O  OD1 . ASN B 22  ? 1.0664 1.1840 1.6989 -0.0470 -0.2350 -0.2056 168 ASN B OD1 
1384 N  ND2 . ASN B 22  ? 1.0664 1.1979 1.7777 -0.0533 -0.2495 -0.2053 168 ASN B ND2 
1385 N  N   . THR B 23  ? 1.0061 1.1511 1.6965 -0.0875 -0.1598 -0.1511 169 THR B N   
1386 C  CA  . THR B 23  ? 0.9846 1.1391 1.6845 -0.0957 -0.1362 -0.1351 169 THR B CA  
1387 C  C   . THR B 23  ? 0.9430 1.0924 1.5953 -0.0938 -0.1180 -0.1302 169 THR B C   
1388 O  O   . THR B 23  ? 0.9492 1.1051 1.5922 -0.0929 -0.1031 -0.1228 169 THR B O   
1389 C  CB  . THR B 23  ? 1.0137 1.1693 1.7451 -0.1063 -0.1337 -0.1277 169 THR B CB  
1390 O  OG1 . THR B 23  ? 1.0312 1.1727 1.7365 -0.1058 -0.1388 -0.1333 169 THR B OG1 
1391 C  CG2 . THR B 23  ? 1.0078 1.1691 1.7909 -0.1098 -0.1513 -0.1308 169 THR B CG2 
1392 N  N   . LYS B 24  ? 0.9014 1.0391 1.5237 -0.0929 -0.1201 -0.1345 170 LYS B N   
1393 C  CA  . LYS B 24  ? 0.8627 0.9956 1.4422 -0.0925 -0.1034 -0.1291 170 LYS B CA  
1394 C  C   . LYS B 24  ? 0.8391 0.9666 1.3781 -0.0828 -0.1074 -0.1365 170 LYS B C   
1395 O  O   . LYS B 24  ? 0.8238 0.9479 1.3273 -0.0820 -0.0943 -0.1319 170 LYS B O   
1396 C  CB  . LYS B 24  ? 0.8725 0.9967 1.4390 -0.0961 -0.1029 -0.1294 170 LYS B CB  
1397 C  CG  . LYS B 24  ? 0.8724 0.9948 1.4092 -0.0996 -0.0819 -0.1195 170 LYS B CG  
1398 C  CD  . LYS B 24  ? 0.8706 0.9846 1.3955 -0.1023 -0.0833 -0.1210 170 LYS B CD  
1399 C  CE  . LYS B 24  ? 0.8442 0.9576 1.3469 -0.1072 -0.0621 -0.1100 170 LYS B CE  
1400 N  NZ  . LYS B 24  ? 0.8352 0.9401 1.3219 -0.1085 -0.0644 -0.1126 170 LYS B NZ  
1401 N  N   . ILE B 25  ? 0.8407 0.9672 1.3858 -0.0754 -0.1261 -0.1477 171 ILE B N   
1402 C  CA  . ILE B 25  ? 0.8289 0.9507 1.3379 -0.0657 -0.1313 -0.1545 171 ILE B CA  
1403 C  C   . ILE B 25  ? 0.7746 0.9028 1.2813 -0.0644 -0.1203 -0.1482 171 ILE B C   
1404 O  O   . ILE B 25  ? 0.7601 0.8843 1.2304 -0.0612 -0.1116 -0.1457 171 ILE B O   
1405 C  CB  . ILE B 25  ? 0.8555 0.9735 1.3700 -0.0570 -0.1557 -0.1691 171 ILE B CB  
1406 C  CG1 . ILE B 25  ? 0.8502 0.9580 1.3273 -0.0506 -0.1637 -0.1771 171 ILE B CG1 
1407 C  CG2 . ILE B 25  ? 0.8764 0.9976 1.3878 -0.0495 -0.1611 -0.1729 171 ILE B CG2 
1408 C  CD1 . ILE B 25  ? 0.8318 0.9366 1.2625 -0.0460 -0.1538 -0.1744 171 ILE B CD1 
1409 N  N   . ARG B 26  ? 0.7338 0.8720 1.2800 -0.0668 -0.1210 -0.1454 172 ARG B N   
1410 C  CA  . ARG B 26  ? 0.7068 0.8521 1.2539 -0.0647 -0.1110 -0.1397 172 ARG B CA  
1411 C  C   . ARG B 26  ? 0.6328 0.7795 1.1661 -0.0704 -0.0878 -0.1266 172 ARG B C   
1412 O  O   . ARG B 26  ? 0.6021 0.7518 1.1256 -0.0681 -0.0771 -0.1212 172 ARG B O   
1413 C  CB  . ARG B 26  ? 0.7191 0.8767 1.3145 -0.0658 -0.1176 -0.1396 172 ARG B CB  
1414 C  CG  . ARG B 26  ? 0.7537 0.9091 1.3634 -0.0598 -0.1420 -0.1531 172 ARG B CG  
1415 C  CD  . ARG B 26  ? 0.8022 0.9705 1.4554 -0.0594 -0.1485 -0.1532 172 ARG B CD  
1416 N  NE  . ARG B 26  ? 0.8831 1.0480 1.5462 -0.0526 -0.1728 -0.1671 172 ARG B NE  
1417 C  CZ  . ARG B 26  ? 0.9573 1.1194 1.6445 -0.0549 -0.1891 -0.1738 172 ARG B CZ  
1418 N  NH1 . ARG B 26  ? 0.9784 1.1408 1.6825 -0.0644 -0.1832 -0.1674 172 ARG B NH1 
1419 N  NH2 . ARG B 26  ? 0.9724 1.1307 1.6661 -0.0473 -0.2118 -0.1871 172 ARG B NH2 
1420 N  N   . ALA B 27  ? 0.5874 0.7313 1.1190 -0.0772 -0.0808 -0.1221 173 ALA B N   
1421 C  CA  . ALA B 27  ? 0.5693 0.7129 1.0845 -0.0823 -0.0597 -0.1106 173 ALA B CA  
1422 C  C   . ALA B 27  ? 0.5352 0.6682 1.0001 -0.0780 -0.0554 -0.1119 173 ALA B C   
1423 O  O   . ALA B 27  ? 0.4777 0.6104 0.9241 -0.0771 -0.0425 -0.1054 173 ALA B O   
1424 C  CB  . ALA B 27  ? 0.5792 0.7222 1.1077 -0.0904 -0.0552 -0.1060 173 ALA B CB  
1425 N  N   . LEU B 28  ? 0.5272 0.6519 0.9704 -0.0752 -0.0669 -0.1202 174 LEU B N   
1426 C  CA  . LEU B 28  ? 0.5312 0.6473 0.9287 -0.0708 -0.0651 -0.1217 174 LEU B CA  
1427 C  C   . LEU B 28  ? 0.5362 0.6522 0.9232 -0.0639 -0.0685 -0.1240 174 LEU B C   
1428 O  O   . LEU B 28  ? 0.5353 0.6467 0.8925 -0.0626 -0.0591 -0.1192 174 LEU B O   
1429 C  CB  . LEU B 28  ? 0.5679 0.6776 0.9480 -0.0673 -0.0788 -0.1310 174 LEU B CB  
1430 C  CG  . LEU B 28  ? 0.6008 0.7087 0.9850 -0.0731 -0.0762 -0.1296 174 LEU B CG  
1431 C  CD1 . LEU B 28  ? 0.6232 0.7248 0.9851 -0.0674 -0.0898 -0.1392 174 LEU B CD1 
1432 C  CD2 . LEU B 28  ? 0.5759 0.6826 0.9424 -0.0795 -0.0561 -0.1183 174 LEU B CD2 
1433 N  N   . GLN B 29  ? 0.5079 0.6284 0.9200 -0.0593 -0.0824 -0.1312 175 GLN B N   
1434 C  CA  . GLN B 29  ? 0.5346 0.6556 0.9406 -0.0521 -0.0869 -0.1340 175 GLN B CA  
1435 C  C   . GLN B 29  ? 0.5098 0.6340 0.9147 -0.0541 -0.0701 -0.1238 175 GLN B C   
1436 O  O   . GLN B 29  ? 0.4783 0.5964 0.8531 -0.0502 -0.0659 -0.1220 175 GLN B O   
1437 C  CB  . GLN B 29  ? 0.5754 0.7030 1.0170 -0.0481 -0.1032 -0.1422 175 GLN B CB  
1438 C  CG  . GLN B 29  ? 0.6251 0.7531 1.0610 -0.0398 -0.1095 -0.1460 175 GLN B CG  
1439 C  CD  . GLN B 29  ? 0.6833 0.8183 1.1554 -0.0357 -0.1263 -0.1545 175 GLN B CD  
1440 O  OE1 . GLN B 29  ? 0.6947 0.8330 1.1952 -0.0389 -0.1355 -0.1584 175 GLN B OE1 
1441 N  NE2 . GLN B 29  ? 0.6942 0.8309 1.1655 -0.0286 -0.1313 -0.1574 175 GLN B NE2 
1442 N  N   . GLY B 30  ? 0.4893 0.6229 0.9267 -0.0598 -0.0606 -0.1169 176 GLY B N   
1443 C  CA  . GLY B 30  ? 0.4415 0.5796 0.8807 -0.0607 -0.0444 -0.1072 176 GLY B CA  
1444 C  C   . GLY B 30  ? 0.4111 0.5400 0.8117 -0.0626 -0.0303 -0.1004 176 GLY B C   
1445 O  O   . GLY B 30  ? 0.4251 0.5489 0.8022 -0.0583 -0.0258 -0.0985 176 GLY B O   
1446 N  N   . SER B 31  ? 0.3910 0.5170 0.7849 -0.0691 -0.0239 -0.0969 177 SER B N   
1447 C  CA  . SER B 31  ? 0.4450 0.5628 0.8046 -0.0716 -0.0104 -0.0902 177 SER B CA  
1448 C  C   . SER B 31  ? 0.4546 0.5615 0.7741 -0.0668 -0.0160 -0.0940 177 SER B C   
1449 O  O   . SER B 31  ? 0.4508 0.5508 0.7429 -0.0666 -0.0065 -0.0885 177 SER B O   
1450 C  CB  . SER B 31  ? 0.4741 0.5902 0.8316 -0.0786 -0.0060 -0.0878 177 SER B CB  
1451 O  OG  . SER B 31  ? 0.5389 0.6499 0.8833 -0.0772 -0.0193 -0.0961 177 SER B OG  
1452 N  N   . LEU B 32  ? 0.4391 0.5442 0.7554 -0.0625 -0.0320 -0.1033 178 LEU B N   
1453 C  CA  . LEU B 32  ? 0.4354 0.5314 0.7154 -0.0575 -0.0385 -0.1067 178 LEU B CA  
1454 C  C   . LEU B 32  ? 0.4657 0.5592 0.7382 -0.0518 -0.0384 -0.1058 178 LEU B C   
1455 O  O   . LEU B 32  ? 0.4636 0.5481 0.7034 -0.0507 -0.0342 -0.1023 178 LEU B O   
1456 C  CB  . LEU B 32  ? 0.4480 0.5439 0.7284 -0.0531 -0.0559 -0.1170 178 LEU B CB  
1457 C  CG  . LEU B 32  ? 0.5067 0.5944 0.7475 -0.0488 -0.0619 -0.1197 178 LEU B CG  
1458 C  CD1 . LEU B 32  ? 0.5467 0.6290 0.7585 -0.0546 -0.0492 -0.1117 178 LEU B CD1 
1459 C  CD2 . LEU B 32  ? 0.5077 0.5966 0.7508 -0.0442 -0.0778 -0.1297 178 LEU B CD2 
1460 N  N   . GLU B 33  ? 0.4921 0.5935 0.7951 -0.0482 -0.0435 -0.1090 179 GLU B N   
1461 C  CA  . GLU B 33  ? 0.5465 0.6462 0.8445 -0.0420 -0.0435 -0.1084 179 GLU B CA  
1462 C  C   . GLU B 33  ? 0.5384 0.6365 0.8289 -0.0442 -0.0266 -0.0987 179 GLU B C   
1463 O  O   . GLU B 33  ? 0.5126 0.6038 0.7834 -0.0396 -0.0247 -0.0969 179 GLU B O   
1464 C  CB  . GLU B 33  ? 0.5668 0.6767 0.9006 -0.0370 -0.0537 -0.1144 179 GLU B CB  
1465 C  CG  . GLU B 33  ? 0.6340 0.7570 1.0110 -0.0421 -0.0514 -0.1130 179 GLU B CG  
1466 C  CD  . GLU B 33  ? 0.7256 0.8582 1.1377 -0.0377 -0.0654 -0.1205 179 GLU B CD  
1467 O  OE1 . GLU B 33  ? 0.7581 0.9032 1.2068 -0.0397 -0.0608 -0.1167 179 GLU B OE1 
1468 O  OE2 . GLU B 33  ? 0.7409 0.8690 1.1444 -0.0321 -0.0811 -0.1298 179 GLU B OE2 
1469 N  N   . ASN B 34  ? 0.5351 0.6386 0.8401 -0.0507 -0.0149 -0.0926 180 ASN B N   
1470 C  CA  . ASN B 34  ? 0.5301 0.6318 0.8265 -0.0524 0.0014  -0.0834 180 ASN B CA  
1471 C  C   . ASN B 34  ? 0.5123 0.5994 0.7653 -0.0541 0.0062  -0.0800 180 ASN B C   
1472 O  O   . ASN B 34  ? 0.5021 0.5824 0.7371 -0.0514 0.0132  -0.0755 180 ASN B O   
1473 C  CB  . ASN B 34  ? 0.5783 0.6896 0.9007 -0.0588 0.0124  -0.0775 180 ASN B CB  
1474 C  CG  . ASN B 34  ? 0.6601 0.7870 1.0263 -0.0573 0.0123  -0.0770 180 ASN B CG  
1475 O  OD1 . ASN B 34  ? 0.6909 0.8216 1.0670 -0.0508 0.0061  -0.0804 180 ASN B OD1 
1476 N  ND2 . ASN B 34  ? 0.6678 0.8040 1.0610 -0.0633 0.0192  -0.0722 180 ASN B ND2 
1477 N  N   . MET B 35  ? 0.4975 0.5800 0.7342 -0.0582 0.0020  -0.0819 181 MET B N   
1478 C  CA  . MET B 35  ? 0.5133 0.5835 0.7105 -0.0603 0.0053  -0.0784 181 MET B CA  
1479 C  C   . MET B 35  ? 0.5089 0.5700 0.6822 -0.0544 -0.0033 -0.0810 181 MET B C   
1480 O  O   . MET B 35  ? 0.4907 0.5413 0.6376 -0.0543 0.0016  -0.0762 181 MET B O   
1481 C  CB  . MET B 35  ? 0.5130 0.5826 0.6999 -0.0654 0.0024  -0.0800 181 MET B CB  
1482 C  CG  . MET B 35  ? 0.5144 0.5877 0.7106 -0.0723 0.0141  -0.0746 181 MET B CG  
1483 S  SD  . MET B 35  ? 1.0602 1.1324 1.2415 -0.0773 0.0107  -0.0766 181 MET B SD  
1484 C  CE  . MET B 35  ? 0.4195 0.4997 0.6275 -0.0733 -0.0057 -0.0872 181 MET B CE  
1485 N  N   . SER B 36  ? 0.4670 0.5314 0.6499 -0.0493 -0.0168 -0.0887 182 SER B N   
1486 C  CA  . SER B 36  ? 0.4628 0.5194 0.6262 -0.0428 -0.0258 -0.0915 182 SER B CA  
1487 C  C   . SER B 36  ? 0.4603 0.5120 0.6202 -0.0392 -0.0194 -0.0874 182 SER B C   
1488 O  O   . SER B 36  ? 0.4616 0.5009 0.5921 -0.0374 -0.0200 -0.0846 182 SER B O   
1489 C  CB  . SER B 36  ? 0.4742 0.5375 0.6570 -0.0366 -0.0406 -0.1009 182 SER B CB  
1490 O  OG  . SER B 36  ? 0.4866 0.5448 0.6611 -0.0292 -0.0474 -0.1032 182 SER B OG  
1491 N  N   . LYS B 37  ? 0.4343 0.4957 0.6244 -0.0378 -0.0135 -0.0867 183 LYS B N   
1492 C  CA  . LYS B 37  ? 0.4316 0.4902 0.6206 -0.0330 -0.0069 -0.0830 183 LYS B CA  
1493 C  C   . LYS B 37  ? 0.3899 0.4380 0.5529 -0.0369 0.0052  -0.0751 183 LYS B C   
1494 O  O   . LYS B 37  ? 0.3744 0.4113 0.5158 -0.0330 0.0065  -0.0727 183 LYS B O   
1495 C  CB  . LYS B 37  ? 0.4429 0.5172 0.6720 -0.0309 -0.0022 -0.0830 183 LYS B CB  
1496 C  CG  . LYS B 37  ? 0.5108 0.5952 0.7674 -0.0266 -0.0152 -0.0910 183 LYS B CG  
1497 C  CD  . LYS B 37  ? 0.5400 0.6407 0.8367 -0.0243 -0.0104 -0.0897 183 LYS B CD  
1498 C  CE  . LYS B 37  ? 0.5695 0.6796 0.8933 -0.0198 -0.0247 -0.0979 183 LYS B CE  
1499 N  NZ  . LYS B 37  ? 0.5648 0.6918 0.9282 -0.0171 -0.0203 -0.0959 183 LYS B NZ  
1500 N  N   . LEU B 38  ? 0.3659 0.4170 0.5310 -0.0444 0.0132  -0.0714 184 LEU B N   
1501 C  CA  . LEU B 38  ? 0.3888 0.4306 0.5307 -0.0484 0.0244  -0.0642 184 LEU B CA  
1502 C  C   . LEU B 38  ? 0.3922 0.4184 0.4958 -0.0500 0.0188  -0.0632 184 LEU B C   
1503 O  O   . LEU B 38  ? 0.4133 0.4272 0.4934 -0.0494 0.0231  -0.0587 184 LEU B O   
1504 C  CB  . LEU B 38  ? 0.4205 0.4694 0.5737 -0.0560 0.0328  -0.0611 184 LEU B CB  
1505 C  CG  . LEU B 38  ? 0.4898 0.5298 0.6198 -0.0608 0.0439  -0.0540 184 LEU B CG  
1506 C  CD1 . LEU B 38  ? 0.5292 0.5625 0.6502 -0.0554 0.0514  -0.0499 184 LEU B CD1 
1507 C  CD2 . LEU B 38  ? 0.5053 0.5546 0.6530 -0.0669 0.0527  -0.0512 184 LEU B CD2 
1508 N  N   . LEU B 39  ? 0.4219 0.4489 0.5195 -0.0516 0.0088  -0.0672 185 LEU B N   
1509 C  CA  . LEU B 39  ? 0.4670 0.4817 0.5301 -0.0534 0.0033  -0.0654 185 LEU B CA  
1510 C  C   . LEU B 39  ? 0.4761 0.4800 0.5237 -0.0469 -0.0037 -0.0661 185 LEU B C   
1511 O  O   . LEU B 39  ? 0.4771 0.4671 0.4955 -0.0484 -0.0036 -0.0612 185 LEU B O   
1512 C  CB  . LEU B 39  ? 0.4517 0.4722 0.5137 -0.0551 -0.0056 -0.0696 185 LEU B CB  
1513 C  CG  . LEU B 39  ? 0.4959 0.5069 0.5234 -0.0580 -0.0096 -0.0661 185 LEU B CG  
1514 C  CD1 . LEU B 39  ? 0.5319 0.5350 0.5403 -0.0649 0.0009  -0.0578 185 LEU B CD1 
1515 C  CD2 . LEU B 39  ? 0.5321 0.5512 0.5597 -0.0588 -0.0166 -0.0701 185 LEU B CD2 
1516 N  N   . LYS B 40  ? 0.4286 0.4386 0.4961 -0.0396 -0.0103 -0.0720 186 LYS B N   
1517 C  CA  . LYS B 40  ? 0.4700 0.4704 0.5255 -0.0323 -0.0171 -0.0732 186 LYS B CA  
1518 C  C   . LYS B 40  ? 0.4597 0.4497 0.5037 -0.0309 -0.0084 -0.0679 186 LYS B C   
1519 O  O   . LYS B 40  ? 0.4281 0.4026 0.4453 -0.0291 -0.0119 -0.0652 186 LYS B O   
1520 C  CB  . LYS B 40  ? 0.5241 0.5350 0.6079 -0.0246 -0.0243 -0.0806 186 LYS B CB  
1521 C  CG  . LYS B 40  ? 0.6453 0.6470 0.7190 -0.0160 -0.0305 -0.0822 186 LYS B CG  
1522 C  CD  . LYS B 40  ? 0.7669 0.7810 0.8736 -0.0084 -0.0324 -0.0875 186 LYS B CD  
1523 C  CE  . LYS B 40  ? 0.8270 0.8547 0.9588 -0.0078 -0.0416 -0.0947 186 LYS B CE  
1524 N  NZ  . LYS B 40  ? 0.8711 0.9112 1.0360 -0.0007 -0.0447 -0.0997 186 LYS B NZ  
1525 N  N   . ARG B 41  ? 0.4650 0.4637 0.5295 -0.0313 0.0025  -0.0662 187 ARG B N   
1526 C  CA  . ARG B 41  ? 0.4975 0.4886 0.5539 -0.0283 0.0114  -0.0617 187 ARG B CA  
1527 C  C   . ARG B 41  ? 0.4601 0.4353 0.4834 -0.0343 0.0151  -0.0555 187 ARG B C   
1528 O  O   . ARG B 41  ? 0.4780 0.4382 0.4802 -0.0308 0.0151  -0.0530 187 ARG B O   
1529 C  CB  . ARG B 41  ? 0.5851 0.5915 0.6717 -0.0279 0.0230  -0.0604 187 ARG B CB  
1530 C  CG  . ARG B 41  ? 0.7077 0.7083 0.7866 -0.0243 0.0340  -0.0554 187 ARG B CG  
1531 C  CD  . ARG B 41  ? 0.8180 0.8368 0.9304 -0.0225 0.0450  -0.0538 187 ARG B CD  
1532 N  NE  . ARG B 41  ? 0.9447 0.9592 1.0485 -0.0191 0.0569  -0.0484 187 ARG B NE  
1533 C  CZ  . ARG B 41  ? 1.0414 1.0703 1.1694 -0.0166 0.0685  -0.0451 187 ARG B CZ  
1534 N  NH1 . ARG B 41  ? 1.0438 1.0923 1.2082 -0.0183 0.0694  -0.0463 187 ARG B NH1 
1535 N  NH2 . ARG B 41  ? 1.0870 1.1109 1.2032 -0.0122 0.0789  -0.0404 187 ARG B NH2 
1536 N  N   . GLN B 42  ? 0.3904 0.3684 0.4091 -0.0431 0.0174  -0.0532 188 GLN B N   
1537 C  CA  . GLN B 42  ? 0.3930 0.3574 0.3818 -0.0497 0.0202  -0.0472 188 GLN B CA  
1538 C  C   . GLN B 42  ? 0.3993 0.3489 0.3602 -0.0495 0.0094  -0.0461 188 GLN B C   
1539 O  O   . GLN B 42  ? 0.3789 0.3126 0.3143 -0.0515 0.0096  -0.0411 188 GLN B O   
1540 C  CB  . GLN B 42  ? 0.3810 0.3536 0.3727 -0.0586 0.0247  -0.0452 188 GLN B CB  
1541 C  CG  . GLN B 42  ? 0.4526 0.4372 0.4684 -0.0598 0.0363  -0.0446 188 GLN B CG  
1542 C  CD  . GLN B 42  ? 0.5458 0.5350 0.5592 -0.0686 0.0412  -0.0419 188 GLN B CD  
1543 O  OE1 . GLN B 42  ? 0.6161 0.5993 0.6077 -0.0738 0.0371  -0.0398 188 GLN B OE1 
1544 N  NE2 . GLN B 42  ? 0.5277 0.5279 0.5635 -0.0701 0.0503  -0.0413 188 GLN B NE2 
1545 N  N   . ASN B 43  ? 0.4035 0.3582 0.3695 -0.0468 -0.0006 -0.0506 189 ASN B N   
1546 C  CA  . ASN B 43  ? 0.4398 0.3814 0.3808 -0.0457 -0.0112 -0.0493 189 ASN B CA  
1547 C  C   . ASN B 43  ? 0.4274 0.3544 0.3577 -0.0385 -0.0143 -0.0492 189 ASN B C   
1548 O  O   . ASN B 43  ? 0.4873 0.3972 0.3903 -0.0402 -0.0187 -0.0445 189 ASN B O   
1549 C  CB  . ASN B 43  ? 0.4422 0.3929 0.3913 -0.0429 -0.0212 -0.0547 189 ASN B CB  
1550 C  CG  . ASN B 43  ? 0.5187 0.4572 0.4401 -0.0427 -0.0312 -0.0518 189 ASN B CG  
1551 O  OD1 . ASN B 43  ? 0.6088 0.5404 0.5078 -0.0498 -0.0304 -0.0451 189 ASN B OD1 
1552 N  ND2 . ASN B 43  ? 0.4789 0.4151 0.4021 -0.0346 -0.0407 -0.0564 189 ASN B ND2 
1553 N  N   . ASP B 44  ? 0.3486 0.2824 0.3008 -0.0303 -0.0126 -0.0541 190 ASP B N   
1554 C  CA  . ASP B 44  ? 0.3920 0.3134 0.3358 -0.0218 -0.0151 -0.0547 190 ASP B CA  
1555 C  C   . ASP B 44  ? 0.4218 0.3269 0.3428 -0.0244 -0.0094 -0.0487 190 ASP B C   
1556 O  O   . ASP B 44  ? 0.4381 0.3242 0.3347 -0.0221 -0.0156 -0.0465 190 ASP B O   
1557 C  CB  . ASP B 44  ? 0.4500 0.3850 0.4240 -0.0130 -0.0109 -0.0599 190 ASP B CB  
1558 C  CG  . ASP B 44  ? 0.5180 0.4666 0.5141 -0.0087 -0.0191 -0.0667 190 ASP B CG  
1559 O  OD1 . ASP B 44  ? 0.5523 0.4971 0.5366 -0.0105 -0.0290 -0.0679 190 ASP B OD1 
1560 O  OD2 . ASP B 44  ? 0.5218 0.4850 0.5474 -0.0032 -0.0159 -0.0705 190 ASP B OD2 
1561 N  N   . ILE B 45  ? 0.3776 0.2895 0.3064 -0.0291 0.0019  -0.0460 191 ILE B N   
1562 C  CA  . ILE B 45  ? 0.3940 0.2916 0.3029 -0.0313 0.0078  -0.0408 191 ILE B CA  
1563 C  C   . ILE B 45  ? 0.4001 0.2824 0.2796 -0.0401 0.0020  -0.0352 191 ILE B C   
1564 O  O   . ILE B 45  ? 0.4713 0.3337 0.3268 -0.0393 -0.0018 -0.0320 191 ILE B O   
1565 C  CB  . ILE B 45  ? 0.3711 0.2807 0.2955 -0.0347 0.0212  -0.0391 191 ILE B CB  
1566 C  CG1 . ILE B 45  ? 0.4127 0.3364 0.3649 -0.0255 0.0282  -0.0427 191 ILE B CG1 
1567 C  CG2 . ILE B 45  ? 0.3385 0.2325 0.2392 -0.0380 0.0261  -0.0337 191 ILE B CG2 
1568 C  CD1 . ILE B 45  ? 0.4260 0.3642 0.3975 -0.0289 0.0414  -0.0405 191 ILE B CD1 
1569 N  N   . LEU B 46  ? 0.3931 0.2849 0.2749 -0.0482 0.0009  -0.0339 192 LEU B N   
1570 C  CA  . LEU B 46  ? 0.4002 0.2815 0.2569 -0.0571 -0.0041 -0.0277 192 LEU B CA  
1571 C  C   . LEU B 46  ? 0.4989 0.3632 0.3347 -0.0542 -0.0160 -0.0262 192 LEU B C   
1572 O  O   . LEU B 46  ? 0.5639 0.4110 0.3752 -0.0590 -0.0195 -0.0199 192 LEU B O   
1573 C  CB  . LEU B 46  ? 0.3940 0.2911 0.2586 -0.0636 -0.0043 -0.0277 192 LEU B CB  
1574 C  CG  . LEU B 46  ? 0.3972 0.2878 0.2379 -0.0727 -0.0085 -0.0204 192 LEU B CG  
1575 C  CD1 . LEU B 46  ? 0.4026 0.2826 0.2282 -0.0797 -0.0026 -0.0140 192 LEU B CD1 
1576 C  CD2 . LEU B 46  ? 0.3892 0.2976 0.2390 -0.0768 -0.0085 -0.0214 192 LEU B CD2 
1577 N  N   . GLN B 47  ? 0.4852 0.3540 0.3312 -0.0464 -0.0226 -0.0317 193 GLN B N   
1578 C  CA  . GLN B 47  ? 0.5316 0.3851 0.3588 -0.0430 -0.0344 -0.0305 193 GLN B CA  
1579 C  C   . GLN B 47  ? 0.5414 0.3729 0.3510 -0.0388 -0.0365 -0.0286 193 GLN B C   
1580 O  O   . GLN B 47  ? 0.5862 0.3992 0.3714 -0.0416 -0.0447 -0.0233 193 GLN B O   
1581 C  CB  . GLN B 47  ? 0.6200 0.4832 0.4635 -0.0340 -0.0409 -0.0379 193 GLN B CB  
1582 C  CG  . GLN B 47  ? 0.6723 0.5544 0.5298 -0.0367 -0.0421 -0.0405 193 GLN B CG  
1583 C  CD  . GLN B 47  ? 0.7314 0.6100 0.5676 -0.0451 -0.0463 -0.0336 193 GLN B CD  
1584 O  OE1 . GLN B 47  ? 0.8133 0.6778 0.6279 -0.0450 -0.0548 -0.0293 193 GLN B OE1 
1585 N  NE2 . GLN B 47  ? 0.6796 0.5714 0.5218 -0.0523 -0.0404 -0.0320 193 GLN B NE2 
1586 N  N   . VAL B 48  ? 0.4952 0.3287 0.3172 -0.0317 -0.0295 -0.0326 194 VAL B N   
1587 C  CA  . VAL B 48  ? 0.4870 0.3000 0.2925 -0.0256 -0.0316 -0.0320 194 VAL B CA  
1588 C  C   . VAL B 48  ? 0.4822 0.2814 0.2684 -0.0333 -0.0281 -0.0256 194 VAL B C   
1589 O  O   . VAL B 48  ? 0.4773 0.2535 0.2393 -0.0335 -0.0353 -0.0221 194 VAL B O   
1590 C  CB  . VAL B 48  ? 0.4510 0.2723 0.2761 -0.0136 -0.0251 -0.0383 194 VAL B CB  
1591 C  CG1 . VAL B 48  ? 0.4263 0.2261 0.2320 -0.0062 -0.0271 -0.0380 194 VAL B CG1 
1592 C  CG2 . VAL B 48  ? 0.4476 0.2809 0.2914 -0.0054 -0.0303 -0.0448 194 VAL B CG2 
1593 N  N   . VAL B 49  ? 0.5062 0.3190 0.3033 -0.0399 -0.0177 -0.0241 195 VAL B N   
1594 C  CA  . VAL B 49  ? 0.5071 0.3093 0.2877 -0.0478 -0.0141 -0.0182 195 VAL B CA  
1595 C  C   . VAL B 49  ? 0.5247 0.3150 0.2834 -0.0583 -0.0231 -0.0109 195 VAL B C   
1596 O  O   . VAL B 49  ? 0.4776 0.2504 0.2160 -0.0635 -0.0256 -0.0055 195 VAL B O   
1597 C  CB  . VAL B 49  ? 0.4658 0.2871 0.2642 -0.0527 -0.0014 -0.0181 195 VAL B CB  
1598 C  CG1 . VAL B 49  ? 0.4483 0.2606 0.2293 -0.0630 0.0010  -0.0115 195 VAL B CG1 
1599 C  CG2 . VAL B 49  ? 0.3580 0.1873 0.1741 -0.0427 0.0080  -0.0231 195 VAL B CG2 
1600 N  N   . SER B 50  ? 0.5416 0.3417 0.3047 -0.0610 -0.0282 -0.0105 196 SER B N   
1601 C  CA  . SER B 50  ? 0.5776 0.3694 0.3214 -0.0700 -0.0366 -0.0028 196 SER B CA  
1602 C  C   . SER B 50  ? 0.5860 0.3527 0.3078 -0.0671 -0.0486 0.0000  196 SER B C   
1603 O  O   . SER B 50  ? 0.5381 0.2946 0.2419 -0.0748 -0.0562 0.0079  196 SER B O   
1604 C  CB  . SER B 50  ? 0.6088 0.4192 0.3635 -0.0714 -0.0386 -0.0039 196 SER B CB  
1605 O  OG  . SER B 50  ? 0.6345 0.4656 0.4053 -0.0761 -0.0293 -0.0050 196 SER B OG  
1606 N  N   . GLN B 51  ? 0.5776 0.3349 0.3012 -0.0556 -0.0505 -0.0061 197 GLN B N   
1607 C  CA  . GLN B 51  ? 0.6681 0.4000 0.3708 -0.0513 -0.0622 -0.0044 197 GLN B CA  
1608 C  C   . GLN B 51  ? 0.6542 0.3660 0.3434 -0.0488 -0.0618 -0.0042 197 GLN B C   
1609 O  O   . GLN B 51  ? 0.6203 0.3110 0.2954 -0.0413 -0.0703 -0.0057 197 GLN B O   
1610 C  CB  . GLN B 51  ? 0.7268 0.4610 0.4386 -0.0388 -0.0671 -0.0118 197 GLN B CB  
1611 C  CG  . GLN B 51  ? 0.7715 0.5231 0.4943 -0.0401 -0.0696 -0.0126 197 GLN B CG  
1612 C  CD  . GLN B 51  ? 0.8435 0.6008 0.5797 -0.0272 -0.0733 -0.0211 197 GLN B CD  
1613 O  OE1 . GLN B 51  ? 0.9012 0.6464 0.6344 -0.0173 -0.0759 -0.0253 197 GLN B OE1 
1614 N  NE2 . GLN B 51  ? 0.8344 0.6102 0.5854 -0.0267 -0.0740 -0.0240 197 GLN B NE2 
1615 N  N   . GLY B 52  ? 0.6574 0.3754 0.3503 -0.0544 -0.0523 -0.0026 198 GLY B N   
1616 C  CA  . GLY B 52  ? 0.6362 0.3352 0.3143 -0.0532 -0.0522 -0.0017 198 GLY B CA  
1617 C  C   . GLY B 52  ? 0.6304 0.3321 0.3184 -0.0395 -0.0448 -0.0097 198 GLY B C   
1618 O  O   . GLY B 52  ? 0.6560 0.3392 0.3295 -0.0344 -0.0465 -0.0105 198 GLY B O   
1619 N  N   . TRP B 53  ? 0.3464 0.3291 0.2568 -0.0032 0.0201  -0.0022 199 TRP B N   
1620 C  CA  . TRP B 53  ? 0.3092 0.2825 0.2202 -0.0039 0.0192  -0.0037 199 TRP B CA  
1621 C  C   . TRP B 53  ? 0.3082 0.2760 0.2211 -0.0031 0.0192  -0.0068 199 TRP B C   
1622 O  O   . TRP B 53  ? 0.3257 0.2983 0.2396 -0.0006 0.0191  -0.0087 199 TRP B O   
1623 C  CB  . TRP B 53  ? 0.3042 0.2813 0.2155 -0.0022 0.0189  -0.0079 199 TRP B CB  
1624 C  CG  . TRP B 53  ? 0.3350 0.3141 0.2409 0.0001  0.0184  -0.0041 199 TRP B CG  
1625 C  CD1 . TRP B 53  ? 0.3572 0.3392 0.2566 0.0024  0.0196  0.0008  199 TRP B CD1 
1626 C  CD2 . TRP B 53  ? 0.3092 0.2858 0.2137 0.0013  0.0174  -0.0048 199 TRP B CD2 
1627 N  NE1 . TRP B 53  ? 0.3462 0.3252 0.2381 0.0063  0.0195  0.0040  199 TRP B NE1 
1628 C  CE2 . TRP B 53  ? 0.3288 0.3061 0.2245 0.0061  0.0175  0.0003  199 TRP B CE2 
1629 C  CE3 . TRP B 53  ? 0.3048 0.2783 0.2136 -0.0009 0.0173  -0.0093 199 TRP B CE3 
1630 C  CZ2 . TRP B 53  ? 0.3653 0.3412 0.2563 0.0105  0.0163  0.0007  199 TRP B CZ2 
1631 C  CZ3 . TRP B 53  ? 0.3645 0.3394 0.2712 0.0018  0.0162  -0.0097 199 TRP B CZ3 
1632 C  CH2 . TRP B 53  ? 0.3844 0.3610 0.2822 0.0084  0.0150  -0.0049 199 TRP B CH2 
1633 N  N   . LYS B 54  ? 0.2732 0.2295 0.1846 -0.0042 0.0199  -0.0070 200 LYS B N   
1634 C  CA  . LYS B 54  ? 0.3116 0.2570 0.2204 -0.0021 0.0215  -0.0088 200 LYS B CA  
1635 C  C   . LYS B 54  ? 0.3783 0.3169 0.2878 -0.0045 0.0253  -0.0142 200 LYS B C   
1636 O  O   . LYS B 54  ? 0.3208 0.2658 0.2340 -0.0074 0.0253  -0.0168 200 LYS B O   
1637 C  CB  . LYS B 54  ? 0.3790 0.3151 0.2836 -0.0017 0.0207  -0.0049 200 LYS B CB  
1638 C  CG  . LYS B 54  ? 0.4121 0.3569 0.3184 -0.0023 0.0176  -0.0017 200 LYS B CG  
1639 C  CD  . LYS B 54  ? 0.4345 0.3886 0.3418 0.0020  0.0158  -0.0033 200 LYS B CD  
1640 C  CE  . LYS B 54  ? 0.4335 0.3969 0.3438 0.0000  0.0137  -0.0027 200 LYS B CE  
1641 N  NZ  . LYS B 54  ? 0.4084 0.3797 0.3232 -0.0067 0.0154  -0.0014 200 LYS B NZ  
1642 N  N   . TYR B 55  ? 0.4155 0.3409 0.3207 -0.0029 0.0293  -0.0168 201 TYR B N   
1643 C  CA  . TYR B 55  ? 0.4223 0.3388 0.3284 -0.0074 0.0355  -0.0236 201 TYR B CA  
1644 C  C   . TYR B 55  ? 0.4353 0.3278 0.3315 -0.0066 0.0417  -0.0220 201 TYR B C   
1645 O  O   . TYR B 55  ? 0.4659 0.3484 0.3532 0.0005  0.0415  -0.0181 201 TYR B O   
1646 C  CB  . TYR B 55  ? 0.4088 0.3314 0.3189 -0.0075 0.0374  -0.0310 201 TYR B CB  
1647 C  CG  . TYR B 55  ? 0.4248 0.3358 0.3358 -0.0135 0.0459  -0.0400 201 TYR B CG  
1648 C  CD1 . TYR B 55  ? 0.4094 0.3317 0.3295 -0.0204 0.0474  -0.0480 201 TYR B CD1 
1649 C  CD2 . TYR B 55  ? 0.4318 0.3202 0.3340 -0.0122 0.0531  -0.0412 201 TYR B CD2 
1650 C  CE1 . TYR B 55  ? 0.4467 0.3607 0.3699 -0.0280 0.0564  -0.0585 201 TYR B CE1 
1651 C  CE2 . TYR B 55  ? 0.4704 0.3450 0.3730 -0.0197 0.0634  -0.0502 201 TYR B CE2 
1652 C  CZ  . TYR B 55  ? 0.5109 0.3997 0.4254 -0.0288 0.0652  -0.0596 201 TYR B CZ  
1653 O  OH  . TYR B 55  ? 0.5466 0.4246 0.4640 -0.0385 0.0765  -0.0709 201 TYR B OH  
1654 N  N   . PHE B 56  ? 0.3827 0.2663 0.2794 -0.0131 0.0477  -0.0256 202 PHE B N   
1655 C  CA  . PHE B 56  ? 0.3753 0.2325 0.2601 -0.0131 0.0560  -0.0240 202 PHE B CA  
1656 C  C   . PHE B 56  ? 0.4139 0.2644 0.3029 -0.0235 0.0655  -0.0324 202 PHE B C   
1657 O  O   . PHE B 56  ? 0.4306 0.2934 0.3279 -0.0288 0.0640  -0.0349 202 PHE B O   
1658 C  CB  . PHE B 56  ? 0.3647 0.2160 0.2414 -0.0084 0.0525  -0.0152 202 PHE B CB  
1659 C  CG  . PHE B 56  ? 0.4039 0.2269 0.2647 -0.0060 0.0611  -0.0121 202 PHE B CG  
1660 C  CD1 . PHE B 56  ? 0.4561 0.2603 0.3020 0.0032  0.0644  -0.0090 202 PHE B CD1 
1661 C  CD2 . PHE B 56  ? 0.4203 0.2347 0.2791 -0.0119 0.0665  -0.0121 202 PHE B CD2 
1662 C  CE1 . PHE B 56  ? 0.5025 0.2770 0.3293 0.0074  0.0734  -0.0050 202 PHE B CE1 
1663 C  CE2 . PHE B 56  ? 0.4675 0.2536 0.3089 -0.0094 0.0758  -0.0086 202 PHE B CE2 
1664 C  CZ  . PHE B 56  ? 0.5000 0.2648 0.3242 0.0007  0.0795  -0.0045 202 PHE B CZ  
1665 N  N   . LYS B 57  ? 0.4640 0.2949 0.3473 -0.0264 0.0760  -0.0377 203 LYS B N   
1666 C  CA  . LYS B 57  ? 0.5111 0.3327 0.3979 -0.0382 0.0880  -0.0474 203 LYS B CA  
1667 C  C   . LYS B 57  ? 0.4676 0.3193 0.3741 -0.0466 0.0848  -0.0582 203 LYS B C   
1668 O  O   . LYS B 57  ? 0.4854 0.3418 0.3962 -0.0520 0.0867  -0.0604 203 LYS B O   
1669 C  CB  . LYS B 57  ? 0.5713 0.3688 0.4449 -0.0392 0.0958  -0.0414 203 LYS B CB  
1670 C  CG  . LYS B 57  ? 0.6474 0.4097 0.4980 -0.0308 0.1032  -0.0333 203 LYS B CG  
1671 C  CD  . LYS B 57  ? 0.7217 0.4581 0.5580 -0.0334 0.1141  -0.0293 203 LYS B CD  
1672 C  CE  . LYS B 57  ? 0.7860 0.4832 0.5951 -0.0234 0.1234  -0.0213 203 LYS B CE  
1673 N  NZ  . LYS B 57  ? 0.8170 0.4847 0.6093 -0.0267 0.1372  -0.0179 203 LYS B NZ  
1674 N  N   . GLY B 58  ? 0.4413 0.3142 0.3585 -0.0464 0.0797  -0.0655 204 GLY B N   
1675 C  CA  . GLY B 58  ? 0.4581 0.3601 0.3921 -0.0524 0.0773  -0.0780 204 GLY B CA  
1676 C  C   . GLY B 58  ? 0.4653 0.3902 0.4041 -0.0467 0.0657  -0.0727 204 GLY B C   
1677 O  O   . GLY B 58  ? 0.4590 0.4069 0.4091 -0.0494 0.0636  -0.0822 204 GLY B O   
1678 N  N   . ASN B 59  ? 0.4479 0.3666 0.3775 -0.0384 0.0586  -0.0585 205 ASN B N   
1679 C  CA  . ASN B 59  ? 0.4192 0.3541 0.3508 -0.0331 0.0491  -0.0525 205 ASN B CA  
1680 C  C   . ASN B 59  ? 0.4197 0.3569 0.3458 -0.0249 0.0413  -0.0422 205 ASN B C   
1681 O  O   . ASN B 59  ? 0.4318 0.3548 0.3504 -0.0222 0.0423  -0.0364 205 ASN B O   
1682 C  CB  . ASN B 59  ? 0.4239 0.3487 0.3514 -0.0346 0.0506  -0.0474 205 ASN B CB  
1683 C  CG  . ASN B 59  ? 0.4488 0.3818 0.3850 -0.0422 0.0563  -0.0587 205 ASN B CG  
1684 O  OD1 . ASN B 59  ? 0.4404 0.3971 0.3858 -0.0409 0.0516  -0.0655 205 ASN B OD1 
1685 N  ND2 . ASN B 59  ? 0.4626 0.3763 0.3953 -0.0495 0.0670  -0.0613 205 ASN B ND2 
1686 N  N   . PHE B 60  ? 0.4059 0.3613 0.3349 -0.0206 0.0343  -0.0407 206 PHE B N   
1687 C  CA  . PHE B 60  ? 0.3241 0.2820 0.2481 -0.0146 0.0287  -0.0315 206 PHE B CA  
1688 C  C   . PHE B 60  ? 0.3578 0.3103 0.2772 -0.0132 0.0259  -0.0228 206 PHE B C   
1689 O  O   . PHE B 60  ? 0.3568 0.3117 0.2776 -0.0140 0.0256  -0.0243 206 PHE B O   
1690 C  CB  . PHE B 60  ? 0.3439 0.3212 0.2705 -0.0103 0.0246  -0.0346 206 PHE B CB  
1691 C  CG  . PHE B 60  ? 0.3594 0.3438 0.2902 -0.0109 0.0265  -0.0429 206 PHE B CG  
1692 C  CD1 . PHE B 60  ? 0.3410 0.3163 0.2689 -0.0103 0.0280  -0.0403 206 PHE B CD1 
1693 C  CD2 . PHE B 60  ? 0.3425 0.3447 0.2802 -0.0111 0.0263  -0.0546 206 PHE B CD2 
1694 C  CE1 . PHE B 60  ? 0.3584 0.3391 0.2896 -0.0105 0.0299  -0.0484 206 PHE B CE1 
1695 C  CE2 . PHE B 60  ? 0.3226 0.3322 0.2648 -0.0120 0.0281  -0.0638 206 PHE B CE2 
1696 C  CZ  . PHE B 60  ? 0.3182 0.3154 0.2567 -0.0120 0.0303  -0.0602 206 PHE B CZ  
1697 N  N   . TYR B 61  ? 0.3339 0.2803 0.2485 -0.0112 0.0239  -0.0150 207 TYR B N   
1698 C  CA  . TYR B 61  ? 0.3191 0.2591 0.2298 -0.0110 0.0222  -0.0082 207 TYR B CA  
1699 C  C   . TYR B 61  ? 0.3089 0.2542 0.2176 -0.0092 0.0195  -0.0029 207 TYR B C   
1700 O  O   . TYR B 61  ? 0.3736 0.3239 0.2830 -0.0080 0.0193  -0.0029 207 TYR B O   
1701 C  CB  . TYR B 61  ? 0.2974 0.2236 0.2041 -0.0116 0.0239  -0.0060 207 TYR B CB  
1702 C  CG  . TYR B 61  ? 0.3286 0.2446 0.2344 -0.0145 0.0289  -0.0100 207 TYR B CG  
1703 C  CD1 . TYR B 61  ? 0.3239 0.2352 0.2286 -0.0165 0.0299  -0.0093 207 TYR B CD1 
1704 C  CD2 . TYR B 61  ? 0.3500 0.2599 0.2556 -0.0157 0.0340  -0.0151 207 TYR B CD2 
1705 C  CE1 . TYR B 61  ? 0.3532 0.2552 0.2570 -0.0203 0.0361  -0.0135 207 TYR B CE1 
1706 C  CE2 . TYR B 61  ? 0.3352 0.2331 0.2391 -0.0201 0.0411  -0.0194 207 TYR B CE2 
1707 C  CZ  . TYR B 61  ? 0.3767 0.2713 0.2800 -0.0227 0.0423  -0.0185 207 TYR B CZ  
1708 O  OH  . TYR B 61  ? 0.3905 0.2733 0.2921 -0.0282 0.0509  -0.0232 207 TYR B OH  
1709 N  N   . TYR B 62  ? 0.2514 0.1944 0.1571 -0.0092 0.0186  0.0013  208 TYR B N   
1710 C  CA  . TYR B 62  ? 0.2935 0.2377 0.1964 -0.0095 0.0187  0.0061  208 TYR B CA  
1711 C  C   . TYR B 62  ? 0.3389 0.2753 0.2406 -0.0128 0.0189  0.0091  208 TYR B C   
1712 O  O   . TYR B 62  ? 0.3471 0.2765 0.2462 -0.0131 0.0189  0.0105  208 TYR B O   
1713 C  CB  . TYR B 62  ? 0.3097 0.2567 0.2074 -0.0060 0.0192  0.0083  208 TYR B CB  
1714 C  CG  . TYR B 62  ? 0.3388 0.2830 0.2312 -0.0074 0.0220  0.0135  208 TYR B CG  
1715 C  CD1 . TYR B 62  ? 0.3661 0.3181 0.2595 -0.0076 0.0234  0.0133  208 TYR B CD1 
1716 C  CD2 . TYR B 62  ? 0.3892 0.3219 0.2756 -0.0093 0.0245  0.0180  208 TYR B CD2 
1717 C  CE1 . TYR B 62  ? 0.4292 0.3785 0.3180 -0.0104 0.0279  0.0172  208 TYR B CE1 
1718 C  CE2 . TYR B 62  ? 0.4464 0.3741 0.3276 -0.0124 0.0296  0.0219  208 TYR B CE2 
1719 C  CZ  . TYR B 62  ? 0.4412 0.3776 0.3238 -0.0134 0.0316  0.0215  208 TYR B CZ  
1720 O  OH  . TYR B 62  ? 0.4068 0.3383 0.2845 -0.0180 0.0385  0.0246  208 TYR B OH  
1721 N  N   . PHE B 63  ? 0.3684 0.3081 0.2726 -0.0147 0.0188  0.0087  209 PHE B N   
1722 C  CA  . PHE B 63  ? 0.2983 0.2353 0.2030 -0.0181 0.0188  0.0091  209 PHE B CA  
1723 C  C   . PHE B 63  ? 0.3175 0.2560 0.2217 -0.0226 0.0224  0.0108  209 PHE B C   
1724 O  O   . PHE B 63  ? 0.3820 0.3295 0.2891 -0.0240 0.0238  0.0094  209 PHE B O   
1725 C  CB  . PHE B 63  ? 0.3310 0.2743 0.2388 -0.0163 0.0165  0.0057  209 PHE B CB  
1726 C  CG  . PHE B 63  ? 0.3355 0.2716 0.2400 -0.0118 0.0150  0.0050  209 PHE B CG  
1727 C  CD1 . PHE B 63  ? 0.3380 0.2695 0.2396 -0.0104 0.0135  0.0046  209 PHE B CD1 
1728 C  CD2 . PHE B 63  ? 0.3383 0.2714 0.2417 -0.0093 0.0162  0.0043  209 PHE B CD2 
1729 C  CE1 . PHE B 63  ? 0.3306 0.2521 0.2261 -0.0060 0.0140  0.0049  209 PHE B CE1 
1730 C  CE2 . PHE B 63  ? 0.3529 0.2755 0.2517 -0.0066 0.0175  0.0035  209 PHE B CE2 
1731 C  CZ  . PHE B 63  ? 0.3286 0.2441 0.2224 -0.0047 0.0168  0.0046  209 PHE B CZ  
1732 N  N   . SER B 64  ? 0.3191 0.2470 0.2185 -0.0250 0.0249  0.0135  210 SER B N   
1733 C  CA  . SER B 64  ? 0.3854 0.3081 0.2802 -0.0291 0.0309  0.0163  210 SER B CA  
1734 C  C   . SER B 64  ? 0.4313 0.3603 0.3324 -0.0374 0.0343  0.0121  210 SER B C   
1735 O  O   . SER B 64  ? 0.3910 0.3274 0.2991 -0.0392 0.0311  0.0069  210 SER B O   
1736 C  CB  . SER B 64  ? 0.3564 0.2626 0.2422 -0.0282 0.0335  0.0203  210 SER B CB  
1737 O  OG  . SER B 64  ? 0.3616 0.2630 0.2503 -0.0334 0.0337  0.0176  210 SER B OG  
1738 N  N   . LEU B 65  ? 0.4277 0.3550 0.3259 -0.0420 0.0415  0.0136  211 LEU B N   
1739 C  CA  . LEU B 65  ? 0.3877 0.3217 0.2928 -0.0522 0.0471  0.0080  211 LEU B CA  
1740 C  C   . LEU B 65  ? 0.4289 0.3441 0.3274 -0.0595 0.0550  0.0094  211 LEU B C   
1741 O  O   . LEU B 65  ? 0.4317 0.3503 0.3368 -0.0702 0.0608  0.0028  211 LEU B O   
1742 C  CB  . LEU B 65  ? 0.3971 0.3398 0.3029 -0.0546 0.0523  0.0078  211 LEU B CB  
1743 C  CG  . LEU B 65  ? 0.4205 0.3823 0.3333 -0.0481 0.0454  0.0050  211 LEU B CG  
1744 C  CD1 . LEU B 65  ? 0.4771 0.4474 0.3901 -0.0509 0.0515  0.0047  211 LEU B CD1 
1745 C  CD2 . LEU B 65  ? 0.3901 0.3685 0.3147 -0.0478 0.0390  -0.0033 211 LEU B CD2 
1746 N  N   . ILE B 66  ? 0.4167 0.3127 0.3024 -0.0535 0.0556  0.0168  212 ILE B N   
1747 C  CA  . ILE B 66  ? 0.4172 0.2903 0.2929 -0.0579 0.0636  0.0194  212 ILE B CA  
1748 C  C   . ILE B 66  ? 0.4096 0.2763 0.2847 -0.0535 0.0574  0.0193  212 ILE B C   
1749 O  O   . ILE B 66  ? 0.4343 0.3058 0.3088 -0.0439 0.0494  0.0216  212 ILE B O   
1750 C  CB  . ILE B 66  ? 0.5086 0.3615 0.3652 -0.0523 0.0712  0.0291  212 ILE B CB  
1751 C  CG1 . ILE B 66  ? 0.5459 0.3717 0.3905 -0.0594 0.0838  0.0313  212 ILE B CG1 
1752 C  CG2 . ILE B 66  ? 0.5111 0.3612 0.3592 -0.0376 0.0634  0.0347  212 ILE B CG2 
1753 C  CD1 . ILE B 66  ? 0.6004 0.4018 0.4212 -0.0511 0.0920  0.0420  212 ILE B CD1 
1754 N  N   . PRO B 67  ? 0.3831 0.2402 0.2592 -0.0613 0.0617  0.0152  213 PRO B N   
1755 C  CA  . PRO B 67  ? 0.3656 0.2156 0.2402 -0.0575 0.0568  0.0147  213 PRO B CA  
1756 C  C   . PRO B 67  ? 0.3854 0.2099 0.2427 -0.0509 0.0613  0.0225  213 PRO B C   
1757 O  O   . PRO B 67  ? 0.4210 0.2269 0.2665 -0.0536 0.0717  0.0266  213 PRO B O   
1758 C  CB  . PRO B 67  ? 0.3280 0.1807 0.2117 -0.0694 0.0603  0.0052  213 PRO B CB  
1759 C  CG  . PRO B 67  ? 0.3746 0.2216 0.2574 -0.0802 0.0721  0.0034  213 PRO B CG  
1760 C  CD  . PRO B 67  ? 0.3744 0.2301 0.2556 -0.0755 0.0715  0.0086  213 PRO B CD  
1761 N  N   . LYS B 68  ? 0.4026 0.2256 0.2571 -0.0418 0.0545  0.0243  214 LYS B N   
1762 C  CA  . LYS B 68  ? 0.4592 0.2608 0.2974 -0.0331 0.0573  0.0304  214 LYS B CA  
1763 C  C   . LYS B 68  ? 0.4335 0.2343 0.2739 -0.0296 0.0518  0.0276  214 LYS B C   
1764 O  O   . LYS B 68  ? 0.4354 0.2526 0.2885 -0.0323 0.0452  0.0222  214 LYS B O   
1765 C  CB  . LYS B 68  ? 0.4703 0.2751 0.2996 -0.0202 0.0544  0.0366  214 LYS B CB  
1766 C  CG  . LYS B 68  ? 0.4910 0.2891 0.3108 -0.0206 0.0619  0.0416  214 LYS B CG  
1767 C  CD  . LYS B 68  ? 0.5597 0.3687 0.3739 -0.0074 0.0566  0.0453  214 LYS B CD  
1768 C  CE  . LYS B 68  ? 0.6173 0.4176 0.4182 -0.0054 0.0645  0.0513  214 LYS B CE  
1769 N  NZ  . LYS B 68  ? 0.7200 0.4880 0.4974 -0.0009 0.0751  0.0587  214 LYS B NZ  
1770 N  N   . THR B 69  ? 0.4401 0.2207 0.2662 -0.0225 0.0549  0.0315  215 THR B N   
1771 C  CA  . THR B 69  ? 0.4655 0.2466 0.2925 -0.0169 0.0494  0.0291  215 THR B CA  
1772 C  C   . THR B 69  ? 0.4327 0.2344 0.2654 -0.0078 0.0406  0.0290  215 THR B C   
1773 O  O   . THR B 69  ? 0.4382 0.2485 0.2702 -0.0039 0.0396  0.0316  215 THR B O   
1774 C  CB  . THR B 69  ? 0.5054 0.2606 0.3141 -0.0084 0.0546  0.0335  215 THR B CB  
1775 O  OG1 . THR B 69  ? 0.5076 0.2615 0.3037 0.0061  0.0534  0.0397  215 THR B OG1 
1776 C  CG2 . THR B 69  ? 0.4896 0.2186 0.2891 -0.0178 0.0668  0.0344  215 THR B CG2 
1777 N  N   . TRP B 70  ? 0.4607 0.2707 0.2993 -0.0052 0.0351  0.0251  216 TRP B N   
1778 C  CA  . TRP B 70  ? 0.4506 0.2799 0.2960 0.0009  0.0287  0.0231  216 TRP B CA  
1779 C  C   . TRP B 70  ? 0.4833 0.3137 0.3191 0.0132  0.0281  0.0262  216 TRP B C   
1780 O  O   . TRP B 70  ? 0.4628 0.3080 0.3030 0.0154  0.0256  0.0255  216 TRP B O   
1781 C  CB  . TRP B 70  ? 0.3927 0.2269 0.2428 0.0021  0.0252  0.0186  216 TRP B CB  
1782 C  CG  . TRP B 70  ? 0.4227 0.2764 0.2822 0.0038  0.0209  0.0147  216 TRP B CG  
1783 C  CD1 . TRP B 70  ? 0.4231 0.2868 0.2921 -0.0028 0.0196  0.0121  216 TRP B CD1 
1784 C  CD2 . TRP B 70  ? 0.4805 0.3455 0.3403 0.0126  0.0186  0.0117  216 TRP B CD2 
1785 N  NE1 . TRP B 70  ? 0.4118 0.2886 0.2863 -0.0003 0.0181  0.0082  216 TRP B NE1 
1786 C  CE2 . TRP B 70  ? 0.4598 0.3403 0.3307 0.0083  0.0172  0.0069  216 TRP B CE2 
1787 C  CE3 . TRP B 70  ? 0.5244 0.3885 0.3755 0.0244  0.0177  0.0119  216 TRP B CE3 
1788 C  CZ2 . TRP B 70  ? 0.5124 0.4092 0.3886 0.0129  0.0158  0.0007  216 TRP B CZ2 
1789 C  CZ3 . TRP B 70  ? 0.4963 0.3801 0.3530 0.0310  0.0146  0.0056  216 TRP B CZ3 
1790 C  CH2 . TRP B 70  ? 0.5417 0.4425 0.4121 0.0240  0.0140  -0.0007 216 TRP B CH2 
1791 N  N   . TYR B 71  ? 0.5202 0.3347 0.3419 0.0222  0.0305  0.0291  217 TYR B N   
1792 C  CA  . TYR B 71  ? 0.5472 0.3635 0.3569 0.0376  0.0292  0.0316  217 TYR B CA  
1793 C  C   . TYR B 71  ? 0.4785 0.2938 0.2815 0.0393  0.0319  0.0365  217 TYR B C   
1794 O  O   . TYR B 71  ? 0.4970 0.3293 0.3002 0.0481  0.0277  0.0350  217 TYR B O   
1795 C  CB  . TYR B 71  ? 0.6883 0.4819 0.4796 0.0484  0.0326  0.0353  217 TYR B CB  
1796 C  CG  . TYR B 71  ? 0.7589 0.5541 0.5559 0.0483  0.0299  0.0300  217 TYR B CG  
1797 C  CD1 . TYR B 71  ? 0.7557 0.5736 0.5604 0.0562  0.0232  0.0235  217 TYR B CD1 
1798 C  CD2 . TYR B 71  ? 0.7952 0.5710 0.5905 0.0396  0.0345  0.0303  217 TYR B CD2 
1799 C  CE1 . TYR B 71  ? 0.7619 0.5820 0.5715 0.0559  0.0215  0.0186  217 TYR B CE1 
1800 C  CE2 . TYR B 71  ? 0.8184 0.5963 0.6182 0.0400  0.0320  0.0253  217 TYR B CE2 
1801 C  CZ  . TYR B 71  ? 0.8105 0.6100 0.6170 0.0484  0.0256  0.0200  217 TYR B CZ  
1802 O  OH  . TYR B 71  ? 0.8431 0.6452 0.6538 0.0486  0.0239  0.0149  217 TYR B OH  
1803 N  N   . SER B 72  ? 0.4722 0.2688 0.2696 0.0304  0.0394  0.0413  218 SER B N   
1804 C  CA  . SER B 72  ? 0.5710 0.3643 0.3603 0.0314  0.0437  0.0464  218 SER B CA  
1805 C  C   . SER B 72  ? 0.5711 0.3897 0.3778 0.0244  0.0389  0.0421  218 SER B C   
1806 O  O   . SER B 72  ? 0.5404 0.3663 0.3430 0.0292  0.0389  0.0442  218 SER B O   
1807 C  CB  . SER B 72  ? 0.6112 0.3779 0.3909 0.0216  0.0550  0.0512  218 SER B CB  
1808 O  OG  . SER B 72  ? 0.6962 0.4337 0.4541 0.0303  0.0617  0.0567  218 SER B OG  
1809 N  N   . ALA B 73  ? 0.5111 0.3417 0.3352 0.0142  0.0351  0.0363  219 ALA B N   
1810 C  CA  . ALA B 73  ? 0.4024 0.2540 0.2414 0.0088  0.0309  0.0320  219 ALA B CA  
1811 C  C   . ALA B 73  ? 0.4674 0.3374 0.3095 0.0184  0.0250  0.0283  219 ALA B C   
1812 O  O   . ALA B 73  ? 0.4966 0.3795 0.3422 0.0195  0.0235  0.0270  219 ALA B O   
1813 C  CB  . ALA B 73  ? 0.3079 0.1648 0.1604 -0.0013 0.0288  0.0273  219 ALA B CB  
1814 N  N   . GLU B 74  ? 0.4859 0.3589 0.3276 0.0249  0.0219  0.0251  220 GLU B N   
1815 C  CA  . GLU B 74  ? 0.5191 0.4130 0.3655 0.0331  0.0169  0.0187  220 GLU B CA  
1816 C  C   . GLU B 74  ? 0.5335 0.4315 0.3678 0.0459  0.0163  0.0210  220 GLU B C   
1817 O  O   . GLU B 74  ? 0.5131 0.4308 0.3539 0.0483  0.0132  0.0157  220 GLU B O   
1818 C  CB  . GLU B 74  ? 0.5109 0.4089 0.3591 0.0381  0.0144  0.0138  220 GLU B CB  
1819 C  CG  . GLU B 74  ? 0.5413 0.4639 0.3945 0.0475  0.0099  0.0051  220 GLU B CG  
1820 C  CD  . GLU B 74  ? 0.5599 0.5019 0.4303 0.0383  0.0089  -0.0032 220 GLU B CD  
1821 O  OE1 . GLU B 74  ? 0.5731 0.5081 0.4493 0.0269  0.0113  -0.0008 220 GLU B OE1 
1822 O  OE2 . GLU B 74  ? 0.5416 0.5062 0.4195 0.0430  0.0062  -0.0131 220 GLU B OE2 
1823 N  N   . GLN B 75  ? 0.5442 0.4224 0.3594 0.0547  0.0199  0.0286  221 GLN B N   
1824 C  CA  . GLN B 75  ? 0.5741 0.4523 0.3727 0.0692  0.0202  0.0324  221 GLN B CA  
1825 C  C   . GLN B 75  ? 0.5575 0.4422 0.3600 0.0628  0.0219  0.0337  221 GLN B C   
1826 O  O   . GLN B 75  ? 0.5621 0.4635 0.3622 0.0719  0.0186  0.0310  221 GLN B O   
1827 C  CB  . GLN B 75  ? 0.6435 0.4902 0.4173 0.0775  0.0271  0.0427  221 GLN B CB  
1828 C  CG  . GLN B 75  ? 0.7611 0.5995 0.5268 0.0878  0.0256  0.0419  221 GLN B CG  
1829 C  CD  . GLN B 75  ? 0.9318 0.7329 0.6711 0.0947  0.0345  0.0524  221 GLN B CD  
1830 O  OE1 . GLN B 75  ? 0.9961 0.7782 0.7213 0.0931  0.0423  0.0604  221 GLN B OE1 
1831 N  NE2 . GLN B 75  ? 0.9602 0.7492 0.6918 0.1020  0.0343  0.0522  221 GLN B NE2 
1832 N  N   . PHE B 76  ? 0.4999 0.3736 0.3088 0.0477  0.0266  0.0367  222 PHE B N   
1833 C  CA  . PHE B 76  ? 0.4500 0.3295 0.2636 0.0406  0.0287  0.0377  222 PHE B CA  
1834 C  C   . PHE B 76  ? 0.4522 0.3589 0.2826 0.0392  0.0221  0.0287  222 PHE B C   
1835 O  O   . PHE B 76  ? 0.4945 0.4127 0.3239 0.0429  0.0213  0.0276  222 PHE B O   
1836 C  CB  . PHE B 76  ? 0.4818 0.3491 0.3022 0.0249  0.0340  0.0397  222 PHE B CB  
1837 C  CG  . PHE B 76  ? 0.4913 0.3666 0.3183 0.0173  0.0361  0.0395  222 PHE B CG  
1838 C  CD1 . PHE B 76  ? 0.5386 0.3996 0.3552 0.0136  0.0446  0.0454  222 PHE B CD1 
1839 C  CD2 . PHE B 76  ? 0.4486 0.3444 0.2915 0.0135  0.0306  0.0329  222 PHE B CD2 
1840 C  CE1 . PHE B 76  ? 0.5768 0.4477 0.4004 0.0066  0.0466  0.0442  222 PHE B CE1 
1841 C  CE2 . PHE B 76  ? 0.4907 0.3943 0.3393 0.0079  0.0323  0.0323  222 PHE B CE2 
1842 C  CZ  . PHE B 76  ? 0.5423 0.4351 0.3819 0.0046  0.0398  0.0376  222 PHE B CZ  
1843 N  N   . CYS B 77  ? 0.4339 0.3495 0.2788 0.0337  0.0185  0.0220  223 CYS B N   
1844 C  CA  . CYS B 77  ? 0.3988 0.3362 0.2586 0.0311  0.0144  0.0128  223 CYS B CA  
1845 C  C   . CYS B 77  ? 0.4319 0.3883 0.2892 0.0437  0.0103  0.0064  223 CYS B C   
1846 O  O   . CYS B 77  ? 0.4206 0.3934 0.2833 0.0446  0.0085  0.0008  223 CYS B O   
1847 C  CB  . CYS B 77  ? 0.3075 0.2460 0.1800 0.0225  0.0137  0.0077  223 CYS B CB  
1848 S  SG  . CYS B 77  ? 0.4450 0.3667 0.3207 0.0099  0.0170  0.0129  223 CYS B SG  
1849 N  N   . VAL B 78  ? 0.4284 0.3841 0.2774 0.0542  0.0085  0.0061  224 VAL B N   
1850 C  CA  . VAL B 78  ? 0.4664 0.4435 0.3120 0.0689  0.0036  -0.0012 224 VAL B CA  
1851 C  C   . VAL B 78  ? 0.5007 0.4815 0.3339 0.0785  0.0035  0.0023  224 VAL B C   
1852 O  O   . VAL B 78  ? 0.5598 0.5657 0.3986 0.0840  -0.0007 -0.0072 224 VAL B O   
1853 C  CB  . VAL B 78  ? 0.4727 0.4449 0.3064 0.0821  0.0019  0.0001  224 VAL B CB  
1854 C  CG1 . VAL B 78  ? 0.4318 0.4276 0.2586 0.1011  -0.0038 -0.0072 224 VAL B CG1 
1855 C  CG2 . VAL B 78  ? 0.4059 0.3810 0.2537 0.0738  0.0014  -0.0061 224 VAL B CG2 
1856 N  N   . SER B 79  ? 0.4728 0.4288 0.2889 0.0797  0.0089  0.0150  225 SER B N   
1857 C  CA  . SER B 79  ? 0.4584 0.4138 0.2601 0.0881  0.0107  0.0201  225 SER B CA  
1858 C  C   . SER B 79  ? 0.4601 0.4300 0.2762 0.0777  0.0104  0.0152  225 SER B C   
1859 O  O   . SER B 79  ? 0.4768 0.4527 0.2841 0.0844  0.0108  0.0167  225 SER B O   
1860 C  CB  . SER B 79  ? 0.5229 0.4450 0.3036 0.0883  0.0194  0.0345  225 SER B CB  
1861 O  OG  . SER B 79  ? 0.5810 0.4921 0.3721 0.0700  0.0247  0.0375  225 SER B OG  
1862 N  N   . ARG B 80  ? 0.4406 0.4145 0.2769 0.0624  0.0100  0.0099  226 ARG B N   
1863 C  CA  . ARG B 80  ? 0.4396 0.4262 0.2892 0.0537  0.0096  0.0043  226 ARG B CA  
1864 C  C   . ARG B 80  ? 0.4218 0.4315 0.2888 0.0514  0.0052  -0.0100 226 ARG B C   
1865 O  O   . ARG B 80  ? 0.4756 0.4904 0.3561 0.0410  0.0061  -0.0155 226 ARG B O   
1866 C  CB  . ARG B 80  ? 0.4383 0.4098 0.2950 0.0390  0.0139  0.0093  226 ARG B CB  
1867 C  CG  . ARG B 80  ? 0.5206 0.4694 0.3637 0.0375  0.0199  0.0210  226 ARG B CG  
1868 C  CD  . ARG B 80  ? 0.6272 0.5758 0.4593 0.0416  0.0235  0.0256  226 ARG B CD  
1869 N  NE  . ARG B 80  ? 0.6769 0.6110 0.5082 0.0310  0.0303  0.0319  226 ARG B NE  
1870 C  CZ  . ARG B 80  ? 0.7005 0.6135 0.5165 0.0309  0.0379  0.0406  226 ARG B CZ  
1871 N  NH1 . ARG B 80  ? 0.7185 0.6191 0.5160 0.0427  0.0395  0.0458  226 ARG B NH1 
1872 N  NH2 . ARG B 80  ? 0.7086 0.6130 0.5274 0.0192  0.0446  0.0433  226 ARG B NH2 
1873 N  N   . ASN B 81  ? 0.4032 0.4263 0.2691 0.0611  0.0013  -0.0166 227 ASN B N   
1874 C  CA  A ASN B 81  ? 0.4289 0.4764 0.3121 0.0583  -0.0016 -0.0325 227 ASN B CA  
1875 C  CA  B ASN B 81  ? 0.4289 0.4765 0.3121 0.0582  -0.0016 -0.0325 227 ASN B CA  
1876 C  C   . ASN B 81  ? 0.4688 0.5081 0.3673 0.0417  0.0021  -0.0355 227 ASN B C   
1877 O  O   . ASN B 81  ? 0.5384 0.5880 0.4503 0.0332  0.0036  -0.0454 227 ASN B O   
1878 C  CB  A ASN B 81  ? 0.4304 0.5009 0.3184 0.0614  -0.0039 -0.0423 227 ASN B CB  
1879 C  CB  B ASN B 81  ? 0.4298 0.5004 0.3183 0.0611  -0.0039 -0.0426 227 ASN B CB  
1880 C  CG  A ASN B 81  ? 0.4213 0.4992 0.2909 0.0797  -0.0073 -0.0385 227 ASN B CG  
1881 C  CG  B ASN B 81  ? 0.4521 0.5534 0.3555 0.0623  -0.0071 -0.0616 227 ASN B CG  
1882 O  OD1 A ASN B 81  ? 0.3766 0.4594 0.2355 0.0939  -0.0106 -0.0383 227 ASN B OD1 
1883 O  OD1 B ASN B 81  ? 0.4653 0.5749 0.3706 0.0669  -0.0092 -0.0666 227 ASN B OD1 
1884 N  ND2 A ASN B 81  ? 0.4279 0.5058 0.2919 0.0808  -0.0063 -0.0351 227 ASN B ND2 
1885 N  ND2 B ASN B 81  ? 0.4700 0.5895 0.3847 0.0577  -0.0071 -0.0736 227 ASN B ND2 
1886 N  N   . SER B 82  ? 0.4971 0.5163 0.3917 0.0378  0.0041  -0.0270 228 SER B N   
1887 C  CA  . SER B 82  ? 0.4963 0.5051 0.4012 0.0246  0.0077  -0.0281 228 SER B CA  
1888 C  C   . SER B 82  ? 0.5147 0.5111 0.4150 0.0255  0.0080  -0.0232 228 SER B C   
1889 O  O   . SER B 82  ? 0.5585 0.5543 0.4483 0.0364  0.0056  -0.0197 228 SER B O   
1890 C  CB  . SER B 82  ? 0.4808 0.4737 0.3849 0.0164  0.0107  -0.0204 228 SER B CB  
1891 O  OG  . SER B 82  ? 0.4724 0.4482 0.3651 0.0184  0.0114  -0.0084 228 SER B OG  
1892 N  N   . HIS B 83  ? 0.4771 0.4625 0.3835 0.0153  0.0112  -0.0227 229 HIS B N   
1893 C  CA  . HIS B 83  ? 0.4630 0.4365 0.3659 0.0150  0.0117  -0.0187 229 HIS B CA  
1894 C  C   . HIS B 83  ? 0.4737 0.4278 0.3755 0.0062  0.0146  -0.0114 229 HIS B C   
1895 O  O   . HIS B 83  ? 0.4452 0.3972 0.3514 -0.0002 0.0165  -0.0120 229 HIS B O   
1896 C  CB  . HIS B 83  ? 0.4414 0.4276 0.3539 0.0129  0.0126  -0.0295 229 HIS B CB  
1897 C  CG  . HIS B 83  ? 0.4967 0.5055 0.4105 0.0235  0.0088  -0.0383 229 HIS B CG  
1898 N  ND1 . HIS B 83  ? 0.5075 0.5163 0.4126 0.0347  0.0056  -0.0358 229 HIS B ND1 
1899 C  CD2 . HIS B 83  ? 0.4834 0.5172 0.4061 0.0257  0.0074  -0.0507 229 HIS B CD2 
1900 C  CE1 . HIS B 83  ? 0.5216 0.5555 0.4292 0.0450  0.0017  -0.0460 229 HIS B CE1 
1901 N  NE2 . HIS B 83  ? 0.5176 0.5686 0.4367 0.0392  0.0026  -0.0559 229 HIS B NE2 
1902 N  N   . LEU B 84  ? 0.4024 0.3432 0.2980 0.0067  0.0147  -0.0055 230 LEU B N   
1903 C  CA  . LEU B 84  ? 0.3526 0.2795 0.2483 -0.0007 0.0167  -0.0014 230 LEU B CA  
1904 C  C   . LEU B 84  ? 0.3765 0.3068 0.2800 -0.0067 0.0194  -0.0076 230 LEU B C   
1905 O  O   . LEU B 84  ? 0.3705 0.3103 0.2792 -0.0067 0.0206  -0.0150 230 LEU B O   
1906 C  CB  . LEU B 84  ? 0.3492 0.2648 0.2393 0.0005  0.0166  0.0022  230 LEU B CB  
1907 C  CG  . LEU B 84  ? 0.3810 0.2845 0.2617 0.0027  0.0169  0.0095  230 LEU B CG  
1908 C  CD1 . LEU B 84  ? 0.3611 0.2533 0.2359 0.0047  0.0174  0.0112  230 LEU B CD1 
1909 C  CD2 . LEU B 84  ? 0.3806 0.2788 0.2626 -0.0042 0.0182  0.0127  230 LEU B CD2 
1910 N  N   . THR B 85  ? 0.3166 0.2391 0.2201 -0.0115 0.0211  -0.0052 231 THR B N   
1911 C  CA  . THR B 85  ? 0.3009 0.2222 0.2083 -0.0162 0.0255  -0.0102 231 THR B CA  
1912 C  C   . THR B 85  ? 0.3277 0.2437 0.2350 -0.0192 0.0292  -0.0130 231 THR B C   
1913 O  O   . THR B 85  ? 0.3732 0.2821 0.2759 -0.0181 0.0278  -0.0088 231 THR B O   
1914 C  CB  . THR B 85  ? 0.3880 0.2996 0.2918 -0.0177 0.0265  -0.0062 231 THR B CB  
1915 O  OG1 . THR B 85  ? 0.3996 0.3066 0.3045 -0.0212 0.0321  -0.0109 231 THR B OG1 
1916 C  CG2 . THR B 85  ? 0.4091 0.3099 0.3066 -0.0172 0.0254  -0.0006 231 THR B CG2 
1917 N  N   . SER B 86  ? 0.3319 0.2517 0.2445 -0.0238 0.0347  -0.0209 232 SER B N   
1918 C  CA  . SER B 86  ? 0.3550 0.2661 0.2661 -0.0286 0.0412  -0.0234 232 SER B CA  
1919 C  C   . SER B 86  ? 0.3242 0.2166 0.2274 -0.0312 0.0468  -0.0197 232 SER B C   
1920 O  O   . SER B 86  ? 0.3427 0.2324 0.2439 -0.0293 0.0451  -0.0169 232 SER B O   
1921 C  CB  . SER B 86  ? 0.4016 0.3267 0.3229 -0.0335 0.0463  -0.0357 232 SER B CB  
1922 O  OG  . SER B 86  ? 0.3387 0.2695 0.2659 -0.0373 0.0496  -0.0424 232 SER B OG  
1923 N  N   . VAL B 87  ? 0.3528 0.2316 0.2495 -0.0342 0.0536  -0.0193 233 VAL B N   
1924 C  CA  . VAL B 87  ? 0.4356 0.2932 0.3205 -0.0343 0.0603  -0.0153 233 VAL B CA  
1925 C  C   . VAL B 87  ? 0.4814 0.3287 0.3649 -0.0424 0.0732  -0.0216 233 VAL B C   
1926 O  O   . VAL B 87  ? 0.5149 0.3604 0.3969 -0.0447 0.0769  -0.0228 233 VAL B O   
1927 C  CB  . VAL B 87  ? 0.4367 0.2826 0.3088 -0.0276 0.0566  -0.0062 233 VAL B CB  
1928 C  CG1 . VAL B 87  ? 0.4015 0.2258 0.2584 -0.0242 0.0628  -0.0018 233 VAL B CG1 
1929 C  CG2 . VAL B 87  ? 0.3962 0.2537 0.2717 -0.0222 0.0455  -0.0021 233 VAL B CG2 
1930 N  N   . THR B 88  ? 0.5170 0.3568 0.4010 -0.0473 0.0812  -0.0265 234 THR B N   
1931 C  CA  . THR B 88  ? 0.5448 0.3767 0.4304 -0.0579 0.0955  -0.0354 234 THR B CA  
1932 C  C   . THR B 88  ? 0.6140 0.4117 0.4801 -0.0582 0.1080  -0.0300 234 THR B C   
1933 O  O   . THR B 88  ? 0.6553 0.4391 0.5181 -0.0675 0.1227  -0.0356 234 THR B O   
1934 C  CB  . THR B 88  ? 0.5226 0.3731 0.4253 -0.0657 0.0979  -0.0489 234 THR B CB  
1935 O  OG1 . THR B 88  ? 0.5755 0.4203 0.4754 -0.0624 0.0958  -0.0467 234 THR B OG1 
1936 C  CG2 . THR B 88  ? 0.4635 0.3470 0.3821 -0.0631 0.0866  -0.0545 234 THR B CG2 
1937 N  N   . SER B 89  ? 0.6027 0.3866 0.4548 -0.0477 0.1029  -0.0196 235 SER B N   
1938 C  CA  . SER B 89  ? 0.6299 0.3798 0.4594 -0.0439 0.1138  -0.0134 235 SER B CA  
1939 C  C   . SER B 89  ? 0.6261 0.3683 0.4395 -0.0284 0.1044  -0.0014 235 SER B C   
1940 O  O   . SER B 89  ? 0.5875 0.3505 0.4098 -0.0226 0.0903  0.0006  235 SER B O   
1941 C  CB  . SER B 89  ? 0.5994 0.3371 0.4288 -0.0487 0.1229  -0.0189 235 SER B CB  
1942 O  OG  . SER B 89  ? 0.5817 0.3341 0.4180 -0.0421 0.1110  -0.0178 235 SER B OG  
1943 N  N   . GLU B 90  ? 0.6396 0.3524 0.4288 -0.0217 0.1130  0.0057  236 GLU B N   
1944 C  CA  . GLU B 90  ? 0.7081 0.4141 0.4799 -0.0050 0.1049  0.0154  236 GLU B CA  
1945 C  C   . GLU B 90  ? 0.6726 0.3866 0.4485 0.0015  0.0971  0.0156  236 GLU B C   
1946 O  O   . GLU B 90  ? 0.6377 0.3672 0.4146 0.0116  0.0841  0.0189  236 GLU B O   
1947 C  CB  . GLU B 90  ? 0.8332 0.5020 0.5745 0.0027  0.1181  0.0224  236 GLU B CB  
1948 C  CG  . GLU B 90  ? 0.9500 0.6108 0.6701 0.0230  0.1106  0.0313  236 GLU B CG  
1949 C  CD  . GLU B 90  ? 1.0949 0.7172 0.7807 0.0332  0.1239  0.0392  236 GLU B CD  
1950 O  OE1 . GLU B 90  ? 1.1580 0.7613 0.8217 0.0489  0.1248  0.0450  236 GLU B OE1 
1951 O  OE2 . GLU B 90  ? 1.1299 0.7401 0.8093 0.0263  0.1339  0.0397  236 GLU B OE2 
1952 N  N   . SER B 91  ? 0.6405 0.3447 0.4194 -0.0052 0.1058  0.0105  237 SER B N   
1953 C  CA  . SER B 91  ? 0.6401 0.3510 0.4235 -0.0005 0.1001  0.0093  237 SER B CA  
1954 C  C   . SER B 91  ? 0.5240 0.2717 0.3307 -0.0025 0.0849  0.0061  237 SER B C   
1955 O  O   . SER B 91  ? 0.4947 0.2539 0.3022 0.0065  0.0751  0.0087  237 SER B O   
1956 C  CB  . SER B 91  ? 0.6984 0.3945 0.4844 -0.0106 0.1133  0.0018  237 SER B CB  
1957 O  OG  . SER B 91  ? 0.7049 0.4152 0.5014 -0.0088 0.1065  -0.0017 237 SER B OG  
1958 N  N   . GLU B 92  ? 0.4793 0.2450 0.3037 -0.0138 0.0838  0.0002  238 GLU B N   
1959 C  CA  . GLU B 92  ? 0.4741 0.2704 0.3169 -0.0151 0.0711  -0.0018 238 GLU B CA  
1960 C  C   . GLU B 92  ? 0.4358 0.2405 0.2751 -0.0073 0.0611  0.0046  238 GLU B C   
1961 O  O   . GLU B 92  ? 0.4094 0.2306 0.2553 -0.0033 0.0514  0.0058  238 GLU B O   
1962 C  CB  . GLU B 92  ? 0.4745 0.2861 0.3335 -0.0263 0.0728  -0.0096 238 GLU B CB  
1963 C  CG  . GLU B 92  ? 0.4638 0.3028 0.3379 -0.0260 0.0613  -0.0110 238 GLU B CG  
1964 C  CD  . GLU B 92  ? 0.4795 0.3350 0.3681 -0.0341 0.0627  -0.0200 238 GLU B CD  
1965 O  OE1 . GLU B 92  ? 0.4918 0.3409 0.3808 -0.0409 0.0717  -0.0253 238 GLU B OE1 
1966 O  OE2 . GLU B 92  ? 0.4775 0.3532 0.3765 -0.0330 0.0552  -0.0223 238 GLU B OE2 
1967 N  N   . GLN B 93  ? 0.4382 0.2316 0.2672 -0.0058 0.0644  0.0079  239 GLN B N   
1968 C  CA  . GLN B 93  ? 0.3922 0.1928 0.2170 0.0014  0.0559  0.0123  239 GLN B CA  
1969 C  C   . GLN B 93  ? 0.4411 0.2422 0.2567 0.0136  0.0498  0.0160  239 GLN B C   
1970 O  O   . GLN B 93  ? 0.4298 0.2486 0.2512 0.0172  0.0401  0.0160  239 GLN B O   
1971 C  CB  . GLN B 93  ? 0.4143 0.1993 0.2258 0.0024  0.0621  0.0150  239 GLN B CB  
1972 C  CG  . GLN B 93  ? 0.4948 0.2869 0.3003 0.0108  0.0537  0.0185  239 GLN B CG  
1973 C  CD  . GLN B 93  ? 0.4934 0.3066 0.3155 0.0048  0.0459  0.0154  239 GLN B CD  
1974 O  OE1 . GLN B 93  ? 0.4975 0.3219 0.3348 -0.0033 0.0450  0.0118  239 GLN B OE1 
1975 N  NE2 . GLN B 93  ? 0.5189 0.3370 0.3367 0.0096  0.0405  0.0166  239 GLN B NE2 
1976 N  N   . GLU B 94  ? 0.4903 0.2717 0.2911 0.0201  0.0564  0.0181  240 GLU B N   
1977 C  CA  . GLU B 94  ? 0.5069 0.2892 0.2974 0.0341  0.0508  0.0207  240 GLU B CA  
1978 C  C   . GLU B 94  ? 0.4962 0.3007 0.3033 0.0322  0.0432  0.0169  240 GLU B C   
1979 O  O   . GLU B 94  ? 0.5002 0.3227 0.3106 0.0391  0.0340  0.0163  240 GLU B O   
1980 C  CB  . GLU B 94  ? 0.5564 0.3078 0.3238 0.0430  0.0610  0.0244  240 GLU B CB  
1981 C  CG  . GLU B 94  ? 0.6479 0.4015 0.4039 0.0601  0.0548  0.0263  240 GLU B CG  
1982 C  CD  . GLU B 94  ? 0.7888 0.5075 0.5185 0.0709  0.0657  0.0307  240 GLU B CD  
1983 O  OE1 . GLU B 94  ? 0.8245 0.5201 0.5514 0.0610  0.0787  0.0300  240 GLU B OE1 
1984 O  OE2 . GLU B 94  ? 0.8384 0.5528 0.5497 0.0897  0.0618  0.0341  240 GLU B OE2 
1985 N  N   . PHE B 95  ? 0.4643 0.2691 0.2820 0.0229  0.0475  0.0134  241 PHE B N   
1986 C  CA  . PHE B 95  ? 0.4353 0.2608 0.2679 0.0209  0.0411  0.0100  241 PHE B CA  
1987 C  C   . PHE B 95  ? 0.4022 0.2515 0.2482 0.0172  0.0321  0.0094  241 PHE B C   
1988 O  O   . PHE B 95  ? 0.4372 0.3036 0.2894 0.0203  0.0254  0.0083  241 PHE B O   
1989 C  CB  . PHE B 95  ? 0.4094 0.2346 0.2522 0.0108  0.0466  0.0052  241 PHE B CB  
1990 C  CG  . PHE B 95  ? 0.3703 0.2197 0.2293 0.0071  0.0397  0.0021  241 PHE B CG  
1991 C  CD1 . PHE B 95  ? 0.3999 0.2570 0.2596 0.0131  0.0361  0.0015  241 PHE B CD1 
1992 C  CD2 . PHE B 95  ? 0.3685 0.2322 0.2402 -0.0011 0.0372  0.0000  241 PHE B CD2 
1993 C  CE1 . PHE B 95  ? 0.4273 0.3055 0.3003 0.0096  0.0310  -0.0009 241 PHE B CE1 
1994 C  CE2 . PHE B 95  ? 0.3638 0.2465 0.2465 -0.0030 0.0320  -0.0017 241 PHE B CE2 
1995 C  CZ  . PHE B 95  ? 0.3800 0.2696 0.2633 0.0016  0.0294  -0.0020 241 PHE B CZ  
1996 N  N   . LEU B 96  ? 0.3675 0.2172 0.2176 0.0102  0.0330  0.0095  242 LEU B N   
1997 C  CA  . LEU B 96  ? 0.3625 0.2300 0.2239 0.0059  0.0264  0.0088  242 LEU B CA  
1998 C  C   . LEU B 96  ? 0.3700 0.2451 0.2277 0.0123  0.0203  0.0095  242 LEU B C   
1999 O  O   . LEU B 96  ? 0.3168 0.2087 0.1835 0.0109  0.0151  0.0074  242 LEU B O   
2000 C  CB  . LEU B 96  ? 0.3232 0.1885 0.1889 -0.0015 0.0290  0.0081  242 LEU B CB  
2001 C  CG  . LEU B 96  ? 0.3697 0.2357 0.2428 -0.0083 0.0335  0.0045  242 LEU B CG  
2002 C  CD1 . LEU B 96  ? 0.3649 0.2299 0.2409 -0.0136 0.0364  0.0026  242 LEU B CD1 
2003 C  CD2 . LEU B 96  ? 0.3531 0.2353 0.2367 -0.0099 0.0291  0.0029  242 LEU B CD2 
2004 N  N   . TYR B 97  ? 0.3814 0.2450 0.2256 0.0193  0.0217  0.0115  243 TYR B N   
2005 C  CA  . TYR B 97  ? 0.4327 0.3072 0.2739 0.0262  0.0152  0.0102  243 TYR B CA  
2006 C  C   . TYR B 97  ? 0.4711 0.3586 0.3124 0.0347  0.0104  0.0076  243 TYR B C   
2007 O  O   . TYR B 97  ? 0.5178 0.4258 0.3673 0.0350  0.0042  0.0029  243 TYR B O   
2008 C  CB  . TYR B 97  ? 0.4171 0.2776 0.2419 0.0333  0.0173  0.0128  243 TYR B CB  
2009 C  CG  . TYR B 97  ? 0.4368 0.2845 0.2414 0.0484  0.0189  0.0156  243 TYR B CG  
2010 C  CD1 . TYR B 97  ? 0.3898 0.2529 0.1911 0.0605  0.0114  0.0126  243 TYR B CD1 
2011 C  CD2 . TYR B 97  ? 0.4780 0.2977 0.2654 0.0513  0.0286  0.0207  243 TYR B CD2 
2012 C  CE1 . TYR B 97  ? 0.4500 0.3006 0.2297 0.0775  0.0125  0.0155  243 TYR B CE1 
2013 C  CE2 . TYR B 97  ? 0.5188 0.3216 0.2834 0.0668  0.0315  0.0244  243 TYR B CE2 
2014 C  CZ  . TYR B 97  ? 0.5355 0.3537 0.2953 0.0812  0.0228  0.0223  243 TYR B CZ  
2015 O  OH  . TYR B 97  ? 0.6174 0.4180 0.3515 0.0998  0.0253  0.0263  243 TYR B OH  
2016 N  N   . LYS B 98  ? 0.4317 0.3079 0.2647 0.0409  0.0139  0.0095  244 LYS B N   
2017 C  CA  . LYS B 98  ? 0.4360 0.3245 0.2684 0.0505  0.0095  0.0068  244 LYS B CA  
2018 C  C   . LYS B 98  ? 0.4018 0.3127 0.2538 0.0414  0.0061  0.0024  244 LYS B C   
2019 O  O   . LYS B 98  ? 0.3832 0.3164 0.2424 0.0441  0.0003  -0.0029 244 LYS B O   
2020 C  CB  . LYS B 98  ? 0.4760 0.3433 0.2942 0.0586  0.0155  0.0100  244 LYS B CB  
2021 C  CG  . LYS B 98  ? 0.5631 0.4043 0.3571 0.0701  0.0207  0.0150  244 LYS B CG  
2022 C  CD  . LYS B 98  ? 0.6667 0.5110 0.4450 0.0902  0.0159  0.0146  244 LYS B CD  
2023 C  CE  . LYS B 98  ? 0.7958 0.6100 0.5452 0.1037  0.0223  0.0211  244 LYS B CE  
2024 N  NZ  . LYS B 98  ? 0.8741 0.6875 0.6040 0.1268  0.0184  0.0214  244 LYS B NZ  
2025 N  N   . THR B 99  ? 0.2921 0.1979 0.1521 0.0308  0.0103  0.0038  245 THR B N   
2026 C  CA  . THR B 99  ? 0.3257 0.2487 0.2008 0.0228  0.0086  0.0010  245 THR B CA  
2027 C  C   . THR B 99  ? 0.3253 0.2630 0.2105 0.0152  0.0056  -0.0014 245 THR B C   
2028 O  O   . THR B 99  ? 0.3288 0.2836 0.2238 0.0115  0.0039  -0.0051 245 THR B O   
2029 C  CB  . THR B 99  ? 0.3799 0.2945 0.2589 0.0153  0.0134  0.0027  245 THR B CB  
2030 O  OG1 . THR B 99  ? 0.4090 0.3071 0.2785 0.0205  0.0180  0.0035  245 THR B OG1 
2031 C  CG2 . THR B 99  ? 0.3604 0.2912 0.2507 0.0106  0.0121  0.0005  245 THR B CG2 
2032 N  N   . ALA B 100 ? 0.2766 0.2065 0.1590 0.0123  0.0060  0.0002  246 ALA B N   
2033 C  CA  . ALA B 100 ? 0.2778 0.2179 0.1681 0.0052  0.0042  -0.0026 246 ALA B CA  
2034 C  C   . ALA B 100 ? 0.3531 0.3134 0.2477 0.0089  -0.0003 -0.0096 246 ALA B C   
2035 O  O   . ALA B 100 ? 0.3356 0.3094 0.2407 0.0009  -0.0003 -0.0145 246 ALA B O   
2036 C  CB  . ALA B 100 ? 0.2696 0.1979 0.1543 0.0041  0.0050  -0.0006 246 ALA B CB  
2037 N  N   . GLY B 101 ? 0.3585 0.3207 0.2442 0.0215  -0.0034 -0.0108 247 GLY B N   
2038 C  CA  . GLY B 101 ? 0.3611 0.3468 0.2505 0.0283  -0.0088 -0.0190 247 GLY B CA  
2039 C  C   . GLY B 101 ? 0.3944 0.3963 0.2921 0.0227  -0.0114 -0.0268 247 GLY B C   
2040 O  O   . GLY B 101 ? 0.3899 0.4151 0.3005 0.0178  -0.0128 -0.0357 247 GLY B O   
2041 N  N   . GLY B 102 ? 0.4282 0.4183 0.3192 0.0225  -0.0114 -0.0245 248 GLY B N   
2042 C  CA  . GLY B 102 ? 0.4413 0.4457 0.3387 0.0182  -0.0140 -0.0328 248 GLY B CA  
2043 C  C   . GLY B 102 ? 0.4336 0.4331 0.3416 0.0015  -0.0091 -0.0334 248 GLY B C   
2044 O  O   . GLY B 102 ? 0.4724 0.4772 0.3839 -0.0032 -0.0098 -0.0394 248 GLY B O   
2045 N  N   . LEU B 103 ? 0.3770 0.3657 0.2885 -0.0066 -0.0040 -0.0274 249 LEU B N   
2046 C  CA  . LEU B 103 ? 0.3529 0.3330 0.2702 -0.0198 0.0014  -0.0265 249 LEU B CA  
2047 C  C   . LEU B 103 ? 0.3349 0.2923 0.2433 -0.0194 0.0032  -0.0183 249 LEU B C   
2048 O  O   . LEU B 103 ? 0.3737 0.3209 0.2732 -0.0117 0.0022  -0.0126 249 LEU B O   
2049 C  CB  . LEU B 103 ? 0.3571 0.3375 0.2805 -0.0273 0.0064  -0.0244 249 LEU B CB  
2050 C  CG  . LEU B 103 ? 0.3839 0.3884 0.3177 -0.0291 0.0059  -0.0332 249 LEU B CG  
2051 C  CD1 . LEU B 103 ? 0.3655 0.3671 0.3031 -0.0368 0.0123  -0.0299 249 LEU B CD1 
2052 C  CD2 . LEU B 103 ? 0.3975 0.4187 0.3406 -0.0360 0.0060  -0.0454 249 LEU B CD2 
2053 N  N   . ILE B 104 ? 0.3651 0.3140 0.2756 -0.0281 0.0068  -0.0185 250 ILE B N   
2054 C  CA  . ILE B 104 ? 0.3680 0.2983 0.2711 -0.0273 0.0083  -0.0122 250 ILE B CA  
2055 C  C   . ILE B 104 ? 0.3690 0.2879 0.2708 -0.0296 0.0124  -0.0052 250 ILE B C   
2056 O  O   . ILE B 104 ? 0.4156 0.3349 0.3210 -0.0356 0.0162  -0.0053 250 ILE B O   
2057 C  CB  . ILE B 104 ? 0.3149 0.2411 0.2190 -0.0330 0.0097  -0.0166 250 ILE B CB  
2058 C  CG1 . ILE B 104 ? 0.2939 0.2343 0.1988 -0.0292 0.0047  -0.0249 250 ILE B CG1 
2059 C  CG2 . ILE B 104 ? 0.3268 0.2352 0.2235 -0.0313 0.0112  -0.0105 250 ILE B CG2 
2060 C  CD1 . ILE B 104 ? 0.2467 0.1887 0.1560 -0.0370 0.0063  -0.0331 250 ILE B CD1 
2061 N  N   . TYR B 105 ? 0.2990 0.2088 0.1951 -0.0246 0.0121  0.0001  251 TYR B N   
2062 C  CA  . TYR B 105 ? 0.3351 0.2384 0.2302 -0.0248 0.0148  0.0049  251 TYR B CA  
2063 C  C   . TYR B 105 ? 0.3126 0.2055 0.2031 -0.0229 0.0156  0.0074  251 TYR B C   
2064 O  O   . TYR B 105 ? 0.2948 0.1855 0.1826 -0.0197 0.0148  0.0072  251 TYR B O   
2065 C  CB  . TYR B 105 ? 0.3669 0.2751 0.2626 -0.0209 0.0141  0.0063  251 TYR B CB  
2066 C  CG  . TYR B 105 ? 0.3571 0.2767 0.2575 -0.0220 0.0137  0.0042  251 TYR B CG  
2067 C  CD1 . TYR B 105 ? 0.3285 0.2502 0.2310 -0.0246 0.0163  0.0060  251 TYR B CD1 
2068 C  CD2 . TYR B 105 ? 0.3621 0.2917 0.2640 -0.0191 0.0107  0.0000  251 TYR B CD2 
2069 C  CE1 . TYR B 105 ? 0.3163 0.2496 0.2236 -0.0260 0.0166  0.0035  251 TYR B CE1 
2070 C  CE2 . TYR B 105 ? 0.3399 0.2830 0.2473 -0.0195 0.0101  -0.0032 251 TYR B CE2 
2071 C  CZ  . TYR B 105 ? 0.3505 0.2953 0.2612 -0.0238 0.0134  -0.0015 251 TYR B CZ  
2072 O  OH  . TYR B 105 ? 0.3907 0.3503 0.3073 -0.0246 0.0135  -0.0053 251 TYR B OH  
2073 N  N   . TRP B 106 ? 0.3121 0.1983 0.2007 -0.0242 0.0180  0.0095  252 TRP B N   
2074 C  CA  . TRP B 106 ? 0.2700 0.1505 0.1551 -0.0204 0.0183  0.0109  252 TRP B CA  
2075 C  C   . TRP B 106 ? 0.2524 0.1390 0.1395 -0.0174 0.0177  0.0105  252 TRP B C   
2076 O  O   . TRP B 106 ? 0.2463 0.1388 0.1358 -0.0173 0.0177  0.0109  252 TRP B O   
2077 C  CB  . TRP B 106 ? 0.2384 0.1120 0.1187 -0.0188 0.0208  0.0139  252 TRP B CB  
2078 C  CG  . TRP B 106 ? 0.2934 0.1545 0.1687 -0.0212 0.0235  0.0143  252 TRP B CG  
2079 C  CD1 . TRP B 106 ? 0.3260 0.1770 0.1962 -0.0239 0.0283  0.0166  252 TRP B CD1 
2080 C  CD2 . TRP B 106 ? 0.3103 0.1655 0.1841 -0.0214 0.0229  0.0119  252 TRP B CD2 
2081 N  NE1 . TRP B 106 ? 0.3547 0.1924 0.2205 -0.0262 0.0312  0.0154  252 TRP B NE1 
2082 C  CE2 . TRP B 106 ? 0.3163 0.1576 0.1847 -0.0245 0.0272  0.0123  252 TRP B CE2 
2083 C  CE3 . TRP B 106 ? 0.3714 0.2304 0.2470 -0.0196 0.0201  0.0094  252 TRP B CE3 
2084 C  CZ2 . TRP B 106 ? 0.3798 0.2124 0.2457 -0.0255 0.0279  0.0095  252 TRP B CZ2 
2085 C  CZ3 . TRP B 106 ? 0.4206 0.2723 0.2934 -0.0201 0.0205  0.0071  252 TRP B CZ3 
2086 C  CH2 . TRP B 106 ? 0.4275 0.2667 0.2960 -0.0230 0.0239  0.0069  252 TRP B CH2 
2087 N  N   . ILE B 107 ? 0.2733 0.1586 0.1598 -0.0158 0.0181  0.0088  253 ILE B N   
2088 C  CA  . ILE B 107 ? 0.3432 0.2341 0.2326 -0.0146 0.0195  0.0063  253 ILE B CA  
2089 C  C   . ILE B 107 ? 0.3651 0.2588 0.2551 -0.0120 0.0199  0.0036  253 ILE B C   
2090 O  O   . ILE B 107 ? 0.3335 0.2224 0.2199 -0.0098 0.0189  0.0050  253 ILE B O   
2091 C  CB  . ILE B 107 ? 0.3861 0.2736 0.2745 -0.0161 0.0218  0.0049  253 ILE B CB  
2092 C  CG1 . ILE B 107 ? 0.3976 0.2785 0.2818 -0.0161 0.0229  0.0045  253 ILE B CG1 
2093 C  CG2 . ILE B 107 ? 0.3970 0.2837 0.2836 -0.0157 0.0205  0.0069  253 ILE B CG2 
2094 C  CD1 . ILE B 107 ? 0.4537 0.3273 0.3325 -0.0162 0.0267  0.0043  253 ILE B CD1 
2095 N  N   . GLY B 108 ? 0.3063 0.2081 0.2010 -0.0122 0.0217  -0.0013 254 GLY B N   
2096 C  CA  . GLY B 108 ? 0.3725 0.2834 0.2698 -0.0086 0.0215  -0.0062 254 GLY B CA  
2097 C  C   . GLY B 108 ? 0.4480 0.3566 0.3448 -0.0090 0.0232  -0.0088 254 GLY B C   
2098 O  O   . GLY B 108 ? 0.4784 0.3983 0.3796 -0.0069 0.0238  -0.0153 254 GLY B O   
2099 N  N   . LEU B 109 ? 0.4622 0.3587 0.3540 -0.0113 0.0237  -0.0049 255 LEU B N   
2100 C  CA  . LEU B 109 ? 0.4587 0.3521 0.3487 -0.0116 0.0255  -0.0070 255 LEU B CA  
2101 C  C   . LEU B 109 ? 0.4858 0.3774 0.3724 -0.0061 0.0224  -0.0061 255 LEU B C   
2102 O  O   . LEU B 109 ? 0.4708 0.3534 0.3524 -0.0049 0.0202  -0.0014 255 LEU B O   
2103 C  CB  . LEU B 109 ? 0.4894 0.3714 0.3736 -0.0146 0.0270  -0.0037 255 LEU B CB  
2104 C  CG  . LEU B 109 ? 0.4983 0.3762 0.3808 -0.0184 0.0330  -0.0053 255 LEU B CG  
2105 C  CD1 . LEU B 109 ? 0.5320 0.3990 0.4055 -0.0173 0.0325  -0.0006 255 LEU B CD1 
2106 C  CD2 . LEU B 109 ? 0.4755 0.3563 0.3597 -0.0203 0.0381  -0.0107 255 LEU B CD2 
2107 N  N   . THR B 110 ? 0.5360 0.4355 0.4249 -0.0030 0.0231  -0.0115 256 THR B N   
2108 C  CA  . THR B 110 ? 0.5619 0.4581 0.4458 0.0040  0.0206  -0.0111 256 THR B CA  
2109 C  C   . THR B 110 ? 0.5676 0.4718 0.4547 0.0050  0.0227  -0.0178 256 THR B C   
2110 O  O   . THR B 110 ? 0.6004 0.5171 0.4952 0.0010  0.0262  -0.0242 256 THR B O   
2111 C  CB  . THR B 110 ? 0.6442 0.5458 0.5256 0.0129  0.0176  -0.0107 256 THR B CB  
2112 O  OG1 . THR B 110 ? 0.7317 0.6221 0.6036 0.0205  0.0162  -0.0079 256 THR B OG1 
2113 C  CG2 . THR B 110 ? 0.6166 0.5405 0.5063 0.0166  0.0174  -0.0197 256 THR B CG2 
2114 N  N   . LYS B 111 ? 0.5765 0.4736 0.4579 0.0096  0.0215  -0.0172 257 LYS B N   
2115 C  CA  . LYS B 111 ? 0.6508 0.5567 0.5351 0.0113  0.0233  -0.0240 257 LYS B CA  
2116 C  C   . LYS B 111 ? 0.7706 0.6933 0.6580 0.0214  0.0209  -0.0305 257 LYS B C   
2117 O  O   . LYS B 111 ? 0.7475 0.6683 0.6294 0.0300  0.0171  -0.0275 257 LYS B O   
2118 C  CB  . LYS B 111 ? 0.6399 0.5319 0.5167 0.0124  0.0230  -0.0217 257 LYS B CB  
2119 C  CG  . LYS B 111 ? 0.6176 0.4997 0.4919 0.0042  0.0254  -0.0186 257 LYS B CG  
2120 C  CD  . LYS B 111 ? 0.6737 0.5523 0.5442 0.0050  0.0269  -0.0213 257 LYS B CD  
2121 C  CE  . LYS B 111 ? 0.6711 0.5372 0.5351 0.0011  0.0265  -0.0176 257 LYS B CE  
2122 N  NZ  . LYS B 111 ? 0.6753 0.5302 0.5351 0.0029  0.0228  -0.0149 257 LYS B NZ  
2123 N  N   . ALA B 112 ? 0.8989 0.8386 0.7941 0.0209  0.0235  -0.0400 258 ALA B N   
2124 C  CA  . ALA B 112 ? 0.9827 0.9448 0.8829 0.0313  0.0208  -0.0492 258 ALA B CA  
2125 C  C   . ALA B 112 ? 1.0768 1.0542 0.9846 0.0297  0.0245  -0.0595 258 ALA B C   
2126 O  O   . ALA B 112 ? 1.0960 1.0881 1.0153 0.0198  0.0306  -0.0678 258 ALA B O   
2127 C  CB  . ALA B 112 ? 0.9512 0.9323 0.8605 0.0303  0.0203  -0.0548 258 ALA B CB  
2128 N  N   . GLY B 113 ? 1.1295 1.1024 1.0303 0.0390  0.0221  -0.0594 259 GLY B N   
2129 C  CA  . GLY B 113 ? 1.1391 1.1269 1.0463 0.0387  0.0254  -0.0692 259 GLY B CA  
2130 C  C   . GLY B 113 ? 1.1465 1.1306 1.0447 0.0536  0.0208  -0.0695 259 GLY B C   
2131 O  O   . GLY B 113 ? 1.1539 1.1181 1.0434 0.0527  0.0216  -0.0639 259 GLY B O   
2132 N  N   . GLY B 116 ? 0.7364 0.6705 0.6246 0.0190  0.0345  -0.0528 262 GLY B N   
2133 C  CA  . GLY B 116 ? 0.7540 0.6798 0.6408 0.0175  0.0315  -0.0458 262 GLY B CA  
2134 C  C   . GLY B 116 ? 0.7920 0.7157 0.6819 0.0058  0.0369  -0.0438 262 GLY B C   
2135 O  O   . GLY B 116 ? 0.8103 0.7179 0.6930 0.0010  0.0382  -0.0371 262 GLY B O   
2136 N  N   . ASP B 117 ? 0.7653 0.7058 0.6656 0.0020  0.0403  -0.0504 263 ASP B N   
2137 C  CA  . ASP B 117 ? 0.7348 0.6711 0.6372 -0.0089 0.0469  -0.0494 263 ASP B CA  
2138 C  C   . ASP B 117 ? 0.6161 0.5462 0.5175 -0.0087 0.0427  -0.0430 263 ASP B C   
2139 O  O   . ASP B 117 ? 0.6155 0.5541 0.5197 -0.0018 0.0367  -0.0437 263 ASP B O   
2140 C  CB  . ASP B 117 ? 0.8249 0.7816 0.7399 -0.0156 0.0549  -0.0618 263 ASP B CB  
2141 C  CG  . ASP B 117 ? 0.8933 0.8551 0.8093 -0.0188 0.0620  -0.0683 263 ASP B CG  
2142 O  OD1 . ASP B 117 ? 0.9015 0.8446 0.8064 -0.0219 0.0660  -0.0617 263 ASP B OD1 
2143 O  OD2 . ASP B 117 ? 0.9223 0.9085 0.8499 -0.0176 0.0635  -0.0808 263 ASP B OD2 
2144 N  N   . TRP B 118 ? 0.5160 0.4313 0.4120 -0.0153 0.0462  -0.0369 264 TRP B N   
2145 C  CA  . TRP B 118 ? 0.4805 0.3915 0.3765 -0.0159 0.0432  -0.0318 264 TRP B CA  
2146 C  C   . TRP B 118 ? 0.5047 0.4318 0.4117 -0.0192 0.0458  -0.0395 264 TRP B C   
2147 O  O   . TRP B 118 ? 0.5330 0.4695 0.4471 -0.0256 0.0536  -0.0483 264 TRP B O   
2148 C  CB  . TRP B 118 ? 0.4301 0.3230 0.3169 -0.0203 0.0464  -0.0246 264 TRP B CB  
2149 C  CG  . TRP B 118 ? 0.4398 0.3207 0.3169 -0.0165 0.0422  -0.0184 264 TRP B CG  
2150 C  CD1 . TRP B 118 ? 0.4157 0.2889 0.2849 -0.0167 0.0454  -0.0177 264 TRP B CD1 
2151 C  CD2 . TRP B 118 ? 0.4431 0.3193 0.3176 -0.0124 0.0346  -0.0134 264 TRP B CD2 
2152 N  NE1 . TRP B 118 ? 0.4745 0.3406 0.3374 -0.0127 0.0393  -0.0135 264 TRP B NE1 
2153 C  CE2 . TRP B 118 ? 0.4391 0.3066 0.3057 -0.0109 0.0333  -0.0112 264 TRP B CE2 
2154 C  CE3 . TRP B 118 ? 0.4820 0.3606 0.3597 -0.0103 0.0299  -0.0111 264 TRP B CE3 
2155 C  CZ2 . TRP B 118 ? 0.3962 0.2584 0.2601 -0.0089 0.0277  -0.0085 264 TRP B CZ2 
2156 C  CZ3 . TRP B 118 ? 0.4492 0.3199 0.3226 -0.0085 0.0254  -0.0070 264 TRP B CZ3 
2157 C  CH2 . TRP B 118 ? 0.4057 0.2690 0.2734 -0.0085 0.0245  -0.0065 264 TRP B CH2 
2158 N  N   . SER B 119 ? 0.4802 0.4108 0.3888 -0.0153 0.0401  -0.0371 265 SER B N   
2159 C  CA  . SER B 119 ? 0.4718 0.4193 0.3907 -0.0173 0.0413  -0.0450 265 SER B CA  
2160 C  C   . SER B 119 ? 0.4997 0.4417 0.4159 -0.0154 0.0369  -0.0385 265 SER B C   
2161 O  O   . SER B 119 ? 0.5361 0.4651 0.4438 -0.0113 0.0321  -0.0290 265 SER B O   
2162 C  CB  . SER B 119 ? 0.4251 0.3967 0.3518 -0.0095 0.0374  -0.0547 265 SER B CB  
2163 O  OG  . SER B 119 ? 0.4794 0.4480 0.3985 0.0023  0.0289  -0.0481 265 SER B OG  
2164 N  N   . TRP B 120 ? 0.4696 0.4224 0.3936 -0.0192 0.0393  -0.0447 266 TRP B N   
2165 C  CA  . TRP B 120 ? 0.4330 0.3838 0.3554 -0.0170 0.0352  -0.0398 266 TRP B CA  
2166 C  C   . TRP B 120 ? 0.4768 0.4462 0.4021 -0.0073 0.0286  -0.0437 266 TRP B C   
2167 O  O   . TRP B 120 ? 0.5073 0.4987 0.4417 -0.0056 0.0289  -0.0554 266 TRP B O   
2168 C  CB  . TRP B 120 ? 0.4015 0.3510 0.3287 -0.0259 0.0418  -0.0440 266 TRP B CB  
2169 C  CG  . TRP B 120 ? 0.4262 0.3537 0.3458 -0.0326 0.0488  -0.0386 266 TRP B CG  
2170 C  CD1 . TRP B 120 ? 0.4464 0.3682 0.3668 -0.0409 0.0592  -0.0441 266 TRP B CD1 
2171 C  CD2 . TRP B 120 ? 0.4188 0.3272 0.3272 -0.0304 0.0465  -0.0272 266 TRP B CD2 
2172 N  NE1 . TRP B 120 ? 0.4245 0.3223 0.3321 -0.0423 0.0633  -0.0353 266 TRP B NE1 
2173 C  CE2 . TRP B 120 ? 0.4124 0.3041 0.3135 -0.0354 0.0548  -0.0257 266 TRP B CE2 
2174 C  CE3 . TRP B 120 ? 0.4198 0.3245 0.3235 -0.0248 0.0389  -0.0191 266 TRP B CE3 
2175 C  CZ2 . TRP B 120 ? 0.4267 0.3006 0.3156 -0.0325 0.0540  -0.0165 266 TRP B CZ2 
2176 C  CZ3 . TRP B 120 ? 0.4302 0.3196 0.3248 -0.0242 0.0386  -0.0115 266 TRP B CZ3 
2177 C  CH2 . TRP B 120 ? 0.4264 0.3018 0.3136 -0.0269 0.0452  -0.0104 266 TRP B CH2 
2178 N  N   . VAL B 121 ? 0.4966 0.4577 0.4134 -0.0005 0.0231  -0.0345 267 VAL B N   
2179 C  CA  . VAL B 121 ? 0.5306 0.5039 0.4445 0.0114  0.0173  -0.0357 267 VAL B CA  
2180 C  C   . VAL B 121 ? 0.5295 0.5249 0.4522 0.0122  0.0166  -0.0453 267 VAL B C   
2181 O  O   . VAL B 121 ? 0.5232 0.5363 0.4454 0.0233  0.0120  -0.0505 267 VAL B O   
2182 C  CB  . VAL B 121 ? 0.4955 0.4510 0.3963 0.0170  0.0141  -0.0233 267 VAL B CB  
2183 C  CG1 . VAL B 121 ? 0.4612 0.4120 0.3627 0.0115  0.0150  -0.0192 267 VAL B CG1 
2184 C  CG2 . VAL B 121 ? 0.4965 0.4587 0.3889 0.0318  0.0096  -0.0229 267 VAL B CG2 
2185 N  N   . ASP B 122 ? 0.5187 0.5131 0.4485 0.0016  0.0213  -0.0483 268 ASP B N   
2186 C  CA  . ASP B 122 ? 0.5068 0.5223 0.4463 0.0005  0.0216  -0.0594 268 ASP B CA  
2187 C  C   . ASP B 122 ? 0.4987 0.5340 0.4524 -0.0061 0.0267  -0.0756 268 ASP B C   
2188 O  O   . ASP B 122 ? 0.4569 0.5088 0.4217 -0.0117 0.0298  -0.0878 268 ASP B O   
2189 C  CB  . ASP B 122 ? 0.4558 0.4602 0.3953 -0.0068 0.0245  -0.0556 268 ASP B CB  
2190 C  CG  . ASP B 122 ? 0.4604 0.4474 0.4013 -0.0191 0.0327  -0.0548 268 ASP B CG  
2191 O  OD1 . ASP B 122 ? 0.4262 0.4142 0.3714 -0.0245 0.0379  -0.0606 268 ASP B OD1 
2192 O  OD2 . ASP B 122 ? 0.5228 0.4948 0.4593 -0.0226 0.0344  -0.0484 268 ASP B OD2 
2193 N  N   . ASP B 123 ? 0.5375 0.5714 0.4913 -0.0063 0.0284  -0.0765 269 ASP B N   
2194 C  CA  . ASP B 123 ? 0.5775 0.6318 0.5449 -0.0126 0.0340  -0.0926 269 ASP B CA  
2195 C  C   . ASP B 123 ? 0.5570 0.6021 0.5316 -0.0300 0.0461  -0.0983 269 ASP B C   
2196 O  O   . ASP B 123 ? 0.5681 0.6297 0.5553 -0.0384 0.0534  -0.1134 269 ASP B O   
2197 C  CB  . ASP B 123 ? 0.6305 0.7217 0.6085 -0.0043 0.0289  -0.1082 269 ASP B CB  
2198 C  CG  . ASP B 123 ? 0.7171 0.8166 0.6854 0.0149  0.0188  -0.1039 269 ASP B CG  
2199 O  OD1 . ASP B 123 ? 0.7099 0.7924 0.6688 0.0186  0.0179  -0.0944 269 ASP B OD1 
2200 O  OD2 . ASP B 123 ? 0.7754 0.8973 0.7441 0.0271  0.0120  -0.1100 269 ASP B OD2 
2201 N  N   . THR B 124 ? 0.5371 0.5554 0.5027 -0.0350 0.0490  -0.0869 270 THR B N   
2202 C  CA  . THR B 124 ? 0.5738 0.5743 0.5397 -0.0489 0.0614  -0.0886 270 THR B CA  
2203 C  C   . THR B 124 ? 0.5861 0.5789 0.5493 -0.0525 0.0671  -0.0882 270 THR B C   
2204 O  O   . THR B 124 ? 0.5776 0.5608 0.5313 -0.0448 0.0612  -0.0775 270 THR B O   
2205 C  CB  . THR B 124 ? 0.5817 0.5526 0.5342 -0.0494 0.0620  -0.0740 270 THR B CB  
2206 O  OG1 . THR B 124 ? 0.5886 0.5664 0.5439 -0.0470 0.0580  -0.0752 270 THR B OG1 
2207 C  CG2 . THR B 124 ? 0.5454 0.4931 0.4929 -0.0607 0.0755  -0.0741 270 THR B CG2 
2208 N  N   . PRO B 125 ? 0.6084 0.6057 0.5803 -0.0648 0.0795  -0.1007 271 PRO B N   
2209 C  CA  . PRO B 125 ? 0.6368 0.6269 0.6057 -0.0691 0.0867  -0.1009 271 PRO B CA  
2210 C  C   . PRO B 125 ? 0.6676 0.6223 0.6170 -0.0676 0.0884  -0.0833 271 PRO B C   
2211 O  O   . PRO B 125 ? 0.7224 0.6540 0.6627 -0.0719 0.0945  -0.0772 271 PRO B O   
2212 C  CB  . PRO B 125 ? 0.6339 0.6289 0.6137 -0.0855 0.1029  -0.1169 271 PRO B CB  
2213 C  CG  . PRO B 125 ? 0.6112 0.6321 0.6062 -0.0869 0.1001  -0.1306 271 PRO B CG  
2214 C  CD  . PRO B 125 ? 0.6067 0.6172 0.5920 -0.0761 0.0884  -0.1168 271 PRO B CD  
2215 N  N   . PHE B 126 ? 0.6372 0.5886 0.5797 -0.0603 0.0828  -0.0761 272 PHE B N   
2216 C  CA  . PHE B 126 ? 0.6094 0.5322 0.5341 -0.0574 0.0830  -0.0612 272 PHE B CA  
2217 C  C   . PHE B 126 ? 0.6352 0.5408 0.5524 -0.0663 0.0975  -0.0622 272 PHE B C   
2218 O  O   . PHE B 126 ? 0.6221 0.5386 0.5451 -0.0702 0.1027  -0.0703 272 PHE B O   
2219 C  CB  . PHE B 126 ? 0.5590 0.4847 0.4791 -0.0465 0.0716  -0.0540 272 PHE B CB  
2220 C  CG  . PHE B 126 ? 0.5318 0.4330 0.4355 -0.0429 0.0702  -0.0409 272 PHE B CG  
2221 C  CD1 . PHE B 126 ? 0.4728 0.3628 0.3692 -0.0383 0.0640  -0.0313 272 PHE B CD1 
2222 C  CD2 . PHE B 126 ? 0.5117 0.4038 0.4076 -0.0437 0.0751  -0.0393 272 PHE B CD2 
2223 C  CE1 . PHE B 126 ? 0.4970 0.3696 0.3798 -0.0343 0.0620  -0.0217 272 PHE B CE1 
2224 C  CE2 . PHE B 126 ? 0.4952 0.3682 0.3760 -0.0391 0.0731  -0.0288 272 PHE B CE2 
2225 C  CZ  . PHE B 126 ? 0.4881 0.3525 0.3629 -0.0343 0.0662  -0.0206 272 PHE B CZ  
2226 N  N   . ASN B 127 ? 0.6898 0.5678 0.5926 -0.0685 0.1043  -0.0540 273 ASN B N   
2227 C  CA  . ASN B 127 ? 0.7215 0.5761 0.6113 -0.0754 0.1197  -0.0525 273 ASN B CA  
2228 C  C   . ASN B 127 ? 0.6903 0.5267 0.5612 -0.0664 0.1161  -0.0395 273 ASN B C   
2229 O  O   . ASN B 127 ? 0.6869 0.5054 0.5434 -0.0590 0.1121  -0.0286 273 ASN B O   
2230 C  CB  . ASN B 127 ? 0.7861 0.6183 0.6680 -0.0817 0.1312  -0.0517 273 ASN B CB  
2231 C  CG  . ASN B 127 ? 0.8834 0.6845 0.7463 -0.0872 0.1489  -0.0481 273 ASN B CG  
2232 O  OD1 . ASN B 127 ? 0.9218 0.7189 0.7773 -0.0862 0.1521  -0.0458 273 ASN B OD1 
2233 N  ND2 . ASN B 127 ? 0.9119 0.6886 0.7649 -0.0924 0.1612  -0.0473 273 ASN B ND2 
2234 N  N   . LYS B 128 ? 0.7021 0.5453 0.5736 -0.0665 0.1174  -0.0421 274 LYS B N   
2235 C  CA  . LYS B 128 ? 0.7433 0.5734 0.5985 -0.0579 0.1136  -0.0320 274 LYS B CA  
2236 C  C   . LYS B 128 ? 0.7527 0.5506 0.5840 -0.0555 0.1223  -0.0220 274 LYS B C   
2237 O  O   . LYS B 128 ? 0.7289 0.5171 0.5467 -0.0449 0.1141  -0.0121 274 LYS B O   
2238 C  CB  . LYS B 128 ? 0.8164 0.6561 0.6750 -0.0608 0.1183  -0.0382 274 LYS B CB  
2239 C  CG  . LYS B 128 ? 0.8746 0.7463 0.7547 -0.0612 0.1108  -0.0492 274 LYS B CG  
2240 C  CD  . LYS B 128 ? 0.9369 0.8186 0.8199 -0.0636 0.1164  -0.0563 274 LYS B CD  
2241 C  CE  . LYS B 128 ? 0.9697 0.8593 0.8515 -0.0523 0.1030  -0.0524 274 LYS B CE  
2242 N  NZ  . LYS B 128 ? 1.0098 0.8773 0.8728 -0.0447 0.0979  -0.0392 274 LYS B NZ  
2243 N  N   . VAL B 129 ? 0.8002 0.5820 0.6259 -0.0651 0.1395  -0.0254 275 VAL B N   
2244 C  CA  . VAL B 129 ? 0.8423 0.5889 0.6411 -0.0620 0.1511  -0.0159 275 VAL B CA  
2245 C  C   . VAL B 129 ? 0.7926 0.5258 0.5814 -0.0531 0.1446  -0.0074 275 VAL B C   
2246 O  O   . VAL B 129 ? 0.7977 0.5152 0.5660 -0.0406 0.1404  0.0033  275 VAL B O   
2247 C  CB  . VAL B 129 ? 0.9335 0.6627 0.7284 -0.0762 0.1739  -0.0226 275 VAL B CB  
2248 C  CG1 . VAL B 129 ? 0.9930 0.6799 0.7548 -0.0708 0.1871  -0.0110 275 VAL B CG1 
2249 C  CG2 . VAL B 129 ? 0.9379 0.6821 0.7429 -0.0854 0.1815  -0.0322 275 VAL B CG2 
2250 N  N   . GLN B 130 ? 0.7691 0.5107 0.5723 -0.0589 0.1437  -0.0131 276 GLN B N   
2251 C  CA  . GLN B 130 ? 0.8037 0.5351 0.5993 -0.0508 0.1376  -0.0062 276 GLN B CA  
2252 C  C   . GLN B 130 ? 0.7811 0.5284 0.5790 -0.0384 0.1181  0.0000  276 GLN B C   
2253 O  O   . GLN B 130 ? 0.8147 0.5502 0.5974 -0.0271 0.1130  0.0084  276 GLN B O   
2254 C  CB  . GLN B 130 ? 0.8433 0.5851 0.6566 -0.0598 0.1393  -0.0151 276 GLN B CB  
2255 C  CG  . GLN B 130 ? 0.8875 0.6193 0.6936 -0.0520 0.1340  -0.0090 276 GLN B CG  
2256 C  CD  . GLN B 130 ? 0.9129 0.6622 0.7396 -0.0595 0.1318  -0.0185 276 GLN B CD  
2257 O  OE1 . GLN B 130 ? 0.8811 0.6604 0.7277 -0.0604 0.1203  -0.0239 276 GLN B OE1 
2258 N  NE2 . GLN B 130 ? 0.9314 0.6606 0.7514 -0.0639 0.1434  -0.0205 276 GLN B NE2 
2259 N  N   . SER B 131 ? 0.7465 0.5205 0.5630 -0.0404 0.1080  -0.0052 277 SER B N   
2260 C  CA  . SER B 131 ? 0.7227 0.5116 0.5437 -0.0314 0.0914  -0.0012 277 SER B CA  
2261 C  C   . SER B 131 ? 0.6702 0.4503 0.4746 -0.0219 0.0879  0.0057  277 SER B C   
2262 O  O   . SER B 131 ? 0.6595 0.4466 0.4631 -0.0140 0.0762  0.0093  277 SER B O   
2263 C  CB  . SER B 131 ? 0.7844 0.5993 0.6261 -0.0352 0.0838  -0.0083 277 SER B CB  
2264 O  OG  . SER B 131 ? 0.8845 0.7113 0.7410 -0.0414 0.0848  -0.0152 277 SER B OG  
2265 N  N   . ALA B 132 ? 0.6452 0.4114 0.4367 -0.0231 0.0984  0.0065  278 ALA B N   
2266 C  CA  . ALA B 132 ? 0.6748 0.4331 0.4487 -0.0131 0.0955  0.0124  278 ALA B CA  
2267 C  C   . ALA B 132 ? 0.7086 0.4568 0.4665 -0.0006 0.0899  0.0198  278 ALA B C   
2268 O  O   . ALA B 132 ? 0.7341 0.4887 0.4856 0.0092  0.0802  0.0222  278 ALA B O   
2269 C  CB  . ALA B 132 ? 0.6499 0.3896 0.4077 -0.0158 0.1108  0.0133  278 ALA B CB  
2270 N  N   . ARG B 133 ? 0.6572 0.3915 0.4095 -0.0007 0.0959  0.0220  279 ARG B N   
2271 C  CA  . ARG B 133 ? 0.6609 0.3842 0.3959 0.0128  0.0921  0.0285  279 ARG B CA  
2272 C  C   . ARG B 133 ? 0.6155 0.3612 0.3657 0.0164  0.0767  0.0268  279 ARG B C   
2273 O  O   . ARG B 133 ? 0.6175 0.3619 0.3566 0.0286  0.0708  0.0304  279 ARG B O   
2274 C  CB  . ARG B 133 ? 0.7351 0.4312 0.4561 0.0118  0.1061  0.0314  279 ARG B CB  
2275 C  CG  . ARG B 133 ? 0.8348 0.5076 0.5442 0.0033  0.1250  0.0312  279 ARG B CG  
2276 C  CD  . ARG B 133 ? 0.9064 0.5455 0.5966 0.0035  0.1410  0.0348  279 ARG B CD  
2277 N  NE  . ARG B 133 ? 0.9163 0.5624 0.6252 -0.0060 0.1412  0.0287  279 ARG B NE  
2278 C  CZ  . ARG B 133 ? 0.9874 0.6273 0.6907 0.0023  0.1371  0.0319  279 ARG B CZ  
2279 N  NH1 . ARG B 133 ? 1.0104 0.6580 0.7315 -0.0070 0.1377  0.0254  279 ARG B NH1 
2280 N  NH2 . ARG B 133 ? 1.0109 0.6388 0.6909 0.0210  0.1320  0.0406  279 ARG B NH2 
2281 N  N   . PHE B 134 ? 0.5140 0.2804 0.2886 0.0065  0.0709  0.0211  280 PHE B N   
2282 C  CA  . PHE B 134 ? 0.4796 0.2637 0.2681 0.0076  0.0596  0.0195  280 PHE B CA  
2283 C  C   . PHE B 134 ? 0.4484 0.2518 0.2454 0.0102  0.0476  0.0176  280 PHE B C   
2284 O  O   . PHE B 134 ? 0.4489 0.2659 0.2550 0.0116  0.0391  0.0163  280 PHE B O   
2285 C  CB  . PHE B 134 ? 0.5349 0.3277 0.3420 -0.0032 0.0614  0.0148  280 PHE B CB  
2286 C  CG  . PHE B 134 ? 0.5261 0.3027 0.3278 -0.0062 0.0721  0.0148  280 PHE B CG  
2287 C  CD1 . PHE B 134 ? 0.5628 0.3190 0.3443 0.0028  0.0766  0.0203  280 PHE B CD1 
2288 C  CD2 . PHE B 134 ? 0.5301 0.3122 0.3461 -0.0173 0.0777  0.0083  280 PHE B CD2 
2289 C  CE1 . PHE B 134 ? 0.6365 0.3740 0.4115 -0.0003 0.0878  0.0201  280 PHE B CE1 
2290 C  CE2 . PHE B 134 ? 0.5804 0.3477 0.3925 -0.0217 0.0884  0.0065  280 PHE B CE2 
2291 C  CZ  . PHE B 134 ? 0.6220 0.3649 0.4133 -0.0138 0.0941  0.0126  280 PHE B CZ  
2292 N  N   . TRP B 135 ? 0.4515 0.2553 0.2454 0.0099  0.0480  0.0166  281 TRP B N   
2293 C  CA  . TRP B 135 ? 0.4153 0.2342 0.2154 0.0118  0.0382  0.0137  281 TRP B CA  
2294 C  C   . TRP B 135 ? 0.4179 0.2391 0.2052 0.0236  0.0324  0.0146  281 TRP B C   
2295 O  O   . TRP B 135 ? 0.4742 0.2814 0.2418 0.0326  0.0371  0.0187  281 TRP B O   
2296 C  CB  . TRP B 135 ? 0.4116 0.2300 0.2120 0.0084  0.0409  0.0116  281 TRP B CB  
2297 C  CG  . TRP B 135 ? 0.4356 0.2585 0.2505 -0.0013 0.0441  0.0083  281 TRP B CG  
2298 C  CD1 . TRP B 135 ? 0.4602 0.2762 0.2747 -0.0067 0.0540  0.0071  281 TRP B CD1 
2299 C  CD2 . TRP B 135 ? 0.3982 0.2345 0.2292 -0.0056 0.0379  0.0049  281 TRP B CD2 
2300 N  NE1 . TRP B 135 ? 0.4688 0.2970 0.2995 -0.0131 0.0529  0.0022  281 TRP B NE1 
2301 C  CE2 . TRP B 135 ? 0.4170 0.2559 0.2562 -0.0114 0.0430  0.0018  281 TRP B CE2 
2302 C  CE3 . TRP B 135 ? 0.4085 0.2542 0.2467 -0.0050 0.0295  0.0038  281 TRP B CE3 
2303 C  CZ2 . TRP B 135 ? 0.4090 0.2589 0.2609 -0.0138 0.0389  -0.0014 281 TRP B CZ2 
2304 C  CZ3 . TRP B 135 ? 0.3795 0.2318 0.2293 -0.0090 0.0272  0.0016  281 TRP B CZ3 
2305 C  CH2 . TRP B 135 ? 0.4046 0.2588 0.2600 -0.0119 0.0313  -0.0005 281 TRP B CH2 
2306 N  N   . ILE B 136 ? 0.3964 0.2354 0.1940 0.0239  0.0229  0.0100  282 ILE B N   
2307 C  CA  . ILE B 136 ? 0.4388 0.2870 0.2276 0.0342  0.0162  0.0072  282 ILE B CA  
2308 C  C   . ILE B 136 ? 0.4486 0.2892 0.2232 0.0390  0.0190  0.0078  282 ILE B C   
2309 O  O   . ILE B 136 ? 0.4528 0.2896 0.2326 0.0313  0.0226  0.0072  282 ILE B O   
2310 C  CB  . ILE B 136 ? 0.4368 0.3062 0.2427 0.0292  0.0076  -0.0006 282 ILE B CB  
2311 C  CG1 . ILE B 136 ? 0.4384 0.3163 0.2556 0.0262  0.0053  -0.0012 282 ILE B CG1 
2312 C  CG2 . ILE B 136 ? 0.3898 0.2731 0.1895 0.0380  0.0008  -0.0070 282 ILE B CG2 
2313 C  CD1 . ILE B 136 ? 0.4469 0.3412 0.2816 0.0177  0.0005  -0.0083 282 ILE B CD1 
2314 N  N   . PRO B 137 ? 0.4697 0.3084 0.2250 0.0531  0.0173  0.0088  283 PRO B N   
2315 C  CA  . PRO B 137 ? 0.4976 0.3298 0.2379 0.0585  0.0200  0.0093  283 PRO B CA  
2316 C  C   . PRO B 137 ? 0.4908 0.3399 0.2453 0.0522  0.0135  0.0009  283 PRO B C   
2317 O  O   . PRO B 137 ? 0.4550 0.3241 0.2203 0.0525  0.0046  -0.0068 283 PRO B O   
2318 C  CB  . PRO B 137 ? 0.5020 0.3343 0.2195 0.0774  0.0166  0.0106  283 PRO B CB  
2319 C  CG  . PRO B 137 ? 0.4578 0.2856 0.1736 0.0814  0.0172  0.0143  283 PRO B CG  
2320 C  CD  . PRO B 137 ? 0.4718 0.3140 0.2160 0.0664  0.0133  0.0097  283 PRO B CD  
2321 N  N   . GLY B 138 ? 0.4627 0.3040 0.2178 0.0459  0.0188  0.0015  284 GLY B N   
2322 C  CA  . GLY B 138 ? 0.4623 0.3158 0.2298 0.0399  0.0140  -0.0062 284 GLY B CA  
2323 C  C   . GLY B 138 ? 0.4471 0.3022 0.2354 0.0265  0.0146  -0.0078 284 GLY B C   
2324 O  O   . GLY B 138 ? 0.4534 0.3136 0.2503 0.0215  0.0124  -0.0132 284 GLY B O   
2325 N  N   . GLU B 139 ? 0.4274 0.2775 0.2221 0.0218  0.0178  -0.0033 285 GLU B N   
2326 C  CA  . GLU B 139 ? 0.4392 0.2898 0.2502 0.0115  0.0191  -0.0038 285 GLU B CA  
2327 C  C   . GLU B 139 ? 0.4627 0.3024 0.2719 0.0082  0.0279  0.0003  285 GLU B C   
2328 O  O   . GLU B 139 ? 0.5098 0.3393 0.3071 0.0115  0.0339  0.0045  285 GLU B O   
2329 C  CB  . GLU B 139 ? 0.4291 0.2863 0.2508 0.0084  0.0155  -0.0038 285 GLU B CB  
2330 C  CG  . GLU B 139 ? 0.4577 0.3283 0.2821 0.0111  0.0082  -0.0092 285 GLU B CG  
2331 C  CD  . GLU B 139 ? 0.4683 0.3460 0.3025 0.0051  0.0049  -0.0165 285 GLU B CD  
2332 O  OE1 . GLU B 139 ? 0.4666 0.3373 0.3049 0.0001  0.0077  -0.0162 285 GLU B OE1 
2333 O  OE2 . GLU B 139 ? 0.4845 0.3753 0.3222 0.0058  -0.0001 -0.0236 285 GLU B OE2 
2334 N  N   . PRO B 140 ? 0.4815 0.3234 0.3018 0.0018  0.0293  -0.0019 286 PRO B N   
2335 C  CA  . PRO B 140 ? 0.4456 0.2941 0.2772 -0.0015 0.0241  -0.0058 286 PRO B CA  
2336 C  C   . PRO B 140 ? 0.4963 0.3459 0.3242 0.0006  0.0219  -0.0101 286 PRO B C   
2337 O  O   . PRO B 140 ? 0.5112 0.3576 0.3336 0.0019  0.0260  -0.0107 286 PRO B O   
2338 C  CB  . PRO B 140 ? 0.4150 0.2640 0.2549 -0.0054 0.0279  -0.0061 286 PRO B CB  
2339 C  CG  . PRO B 140 ? 0.4163 0.2611 0.2520 -0.0065 0.0354  -0.0041 286 PRO B CG  
2340 C  CD  . PRO B 140 ? 0.4341 0.2710 0.2548 -0.0019 0.0376  -0.0014 286 PRO B CD  
2341 N  N   . ASN B 141 ? 0.5465 0.4009 0.3780 0.0000  0.0163  -0.0142 287 ASN B N   
2342 C  CA  . ASN B 141 ? 0.5245 0.3804 0.3531 0.0014  0.0141  -0.0201 287 ASN B CA  
2343 C  C   . ASN B 141 ? 0.4976 0.3494 0.3336 -0.0026 0.0143  -0.0232 287 ASN B C   
2344 O  O   . ASN B 141 ? 0.4661 0.3171 0.3001 -0.0020 0.0134  -0.0285 287 ASN B O   
2345 C  CB  . ASN B 141 ? 0.4837 0.3490 0.3110 0.0033  0.0086  -0.0255 287 ASN B CB  
2346 C  CG  . ASN B 141 ? 0.4744 0.3443 0.3133 -0.0030 0.0060  -0.0287 287 ASN B CG  
2347 O  OD1 . ASN B 141 ? 0.4257 0.2902 0.2711 -0.0074 0.0082  -0.0247 287 ASN B OD1 
2348 N  ND2 . ASN B 141 ? 0.5161 0.3974 0.3577 -0.0036 0.0017  -0.0370 287 ASN B ND2 
2349 N  N   . ASN B 142 ? 0.4956 0.3442 0.3384 -0.0055 0.0158  -0.0200 288 ASN B N   
2350 C  CA  . ASN B 142 ? 0.4837 0.3255 0.3298 -0.0065 0.0166  -0.0215 288 ASN B CA  
2351 C  C   . ASN B 142 ? 0.4987 0.3365 0.3449 -0.0092 0.0150  -0.0278 288 ASN B C   
2352 O  O   . ASN B 142 ? 0.5407 0.3720 0.3844 -0.0078 0.0160  -0.0313 288 ASN B O   
2353 C  CB  . ASN B 142 ? 0.4906 0.3318 0.3343 -0.0025 0.0193  -0.0220 288 ASN B CB  
2354 C  CG  . ASN B 142 ? 0.5096 0.3447 0.3553 -0.0002 0.0200  -0.0224 288 ASN B CG  
2355 O  OD1 . ASN B 142 ? 0.5234 0.3525 0.3708 -0.0014 0.0196  -0.0203 288 ASN B OD1 
2356 N  ND2 . ASN B 142 ? 0.5000 0.3364 0.3440 0.0042  0.0215  -0.0251 288 ASN B ND2 
2357 N  N   . ALA B 143 ? 0.4859 0.3285 0.3354 -0.0134 0.0130  -0.0305 289 ALA B N   
2358 C  CA  . ALA B 143 ? 0.4805 0.3220 0.3323 -0.0183 0.0124  -0.0391 289 ALA B CA  
2359 C  C   . ALA B 143 ? 0.5487 0.3732 0.4009 -0.0217 0.0168  -0.0394 289 ALA B C   
2360 O  O   . ALA B 143 ? 0.5822 0.3993 0.4353 -0.0228 0.0193  -0.0336 289 ALA B O   
2361 C  CB  . ALA B 143 ? 0.4435 0.2967 0.3012 -0.0229 0.0101  -0.0431 289 ALA B CB  
2362 N  N   . GLY B 144 ? 0.6134 0.4303 0.4629 -0.0224 0.0181  -0.0460 290 GLY B N   
2363 C  CA  . GLY B 144 ? 0.6895 0.4856 0.5355 -0.0239 0.0234  -0.0460 290 GLY B CA  
2364 C  C   . GLY B 144 ? 0.7193 0.5078 0.5593 -0.0146 0.0242  -0.0386 290 GLY B C   
2365 O  O   . GLY B 144 ? 0.7333 0.5036 0.5673 -0.0119 0.0282  -0.0365 290 GLY B O   
2366 N  N   . ASN B 145 ? 0.7049 0.5073 0.5458 -0.0093 0.0209  -0.0352 291 ASN B N   
2367 C  CA  . ASN B 145 ? 0.7318 0.5340 0.5699 -0.0011 0.0214  -0.0309 291 ASN B CA  
2368 C  C   . ASN B 145 ? 0.6709 0.4663 0.5081 0.0017  0.0230  -0.0247 291 ASN B C   
2369 O  O   . ASN B 145 ? 0.6899 0.4842 0.5239 0.0100  0.0234  -0.0229 291 ASN B O   
2370 C  CB  . ASN B 145 ? 0.8052 0.5994 0.6377 0.0042  0.0225  -0.0355 291 ASN B CB  
2371 C  CG  . ASN B 145 ? 0.8797 0.6858 0.7123 0.0110  0.0218  -0.0354 291 ASN B CG  
2372 O  OD1 . ASN B 145 ? 0.8841 0.7007 0.7172 0.0099  0.0211  -0.0378 291 ASN B OD1 
2373 N  ND2 . ASN B 145 ? 0.9123 0.7178 0.7438 0.0185  0.0225  -0.0332 291 ASN B ND2 
2374 N  N   . ASN B 146 ? 0.6120 0.4051 0.4518 -0.0043 0.0239  -0.0221 292 ASN B N   
2375 C  CA  . ASN B 146 ? 0.6360 0.4217 0.4732 -0.0016 0.0258  -0.0160 292 ASN B CA  
2376 C  C   . ASN B 146 ? 0.5883 0.3865 0.4322 -0.0057 0.0242  -0.0124 292 ASN B C   
2377 O  O   . ASN B 146 ? 0.6309 0.4227 0.4739 -0.0082 0.0265  -0.0089 292 ASN B O   
2378 C  CB  . ASN B 146 ? 0.7268 0.4897 0.5569 -0.0049 0.0313  -0.0163 292 ASN B CB  
2379 C  CG  . ASN B 146 ? 0.8087 0.5591 0.6308 0.0009  0.0346  -0.0091 292 ASN B CG  
2380 O  OD1 . ASN B 146 ? 0.8818 0.6359 0.6999 0.0120  0.0325  -0.0058 292 ASN B OD1 
2381 N  ND2 . ASN B 146 ? 0.8232 0.5597 0.6426 -0.0064 0.0401  -0.0075 292 ASN B ND2 
2382 N  N   . GLU B 147 ? 0.5267 0.3411 0.3761 -0.0063 0.0212  -0.0130 293 GLU B N   
2383 C  CA  . GLU B 147 ? 0.4688 0.2934 0.3234 -0.0094 0.0200  -0.0099 293 GLU B CA  
2384 C  C   . GLU B 147 ? 0.4958 0.3298 0.3526 -0.0046 0.0196  -0.0075 293 GLU B C   
2385 O  O   . GLU B 147 ? 0.5344 0.3767 0.3927 -0.0045 0.0197  -0.0089 293 GLU B O   
2386 C  CB  . GLU B 147 ? 0.4461 0.2794 0.3033 -0.0136 0.0179  -0.0129 293 GLU B CB  
2387 C  CG  . GLU B 147 ? 0.4701 0.3000 0.3282 -0.0193 0.0179  -0.0183 293 GLU B CG  
2388 C  CD  . GLU B 147 ? 0.5077 0.3509 0.3691 -0.0219 0.0147  -0.0217 293 GLU B CD  
2389 O  OE1 . GLU B 147 ? 0.5169 0.3678 0.3755 -0.0174 0.0126  -0.0205 293 GLU B OE1 
2390 O  OE2 . GLU B 147 ? 0.5268 0.3727 0.3929 -0.0279 0.0150  -0.0261 293 GLU B OE2 
2391 N  N   . HIS B 148 ? 0.5007 0.3332 0.3568 -0.0008 0.0202  -0.0045 294 HIS B N   
2392 C  CA  . HIS B 148 ? 0.5118 0.3561 0.3711 0.0041  0.0198  -0.0049 294 HIS B CA  
2393 C  C   . HIS B 148 ? 0.4659 0.3183 0.3300 0.0021  0.0194  -0.0024 294 HIS B C   
2394 O  O   . HIS B 148 ? 0.5036 0.3671 0.3712 0.0057  0.0193  -0.0042 294 HIS B O   
2395 C  CB  . HIS B 148 ? 0.5335 0.3747 0.3876 0.0138  0.0196  -0.0056 294 HIS B CB  
2396 C  CG  . HIS B 148 ? 0.5877 0.4192 0.4362 0.0167  0.0202  -0.0082 294 HIS B CG  
2397 N  ND1 . HIS B 148 ? 0.6546 0.4901 0.5057 0.0131  0.0204  -0.0121 294 HIS B ND1 
2398 C  CD2 . HIS B 148 ? 0.6198 0.4360 0.4586 0.0235  0.0212  -0.0074 294 HIS B CD2 
2399 C  CE1 . HIS B 148 ? 0.6970 0.5224 0.5421 0.0170  0.0208  -0.0144 294 HIS B CE1 
2400 N  NE2 . HIS B 148 ? 0.6790 0.4916 0.5165 0.0233  0.0216  -0.0117 294 HIS B NE2 
2401 N  N   . CYS B 149 ? 0.4087 0.2574 0.2734 -0.0035 0.0194  0.0003  295 CYS B N   
2402 C  CA  . CYS B 149 ? 0.4047 0.2608 0.2737 -0.0054 0.0191  0.0023  295 CYS B CA  
2403 C  C   . CYS B 149 ? 0.4664 0.3252 0.3379 -0.0108 0.0188  0.0022  295 CYS B C   
2404 O  O   . CYS B 149 ? 0.4663 0.3215 0.3358 -0.0130 0.0182  0.0007  295 CYS B O   
2405 C  CB  . CYS B 149 ? 0.4161 0.2657 0.2818 -0.0046 0.0197  0.0061  295 CYS B CB  
2406 S  SG  . CYS B 149 ? 0.5496 0.3948 0.4074 0.0061  0.0200  0.0076  295 CYS B SG  
2407 N  N   . GLY B 150 ? 0.4319 0.2975 0.3069 -0.0119 0.0190  0.0031  296 GLY B N   
2408 C  CA  . GLY B 150 ? 0.4413 0.3083 0.3162 -0.0143 0.0190  0.0033  296 GLY B CA  
2409 C  C   . GLY B 150 ? 0.4358 0.3062 0.3133 -0.0158 0.0179  0.0052  296 GLY B C   
2410 O  O   . GLY B 150 ? 0.4306 0.3042 0.3109 -0.0154 0.0182  0.0064  296 GLY B O   
2411 N  N   . ASN B 151 ? 0.3797 0.2513 0.2561 -0.0167 0.0163  0.0047  297 ASN B N   
2412 C  CA  . ASN B 151 ? 0.3187 0.1961 0.1980 -0.0176 0.0151  0.0053  297 ASN B CA  
2413 C  C   . ASN B 151 ? 0.3794 0.2592 0.2550 -0.0142 0.0141  0.0048  297 ASN B C   
2414 O  O   . ASN B 151 ? 0.3678 0.2435 0.2370 -0.0113 0.0144  0.0043  297 ASN B O   
2415 C  CB  . ASN B 151 ? 0.3301 0.2095 0.2126 -0.0217 0.0144  0.0035  297 ASN B CB  
2416 C  CG  . ASN B 151 ? 0.4296 0.3105 0.3111 -0.0227 0.0126  -0.0011 297 ASN B CG  
2417 O  OD1 . ASN B 151 ? 0.3944 0.2800 0.2730 -0.0188 0.0102  -0.0027 297 ASN B OD1 
2418 N  ND2 . ASN B 151 ? 0.4658 0.3423 0.3487 -0.0274 0.0142  -0.0036 297 ASN B ND2 
2419 N  N   . ILE B 152 ? 0.3853 0.2708 0.2630 -0.0133 0.0132  0.0053  298 ILE B N   
2420 C  CA  . ILE B 152 ? 0.4004 0.2876 0.2725 -0.0075 0.0119  0.0049  298 ILE B CA  
2421 C  C   . ILE B 152 ? 0.3856 0.2847 0.2604 -0.0067 0.0075  0.0004  298 ILE B C   
2422 O  O   . ILE B 152 ? 0.4102 0.3181 0.2932 -0.0114 0.0068  -0.0018 298 ILE B O   
2423 C  CB  . ILE B 152 ? 0.4659 0.3535 0.3386 -0.0058 0.0134  0.0067  298 ILE B CB  
2424 C  CG1 . ILE B 152 ? 0.5205 0.3971 0.3897 -0.0063 0.0187  0.0087  298 ILE B CG1 
2425 C  CG2 . ILE B 152 ? 0.5067 0.3981 0.3735 0.0018  0.0110  0.0059  298 ILE B CG2 
2426 C  CD1 . ILE B 152 ? 0.5608 0.4347 0.4283 -0.0042 0.0212  0.0093  298 ILE B CD1 
2427 N  N   . LYS B 153 ? 0.3793 0.2798 0.2468 -0.0008 0.0051  -0.0017 299 LYS B N   
2428 C  CA  . LYS B 153 ? 0.3675 0.2833 0.2389 -0.0003 0.0005  -0.0089 299 LYS B CA  
2429 C  C   . LYS B 153 ? 0.3956 0.3206 0.2591 0.0115  -0.0036 -0.0114 299 LYS B C   
2430 O  O   . LYS B 153 ? 0.4682 0.4104 0.3382 0.0128  -0.0071 -0.0170 299 LYS B O   
2431 C  CB  . LYS B 153 ? 0.3992 0.3126 0.2700 -0.0033 0.0002  -0.0121 299 LYS B CB  
2432 C  CG  . LYS B 153 ? 0.3987 0.3291 0.2753 -0.0046 -0.0038 -0.0221 299 LYS B CG  
2433 C  CD  . LYS B 153 ? 0.4399 0.3652 0.3153 -0.0080 -0.0033 -0.0252 299 LYS B CD  
2434 C  CE  . LYS B 153 ? 0.4632 0.4061 0.3467 -0.0119 -0.0063 -0.0375 299 LYS B CE  
2435 N  NZ  . LYS B 153 ? 0.5630 0.4990 0.4449 -0.0154 -0.0053 -0.0408 299 LYS B NZ  
2436 N  N   . ALA B 154 ? 0.3160 0.2295 0.1642 0.0208  -0.0028 -0.0075 300 ALA B N   
2437 C  CA  . ALA B 154 ? 0.4048 0.3244 0.2407 0.0352  -0.0066 -0.0091 300 ALA B CA  
2438 C  C   . ALA B 154 ? 0.4714 0.3838 0.3003 0.0424  -0.0046 -0.0042 300 ALA B C   
2439 O  O   . ALA B 154 ? 0.4378 0.3326 0.2647 0.0381  0.0016  0.0022  300 ALA B O   
2440 C  CB  . ALA B 154 ? 0.3957 0.3034 0.2143 0.0436  -0.0055 -0.0064 300 ALA B CB  
2441 N  N   . PRO B 155 ? 0.5285 0.4556 0.3536 0.0540  -0.0100 -0.0084 301 PRO B N   
2442 C  CA  . PRO B 155 ? 0.5248 0.4457 0.3427 0.0624  -0.0085 -0.0047 301 PRO B CA  
2443 C  C   . PRO B 155 ? 0.5670 0.4610 0.3595 0.0752  -0.0032 0.0035  301 PRO B C   
2444 O  O   . PRO B 155 ? 0.6079 0.5020 0.3845 0.0924  -0.0057 0.0037  301 PRO B O   
2445 C  CB  . PRO B 155 ? 0.5394 0.4889 0.3615 0.0722  -0.0169 -0.0139 301 PRO B CB  
2446 C  CG  . PRO B 155 ? 0.5573 0.5288 0.3908 0.0666  -0.0221 -0.0237 301 PRO B CG  
2447 C  CD  . PRO B 155 ? 0.5380 0.4901 0.3651 0.0610  -0.0179 -0.0184 301 PRO B CD  
2448 N  N   . SER B 156 ? 0.5671 0.4381 0.3550 0.0674  0.0050  0.0098  302 SER B N   
2449 C  CA  . SER B 156 ? 0.5894 0.4309 0.3531 0.0764  0.0133  0.0175  302 SER B CA  
2450 C  C   . SER B 156 ? 0.6241 0.4463 0.3916 0.0621  0.0232  0.0214  302 SER B C   
2451 O  O   . SER B 156 ? 0.6375 0.4707 0.4248 0.0481  0.0219  0.0184  302 SER B O   
2452 C  CB  . SER B 156 ? 0.6161 0.4555 0.3609 0.0897  0.0111  0.0180  302 SER B CB  
2453 O  OG  . SER B 156 ? 0.6197 0.4418 0.3587 0.0828  0.0184  0.0219  302 SER B OG  
2454 N  N   . LEU B 157 ? 0.6433 0.4367 0.3910 0.0661  0.0338  0.0275  303 LEU B N   
2455 C  CA  . LEU B 157 ? 0.6179 0.3949 0.3693 0.0524  0.0444  0.0291  303 LEU B CA  
2456 C  C   . LEU B 157 ? 0.5957 0.3822 0.3568 0.0438  0.0427  0.0267  303 LEU B C   
2457 O  O   . LEU B 157 ? 0.6019 0.3908 0.3777 0.0304  0.0461  0.0243  303 LEU B O   
2458 C  CB  . LEU B 157 ? 0.6354 0.3780 0.3615 0.0580  0.0581  0.0352  303 LEU B CB  
2459 C  CG  . LEU B 157 ? 0.6753 0.4021 0.3978 0.0578  0.0651  0.0363  303 LEU B CG  
2460 C  CD1 . LEU B 157 ? 0.7289 0.4169 0.4206 0.0665  0.0795  0.0429  303 LEU B CD1 
2461 C  CD2 . LEU B 157 ? 0.5966 0.3303 0.3424 0.0393  0.0688  0.0311  303 LEU B CD2 
2462 N  N   . GLN B 158 ? 0.5635 0.3569 0.3160 0.0526  0.0370  0.0263  304 GLN B N   
2463 C  CA  . GLN B 158 ? 0.5529 0.3579 0.3154 0.0456  0.0336  0.0229  304 GLN B CA  
2464 C  C   . GLN B 158 ? 0.4865 0.3182 0.2708 0.0401  0.0230  0.0166  304 GLN B C   
2465 O  O   . GLN B 158 ? 0.4797 0.3273 0.2644 0.0463  0.0149  0.0124  304 GLN B O   
2466 C  CB  . GLN B 158 ? 0.6078 0.4084 0.3509 0.0574  0.0327  0.0242  304 GLN B CB  
2467 C  CG  . GLN B 158 ? 0.6755 0.4457 0.3930 0.0634  0.0453  0.0315  304 GLN B CG  
2468 C  CD  . GLN B 158 ? 0.7429 0.5086 0.4382 0.0770  0.0444  0.0333  304 GLN B CD  
2469 O  OE1 . GLN B 158 ? 0.7348 0.5108 0.4196 0.0925  0.0360  0.0322  304 GLN B OE1 
2470 N  NE2 . GLN B 158 ? 0.7546 0.5071 0.4427 0.0720  0.0529  0.0353  304 GLN B NE2 
2471 N  N   . ALA B 159 ? 0.4096 0.2461 0.2113 0.0284  0.0238  0.0153  305 ALA B N   
2472 C  CA  . ALA B 159 ? 0.3441 0.2009 0.1635 0.0234  0.0163  0.0107  305 ALA B CA  
2473 C  C   . ALA B 159 ? 0.3804 0.2443 0.2136 0.0130  0.0150  0.0077  305 ALA B C   
2474 O  O   . ALA B 159 ? 0.3950 0.2730 0.2385 0.0098  0.0097  0.0035  305 ALA B O   
2475 C  CB  . ALA B 159 ? 0.2982 0.1560 0.1242 0.0211  0.0175  0.0116  305 ALA B CB  
2476 N  N   . TRP B 160 ? 0.3762 0.2302 0.2093 0.0079  0.0205  0.0094  306 TRP B N   
2477 C  CA  . TRP B 160 ? 0.3421 0.2014 0.1870 0.0000  0.0195  0.0070  306 TRP B CA  
2478 C  C   . TRP B 160 ? 0.3709 0.2346 0.2154 0.0004  0.0158  0.0037  306 TRP B C   
2479 O  O   . TRP B 160 ? 0.3711 0.2309 0.2050 0.0056  0.0163  0.0036  306 TRP B O   
2480 C  CB  . TRP B 160 ? 0.3261 0.1778 0.1722 -0.0045 0.0260  0.0077  306 TRP B CB  
2481 C  CG  . TRP B 160 ? 0.3163 0.1638 0.1639 -0.0066 0.0311  0.0087  306 TRP B CG  
2482 C  CD1 . TRP B 160 ? 0.3098 0.1597 0.1595 -0.0055 0.0298  0.0097  306 TRP B CD1 
2483 C  CD2 . TRP B 160 ? 0.3435 0.1849 0.1915 -0.0110 0.0390  0.0072  306 TRP B CD2 
2484 N  NE1 . TRP B 160 ? 0.3445 0.1887 0.1953 -0.0087 0.0362  0.0090  306 TRP B NE1 
2485 C  CE2 . TRP B 160 ? 0.3512 0.1908 0.2017 -0.0128 0.0422  0.0069  306 TRP B CE2 
2486 C  CE3 . TRP B 160 ? 0.3956 0.2343 0.2430 -0.0141 0.0441  0.0049  306 TRP B CE3 
2487 C  CZ2 . TRP B 160 ? 0.3885 0.2241 0.2417 -0.0186 0.0507  0.0033  306 TRP B CZ2 
2488 C  CZ3 . TRP B 160 ? 0.4383 0.2744 0.2889 -0.0199 0.0526  0.0013  306 TRP B CZ3 
2489 C  CH2 . TRP B 160 ? 0.4253 0.2599 0.2791 -0.0226 0.0561  0.0001  306 TRP B CH2 
2490 N  N   . ASN B 161 ? 0.3538 0.2241 0.2086 -0.0051 0.0131  0.0009  307 ASN B N   
2491 C  CA  . ASN B 161 ? 0.3891 0.2606 0.2451 -0.0070 0.0113  -0.0030 307 ASN B CA  
2492 C  C   . ASN B 161 ? 0.4826 0.3492 0.3444 -0.0119 0.0135  -0.0023 307 ASN B C   
2493 O  O   . ASN B 161 ? 0.4919 0.3590 0.3591 -0.0144 0.0144  -0.0004 307 ASN B O   
2494 C  CB  . ASN B 161 ? 0.3454 0.2278 0.2064 -0.0086 0.0069  -0.0086 307 ASN B CB  
2495 C  CG  . ASN B 161 ? 0.3703 0.2523 0.2337 -0.0125 0.0062  -0.0140 307 ASN B CG  
2496 O  OD1 . ASN B 161 ? 0.3686 0.2461 0.2258 -0.0097 0.0066  -0.0146 307 ASN B OD1 
2497 N  ND2 . ASN B 161 ? 0.3764 0.2619 0.2482 -0.0194 0.0063  -0.0183 307 ASN B ND2 
2498 N  N   . ASP B 162 ? 0.4578 0.3201 0.3171 -0.0116 0.0143  -0.0041 308 ASP B N   
2499 C  CA  . ASP B 162 ? 0.3937 0.2516 0.2565 -0.0137 0.0157  -0.0042 308 ASP B CA  
2500 C  C   . ASP B 162 ? 0.4449 0.3005 0.3101 -0.0172 0.0144  -0.0075 308 ASP B C   
2501 O  O   . ASP B 162 ? 0.4467 0.3052 0.3109 -0.0181 0.0126  -0.0123 308 ASP B O   
2502 C  CB  . ASP B 162 ? 0.4317 0.2864 0.2910 -0.0112 0.0180  -0.0052 308 ASP B CB  
2503 C  CG  . ASP B 162 ? 0.4656 0.3190 0.3193 -0.0098 0.0168  -0.0087 308 ASP B CG  
2504 O  OD1 . ASP B 162 ? 0.4734 0.3308 0.3246 -0.0090 0.0142  -0.0103 308 ASP B OD1 
2505 O  OD2 . ASP B 162 ? 0.4878 0.3383 0.3397 -0.0084 0.0180  -0.0108 308 ASP B OD2 
2506 N  N   . ALA B 163 ? 0.4719 0.3221 0.3393 -0.0191 0.0162  -0.0056 309 ALA B N   
2507 C  CA  . ALA B 163 ? 0.4371 0.2806 0.3054 -0.0240 0.0178  -0.0081 309 ALA B CA  
2508 C  C   . ALA B 163 ? 0.4414 0.2715 0.3050 -0.0216 0.0211  -0.0050 309 ALA B C   
2509 O  O   . ALA B 163 ? 0.4747 0.3061 0.3368 -0.0158 0.0207  -0.0015 309 ALA B O   
2510 C  CB  . ALA B 163 ? 0.3771 0.2269 0.2505 -0.0288 0.0181  -0.0082 309 ALA B CB  
2511 N  N   . PRO B 164 ? 0.4205 0.2375 0.2810 -0.0253 0.0248  -0.0071 310 PRO B N   
2512 C  CA  . PRO B 164 ? 0.4201 0.2201 0.2719 -0.0204 0.0286  -0.0033 310 PRO B CA  
2513 C  C   . PRO B 164 ? 0.4362 0.2351 0.2857 -0.0177 0.0302  0.0031  310 PRO B C   
2514 O  O   . PRO B 164 ? 0.4389 0.2403 0.2920 -0.0241 0.0320  0.0035  310 PRO B O   
2515 C  CB  . PRO B 164 ? 0.4220 0.2055 0.2704 -0.0274 0.0343  -0.0074 310 PRO B CB  
2516 C  CG  . PRO B 164 ? 0.4142 0.2109 0.2710 -0.0341 0.0312  -0.0158 310 PRO B CG  
2517 C  CD  . PRO B 164 ? 0.3827 0.1995 0.2467 -0.0336 0.0262  -0.0144 310 PRO B CD  
2518 N  N   . CYS B 165 ? 0.4130 0.2104 0.2568 -0.0077 0.0292  0.0068  311 CYS B N   
2519 C  CA  . CYS B 165 ? 0.4251 0.2243 0.2657 -0.0029 0.0297  0.0120  311 CYS B CA  
2520 C  C   . CYS B 165 ? 0.4189 0.2015 0.2519 -0.0065 0.0362  0.0159  311 CYS B C   
2521 O  O   . CYS B 165 ? 0.4556 0.2420 0.2877 -0.0053 0.0369  0.0197  311 CYS B O   
2522 C  CB  . CYS B 165 ? 0.5262 0.3270 0.3603 0.0102  0.0277  0.0134  311 CYS B CB  
2523 S  SG  . CYS B 165 ? 0.8019 0.6265 0.6474 0.0124  0.0222  0.0078  311 CYS B SG  
2524 N  N   . ASP B 166 ? 0.4843 0.2480 0.3117 -0.0118 0.0420  0.0142  312 ASP B N   
2525 C  CA  . ASP B 166 ? 0.5598 0.3028 0.3778 -0.0165 0.0511  0.0174  312 ASP B CA  
2526 C  C   . ASP B 166 ? 0.5395 0.2907 0.3688 -0.0312 0.0539  0.0130  312 ASP B C   
2527 O  O   . ASP B 166 ? 0.5508 0.2876 0.3745 -0.0375 0.0628  0.0146  312 ASP B O   
2528 C  CB  . ASP B 166 ? 0.7282 0.4431 0.5333 -0.0157 0.0583  0.0168  312 ASP B CB  
2529 C  CG  . ASP B 166 ? 0.8309 0.5487 0.6458 -0.0261 0.0580  0.0075  312 ASP B CG  
2530 O  OD1 . ASP B 166 ? 0.9058 0.6198 0.7259 -0.0397 0.0640  0.0022  312 ASP B OD1 
2531 O  OD2 . ASP B 166 ? 0.8013 0.5271 0.6191 -0.0208 0.0519  0.0044  312 ASP B OD2 
2532 N  N   . LYS B 167 ? 0.4994 0.2735 0.3435 -0.0360 0.0472  0.0069  313 LYS B N   
2533 C  CA  . LYS B 167 ? 0.5062 0.2936 0.3619 -0.0475 0.0482  0.0013  313 LYS B CA  
2534 C  C   . LYS B 167 ? 0.4668 0.2607 0.3229 -0.0465 0.0490  0.0066  313 LYS B C   
2535 O  O   . LYS B 167 ? 0.5218 0.3197 0.3742 -0.0369 0.0449  0.0125  313 LYS B O   
2536 C  CB  . LYS B 167 ? 0.5121 0.3226 0.3797 -0.0482 0.0397  -0.0051 313 LYS B CB  
2537 C  CG  . LYS B 167 ? 0.6077 0.4183 0.4790 -0.0542 0.0400  -0.0143 313 LYS B CG  
2538 C  CD  . LYS B 167 ? 0.7316 0.5469 0.6110 -0.0671 0.0454  -0.0231 313 LYS B CD  
2539 C  CE  . LYS B 167 ? 0.8035 0.6010 0.6797 -0.0750 0.0529  -0.0300 313 LYS B CE  
2540 N  NZ  . LYS B 167 ? 0.8458 0.6115 0.7068 -0.0729 0.0620  -0.0218 313 LYS B NZ  
2541 N  N   . THR B 168 ? 0.4804 0.2772 0.3417 -0.0568 0.0544  0.0031  314 THR B N   
2542 C  CA  . THR B 168 ? 0.5289 0.3333 0.3910 -0.0561 0.0553  0.0076  314 THR B CA  
2543 C  C   . THR B 168 ? 0.4471 0.2792 0.3243 -0.0593 0.0488  0.0018  314 THR B C   
2544 O  O   . THR B 168 ? 0.3798 0.2225 0.2668 -0.0688 0.0504  -0.0070 314 THR B O   
2545 C  CB  . THR B 168 ? 0.6016 0.3871 0.4552 -0.0633 0.0679  0.0098  314 THR B CB  
2546 O  OG1 . THR B 168 ? 0.6407 0.4322 0.5052 -0.0783 0.0734  -0.0004 314 THR B OG1 
2547 C  CG2 . THR B 168 ? 0.6584 0.4122 0.4933 -0.0581 0.0750  0.0159  314 THR B CG2 
2548 N  N   . PHE B 169 ? 0.4121 0.2560 0.2906 -0.0507 0.0418  0.0060  315 PHE B N   
2549 C  CA  . PHE B 169 ? 0.4189 0.2853 0.3080 -0.0506 0.0358  0.0022  315 PHE B CA  
2550 C  C   . PHE B 169 ? 0.4755 0.3471 0.3635 -0.0463 0.0354  0.0075  315 PHE B C   
2551 O  O   . PHE B 169 ? 0.4773 0.3382 0.3564 -0.0410 0.0374  0.0139  315 PHE B O   
2552 C  CB  . PHE B 169 ? 0.4085 0.2822 0.2992 -0.0438 0.0281  0.0012  315 PHE B CB  
2553 C  CG  . PHE B 169 ? 0.4189 0.2916 0.3109 -0.0465 0.0269  -0.0047 315 PHE B CG  
2554 C  CD1 . PHE B 169 ? 0.4086 0.2937 0.3086 -0.0530 0.0267  -0.0137 315 PHE B CD1 
2555 C  CD2 . PHE B 169 ? 0.4422 0.3046 0.3282 -0.0419 0.0256  -0.0027 315 PHE B CD2 
2556 C  CE1 . PHE B 169 ? 0.4041 0.2907 0.3054 -0.0548 0.0251  -0.0206 315 PHE B CE1 
2557 C  CE2 . PHE B 169 ? 0.4660 0.3281 0.3527 -0.0438 0.0244  -0.0086 315 PHE B CE2 
2558 C  CZ  . PHE B 169 ? 0.4066 0.2806 0.3007 -0.0502 0.0240  -0.0176 315 PHE B CZ  
2559 N  N   . LEU B 170 ? 0.4241 0.3133 0.3204 -0.0472 0.0323  0.0041  316 LEU B N   
2560 C  CA  . LEU B 170 ? 0.3779 0.2737 0.2739 -0.0419 0.0305  0.0080  316 LEU B CA  
2561 C  C   . LEU B 170 ? 0.3516 0.2440 0.2436 -0.0336 0.0260  0.0115  316 LEU B C   
2562 O  O   . LEU B 170 ? 0.3855 0.2727 0.2759 -0.0321 0.0241  0.0106  316 LEU B O   
2563 C  CB  . LEU B 170 ? 0.3447 0.2595 0.2497 -0.0422 0.0270  0.0029  316 LEU B CB  
2564 C  CG  . LEU B 170 ? 0.3686 0.2925 0.2805 -0.0511 0.0316  -0.0031 316 LEU B CG  
2565 C  CD1 . LEU B 170 ? 0.3775 0.3237 0.2983 -0.0490 0.0266  -0.0097 316 LEU B CD1 
2566 C  CD2 . LEU B 170 ? 0.3086 0.2248 0.2158 -0.0546 0.0390  0.0015  316 LEU B CD2 
2567 N  N   . PHE B 171 ? 0.3223 0.2188 0.2134 -0.0287 0.0248  0.0142  317 PHE B N   
2568 C  CA  . PHE B 171 ? 0.3258 0.2211 0.2146 -0.0225 0.0220  0.0153  317 PHE B CA  
2569 C  C   . PHE B 171 ? 0.3479 0.2532 0.2402 -0.0195 0.0201  0.0143  317 PHE B C   
2570 O  O   . PHE B 171 ? 0.3486 0.2604 0.2430 -0.0205 0.0209  0.0143  317 PHE B O   
2571 C  CB  . PHE B 171 ? 0.3423 0.2281 0.2230 -0.0184 0.0240  0.0188  317 PHE B CB  
2572 C  CG  . PHE B 171 ? 0.3667 0.2506 0.2417 -0.0169 0.0275  0.0224  317 PHE B CG  
2573 C  CD1 . PHE B 171 ? 0.3950 0.2879 0.2694 -0.0112 0.0258  0.0227  317 PHE B CD1 
2574 C  CD2 . PHE B 171 ? 0.3457 0.2185 0.2152 -0.0217 0.0335  0.0249  317 PHE B CD2 
2575 C  CE1 . PHE B 171 ? 0.3921 0.2834 0.2592 -0.0085 0.0291  0.0264  317 PHE B CE1 
2576 C  CE2 . PHE B 171 ? 0.3920 0.2604 0.2536 -0.0201 0.0384  0.0290  317 PHE B CE2 
2577 C  CZ  . PHE B 171 ? 0.3969 0.2748 0.2566 -0.0127 0.0358  0.0303  317 PHE B CZ  
2578 N  N   . ILE B 172 ? 0.3897 0.2960 0.2829 -0.0164 0.0185  0.0126  318 ILE B N   
2579 C  CA  . ILE B 172 ? 0.3737 0.2871 0.2701 -0.0146 0.0181  0.0102  318 ILE B CA  
2580 C  C   . ILE B 172 ? 0.3645 0.2821 0.2612 -0.0113 0.0181  0.0078  318 ILE B C   
2581 O  O   . ILE B 172 ? 0.3380 0.2537 0.2348 -0.0107 0.0183  0.0058  318 ILE B O   
2582 C  CB  . ILE B 172 ? 0.3576 0.2684 0.2550 -0.0150 0.0180  0.0081  318 ILE B CB  
2583 C  CG1 . ILE B 172 ? 0.3615 0.2725 0.2584 -0.0158 0.0166  0.0087  318 ILE B CG1 
2584 C  CG2 . ILE B 172 ? 0.2984 0.2128 0.1980 -0.0139 0.0193  0.0052  318 ILE B CG2 
2585 C  CD1 . ILE B 172 ? 0.3322 0.2375 0.2253 -0.0136 0.0162  0.0079  318 ILE B CD1 
2586 N  N   . CYS B 173 ? 0.3285 0.2544 0.2260 -0.0089 0.0180  0.0069  319 CYS B N   
2587 C  CA  . CYS B 173 ? 0.3484 0.2839 0.2475 -0.0049 0.0173  0.0022  319 CYS B CA  
2588 C  C   . CYS B 173 ? 0.3485 0.2898 0.2547 -0.0078 0.0186  -0.0045 319 CYS B C   
2589 O  O   . CYS B 173 ? 0.3019 0.2403 0.2090 -0.0101 0.0196  -0.0038 319 CYS B O   
2590 C  CB  . CYS B 173 ? 0.3770 0.3190 0.2712 0.0007  0.0165  0.0042  319 CYS B CB  
2591 S  SG  . CYS B 173 ? 0.5079 0.4367 0.3899 0.0038  0.0180  0.0128  319 CYS B SG  
2592 N  N   . LYS B 174 ? 0.3596 0.3094 0.2704 -0.0074 0.0192  -0.0119 320 LYS B N   
2593 C  CA  . LYS B 174 ? 0.3764 0.3305 0.2941 -0.0117 0.0226  -0.0202 320 LYS B CA  
2594 C  C   . LYS B 174 ? 0.4238 0.3977 0.3475 -0.0088 0.0214  -0.0299 320 LYS B C   
2595 O  O   . LYS B 174 ? 0.4053 0.3887 0.3291 -0.0042 0.0190  -0.0325 320 LYS B O   
2596 C  CB  . LYS B 174 ? 0.3724 0.3165 0.2913 -0.0171 0.0271  -0.0226 320 LYS B CB  
2597 C  CG  . LYS B 174 ? 0.3900 0.3327 0.3141 -0.0234 0.0337  -0.0313 320 LYS B CG  
2598 C  CD  . LYS B 174 ? 0.3890 0.3281 0.3155 -0.0286 0.0391  -0.0363 320 LYS B CD  
2599 C  CE  . LYS B 174 ? 0.4310 0.3526 0.3547 -0.0354 0.0484  -0.0385 320 LYS B CE  
2600 N  NZ  . LYS B 174 ? 0.4769 0.3921 0.4002 -0.0403 0.0545  -0.0412 320 LYS B NZ  
2601 N  N   . ARG B 175 ? 0.4409 0.4222 0.3693 -0.0105 0.0227  -0.0361 321 ARG B N   
2602 C  CA  . ARG B 175 ? 0.4181 0.4212 0.3544 -0.0090 0.0221  -0.0488 321 ARG B CA  
2603 C  C   . ARG B 175 ? 0.4597 0.4629 0.4036 -0.0168 0.0278  -0.0585 321 ARG B C   
2604 O  O   . ARG B 175 ? 0.3917 0.3819 0.3320 -0.0186 0.0297  -0.0536 321 ARG B O   
2605 C  CB  . ARG B 175 ? 0.3674 0.3849 0.2986 0.0013  0.0162  -0.0469 321 ARG B CB  
2606 C  CG  . ARG B 175 ? 0.3904 0.4037 0.3175 0.0022  0.0159  -0.0416 321 ARG B CG  
2607 C  CD  . ARG B 175 ? 0.4574 0.4862 0.3788 0.0124  0.0115  -0.0416 321 ARG B CD  
2608 N  NE  . ARG B 175 ? 0.5851 0.6246 0.5112 0.0115  0.0119  -0.0488 321 ARG B NE  
2609 C  CZ  . ARG B 175 ? 0.6078 0.6427 0.5287 0.0128  0.0120  -0.0424 321 ARG B CZ  
2610 N  NH1 . ARG B 175 ? 0.6472 0.6680 0.5588 0.0141  0.0123  -0.0295 321 ARG B NH1 
2611 N  NH2 . ARG B 175 ? 0.5623 0.6078 0.4880 0.0123  0.0125  -0.0503 321 ARG B NH2 
2612 N  N   . PRO B 176 ? 0.5150 0.5334 0.4696 -0.0214 0.0311  -0.0734 322 PRO B N   
2613 C  CA  . PRO B 176 ? 0.4919 0.5081 0.4542 -0.0310 0.0390  -0.0848 322 PRO B CA  
2614 C  C   . PRO B 176 ? 0.4721 0.4952 0.4345 -0.0280 0.0369  -0.0872 322 PRO B C   
2615 O  O   . PRO B 176 ? 0.4772 0.5200 0.4392 -0.0193 0.0296  -0.0881 322 PRO B O   
2616 C  CB  . PRO B 176 ? 0.5227 0.5628 0.4984 -0.0353 0.0414  -0.1026 322 PRO B CB  
2617 C  CG  . PRO B 176 ? 0.5651 0.6122 0.5384 -0.0290 0.0362  -0.0980 322 PRO B CG  
2618 C  CD  . PRO B 176 ? 0.5416 0.5813 0.5018 -0.0177 0.0280  -0.0815 322 PRO B CD  
2619 N  N   . TYR B 177 ? 0.4313 0.4369 0.3925 -0.0341 0.0435  -0.0881 323 TYR B N   
2620 C  CA  . TYR B 177 ? 0.4462 0.4601 0.4099 -0.0329 0.0430  -0.0943 323 TYR B CA  
2621 C  C   . TYR B 177 ? 0.4891 0.5261 0.4669 -0.0387 0.0463  -0.1150 323 TYR B C   
2622 O  O   . TYR B 177 ? 0.5140 0.5465 0.4990 -0.0494 0.0551  -0.1255 323 TYR B O   
2623 C  CB  . TYR B 177 ? 0.4420 0.4289 0.3989 -0.0363 0.0496  -0.0897 323 TYR B CB  
2624 C  CG  . TYR B 177 ? 0.4677 0.4609 0.4290 -0.0376 0.0520  -0.1001 323 TYR B CG  
2625 C  CD1 . TYR B 177 ? 0.4543 0.4717 0.4183 -0.0303 0.0441  -0.1027 323 TYR B CD1 
2626 C  CD2 . TYR B 177 ? 0.4957 0.4688 0.4567 -0.0457 0.0629  -0.1073 323 TYR B CD2 
2627 C  CE1 . TYR B 177 ? 0.4668 0.4913 0.4349 -0.0312 0.0460  -0.1130 323 TYR B CE1 
2628 C  CE2 . TYR B 177 ? 0.5116 0.4895 0.4765 -0.0471 0.0655  -0.1178 323 TYR B CE2 
2629 C  CZ  . TYR B 177 ? 0.4943 0.4994 0.4636 -0.0399 0.0564  -0.1210 323 TYR B CZ  
2630 O  OH  . TYR B 177 ? 0.4697 0.4808 0.4430 -0.0410 0.0587  -0.1320 323 TYR B OH  
2631 N  N   . VAL B 178 ? 0.4864 0.5494 0.4679 -0.0318 0.0396  -0.1218 324 VAL B N   
2632 C  CA  . VAL B 178 ? 0.6129 0.7027 0.6088 -0.0364 0.0416  -0.1438 324 VAL B CA  
2633 C  C   . VAL B 178 ? 0.6948 0.7971 0.6911 -0.0318 0.0385  -0.1494 324 VAL B C   
2634 O  O   . VAL B 178 ? 0.7253 0.8394 0.7139 -0.0193 0.0294  -0.1414 324 VAL B O   
2635 C  CB  . VAL B 178 ? 0.8276 0.9489 0.8302 -0.0304 0.0352  -0.1523 324 VAL B CB  
2636 C  CG1 . VAL B 178 ? 0.8207 0.9498 0.8104 -0.0135 0.0237  -0.1379 324 VAL B CG1 
2637 C  CG2 . VAL B 178 ? 0.8225 0.9780 0.8415 -0.0341 0.0361  -0.1777 324 VAL B CG2 
2638 N  N   . PRO B 179 ? 0.7300 0.8269 0.7339 -0.0421 0.0472  -0.1629 325 PRO B N   
2639 C  CA  . PRO B 179 ? 0.7740 0.8811 0.7789 -0.0390 0.0454  -0.1698 325 PRO B CA  
2640 C  C   . PRO B 179 ? 0.8142 0.9643 0.8292 -0.0331 0.0383  -0.1872 325 PRO B C   
2641 O  O   . PRO B 179 ? 0.8709 1.0345 0.8932 -0.0357 0.0401  -0.2024 325 PRO B O   
2642 C  CB  . PRO B 179 ? 0.7734 0.8587 0.7834 -0.0534 0.0590  -0.1809 325 PRO B CB  
2643 C  CG  . PRO B 179 ? 0.7530 0.8081 0.7584 -0.0614 0.0675  -0.1725 325 PRO B CG  
2644 C  CD  . PRO B 179 ? 0.7351 0.8097 0.7441 -0.0576 0.0608  -0.1704 325 PRO B CD  
2645 N  N   . LEU C 21  ? 1.2181 0.8298 1.0737 0.0367  -0.2816 -0.1937 167 LEU C N   
2646 C  CA  . LEU C 21  ? 1.3105 0.8801 1.1611 0.0239  -0.2995 -0.1846 167 LEU C CA  
2647 C  C   . LEU C 21  ? 1.3312 0.9008 1.1783 0.0298  -0.2950 -0.1814 167 LEU C C   
2648 O  O   . LEU C 21  ? 1.2979 0.8485 1.1395 0.0129  -0.2943 -0.1647 167 LEU C O   
2649 C  CB  . LEU C 21  ? 1.3758 0.9116 1.2282 0.0321  -0.3315 -0.1996 167 LEU C CB  
2650 C  CG  . LEU C 21  ? 1.4174 0.9053 1.2650 0.0191  -0.3550 -0.1907 167 LEU C CG  
2651 C  CD1 . LEU C 21  ? 1.4215 0.9007 1.2638 -0.0115 -0.3446 -0.1642 167 LEU C CD1 
2652 C  CD2 . LEU C 21  ? 1.4331 0.8870 1.2838 0.0240  -0.3871 -0.2040 167 LEU C CD2 
2653 N  N   . ASN C 22  ? 1.3464 0.9397 1.1968 0.0536  -0.2920 -0.1974 168 ASN C N   
2654 C  CA  . ASN C 22  ? 1.3042 0.9035 1.1526 0.0616  -0.2867 -0.1962 168 ASN C CA  
2655 C  C   . ASN C 22  ? 1.2440 0.8835 1.0930 0.0598  -0.2567 -0.1869 168 ASN C C   
2656 O  O   . ASN C 22  ? 1.2117 0.8589 1.0588 0.0619  -0.2480 -0.1816 168 ASN C O   
2657 C  CB  . ASN C 22  ? 1.3223 0.9256 1.1745 0.0890  -0.3028 -0.2198 168 ASN C CB  
2658 C  CG  . ASN C 22  ? 1.3333 0.9407 1.1840 0.0978  -0.3004 -0.2197 168 ASN C CG  
2659 O  OD1 . ASN C 22  ? 1.3541 0.9446 1.1996 0.0824  -0.2963 -0.2028 168 ASN C OD1 
2660 N  ND2 . ASN C 22  ? 1.3224 0.9545 1.1776 0.1227  -0.3031 -0.2391 168 ASN C ND2 
2661 N  N   . THR C 23  ? 1.2198 0.8840 1.0718 0.0559  -0.2420 -0.1848 169 THR C N   
2662 C  CA  . THR C 23  ? 1.1390 0.8404 0.9926 0.0541  -0.2153 -0.1761 169 THR C CA  
2663 C  C   . THR C 23  ? 1.1238 0.8155 0.9727 0.0350  -0.2036 -0.1559 169 THR C C   
2664 O  O   . THR C 23  ? 1.1082 0.8245 0.9578 0.0341  -0.1843 -0.1482 169 THR C O   
2665 C  CB  . THR C 23  ? 1.0745 0.7983 0.9320 0.0503  -0.2041 -0.1756 169 THR C CB  
2666 O  OG1 . THR C 23  ? 1.0315 0.7390 0.8866 0.0275  -0.2001 -0.1600 169 THR C OG1 
2667 C  CG2 . THR C 23  ? 1.0906 0.8143 0.9516 0.0645  -0.2202 -0.1946 169 THR C CG2 
2668 N  N   . LYS C 24  ? 1.1419 0.7980 0.9859 0.0194  -0.2163 -0.1473 170 LYS C N   
2669 C  CA  . LYS C 24  ? 1.1580 0.8041 0.9965 0.0003  -0.2072 -0.1286 170 LYS C CA  
2670 C  C   . LYS C 24  ? 1.1205 0.7657 0.9563 0.0075  -0.2058 -0.1275 170 LYS C C   
2671 O  O   . LYS C 24  ? 1.1103 0.7722 0.9451 0.0023  -0.1879 -0.1175 170 LYS C O   
2672 C  CB  . LYS C 24  ? 1.2564 0.8662 1.0900 -0.0185 -0.2236 -0.1196 170 LYS C CB  
2673 C  CG  . LYS C 24  ? 1.2959 0.9113 1.1276 -0.0412 -0.2101 -0.1030 170 LYS C CG  
2674 C  CD  . LYS C 24  ? 1.3667 0.9533 1.1960 -0.0578 -0.2279 -0.0976 170 LYS C CD  
2675 C  CE  . LYS C 24  ? 1.3839 0.9688 1.2190 -0.0473 -0.2402 -0.1124 170 LYS C CE  
2676 N  NZ  . LYS C 24  ? 1.4195 0.9779 1.2531 -0.0652 -0.2571 -0.1058 170 LYS C NZ  
2677 N  N   . ILE C 25  ? 1.1145 0.7398 0.9496 0.0198  -0.2257 -0.1385 171 ILE C N   
2678 C  CA  . ILE C 25  ? 1.0803 0.7044 0.9135 0.0284  -0.2267 -0.1393 171 ILE C CA  
2679 C  C   . ILE C 25  ? 1.0590 0.7241 0.8969 0.0418  -0.2073 -0.1436 171 ILE C C   
2680 O  O   . ILE C 25  ? 1.0392 0.7133 0.8753 0.0385  -0.1954 -0.1346 171 ILE C O   
2681 C  CB  . ILE C 25  ? 1.0621 0.6616 0.8957 0.0435  -0.2528 -0.1544 171 ILE C CB  
2682 C  CG1 . ILE C 25  ? 1.1051 0.6597 0.9319 0.0275  -0.2717 -0.1440 171 ILE C CG1 
2683 C  CG2 . ILE C 25  ? 1.0181 0.6348 0.8538 0.0619  -0.2504 -0.1631 171 ILE C CG2 
2684 C  CD1 . ILE C 25  ? 1.1170 0.6647 0.9376 0.0161  -0.2643 -0.1286 171 ILE C CD1 
2685 N  N   . ARG C 26  ? 1.0280 0.7185 0.8719 0.0562  -0.2050 -0.1568 172 ARG C N   
2686 C  CA  . ARG C 26  ? 1.0262 0.7582 0.8749 0.0685  -0.1883 -0.1605 172 ARG C CA  
2687 C  C   . ARG C 26  ? 0.9265 0.6739 0.7745 0.0536  -0.1658 -0.1429 172 ARG C C   
2688 O  O   . ARG C 26  ? 0.8708 0.6385 0.7201 0.0574  -0.1541 -0.1390 172 ARG C O   
2689 C  CB  . ARG C 26  ? 1.1212 0.8785 0.9755 0.0815  -0.1883 -0.1744 172 ARG C CB  
2690 C  CG  . ARG C 26  ? 1.2389 0.9769 1.0941 0.0941  -0.2123 -0.1925 172 ARG C CG  
2691 C  CD  . ARG C 26  ? 1.3173 1.0773 1.1770 0.1027  -0.2116 -0.2040 172 ARG C CD  
2692 N  NE  . ARG C 26  ? 1.3979 1.1297 1.2578 0.1070  -0.2350 -0.2170 172 ARG C NE  
2693 C  CZ  . ARG C 26  ? 1.4380 1.1796 1.3011 0.1125  -0.2389 -0.2274 172 ARG C CZ  
2694 N  NH1 . ARG C 26  ? 1.4137 1.1933 1.2797 0.1143  -0.2207 -0.2261 172 ARG C NH1 
2695 N  NH2 . ARG C 26  ? 1.4825 1.1949 1.3459 0.1160  -0.2622 -0.2391 172 ARG C NH2 
2696 N  N   . ALA C 27  ? 0.8925 0.6303 0.7388 0.0368  -0.1607 -0.1328 173 ALA C N   
2697 C  CA  . ALA C 27  ? 0.8449 0.5975 0.6914 0.0235  -0.1406 -0.1180 173 ALA C CA  
2698 C  C   . ALA C 27  ? 0.8336 0.5708 0.6746 0.0125  -0.1375 -0.1058 173 ALA C C   
2699 O  O   . ALA C 27  ? 0.7926 0.5471 0.6348 0.0095  -0.1222 -0.0977 173 ALA C O   
2700 C  CB  . ALA C 27  ? 0.8383 0.5872 0.6851 0.0099  -0.1372 -0.1125 173 ALA C CB  
2701 N  N   . LEU C 28  ? 0.8251 0.5296 0.6604 0.0062  -0.1531 -0.1043 174 LEU C N   
2702 C  CA  . LEU C 28  ? 0.8242 0.5135 0.6534 -0.0035 -0.1521 -0.0934 174 LEU C CA  
2703 C  C   . LEU C 28  ? 0.8071 0.5119 0.6385 0.0102  -0.1478 -0.0974 174 LEU C C   
2704 O  O   . LEU C 28  ? 0.7957 0.5137 0.6269 0.0055  -0.1335 -0.0886 174 LEU C O   
2705 C  CB  . LEU C 28  ? 0.8488 0.5000 0.6715 -0.0110 -0.1727 -0.0917 174 LEU C CB  
2706 C  CG  . LEU C 28  ? 0.8913 0.5247 0.7107 -0.0294 -0.1778 -0.0836 174 LEU C CG  
2707 C  CD1 . LEU C 28  ? 0.9626 0.5580 0.7769 -0.0337 -0.2024 -0.0840 174 LEU C CD1 
2708 C  CD2 . LEU C 28  ? 0.8408 0.4811 0.6564 -0.0485 -0.1620 -0.0676 174 LEU C CD2 
2709 N  N   . GLN C 29  ? 0.7885 0.4926 0.6222 0.0275  -0.1608 -0.1113 175 GLN C N   
2710 C  CA  . GLN C 29  ? 0.7891 0.5119 0.6256 0.0416  -0.1575 -0.1164 175 GLN C CA  
2711 C  C   . GLN C 29  ? 0.7324 0.4909 0.5739 0.0413  -0.1361 -0.1106 175 GLN C C   
2712 O  O   . GLN C 29  ? 0.7057 0.4757 0.5477 0.0421  -0.1279 -0.1053 175 GLN C O   
2713 C  CB  . GLN C 29  ? 0.8281 0.5572 0.6689 0.0627  -0.1718 -0.1353 175 GLN C CB  
2714 C  CG  . GLN C 29  ? 0.9077 0.5996 0.7446 0.0655  -0.1958 -0.1421 175 GLN C CG  
2715 C  CD  . GLN C 29  ? 0.9101 0.6062 0.7517 0.0859  -0.2117 -0.1629 175 GLN C CD  
2716 O  OE1 . GLN C 29  ? 0.8496 0.5703 0.6960 0.0933  -0.2061 -0.1709 175 GLN C OE1 
2717 N  NE2 . GLN C 29  ? 0.9237 0.5960 0.7642 0.0956  -0.2325 -0.1724 175 GLN C NE2 
2718 N  N   . GLY C 30  ? 0.7229 0.4974 0.5680 0.0397  -0.1283 -0.1112 176 GLY C N   
2719 C  CA  . GLY C 30  ? 0.7040 0.5111 0.5543 0.0395  -0.1102 -0.1057 176 GLY C CA  
2720 C  C   . GLY C 30  ? 0.7151 0.5198 0.5636 0.0240  -0.0970 -0.0903 176 GLY C C   
2721 O  O   . GLY C 30  ? 0.6815 0.5061 0.5333 0.0254  -0.0860 -0.0850 176 GLY C O   
2722 N  N   . SER C 31  ? 0.7237 0.5052 0.5672 0.0092  -0.0985 -0.0833 177 SER C N   
2723 C  CA  . SER C 31  ? 0.7194 0.4987 0.5606 -0.0050 -0.0872 -0.0704 177 SER C CA  
2724 C  C   . SER C 31  ? 0.7022 0.4733 0.5398 -0.0044 -0.0889 -0.0668 177 SER C C   
2725 O  O   . SER C 31  ? 0.7313 0.5150 0.5708 -0.0067 -0.0779 -0.0602 177 SER C O   
2726 C  CB  . SER C 31  ? 0.7833 0.5421 0.6194 -0.0209 -0.0900 -0.0645 177 SER C CB  
2727 O  OG  . SER C 31  ? 0.8431 0.6077 0.6826 -0.0209 -0.0907 -0.0689 177 SER C OG  
2728 N  N   . LEU C 32  ? 0.6906 0.4398 0.5235 -0.0011 -0.1039 -0.0714 178 LEU C N   
2729 C  CA  . LEU C 32  ? 0.6771 0.4167 0.5064 0.0005  -0.1078 -0.0690 178 LEU C CA  
2730 C  C   . LEU C 32  ? 0.6706 0.4374 0.5062 0.0131  -0.1005 -0.0722 178 LEU C C   
2731 O  O   . LEU C 32  ? 0.6775 0.4468 0.5121 0.0103  -0.0950 -0.0657 178 LEU C O   
2732 C  CB  . LEU C 32  ? 0.6595 0.3721 0.4841 0.0051  -0.1277 -0.0756 178 LEU C CB  
2733 C  CG  . LEU C 32  ? 0.6877 0.3903 0.5092 0.0100  -0.1348 -0.0756 178 LEU C CG  
2734 C  CD1 . LEU C 32  ? 0.6477 0.3431 0.4636 -0.0050 -0.1264 -0.0618 178 LEU C CD1 
2735 C  CD2 . LEU C 32  ? 0.7285 0.4016 0.5460 0.0144  -0.1567 -0.0825 178 LEU C CD2 
2736 N  N   . GLU C 33  ? 0.6677 0.4564 0.5096 0.0263  -0.1007 -0.0818 179 GLU C N   
2737 C  CA  . GLU C 33  ? 0.6840 0.5033 0.5323 0.0376  -0.0941 -0.0843 179 GLU C CA  
2738 C  C   . GLU C 33  ? 0.6201 0.4590 0.4723 0.0296  -0.0775 -0.0731 179 GLU C C   
2739 O  O   . GLU C 33  ? 0.5572 0.4104 0.4122 0.0313  -0.0719 -0.0687 179 GLU C O   
2740 C  CB  . GLU C 33  ? 0.7557 0.5970 0.6093 0.0535  -0.0989 -0.0977 179 GLU C CB  
2741 C  CG  . GLU C 33  ? 0.8946 0.7223 0.7464 0.0665  -0.1167 -0.1115 179 GLU C CG  
2742 C  CD  . GLU C 33  ? 0.9782 0.8241 0.8344 0.0814  -0.1230 -0.1265 179 GLU C CD  
2743 O  OE1 . GLU C 33  ? 0.9937 0.8649 0.8542 0.0813  -0.1127 -0.1253 179 GLU C OE1 
2744 O  OE2 . GLU C 33  ? 1.0119 0.8467 0.8675 0.0935  -0.1392 -0.1401 179 GLU C OE2 
2745 N  N   . ASN C 34  ? 0.6029 0.4423 0.4560 0.0211  -0.0706 -0.0689 180 ASN C N   
2746 C  CA  . ASN C 34  ? 0.6284 0.4825 0.4855 0.0133  -0.0568 -0.0589 180 ASN C CA  
2747 C  C   . ASN C 34  ? 0.5813 0.4187 0.4340 0.0019  -0.0533 -0.0497 180 ASN C C   
2748 O  O   . ASN C 34  ? 0.5611 0.4100 0.4173 -0.0005 -0.0452 -0.0429 180 ASN C O   
2749 C  CB  . ASN C 34  ? 0.7137 0.5721 0.5730 0.0080  -0.0516 -0.0579 180 ASN C CB  
2750 C  CG  . ASN C 34  ? 0.7981 0.6774 0.6622 0.0192  -0.0535 -0.0663 180 ASN C CG  
2751 O  OD1 . ASN C 34  ? 0.8745 0.7592 0.7387 0.0310  -0.0617 -0.0757 180 ASN C OD1 
2752 N  ND2 . ASN C 34  ? 0.7763 0.6686 0.6446 0.0161  -0.0464 -0.0638 180 ASN C ND2 
2753 N  N   . MET C 35  ? 0.5555 0.3661 0.4005 -0.0055 -0.0603 -0.0493 181 MET C N   
2754 C  CA  . MET C 35  ? 0.5254 0.3205 0.3648 -0.0157 -0.0588 -0.0416 181 MET C CA  
2755 C  C   . MET C 35  ? 0.4921 0.2913 0.3321 -0.0090 -0.0606 -0.0414 181 MET C C   
2756 O  O   . MET C 35  ? 0.4183 0.2214 0.2591 -0.0137 -0.0537 -0.0347 181 MET C O   
2757 C  CB  . MET C 35  ? 0.5673 0.3344 0.3976 -0.0242 -0.0686 -0.0411 181 MET C CB  
2758 C  CG  . MET C 35  ? 0.5872 0.3490 0.4149 -0.0380 -0.0636 -0.0358 181 MET C CG  
2759 S  SD  . MET C 35  ? 1.7508 1.4820 1.5668 -0.0517 -0.0748 -0.0310 181 MET C SD  
2760 C  CE  . MET C 35  ? 0.5711 0.2947 0.3821 -0.0519 -0.0759 -0.0263 181 MET C CE  
2761 N  N   . SER C 36  ? 0.5452 0.3446 0.3855 0.0027  -0.0704 -0.0496 182 SER C N   
2762 C  CA  . SER C 36  ? 0.5888 0.3943 0.4304 0.0103  -0.0732 -0.0507 182 SER C CA  
2763 C  C   . SER C 36  ? 0.5895 0.4238 0.4391 0.0128  -0.0621 -0.0462 182 SER C C   
2764 O  O   . SER C 36  ? 0.5819 0.4185 0.4319 0.0110  -0.0597 -0.0411 182 SER C O   
2765 C  CB  . SER C 36  ? 0.6412 0.4474 0.4835 0.0248  -0.0858 -0.0627 182 SER C CB  
2766 O  OG  . SER C 36  ? 0.6735 0.5002 0.5207 0.0349  -0.0853 -0.0652 182 SER C OG  
2767 N  N   . LYS C 37  ? 0.5781 0.4342 0.4340 0.0162  -0.0563 -0.0476 183 LYS C N   
2768 C  CA  . LYS C 37  ? 0.5729 0.4573 0.4369 0.0175  -0.0472 -0.0420 183 LYS C CA  
2769 C  C   . LYS C 37  ? 0.5230 0.4018 0.3877 0.0054  -0.0388 -0.0311 183 LYS C C   
2770 O  O   . LYS C 37  ? 0.5066 0.3977 0.3757 0.0046  -0.0349 -0.0250 183 LYS C O   
2771 C  CB  . LYS C 37  ? 0.6464 0.5541 0.5162 0.0227  -0.0438 -0.0451 183 LYS C CB  
2772 C  CG  . LYS C 37  ? 0.6971 0.6232 0.5690 0.0373  -0.0506 -0.0563 183 LYS C CG  
2773 C  CD  . LYS C 37  ? 0.7384 0.6943 0.6165 0.0414  -0.0452 -0.0569 183 LYS C CD  
2774 C  CE  . LYS C 37  ? 0.7776 0.7595 0.6584 0.0568  -0.0511 -0.0685 183 LYS C CE  
2775 N  NZ  . LYS C 37  ? 0.7800 0.7988 0.6673 0.0598  -0.0446 -0.0664 183 LYS C NZ  
2776 N  N   . LEU C 38  ? 0.5055 0.3669 0.3661 -0.0037 -0.0366 -0.0291 184 LEU C N   
2777 C  CA  . LEU C 38  ? 0.4996 0.3557 0.3607 -0.0140 -0.0295 -0.0212 184 LEU C CA  
2778 C  C   . LEU C 38  ? 0.4905 0.3314 0.3462 -0.0183 -0.0319 -0.0181 184 LEU C C   
2779 O  O   . LEU C 38  ? 0.4596 0.3045 0.3184 -0.0222 -0.0274 -0.0123 184 LEU C O   
2780 C  CB  . LEU C 38  ? 0.5349 0.3805 0.3933 -0.0220 -0.0266 -0.0213 184 LEU C CB  
2781 C  CG  . LEU C 38  ? 0.6510 0.5110 0.5148 -0.0183 -0.0242 -0.0241 184 LEU C CG  
2782 C  CD1 . LEU C 38  ? 0.6662 0.5146 0.5265 -0.0259 -0.0232 -0.0254 184 LEU C CD1 
2783 C  CD2 . LEU C 38  ? 0.6370 0.5188 0.5103 -0.0170 -0.0174 -0.0188 184 LEU C CD2 
2784 N  N   . LEU C 39  ? 0.4740 0.2969 0.3218 -0.0176 -0.0400 -0.0219 185 LEU C N   
2785 C  CA  . LEU C 39  ? 0.4789 0.2874 0.3209 -0.0213 -0.0434 -0.0190 185 LEU C CA  
2786 C  C   . LEU C 39  ? 0.4645 0.2885 0.3123 -0.0144 -0.0432 -0.0178 185 LEU C C   
2787 O  O   . LEU C 39  ? 0.5375 0.3587 0.3848 -0.0187 -0.0413 -0.0128 185 LEU C O   
2788 C  CB  . LEU C 39  ? 0.4839 0.2700 0.3167 -0.0213 -0.0543 -0.0229 185 LEU C CB  
2789 C  CG  . LEU C 39  ? 0.5532 0.3242 0.3794 -0.0245 -0.0593 -0.0198 185 LEU C CG  
2790 C  CD1 . LEU C 39  ? 0.5696 0.3373 0.3931 -0.0359 -0.0517 -0.0126 185 LEU C CD1 
2791 C  CD2 . LEU C 39  ? 0.5564 0.3029 0.3735 -0.0257 -0.0719 -0.0224 185 LEU C CD2 
2792 N  N   . LYS C 40  ? 0.4265 0.2693 0.2801 -0.0038 -0.0452 -0.0225 186 LYS C N   
2793 C  CA  . LYS C 40  ? 0.5046 0.3673 0.3643 0.0026  -0.0451 -0.0212 186 LYS C CA  
2794 C  C   . LYS C 40  ? 0.5229 0.4001 0.3898 -0.0036 -0.0364 -0.0121 186 LYS C C   
2795 O  O   . LYS C 40  ? 0.5012 0.3826 0.3705 -0.0052 -0.0360 -0.0072 186 LYS C O   
2796 C  CB  . LYS C 40  ? 0.5671 0.4521 0.4317 0.0153  -0.0486 -0.0289 186 LYS C CB  
2797 C  CG  . LYS C 40  ? 0.6737 0.5815 0.5439 0.0224  -0.0499 -0.0287 186 LYS C CG  
2798 C  CD  . LYS C 40  ? 0.7899 0.6790 0.6549 0.0209  -0.0553 -0.0280 186 LYS C CD  
2799 C  CE  . LYS C 40  ? 0.8459 0.7573 0.7175 0.0233  -0.0540 -0.0238 186 LYS C CE  
2800 N  NZ  . LYS C 40  ? 0.8668 0.7584 0.7335 0.0183  -0.0570 -0.0203 186 LYS C NZ  
2801 N  N   . ARG C 41  ? 0.5486 0.4322 0.4193 -0.0071 -0.0307 -0.0097 187 ARG C N   
2802 C  CA  . ARG C 41  ? 0.5681 0.4631 0.4463 -0.0127 -0.0245 -0.0012 187 ARG C CA  
2803 C  C   . ARG C 41  ? 0.5573 0.4331 0.4322 -0.0215 -0.0231 0.0029  187 ARG C C   
2804 O  O   . ARG C 41  ? 0.5363 0.4167 0.4154 -0.0240 -0.0227 0.0086  187 ARG C O   
2805 C  CB  . ARG C 41  ? 0.5233 0.4277 0.4061 -0.0138 -0.0199 -0.0003 187 ARG C CB  
2806 C  CG  . ARG C 41  ? 0.5805 0.4963 0.4721 -0.0189 -0.0157 0.0087  187 ARG C CG  
2807 C  CD  . ARG C 41  ? 0.6678 0.5921 0.5638 -0.0195 -0.0123 0.0094  187 ARG C CD  
2808 N  NE  . ARG C 41  ? 0.7569 0.6919 0.6621 -0.0239 -0.0104 0.0187  187 ARG C NE  
2809 C  CZ  . ARG C 41  ? 0.7714 0.7310 0.6839 -0.0223 -0.0108 0.0254  187 ARG C CZ  
2810 N  NH1 . ARG C 41  ? 0.7557 0.7350 0.6675 -0.0152 -0.0120 0.0224  187 ARG C NH1 
2811 N  NH2 . ARG C 41  ? 0.7673 0.7328 0.6881 -0.0278 -0.0108 0.0351  187 ARG C NH2 
2812 N  N   . GLN C 42  ? 0.5827 0.4388 0.4501 -0.0265 -0.0228 -0.0001 188 GLN C N   
2813 C  CA  . GLN C 42  ? 0.5533 0.3937 0.4164 -0.0345 -0.0215 0.0023  188 GLN C CA  
2814 C  C   . GLN C 42  ? 0.5062 0.3407 0.3661 -0.0341 -0.0256 0.0038  188 GLN C C   
2815 O  O   . GLN C 42  ? 0.5158 0.3485 0.3777 -0.0383 -0.0244 0.0077  188 GLN C O   
2816 C  CB  . GLN C 42  ? 0.5655 0.3891 0.4197 -0.0400 -0.0215 -0.0013 188 GLN C CB  
2817 C  CG  . GLN C 42  ? 0.6518 0.4813 0.5092 -0.0408 -0.0175 -0.0032 188 GLN C CG  
2818 C  CD  . GLN C 42  ? 0.6990 0.5149 0.5483 -0.0480 -0.0170 -0.0056 188 GLN C CD  
2819 O  OE1 . GLN C 42  ? 0.7169 0.5208 0.5588 -0.0542 -0.0181 -0.0046 188 GLN C OE1 
2820 N  NE2 . GLN C 42  ? 0.6786 0.4981 0.5291 -0.0480 -0.0156 -0.0083 188 GLN C NE2 
2821 N  N   . ASN C 43  ? 0.4939 0.3253 0.3493 -0.0285 -0.0315 0.0001  189 ASN C N   
2822 C  CA  . ASN C 43  ? 0.5356 0.3619 0.3881 -0.0271 -0.0363 0.0009  189 ASN C CA  
2823 C  C   . ASN C 43  ? 0.5182 0.3635 0.3803 -0.0250 -0.0348 0.0059  189 ASN C C   
2824 O  O   . ASN C 43  ? 0.5202 0.3606 0.3819 -0.0288 -0.0355 0.0095  189 ASN C O   
2825 C  CB  . ASN C 43  ? 0.6197 0.4410 0.4674 -0.0194 -0.0444 -0.0052 189 ASN C CB  
2826 C  CG  . ASN C 43  ? 0.7151 0.5306 0.5598 -0.0173 -0.0503 -0.0048 189 ASN C CG  
2827 O  OD1 . ASN C 43  ? 0.7145 0.5142 0.5528 -0.0245 -0.0510 -0.0017 189 ASN C OD1 
2828 N  ND2 . ASN C 43  ? 0.7663 0.5969 0.6158 -0.0073 -0.0546 -0.0083 189 ASN C ND2 
2829 N  N   . ASP C 44  ? 0.4537 0.3217 0.3242 -0.0197 -0.0330 0.0065  190 ASP C N   
2830 C  CA  . ASP C 44  ? 0.4777 0.3673 0.3578 -0.0189 -0.0322 0.0127  190 ASP C CA  
2831 C  C   . ASP C 44  ? 0.5086 0.3943 0.3934 -0.0277 -0.0289 0.0203  190 ASP C C   
2832 O  O   . ASP C 44  ? 0.4597 0.3501 0.3489 -0.0304 -0.0305 0.0257  190 ASP C O   
2833 C  CB  . ASP C 44  ? 0.5130 0.4302 0.4006 -0.0128 -0.0306 0.0128  190 ASP C CB  
2834 C  CG  . ASP C 44  ? 0.5955 0.5235 0.4810 -0.0019 -0.0354 0.0046  190 ASP C CG  
2835 O  OD1 . ASP C 44  ? 0.6631 0.5781 0.5430 0.0010  -0.0407 0.0003  190 ASP C OD1 
2836 O  OD2 . ASP C 44  ? 0.5665 0.5168 0.4564 0.0044  -0.0345 0.0019  190 ASP C OD2 
2837 N  N   . ILE C 45  ? 0.4809 0.3583 0.3653 -0.0318 -0.0252 0.0199  191 ILE C N   
2838 C  CA  . ILE C 45  ? 0.4238 0.2961 0.3131 -0.0387 -0.0234 0.0248  191 ILE C CA  
2839 C  C   . ILE C 45  ? 0.4038 0.2565 0.2865 -0.0432 -0.0250 0.0232  191 ILE C C   
2840 O  O   . ILE C 45  ? 0.4214 0.2724 0.3088 -0.0471 -0.0264 0.0273  191 ILE C O   
2841 C  CB  . ILE C 45  ? 0.3965 0.2656 0.2866 -0.0404 -0.0195 0.0227  191 ILE C CB  
2842 C  CG1 . ILE C 45  ? 0.4112 0.3001 0.3069 -0.0358 -0.0181 0.0240  191 ILE C CG1 
2843 C  CG2 . ILE C 45  ? 0.3790 0.2424 0.2750 -0.0459 -0.0191 0.0261  191 ILE C CG2 
2844 C  CD1 . ILE C 45  ? 0.4341 0.3216 0.3315 -0.0370 -0.0146 0.0221  191 ILE C CD1 
2845 N  N   . LEU C 46  ? 0.4365 0.2748 0.3082 -0.0430 -0.0256 0.0174  192 LEU C N   
2846 C  CA  . LEU C 46  ? 0.4847 0.3060 0.3484 -0.0476 -0.0272 0.0159  192 LEU C CA  
2847 C  C   . LEU C 46  ? 0.5164 0.3386 0.3808 -0.0469 -0.0315 0.0189  192 LEU C C   
2848 O  O   . LEU C 46  ? 0.5048 0.3191 0.3681 -0.0513 -0.0325 0.0201  192 LEU C O   
2849 C  CB  . LEU C 46  ? 0.4796 0.2867 0.3311 -0.0487 -0.0282 0.0110  192 LEU C CB  
2850 C  CG  . LEU C 46  ? 0.4984 0.2900 0.3402 -0.0549 -0.0296 0.0102  192 LEU C CG  
2851 C  CD1 . LEU C 46  ? 0.5318 0.3235 0.3766 -0.0599 -0.0256 0.0098  192 LEU C CD1 
2852 C  CD2 . LEU C 46  ? 0.5119 0.2905 0.3418 -0.0578 -0.0315 0.0075  192 LEU C CD2 
2853 N  N   . GLN C 47  ? 0.5369 0.3699 0.4032 -0.0408 -0.0345 0.0193  193 GLN C N   
2854 C  CA  . GLN C 47  ? 0.5776 0.4139 0.4451 -0.0394 -0.0388 0.0217  193 GLN C CA  
2855 C  C   . GLN C 47  ? 0.5057 0.3524 0.3839 -0.0434 -0.0384 0.0287  193 GLN C C   
2856 O  O   . GLN C 47  ? 0.4833 0.3268 0.3619 -0.0459 -0.0416 0.0312  193 GLN C O   
2857 C  CB  . GLN C 47  ? 0.6493 0.4999 0.5185 -0.0307 -0.0422 0.0195  193 GLN C CB  
2858 C  CG  . GLN C 47  ? 0.7783 0.6172 0.6382 -0.0259 -0.0451 0.0122  193 GLN C CG  
2859 C  CD  . GLN C 47  ? 0.8937 0.7099 0.7424 -0.0283 -0.0502 0.0101  193 GLN C CD  
2860 O  OE1 . GLN C 47  ? 0.9441 0.7538 0.7913 -0.0335 -0.0506 0.0134  193 GLN C OE1 
2861 N  NE2 . GLN C 47  ? 0.9362 0.7400 0.7770 -0.0250 -0.0551 0.0049  193 GLN C NE2 
2862 N  N   . VAL C 48  ? 0.4648 0.3232 0.3515 -0.0444 -0.0355 0.0323  194 VAL C N   
2863 C  CA  . VAL C 48  ? 0.4581 0.3257 0.3559 -0.0490 -0.0369 0.0403  194 VAL C CA  
2864 C  C   . VAL C 48  ? 0.4413 0.2912 0.3389 -0.0549 -0.0372 0.0395  194 VAL C C   
2865 O  O   . VAL C 48  ? 0.4327 0.2785 0.3342 -0.0588 -0.0412 0.0429  194 VAL C O   
2866 C  CB  . VAL C 48  ? 0.4446 0.3329 0.3519 -0.0482 -0.0350 0.0457  194 VAL C CB  
2867 C  CG1 . VAL C 48  ? 0.3168 0.2103 0.2354 -0.0548 -0.0381 0.0553  194 VAL C CG1 
2868 C  CG2 . VAL C 48  ? 0.3480 0.2594 0.2567 -0.0417 -0.0352 0.0459  194 VAL C CG2 
2869 N  N   . VAL C 49  ? 0.4016 0.2422 0.2952 -0.0551 -0.0336 0.0343  195 VAL C N   
2870 C  CA  . VAL C 49  ? 0.3994 0.2256 0.2920 -0.0590 -0.0338 0.0308  195 VAL C CA  
2871 C  C   . VAL C 49  ? 0.4322 0.2450 0.3158 -0.0609 -0.0359 0.0270  195 VAL C C   
2872 O  O   . VAL C 49  ? 0.4674 0.2721 0.3525 -0.0639 -0.0384 0.0254  195 VAL C O   
2873 C  CB  . VAL C 49  ? 0.4123 0.2344 0.3011 -0.0584 -0.0289 0.0248  195 VAL C CB  
2874 C  CG1 . VAL C 49  ? 0.4363 0.2455 0.3206 -0.0613 -0.0286 0.0183  195 VAL C CG1 
2875 C  CG2 . VAL C 49  ? 0.4339 0.2672 0.3334 -0.0575 -0.0281 0.0288  195 VAL C CG2 
2876 N  N   . SER C 50  ? 0.4403 0.2509 0.3146 -0.0589 -0.0358 0.0252  196 SER C N   
2877 C  CA  . SER C 50  ? 0.4499 0.2487 0.3148 -0.0608 -0.0384 0.0228  196 SER C CA  
2878 C  C   . SER C 50  ? 0.5043 0.3052 0.3753 -0.0623 -0.0434 0.0272  196 SER C C   
2879 O  O   . SER C 50  ? 0.5252 0.3163 0.3900 -0.0645 -0.0460 0.0251  196 SER C O   
2880 C  CB  . SER C 50  ? 0.3902 0.1858 0.2454 -0.0578 -0.0394 0.0211  196 SER C CB  
2881 O  OG  . SER C 50  ? 0.4338 0.2205 0.2796 -0.0595 -0.0367 0.0166  196 SER C OG  
2882 N  N   . GLN C 51  ? 0.4506 0.2655 0.3338 -0.0616 -0.0450 0.0338  197 GLN C N   
2883 C  CA  . GLN C 51  ? 0.4558 0.2751 0.3461 -0.0640 -0.0504 0.0394  197 GLN C CA  
2884 C  C   . GLN C 51  ? 0.4532 0.2704 0.3541 -0.0686 -0.0539 0.0429  197 GLN C C   
2885 O  O   . GLN C 51  ? 0.4417 0.2666 0.3524 -0.0716 -0.0590 0.0505  197 GLN C O   
2886 C  CB  . GLN C 51  ? 0.4492 0.2884 0.3452 -0.0609 -0.0515 0.0453  197 GLN C CB  
2887 C  CG  . GLN C 51  ? 0.4984 0.3370 0.3844 -0.0551 -0.0508 0.0402  197 GLN C CG  
2888 C  CD  . GLN C 51  ? 0.5611 0.4227 0.4532 -0.0500 -0.0518 0.0434  197 GLN C CD  
2889 O  OE1 . GLN C 51  ? 0.6130 0.4887 0.5133 -0.0517 -0.0550 0.0496  197 GLN C OE1 
2890 N  NE2 . GLN C 51  ? 0.5622 0.4290 0.4503 -0.0435 -0.0496 0.0388  197 GLN C NE2 
2891 N  N   . GLY C 52  ? 0.4645 0.2714 0.3639 -0.0691 -0.0520 0.0373  198 GLY C N   
2892 C  CA  . GLY C 52  ? 0.5015 0.3025 0.4103 -0.0721 -0.0570 0.0380  198 GLY C CA  
2893 C  C   . GLY C 52  ? 0.4874 0.2981 0.4084 -0.0729 -0.0582 0.0451  198 GLY C C   
2894 O  O   . GLY C 52  ? 0.4928 0.2990 0.4241 -0.0759 -0.0650 0.0483  198 GLY C O   
2895 N  N   . TRP C 53  ? 0.5431 0.2438 0.2790 -0.0348 0.0053  0.0034  199 TRP C N   
2896 C  CA  . TRP C 53  ? 0.5163 0.2320 0.2591 -0.0385 0.0060  -0.0017 199 TRP C CA  
2897 C  C   . TRP C 53  ? 0.5218 0.2390 0.2606 -0.0440 0.0115  -0.0082 199 TRP C C   
2898 O  O   . TRP C 53  ? 0.5019 0.2075 0.2343 -0.0451 0.0172  -0.0099 199 TRP C O   
2899 C  CB  . TRP C 53  ? 0.5392 0.2596 0.2915 -0.0380 0.0104  -0.0031 199 TRP C CB  
2900 C  CG  . TRP C 53  ? 0.5585 0.2832 0.3196 -0.0332 0.0042  0.0031  199 TRP C CG  
2901 C  CD1 . TRP C 53  ? 0.5961 0.3140 0.3590 -0.0281 -0.0008 0.0105  199 TRP C CD1 
2902 C  CD2 . TRP C 53  ? 0.5500 0.2871 0.3202 -0.0330 0.0023  0.0027  199 TRP C CD2 
2903 N  NE1 . TRP C 53  ? 0.6000 0.3259 0.3744 -0.0251 -0.0058 0.0146  199 TRP C NE1 
2904 C  CE2 . TRP C 53  ? 0.5796 0.3164 0.3584 -0.0278 -0.0032 0.0098  199 TRP C CE2 
2905 C  CE3 . TRP C 53  ? 0.4754 0.2236 0.2470 -0.0366 0.0047  -0.0025 199 TRP C CE3 
2906 C  CZ2 . TRP C 53  ? 0.5715 0.3178 0.3612 -0.0260 -0.0052 0.0113  199 TRP C CZ2 
2907 C  CZ3 . TRP C 53  ? 0.5135 0.2705 0.2937 -0.0345 0.0027  -0.0007 199 TRP C CZ3 
2908 C  CH2 . TRP C 53  ? 0.5364 0.2920 0.3260 -0.0292 -0.0016 0.0060  199 TRP C CH2 
2909 N  N   . LYS C 54  ? 0.5484 0.2800 0.2916 -0.0472 0.0099  -0.0113 200 LYS C N   
2910 C  CA  . LYS C 54  ? 0.5464 0.2829 0.2890 -0.0528 0.0141  -0.0170 200 LYS C CA  
2911 C  C   . LYS C 54  ? 0.5484 0.2936 0.2958 -0.0570 0.0185  -0.0231 200 LYS C C   
2912 O  O   . LYS C 54  ? 0.5618 0.3093 0.3125 -0.0552 0.0184  -0.0225 200 LYS C O   
2913 C  CB  . LYS C 54  ? 0.5803 0.3277 0.3247 -0.0536 0.0090  -0.0152 200 LYS C CB  
2914 C  CG  . LYS C 54  ? 0.6064 0.3454 0.3451 -0.0502 0.0046  -0.0095 200 LYS C CG  
2915 C  CD  . LYS C 54  ? 0.6218 0.3455 0.3518 -0.0512 0.0092  -0.0100 200 LYS C CD  
2916 C  CE  . LYS C 54  ? 0.7338 0.4498 0.4562 -0.0493 0.0055  -0.0053 200 LYS C CE  
2917 N  NZ  . LYS C 54  ? 0.7943 0.5061 0.5133 -0.0451 -0.0017 -0.0005 200 LYS C NZ  
2918 N  N   . TYR C 55  ? 0.5331 0.2827 0.2808 -0.0630 0.0226  -0.0291 201 TYR C N   
2919 C  CA  . TYR C 55  ? 0.4952 0.2531 0.2451 -0.0685 0.0262  -0.0359 201 TYR C CA  
2920 C  C   . TYR C 55  ? 0.4898 0.2625 0.2427 -0.0749 0.0245  -0.0400 201 TYR C C   
2921 O  O   . TYR C 55  ? 0.4919 0.2628 0.2460 -0.0769 0.0260  -0.0407 201 TYR C O   
2922 C  CB  . TYR C 55  ? 0.4549 0.1993 0.2023 -0.0708 0.0359  -0.0410 201 TYR C CB  
2923 C  CG  . TYR C 55  ? 0.4937 0.2455 0.2416 -0.0787 0.0405  -0.0497 201 TYR C CG  
2924 C  CD1 . TYR C 55  ? 0.5253 0.2799 0.2725 -0.0793 0.0420  -0.0515 201 TYR C CD1 
2925 C  CD2 . TYR C 55  ? 0.5041 0.2601 0.2529 -0.0860 0.0432  -0.0563 201 TYR C CD2 
2926 C  CE1 . TYR C 55  ? 0.5087 0.2689 0.2534 -0.0875 0.0461  -0.0601 201 TYR C CE1 
2927 C  CE2 . TYR C 55  ? 0.5396 0.3031 0.2877 -0.0943 0.0462  -0.0649 201 TYR C CE2 
2928 C  CZ  . TYR C 55  ? 0.5524 0.3176 0.2971 -0.0953 0.0476  -0.0670 201 TYR C CZ  
2929 O  OH  . TYR C 55  ? 0.5859 0.3571 0.3271 -0.1045 0.0506  -0.0761 201 TYR C OH  
2930 N  N   . PHE C 56  ? 0.4926 0.2798 0.2471 -0.0779 0.0217  -0.0424 202 PHE C N   
2931 C  CA  . PHE C 56  ? 0.5430 0.3465 0.3009 -0.0841 0.0189  -0.0455 202 PHE C CA  
2932 C  C   . PHE C 56  ? 0.5522 0.3670 0.3075 -0.0895 0.0182  -0.0508 202 PHE C C   
2933 O  O   . PHE C 56  ? 0.4617 0.2814 0.2152 -0.0862 0.0153  -0.0479 202 PHE C O   
2934 C  CB  . PHE C 56  ? 0.5692 0.3838 0.3323 -0.0804 0.0121  -0.0383 202 PHE C CB  
2935 C  CG  . PHE C 56  ? 0.5859 0.4188 0.3551 -0.0858 0.0088  -0.0394 202 PHE C CG  
2936 C  CD1 . PHE C 56  ? 0.5686 0.4014 0.3433 -0.0896 0.0111  -0.0411 202 PHE C CD1 
2937 C  CD2 . PHE C 56  ? 0.5620 0.4122 0.3321 -0.0868 0.0034  -0.0382 202 PHE C CD2 
2938 C  CE1 . PHE C 56  ? 0.5407 0.3920 0.3238 -0.0945 0.0075  -0.0412 202 PHE C CE1 
2939 C  CE2 . PHE C 56  ? 0.5613 0.4299 0.3377 -0.0914 -0.0007 -0.0380 202 PHE C CE2 
2940 C  CZ  . PHE C 56  ? 0.5318 0.4017 0.3157 -0.0954 0.0010  -0.0394 202 PHE C CZ  
2941 N  N   . LYS C 57  ? 0.6144 0.4326 0.3691 -0.0980 0.0213  -0.0589 203 LYS C N   
2942 C  CA  . LYS C 57  ? 0.6080 0.4369 0.3578 -0.1053 0.0204  -0.0653 203 LYS C CA  
2943 C  C   . LYS C 57  ? 0.5230 0.3462 0.2655 -0.1026 0.0229  -0.0653 203 LYS C C   
2944 O  O   . LYS C 57  ? 0.5365 0.3709 0.2766 -0.1013 0.0177  -0.0625 203 LYS C O   
2945 C  CB  . LYS C 57  ? 0.6918 0.5434 0.4459 -0.1078 0.0112  -0.0625 203 LYS C CB  
2946 C  CG  . LYS C 57  ? 0.7617 0.6207 0.5250 -0.1124 0.0099  -0.0637 203 LYS C CG  
2947 C  CD  . LYS C 57  ? 0.8101 0.6931 0.5798 -0.1148 0.0008  -0.0598 203 LYS C CD  
2948 C  CE  . LYS C 57  ? 0.8310 0.7205 0.6133 -0.1187 0.0003  -0.0598 203 LYS C CE  
2949 N  NZ  . LYS C 57  ? 0.8450 0.7588 0.6369 -0.1199 -0.0084 -0.0539 203 LYS C NZ  
2950 N  N   . GLY C 58  ? 0.4718 0.2767 0.2113 -0.1015 0.0317  -0.0681 204 GLY C N   
2951 C  CA  . GLY C 58  ? 0.4772 0.2745 0.2115 -0.0995 0.0364  -0.0686 204 GLY C CA  
2952 C  C   . GLY C 58  ? 0.4773 0.2701 0.2160 -0.0891 0.0341  -0.0591 204 GLY C C   
2953 O  O   . GLY C 58  ? 0.5201 0.3059 0.2569 -0.0867 0.0387  -0.0586 204 GLY C O   
2954 N  N   . ASN C 59  ? 0.4819 0.2782 0.2267 -0.0832 0.0276  -0.0518 205 ASN C N   
2955 C  CA  . ASN C 59  ? 0.4749 0.2683 0.2244 -0.0741 0.0243  -0.0433 205 ASN C CA  
2956 C  C   . ASN C 59  ? 0.4875 0.2703 0.2408 -0.0686 0.0233  -0.0379 205 ASN C C   
2957 O  O   . ASN C 59  ? 0.5186 0.3001 0.2715 -0.0704 0.0226  -0.0386 205 ASN C O   
2958 C  CB  . ASN C 59  ? 0.4410 0.2504 0.1929 -0.0717 0.0163  -0.0385 205 ASN C CB  
2959 C  CG  . ASN C 59  ? 0.5402 0.3577 0.2869 -0.0747 0.0172  -0.0415 205 ASN C CG  
2960 O  OD1 . ASN C 59  ? 0.5988 0.4094 0.3448 -0.0719 0.0213  -0.0408 205 ASN C OD1 
2961 N  ND2 . ASN C 59  ? 0.5061 0.3380 0.2493 -0.0804 0.0133  -0.0444 205 ASN C ND2 
2962 N  N   . PHE C 60  ? 0.4836 0.2585 0.2405 -0.0620 0.0233  -0.0323 206 PHE C N   
2963 C  CA  . PHE C 60  ? 0.5136 0.2796 0.2727 -0.0565 0.0203  -0.0261 206 PHE C CA  
2964 C  C   . PHE C 60  ? 0.4747 0.2488 0.2376 -0.0518 0.0116  -0.0196 206 PHE C C   
2965 O  O   . PHE C 60  ? 0.4826 0.2635 0.2499 -0.0495 0.0097  -0.0174 206 PHE C O   
2966 C  CB  . PHE C 60  ? 0.5556 0.3080 0.3175 -0.0523 0.0252  -0.0232 206 PHE C CB  
2967 C  CG  . PHE C 60  ? 0.5429 0.2841 0.3016 -0.0560 0.0355  -0.0288 206 PHE C CG  
2968 C  CD1 . PHE C 60  ? 0.5718 0.3063 0.3259 -0.0586 0.0381  -0.0314 206 PHE C CD1 
2969 C  CD2 . PHE C 60  ? 0.4946 0.2305 0.2551 -0.0570 0.0439  -0.0314 206 PHE C CD2 
2970 C  CE1 . PHE C 60  ? 0.5693 0.2928 0.3213 -0.0621 0.0488  -0.0368 206 PHE C CE1 
2971 C  CE2 . PHE C 60  ? 0.4918 0.2161 0.2495 -0.0607 0.0549  -0.0368 206 PHE C CE2 
2972 C  CZ  . PHE C 60  ? 0.5405 0.2591 0.2943 -0.0633 0.0573  -0.0396 206 PHE C CZ  
2973 N  N   . TYR C 61  ? 0.4553 0.2273 0.2164 -0.0507 0.0075  -0.0167 207 TYR C N   
2974 C  CA  . TYR C 61  ? 0.4724 0.2502 0.2362 -0.0472 0.0004  -0.0111 207 TYR C CA  
2975 C  C   . TYR C 61  ? 0.5226 0.2885 0.2844 -0.0431 -0.0032 -0.0060 207 TYR C C   
2976 O  O   . TYR C 61  ? 0.5437 0.2979 0.2991 -0.0438 -0.0009 -0.0065 207 TYR C O   
2977 C  CB  . TYR C 61  ? 0.4506 0.2375 0.2132 -0.0503 -0.0012 -0.0121 207 TYR C CB  
2978 C  CG  . TYR C 61  ? 0.5410 0.3418 0.3053 -0.0547 0.0004  -0.0163 207 TYR C CG  
2979 C  CD1 . TYR C 61  ? 0.5778 0.3927 0.3463 -0.0534 -0.0029 -0.0137 207 TYR C CD1 
2980 C  CD2