data_3LNX
# 
_entry.id   3LNX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3LNX         
RCSB  RCSB057511   
WWPDB D_1000057511 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
TargetDB GO.102606 . unspecified 
PDB      3LNY      . unspecified 
# 
_pdbx_database_status.entry_id                        3LNX 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-02-03 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, J.'                                        1 
'Chang, A.'                                        2 
'Ke, H.'                                           3 
'Phillips Jr., G.N.'                               4 
'Lee, A.L.'                                        5 
'Center for Eukaryotic Structural Genomics (CESG)' 6 
# 
_citation.id                        primary 
_citation.title                     
;Crystallographic and nuclear magnetic resonance evaluation of the impact of peptide binding to the second PDZ domain of protein tyrosine phosphatase 1E.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            49 
_citation.page_first                9280 
_citation.page_last                 9291 
_citation.year                      2010 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20839809 
_citation.pdbx_database_id_DOI      10.1021/bi101131f 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, J.'      1 
primary 'Sapienza, P.J.' 2 
primary 'Ke, H.'         3 
primary 'Chang, A.'      4 
primary 'Hengel, S.R.'   5 
primary 'Wang, H.'       6 
primary 'Phillips, G.N.' 7 
primary 'Lee, A.L.'      8 
# 
_cell.length_a           63.023 
_cell.length_b           95.148 
_cell.length_c           101.989 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3LNX 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              24 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         3LNX 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tyrosine-protein phosphatase non-receptor type 13' 10020.252 6   ? ? 'PDZ2 domain' ? 
2 non-polymer syn 'IODIDE ION'                                        126.904   25  ? ? ?             ? 
3 non-polymer syn 'THIOCYANATE ION'                                   58.082    14  ? ? ?             ? 
4 water       nat water                                               18.015    433 ? ? ?             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Protein-tyrosine phosphatase 1E, PTP-E1, hPTPE1, PTP-BAS, Protein-tyrosine phosphatase PTPL1, Fas-associated protein-tyrosine phosphatase 1, FAP-1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
TGQVVHLLLEKGQSPT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
TGQVVHLLLEKGQSPT
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         GO.102606 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  LYS n 
1 3  PRO n 
1 4  GLY n 
1 5  ASP n 
1 6  ILE n 
1 7  PHE n 
1 8  GLU n 
1 9  VAL n 
1 10 GLU n 
1 11 LEU n 
1 12 ALA n 
1 13 LYS n 
1 14 ASN n 
1 15 ASP n 
1 16 ASN n 
1 17 SER n 
1 18 LEU n 
1 19 GLY n 
1 20 ILE n 
1 21 SER n 
1 22 VAL n 
1 23 THR n 
1 24 GLY n 
1 25 GLY n 
1 26 VAL n 
1 27 ASN n 
1 28 THR n 
1 29 SER n 
1 30 VAL n 
1 31 ARG n 
1 32 HIS n 
1 33 GLY n 
1 34 GLY n 
1 35 ILE n 
1 36 TYR n 
1 37 VAL n 
1 38 LYS n 
1 39 ALA n 
1 40 VAL n 
1 41 ILE n 
1 42 PRO n 
1 43 GLN n 
1 44 GLY n 
1 45 ALA n 
1 46 ALA n 
1 47 GLU n 
1 48 SER n 
1 49 ASP n 
1 50 GLY n 
1 51 ARG n 
1 52 ILE n 
1 53 HIS n 
1 54 LYS n 
1 55 GLY n 
1 56 ASP n 
1 57 ARG n 
1 58 VAL n 
1 59 LEU n 
1 60 ALA n 
1 61 VAL n 
1 62 ASN n 
1 63 GLY n 
1 64 VAL n 
1 65 SER n 
1 66 LEU n 
1 67 GLU n 
1 68 GLY n 
1 69 ALA n 
1 70 THR n 
1 71 HIS n 
1 72 LYS n 
1 73 GLN n 
1 74 ALA n 
1 75 VAL n 
1 76 GLU n 
1 77 THR n 
1 78 LEU n 
1 79 ARG n 
1 80 ASN n 
1 81 THR n 
1 82 GLY n 
1 83 GLN n 
1 84 VAL n 
1 85 VAL n 
1 86 HIS n 
1 87 LEU n 
1 88 LEU n 
1 89 LEU n 
1 90 GLU n 
1 91 LYS n 
1 92 GLY n 
1 93 GLN n 
1 94 SER n 
1 95 PRO n 
1 96 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PTPN13, PNP1, PTP1E, PTPL1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   'NdeI BamHI restriction sites' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PTN13_HUMAN 
_struct_ref.pdbx_db_accession          Q12923 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
TGQVVHLLLEKGQSPT
;
_struct_ref.pdbx_align_begin           1361 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3LNX A 1 ? 96 ? Q12923 1361 ? 1456 ? 1 96 
2 1 3LNX B 1 ? 96 ? Q12923 1361 ? 1456 ? 1 96 
3 1 3LNX C 1 ? 96 ? Q12923 1361 ? 1456 ? 1 96 
4 1 3LNX D 1 ? 96 ? Q12923 1361 ? 1456 ? 1 96 
5 1 3LNX E 1 ? 96 ? Q12923 1361 ? 1456 ? 1 96 
6 1 3LNX F 1 ? 96 ? Q12923 1361 ? 1456 ? 1 96 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
IOD non-polymer         . 'IODIDE ION'      ? 'I -1'           126.904 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SCN non-polymer         . 'THIOCYANATE ION' ? 'C N S -1'       58.082  
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3LNX 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.63 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'28% PEG 3350, 0.2 M KI, 0.2 M NaSCN, 0.1 M NaAc, pH 4.5, hanging drop, temperature 298K, VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-01-01 
_diffrn_detector.details                ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.monochromator 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.pdbx_scattering_type 
1 'SINGLE WAVELENGTH' 'Si(111)' 1 ? x-ray 
2 'SINGLE WAVELENGTH' 'Si(111)' 1 ? x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0809 
_diffrn_radiation_wavelength.wt           1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_wavelength_list 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
1 SYNCHROTRON 'NSLS BEAMLINE X29A' 1.0809 ? NSLS X29A 
2 SYNCHROTRON 'NSLS BEAMLINE X29A' 1.0809 ? NSLS X29A 
# 
_reflns.entry_id                     3LNX 
_reflns.d_resolution_high            1.642 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   74902 
_reflns.pdbx_Rmerge_I_obs            0.114 
_reflns.pdbx_netI_over_sigmaI        12.800 
_reflns.pdbx_chi_squared             0.704 
_reflns.pdbx_redundancy              16.200 
_reflns.percent_possible_obs         98.600 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             1.65 
_reflns_shell.d_res_low              1.68 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.856 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.782 
_reflns_shell.pdbx_redundancy        10.80 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2764 
_reflns_shell.percent_possible_all   73.60 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 3LNX 
_refine.ls_d_res_high                            1.642 
_refine.ls_d_res_low                             39.643 
_refine.pdbx_ls_sigma_F                          0.06 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    92.330 
_refine.ls_number_reflns_obs                     69477 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.197 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.237 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 2.660 
_refine.ls_number_reflns_R_free                  3545 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               38.951 
_refine.solvent_model_param_bsol                 37.995 
_refine.solvent_model_param_ksol                 0.324 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            13.051 
_refine.aniso_B[2][2]                            -4.491 
_refine.aniso_B[3][3]                            -7.576 
_refine.aniso_B[1][2]                            -0.000 
_refine.aniso_B[1][3]                            -0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.200 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.110 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.900 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                144.03 
_refine.B_iso_min                                13.16 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.31 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1,2 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4140 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         67 
_refine_hist.number_atoms_solvent             433 
_refine_hist.number_atoms_total               4640 
_refine_hist.d_res_high                       1.642 
_refine_hist.d_res_low                        39.643 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           4246 0.008  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          5710 1.181  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     670  0.080  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      751  0.004  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 1546 15.242 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.642 1.665  25 63.000  3538 . 0.282 0.315 . 104 . 3642 . . 'X-RAY DIFFRACTION' 
1.665 1.689  25 78.000  4381 . 0.256 0.258 . 106 . 4487 . . 'X-RAY DIFFRACTION' 
1.689 1.714  25 82.000  4606 . 0.240 0.297 . 131 . 4737 . . 'X-RAY DIFFRACTION' 
1.714 1.741  25 85.000  4786 . 0.229 0.308 . 122 . 4908 . . 'X-RAY DIFFRACTION' 
1.741 1.769  25 86.000  4793 . 0.217 0.252 . 135 . 4928 . . 'X-RAY DIFFRACTION' 
1.769 1.800  25 88.000  5028 . 0.214 0.239 . 125 . 5153 . . 'X-RAY DIFFRACTION' 
1.800 1.832  25 89.000  5010 . 0.203 0.244 . 128 . 5138 . . 'X-RAY DIFFRACTION' 
1.832 1.868  25 90.000  5090 . 0.203 0.232 . 138 . 5228 . . 'X-RAY DIFFRACTION' 
1.868 1.906  25 91.000  5151 . 0.204 0.269 . 131 . 5282 . . 'X-RAY DIFFRACTION' 
1.906 1.947  25 95.000  5288 . 0.191 0.193 . 149 . 5437 . . 'X-RAY DIFFRACTION' 
1.947 1.992  25 94.000  5321 . 0.188 0.205 . 149 . 5470 . . 'X-RAY DIFFRACTION' 
1.992 2.042  25 96.000  5413 . 0.191 0.196 . 157 . 5570 . . 'X-RAY DIFFRACTION' 
2.042 2.098  25 97.000  5439 . 0.205 0.275 . 156 . 5595 . . 'X-RAY DIFFRACTION' 
2.098 2.159  25 98.000  5475 . 0.191 0.242 . 149 . 5624 . . 'X-RAY DIFFRACTION' 
2.159 2.229  25 97.000  5492 . 0.193 0.221 . 133 . 5625 . . 'X-RAY DIFFRACTION' 
2.229 2.309  25 98.000  5481 . 0.191 0.224 . 164 . 5645 . . 'X-RAY DIFFRACTION' 
2.309 2.401  25 97.000  5522 . 0.206 0.292 . 136 . 5658 . . 'X-RAY DIFFRACTION' 
2.401 2.510  25 95.000  5357 . 0.197 0.264 . 153 . 5510 . . 'X-RAY DIFFRACTION' 
2.510 2.643  25 96.000  5358 . 0.201 0.284 . 150 . 5508 . . 'X-RAY DIFFRACTION' 
2.643 2.808  25 97.000  5465 . 0.208 0.220 . 153 . 5618 . . 'X-RAY DIFFRACTION' 
2.808 3.025  25 98.000  5508 . 0.206 0.209 . 148 . 5656 . . 'X-RAY DIFFRACTION' 
3.025 3.329  25 99.000  5563 . 0.194 0.255 . 159 . 5722 . . 'X-RAY DIFFRACTION' 
3.329 3.811  25 99.000  5584 . 0.180 0.228 . 161 . 5745 . . 'X-RAY DIFFRACTION' 
3.811 4.800  25 100.000 5630 . 0.157 0.208 . 153 . 5783 . . 'X-RAY DIFFRACTION' 
4.800 39.654 25 99.000  5576 . 0.195 0.221 . 155 . 5731 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3LNX 
_struct.title                     'Second PDZ domain from human PTP1E' 
_struct.pdbx_descriptor           'Tyrosine-protein phosphatase non-receptor type 13' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LNX 
_struct_keywords.text            
;PDZ2, Structural Genomics, Protein Structure Initiative, PSI-2, Center for Eukaryotic Structural Genomics, CESG, Cytoskeleton, SIGNALING PROTEIN
;
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 2 ? 
FA N N 3 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 3 ? 
LA N N 3 ? 
MA N N 3 ? 
NA N N 3 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 3 ? 
RA N N 3 ? 
SA N N 3 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 4 ? 
WA N N 4 ? 
XA N N 4 ? 
YA N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 30 ? GLY A 33 ? VAL A 30 GLY A 33 5 ? 4  
HELX_P HELX_P2  2  GLY A 44 ? GLY A 50 ? GLY A 44 GLY A 50 1 ? 7  
HELX_P HELX_P3  3  THR A 70 ? ASN A 80 ? THR A 70 ASN A 80 1 ? 11 
HELX_P HELX_P4  4  GLY B 44 ? GLY B 50 ? GLY B 44 GLY B 50 1 ? 7  
HELX_P HELX_P5  5  THR B 70 ? ASN B 80 ? THR B 70 ASN B 80 1 ? 11 
HELX_P HELX_P6  6  GLY C 44 ? GLY C 50 ? GLY C 44 GLY C 50 1 ? 7  
HELX_P HELX_P7  7  THR C 70 ? ASN C 80 ? THR C 70 ASN C 80 1 ? 11 
HELX_P HELX_P8  8  VAL D 30 ? GLY D 33 ? VAL D 30 GLY D 33 5 ? 4  
HELX_P HELX_P9  9  GLY D 44 ? GLY D 50 ? GLY D 44 GLY D 50 1 ? 7  
HELX_P HELX_P10 10 THR D 70 ? ASN D 80 ? THR D 70 ASN D 80 1 ? 11 
HELX_P HELX_P11 11 VAL E 30 ? GLY E 33 ? VAL E 30 GLY E 33 5 ? 4  
HELX_P HELX_P12 12 GLY E 44 ? GLY E 50 ? GLY E 44 GLY E 50 1 ? 7  
HELX_P HELX_P13 13 THR E 70 ? ASN E 80 ? THR E 70 ASN E 80 1 ? 11 
HELX_P HELX_P14 14 VAL F 30 ? GLY F 33 ? VAL F 30 GLY F 33 5 ? 4  
HELX_P HELX_P15 15 GLY F 44 ? GLY F 50 ? GLY F 44 GLY F 50 1 ? 7  
HELX_P HELX_P16 16 THR F 70 ? ASN F 80 ? THR F 70 ASN F 80 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
E ? 5 ? 
F ? 4 ? 
G ? 4 ? 
H ? 2 ? 
I ? 4 ? 
J ? 2 ? 
K ? 4 ? 
L ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 6  ? ALA A 12 ? ILE A 6  ALA A 12 
A 2 VAL A 84 ? GLU A 90 ? VAL A 84 GLU A 90 
A 3 ARG A 57 ? VAL A 61 ? ARG A 57 VAL A 61 
A 4 VAL A 64 ? SER A 65 ? VAL A 64 SER A 65 
B 1 ILE A 20 ? GLY A 24 ? ILE A 20 GLY A 24 
B 2 ILE A 35 ? VAL A 40 ? ILE A 35 VAL A 40 
C 1 ILE B 6  ? ALA B 12 ? ILE B 6  ALA B 12 
C 2 VAL B 84 ? GLU B 90 ? VAL B 84 GLU B 90 
C 3 ARG B 57 ? VAL B 61 ? ARG B 57 VAL B 61 
C 4 VAL B 64 ? SER B 65 ? VAL B 64 SER B 65 
D 1 ILE B 20 ? GLY B 24 ? ILE B 20 GLY B 24 
D 2 ILE B 35 ? VAL B 40 ? ILE B 35 VAL B 40 
E 1 ILE C 6  ? ALA C 12 ? ILE C 6  ALA C 12 
E 2 VAL C 84 ? GLU C 90 ? VAL C 84 GLU C 90 
E 3 ARG C 57 ? VAL C 61 ? ARG C 57 VAL C 61 
E 4 ILE C 35 ? VAL C 40 ? ILE C 35 VAL C 40 
E 5 ILE C 20 ? GLY C 24 ? ILE C 20 GLY C 24 
F 1 ILE C 6  ? ALA C 12 ? ILE C 6  ALA C 12 
F 2 VAL C 84 ? GLU C 90 ? VAL C 84 GLU C 90 
F 3 ARG C 57 ? VAL C 61 ? ARG C 57 VAL C 61 
F 4 VAL C 64 ? SER C 65 ? VAL C 64 SER C 65 
G 1 ILE D 6  ? ALA D 12 ? ILE D 6  ALA D 12 
G 2 VAL D 84 ? GLU D 90 ? VAL D 84 GLU D 90 
G 3 ARG D 57 ? VAL D 61 ? ARG D 57 VAL D 61 
G 4 VAL D 64 ? SER D 65 ? VAL D 64 SER D 65 
H 1 ILE D 20 ? GLY D 24 ? ILE D 20 GLY D 24 
H 2 ILE D 35 ? VAL D 40 ? ILE D 35 VAL D 40 
I 1 ILE E 6  ? ALA E 12 ? ILE E 6  ALA E 12 
I 2 VAL E 84 ? GLU E 90 ? VAL E 84 GLU E 90 
I 3 ARG E 57 ? VAL E 61 ? ARG E 57 VAL E 61 
I 4 VAL E 64 ? SER E 65 ? VAL E 64 SER E 65 
J 1 ILE E 20 ? GLY E 24 ? ILE E 20 GLY E 24 
J 2 ILE E 35 ? VAL E 40 ? ILE E 35 VAL E 40 
K 1 ILE F 6  ? ALA F 12 ? ILE F 6  ALA F 12 
K 2 VAL F 84 ? GLU F 90 ? VAL F 84 GLU F 90 
K 3 ARG F 57 ? VAL F 61 ? ARG F 57 VAL F 61 
K 4 VAL F 64 ? SER F 65 ? VAL F 64 SER F 65 
L 1 ILE F 20 ? GLY F 24 ? ILE F 20 GLY F 24 
L 2 ILE F 35 ? VAL F 40 ? ILE F 35 VAL F 40 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 7  ? N PHE A 7  O LEU A 89 ? O LEU A 89 
A 2 3 O GLU A 90 ? O GLU A 90 N ARG A 57 ? N ARG A 57 
A 3 4 N VAL A 61 ? N VAL A 61 O VAL A 64 ? O VAL A 64 
B 1 2 N THR A 23 ? N THR A 23 O TYR A 36 ? O TYR A 36 
C 1 2 N PHE B 7  ? N PHE B 7  O LEU B 89 ? O LEU B 89 
C 2 3 O GLU B 90 ? O GLU B 90 N ARG B 57 ? N ARG B 57 
C 3 4 N VAL B 61 ? N VAL B 61 O VAL B 64 ? O VAL B 64 
D 1 2 N THR B 23 ? N THR B 23 O TYR B 36 ? O TYR B 36 
E 1 2 N PHE C 7  ? N PHE C 7  O LEU C 89 ? O LEU C 89 
E 2 3 O LEU C 88 ? O LEU C 88 N LEU C 59 ? N LEU C 59 
E 3 4 O VAL C 58 ? O VAL C 58 N ILE C 35 ? N ILE C 35 
E 4 5 O LYS C 38 ? O LYS C 38 N SER C 21 ? N SER C 21 
F 1 2 N PHE C 7  ? N PHE C 7  O LEU C 89 ? O LEU C 89 
F 2 3 O LEU C 88 ? O LEU C 88 N LEU C 59 ? N LEU C 59 
F 3 4 N VAL C 61 ? N VAL C 61 O VAL C 64 ? O VAL C 64 
G 1 2 N PHE D 7  ? N PHE D 7  O LEU D 89 ? O LEU D 89 
G 2 3 O LEU D 88 ? O LEU D 88 N LEU D 59 ? N LEU D 59 
G 3 4 N VAL D 61 ? N VAL D 61 O VAL D 64 ? O VAL D 64 
H 1 2 N THR D 23 ? N THR D 23 O TYR D 36 ? O TYR D 36 
I 1 2 N PHE E 7  ? N PHE E 7  O LEU E 89 ? O LEU E 89 
I 2 3 O LEU E 88 ? O LEU E 88 N LEU E 59 ? N LEU E 59 
I 3 4 N VAL E 61 ? N VAL E 61 O VAL E 64 ? O VAL E 64 
J 1 2 N SER E 21 ? N SER E 21 O LYS E 38 ? O LYS E 38 
K 1 2 N PHE F 7  ? N PHE F 7  O LEU F 89 ? O LEU F 89 
K 2 3 O LEU F 88 ? O LEU F 88 N LEU F 59 ? N LEU F 59 
K 3 4 N VAL F 61 ? N VAL F 61 O VAL F 64 ? O VAL F 64 
L 1 2 N SER F 21 ? N SER F 21 O LYS F 38 ? O LYS F 38 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD A 97'  
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD A 98'  
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD A 99'  
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD A 100' 
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD A 101' 
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD A 102' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SCN A 103' 
AC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD B 97'  
AC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD B 98'  
BC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD B 100' 
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SCN B 101' 
BC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SCN B 102' 
BC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SCN B 103' 
BC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD C 98'  
BC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD C 99'  
BC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD C 100' 
BC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SCN C 101' 
BC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SCN C 102' 
CC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD D 97'  
CC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD D 99'  
CC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD D 100' 
CC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD D 101' 
CC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SCN D 102' 
CC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD E 97'  
CC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD E 98'  
CC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD E 99'  
CC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SCN E 101' 
DC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SCN E 102' 
DC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SCN E 103' 
DC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SCN E 104' 
DC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD F 97'  
DC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD F 98'  
DC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SCN F 100' 
DC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SCN F 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1 LEU A  18 ? LEU A 18  . ? 1_555 ? 
2  AC2 1 GLN F  83 ? GLN F 83  . ? 1_555 ? 
3  AC3 2 ARG A  31 ? ARG A 31  . ? 1_555 ? 
4  AC3 2 HIS E  32 ? HIS E 32  . ? 2_454 ? 
5  AC4 1 ASP B  15 ? ASP B 15  . ? 3_545 ? 
6  AC5 2 ASN A  14 ? ASN A 14  . ? 1_555 ? 
7  AC5 2 SER A  48 ? SER A 48  . ? 1_555 ? 
8  AC6 1 LYS A  91 ? LYS A 91  . ? 1_555 ? 
9  AC7 6 ALA A  60 ? ALA A 60  . ? 1_555 ? 
10 AC7 6 ASN A  62 ? ASN A 62  . ? 1_555 ? 
11 AC7 6 GLY A  63 ? GLY A 63  . ? 1_555 ? 
12 AC7 6 HIS A  86 ? HIS A 86  . ? 1_555 ? 
13 AC7 6 LEU A  88 ? LEU A 88  . ? 1_555 ? 
14 AC7 6 HOH TA .  ? HOH A 165 . ? 1_555 ? 
15 AC8 1 LEU B  18 ? LEU B 18  . ? 1_555 ? 
16 AC9 1 GLN C  83 ? GLN C 83  . ? 1_555 ? 
17 BC1 1 LYS B  91 ? LYS B 91  . ? 1_555 ? 
18 BC2 6 ALA B  60 ? ALA B 60  . ? 1_555 ? 
19 BC2 6 ASN B  62 ? ASN B 62  . ? 1_555 ? 
20 BC2 6 GLY B  63 ? GLY B 63  . ? 1_555 ? 
21 BC2 6 HIS B  86 ? HIS B 86  . ? 1_555 ? 
22 BC2 6 LEU B  88 ? LEU B 88  . ? 1_555 ? 
23 BC2 6 HOH UA .  ? HOH B 221 . ? 1_555 ? 
24 BC3 7 ARG A  57 ? ARG A 57  . ? 1_555 ? 
25 BC3 7 LEU A  59 ? LEU A 59  . ? 1_555 ? 
26 BC3 7 ARG B  57 ? ARG B 57  . ? 1_555 ? 
27 BC3 7 SCN T  .  ? SCN B 103 . ? 1_555 ? 
28 BC3 7 HOH UA .  ? HOH B 116 . ? 1_555 ? 
29 BC3 7 HOH UA .  ? HOH B 224 . ? 1_555 ? 
30 BC3 7 HOH UA .  ? HOH B 270 . ? 1_555 ? 
31 BC4 6 ARG A  57 ? ARG A 57  . ? 1_555 ? 
32 BC4 6 GLU A  67 ? GLU A 67  . ? 1_555 ? 
33 BC4 6 HOH TA .  ? HOH A 168 . ? 1_555 ? 
34 BC4 6 ARG B  57 ? ARG B 57  . ? 1_555 ? 
35 BC4 6 LEU B  59 ? LEU B 59  . ? 1_555 ? 
36 BC4 6 SCN S  .  ? SCN B 102 . ? 1_555 ? 
37 BC5 1 VAL C  37 ? VAL C 37  . ? 1_555 ? 
38 BC6 2 ALA C  39 ? ALA C 39  . ? 1_555 ? 
39 BC6 2 VAL C  40 ? VAL C 40  . ? 1_555 ? 
40 BC7 1 LYS C  91 ? LYS C 91  . ? 1_555 ? 
41 BC8 7 ALA C  60 ? ALA C 60  . ? 1_555 ? 
42 BC8 7 ASN C  62 ? ASN C 62  . ? 1_555 ? 
43 BC8 7 GLY C  63 ? GLY C 63  . ? 1_555 ? 
44 BC8 7 HIS C  86 ? HIS C 86  . ? 1_555 ? 
45 BC8 7 LEU C  88 ? LEU C 88  . ? 1_555 ? 
46 BC8 7 HOH VA .  ? HOH C 477 . ? 1_555 ? 
47 BC8 7 HOH VA .  ? HOH C 493 . ? 1_555 ? 
48 BC9 5 SER C  21 ? SER C 21  . ? 1_555 ? 
49 BC9 5 VAL C  22 ? VAL C 22  . ? 1_555 ? 
50 BC9 5 HIS C  71 ? HIS C 71  . ? 1_555 ? 
51 BC9 5 HOH VA .  ? HOH C 111 . ? 1_555 ? 
52 BC9 5 ASP D  15 ? ASP D 15  . ? 4_456 ? 
53 CC1 1 LEU D  18 ? LEU D 18  . ? 1_555 ? 
54 CC2 2 ASN B  14 ? ASN B 14  . ? 1_555 ? 
55 CC2 2 SER B  48 ? SER B 48  . ? 1_555 ? 
56 CC3 1 LYS D  91 ? LYS D 91  . ? 1_555 ? 
57 CC4 1 HOH WA .  ? HOH D 148 . ? 1_555 ? 
58 CC5 5 ASN D  62 ? ASN D 62  . ? 1_555 ? 
59 CC5 5 GLY D  63 ? GLY D 63  . ? 1_555 ? 
60 CC5 5 HIS D  86 ? HIS D 86  . ? 1_555 ? 
61 CC5 5 LEU D  88 ? LEU D 88  . ? 1_555 ? 
62 CC5 5 HOH WA .  ? HOH D 137 . ? 1_555 ? 
63 CC6 2 HIS A  32 ? HIS A 32  . ? 2_455 ? 
64 CC6 2 ARG E  31 ? ARG E 31  . ? 1_555 ? 
65 CC7 1 LEU E  18 ? LEU E 18  . ? 1_555 ? 
66 CC8 2 ASN B  27 ? ASN B 27  . ? 2_455 ? 
67 CC8 2 THR E  23 ? THR E 23  . ? 1_555 ? 
68 CC9 4 ARG C  57 ? ARG C 57  . ? 1_555 ? 
69 CC9 4 ARG E  57 ? ARG E 57  . ? 1_555 ? 
70 CC9 4 LEU E  59 ? LEU E 59  . ? 1_555 ? 
71 CC9 4 HOH XA .  ? HOH E 271 . ? 1_555 ? 
72 DC1 5 ASN E  62 ? ASN E 62  . ? 1_555 ? 
73 DC1 5 GLY E  63 ? GLY E 63  . ? 1_555 ? 
74 DC1 5 HIS E  86 ? HIS E 86  . ? 1_555 ? 
75 DC1 5 LEU E  88 ? LEU E 88  . ? 1_555 ? 
76 DC1 5 HOH XA .  ? HOH E 578 . ? 1_555 ? 
77 DC2 2 ASN E  14 ? ASN E 14  . ? 1_555 ? 
78 DC2 2 SER E  48 ? SER E 48  . ? 1_555 ? 
79 DC3 5 LEU C  59 ? LEU C 59  . ? 1_555 ? 
80 DC3 5 ARG E  57 ? ARG E 57  . ? 1_555 ? 
81 DC3 5 GLU E  67 ? GLU E 67  . ? 1_555 ? 
82 DC3 5 HOH XA .  ? HOH E 110 . ? 1_555 ? 
83 DC3 5 HOH XA .  ? HOH E 368 . ? 1_555 ? 
84 DC4 1 LEU F  18 ? LEU F 18  . ? 1_555 ? 
85 DC5 1 LYS F  91 ? LYS F 91  . ? 1_555 ? 
86 DC6 5 ASN F  62 ? ASN F 62  . ? 1_555 ? 
87 DC6 5 GLY F  63 ? GLY F 63  . ? 1_555 ? 
88 DC6 5 HIS F  86 ? HIS F 86  . ? 1_555 ? 
89 DC6 5 LEU F  88 ? LEU F 88  . ? 1_555 ? 
90 DC6 5 HOH YA .  ? HOH F 114 . ? 1_555 ? 
91 DC7 2 GLN A  83 ? GLN A 83  . ? 1_555 ? 
92 DC7 2 ASN F  14 ? ASN F 14  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3LNX 
_atom_sites.fract_transf_matrix[1][1]   0.015867 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010510 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009805 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A  1 1  ? -15.254 -1.149  34.027 1.00 29.32  ? 1   PRO A N   1 
ATOM   2    C CA  . PRO A  1 1  ? -14.717 -0.066  33.192 1.00 26.44  ? 1   PRO A CA  1 
ATOM   3    C C   . PRO A  1 1  ? -15.704 0.272   32.100 1.00 26.36  ? 1   PRO A C   1 
ATOM   4    O O   . PRO A  1 1  ? -16.576 -0.557  31.817 1.00 30.31  ? 1   PRO A O   1 
ATOM   5    C CB  . PRO A  1 1  ? -13.459 -0.688  32.571 1.00 28.94  ? 1   PRO A CB  1 
ATOM   6    C CG  . PRO A  1 1  ? -13.127 -1.910  33.438 1.00 33.92  ? 1   PRO A CG  1 
ATOM   7    C CD  . PRO A  1 1  ? -14.187 -2.034  34.518 1.00 32.42  ? 1   PRO A CD  1 
ATOM   8    N N   . LYS A  1 2  ? -15.589 1.457   31.499 1.00 24.32  ? 2   LYS A N   1 
ATOM   9    C CA  . LYS A  1 2  ? -16.362 1.788   30.311 1.00 24.54  ? 2   LYS A CA  1 
ATOM   10   C C   . LYS A  1 2  ? -15.462 1.546   29.117 1.00 22.91  ? 2   LYS A C   1 
ATOM   11   O O   . LYS A  1 2  ? -14.248 1.508   29.274 1.00 23.37  ? 2   LYS A O   1 
ATOM   12   C CB  . LYS A  1 2  ? -16.757 3.265   30.297 1.00 30.70  ? 2   LYS A CB  1 
ATOM   13   C CG  . LYS A  1 2  ? -17.699 3.698   31.382 1.00 38.63  ? 2   LYS A CG  1 
ATOM   14   C CD  . LYS A  1 2  ? -18.020 5.184   31.234 1.00 44.36  ? 2   LYS A CD  1 
ATOM   15   C CE  . LYS A  1 2  ? -16.767 6.011   30.918 1.00 47.73  ? 2   LYS A CE  1 
ATOM   16   N NZ  . LYS A  1 2  ? -17.057 7.466   30.675 1.00 51.48  ? 2   LYS A NZ  1 
ATOM   17   N N   . PRO A  1 3  ? -16.041 1.391   27.914 1.00 25.01  ? 3   PRO A N   1 
ATOM   18   C CA  . PRO A  1 3  ? -15.177 1.247   26.726 1.00 25.38  ? 3   PRO A CA  1 
ATOM   19   C C   . PRO A  1 3  ? -14.124 2.354   26.641 1.00 24.21  ? 3   PRO A C   1 
ATOM   20   O O   . PRO A  1 3  ? -14.418 3.551   26.858 1.00 23.16  ? 3   PRO A O   1 
ATOM   21   C CB  . PRO A  1 3  ? -16.161 1.355   25.553 1.00 28.16  ? 3   PRO A CB  1 
ATOM   22   C CG  . PRO A  1 3  ? -17.468 0.883   26.143 1.00 28.89  ? 3   PRO A CG  1 
ATOM   23   C CD  . PRO A  1 3  ? -17.475 1.372   27.562 1.00 27.57  ? 3   PRO A CD  1 
ATOM   24   N N   . GLY A  1 4  ? -12.894 1.946   26.351 1.00 20.84  ? 4   GLY A N   1 
ATOM   25   C CA  . GLY A  1 4  ? -11.783 2.876   26.276 1.00 19.26  ? 4   GLY A CA  1 
ATOM   26   C C   . GLY A  1 4  ? -10.954 2.930   27.556 1.00 20.06  ? 4   GLY A C   1 
ATOM   27   O O   . GLY A  1 4  ? -9.792  3.353   27.518 1.00 21.83  ? 4   GLY A O   1 
ATOM   28   N N   . ASP A  1 5  ? -11.535 2.533   28.687 1.00 19.24  ? 5   ASP A N   1 
ATOM   29   C CA  . ASP A  1 5  ? -10.801 2.593   29.959 1.00 18.15  ? 5   ASP A CA  1 
ATOM   30   C C   . ASP A  1 5  ? -9.682  1.557   30.043 1.00 18.03  ? 5   ASP A C   1 
ATOM   31   O O   . ASP A  1 5  ? -9.823  0.430   29.590 1.00 20.49  ? 5   ASP A O   1 
ATOM   32   C CB  . ASP A  1 5  ? -11.722 2.334   31.152 1.00 18.92  ? 5   ASP A CB  1 
ATOM   33   C CG  . ASP A  1 5  ? -12.664 3.485   31.479 1.00 24.12  ? 5   ASP A CG  1 
ATOM   34   O OD1 . ASP A  1 5  ? -12.525 4.615   30.971 1.00 24.90  ? 5   ASP A OD1 1 
ATOM   35   O OD2 . ASP A  1 5  ? -13.561 3.229   32.326 1.00 26.57  ? 5   ASP A OD2 1 
ATOM   36   N N   . ILE A  1 6  ? -8.590  1.946   30.692 1.00 17.81  ? 6   ILE A N   1 
ATOM   37   C CA  . ILE A  1 6  ? -7.513  1.031   31.031 1.00 16.66  ? 6   ILE A CA  1 
ATOM   38   C C   . ILE A  1 6  ? -7.859  0.258   32.303 1.00 18.71  ? 6   ILE A C   1 
ATOM   39   O O   . ILE A  1 6  ? -8.378  0.844   33.265 1.00 20.41  ? 6   ILE A O   1 
ATOM   40   C CB  . ILE A  1 6  ? -6.214  1.844   31.304 1.00 17.52  ? 6   ILE A CB  1 
ATOM   41   C CG1 . ILE A  1 6  ? -5.784  2.656   30.066 1.00 16.75  ? 6   ILE A CG1 1 
ATOM   42   C CG2 . ILE A  1 6  ? -5.085  0.890   31.721 1.00 19.26  ? 6   ILE A CG2 1 
ATOM   43   C CD1 . ILE A  1 6  ? -5.509  1.770   28.820 1.00 20.15  ? 6   ILE A CD1 1 
ATOM   44   N N   . PHE A  1 7  ? -7.636  -1.060  32.287 1.00 19.27  ? 7   PHE A N   1 
ATOM   45   C CA  . PHE A  1 7  ? -7.709  -1.823  33.532 1.00 18.16  ? 7   PHE A CA  1 
ATOM   46   C C   . PHE A  1 7  ? -6.624  -2.891  33.539 1.00 18.81  ? 7   PHE A C   1 
ATOM   47   O O   . PHE A  1 7  ? -6.033  -3.202  32.488 1.00 20.00  ? 7   PHE A O   1 
ATOM   48   C CB  . PHE A  1 7  ? -9.114  -2.400  33.751 1.00 20.60  ? 7   PHE A CB  1 
ATOM   49   C CG  . PHE A  1 7  ? -9.532  -3.453  32.752 1.00 19.21  ? 7   PHE A CG  1 
ATOM   50   C CD1 . PHE A  1 7  ? -9.518  -4.795  33.114 1.00 22.14  ? 7   PHE A CD1 1 
ATOM   51   C CD2 . PHE A  1 7  ? -9.967  -3.117  31.462 1.00 21.35  ? 7   PHE A CD2 1 
ATOM   52   C CE1 . PHE A  1 7  ? -9.906  -5.794  32.211 1.00 24.08  ? 7   PHE A CE1 1 
ATOM   53   C CE2 . PHE A  1 7  ? -10.371 -4.126  30.562 1.00 22.60  ? 7   PHE A CE2 1 
ATOM   54   C CZ  . PHE A  1 7  ? -10.330 -5.468  30.954 1.00 21.86  ? 7   PHE A CZ  1 
ATOM   55   N N   . GLU A  1 8  ? -6.328  -3.413  34.730 1.00 20.01  ? 8   GLU A N   1 
ATOM   56   C CA  . GLU A  1 8  ? -5.337  -4.474  34.847 1.00 20.05  ? 8   GLU A CA  1 
ATOM   57   C C   . GLU A  1 8  ? -5.871  -5.599  35.701 1.00 19.10  ? 8   GLU A C   1 
ATOM   58   O O   . GLU A  1 8  ? -6.744  -5.408  36.564 1.00 23.79  ? 8   GLU A O   1 
ATOM   59   C CB  . GLU A  1 8  ? -3.991  -3.953  35.395 1.00 28.37  ? 8   GLU A CB  1 
ATOM   60   C CG  . GLU A  1 8  ? -4.041  -3.271  36.764 1.00 35.20  ? 8   GLU A CG  1 
ATOM   61   C CD  . GLU A  1 8  ? -2.739  -2.536  37.111 1.00 40.94  ? 8   GLU A CD  1 
ATOM   62   O OE1 . GLU A  1 8  ? -2.813  -1.423  37.684 1.00 46.16  ? 8   GLU A OE1 1 
ATOM   63   O OE2 . GLU A  1 8  ? -1.643  -3.054  36.814 1.00 39.29  ? 8   GLU A OE2 1 
ATOM   64   N N   . VAL A  1 9  ? -5.346  -6.779  35.440 1.00 19.09  ? 9   VAL A N   1 
ATOM   65   C CA  . VAL A  1 9  ? -5.751  -7.949  36.206 1.00 21.15  ? 9   VAL A CA  1 
ATOM   66   C C   . VAL A  1 9  ? -4.536  -8.804  36.489 1.00 24.38  ? 9   VAL A C   1 
ATOM   67   O O   . VAL A  1 9  ? -3.569  -8.813  35.724 1.00 26.62  ? 9   VAL A O   1 
ATOM   68   C CB  . VAL A  1 9  ? -6.741  -8.808  35.444 1.00 24.78  ? 9   VAL A CB  1 
ATOM   69   C CG1 . VAL A  1 9  ? -7.953  -8.002  35.015 1.00 25.30  ? 9   VAL A CG1 1 
ATOM   70   C CG2 . VAL A  1 9  ? -6.050  -9.449  34.261 1.00 24.82  ? 9   VAL A CG2 1 
ATOM   71   N N   . GLU A  1 10 ? -4.601  -9.525  37.601 1.00 22.69  ? 10  GLU A N   1 
ATOM   72   C CA  . GLU A  1 10 ? -3.686  -10.628 37.853 1.00 22.63  ? 10  GLU A CA  1 
ATOM   73   C C   . GLU A  1 10 ? -4.533  -11.883 37.730 1.00 26.25  ? 10  GLU A C   1 
ATOM   74   O O   . GLU A  1 10 ? -5.432  -12.115 38.556 1.00 29.31  ? 10  GLU A O   1 
ATOM   75   C CB  . GLU A  1 10 ? -3.072  -10.556 39.243 1.00 26.38  ? 10  GLU A CB  1 
ATOM   76   C CG  . GLU A  1 10 ? -2.137  -9.378  39.434 1.00 29.39  ? 10  GLU A CG  1 
ATOM   77   C CD  . GLU A  1 10 ? -0.744  -9.664  38.917 1.00 30.29  ? 10  GLU A CD  1 
ATOM   78   O OE1 . GLU A  1 10 ? -0.528  -10.763 38.375 1.00 34.25  ? 10  GLU A OE1 1 
ATOM   79   O OE2 . GLU A  1 10 ? 0.134   -8.782  39.065 1.00 37.14  ? 10  GLU A OE2 1 
ATOM   80   N N   . LEU A  1 11 ? -4.228  -12.690 36.722 1.00 26.49  ? 11  LEU A N   1 
ATOM   81   C CA  . LEU A  1 11 ? -5.070  -13.826 36.359 1.00 26.18  ? 11  LEU A CA  1 
ATOM   82   C C   . LEU A  1 11 ? -4.286  -15.108 36.579 1.00 27.78  ? 11  LEU A C   1 
ATOM   83   O O   . LEU A  1 11 ? -3.154  -15.258 36.082 1.00 28.93  ? 11  LEU A O   1 
ATOM   84   C CB  . LEU A  1 11 ? -5.499  -13.693 34.886 1.00 30.95  ? 11  LEU A CB  1 
ATOM   85   C CG  . LEU A  1 11 ? -6.539  -14.629 34.263 1.00 34.23  ? 11  LEU A CG  1 
ATOM   86   C CD1 . LEU A  1 11 ? -7.885  -14.462 34.948 1.00 38.21  ? 11  LEU A CD1 1 
ATOM   87   C CD2 . LEU A  1 11 ? -6.679  -14.376 32.758 1.00 32.91  ? 11  LEU A CD2 1 
ATOM   88   N N   . ALA A  1 12 ? -4.901  -16.043 37.312 1.00 27.42  ? 12  ALA A N   1 
ATOM   89   C CA  . ALA A  1 12 ? -4.313  -17.342 37.599 1.00 31.92  ? 12  ALA A CA  1 
ATOM   90   C C   . ALA A  1 12 ? -4.721  -18.309 36.494 1.00 34.54  ? 12  ALA A C   1 
ATOM   91   O O   . ALA A  1 12 ? -5.901  -18.419 36.175 1.00 35.99  ? 12  ALA A O   1 
ATOM   92   C CB  . ALA A  1 12 ? -4.801  -17.868 38.968 1.00 32.17  ? 12  ALA A CB  1 
ATOM   93   N N   . LYS A  1 13 ? -3.756  -19.002 35.904 1.00 33.05  ? 13  LYS A N   1 
ATOM   94   C CA  . LYS A  1 13 ? -4.096  -20.025 34.918 1.00 32.89  ? 13  LYS A CA  1 
ATOM   95   C C   . LYS A  1 13 ? -4.922  -21.195 35.481 1.00 35.89  ? 13  LYS A C   1 
ATOM   96   O O   . LYS A  1 13 ? -4.760  -21.614 36.637 1.00 37.96  ? 13  LYS A O   1 
ATOM   97   C CB  . LYS A  1 13 ? -2.837  -20.582 34.232 1.00 31.53  ? 13  LYS A CB  1 
ATOM   98   C CG  . LYS A  1 13 ? -2.065  -19.521 33.415 1.00 29.28  ? 13  LYS A CG  1 
ATOM   99   C CD  . LYS A  1 13 ? -0.760  -20.123 32.871 1.00 32.78  ? 13  LYS A CD  1 
ATOM   100  C CE  . LYS A  1 13 ? 0.045   -19.029 32.138 1.00 33.56  ? 13  LYS A CE  1 
ATOM   101  N NZ  . LYS A  1 13 ? 1.345   -19.551 31.650 1.00 35.30  ? 13  LYS A NZ  1 
ATOM   102  N N   . ASN A  1 14 ? -5.831  -21.694 34.651 1.00 33.02  ? 14  ASN A N   1 
ATOM   103  C CA  . ASN A  1 14 ? -6.490  -22.971 34.919 1.00 37.05  ? 14  ASN A CA  1 
ATOM   104  C C   . ASN A  1 14 ? -5.852  -23.978 34.008 1.00 40.68  ? 14  ASN A C   1 
ATOM   105  O O   . ASN A  1 14 ? -5.916  -23.828 32.786 1.00 40.80  ? 14  ASN A O   1 
ATOM   106  C CB  . ASN A  1 14 ? -7.978  -22.903 34.599 1.00 39.17  ? 14  ASN A CB  1 
ATOM   107  C CG  . ASN A  1 14 ? -8.755  -22.093 35.618 1.00 47.76  ? 14  ASN A CG  1 
ATOM   108  O OD1 . ASN A  1 14 ? -8.196  -21.623 36.614 1.00 52.74  ? 14  ASN A OD1 1 
ATOM   109  N ND2 . ASN A  1 14 ? -10.054 -21.923 35.375 1.00 48.12  ? 14  ASN A ND2 1 
ATOM   110  N N   . ASP A  1 15 ? -5.229  -24.993 34.595 1.00 41.87  ? 15  ASP A N   1 
ATOM   111  C CA  . ASP A  1 15 ? -4.580  -26.052 33.827 1.00 43.38  ? 15  ASP A CA  1 
ATOM   112  C C   . ASP A  1 15 ? -3.638  -25.492 32.769 1.00 43.52  ? 15  ASP A C   1 
ATOM   113  O O   . ASP A  1 15 ? -3.686  -25.879 31.591 1.00 46.15  ? 15  ASP A O   1 
ATOM   114  C CB  . ASP A  1 15 ? -5.619  -26.964 33.181 1.00 45.91  ? 15  ASP A CB  1 
ATOM   115  C CG  . ASP A  1 15 ? -6.374  -27.782 34.201 1.00 54.24  ? 15  ASP A CG  1 
ATOM   116  O OD1 . ASP A  1 15 ? -5.734  -28.308 35.139 1.00 57.98  ? 15  ASP A OD1 1 
ATOM   117  O OD2 . ASP A  1 15 ? -7.610  -27.892 34.071 1.00 59.12  ? 15  ASP A OD2 1 
ATOM   118  N N   . ASN A  1 16 ? -2.788  -24.573 33.204 1.00 39.67  ? 16  ASN A N   1 
ATOM   119  C CA  . ASN A  1 16 ? -1.770  -23.982 32.349 1.00 41.44  ? 16  ASN A CA  1 
ATOM   120  C C   . ASN A  1 16 ? -2.280  -23.125 31.182 1.00 36.00  ? 16  ASN A C   1 
ATOM   121  O O   . ASN A  1 16 ? -1.537  -22.856 30.248 1.00 39.53  ? 16  ASN A O   1 
ATOM   122  C CB  . ASN A  1 16 ? -0.814  -25.066 31.829 1.00 48.15  ? 16  ASN A CB  1 
ATOM   123  C CG  . ASN A  1 16 ? 0.616   -24.575 31.728 1.00 51.75  ? 16  ASN A CG  1 
ATOM   124  O OD1 . ASN A  1 16 ? 1.068   -23.778 32.552 1.00 50.85  ? 16  ASN A OD1 1 
ATOM   125  N ND2 . ASN A  1 16 ? 1.341   -25.055 30.725 1.00 54.30  ? 16  ASN A ND2 1 
ATOM   126  N N   . SER A  1 17 ? -3.515  -22.630 31.266 1.00 36.75  ? 17  SER A N   1 
ATOM   127  C CA  . SER A  1 17 ? -4.044  -21.725 30.240 1.00 32.55  ? 17  SER A CA  1 
ATOM   128  C C   . SER A  1 17 ? -4.827  -20.584 30.854 1.00 31.15  ? 17  SER A C   1 
ATOM   129  O O   . SER A  1 17 ? -5.562  -20.810 31.831 1.00 31.74  ? 17  SER A O   1 
ATOM   130  C CB  . SER A  1 17 ? -4.958  -22.512 29.290 1.00 36.45  ? 17  SER A CB  1 
ATOM   131  O OG  . SER A  1 17 ? -5.598  -21.615 28.391 1.00 35.79  ? 17  SER A OG  1 
ATOM   132  N N   . LEU A  1 18 ? -4.664  -19.376 30.307 1.00 28.41  ? 18  LEU A N   1 
ATOM   133  C CA  . LEU A  1 18 ? -5.391  -18.189 30.774 1.00 27.62  ? 18  LEU A CA  1 
ATOM   134  C C   . LEU A  1 18 ? -6.857  -18.205 30.337 1.00 29.19  ? 18  LEU A C   1 
ATOM   135  O O   . LEU A  1 18 ? -7.666  -17.457 30.875 1.00 27.60  ? 18  LEU A O   1 
ATOM   136  C CB  . LEU A  1 18 ? -4.715  -16.874 30.331 1.00 24.42  ? 18  LEU A CB  1 
ATOM   137  C CG  . LEU A  1 18 ? -3.338  -16.611 30.940 1.00 30.70  ? 18  LEU A CG  1 
ATOM   138  C CD1 . LEU A  1 18 ? -2.643  -15.505 30.174 1.00 29.13  ? 18  LEU A CD1 1 
ATOM   139  C CD2 . LEU A  1 18 ? -3.428  -16.303 32.442 1.00 28.44  ? 18  LEU A CD2 1 
ATOM   140  N N   . GLY A  1 19 ? -7.188  -19.039 29.354 1.00 32.64  ? 19  GLY A N   1 
ATOM   141  C CA  . GLY A  1 19 ? -8.560  -19.141 28.869 1.00 33.99  ? 19  GLY A CA  1 
ATOM   142  C C   . GLY A  1 19 ? -9.011  -17.964 28.022 1.00 33.76  ? 19  GLY A C   1 
ATOM   143  O O   . GLY A  1 19 ? -10.176 -17.548 28.039 1.00 32.07  ? 19  GLY A O   1 
ATOM   144  N N   . ILE A  1 20 ? -8.083  -17.410 27.259 1.00 32.81  ? 20  ILE A N   1 
ATOM   145  C CA  . ILE A  1 20 ? -8.468  -16.396 26.286 1.00 30.80  ? 20  ILE A CA  1 
ATOM   146  C C   . ILE A  1 20 ? -7.823  -16.717 24.947 1.00 32.67  ? 20  ILE A C   1 
ATOM   147  O O   . ILE A  1 20 ? -6.665  -17.136 24.886 1.00 36.15  ? 20  ILE A O   1 
ATOM   148  C CB  . ILE A  1 20 ? -8.079  -14.988 26.705 1.00 33.97  ? 20  ILE A CB  1 
ATOM   149  C CG1 . ILE A  1 20 ? -6.591  -14.772 26.552 1.00 36.84  ? 20  ILE A CG1 1 
ATOM   150  C CG2 . ILE A  1 20 ? -8.472  -14.705 28.147 1.00 32.08  ? 20  ILE A CG2 1 
ATOM   151  C CD1 . ILE A  1 20 ? -6.262  -13.315 26.371 1.00 37.13  ? 20  ILE A CD1 1 
ATOM   152  N N   . SER A  1 21 ? -8.597  -16.555 23.884 1.00 27.90  ? 21  SER A N   1 
ATOM   153  C CA  . SER A  1 21 ? -8.033  -16.635 22.540 1.00 26.65  ? 21  SER A CA  1 
ATOM   154  C C   . SER A  1 21 ? -7.938  -15.206 22.034 1.00 23.87  ? 21  SER A C   1 
ATOM   155  O O   . SER A  1 21 ? -8.716  -14.333 22.429 1.00 27.31  ? 21  SER A O   1 
ATOM   156  C CB  . SER A  1 21 ? -8.880  -17.497 21.597 1.00 34.49  ? 21  SER A CB  1 
ATOM   157  O OG  . SER A  1 21 ? -10.206 -17.010 21.496 1.00 35.34  ? 21  SER A OG  1 
ATOM   158  N N   . VAL A  1 22 ? -6.970  -14.945 21.175 1.00 25.03  ? 22  VAL A N   1 
ATOM   159  C CA  . VAL A  1 22 ? -6.818  -13.578 20.705 1.00 23.71  ? 22  VAL A CA  1 
ATOM   160  C C   . VAL A  1 22 ? -6.947  -13.480 19.201 1.00 21.76  ? 22  VAL A C   1 
ATOM   161  O O   . VAL A  1 22 ? -6.814  -14.469 18.468 1.00 22.18  ? 22  VAL A O   1 
ATOM   162  C CB  . VAL A  1 22 ? -5.478  -12.963 21.139 1.00 22.41  ? 22  VAL A CB  1 
ATOM   163  C CG1 . VAL A  1 22 ? -5.443  -12.765 22.678 1.00 25.53  ? 22  VAL A CG1 1 
ATOM   164  C CG2 . VAL A  1 22 ? -4.338  -13.847 20.663 1.00 26.69  ? 22  VAL A CG2 1 
ATOM   165  N N   . THR A  1 23 ? -7.244  -12.264 18.752 1.00 21.45  ? 23  THR A N   1 
ATOM   166  C CA  . THR A  1 23 ? -7.236  -11.947 17.334 1.00 21.80  ? 23  THR A CA  1 
ATOM   167  C C   . THR A  1 23 ? -6.376  -10.718 17.090 1.00 26.26  ? 23  THR A C   1 
ATOM   168  O O   . THR A  1 23 ? -6.251  -9.867  17.959 1.00 25.36  ? 23  THR A O   1 
ATOM   169  C CB  . THR A  1 23 ? -8.662  -11.679 16.837 1.00 29.77  ? 23  THR A CB  1 
ATOM   170  O OG1 . THR A  1 23 ? -8.635  -11.448 15.432 1.00 34.12  ? 23  THR A OG1 1 
ATOM   171  C CG2 . THR A  1 23 ? -9.276  -10.474 17.558 1.00 29.31  ? 23  THR A CG2 1 
ATOM   172  N N   . GLY A  1 24 ? -5.776  -10.633 15.911 1.00 25.13  ? 24  GLY A N   1 
ATOM   173  C CA  . GLY A  1 24 ? -5.002  -9.448  15.576 1.00 25.62  ? 24  GLY A CA  1 
ATOM   174  C C   . GLY A  1 24 ? -3.505  -9.681  15.540 1.00 23.97  ? 24  GLY A C   1 
ATOM   175  O O   . GLY A  1 24 ? -3.031  -10.823 15.506 1.00 25.00  ? 24  GLY A O   1 
ATOM   176  N N   . GLY A  1 25 ? -2.767  -8.574  15.502 1.00 24.32  ? 25  GLY A N   1 
ATOM   177  C CA  . GLY A  1 25 ? -1.329  -8.586  15.314 1.00 29.12  ? 25  GLY A CA  1 
ATOM   178  C C   . GLY A  1 25 ? -0.990  -7.752  14.089 1.00 29.36  ? 25  GLY A C   1 
ATOM   179  O O   . GLY A  1 25 ? -1.847  -7.515  13.222 1.00 29.59  ? 25  GLY A O   1 
ATOM   180  N N   . VAL A  1 26 ? 0.259   -7.318  13.985 1.00 28.64  ? 26  VAL A N   1 
ATOM   181  C CA  . VAL A  1 26 ? 0.645   -6.404  12.903 1.00 36.33  ? 26  VAL A CA  1 
ATOM   182  C C   . VAL A  1 26 ? 0.557   -7.032  11.514 1.00 41.33  ? 26  VAL A C   1 
ATOM   183  O O   . VAL A  1 26 ? 0.494   -6.334  10.511 1.00 48.50  ? 26  VAL A O   1 
ATOM   184  C CB  . VAL A  1 26 ? 2.065   -5.850  13.123 1.00 40.23  ? 26  VAL A CB  1 
ATOM   185  C CG1 . VAL A  1 26 ? 2.095   -4.989  14.367 1.00 41.03  ? 26  VAL A CG1 1 
ATOM   186  C CG2 . VAL A  1 26 ? 3.064   -6.982  13.240 1.00 41.53  ? 26  VAL A CG2 1 
ATOM   187  N N   . ASN A  1 27 ? 0.546   -8.358  11.479 1.00 39.33  ? 27  ASN A N   1 
ATOM   188  C CA  . ASN A  1 27 ? 0.505   -9.101  10.234 1.00 44.57  ? 27  ASN A CA  1 
ATOM   189  C C   . ASN A  1 27 ? -0.935  -9.338  9.788  1.00 45.64  ? 27  ASN A C   1 
ATOM   190  O O   . ASN A  1 27 ? -1.177  -9.993  8.777  1.00 50.35  ? 27  ASN A O   1 
ATOM   191  C CB  . ASN A  1 27 ? 1.218   -10.440 10.419 1.00 42.29  ? 27  ASN A CB  1 
ATOM   192  C CG  . ASN A  1 27 ? 0.587   -11.274 11.511 1.00 37.85  ? 27  ASN A CG  1 
ATOM   193  O OD1 . ASN A  1 27 ? 0.288   -10.766 12.591 1.00 27.68  ? 27  ASN A OD1 1 
ATOM   194  N ND2 . ASN A  1 27 ? 0.338   -12.553 11.217 1.00 42.69  ? 27  ASN A ND2 1 
ATOM   195  N N   . THR A  1 28 ? -1.884  -8.797  10.546 1.00 37.48  ? 28  THR A N   1 
ATOM   196  C CA  . THR A  1 28 ? -3.302  -8.909  10.226 1.00 35.51  ? 28  THR A CA  1 
ATOM   197  C C   . THR A  1 28 ? -3.870  -7.552  9.845  1.00 42.20  ? 28  THR A C   1 
ATOM   198  O O   . THR A  1 28 ? -3.171  -6.533  9.897  1.00 44.77  ? 28  THR A O   1 
ATOM   199  C CB  . THR A  1 28 ? -4.124  -9.439  11.440 1.00 29.55  ? 28  THR A CB  1 
ATOM   200  O OG1 . THR A  1 28 ? -4.379  -8.383  12.372 1.00 31.52  ? 28  THR A OG1 1 
ATOM   201  C CG2 . THR A  1 28 ? -3.413  -10.584 12.125 1.00 30.54  ? 28  THR A CG2 1 
ATOM   202  N N   . SER A  1 29 ? -5.144  -7.538  9.468  1.00 41.24  ? 29  SER A N   1 
ATOM   203  C CA  . SER A  1 29 ? -5.831  -6.284  9.194  1.00 46.68  ? 29  SER A CA  1 
ATOM   204  C C   . SER A  1 29 ? -6.822  -5.942  10.301 1.00 44.94  ? 29  SER A C   1 
ATOM   205  O O   . SER A  1 29 ? -7.729  -5.132  10.120 1.00 48.98  ? 29  SER A O   1 
ATOM   206  C CB  . SER A  1 29 ? -6.528  -6.317  7.832  1.00 52.36  ? 29  SER A CB  1 
ATOM   207  O OG  . SER A  1 29 ? -6.981  -5.020  7.497  1.00 62.09  ? 29  SER A OG  1 
ATOM   208  N N   . VAL A  1 30 ? -6.633  -6.558  11.463 1.00 40.15  ? 30  VAL A N   1 
ATOM   209  C CA  . VAL A  1 30 ? -7.370  -6.150  12.642 1.00 37.44  ? 30  VAL A CA  1 
ATOM   210  C C   . VAL A  1 30 ? -6.931  -4.719  12.999 1.00 48.22  ? 30  VAL A C   1 
ATOM   211  O O   . VAL A  1 30 ? -5.752  -4.367  12.874 1.00 50.51  ? 30  VAL A O   1 
ATOM   212  C CB  . VAL A  1 30 ? -7.144  -7.165  13.786 1.00 36.49  ? 30  VAL A CB  1 
ATOM   213  C CG1 . VAL A  1 30 ? -7.617  -6.607  15.121 1.00 40.85  ? 30  VAL A CG1 1 
ATOM   214  C CG2 . VAL A  1 30 ? -7.826  -8.483  13.428 1.00 36.90  ? 30  VAL A CG2 1 
ATOM   215  N N   . ARG A  1 31 ? -7.893  -3.888  13.393 1.00 50.14  ? 31  ARG A N   1 
ATOM   216  C CA  . ARG A  1 31 ? -7.658  -2.466  13.699 1.00 50.49  ? 31  ARG A CA  1 
ATOM   217  C C   . ARG A  1 31 ? -6.350  -2.165  14.466 1.00 46.50  ? 31  ARG A C   1 
ATOM   218  O O   . ARG A  1 31 ? -6.006  -2.860  15.417 1.00 44.84  ? 31  ARG A O   1 
ATOM   219  C CB  . ARG A  1 31 ? -8.846  -1.953  14.503 1.00 57.71  ? 31  ARG A CB  1 
ATOM   220  C CG  . ARG A  1 31 ? -9.507  -3.064  15.318 1.00 58.92  ? 31  ARG A CG  1 
ATOM   221  C CD  . ARG A  1 31 ? -10.901 -2.683  15.761 1.00 65.48  ? 31  ARG A CD  1 
ATOM   222  N NE  . ARG A  1 31 ? -10.859 -1.559  16.685 1.00 67.95  ? 31  ARG A NE  1 
ATOM   223  C CZ  . ARG A  1 31 ? -11.180 -0.310  16.363 1.00 76.49  ? 31  ARG A CZ  1 
ATOM   224  N NH1 . ARG A  1 31 ? -11.582 -0.020  15.129 1.00 77.43  ? 31  ARG A NH1 1 
ATOM   225  N NH2 . ARG A  1 31 ? -11.103 0.650   17.279 1.00 81.61  ? 31  ARG A NH2 1 
ATOM   226  N N   . HIS A  1 32 ? -5.620  -1.148  14.012 1.00 49.02  ? 32  HIS A N   1 
ATOM   227  C CA  . HIS A  1 32 ? -4.405  -0.682  14.668 1.00 49.80  ? 32  HIS A CA  1 
ATOM   228  C C   . HIS A  1 32 ? -3.347  -1.772  14.785 1.00 47.58  ? 32  HIS A C   1 
ATOM   229  O O   . HIS A  1 32 ? -2.268  -1.561  15.341 1.00 53.30  ? 32  HIS A O   1 
ATOM   230  C CB  . HIS A  1 32 ? -4.776  -0.039  16.016 1.00 51.87  ? 32  HIS A CB  1 
ATOM   231  C CG  . HIS A  1 32 ? -6.001  0.818   15.925 1.00 59.43  ? 32  HIS A CG  1 
ATOM   232  N ND1 . HIS A  1 32 ? -7.225  0.429   16.426 1.00 60.88  ? 32  HIS A ND1 1 
ATOM   233  C CD2 . HIS A  1 32 ? -6.212  2.000   15.304 1.00 65.29  ? 32  HIS A CD2 1 
ATOM   234  C CE1 . HIS A  1 32 ? -8.127  1.357   16.158 1.00 61.53  ? 32  HIS A CE1 1 
ATOM   235  N NE2 . HIS A  1 32 ? -7.540  2.315   15.467 1.00 68.61  ? 32  HIS A NE2 1 
ATOM   236  N N   . GLY A  1 33 ? -3.673  -2.939  14.238 1.00 38.93  ? 33  GLY A N   1 
ATOM   237  C CA  . GLY A  1 33 ? -2.823  -4.112  14.315 1.00 35.36  ? 33  GLY A CA  1 
ATOM   238  C C   . GLY A  1 33 ? -2.733  -4.686  15.719 1.00 29.54  ? 33  GLY A C   1 
ATOM   239  O O   . GLY A  1 33 ? -1.871  -5.518  15.962 1.00 29.68  ? 33  GLY A O   1 
ATOM   240  N N   . GLY A  1 34 ? -3.613  -4.237  16.619 1.00 27.09  ? 34  GLY A N   1 
ATOM   241  C CA  . GLY A  1 34 ? -3.574  -4.570  18.027 1.00 24.73  ? 34  GLY A CA  1 
ATOM   242  C C   . GLY A  1 34 ? -3.926  -6.030  18.266 1.00 22.89  ? 34  GLY A C   1 
ATOM   243  O O   . GLY A  1 34 ? -4.310  -6.749  17.339 1.00 24.71  ? 34  GLY A O   1 
ATOM   244  N N   . ILE A  1 35 ? -3.761  -6.450  19.516 1.00 22.57  ? 35  ILE A N   1 
ATOM   245  C CA  . ILE A  1 35 ? -4.071  -7.803  19.956 1.00 20.39  ? 35  ILE A CA  1 
ATOM   246  C C   . ILE A  1 35 ? -5.344  -7.702  20.770 1.00 21.61  ? 35  ILE A C   1 
ATOM   247  O O   . ILE A  1 35 ? -5.358  -7.045  21.813 1.00 23.87  ? 35  ILE A O   1 
ATOM   248  C CB  . ILE A  1 35 ? -2.962  -8.344  20.863 1.00 22.65  ? 35  ILE A CB  1 
ATOM   249  C CG1 . ILE A  1 35 ? -1.636  -8.370  20.093 1.00 23.81  ? 35  ILE A CG1 1 
ATOM   250  C CG2 . ILE A  1 35 ? -3.324  -9.740  21.405 1.00 21.81  ? 35  ILE A CG2 1 
ATOM   251  C CD1 . ILE A  1 35 ? -1.673  -9.178  18.789 1.00 27.83  ? 35  ILE A CD1 1 
ATOM   252  N N   . TYR A  1 36 ? -6.403  -8.377  20.319 1.00 21.87  ? 36  TYR A N   1 
ATOM   253  C CA  . TYR A  1 36 ? -7.700  -8.254  20.997 1.00 23.36  ? 36  TYR A CA  1 
ATOM   254  C C   . TYR A  1 36 ? -8.187  -9.599  21.481 1.00 22.64  ? 36  TYR A C   1 
ATOM   255  O O   . TYR A  1 36 ? -7.769  -10.621 20.971 1.00 24.23  ? 36  TYR A O   1 
ATOM   256  C CB  . TYR A  1 36 ? -8.749  -7.640  20.050 1.00 23.06  ? 36  TYR A CB  1 
ATOM   257  C CG  . TYR A  1 36 ? -8.428  -6.216  19.639 1.00 23.37  ? 36  TYR A CG  1 
ATOM   258  C CD1 . TYR A  1 36 ? -7.568  -5.965  18.579 1.00 27.25  ? 36  TYR A CD1 1 
ATOM   259  C CD2 . TYR A  1 36 ? -8.968  -5.136  20.326 1.00 26.54  ? 36  TYR A CD2 1 
ATOM   260  C CE1 . TYR A  1 36 ? -7.268  -4.672  18.194 1.00 28.55  ? 36  TYR A CE1 1 
ATOM   261  C CE2 . TYR A  1 36 ? -8.673  -3.818  19.935 1.00 27.29  ? 36  TYR A CE2 1 
ATOM   262  C CZ  . TYR A  1 36 ? -7.816  -3.613  18.887 1.00 29.32  ? 36  TYR A CZ  1 
ATOM   263  O OH  . TYR A  1 36 ? -7.515  -2.328  18.500 1.00 34.06  ? 36  TYR A OH  1 
ATOM   264  N N   . VAL A  1 37 ? -9.069  -9.603  22.481 1.00 19.05  ? 37  VAL A N   1 
ATOM   265  C CA  . VAL A  1 37 ? -9.651  -10.854 22.929 1.00 21.32  ? 37  VAL A CA  1 
ATOM   266  C C   . VAL A  1 37 ? -10.711 -11.306 21.927 1.00 23.26  ? 37  VAL A C   1 
ATOM   267  O O   . VAL A  1 37 ? -11.691 -10.605 21.665 1.00 26.29  ? 37  VAL A O   1 
ATOM   268  C CB  . VAL A  1 37 ? -10.257 -10.717 24.343 1.00 21.31  ? 37  VAL A CB  1 
ATOM   269  C CG1 . VAL A  1 37 ? -10.939 -12.012 24.767 1.00 24.04  ? 37  VAL A CG1 1 
ATOM   270  C CG2 . VAL A  1 37 ? -9.177  -10.312 25.348 1.00 22.40  ? 37  VAL A CG2 1 
ATOM   271  N N   . LYS A  1 38 ? -10.483 -12.470 21.335 1.00 22.86  ? 38  LYS A N   1 
ATOM   272  C CA  . LYS A  1 38 ? -11.438 -13.073 20.406 1.00 25.18  ? 38  LYS A CA  1 
ATOM   273  C C   . LYS A  1 38 ? -12.536 -13.822 21.138 1.00 30.50  ? 38  LYS A C   1 
ATOM   274  O O   . LYS A  1 38 ? -13.712 -13.747 20.776 1.00 30.04  ? 38  LYS A O   1 
ATOM   275  C CB  . LYS A  1 38 ? -10.680 -14.016 19.483 1.00 27.12  ? 38  LYS A CB  1 
ATOM   276  C CG  . LYS A  1 38 ? -11.523 -14.910 18.588 1.00 32.01  ? 38  LYS A CG  1 
ATOM   277  C CD  . LYS A  1 38 ? -10.570 -15.816 17.844 1.00 35.55  ? 38  LYS A CD  1 
ATOM   278  C CE  . LYS A  1 38 ? -11.243 -16.580 16.733 1.00 43.61  ? 38  LYS A CE  1 
ATOM   279  N NZ  . LYS A  1 38 ? -10.304 -17.630 16.221 1.00 49.85  ? 38  LYS A NZ  1 
ATOM   280  N N   . ALA A  1 39 ? -12.148 -14.530 22.189 1.00 31.17  ? 39  ALA A N   1 
ATOM   281  C CA  . ALA A  1 39 ? -13.102 -15.274 22.986 1.00 30.03  ? 39  ALA A CA  1 
ATOM   282  C C   . ALA A  1 39 ? -12.559 -15.479 24.383 1.00 31.20  ? 39  ALA A C   1 
ATOM   283  O O   . ALA A  1 39 ? -11.353 -15.652 24.572 1.00 29.74  ? 39  ALA A O   1 
ATOM   284  C CB  . ALA A  1 39 ? -13.389 -16.621 22.326 1.00 30.97  ? 39  ALA A CB  1 
ATOM   285  N N   . VAL A  1 40 ? -13.469 -15.445 25.354 1.00 31.06  ? 40  VAL A N   1 
ATOM   286  C CA  . VAL A  1 40 ? -13.197 -15.893 26.710 1.00 31.29  ? 40  VAL A CA  1 
ATOM   287  C C   . VAL A  1 40 ? -13.670 -17.340 26.755 1.00 34.46  ? 40  VAL A C   1 
ATOM   288  O O   . VAL A  1 40 ? -14.867 -17.610 26.656 1.00 34.90  ? 40  VAL A O   1 
ATOM   289  C CB  . VAL A  1 40 ? -13.955 -15.030 27.716 1.00 31.85  ? 40  VAL A CB  1 
ATOM   290  C CG1 . VAL A  1 40 ? -13.793 -15.575 29.101 1.00 35.26  ? 40  VAL A CG1 1 
ATOM   291  C CG2 . VAL A  1 40 ? -13.436 -13.576 27.640 1.00 30.68  ? 40  VAL A CG2 1 
ATOM   292  N N   . ILE A  1 41 ? -12.715 -18.268 26.843 1.00 29.37  ? 41  ILE A N   1 
ATOM   293  C CA  . ILE A  1 41 ? -12.994 -19.697 26.696 1.00 32.71  ? 41  ILE A CA  1 
ATOM   294  C C   . ILE A  1 41 ? -13.876 -20.212 27.823 1.00 33.47  ? 41  ILE A C   1 
ATOM   295  O O   . ILE A  1 41 ? -13.573 -20.012 29.014 1.00 33.59  ? 41  ILE A O   1 
ATOM   296  C CB  . ILE A  1 41 ? -11.693 -20.528 26.611 1.00 31.83  ? 41  ILE A CB  1 
ATOM   297  C CG1 . ILE A  1 41 ? -10.809 -19.996 25.476 1.00 34.99  ? 41  ILE A CG1 1 
ATOM   298  C CG2 . ILE A  1 41 ? -12.004 -22.003 26.445 1.00 33.77  ? 41  ILE A CG2 1 
ATOM   299  C CD1 . ILE A  1 41 ? -11.479 -20.041 24.106 1.00 36.38  ? 41  ILE A CD1 1 
ATOM   300  N N   . PRO A  1 42 ? -14.996 -20.843 27.455 1.00 34.30  ? 42  PRO A N   1 
ATOM   301  C CA  . PRO A  1 42 ? -15.875 -21.368 28.495 1.00 39.41  ? 42  PRO A CA  1 
ATOM   302  C C   . PRO A  1 42 ? -15.099 -22.213 29.500 1.00 42.98  ? 42  PRO A C   1 
ATOM   303  O O   . PRO A  1 42 ? -14.223 -22.999 29.111 1.00 39.86  ? 42  PRO A O   1 
ATOM   304  C CB  . PRO A  1 42 ? -16.867 -22.217 27.703 1.00 42.71  ? 42  PRO A CB  1 
ATOM   305  C CG  . PRO A  1 42 ? -16.967 -21.488 26.389 1.00 40.77  ? 42  PRO A CG  1 
ATOM   306  C CD  . PRO A  1 42 ? -15.608 -20.918 26.118 1.00 37.15  ? 42  PRO A CD  1 
ATOM   307  N N   . GLN A  1 43 ? -15.416 -22.012 30.777 1.00 43.32  ? 43  GLN A N   1 
ATOM   308  C CA  . GLN A  1 43 ? -14.839 -22.756 31.889 1.00 45.37  ? 43  GLN A CA  1 
ATOM   309  C C   . GLN A  1 43 ? -13.380 -22.447 32.176 1.00 43.02  ? 43  GLN A C   1 
ATOM   310  O O   . GLN A  1 43 ? -12.759 -23.098 33.025 1.00 42.52  ? 43  GLN A O   1 
ATOM   311  C CB  . GLN A  1 43 ? -15.034 -24.258 31.700 1.00 52.35  ? 43  GLN A CB  1 
ATOM   312  C CG  . GLN A  1 43 ? -16.471 -24.684 31.860 1.00 59.17  ? 43  GLN A CG  1 
ATOM   313  C CD  . GLN A  1 43 ? -16.596 -26.163 32.128 1.00 67.43  ? 43  GLN A CD  1 
ATOM   314  O OE1 . GLN A  1 43 ? -16.090 -26.987 31.364 1.00 70.67  ? 43  GLN A OE1 1 
ATOM   315  N NE2 . GLN A  1 43 ? -17.268 -26.512 33.222 1.00 71.85  ? 43  GLN A NE2 1 
ATOM   316  N N   . GLY A  1 44 ? -12.842 -21.453 31.478 1.00 35.77  ? 44  GLY A N   1 
ATOM   317  C CA  . GLY A  1 44 ? -11.446 -21.098 31.621 1.00 33.39  ? 44  GLY A CA  1 
ATOM   318  C C   . GLY A  1 44 ? -11.226 -20.023 32.664 1.00 33.85  ? 44  GLY A C   1 
ATOM   319  O O   . GLY A  1 44 ? -12.176 -19.522 33.282 1.00 31.83  ? 44  GLY A O   1 
ATOM   320  N N   . ALA A  1 45 ? -9.966  -19.657 32.860 1.00 30.43  ? 45  ALA A N   1 
ATOM   321  C CA  . ALA A  1 45 ? -9.618  -18.726 33.930 1.00 31.92  ? 45  ALA A CA  1 
ATOM   322  C C   . ALA A  1 45 ? -10.199 -17.331 33.727 1.00 32.06  ? 45  ALA A C   1 
ATOM   323  O O   . ALA A  1 45 ? -10.732 -16.747 34.665 1.00 31.01  ? 45  ALA A O   1 
ATOM   324  C CB  . ALA A  1 45 ? -8.107  -18.661 34.128 1.00 32.86  ? 45  ALA A CB  1 
ATOM   325  N N   . ALA A  1 46 ? -10.097 -16.789 32.513 1.00 27.84  ? 46  ALA A N   1 
ATOM   326  C CA  . ALA A  1 46 ? -10.613 -15.444 32.270 1.00 27.83  ? 46  ALA A CA  1 
ATOM   327  C C   . ALA A  1 46 ? -12.122 -15.374 32.481 1.00 27.02  ? 46  ALA A C   1 
ATOM   328  O O   . ALA A  1 46 ? -12.637 -14.374 32.990 1.00 28.52  ? 46  ALA A O   1 
ATOM   329  C CB  . ALA A  1 46 ? -10.230 -14.949 30.879 1.00 29.17  ? 46  ALA A CB  1 
ATOM   330  N N   . GLU A  1 47 ? -12.834 -16.429 32.091 1.00 29.61  ? 47  GLU A N   1 
ATOM   331  C CA  . GLU A  1 47 ? -14.276 -16.421 32.263 1.00 32.32  ? 47  GLU A CA  1 
ATOM   332  C C   . GLU A  1 47 ? -14.663 -16.414 33.735 1.00 32.27  ? 47  GLU A C   1 
ATOM   333  O O   . GLU A  1 47 ? -15.543 -15.650 34.158 1.00 34.54  ? 47  GLU A O   1 
ATOM   334  C CB  . GLU A  1 47 ? -14.919 -17.618 31.577 1.00 35.22  ? 47  GLU A CB  1 
ATOM   335  C CG  . GLU A  1 47 ? -16.412 -17.638 31.737 1.00 40.48  ? 47  GLU A CG  1 
ATOM   336  C CD  . GLU A  1 47 ? -17.020 -18.934 31.286 1.00 45.82  ? 47  GLU A CD  1 
ATOM   337  O OE1 . GLU A  1 47 ? -16.797 -19.966 31.968 1.00 48.60  ? 47  GLU A OE1 1 
ATOM   338  O OE2 . GLU A  1 47 ? -17.725 -18.915 30.253 1.00 45.78  ? 47  GLU A OE2 1 
ATOM   339  N N   . SER A  1 48 ? -13.999 -17.259 34.516 1.00 31.52  ? 48  SER A N   1 
ATOM   340  C CA  . SER A  1 48 ? -14.302 -17.399 35.944 1.00 33.00  ? 48  SER A CA  1 
ATOM   341  C C   . SER A  1 48 ? -14.065 -16.075 36.655 1.00 31.92  ? 48  SER A C   1 
ATOM   342  O O   . SER A  1 48 ? -14.837 -15.690 37.530 1.00 33.77  ? 48  SER A O   1 
ATOM   343  C CB  . SER A  1 48 ? -13.417 -18.475 36.559 1.00 36.62  ? 48  SER A CB  1 
ATOM   344  O OG  . SER A  1 48 ? -13.836 -19.775 36.146 1.00 43.88  ? 48  SER A OG  1 
ATOM   345  N N   . ASP A  1 49 ? -12.981 -15.407 36.278 1.00 28.10  ? 49  ASP A N   1 
ATOM   346  C CA  . ASP A  1 49 ? -12.615 -14.105 36.846 1.00 27.47  ? 49  ASP A CA  1 
ATOM   347  C C   . ASP A  1 49 ? -13.634 -12.998 36.538 1.00 28.80  ? 49  ASP A C   1 
ATOM   348  O O   . ASP A  1 49 ? -13.961 -12.180 37.415 1.00 32.77  ? 49  ASP A O   1 
ATOM   349  C CB  . ASP A  1 49 ? -11.223 -13.722 36.374 1.00 27.19  ? 49  ASP A CB  1 
ATOM   350  C CG  . ASP A  1 49 ? -10.827 -12.337 36.821 1.00 25.22  ? 49  ASP A CG  1 
ATOM   351  O OD1 . ASP A  1 49 ? -10.930 -11.411 35.996 1.00 27.05  ? 49  ASP A OD1 1 
ATOM   352  O OD2 . ASP A  1 49 ? -10.414 -12.186 37.991 1.00 29.90  ? 49  ASP A OD2 1 
ATOM   353  N N   . GLY A  1 50 ? -14.121 -12.952 35.302 1.00 26.67  ? 50  GLY A N   1 
ATOM   354  C CA  . GLY A  1 50 ? -15.233 -12.088 34.949 1.00 30.90  ? 50  GLY A CA  1 
ATOM   355  C C   . GLY A  1 50 ? -14.906 -10.687 34.471 1.00 29.96  ? 50  GLY A C   1 
ATOM   356  O O   . GLY A  1 50 ? -15.818 -9.933  34.124 1.00 34.58  ? 50  GLY A O   1 
ATOM   357  N N   . ARG A  1 51 ? -13.623 -10.323 34.445 1.00 26.28  ? 51  ARG A N   1 
ATOM   358  C CA  . ARG A  1 51 ? -13.246 -8.932  34.111 1.00 24.57  ? 51  ARG A CA  1 
ATOM   359  C C   . ARG A  1 51 ? -12.898 -8.727  32.642 1.00 26.96  ? 51  ARG A C   1 
ATOM   360  O O   . ARG A  1 51 ? -12.978 -7.610  32.130 1.00 30.58  ? 51  ARG A O   1 
ATOM   361  C CB  . ARG A  1 51 ? -12.068 -8.480  34.968 1.00 23.86  ? 51  ARG A CB  1 
ATOM   362  C CG  . ARG A  1 51 ? -12.443 -8.079  36.408 1.00 25.23  ? 51  ARG A CG  1 
ATOM   363  C CD  . ARG A  1 51 ? -11.215 -7.713  37.205 1.00 26.30  ? 51  ARG A CD  1 
ATOM   364  N NE  . ARG A  1 51 ? -10.450 -8.899  37.587 1.00 23.12  ? 51  ARG A NE  1 
ATOM   365  C CZ  . ARG A  1 51 ? -9.396  -8.867  38.395 1.00 26.18  ? 51  ARG A CZ  1 
ATOM   366  N NH1 . ARG A  1 51 ? -8.970  -7.690  38.880 1.00 26.13  ? 51  ARG A NH1 1 
ATOM   367  N NH2 . ARG A  1 51 ? -8.770  -9.990  38.708 1.00 25.74  ? 51  ARG A NH2 1 
ATOM   368  N N   . ILE A  1 52 ? -12.483 -9.803  31.979 1.00 23.03  ? 52  ILE A N   1 
ATOM   369  C CA  . ILE A  1 52 ? -12.071 -9.697  30.591 1.00 23.51  ? 52  ILE A CA  1 
ATOM   370  C C   . ILE A  1 52 ? -13.185 -10.193 29.676 1.00 28.14  ? 52  ILE A C   1 
ATOM   371  O O   . ILE A  1 52 ? -13.811 -11.226 29.947 1.00 29.29  ? 52  ILE A O   1 
ATOM   372  C CB  . ILE A  1 52 ? -10.781 -10.490 30.335 1.00 23.74  ? 52  ILE A CB  1 
ATOM   373  C CG1 . ILE A  1 52 ? -9.628  -9.859  31.118 1.00 25.34  ? 52  ILE A CG1 1 
ATOM   374  C CG2 . ILE A  1 52 ? -10.433 -10.498 28.841 1.00 24.30  ? 52  ILE A CG2 1 
ATOM   375  C CD1 . ILE A  1 52 ? -8.407  -10.744 31.260 1.00 27.43  ? 52  ILE A CD1 1 
ATOM   376  N N   . HIS A  1 53 ? -13.436 -9.452  28.602 1.00 26.75  ? 53  HIS A N   1 
ATOM   377  C CA  . HIS A  1 53 ? -14.461 -9.831  27.632 1.00 25.16  ? 53  HIS A CA  1 
ATOM   378  C C   . HIS A  1 53 ? -13.995 -9.733  26.188 1.00 27.47  ? 53  HIS A C   1 
ATOM   379  O O   . HIS A  1 53 ? -13.022 -9.038  25.870 1.00 26.60  ? 53  HIS A O   1 
ATOM   380  C CB  . HIS A  1 53 ? -15.697 -8.960  27.804 1.00 28.00  ? 53  HIS A CB  1 
ATOM   381  C CG  . HIS A  1 53 ? -16.348 -9.121  29.143 1.00 33.27  ? 53  HIS A CG  1 
ATOM   382  N ND1 . HIS A  1 53 ? -16.050 -8.310  30.213 1.00 37.57  ? 53  HIS A ND1 1 
ATOM   383  C CD2 . HIS A  1 53 ? -17.226 -10.045 29.601 1.00 35.37  ? 53  HIS A CD2 1 
ATOM   384  C CE1 . HIS A  1 53 ? -16.751 -8.697  31.265 1.00 38.94  ? 53  HIS A CE1 1 
ATOM   385  N NE2 . HIS A  1 53 ? -17.473 -9.750  30.920 1.00 37.75  ? 53  HIS A NE2 1 
ATOM   386  N N   . LYS A  1 54 ? -14.718 -10.423 25.316 1.00 29.00  ? 54  LYS A N   1 
ATOM   387  C CA  . LYS A  1 54 ? -14.474 -10.330 23.890 1.00 25.85  ? 54  LYS A CA  1 
ATOM   388  C C   . LYS A  1 54 ? -14.366 -8.856  23.493 1.00 24.41  ? 54  LYS A C   1 
ATOM   389  O O   . LYS A  1 54 ? -15.185 -8.019  23.914 1.00 26.02  ? 54  LYS A O   1 
ATOM   390  C CB  . LYS A  1 54 ? -15.603 -11.032 23.123 1.00 28.35  ? 54  LYS A CB  1 
ATOM   391  C CG  . LYS A  1 54 ? -15.460 -10.929 21.626 1.00 30.39  ? 54  LYS A CG  1 
ATOM   392  C CD  . LYS A  1 54 ? -16.697 -11.471 20.910 1.00 40.48  ? 54  LYS A CD  1 
ATOM   393  C CE  . LYS A  1 54 ? -16.550 -11.318 19.405 1.00 44.71  ? 54  LYS A CE  1 
ATOM   394  N NZ  . LYS A  1 54 ? -17.250 -12.406 18.656 1.00 49.53  ? 54  LYS A NZ  1 
ATOM   395  N N   . GLY A  1 55 ? -13.335 -8.520  22.723 1.00 24.28  ? 55  GLY A N   1 
ATOM   396  C CA  . GLY A  1 55 ? -13.174 -7.168  22.228 1.00 25.13  ? 55  GLY A CA  1 
ATOM   397  C C   . GLY A  1 55 ? -12.208 -6.308  23.027 1.00 23.92  ? 55  GLY A C   1 
ATOM   398  O O   . GLY A  1 55 ? -11.765 -5.261  22.558 1.00 25.02  ? 55  GLY A O   1 
ATOM   399  N N   . ASP A  1 56 ? -11.880 -6.730  24.244 1.00 23.05  ? 56  ASP A N   1 
ATOM   400  C CA  . ASP A  1 56 ? -10.887 -5.994  25.027 1.00 21.42  ? 56  ASP A CA  1 
ATOM   401  C C   . ASP A  1 56 ? -9.531  -6.053  24.329 1.00 22.58  ? 56  ASP A C   1 
ATOM   402  O O   . ASP A  1 56 ? -9.209  -7.039  23.648 1.00 24.14  ? 56  ASP A O   1 
ATOM   403  C CB  . ASP A  1 56 ? -10.775 -6.573  26.439 1.00 22.25  ? 56  ASP A CB  1 
ATOM   404  C CG  . ASP A  1 56 ? -12.002 -6.332  27.261 1.00 24.77  ? 56  ASP A CG  1 
ATOM   405  O OD1 . ASP A  1 56 ? -12.118 -6.962  28.335 1.00 26.11  ? 56  ASP A OD1 1 
ATOM   406  O OD2 . ASP A  1 56 ? -12.833 -5.482  26.860 1.00 26.94  ? 56  ASP A OD2 1 
ATOM   407  N N   . ARG A  1 57 ? -8.746  -4.990  24.451 1.00 22.29  ? 57  ARG A N   1 
ATOM   408  C CA  . ARG A  1 57 ? -7.424  -5.019  23.839 1.00 21.07  ? 57  ARG A CA  1 
ATOM   409  C C   . ARG A  1 57 ? -6.383  -5.424  24.878 1.00 23.30  ? 57  ARG A C   1 
ATOM   410  O O   . ARG A  1 57 ? -6.394  -4.900  25.985 1.00 22.58  ? 57  ARG A O   1 
ATOM   411  C CB  . ARG A  1 57 ? -7.082  -3.652  23.268 1.00 21.98  ? 57  ARG A CB  1 
ATOM   412  C CG  . ARG A  1 57 ? -5.819  -3.677  22.475 1.00 20.44  ? 57  ARG A CG  1 
ATOM   413  C CD  . ARG A  1 57 ? -5.558  -2.340  21.806 1.00 23.03  ? 57  ARG A CD  1 
ATOM   414  N NE  . ARG A  1 57 ? -4.306  -2.363  21.065 1.00 24.42  ? 57  ARG A NE  1 
ATOM   415  C CZ  . ARG A  1 57 ? -3.957  -1.441  20.158 1.00 27.41  ? 57  ARG A CZ  1 
ATOM   416  N NH1 . ARG A  1 57 ? -4.770  -0.432  19.869 1.00 29.86  ? 57  ARG A NH1 1 
ATOM   417  N NH2 . ARG A  1 57 ? -2.798  -1.537  19.524 1.00 30.20  ? 57  ARG A NH2 1 
ATOM   418  N N   . VAL A  1 58 ? -5.486  -6.345  24.536 1.00 18.54  ? 58  VAL A N   1 
ATOM   419  C CA  . VAL A  1 58 ? -4.376  -6.667  25.436 1.00 17.65  ? 58  VAL A CA  1 
ATOM   420  C C   . VAL A  1 58 ? -3.193  -5.780  25.108 1.00 19.82  ? 58  VAL A C   1 
ATOM   421  O O   . VAL A  1 58 ? -2.590  -5.892  24.033 1.00 19.81  ? 58  VAL A O   1 
ATOM   422  C CB  . VAL A  1 58 ? -3.914  -8.141  25.314 1.00 18.68  ? 58  VAL A CB  1 
ATOM   423  C CG1 . VAL A  1 58 ? -2.868  -8.421  26.412 1.00 21.79  ? 58  VAL A CG1 1 
ATOM   424  C CG2 . VAL A  1 58 ? -5.078  -9.061  25.494 1.00 23.38  ? 58  VAL A CG2 1 
ATOM   425  N N   . LEU A  1 59 ? -2.839  -4.893  26.039 1.00 19.22  ? 59  LEU A N   1 
ATOM   426  C CA  . LEU A  1 59 ? -1.761  -3.948  25.824 1.00 19.27  ? 59  LEU A CA  1 
ATOM   427  C C   . LEU A  1 59 ? -0.389  -4.445  26.287 1.00 18.82  ? 59  LEU A C   1 
ATOM   428  O O   . LEU A  1 59 ? 0.641   -4.060  25.697 1.00 20.52  ? 59  LEU A O   1 
ATOM   429  C CB  . LEU A  1 59 ? -2.068  -2.604  26.518 1.00 19.91  ? 59  LEU A CB  1 
ATOM   430  C CG  . LEU A  1 59 ? -3.360  -1.907  26.080 1.00 22.45  ? 59  LEU A CG  1 
ATOM   431  C CD1 . LEU A  1 59 ? -3.593  -0.647  26.959 1.00 22.90  ? 59  LEU A CD1 1 
ATOM   432  C CD2 . LEU A  1 59 ? -3.307  -1.515  24.639 1.00 27.03  ? 59  LEU A CD2 1 
ATOM   433  N N   . ALA A  1 60 ? -0.360  -5.260  27.338 1.00 18.29  ? 60  ALA A N   1 
ATOM   434  C CA  . ALA A  1 60 ? 0.917   -5.704  27.878 1.00 18.86  ? 60  ALA A CA  1 
ATOM   435  C C   . ALA A  1 60 ? 0.740   -6.964  28.697 1.00 17.71  ? 60  ALA A C   1 
ATOM   436  O O   . ALA A  1 60 ? -0.343  -7.261  29.217 1.00 17.78  ? 60  ALA A O   1 
ATOM   437  C CB  . ALA A  1 60 ? 1.596   -4.596  28.725 1.00 19.55  ? 60  ALA A CB  1 
ATOM   438  N N   . VAL A  1 61 ? 1.838   -7.682  28.809 1.00 19.02  ? 61  VAL A N   1 
ATOM   439  C CA  . VAL A  1 61 ? 1.898   -8.927  29.580 1.00 21.31  ? 61  VAL A CA  1 
ATOM   440  C C   . VAL A  1 61 ? 3.118   -8.868  30.492 1.00 20.13  ? 61  VAL A C   1 
ATOM   441  O O   . VAL A  1 61 ? 4.253   -8.714  30.030 1.00 20.23  ? 61  VAL A O   1 
ATOM   442  C CB  . VAL A  1 61 ? 2.034   -10.122 28.641 1.00 18.16  ? 61  VAL A CB  1 
ATOM   443  C CG1 . VAL A  1 61 ? 2.213   -11.457 29.438 1.00 22.76  ? 61  VAL A CG1 1 
ATOM   444  C CG2 . VAL A  1 61 ? 0.830   -10.231 27.698 1.00 20.62  ? 61  VAL A CG2 1 
ATOM   445  N N   . ASN A  1 62 ? 2.882   -9.002  31.789 1.00 18.53  ? 62  ASN A N   1 
ATOM   446  C CA  . ASN A  1 62 ? 3.974   -8.941  32.784 1.00 20.62  ? 62  ASN A CA  1 
ATOM   447  C C   . ASN A  1 62 ? 4.924   -7.745  32.578 1.00 22.83  ? 62  ASN A C   1 
ATOM   448  O O   . ASN A  1 62 ? 6.156   -7.866  32.650 1.00 25.47  ? 62  ASN A O   1 
ATOM   449  C CB  . ASN A  1 62 ? 4.740   -10.268 32.841 1.00 23.16  ? 62  ASN A CB  1 
ATOM   450  C CG  . ASN A  1 62 ? 3.915   -11.391 33.460 1.00 23.34  ? 62  ASN A CG  1 
ATOM   451  O OD1 . ASN A  1 62 ? 2.912   -11.132 34.143 1.00 23.86  ? 62  ASN A OD1 1 
ATOM   452  N ND2 . ASN A  1 62 ? 4.355   -12.637 33.260 1.00 25.06  ? 62  ASN A ND2 1 
ATOM   453  N N   . GLY A  1 63 ? 4.335   -6.592  32.301 1.00 19.96  ? 63  GLY A N   1 
ATOM   454  C CA  . GLY A  1 63 ? 5.105   -5.364  32.246 1.00 21.00  ? 63  GLY A CA  1 
ATOM   455  C C   . GLY A  1 63 ? 5.703   -5.054  30.891 1.00 23.60  ? 63  GLY A C   1 
ATOM   456  O O   . GLY A  1 63 ? 6.330   -4.006  30.725 1.00 22.47  ? 63  GLY A O   1 
ATOM   457  N N   . VAL A  1 64 ? 5.509   -5.944  29.923 1.00 22.45  ? 64  VAL A N   1 
ATOM   458  C CA  . VAL A  1 64 ? 6.090   -5.747  28.582 1.00 21.62  ? 64  VAL A CA  1 
ATOM   459  C C   . VAL A  1 64 ? 5.006   -5.532  27.547 1.00 17.97  ? 64  VAL A C   1 
ATOM   460  O O   . VAL A  1 64 ? 4.074   -6.340  27.446 1.00 18.98  ? 64  VAL A O   1 
ATOM   461  C CB  . VAL A  1 64 ? 6.951   -6.961  28.162 1.00 24.05  ? 64  VAL A CB  1 
ATOM   462  C CG1 . VAL A  1 64 ? 7.590   -6.714  26.786 1.00 25.48  ? 64  VAL A CG1 1 
ATOM   463  C CG2 . VAL A  1 64 ? 8.031   -7.227  29.218 1.00 25.66  ? 64  VAL A CG2 1 
ATOM   464  N N   . SER A  1 65 ? 5.102   -4.404  26.839 1.00 19.97  ? 65  SER A N   1 
ATOM   465  C CA  . SER A  1 65 ? 4.136   -4.054  25.807 1.00 20.49  ? 65  SER A CA  1 
ATOM   466  C C   . SER A  1 65 ? 4.042   -5.113  24.724 1.00 22.27  ? 65  SER A C   1 
ATOM   467  O O   . SER A  1 65 ? 5.048   -5.685  24.308 1.00 22.58  ? 65  SER A O   1 
ATOM   468  C CB  . SER A  1 65 ? 4.565   -2.735  25.141 1.00 20.20  ? 65  SER A CB  1 
ATOM   469  O OG  . SER A  1 65 ? 3.669   -2.349  24.113 1.00 23.97  ? 65  SER A OG  1 
ATOM   470  N N   . LEU A  1 66 ? 2.831   -5.330  24.224 1.00 19.89  ? 66  LEU A N   1 
ATOM   471  C CA  . LEU A  1 66 ? 2.677   -6.042  22.952 1.00 20.90  ? 66  LEU A CA  1 
ATOM   472  C C   . LEU A  1 66 ? 2.855   -5.200  21.694 1.00 26.23  ? 66  LEU A C   1 
ATOM   473  O O   . LEU A  1 66 ? 2.566   -5.702  20.594 1.00 26.02  ? 66  LEU A O   1 
ATOM   474  C CB  . LEU A  1 66 ? 1.322   -6.736  22.884 1.00 21.18  ? 66  LEU A CB  1 
ATOM   475  C CG  . LEU A  1 66 ? 1.072   -7.776  23.975 1.00 22.75  ? 66  LEU A CG  1 
ATOM   476  C CD1 . LEU A  1 66 ? -0.254  -8.518  23.733 1.00 22.94  ? 66  LEU A CD1 1 
ATOM   477  C CD2 . LEU A  1 66 ? 2.248   -8.765  24.073 1.00 29.95  ? 66  LEU A CD2 1 
ATOM   478  N N   . GLU A  1 67 ? 3.337   -3.959  21.827 1.00 23.54  ? 67  GLU A N   1 
ATOM   479  C CA  . GLU A  1 67 ? 3.519   -3.098  20.639 1.00 29.14  ? 67  GLU A CA  1 
ATOM   480  C C   . GLU A  1 67 ? 4.322   -3.772  19.553 1.00 28.08  ? 67  GLU A C   1 
ATOM   481  O O   . GLU A  1 67 ? 5.439   -4.248  19.782 1.00 28.69  ? 67  GLU A O   1 
ATOM   482  C CB  . GLU A  1 67 ? 4.176   -1.765  20.982 1.00 36.23  ? 67  GLU A CB  1 
ATOM   483  C CG  . GLU A  1 67 ? 3.883   -0.685  19.931 1.00 45.81  ? 67  GLU A CG  1 
ATOM   484  C CD  . GLU A  1 67 ? 5.007   0.296   19.744 1.00 52.26  ? 67  GLU A CD  1 
ATOM   485  O OE1 . GLU A  1 67 ? 4.954   1.062   18.763 1.00 54.27  ? 67  GLU A OE1 1 
ATOM   486  O OE2 . GLU A  1 67 ? 5.957   0.290   20.548 1.00 57.54  ? 67  GLU A OE2 1 
ATOM   487  N N   . GLY A  1 68 ? 3.740   -3.792  18.357 1.00 29.49  ? 68  GLY A N   1 
ATOM   488  C CA  . GLY A  1 68 ? 4.410   -4.335  17.197 1.00 29.21  ? 68  GLY A CA  1 
ATOM   489  C C   . GLY A  1 68 ? 4.409   -5.842  17.074 1.00 30.68  ? 68  GLY A C   1 
ATOM   490  O O   . GLY A  1 68 ? 5.079   -6.383  16.192 1.00 33.08  ? 68  GLY A O   1 
ATOM   491  N N   . ALA A  1 69 ? 3.653   -6.525  17.934 1.00 27.23  ? 69  ALA A N   1 
ATOM   492  C CA  . ALA A  1 69 ? 3.648   -7.982  17.922 1.00 23.26  ? 69  ALA A CA  1 
ATOM   493  C C   . ALA A  1 69 ? 2.851   -8.508  16.750 1.00 25.51  ? 69  ALA A C   1 
ATOM   494  O O   . ALA A  1 69 ? 1.778   -7.993  16.452 1.00 27.69  ? 69  ALA A O   1 
ATOM   495  C CB  . ALA A  1 69 ? 3.056   -8.536  19.237 1.00 22.70  ? 69  ALA A CB  1 
ATOM   496  N N   . THR A  1 70 ? 3.387   -9.528  16.095 1.00 26.96  ? 70  THR A N   1 
ATOM   497  C CA  . THR A  1 70 ? 2.603   -10.329 15.165 1.00 27.05  ? 70  THR A CA  1 
ATOM   498  C C   . THR A  1 70 ? 1.686   -11.173 16.024 1.00 25.35  ? 70  THR A C   1 
ATOM   499  O O   . THR A  1 70 ? 1.861   -11.278 17.251 1.00 26.88  ? 70  THR A O   1 
ATOM   500  C CB  . THR A  1 70 ? 3.458   -11.324 14.348 1.00 31.10  ? 70  THR A CB  1 
ATOM   501  O OG1 . THR A  1 70 ? 4.101   -12.249 15.240 1.00 27.81  ? 70  THR A OG1 1 
ATOM   502  C CG2 . THR A  1 70 ? 4.518   -10.601 13.541 1.00 32.67  ? 70  THR A CG2 1 
ATOM   503  N N   . HIS A  1 71 ? 0.722   -11.803 15.373 1.00 25.80  ? 71  HIS A N   1 
ATOM   504  C CA  . HIS A  1 71 ? -0.181  -12.708 16.068 1.00 27.55  ? 71  HIS A CA  1 
ATOM   505  C C   . HIS A  1 71 ? 0.594   -13.796 16.839 1.00 23.94  ? 71  HIS A C   1 
ATOM   506  O O   . HIS A  1 71 ? 0.321   -14.049 18.028 1.00 23.81  ? 71  HIS A O   1 
ATOM   507  C CB  . HIS A  1 71 ? -1.113  -13.348 15.041 1.00 25.37  ? 71  HIS A CB  1 
ATOM   508  C CG  . HIS A  1 71 ? -2.240  -14.114 15.663 1.00 24.52  ? 71  HIS A CG  1 
ATOM   509  N ND1 . HIS A  1 71 ? -3.396  -13.505 16.094 1.00 26.86  ? 71  HIS A ND1 1 
ATOM   510  C CD2 . HIS A  1 71 ? -2.381  -15.432 15.941 1.00 28.83  ? 71  HIS A CD2 1 
ATOM   511  C CE1 . HIS A  1 71 ? -4.202  -14.413 16.617 1.00 27.36  ? 71  HIS A CE1 1 
ATOM   512  N NE2 . HIS A  1 71 ? -3.610  -15.589 16.535 1.00 27.84  ? 71  HIS A NE2 1 
ATOM   513  N N   . LYS A  1 72 ? 1.536   -14.442 16.146 1.00 27.88  ? 72  LYS A N   1 
ATOM   514  C CA  . LYS A  1 72 ? 2.326   -15.527 16.726 1.00 28.84  ? 72  LYS A CA  1 
ATOM   515  C C   . LYS A  1 72 ? 3.110   -15.053 17.927 1.00 26.35  ? 72  LYS A C   1 
ATOM   516  O O   . LYS A  1 72 ? 3.150   -15.724 18.966 1.00 27.88  ? 72  LYS A O   1 
ATOM   517  C CB  . LYS A  1 72 ? 3.295   -16.135 15.700 1.00 31.57  ? 72  LYS A CB  1 
ATOM   518  C CG  . LYS A  1 72 ? 2.614   -16.871 14.570 1.00 38.75  ? 72  LYS A CG  1 
ATOM   519  C CD  . LYS A  1 72 ? 3.635   -17.598 13.689 1.00 43.03  ? 72  LYS A CD  1 
ATOM   520  C CE  . LYS A  1 72 ? 2.939   -18.272 12.503 1.00 48.79  ? 72  LYS A CE  1 
ATOM   521  N NZ  . LYS A  1 72 ? 3.907   -18.800 11.490 1.00 48.88  ? 72  LYS A NZ  1 
ATOM   522  N N   . GLN A  1 73 ? 3.730   -13.884 17.800 1.00 26.57  ? 73  GLN A N   1 
ATOM   523  C CA  . GLN A  1 73 ? 4.509   -13.336 18.899 1.00 26.75  ? 73  GLN A CA  1 
ATOM   524  C C   . GLN A  1 73 ? 3.637   -13.076 20.121 1.00 26.74  ? 73  GLN A C   1 
ATOM   525  O O   . GLN A  1 73 ? 4.037   -13.371 21.255 1.00 25.76  ? 73  GLN A O   1 
ATOM   526  C CB  . GLN A  1 73 ? 5.226   -12.061 18.464 1.00 28.02  ? 73  GLN A CB  1 
ATOM   527  C CG  . GLN A  1 73 ? 6.403   -12.316 17.525 1.00 30.72  ? 73  GLN A CG  1 
ATOM   528  C CD  . GLN A  1 73 ? 6.842   -11.082 16.772 1.00 34.03  ? 73  GLN A CD  1 
ATOM   529  O OE1 . GLN A  1 73 ? 6.202   -10.031 16.835 1.00 34.39  ? 73  GLN A OE1 1 
ATOM   530  N NE2 . GLN A  1 73 ? 7.939   -11.207 16.031 1.00 39.43  ? 73  GLN A NE2 1 
ATOM   531  N N   . ALA A  1 74 ? 2.447   -12.522 19.901 1.00 22.41  ? 74  ALA A N   1 
ATOM   532  C CA  . ALA A  1 74 ? 1.558   -12.225 21.008 1.00 22.51  ? 74  ALA A CA  1 
ATOM   533  C C   . ALA A  1 74 ? 1.129   -13.492 21.728 1.00 22.36  ? 74  ALA A C   1 
ATOM   534  O O   . ALA A  1 74 ? 1.110   -13.535 22.961 1.00 22.37  ? 74  ALA A O   1 
ATOM   535  C CB  . ALA A  1 74 ? 0.332   -11.428 20.553 1.00 25.36  ? 74  ALA A CB  1 
ATOM   536  N N   . VAL A  1 75 ? 0.760   -14.500 20.960 1.00 22.69  ? 75  VAL A N   1 
ATOM   537  C CA  . VAL A  1 75 ? 0.381   -15.785 21.540 1.00 23.52  ? 75  VAL A CA  1 
ATOM   538  C C   . VAL A  1 75 ? 1.518   -16.393 22.363 1.00 22.69  ? 75  VAL A C   1 
ATOM   539  O O   . VAL A  1 75 ? 1.289   -16.887 23.476 1.00 25.44  ? 75  VAL A O   1 
ATOM   540  C CB  . VAL A  1 75 ? -0.114  -16.756 20.461 1.00 24.21  ? 75  VAL A CB  1 
ATOM   541  C CG1 . VAL A  1 75 ? -0.220  -18.185 21.010 1.00 24.77  ? 75  VAL A CG1 1 
ATOM   542  C CG2 . VAL A  1 75 ? -1.434  -16.292 19.958 1.00 24.04  ? 75  VAL A CG2 1 
ATOM   543  N N   . GLU A  1 76 ? 2.736   -16.302 21.851 1.00 24.69  ? 76  GLU A N   1 
ATOM   544  C CA  . GLU A  1 76 ? 3.896   -16.829 22.571 1.00 30.66  ? 76  GLU A CA  1 
ATOM   545  C C   . GLU A  1 76 ? 4.151   -16.064 23.874 1.00 27.39  ? 76  GLU A C   1 
ATOM   546  O O   . GLU A  1 76 ? 4.471   -16.650 24.900 1.00 27.87  ? 76  GLU A O   1 
ATOM   547  C CB  . GLU A  1 76 ? 5.137   -16.774 21.694 1.00 33.60  ? 76  GLU A CB  1 
ATOM   548  C CG  . GLU A  1 76 ? 5.326   -17.979 20.788 1.00 45.89  ? 76  GLU A CG  1 
ATOM   549  C CD  . GLU A  1 76 ? 5.870   -19.193 21.533 1.00 53.72  ? 76  GLU A CD  1 
ATOM   550  O OE1 . GLU A  1 76 ? 5.602   -19.326 22.753 1.00 53.63  ? 76  GLU A OE1 1 
ATOM   551  O OE2 . GLU A  1 76 ? 6.573   -20.009 20.894 1.00 58.29  ? 76  GLU A OE2 1 
ATOM   552  N N   . THR A  1 77 ? 4.016   -14.745 23.815 1.00 25.41  ? 77  THR A N   1 
ATOM   553  C CA  . THR A  1 77 ? 4.210   -13.891 24.985 1.00 22.00  ? 77  THR A CA  1 
ATOM   554  C C   . THR A  1 77 ? 3.223   -14.255 26.085 1.00 26.20  ? 77  THR A C   1 
ATOM   555  O O   . THR A  1 77 ? 3.586   -14.331 27.259 1.00 29.46  ? 77  THR A O   1 
ATOM   556  C CB  . THR A  1 77 ? 4.063   -12.419 24.596 1.00 22.49  ? 77  THR A CB  1 
ATOM   557  O OG1 . THR A  1 77 ? 5.128   -12.074 23.701 1.00 23.95  ? 77  THR A OG1 1 
ATOM   558  C CG2 . THR A  1 77 ? 4.107   -11.527 25.847 1.00 23.75  ? 77  THR A CG2 1 
ATOM   559  N N   . LEU A  1 78 ? 1.980   -14.523 25.699 1.00 24.07  ? 78  LEU A N   1 
ATOM   560  C CA  . LEU A  1 78 ? 0.982   -14.956 26.655 1.00 24.76  ? 78  LEU A CA  1 
ATOM   561  C C   . LEU A  1 78 ? 1.341   -16.312 27.252 1.00 25.98  ? 78  LEU A C   1 
ATOM   562  O O   . LEU A  1 78 ? 1.222   -16.502 28.455 1.00 28.77  ? 78  LEU A O   1 
ATOM   563  C CB  . LEU A  1 78 ? -0.396  -15.004 26.014 1.00 26.98  ? 78  LEU A CB  1 
ATOM   564  C CG  . LEU A  1 78 ? -0.950  -13.592 25.829 1.00 22.28  ? 78  LEU A CG  1 
ATOM   565  C CD1 . LEU A  1 78 ? -2.049  -13.547 24.779 1.00 26.38  ? 78  LEU A CD1 1 
ATOM   566  C CD2 . LEU A  1 78 ? -1.421  -13.003 27.174 1.00 21.29  ? 78  LEU A CD2 1 
ATOM   567  N N   A ARG A  1 79 ? 1.764   -17.245 26.410 0.40 24.80  ? 79  ARG A N   1 
ATOM   568  N N   B ARG A  1 79 ? 1.801   -17.227 26.394 0.60 24.45  ? 79  ARG A N   1 
ATOM   569  C CA  A ARG A  1 79 ? 2.053   -18.596 26.868 0.40 25.99  ? 79  ARG A CA  1 
ATOM   570  C CA  B ARG A  1 79 ? 2.091   -18.622 26.757 0.60 25.87  ? 79  ARG A CA  1 
ATOM   571  C C   A ARG A  1 79 ? 3.270   -18.621 27.787 0.40 28.10  ? 79  ARG A C   1 
ATOM   572  C C   B ARG A  1 79 ? 3.369   -18.803 27.570 0.60 28.12  ? 79  ARG A C   1 
ATOM   573  O O   A ARG A  1 79 ? 3.258   -19.277 28.839 0.40 27.50  ? 79  ARG A O   1 
ATOM   574  O O   B ARG A  1 79 ? 3.513   -19.782 28.313 0.60 30.35  ? 79  ARG A O   1 
ATOM   575  C CB  A ARG A  1 79 ? 2.240   -19.520 25.661 0.40 29.20  ? 79  ARG A CB  1 
ATOM   576  C CB  B ARG A  1 79 ? 2.195   -19.476 25.487 0.60 29.93  ? 79  ARG A CB  1 
ATOM   577  C CG  A ARG A  1 79 ? 0.984   -19.611 24.804 0.40 31.29  ? 79  ARG A CG  1 
ATOM   578  C CG  B ARG A  1 79 ? 0.866   -19.767 24.818 0.60 32.48  ? 79  ARG A CG  1 
ATOM   579  C CD  A ARG A  1 79 ? 1.212   -20.320 23.471 0.40 34.41  ? 79  ARG A CD  1 
ATOM   580  C CD  B ARG A  1 79 ? 1.042   -20.584 23.528 0.60 35.54  ? 79  ARG A CD  1 
ATOM   581  N NE  A ARG A  1 79 ? 1.334   -21.768 23.614 0.40 35.53  ? 79  ARG A NE  1 
ATOM   582  N NE  B ARG A  1 79 ? 1.580   -21.921 23.775 0.60 35.43  ? 79  ARG A NE  1 
ATOM   583  C CZ  A ARG A  1 79 ? 2.493   -22.412 23.671 0.40 37.27  ? 79  ARG A CZ  1 
ATOM   584  C CZ  B ARG A  1 79 ? 0.845   -22.964 24.144 0.60 35.13  ? 79  ARG A CZ  1 
ATOM   585  N NH1 A ARG A  1 79 ? 3.633   -21.735 23.594 0.40 39.07  ? 79  ARG A NH1 1 
ATOM   586  N NH1 B ARG A  1 79 ? 1.416   -24.144 24.343 0.60 35.38  ? 79  ARG A NH1 1 
ATOM   587  N NH2 A ARG A  1 79 ? 2.515   -23.730 23.799 0.40 35.35  ? 79  ARG A NH2 1 
ATOM   588  N NH2 B ARG A  1 79 ? -0.461  -22.827 24.319 0.60 34.35  ? 79  ARG A NH2 1 
ATOM   589  N N   . ASN A  1 80 ? 4.304   -17.880 27.405 1.00 30.27  ? 80  ASN A N   1 
ATOM   590  C CA  . ASN A  1 80 ? 5.587   -17.934 28.089 1.00 35.86  ? 80  ASN A CA  1 
ATOM   591  C C   . ASN A  1 80 ? 5.549   -17.131 29.386 1.00 36.01  ? 80  ASN A C   1 
ATOM   592  O O   . ASN A  1 80 ? 6.277   -16.156 29.565 1.00 40.33  ? 80  ASN A O   1 
ATOM   593  C CB  . ASN A  1 80 ? 6.690   -17.432 27.152 1.00 42.69  ? 80  ASN A CB  1 
ATOM   594  C CG  . ASN A  1 80 ? 8.076   -17.654 27.711 1.00 49.11  ? 80  ASN A CG  1 
ATOM   595  O OD1 . ASN A  1 80 ? 8.363   -18.697 28.298 1.00 52.01  ? 80  ASN A OD1 1 
ATOM   596  N ND2 . ASN A  1 80 ? 8.951   -16.671 27.527 1.00 49.95  ? 80  ASN A ND2 1 
ATOM   597  N N   . THR A  1 81 ? 4.656   -17.542 30.276 1.00 31.19  ? 81  THR A N   1 
ATOM   598  C CA  . THR A  1 81 ? 4.436   -16.874 31.556 1.00 30.99  ? 81  THR A CA  1 
ATOM   599  C C   . THR A  1 81 ? 4.347   -17.942 32.627 1.00 31.00  ? 81  THR A C   1 
ATOM   600  O O   . THR A  1 81 ? 4.264   -19.130 32.316 1.00 32.25  ? 81  THR A O   1 
ATOM   601  C CB  . THR A  1 81 ? 3.115   -16.086 31.546 1.00 29.81  ? 81  THR A CB  1 
ATOM   602  O OG1 . THR A  1 81 ? 2.061   -16.906 31.006 1.00 28.56  ? 81  THR A OG1 1 
ATOM   603  C CG2 . THR A  1 81 ? 3.249   -14.813 30.705 1.00 27.62  ? 81  THR A CG2 1 
ATOM   604  N N   . GLY A  1 82 ? 4.381   -17.525 33.886 1.00 30.10  ? 82  GLY A N   1 
ATOM   605  C CA  . GLY A  1 82 ? 4.235   -18.473 34.982 1.00 32.46  ? 82  GLY A CA  1 
ATOM   606  C C   . GLY A  1 82 ? 2.762   -18.656 35.284 1.00 32.85  ? 82  GLY A C   1 
ATOM   607  O O   . GLY A  1 82 ? 1.909   -18.372 34.445 1.00 31.37  ? 82  GLY A O   1 
ATOM   608  N N   . GLN A  1 83 ? 2.463   -19.105 36.498 1.00 33.06  ? 83  GLN A N   1 
ATOM   609  C CA  . GLN A  1 83 ? 1.104   -19.478 36.876 1.00 30.78  ? 83  GLN A CA  1 
ATOM   610  C C   . GLN A  1 83 ? 0.126   -18.310 37.042 1.00 32.71  ? 83  GLN A C   1 
ATOM   611  O O   . GLN A  1 83 ? -1.047  -18.418 36.676 1.00 34.76  ? 83  GLN A O   1 
ATOM   612  C CB  . GLN A  1 83 ? 1.158   -20.356 38.134 1.00 37.69  ? 83  GLN A CB  1 
ATOM   613  C CG  . GLN A  1 83 ? -0.177  -20.618 38.783 1.00 38.80  ? 83  GLN A CG  1 
ATOM   614  C CD  . GLN A  1 83 ? -1.154  -21.306 37.863 1.00 38.93  ? 83  GLN A CD  1 
ATOM   615  O OE1 . GLN A  1 83 ? -0.766  -21.932 36.860 1.00 37.89  ? 83  GLN A OE1 1 
ATOM   616  N NE2 . GLN A  1 83 ? -2.438  -21.206 38.196 1.00 39.39  ? 83  GLN A NE2 1 
ATOM   617  N N   . VAL A  1 84 ? 0.610   -17.185 37.571 1.00 28.26  ? 84  VAL A N   1 
ATOM   618  C CA  . VAL A  1 84 ? -0.188  -15.970 37.693 1.00 25.10  ? 84  VAL A CA  1 
ATOM   619  C C   . VAL A  1 84 ? 0.397   -14.939 36.737 1.00 26.49  ? 84  VAL A C   1 
ATOM   620  O O   . VAL A  1 84 ? 1.613   -14.740 36.703 1.00 31.51  ? 84  VAL A O   1 
ATOM   621  C CB  . VAL A  1 84 ? -0.197  -15.420 39.131 1.00 28.72  ? 84  VAL A CB  1 
ATOM   622  C CG1 . VAL A  1 84 ? -0.742  -14.010 39.162 1.00 32.86  ? 84  VAL A CG1 1 
ATOM   623  C CG2 . VAL A  1 84 ? -1.014  -16.336 40.036 1.00 30.55  ? 84  VAL A CG2 1 
ATOM   624  N N   . VAL A  1 85 ? -0.459  -14.308 35.947 1.00 25.08  ? 85  VAL A N   1 
ATOM   625  C CA  . VAL A  1 85 ? 0.003   -13.418 34.884 1.00 22.13  ? 85  VAL A CA  1 
ATOM   626  C C   . VAL A  1 85 ? -0.613  -12.029 35.049 1.00 24.09  ? 85  VAL A C   1 
ATOM   627  O O   . VAL A  1 85 ? -1.814  -11.894 35.283 1.00 24.31  ? 85  VAL A O   1 
ATOM   628  C CB  . VAL A  1 85 ? -0.369  -13.984 33.502 1.00 22.18  ? 85  VAL A CB  1 
ATOM   629  C CG1 . VAL A  1 85 ? 0.147   -13.076 32.369 1.00 21.21  ? 85  VAL A CG1 1 
ATOM   630  C CG2 . VAL A  1 85 ? 0.190   -15.402 33.315 1.00 24.70  ? 85  VAL A CG2 1 
ATOM   631  N N   . HIS A  1 86 ? 0.219   -11.003 34.952 1.00 21.97  ? 86  HIS A N   1 
ATOM   632  C CA  . HIS A  1 86 ? -0.251  -9.637  35.028 1.00 22.51  ? 86  HIS A CA  1 
ATOM   633  C C   . HIS A  1 86 ? -0.607  -9.197  33.600 1.00 22.11  ? 86  HIS A C   1 
ATOM   634  O O   . HIS A  1 86 ? 0.222   -9.271  32.702 1.00 23.57  ? 86  HIS A O   1 
ATOM   635  C CB  . HIS A  1 86 ? 0.852   -8.769  35.603 1.00 25.10  ? 86  HIS A CB  1 
ATOM   636  C CG  . HIS A  1 86 ? 0.431   -7.368  35.882 1.00 25.29  ? 86  HIS A CG  1 
ATOM   637  N ND1 . HIS A  1 86 ? 1.339   -6.340  36.021 1.00 29.42  ? 86  HIS A ND1 1 
ATOM   638  C CD2 . HIS A  1 86 ? -0.794  -6.824  36.084 1.00 29.49  ? 86  HIS A CD2 1 
ATOM   639  C CE1 . HIS A  1 86 ? 0.688   -5.220  36.297 1.00 31.80  ? 86  HIS A CE1 1 
ATOM   640  N NE2 . HIS A  1 86 ? -0.606  -5.482  36.332 1.00 30.94  ? 86  HIS A NE2 1 
ATOM   641  N N   . LEU A  1 87 ? -1.846  -8.764  33.401 1.00 20.64  ? 87  LEU A N   1 
ATOM   642  C CA  . LEU A  1 87 ? -2.297  -8.286  32.097 1.00 17.05  ? 87  LEU A CA  1 
ATOM   643  C C   . LEU A  1 87 ? -2.799  -6.864  32.181 1.00 19.58  ? 87  LEU A C   1 
ATOM   644  O O   . LEU A  1 87 ? -3.507  -6.491  33.115 1.00 20.43  ? 87  LEU A O   1 
ATOM   645  C CB  . LEU A  1 87 ? -3.416  -9.163  31.563 1.00 19.82  ? 87  LEU A CB  1 
ATOM   646  C CG  . LEU A  1 87 ? -3.075  -10.644 31.411 1.00 20.26  ? 87  LEU A CG  1 
ATOM   647  C CD1 . LEU A  1 87 ? -4.340  -11.437 31.098 1.00 24.16  ? 87  LEU A CD1 1 
ATOM   648  C CD2 . LEU A  1 87 ? -1.989  -10.885 30.361 1.00 23.02  ? 87  LEU A CD2 1 
ATOM   649  N N   . LEU A  1 88 ? -2.399  -6.069  31.206 1.00 17.98  ? 88  LEU A N   1 
ATOM   650  C CA  . LEU A  1 88 ? -2.875  -4.683  31.087 1.00 17.94  ? 88  LEU A CA  1 
ATOM   651  C C   . LEU A  1 88 ? -3.790  -4.609  29.866 1.00 19.51  ? 88  LEU A C   1 
ATOM   652  O O   . LEU A  1 88 ? -3.396  -5.022  28.768 1.00 19.63  ? 88  LEU A O   1 
ATOM   653  C CB  . LEU A  1 88 ? -1.681  -3.763  30.871 1.00 17.98  ? 88  LEU A CB  1 
ATOM   654  C CG  . LEU A  1 88 ? -1.953  -2.272  30.758 1.00 21.34  ? 88  LEU A CG  1 
ATOM   655  C CD1 . LEU A  1 88 ? -2.523  -1.742  32.046 1.00 21.06  ? 88  LEU A CD1 1 
ATOM   656  C CD2 . LEU A  1 88 ? -0.648  -1.536  30.414 1.00 25.04  ? 88  LEU A CD2 1 
ATOM   657  N N   . LEU A  1 89 ? -4.995  -4.070  30.034 1.00 18.37  ? 89  LEU A N   1 
ATOM   658  C CA  . LEU A  1 89 ? -5.998  -4.089  28.960 1.00 18.25  ? 89  LEU A CA  1 
ATOM   659  C C   . LEU A  1 89 ? -6.692  -2.765  28.763 1.00 19.24  ? 89  LEU A C   1 
ATOM   660  O O   . LEU A  1 89 ? -6.658  -1.913  29.628 1.00 18.73  ? 89  LEU A O   1 
ATOM   661  C CB  . LEU A  1 89 ? -7.083  -5.127  29.234 1.00 16.97  ? 89  LEU A CB  1 
ATOM   662  C CG  . LEU A  1 89 ? -6.627  -6.599  29.284 1.00 20.74  ? 89  LEU A CG  1 
ATOM   663  C CD1 . LEU A  1 89 ? -6.405  -7.034  30.732 1.00 22.54  ? 89  LEU A CD1 1 
ATOM   664  C CD2 . LEU A  1 89 ? -7.641  -7.529  28.590 1.00 22.81  ? 89  LEU A CD2 1 
ATOM   665  N N   . GLU A  1 90 ? -7.312  -2.619  27.594 1.00 17.20  ? 90  GLU A N   1 
ATOM   666  C CA  . GLU A  1 90 ? -8.231  -1.539  27.308 1.00 17.65  ? 90  GLU A CA  1 
ATOM   667  C C   . GLU A  1 90 ? -9.592  -2.181  27.107 1.00 22.11  ? 90  GLU A C   1 
ATOM   668  O O   . GLU A  1 90 ? -9.753  -3.105  26.315 1.00 22.45  ? 90  GLU A O   1 
ATOM   669  C CB  . GLU A  1 90 ? -7.844  -0.808  26.017 1.00 18.49  ? 90  GLU A CB  1 
ATOM   670  C CG  . GLU A  1 90 ? -8.903  0.165   25.562 1.00 22.16  ? 90  GLU A CG  1 
ATOM   671  C CD  . GLU A  1 90 ? -8.707  0.640   24.146 1.00 29.60  ? 90  GLU A CD  1 
ATOM   672  O OE1 . GLU A  1 90 ? -7.772  0.149   23.483 1.00 30.26  ? 90  GLU A OE1 1 
ATOM   673  O OE2 . GLU A  1 90 ? -9.495  1.519   23.710 1.00 29.80  ? 90  GLU A OE2 1 
ATOM   674  N N   A LYS A  1 91 ? -10.584 -1.694  27.840 0.31 21.26  ? 91  LYS A N   1 
ATOM   675  N N   B LYS A  1 91 ? -10.576 -1.704  27.852 0.69 20.70  ? 91  LYS A N   1 
ATOM   676  C CA  A LYS A  1 91 ? -11.945 -2.189  27.689 0.31 22.46  ? 91  LYS A CA  1 
ATOM   677  C CA  B LYS A  1 91 ? -11.943 -2.178  27.696 0.69 22.22  ? 91  LYS A CA  1 
ATOM   678  C C   A LYS A  1 91 ? -12.482 -1.917  26.280 0.31 23.77  ? 91  LYS A C   1 
ATOM   679  C C   B LYS A  1 91 ? -12.506 -1.907  26.284 0.69 24.37  ? 91  LYS A C   1 
ATOM   680  O O   A LYS A  1 91 ? -12.404 -0.796  25.769 0.31 22.89  ? 91  LYS A O   1 
ATOM   681  O O   B LYS A  1 91 ? -12.472 -0.782  25.767 0.69 21.87  ? 91  LYS A O   1 
ATOM   682  C CB  A LYS A  1 91 ? -12.855 -1.544  28.740 0.31 24.74  ? 91  LYS A CB  1 
ATOM   683  C CB  B LYS A  1 91 ? -12.809 -1.520  28.778 0.69 23.39  ? 91  LYS A CB  1 
ATOM   684  C CG  A LYS A  1 91 ? -14.296 -2.006  28.689 0.31 29.75  ? 91  LYS A CG  1 
ATOM   685  C CG  B LYS A  1 91 ? -14.273 -1.852  28.733 0.69 28.41  ? 91  LYS A CG  1 
ATOM   686  C CD  A LYS A  1 91 ? -14.480 -3.323  29.408 0.31 31.78  ? 91  LYS A CD  1 
ATOM   687  C CD  B LYS A  1 91 ? -14.538 -3.244  29.229 0.69 31.90  ? 91  LYS A CD  1 
ATOM   688  C CE  A LYS A  1 91 ? -15.849 -3.923  29.106 0.31 35.16  ? 91  LYS A CE  1 
ATOM   689  C CE  B LYS A  1 91 ? -16.040 -3.464  29.369 0.69 36.06  ? 91  LYS A CE  1 
ATOM   690  N NZ  A LYS A  1 91 ? -16.961 -2.959  29.325 0.31 36.93  ? 91  LYS A NZ  1 
ATOM   691  N NZ  B LYS A  1 91 ? -16.377 -4.876  29.688 0.69 35.84  ? 91  LYS A NZ  1 
ATOM   692  N N   . GLY A  1 92 ? -13.031 -2.949  25.649 1.00 24.57  ? 92  GLY A N   1 
ATOM   693  C CA  . GLY A  1 92 ? -13.570 -2.810  24.319 1.00 26.40  ? 92  GLY A CA  1 
ATOM   694  C C   . GLY A  1 92 ? -14.976 -2.257  24.253 1.00 28.71  ? 92  GLY A C   1 
ATOM   695  O O   . GLY A  1 92 ? -15.586 -1.969  25.281 1.00 30.95  ? 92  GLY A O   1 
ATOM   696  N N   . GLN A  1 93 ? -15.493 -2.144  23.028 1.00 35.03  ? 93  GLN A N   1 
ATOM   697  C CA  . GLN A  1 93 ? -16.836 -1.626  22.797 1.00 45.92  ? 93  GLN A CA  1 
ATOM   698  C C   . GLN A  1 93 ? -17.902 -2.663  23.133 1.00 52.59  ? 93  GLN A C   1 
ATOM   699  O O   . GLN A  1 93 ? -17.625 -3.864  23.159 1.00 49.71  ? 93  GLN A O   1 
ATOM   700  C CB  . GLN A  1 93 ? -16.997 -1.183  21.337 1.00 51.57  ? 93  GLN A CB  1 
ATOM   701  C CG  . GLN A  1 93 ? -16.033 -0.087  20.897 1.00 55.87  ? 93  GLN A CG  1 
ATOM   702  C CD  . GLN A  1 93 ? -16.097 1.143   21.788 1.00 60.62  ? 93  GLN A CD  1 
ATOM   703  O OE1 . GLN A  1 93 ? -15.064 1.673   22.207 1.00 62.13  ? 93  GLN A OE1 1 
ATOM   704  N NE2 . GLN A  1 93 ? -17.312 1.599   22.090 1.00 61.64  ? 93  GLN A NE2 1 
ATOM   705  N N   . SER A  1 94 ? -19.110 -2.175  23.411 1.00 62.22  ? 94  SER A N   1 
ATOM   706  C CA  . SER A  1 94 ? -20.318 -3.001  23.506 1.00 71.81  ? 94  SER A CA  1 
ATOM   707  C C   . SER A  1 94 ? -20.103 -4.409  24.057 1.00 76.54  ? 94  SER A C   1 
ATOM   708  O O   . SER A  1 94 ? -20.910 -5.310  23.806 1.00 80.07  ? 94  SER A O   1 
ATOM   709  C CB  . SER A  1 94 ? -21.007 -3.082  22.138 1.00 73.97  ? 94  SER A CB  1 
ATOM   710  O OG  . SER A  1 94 ? -20.131 -3.585  21.143 1.00 74.14  ? 94  SER A OG  1 
ATOM   711  N N   . PRO B  1 1  ? 13.197  1.967   32.886 1.00 28.18  ? 1   PRO B N   1 
ATOM   712  C CA  . PRO B  1 1  ? 12.596  0.878   32.115 1.00 28.03  ? 1   PRO B CA  1 
ATOM   713  C C   . PRO B  1 1  ? 13.512  0.571   30.942 1.00 29.59  ? 1   PRO B C   1 
ATOM   714  O O   . PRO B  1 1  ? 14.321  1.433   30.599 1.00 30.92  ? 1   PRO B O   1 
ATOM   715  C CB  . PRO B  1 1  ? 11.285  1.496   31.608 1.00 28.63  ? 1   PRO B CB  1 
ATOM   716  C CG  . PRO B  1 1  ? 11.044  2.727   32.426 1.00 29.24  ? 1   PRO B CG  1 
ATOM   717  C CD  . PRO B  1 1  ? 12.180  2.899   33.398 1.00 29.79  ? 1   PRO B CD  1 
ATOM   718  N N   . LYS B  1 2  ? 13.408  -0.619  30.359 1.00 25.39  ? 2   LYS B N   1 
ATOM   719  C CA  . LYS B  1 2  ? 14.085  -0.906  29.091 1.00 24.88  ? 2   LYS B CA  1 
ATOM   720  C C   . LYS B  1 2  ? 13.069  -0.767  27.939 1.00 23.51  ? 2   LYS B C   1 
ATOM   721  O O   . LYS B  1 2  ? 11.862  -0.769  28.164 1.00 21.85  ? 2   LYS B O   1 
ATOM   722  C CB  . LYS B  1 2  ? 14.733  -2.296  29.097 1.00 30.46  ? 2   LYS B CB  1 
ATOM   723  C CG  . LYS B  1 2  ? 13.752  -3.442  29.094 1.00 35.94  ? 2   LYS B CG  1 
ATOM   724  C CD  . LYS B  1 2  ? 14.466  -4.789  29.151 1.00 42.24  ? 2   LYS B CD  1 
ATOM   725  C CE  . LYS B  1 2  ? 13.454  -5.928  29.244 1.00 44.07  ? 2   LYS B CE  1 
ATOM   726  N NZ  . LYS B  1 2  ? 14.122  -7.276  29.295 1.00 45.82  ? 2   LYS B NZ  1 
ATOM   727  N N   . PRO B  1 3  ? 13.559  -0.627  26.705 1.00 25.89  ? 3   PRO B N   1 
ATOM   728  C CA  . PRO B  1 3  ? 12.626  -0.482  25.581 1.00 22.86  ? 3   PRO B CA  1 
ATOM   729  C C   . PRO B  1 3  ? 11.589  -1.582  25.587 1.00 22.80  ? 3   PRO B C   1 
ATOM   730  O O   . PRO B  1 3  ? 11.919  -2.771  25.784 1.00 24.26  ? 3   PRO B O   1 
ATOM   731  C CB  . PRO B  1 3  ? 13.549  -0.599  24.366 1.00 24.46  ? 3   PRO B CB  1 
ATOM   732  C CG  . PRO B  1 3  ? 14.830  -0.002  24.852 1.00 27.50  ? 3   PRO B CG  1 
ATOM   733  C CD  . PRO B  1 3  ? 14.962  -0.461  26.282 1.00 28.74  ? 3   PRO B CD  1 
ATOM   734  N N   . GLY B  1 4  ? 10.332  -1.195  25.392 1.00 23.96  ? 4   GLY B N   1 
ATOM   735  C CA  . GLY B  1 4  ? 9.240   -2.147  25.388 1.00 21.99  ? 4   GLY B CA  1 
ATOM   736  C C   . GLY B  1 4  ? 8.502   -2.220  26.717 1.00 20.33  ? 4   GLY B C   1 
ATOM   737  O O   . GLY B  1 4  ? 7.369   -2.676  26.763 1.00 22.96  ? 4   GLY B O   1 
ATOM   738  N N   . ASP B  1 5  ? 9.141   -1.781  27.797 1.00 21.73  ? 5   ASP B N   1 
ATOM   739  C CA  . ASP B  1 5  ? 8.503   -1.848  29.105 1.00 20.38  ? 5   ASP B CA  1 
ATOM   740  C C   . ASP B  1 5  ? 7.395   -0.819  29.242 1.00 19.39  ? 5   ASP B C   1 
ATOM   741  O O   . ASP B  1 5  ? 7.535   0.305   28.785 1.00 21.80  ? 5   ASP B O   1 
ATOM   742  C CB  . ASP B  1 5  ? 9.527   -1.566  30.215 1.00 21.24  ? 5   ASP B CB  1 
ATOM   743  C CG  . ASP B  1 5  ? 10.487  -2.731  30.471 1.00 27.55  ? 5   ASP B CG  1 
ATOM   744  O OD1 . ASP B  1 5  ? 10.291  -3.852  29.953 1.00 28.32  ? 5   ASP B OD1 1 
ATOM   745  O OD2 . ASP B  1 5  ? 11.457  -2.497  31.235 1.00 30.25  ? 5   ASP B OD2 1 
ATOM   746  N N   . ILE B  1 6  ? 6.321   -1.212  29.931 1.00 18.19  ? 6   ILE B N   1 
ATOM   747  C CA  . ILE B  1 6  ? 5.275   -0.304  30.388 1.00 17.81  ? 6   ILE B CA  1 
ATOM   748  C C   . ILE B  1 6  ? 5.794   0.493   31.587 1.00 17.24  ? 6   ILE B C   1 
ATOM   749  O O   . ILE B  1 6  ? 6.477   -0.072  32.475 1.00 21.99  ? 6   ILE B O   1 
ATOM   750  C CB  . ILE B  1 6  ? 4.035   -1.114  30.872 1.00 18.21  ? 6   ILE B CB  1 
ATOM   751  C CG1 . ILE B  1 6  ? 3.435   -1.909  29.701 1.00 19.47  ? 6   ILE B CG1 1 
ATOM   752  C CG2 . ILE B  1 6  ? 2.980   -0.179  31.434 1.00 23.35  ? 6   ILE B CG2 1 
ATOM   753  C CD1 . ILE B  1 6  ? 2.960   -0.992  28.565 1.00 21.93  ? 6   ILE B CD1 1 
ATOM   754  N N   . PHE B  1 7  ? 5.492   1.786   31.615 1.00 18.08  ? 7   PHE B N   1 
ATOM   755  C CA  . PHE B  1 7  ? 5.678   2.580   32.847 1.00 17.87  ? 7   PHE B CA  1 
ATOM   756  C C   . PHE B  1 7  ? 4.592   3.629   32.949 1.00 18.30  ? 7   PHE B C   1 
ATOM   757  O O   . PHE B  1 7  ? 3.936   3.985   31.946 1.00 18.19  ? 7   PHE B O   1 
ATOM   758  C CB  . PHE B  1 7  ? 7.086   3.200   32.955 1.00 20.28  ? 7   PHE B CB  1 
ATOM   759  C CG  . PHE B  1 7  ? 7.410   4.267   31.920 1.00 20.84  ? 7   PHE B CG  1 
ATOM   760  C CD1 . PHE B  1 7  ? 7.420   5.617   32.283 1.00 21.00  ? 7   PHE B CD1 1 
ATOM   761  C CD2 . PHE B  1 7  ? 7.766   3.918   30.614 1.00 20.57  ? 7   PHE B CD2 1 
ATOM   762  C CE1 . PHE B  1 7  ? 7.739   6.610   31.340 1.00 19.84  ? 7   PHE B CE1 1 
ATOM   763  C CE2 . PHE B  1 7  ? 8.089   4.884   29.671 1.00 19.02  ? 7   PHE B CE2 1 
ATOM   764  C CZ  . PHE B  1 7  ? 8.070   6.246   30.029 1.00 18.69  ? 7   PHE B CZ  1 
ATOM   765  N N   . GLU B  1 8  ? 4.391   4.123   34.163 1.00 18.87  ? 8   GLU B N   1 
ATOM   766  C CA  . GLU B  1 8  ? 3.412   5.177   34.389 1.00 18.60  ? 8   GLU B CA  1 
ATOM   767  C C   . GLU B  1 8  ? 4.028   6.325   35.166 1.00 17.30  ? 8   GLU B C   1 
ATOM   768  O O   . GLU B  1 8  ? 4.960   6.128   35.977 1.00 23.05  ? 8   GLU B O   1 
ATOM   769  C CB  . GLU B  1 8  ? 2.172   4.632   35.108 1.00 27.32  ? 8   GLU B CB  1 
ATOM   770  C CG  . GLU B  1 8  ? 2.457   3.844   36.359 1.00 35.42  ? 8   GLU B CG  1 
ATOM   771  C CD  . GLU B  1 8  ? 1.191   3.299   37.008 1.00 40.55  ? 8   GLU B CD  1 
ATOM   772  O OE1 . GLU B  1 8  ? 1.309   2.366   37.835 1.00 46.07  ? 8   GLU B OE1 1 
ATOM   773  O OE2 . GLU B  1 8  ? 0.082   3.794   36.701 1.00 33.48  ? 8   GLU B OE2 1 
ATOM   774  N N   . VAL B  1 9  ? 3.535   7.528   34.891 1.00 16.69  ? 9   VAL B N   1 
ATOM   775  C CA  . VAL B  1 9  ? 3.995   8.714   35.609 1.00 17.39  ? 9   VAL B CA  1 
ATOM   776  C C   . VAL B  1 9  ? 2.816   9.592   36.036 1.00 20.85  ? 9   VAL B C   1 
ATOM   777  O O   . VAL B  1 9  ? 1.761   9.604   35.391 1.00 25.63  ? 9   VAL B O   1 
ATOM   778  C CB  . VAL B  1 9  ? 4.958   9.550   34.773 1.00 19.68  ? 9   VAL B CB  1 
ATOM   779  C CG1 . VAL B  1 9  ? 6.116   8.683   34.259 1.00 21.42  ? 9   VAL B CG1 1 
ATOM   780  C CG2 . VAL B  1 9  ? 4.241   10.218  33.589 1.00 22.68  ? 9   VAL B CG2 1 
ATOM   781  N N   . GLU B  1 10 ? 2.991   10.314  37.137 1.00 19.61  ? 10  GLU B N   1 
ATOM   782  C CA  . GLU B  1 10 ? 2.088   11.403  37.483 1.00 20.38  ? 10  GLU B CA  1 
ATOM   783  C C   . GLU B  1 10 ? 2.916   12.659  37.290 1.00 20.78  ? 10  GLU B C   1 
ATOM   784  O O   . GLU B  1 10 ? 3.881   12.893  38.032 1.00 22.93  ? 10  GLU B O   1 
ATOM   785  C CB  . GLU B  1 10 ? 1.610   11.299  38.939 1.00 22.54  ? 10  GLU B CB  1 
ATOM   786  C CG  . GLU B  1 10 ? 0.668   10.134  39.217 1.00 22.90  ? 10  GLU B CG  1 
ATOM   787  C CD  . GLU B  1 10 ? -0.757  10.424  38.767 1.00 23.46  ? 10  GLU B CD  1 
ATOM   788  O OE1 . GLU B  1 10 ? -1.008  11.556  38.305 1.00 26.92  ? 10  GLU B OE1 1 
ATOM   789  O OE2 . GLU B  1 10 ? -1.616  9.543   38.968 1.00 26.99  ? 10  GLU B OE2 1 
ATOM   790  N N   . LEU B  1 11 ? 2.553   13.453  36.287 1.00 19.84  ? 11  LEU B N   1 
ATOM   791  C CA  . LEU B  1 11 ? 3.395   14.537  35.850 1.00 18.28  ? 11  LEU B CA  1 
ATOM   792  C C   . LEU B  1 11 ? 2.640   15.811  36.135 1.00 20.87  ? 11  LEU B C   1 
ATOM   793  O O   . LEU B  1 11 ? 1.507   15.988  35.682 1.00 21.02  ? 11  LEU B O   1 
ATOM   794  C CB  . LEU B  1 11 ? 3.675   14.378  34.353 1.00 21.61  ? 11  LEU B CB  1 
ATOM   795  C CG  . LEU B  1 11 ? 4.600   15.386  33.686 1.00 23.58  ? 11  LEU B CG  1 
ATOM   796  C CD1 . LEU B  1 11 ? 5.977   15.297  34.342 1.00 25.43  ? 11  LEU B CD1 1 
ATOM   797  C CD2 . LEU B  1 11 ? 4.701   15.056  32.210 1.00 22.02  ? 11  LEU B CD2 1 
ATOM   798  N N   . ALA B  1 12 ? 3.273   16.700  36.905 1.00 18.79  ? 12  ALA B N   1 
ATOM   799  C CA  . ALA B  1 12 ? 2.741   18.057  37.126 1.00 19.84  ? 12  ALA B CA  1 
ATOM   800  C C   . ALA B  1 12 ? 3.080   19.001  35.980 1.00 20.48  ? 12  ALA B C   1 
ATOM   801  O O   . ALA B  1 12 ? 4.226   19.108  35.563 1.00 21.67  ? 12  ALA B O   1 
ATOM   802  C CB  . ALA B  1 12 ? 3.300   18.634  38.453 1.00 21.16  ? 12  ALA B CB  1 
ATOM   803  N N   . LYS B  1 13 ? 2.081   19.701  35.474 1.00 19.99  ? 13  LYS B N   1 
ATOM   804  C CA  . LYS B  1 13 ? 2.362   20.718  34.448 1.00 18.87  ? 13  LYS B CA  1 
ATOM   805  C C   . LYS B  1 13 ? 3.198   21.890  34.956 1.00 21.52  ? 13  LYS B C   1 
ATOM   806  O O   . LYS B  1 13 ? 3.181   22.242  36.137 1.00 23.54  ? 13  LYS B O   1 
ATOM   807  C CB  . LYS B  1 13 ? 1.057   21.245  33.859 1.00 21.11  ? 13  LYS B CB  1 
ATOM   808  C CG  . LYS B  1 13 ? 0.291   20.157  33.127 1.00 22.58  ? 13  LYS B CG  1 
ATOM   809  C CD  . LYS B  1 13 ? -0.991  20.698  32.529 1.00 23.06  ? 13  LYS B CD  1 
ATOM   810  C CE  . LYS B  1 13 ? -1.867  19.565  31.981 1.00 22.91  ? 13  LYS B CE  1 
ATOM   811  N NZ  . LYS B  1 13 ? -3.222  20.128  31.670 1.00 25.48  ? 13  LYS B NZ  1 
ATOM   812  N N   . ASN B  1 14 ? 3.934   22.482  34.021 1.00 20.78  ? 14  ASN B N   1 
ATOM   813  C CA  . ASN B  1 14 ? 4.638   23.754  34.235 1.00 22.99  ? 14  ASN B CA  1 
ATOM   814  C C   . ASN B  1 14 ? 3.978   24.791  33.332 1.00 23.84  ? 14  ASN B C   1 
ATOM   815  O O   . ASN B  1 14 ? 3.939   24.616  32.111 1.00 25.08  ? 14  ASN B O   1 
ATOM   816  C CB  . ASN B  1 14 ? 6.122   23.603  33.856 1.00 26.43  ? 14  ASN B CB  1 
ATOM   817  C CG  . ASN B  1 14 ? 6.925   22.793  34.890 1.00 36.39  ? 14  ASN B CG  1 
ATOM   818  O OD1 . ASN B  1 14 ? 6.402   22.405  35.937 1.00 35.67  ? 14  ASN B OD1 1 
ATOM   819  N ND2 . ASN B  1 14 ? 8.211   22.552  34.594 1.00 40.42  ? 14  ASN B ND2 1 
ATOM   820  N N   . ASP B  1 15 ? 3.452   25.854  33.931 1.00 25.23  ? 15  ASP B N   1 
ATOM   821  C CA  . ASP B  1 15 ? 2.705   26.864  33.161 1.00 25.06  ? 15  ASP B CA  1 
ATOM   822  C C   . ASP B  1 15 ? 1.709   26.174  32.228 1.00 22.72  ? 15  ASP B C   1 
ATOM   823  O O   . ASP B  1 15 ? 1.616   26.482  31.014 1.00 24.30  ? 15  ASP B O   1 
ATOM   824  C CB  . ASP B  1 15 ? 3.641   27.799  32.415 1.00 27.67  ? 15  ASP B CB  1 
ATOM   825  C CG  . ASP B  1 15 ? 4.112   28.959  33.287 1.00 33.33  ? 15  ASP B CG  1 
ATOM   826  O OD1 . ASP B  1 15 ? 4.084   28.826  34.521 1.00 36.33  ? 15  ASP B OD1 1 
ATOM   827  O OD2 . ASP B  1 15 ? 4.514   29.993  32.747 1.00 32.99  ? 15  ASP B OD2 1 
ATOM   828  N N   . ASN B  1 16 ? 0.986   25.230  32.835 1.00 21.63  ? 16  ASN B N   1 
ATOM   829  C CA  . ASN B  1 16 ? -0.094  24.511  32.185 1.00 23.41  ? 16  ASN B CA  1 
ATOM   830  C C   . ASN B  1 16 ? 0.314   23.727  30.926 1.00 22.77  ? 16  ASN B C   1 
ATOM   831  O O   . ASN B  1 16 ? -0.506  23.505  30.036 1.00 22.48  ? 16  ASN B O   1 
ATOM   832  C CB  . ASN B  1 16 ? -1.240  25.477  31.855 1.00 28.79  ? 16  ASN B CB  1 
ATOM   833  C CG  . ASN B  1 16 ? -2.580  24.796  31.890 1.00 32.19  ? 16  ASN B CG  1 
ATOM   834  O OD1 . ASN B  1 16 ? -2.758  23.827  32.623 1.00 35.16  ? 16  ASN B OD1 1 
ATOM   835  N ND2 . ASN B  1 16 ? -3.520  25.272  31.089 1.00 33.78  ? 16  ASN B ND2 1 
ATOM   836  N N   . SER B  1 17 ? 1.579   23.319  30.856 1.00 22.21  ? 17  SER B N   1 
ATOM   837  C CA  . SER B  1 17 ? 2.050   22.437  29.781 1.00 21.20  ? 17  SER B CA  1 
ATOM   838  C C   . SER B  1 17 ? 2.808   21.269  30.368 1.00 20.27  ? 17  SER B C   1 
ATOM   839  O O   . SER B  1 17 ? 3.577   21.439  31.313 1.00 20.12  ? 17  SER B O   1 
ATOM   840  C CB  . SER B  1 17 ? 3.003   23.191  28.866 1.00 23.19  ? 17  SER B CB  1 
ATOM   841  O OG  . SER B  1 17 ? 3.497   22.326  27.859 1.00 24.16  ? 17  SER B OG  1 
ATOM   842  N N   . LEU B  1 18 ? 2.600   20.084  29.809 1.00 19.76  ? 18  LEU B N   1 
ATOM   843  C CA  . LEU B  1 18 ? 3.363   18.901  30.195 1.00 20.47  ? 18  LEU B CA  1 
ATOM   844  C C   . LEU B  1 18 ? 4.774   18.948  29.615 1.00 20.59  ? 18  LEU B C   1 
ATOM   845  O O   . LEU B  1 18 ? 5.641   18.163  30.012 1.00 20.79  ? 18  LEU B O   1 
ATOM   846  C CB  . LEU B  1 18 ? 2.655   17.634  29.706 1.00 18.87  ? 18  LEU B CB  1 
ATOM   847  C CG  . LEU B  1 18 ? 1.333   17.333  30.412 1.00 22.67  ? 18  LEU B CG  1 
ATOM   848  C CD1 . LEU B  1 18 ? 0.514   16.294  29.635 1.00 24.55  ? 18  LEU B CD1 1 
ATOM   849  C CD2 . LEU B  1 18 ? 1.568   16.909  31.845 1.00 21.96  ? 18  LEU B CD2 1 
ATOM   850  N N   . GLY B  1 19 ? 4.998   19.833  28.650 1.00 20.85  ? 19  GLY B N   1 
ATOM   851  C CA  . GLY B  1 19 ? 6.316   19.948  28.045 1.00 21.92  ? 19  GLY B CA  1 
ATOM   852  C C   . GLY B  1 19 ? 6.662   18.767  27.152 1.00 21.69  ? 19  GLY B C   1 
ATOM   853  O O   . GLY B  1 19 ? 7.817   18.330  27.067 1.00 21.83  ? 19  GLY B O   1 
ATOM   854  N N   . ILE B  1 20 ? 5.663   18.227  26.468 1.00 22.05  ? 20  ILE B N   1 
ATOM   855  C CA  . ILE B  1 20 ? 5.978   17.242  25.435 1.00 22.89  ? 20  ILE B CA  1 
ATOM   856  C C   . ILE B  1 20 ? 5.280   17.559  24.122 1.00 24.48  ? 20  ILE B C   1 
ATOM   857  O O   . ILE B  1 20 ? 4.122   17.952  24.099 1.00 27.85  ? 20  ILE B O   1 
ATOM   858  C CB  . ILE B  1 20 ? 5.577   15.835  25.837 1.00 28.51  ? 20  ILE B CB  1 
ATOM   859  C CG1 . ILE B  1 20 ? 4.078   15.760  26.028 1.00 30.09  ? 20  ILE B CG1 1 
ATOM   860  C CG2 . ILE B  1 20 ? 6.285   15.386  27.105 1.00 32.25  ? 20  ILE B CG2 1 
ATOM   861  C CD1 . ILE B  1 20 ? 3.578   14.355  25.980 1.00 33.70  ? 20  ILE B CD1 1 
ATOM   862  N N   . SER B  1 21 ? 5.989   17.394  23.026 1.00 19.96  ? 21  SER B N   1 
ATOM   863  C CA  . SER B  1 21 ? 5.300   17.400  21.755 1.00 19.64  ? 21  SER B CA  1 
ATOM   864  C C   . SER B  1 21 ? 5.100   15.963  21.315 1.00 20.88  ? 21  SER B C   1 
ATOM   865  O O   . SER B  1 21 ? 5.896   15.070  21.645 1.00 22.49  ? 21  SER B O   1 
ATOM   866  C CB  . SER B  1 21 ? 6.061   18.212  20.701 1.00 26.92  ? 21  SER B CB  1 
ATOM   867  O OG  . SER B  1 21 ? 7.324   17.643  20.427 1.00 33.09  ? 21  SER B OG  1 
ATOM   868  N N   . VAL B  1 22 ? 3.987   15.710  20.638 1.00 23.96  ? 22  VAL B N   1 
ATOM   869  C CA  . VAL B  1 22 ? 3.738   14.351  20.171 1.00 21.53  ? 22  VAL B CA  1 
ATOM   870  C C   . VAL B  1 22 ? 3.640   14.307  18.656 1.00 24.42  ? 22  VAL B C   1 
ATOM   871  O O   . VAL B  1 22 ? 3.446   15.330  17.980 1.00 24.95  ? 22  VAL B O   1 
ATOM   872  C CB  . VAL B  1 22 ? 2.472   13.720  20.794 1.00 22.19  ? 22  VAL B CB  1 
ATOM   873  C CG1 . VAL B  1 22 ? 2.612   13.620  22.293 1.00 21.09  ? 22  VAL B CG1 1 
ATOM   874  C CG2 . VAL B  1 22 ? 1.243   14.565  20.420 1.00 28.45  ? 22  VAL B CG2 1 
ATOM   875  N N   . THR B  1 23 ? 3.832   13.113  18.136 1.00 22.27  ? 23  THR B N   1 
ATOM   876  C CA  . THR B  1 23 ? 3.711   12.836  16.718 1.00 24.04  ? 23  THR B CA  1 
ATOM   877  C C   . THR B  1 23 ? 2.882   11.580  16.604 1.00 25.68  ? 23  THR B C   1 
ATOM   878  O O   . THR B  1 23 ? 2.814   10.800  17.553 1.00 23.36  ? 23  THR B O   1 
ATOM   879  C CB  . THR B  1 23 ? 5.074   12.607  16.075 1.00 27.63  ? 23  THR B CB  1 
ATOM   880  O OG1 . THR B  1 23 ? 4.891   12.407  14.660 1.00 32.85  ? 23  THR B OG1 1 
ATOM   881  C CG2 . THR B  1 23 ? 5.748   11.397  16.668 1.00 29.19  ? 23  THR B CG2 1 
ATOM   882  N N   . GLY B  1 24 ? 2.220   11.397  15.464 1.00 26.10  ? 24  GLY B N   1 
ATOM   883  C CA  . GLY B  1 24 ? 1.404   10.207  15.258 1.00 25.10  ? 24  GLY B CA  1 
ATOM   884  C C   . GLY B  1 24 ? -0.096  10.436  15.397 1.00 25.89  ? 24  GLY B C   1 
ATOM   885  O O   . GLY B  1 24 ? -0.555  11.550  15.619 1.00 30.76  ? 24  GLY B O   1 
ATOM   886  N N   . GLY B  1 25 ? -0.865  9.359   15.308 1.00 25.41  ? 25  GLY B N   1 
ATOM   887  C CA  . GLY B  1 25 ? -2.310  9.455   15.236 1.00 25.51  ? 25  GLY B CA  1 
ATOM   888  C C   . GLY B  1 25 ? -2.828  8.598   14.090 1.00 26.13  ? 25  GLY B C   1 
ATOM   889  O O   . GLY B  1 25 ? -2.098  8.325   13.139 1.00 25.72  ? 25  GLY B O   1 
ATOM   890  N N   . VAL B  1 26 ? -4.085  8.188   14.154 1.00 27.06  ? 26  VAL B N   1 
ATOM   891  C CA  . VAL B  1 26 ? -4.591  7.279   13.138 1.00 31.26  ? 26  VAL B CA  1 
ATOM   892  C C   . VAL B  1 26 ? -4.582  7.911   11.750 1.00 31.07  ? 26  VAL B C   1 
ATOM   893  O O   . VAL B  1 26 ? -4.531  7.212   10.741 1.00 29.76  ? 26  VAL B O   1 
ATOM   894  C CB  . VAL B  1 26 ? -6.005  6.742   13.450 1.00 36.70  ? 26  VAL B CB  1 
ATOM   895  C CG1 . VAL B  1 26 ? -5.954  5.802   14.634 1.00 36.34  ? 26  VAL B CG1 1 
ATOM   896  C CG2 . VAL B  1 26 ? -6.986  7.878   13.674 1.00 35.99  ? 26  VAL B CG2 1 
ATOM   897  N N   . ASN B  1 27 ? -4.624  9.239   11.711 1.00 30.63  ? 27  ASN B N   1 
ATOM   898  C CA  . ASN B  1 27 ? -4.661  9.972   10.452 1.00 33.51  ? 27  ASN B CA  1 
ATOM   899  C C   . ASN B  1 27 ? -3.285  10.090  9.816  1.00 33.34  ? 27  ASN B C   1 
ATOM   900  O O   . ASN B  1 27 ? -3.151  10.612  8.718  1.00 39.33  ? 27  ASN B O   1 
ATOM   901  C CB  . ASN B  1 27 ? -5.223  11.374  10.684 1.00 38.66  ? 27  ASN B CB  1 
ATOM   902  C CG  . ASN B  1 27 ? -4.362  12.200  11.630 1.00 41.22  ? 27  ASN B CG  1 
ATOM   903  O OD1 . ASN B  1 27 ? -4.153  11.835  12.793 1.00 36.38  ? 27  ASN B OD1 1 
ATOM   904  N ND2 . ASN B  1 27 ? -3.839  13.318  11.122 1.00 48.99  ? 27  ASN B ND2 1 
ATOM   905  N N   . THR B  1 28 ? -2.254  9.619   10.513 1.00 31.82  ? 28  THR B N   1 
ATOM   906  C CA  . THR B  1 28 ? -0.878  9.762   10.020 1.00 32.00  ? 28  THR B CA  1 
ATOM   907  C C   . THR B  1 28 ? -0.348  8.424   9.538  1.00 31.70  ? 28  THR B C   1 
ATOM   908  O O   . THR B  1 28 ? -0.968  7.389   9.749  1.00 31.49  ? 28  THR B O   1 
ATOM   909  C CB  . THR B  1 28 ? 0.098   10.252  11.139 1.00 31.54  ? 28  THR B CB  1 
ATOM   910  O OG1 . THR B  1 28 ? 0.397   9.167   12.021 1.00 29.51  ? 28  THR B OG1 1 
ATOM   911  C CG2 . THR B  1 28 ? -0.489  11.429  11.919 1.00 35.69  ? 28  THR B CG2 1 
ATOM   912  N N   . SER B  1 29 ? 0.827   8.448   8.909  1.00 35.13  ? 29  SER B N   1 
ATOM   913  C CA  . SER B  1 29 ? 1.511   7.217   8.524  1.00 41.08  ? 29  SER B CA  1 
ATOM   914  C C   . SER B  1 29 ? 2.565   6.818   9.562  1.00 44.32  ? 29  SER B C   1 
ATOM   915  O O   . SER B  1 29 ? 3.409   5.964   9.308  1.00 48.59  ? 29  SER B O   1 
ATOM   916  C CB  . SER B  1 29 ? 2.169   7.381   7.155  1.00 51.01  ? 29  SER B CB  1 
ATOM   917  O OG  . SER B  1 29 ? 2.982   8.541   7.143  1.00 54.88  ? 29  SER B OG  1 
ATOM   918  N N   . VAL B  1 30 ? 2.503   7.447   10.731 1.00 39.93  ? 30  VAL B N   1 
ATOM   919  C CA  . VAL B  1 30 ? 3.446   7.161   11.805 1.00 41.30  ? 30  VAL B CA  1 
ATOM   920  C C   . VAL B  1 30 ? 3.215   5.769   12.385 1.00 40.47  ? 30  VAL B C   1 
ATOM   921  O O   . VAL B  1 30 ? 2.115   5.448   12.835 1.00 33.95  ? 30  VAL B O   1 
ATOM   922  C CB  . VAL B  1 30 ? 3.345   8.201   12.937 1.00 36.19  ? 30  VAL B CB  1 
ATOM   923  C CG1 . VAL B  1 30 ? 4.288   7.840   14.074 1.00 38.40  ? 30  VAL B CG1 1 
ATOM   924  C CG2 . VAL B  1 30 ? 3.649   9.593   12.405 1.00 36.71  ? 30  VAL B CG2 1 
ATOM   925  N N   . ARG B  1 31 ? 4.249   4.935   12.373 1.00 45.21  ? 31  ARG B N   1 
ATOM   926  C CA  . ARG B  1 31 ? 4.118   3.574   12.883 1.00 48.33  ? 31  ARG B CA  1 
ATOM   927  C C   . ARG B  1 31 ? 2.747   3.003   12.527 1.00 46.90  ? 31  ARG B C   1 
ATOM   928  O O   . ARG B  1 31 ? 2.365   2.977   11.357 1.00 48.00  ? 31  ARG B O   1 
ATOM   929  C CB  . ARG B  1 31 ? 4.324   3.546   14.398 1.00 52.30  ? 31  ARG B CB  1 
ATOM   930  C CG  . ARG B  1 31 ? 5.681   4.059   14.850 1.00 60.25  ? 31  ARG B CG  1 
ATOM   931  C CD  . ARG B  1 31 ? 6.809   3.215   14.279 1.00 63.81  ? 31  ARG B CD  1 
ATOM   932  N NE  . ARG B  1 31 ? 6.722   1.823   14.711 1.00 67.74  ? 31  ARG B NE  1 
ATOM   933  C CZ  . ARG B  1 31 ? 7.294   1.345   15.811 1.00 65.17  ? 31  ARG B CZ  1 
ATOM   934  N NH1 . ARG B  1 31 ? 7.997   2.149   16.598 1.00 59.15  ? 31  ARG B NH1 1 
ATOM   935  N NH2 . ARG B  1 31 ? 7.163   0.064   16.127 1.00 68.58  ? 31  ARG B NH2 1 
ATOM   936  N N   . HIS B  1 32 ? 2.008   2.551   13.537 1.00 43.12  ? 32  HIS B N   1 
ATOM   937  C CA  . HIS B  1 32 ? 0.673   2.031   13.320 1.00 43.56  ? 32  HIS B CA  1 
ATOM   938  C C   . HIS B  1 32 ? -0.395  2.938   13.860 1.00 39.08  ? 32  HIS B C   1 
ATOM   939  O O   . HIS B  1 32 ? -1.399  2.477   14.287 1.00 38.36  ? 32  HIS B O   1 
ATOM   940  C CB  . HIS B  1 32 ? 0.488   0.658   13.935 1.00 52.40  ? 32  HIS B CB  1 
ATOM   941  C CG  . HIS B  1 32 ? 1.053   -0.458  13.123 1.00 63.25  ? 32  HIS B CG  1 
ATOM   942  N ND1 . HIS B  1 32 ? 2.331   -0.920  13.291 1.00 69.64  ? 32  HIS B ND1 1 
ATOM   943  C CD2 . HIS B  1 32 ? 0.501   -1.229  12.164 1.00 67.61  ? 32  HIS B CD2 1 
ATOM   944  C CE1 . HIS B  1 32 ? 2.558   -1.899  12.445 1.00 75.49  ? 32  HIS B CE1 1 
ATOM   945  N NE2 . HIS B  1 32 ? 1.462   -2.110  11.753 1.00 74.22  ? 32  HIS B NE2 1 
ATOM   946  N N   . GLY B  1 33 ? -0.149  4.230   13.845 1.00 27.81  ? 33  GLY B N   1 
ATOM   947  C CA  . GLY B  1 33 ? -1.159  5.192   14.221 1.00 29.62  ? 33  GLY B CA  1 
ATOM   948  C C   . GLY B  1 33 ? -1.052  5.640   15.665 1.00 26.45  ? 33  GLY B C   1 
ATOM   949  O O   . GLY B  1 33 ? -1.830  6.487   16.106 1.00 25.35  ? 33  GLY B O   1 
ATOM   950  N N   . GLY B  1 34 ? -0.108  5.062   16.409 1.00 24.38  ? 34  GLY B N   1 
ATOM   951  C CA  . GLY B  1 34 ? 0.071   5.397   17.819 1.00 22.23  ? 34  GLY B CA  1 
ATOM   952  C C   . GLY B  1 34 ? 0.585   6.811   18.040 1.00 20.37  ? 34  GLY B C   1 
ATOM   953  O O   . GLY B  1 34 ? 1.082   7.489   17.134 1.00 22.31  ? 34  GLY B O   1 
ATOM   954  N N   . ILE B  1 35 ? 0.478   7.255   19.283 1.00 19.33  ? 35  ILE B N   1 
ATOM   955  C CA  . ILE B  1 35 ? 0.908   8.576   19.694 1.00 17.38  ? 35  ILE B CA  1 
ATOM   956  C C   . ILE B  1 35 ? 2.270   8.440   20.379 1.00 19.69  ? 35  ILE B C   1 
ATOM   957  O O   . ILE B  1 35 ? 2.394   7.745   21.404 1.00 20.93  ? 35  ILE B O   1 
ATOM   958  C CB  . ILE B  1 35 ? -0.121  9.163   20.672 1.00 18.06  ? 35  ILE B CB  1 
ATOM   959  C CG1 . ILE B  1 35 ? -1.531  9.144   20.050 1.00 22.86  ? 35  ILE B CG1 1 
ATOM   960  C CG2 . ILE B  1 35 ? 0.288   10.558  21.183 1.00 18.98  ? 35  ILE B CG2 1 
ATOM   961  C CD1 . ILE B  1 35 ? -1.665  9.915   18.732 1.00 24.16  ? 35  ILE B CD1 1 
ATOM   962  N N   . TYR B  1 36 ? 3.283   9.124   19.828 1.00 18.16  ? 36  TYR B N   1 
ATOM   963  C CA  . TYR B  1 36 ? 4.641   9.020   20.355 1.00 18.15  ? 36  TYR B CA  1 
ATOM   964  C C   . TYR B  1 36 ? 5.178   10.371  20.761 1.00 19.30  ? 36  TYR B C   1 
ATOM   965  O O   . TYR B  1 36 ? 4.794   11.400  20.232 1.00 20.51  ? 36  TYR B O   1 
ATOM   966  C CB  . TYR B  1 36 ? 5.573   8.420   19.298 1.00 19.50  ? 36  TYR B CB  1 
ATOM   967  C CG  . TYR B  1 36 ? 5.194   7.012   18.925 1.00 20.99  ? 36  TYR B CG  1 
ATOM   968  C CD1 . TYR B  1 36 ? 4.181   6.770   17.999 1.00 20.52  ? 36  TYR B CD1 1 
ATOM   969  C CD2 . TYR B  1 36 ? 5.825   5.924   19.504 1.00 22.19  ? 36  TYR B CD2 1 
ATOM   970  C CE1 . TYR B  1 36 ? 3.835   5.477   17.658 1.00 22.13  ? 36  TYR B CE1 1 
ATOM   971  C CE2 . TYR B  1 36 ? 5.473   4.639   19.166 1.00 23.48  ? 36  TYR B CE2 1 
ATOM   972  C CZ  . TYR B  1 36 ? 4.483   4.429   18.248 1.00 25.53  ? 36  TYR B CZ  1 
ATOM   973  O OH  . TYR B  1 36 ? 4.124   3.137   17.921 1.00 29.10  ? 36  TYR B OH  1 
ATOM   974  N N   . VAL B  1 37 ? 6.097   10.369  21.718 1.00 17.42  ? 37  VAL B N   1 
ATOM   975  C CA  . VAL B  1 37 ? 6.731   11.602  22.096 1.00 18.51  ? 37  VAL B CA  1 
ATOM   976  C C   . VAL B  1 37 ? 7.729   12.005  21.011 1.00 18.68  ? 37  VAL B C   1 
ATOM   977  O O   . VAL B  1 37 ? 8.676   11.281  20.718 1.00 21.08  ? 37  VAL B O   1 
ATOM   978  C CB  . VAL B  1 37 ? 7.468   11.417  23.420 1.00 18.93  ? 37  VAL B CB  1 
ATOM   979  C CG1 . VAL B  1 37 ? 8.192   12.707  23.793 1.00 19.81  ? 37  VAL B CG1 1 
ATOM   980  C CG2 . VAL B  1 37 ? 6.477   11.001  24.515 1.00 19.95  ? 37  VAL B CG2 1 
ATOM   981  N N   . LYS B  1 38 ? 7.484   13.173  20.423 1.00 18.56  ? 38  LYS B N   1 
ATOM   982  C CA  . LYS B  1 38 ? 8.375   13.703  19.385 1.00 20.43  ? 38  LYS B CA  1 
ATOM   983  C C   . LYS B  1 38 ? 9.567   14.406  20.024 1.00 23.43  ? 38  LYS B C   1 
ATOM   984  O O   . LYS B  1 38 ? 10.711  14.285  19.568 1.00 25.63  ? 38  LYS B O   1 
ATOM   985  C CB  . LYS B  1 38 ? 7.583   14.686  18.534 1.00 22.20  ? 38  LYS B CB  1 
ATOM   986  C CG  . LYS B  1 38 ? 8.396   15.330  17.431 1.00 26.53  ? 38  LYS B CG  1 
ATOM   987  C CD  . LYS B  1 38 ? 7.456   16.097  16.508 1.00 27.31  ? 38  LYS B CD  1 
ATOM   988  C CE  . LYS B  1 38 ? 8.229   16.700  15.349 1.00 34.70  ? 38  LYS B CE  1 
ATOM   989  N NZ  . LYS B  1 38 ? 7.311   17.469  14.454 1.00 41.89  ? 38  LYS B NZ  1 
ATOM   990  N N   . ALA B  1 39 ? 9.284   15.160  21.078 1.00 22.32  ? 39  ALA B N   1 
ATOM   991  C CA  . ALA B  1 39 ? 10.306  15.905  21.787 1.00 24.21  ? 39  ALA B CA  1 
ATOM   992  C C   . ALA B  1 39 ? 9.868   16.107  23.218 1.00 22.02  ? 39  ALA B C   1 
ATOM   993  O O   . ALA B  1 39 ? 8.677   16.247  23.513 1.00 22.26  ? 39  ALA B O   1 
ATOM   994  C CB  . ALA B  1 39 ? 10.549  17.270  21.115 1.00 23.98  ? 39  ALA B CB  1 
ATOM   995  N N   . VAL B  1 40 ? 10.866  16.132  24.093 1.00 23.89  ? 40  VAL B N   1 
ATOM   996  C CA  . VAL B  1 40 ? 10.743  16.609  25.446 1.00 22.41  ? 40  VAL B CA  1 
ATOM   997  C C   . VAL B  1 40 ? 11.257  18.049  25.444 1.00 23.03  ? 40  VAL B C   1 
ATOM   998  O O   . VAL B  1 40 ? 12.422  18.314  25.156 1.00 27.59  ? 40  VAL B O   1 
ATOM   999  C CB  . VAL B  1 40 ? 11.542  15.707  26.394 1.00 26.50  ? 40  VAL B CB  1 
ATOM   1000 C CG1 . VAL B  1 40 ? 11.481  16.231  27.785 1.00 26.83  ? 40  VAL B CG1 1 
ATOM   1001 C CG2 . VAL B  1 40 ? 10.953  14.298  26.326 1.00 27.12  ? 40  VAL B CG2 1 
ATOM   1002 N N   . ILE B  1 41 ? 10.363  18.988  25.712 1.00 20.11  ? 41  ILE B N   1 
ATOM   1003 C CA  . ILE B  1 41 ? 10.701  20.401  25.540 1.00 20.72  ? 41  ILE B CA  1 
ATOM   1004 C C   . ILE B  1 41 ? 11.699  20.878  26.591 1.00 24.35  ? 41  ILE B C   1 
ATOM   1005 O O   . ILE B  1 41 ? 11.488  20.684  27.787 1.00 25.53  ? 41  ILE B O   1 
ATOM   1006 C CB  . ILE B  1 41 ? 9.433   21.261  25.591 1.00 23.71  ? 41  ILE B CB  1 
ATOM   1007 C CG1 . ILE B  1 41 ? 8.426   20.818  24.516 1.00 26.40  ? 41  ILE B CG1 1 
ATOM   1008 C CG2 . ILE B  1 41 ? 9.787   22.749  25.448 1.00 26.76  ? 41  ILE B CG2 1 
ATOM   1009 C CD1 . ILE B  1 41 ? 8.989   20.761  23.106 1.00 31.47  ? 41  ILE B CD1 1 
ATOM   1010 N N   . PRO B  1 42 ? 12.787  21.528  26.162 1.00 23.27  ? 42  PRO B N   1 
ATOM   1011 C CA  . PRO B  1 42 ? 13.736  21.962  27.196 1.00 25.10  ? 42  PRO B CA  1 
ATOM   1012 C C   . PRO B  1 42 ? 13.085  22.852  28.256 1.00 29.30  ? 42  PRO B C   1 
ATOM   1013 O O   . PRO B  1 42 ? 12.230  23.683  27.920 1.00 27.42  ? 42  PRO B O   1 
ATOM   1014 C CB  . PRO B  1 42 ? 14.776  22.756  26.400 1.00 28.11  ? 42  PRO B CB  1 
ATOM   1015 C CG  . PRO B  1 42 ? 14.700  22.195  25.015 1.00 30.11  ? 42  PRO B CG  1 
ATOM   1016 C CD  . PRO B  1 42 ? 13.249  21.848  24.800 1.00 26.56  ? 42  PRO B CD  1 
ATOM   1017 N N   . GLN B  1 43 ? 13.477  22.650  29.514 1.00 28.21  ? 43  GLN B N   1 
ATOM   1018 C CA  . GLN B  1 43 ? 13.015  23.451  30.647 1.00 30.26  ? 43  GLN B CA  1 
ATOM   1019 C C   . GLN B  1 43 ? 11.559  23.126  31.038 1.00 30.32  ? 43  GLN B C   1 
ATOM   1020 O O   . GLN B  1 43 ? 10.993  23.730  31.952 1.00 33.35  ? 43  GLN B O   1 
ATOM   1021 C CB  . GLN B  1 43 ? 13.239  24.961  30.371 1.00 37.86  ? 43  GLN B CB  1 
ATOM   1022 C CG  . GLN B  1 43 ? 14.662  25.271  29.871 1.00 44.24  ? 43  GLN B CG  1 
ATOM   1023 C CD  . GLN B  1 43 ? 14.877  26.718  29.421 1.00 51.11  ? 43  GLN B CD  1 
ATOM   1024 O OE1 . GLN B  1 43 ? 15.698  26.989  28.530 1.00 53.46  ? 43  GLN B OE1 1 
ATOM   1025 N NE2 . GLN B  1 43 ? 14.157  27.652  30.043 1.00 50.48  ? 43  GLN B NE2 1 
ATOM   1026 N N   . GLY B  1 44 ? 10.955  22.155  30.354 1.00 26.66  ? 44  GLY B N   1 
ATOM   1027 C CA  . GLY B  1 44 ? 9.569   21.808  30.617 1.00 23.33  ? 44  GLY B CA  1 
ATOM   1028 C C   . GLY B  1 44 ? 9.384   20.739  31.681 1.00 22.83  ? 44  GLY B C   1 
ATOM   1029 O O   . GLY B  1 44 ? 10.349  20.166  32.186 1.00 23.83  ? 44  GLY B O   1 
ATOM   1030 N N   . ALA B  1 45 ? 8.127   20.445  31.993 1.00 21.06  ? 45  ALA B N   1 
ATOM   1031 C CA  . ALA B  1 45 ? 7.802   19.490  33.061 1.00 22.65  ? 45  ALA B CA  1 
ATOM   1032 C C   . ALA B  1 45 ? 8.346   18.076  32.809 1.00 24.30  ? 45  ALA B C   1 
ATOM   1033 O O   . ALA B  1 45 ? 8.966   17.467  33.690 1.00 23.07  ? 45  ALA B O   1 
ATOM   1034 C CB  . ALA B  1 45 ? 6.309   19.440  33.285 1.00 22.30  ? 45  ALA B CB  1 
ATOM   1035 N N   . ALA B  1 46 ? 8.121   17.560  31.609 1.00 20.06  ? 46  ALA B N   1 
ATOM   1036 C CA  . ALA B  1 46 ? 8.562   16.196  31.279 1.00 19.39  ? 46  ALA B CA  1 
ATOM   1037 C C   . ALA B  1 46 ? 10.085  16.103  31.406 1.00 21.80  ? 46  ALA B C   1 
ATOM   1038 O O   . ALA B  1 46 ? 10.610  15.096  31.881 1.00 23.92  ? 46  ALA B O   1 
ATOM   1039 C CB  . ALA B  1 46 ? 8.093   15.780  29.853 1.00 19.65  ? 46  ALA B CB  1 
ATOM   1040 N N   . GLU B  1 47 ? 10.801  17.140  30.972 1.00 20.72  ? 47  GLU B N   1 
ATOM   1041 C CA  . GLU B  1 47 ? 12.261  17.113  31.034 1.00 24.58  ? 47  GLU B CA  1 
ATOM   1042 C C   . GLU B  1 47 ? 12.748  17.107  32.485 1.00 24.83  ? 47  GLU B C   1 
ATOM   1043 O O   . GLU B  1 47 ? 13.650  16.344  32.846 1.00 27.70  ? 47  GLU B O   1 
ATOM   1044 C CB  . GLU B  1 47 ? 12.884  18.303  30.296 1.00 28.96  ? 47  GLU B CB  1 
ATOM   1045 C CG  . GLU B  1 47 ? 14.409  18.216  30.211 1.00 31.84  ? 47  GLU B CG  1 
ATOM   1046 C CD  . GLU B  1 47 ? 15.045  19.479  29.654 1.00 36.79  ? 47  GLU B CD  1 
ATOM   1047 O OE1 . GLU B  1 47 ? 14.998  20.526  30.333 1.00 39.28  ? 47  GLU B OE1 1 
ATOM   1048 O OE2 . GLU B  1 47 ? 15.598  19.419  28.536 1.00 41.57  ? 47  GLU B OE2 1 
ATOM   1049 N N   . SER B  1 48 ? 12.153  17.972  33.310 1.00 23.78  ? 48  SER B N   1 
ATOM   1050 C CA  . SER B  1 48 ? 12.533  18.084  34.715 1.00 25.93  ? 48  SER B CA  1 
ATOM   1051 C C   . SER B  1 48 ? 12.325  16.768  35.436 1.00 24.08  ? 48  SER B C   1 
ATOM   1052 O O   . SER B  1 48 ? 13.121  16.380  36.314 1.00 27.37  ? 48  SER B O   1 
ATOM   1053 C CB  . SER B  1 48 ? 11.682  19.149  35.403 1.00 27.37  ? 48  SER B CB  1 
ATOM   1054 O OG  . SER B  1 48 ? 12.035  20.452  34.953 1.00 33.43  ? 48  SER B OG  1 
ATOM   1055 N N   . ASP B  1 49 ? 11.222  16.112  35.105 1.00 22.53  ? 49  ASP B N   1 
ATOM   1056 C CA  . ASP B  1 49 ? 10.864  14.862  35.776 1.00 22.30  ? 49  ASP B CA  1 
ATOM   1057 C C   . ASP B  1 49 ? 11.819  13.742  35.372 1.00 25.48  ? 49  ASP B C   1 
ATOM   1058 O O   . ASP B  1 49 ? 12.161  12.877  36.187 1.00 28.61  ? 49  ASP B O   1 
ATOM   1059 C CB  . ASP B  1 49 ? 9.428   14.498  35.455 1.00 22.53  ? 49  ASP B CB  1 
ATOM   1060 C CG  . ASP B  1 49 ? 9.075   13.111  35.917 1.00 25.39  ? 49  ASP B CG  1 
ATOM   1061 O OD1 . ASP B  1 49 ? 9.128   12.177  35.091 1.00 23.46  ? 49  ASP B OD1 1 
ATOM   1062 O OD2 . ASP B  1 49 ? 8.733   12.968  37.109 1.00 26.97  ? 49  ASP B OD2 1 
ATOM   1063 N N   . GLY B  1 50 ? 12.232  13.749  34.109 1.00 24.68  ? 50  GLY B N   1 
ATOM   1064 C CA  . GLY B  1 50 ? 13.328  12.908  33.662 1.00 25.36  ? 50  GLY B CA  1 
ATOM   1065 C C   . GLY B  1 50 ? 12.971  11.493  33.230 1.00 24.87  ? 50  GLY B C   1 
ATOM   1066 O O   . GLY B  1 50 ? 13.848  10.764  32.773 1.00 28.58  ? 50  GLY B O   1 
ATOM   1067 N N   . ARG B  1 51 ? 11.706  11.099  33.341 1.00 20.92  ? 51  ARG B N   1 
ATOM   1068 C CA  . ARG B  1 51 ? 11.293  9.717   32.981 1.00 20.48  ? 51  ARG B CA  1 
ATOM   1069 C C   . ARG B  1 51 ? 10.848  9.484   31.524 1.00 22.02  ? 51  ARG B C   1 
ATOM   1070 O O   . ARG B  1 51 ? 10.893  8.360   31.038 1.00 23.48  ? 51  ARG B O   1 
ATOM   1071 C CB  . ARG B  1 51 ? 10.175  9.237   33.901 1.00 20.33  ? 51  ARG B CB  1 
ATOM   1072 C CG  . ARG B  1 51 ? 10.694  8.879   35.319 1.00 20.41  ? 51  ARG B CG  1 
ATOM   1073 C CD  . ARG B  1 51 ? 9.558   8.509   36.253 1.00 21.58  ? 51  ARG B CD  1 
ATOM   1074 N NE  . ARG B  1 51 ? 8.835   9.698   36.712 1.00 19.56  ? 51  ARG B NE  1 
ATOM   1075 C CZ  . ARG B  1 51 ? 7.818   9.642   37.567 1.00 19.94  ? 51  ARG B CZ  1 
ATOM   1076 N NH1 . ARG B  1 51 ? 7.426   8.463   38.033 1.00 21.21  ? 51  ARG B NH1 1 
ATOM   1077 N NH2 . ARG B  1 51 ? 7.195   10.744  37.938 1.00 19.68  ? 51  ARG B NH2 1 
ATOM   1078 N N   . ILE B  1 52 ? 10.412  10.537  30.855 1.00 18.44  ? 52  ILE B N   1 
ATOM   1079 C CA  . ILE B  1 52 ? 9.831   10.411  29.517 1.00 17.34  ? 52  ILE B CA  1 
ATOM   1080 C C   . ILE B  1 52 ? 10.837  10.927  28.516 1.00 17.89  ? 52  ILE B C   1 
ATOM   1081 O O   . ILE B  1 52 ? 11.509  11.938  28.765 1.00 21.30  ? 52  ILE B O   1 
ATOM   1082 C CB  . ILE B  1 52 ? 8.549   11.229  29.414 1.00 19.35  ? 52  ILE B CB  1 
ATOM   1083 C CG1 . ILE B  1 52 ? 7.474   10.605  30.314 1.00 20.21  ? 52  ILE B CG1 1 
ATOM   1084 C CG2 . ILE B  1 52 ? 8.065   11.279  27.981 1.00 17.93  ? 52  ILE B CG2 1 
ATOM   1085 C CD1 . ILE B  1 52 ? 6.258   11.499  30.549 1.00 23.34  ? 52  ILE B CD1 1 
ATOM   1086 N N   . HIS B  1 53 ? 10.990  10.202  27.416 1.00 19.45  ? 53  HIS B N   1 
ATOM   1087 C CA  . HIS B  1 53 ? 11.920  10.598  26.369 1.00 20.76  ? 53  HIS B CA  1 
ATOM   1088 C C   . HIS B  1 53 ? 11.335  10.475  24.982 1.00 18.99  ? 53  HIS B C   1 
ATOM   1089 O O   . HIS B  1 53 ? 10.364  9.746   24.754 1.00 19.61  ? 53  HIS B O   1 
ATOM   1090 C CB  . HIS B  1 53 ? 13.218  9.778   26.465 1.00 22.80  ? 53  HIS B CB  1 
ATOM   1091 C CG  . HIS B  1 53 ? 13.901  9.934   27.786 1.00 26.21  ? 53  HIS B CG  1 
ATOM   1092 N ND1 . HIS B  1 53 ? 13.586  9.153   28.875 1.00 30.89  ? 53  HIS B ND1 1 
ATOM   1093 C CD2 . HIS B  1 53 ? 14.819  10.834  28.217 1.00 30.15  ? 53  HIS B CD2 1 
ATOM   1094 C CE1 . HIS B  1 53 ? 14.306  9.543   29.914 1.00 30.51  ? 53  HIS B CE1 1 
ATOM   1095 N NE2 . HIS B  1 53 ? 15.068  10.558  29.540 1.00 30.99  ? 53  HIS B NE2 1 
ATOM   1096 N N   . LYS B  1 54 ? 11.966  11.181  24.049 1.00 21.67  ? 54  LYS B N   1 
ATOM   1097 C CA  . LYS B  1 54 ? 11.594  11.085  22.649 1.00 21.36  ? 54  LYS B CA  1 
ATOM   1098 C C   . LYS B  1 54 ? 11.485  9.617   22.273 1.00 21.58  ? 54  LYS B C   1 
ATOM   1099 O O   . LYS B  1 54 ? 12.370  8.798   22.607 1.00 24.08  ? 54  LYS B O   1 
ATOM   1100 C CB  . LYS B  1 54 ? 12.664  11.760  21.797 1.00 24.74  ? 54  LYS B CB  1 
ATOM   1101 C CG  . LYS B  1 54 ? 12.453  11.549  20.320 1.00 26.95  ? 54  LYS B CG  1 
ATOM   1102 C CD  . LYS B  1 54 ? 13.370  12.469  19.520 1.00 33.05  ? 54  LYS B CD  1 
ATOM   1103 C CE  . LYS B  1 54 ? 13.050  12.390  18.027 1.00 38.46  ? 54  LYS B CE  1 
ATOM   1104 N NZ  . LYS B  1 54 ? 14.108  13.061  17.208 1.00 43.96  ? 54  LYS B NZ  1 
ATOM   1105 N N   . GLY B  1 55 ? 10.411  9.261   21.566 1.00 20.23  ? 55  GLY B N   1 
ATOM   1106 C CA  . GLY B  1 55 ? 10.229  7.889   21.129 1.00 23.03  ? 55  GLY B CA  1 
ATOM   1107 C C   . GLY B  1 55 ? 9.354   7.015   22.001 1.00 23.04  ? 55  GLY B C   1 
ATOM   1108 O O   . GLY B  1 55 ? 8.919   5.942   21.574 1.00 23.09  ? 55  GLY B O   1 
ATOM   1109 N N   . ASP B  1 56 ? 9.108   7.456   23.232 1.00 21.62  ? 56  ASP B N   1 
ATOM   1110 C CA  . ASP B  1 56 ? 8.181   6.721   24.094 1.00 18.42  ? 56  ASP B CA  1 
ATOM   1111 C C   . ASP B  1 56 ? 6.774   6.811   23.505 1.00 19.25  ? 56  ASP B C   1 
ATOM   1112 O O   . ASP B  1 56 ? 6.415   7.840   22.880 1.00 22.50  ? 56  ASP B O   1 
ATOM   1113 C CB  . ASP B  1 56 ? 8.185   7.330   25.482 1.00 18.41  ? 56  ASP B CB  1 
ATOM   1114 C CG  . ASP B  1 56 ? 9.455   7.046   26.254 1.00 21.44  ? 56  ASP B CG  1 
ATOM   1115 O OD1 . ASP B  1 56 ? 9.634   7.692   27.311 1.00 21.31  ? 56  ASP B OD1 1 
ATOM   1116 O OD2 . ASP B  1 56 ? 10.257  6.193   25.823 1.00 24.06  ? 56  ASP B OD2 1 
ATOM   1117 N N   . ARG B  1 57 ? 5.973   5.770   23.708 1.00 19.44  ? 57  ARG B N   1 
ATOM   1118 C CA  . ARG B  1 57 ? 4.591   5.777   23.220 1.00 20.04  ? 57  ARG B CA  1 
ATOM   1119 C C   . ARG B  1 57 ? 3.625   6.139   24.347 1.00 19.89  ? 57  ARG B C   1 
ATOM   1120 O O   . ARG B  1 57 ? 3.734   5.608   25.442 1.00 19.78  ? 57  ARG B O   1 
ATOM   1121 C CB  . ARG B  1 57 ? 4.216   4.422   22.660 1.00 21.33  ? 57  ARG B CB  1 
ATOM   1122 C CG  . ARG B  1 57 ? 2.890   4.481   21.961 1.00 22.94  ? 57  ARG B CG  1 
ATOM   1123 C CD  . ARG B  1 57 ? 2.574   3.164   21.303 1.00 27.39  ? 57  ARG B CD  1 
ATOM   1124 N NE  . ARG B  1 57 ? 1.198   3.184   20.862 1.00 26.78  ? 57  ARG B NE  1 
ATOM   1125 C CZ  . ARG B  1 57 ? 0.704   2.349   19.963 1.00 32.56  ? 57  ARG B CZ  1 
ATOM   1126 N NH1 . ARG B  1 57 ? 1.496   1.452   19.392 1.00 36.07  ? 57  ARG B NH1 1 
ATOM   1127 N NH2 . ARG B  1 57 ? -0.570  2.432   19.625 1.00 34.89  ? 57  ARG B NH2 1 
ATOM   1128 N N   . VAL B  1 58 ? 2.702   7.064   24.098 1.00 16.12  ? 58  VAL B N   1 
ATOM   1129 C CA  . VAL B  1 58 ? 1.707   7.409   25.116 1.00 14.71  ? 58  VAL B CA  1 
ATOM   1130 C C   . VAL B  1 58 ? 0.476   6.551   24.889 1.00 17.64  ? 58  VAL B C   1 
ATOM   1131 O O   . VAL B  1 58 ? -0.240  6.719   23.885 1.00 18.55  ? 58  VAL B O   1 
ATOM   1132 C CB  . VAL B  1 58 ? 1.296   8.889   25.031 1.00 15.26  ? 58  VAL B CB  1 
ATOM   1133 C CG1 . VAL B  1 58 ? 0.314   9.209   26.135 1.00 16.82  ? 58  VAL B CG1 1 
ATOM   1134 C CG2 . VAL B  1 58 ? 2.525   9.818   25.080 1.00 21.86  ? 58  VAL B CG2 1 
ATOM   1135 N N   . LEU B  1 59 ? 0.220   5.627   25.825 1.00 16.55  ? 59  LEU B N   1 
ATOM   1136 C CA  . LEU B  1 59 ? -0.857  4.661   25.664 1.00 17.22  ? 59  LEU B CA  1 
ATOM   1137 C C   . LEU B  1 59 ? -2.184  5.167   26.237 1.00 16.20  ? 59  LEU B C   1 
ATOM   1138 O O   . LEU B  1 59 ? -3.264  4.805   25.727 1.00 17.22  ? 59  LEU B O   1 
ATOM   1139 C CB  . LEU B  1 59 ? -0.503  3.334   26.346 1.00 18.97  ? 59  LEU B CB  1 
ATOM   1140 C CG  . LEU B  1 59 ? 0.735   2.609   25.832 1.00 21.30  ? 59  LEU B CG  1 
ATOM   1141 C CD1 . LEU B  1 59 ? 1.011   1.435   26.775 1.00 22.34  ? 59  LEU B CD1 1 
ATOM   1142 C CD2 . LEU B  1 59 ? 0.517   2.137   24.438 1.00 24.41  ? 59  LEU B CD2 1 
ATOM   1143 N N   . ALA B  1 60 ? -2.113  5.979   27.293 1.00 16.29  ? 60  ALA B N   1 
ATOM   1144 C CA  . ALA B  1 60 ? -3.356  6.438   27.929 1.00 15.15  ? 60  ALA B CA  1 
ATOM   1145 C C   . ALA B  1 60 ? -3.106  7.701   28.720 1.00 15.52  ? 60  ALA B C   1 
ATOM   1146 O O   . ALA B  1 60 ? -1.981  7.978   29.110 1.00 16.29  ? 60  ALA B O   1 
ATOM   1147 C CB  . ALA B  1 60 ? -3.968  5.338   28.842 1.00 16.13  ? 60  ALA B CB  1 
ATOM   1148 N N   . VAL B  1 61 ? -4.182  8.434   28.965 1.00 16.46  ? 61  VAL B N   1 
ATOM   1149 C CA  . VAL B  1 61 ? -4.123  9.685   29.709 1.00 16.04  ? 61  VAL B CA  1 
ATOM   1150 C C   . VAL B  1 61 ? -5.256  9.618   30.702 1.00 17.34  ? 61  VAL B C   1 
ATOM   1151 O O   . VAL B  1 61 ? -6.407  9.449   30.308 1.00 17.65  ? 61  VAL B O   1 
ATOM   1152 C CB  . VAL B  1 61 ? -4.350  10.886  28.775 1.00 16.81  ? 61  VAL B CB  1 
ATOM   1153 C CG1 . VAL B  1 61 ? -4.363  12.185  29.591 1.00 18.54  ? 61  VAL B CG1 1 
ATOM   1154 C CG2 . VAL B  1 61 ? -3.249  10.961  27.712 1.00 19.00  ? 61  VAL B CG2 1 
ATOM   1155 N N   . ASN B  1 62 ? -4.924  9.756   31.991 1.00 15.94  ? 62  ASN B N   1 
ATOM   1156 C CA  . ASN B  1 62 ? -5.923  9.745   33.063 1.00 16.84  ? 62  ASN B CA  1 
ATOM   1157 C C   . ASN B  1 62 ? -6.884  8.568   32.911 1.00 18.07  ? 62  ASN B C   1 
ATOM   1158 O O   . ASN B  1 62 ? -8.099  8.693   33.076 1.00 19.00  ? 62  ASN B O   1 
ATOM   1159 C CB  . ASN B  1 62 ? -6.669  11.079  33.153 1.00 18.49  ? 62  ASN B CB  1 
ATOM   1160 C CG  . ASN B  1 62 ? -5.802  12.177  33.674 1.00 20.66  ? 62  ASN B CG  1 
ATOM   1161 O OD1 . ASN B  1 62 ? -4.783  11.903  34.308 1.00 20.03  ? 62  ASN B OD1 1 
ATOM   1162 N ND2 . ASN B  1 62 ? -6.209  13.435  33.452 1.00 21.02  ? 62  ASN B ND2 1 
ATOM   1163 N N   . GLY B  1 63 ? -6.316  7.418   32.587 1.00 16.90  ? 63  GLY B N   1 
ATOM   1164 C CA  . GLY B  1 63 ? -7.081  6.185   32.624 1.00 18.51  ? 63  GLY B CA  1 
ATOM   1165 C C   . GLY B  1 63 ? -7.832  5.802   31.366 1.00 18.56  ? 63  GLY B C   1 
ATOM   1166 O O   . GLY B  1 63 ? -8.517  4.766   31.367 1.00 19.02  ? 63  GLY B O   1 
ATOM   1167 N N   . VAL B  1 64 ? -7.717  6.622   30.326 1.00 16.66  ? 64  VAL B N   1 
ATOM   1168 C CA  . VAL B  1 64 ? -8.427  6.407   29.059 1.00 15.54  ? 64  VAL B CA  1 
ATOM   1169 C C   . VAL B  1 64 ? -7.418  6.210   27.965 1.00 18.18  ? 64  VAL B C   1 
ATOM   1170 O O   . VAL B  1 64 ? -6.537  7.041   27.772 1.00 16.06  ? 64  VAL B O   1 
ATOM   1171 C CB  . VAL B  1 64 ? -9.327  7.616   28.724 1.00 20.35  ? 64  VAL B CB  1 
ATOM   1172 C CG1 . VAL B  1 64 ? -10.108 7.371   27.415 1.00 20.53  ? 64  VAL B CG1 1 
ATOM   1173 C CG2 . VAL B  1 64 ? -10.314 7.844   29.886 1.00 23.53  ? 64  VAL B CG2 1 
ATOM   1174 N N   . SER B  1 65 ? -7.572  5.102   27.244 1.00 17.30  ? 65  SER B N   1 
ATOM   1175 C CA  . SER B  1 65 ? -6.719  4.813   26.096 1.00 18.12  ? 65  SER B CA  1 
ATOM   1176 C C   . SER B  1 65 ? -6.802  5.867   25.020 1.00 17.42  ? 65  SER B C   1 
ATOM   1177 O O   . SER B  1 65 ? -7.864  6.435   24.762 1.00 18.53  ? 65  SER B O   1 
ATOM   1178 C CB  . SER B  1 65 ? -7.177  3.498   25.460 1.00 18.81  ? 65  SER B CB  1 
ATOM   1179 O OG  . SER B  1 65 ? -6.402  3.177   24.301 1.00 23.03  ? 65  SER B OG  1 
ATOM   1180 N N   . LEU B  1 66 ? -5.668  6.085   24.363 1.00 16.10  ? 66  LEU B N   1 
ATOM   1181 C CA  . LEU B  1 66 ? -5.588  6.920   23.161 1.00 19.22  ? 66  LEU B CA  1 
ATOM   1182 C C   . LEU B  1 66 ? -5.914  6.145   21.874 1.00 22.78  ? 66  LEU B C   1 
ATOM   1183 O O   . LEU B  1 66 ? -5.719  6.675   20.784 1.00 25.05  ? 66  LEU B O   1 
ATOM   1184 C CB  . LEU B  1 66 ? -4.199  7.526   23.028 1.00 21.45  ? 66  LEU B CB  1 
ATOM   1185 C CG  . LEU B  1 66 ? -3.897  8.540   24.124 1.00 20.50  ? 66  LEU B CG  1 
ATOM   1186 C CD1 . LEU B  1 66 ? -2.606  9.218   23.829 1.00 19.18  ? 66  LEU B CD1 1 
ATOM   1187 C CD2 . LEU B  1 66 ? -5.027  9.577   24.160 1.00 28.95  ? 66  LEU B CD2 1 
ATOM   1188 N N   . GLU B  1 67 ? -6.408  4.919   21.985 1.00 23.57  ? 67  GLU B N   1 
ATOM   1189 C CA  . GLU B  1 67 ? -6.685  4.141   20.780 1.00 25.78  ? 67  GLU B CA  1 
ATOM   1190 C C   . GLU B  1 67 ? -7.696  4.825   19.892 1.00 26.62  ? 67  GLU B C   1 
ATOM   1191 O O   . GLU B  1 67 ? -8.750  5.288   20.344 1.00 27.46  ? 67  GLU B O   1 
ATOM   1192 C CB  . GLU B  1 67 ? -7.137  2.729   21.107 1.00 27.44  ? 67  GLU B CB  1 
ATOM   1193 C CG  . GLU B  1 67 ? -7.740  2.056   19.893 1.00 30.64  ? 67  GLU B CG  1 
ATOM   1194 C CD  . GLU B  1 67 ? -8.084  0.626   20.139 1.00 35.73  ? 67  GLU B CD  1 
ATOM   1195 O OE1 . GLU B  1 67 ? -8.968  0.092   19.438 1.00 39.59  ? 67  GLU B OE1 1 
ATOM   1196 O OE2 . GLU B  1 67 ? -7.442  0.039   21.010 1.00 32.14  ? 67  GLU B OE2 1 
ATOM   1197 N N   . GLY B  1 68 ? -7.360  4.914   18.612 1.00 25.51  ? 68  GLY B N   1 
ATOM   1198 C CA  . GLY B  1 68 ? -8.253  5.563   17.676 1.00 28.25  ? 68  GLY B CA  1 
ATOM   1199 C C   . GLY B  1 68 ? -8.110  7.073   17.595 1.00 27.25  ? 68  GLY B C   1 
ATOM   1200 O O   . GLY B  1 68 ? -8.814  7.724   16.816 1.00 30.34  ? 68  GLY B O   1 
ATOM   1201 N N   . ALA B  1 69 ? -7.207  7.650   18.389 1.00 23.54  ? 69  ALA B N   1 
ATOM   1202 C CA  . ALA B  1 69 ? -7.030  9.088   18.366 1.00 24.35  ? 69  ALA B CA  1 
ATOM   1203 C C   . ALA B  1 69 ? -6.314  9.539   17.122 1.00 24.60  ? 69  ALA B C   1 
ATOM   1204 O O   . ALA B  1 69 ? -5.285  8.975   16.742 1.00 25.29  ? 69  ALA B O   1 
ATOM   1205 C CB  . ALA B  1 69 ? -6.233  9.572   19.590 1.00 24.78  ? 69  ALA B CB  1 
ATOM   1206 N N   . THR B  1 70 ? -6.826  10.601  16.523 1.00 25.34  ? 70  THR B N   1 
ATOM   1207 C CA  . THR B  1 70 ? -6.043  11.308  15.533 1.00 25.18  ? 70  THR B CA  1 
ATOM   1208 C C   . THR B  1 70 ? -5.026  12.163  16.265 1.00 22.38  ? 70  THR B C   1 
ATOM   1209 O O   . THR B  1 70 ? -5.090  12.329  17.480 1.00 24.93  ? 70  THR B O   1 
ATOM   1210 C CB  . THR B  1 70 ? -6.900  12.251  14.682 1.00 28.71  ? 70  THR B CB  1 
ATOM   1211 O OG1 . THR B  1 70 ? -7.432  13.284  15.517 1.00 28.44  ? 70  THR B OG1 1 
ATOM   1212 C CG2 . THR B  1 70 ? -8.054  11.488  14.042 1.00 33.14  ? 70  THR B CG2 1 
ATOM   1213 N N   . HIS B  1 71 ? -4.091  12.719  15.520 1.00 23.33  ? 71  HIS B N   1 
ATOM   1214 C CA  . HIS B  1 71 ? -3.130  13.620  16.105 1.00 25.28  ? 71  HIS B CA  1 
ATOM   1215 C C   . HIS B  1 71 ? -3.804  14.762  16.867 1.00 26.48  ? 71  HIS B C   1 
ATOM   1216 O O   . HIS B  1 71 ? -3.491  15.029  18.030 1.00 24.27  ? 71  HIS B O   1 
ATOM   1217 C CB  . HIS B  1 71 ? -2.229  14.205  15.025 1.00 28.36  ? 71  HIS B CB  1 
ATOM   1218 C CG  . HIS B  1 71 ? -1.098  14.987  15.593 1.00 30.46  ? 71  HIS B CG  1 
ATOM   1219 N ND1 . HIS B  1 71 ? -1.122  16.359  15.706 1.00 35.06  ? 71  HIS B ND1 1 
ATOM   1220 C CD2 . HIS B  1 71 ? 0.066   14.582  16.147 1.00 31.59  ? 71  HIS B CD2 1 
ATOM   1221 C CE1 . HIS B  1 71 ? -0.009  16.768  16.291 1.00 34.44  ? 71  HIS B CE1 1 
ATOM   1222 N NE2 . HIS B  1 71 ? 0.728   15.709  16.567 1.00 35.61  ? 71  HIS B NE2 1 
ATOM   1223 N N   . LYS B  1 72 ? -4.711  15.475  16.207 1.00 29.42  ? 72  LYS B N   1 
ATOM   1224 C CA  . LYS B  1 72 ? -5.391  16.590  16.866 1.00 28.75  ? 72  LYS B CA  1 
ATOM   1225 C C   . LYS B  1 72 ? -6.093  16.130  18.132 1.00 28.65  ? 72  LYS B C   1 
ATOM   1226 O O   . LYS B  1 72 ? -6.015  16.795  19.169 1.00 28.79  ? 72  LYS B O   1 
ATOM   1227 C CB  . LYS B  1 72 ? -6.423  17.224  15.921 1.00 31.87  ? 72  LYS B CB  1 
ATOM   1228 C CG  . LYS B  1 72 ? -7.021  18.535  16.404 1.00 42.46  ? 72  LYS B CG  1 
ATOM   1229 C CD  . LYS B  1 72 ? -7.816  18.416  17.711 1.00 48.39  ? 72  LYS B CD  1 
ATOM   1230 C CE  . LYS B  1 72 ? -9.207  17.812  17.537 1.00 51.97  ? 72  LYS B CE  1 
ATOM   1231 N NZ  . LYS B  1 72 ? -9.776  17.368  18.848 1.00 52.54  ? 72  LYS B NZ  1 
ATOM   1232 N N   . GLN B  1 73 ? -6.796  15.004  18.052 1.00 26.45  ? 73  GLN B N   1 
ATOM   1233 C CA  . GLN B  1 73 ? -7.515  14.478  19.200 1.00 25.55  ? 73  GLN B CA  1 
ATOM   1234 C C   . GLN B  1 73 ? -6.579  14.181  20.380 1.00 24.19  ? 73  GLN B C   1 
ATOM   1235 O O   . GLN B  1 73 ? -6.931  14.457  21.517 1.00 26.70  ? 73  GLN B O   1 
ATOM   1236 C CB  . GLN B  1 73 ? -8.297  13.228  18.823 1.00 31.43  ? 73  GLN B CB  1 
ATOM   1237 C CG  . GLN B  1 73 ? -9.454  13.538  17.884 1.00 35.85  ? 73  GLN B CG  1 
ATOM   1238 C CD  . GLN B  1 73 ? -10.131 12.286  17.354 1.00 40.48  ? 73  GLN B CD  1 
ATOM   1239 O OE1 . GLN B  1 73 ? -9.546  11.201  17.340 1.00 37.89  ? 73  GLN B OE1 1 
ATOM   1240 N NE2 . GLN B  1 73 ? -11.374 12.438  16.900 1.00 45.64  ? 73  GLN B NE2 1 
ATOM   1241 N N   . ALA B  1 74 ? -5.396  13.633  20.087 1.00 22.32  ? 74  ALA B N   1 
ATOM   1242 C CA  . ALA B  1 74 ? -4.416  13.304  21.145 1.00 20.81  ? 74  ALA B CA  1 
ATOM   1243 C C   . ALA B  1 74 ? -3.907  14.566  21.820 1.00 24.05  ? 74  ALA B C   1 
ATOM   1244 O O   . ALA B  1 74 ? -3.819  14.645  23.060 1.00 23.85  ? 74  ALA B O   1 
ATOM   1245 C CB  . ALA B  1 74 ? -3.264  12.511  20.562 1.00 20.79  ? 74  ALA B CB  1 
ATOM   1246 N N   . VAL B  1 75 ? -3.585  15.561  21.008 1.00 23.15  ? 75  VAL B N   1 
ATOM   1247 C CA  . VAL B  1 75 ? -3.116  16.834  21.527 1.00 24.42  ? 75  VAL B CA  1 
ATOM   1248 C C   . VAL B  1 75 ? -4.163  17.441  22.433 1.00 25.89  ? 75  VAL B C   1 
ATOM   1249 O O   . VAL B  1 75 ? -3.849  17.870  23.530 1.00 24.78  ? 75  VAL B O   1 
ATOM   1250 C CB  . VAL B  1 75 ? -2.773  17.785  20.382 1.00 22.95  ? 75  VAL B CB  1 
ATOM   1251 C CG1 . VAL B  1 75 ? -2.598  19.197  20.899 1.00 25.44  ? 75  VAL B CG1 1 
ATOM   1252 C CG2 . VAL B  1 75 ? -1.526  17.284  19.670 1.00 23.14  ? 75  VAL B CG2 1 
ATOM   1253 N N   . GLU B  1 76 ? -5.423  17.423  22.005 1.00 24.45  ? 76  GLU B N   1 
ATOM   1254 C CA  . GLU B  1 76 ? -6.496  17.955  22.843 1.00 28.07  ? 76  GLU B CA  1 
ATOM   1255 C C   . GLU B  1 76 ? -6.759  17.125  24.095 1.00 26.94  ? 76  GLU B C   1 
ATOM   1256 O O   . GLU B  1 76 ? -7.113  17.672  25.128 1.00 25.41  ? 76  GLU B O   1 
ATOM   1257 C CB  . GLU B  1 76 ? -7.784  18.133  22.047 1.00 34.83  ? 76  GLU B CB  1 
ATOM   1258 C CG  . GLU B  1 76 ? -7.649  19.173  20.941 1.00 43.67  ? 76  GLU B CG  1 
ATOM   1259 C CD  . GLU B  1 76 ? -7.244  20.555  21.474 1.00 53.16  ? 76  GLU B CD  1 
ATOM   1260 O OE1 . GLU B  1 76 ? -6.312  21.179  20.904 1.00 55.36  ? 76  GLU B OE1 1 
ATOM   1261 O OE2 . GLU B  1 76 ? -7.856  21.019  22.465 1.00 55.05  ? 76  GLU B OE2 1 
ATOM   1262 N N   . THR B  1 77 ? -6.605  15.808  23.998 1.00 23.68  ? 77  THR B N   1 
ATOM   1263 C CA  . THR B  1 77 ? -6.785  14.947  25.156 1.00 23.48  ? 77  THR B CA  1 
ATOM   1264 C C   . THR B  1 77 ? -5.728  15.271  26.207 1.00 24.07  ? 77  THR B C   1 
ATOM   1265 O O   . THR B  1 77 ? -6.024  15.307  27.408 1.00 26.26  ? 77  THR B O   1 
ATOM   1266 C CB  . THR B  1 77 ? -6.758  13.459  24.768 1.00 24.33  ? 77  THR B CB  1 
ATOM   1267 O OG1 . THR B  1 77 ? -7.943  13.163  24.027 1.00 25.84  ? 77  THR B OG1 1 
ATOM   1268 C CG2 . THR B  1 77 ? -6.673  12.553  26.023 1.00 25.48  ? 77  THR B CG2 1 
ATOM   1269 N N   . LEU B  1 78 ? -4.508  15.566  25.760 1.00 22.41  ? 78  LEU B N   1 
ATOM   1270 C CA  . LEU B  1 78 ? -3.446  15.919  26.704 1.00 22.67  ? 78  LEU B CA  1 
ATOM   1271 C C   . LEU B  1 78 ? -3.700  17.279  27.344 1.00 26.09  ? 78  LEU B C   1 
ATOM   1272 O O   . LEU B  1 78 ? -3.429  17.468  28.537 1.00 27.87  ? 78  LEU B O   1 
ATOM   1273 C CB  . LEU B  1 78 ? -2.083  15.918  26.014 1.00 24.46  ? 78  LEU B CB  1 
ATOM   1274 C CG  . LEU B  1 78 ? -1.578  14.512  25.703 1.00 25.07  ? 78  LEU B CG  1 
ATOM   1275 C CD1 . LEU B  1 78 ? -0.509  14.549  24.632 1.00 26.69  ? 78  LEU B CD1 1 
ATOM   1276 C CD2 . LEU B  1 78 ? -1.042  13.830  26.972 1.00 21.68  ? 78  LEU B CD2 1 
ATOM   1277 N N   . ARG B  1 79 ? -4.222  18.218  26.560 1.00 23.75  ? 79  ARG B N   1 
ATOM   1278 C CA  . ARG B  1 79 ? -4.529  19.562  27.051 1.00 26.72  ? 79  ARG B CA  1 
ATOM   1279 C C   . ARG B  1 79 ? -5.707  19.608  28.021 1.00 31.23  ? 79  ARG B C   1 
ATOM   1280 O O   . ARG B  1 79 ? -5.722  20.397  28.978 1.00 29.94  ? 79  ARG B O   1 
ATOM   1281 C CB  . ARG B  1 79 ? -4.826  20.495  25.882 1.00 30.39  ? 79  ARG B CB  1 
ATOM   1282 C CG  . ARG B  1 79 ? -3.633  20.793  24.997 1.00 34.50  ? 79  ARG B CG  1 
ATOM   1283 C CD  . ARG B  1 79 ? -3.928  22.003  24.131 1.00 44.87  ? 79  ARG B CD  1 
ATOM   1284 N NE  . ARG B  1 79 ? -2.689  22.625  23.685 1.00 51.42  ? 79  ARG B NE  1 
ATOM   1285 C CZ  . ARG B  1 79 ? -2.580  23.883  23.274 1.00 54.46  ? 79  ARG B CZ  1 
ATOM   1286 N NH1 . ARG B  1 79 ? -3.644  24.678  23.242 1.00 55.95  ? 79  ARG B NH1 1 
ATOM   1287 N NH2 . ARG B  1 79 ? -1.398  24.345  22.898 1.00 56.24  ? 79  ARG B NH2 1 
ATOM   1288 N N   . ASN B  1 80 ? -6.713  18.786  27.754 1.00 30.62  ? 80  ASN B N   1 
ATOM   1289 C CA  . ASN B  1 80 ? -7.939  18.779  28.548 1.00 35.09  ? 80  ASN B CA  1 
ATOM   1290 C C   . ASN B  1 80 ? -7.822  17.916  29.808 1.00 34.29  ? 80  ASN B C   1 
ATOM   1291 O O   . ASN B  1 80 ? -8.523  16.903  30.000 1.00 34.25  ? 80  ASN B O   1 
ATOM   1292 C CB  . ASN B  1 80 ? -9.130  18.371  27.682 1.00 43.13  ? 80  ASN B CB  1 
ATOM   1293 C CG  . ASN B  1 80 ? -9.422  19.394  26.595 1.00 51.50  ? 80  ASN B CG  1 
ATOM   1294 O OD1 . ASN B  1 80 ? -9.146  20.587  26.758 1.00 52.60  ? 80  ASN B OD1 1 
ATOM   1295 N ND2 . ASN B  1 80 ? -9.975  18.932  25.474 1.00 55.85  ? 80  ASN B ND2 1 
ATOM   1296 N N   . THR B  1 81 ? -6.895  18.331  30.660 1.00 30.31  ? 81  THR B N   1 
ATOM   1297 C CA  . THR B  1 81 ? -6.538  17.622  31.872 1.00 26.47  ? 81  THR B CA  1 
ATOM   1298 C C   . THR B  1 81 ? -6.350  18.694  32.931 1.00 27.90  ? 81  THR B C   1 
ATOM   1299 O O   . THR B  1 81 ? -6.345  19.893  32.615 1.00 30.86  ? 81  THR B O   1 
ATOM   1300 C CB  . THR B  1 81 ? -5.201  16.850  31.700 1.00 25.91  ? 81  THR B CB  1 
ATOM   1301 O OG1 . THR B  1 81 ? -4.199  17.739  31.186 1.00 29.64  ? 81  THR B OG1 1 
ATOM   1302 C CG2 . THR B  1 81 ? -5.342  15.662  30.748 1.00 23.53  ? 81  THR B CG2 1 
ATOM   1303 N N   . GLY B  1 82 ? -6.209  18.275  34.179 1.00 24.76  ? 82  GLY B N   1 
ATOM   1304 C CA  . GLY B  1 82 ? -5.906  19.177  35.268 1.00 26.02  ? 82  GLY B CA  1 
ATOM   1305 C C   . GLY B  1 82 ? -4.416  19.382  35.419 1.00 23.86  ? 82  GLY B C   1 
ATOM   1306 O O   . GLY B  1 82 ? -3.648  19.150  34.468 1.00 22.37  ? 82  GLY B O   1 
ATOM   1307 N N   . GLN B  1 83 ? -4.007  19.786  36.617 1.00 23.57  ? 83  GLN B N   1 
ATOM   1308 C CA  . GLN B  1 83 ? -2.640  20.242  36.843 1.00 24.62  ? 83  GLN B CA  1 
ATOM   1309 C C   . GLN B  1 83 ? -1.638  19.091  36.971 1.00 23.68  ? 83  GLN B C   1 
ATOM   1310 O O   . GLN B  1 83 ? -0.468  19.243  36.607 1.00 25.67  ? 83  GLN B O   1 
ATOM   1311 C CB  . GLN B  1 83 ? -2.580  21.188  38.044 1.00 27.91  ? 83  GLN B CB  1 
ATOM   1312 C CG  . GLN B  1 83 ? -1.202  21.381  38.610 1.00 24.76  ? 83  GLN B CG  1 
ATOM   1313 C CD  . GLN B  1 83 ? -0.215  22.024  37.667 1.00 28.39  ? 83  GLN B CD  1 
ATOM   1314 O OE1 . GLN B  1 83 ? -0.582  22.643  36.652 1.00 27.68  ? 83  GLN B OE1 1 
ATOM   1315 N NE2 . GLN B  1 83 ? 1.070   21.911  38.019 1.00 28.45  ? 83  GLN B NE2 1 
ATOM   1316 N N   A VAL B  1 84 ? -2.127  17.951  37.442 0.60 19.18  ? 84  VAL B N   1 
ATOM   1317 N N   B VAL B  1 84 ? -2.081  17.943  37.483 0.40 19.38  ? 84  VAL B N   1 
ATOM   1318 C CA  A VAL B  1 84 ? -1.329  16.732  37.480 0.60 17.60  ? 84  VAL B CA  1 
ATOM   1319 C CA  B VAL B  1 84 ? -1.226  16.745  37.484 0.40 17.35  ? 84  VAL B CA  1 
ATOM   1320 C C   A VAL B  1 84 ? -2.006  15.714  36.568 0.60 18.68  ? 84  VAL B C   1 
ATOM   1321 C C   B VAL B  1 84 ? -1.911  15.587  36.734 0.40 18.33  ? 84  VAL B C   1 
ATOM   1322 O O   A VAL B  1 84 ? -3.240  15.573  36.578 0.60 18.33  ? 84  VAL B O   1 
ATOM   1323 O O   B VAL B  1 84 ? -3.047  15.216  37.037 0.40 20.39  ? 84  VAL B O   1 
ATOM   1324 C CB  A VAL B  1 84 ? -1.196  16.222  38.913 0.60 20.17  ? 84  VAL B CB  1 
ATOM   1325 C CB  B VAL B  1 84 ? -0.767  16.324  38.909 0.40 20.32  ? 84  VAL B CB  1 
ATOM   1326 C CG1 A VAL B  1 84 ? -0.689  14.776  38.961 0.60 19.41  ? 84  VAL B CG1 1 
ATOM   1327 C CG1 B VAL B  1 84 ? -1.953  15.916  39.776 0.40 20.65  ? 84  VAL B CG1 1 
ATOM   1328 C CG2 A VAL B  1 84 ? -0.270  17.147  39.654 0.60 16.77  ? 84  VAL B CG2 1 
ATOM   1329 C CG2 B VAL B  1 84 ? 0.262   15.201  38.832 0.40 18.51  ? 84  VAL B CG2 1 
ATOM   1330 N N   . VAL B  1 85 ? -1.203  15.045  35.749 1.00 16.95  ? 85  VAL B N   1 
ATOM   1331 C CA  . VAL B  1 85 ? -1.774  14.132  34.747 1.00 15.92  ? 85  VAL B CA  1 
ATOM   1332 C C   . VAL B  1 85 ? -1.159  12.766  34.893 1.00 17.88  ? 85  VAL B C   1 
ATOM   1333 O O   . VAL B  1 85 ? 0.064   12.636  34.966 1.00 18.85  ? 85  VAL B O   1 
ATOM   1334 C CB  . VAL B  1 85 ? -1.511  14.661  33.339 1.00 16.17  ? 85  VAL B CB  1 
ATOM   1335 C CG1 . VAL B  1 85 ? -2.141  13.741  32.265 1.00 18.70  ? 85  VAL B CG1 1 
ATOM   1336 C CG2 . VAL B  1 85 ? -2.038  16.173  33.181 1.00 17.21  ? 85  VAL B CG2 1 
ATOM   1337 N N   . HIS B  1 86 ? -2.014  11.747  34.900 1.00 16.55  ? 86  HIS B N   1 
ATOM   1338 C CA  . HIS B  1 86 ? -1.555  10.350  34.936 1.00 18.12  ? 86  HIS B CA  1 
ATOM   1339 C C   . HIS B  1 86 ? -1.316  9.913   33.505 1.00 18.05  ? 86  HIS B C   1 
ATOM   1340 O O   . HIS B  1 86 ? -2.219  10.039  32.657 1.00 17.77  ? 86  HIS B O   1 
ATOM   1341 C CB  . HIS B  1 86 ? -2.644  9.488   35.559 1.00 18.63  ? 86  HIS B CB  1 
ATOM   1342 C CG  . HIS B  1 86 ? -2.196  8.096   35.851 1.00 20.89  ? 86  HIS B CG  1 
ATOM   1343 N ND1 . HIS B  1 86 ? -3.084  7.072   36.093 1.00 24.67  ? 86  HIS B ND1 1 
ATOM   1344 C CD2 . HIS B  1 86 ? -0.957  7.557   35.957 1.00 25.14  ? 86  HIS B CD2 1 
ATOM   1345 C CE1 . HIS B  1 86 ? -2.410  5.958   36.340 1.00 27.10  ? 86  HIS B CE1 1 
ATOM   1346 N NE2 . HIS B  1 86 ? -1.121  6.227   36.281 1.00 25.16  ? 86  HIS B NE2 1 
ATOM   1347 N N   . LEU B  1 87 ? -0.104  9.451   33.206 1.00 16.11  ? 87  LEU B N   1 
ATOM   1348 C CA  . LEU B  1 87 ? 0.215   9.025   31.818 1.00 13.16  ? 87  LEU B CA  1 
ATOM   1349 C C   . LEU B  1 87 ? 0.719   7.591   31.854 1.00 17.38  ? 87  LEU B C   1 
ATOM   1350 O O   . LEU B  1 87 ? 1.518   7.212   32.727 1.00 17.30  ? 87  LEU B O   1 
ATOM   1351 C CB  . LEU B  1 87 ? 1.294   9.915   31.200 1.00 13.54  ? 87  LEU B CB  1 
ATOM   1352 C CG  . LEU B  1 87 ? 0.957   11.407  31.086 1.00 14.97  ? 87  LEU B CG  1 
ATOM   1353 C CD1 . LEU B  1 87 ? 2.209   12.186  30.731 1.00 20.29  ? 87  LEU B CD1 1 
ATOM   1354 C CD2 . LEU B  1 87 ? -0.114  11.567  30.008 1.00 18.84  ? 87  LEU B CD2 1 
ATOM   1355 N N   . LEU B  1 88 ? 0.255   6.784   30.913 1.00 15.58  ? 88  LEU B N   1 
ATOM   1356 C CA  . LEU B  1 88 ? 0.726   5.404   30.800 1.00 15.48  ? 88  LEU B CA  1 
ATOM   1357 C C   . LEU B  1 88 ? 1.517   5.354   29.516 1.00 15.45  ? 88  LEU B C   1 
ATOM   1358 O O   . LEU B  1 88 ? 1.015   5.778   28.462 1.00 16.61  ? 88  LEU B O   1 
ATOM   1359 C CB  . LEU B  1 88 ? -0.466  4.479   30.669 1.00 17.88  ? 88  LEU B CB  1 
ATOM   1360 C CG  . LEU B  1 88 ? -0.233  2.988   30.493 1.00 19.45  ? 88  LEU B CG  1 
ATOM   1361 C CD1 . LEU B  1 88 ? 0.430   2.472   31.743 1.00 21.65  ? 88  LEU B CD1 1 
ATOM   1362 C CD2 . LEU B  1 88 ? -1.586  2.280   30.251 1.00 21.86  ? 88  LEU B CD2 1 
ATOM   1363 N N   . LEU B  1 89 ? 2.749   4.849   29.600 1.00 16.38  ? 89  LEU B N   1 
ATOM   1364 C CA  . LEU B  1 89 ? 3.659   4.847   28.452 1.00 17.04  ? 89  LEU B CA  1 
ATOM   1365 C C   . LEU B  1 89 ? 4.299   3.511   28.185 1.00 18.44  ? 89  LEU B C   1 
ATOM   1366 O O   . LEU B  1 89 ? 4.353   2.647   29.078 1.00 18.00  ? 89  LEU B O   1 
ATOM   1367 C CB  . LEU B  1 89 ? 4.770   5.867   28.692 1.00 16.58  ? 89  LEU B CB  1 
ATOM   1368 C CG  . LEU B  1 89 ? 4.267   7.313   28.735 1.00 17.31  ? 89  LEU B CG  1 
ATOM   1369 C CD1 . LEU B  1 89 ? 4.270   7.821   30.184 1.00 18.89  ? 89  LEU B CD1 1 
ATOM   1370 C CD2 . LEU B  1 89 ? 5.155   8.186   27.844 1.00 20.02  ? 89  LEU B CD2 1 
ATOM   1371 N N   . GLU B  1 90 ? 4.778   3.338   26.949 1.00 16.76  ? 90  GLU B N   1 
ATOM   1372 C CA  . GLU B  1 90 ? 5.689   2.254   26.635 1.00 17.75  ? 90  GLU B CA  1 
ATOM   1373 C C   . GLU B  1 90 ? 7.030   2.887   26.280 1.00 20.54  ? 90  GLU B C   1 
ATOM   1374 O O   . GLU B  1 90 ? 7.094   3.821   25.482 1.00 21.32  ? 90  GLU B O   1 
ATOM   1375 C CB  . GLU B  1 90 ? 5.176   1.420   25.468 1.00 22.02  ? 90  GLU B CB  1 
ATOM   1376 C CG  . GLU B  1 90 ? 6.290   0.553   24.911 1.00 27.19  ? 90  GLU B CG  1 
ATOM   1377 C CD  . GLU B  1 90 ? 6.036   0.070   23.524 1.00 34.05  ? 90  GLU B CD  1 
ATOM   1378 O OE1 . GLU B  1 90 ? 4.992   0.449   22.951 1.00 35.89  ? 90  GLU B OE1 1 
ATOM   1379 O OE2 . GLU B  1 90 ? 6.883   -0.704  23.007 1.00 33.22  ? 90  GLU B OE2 1 
ATOM   1380 N N   . LYS B  1 91 ? 8.086   2.413   26.934 1.00 20.37  ? 91  LYS B N   1 
ATOM   1381 C CA  . LYS B  1 91 ? 9.437   2.884   26.686 1.00 21.14  ? 91  LYS B CA  1 
ATOM   1382 C C   . LYS B  1 91 ? 9.904   2.607   25.241 1.00 23.73  ? 91  LYS B C   1 
ATOM   1383 O O   . LYS B  1 91 ? 9.849   1.480   24.740 1.00 23.68  ? 91  LYS B O   1 
ATOM   1384 C CB  . LYS B  1 91 ? 10.366  2.257   27.751 1.00 23.92  ? 91  LYS B CB  1 
ATOM   1385 C CG  . LYS B  1 91 ? 11.843  2.521   27.572 1.00 29.93  ? 91  LYS B CG  1 
ATOM   1386 C CD  . LYS B  1 91 ? 12.207  3.888   28.047 1.00 31.51  ? 91  LYS B CD  1 
ATOM   1387 C CE  . LYS B  1 91 ? 13.716  4.011   28.225 1.00 34.17  ? 91  LYS B CE  1 
ATOM   1388 N NZ  . LYS B  1 91 ? 14.122  5.448   28.100 1.00 35.52  ? 91  LYS B NZ  1 
ATOM   1389 N N   . GLY B  1 92 ? 10.355  3.663   24.578 1.00 22.61  ? 92  GLY B N   1 
ATOM   1390 C CA  . GLY B  1 92 ? 10.805  3.578   23.201 1.00 22.77  ? 92  GLY B CA  1 
ATOM   1391 C C   . GLY B  1 92 ? 12.202  3.003   23.082 1.00 28.45  ? 92  GLY B C   1 
ATOM   1392 O O   . GLY B  1 92 ? 12.903  2.791   24.080 1.00 31.09  ? 92  GLY B O   1 
ATOM   1393 N N   . GLN B  1 93 ? 12.608  2.763   21.841 1.00 39.45  ? 93  GLN B N   1 
ATOM   1394 C CA  . GLN B  1 93 ? 13.951  2.293   21.533 1.00 49.68  ? 93  GLN B CA  1 
ATOM   1395 C C   . GLN B  1 93 ? 14.971  3.421   21.693 1.00 54.14  ? 93  GLN B C   1 
ATOM   1396 O O   . GLN B  1 93 ? 14.630  4.602   21.581 1.00 51.35  ? 93  GLN B O   1 
ATOM   1397 C CB  . GLN B  1 93 ? 13.986  1.739   20.107 1.00 55.89  ? 93  GLN B CB  1 
ATOM   1398 C CG  . GLN B  1 93 ? 13.007  0.598   19.884 1.00 59.48  ? 93  GLN B CG  1 
ATOM   1399 C CD  . GLN B  1 93 ? 13.318  -0.606  20.755 1.00 60.69  ? 93  GLN B CD  1 
ATOM   1400 O OE1 . GLN B  1 93 ? 14.484  -0.905  21.025 1.00 60.79  ? 93  GLN B OE1 1 
ATOM   1401 N NE2 . GLN B  1 93 ? 12.272  -1.306  21.201 1.00 61.10  ? 93  GLN B NE2 1 
ATOM   1402 N N   . SER B  1 94 ? 16.219  3.050   21.959 1.00 60.93  ? 94  SER B N   1 
ATOM   1403 C CA  . SER B  1 94 ? 17.286  4.027   22.157 1.00 67.58  ? 94  SER B CA  1 
ATOM   1404 C C   . SER B  1 94 ? 18.011  4.351   20.851 1.00 69.97  ? 94  SER B C   1 
ATOM   1405 O O   . SER B  1 94 ? 18.217  5.518   20.516 1.00 71.52  ? 94  SER B O   1 
ATOM   1406 C CB  . SER B  1 94 ? 18.278  3.524   23.209 1.00 71.27  ? 94  SER B CB  1 
ATOM   1407 O OG  . SER B  1 94 ? 18.726  2.212   22.905 1.00 74.43  ? 94  SER B OG  1 
ATOM   1408 N N   . PRO C  1 1  ? -14.771 4.731   34.302 1.00 27.72  ? 1   PRO C N   1 
ATOM   1409 C CA  . PRO C  1 1  ? -15.333 3.653   35.125 1.00 26.89  ? 1   PRO C CA  1 
ATOM   1410 C C   . PRO C  1 1  ? -16.840 3.586   34.947 1.00 27.99  ? 1   PRO C C   1 
ATOM   1411 O O   . PRO C  1 1  ? -17.449 4.583   34.527 1.00 29.54  ? 1   PRO C O   1 
ATOM   1412 C CB  . PRO C  1 1  ? -15.011 4.085   36.564 1.00 27.47  ? 1   PRO C CB  1 
ATOM   1413 C CG  . PRO C  1 1  ? -14.103 5.302   36.464 1.00 27.86  ? 1   PRO C CG  1 
ATOM   1414 C CD  . PRO C  1 1  ? -13.713 5.468   35.012 1.00 28.81  ? 1   PRO C CD  1 
ATOM   1415 N N   . LYS C  1 2  ? -17.424 2.436   35.265 1.00 25.73  ? 2   LYS C N   1 
ATOM   1416 C CA  . LYS C  1 2  ? -18.869 2.258   35.282 1.00 27.80  ? 2   LYS C CA  1 
ATOM   1417 C C   . LYS C  1 2  ? -19.352 2.473   36.708 1.00 26.57  ? 2   LYS C C   1 
ATOM   1418 O O   . LYS C  1 2  ? -18.576 2.323   37.659 1.00 25.90  ? 2   LYS C O   1 
ATOM   1419 C CB  . LYS C  1 2  ? -19.238 0.829   34.890 1.00 32.82  ? 2   LYS C CB  1 
ATOM   1420 C CG  . LYS C  1 2  ? -19.063 0.478   33.421 1.00 38.27  ? 2   LYS C CG  1 
ATOM   1421 C CD  . LYS C  1 2  ? -19.749 -0.852  33.148 1.00 44.46  ? 2   LYS C CD  1 
ATOM   1422 C CE  . LYS C  1 2  ? -19.673 -1.767  34.374 1.00 47.57  ? 2   LYS C CE  1 
ATOM   1423 N NZ  . LYS C  1 2  ? -20.111 -3.167  34.060 1.00 53.79  ? 2   LYS C NZ  1 
ATOM   1424 N N   . PRO C  1 3  ? -20.637 2.810   36.872 1.00 25.68  ? 3   PRO C N   1 
ATOM   1425 C CA  . PRO C  1 3  ? -21.164 2.914   38.229 1.00 27.50  ? 3   PRO C CA  1 
ATOM   1426 C C   . PRO C  1 3  ? -20.794 1.692   39.079 1.00 29.04  ? 3   PRO C C   1 
ATOM   1427 O O   . PRO C  1 3  ? -20.930 0.535   38.615 1.00 28.02  ? 3   PRO C O   1 
ATOM   1428 C CB  . PRO C  1 3  ? -22.679 2.999   37.993 1.00 28.89  ? 3   PRO C CB  1 
ATOM   1429 C CG  . PRO C  1 3  ? -22.802 3.717   36.709 1.00 30.04  ? 3   PRO C CG  1 
ATOM   1430 C CD  . PRO C  1 3  ? -21.630 3.234   35.863 1.00 29.47  ? 3   PRO C CD  1 
ATOM   1431 N N   . GLY C  1 4  ? -20.318 1.939   40.300 1.00 27.13  ? 4   GLY C N   1 
ATOM   1432 C CA  . GLY C  1 4  ? -19.887 0.884   41.195 1.00 25.56  ? 4   GLY C CA  1 
ATOM   1433 C C   . GLY C  1 4  ? -18.409 0.523   41.139 1.00 25.92  ? 4   GLY C C   1 
ATOM   1434 O O   . GLY C  1 4  ? -17.876 -0.109  42.056 1.00 25.53  ? 4   GLY C O   1 
ATOM   1435 N N   . ASP C  1 5  ? -17.728 0.925   40.070 1.00 23.79  ? 5   ASP C N   1 
ATOM   1436 C CA  . ASP C  1 5  ? -16.308 0.651   39.959 1.00 21.01  ? 5   ASP C CA  1 
ATOM   1437 C C   . ASP C  1 5  ? -15.477 1.495   40.913 1.00 20.61  ? 5   ASP C C   1 
ATOM   1438 O O   . ASP C  1 5  ? -15.768 2.667   41.135 1.00 22.39  ? 5   ASP C O   1 
ATOM   1439 C CB  . ASP C  1 5  ? -15.834 0.990   38.546 1.00 20.95  ? 5   ASP C CB  1 
ATOM   1440 C CG  . ASP C  1 5  ? -16.233 -0.053  37.496 1.00 23.83  ? 5   ASP C CG  1 
ATOM   1441 O OD1 . ASP C  1 5  ? -16.756 -1.168  37.812 1.00 26.97  ? 5   ASP C OD1 1 
ATOM   1442 O OD2 . ASP C  1 5  ? -15.995 0.244   36.305 1.00 26.22  ? 5   ASP C OD2 1 
ATOM   1443 N N   . ILE C  1 6  ? -14.405 0.899   41.415 1.00 20.65  ? 6   ILE C N   1 
ATOM   1444 C CA  . ILE C  1 6  ? -13.392 1.620   42.176 1.00 19.38  ? 6   ILE C CA  1 
ATOM   1445 C C   . ILE C  1 6  ? -12.465 2.345   41.208 1.00 21.68  ? 6   ILE C C   1 
ATOM   1446 O O   . ILE C  1 6  ? -12.051 1.776   40.174 1.00 22.36  ? 6   ILE C O   1 
ATOM   1447 C CB  . ILE C  1 6  ? -12.541 0.629   43.012 1.00 21.21  ? 6   ILE C CB  1 
ATOM   1448 C CG1 . ILE C  1 6  ? -13.403 -0.145  44.029 1.00 22.54  ? 6   ILE C CG1 1 
ATOM   1449 C CG2 . ILE C  1 6  ? -11.397 1.341   43.719 1.00 23.60  ? 6   ILE C CG2 1 
ATOM   1450 C CD1 . ILE C  1 6  ? -14.068 0.738   45.083 1.00 24.02  ? 6   ILE C CD1 1 
ATOM   1451 N N   . PHE C  1 7  ? -12.135 3.599   41.518 1.00 19.98  ? 7   PHE C N   1 
ATOM   1452 C CA  . PHE C  1 7  ? -11.066 4.278   40.790 1.00 17.44  ? 7   PHE C CA  1 
ATOM   1453 C C   . PHE C  1 7  ? -10.254 5.138   41.738 1.00 20.29  ? 7   PHE C C   1 
ATOM   1454 O O   . PHE C  1 7  ? -10.712 5.461   42.838 1.00 22.33  ? 7   PHE C O   1 
ATOM   1455 C CB  . PHE C  1 7  ? -11.567 5.052   39.545 1.00 18.48  ? 7   PHE C CB  1 
ATOM   1456 C CG  . PHE C  1 7  ? -12.447 6.220   39.844 1.00 20.07  ? 7   PHE C CG  1 
ATOM   1457 C CD1 . PHE C  1 7  ? -11.948 7.526   39.732 1.00 20.99  ? 7   PHE C CD1 1 
ATOM   1458 C CD2 . PHE C  1 7  ? -13.772 6.043   40.213 1.00 22.46  ? 7   PHE C CD2 1 
ATOM   1459 C CE1 . PHE C  1 7  ? -12.745 8.621   39.965 1.00 21.28  ? 7   PHE C CE1 1 
ATOM   1460 C CE2 . PHE C  1 7  ? -14.587 7.125   40.453 1.00 20.26  ? 7   PHE C CE2 1 
ATOM   1461 C CZ  . PHE C  1 7  ? -14.069 8.431   40.373 1.00 20.87  ? 7   PHE C CZ  1 
ATOM   1462 N N   . GLU C  1 8  ? -9.058  5.510   41.324 1.00 19.22  ? 8   GLU C N   1 
ATOM   1463 C CA  . GLU C  1 8  ? -8.261  6.414   42.141 1.00 19.62  ? 8   GLU C CA  1 
ATOM   1464 C C   . GLU C  1 8  ? -7.725  7.538   41.311 1.00 19.06  ? 8   GLU C C   1 
ATOM   1465 O O   . GLU C  1 8  ? -7.502  7.378   40.105 1.00 22.02  ? 8   GLU C O   1 
ATOM   1466 C CB  . GLU C  1 8  ? -7.123  5.681   42.831 1.00 27.23  ? 8   GLU C CB  1 
ATOM   1467 C CG  . GLU C  1 8  ? -6.222  4.896   41.943 1.00 33.07  ? 8   GLU C CG  1 
ATOM   1468 C CD  . GLU C  1 8  ? -5.298  3.984   42.740 1.00 38.80  ? 8   GLU C CD  1 
ATOM   1469 O OE1 . GLU C  1 8  ? -4.772  3.012   42.162 1.00 43.98  ? 8   GLU C OE1 1 
ATOM   1470 O OE2 . GLU C  1 8  ? -5.105  4.234   43.950 1.00 37.32  ? 8   GLU C OE2 1 
ATOM   1471 N N   . VAL C  1 9  ? -7.507  8.666   41.969 1.00 17.90  ? 9   VAL C N   1 
ATOM   1472 C CA  . VAL C  1 9  ? -6.958  9.838   41.309 1.00 20.32  ? 9   VAL C CA  1 
ATOM   1473 C C   . VAL C  1 9  ? -5.907  10.499  42.164 1.00 21.22  ? 9   VAL C C   1 
ATOM   1474 O O   . VAL C  1 9  ? -5.972  10.477  43.398 1.00 24.31  ? 9   VAL C O   1 
ATOM   1475 C CB  . VAL C  1 9  ? -8.028  10.877  40.984 1.00 25.28  ? 9   VAL C CB  1 
ATOM   1476 C CG1 . VAL C  1 9  ? -9.083  10.300  40.061 1.00 23.65  ? 9   VAL C CG1 1 
ATOM   1477 C CG2 . VAL C  1 9  ? -8.627  11.459  42.252 1.00 31.60  ? 9   VAL C CG2 1 
ATOM   1478 N N   . GLU C  1 10 ? -4.947  11.119  41.501 1.00 17.81  ? 10  GLU C N   1 
ATOM   1479 C CA  . GLU C  1 10 ? -4.044  12.034  42.187 1.00 19.55  ? 10  GLU C CA  1 
ATOM   1480 C C   . GLU C  1 10 ? -4.440  13.409  41.694 1.00 22.00  ? 10  GLU C C   1 
ATOM   1481 O O   . GLU C  1 10 ? -4.256  13.734  40.508 1.00 22.32  ? 10  GLU C O   1 
ATOM   1482 C CB  . GLU C  1 10 ? -2.596  11.731  41.819 1.00 19.42  ? 10  GLU C CB  1 
ATOM   1483 C CG  . GLU C  1 10 ? -2.074  10.417  42.406 1.00 21.15  ? 10  GLU C CG  1 
ATOM   1484 C CD  . GLU C  1 10 ? -1.689  10.526  43.891 1.00 24.79  ? 10  GLU C CD  1 
ATOM   1485 O OE1 . GLU C  1 10 ? -1.920  11.588  44.507 1.00 28.04  ? 10  GLU C OE1 1 
ATOM   1486 O OE2 . GLU C  1 10 ? -1.140  9.543   44.423 1.00 29.72  ? 10  GLU C OE2 1 
ATOM   1487 N N   . LEU C  1 11 ? -5.021  14.197  42.590 1.00 20.84  ? 11  LEU C N   1 
ATOM   1488 C CA  . LEU C  1 11 ? -5.640  15.458  42.196 1.00 22.11  ? 11  LEU C CA  1 
ATOM   1489 C C   . LEU C  1 11 ? -4.827  16.605  42.746 1.00 23.55  ? 11  LEU C C   1 
ATOM   1490 O O   . LEU C  1 11 ? -4.640  16.718  43.964 1.00 23.05  ? 11  LEU C O   1 
ATOM   1491 C CB  . LEU C  1 11 ? -7.087  15.515  42.719 1.00 23.89  ? 11  LEU C CB  1 
ATOM   1492 C CG  . LEU C  1 11 ? -7.982  16.676  42.258 1.00 24.51  ? 11  LEU C CG  1 
ATOM   1493 C CD1 . LEU C  1 11 ? -8.129  16.750  40.746 1.00 27.19  ? 11  LEU C CD1 1 
ATOM   1494 C CD2 . LEU C  1 11 ? -9.352  16.568  42.917 1.00 25.16  ? 11  LEU C CD2 1 
ATOM   1495 N N   . ALA C  1 12 ? -4.337  17.463  41.850 1.00 20.53  ? 12  ALA C N   1 
ATOM   1496 C CA  . ALA C  1 12 ? -3.670  18.697  42.267 1.00 22.69  ? 12  ALA C CA  1 
ATOM   1497 C C   . ALA C  1 12 ? -4.679  19.802  42.569 1.00 26.15  ? 12  ALA C C   1 
ATOM   1498 O O   . ALA C  1 12 ? -5.598  20.039  41.781 1.00 27.86  ? 12  ALA C O   1 
ATOM   1499 C CB  . ALA C  1 12 ? -2.676  19.155  41.195 1.00 22.46  ? 12  ALA C CB  1 
ATOM   1500 N N   . LYS C  1 13 ? -4.491  20.497  43.687 1.00 25.77  ? 13  LYS C N   1 
ATOM   1501 C CA  . LYS C  1 13 ? -5.344  21.632  44.046 1.00 24.89  ? 13  LYS C CA  1 
ATOM   1502 C C   . LYS C  1 13 ? -5.151  22.831  43.115 1.00 28.42  ? 13  LYS C C   1 
ATOM   1503 O O   . LYS C  1 13 ? -4.096  23.012  42.503 1.00 28.79  ? 13  LYS C O   1 
ATOM   1504 C CB  . LYS C  1 13 ? -5.087  22.080  45.489 1.00 26.25  ? 13  LYS C CB  1 
ATOM   1505 C CG  . LYS C  1 13 ? -5.456  21.010  46.527 1.00 27.20  ? 13  LYS C CG  1 
ATOM   1506 C CD  . LYS C  1 13 ? -5.108  21.443  47.946 1.00 27.99  ? 13  LYS C CD  1 
ATOM   1507 C CE  . LYS C  1 13 ? -5.433  20.340  48.958 1.00 30.13  ? 13  LYS C CE  1 
ATOM   1508 N NZ  . LYS C  1 13 ? -4.878  20.719  50.307 1.00 30.51  ? 13  LYS C NZ  1 
ATOM   1509 N N   . ASN C  1 14 ? -6.196  23.644  43.023 1.00 27.19  ? 14  ASN C N   1 
ATOM   1510 C CA  . ASN C  1 14 ? -6.137  24.924  42.337 1.00 29.79  ? 14  ASN C CA  1 
ATOM   1511 C C   . ASN C  1 14 ? -6.531  25.956  43.366 1.00 28.79  ? 14  ASN C C   1 
ATOM   1512 O O   . ASN C  1 14 ? -7.587  25.818  43.996 1.00 29.29  ? 14  ASN C O   1 
ATOM   1513 C CB  . ASN C  1 14 ? -7.143  24.937  41.201 1.00 32.61  ? 14  ASN C CB  1 
ATOM   1514 C CG  . ASN C  1 14 ? -7.159  26.243  40.476 1.00 38.51  ? 14  ASN C CG  1 
ATOM   1515 O OD1 . ASN C  1 14 ? -6.251  26.538  39.697 1.00 41.86  ? 14  ASN C OD1 1 
ATOM   1516 N ND2 . ASN C  1 14 ? -8.182  27.053  40.734 1.00 40.59  ? 14  ASN C ND2 1 
ATOM   1517 N N   . ASP C  1 15 ? -5.690  26.971  43.551 1.00 31.69  ? 15  ASP C N   1 
ATOM   1518 C CA  . ASP C  1 15 ? -5.933  28.004  44.552 1.00 36.18  ? 15  ASP C CA  1 
ATOM   1519 C C   . ASP C  1 15 ? -6.284  27.355  45.889 1.00 36.71  ? 15  ASP C C   1 
ATOM   1520 O O   . ASP C  1 15 ? -7.240  27.741  46.562 1.00 38.40  ? 15  ASP C O   1 
ATOM   1521 C CB  . ASP C  1 15 ? -7.032  28.963  44.086 1.00 42.30  ? 15  ASP C CB  1 
ATOM   1522 C CG  . ASP C  1 15 ? -6.636  29.746  42.819 1.00 48.90  ? 15  ASP C CG  1 
ATOM   1523 O OD1 . ASP C  1 15 ? -7.544  30.150  42.061 1.00 52.72  ? 15  ASP C OD1 1 
ATOM   1524 O OD2 . ASP C  1 15 ? -5.420  29.945  42.575 1.00 47.90  ? 15  ASP C OD2 1 
ATOM   1525 N N   . ASN C  1 16 ? -5.506  26.335  46.234 1.00 32.74  ? 16  ASN C N   1 
ATOM   1526 C CA  . ASN C  1 16 ? -5.622  25.639  47.517 1.00 33.74  ? 16  ASN C CA  1 
ATOM   1527 C C   . ASN C  1 16 ? -6.930  24.868  47.757 1.00 33.56  ? 16  ASN C C   1 
ATOM   1528 O O   . ASN C  1 16 ? -7.258  24.533  48.909 1.00 34.56  ? 16  ASN C O   1 
ATOM   1529 C CB  . ASN C  1 16 ? -5.362  26.612  48.670 1.00 41.49  ? 16  ASN C CB  1 
ATOM   1530 C CG  . ASN C  1 16 ? -5.134  25.902  49.990 1.00 51.46  ? 16  ASN C CG  1 
ATOM   1531 O OD1 . ASN C  1 16 ? -4.505  24.844  50.033 1.00 55.06  ? 16  ASN C OD1 1 
ATOM   1532 N ND2 . ASN C  1 16 ? -5.648  26.479  51.076 1.00 56.37  ? 16  ASN C ND2 1 
ATOM   1533 N N   . SER C  1 17 ? -7.656  24.564  46.681 1.00 30.11  ? 17  SER C N   1 
ATOM   1534 C CA  . SER C  1 17 ? -8.912  23.802  46.776 1.00 28.63  ? 17  SER C CA  1 
ATOM   1535 C C   . SER C  1 17 ? -8.951  22.634  45.793 1.00 25.98  ? 17  SER C C   1 
ATOM   1536 O O   . SER C  1 17 ? -8.496  22.760  44.644 1.00 25.95  ? 17  SER C O   1 
ATOM   1537 C CB  . SER C  1 17 ? -10.119 24.721  46.500 1.00 32.78  ? 17  SER C CB  1 
ATOM   1538 O OG  . SER C  1 17 ? -11.328 23.970  46.390 1.00 34.51  ? 17  SER C OG  1 
ATOM   1539 N N   . LEU C  1 18 ? -9.511  21.500  46.220 1.00 26.27  ? 18  LEU C N   1 
ATOM   1540 C CA  . LEU C  1 18 ? -9.702  20.348  45.323 1.00 24.11  ? 18  LEU C CA  1 
ATOM   1541 C C   . LEU C  1 18 ? -10.882 20.575  44.366 1.00 26.82  ? 18  LEU C C   1 
ATOM   1542 O O   . LEU C  1 18 ? -11.083 19.828  43.412 1.00 26.51  ? 18  LEU C O   1 
ATOM   1543 C CB  . LEU C  1 18 ? -9.868  19.015  46.107 1.00 25.87  ? 18  LEU C CB  1 
ATOM   1544 C CG  . LEU C  1 18 ? -8.678  18.476  46.928 1.00 24.70  ? 18  LEU C CG  1 
ATOM   1545 C CD1 . LEU C  1 18 ? -9.101  17.350  47.923 1.00 24.92  ? 18  LEU C CD1 1 
ATOM   1546 C CD2 . LEU C  1 18 ? -7.547  18.003  46.017 1.00 24.72  ? 18  LEU C CD2 1 
ATOM   1547 N N   . GLY C  1 19 ? -11.679 21.604  44.633 1.00 27.67  ? 19  GLY C N   1 
ATOM   1548 C CA  . GLY C  1 19 ? -12.744 21.963  43.718 1.00 28.51  ? 19  GLY C CA  1 
ATOM   1549 C C   . GLY C  1 19 ? -13.921 21.019  43.849 1.00 27.20  ? 19  GLY C C   1 
ATOM   1550 O O   . GLY C  1 19 ? -14.663 20.779  42.895 1.00 29.42  ? 19  GLY C O   1 
ATOM   1551 N N   . ILE C  1 20 ? -14.096 20.461  45.037 1.00 29.52  ? 20  ILE C N   1 
ATOM   1552 C CA  . ILE C  1 20 ? -15.263 19.628  45.254 1.00 28.37  ? 20  ILE C CA  1 
ATOM   1553 C C   . ILE C  1 20 ? -15.974 19.999  46.532 1.00 31.09  ? 20  ILE C C   1 
ATOM   1554 O O   . ILE C  1 20 ? -15.362 20.433  47.511 1.00 36.44  ? 20  ILE C O   1 
ATOM   1555 C CB  . ILE C  1 20 ? -14.933 18.154  45.273 1.00 31.31  ? 20  ILE C CB  1 
ATOM   1556 C CG1 . ILE C  1 20 ? -13.975 17.828  46.400 1.00 29.83  ? 20  ILE C CG1 1 
ATOM   1557 C CG2 . ILE C  1 20 ? -14.326 17.735  43.964 1.00 31.00  ? 20  ILE C CG2 1 
ATOM   1558 C CD1 . ILE C  1 20 ? -14.105 16.398  46.841 1.00 35.83  ? 20  ILE C CD1 1 
ATOM   1559 N N   . SER C  1 21 ? -17.282 19.835  46.505 1.00 25.11  ? 21  SER C N   1 
ATOM   1560 C CA  . SER C  1 21 ? -18.035 19.964  47.746 1.00 24.02  ? 21  SER C CA  1 
ATOM   1561 C C   . SER C  1 21 ? -18.621 18.612  48.033 1.00 28.03  ? 21  SER C C   1 
ATOM   1562 O O   . SER C  1 21 ? -19.089 17.923  47.127 1.00 30.15  ? 21  SER C O   1 
ATOM   1563 C CB  . SER C  1 21 ? -19.100 21.055  47.650 1.00 32.05  ? 21  SER C CB  1 
ATOM   1564 O OG  . SER C  1 21 ? -20.203 20.666  46.868 1.00 38.23  ? 21  SER C OG  1 
ATOM   1565 N N   . VAL C  1 22 ? -18.534 18.197  49.285 1.00 28.70  ? 22  VAL C N   1 
ATOM   1566 C CA  . VAL C  1 22 ? -19.019 16.883  49.660 1.00 23.96  ? 22  VAL C CA  1 
ATOM   1567 C C   . VAL C  1 22 ? -20.210 16.999  50.597 1.00 25.74  ? 22  VAL C C   1 
ATOM   1568 O O   . VAL C  1 22 ? -20.466 18.050  51.207 1.00 28.93  ? 22  VAL C O   1 
ATOM   1569 C CB  . VAL C  1 22 ? -17.908 16.030  50.295 1.00 28.45  ? 22  VAL C CB  1 
ATOM   1570 C CG1 . VAL C  1 22 ? -16.777 15.838  49.292 1.00 27.87  ? 22  VAL C CG1 1 
ATOM   1571 C CG2 . VAL C  1 22 ? -17.388 16.718  51.554 1.00 31.42  ? 22  VAL C CG2 1 
ATOM   1572 N N   . THR C  1 23 ? -20.962 15.916  50.640 1.00 26.27  ? 23  THR C N   1 
ATOM   1573 C CA  . THR C  1 23 ? -22.132 15.817  51.489 1.00 25.80  ? 23  THR C CA  1 
ATOM   1574 C C   . THR C  1 23 ? -22.084 14.440  52.116 1.00 26.07  ? 23  THR C C   1 
ATOM   1575 O O   . THR C  1 23 ? -21.493 13.518  51.562 1.00 26.96  ? 23  THR C O   1 
ATOM   1576 C CB  . THR C  1 23 ? -23.433 16.008  50.666 1.00 34.66  ? 23  THR C CB  1 
ATOM   1577 O OG1 . THR C  1 23 ? -24.572 16.035  51.546 1.00 36.99  ? 23  THR C OG1 1 
ATOM   1578 C CG2 . THR C  1 23 ? -23.591 14.877  49.628 1.00 30.96  ? 23  THR C CG2 1 
ATOM   1579 N N   . GLY C  1 24 ? -22.690 14.308  53.291 1.00 34.69  ? 24  GLY C N   1 
ATOM   1580 C CA  . GLY C  1 24 ? -22.730 13.026  53.984 1.00 37.41  ? 24  GLY C CA  1 
ATOM   1581 C C   . GLY C  1 24 ? -21.853 12.978  55.221 1.00 33.30  ? 24  GLY C C   1 
ATOM   1582 O O   . GLY C  1 24 ? -21.330 13.998  55.665 1.00 37.35  ? 24  GLY C O   1 
ATOM   1583 N N   . GLY C  1 25 ? -21.669 11.776  55.762 1.00 32.52  ? 25  GLY C N   1 
ATOM   1584 C CA  . GLY C  1 25 ? -20.988 11.597  57.035 1.00 32.25  ? 25  GLY C CA  1 
ATOM   1585 C C   . GLY C  1 25 ? -21.912 10.835  57.964 1.00 33.13  ? 25  GLY C C   1 
ATOM   1586 O O   . GLY C  1 25 ? -23.121 10.768  57.724 1.00 34.63  ? 25  GLY C O   1 
ATOM   1587 N N   . VAL C  1 26 ? -21.361 10.242  59.020 1.00 31.06  ? 26  VAL C N   1 
ATOM   1588 C CA  . VAL C  1 26 ? -22.180 9.402   59.882 1.00 34.17  ? 26  VAL C CA  1 
ATOM   1589 C C   . VAL C  1 26 ? -23.300 10.157  60.597 1.00 35.80  ? 26  VAL C C   1 
ATOM   1590 O O   . VAL C  1 26 ? -24.323 9.561   60.942 1.00 36.83  ? 26  VAL C O   1 
ATOM   1591 C CB  . VAL C  1 26 ? -21.330 8.604   60.896 1.00 37.52  ? 26  VAL C CB  1 
ATOM   1592 C CG1 . VAL C  1 26 ? -20.361 7.681   60.146 1.00 38.04  ? 26  VAL C CG1 1 
ATOM   1593 C CG2 . VAL C  1 26 ? -20.590 9.537   61.832 1.00 37.52  ? 26  VAL C CG2 1 
ATOM   1594 N N   . ASN C  1 27 ? -23.108 11.463  60.798 1.00 36.75  ? 27  ASN C N   1 
ATOM   1595 C CA  . ASN C  1 27 ? -24.053 12.305  61.527 1.00 40.72  ? 27  ASN C CA  1 
ATOM   1596 C C   . ASN C  1 27 ? -25.243 12.727  60.678 1.00 43.09  ? 27  ASN C C   1 
ATOM   1597 O O   . ASN C  1 27 ? -26.170 13.383  61.160 1.00 48.15  ? 27  ASN C O   1 
ATOM   1598 C CB  . ASN C  1 27 ? -23.342 13.567  62.020 1.00 43.39  ? 27  ASN C CB  1 
ATOM   1599 C CG  . ASN C  1 27 ? -22.624 14.312  60.892 1.00 49.09  ? 27  ASN C CG  1 
ATOM   1600 O OD1 . ASN C  1 27 ? -21.687 13.787  60.281 1.00 47.63  ? 27  ASN C OD1 1 
ATOM   1601 N ND2 . ASN C  1 27 ? -23.057 15.547  60.618 1.00 50.49  ? 27  ASN C ND2 1 
ATOM   1602 N N   . THR C  1 28 ? -25.199 12.381  59.400 1.00 40.11  ? 28  THR C N   1 
ATOM   1603 C CA  . THR C  1 28 ? -26.210 12.824  58.460 1.00 40.59  ? 28  THR C CA  1 
ATOM   1604 C C   . THR C  1 28 ? -27.138 11.666  58.123 1.00 41.40  ? 28  THR C C   1 
ATOM   1605 O O   . THR C  1 28 ? -26.897 10.532  58.533 1.00 40.62  ? 28  THR C O   1 
ATOM   1606 C CB  . THR C  1 28 ? -25.565 13.298  57.151 1.00 40.77  ? 28  THR C CB  1 
ATOM   1607 O OG1 . THR C  1 28 ? -25.011 12.167  56.469 1.00 40.86  ? 28  THR C OG1 1 
ATOM   1608 C CG2 . THR C  1 28 ? -24.440 14.325  57.416 1.00 39.82  ? 28  THR C CG2 1 
ATOM   1609 N N   . SER C  1 29 ? -28.177 11.957  57.345 1.00 46.34  ? 29  SER C N   1 
ATOM   1610 C CA  . SER C  1 29 ? -29.088 10.933  56.846 1.00 53.16  ? 29  SER C CA  1 
ATOM   1611 C C   . SER C  1 29 ? -28.738 10.488  55.420 1.00 52.83  ? 29  SER C C   1 
ATOM   1612 O O   . SER C  1 29 ? -29.495 9.747   54.788 1.00 52.23  ? 29  SER C O   1 
ATOM   1613 C CB  . SER C  1 29 ? -30.523 11.447  56.874 1.00 61.62  ? 29  SER C CB  1 
ATOM   1614 O OG  . SER C  1 29 ? -31.418 10.459  56.393 1.00 68.33  ? 29  SER C OG  1 
ATOM   1615 N N   . VAL C  1 30 ? -27.591 10.939  54.924 1.00 48.46  ? 30  VAL C N   1 
ATOM   1616 C CA  . VAL C  1 30 ? -27.136 10.583  53.580 1.00 48.93  ? 30  VAL C CA  1 
ATOM   1617 C C   . VAL C  1 30 ? -26.770 9.104   53.483 1.00 49.81  ? 30  VAL C C   1 
ATOM   1618 O O   . VAL C  1 30 ? -25.879 8.637   54.193 1.00 48.27  ? 30  VAL C O   1 
ATOM   1619 C CB  . VAL C  1 30 ? -25.899 11.420  53.179 1.00 46.20  ? 30  VAL C CB  1 
ATOM   1620 C CG1 . VAL C  1 30 ? -25.449 11.092  51.753 1.00 48.29  ? 30  VAL C CG1 1 
ATOM   1621 C CG2 . VAL C  1 30 ? -26.201 12.907  53.329 1.00 47.11  ? 30  VAL C CG2 1 
ATOM   1622 N N   . ARG C  1 31 ? -27.468 8.373   52.615 1.00 50.90  ? 31  ARG C N   1 
ATOM   1623 C CA  . ARG C  1 31 ? -27.132 6.980   52.320 1.00 56.80  ? 31  ARG C CA  1 
ATOM   1624 C C   . ARG C  1 31 ? -26.868 6.159   53.580 1.00 57.10  ? 31  ARG C C   1 
ATOM   1625 O O   . ARG C  1 31 ? -27.703 6.103   54.488 1.00 59.74  ? 31  ARG C O   1 
ATOM   1626 C CB  . ARG C  1 31 ? -25.907 6.937   51.408 1.00 59.34  ? 31  ARG C CB  1 
ATOM   1627 C CG  . ARG C  1 31 ? -25.943 7.991   50.317 1.00 63.21  ? 31  ARG C CG  1 
ATOM   1628 C CD  . ARG C  1 31 ? -26.904 7.606   49.212 1.00 70.09  ? 31  ARG C CD  1 
ATOM   1629 N NE  . ARG C  1 31 ? -26.456 6.395   48.533 1.00 73.71  ? 31  ARG C NE  1 
ATOM   1630 C CZ  . ARG C  1 31 ? -25.733 6.388   47.417 1.00 73.67  ? 31  ARG C CZ  1 
ATOM   1631 N NH1 . ARG C  1 31 ? -25.385 7.534   46.841 1.00 72.68  ? 31  ARG C NH1 1 
ATOM   1632 N NH2 . ARG C  1 31 ? -25.362 5.234   46.876 1.00 74.45  ? 31  ARG C NH2 1 
ATOM   1633 N N   . HIS C  1 32 ? -25.700 5.526   53.631 1.00 55.10  ? 32  HIS C N   1 
ATOM   1634 C CA  . HIS C  1 32 ? -25.266 4.806   54.821 1.00 57.69  ? 32  HIS C CA  1 
ATOM   1635 C C   . HIS C  1 32 ? -24.134 5.536   55.546 1.00 50.27  ? 32  HIS C C   1 
ATOM   1636 O O   . HIS C  1 32 ? -23.269 4.922   56.166 1.00 50.22  ? 32  HIS C O   1 
ATOM   1637 C CB  . HIS C  1 32 ? -24.869 3.370   54.470 1.00 67.77  ? 32  HIS C CB  1 
ATOM   1638 C CG  . HIS C  1 32 ? -26.031 2.502   54.090 1.00 78.12  ? 32  HIS C CG  1 
ATOM   1639 N ND1 . HIS C  1 32 ? -26.972 2.884   53.157 1.00 82.34  ? 32  HIS C ND1 1 
ATOM   1640 C CD2 . HIS C  1 32 ? -26.403 1.271   54.514 1.00 82.96  ? 32  HIS C CD2 1 
ATOM   1641 C CE1 . HIS C  1 32 ? -27.875 1.929   53.026 1.00 86.51  ? 32  HIS C CE1 1 
ATOM   1642 N NE2 . HIS C  1 32 ? -27.551 0.938   53.837 1.00 86.96  ? 32  HIS C NE2 1 
ATOM   1643 N N   . GLY C  1 33 ? -24.152 6.860   55.463 1.00 33.54  ? 33  GLY C N   1 
ATOM   1644 C CA  . GLY C  1 33 ? -23.199 7.685   56.176 1.00 31.86  ? 33  GLY C CA  1 
ATOM   1645 C C   . GLY C  1 33 ? -21.953 8.004   55.372 1.00 31.56  ? 33  GLY C C   1 
ATOM   1646 O O   . GLY C  1 33 ? -21.061 8.704   55.859 1.00 32.70  ? 33  GLY C O   1 
ATOM   1647 N N   . GLY C  1 34 ? -21.895 7.513   54.135 1.00 30.20  ? 34  GLY C N   1 
ATOM   1648 C CA  . GLY C  1 34 ? -20.743 7.763   53.289 1.00 31.42  ? 34  GLY C CA  1 
ATOM   1649 C C   . GLY C  1 34 ? -20.543 9.228   52.917 1.00 30.33  ? 34  GLY C C   1 
ATOM   1650 O O   . GLY C  1 34 ? -21.431 10.066  53.105 1.00 29.09  ? 34  GLY C O   1 
ATOM   1651 N N   . ILE C  1 35 ? -19.366 9.522   52.366 1.00 24.05  ? 35  ILE C N   1 
ATOM   1652 C CA  . ILE C  1 35 ? -18.992 10.853  51.936 1.00 23.09  ? 35  ILE C CA  1 
ATOM   1653 C C   . ILE C  1 35 ? -19.120 10.911  50.411 1.00 26.21  ? 35  ILE C C   1 
ATOM   1654 O O   . ILE C  1 35 ? -18.447 10.163  49.704 1.00 27.61  ? 35  ILE C O   1 
ATOM   1655 C CB  . ILE C  1 35 ? -17.529 11.174  52.310 1.00 24.02  ? 35  ILE C CB  1 
ATOM   1656 C CG1 . ILE C  1 35 ? -17.301 11.004  53.828 1.00 25.32  ? 35  ILE C CG1 1 
ATOM   1657 C CG2 . ILE C  1 35 ? -17.134 12.568  51.830 1.00 24.62  ? 35  ILE C CG2 1 
ATOM   1658 C CD1 . ILE C  1 35 ? -18.318 11.742  54.712 1.00 30.65  ? 35  ILE C CD1 1 
ATOM   1659 N N   . TYR C  1 36 ? -19.985 11.781  49.906 1.00 25.70  ? 36  TYR C N   1 
ATOM   1660 C CA  . TYR C  1 36 ? -20.235 11.814  48.468 1.00 24.80  ? 36  TYR C CA  1 
ATOM   1661 C C   . TYR C  1 36 ? -19.962 13.193  47.892 1.00 23.21  ? 36  TYR C C   1 
ATOM   1662 O O   . TYR C  1 36 ? -20.096 14.202  48.579 1.00 24.26  ? 36  TYR C O   1 
ATOM   1663 C CB  . TYR C  1 36 ? -21.678 11.419  48.155 1.00 25.79  ? 36  TYR C CB  1 
ATOM   1664 C CG  . TYR C  1 36 ? -22.015 10.017  48.560 1.00 29.55  ? 36  TYR C CG  1 
ATOM   1665 C CD1 . TYR C  1 36 ? -22.412 9.739   49.863 1.00 31.60  ? 36  TYR C CD1 1 
ATOM   1666 C CD2 . TYR C  1 36 ? -21.917 8.967   47.659 1.00 30.28  ? 36  TYR C CD2 1 
ATOM   1667 C CE1 . TYR C  1 36 ? -22.718 8.453   50.258 1.00 32.94  ? 36  TYR C CE1 1 
ATOM   1668 C CE2 . TYR C  1 36 ? -22.221 7.676   48.046 1.00 31.87  ? 36  TYR C CE2 1 
ATOM   1669 C CZ  . TYR C  1 36 ? -22.624 7.429   49.354 1.00 34.21  ? 36  TYR C CZ  1 
ATOM   1670 O OH  . TYR C  1 36 ? -22.938 6.152   49.777 1.00 35.19  ? 36  TYR C OH  1 
ATOM   1671 N N   . VAL C  1 37 ? -19.573 13.235  46.618 1.00 20.08  ? 37  VAL C N   1 
ATOM   1672 C CA  . VAL C  1 37 ? -19.356 14.493  45.931 1.00 22.67  ? 37  VAL C CA  1 
ATOM   1673 C C   . VAL C  1 37 ? -20.703 15.136  45.644 1.00 25.66  ? 37  VAL C C   1 
ATOM   1674 O O   . VAL C  1 37 ? -21.530 14.593  44.913 1.00 25.86  ? 37  VAL C O   1 
ATOM   1675 C CB  . VAL C  1 37 ? -18.582 14.287  44.601 1.00 23.48  ? 37  VAL C CB  1 
ATOM   1676 C CG1 . VAL C  1 37 ? -18.448 15.604  43.861 1.00 20.74  ? 37  VAL C CG1 1 
ATOM   1677 C CG2 . VAL C  1 37 ? -17.229 13.697  44.883 1.00 23.51  ? 37  VAL C CG2 1 
ATOM   1678 N N   . LYS C  1 38 ? -20.946 16.282  46.265 1.00 23.44  ? 38  LYS C N   1 
ATOM   1679 C CA  . LYS C  1 38 ? -22.187 17.002  46.021 1.00 25.38  ? 38  LYS C CA  1 
ATOM   1680 C C   . LYS C  1 38 ? -22.131 17.824  44.762 1.00 28.13  ? 38  LYS C C   1 
ATOM   1681 O O   . LYS C  1 38 ? -23.119 17.907  44.023 1.00 31.24  ? 38  LYS C O   1 
ATOM   1682 C CB  . LYS C  1 38 ? -22.524 17.885  47.218 1.00 27.01  ? 38  LYS C CB  1 
ATOM   1683 C CG  . LYS C  1 38 ? -23.954 18.385  47.219 1.00 35.87  ? 38  LYS C CG  1 
ATOM   1684 C CD  . LYS C  1 38 ? -24.289 19.034  48.546 1.00 40.68  ? 38  LYS C CD  1 
ATOM   1685 C CE  . LYS C  1 38 ? -25.718 19.541  48.570 1.00 46.85  ? 38  LYS C CE  1 
ATOM   1686 N NZ  . LYS C  1 38 ? -26.367 19.295  49.900 1.00 51.53  ? 38  LYS C NZ  1 
ATOM   1687 N N   . ALA C  1 39 ? -20.984 18.464  44.519 1.00 26.30  ? 39  ALA C N   1 
ATOM   1688 C CA  . ALA C  1 39 ? -20.795 19.267  43.318 1.00 27.07  ? 39  ALA C CA  1 
ATOM   1689 C C   . ALA C  1 39 ? -19.318 19.355  42.993 1.00 27.18  ? 39  ALA C C   1 
ATOM   1690 O O   . ALA C  1 39 ? -18.487 19.212  43.882 1.00 25.36  ? 39  ALA C O   1 
ATOM   1691 C CB  . ALA C  1 39 ? -21.372 20.682  43.526 1.00 28.51  ? 39  ALA C CB  1 
ATOM   1692 N N   . VAL C  1 40 ? -18.988 19.565  41.718 1.00 28.38  ? 40  VAL C N   1 
ATOM   1693 C CA  . VAL C  1 40 ? -17.630 19.926  41.350 1.00 27.86  ? 40  VAL C CA  1 
ATOM   1694 C C   . VAL C  1 40 ? -17.694 21.388  40.965 1.00 35.87  ? 40  VAL C C   1 
ATOM   1695 O O   . VAL C  1 40 ? -18.562 21.812  40.202 1.00 42.52  ? 40  VAL C O   1 
ATOM   1696 C CB  . VAL C  1 40 ? -17.057 19.080  40.200 1.00 34.37  ? 40  VAL C CB  1 
ATOM   1697 C CG1 . VAL C  1 40 ? -17.222 17.586  40.502 1.00 34.51  ? 40  VAL C CG1 1 
ATOM   1698 C CG2 . VAL C  1 40 ? -17.703 19.450  38.891 1.00 39.34  ? 40  VAL C CG2 1 
ATOM   1699 N N   . ILE C  1 41 ? -16.788 22.161  41.530 1.00 35.64  ? 41  ILE C N   1 
ATOM   1700 C CA  . ILE C  1 41 ? -16.813 23.603  41.361 1.00 38.79  ? 41  ILE C CA  1 
ATOM   1701 C C   . ILE C  1 41 ? -16.343 23.999  39.965 1.00 39.96  ? 41  ILE C C   1 
ATOM   1702 O O   . ILE C  1 41 ? -15.251 23.620  39.541 1.00 36.10  ? 41  ILE C O   1 
ATOM   1703 C CB  . ILE C  1 41 ? -15.964 24.248  42.465 1.00 40.37  ? 41  ILE C CB  1 
ATOM   1704 C CG1 . ILE C  1 41 ? -16.469 23.757  43.831 1.00 38.17  ? 41  ILE C CG1 1 
ATOM   1705 C CG2 . ILE C  1 41 ? -15.995 25.759  42.349 1.00 43.41  ? 41  ILE C CG2 1 
ATOM   1706 C CD1 . ILE C  1 41 ? -15.681 24.250  45.004 1.00 39.33  ? 41  ILE C CD1 1 
ATOM   1707 N N   . PRO C  1 42 ? -17.182 24.752  39.225 1.00 42.68  ? 42  PRO C N   1 
ATOM   1708 C CA  . PRO C  1 42 ? -16.807 25.162  37.870 1.00 41.68  ? 42  PRO C CA  1 
ATOM   1709 C C   . PRO C  1 42 ? -15.394 25.732  37.829 1.00 41.14  ? 42  PRO C C   1 
ATOM   1710 O O   . PRO C  1 42 ? -15.001 26.493  38.718 1.00 40.34  ? 42  PRO C O   1 
ATOM   1711 C CB  . PRO C  1 42 ? -17.844 26.239  37.527 1.00 46.47  ? 42  PRO C CB  1 
ATOM   1712 C CG  . PRO C  1 42 ? -19.047 25.847  38.326 1.00 46.63  ? 42  PRO C CG  1 
ATOM   1713 C CD  . PRO C  1 42 ? -18.512 25.257  39.613 1.00 45.92  ? 42  PRO C CD  1 
ATOM   1714 N N   . GLN C  1 43 ? -14.635 25.329  36.815 1.00 43.15  ? 43  GLN C N   1 
ATOM   1715 C CA  . GLN C  1 43 ? -13.266 25.794  36.623 1.00 47.81  ? 43  GLN C CA  1 
ATOM   1716 C C   . GLN C  1 43 ? -12.304 25.414  37.742 1.00 43.10  ? 43  GLN C C   1 
ATOM   1717 O O   . GLN C  1 43 ? -11.178 25.907  37.775 1.00 43.05  ? 43  GLN C O   1 
ATOM   1718 C CB  . GLN C  1 43 ? -13.232 27.309  36.397 1.00 57.38  ? 43  GLN C CB  1 
ATOM   1719 C CG  . GLN C  1 43 ? -13.655 27.736  34.996 1.00 65.15  ? 43  GLN C CG  1 
ATOM   1720 C CD  . GLN C  1 43 ? -15.138 27.543  34.748 1.00 71.25  ? 43  GLN C CD  1 
ATOM   1721 O OE1 . GLN C  1 43 ? -15.968 28.284  35.278 1.00 73.86  ? 43  GLN C OE1 1 
ATOM   1722 N NE2 . GLN C  1 43 ? -15.479 26.548  33.935 1.00 72.65  ? 43  GLN C NE2 1 
ATOM   1723 N N   . GLY C  1 44 ? -12.734 24.545  38.656 1.00 35.34  ? 44  GLY C N   1 
ATOM   1724 C CA  . GLY C  1 44 ? -11.871 24.128  39.742 1.00 32.92  ? 44  GLY C CA  1 
ATOM   1725 C C   . GLY C  1 44 ? -11.062 22.897  39.394 1.00 30.36  ? 44  GLY C C   1 
ATOM   1726 O O   . GLY C  1 44 ? -11.185 22.350  38.295 1.00 30.70  ? 44  GLY C O   1 
ATOM   1727 N N   . ALA C  1 45 ? -10.232 22.448  40.331 1.00 28.03  ? 45  ALA C N   1 
ATOM   1728 C CA  . ALA C  1 45 ? -9.356  21.295  40.087 1.00 27.96  ? 45  ALA C CA  1 
ATOM   1729 C C   . ALA C  1 45 ? -10.055 20.005  39.631 1.00 26.67  ? 45  ALA C C   1 
ATOM   1730 O O   . ALA C  1 45 ? -9.667  19.428  38.614 1.00 27.72  ? 45  ALA C O   1 
ATOM   1731 C CB  . ALA C  1 45 ? -8.481  21.018  41.294 1.00 27.22  ? 45  ALA C CB  1 
ATOM   1732 N N   . ALA C  1 46 ? -11.065 19.552  40.372 1.00 25.03  ? 46  ALA C N   1 
ATOM   1733 C CA  . ALA C  1 46 ? -11.778 18.326  40.002 1.00 22.91  ? 46  ALA C CA  1 
ATOM   1734 C C   . ALA C  1 46 ? -12.440 18.435  38.624 1.00 25.72  ? 46  ALA C C   1 
ATOM   1735 O O   . ALA C  1 46 ? -12.421 17.484  37.826 1.00 25.27  ? 46  ALA C O   1 
ATOM   1736 C CB  . ALA C  1 46 ? -12.803 17.973  41.050 1.00 21.60  ? 46  ALA C CB  1 
ATOM   1737 N N   . GLU C  1 47 ? -13.009 19.602  38.328 1.00 27.43  ? 47  GLU C N   1 
ATOM   1738 C CA  . GLU C  1 47 ? -13.629 19.797  37.027 1.00 30.66  ? 47  GLU C CA  1 
ATOM   1739 C C   . GLU C  1 47 ? -12.610 19.689  35.897 1.00 27.84  ? 47  GLU C C   1 
ATOM   1740 O O   . GLU C  1 47 ? -12.860 19.039  34.882 1.00 31.58  ? 47  GLU C O   1 
ATOM   1741 C CB  . GLU C  1 47 ? -14.338 21.149  36.940 1.00 34.91  ? 47  GLU C CB  1 
ATOM   1742 C CG  . GLU C  1 47 ? -15.158 21.291  35.681 1.00 38.80  ? 47  GLU C CG  1 
ATOM   1743 C CD  . GLU C  1 47 ? -15.589 22.719  35.421 1.00 46.98  ? 47  GLU C CD  1 
ATOM   1744 O OE1 . GLU C  1 47 ? -14.787 23.482  34.839 1.00 46.21  ? 47  GLU C OE1 1 
ATOM   1745 O OE2 . GLU C  1 47 ? -16.731 23.071  35.796 1.00 51.09  ? 47  GLU C OE2 1 
ATOM   1746 N N   . SER C  1 48 ? -11.467 20.348  36.056 1.00 28.38  ? 48  SER C N   1 
ATOM   1747 C CA  . SER C  1 48 ? -10.453 20.360  35.005 1.00 30.91  ? 48  SER C CA  1 
ATOM   1748 C C   . SER C  1 48 ? -9.917  18.964  34.758 1.00 26.10  ? 48  SER C C   1 
ATOM   1749 O O   . SER C  1 48 ? -9.682  18.558  33.620 1.00 28.49  ? 48  SER C O   1 
ATOM   1750 C CB  . SER C  1 48 ? -9.319  21.304  35.376 1.00 37.04  ? 48  SER C CB  1 
ATOM   1751 O OG  . SER C  1 48 ? -9.831  22.612  35.529 1.00 42.09  ? 48  SER C OG  1 
ATOM   1752 N N   . ASP C  1 49 ? -9.754  18.224  35.843 1.00 25.27  ? 49  ASP C N   1 
ATOM   1753 C CA  . ASP C  1 49 ? -9.265  16.843  35.763 1.00 24.91  ? 49  ASP C CA  1 
ATOM   1754 C C   . ASP C  1 49 ? -10.244 15.890  35.064 1.00 27.76  ? 49  ASP C C   1 
ATOM   1755 O O   . ASP C  1 49 ? -9.823  14.996  34.336 1.00 28.61  ? 49  ASP C O   1 
ATOM   1756 C CB  . ASP C  1 49 ? -8.900  16.346  37.152 1.00 25.82  ? 49  ASP C CB  1 
ATOM   1757 C CG  . ASP C  1 49 ? -8.494  14.897  37.143 1.00 30.95  ? 49  ASP C CG  1 
ATOM   1758 O OD1 . ASP C  1 49 ? -9.369  14.048  37.407 1.00 27.91  ? 49  ASP C OD1 1 
ATOM   1759 O OD2 . ASP C  1 49 ? -7.320  14.613  36.808 1.00 33.26  ? 49  ASP C OD2 1 
ATOM   1760 N N   . GLY C  1 50 ? -11.540 16.050  35.314 1.00 24.56  ? 50  GLY C N   1 
ATOM   1761 C CA  . GLY C  1 50 ? -12.560 15.374  34.523 1.00 28.43  ? 50  GLY C CA  1 
ATOM   1762 C C   . GLY C  1 50 ? -12.954 13.953  34.938 1.00 26.43  ? 50  GLY C C   1 
ATOM   1763 O O   . GLY C  1 50 ? -13.809 13.324  34.293 1.00 28.87  ? 50  GLY C O   1 
ATOM   1764 N N   . ARG C  1 51 ? -12.340 13.425  35.992 1.00 21.32  ? 51  ARG C N   1 
ATOM   1765 C CA  . ARG C  1 51 ? -12.648 12.065  36.447 1.00 21.63  ? 51  ARG C CA  1 
ATOM   1766 C C   . ARG C  1 51 ? -13.654 11.965  37.599 1.00 21.42  ? 51  ARG C C   1 
ATOM   1767 O O   . ARG C  1 51 ? -14.277 10.917  37.784 1.00 28.02  ? 51  ARG C O   1 
ATOM   1768 C CB  . ARG C  1 51 ? -11.368 11.331  36.843 1.00 20.22  ? 51  ARG C CB  1 
ATOM   1769 C CG  . ARG C  1 51 ? -10.461 11.003  35.625 1.00 20.60  ? 51  ARG C CG  1 
ATOM   1770 C CD  . ARG C  1 51 ? -9.130  10.408  36.104 1.00 22.96  ? 51  ARG C CD  1 
ATOM   1771 N NE  . ARG C  1 51 ? -8.207  11.455  36.566 1.00 21.49  ? 51  ARG C NE  1 
ATOM   1772 C CZ  . ARG C  1 51 ? -6.984  11.206  37.021 1.00 21.06  ? 51  ARG C CZ  1 
ATOM   1773 N NH1 . ARG C  1 51 ? -6.526  9.953   37.041 1.00 20.73  ? 51  ARG C NH1 1 
ATOM   1774 N NH2 . ARG C  1 51 ? -6.205  12.200  37.421 1.00 22.82  ? 51  ARG C NH2 1 
ATOM   1775 N N   . ILE C  1 52 ? -13.786 13.014  38.387 1.00 21.60  ? 52  ILE C N   1 
ATOM   1776 C CA  . ILE C  1 52 ? -14.673 12.971  39.545 1.00 21.19  ? 52  ILE C CA  1 
ATOM   1777 C C   . ILE C  1 52 ? -15.940 13.766  39.219 1.00 24.41  ? 52  ILE C C   1 
ATOM   1778 O O   . ILE C  1 52 ? -15.854 14.866  38.675 1.00 27.15  ? 52  ILE C O   1 
ATOM   1779 C CB  . ILE C  1 52 ? -13.969 13.561  40.780 1.00 23.04  ? 52  ILE C CB  1 
ATOM   1780 C CG1 . ILE C  1 52 ? -12.787 12.664  41.179 1.00 22.83  ? 52  ILE C CG1 1 
ATOM   1781 C CG2 . ILE C  1 52 ? -14.961 13.744  41.939 1.00 22.69  ? 52  ILE C CG2 1 
ATOM   1782 C CD1 . ILE C  1 52 ? -11.863 13.319  42.192 1.00 27.08  ? 52  ILE C CD1 1 
ATOM   1783 N N   . HIS C  1 53 ? -17.104 13.203  39.540 1.00 23.32  ? 53  HIS C N   1 
ATOM   1784 C CA  . HIS C  1 53 ? -18.373 13.865  39.272 1.00 23.84  ? 53  HIS C CA  1 
ATOM   1785 C C   . HIS C  1 53 ? -19.324 13.747  40.434 1.00 23.03  ? 53  HIS C C   1 
ATOM   1786 O O   . HIS C  1 53 ? -19.146 12.904  41.317 1.00 23.78  ? 53  HIS C O   1 
ATOM   1787 C CB  . HIS C  1 53 ? -19.014 13.259  38.037 1.00 29.77  ? 53  HIS C CB  1 
ATOM   1788 C CG  . HIS C  1 53 ? -18.124 13.321  36.834 1.00 30.77  ? 53  HIS C CG  1 
ATOM   1789 N ND1 . HIS C  1 53 ? -17.234 12.317  36.519 1.00 31.62  ? 53  HIS C ND1 1 
ATOM   1790 C CD2 . HIS C  1 53 ? -17.939 14.294  35.910 1.00 35.06  ? 53  HIS C CD2 1 
ATOM   1791 C CE1 . HIS C  1 53 ? -16.564 12.652  35.430 1.00 31.49  ? 53  HIS C CE1 1 
ATOM   1792 N NE2 . HIS C  1 53 ? -16.975 13.847  35.037 1.00 34.03  ? 53  HIS C NE2 1 
ATOM   1793 N N   . LYS C  1 54 ? -20.353 14.583  40.404 1.00 22.86  ? 54  LYS C N   1 
ATOM   1794 C CA  . LYS C  1 54 ? -21.384 14.541  41.423 1.00 24.45  ? 54  LYS C CA  1 
ATOM   1795 C C   . LYS C  1 54 ? -21.885 13.118  41.596 1.00 26.48  ? 54  LYS C C   1 
ATOM   1796 O O   . LYS C  1 54 ? -22.156 12.407  40.618 1.00 27.89  ? 54  LYS C O   1 
ATOM   1797 C CB  . LYS C  1 54 ? -22.532 15.455  41.038 1.00 27.62  ? 54  LYS C CB  1 
ATOM   1798 C CG  . LYS C  1 54 ? -23.711 15.376  41.998 1.00 30.26  ? 54  LYS C CG  1 
ATOM   1799 C CD  . LYS C  1 54 ? -24.721 16.448  41.598 1.00 33.45  ? 54  LYS C CD  1 
ATOM   1800 C CE  . LYS C  1 54 ? -26.112 16.121  42.111 1.00 40.77  ? 54  LYS C CE  1 
ATOM   1801 N NZ  . LYS C  1 54 ? -27.062 17.168  41.632 1.00 47.46  ? 54  LYS C NZ  1 
ATOM   1802 N N   . GLY C  1 55 ? -21.989 12.692  42.852 1.00 22.70  ? 55  GLY C N   1 
ATOM   1803 C CA  . GLY C  1 55 ? -22.470 11.352  43.145 1.00 24.21  ? 55  GLY C CA  1 
ATOM   1804 C C   . GLY C  1 55 ? -21.400 10.304  43.407 1.00 23.27  ? 55  GLY C C   1 
ATOM   1805 O O   . GLY C  1 55 ? -21.703 9.226   43.943 1.00 24.84  ? 55  GLY C O   1 
ATOM   1806 N N   . ASP C  1 56 ? -20.159 10.589  43.017 1.00 20.95  ? 56  ASP C N   1 
ATOM   1807 C CA  . ASP C  1 56 ? -19.068 9.676   43.359 1.00 21.92  ? 56  ASP C CA  1 
ATOM   1808 C C   . ASP C  1 56 ? -18.888 9.643   44.880 1.00 23.88  ? 56  ASP C C   1 
ATOM   1809 O O   . ASP C  1 56 ? -19.156 10.633  45.569 1.00 24.63  ? 56  ASP C O   1 
ATOM   1810 C CB  . ASP C  1 56 ? -17.755 10.062  42.670 1.00 23.57  ? 56  ASP C CB  1 
ATOM   1811 C CG  . ASP C  1 56 ? -17.817 9.913   41.171 1.00 25.64  ? 56  ASP C CG  1 
ATOM   1812 O OD1 . ASP C  1 56 ? -16.944 10.470  40.476 1.00 26.26  ? 56  ASP C OD1 1 
ATOM   1813 O OD2 . ASP C  1 56 ? -18.732 9.235   40.674 1.00 23.09  ? 56  ASP C OD2 1 
ATOM   1814 N N   . ARG C  1 57 ? -18.468 8.493   45.396 1.00 23.59  ? 57  ARG C N   1 
ATOM   1815 C CA  . ARG C  1 57 ? -18.236 8.341   46.828 1.00 23.62  ? 57  ARG C CA  1 
ATOM   1816 C C   . ARG C  1 57 ? -16.740 8.408   47.100 1.00 23.34  ? 57  ARG C C   1 
ATOM   1817 O O   . ARG C  1 57 ? -15.944 7.780   46.405 1.00 22.89  ? 57  ARG C O   1 
ATOM   1818 C CB  . ARG C  1 57 ? -18.798 7.005   47.301 1.00 26.03  ? 57  ARG C CB  1 
ATOM   1819 C CG  . ARG C  1 57 ? -18.679 6.807   48.821 1.00 27.61  ? 57  ARG C CG  1 
ATOM   1820 C CD  . ARG C  1 57 ? -19.218 5.446   49.266 1.00 32.21  ? 57  ARG C CD  1 
ATOM   1821 N NE  . ARG C  1 57 ? -19.148 5.350   50.725 1.00 36.27  ? 57  ARG C NE  1 
ATOM   1822 C CZ  . ARG C  1 57 ? -19.904 4.539   51.458 1.00 42.00  ? 57  ARG C CZ  1 
ATOM   1823 N NH1 . ARG C  1 57 ? -20.795 3.750   50.876 1.00 45.75  ? 57  ARG C NH1 1 
ATOM   1824 N NH2 . ARG C  1 57 ? -19.773 4.524   52.777 1.00 44.15  ? 57  ARG C NH2 1 
ATOM   1825 N N   . VAL C  1 58 ? -16.339 9.190   48.103 1.00 21.26  ? 58  VAL C N   1 
ATOM   1826 C CA  . VAL C  1 58 ? -14.931 9.246   48.473 1.00 18.19  ? 58  VAL C CA  1 
ATOM   1827 C C   . VAL C  1 58 ? -14.715 8.222   49.586 1.00 20.01  ? 58  VAL C C   1 
ATOM   1828 O O   . VAL C  1 58 ? -15.276 8.343   50.685 1.00 23.24  ? 58  VAL C O   1 
ATOM   1829 C CB  . VAL C  1 58 ? -14.546 10.650  48.978 1.00 20.71  ? 58  VAL C CB  1 
ATOM   1830 C CG1 . VAL C  1 58 ? -13.068 10.705  49.356 1.00 24.65  ? 58  VAL C CG1 1 
ATOM   1831 C CG2 . VAL C  1 58 ? -14.892 11.718  47.932 1.00 24.82  ? 58  VAL C CG2 1 
ATOM   1832 N N   . LEU C  1 59 ? -13.910 7.210   49.280 1.00 22.42  ? 59  LEU C N   1 
ATOM   1833 C CA  . LEU C  1 59 ? -13.656 6.107   50.202 1.00 20.15  ? 59  LEU C CA  1 
ATOM   1834 C C   . LEU C  1 59 ? -12.449 6.355   51.087 1.00 21.91  ? 59  LEU C C   1 
ATOM   1835 O O   . LEU C  1 59 ? -12.398 5.868   52.224 1.00 25.09  ? 59  LEU C O   1 
ATOM   1836 C CB  . LEU C  1 59 ? -13.443 4.803   49.431 1.00 21.62  ? 59  LEU C CB  1 
ATOM   1837 C CG  . LEU C  1 59 ? -14.633 4.251   48.626 1.00 23.72  ? 59  LEU C CG  1 
ATOM   1838 C CD1 . LEU C  1 59 ? -14.222 3.061   47.743 1.00 25.60  ? 59  LEU C CD1 1 
ATOM   1839 C CD2 . LEU C  1 59 ? -15.769 3.860   49.522 1.00 29.53  ? 59  LEU C CD2 1 
ATOM   1840 N N   . ALA C  1 60 ? -11.474 7.099   50.578 1.00 21.75  ? 60  ALA C N   1 
ATOM   1841 C CA  . ALA C  1 60 ? -10.252 7.299   51.345 1.00 20.77  ? 60  ALA C CA  1 
ATOM   1842 C C   . ALA C  1 60 ? -9.470  8.475   50.836 1.00 22.03  ? 60  ALA C C   1 
ATOM   1843 O O   . ALA C  1 60 ? -9.601  8.845   49.667 1.00 21.77  ? 60  ALA C O   1 
ATOM   1844 C CB  . ALA C  1 60 ? -9.386  6.021   51.292 1.00 22.59  ? 60  ALA C CB  1 
ATOM   1845 N N   . VAL C  1 61 ? -8.615  9.014   51.696 1.00 20.10  ? 61  VAL C N   1 
ATOM   1846 C CA  . VAL C  1 61 ? -7.785  10.166  51.344 1.00 21.57  ? 61  VAL C CA  1 
ATOM   1847 C C   . VAL C  1 61 ? -6.373  9.835   51.783 1.00 22.98  ? 61  VAL C C   1 
ATOM   1848 O O   . VAL C  1 61 ? -6.149  9.506   52.951 1.00 25.26  ? 61  VAL C O   1 
ATOM   1849 C CB  . VAL C  1 61 ? -8.220  11.441  52.122 1.00 24.45  ? 61  VAL C CB  1 
ATOM   1850 C CG1 . VAL C  1 61 ? -7.316  12.647  51.777 1.00 24.62  ? 61  VAL C CG1 1 
ATOM   1851 C CG2 . VAL C  1 61 ? -9.679  11.753  51.863 1.00 25.85  ? 61  VAL C CG2 1 
ATOM   1852 N N   . ASN C  1 62 ? -5.420  9.920   50.861 1.00 21.44  ? 62  ASN C N   1 
ATOM   1853 C CA  . ASN C  1 62 ? -4.029  9.629   51.197 1.00 21.93  ? 62  ASN C CA  1 
ATOM   1854 C C   . ASN C  1 62 ? -3.848  8.345   51.995 1.00 23.48  ? 62  ASN C C   1 
ATOM   1855 O O   . ASN C  1 62 ? -3.074  8.280   52.956 1.00 25.32  ? 62  ASN C O   1 
ATOM   1856 C CB  . ASN C  1 62 ? -3.377  10.811  51.902 1.00 22.83  ? 62  ASN C CB  1 
ATOM   1857 C CG  . ASN C  1 62 ? -3.171  11.984  50.976 1.00 24.07  ? 62  ASN C CG  1 
ATOM   1858 O OD1 . ASN C  1 62 ? -3.213  11.835  49.736 1.00 21.62  ? 62  ASN C OD1 1 
ATOM   1859 N ND2 . ASN C  1 62 ? -2.931  13.157  51.552 1.00 25.65  ? 62  ASN C ND2 1 
ATOM   1860 N N   . GLY C  1 63 ? -4.571  7.319   51.588 1.00 23.03  ? 63  GLY C N   1 
ATOM   1861 C CA  . GLY C  1 63 ? -4.358  5.985   52.127 1.00 22.79  ? 63  GLY C CA  1 
ATOM   1862 C C   . GLY C  1 63 ? -5.168  5.663   53.369 1.00 23.63  ? 63  GLY C C   1 
ATOM   1863 O O   . GLY C  1 63 ? -5.057  4.554   53.888 1.00 24.00  ? 63  GLY C O   1 
ATOM   1864 N N   . VAL C  1 64 ? -5.986  6.601   53.836 1.00 22.81  ? 64  VAL C N   1 
ATOM   1865 C CA  . VAL C  1 64 ? -6.743  6.385   55.085 1.00 26.20  ? 64  VAL C CA  1 
ATOM   1866 C C   . VAL C  1 64 ? -8.233  6.453   54.814 1.00 23.99  ? 64  VAL C C   1 
ATOM   1867 O O   . VAL C  1 64 ? -8.719  7.408   54.209 1.00 25.04  ? 64  VAL C O   1 
ATOM   1868 C CB  . VAL C  1 64 ? -6.380  7.422   56.136 1.00 28.89  ? 64  VAL C CB  1 
ATOM   1869 C CG1 . VAL C  1 64 ? -7.166  7.175   57.428 1.00 29.63  ? 64  VAL C CG1 1 
ATOM   1870 C CG2 . VAL C  1 64 ? -4.884  7.389   56.408 1.00 30.71  ? 64  VAL C CG2 1 
ATOM   1871 N N   . SER C  1 65 ? -8.944  5.422   55.240 1.00 23.94  ? 65  SER C N   1 
ATOM   1872 C CA  . SER C  1 65 ? -10.381 5.307   54.991 1.00 25.98  ? 65  SER C CA  1 
ATOM   1873 C C   . SER C  1 65 ? -11.166 6.387   55.692 1.00 26.09  ? 65  SER C C   1 
ATOM   1874 O O   . SER C  1 65 ? -10.796 6.814   56.796 1.00 27.87  ? 65  SER C O   1 
ATOM   1875 C CB  . SER C  1 65 ? -10.893 3.958   55.483 1.00 29.82  ? 65  SER C CB  1 
ATOM   1876 O OG  . SER C  1 65 ? -12.315 3.910   55.485 1.00 31.16  ? 65  SER C OG  1 
ATOM   1877 N N   . LEU C  1 66 ? -12.264 6.818   55.068 1.00 25.78  ? 66  LEU C N   1 
ATOM   1878 C CA  . LEU C  1 66 ? -13.175 7.747   55.718 1.00 28.22  ? 66  LEU C CA  1 
ATOM   1879 C C   . LEU C  1 66 ? -14.244 7.011   56.522 1.00 28.80  ? 66  LEU C C   1 
ATOM   1880 O O   . LEU C  1 66 ? -15.232 7.610   56.920 1.00 30.10  ? 66  LEU C O   1 
ATOM   1881 C CB  . LEU C  1 66 ? -13.831 8.683   54.689 1.00 27.30  ? 66  LEU C CB  1 
ATOM   1882 C CG  . LEU C  1 66 ? -12.872 9.583   53.922 1.00 26.90  ? 66  LEU C CG  1 
ATOM   1883 C CD1 . LEU C  1 66 ? -13.641 10.484  52.963 1.00 27.61  ? 66  LEU C CD1 1 
ATOM   1884 C CD2 . LEU C  1 66 ? -12.095 10.447  54.914 1.00 29.35  ? 66  LEU C CD2 1 
ATOM   1885 N N   . GLU C  1 67 ? -14.045 5.719   56.769 1.00 29.27  ? 67  GLU C N   1 
ATOM   1886 C CA  . GLU C  1 67 ? -14.993 4.979   57.600 1.00 35.35  ? 67  GLU C CA  1 
ATOM   1887 C C   . GLU C  1 67 ? -15.251 5.685   58.925 1.00 32.95  ? 67  GLU C C   1 
ATOM   1888 O O   . GLU C  1 67 ? -14.308 6.065   59.633 1.00 36.04  ? 67  GLU C O   1 
ATOM   1889 C CB  . GLU C  1 67 ? -14.493 3.566   57.867 1.00 40.21  ? 67  GLU C CB  1 
ATOM   1890 C CG  . GLU C  1 67 ? -15.104 2.970   59.114 1.00 46.06  ? 67  GLU C CG  1 
ATOM   1891 C CD  . GLU C  1 67 ? -15.687 1.603   58.879 1.00 51.71  ? 67  GLU C CD  1 
ATOM   1892 O OE1 . GLU C  1 67 ? -16.324 1.068   59.807 1.00 54.74  ? 67  GLU C OE1 1 
ATOM   1893 O OE2 . GLU C  1 67 ? -15.512 1.069   57.769 1.00 52.09  ? 67  GLU C OE2 1 
ATOM   1894 N N   . GLY C  1 68 ? -16.533 5.883   59.240 1.00 29.39  ? 68  GLY C N   1 
ATOM   1895 C CA  . GLY C  1 68 ? -16.969 6.456   60.506 1.00 29.99  ? 68  GLY C CA  1 
ATOM   1896 C C   . GLY C  1 68 ? -16.831 7.962   60.652 1.00 32.11  ? 68  GLY C C   1 
ATOM   1897 O O   . GLY C  1 68 ? -17.043 8.534   61.743 1.00 37.11  ? 68  GLY C O   1 
ATOM   1898 N N   . ALA C  1 69 ? -16.474 8.618   59.550 1.00 29.46  ? 69  ALA C N   1 
ATOM   1899 C CA  . ALA C  1 69 ? -16.237 10.048  59.545 1.00 30.31  ? 69  ALA C CA  1 
ATOM   1900 C C   . ALA C  1 69 ? -17.549 10.813  59.602 1.00 31.05  ? 69  ALA C C   1 
ATOM   1901 O O   . ALA C  1 69 ? -18.502 10.504  58.880 1.00 32.15  ? 69  ALA C O   1 
ATOM   1902 C CB  . ALA C  1 69 ? -15.439 10.457  58.298 1.00 30.95  ? 69  ALA C CB  1 
ATOM   1903 N N   . THR C  1 70 ? -17.600 11.801  60.478 1.00 33.31  ? 70  THR C N   1 
ATOM   1904 C CA  . THR C  1 70 ? -18.662 12.779  60.410 1.00 32.68  ? 70  THR C CA  1 
ATOM   1905 C C   . THR C  1 70 ? -18.337 13.680  59.234 1.00 30.66  ? 70  THR C C   1 
ATOM   1906 O O   . THR C  1 70 ? -17.224 13.637  58.688 1.00 28.97  ? 70  THR C O   1 
ATOM   1907 C CB  . THR C  1 70 ? -18.704 13.643  61.658 1.00 37.92  ? 70  THR C CB  1 
ATOM   1908 O OG1 . THR C  1 70 ? -17.497 14.414  61.740 1.00 38.26  ? 70  THR C OG1 1 
ATOM   1909 C CG2 . THR C  1 70 ? -18.854 12.768  62.913 1.00 37.25  ? 70  THR C CG2 1 
ATOM   1910 N N   . HIS C  1 71 ? -19.292 14.516  58.848 1.00 30.59  ? 71  HIS C N   1 
ATOM   1911 C CA  . HIS C  1 71 ? -19.053 15.407  57.735 1.00 31.63  ? 71  HIS C CA  1 
ATOM   1912 C C   . HIS C  1 71 ? -17.862 16.299  58.025 1.00 29.11  ? 71  HIS C C   1 
ATOM   1913 O O   . HIS C  1 71 ? -16.997 16.501  57.170 1.00 29.57  ? 71  HIS C O   1 
ATOM   1914 C CB  . HIS C  1 71 ? -20.276 16.269  57.471 1.00 34.76  ? 71  HIS C CB  1 
ATOM   1915 C CG  . HIS C  1 71 ? -20.154 17.093  56.235 1.00 34.29  ? 71  HIS C CG  1 
ATOM   1916 N ND1 . HIS C  1 71 ? -19.705 18.397  56.250 1.00 34.28  ? 71  HIS C ND1 1 
ATOM   1917 C CD2 . HIS C  1 71 ? -20.389 16.788  54.938 1.00 32.58  ? 71  HIS C CD2 1 
ATOM   1918 C CE1 . HIS C  1 71 ? -19.684 18.865  55.013 1.00 32.55  ? 71  HIS C CE1 1 
ATOM   1919 N NE2 . HIS C  1 71 ? -20.089 17.906  54.199 1.00 34.14  ? 71  HIS C NE2 1 
ATOM   1920 N N   . LYS C  1 72 ? -17.826 16.843  59.230 1.00 31.60  ? 72  LYS C N   1 
ATOM   1921 C CA  . LYS C  1 72 ? -16.812 17.839  59.557 1.00 32.89  ? 72  LYS C CA  1 
ATOM   1922 C C   . LYS C  1 72 ? -15.458 17.148  59.564 1.00 34.19  ? 72  LYS C C   1 
ATOM   1923 O O   . LYS C  1 72 ? -14.474 17.678  59.038 1.00 33.66  ? 72  LYS C O   1 
ATOM   1924 C CB  . LYS C  1 72 ? -17.135 18.542  60.881 1.00 38.66  ? 72  LYS C CB  1 
ATOM   1925 C CG  . LYS C  1 72 ? -18.337 19.495  60.757 1.00 46.82  ? 72  LYS C CG  1 
ATOM   1926 C CD  . LYS C  1 72 ? -18.437 20.092  59.341 1.00 50.83  ? 72  LYS C CD  1 
ATOM   1927 C CE  . LYS C  1 72 ? -17.204 20.929  58.992 1.00 49.76  ? 72  LYS C CE  1 
ATOM   1928 N NZ  . LYS C  1 72 ? -17.148 21.334  57.568 1.00 40.15  ? 72  LYS C NZ  1 
ATOM   1929 N N   . GLN C  1 73 ? -15.415 15.941  60.122 1.00 31.17  ? 73  GLN C N   1 
ATOM   1930 C CA  . GLN C  1 73 ? -14.191 15.149  60.052 1.00 30.76  ? 73  GLN C CA  1 
ATOM   1931 C C   . GLN C  1 73 ? -13.719 14.895  58.614 1.00 28.82  ? 73  GLN C C   1 
ATOM   1932 O O   . GLN C  1 73 ? -12.542 15.067  58.308 1.00 31.98  ? 73  GLN C O   1 
ATOM   1933 C CB  . GLN C  1 73 ? -14.368 13.825  60.790 1.00 32.96  ? 73  GLN C CB  1 
ATOM   1934 C CG  . GLN C  1 73 ? -14.513 14.002  62.282 1.00 36.29  ? 73  GLN C CG  1 
ATOM   1935 C CD  . GLN C  1 73 ? -14.842 12.716  62.983 1.00 36.21  ? 73  GLN C CD  1 
ATOM   1936 O OE1 . GLN C  1 73 ? -15.356 11.774  62.379 1.00 36.51  ? 73  GLN C OE1 1 
ATOM   1937 N NE2 . GLN C  1 73 ? -14.539 12.658  64.274 1.00 43.68  ? 73  GLN C NE2 1 
ATOM   1938 N N   . ALA C  1 74 ? -14.633 14.500  57.733 1.00 27.39  ? 74  ALA C N   1 
ATOM   1939 C CA  . ALA C  1 74 ? -14.298 14.278  56.319 1.00 26.41  ? 74  ALA C CA  1 
ATOM   1940 C C   . ALA C  1 74 ? -13.730 15.527  55.640 1.00 25.27  ? 74  ALA C C   1 
ATOM   1941 O O   . ALA C  1 74 ? -12.730 15.461  54.913 1.00 25.99  ? 74  ALA C O   1 
ATOM   1942 C CB  . ALA C  1 74 ? -15.521 13.775  55.566 1.00 27.07  ? 74  ALA C CB  1 
ATOM   1943 N N   . VAL C  1 75 ? -14.381 16.671  55.848 1.00 25.93  ? 75  VAL C N   1 
ATOM   1944 C CA  . VAL C  1 75 ? -13.898 17.923  55.288 1.00 26.81  ? 75  VAL C CA  1 
ATOM   1945 C C   . VAL C  1 75 ? -12.502 18.261  55.815 1.00 28.17  ? 75  VAL C C   1 
ATOM   1946 O O   . VAL C  1 75 ? -11.616 18.639  55.046 1.00 27.08  ? 75  VAL C O   1 
ATOM   1947 C CB  . VAL C  1 75 ? -14.877 19.065  55.599 1.00 28.56  ? 75  VAL C CB  1 
ATOM   1948 C CG1 . VAL C  1 75 ? -14.318 20.407  55.166 1.00 32.92  ? 75  VAL C CG1 1 
ATOM   1949 C CG2 . VAL C  1 75 ? -16.209 18.777  54.922 1.00 28.78  ? 75  VAL C CG2 1 
ATOM   1950 N N   . GLU C  1 76 ? -12.292 18.073  57.114 1.00 27.69  ? 76  GLU C N   1 
ATOM   1951 C CA  . GLU C  1 76 ? -10.991 18.384  57.692 1.00 29.68  ? 76  GLU C CA  1 
ATOM   1952 C C   . GLU C  1 76 ? -9.906  17.459  57.130 1.00 29.03  ? 76  GLU C C   1 
ATOM   1953 O O   . GLU C  1 76 ? -8.786  17.902  56.875 1.00 30.71  ? 76  GLU C O   1 
ATOM   1954 C CB  . GLU C  1 76 ? -11.038 18.355  59.219 1.00 34.78  ? 76  GLU C CB  1 
ATOM   1955 C CG  . GLU C  1 76 ? -11.738 19.591  59.775 1.00 43.42  ? 76  GLU C CG  1 
ATOM   1956 C CD  . GLU C  1 76 ? -11.122 20.894  59.255 1.00 51.08  ? 76  GLU C CD  1 
ATOM   1957 O OE1 . GLU C  1 76 ? -11.816 21.660  58.538 1.00 51.82  ? 76  GLU C OE1 1 
ATOM   1958 O OE2 . GLU C  1 76 ? -9.934  21.143  59.556 1.00 54.02  ? 76  GLU C OE2 1 
ATOM   1959 N N   . THR C  1 77 ? -10.261 16.191  56.928 1.00 27.99  ? 77  THR C N   1 
ATOM   1960 C CA  . THR C  1 77 ? -9.349  15.216  56.356 1.00 27.05  ? 77  THR C CA  1 
ATOM   1961 C C   . THR C  1 77 ? -8.961  15.626  54.937 1.00 28.07  ? 77  THR C C   1 
ATOM   1962 O O   . THR C  1 77 ? -7.790  15.548  54.550 1.00 30.03  ? 77  THR C O   1 
ATOM   1963 C CB  . THR C  1 77 ? -9.943  13.795  56.401 1.00 27.67  ? 77  THR C CB  1 
ATOM   1964 O OG1 . THR C  1 77 ? -10.007 13.387  57.774 1.00 29.28  ? 77  THR C OG1 1 
ATOM   1965 C CG2 . THR C  1 77 ? -9.084  12.819  55.586 1.00 27.68  ? 77  THR C CG2 1 
ATOM   1966 N N   . LEU C  1 78 ? -9.933  16.099  54.164 1.00 25.26  ? 78  LEU C N   1 
ATOM   1967 C CA  . LEU C  1 78 ? -9.614  16.579  52.811 1.00 26.95  ? 78  LEU C CA  1 
ATOM   1968 C C   . LEU C  1 78 ? -8.718  17.822  52.829 1.00 27.62  ? 78  LEU C C   1 
ATOM   1969 O O   . LEU C  1 78 ? -7.830  17.976  51.970 1.00 29.72  ? 78  LEU C O   1 
ATOM   1970 C CB  . LEU C  1 78 ? -10.897 16.876  52.037 1.00 26.42  ? 78  LEU C CB  1 
ATOM   1971 C CG  . LEU C  1 78 ? -11.642 15.617  51.599 1.00 26.02  ? 78  LEU C CG  1 
ATOM   1972 C CD1 . LEU C  1 78 ? -13.116 15.851  51.381 1.00 27.10  ? 78  LEU C CD1 1 
ATOM   1973 C CD2 . LEU C  1 78 ? -10.996 14.960  50.363 1.00 25.57  ? 78  LEU C CD2 1 
ATOM   1974 N N   . ARG C  1 79 ? -8.954  18.704  53.798 1.00 27.00  ? 79  ARG C N   1 
ATOM   1975 C CA  . ARG C  1 79 ? -8.229  19.975  53.850 1.00 30.58  ? 79  ARG C CA  1 
ATOM   1976 C C   . ARG C  1 79 ? -6.810  19.814  54.371 1.00 33.70  ? 79  ARG C C   1 
ATOM   1977 O O   . ARG C  1 79 ? -5.903  20.532  53.929 1.00 34.84  ? 79  ARG C O   1 
ATOM   1978 C CB  . ARG C  1 79 ? -8.982  21.007  54.700 1.00 35.88  ? 79  ARG C CB  1 
ATOM   1979 C CG  . ARG C  1 79 ? -10.212 21.561  54.026 1.00 37.84  ? 79  ARG C CG  1 
ATOM   1980 C CD  . ARG C  1 79 ? -10.943 22.534  54.941 1.00 44.55  ? 79  ARG C CD  1 
ATOM   1981 N NE  . ARG C  1 79 ? -12.122 23.072  54.271 1.00 49.05  ? 79  ARG C NE  1 
ATOM   1982 C CZ  . ARG C  1 79 ? -13.140 23.654  54.894 1.00 51.92  ? 79  ARG C CZ  1 
ATOM   1983 N NH1 . ARG C  1 79 ? -13.126 23.787  56.216 1.00 51.50  ? 79  ARG C NH1 1 
ATOM   1984 N NH2 . ARG C  1 79 ? -14.169 24.109  54.187 1.00 54.08  ? 79  ARG C NH2 1 
ATOM   1985 N N   . ASN C  1 80 ? -6.623  18.877  55.305 1.00 30.53  ? 80  ASN C N   1 
ATOM   1986 C CA  . ASN C  1 80 ? -5.326  18.668  55.938 1.00 32.45  ? 80  ASN C CA  1 
ATOM   1987 C C   . ASN C  1 80 ? -4.431  17.802  55.089 1.00 30.16  ? 80  ASN C C   1 
ATOM   1988 O O   . ASN C  1 80 ? -4.047  16.686  55.464 1.00 29.89  ? 80  ASN C O   1 
ATOM   1989 C CB  . ASN C  1 80 ? -5.498  18.103  57.347 1.00 39.72  ? 80  ASN C CB  1 
ATOM   1990 C CG  . ASN C  1 80 ? -6.051  19.146  58.318 1.00 47.78  ? 80  ASN C CG  1 
ATOM   1991 O OD1 . ASN C  1 80 ? -5.954  20.362  58.081 1.00 48.33  ? 80  ASN C OD1 1 
ATOM   1992 N ND2 . ASN C  1 80 ? -6.638  18.676  59.413 1.00 51.97  ? 80  ASN C ND2 1 
ATOM   1993 N N   . THR C  1 81 ? -4.132  18.321  53.901 1.00 29.70  ? 81  THR C N   1 
ATOM   1994 C CA  . THR C  1 81 ? -3.424  17.561  52.890 1.00 25.35  ? 81  THR C CA  1 
ATOM   1995 C C   . THR C  1 81 ? -2.487  18.547  52.187 1.00 26.30  ? 81  THR C C   1 
ATOM   1996 O O   . THR C  1 81 ? -2.528  19.759  52.444 1.00 27.95  ? 81  THR C O   1 
ATOM   1997 C CB  . THR C  1 81 ? -4.402  16.984  51.842 1.00 26.25  ? 81  THR C CB  1 
ATOM   1998 O OG1 . THR C  1 81 ? -5.266  18.035  51.386 1.00 25.54  ? 81  THR C OG1 1 
ATOM   1999 C CG2 . THR C  1 81 ? -5.250  15.830  52.434 1.00 25.82  ? 81  THR C CG2 1 
ATOM   2000 N N   . GLY C  1 82 ? -1.646  18.016  51.309 1.00 27.44  ? 82  GLY C N   1 
ATOM   2001 C CA  . GLY C  1 82 ? -0.728  18.833  50.555 1.00 25.47  ? 82  GLY C CA  1 
ATOM   2002 C C   . GLY C  1 82 ? -1.333  19.244  49.228 1.00 24.85  ? 82  GLY C C   1 
ATOM   2003 O O   . GLY C  1 82 ? -2.538  19.110  49.010 1.00 28.28  ? 82  GLY C O   1 
ATOM   2004 N N   . GLN C  1 83 ? -0.485  19.696  48.318 1.00 24.38  ? 83  GLN C N   1 
ATOM   2005 C CA  . GLN C  1 83 ? -0.918  20.283  47.064 1.00 25.01  ? 83  GLN C CA  1 
ATOM   2006 C C   . GLN C  1 83 ? -1.480  19.225  46.094 1.00 23.78  ? 83  GLN C C   1 
ATOM   2007 O O   . GLN C  1 83 ? -2.354  19.520  45.273 1.00 23.36  ? 83  GLN C O   1 
ATOM   2008 C CB  . GLN C  1 83 ? 0.260   21.074  46.474 1.00 26.03  ? 83  GLN C CB  1 
ATOM   2009 C CG  . GLN C  1 83 ? 0.173   21.432  44.990 1.00 27.91  ? 83  GLN C CG  1 
ATOM   2010 C CD  . GLN C  1 83 ? -1.088  22.182  44.624 1.00 30.44  ? 83  GLN C CD  1 
ATOM   2011 O OE1 . GLN C  1 83 ? -1.724  22.802  45.470 1.00 34.65  ? 83  GLN C OE1 1 
ATOM   2012 N NE2 . GLN C  1 83 ? -1.454  22.133  43.340 1.00 32.30  ? 83  GLN C NE2 1 
ATOM   2013 N N   . VAL C  1 84 ? -0.983  17.994  46.196 1.00 20.97  ? 84  VAL C N   1 
ATOM   2014 C CA  . VAL C  1 84 ? -1.526  16.857  45.419 1.00 20.93  ? 84  VAL C CA  1 
ATOM   2015 C C   . VAL C  1 84 ? -2.073  15.801  46.396 1.00 23.50  ? 84  VAL C C   1 
ATOM   2016 O O   . VAL C  1 84 ? -1.389  15.416  47.345 1.00 24.63  ? 84  VAL C O   1 
ATOM   2017 C CB  . VAL C  1 84 ? -0.452  16.255  44.491 1.00 21.96  ? 84  VAL C CB  1 
ATOM   2018 C CG1 . VAL C  1 84 ? -0.838  14.828  44.079 1.00 30.87  ? 84  VAL C CG1 1 
ATOM   2019 C CG2 . VAL C  1 84 ? -0.256  17.162  43.281 1.00 26.46  ? 84  VAL C CG2 1 
ATOM   2020 N N   . VAL C  1 85 ? -3.308  15.351  46.173 1.00 20.91  ? 85  VAL C N   1 
ATOM   2021 C CA  . VAL C  1 85 ? -4.017  14.510  47.125 1.00 21.36  ? 85  VAL C CA  1 
ATOM   2022 C C   . VAL C  1 85 ? -4.410  13.205  46.442 1.00 22.12  ? 85  VAL C C   1 
ATOM   2023 O O   . VAL C  1 85 ? -4.961  13.219  45.339 1.00 20.05  ? 85  VAL C O   1 
ATOM   2024 C CB  . VAL C  1 85 ? -5.288  15.208  47.648 1.00 21.72  ? 85  VAL C CB  1 
ATOM   2025 C CG1 . VAL C  1 85 ? -5.988  14.360  48.714 1.00 22.28  ? 85  VAL C CG1 1 
ATOM   2026 C CG2 . VAL C  1 85 ? -4.946  16.608  48.208 1.00 20.78  ? 85  VAL C CG2 1 
ATOM   2027 N N   . HIS C  1 86 ? -4.115  12.084  47.097 1.00 20.24  ? 86  HIS C N   1 
ATOM   2028 C CA  . HIS C  1 86 ? -4.484  10.785  46.581 1.00 20.50  ? 86  HIS C CA  1 
ATOM   2029 C C   . HIS C  1 86 ? -5.902  10.471  47.059 1.00 22.43  ? 86  HIS C C   1 
ATOM   2030 O O   . HIS C  1 86 ? -6.178  10.493  48.260 1.00 23.72  ? 86  HIS C O   1 
ATOM   2031 C CB  . HIS C  1 86 ? -3.489  9.738   47.069 1.00 19.43  ? 86  HIS C CB  1 
ATOM   2032 C CG  . HIS C  1 86 ? -3.686  8.391   46.458 1.00 23.28  ? 86  HIS C CG  1 
ATOM   2033 N ND1 . HIS C  1 86 ? -3.270  7.232   47.074 1.00 26.38  ? 86  HIS C ND1 1 
ATOM   2034 C CD2 . HIS C  1 86 ? -4.240  8.016   45.276 1.00 25.48  ? 86  HIS C CD2 1 
ATOM   2035 C CE1 . HIS C  1 86 ? -3.562  6.195   46.305 1.00 27.63  ? 86  HIS C CE1 1 
ATOM   2036 N NE2 . HIS C  1 86 ? -4.155  6.641   45.211 1.00 27.37  ? 86  HIS C NE2 1 
ATOM   2037 N N   . LEU C  1 87 ? -6.815  10.249  46.120 1.00 21.37  ? 87  LEU C N   1 
ATOM   2038 C CA  . LEU C  1 87 ? -8.202  9.965   46.481 1.00 19.03  ? 87  LEU C CA  1 
ATOM   2039 C C   . LEU C  1 87 ? -8.641  8.620   45.920 1.00 19.77  ? 87  LEU C C   1 
ATOM   2040 O O   . LEU C  1 87 ? -8.319  8.275   44.761 1.00 20.14  ? 87  LEU C O   1 
ATOM   2041 C CB  . LEU C  1 87 ? -9.109  11.044  45.896 1.00 17.81  ? 87  LEU C CB  1 
ATOM   2042 C CG  . LEU C  1 87 ? -8.881  12.479  46.399 1.00 19.33  ? 87  LEU C CG  1 
ATOM   2043 C CD1 . LEU C  1 87 ? -9.731  13.394  45.571 1.00 22.43  ? 87  LEU C CD1 1 
ATOM   2044 C CD2 . LEU C  1 87 ? -9.255  12.546  47.874 1.00 22.01  ? 87  LEU C CD2 1 
ATOM   2045 N N   . LEU C  1 88 ? -9.354  7.855   46.745 1.00 19.97  ? 88  LEU C N   1 
ATOM   2046 C CA  . LEU C  1 88 ? -9.924  6.571   46.304 1.00 18.77  ? 88  LEU C CA  1 
ATOM   2047 C C   . LEU C  1 88 ? -11.429 6.755   46.280 1.00 20.41  ? 88  LEU C C   1 
ATOM   2048 O O   . LEU C  1 88 ? -12.017 7.181   47.295 1.00 20.65  ? 88  LEU C O   1 
ATOM   2049 C CB  . LEU C  1 88 ? -9.584  5.499   47.323 1.00 21.05  ? 88  LEU C CB  1 
ATOM   2050 C CG  . LEU C  1 88 ? -10.133 4.098   47.094 1.00 19.60  ? 88  LEU C CG  1 
ATOM   2051 C CD1 . LEU C  1 88 ? -9.448  3.507   45.874 1.00 21.13  ? 88  LEU C CD1 1 
ATOM   2052 C CD2 . LEU C  1 88 ? -9.892  3.244   48.350 1.00 24.10  ? 88  LEU C CD2 1 
ATOM   2053 N N   . LEU C  1 89 ? -12.048 6.447   45.142 1.00 24.12  ? 89  LEU C N   1 
ATOM   2054 C CA  . LEU C  1 89 ? -13.479 6.685   44.920 1.00 25.39  ? 89  LEU C CA  1 
ATOM   2055 C C   . LEU C  1 89 ? -14.250 5.474   44.433 1.00 24.41  ? 89  LEU C C   1 
ATOM   2056 O O   . LEU C  1 89 ? -13.678 4.536   43.856 1.00 23.76  ? 89  LEU C O   1 
ATOM   2057 C CB  . LEU C  1 89 ? -13.691 7.817   43.894 1.00 23.84  ? 89  LEU C CB  1 
ATOM   2058 C CG  . LEU C  1 89 ? -13.082 9.140   44.348 1.00 25.55  ? 89  LEU C CG  1 
ATOM   2059 C CD1 . LEU C  1 89 ? -11.808 9.448   43.597 1.00 24.17  ? 89  LEU C CD1 1 
ATOM   2060 C CD2 . LEU C  1 89 ? -14.096 10.288  44.229 1.00 27.40  ? 89  LEU C CD2 1 
ATOM   2061 N N   . GLU C  1 90 ? -15.563 5.509   44.636 1.00 22.82  ? 90  GLU C N   1 
ATOM   2062 C CA  . GLU C  1 90 ? -16.466 4.603   43.932 1.00 23.06  ? 90  GLU C CA  1 
ATOM   2063 C C   . GLU C  1 90 ? -17.282 5.452   42.957 1.00 23.08  ? 90  GLU C C   1 
ATOM   2064 O O   . GLU C  1 90 ? -17.835 6.482   43.323 1.00 25.22  ? 90  GLU C O   1 
ATOM   2065 C CB  . GLU C  1 90 ? -17.395 3.871   44.903 1.00 29.02  ? 90  GLU C CB  1 
ATOM   2066 C CG  . GLU C  1 90 ? -18.463 3.102   44.159 1.00 30.79  ? 90  GLU C CG  1 
ATOM   2067 C CD  . GLU C  1 90 ? -19.534 2.572   45.065 1.00 37.74  ? 90  GLU C CD  1 
ATOM   2068 O OE1 . GLU C  1 90 ? -19.394 2.747   46.291 1.00 41.35  ? 90  GLU C OE1 1 
ATOM   2069 O OE2 . GLU C  1 90 ? -20.508 1.968   44.558 1.00 38.25  ? 90  GLU C OE2 1 
ATOM   2070 N N   . LYS C  1 91 ? -17.360 5.006   41.713 1.00 22.75  ? 91  LYS C N   1 
ATOM   2071 C CA  . LYS C  1 91 ? -18.076 5.750   40.687 1.00 23.82  ? 91  LYS C CA  1 
ATOM   2072 C C   . LYS C  1 91 ? -19.583 5.689   40.984 1.00 27.14  ? 91  LYS C C   1 
ATOM   2073 O O   . LYS C  1 91 ? -20.144 4.619   41.237 1.00 27.39  ? 91  LYS C O   1 
ATOM   2074 C CB  . LYS C  1 91 ? -17.722 5.176   39.317 1.00 23.08  ? 91  LYS C CB  1 
ATOM   2075 C CG  . LYS C  1 91 ? -18.578 5.665   38.169 1.00 27.18  ? 91  LYS C CG  1 
ATOM   2076 C CD  . LYS C  1 91 ? -18.182 7.051   37.753 1.00 31.98  ? 91  LYS C CD  1 
ATOM   2077 C CE  . LYS C  1 91 ? -18.887 7.427   36.447 1.00 35.24  ? 91  LYS C CE  1 
ATOM   2078 N NZ  . LYS C  1 91 ? -18.641 8.852   36.136 1.00 36.77  ? 91  LYS C NZ  1 
ATOM   2079 N N   . GLY C  1 92 ? -20.228 6.852   41.009 1.00 28.43  ? 92  GLY C N   1 
ATOM   2080 C CA  . GLY C  1 92 ? -21.628 6.926   41.367 1.00 32.16  ? 92  GLY C CA  1 
ATOM   2081 C C   . GLY C  1 92 ? -22.543 6.548   40.215 1.00 40.37  ? 92  GLY C C   1 
ATOM   2082 O O   . GLY C  1 92 ? -22.088 6.386   39.080 1.00 40.37  ? 92  GLY C O   1 
ATOM   2083 N N   . GLN C  1 93 ? -23.831 6.395   40.516 1.00 50.71  ? 93  GLN C N   1 
ATOM   2084 C CA  . GLN C  1 93 ? -24.808 6.053   39.492 1.00 62.42  ? 93  GLN C CA  1 
ATOM   2085 C C   . GLN C  1 93 ? -24.960 7.200   38.501 1.00 71.75  ? 93  GLN C C   1 
ATOM   2086 O O   . GLN C  1 93 ? -24.972 8.370   38.887 1.00 71.22  ? 93  GLN C O   1 
ATOM   2087 C CB  . GLN C  1 93 ? -26.152 5.661   40.110 1.00 67.92  ? 93  GLN C CB  1 
ATOM   2088 C CG  . GLN C  1 93 ? -26.285 4.168   40.379 1.00 69.43  ? 93  GLN C CG  1 
ATOM   2089 C CD  . GLN C  1 93 ? -26.186 3.332   39.106 1.00 72.36  ? 93  GLN C CD  1 
ATOM   2090 O OE1 . GLN C  1 93 ? -26.264 3.856   37.987 1.00 73.84  ? 93  GLN C OE1 1 
ATOM   2091 N NE2 . GLN C  1 93 ? -26.013 2.023   39.273 1.00 72.55  ? 93  GLN C NE2 1 
ATOM   2092 N N   . SER C  1 94 ? -25.061 6.849   37.223 1.00 81.89  ? 94  SER C N   1 
ATOM   2093 C CA  . SER C  1 94 ? -24.997 7.822   36.138 1.00 89.58  ? 94  SER C CA  1 
ATOM   2094 C C   . SER C  1 94 ? -23.581 8.394   36.038 1.00 88.75  ? 94  SER C C   1 
ATOM   2095 O O   . SER C  1 94 ? -22.601 7.729   36.394 1.00 86.52  ? 94  SER C O   1 
ATOM   2096 C CB  . SER C  1 94 ? -26.023 8.941   36.343 1.00 94.76  ? 94  SER C CB  1 
ATOM   2097 O OG  . SER C  1 94 ? -26.134 9.751   35.188 1.00 96.89  ? 94  SER C OG  1 
ATOM   2098 N N   . PRO D  1 1  ? 0.344   3.358   57.846 1.00 36.95  ? 1   PRO D N   1 
ATOM   2099 C CA  . PRO D  1 1  ? 1.230   2.191   57.904 1.00 36.94  ? 1   PRO D CA  1 
ATOM   2100 C C   . PRO D  1 1  ? 1.805   1.964   59.291 1.00 36.91  ? 1   PRO D C   1 
ATOM   2101 O O   . PRO D  1 1  ? 1.898   2.894   60.101 1.00 39.04  ? 1   PRO D O   1 
ATOM   2102 C CB  . PRO D  1 1  ? 2.388   2.574   56.993 1.00 35.42  ? 1   PRO D CB  1 
ATOM   2103 C CG  . PRO D  1 1  ? 1.822   3.583   56.048 1.00 36.42  ? 1   PRO D CG  1 
ATOM   2104 C CD  . PRO D  1 1  ? 0.625   4.223   56.687 1.00 37.09  ? 1   PRO D CD  1 
ATOM   2105 N N   . LYS D  1 2  ? 2.214   0.729   59.535 1.00 37.28  ? 2   LYS D N   1 
ATOM   2106 C CA  . LYS D  1 2  ? 2.958   0.370   60.734 1.00 38.53  ? 2   LYS D CA  1 
ATOM   2107 C C   . LYS D  1 2  ? 4.444   0.420   60.416 1.00 35.49  ? 2   LYS D C   1 
ATOM   2108 O O   . LYS D  1 2  ? 4.835   0.279   59.257 1.00 37.89  ? 2   LYS D O   1 
ATOM   2109 C CB  . LYS D  1 2  ? 2.599   -1.051  61.189 1.00 44.04  ? 2   LYS D CB  1 
ATOM   2110 C CG  . LYS D  1 2  ? 1.149   -1.235  61.592 1.00 47.30  ? 2   LYS D CG  1 
ATOM   2111 C CD  . LYS D  1 2  ? 0.905   -2.630  62.137 1.00 52.64  ? 2   LYS D CD  1 
ATOM   2112 C CE  . LYS D  1 2  ? -0.065  -2.605  63.322 1.00 54.76  ? 2   LYS D CE  1 
ATOM   2113 N NZ  . LYS D  1 2  ? -1.481  -2.291  62.942 1.00 52.21  ? 2   LYS D NZ  1 
ATOM   2114 N N   . PRO D  1 3  ? 5.285   0.581   61.448 1.00 35.31  ? 3   PRO D N   1 
ATOM   2115 C CA  . PRO D  1 3  ? 6.727   0.532   61.206 1.00 35.77  ? 3   PRO D CA  1 
ATOM   2116 C C   . PRO D  1 3  ? 7.094   -0.733  60.446 1.00 38.62  ? 3   PRO D C   1 
ATOM   2117 O O   . PRO D  1 3  ? 6.621   -1.826  60.790 1.00 38.85  ? 3   PRO D O   1 
ATOM   2118 C CB  . PRO D  1 3  ? 7.308   0.495   62.628 1.00 41.25  ? 3   PRO D CB  1 
ATOM   2119 C CG  . PRO D  1 3  ? 6.298   1.233   63.437 1.00 42.27  ? 3   PRO D CG  1 
ATOM   2120 C CD  . PRO D  1 3  ? 4.967   0.862   62.863 1.00 37.97  ? 3   PRO D CD  1 
ATOM   2121 N N   . GLY D  1 4  ? 7.942   -0.580  59.434 1.00 37.78  ? 4   GLY D N   1 
ATOM   2122 C CA  . GLY D  1 4  ? 8.353   -1.698  58.604 1.00 39.67  ? 4   GLY D CA  1 
ATOM   2123 C C   . GLY D  1 4  ? 7.571   -1.813  57.310 1.00 38.26  ? 4   GLY D C   1 
ATOM   2124 O O   . GLY D  1 4  ? 8.045   -2.429  56.347 1.00 40.25  ? 4   GLY D O   1 
ATOM   2125 N N   . ASP D  1 5  ? 6.373   -1.228  57.276 1.00 34.55  ? 5   ASP D N   1 
ATOM   2126 C CA  . ASP D  1 5  ? 5.528   -1.302  56.077 1.00 30.37  ? 5   ASP D CA  1 
ATOM   2127 C C   . ASP D  1 5  ? 6.104   -0.455  54.946 1.00 28.28  ? 5   ASP D C   1 
ATOM   2128 O O   . ASP D  1 5  ? 6.621   0.642   55.188 1.00 34.64  ? 5   ASP D O   1 
ATOM   2129 C CB  . ASP D  1 5  ? 4.110   -0.794  56.362 1.00 29.69  ? 5   ASP D CB  1 
ATOM   2130 C CG  . ASP D  1 5  ? 3.285   -1.746  57.197 1.00 37.86  ? 5   ASP D CG  1 
ATOM   2131 O OD1 . ASP D  1 5  ? 3.716   -2.894  57.457 1.00 41.13  ? 5   ASP D OD1 1 
ATOM   2132 O OD2 . ASP D  1 5  ? 2.181   -1.326  57.606 1.00 39.62  ? 5   ASP D OD2 1 
ATOM   2133 N N   . ILE D  1 6  ? 5.989   -0.947  53.710 1.00 28.32  ? 6   ILE D N   1 
ATOM   2134 C CA  . ILE D  1 6  ? 6.296   -0.150  52.532 1.00 29.04  ? 6   ILE D CA  1 
ATOM   2135 C C   . ILE D  1 6  ? 5.108   0.754   52.246 1.00 29.05  ? 6   ILE D C   1 
ATOM   2136 O O   . ILE D  1 6  ? 3.960   0.330   52.390 1.00 29.47  ? 6   ILE D O   1 
ATOM   2137 C CB  . ILE D  1 6  ? 6.466   -1.048  51.286 1.00 27.56  ? 6   ILE D CB  1 
ATOM   2138 C CG1 . ILE D  1 6  ? 7.660   -1.993  51.462 1.00 32.89  ? 6   ILE D CG1 1 
ATOM   2139 C CG2 . ILE D  1 6  ? 6.603   -0.211  50.025 1.00 27.60  ? 6   ILE D CG2 1 
ATOM   2140 C CD1 . ILE D  1 6  ? 8.992   -1.297  51.497 1.00 36.34  ? 6   ILE D CD1 1 
ATOM   2141 N N   . PHE D  1 7  ? 5.371   2.000   51.861 1.00 28.28  ? 7   PHE D N   1 
ATOM   2142 C CA  . PHE D  1 7  ? 4.304   2.846   51.317 1.00 25.91  ? 7   PHE D CA  1 
ATOM   2143 C C   . PHE D  1 7  ? 4.834   3.774   50.228 1.00 26.61  ? 7   PHE D C   1 
ATOM   2144 O O   . PHE D  1 7  ? 6.041   3.988   50.137 1.00 27.74  ? 7   PHE D O   1 
ATOM   2145 C CB  . PHE D  1 7  ? 3.585   3.628   52.435 1.00 27.44  ? 7   PHE D CB  1 
ATOM   2146 C CG  . PHE D  1 7  ? 4.436   4.672   53.120 1.00 27.56  ? 7   PHE D CG  1 
ATOM   2147 C CD1 . PHE D  1 7  ? 4.340   6.017   52.762 1.00 28.13  ? 7   PHE D CD1 1 
ATOM   2148 C CD2 . PHE D  1 7  ? 5.302   4.319   54.148 1.00 32.77  ? 7   PHE D CD2 1 
ATOM   2149 C CE1 . PHE D  1 7  ? 5.105   6.981   53.406 1.00 28.68  ? 7   PHE D CE1 1 
ATOM   2150 C CE2 . PHE D  1 7  ? 6.077   5.290   54.804 1.00 32.12  ? 7   PHE D CE2 1 
ATOM   2151 C CZ  . PHE D  1 7  ? 5.981   6.610   54.428 1.00 30.97  ? 7   PHE D CZ  1 
ATOM   2152 N N   . GLU D  1 8  ? 3.940   4.293   49.382 1.00 24.33  ? 8   GLU D N   1 
ATOM   2153 C CA  . GLU D  1 8  ? 4.350   5.205   48.325 1.00 23.03  ? 8   GLU D CA  1 
ATOM   2154 C C   . GLU D  1 8  ? 3.503   6.475   48.384 1.00 27.00  ? 8   GLU D C   1 
ATOM   2155 O O   . GLU D  1 8  ? 2.356   6.471   48.857 1.00 28.19  ? 8   GLU D O   1 
ATOM   2156 C CB  . GLU D  1 8  ? 4.272   4.536   46.941 1.00 25.81  ? 8   GLU D CB  1 
ATOM   2157 C CG  . GLU D  1 8  ? 2.994   3.819   46.653 1.00 33.25  ? 8   GLU D CG  1 
ATOM   2158 C CD  . GLU D  1 8  ? 3.044   3.097   45.307 1.00 38.15  ? 8   GLU D CD  1 
ATOM   2159 O OE1 . GLU D  1 8  ? 2.340   2.078   45.152 1.00 39.79  ? 8   GLU D OE1 1 
ATOM   2160 O OE2 . GLU D  1 8  ? 3.803   3.542   44.413 1.00 36.76  ? 8   GLU D OE2 1 
ATOM   2161 N N   . VAL D  1 9  ? 4.092   7.565   47.927 1.00 24.93  ? 9   VAL D N   1 
ATOM   2162 C CA  . VAL D  1 9  ? 3.403   8.846   47.921 1.00 25.17  ? 9   VAL D CA  1 
ATOM   2163 C C   . VAL D  1 9  ? 3.733   9.558   46.618 1.00 25.81  ? 9   VAL D C   1 
ATOM   2164 O O   . VAL D  1 9  ? 4.814   9.381   46.057 1.00 29.24  ? 9   VAL D O   1 
ATOM   2165 C CB  . VAL D  1 9  ? 3.838   9.730   49.125 1.00 29.78  ? 9   VAL D CB  1 
ATOM   2166 C CG1 . VAL D  1 9  ? 3.681   8.979   50.452 1.00 30.06  ? 9   VAL D CG1 1 
ATOM   2167 C CG2 . VAL D  1 9  ? 5.267   10.171  48.963 1.00 33.57  ? 9   VAL D CG2 1 
ATOM   2168 N N   . GLU D  1 10 ? 2.792   10.359  46.133 1.00 23.89  ? 10  GLU D N   1 
ATOM   2169 C CA  . GLU D  1 10 ? 3.072   11.319  45.072 1.00 22.70  ? 10  GLU D CA  1 
ATOM   2170 C C   . GLU D  1 10 ? 3.052   12.681  45.769 1.00 25.24  ? 10  GLU D C   1 
ATOM   2171 O O   . GLU D  1 10 ? 2.008   13.145  46.246 1.00 26.18  ? 10  GLU D O   1 
ATOM   2172 C CB  . GLU D  1 10 ? 1.985   11.284  43.999 1.00 22.77  ? 10  GLU D CB  1 
ATOM   2173 C CG  . GLU D  1 10 ? 1.999   10.077  43.097 1.00 21.06  ? 10  GLU D CG  1 
ATOM   2174 C CD  . GLU D  1 10 ? 3.161   10.032  42.120 1.00 23.89  ? 10  GLU D CD  1 
ATOM   2175 O OE1 . GLU D  1 10 ? 3.945   10.992  42.070 1.00 28.95  ? 10  GLU D OE1 1 
ATOM   2176 O OE2 . GLU D  1 10 ? 3.268   9.018   41.401 1.00 29.22  ? 10  GLU D OE2 1 
ATOM   2177 N N   . LEU D  1 11 ? 4.224   13.276  45.917 1.00 24.70  ? 11  LEU D N   1 
ATOM   2178 C CA  . LEU D  1 11 ? 4.357   14.456  46.768 1.00 24.73  ? 11  LEU D CA  1 
ATOM   2179 C C   . LEU D  1 11 ? 4.584   15.661  45.887 1.00 26.56  ? 11  LEU D C   1 
ATOM   2180 O O   . LEU D  1 11 ? 5.542   15.691  45.124 1.00 25.23  ? 11  LEU D O   1 
ATOM   2181 C CB  . LEU D  1 11 ? 5.524   14.271  47.748 1.00 25.81  ? 11  LEU D CB  1 
ATOM   2182 C CG  . LEU D  1 11 ? 5.790   15.385  48.765 1.00 30.60  ? 11  LEU D CG  1 
ATOM   2183 C CD1 . LEU D  1 11 ? 4.564   15.575  49.661 1.00 34.48  ? 11  LEU D CD1 1 
ATOM   2184 C CD2 . LEU D  1 11 ? 7.016   15.048  49.645 1.00 29.59  ? 11  LEU D CD2 1 
ATOM   2185 N N   . ALA D  1 12 ? 3.687   16.642  45.976 1.00 26.06  ? 12  ALA D N   1 
ATOM   2186 C CA  . ALA D  1 12 ? 3.865   17.927  45.297 1.00 26.22  ? 12  ALA D CA  1 
ATOM   2187 C C   . ALA D  1 12 ? 4.743   18.861  46.118 1.00 26.00  ? 12  ALA D C   1 
ATOM   2188 O O   . ALA D  1 12 ? 4.576   19.000  47.322 1.00 25.92  ? 12  ALA D O   1 
ATOM   2189 C CB  . ALA D  1 12 ? 2.516   18.588  45.040 1.00 26.66  ? 12  ALA D CB  1 
ATOM   2190 N N   . LYS D  1 13 ? 5.675   19.525  45.453 1.00 24.28  ? 13  LYS D N   1 
ATOM   2191 C CA  . LYS D  1 13 ? 6.556   20.443  46.150 1.00 21.47  ? 13  LYS D CA  1 
ATOM   2192 C C   . LYS D  1 13 ? 5.810   21.721  46.534 1.00 24.80  ? 13  LYS D C   1 
ATOM   2193 O O   . LYS D  1 13 ? 4.786   22.059  45.922 1.00 28.68  ? 13  LYS D O   1 
ATOM   2194 C CB  . LYS D  1 13 ? 7.737   20.804  45.254 1.00 23.48  ? 13  LYS D CB  1 
ATOM   2195 C CG  . LYS D  1 13 ? 8.680   19.658  45.030 1.00 27.74  ? 13  LYS D CG  1 
ATOM   2196 C CD  . LYS D  1 13 ? 9.703   19.972  43.973 1.00 28.96  ? 13  LYS D CD  1 
ATOM   2197 C CE  . LYS D  1 13 ? 10.606  18.768  43.707 1.00 29.10  ? 13  LYS D CE  1 
ATOM   2198 N NZ  . LYS D  1 13 ? 11.633  19.083  42.653 1.00 26.02  ? 13  LYS D NZ  1 
ATOM   2199 N N   . ASN D  1 14 ? 6.310   22.376  47.581 1.00 26.43  ? 14  ASN D N   1 
ATOM   2200 C CA  . ASN D  1 14 ? 5.927   23.735  47.914 1.00 29.92  ? 14  ASN D CA  1 
ATOM   2201 C C   . ASN D  1 14 ? 7.192   24.580  47.941 1.00 30.63  ? 14  ASN D C   1 
ATOM   2202 O O   . ASN D  1 14 ? 8.217   24.159  48.491 1.00 31.19  ? 14  ASN D O   1 
ATOM   2203 C CB  . ASN D  1 14 ? 5.232   23.800  49.269 1.00 38.57  ? 14  ASN D CB  1 
ATOM   2204 C CG  . ASN D  1 14 ? 4.292   24.985  49.369 1.00 48.96  ? 14  ASN D CG  1 
ATOM   2205 O OD1 . ASN D  1 14 ? 3.661   25.375  48.379 1.00 53.60  ? 14  ASN D OD1 1 
ATOM   2206 N ND2 . ASN D  1 14 ? 4.193   25.567  50.552 1.00 50.59  ? 14  ASN D ND2 1 
ATOM   2207 N N   . ASP D  1 15 ? 7.130   25.770  47.358 1.00 34.32  ? 15  ASP D N   1 
ATOM   2208 C CA  . ASP D  1 15 ? 8.321   26.617  47.277 1.00 33.80  ? 15  ASP D CA  1 
ATOM   2209 C C   . ASP D  1 15 ? 9.444   25.833  46.599 1.00 29.14  ? 15  ASP D C   1 
ATOM   2210 O O   . ASP D  1 15 ? 10.626  25.979  46.964 1.00 31.03  ? 15  ASP D O   1 
ATOM   2211 C CB  . ASP D  1 15 ? 8.762   27.077  48.668 1.00 40.75  ? 15  ASP D CB  1 
ATOM   2212 C CG  . ASP D  1 15 ? 7.705   27.909  49.368 1.00 46.35  ? 15  ASP D CG  1 
ATOM   2213 O OD1 . ASP D  1 15 ? 7.272   28.931  48.802 1.00 46.11  ? 15  ASP D OD1 1 
ATOM   2214 O OD2 . ASP D  1 15 ? 7.304   27.533  50.484 1.00 50.14  ? 15  ASP D OD2 1 
ATOM   2215 N N   . ASN D  1 16 ? 9.039   24.976  45.662 1.00 26.16  ? 16  ASN D N   1 
ATOM   2216 C CA  . ASN D  1 16 ? 9.942   24.114  44.884 1.00 26.93  ? 16  ASN D CA  1 
ATOM   2217 C C   . ASN D  1 16 ? 10.819  23.203  45.771 1.00 29.15  ? 16  ASN D C   1 
ATOM   2218 O O   . ASN D  1 16 ? 11.920  22.809  45.380 1.00 31.74  ? 16  ASN D O   1 
ATOM   2219 C CB  . ASN D  1 16 ? 10.801  24.944  43.915 1.00 28.37  ? 16  ASN D CB  1 
ATOM   2220 C CG  . ASN D  1 16 ? 11.408  24.102  42.805 1.00 32.42  ? 16  ASN D CG  1 
ATOM   2221 O OD1 . ASN D  1 16 ? 10.719  23.297  42.160 1.00 33.32  ? 16  ASN D OD1 1 
ATOM   2222 N ND2 . ASN D  1 16 ? 12.704  24.276  42.582 1.00 36.23  ? 16  ASN D ND2 1 
ATOM   2223 N N   . SER D  1 17 ? 10.294  22.836  46.937 1.00 28.33  ? 17  SER D N   1 
ATOM   2224 C CA  . SER D  1 17 ? 10.980  21.902  47.835 1.00 30.51  ? 17  SER D CA  1 
ATOM   2225 C C   . SER D  1 17 ? 10.044  20.798  48.310 1.00 31.24  ? 17  SER D C   1 
ATOM   2226 O O   . SER D  1 17 ? 8.863   21.049  48.542 1.00 27.41  ? 17  SER D O   1 
ATOM   2227 C CB  . SER D  1 17 ? 11.495  22.657  49.063 1.00 33.55  ? 17  SER D CB  1 
ATOM   2228 O OG  . SER D  1 17 ? 11.970  21.776  50.071 1.00 34.61  ? 17  SER D OG  1 
ATOM   2229 N N   . LEU D  1 18 ? 10.569  19.584  48.485 1.00 29.52  ? 18  LEU D N   1 
ATOM   2230 C CA  . LEU D  1 18 ? 9.767   18.516  49.079 1.00 29.39  ? 18  LEU D CA  1 
ATOM   2231 C C   . LEU D  1 18 ? 9.572   18.694  50.582 1.00 30.46  ? 18  LEU D C   1 
ATOM   2232 O O   . LEU D  1 18 ? 8.724   18.036  51.188 1.00 30.43  ? 18  LEU D O   1 
ATOM   2233 C CB  . LEU D  1 18 ? 10.356  17.128  48.790 1.00 28.37  ? 18  LEU D CB  1 
ATOM   2234 C CG  . LEU D  1 18 ? 10.344  16.698  47.317 1.00 29.13  ? 18  LEU D CG  1 
ATOM   2235 C CD1 . LEU D  1 18 ? 11.265  15.511  47.146 1.00 31.46  ? 18  LEU D CD1 1 
ATOM   2236 C CD2 . LEU D  1 18 ? 8.940   16.368  46.759 1.00 30.27  ? 18  LEU D CD2 1 
ATOM   2237 N N   . GLY D  1 19 ? 10.346  19.579  51.212 1.00 28.07  ? 19  GLY D N   1 
ATOM   2238 C CA  . GLY D  1 19 ? 10.114  19.846  52.608 1.00 31.59  ? 19  GLY D CA  1 
ATOM   2239 C C   . GLY D  1 19 ? 10.653  18.744  53.506 1.00 31.93  ? 19  GLY D C   1 
ATOM   2240 O O   . GLY D  1 19 ? 10.135  18.525  54.592 1.00 33.78  ? 19  GLY D O   1 
ATOM   2241 N N   . ILE D  1 20 ? 11.694  18.055  53.049 1.00 35.05  ? 20  ILE D N   1 
ATOM   2242 C CA  . ILE D  1 20 ? 12.407  17.113  53.907 1.00 40.14  ? 20  ILE D CA  1 
ATOM   2243 C C   . ILE D  1 20 ? 13.916  17.318  53.845 1.00 42.48  ? 20  ILE D C   1 
ATOM   2244 O O   . ILE D  1 20 ? 14.453  17.788  52.843 1.00 44.57  ? 20  ILE D O   1 
ATOM   2245 C CB  . ILE D  1 20 ? 12.120  15.646  53.536 1.00 40.37  ? 20  ILE D CB  1 
ATOM   2246 C CG1 . ILE D  1 20 ? 12.664  15.323  52.152 1.00 42.23  ? 20  ILE D CG1 1 
ATOM   2247 C CG2 . ILE D  1 20 ? 10.645  15.340  53.612 1.00 41.65  ? 20  ILE D CG2 1 
ATOM   2248 C CD1 . ILE D  1 20 ? 12.501  13.866  51.775 1.00 45.28  ? 20  ILE D CD1 1 
ATOM   2249 N N   . SER D  1 21 ? 14.596  16.966  54.927 1.00 41.96  ? 21  SER D N   1 
ATOM   2250 C CA  . SER D  1 21 ? 16.044  16.818  54.898 1.00 44.11  ? 21  SER D CA  1 
ATOM   2251 C C   . SER D  1 21 ? 16.371  15.333  55.059 1.00 42.92  ? 21  SER D C   1 
ATOM   2252 O O   . SER D  1 21 ? 15.617  14.580  55.678 1.00 41.35  ? 21  SER D O   1 
ATOM   2253 C CB  . SER D  1 21 ? 16.729  17.674  55.973 1.00 46.54  ? 21  SER D CB  1 
ATOM   2254 O OG  . SER D  1 21 ? 16.257  17.382  57.273 1.00 48.27  ? 21  SER D OG  1 
ATOM   2255 N N   . VAL D  1 22 ? 17.467  14.892  54.464 1.00 41.32  ? 22  VAL D N   1 
ATOM   2256 C CA  . VAL D  1 22 ? 17.812  13.480  54.559 1.00 40.61  ? 22  VAL D CA  1 
ATOM   2257 C C   . VAL D  1 22 ? 19.144  13.286  55.263 1.00 42.41  ? 22  VAL D C   1 
ATOM   2258 O O   . VAL D  1 22 ? 19.976  14.197  55.318 1.00 44.09  ? 22  VAL D O   1 
ATOM   2259 C CB  . VAL D  1 22 ? 17.810  12.775  53.181 1.00 43.98  ? 22  VAL D CB  1 
ATOM   2260 C CG1 . VAL D  1 22 ? 16.381  12.620  52.676 1.00 40.14  ? 22  VAL D CG1 1 
ATOM   2261 C CG2 . VAL D  1 22 ? 18.653  13.543  52.170 1.00 45.84  ? 22  VAL D CG2 1 
ATOM   2262 N N   . THR D  1 23 ? 19.308  12.098  55.830 1.00 41.70  ? 23  THR D N   1 
ATOM   2263 C CA  . THR D  1 23 ? 20.544  11.699  56.488 1.00 41.04  ? 23  THR D CA  1 
ATOM   2264 C C   . THR D  1 23 ? 20.882  10.321  55.953 1.00 42.35  ? 23  THR D C   1 
ATOM   2265 O O   . THR D  1 23 ? 19.987  9.595   55.530 1.00 43.90  ? 23  THR D O   1 
ATOM   2266 C CB  . THR D  1 23 ? 20.366  11.605  58.009 1.00 43.92  ? 23  THR D CB  1 
ATOM   2267 O OG1 . THR D  1 23 ? 21.651  11.457  58.622 1.00 46.19  ? 23  THR D OG1 1 
ATOM   2268 C CG2 . THR D  1 23 ? 19.486  10.409  58.379 1.00 42.28  ? 23  THR D CG2 1 
ATOM   2269 N N   . GLY D  1 24 ? 22.161  9.965   55.931 1.00 67.78  ? 24  GLY D N   1 
ATOM   2270 C CA  . GLY D  1 24 ? 22.558  8.653   55.450 1.00 69.21  ? 24  GLY D CA  1 
ATOM   2271 C C   . GLY D  1 24 ? 23.245  8.650   54.095 1.00 70.58  ? 24  GLY D C   1 
ATOM   2272 O O   . GLY D  1 24 ? 23.482  9.700   53.499 1.00 75.20  ? 24  GLY D O   1 
ATOM   2273 N N   . GLY D  1 25 ? 23.565  7.453   53.612 1.00 66.52  ? 25  GLY D N   1 
ATOM   2274 C CA  . GLY D  1 25 ? 24.328  7.284   52.388 1.00 69.85  ? 25  GLY D CA  1 
ATOM   2275 C C   . GLY D  1 25 ? 25.397  6.221   52.576 1.00 70.94  ? 25  GLY D C   1 
ATOM   2276 O O   . GLY D  1 25 ? 25.782  5.917   53.703 1.00 68.40  ? 25  GLY D O   1 
ATOM   2277 N N   . VAL D  1 26 ? 25.872  5.641   51.478 1.00 73.84  ? 26  VAL D N   1 
ATOM   2278 C CA  . VAL D  1 26 ? 26.856  4.564   51.561 1.00 75.11  ? 26  VAL D CA  1 
ATOM   2279 C C   . VAL D  1 26 ? 28.155  5.041   52.188 1.00 79.01  ? 26  VAL D C   1 
ATOM   2280 O O   . VAL D  1 26 ? 28.879  4.261   52.809 1.00 79.96  ? 26  VAL D O   1 
ATOM   2281 C CB  . VAL D  1 26 ? 27.160  3.959   50.182 1.00 78.39  ? 26  VAL D CB  1 
ATOM   2282 C CG1 . VAL D  1 26 ? 25.987  3.125   49.702 1.00 76.53  ? 26  VAL D CG1 1 
ATOM   2283 C CG2 . VAL D  1 26 ? 27.496  5.058   49.186 1.00 82.45  ? 26  VAL D CG2 1 
ATOM   2284 N N   . ASN D  1 27 ? 28.438  6.330   52.020 1.00 82.37  ? 27  ASN D N   1 
ATOM   2285 C CA  . ASN D  1 27 ? 29.634  6.951   52.576 1.00 86.69  ? 27  ASN D CA  1 
ATOM   2286 C C   . ASN D  1 27 ? 29.535  7.104   54.087 1.00 82.33  ? 27  ASN D C   1 
ATOM   2287 O O   . ASN D  1 27 ? 30.490  7.515   54.747 1.00 82.14  ? 27  ASN D O   1 
ATOM   2288 C CB  . ASN D  1 27 ? 29.865  8.322   51.932 1.00 92.62  ? 27  ASN D CB  1 
ATOM   2289 C CG  . ASN D  1 27 ? 28.645  9.234   52.032 1.00 91.50  ? 27  ASN D CG  1 
ATOM   2290 O OD1 . ASN D  1 27 ? 27.530  8.782   52.288 1.00 86.19  ? 27  ASN D OD1 1 
ATOM   2291 N ND2 . ASN D  1 27 ? 28.862  10.527  51.833 1.00 96.88  ? 27  ASN D ND2 1 
ATOM   2292 N N   . THR D  1 28 ? 28.370  6.766   54.628 1.00 79.27  ? 28  THR D N   1 
ATOM   2293 C CA  . THR D  1 28 ? 28.090  6.994   56.039 1.00 77.38  ? 28  THR D CA  1 
ATOM   2294 C C   . THR D  1 28 ? 28.001  5.689   56.826 1.00 75.13  ? 28  THR D C   1 
ATOM   2295 O O   . THR D  1 28 ? 27.844  4.604   56.257 1.00 73.05  ? 28  THR D O   1 
ATOM   2296 C CB  . THR D  1 28 ? 26.761  7.760   56.223 1.00 75.83  ? 28  THR D CB  1 
ATOM   2297 O OG1 . THR D  1 28 ? 25.669  6.840   56.148 1.00 73.34  ? 28  THR D OG1 1 
ATOM   2298 C CG2 . THR D  1 28 ? 26.598  8.830   55.150 1.00 77.93  ? 28  THR D CG2 1 
ATOM   2299 N N   . SER D  1 29 ? 28.102  5.810   58.145 1.00 75.38  ? 29  SER D N   1 
ATOM   2300 C CA  . SER D  1 29 ? 27.910  4.681   59.039 1.00 77.35  ? 29  SER D CA  1 
ATOM   2301 C C   . SER D  1 29 ? 26.453  4.645   59.483 1.00 80.30  ? 29  SER D C   1 
ATOM   2302 O O   . SER D  1 29 ? 26.042  3.762   60.240 1.00 78.71  ? 29  SER D O   1 
ATOM   2303 C CB  . SER D  1 29 ? 28.836  4.797   60.249 1.00 78.70  ? 29  SER D CB  1 
ATOM   2304 O OG  . SER D  1 29 ? 28.695  3.679   61.105 1.00 78.11  ? 29  SER D OG  1 
ATOM   2305 N N   . VAL D  1 30 ? 25.680  5.623   59.013 1.00 85.90  ? 30  VAL D N   1 
ATOM   2306 C CA  . VAL D  1 30 ? 24.234  5.612   59.186 1.00 88.83  ? 30  VAL D CA  1 
ATOM   2307 C C   . VAL D  1 30 ? 23.761  4.225   58.774 1.00 93.05  ? 30  VAL D C   1 
ATOM   2308 O O   . VAL D  1 30 ? 24.187  3.706   57.746 1.00 94.46  ? 30  VAL D O   1 
ATOM   2309 C CB  . VAL D  1 30 ? 23.548  6.686   58.310 1.00 89.69  ? 30  VAL D CB  1 
ATOM   2310 C CG1 . VAL D  1 30 ? 22.031  6.612   58.445 1.00 88.59  ? 30  VAL D CG1 1 
ATOM   2311 C CG2 . VAL D  1 30 ? 24.058  8.080   58.665 1.00 90.84  ? 30  VAL D CG2 1 
ATOM   2312 N N   . ARG D  1 31 ? 22.849  3.640   59.531 1.00 96.20  ? 31  ARG D N   1 
ATOM   2313 C CA  . ARG D  1 31 ? 22.701  2.216   59.448 1.00 100.35 ? 31  ARG D CA  1 
ATOM   2314 C C   . ARG D  1 31 ? 22.641  1.758   58.004 1.00 101.98 ? 31  ARG D C   1 
ATOM   2315 O O   . ARG D  1 31 ? 21.826  2.205   57.197 1.00 102.79 ? 31  ARG D O   1 
ATOM   2316 C CB  . ARG D  1 31 ? 21.440  1.768   60.191 1.00 103.21 ? 31  ARG D CB  1 
ATOM   2317 C CG  . ARG D  1 31 ? 21.428  2.130   61.667 1.00 106.42 ? 31  ARG D CG  1 
ATOM   2318 C CD  . ARG D  1 31 ? 20.137  1.683   62.334 1.00 109.29 ? 31  ARG D CD  1 
ATOM   2319 N NE  . ARG D  1 31 ? 18.964  2.304   61.727 1.00 110.47 ? 31  ARG D NE  1 
ATOM   2320 C CZ  . ARG D  1 31 ? 17.714  2.085   62.121 1.00 112.76 ? 31  ARG D CZ  1 
ATOM   2321 N NH1 . ARG D  1 31 ? 17.469  1.257   63.127 1.00 115.01 ? 31  ARG D NH1 1 
ATOM   2322 N NH2 . ARG D  1 31 ? 16.707  2.695   61.510 1.00 112.82 ? 31  ARG D NH2 1 
ATOM   2323 N N   . HIS D  1 32 ? 23.549  0.829   57.727 1.00 102.34 ? 32  HIS D N   1 
ATOM   2324 C CA  . HIS D  1 32 ? 23.671  0.118   56.454 1.00 102.44 ? 32  HIS D CA  1 
ATOM   2325 C C   . HIS D  1 32 ? 23.829  1.040   55.245 1.00 96.34  ? 32  HIS D C   1 
ATOM   2326 O O   . HIS D  1 32 ? 23.863  0.576   54.106 1.00 97.88  ? 32  HIS D O   1 
ATOM   2327 C CB  . HIS D  1 32 ? 22.480  -0.824  56.246 1.00 107.17 ? 32  HIS D CB  1 
ATOM   2328 C CG  . HIS D  1 32 ? 22.077  -1.569  57.480 1.00 110.90 ? 32  HIS D CG  1 
ATOM   2329 N ND1 . HIS D  1 32 ? 20.786  -1.561  57.966 1.00 112.02 ? 32  HIS D ND1 1 
ATOM   2330 C CD2 . HIS D  1 32 ? 22.796  -2.334  58.336 1.00 113.04 ? 32  HIS D CD2 1 
ATOM   2331 C CE1 . HIS D  1 32 ? 20.726  -2.296  59.062 1.00 113.34 ? 32  HIS D CE1 1 
ATOM   2332 N NE2 . HIS D  1 32 ? 21.932  -2.776  59.309 1.00 113.86 ? 32  HIS D NE2 1 
ATOM   2333 N N   . GLY D  1 33 ? 23.922  2.341   55.497 1.00 79.95  ? 33  GLY D N   1 
ATOM   2334 C CA  . GLY D  1 33 ? 24.134  3.315   54.441 1.00 71.71  ? 33  GLY D CA  1 
ATOM   2335 C C   . GLY D  1 33 ? 22.858  3.819   53.787 1.00 61.79  ? 33  GLY D C   1 
ATOM   2336 O O   . GLY D  1 33 ? 22.913  4.607   52.844 1.00 59.13  ? 33  GLY D O   1 
ATOM   2337 N N   . GLY D  1 34 ? 21.710  3.373   54.290 1.00 54.80  ? 34  GLY D N   1 
ATOM   2338 C CA  . GLY D  1 34 ? 20.431  3.792   53.749 1.00 52.14  ? 34  GLY D CA  1 
ATOM   2339 C C   . GLY D  1 34 ? 20.208  5.294   53.822 1.00 50.25  ? 34  GLY D C   1 
ATOM   2340 O O   . GLY D  1 34 ? 20.889  6.002   54.581 1.00 49.22  ? 34  GLY D O   1 
ATOM   2341 N N   . ILE D  1 35 ? 19.253  5.770   53.022 1.00 45.85  ? 35  ILE D N   1 
ATOM   2342 C CA  . ILE D  1 35 ? 18.826  7.165   53.045 1.00 42.72  ? 35  ILE D CA  1 
ATOM   2343 C C   . ILE D  1 35 ? 17.550  7.294   53.861 1.00 40.72  ? 35  ILE D C   1 
ATOM   2344 O O   . ILE D  1 35 ? 16.539  6.659   53.533 1.00 37.58  ? 35  ILE D O   1 
ATOM   2345 C CB  . ILE D  1 35 ? 18.509  7.699   51.644 1.00 40.82  ? 35  ILE D CB  1 
ATOM   2346 C CG1 . ILE D  1 35 ? 19.676  7.444   50.682 1.00 42.22  ? 35  ILE D CG1 1 
ATOM   2347 C CG2 . ILE D  1 35 ? 18.149  9.179   51.731 1.00 40.99  ? 35  ILE D CG2 1 
ATOM   2348 C CD1 . ILE D  1 35 ? 21.010  7.994   51.144 1.00 41.88  ? 35  ILE D CD1 1 
ATOM   2349 N N   . TYR D  1 36 ? 17.610  8.118   54.908 1.00 41.57  ? 36  TYR D N   1 
ATOM   2350 C CA  . TYR D  1 36 ? 16.511  8.285   55.853 1.00 39.63  ? 36  TYR D CA  1 
ATOM   2351 C C   . TYR D  1 36 ? 16.073  9.726   55.987 1.00 39.97  ? 36  TYR D C   1 
ATOM   2352 O O   . TYR D  1 36 ? 16.866  10.654  55.790 1.00 40.69  ? 36  TYR D O   1 
ATOM   2353 C CB  . TYR D  1 36 ? 16.925  7.754   57.232 1.00 42.68  ? 36  TYR D CB  1 
ATOM   2354 C CG  . TYR D  1 36 ? 17.238  6.281   57.209 1.00 45.89  ? 36  TYR D CG  1 
ATOM   2355 C CD1 . TYR D  1 36 ? 18.479  5.823   56.785 1.00 48.72  ? 36  TYR D CD1 1 
ATOM   2356 C CD2 . TYR D  1 36 ? 16.288  5.343   57.586 1.00 47.57  ? 36  TYR D CD2 1 
ATOM   2357 C CE1 . TYR D  1 36 ? 18.767  4.472   56.744 1.00 49.58  ? 36  TYR D CE1 1 
ATOM   2358 C CE2 . TYR D  1 36 ? 16.566  3.993   57.545 1.00 48.28  ? 36  TYR D CE2 1 
ATOM   2359 C CZ  . TYR D  1 36 ? 17.810  3.564   57.128 1.00 51.51  ? 36  TYR D CZ  1 
ATOM   2360 O OH  . TYR D  1 36 ? 18.103  2.216   57.087 1.00 55.03  ? 36  TYR D OH  1 
ATOM   2361 N N   . VAL D  1 37 ? 14.806  9.913   56.332 1.00 40.24  ? 37  VAL D N   1 
ATOM   2362 C CA  . VAL D  1 37 ? 14.280  11.244  56.575 1.00 39.42  ? 37  VAL D CA  1 
ATOM   2363 C C   . VAL D  1 37 ? 14.836  11.785  57.893 1.00 41.16  ? 37  VAL D C   1 
ATOM   2364 O O   . VAL D  1 37 ? 14.590  11.238  58.964 1.00 44.83  ? 37  VAL D O   1 
ATOM   2365 C CB  . VAL D  1 37 ? 12.740  11.250  56.586 1.00 35.99  ? 37  VAL D CB  1 
ATOM   2366 C CG1 . VAL D  1 37 ? 12.223  12.605  57.059 1.00 39.91  ? 37  VAL D CG1 1 
ATOM   2367 C CG2 . VAL D  1 37 ? 12.200  10.894  55.187 1.00 34.28  ? 37  VAL D CG2 1 
ATOM   2368 N N   . LYS D  1 38 ? 15.602  12.862  57.805 1.00 40.35  ? 38  LYS D N   1 
ATOM   2369 C CA  . LYS D  1 38 ? 16.216  13.433  58.998 1.00 46.14  ? 38  LYS D CA  1 
ATOM   2370 C C   . LYS D  1 38 ? 15.209  14.314  59.724 1.00 48.19  ? 38  LYS D C   1 
ATOM   2371 O O   . LYS D  1 38 ? 15.095  14.280  60.952 1.00 49.80  ? 38  LYS D O   1 
ATOM   2372 C CB  . LYS D  1 38 ? 17.437  14.259  58.604 1.00 47.96  ? 38  LYS D CB  1 
ATOM   2373 C CG  . LYS D  1 38 ? 18.269  14.735  59.791 1.00 54.75  ? 38  LYS D CG  1 
ATOM   2374 C CD  . LYS D  1 38 ? 19.367  15.663  59.333 1.00 60.08  ? 38  LYS D CD  1 
ATOM   2375 C CE  . LYS D  1 38 ? 20.247  16.077  60.497 1.00 68.29  ? 38  LYS D CE  1 
ATOM   2376 N NZ  . LYS D  1 38 ? 21.204  17.139  60.091 1.00 72.64  ? 38  LYS D NZ  1 
ATOM   2377 N N   . ALA D  1 39 ? 14.466  15.089  58.942 1.00 47.59  ? 39  ALA D N   1 
ATOM   2378 C CA  . ALA D  1 39 ? 13.513  16.058  59.464 1.00 46.68  ? 39  ALA D CA  1 
ATOM   2379 C C   . ALA D  1 39 ? 12.497  16.428  58.383 1.00 45.13  ? 39  ALA D C   1 
ATOM   2380 O O   . ALA D  1 39 ? 12.839  16.495  57.205 1.00 42.81  ? 39  ALA D O   1 
ATOM   2381 C CB  . ALA D  1 39 ? 14.244  17.305  59.944 1.00 49.95  ? 39  ALA D CB  1 
ATOM   2382 N N   . VAL D  1 40 ? 11.251  16.643  58.793 1.00 45.70  ? 40  VAL D N   1 
ATOM   2383 C CA  . VAL D  1 40 ? 10.255  17.265  57.933 1.00 44.39  ? 40  VAL D CA  1 
ATOM   2384 C C   . VAL D  1 40 ? 10.216  18.752  58.299 1.00 42.79  ? 40  VAL D C   1 
ATOM   2385 O O   . VAL D  1 40 ? 10.095  19.116  59.470 1.00 42.85  ? 40  VAL D O   1 
ATOM   2386 C CB  . VAL D  1 40 ? 8.855   16.615  58.069 1.00 47.59  ? 40  VAL D CB  1 
ATOM   2387 C CG1 . VAL D  1 40 ? 8.947   15.103  57.902 1.00 46.58  ? 40  VAL D CG1 1 
ATOM   2388 C CG2 . VAL D  1 40 ? 8.225   16.960  59.397 1.00 49.24  ? 40  VAL D CG2 1 
ATOM   2389 N N   . ILE D  1 41 ? 10.362  19.606  57.291 1.00 39.07  ? 41  ILE D N   1 
ATOM   2390 C CA  . ILE D  1 41 ? 10.509  21.041  57.509 1.00 36.54  ? 41  ILE D CA  1 
ATOM   2391 C C   . ILE D  1 41 ? 9.152   21.651  57.845 1.00 34.19  ? 41  ILE D C   1 
ATOM   2392 O O   . ILE D  1 41 ? 8.168   21.421  57.145 1.00 35.12  ? 41  ILE D O   1 
ATOM   2393 C CB  . ILE D  1 41 ? 11.094  21.725  56.251 1.00 39.48  ? 41  ILE D CB  1 
ATOM   2394 C CG1 . ILE D  1 41 ? 12.350  20.988  55.770 1.00 41.02  ? 41  ILE D CG1 1 
ATOM   2395 C CG2 . ILE D  1 41 ? 11.361  23.207  56.502 1.00 42.19  ? 41  ILE D CG2 1 
ATOM   2396 C CD1 . ILE D  1 41 ? 13.338  20.672  56.870 1.00 45.87  ? 41  ILE D CD1 1 
ATOM   2397 N N   . PRO D  1 42 ? 9.085   22.414  58.933 1.00 38.27  ? 42  PRO D N   1 
ATOM   2398 C CA  . PRO D  1 42 ? 7.808   23.026  59.307 1.00 38.57  ? 42  PRO D CA  1 
ATOM   2399 C C   . PRO D  1 42 ? 7.127   23.726  58.131 1.00 39.64  ? 42  PRO D C   1 
ATOM   2400 O O   . PRO D  1 42 ? 7.771   24.456  57.362 1.00 38.78  ? 42  PRO D O   1 
ATOM   2401 C CB  . PRO D  1 42 ? 8.214   24.032  60.387 1.00 40.49  ? 42  PRO D CB  1 
ATOM   2402 C CG  . PRO D  1 42 ? 9.458   23.443  60.984 1.00 42.42  ? 42  PRO D CG  1 
ATOM   2403 C CD  . PRO D  1 42 ? 10.181  22.800  59.838 1.00 38.96  ? 42  PRO D CD  1 
ATOM   2404 N N   . GLN D  1 43 ? 5.828   23.476  57.990 1.00 41.59  ? 43  GLN D N   1 
ATOM   2405 C CA  . GLN D  1 43 ? 4.990   24.048  56.934 1.00 46.31  ? 43  GLN D CA  1 
ATOM   2406 C C   . GLN D  1 43 ? 5.444   23.730  55.499 1.00 41.99  ? 43  GLN D C   1 
ATOM   2407 O O   . GLN D  1 43 ? 4.981   24.353  54.532 1.00 43.63  ? 43  GLN D O   1 
ATOM   2408 C CB  . GLN D  1 43 ? 4.834   25.547  57.149 1.00 56.70  ? 43  GLN D CB  1 
ATOM   2409 C CG  . GLN D  1 43 ? 4.599   25.900  58.606 1.00 65.94  ? 43  GLN D CG  1 
ATOM   2410 C CD  . GLN D  1 43 ? 4.903   27.348  58.894 1.00 75.22  ? 43  GLN D CD  1 
ATOM   2411 O OE1 . GLN D  1 43 ? 4.719   28.212  58.034 1.00 78.03  ? 43  GLN D OE1 1 
ATOM   2412 N NE2 . GLN D  1 43 ? 5.375   27.627  60.105 1.00 79.02  ? 43  GLN D NE2 1 
ATOM   2413 N N   . GLY D  1 44 ? 6.332   22.748  55.366 1.00 36.92  ? 44  GLY D N   1 
ATOM   2414 C CA  . GLY D  1 44 ? 6.768   22.292  54.058 1.00 33.13  ? 44  GLY D CA  1 
ATOM   2415 C C   . GLY D  1 44 ? 5.824   21.257  53.468 1.00 32.56  ? 44  GLY D C   1 
ATOM   2416 O O   . GLY D  1 44 ? 4.840   20.870  54.109 1.00 30.91  ? 44  GLY D O   1 
ATOM   2417 N N   . ALA D  1 45 ? 6.139   20.800  52.257 1.00 26.61  ? 45  ALA D N   1 
ATOM   2418 C CA  . ALA D  1 45 ? 5.265   19.888  51.514 1.00 26.71  ? 45  ALA D CA  1 
ATOM   2419 C C   . ALA D  1 45 ? 5.053   18.577  52.271 1.00 29.42  ? 45  ALA D C   1 
ATOM   2420 O O   . ALA D  1 45 ? 3.921   18.120  52.449 1.00 28.80  ? 45  ALA D O   1 
ATOM   2421 C CB  . ALA D  1 45 ? 5.836   19.613  50.135 1.00 27.17  ? 45  ALA D CB  1 
ATOM   2422 N N   . ALA D  1 46 ? 6.143   17.971  52.716 1.00 32.11  ? 46  ALA D N   1 
ATOM   2423 C CA  . ALA D  1 46 ? 6.029   16.688  53.407 1.00 32.03  ? 46  ALA D CA  1 
ATOM   2424 C C   . ALA D  1 46 ? 5.163   16.803  54.655 1.00 32.38  ? 46  ALA D C   1 
ATOM   2425 O O   . ALA D  1 46 ? 4.370   15.902  54.966 1.00 29.28  ? 46  ALA D O   1 
ATOM   2426 C CB  . ALA D  1 46 ? 7.396   16.143  53.757 1.00 33.60  ? 46  ALA D CB  1 
ATOM   2427 N N   . GLU D  1 47 ? 5.313   17.903  55.382 1.00 31.69  ? 47  GLU D N   1 
ATOM   2428 C CA  . GLU D  1 47 ? 4.576   18.034  56.629 1.00 32.52  ? 47  GLU D CA  1 
ATOM   2429 C C   . GLU D  1 47 ? 3.090   18.186  56.338 1.00 31.15  ? 47  GLU D C   1 
ATOM   2430 O O   . GLU D  1 47 ? 2.257   17.585  57.013 1.00 35.61  ? 47  GLU D O   1 
ATOM   2431 C CB  . GLU D  1 47 ? 5.070   19.221  57.445 1.00 35.74  ? 47  GLU D CB  1 
ATOM   2432 C CG  . GLU D  1 47 ? 4.313   19.375  58.743 1.00 40.12  ? 47  GLU D CG  1 
ATOM   2433 C CD  . GLU D  1 47 ? 4.729   20.608  59.503 1.00 49.08  ? 47  GLU D CD  1 
ATOM   2434 O OE1 . GLU D  1 47 ? 4.310   21.714  59.097 1.00 52.87  ? 47  GLU D OE1 1 
ATOM   2435 O OE2 . GLU D  1 47 ? 5.472   20.468  60.499 1.00 50.57  ? 47  GLU D OE2 1 
ATOM   2436 N N   . SER D  1 48 ? 2.756   19.006  55.348 1.00 30.09  ? 48  SER D N   1 
ATOM   2437 C CA  . SER D  1 48 ? 1.354   19.266  55.015 1.00 32.17  ? 48  SER D CA  1 
ATOM   2438 C C   . SER D  1 48 ? 0.660   18.006  54.534 1.00 30.80  ? 48  SER D C   1 
ATOM   2439 O O   . SER D  1 48 ? -0.514  17.773  54.815 1.00 32.04  ? 48  SER D O   1 
ATOM   2440 C CB  . SER D  1 48 ? 1.243   20.345  53.941 1.00 34.26  ? 48  SER D CB  1 
ATOM   2441 O OG  . SER D  1 48 ? 1.783   21.567  54.415 1.00 41.14  ? 48  SER D OG  1 
ATOM   2442 N N   . ASP D  1 49 ? 1.397   17.212  53.778 1.00 27.12  ? 49  ASP D N   1 
ATOM   2443 C CA  . ASP D  1 49 ? 0.873   15.955  53.242 1.00 28.52  ? 49  ASP D CA  1 
ATOM   2444 C C   . ASP D  1 49 ? 0.616   14.938  54.372 1.00 33.43  ? 49  ASP D C   1 
ATOM   2445 O O   . ASP D  1 49 ? -0.384  14.209  54.346 1.00 37.21  ? 49  ASP D O   1 
ATOM   2446 C CB  . ASP D  1 49 ? 1.862   15.399  52.230 1.00 26.93  ? 49  ASP D CB  1 
ATOM   2447 C CG  . ASP D  1 49 ? 1.437   14.040  51.692 1.00 29.02  ? 49  ASP D CG  1 
ATOM   2448 O OD1 . ASP D  1 49 ? 1.914   13.015  52.220 1.00 31.31  ? 49  ASP D OD1 1 
ATOM   2449 O OD2 . ASP D  1 49 ? 0.619   14.016  50.755 1.00 30.49  ? 49  ASP D OD2 1 
ATOM   2450 N N   . GLY D  1 50 ? 1.548   14.858  55.322 1.00 29.48  ? 50  GLY D N   1 
ATOM   2451 C CA  . GLY D  1 50 ? 1.361   14.109  56.552 1.00 34.60  ? 50  GLY D CA  1 
ATOM   2452 C C   . GLY D  1 50 ? 1.688   12.624  56.566 1.00 35.75  ? 50  GLY D C   1 
ATOM   2453 O O   . GLY D  1 50 ? 1.452   11.964  57.577 1.00 40.06  ? 50  GLY D O   1 
ATOM   2454 N N   . ARG D  1 51 ? 2.228   12.094  55.471 1.00 33.10  ? 51  ARG D N   1 
ATOM   2455 C CA  . ARG D  1 51 ? 2.488   10.661  55.373 1.00 33.22  ? 51  ARG D CA  1 
ATOM   2456 C C   . ARG D  1 51 ? 3.935   10.285  55.636 1.00 35.94  ? 51  ARG D C   1 
ATOM   2457 O O   . ARG D  1 51 ? 4.250   9.117   55.898 1.00 36.88  ? 51  ARG D O   1 
ATOM   2458 C CB  . ARG D  1 51 ? 2.064   10.140  54.007 1.00 30.13  ? 51  ARG D CB  1 
ATOM   2459 C CG  . ARG D  1 51 ? 0.567   9.984   53.861 1.00 28.30  ? 51  ARG D CG  1 
ATOM   2460 C CD  . ARG D  1 51 ? 0.198   9.531   52.456 1.00 27.22  ? 51  ARG D CD  1 
ATOM   2461 N NE  . ARG D  1 51 ? 0.350   10.625  51.493 1.00 26.68  ? 51  ARG D NE  1 
ATOM   2462 C CZ  . ARG D  1 51 ? 0.086   10.512  50.201 1.00 27.81  ? 51  ARG D CZ  1 
ATOM   2463 N NH1 . ARG D  1 51 ? -0.312  9.342   49.703 1.00 28.59  ? 51  ARG D NH1 1 
ATOM   2464 N NH2 . ARG D  1 51 ? 0.238   11.563  49.399 1.00 25.43  ? 51  ARG D NH2 1 
ATOM   2465 N N   . ILE D  1 52 ? 4.809   11.275  55.571 1.00 31.66  ? 52  ILE D N   1 
ATOM   2466 C CA  . ILE D  1 52 ? 6.227   11.049  55.753 1.00 30.26  ? 52  ILE D CA  1 
ATOM   2467 C C   . ILE D  1 52 ? 6.686   11.691  57.062 1.00 33.15  ? 52  ILE D C   1 
ATOM   2468 O O   . ILE D  1 52 ? 6.337   12.841  57.364 1.00 35.88  ? 52  ILE D O   1 
ATOM   2469 C CB  . ILE D  1 52 ? 7.019   11.648  54.572 1.00 29.40  ? 52  ILE D CB  1 
ATOM   2470 C CG1 . ILE D  1 52 ? 6.635   10.943  53.260 1.00 29.38  ? 52  ILE D CG1 1 
ATOM   2471 C CG2 . ILE D  1 52 ? 8.507   11.571  54.833 1.00 31.60  ? 52  ILE D CG2 1 
ATOM   2472 C CD1 . ILE D  1 52 ? 7.176   11.619  51.990 1.00 30.07  ? 52  ILE D CD1 1 
ATOM   2473 N N   . HIS D  1 53 ? 7.470   10.943  57.837 1.00 33.35  ? 53  HIS D N   1 
ATOM   2474 C CA  . HIS D  1 53 ? 7.972   11.425  59.121 1.00 37.58  ? 53  HIS D CA  1 
ATOM   2475 C C   . HIS D  1 53 ? 9.459   11.116  59.285 1.00 36.89  ? 53  HIS D C   1 
ATOM   2476 O O   . HIS D  1 53 ? 10.005  10.283  58.546 1.00 36.16  ? 53  HIS D O   1 
ATOM   2477 C CB  . HIS D  1 53 ? 7.168   10.803  60.272 1.00 42.15  ? 53  HIS D CB  1 
ATOM   2478 C CG  . HIS D  1 53 ? 5.706   11.116  60.214 1.00 44.10  ? 53  HIS D CG  1 
ATOM   2479 N ND1 . HIS D  1 53 ? 4.803   10.324  59.539 1.00 45.06  ? 53  HIS D ND1 1 
ATOM   2480 C CD2 . HIS D  1 53 ? 4.994   12.152  60.718 1.00 45.78  ? 53  HIS D CD2 1 
ATOM   2481 C CE1 . HIS D  1 53 ? 3.596   10.851  59.639 1.00 44.04  ? 53  HIS D CE1 1 
ATOM   2482 N NE2 . HIS D  1 53 ? 3.684   11.963  60.344 1.00 45.77  ? 53  HIS D NE2 1 
ATOM   2483 N N   . LYS D  1 54 ? 10.102  11.815  60.220 1.00 40.61  ? 54  LYS D N   1 
ATOM   2484 C CA  . LYS D  1 54 ? 11.491  11.548  60.589 1.00 41.20  ? 54  LYS D CA  1 
ATOM   2485 C C   . LYS D  1 54 ? 11.626  10.055  60.845 1.00 41.37  ? 54  LYS D C   1 
ATOM   2486 O O   . LYS D  1 54 ? 10.796  9.459   61.531 1.00 45.86  ? 54  LYS D O   1 
ATOM   2487 C CB  . LYS D  1 54 ? 11.889  12.340  61.843 1.00 44.69  ? 54  LYS D CB  1 
ATOM   2488 C CG  . LYS D  1 54 ? 13.313  12.071  62.320 1.00 49.81  ? 54  LYS D CG  1 
ATOM   2489 C CD  . LYS D  1 54 ? 13.686  12.952  63.527 1.00 54.54  ? 54  LYS D CD  1 
ATOM   2490 C CE  . LYS D  1 54 ? 15.130  12.715  63.957 1.00 59.63  ? 54  LYS D CE  1 
ATOM   2491 N NZ  . LYS D  1 54 ? 15.528  13.552  65.140 1.00 63.81  ? 54  LYS D NZ  1 
ATOM   2492 N N   . GLY D  1 55 ? 12.661  9.436   60.289 1.00 42.88  ? 55  GLY D N   1 
ATOM   2493 C CA  . GLY D  1 55 ? 12.875  8.015   60.520 1.00 43.54  ? 55  GLY D CA  1 
ATOM   2494 C C   . GLY D  1 55 ? 12.501  7.088   59.380 1.00 42.93  ? 55  GLY D C   1 
ATOM   2495 O O   . GLY D  1 55 ? 12.978  5.952   59.329 1.00 44.54  ? 55  GLY D O   1 
ATOM   2496 N N   . ASP D  1 56 ? 11.638  7.559   58.476 1.00 40.48  ? 56  ASP D N   1 
ATOM   2497 C CA  . ASP D  1 56 ? 11.256  6.788   57.296 1.00 38.94  ? 56  ASP D CA  1 
ATOM   2498 C C   . ASP D  1 56 ? 12.461  6.644   56.390 1.00 37.98  ? 56  ASP D C   1 
ATOM   2499 O O   . ASP D  1 56 ? 13.284  7.554   56.292 1.00 38.96  ? 56  ASP D O   1 
ATOM   2500 C CB  . ASP D  1 56 ? 10.122  7.484   56.537 1.00 34.93  ? 56  ASP D CB  1 
ATOM   2501 C CG  . ASP D  1 56 ? 8.832   7.545   57.340 1.00 35.72  ? 56  ASP D CG  1 
ATOM   2502 O OD1 . ASP D  1 56 ? 7.898   8.271   56.923 1.00 36.98  ? 56  ASP D OD1 1 
ATOM   2503 O OD2 . ASP D  1 56 ? 8.764   6.875   58.394 1.00 36.88  ? 56  ASP D OD2 1 
ATOM   2504 N N   . ARG D  1 57 ? 12.583  5.484   55.764 1.00 40.06  ? 57  ARG D N   1 
ATOM   2505 C CA  . ARG D  1 57 ? 13.656  5.232   54.812 1.00 39.81  ? 57  ARG D CA  1 
ATOM   2506 C C   . ARG D  1 57 ? 13.159  5.523   53.401 1.00 34.65  ? 57  ARG D C   1 
ATOM   2507 O O   . ARG D  1 57 ? 12.125  5.011   53.003 1.00 36.02  ? 57  ARG D O   1 
ATOM   2508 C CB  . ARG D  1 57 ? 14.101  3.772   54.888 1.00 43.00  ? 57  ARG D CB  1 
ATOM   2509 C CG  . ARG D  1 57 ? 15.299  3.467   54.010 1.00 49.86  ? 57  ARG D CG  1 
ATOM   2510 C CD  . ARG D  1 57 ? 15.794  2.049   54.183 1.00 55.51  ? 57  ARG D CD  1 
ATOM   2511 N NE  . ARG D  1 57 ? 16.925  1.775   53.303 1.00 61.89  ? 57  ARG D NE  1 
ATOM   2512 C CZ  . ARG D  1 57 ? 17.814  0.807   53.504 1.00 71.18  ? 57  ARG D CZ  1 
ATOM   2513 N NH1 . ARG D  1 57 ? 17.714  0.017   54.564 1.00 74.37  ? 57  ARG D NH1 1 
ATOM   2514 N NH2 . ARG D  1 57 ? 18.810  0.634   52.646 1.00 74.83  ? 57  ARG D NH2 1 
ATOM   2515 N N   . VAL D  1 58 ? 13.894  6.354   52.663 1.00 31.43  ? 58  VAL D N   1 
ATOM   2516 C CA  . VAL D  1 58 ? 13.562  6.626   51.270 1.00 28.81  ? 58  VAL D CA  1 
ATOM   2517 C C   . VAL D  1 58 ? 14.217  5.572   50.408 1.00 31.15  ? 58  VAL D C   1 
ATOM   2518 O O   . VAL D  1 58 ? 15.442  5.523   50.309 1.00 36.10  ? 58  VAL D O   1 
ATOM   2519 C CB  . VAL D  1 58 ? 14.058  8.024   50.819 1.00 35.70  ? 58  VAL D CB  1 
ATOM   2520 C CG1 . VAL D  1 58 ? 13.530  8.327   49.418 1.00 31.89  ? 58  VAL D CG1 1 
ATOM   2521 C CG2 . VAL D  1 58 ? 13.610  9.096   51.807 1.00 37.65  ? 58  VAL D CG2 1 
ATOM   2522 N N   . LEU D  1 59 ? 13.406  4.714   49.797 1.00 29.26  ? 59  LEU D N   1 
ATOM   2523 C CA  . LEU D  1 59 ? 13.949  3.584   49.059 1.00 32.12  ? 59  LEU D CA  1 
ATOM   2524 C C   . LEU D  1 59 ? 14.157  3.927   47.595 1.00 30.39  ? 59  LEU D C   1 
ATOM   2525 O O   . LEU D  1 59 ? 15.082  3.416   46.960 1.00 33.12  ? 59  LEU D O   1 
ATOM   2526 C CB  . LEU D  1 59 ? 13.021  2.378   49.159 1.00 31.30  ? 59  LEU D CB  1 
ATOM   2527 C CG  . LEU D  1 59 ? 12.850  1.744   50.543 1.00 33.34  ? 59  LEU D CG  1 
ATOM   2528 C CD1 . LEU D  1 59 ? 11.750  0.711   50.494 1.00 35.43  ? 59  LEU D CD1 1 
ATOM   2529 C CD2 . LEU D  1 59 ? 14.164  1.155   51.075 1.00 36.57  ? 59  LEU D CD2 1 
ATOM   2530 N N   . ALA D  1 60 ? 13.295  4.785   47.057 1.00 28.27  ? 60  ALA D N   1 
ATOM   2531 C CA  . ALA D  1 60 ? 13.379  5.110   45.641 1.00 26.87  ? 60  ALA D CA  1 
ATOM   2532 C C   . ALA D  1 60 ? 12.733  6.447   45.333 1.00 27.18  ? 60  ALA D C   1 
ATOM   2533 O O   . ALA D  1 60 ? 11.872  6.929   46.080 1.00 26.18  ? 60  ALA D O   1 
ATOM   2534 C CB  . ALA D  1 60 ? 12.739  4.021   44.806 1.00 26.19  ? 60  ALA D CB  1 
ATOM   2535 N N   . VAL D  1 61 ? 13.173  7.031   44.224 1.00 26.31  ? 61  VAL D N   1 
ATOM   2536 C CA  . VAL D  1 61 ? 12.649  8.293   43.752 1.00 26.94  ? 61  VAL D CA  1 
ATOM   2537 C C   . VAL D  1 61 ? 12.290  8.127   42.272 1.00 24.60  ? 61  VAL D C   1 
ATOM   2538 O O   . VAL D  1 61 ? 13.148  7.792   41.435 1.00 26.02  ? 61  VAL D O   1 
ATOM   2539 C CB  . VAL D  1 61 ? 13.682  9.436   43.914 1.00 27.92  ? 61  VAL D CB  1 
ATOM   2540 C CG1 . VAL D  1 61 ? 13.124  10.736  43.335 1.00 29.66  ? 61  VAL D CG1 1 
ATOM   2541 C CG2 . VAL D  1 61 ? 14.105  9.609   45.404 1.00 27.17  ? 61  VAL D CG2 1 
ATOM   2542 N N   . ASN D  1 62 ? 11.025  8.342   41.941 1.00 22.26  ? 62  ASN D N   1 
ATOM   2543 C CA  . ASN D  1 62 ? 10.596  8.291   40.532 1.00 21.57  ? 62  ASN D CA  1 
ATOM   2544 C C   . ASN D  1 62 ? 11.026  6.962   39.867 1.00 22.95  ? 62  ASN D C   1 
ATOM   2545 O O   . ASN D  1 62 ? 11.473  6.925   38.712 1.00 26.05  ? 62  ASN D O   1 
ATOM   2546 C CB  . ASN D  1 62 ? 11.108  9.499   39.741 1.00 23.41  ? 62  ASN D CB  1 
ATOM   2547 C CG  . ASN D  1 62 ? 10.334  10.764  40.059 1.00 23.76  ? 62  ASN D CG  1 
ATOM   2548 O OD1 . ASN D  1 62 ? 9.245   10.701  40.636 1.00 22.09  ? 62  ASN D OD1 1 
ATOM   2549 N ND2 . ASN D  1 62 ? 10.890  11.914  39.691 1.00 24.29  ? 62  ASN D ND2 1 
ATOM   2550 N N   . GLY D  1 63 ? 10.913  5.882   40.627 1.00 24.69  ? 63  GLY D N   1 
ATOM   2551 C CA  . GLY D  1 63 ? 11.061  4.552   40.056 1.00 26.82  ? 63  GLY D CA  1 
ATOM   2552 C C   . GLY D  1 63 ? 12.467  4.002   40.101 1.00 26.63  ? 63  GLY D C   1 
ATOM   2553 O O   . GLY D  1 63 ? 12.703  2.867   39.662 1.00 25.64  ? 63  GLY D O   1 
ATOM   2554 N N   . VAL D  1 64 ? 13.393  4.797   40.631 1.00 27.13  ? 64  VAL D N   1 
ATOM   2555 C CA  . VAL D  1 64 ? 14.798  4.411   40.708 1.00 27.42  ? 64  VAL D CA  1 
ATOM   2556 C C   . VAL D  1 64 ? 15.275  4.268   42.138 1.00 28.19  ? 64  VAL D C   1 
ATOM   2557 O O   . VAL D  1 64 ? 15.150  5.194   42.958 1.00 27.32  ? 64  VAL D O   1 
ATOM   2558 C CB  . VAL D  1 64 ? 15.714  5.426   39.987 1.00 29.29  ? 64  VAL D CB  1 
ATOM   2559 C CG1 . VAL D  1 64 ? 17.147  4.941   39.994 1.00 28.72  ? 64  VAL D CG1 1 
ATOM   2560 C CG2 . VAL D  1 64 ? 15.242  5.642   38.556 1.00 29.34  ? 64  VAL D CG2 1 
ATOM   2561 N N   . SER D  1 65 ? 15.847  3.103   42.441 1.00 28.76  ? 65  SER D N   1 
ATOM   2562 C CA  . SER D  1 65 ? 16.386  2.838   43.773 1.00 31.42  ? 65  SER D CA  1 
ATOM   2563 C C   . SER D  1 65 ? 17.475  3.817   44.168 1.00 33.35  ? 65  SER D C   1 
ATOM   2564 O O   . SER D  1 65 ? 18.268  4.251   43.335 1.00 34.58  ? 65  SER D O   1 
ATOM   2565 C CB  . SER D  1 65 ? 16.956  1.421   43.842 1.00 30.92  ? 65  SER D CB  1 
ATOM   2566 O OG  . SER D  1 65 ? 17.692  1.234   45.046 1.00 39.08  ? 65  SER D OG  1 
ATOM   2567 N N   . LEU D  1 66 ? 17.516  4.144   45.452 1.00 33.63  ? 66  LEU D N   1 
ATOM   2568 C CA  . LEU D  1 66 ? 18.595  4.958   45.999 1.00 36.54  ? 66  LEU D CA  1 
ATOM   2569 C C   . LEU D  1 66 ? 19.741  4.090   46.485 1.00 43.34  ? 66  LEU D C   1 
ATOM   2570 O O   . LEU D  1 66 ? 20.734  4.600   46.998 1.00 45.37  ? 66  LEU D O   1 
ATOM   2571 C CB  . LEU D  1 66 ? 18.084  5.844   47.132 1.00 36.03  ? 66  LEU D CB  1 
ATOM   2572 C CG  . LEU D  1 66 ? 17.123  6.939   46.668 1.00 39.05  ? 66  LEU D CG  1 
ATOM   2573 C CD1 . LEU D  1 66 ? 16.787  7.865   47.821 1.00 36.49  ? 66  LEU D CD1 1 
ATOM   2574 C CD2 . LEU D  1 66 ? 17.731  7.720   45.502 1.00 41.61  ? 66  LEU D CD2 1 
ATOM   2575 N N   . GLU D  1 67 ? 19.610  2.779   46.320 1.00 44.81  ? 67  GLU D N   1 
ATOM   2576 C CA  . GLU D  1 67 ? 20.677  1.891   46.759 1.00 50.28  ? 67  GLU D CA  1 
ATOM   2577 C C   . GLU D  1 67 ? 22.015  2.282   46.129 1.00 49.59  ? 67  GLU D C   1 
ATOM   2578 O O   . GLU D  1 67 ? 22.134  2.391   44.899 1.00 47.47  ? 67  GLU D O   1 
ATOM   2579 C CB  . GLU D  1 67 ? 20.361  0.436   46.432 1.00 55.27  ? 67  GLU D CB  1 
ATOM   2580 C CG  . GLU D  1 67 ? 21.417  -0.518  46.975 1.00 63.36  ? 67  GLU D CG  1 
ATOM   2581 C CD  . GLU D  1 67 ? 21.555  -1.768  46.138 1.00 69.16  ? 67  GLU D CD  1 
ATOM   2582 O OE1 . GLU D  1 67 ? 22.570  -1.890  45.423 1.00 73.87  ? 67  GLU D OE1 1 
ATOM   2583 O OE2 . GLU D  1 67 ? 20.652  -2.628  46.191 1.00 69.65  ? 67  GLU D OE2 1 
ATOM   2584 N N   . GLY D  1 68 ? 23.015  2.489   46.985 1.00 49.37  ? 68  GLY D N   1 
ATOM   2585 C CA  . GLY D  1 68 ? 24.361  2.793   46.542 1.00 48.86  ? 68  GLY D CA  1 
ATOM   2586 C C   . GLY D  1 68 ? 24.649  4.284   46.509 1.00 48.70  ? 68  GLY D C   1 
ATOM   2587 O O   . GLY D  1 68 ? 25.773  4.705   46.224 1.00 51.22  ? 68  GLY D O   1 
ATOM   2588 N N   . ALA D  1 69 ? 23.634  5.089   46.804 1.00 45.87  ? 69  ALA D N   1 
ATOM   2589 C CA  . ALA D  1 69 ? 23.799  6.537   46.786 1.00 47.48  ? 69  ALA D CA  1 
ATOM   2590 C C   . ALA D  1 69 ? 24.602  7.047   47.982 1.00 50.71  ? 69  ALA D C   1 
ATOM   2591 O O   . ALA D  1 69 ? 24.371  6.641   49.119 1.00 51.38  ? 69  ALA D O   1 
ATOM   2592 C CB  . ALA D  1 69 ? 22.443  7.230   46.733 1.00 45.03  ? 69  ALA D CB  1 
ATOM   2593 N N   . THR D  1 70 ? 25.544  7.941   47.710 1.00 53.89  ? 70  THR D N   1 
ATOM   2594 C CA  . THR D  1 70 ? 26.161  8.728   48.762 1.00 57.71  ? 70  THR D CA  1 
ATOM   2595 C C   . THR D  1 70 ? 25.162  9.805   49.153 1.00 54.61  ? 70  THR D C   1 
ATOM   2596 O O   . THR D  1 70 ? 24.180  10.041  48.438 1.00 50.15  ? 70  THR D O   1 
ATOM   2597 C CB  . THR D  1 70 ? 27.454  9.404   48.283 1.00 62.59  ? 70  THR D CB  1 
ATOM   2598 O OG1 . THR D  1 70 ? 27.143  10.394  47.294 1.00 61.40  ? 70  THR D OG1 1 
ATOM   2599 C CG2 . THR D  1 70 ? 28.400  8.376   47.690 1.00 66.33  ? 70  THR D CG2 1 
ATOM   2600 N N   . HIS D  1 71 ? 25.403  10.460  50.281 1.00 53.32  ? 71  HIS D N   1 
ATOM   2601 C CA  . HIS D  1 71 ? 24.496  11.502  50.735 1.00 52.16  ? 71  HIS D CA  1 
ATOM   2602 C C   . HIS D  1 71 ? 24.304  12.575  49.659 1.00 51.57  ? 71  HIS D C   1 
ATOM   2603 O O   . HIS D  1 71 ? 23.170  12.950  49.341 1.00 47.38  ? 71  HIS D O   1 
ATOM   2604 C CB  . HIS D  1 71 ? 24.994  12.133  52.037 1.00 53.46  ? 71  HIS D CB  1 
ATOM   2605 C CG  . HIS D  1 71 ? 24.012  13.078  52.657 1.00 53.35  ? 71  HIS D CG  1 
ATOM   2606 N ND1 . HIS D  1 71 ? 24.081  14.444  52.484 1.00 55.23  ? 71  HIS D ND1 1 
ATOM   2607 C CD2 . HIS D  1 71 ? 22.920  12.852  53.424 1.00 53.39  ? 71  HIS D CD2 1 
ATOM   2608 C CE1 . HIS D  1 71 ? 23.082  15.020  53.129 1.00 53.83  ? 71  HIS D CE1 1 
ATOM   2609 N NE2 . HIS D  1 71 ? 22.360  14.076  53.704 1.00 53.56  ? 71  HIS D NE2 1 
ATOM   2610 N N   . LYS D  1 72 ? 25.416  13.057  49.103 1.00 54.80  ? 72  LYS D N   1 
ATOM   2611 C CA  . LYS D  1 72 ? 25.390  14.100  48.078 1.00 56.80  ? 72  LYS D CA  1 
ATOM   2612 C C   . LYS D  1 72 ? 24.481  13.706  46.934 1.00 51.91  ? 72  LYS D C   1 
ATOM   2613 O O   . LYS D  1 72 ? 23.702  14.523  46.446 1.00 47.88  ? 72  LYS D O   1 
ATOM   2614 C CB  . LYS D  1 72 ? 26.793  14.377  47.527 1.00 63.53  ? 72  LYS D CB  1 
ATOM   2615 C CG  . LYS D  1 72 ? 27.735  15.092  48.488 1.00 71.32  ? 72  LYS D CG  1 
ATOM   2616 C CD  . LYS D  1 72 ? 29.127  15.245  47.878 1.00 77.08  ? 72  LYS D CD  1 
ATOM   2617 C CE  . LYS D  1 72 ? 30.147  15.765  48.897 1.00 80.57  ? 72  LYS D CE  1 
ATOM   2618 N NZ  . LYS D  1 72 ? 31.523  15.866  48.324 1.00 83.26  ? 72  LYS D NZ  1 
ATOM   2619 N N   . GLN D  1 73 ? 24.593  12.447  46.515 1.00 50.95  ? 73  GLN D N   1 
ATOM   2620 C CA  . GLN D  1 73 ? 23.838  11.923  45.383 1.00 48.23  ? 73  GLN D CA  1 
ATOM   2621 C C   . GLN D  1 73 ? 22.353  11.816  45.691 1.00 41.53  ? 73  GLN D C   1 
ATOM   2622 O O   . GLN D  1 73 ? 21.519  12.125  44.839 1.00 39.57  ? 73  GLN D O   1 
ATOM   2623 C CB  . GLN D  1 73 ? 24.378  10.556  44.965 1.00 53.10  ? 73  GLN D CB  1 
ATOM   2624 C CG  . GLN D  1 73 ? 25.821  10.570  44.500 1.00 58.59  ? 73  GLN D CG  1 
ATOM   2625 C CD  . GLN D  1 73 ? 26.330  9.184   44.155 1.00 62.19  ? 73  GLN D CD  1 
ATOM   2626 O OE1 . GLN D  1 73 ? 25.722  8.178   44.517 1.00 62.27  ? 73  GLN D OE1 1 
ATOM   2627 N NE2 . GLN D  1 73 ? 27.452  9.124   43.451 1.00 66.54  ? 73  GLN D NE2 1 
ATOM   2628 N N   . ALA D  1 74 ? 22.028  11.371  46.902 1.00 38.58  ? 74  ALA D N   1 
ATOM   2629 C CA  . ALA D  1 74 ? 20.638  11.273  47.329 1.00 36.96  ? 74  ALA D CA  1 
ATOM   2630 C C   . ALA D  1 74 ? 19.973  12.643  47.295 1.00 37.83  ? 74  ALA D C   1 
ATOM   2631 O O   . ALA D  1 74 ? 18.900  12.800  46.721 1.00 36.01  ? 74  ALA D O   1 
ATOM   2632 C CB  . ALA D  1 74 ? 20.531  10.663  48.708 1.00 38.70  ? 74  ALA D CB  1 
ATOM   2633 N N   . VAL D  1 75 ? 20.613  13.628  47.917 1.00 40.50  ? 75  VAL D N   1 
ATOM   2634 C CA  . VAL D  1 75 ? 20.130  15.006  47.869 1.00 39.60  ? 75  VAL D CA  1 
ATOM   2635 C C   . VAL D  1 75 ? 19.925  15.497  46.428 1.00 40.55  ? 75  VAL D C   1 
ATOM   2636 O O   . VAL D  1 75 ? 18.885  16.079  46.102 1.00 39.52  ? 75  VAL D O   1 
ATOM   2637 C CB  . VAL D  1 75 ? 21.093  15.941  48.630 1.00 42.29  ? 75  VAL D CB  1 
ATOM   2638 C CG1 . VAL D  1 75 ? 20.816  17.402  48.292 1.00 42.32  ? 75  VAL D CG1 1 
ATOM   2639 C CG2 . VAL D  1 75 ? 20.974  15.701  50.124 1.00 43.80  ? 75  VAL D CG2 1 
ATOM   2640 N N   . GLU D  1 76 ? 20.902  15.231  45.563 1.00 43.19  ? 76  GLU D N   1 
ATOM   2641 C CA  . GLU D  1 76 ? 20.845  15.637  44.157 1.00 45.16  ? 76  GLU D CA  1 
ATOM   2642 C C   . GLU D  1 76 ? 19.730  14.938  43.383 1.00 41.05  ? 76  GLU D C   1 
ATOM   2643 O O   . GLU D  1 76 ? 19.038  15.555  42.573 1.00 41.12  ? 76  GLU D O   1 
ATOM   2644 C CB  . GLU D  1 76 ? 22.188  15.370  43.473 1.00 54.13  ? 76  GLU D CB  1 
ATOM   2645 C CG  . GLU D  1 76 ? 22.828  16.618  42.901 1.00 62.45  ? 76  GLU D CG  1 
ATOM   2646 C CD  . GLU D  1 76 ? 22.792  17.785  43.874 1.00 67.56  ? 76  GLU D CD  1 
ATOM   2647 O OE1 . GLU D  1 76 ? 23.453  17.704  44.931 1.00 70.87  ? 76  GLU D OE1 1 
ATOM   2648 O OE2 . GLU D  1 76 ? 22.097  18.783  43.582 1.00 68.41  ? 76  GLU D OE2 1 
ATOM   2649 N N   . THR D  1 77 ? 19.572  13.646  43.638 1.00 34.00  ? 77  THR D N   1 
ATOM   2650 C CA  . THR D  1 77 ? 18.484  12.873  43.070 1.00 35.01  ? 77  THR D CA  1 
ATOM   2651 C C   . THR D  1 77 ? 17.125  13.467  43.430 1.00 32.34  ? 77  THR D C   1 
ATOM   2652 O O   . THR D  1 77 ? 16.247  13.597  42.569 1.00 32.11  ? 77  THR D O   1 
ATOM   2653 C CB  . THR D  1 77 ? 18.564  11.406  43.529 1.00 37.52  ? 77  THR D CB  1 
ATOM   2654 O OG1 . THR D  1 77 ? 19.700  10.788  42.917 1.00 41.22  ? 77  THR D OG1 1 
ATOM   2655 C CG2 . THR D  1 77 ? 17.337  10.661  43.138 1.00 35.12  ? 77  THR D CG2 1 
ATOM   2656 N N   . LEU D  1 78 ? 16.962  13.847  44.691 1.00 33.49  ? 78  LEU D N   1 
ATOM   2657 C CA  . LEU D  1 78 ? 15.704  14.431  45.136 1.00 29.00  ? 78  LEU D CA  1 
ATOM   2658 C C   . LEU D  1 78 ? 15.459  15.790  44.497 1.00 32.29  ? 78  LEU D C   1 
ATOM   2659 O O   . LEU D  1 78 ? 14.316  16.145  44.205 1.00 34.70  ? 78  LEU D O   1 
ATOM   2660 C CB  . LEU D  1 78 ? 15.693  14.577  46.652 1.00 29.91  ? 78  LEU D CB  1 
ATOM   2661 C CG  . LEU D  1 78 ? 15.560  13.232  47.352 1.00 29.92  ? 78  LEU D CG  1 
ATOM   2662 C CD1 . LEU D  1 78 ? 16.114  13.253  48.767 1.00 33.83  ? 78  LEU D CD1 1 
ATOM   2663 C CD2 . LEU D  1 78 ? 14.101  12.765  47.297 1.00 31.37  ? 78  LEU D CD2 1 
ATOM   2664 N N   . ARG D  1 79 ? 16.530  16.546  44.287 1.00 31.05  ? 79  ARG D N   1 
ATOM   2665 C CA  . ARG D  1 79 ? 16.398  17.878  43.696 1.00 35.65  ? 79  ARG D CA  1 
ATOM   2666 C C   . ARG D  1 79 ? 16.120  17.831  42.201 1.00 38.20  ? 79  ARG D C   1 
ATOM   2667 O O   . ARG D  1 79 ? 15.363  18.653  41.679 1.00 38.94  ? 79  ARG D O   1 
ATOM   2668 C CB  . ARG D  1 79 ? 17.638  18.726  43.974 1.00 37.87  ? 79  ARG D CB  1 
ATOM   2669 C CG  . ARG D  1 79 ? 17.809  19.029  45.444 1.00 40.44  ? 79  ARG D CG  1 
ATOM   2670 C CD  . ARG D  1 79 ? 18.996  19.944  45.703 1.00 43.63  ? 79  ARG D CD  1 
ATOM   2671 N NE  . ARG D  1 79 ? 19.002  20.326  47.107 1.00 48.10  ? 79  ARG D NE  1 
ATOM   2672 C CZ  . ARG D  1 79 ? 20.008  20.927  47.725 1.00 51.37  ? 79  ARG D CZ  1 
ATOM   2673 N NH1 . ARG D  1 79 ? 21.119  21.228  47.065 1.00 53.92  ? 79  ARG D NH1 1 
ATOM   2674 N NH2 . ARG D  1 79 ? 19.894  21.226  49.010 1.00 52.55  ? 79  ARG D NH2 1 
ATOM   2675 N N   . ASN D  1 80 ? 16.725  16.860  41.522 1.00 39.49  ? 80  ASN D N   1 
ATOM   2676 C CA  . ASN D  1 80 ? 16.601  16.713  40.072 1.00 39.93  ? 80  ASN D CA  1 
ATOM   2677 C C   . ASN D  1 80 ? 15.282  16.031  39.705 1.00 34.58  ? 80  ASN D C   1 
ATOM   2678 O O   . ASN D  1 80 ? 15.252  14.966  39.082 1.00 33.74  ? 80  ASN D O   1 
ATOM   2679 C CB  . ASN D  1 80 ? 17.802  15.921  39.540 1.00 49.04  ? 80  ASN D CB  1 
ATOM   2680 C CG  . ASN D  1 80 ? 17.860  15.877  38.019 1.00 57.54  ? 80  ASN D CG  1 
ATOM   2681 O OD1 . ASN D  1 80 ? 17.733  16.903  37.343 1.00 60.88  ? 80  ASN D OD1 1 
ATOM   2682 N ND2 . ASN D  1 80 ? 18.077  14.681  37.475 1.00 59.51  ? 80  ASN D ND2 1 
ATOM   2683 N N   . THR D  1 81 ? 14.187  16.648  40.131 1.00 31.60  ? 81  THR D N   1 
ATOM   2684 C CA  . THR D  1 81 ? 12.856  16.107  39.946 1.00 29.14  ? 81  THR D CA  1 
ATOM   2685 C C   . THR D  1 81 ? 11.947  17.246  39.522 1.00 27.06  ? 81  THR D C   1 
ATOM   2686 O O   . THR D  1 81 ? 12.332  18.422  39.601 1.00 29.54  ? 81  THR D O   1 
ATOM   2687 C CB  . THR D  1 81 ? 12.297  15.485  41.246 1.00 30.42  ? 81  THR D CB  1 
ATOM   2688 O OG1 . THR D  1 81 ? 12.374  16.440  42.315 1.00 27.09  ? 81  THR D OG1 1 
ATOM   2689 C CG2 . THR D  1 81 ? 13.086  14.237  41.643 1.00 28.12  ? 81  THR D CG2 1 
ATOM   2690 N N   . GLY D  1 82 ? 10.750  16.890  39.065 1.00 26.91  ? 82  GLY D N   1 
ATOM   2691 C CA  . GLY D  1 82 ? 9.736   17.865  38.718 1.00 25.29  ? 82  GLY D CA  1 
ATOM   2692 C C   . GLY D  1 82 ? 8.884   18.281  39.908 1.00 26.54  ? 82  GLY D C   1 
ATOM   2693 O O   . GLY D  1 82 ? 9.230   18.026  41.062 1.00 25.21  ? 82  GLY D O   1 
ATOM   2694 N N   . GLN D  1 83 ? 7.754   18.920  39.623 1.00 25.31  ? 83  GLN D N   1 
ATOM   2695 C CA  . GLN D  1 83 ? 6.955   19.538  40.677 1.00 26.93  ? 83  GLN D CA  1 
ATOM   2696 C C   . GLN D  1 83 ? 6.208   18.487  41.528 1.00 24.55  ? 83  GLN D C   1 
ATOM   2697 O O   . GLN D  1 83 ? 5.954   18.698  42.724 1.00 25.91  ? 83  GLN D O   1 
ATOM   2698 C CB  . GLN D  1 83 ? 6.046   20.619  40.057 1.00 28.99  ? 83  GLN D CB  1 
ATOM   2699 C CG  . GLN D  1 83 ? 4.838   21.029  40.880 1.00 29.80  ? 83  GLN D CG  1 
ATOM   2700 C CD  . GLN D  1 83 ? 5.180   21.655  42.213 1.00 31.13  ? 83  GLN D CD  1 
ATOM   2701 O OE1 . GLN D  1 83 ? 6.262   22.243  42.410 1.00 31.10  ? 83  GLN D OE1 1 
ATOM   2702 N NE2 . GLN D  1 83 ? 4.238   21.554  43.147 1.00 30.11  ? 83  GLN D NE2 1 
ATOM   2703 N N   . VAL D  1 84 ? 5.897   17.334  40.942 1.00 20.69  ? 84  VAL D N   1 
ATOM   2704 C CA  . VAL D  1 84 ? 5.362   16.206  41.725 1.00 22.65  ? 84  VAL D CA  1 
ATOM   2705 C C   . VAL D  1 84 ? 6.314   15.041  41.614 1.00 24.28  ? 84  VAL D C   1 
ATOM   2706 O O   . VAL D  1 84 ? 6.738   14.690  40.511 1.00 24.17  ? 84  VAL D O   1 
ATOM   2707 C CB  . VAL D  1 84 ? 3.964   15.766  41.254 1.00 22.52  ? 84  VAL D CB  1 
ATOM   2708 C CG1 . VAL D  1 84 ? 3.585   14.427  41.870 1.00 28.42  ? 84  VAL D CG1 1 
ATOM   2709 C CG2 . VAL D  1 84 ? 2.948   16.836  41.592 1.00 25.67  ? 84  VAL D CG2 1 
ATOM   2710 N N   . VAL D  1 85 ? 6.646   14.465  42.766 1.00 22.91  ? 85  VAL D N   1 
ATOM   2711 C CA  . VAL D  1 85 ? 7.640   13.406  42.853 1.00 21.86  ? 85  VAL D CA  1 
ATOM   2712 C C   . VAL D  1 85 ? 7.055   12.115  43.429 1.00 21.16  ? 85  VAL D C   1 
ATOM   2713 O O   . VAL D  1 85 ? 6.352   12.126  44.459 1.00 22.39  ? 85  VAL D O   1 
ATOM   2714 C CB  . VAL D  1 85 ? 8.802   13.873  43.735 1.00 22.71  ? 85  VAL D CB  1 
ATOM   2715 C CG1 . VAL D  1 85 ? 9.927   12.855  43.700 1.00 25.51  ? 85  VAL D CG1 1 
ATOM   2716 C CG2 . VAL D  1 85 ? 9.276   15.267  43.267 1.00 22.90  ? 85  VAL D CG2 1 
ATOM   2717 N N   . HIS D  1 86 ? 7.373   10.991  42.779 1.00 21.60  ? 86  HIS D N   1 
ATOM   2718 C CA  . HIS D  1 86 ? 6.969   9.684   43.282 1.00 20.10  ? 86  HIS D CA  1 
ATOM   2719 C C   . HIS D  1 86 ? 8.057   9.175   44.225 1.00 21.08  ? 86  HIS D C   1 
ATOM   2720 O O   . HIS D  1 86 ? 9.223   9.119   43.846 1.00 25.15  ? 86  HIS D O   1 
ATOM   2721 C CB  . HIS D  1 86 ? 6.787   8.724   42.111 1.00 22.94  ? 86  HIS D CB  1 
ATOM   2722 C CG  . HIS D  1 86 ? 6.139   7.438   42.492 1.00 25.76  ? 86  HIS D CG  1 
ATOM   2723 N ND1 . HIS D  1 86 ? 6.173   6.329   41.674 1.00 29.25  ? 86  HIS D ND1 1 
ATOM   2724 C CD2 . HIS D  1 86 ? 5.418   7.083   43.581 1.00 29.62  ? 86  HIS D CD2 1 
ATOM   2725 C CE1 . HIS D  1 86 ? 5.519   5.336   42.256 1.00 30.72  ? 86  HIS D CE1 1 
ATOM   2726 N NE2 . HIS D  1 86 ? 5.047   5.769   43.410 1.00 31.51  ? 86  HIS D NE2 1 
ATOM   2727 N N   . LEU D  1 87 ? 7.677   8.865   45.463 1.00 21.24  ? 87  LEU D N   1 
ATOM   2728 C CA  . LEU D  1 87 ? 8.622   8.374   46.465 1.00 20.51  ? 87  LEU D CA  1 
ATOM   2729 C C   . LEU D  1 87 ? 8.143   7.049   47.023 1.00 24.12  ? 87  LEU D C   1 
ATOM   2730 O O   . LEU D  1 87 ? 6.949   6.871   47.307 1.00 26.45  ? 87  LEU D O   1 
ATOM   2731 C CB  . LEU D  1 87 ? 8.782   9.384   47.618 1.00 24.66  ? 87  LEU D CB  1 
ATOM   2732 C CG  . LEU D  1 87 ? 9.231   10.794  47.227 1.00 26.48  ? 87  LEU D CG  1 
ATOM   2733 C CD1 . LEU D  1 87 ? 8.989   11.783  48.348 1.00 25.86  ? 87  LEU D CD1 1 
ATOM   2734 C CD2 . LEU D  1 87 ? 10.702  10.816  46.798 1.00 27.44  ? 87  LEU D CD2 1 
ATOM   2735 N N   . LEU D  1 88 ? 9.082   6.124   47.181 1.00 24.08  ? 88  LEU D N   1 
ATOM   2736 C CA  . LEU D  1 88 ? 8.828   4.830   47.784 1.00 23.59  ? 88  LEU D CA  1 
ATOM   2737 C C   . LEU D  1 88 ? 9.555   4.807   49.115 1.00 26.33  ? 88  LEU D C   1 
ATOM   2738 O O   . LEU D  1 88 ? 10.758  5.079   49.159 1.00 29.33  ? 88  LEU D O   1 
ATOM   2739 C CB  . LEU D  1 88 ? 9.396   3.723   46.908 1.00 26.75  ? 88  LEU D CB  1 
ATOM   2740 C CG  . LEU D  1 88 ? 9.212   2.269   47.352 1.00 30.35  ? 88  LEU D CG  1 
ATOM   2741 C CD1 . LEU D  1 88 ? 7.737   1.891   47.353 1.00 28.60  ? 88  LEU D CD1 1 
ATOM   2742 C CD2 . LEU D  1 88 ? 9.985   1.372   46.391 1.00 28.21  ? 88  LEU D CD2 1 
ATOM   2743 N N   . LEU D  1 89 ? 8.846   4.470   50.189 1.00 30.32  ? 89  LEU D N   1 
ATOM   2744 C CA  . LEU D  1 89 ? 9.422   4.546   51.530 1.00 31.03  ? 89  LEU D CA  1 
ATOM   2745 C C   . LEU D  1 89 ? 9.140   3.307   52.369 1.00 31.74  ? 89  LEU D C   1 
ATOM   2746 O O   . LEU D  1 89 ? 8.213   2.554   52.082 1.00 33.14  ? 89  LEU D O   1 
ATOM   2747 C CB  . LEU D  1 89 ? 8.872   5.769   52.259 1.00 30.93  ? 89  LEU D CB  1 
ATOM   2748 C CG  . LEU D  1 89 ? 9.144   7.109   51.585 1.00 29.42  ? 89  LEU D CG  1 
ATOM   2749 C CD1 . LEU D  1 89 ? 7.916   7.608   50.846 1.00 34.47  ? 89  LEU D CD1 1 
ATOM   2750 C CD2 . LEU D  1 89 ? 9.624   8.123   52.622 1.00 31.50  ? 89  LEU D CD2 1 
ATOM   2751 N N   . GLU D  1 90 ? 9.960   3.093   53.401 1.00 30.55  ? 90  GLU D N   1 
ATOM   2752 C CA  . GLU D  1 90 ? 9.615   2.157   54.464 1.00 37.48  ? 90  GLU D CA  1 
ATOM   2753 C C   . GLU D  1 90 ? 9.357   2.959   55.741 1.00 38.39  ? 90  GLU D C   1 
ATOM   2754 O O   . GLU D  1 90 ? 10.160  3.814   56.120 1.00 38.63  ? 90  GLU D O   1 
ATOM   2755 C CB  . GLU D  1 90 ? 10.735  1.150   54.725 1.00 43.22  ? 90  GLU D CB  1 
ATOM   2756 C CG  . GLU D  1 90 ? 10.497  0.305   55.970 1.00 47.56  ? 90  GLU D CG  1 
ATOM   2757 C CD  . GLU D  1 90 ? 11.782  -0.283  56.515 1.00 51.32  ? 90  GLU D CD  1 
ATOM   2758 O OE1 . GLU D  1 90 ? 12.814  -0.137  55.824 1.00 54.86  ? 90  GLU D OE1 1 
ATOM   2759 O OE2 . GLU D  1 90 ? 11.765  -0.884  57.621 1.00 45.43  ? 90  GLU D OE2 1 
ATOM   2760 N N   . LYS D  1 91 ? 8.217   2.706   56.370 1.00 32.28  ? 91  LYS D N   1 
ATOM   2761 C CA  . LYS D  1 91 ? 7.812   3.390   57.595 1.00 32.90  ? 91  LYS D CA  1 
ATOM   2762 C C   . LYS D  1 91 ? 8.795   3.112   58.737 1.00 35.88  ? 91  LYS D C   1 
ATOM   2763 O O   . LYS D  1 91 ? 9.037   1.963   59.100 1.00 38.52  ? 91  LYS D O   1 
ATOM   2764 C CB  . LYS D  1 91 ? 6.399   2.937   57.974 1.00 39.14  ? 91  LYS D CB  1 
ATOM   2765 C CG  . LYS D  1 91 ? 5.853   3.454   59.284 1.00 38.87  ? 91  LYS D CG  1 
ATOM   2766 C CD  . LYS D  1 91 ? 5.407   4.877   59.177 1.00 43.31  ? 91  LYS D CD  1 
ATOM   2767 C CE  . LYS D  1 91 ? 4.788   5.384   60.463 1.00 49.20  ? 91  LYS D CE  1 
ATOM   2768 N NZ  . LYS D  1 91 ? 4.433   6.825   60.319 1.00 51.07  ? 91  LYS D NZ  1 
ATOM   2769 N N   . GLY D  1 92 ? 9.362   4.169   59.303 1.00 36.85  ? 92  GLY D N   1 
ATOM   2770 C CA  . GLY D  1 92 ? 10.349  4.023   60.371 1.00 40.19  ? 92  GLY D CA  1 
ATOM   2771 C C   . GLY D  1 92 ? 9.779   3.802   61.761 1.00 49.77  ? 92  GLY D C   1 
ATOM   2772 O O   . GLY D  1 92 ? 8.555   3.756   61.943 1.00 43.89  ? 92  GLY D O   1 
ATOM   2773 N N   . GLN D  1 93 ? 10.678  3.738   62.747 1.00 61.05  ? 93  GLN D N   1 
ATOM   2774 C CA  . GLN D  1 93 ? 10.314  3.567   64.157 1.00 77.04  ? 93  GLN D CA  1 
ATOM   2775 C C   . GLN D  1 93 ? 10.061  2.131   64.642 1.00 94.80  ? 93  GLN D C   1 
ATOM   2776 O O   . GLN D  1 93 ? 9.469   1.937   65.704 1.00 97.00  ? 93  GLN D O   1 
ATOM   2777 C CB  . GLN D  1 93 ? 9.103   4.443   64.497 1.00 74.51  ? 93  GLN D CB  1 
ATOM   2778 C CG  . GLN D  1 93 ? 8.652   4.343   65.945 1.00 75.09  ? 93  GLN D CG  1 
ATOM   2779 C CD  . GLN D  1 93 ? 7.460   5.229   66.247 1.00 75.67  ? 93  GLN D CD  1 
ATOM   2780 O OE1 . GLN D  1 93 ? 6.952   5.926   65.368 1.00 74.61  ? 93  GLN D OE1 1 
ATOM   2781 N NE2 . GLN D  1 93 ? 7.006   5.206   67.495 1.00 76.80  ? 93  GLN D NE2 1 
ATOM   2782 N N   . SER D  1 94 ? 10.490  1.133   63.875 1.00 108.85 ? 94  SER D N   1 
ATOM   2783 C CA  . SER D  1 94 ? 10.212  -0.258  64.230 1.00 123.20 ? 94  SER D CA  1 
ATOM   2784 C C   . SER D  1 94 ? 11.042  -0.728  65.422 1.00 130.12 ? 94  SER D C   1 
ATOM   2785 O O   . SER D  1 94 ? 11.700  0.071   66.090 1.00 133.01 ? 94  SER D O   1 
ATOM   2786 C CB  . SER D  1 94 ? 10.433  -1.179  63.025 1.00 127.96 ? 94  SER D CB  1 
ATOM   2787 O OG  . SER D  1 94 ? 11.728  -1.010  62.475 1.00 129.59 ? 94  SER D OG  1 
ATOM   2788 N N   . PRO E  1 1  ? -0.260  -2.390  57.912 1.00 44.12  ? 1   PRO E N   1 
ATOM   2789 C CA  . PRO E  1 1  ? -1.244  -1.302  57.964 1.00 40.43  ? 1   PRO E CA  1 
ATOM   2790 C C   . PRO E  1 1  ? -1.675  -1.019  59.404 1.00 39.92  ? 1   PRO E C   1 
ATOM   2791 O O   . PRO E  1 1  ? -1.642  -1.934  60.228 1.00 40.03  ? 1   PRO E O   1 
ATOM   2792 C CB  . PRO E  1 1  ? -2.420  -1.867  57.168 1.00 40.06  ? 1   PRO E CB  1 
ATOM   2793 C CG  . PRO E  1 1  ? -1.793  -2.808  56.193 1.00 42.77  ? 1   PRO E CG  1 
ATOM   2794 C CD  . PRO E  1 1  ? -0.522  -3.326  56.803 1.00 45.12  ? 1   PRO E CD  1 
ATOM   2795 N N   . LYS E  1 2  ? -2.022  0.231   59.706 1.00 36.91  ? 2   LYS E N   1 
ATOM   2796 C CA  . LYS E  1 2  ? -2.622  0.578   60.986 1.00 36.92  ? 2   LYS E CA  1 
ATOM   2797 C C   . LYS E  1 2  ? -4.120  0.554   60.809 1.00 34.07  ? 2   LYS E C   1 
ATOM   2798 O O   . LYS E  1 2  ? -4.610  0.655   59.695 1.00 32.05  ? 2   LYS E O   1 
ATOM   2799 C CB  . LYS E  1 2  ? -2.229  1.986   61.425 1.00 42.30  ? 2   LYS E CB  1 
ATOM   2800 C CG  . LYS E  1 2  ? -0.760  2.300   61.352 1.00 49.81  ? 2   LYS E CG  1 
ATOM   2801 C CD  . LYS E  1 2  ? -0.404  3.401   62.352 1.00 55.56  ? 2   LYS E CD  1 
ATOM   2802 C CE  . LYS E  1 2  ? -1.514  4.444   62.446 1.00 56.49  ? 2   LYS E CE  1 
ATOM   2803 N NZ  . LYS E  1 2  ? -1.720  5.180   61.173 1.00 55.52  ? 2   LYS E NZ  1 
ATOM   2804 N N   . PRO E  1 3  ? -4.863  0.464   61.918 1.00 32.49  ? 3   PRO E N   1 
ATOM   2805 C CA  . PRO E  1 3  ? -6.322  0.499   61.780 1.00 32.99  ? 3   PRO E CA  1 
ATOM   2806 C C   . PRO E  1 3  ? -6.767  1.724   61.007 1.00 32.69  ? 3   PRO E C   1 
ATOM   2807 O O   . PRO E  1 3  ? -6.270  2.830   61.268 1.00 34.80  ? 3   PRO E O   1 
ATOM   2808 C CB  . PRO E  1 3  ? -6.792  0.563   63.239 1.00 32.52  ? 3   PRO E CB  1 
ATOM   2809 C CG  . PRO E  1 3  ? -5.741  -0.227  63.957 1.00 35.16  ? 3   PRO E CG  1 
ATOM   2810 C CD  . PRO E  1 3  ? -4.452  0.227   63.317 1.00 33.30  ? 3   PRO E CD  1 
ATOM   2811 N N   . GLY E  1 4  ? -7.667  1.533   60.047 1.00 29.50  ? 4   GLY E N   1 
ATOM   2812 C CA  . GLY E  1 4  ? -8.158  2.636   59.239 1.00 29.50  ? 4   GLY E CA  1 
ATOM   2813 C C   . GLY E  1 4  ? -7.482  2.738   57.869 1.00 27.89  ? 4   GLY E C   1 
ATOM   2814 O O   . GLY E  1 4  ? -8.058  3.289   56.936 1.00 30.45  ? 4   GLY E O   1 
ATOM   2815 N N   . ASP E  1 5  ? -6.263  2.211   57.756 1.00 29.26  ? 5   ASP E N   1 
ATOM   2816 C CA  . ASP E  1 5  ? -5.506  2.205   56.492 1.00 27.56  ? 5   ASP E CA  1 
ATOM   2817 C C   . ASP E  1 5  ? -6.174  1.361   55.414 1.00 26.58  ? 5   ASP E C   1 
ATOM   2818 O O   . ASP E  1 5  ? -6.689  0.276   55.685 1.00 28.45  ? 5   ASP E O   1 
ATOM   2819 C CB  . ASP E  1 5  ? -4.100  1.640   56.727 1.00 31.92  ? 5   ASP E CB  1 
ATOM   2820 C CG  . ASP E  1 5  ? -3.167  2.621   57.432 1.00 34.65  ? 5   ASP E CG  1 
ATOM   2821 O OD1 . ASP E  1 5  ? -3.555  3.783   57.667 1.00 34.92  ? 5   ASP E OD1 1 
ATOM   2822 O OD2 . ASP E  1 5  ? -2.023  2.224   57.742 1.00 37.31  ? 5   ASP E OD2 1 
ATOM   2823 N N   . ILE E  1 6  ? -6.135  1.857   54.177 1.00 26.94  ? 6   ILE E N   1 
ATOM   2824 C CA  . ILE E  1 6  ? -6.500  1.060   53.010 1.00 27.17  ? 6   ILE E CA  1 
ATOM   2825 C C   . ILE E  1 6  ? -5.364  0.105   52.670 1.00 27.35  ? 6   ILE E C   1 
ATOM   2826 O O   . ILE E  1 6  ? -4.193  0.496   52.720 1.00 26.61  ? 6   ILE E O   1 
ATOM   2827 C CB  . ILE E  1 6  ? -6.725  1.967   51.797 1.00 27.32  ? 6   ILE E CB  1 
ATOM   2828 C CG1 . ILE E  1 6  ? -7.896  2.915   52.061 1.00 28.25  ? 6   ILE E CG1 1 
ATOM   2829 C CG2 . ILE E  1 6  ? -6.971  1.153   50.543 1.00 26.19  ? 6   ILE E CG2 1 
ATOM   2830 C CD1 . ILE E  1 6  ? -9.201  2.200   52.282 1.00 27.36  ? 6   ILE E CD1 1 
ATOM   2831 N N   . PHE E  1 7  ? -5.692  -1.144  52.333 1.00 26.26  ? 7   PHE E N   1 
ATOM   2832 C CA  . PHE E  1 7  ? -4.687  -2.030  51.738 1.00 26.07  ? 7   PHE E CA  1 
ATOM   2833 C C   . PHE E  1 7  ? -5.335  -2.938  50.701 1.00 27.11  ? 7   PHE E C   1 
ATOM   2834 O O   . PHE E  1 7  ? -6.553  -3.085  50.679 1.00 24.97  ? 7   PHE E O   1 
ATOM   2835 C CB  . PHE E  1 7  ? -3.924  -2.838  52.805 1.00 27.95  ? 7   PHE E CB  1 
ATOM   2836 C CG  . PHE E  1 7  ? -4.768  -3.845  53.546 1.00 28.38  ? 7   PHE E CG  1 
ATOM   2837 C CD1 . PHE E  1 7  ? -4.726  -5.187  53.206 1.00 29.50  ? 7   PHE E CD1 1 
ATOM   2838 C CD2 . PHE E  1 7  ? -5.580  -3.447  54.598 1.00 29.91  ? 7   PHE E CD2 1 
ATOM   2839 C CE1 . PHE E  1 7  ? -5.481  -6.127  53.907 1.00 29.88  ? 7   PHE E CE1 1 
ATOM   2840 C CE2 . PHE E  1 7  ? -6.337  -4.388  55.294 1.00 29.95  ? 7   PHE E CE2 1 
ATOM   2841 C CZ  . PHE E  1 7  ? -6.285  -5.721  54.946 1.00 29.57  ? 7   PHE E CZ  1 
ATOM   2842 N N   . GLU E  1 8  ? -4.531  -3.484  49.794 1.00 26.87  ? 8   GLU E N   1 
ATOM   2843 C CA  . GLU E  1 8  ? -5.060  -4.402  48.795 1.00 26.52  ? 8   GLU E CA  1 
ATOM   2844 C C   . GLU E  1 8  ? -4.248  -5.684  48.818 1.00 30.12  ? 8   GLU E C   1 
ATOM   2845 O O   . GLU E  1 8  ? -3.077  -5.697  49.216 1.00 31.85  ? 8   GLU E O   1 
ATOM   2846 C CB  . GLU E  1 8  ? -5.094  -3.778  47.391 1.00 29.74  ? 8   GLU E CB  1 
ATOM   2847 C CG  . GLU E  1 8  ? -3.824  -3.084  46.992 1.00 35.26  ? 8   GLU E CG  1 
ATOM   2848 C CD  . GLU E  1 8  ? -3.946  -2.334  45.666 1.00 38.25  ? 8   GLU E CD  1 
ATOM   2849 O OE1 . GLU E  1 8  ? -3.186  -1.360  45.473 1.00 42.73  ? 8   GLU E OE1 1 
ATOM   2850 O OE2 . GLU E  1 8  ? -4.798  -2.706  44.829 1.00 34.31  ? 8   GLU E OE2 1 
ATOM   2851 N N   . VAL E  1 9  ? -4.893  -6.770  48.422 1.00 27.71  ? 9   VAL E N   1 
ATOM   2852 C CA  . VAL E  1 9  ? -4.235  -8.064  48.389 1.00 29.70  ? 9   VAL E CA  1 
ATOM   2853 C C   . VAL E  1 9  ? -4.651  -8.801  47.123 1.00 30.93  ? 9   VAL E C   1 
ATOM   2854 O O   . VAL E  1 9  ? -5.778  -8.656  46.647 1.00 33.56  ? 9   VAL E O   1 
ATOM   2855 C CB  . VAL E  1 9  ? -4.600  -8.930  49.617 1.00 35.02  ? 9   VAL E CB  1 
ATOM   2856 C CG1 . VAL E  1 9  ? -4.243  -8.224  50.915 1.00 29.78  ? 9   VAL E CG1 1 
ATOM   2857 C CG2 . VAL E  1 9  ? -6.078  -9.291  49.602 1.00 38.33  ? 9   VAL E CG2 1 
ATOM   2858 N N   . GLU E  1 10 ? -3.730  -9.577  46.562 1.00 31.06  ? 10  GLU E N   1 
ATOM   2859 C CA  . GLU E  1 10 ? -4.095  -10.548 45.547 1.00 28.03  ? 10  GLU E CA  1 
ATOM   2860 C C   . GLU E  1 10 ? -3.992  -11.890 46.252 1.00 31.62  ? 10  GLU E C   1 
ATOM   2861 O O   . GLU E  1 10 ? -2.884  -12.325 46.576 1.00 36.33  ? 10  GLU E O   1 
ATOM   2862 C CB  . GLU E  1 10 ? -3.112  -10.524 44.378 1.00 29.20  ? 10  GLU E CB  1 
ATOM   2863 C CG  . GLU E  1 10 ? -3.210  -9.296  43.492 1.00 30.36  ? 10  GLU E CG  1 
ATOM   2864 C CD  . GLU E  1 10 ? -4.435  -9.306  42.589 1.00 28.24  ? 10  GLU E CD  1 
ATOM   2865 O OE1 . GLU E  1 10 ? -5.178  -10.307 42.606 1.00 36.04  ? 10  GLU E OE1 1 
ATOM   2866 O OE2 . GLU E  1 10 ? -4.655  -8.292  41.901 1.00 32.54  ? 10  GLU E OE2 1 
ATOM   2867 N N   . LEU E  1 11 ? -5.136  -12.539 46.472 1.00 29.23  ? 11  LEU E N   1 
ATOM   2868 C CA  . LEU E  1 11 ? -5.222  -13.726 47.320 1.00 34.48  ? 11  LEU E CA  1 
ATOM   2869 C C   . LEU E  1 11 ? -5.509  -14.934 46.445 1.00 38.20  ? 11  LEU E C   1 
ATOM   2870 O O   . LEU E  1 11 ? -6.488  -14.947 45.703 1.00 39.65  ? 11  LEU E O   1 
ATOM   2871 C CB  . LEU E  1 11 ? -6.339  -13.545 48.361 1.00 34.72  ? 11  LEU E CB  1 
ATOM   2872 C CG  . LEU E  1 11 ? -6.432  -14.573 49.492 1.00 42.88  ? 11  LEU E CG  1 
ATOM   2873 C CD1 . LEU E  1 11 ? -5.093  -14.701 50.191 1.00 44.82  ? 11  LEU E CD1 1 
ATOM   2874 C CD2 . LEU E  1 11 ? -7.532  -14.211 50.485 1.00 42.18  ? 11  LEU E CD2 1 
ATOM   2875 N N   . ALA E  1 12 ? -4.646  -15.945 46.513 1.00 40.31  ? 12  ALA E N   1 
ATOM   2876 C CA  . ALA E  1 12 ? -4.900  -17.193 45.818 1.00 41.43  ? 12  ALA E CA  1 
ATOM   2877 C C   . ALA E  1 12 ? -5.776  -18.083 46.692 1.00 43.55  ? 12  ALA E C   1 
ATOM   2878 O O   . ALA E  1 12 ? -5.515  -18.237 47.883 1.00 45.01  ? 12  ALA E O   1 
ATOM   2879 C CB  . ALA E  1 12 ? -3.598  -17.901 45.513 1.00 43.79  ? 12  ALA E CB  1 
ATOM   2880 N N   . LYS E  1 13 ? -6.812  -18.670 46.107 1.00 40.12  ? 13  LYS E N   1 
ATOM   2881 C CA  . LYS E  1 13 ? -7.664  -19.587 46.860 1.00 43.78  ? 13  LYS E CA  1 
ATOM   2882 C C   . LYS E  1 13 ? -6.924  -20.877 47.224 1.00 51.94  ? 13  LYS E C   1 
ATOM   2883 O O   . LYS E  1 13 ? -6.023  -21.316 46.512 1.00 50.74  ? 13  LYS E O   1 
ATOM   2884 C CB  . LYS E  1 13 ? -8.940  -19.901 46.065 1.00 45.46  ? 13  LYS E CB  1 
ATOM   2885 C CG  . LYS E  1 13 ? -9.905  -18.716 45.940 1.00 44.39  ? 13  LYS E CG  1 
ATOM   2886 C CD  . LYS E  1 13 ? -11.063 -19.056 45.011 1.00 50.02  ? 13  LYS E CD  1 
ATOM   2887 C CE  . LYS E  1 13 ? -11.908 -17.825 44.692 1.00 48.09  ? 13  LYS E CE  1 
ATOM   2888 N NZ  . LYS E  1 13 ? -12.992 -18.188 43.729 1.00 53.11  ? 13  LYS E NZ  1 
ATOM   2889 N N   . ASN E  1 14 ? -7.302  -21.461 48.355 1.00 51.15  ? 14  ASN E N   1 
ATOM   2890 C CA  . ASN E  1 14 ? -6.881  -22.806 48.742 1.00 57.46  ? 14  ASN E CA  1 
ATOM   2891 C C   . ASN E  1 14 ? -8.128  -23.659 48.698 1.00 59.21  ? 14  ASN E C   1 
ATOM   2892 O O   . ASN E  1 14 ? -9.113  -23.327 49.354 1.00 57.45  ? 14  ASN E O   1 
ATOM   2893 C CB  . ASN E  1 14 ? -6.341  -22.809 50.176 1.00 62.97  ? 14  ASN E CB  1 
ATOM   2894 C CG  . ASN E  1 14 ? -6.298  -24.210 50.789 1.00 74.60  ? 14  ASN E CG  1 
ATOM   2895 O OD1 . ASN E  1 14 ? -6.046  -25.195 50.095 1.00 79.90  ? 14  ASN E OD1 1 
ATOM   2896 N ND2 . ASN E  1 14 ? -6.548  -24.302 52.099 1.00 78.42  ? 14  ASN E ND2 1 
ATOM   2897 N N   . ASP E  1 15 ? -8.097  -24.751 47.940 1.00 63.77  ? 15  ASP E N   1 
ATOM   2898 C CA  . ASP E  1 15 ? -9.269  -25.613 47.823 1.00 68.62  ? 15  ASP E CA  1 
ATOM   2899 C C   . ASP E  1 15 ? -10.506 -24.814 47.448 1.00 64.94  ? 15  ASP E C   1 
ATOM   2900 O O   . ASP E  1 15 ? -11.598 -25.025 47.979 1.00 65.36  ? 15  ASP E O   1 
ATOM   2901 C CB  . ASP E  1 15 ? -9.501  -26.393 49.111 1.00 78.00  ? 15  ASP E CB  1 
ATOM   2902 C CG  . ASP E  1 15 ? -8.592  -27.596 49.223 1.00 88.26  ? 15  ASP E CG  1 
ATOM   2903 O OD1 . ASP E  1 15 ? -8.298  -28.220 48.180 1.00 92.36  ? 15  ASP E OD1 1 
ATOM   2904 O OD2 . ASP E  1 15 ? -8.172  -27.917 50.352 1.00 92.01  ? 15  ASP E OD2 1 
ATOM   2905 N N   . ASN E  1 16 ? -10.310 -23.892 46.518 1.00 60.19  ? 16  ASN E N   1 
ATOM   2906 C CA  . ASN E  1 16 ? -11.383 -23.076 45.977 1.00 62.41  ? 16  ASN E CA  1 
ATOM   2907 C C   . ASN E  1 16 ? -12.077 -22.170 46.975 1.00 58.04  ? 16  ASN E C   1 
ATOM   2908 O O   . ASN E  1 16 ? -13.235 -21.809 46.779 1.00 58.48  ? 16  ASN E O   1 
ATOM   2909 C CB  . ASN E  1 16 ? -12.425 -23.938 45.278 1.00 67.36  ? 16  ASN E CB  1 
ATOM   2910 C CG  . ASN E  1 16 ? -13.084 -23.215 44.130 1.00 69.92  ? 16  ASN E CG  1 
ATOM   2911 O OD1 . ASN E  1 16 ? -12.439 -22.435 43.425 1.00 69.95  ? 16  ASN E OD1 1 
ATOM   2912 N ND2 . ASN E  1 16 ? -14.374 -23.456 43.937 1.00 73.55  ? 16  ASN E ND2 1 
ATOM   2913 N N   . SER E  1 17 ? -11.383 -21.803 48.044 1.00 58.40  ? 17  SER E N   1 
ATOM   2914 C CA  . SER E  1 17 ? -11.934 -20.856 49.008 1.00 53.37  ? 17  SER E CA  1 
ATOM   2915 C C   . SER E  1 17 ? -10.889 -19.831 49.398 1.00 49.14  ? 17  SER E C   1 
ATOM   2916 O O   . SER E  1 17 ? -9.702  -20.161 49.487 1.00 49.04  ? 17  SER E O   1 
ATOM   2917 C CB  . SER E  1 17 ? -12.433 -21.605 50.257 1.00 57.10  ? 17  SER E CB  1 
ATOM   2918 O OG  . SER E  1 17 ? -12.921 -20.709 51.244 1.00 60.44  ? 17  SER E OG  1 
ATOM   2919 N N   . LEU E  1 18 ? -11.337 -18.591 49.615 1.00 43.45  ? 18  LEU E N   1 
ATOM   2920 C CA  . LEU E  1 18 ? -10.475 -17.523 50.104 1.00 39.68  ? 18  LEU E CA  1 
ATOM   2921 C C   . LEU E  1 18 ? -10.170 -17.688 51.588 1.00 43.43  ? 18  LEU E C   1 
ATOM   2922 O O   . LEU E  1 18 ? -9.282  -17.016 52.129 1.00 44.19  ? 18  LEU E O   1 
ATOM   2923 C CB  . LEU E  1 18 ? -11.102 -16.142 49.836 1.00 42.50  ? 18  LEU E CB  1 
ATOM   2924 C CG  . LEU E  1 18 ? -11.285 -15.825 48.352 1.00 43.16  ? 18  LEU E CG  1 
ATOM   2925 C CD1 . LEU E  1 18 ? -12.160 -14.594 48.137 1.00 39.56  ? 18  LEU E CD1 1 
ATOM   2926 C CD2 . LEU E  1 18 ? -9.931  -15.646 47.695 1.00 42.96  ? 18  LEU E CD2 1 
ATOM   2927 N N   . GLY E  1 19 ? -10.912 -18.569 52.248 1.00 47.86  ? 19  GLY E N   1 
ATOM   2928 C CA  . GLY E  1 19 ? -10.707 -18.815 53.663 1.00 52.94  ? 19  GLY E CA  1 
ATOM   2929 C C   . GLY E  1 19 ? -11.177 -17.685 54.562 1.00 51.61  ? 19  GLY E C   1 
ATOM   2930 O O   . GLY E  1 19 ? -10.592 -17.435 55.622 1.00 51.27  ? 19  GLY E O   1 
ATOM   2931 N N   . ILE E  1 20 ? -12.229 -16.988 54.150 1.00 51.65  ? 20  ILE E N   1 
ATOM   2932 C CA  . ILE E  1 20 ? -12.838 -15.970 55.012 1.00 50.78  ? 20  ILE E CA  1 
ATOM   2933 C C   . ILE E  1 20 ? -14.353 -16.095 55.008 1.00 52.43  ? 20  ILE E C   1 
ATOM   2934 O O   . ILE E  1 20 ? -14.945 -16.543 54.027 1.00 57.73  ? 20  ILE E O   1 
ATOM   2935 C CB  . ILE E  1 20 ? -12.473 -14.534 54.594 1.00 51.90  ? 20  ILE E CB  1 
ATOM   2936 C CG1 . ILE E  1 20 ? -12.866 -14.303 53.146 1.00 43.96  ? 20  ILE E CG1 1 
ATOM   2937 C CG2 . ILE E  1 20 ? -10.987 -14.258 54.786 1.00 55.31  ? 20  ILE E CG2 1 
ATOM   2938 C CD1 . ILE E  1 20 ? -12.565 -12.907 52.665 1.00 46.97  ? 20  ILE E CD1 1 
ATOM   2939 N N   . SER E  1 21 ? -14.977 -15.735 56.122 1.00 48.98  ? 21  SER E N   1 
ATOM   2940 C CA  . SER E  1 21 ? -16.426 -15.634 56.172 1.00 48.83  ? 21  SER E CA  1 
ATOM   2941 C C   . SER E  1 21 ? -16.746 -14.176 56.437 1.00 44.25  ? 21  SER E C   1 
ATOM   2942 O O   . SER E  1 21 ? -15.956 -13.478 57.061 1.00 45.37  ? 21  SER E O   1 
ATOM   2943 C CB  . SER E  1 21 ? -17.017 -16.534 57.265 1.00 51.35  ? 21  SER E CB  1 
ATOM   2944 O OG  . SER E  1 21 ? -16.537 -16.211 58.562 1.00 51.39  ? 21  SER E OG  1 
ATOM   2945 N N   . VAL E  1 22 ? -17.877 -13.692 55.939 1.00 46.02  ? 22  VAL E N   1 
ATOM   2946 C CA  . VAL E  1 22 ? -18.195 -12.272 56.109 1.00 44.26  ? 22  VAL E CA  1 
ATOM   2947 C C   . VAL E  1 22 ? -19.487 -12.026 56.898 1.00 43.02  ? 22  VAL E C   1 
ATOM   2948 O O   . VAL E  1 22 ? -20.357 -12.893 56.971 1.00 45.23  ? 22  VAL E O   1 
ATOM   2949 C CB  . VAL E  1 22 ? -18.287 -11.548 54.769 1.00 42.66  ? 22  VAL E CB  1 
ATOM   2950 C CG1 . VAL E  1 22 ? -16.942 -11.583 54.075 1.00 41.17  ? 22  VAL E CG1 1 
ATOM   2951 C CG2 . VAL E  1 22 ? -19.376 -12.186 53.914 1.00 44.14  ? 22  VAL E CG2 1 
ATOM   2952 N N   . THR E  1 23 ? -19.583 -10.832 57.484 1.00 42.16  ? 23  THR E N   1 
ATOM   2953 C CA  . THR E  1 23 ? -20.785 -10.381 58.190 1.00 41.04  ? 23  THR E CA  1 
ATOM   2954 C C   . THR E  1 23 ? -21.239 -9.067  57.552 1.00 40.20  ? 23  THR E C   1 
ATOM   2955 O O   . THR E  1 23 ? -20.419 -8.325  57.050 1.00 40.14  ? 23  THR E O   1 
ATOM   2956 C CB  . THR E  1 23 ? -20.496 -10.130 59.693 1.00 46.69  ? 23  THR E CB  1 
ATOM   2957 O OG1 . THR E  1 23 ? -21.709 -9.784  60.379 1.00 50.51  ? 23  THR E OG1 1 
ATOM   2958 C CG2 . THR E  1 23 ? -19.489 -9.013  59.884 1.00 43.91  ? 23  THR E CG2 1 
ATOM   2959 N N   . GLY E  1 24 ? -22.539 -8.779  57.577 1.00 40.85  ? 24  GLY E N   1 
ATOM   2960 C CA  . GLY E  1 24 ? -23.011 -7.465  57.149 1.00 39.34  ? 24  GLY E CA  1 
ATOM   2961 C C   . GLY E  1 24 ? -23.787 -7.453  55.836 1.00 37.74  ? 24  GLY E C   1 
ATOM   2962 O O   . GLY E  1 24 ? -24.162 -8.502  55.313 1.00 42.54  ? 24  GLY E O   1 
ATOM   2963 N N   . GLY E  1 25 ? -24.058 -6.262  55.321 1.00 34.96  ? 25  GLY E N   1 
ATOM   2964 C CA  . GLY E  1 25 ? -24.930 -6.118  54.169 1.00 36.49  ? 25  GLY E CA  1 
ATOM   2965 C C   . GLY E  1 25 ? -26.051 -5.129  54.446 1.00 38.71  ? 25  GLY E C   1 
ATOM   2966 O O   . GLY E  1 25 ? -26.447 -4.934  55.591 1.00 40.52  ? 25  GLY E O   1 
ATOM   2967 N N   . VAL E  1 26 ? -26.578 -4.529  53.385 1.00 42.48  ? 26  VAL E N   1 
ATOM   2968 C CA  . VAL E  1 26 ? -27.594 -3.493  53.500 1.00 47.21  ? 26  VAL E CA  1 
ATOM   2969 C C   . VAL E  1 26 ? -28.868 -4.034  54.137 1.00 50.42  ? 26  VAL E C   1 
ATOM   2970 O O   . VAL E  1 26 ? -29.683 -3.257  54.639 1.00 55.47  ? 26  VAL E O   1 
ATOM   2971 C CB  . VAL E  1 26 ? -27.944 -2.881  52.130 1.00 51.73  ? 26  VAL E CB  1 
ATOM   2972 C CG1 . VAL E  1 26 ? -26.780 -2.049  51.598 1.00 50.21  ? 26  VAL E CG1 1 
ATOM   2973 C CG2 . VAL E  1 26 ? -28.321 -3.976  51.142 1.00 54.00  ? 26  VAL E CG2 1 
ATOM   2974 N N   . ASN E  1 27 ? -29.037 -5.357  54.098 1.00 47.91  ? 27  ASN E N   1 
ATOM   2975 C CA  . ASN E  1 27 ? -30.171 -6.012  54.773 1.00 48.86  ? 27  ASN E CA  1 
ATOM   2976 C C   . ASN E  1 27 ? -29.924 -6.395  56.233 1.00 47.71  ? 27  ASN E C   1 
ATOM   2977 O O   . ASN E  1 27 ? -30.786 -7.004  56.886 1.00 50.15  ? 27  ASN E O   1 
ATOM   2978 C CB  . ASN E  1 27 ? -30.719 -7.209  53.965 1.00 52.35  ? 27  ASN E CB  1 
ATOM   2979 C CG  . ASN E  1 27 ? -29.653 -8.258  53.613 1.00 49.87  ? 27  ASN E CG  1 
ATOM   2980 O OD1 . ASN E  1 27 ? -28.453 -8.041  53.751 1.00 40.60  ? 27  ASN E OD1 1 
ATOM   2981 N ND2 . ASN E  1 27 ? -30.115 -9.409  53.138 1.00 56.04  ? 27  ASN E ND2 1 
ATOM   2982 N N   . THR E  1 28 ? -28.762 -6.024  56.757 1.00 41.06  ? 28  THR E N   1 
ATOM   2983 C CA  . THR E  1 28 ? -28.463 -6.271  58.167 1.00 38.69  ? 28  THR E CA  1 
ATOM   2984 C C   . THR E  1 28 ? -28.373 -4.967  58.944 1.00 40.80  ? 28  THR E C   1 
ATOM   2985 O O   . THR E  1 28 ? -28.607 -3.892  58.400 1.00 44.82  ? 28  THR E O   1 
ATOM   2986 C CB  . THR E  1 28 ? -27.144 -7.032  58.331 1.00 37.26  ? 28  THR E CB  1 
ATOM   2987 O OG1 . THR E  1 28 ? -26.045 -6.138  58.099 1.00 37.47  ? 28  THR E OG1 1 
ATOM   2988 C CG2 . THR E  1 28 ? -27.073 -8.186  57.322 1.00 37.11  ? 28  THR E CG2 1 
ATOM   2989 N N   . SER E  1 29 ? -28.053 -5.068  60.234 1.00 42.48  ? 29  SER E N   1 
ATOM   2990 C CA  . SER E  1 29 ? -27.848 -3.879  61.049 1.00 46.33  ? 29  SER E CA  1 
ATOM   2991 C C   . SER E  1 29 ? -26.386 -3.733  61.439 1.00 44.54  ? 29  SER E C   1 
ATOM   2992 O O   . SER E  1 29 ? -26.047 -3.064  62.412 1.00 45.42  ? 29  SER E O   1 
ATOM   2993 C CB  . SER E  1 29 ? -28.729 -3.915  62.290 1.00 44.44  ? 29  SER E CB  1 
ATOM   2994 O OG  . SER E  1 29 ? -30.084 -4.147  61.939 1.00 51.36  ? 29  SER E OG  1 
ATOM   2995 N N   . VAL E  1 30 ? -25.521 -4.383  60.677 1.00 39.95  ? 30  VAL E N   1 
ATOM   2996 C CA  . VAL E  1 30 ? -24.097 -4.242  60.870 1.00 38.78  ? 30  VAL E CA  1 
ATOM   2997 C C   . VAL E  1 30 ? -23.716 -2.820  60.479 1.00 44.14  ? 30  VAL E C   1 
ATOM   2998 O O   . VAL E  1 30 ? -24.225 -2.273  59.502 1.00 45.96  ? 30  VAL E O   1 
ATOM   2999 C CB  . VAL E  1 30 ? -23.329 -5.281  60.043 1.00 40.09  ? 30  VAL E CB  1 
ATOM   3000 C CG1 . VAL E  1 30 ? -21.850 -4.972  60.020 1.00 43.84  ? 30  VAL E CG1 1 
ATOM   3001 C CG2 . VAL E  1 30 ? -23.587 -6.677  60.629 1.00 42.34  ? 30  VAL E CG2 1 
ATOM   3002 N N   . ARG E  1 31 ? -22.842 -2.210  61.264 1.00 46.45  ? 31  ARG E N   1 
ATOM   3003 C CA  . ARG E  1 31 ? -22.477 -0.806  61.035 1.00 48.05  ? 31  ARG E CA  1 
ATOM   3004 C C   . ARG E  1 31 ? -22.231 -0.366  59.571 1.00 50.70  ? 31  ARG E C   1 
ATOM   3005 O O   . ARG E  1 31 ? -21.504 -1.017  58.806 1.00 44.98  ? 31  ARG E O   1 
ATOM   3006 C CB  . ARG E  1 31 ? -21.275 -0.445  61.892 1.00 53.55  ? 31  ARG E CB  1 
ATOM   3007 C CG  . ARG E  1 31 ? -19.979 -0.990  61.364 1.00 58.54  ? 31  ARG E CG  1 
ATOM   3008 C CD  . ARG E  1 31 ? -18.824 -0.504  62.210 1.00 65.42  ? 31  ARG E CD  1 
ATOM   3009 N NE  . ARG E  1 31 ? -18.821 -1.209  63.481 1.00 67.20  ? 31  ARG E NE  1 
ATOM   3010 C CZ  . ARG E  1 31 ? -18.431 -2.471  63.612 1.00 69.89  ? 31  ARG E CZ  1 
ATOM   3011 N NH1 . ARG E  1 31 ? -18.009 -3.150  62.547 1.00 66.72  ? 31  ARG E NH1 1 
ATOM   3012 N NH2 . ARG E  1 31 ? -18.462 -3.056  64.804 1.00 72.54  ? 31  ARG E NH2 1 
ATOM   3013 N N   . HIS E  1 32 ? -22.842 0.757   59.203 1.00 52.36  ? 32  HIS E N   1 
ATOM   3014 C CA  . HIS E  1 32 ? -22.698 1.351   57.877 1.00 57.78  ? 32  HIS E CA  1 
ATOM   3015 C C   . HIS E  1 32 ? -23.201 0.430   56.766 1.00 59.68  ? 32  HIS E C   1 
ATOM   3016 O O   . HIS E  1 32 ? -23.055 0.740   55.588 1.00 63.59  ? 32  HIS E O   1 
ATOM   3017 C CB  . HIS E  1 32 ? -21.239 1.759   57.624 1.00 58.55  ? 32  HIS E CB  1 
ATOM   3018 C CG  . HIS E  1 32 ? -20.571 2.373   58.816 1.00 62.94  ? 32  HIS E CG  1 
ATOM   3019 N ND1 . HIS E  1 32 ? -19.364 1.924   59.309 1.00 63.97  ? 32  HIS E ND1 1 
ATOM   3020 C CD2 . HIS E  1 32 ? -20.954 3.384   59.630 1.00 63.79  ? 32  HIS E CD2 1 
ATOM   3021 C CE1 . HIS E  1 32 ? -19.029 2.636   60.371 1.00 62.60  ? 32  HIS E CE1 1 
ATOM   3022 N NE2 . HIS E  1 32 ? -19.978 3.528   60.587 1.00 64.34  ? 32  HIS E NE2 1 
ATOM   3023 N N   . GLY E  1 33 ? -23.819 -0.686  57.151 1.00 48.72  ? 33  GLY E N   1 
ATOM   3024 C CA  . GLY E  1 33 ? -24.231 -1.700  56.191 1.00 48.50  ? 33  GLY E CA  1 
ATOM   3025 C C   . GLY E  1 33 ? -23.045 -2.333  55.486 1.00 47.33  ? 33  GLY E C   1 
ATOM   3026 O O   . GLY E  1 33 ? -23.211 -3.026  54.475 1.00 51.65  ? 33  GLY E O   1 
ATOM   3027 N N   . GLY E  1 34 ? -21.845 -2.086  56.012 1.00 41.64  ? 34  GLY E N   1 
ATOM   3028 C CA  . GLY E  1 34 ? -20.617 -2.632  55.463 1.00 36.76  ? 34  GLY E CA  1 
ATOM   3029 C C   . GLY E  1 34 ? -20.515 -4.159  55.479 1.00 35.25  ? 34  GLY E C   1 
ATOM   3030 O O   . GLY E  1 34 ? -21.287 -4.837  56.165 1.00 35.96  ? 34  GLY E O   1 
ATOM   3031 N N   . ILE E  1 35 ? -19.554 -4.678  54.707 1.00 35.07  ? 35  ILE E N   1 
ATOM   3032 C CA  . ILE E  1 35 ? -19.181 -6.100  54.695 1.00 35.13  ? 35  ILE E CA  1 
ATOM   3033 C C   . ILE E  1 35 ? -17.848 -6.243  55.429 1.00 35.57  ? 35  ILE E C   1 
ATOM   3034 O O   . ILE E  1 35 ? -16.852 -5.622  55.027 1.00 35.71  ? 35  ILE E O   1 
ATOM   3035 C CB  . ILE E  1 35 ? -18.980 -6.618  53.245 1.00 33.58  ? 35  ILE E CB  1 
ATOM   3036 C CG1 . ILE E  1 35 ? -20.233 -6.368  52.400 1.00 35.34  ? 35  ILE E CG1 1 
ATOM   3037 C CG2 . ILE E  1 35 ? -18.606 -8.111  53.227 1.00 34.16  ? 35  ILE E CG2 1 
ATOM   3038 C CD1 . ILE E  1 35 ? -21.492 -6.993  52.981 1.00 36.99  ? 35  ILE E CD1 1 
ATOM   3039 N N   . TYR E  1 36 ? -17.844 -7.022  56.512 1.00 35.11  ? 36  TYR E N   1 
ATOM   3040 C CA  . TYR E  1 36 ? -16.662 -7.218  57.357 1.00 34.38  ? 36  TYR E CA  1 
ATOM   3041 C C   . TYR E  1 36 ? -16.230 -8.676  57.417 1.00 37.65  ? 36  TYR E C   1 
ATOM   3042 O O   . TYR E  1 36 ? -17.044 -9.588  57.246 1.00 38.65  ? 36  TYR E O   1 
ATOM   3043 C CB  . TYR E  1 36 ? -16.919 -6.686  58.771 1.00 35.92  ? 36  TYR E CB  1 
ATOM   3044 C CG  . TYR E  1 36 ? -17.163 -5.193  58.788 1.00 35.12  ? 36  TYR E CG  1 
ATOM   3045 C CD1 . TYR E  1 36 ? -18.425 -4.672  58.525 1.00 38.00  ? 36  TYR E CD1 1 
ATOM   3046 C CD2 . TYR E  1 36 ? -16.133 -4.304  59.046 1.00 37.77  ? 36  TYR E CD2 1 
ATOM   3047 C CE1 . TYR E  1 36 ? -18.658 -3.308  58.532 1.00 38.84  ? 36  TYR E CE1 1 
ATOM   3048 C CE2 . TYR E  1 36 ? -16.357 -2.932  59.070 1.00 38.98  ? 36  TYR E CE2 1 
ATOM   3049 C CZ  . TYR E  1 36 ? -17.620 -2.441  58.808 1.00 38.76  ? 36  TYR E CZ  1 
ATOM   3050 O OH  . TYR E  1 36 ? -17.836 -1.076  58.816 1.00 38.61  ? 36  TYR E OH  1 
ATOM   3051 N N   . VAL E  1 37 ? -14.942 -8.898  57.653 1.00 36.64  ? 37  VAL E N   1 
ATOM   3052 C CA  . VAL E  1 37 ? -14.440 -10.260 57.819 1.00 37.98  ? 37  VAL E CA  1 
ATOM   3053 C C   . VAL E  1 37 ? -14.869 -10.782 59.181 1.00 39.96  ? 37  VAL E C   1 
ATOM   3054 O O   . VAL E  1 37 ? -14.480 -10.233 60.207 1.00 41.63  ? 37  VAL E O   1 
ATOM   3055 C CB  . VAL E  1 37 ? -12.914 -10.302 57.719 1.00 37.05  ? 37  VAL E CB  1 
ATOM   3056 C CG1 . VAL E  1 37 ? -12.394 -11.702 57.990 1.00 41.01  ? 37  VAL E CG1 1 
ATOM   3057 C CG2 . VAL E  1 37 ? -12.451 -9.762  56.350 1.00 33.64  ? 37  VAL E CG2 1 
ATOM   3058 N N   . LYS E  1 38 ? -15.685 -11.833 59.179 1.00 40.35  ? 38  LYS E N   1 
ATOM   3059 C CA  . LYS E  1 38 ? -16.242 -12.390 60.411 1.00 45.14  ? 38  LYS E CA  1 
ATOM   3060 C C   . LYS E  1 38 ? -15.221 -13.313 61.053 1.00 46.60  ? 38  LYS E C   1 
ATOM   3061 O O   . LYS E  1 38 ? -15.022 -13.316 62.278 1.00 49.41  ? 38  LYS E O   1 
ATOM   3062 C CB  . LYS E  1 38 ? -17.515 -13.175 60.076 1.00 48.87  ? 38  LYS E CB  1 
ATOM   3063 C CG  . LYS E  1 38 ? -18.274 -13.742 61.276 1.00 54.30  ? 38  LYS E CG  1 
ATOM   3064 C CD  . LYS E  1 38 ? -19.525 -14.487 60.813 1.00 56.31  ? 38  LYS E CD  1 
ATOM   3065 C CE  . LYS E  1 38 ? -20.387 -14.920 61.997 1.00 63.01  ? 38  LYS E CE  1 
ATOM   3066 N NZ  . LYS E  1 38 ? -21.509 -15.806 61.580 1.00 66.84  ? 38  LYS E NZ  1 
ATOM   3067 N N   . ALA E  1 39 ? -14.588 -14.116 60.210 1.00 46.04  ? 39  ALA E N   1 
ATOM   3068 C CA  . ALA E  1 39 ? -13.575 -15.065 60.639 1.00 50.26  ? 39  ALA E CA  1 
ATOM   3069 C C   . ALA E  1 39 ? -12.635 -15.348 59.481 1.00 49.58  ? 39  ALA E C   1 
ATOM   3070 O O   . ALA E  1 39 ? -13.038 -15.283 58.320 1.00 49.17  ? 39  ALA E O   1 
ATOM   3071 C CB  . ALA E  1 39 ? -14.227 -16.349 61.092 1.00 52.60  ? 39  ALA E CB  1 
ATOM   3072 N N   . VAL E  1 40 ? -11.382 -15.648 59.809 1.00 51.62  ? 40  VAL E N   1 
ATOM   3073 C CA  . VAL E  1 40 ? -10.446 -16.231 58.856 1.00 53.01  ? 40  VAL E CA  1 
ATOM   3074 C C   . VAL E  1 40 ? -10.238 -17.706 59.223 1.00 55.36  ? 40  VAL E C   1 
ATOM   3075 O O   . VAL E  1 40 ? -9.767  -18.030 60.321 1.00 61.88  ? 40  VAL E O   1 
ATOM   3076 C CB  . VAL E  1 40 ? -9.105  -15.461 58.808 1.00 55.25  ? 40  VAL E CB  1 
ATOM   3077 C CG1 . VAL E  1 40 ? -9.361  -13.980 58.555 1.00 51.02  ? 40  VAL E CG1 1 
ATOM   3078 C CG2 . VAL E  1 40 ? -8.319  -15.636 60.087 1.00 56.64  ? 40  VAL E CG2 1 
ATOM   3079 N N   . ILE E  1 41 ? -10.624 -18.593 58.310 1.00 55.69  ? 41  ILE E N   1 
ATOM   3080 C CA  . ILE E  1 41 ? -10.595 -20.035 58.561 1.00 58.61  ? 41  ILE E CA  1 
ATOM   3081 C C   . ILE E  1 41 ? -9.188  -20.565 58.778 1.00 58.76  ? 41  ILE E C   1 
ATOM   3082 O O   . ILE E  1 41 ? -8.318  -20.394 57.920 1.00 58.76  ? 41  ILE E O   1 
ATOM   3083 C CB  . ILE E  1 41 ? -11.178 -20.821 57.371 1.00 58.19  ? 41  ILE E CB  1 
ATOM   3084 C CG1 . ILE E  1 41 ? -12.313 -20.038 56.706 1.00 61.01  ? 41  ILE E CG1 1 
ATOM   3085 C CG2 . ILE E  1 41 ? -11.598 -22.212 57.805 1.00 61.78  ? 41  ILE E CG2 1 
ATOM   3086 C CD1 . ILE E  1 41 ? -13.518 -19.830 57.575 1.00 64.13  ? 41  ILE E CD1 1 
ATOM   3087 N N   . PRO E  1 42 ? -8.968  -21.252 59.907 1.00 59.26  ? 42  PRO E N   1 
ATOM   3088 C CA  . PRO E  1 42 ? -7.671  -21.882 60.171 1.00 59.57  ? 42  PRO E CA  1 
ATOM   3089 C C   . PRO E  1 42 ? -7.133  -22.661 58.971 1.00 60.72  ? 42  PRO E C   1 
ATOM   3090 O O   . PRO E  1 42 ? -7.861  -23.414 58.315 1.00 58.60  ? 42  PRO E O   1 
ATOM   3091 C CB  . PRO E  1 42 ? -7.979  -22.821 61.341 1.00 62.43  ? 42  PRO E CB  1 
ATOM   3092 C CG  . PRO E  1 42 ? -9.084  -22.118 62.072 1.00 62.65  ? 42  PRO E CG  1 
ATOM   3093 C CD  . PRO E  1 42 ? -9.933  -21.496 60.995 1.00 59.75  ? 42  PRO E CD  1 
ATOM   3094 N N   . GLN E  1 43 ? -5.850  -22.455 58.691 1.00 63.25  ? 43  GLN E N   1 
ATOM   3095 C CA  . GLN E  1 43 ? -5.145  -23.137 57.606 1.00 66.25  ? 43  GLN E CA  1 
ATOM   3096 C C   . GLN E  1 43 ? -5.655  -22.769 56.211 1.00 62.55  ? 43  GLN E C   1 
ATOM   3097 O O   . GLN E  1 43 ? -5.267  -23.382 55.223 1.00 65.72  ? 43  GLN E O   1 
ATOM   3098 C CB  . GLN E  1 43 ? -5.156  -24.650 57.822 1.00 74.82  ? 43  GLN E CB  1 
ATOM   3099 C CG  . GLN E  1 43 ? -4.437  -25.072 59.086 1.00 81.44  ? 43  GLN E CG  1 
ATOM   3100 C CD  . GLN E  1 43 ? -4.384  -26.574 59.245 1.00 91.04  ? 43  GLN E CD  1 
ATOM   3101 O OE1 . GLN E  1 43 ? -4.388  -27.312 58.259 1.00 94.15  ? 43  GLN E OE1 1 
ATOM   3102 N NE2 . GLN E  1 43 ? -4.332  -27.039 60.491 1.00 94.79  ? 43  GLN E NE2 1 
ATOM   3103 N N   . GLY E  1 44 ? -6.509  -21.756 56.133 1.00 57.84  ? 44  GLY E N   1 
ATOM   3104 C CA  . GLY E  1 44 ? -7.016  -21.290 54.849 1.00 53.40  ? 44  GLY E CA  1 
ATOM   3105 C C   . GLY E  1 44 ? -6.085  -20.316 54.151 1.00 52.76  ? 44  GLY E C   1 
ATOM   3106 O O   . GLY E  1 44 ? -5.026  -19.953 54.673 1.00 53.08  ? 44  GLY E O   1 
ATOM   3107 N N   . ALA E  1 45 ? -6.494  -19.875 52.967 1.00 50.41  ? 45  ALA E N   1 
ATOM   3108 C CA  . ALA E  1 45 ? -5.687  -18.963 52.163 1.00 49.92  ? 45  ALA E CA  1 
ATOM   3109 C C   . ALA E  1 45 ? -5.398  -17.639 52.866 1.00 46.38  ? 45  ALA E C   1 
ATOM   3110 O O   . ALA E  1 45 ? -4.242  -17.240 52.982 1.00 46.56  ? 45  ALA E O   1 
ATOM   3111 C CB  . ALA E  1 45 ? -6.344  -18.723 50.807 1.00 49.05  ? 45  ALA E CB  1 
ATOM   3112 N N   . ALA E  1 46 ? -6.437  -16.959 53.341 1.00 45.65  ? 46  ALA E N   1 
ATOM   3113 C CA  . ALA E  1 46 ? -6.238  -15.688 54.038 1.00 44.39  ? 46  ALA E CA  1 
ATOM   3114 C C   . ALA E  1 46 ? -5.307  -15.822 55.244 1.00 45.49  ? 46  ALA E C   1 
ATOM   3115 O O   . ALA E  1 46 ? -4.473  -14.947 55.492 1.00 44.25  ? 46  ALA E O   1 
ATOM   3116 C CB  . ALA E  1 46 ? -7.576  -15.070 54.450 1.00 44.14  ? 46  ALA E CB  1 
ATOM   3117 N N   . GLU E  1 47 ? -5.430  -16.915 55.990 1.00 47.88  ? 47  GLU E N   1 
ATOM   3118 C CA  . GLU E  1 47 ? -4.601  -17.095 57.172 1.00 52.52  ? 47  GLU E CA  1 
ATOM   3119 C C   . GLU E  1 47 ? -3.141  -17.342 56.818 1.00 53.61  ? 47  GLU E C   1 
ATOM   3120 O O   . GLU E  1 47 ? -2.244  -16.816 57.474 1.00 55.30  ? 47  GLU E O   1 
ATOM   3121 C CB  . GLU E  1 47 ? -5.123  -18.230 58.055 1.00 59.07  ? 47  GLU E CB  1 
ATOM   3122 C CG  . GLU E  1 47 ? -4.486  -18.249 59.428 1.00 64.46  ? 47  GLU E CG  1 
ATOM   3123 C CD  . GLU E  1 47 ? -4.552  -19.615 60.071 1.00 72.72  ? 47  GLU E CD  1 
ATOM   3124 O OE1 . GLU E  1 47 ? -4.039  -20.577 59.462 1.00 75.83  ? 47  GLU E OE1 1 
ATOM   3125 O OE2 . GLU E  1 47 ? -5.110  -19.728 61.182 1.00 74.63  ? 47  GLU E OE2 1 
ATOM   3126 N N   . SER E  1 48 ? -2.901  -18.154 55.795 1.00 54.87  ? 48  SER E N   1 
ATOM   3127 C CA  . SER E  1 48 ? -1.538  -18.411 55.343 1.00 54.65  ? 48  SER E CA  1 
ATOM   3128 C C   . SER E  1 48 ? -0.904  -17.128 54.853 1.00 50.18  ? 48  SER E C   1 
ATOM   3129 O O   . SER E  1 48 ? 0.273   -16.874 55.095 1.00 50.92  ? 48  SER E O   1 
ATOM   3130 C CB  . SER E  1 48 ? -1.525  -19.433 54.216 1.00 57.87  ? 48  SER E CB  1 
ATOM   3131 O OG  . SER E  1 48 ? -1.968  -20.696 54.677 1.00 63.89  ? 48  SER E OG  1 
ATOM   3132 N N   . ASP E  1 49 ? -1.698  -16.324 54.154 1.00 45.86  ? 49  ASP E N   1 
ATOM   3133 C CA  . ASP E  1 49 ? -1.219  -15.070 53.602 1.00 45.28  ? 49  ASP E CA  1 
ATOM   3134 C C   . ASP E  1 49 ? -0.896  -14.060 54.702 1.00 46.95  ? 49  ASP E C   1 
ATOM   3135 O O   . ASP E  1 49 ? 0.081   -13.316 54.606 1.00 53.26  ? 49  ASP E O   1 
ATOM   3136 C CB  . ASP E  1 49 ? -2.241  -14.502 52.618 1.00 43.86  ? 49  ASP E CB  1 
ATOM   3137 C CG  . ASP E  1 49 ? -1.813  -13.184 52.049 1.00 43.53  ? 49  ASP E CG  1 
ATOM   3138 O OD1 . ASP E  1 49 ? -2.229  -12.156 52.613 1.00 43.26  ? 49  ASP E OD1 1 
ATOM   3139 O OD2 . ASP E  1 49 ? -1.062  -13.185 51.046 1.00 40.64  ? 49  ASP E OD2 1 
ATOM   3140 N N   . GLY E  1 50 ? -1.739  -14.015 55.727 1.00 46.02  ? 50  GLY E N   1 
ATOM   3141 C CA  . GLY E  1 50 ? -1.425  -13.290 56.941 1.00 48.24  ? 50  GLY E CA  1 
ATOM   3142 C C   . GLY E  1 50 ? -1.766  -11.815 56.963 1.00 46.55  ? 50  GLY E C   1 
ATOM   3143 O O   . GLY E  1 50 ? -1.538  -11.144 57.975 1.00 49.07  ? 50  GLY E O   1 
ATOM   3144 N N   . ARG E  1 51 ? -2.320  -11.306 55.866 1.00 42.87  ? 51  ARG E N   1 
ATOM   3145 C CA  . ARG E  1 51 ? -2.598  -9.877  55.754 1.00 40.15  ? 51  ARG E CA  1 
ATOM   3146 C C   . ARG E  1 51 ? -4.016  -9.455  56.136 1.00 40.20  ? 51  ARG E C   1 
ATOM   3147 O O   . ARG E  1 51 ? -4.276  -8.284  56.430 1.00 41.68  ? 51  ARG E O   1 
ATOM   3148 C CB  . ARG E  1 51 ? -2.285  -9.403  54.340 1.00 36.18  ? 51  ARG E CB  1 
ATOM   3149 C CG  . ARG E  1 51 ? -0.805  -9.246  54.073 1.00 38.25  ? 51  ARG E CG  1 
ATOM   3150 C CD  . ARG E  1 51 ? -0.569  -8.770  52.665 1.00 38.08  ? 51  ARG E CD  1 
ATOM   3151 N NE  . ARG E  1 51 ? -0.816  -9.830  51.699 1.00 37.35  ? 51  ARG E NE  1 
ATOM   3152 C CZ  . ARG E  1 51 ? -0.605  -9.706  50.388 1.00 37.36  ? 51  ARG E CZ  1 
ATOM   3153 N NH1 . ARG E  1 51 ? -0.141  -8.573  49.890 1.00 37.08  ? 51  ARG E NH1 1 
ATOM   3154 N NH2 . ARG E  1 51 ? -0.839  -10.730 49.581 1.00 38.97  ? 51  ARG E NH2 1 
ATOM   3155 N N   . ILE E  1 52 ? -4.929  -10.409 56.119 1.00 37.43  ? 52  ILE E N   1 
ATOM   3156 C CA  . ILE E  1 52 ? -6.331  -10.148 56.414 1.00 38.18  ? 52  ILE E CA  1 
ATOM   3157 C C   . ILE E  1 52 ? -6.700  -10.741 57.786 1.00 40.34  ? 52  ILE E C   1 
ATOM   3158 O O   . ILE E  1 52 ? -6.262  -11.843 58.142 1.00 45.23  ? 52  ILE E O   1 
ATOM   3159 C CB  . ILE E  1 52 ? -7.229  -10.756 55.300 1.00 40.05  ? 52  ILE E CB  1 
ATOM   3160 C CG1 . ILE E  1 52 ? -6.987  -10.037 53.971 1.00 38.52  ? 52  ILE E CG1 1 
ATOM   3161 C CG2 . ILE E  1 52 ? -8.698  -10.708 55.686 1.00 42.32  ? 52  ILE E CG2 1 
ATOM   3162 C CD1 . ILE E  1 52 ? -7.681  -10.716 52.775 1.00 36.28  ? 52  ILE E CD1 1 
ATOM   3163 N N   . HIS E  1 53 ? -7.481  -9.995  58.564 1.00 38.09  ? 53  HIS E N   1 
ATOM   3164 C CA  . HIS E  1 53 ? -7.886  -10.454 59.899 1.00 41.32  ? 53  HIS E CA  1 
ATOM   3165 C C   . HIS E  1 53 ? -9.348  -10.122 60.188 1.00 40.47  ? 53  HIS E C   1 
ATOM   3166 O O   . HIS E  1 53 ? -9.918  -9.206  59.573 1.00 40.07  ? 53  HIS E O   1 
ATOM   3167 C CB  . HIS E  1 53 ? -7.007  -9.809  60.968 1.00 46.23  ? 53  HIS E CB  1 
ATOM   3168 C CG  . HIS E  1 53 ? -5.552  -10.129 60.831 1.00 50.97  ? 53  HIS E CG  1 
ATOM   3169 N ND1 . HIS E  1 53 ? -4.669  -9.302  60.168 1.00 55.20  ? 53  HIS E ND1 1 
ATOM   3170 C CD2 . HIS E  1 53 ? -4.825  -11.182 61.272 1.00 56.20  ? 53  HIS E CD2 1 
ATOM   3171 C CE1 . HIS E  1 53 ? -3.461  -9.834  60.208 1.00 57.79  ? 53  HIS E CE1 1 
ATOM   3172 N NE2 . HIS E  1 53 ? -3.528  -10.973 60.875 1.00 58.06  ? 53  HIS E NE2 1 
ATOM   3173 N N   . LYS E  1 54 ? -9.944  -10.870 61.119 1.00 43.45  ? 54  LYS E N   1 
ATOM   3174 C CA  . LYS E  1 54 ? -11.286 -10.560 61.607 1.00 42.00  ? 54  LYS E CA  1 
ATOM   3175 C C   . LYS E  1 54 ? -11.444 -9.052  61.867 1.00 39.83  ? 54  LYS E C   1 
ATOM   3176 O O   . LYS E  1 54 ? -10.569 -8.426  62.470 1.00 40.30  ? 54  LYS E O   1 
ATOM   3177 C CB  . LYS E  1 54 ? -11.584 -11.365 62.877 1.00 43.89  ? 54  LYS E CB  1 
ATOM   3178 C CG  . LYS E  1 54 ? -12.904 -11.030 63.522 1.00 46.39  ? 54  LYS E CG  1 
ATOM   3179 C CD  . LYS E  1 54 ? -13.199 -11.998 64.672 1.00 51.31  ? 54  LYS E CD  1 
ATOM   3180 C CE  . LYS E  1 54 ? -14.251 -11.430 65.606 1.00 54.73  ? 54  LYS E CE  1 
ATOM   3181 N NZ  . LYS E  1 54 ? -14.502 -12.358 66.748 1.00 58.35  ? 54  LYS E NZ  1 
ATOM   3182 N N   . GLY E  1 55 ? -12.551 -8.469  61.412 1.00 37.14  ? 55  GLY E N   1 
ATOM   3183 C CA  . GLY E  1 55 ? -12.807 -7.043  61.605 1.00 34.96  ? 55  GLY E CA  1 
ATOM   3184 C C   . GLY E  1 55 ? -12.411 -6.098  60.458 1.00 34.15  ? 55  GLY E C   1 
ATOM   3185 O O   . GLY E  1 55 ? -12.864 -4.948  60.392 1.00 36.36  ? 55  GLY E O   1 
ATOM   3186 N N   . ASP E  1 56 ? -11.531 -6.564  59.578 1.00 35.93  ? 56  ASP E N   1 
ATOM   3187 C CA  . ASP E  1 56 ? -11.195 -5.822  58.371 1.00 33.08  ? 56  ASP E CA  1 
ATOM   3188 C C   . ASP E  1 56 ? -12.460 -5.637  57.537 1.00 36.58  ? 56  ASP E C   1 
ATOM   3189 O O   . ASP E  1 56 ? -13.338 -6.499  57.538 1.00 36.99  ? 56  ASP E O   1 
ATOM   3190 C CB  . ASP E  1 56 ? -10.149 -6.576  57.550 1.00 35.93  ? 56  ASP E CB  1 
ATOM   3191 C CG  . ASP E  1 56 ? -8.774  -6.529  58.173 1.00 37.41  ? 56  ASP E CG  1 
ATOM   3192 O OD1 . ASP E  1 56 ? -7.869  -7.240  57.690 1.00 38.36  ? 56  ASP E OD1 1 
ATOM   3193 O OD2 . ASP E  1 56 ? -8.589  -5.768  59.140 1.00 38.46  ? 56  ASP E OD2 1 
ATOM   3194 N N   . ARG E  1 57 ? -12.574 -4.499  56.856 1.00 34.29  ? 57  ARG E N   1 
ATOM   3195 C CA  . ARG E  1 57 ? -13.726 -4.271  56.001 1.00 35.33  ? 57  ARG E CA  1 
ATOM   3196 C C   . ARG E  1 57 ? -13.356 -4.616  54.565 1.00 32.13  ? 57  ARG E C   1 
ATOM   3197 O O   . ARG E  1 57 ? -12.275 -4.260  54.108 1.00 30.07  ? 57  ARG E O   1 
ATOM   3198 C CB  . ARG E  1 57 ? -14.178 -2.809  56.079 1.00 33.89  ? 57  ARG E CB  1 
ATOM   3199 C CG  . ARG E  1 57 ? -15.434 -2.524  55.260 1.00 35.48  ? 57  ARG E CG  1 
ATOM   3200 C CD  . ARG E  1 57 ? -15.967 -1.135  55.540 1.00 35.04  ? 57  ARG E CD  1 
ATOM   3201 N NE  . ARG E  1 57 ? -17.212 -0.836  54.835 1.00 37.26  ? 57  ARG E NE  1 
ATOM   3202 C CZ  . ARG E  1 57 ? -17.960 0.239   55.092 1.00 41.42  ? 57  ARG E CZ  1 
ATOM   3203 N NH1 . ARG E  1 57 ? -17.594 1.081   56.047 1.00 40.31  ? 57  ARG E NH1 1 
ATOM   3204 N NH2 . ARG E  1 57 ? -19.084 0.466   54.425 1.00 42.74  ? 57  ARG E NH2 1 
ATOM   3205 N N   . VAL E  1 58 ? -14.240 -5.325  53.866 1.00 29.01  ? 58  VAL E N   1 
ATOM   3206 C CA  . VAL E  1 58 ? -14.039 -5.616  52.435 1.00 27.47  ? 58  VAL E CA  1 
ATOM   3207 C C   . VAL E  1 58 ? -14.729 -4.509  51.633 1.00 29.22  ? 58  VAL E C   1 
ATOM   3208 O O   . VAL E  1 58 ? -15.956 -4.400  51.652 1.00 30.02  ? 58  VAL E O   1 
ATOM   3209 C CB  . VAL E  1 58 ? -14.611 -7.001  52.039 1.00 30.51  ? 58  VAL E CB  1 
ATOM   3210 C CG1 . VAL E  1 58 ? -14.300 -7.320  50.578 1.00 31.46  ? 58  VAL E CG1 1 
ATOM   3211 C CG2 . VAL E  1 58 ? -14.066 -8.093  52.967 1.00 35.77  ? 58  VAL E CG2 1 
ATOM   3212 N N   . LEU E  1 59 ? -13.934 -3.658  50.986 1.00 25.57  ? 59  LEU E N   1 
ATOM   3213 C CA  . LEU E  1 59 ? -14.470 -2.523  50.236 1.00 25.55  ? 59  LEU E CA  1 
ATOM   3214 C C   . LEU E  1 59 ? -14.873 -2.908  48.816 1.00 26.99  ? 59  LEU E C   1 
ATOM   3215 O O   . LEU E  1 59 ? -15.855 -2.393  48.291 1.00 26.70  ? 59  LEU E O   1 
ATOM   3216 C CB  . LEU E  1 59 ? -13.433 -1.389  50.161 1.00 24.97  ? 59  LEU E CB  1 
ATOM   3217 C CG  . LEU E  1 59 ? -13.046 -0.863  51.549 1.00 27.65  ? 59  LEU E CG  1 
ATOM   3218 C CD1 . LEU E  1 59 ? -11.940 0.168   51.444 1.00 30.32  ? 59  LEU E CD1 1 
ATOM   3219 C CD2 . LEU E  1 59 ? -14.263 -0.244  52.225 1.00 30.24  ? 59  LEU E CD2 1 
ATOM   3220 N N   . ALA E  1 60 ? -14.102 -3.801  48.194 1.00 26.43  ? 60  ALA E N   1 
ATOM   3221 C CA  . ALA E  1 60 ? -14.301 -4.139  46.779 1.00 24.11  ? 60  ALA E CA  1 
ATOM   3222 C C   . ALA E  1 60 ? -13.690 -5.483  46.448 1.00 24.55  ? 60  ALA E C   1 
ATOM   3223 O O   . ALA E  1 60 ? -12.788 -5.961  47.143 1.00 24.98  ? 60  ALA E O   1 
ATOM   3224 C CB  . ALA E  1 60 ? -13.728 -3.061  45.851 1.00 23.20  ? 60  ALA E CB  1 
ATOM   3225 N N   . VAL E  1 61 ? -14.211 -6.089  45.394 1.00 23.74  ? 61  VAL E N   1 
ATOM   3226 C CA  . VAL E  1 61 ? -13.709 -7.365  44.905 1.00 26.59  ? 61  VAL E CA  1 
ATOM   3227 C C   . VAL E  1 61 ? -13.485 -7.190  43.410 1.00 24.15  ? 61  VAL E C   1 
ATOM   3228 O O   . VAL E  1 61 ? -14.422 -6.813  42.672 1.00 25.97  ? 61  VAL E O   1 
ATOM   3229 C CB  . VAL E  1 61 ? -14.727 -8.510  45.141 1.00 27.45  ? 61  VAL E CB  1 
ATOM   3230 C CG1 . VAL E  1 61 ? -14.179 -9.819  44.579 1.00 26.26  ? 61  VAL E CG1 1 
ATOM   3231 C CG2 . VAL E  1 61 ? -15.073 -8.650  46.613 1.00 29.24  ? 61  VAL E CG2 1 
ATOM   3232 N N   . ASN E  1 62 ? -12.259 -7.448  42.942 1.00 23.70  ? 62  ASN E N   1 
ATOM   3233 C CA  . ASN E  1 62 ? -11.943 -7.359  41.508 1.00 21.12  ? 62  ASN E CA  1 
ATOM   3234 C C   . ASN E  1 62 ? -12.431 -6.059  40.892 1.00 24.06  ? 62  ASN E C   1 
ATOM   3235 O O   . ASN E  1 62 ? -12.996 -6.035  39.796 1.00 24.34  ? 62  ASN E O   1 
ATOM   3236 C CB  . ASN E  1 62 ? -12.509 -8.580  40.763 1.00 22.87  ? 62  ASN E CB  1 
ATOM   3237 C CG  . ASN E  1 62 ? -11.741 -9.822  41.070 1.00 26.13  ? 62  ASN E CG  1 
ATOM   3238 O OD1 . ASN E  1 62 ? -10.635 -9.754  41.603 1.00 28.24  ? 62  ASN E OD1 1 
ATOM   3239 N ND2 . ASN E  1 62 ? -12.291 -10.970 40.708 1.00 27.34  ? 62  ASN E ND2 1 
ATOM   3240 N N   . GLY E  1 63 ? -12.215 -4.969  41.616 1.00 22.66  ? 63  GLY E N   1 
ATOM   3241 C CA  . GLY E  1 63 ? -12.473 -3.647  41.071 1.00 22.28  ? 63  GLY E CA  1 
ATOM   3242 C C   . GLY E  1 63 ? -13.860 -3.086  41.276 1.00 22.94  ? 63  GLY E C   1 
ATOM   3243 O O   . GLY E  1 63 ? -14.113 -1.945  40.862 1.00 23.66  ? 63  GLY E O   1 
ATOM   3244 N N   . VAL E  1 64 ? -14.750 -3.883  41.844 1.00 23.28  ? 64  VAL E N   1 
ATOM   3245 C CA  . VAL E  1 64 ? -16.144 -3.500  42.039 1.00 24.00  ? 64  VAL E CA  1 
ATOM   3246 C C   . VAL E  1 64 ? -16.499 -3.325  43.500 1.00 27.69  ? 64  VAL E C   1 
ATOM   3247 O O   . VAL E  1 64 ? -16.316 -4.241  44.299 1.00 27.07  ? 64  VAL E O   1 
ATOM   3248 C CB  . VAL E  1 64 ? -17.083 -4.530  41.395 1.00 26.88  ? 64  VAL E CB  1 
ATOM   3249 C CG1 . VAL E  1 64 ? -18.533 -4.084  41.543 1.00 31.06  ? 64  VAL E CG1 1 
ATOM   3250 C CG2 . VAL E  1 64 ? -16.717 -4.677  39.931 1.00 27.99  ? 64  VAL E CG2 1 
ATOM   3251 N N   . SER E  1 65 ? -17.043 -2.157  43.834 1.00 25.39  ? 65  SER E N   1 
ATOM   3252 C CA  . SER E  1 65 ? -17.441 -1.855  45.211 1.00 27.21  ? 65  SER E CA  1 
ATOM   3253 C C   . SER E  1 65 ? -18.540 -2.780  45.680 1.00 29.86  ? 65  SER E C   1 
ATOM   3254 O O   . SER E  1 65 ? -19.401 -3.213  44.907 1.00 30.83  ? 65  SER E O   1 
ATOM   3255 C CB  . SER E  1 65 ? -17.892 -0.395  45.357 1.00 25.92  ? 65  SER E CB  1 
ATOM   3256 O OG  . SER E  1 65 ? -18.498 -0.210  46.638 1.00 31.11  ? 65  SER E OG  1 
ATOM   3257 N N   . LEU E  1 66 ? -18.500 -3.079  46.966 1.00 30.94  ? 66  LEU E N   1 
ATOM   3258 C CA  . LEU E  1 66 ? -19.545 -3.864  47.578 1.00 33.32  ? 66  LEU E CA  1 
ATOM   3259 C C   . LEU E  1 66 ? -20.652 -2.972  48.121 1.00 38.13  ? 66  LEU E C   1 
ATOM   3260 O O   . LEU E  1 66 ? -21.568 -3.460  48.785 1.00 41.06  ? 66  LEU E O   1 
ATOM   3261 C CB  . LEU E  1 66 ? -18.961 -4.734  48.679 1.00 31.96  ? 66  LEU E CB  1 
ATOM   3262 C CG  . LEU E  1 66 ? -18.093 -5.895  48.199 1.00 34.32  ? 66  LEU E CG  1 
ATOM   3263 C CD1 . LEU E  1 66 ? -17.669 -6.725  49.404 1.00 33.75  ? 66  LEU E CD1 1 
ATOM   3264 C CD2 . LEU E  1 66 ? -18.863 -6.766  47.202 1.00 38.69  ? 66  LEU E CD2 1 
ATOM   3265 N N   . GLU E  1 67 ? -20.582 -1.675  47.824 1.00 37.18  ? 67  GLU E N   1 
ATOM   3266 C CA  . GLU E  1 67 ? -21.617 -0.752  48.287 1.00 41.04  ? 67  GLU E CA  1 
ATOM   3267 C C   . GLU E  1 67 ? -22.996 -1.170  47.868 1.00 40.32  ? 67  GLU E C   1 
ATOM   3268 O O   . GLU E  1 67 ? -23.248 -1.369  46.681 1.00 39.21  ? 67  GLU E O   1 
ATOM   3269 C CB  . GLU E  1 67 ? -21.398 0.677   47.799 1.00 45.78  ? 67  GLU E CB  1 
ATOM   3270 C CG  . GLU E  1 67 ? -22.595 1.563   48.155 1.00 52.30  ? 67  GLU E CG  1 
ATOM   3271 C CD  . GLU E  1 67 ? -22.259 3.037   48.191 1.00 56.79  ? 67  GLU E CD  1 
ATOM   3272 O OE1 . GLU E  1 67 ? -21.065 3.367   48.070 1.00 56.91  ? 67  GLU E OE1 1 
ATOM   3273 O OE2 . GLU E  1 67 ? -23.188 3.862   48.354 1.00 59.26  ? 67  GLU E OE2 1 
ATOM   3274 N N   . GLY E  1 68 ? -23.889 -1.279  48.856 1.00 42.82  ? 68  GLY E N   1 
ATOM   3275 C CA  . GLY E  1 68 ? -25.273 -1.619  48.607 1.00 42.21  ? 68  GLY E CA  1 
ATOM   3276 C C   . GLY E  1 68 ? -25.555 -3.104  48.494 1.00 43.54  ? 68  GLY E C   1 
ATOM   3277 O O   . GLY E  1 68 ? -26.697 -3.488  48.259 1.00 46.23  ? 68  GLY E O   1 
ATOM   3278 N N   . ALA E  1 69 ? -24.534 -3.944  48.643 1.00 37.85  ? 69  ALA E N   1 
ATOM   3279 C CA  . ALA E  1 69 ? -24.737 -5.382  48.539 1.00 40.62  ? 69  ALA E CA  1 
ATOM   3280 C C   . ALA E  1 69 ? -25.490 -5.883  49.760 1.00 42.12  ? 69  ALA E C   1 
ATOM   3281 O O   . ALA E  1 69 ? -25.206 -5.468  50.877 1.00 41.33  ? 69  ALA E O   1 
ATOM   3282 C CB  . ALA E  1 69 ? -23.414 -6.110  48.419 1.00 42.10  ? 69  ALA E CB  1 
ATOM   3283 N N   . THR E  1 70 ? -26.456 -6.760  49.527 1.00 47.08  ? 70  THR E N   1 
ATOM   3284 C CA  . THR E  1 70 ? -27.062 -7.512  50.607 1.00 47.54  ? 70  THR E CA  1 
ATOM   3285 C C   . THR E  1 70 ? -26.047 -8.567  50.999 1.00 46.38  ? 70  THR E C   1 
ATOM   3286 O O   . THR E  1 70 ? -25.073 -8.793  50.282 1.00 46.21  ? 70  THR E O   1 
ATOM   3287 C CB  . THR E  1 70 ? -28.337 -8.208  50.142 1.00 51.95  ? 70  THR E CB  1 
ATOM   3288 O OG1 . THR E  1 70 ? -28.000 -9.251  49.220 1.00 53.20  ? 70  THR E OG1 1 
ATOM   3289 C CG2 . THR E  1 70 ? -29.253 -7.210  49.456 1.00 53.70  ? 70  THR E CG2 1 
ATOM   3290 N N   . HIS E  1 71 ? -26.257 -9.207  52.140 1.00 46.12  ? 71  HIS E N   1 
ATOM   3291 C CA  . HIS E  1 71 ? -25.314 -10.217 52.596 1.00 44.24  ? 71  HIS E CA  1 
ATOM   3292 C C   . HIS E  1 71 ? -25.092 -11.316 51.554 1.00 46.40  ? 71  HIS E C   1 
ATOM   3293 O O   . HIS E  1 71 ? -23.955 -11.699 51.270 1.00 46.06  ? 71  HIS E O   1 
ATOM   3294 C CB  . HIS E  1 71 ? -25.764 -10.823 53.925 1.00 46.01  ? 71  HIS E CB  1 
ATOM   3295 C CG  . HIS E  1 71 ? -24.748 -11.737 54.532 1.00 45.63  ? 71  HIS E CG  1 
ATOM   3296 N ND1 . HIS E  1 71 ? -24.780 -13.104 54.362 1.00 51.22  ? 71  HIS E ND1 1 
ATOM   3297 C CD2 . HIS E  1 71 ? -23.651 -11.474 55.282 1.00 41.66  ? 71  HIS E CD2 1 
ATOM   3298 C CE1 . HIS E  1 71 ? -23.759 -13.649 54.998 1.00 51.95  ? 71  HIS E CE1 1 
ATOM   3299 N NE2 . HIS E  1 71 ? -23.054 -12.681 55.556 1.00 49.27  ? 71  HIS E NE2 1 
ATOM   3300 N N   . LYS E  1 72 ? -26.174 -11.816 50.976 1.00 48.08  ? 72  LYS E N   1 
ATOM   3301 C CA  . LYS E  1 72 ? -26.056 -12.930 50.043 1.00 54.62  ? 72  LYS E CA  1 
ATOM   3302 C C   . LYS E  1 72 ? -25.319 -12.506 48.775 1.00 51.60  ? 72  LYS E C   1 
ATOM   3303 O O   . LYS E  1 72 ? -24.559 -13.282 48.201 1.00 51.59  ? 72  LYS E O   1 
ATOM   3304 C CB  . LYS E  1 72 ? -27.427 -13.534 49.727 1.00 61.15  ? 72  LYS E CB  1 
ATOM   3305 C CG  . LYS E  1 72 ? -28.010 -14.377 50.862 1.00 68.97  ? 72  LYS E CG  1 
ATOM   3306 C CD  . LYS E  1 72 ? -27.184 -15.644 51.104 1.00 72.30  ? 72  LYS E CD  1 
ATOM   3307 C CE  . LYS E  1 72 ? -26.301 -15.526 52.343 1.00 72.16  ? 72  LYS E CE  1 
ATOM   3308 N NZ  . LYS E  1 72 ? -25.265 -16.602 52.376 1.00 72.41  ? 72  LYS E NZ  1 
ATOM   3309 N N   . GLN E  1 73 ? -25.521 -11.262 48.359 1.00 51.29  ? 73  GLN E N   1 
ATOM   3310 C CA  . GLN E  1 73 ? -24.828 -10.743 47.183 1.00 49.92  ? 73  GLN E CA  1 
ATOM   3311 C C   . GLN E  1 73 ? -23.335 -10.609 47.420 1.00 47.54  ? 73  GLN E C   1 
ATOM   3312 O O   . GLN E  1 73 ? -22.530 -10.926 46.546 1.00 45.00  ? 73  GLN E O   1 
ATOM   3313 C CB  . GLN E  1 73 ? -25.397 -9.392  46.772 1.00 52.81  ? 73  GLN E CB  1 
ATOM   3314 C CG  . GLN E  1 73 ? -26.851 -9.454  46.384 1.00 57.33  ? 73  GLN E CG  1 
ATOM   3315 C CD  . GLN E  1 73 ? -27.390 -8.101  46.009 1.00 59.55  ? 73  GLN E CD  1 
ATOM   3316 O OE1 . GLN E  1 73 ? -26.994 -7.082  46.575 1.00 56.85  ? 73  GLN E OE1 1 
ATOM   3317 N NE2 . GLN E  1 73 ? -28.295 -8.078  45.039 1.00 63.93  ? 73  GLN E NE2 1 
ATOM   3318 N N   . ALA E  1 74 ? -22.957 -10.115 48.594 1.00 42.93  ? 74  ALA E N   1 
ATOM   3319 C CA  . ALA E  1 74 ? -21.541 -10.024 48.920 1.00 42.70  ? 74  ALA E CA  1 
ATOM   3320 C C   . ALA E  1 74 ? -20.896 -11.414 48.869 1.00 43.79  ? 74  ALA E C   1 
ATOM   3321 O O   . ALA E  1 74 ? -19.842 -11.590 48.254 1.00 43.36  ? 74  ALA E O   1 
ATOM   3322 C CB  . ALA E  1 74 ? -21.340 -9.367  50.282 1.00 41.34  ? 74  ALA E CB  1 
ATOM   3323 N N   . VAL E  1 75 ? -21.544 -12.402 49.486 1.00 44.69  ? 75  VAL E N   1 
ATOM   3324 C CA  . VAL E  1 75 ? -21.024 -13.769 49.513 1.00 43.72  ? 75  VAL E CA  1 
ATOM   3325 C C   . VAL E  1 75 ? -20.872 -14.305 48.101 1.00 47.15  ? 75  VAL E C   1 
ATOM   3326 O O   . VAL E  1 75 ? -19.847 -14.894 47.741 1.00 47.72  ? 75  VAL E O   1 
ATOM   3327 C CB  . VAL E  1 75 ? -21.945 -14.718 50.307 1.00 45.80  ? 75  VAL E CB  1 
ATOM   3328 C CG1 . VAL E  1 75 ? -21.501 -16.174 50.136 1.00 48.87  ? 75  VAL E CG1 1 
ATOM   3329 C CG2 . VAL E  1 75 ? -21.991 -14.318 51.792 1.00 45.44  ? 75  VAL E CG2 1 
ATOM   3330 N N   . GLU E  1 76 ? -21.897 -14.092 47.289 1.00 47.65  ? 76  GLU E N   1 
ATOM   3331 C CA  . GLU E  1 76 ? -21.858 -14.551 45.909 1.00 50.00  ? 76  GLU E CA  1 
ATOM   3332 C C   . GLU E  1 76 ? -20.782 -13.828 45.089 1.00 46.37  ? 76  GLU E C   1 
ATOM   3333 O O   . GLU E  1 76 ? -20.113 -14.446 44.255 1.00 45.51  ? 76  GLU E O   1 
ATOM   3334 C CB  . GLU E  1 76 ? -23.235 -14.405 45.271 1.00 56.75  ? 76  GLU E CB  1 
ATOM   3335 C CG  . GLU E  1 76 ? -24.263 -15.347 45.873 1.00 65.52  ? 76  GLU E CG  1 
ATOM   3336 C CD  . GLU E  1 76 ? -23.869 -16.811 45.712 1.00 72.99  ? 76  GLU E CD  1 
ATOM   3337 O OE1 . GLU E  1 76 ? -24.138 -17.613 46.636 1.00 76.03  ? 76  GLU E OE1 1 
ATOM   3338 O OE2 . GLU E  1 76 ? -23.281 -17.157 44.662 1.00 74.07  ? 76  GLU E OE2 1 
ATOM   3339 N N   . THR E  1 77 ? -20.602 -12.532 45.345 1.00 41.07  ? 77  THR E N   1 
ATOM   3340 C CA  . THR E  1 77 ? -19.583 -11.757 44.651 1.00 39.08  ? 77  THR E CA  1 
ATOM   3341 C C   . THR E  1 77 ? -18.197 -12.315 44.953 1.00 40.39  ? 77  THR E C   1 
ATOM   3342 O O   . THR E  1 77 ? -17.335 -12.384 44.068 1.00 38.94  ? 77  THR E O   1 
ATOM   3343 C CB  . THR E  1 77 ? -19.651 -10.256 45.003 1.00 38.48  ? 77  THR E CB  1 
ATOM   3344 O OG1 . THR E  1 77 ? -20.858 -9.697  44.468 1.00 42.04  ? 77  THR E OG1 1 
ATOM   3345 C CG2 . THR E  1 77 ? -18.457 -9.495  44.420 1.00 34.38  ? 77  THR E CG2 1 
ATOM   3346 N N   . LEU E  1 78 ? -17.985 -12.700 46.207 1.00 40.27  ? 78  LEU E N   1 
ATOM   3347 C CA  . LEU E  1 78 ? -16.731 -13.335 46.599 1.00 39.18  ? 78  LEU E CA  1 
ATOM   3348 C C   . LEU E  1 78 ? -16.540 -14.685 45.920 1.00 42.01  ? 78  LEU E C   1 
ATOM   3349 O O   . LEU E  1 78 ? -15.437 -15.020 45.477 1.00 43.29  ? 78  LEU E O   1 
ATOM   3350 C CB  . LEU E  1 78 ? -16.668 -13.495 48.118 1.00 37.69  ? 78  LEU E CB  1 
ATOM   3351 C CG  . LEU E  1 78 ? -16.436 -12.186 48.864 1.00 37.53  ? 78  LEU E CG  1 
ATOM   3352 C CD1 . LEU E  1 78 ? -16.702 -12.384 50.349 1.00 41.56  ? 78  LEU E CD1 1 
ATOM   3353 C CD2 . LEU E  1 78 ? -15.031 -11.689 48.611 1.00 34.17  ? 78  LEU E CD2 1 
ATOM   3354 N N   . ARG E  1 79 ? -17.617 -15.456 45.829 1.00 42.87  ? 79  ARG E N   1 
ATOM   3355 C CA  . ARG E  1 79 ? -17.528 -16.814 45.300 1.00 48.44  ? 79  ARG E CA  1 
ATOM   3356 C C   . ARG E  1 79 ? -17.363 -16.813 43.785 1.00 48.01  ? 79  ARG E C   1 
ATOM   3357 O O   . ARG E  1 79 ? -16.709 -17.694 43.226 1.00 45.84  ? 79  ARG E O   1 
ATOM   3358 C CB  . ARG E  1 79 ? -18.760 -17.628 45.702 1.00 56.10  ? 79  ARG E CB  1 
ATOM   3359 C CG  . ARG E  1 79 ? -18.481 -19.115 45.864 1.00 64.68  ? 79  ARG E CG  1 
ATOM   3360 C CD  . ARG E  1 79 ? -19.762 -19.941 45.939 1.00 73.18  ? 79  ARG E CD  1 
ATOM   3361 N NE  . ARG E  1 79 ? -20.745 -19.398 46.874 1.00 78.64  ? 79  ARG E NE  1 
ATOM   3362 C CZ  . ARG E  1 79 ? -20.722 -19.597 48.188 1.00 83.03  ? 79  ARG E CZ  1 
ATOM   3363 N NH1 . ARG E  1 79 ? -19.753 -20.317 48.735 1.00 85.94  ? 79  ARG E NH1 1 
ATOM   3364 N NH2 . ARG E  1 79 ? -21.665 -19.072 48.959 1.00 82.74  ? 79  ARG E NH2 1 
ATOM   3365 N N   . ASN E  1 80 ? -17.949 -15.814 43.129 1.00 47.58  ? 80  ASN E N   1 
ATOM   3366 C CA  . ASN E  1 80 ? -17.999 -15.766 41.671 1.00 49.33  ? 80  ASN E CA  1 
ATOM   3367 C C   . ASN E  1 80 ? -16.764 -15.087 41.063 1.00 43.85  ? 80  ASN E C   1 
ATOM   3368 O O   . ASN E  1 80 ? -16.859 -14.045 40.421 1.00 44.19  ? 80  ASN E O   1 
ATOM   3369 C CB  . ASN E  1 80 ? -19.297 -15.097 41.207 1.00 53.77  ? 80  ASN E CB  1 
ATOM   3370 C CG  . ASN E  1 80 ? -20.506 -16.004 41.380 1.00 63.15  ? 80  ASN E CG  1 
ATOM   3371 O OD1 . ASN E  1 80 ? -20.407 -17.224 41.221 1.00 67.39  ? 80  ASN E OD1 1 
ATOM   3372 N ND2 . ASN E  1 80 ? -21.653 -15.415 41.711 1.00 66.67  ? 80  ASN E ND2 1 
ATOM   3373 N N   . THR E  1 81 ? -15.615 -15.713 41.301 1.00 41.32  ? 81  THR E N   1 
ATOM   3374 C CA  . THR E  1 81 ? -14.301 -15.162 41.012 1.00 36.15  ? 81  THR E CA  1 
ATOM   3375 C C   . THR E  1 81 ? -13.416 -16.318 40.561 1.00 38.13  ? 81  THR E C   1 
ATOM   3376 O O   . THR E  1 81 ? -13.834 -17.497 40.595 1.00 40.06  ? 81  THR E O   1 
ATOM   3377 C CB  . THR E  1 81 ? -13.672 -14.535 42.277 1.00 36.87  ? 81  THR E CB  1 
ATOM   3378 O OG1 . THR E  1 81 ? -13.693 -15.494 43.347 1.00 39.53  ? 81  THR E OG1 1 
ATOM   3379 C CG2 . THR E  1 81 ? -14.421 -13.263 42.727 1.00 33.37  ? 81  THR E CG2 1 
ATOM   3380 N N   . GLY E  1 82 ? -12.203 -15.990 40.116 1.00 36.38  ? 82  GLY E N   1 
ATOM   3381 C CA  . GLY E  1 82 ? -11.221 -16.987 39.737 1.00 35.67  ? 82  GLY E CA  1 
ATOM   3382 C C   . GLY E  1 82 ? -10.309 -17.404 40.875 1.00 34.60  ? 82  GLY E C   1 
ATOM   3383 O O   . GLY E  1 82 ? -10.574 -17.093 42.046 1.00 36.78  ? 82  GLY E O   1 
ATOM   3384 N N   . GLN E  1 83 ? -9.231  -18.104 40.521 1.00 34.79  ? 83  GLN E N   1 
ATOM   3385 C CA  . GLN E  1 83 ? -8.306  -18.705 41.481 1.00 39.05  ? 83  GLN E CA  1 
ATOM   3386 C C   . GLN E  1 83 ? -7.505  -17.667 42.264 1.00 36.02  ? 83  GLN E C   1 
ATOM   3387 O O   . GLN E  1 83 ? -7.142  -17.888 43.420 1.00 37.89  ? 83  GLN E O   1 
ATOM   3388 C CB  . GLN E  1 83 ? -7.399  -19.708 40.747 1.00 43.09  ? 83  GLN E CB  1 
ATOM   3389 C CG  . GLN E  1 83 ? -6.169  -20.234 41.492 1.00 44.47  ? 83  GLN E CG  1 
ATOM   3390 C CD  . GLN E  1 83 ? -6.453  -20.828 42.885 1.00 48.31  ? 83  GLN E CD  1 
ATOM   3391 O OE1 . GLN E  1 83 ? -7.544  -21.350 43.178 1.00 46.95  ? 83  GLN E OE1 1 
ATOM   3392 N NE2 . GLN E  1 83 ? -5.441  -20.770 43.741 1.00 48.09  ? 83  GLN E NE2 1 
ATOM   3393 N N   . VAL E  1 84 ? -7.246  -16.529 41.626 1.00 34.48  ? 84  VAL E N   1 
ATOM   3394 C CA  . VAL E  1 84 ? -6.674  -15.373 42.323 1.00 33.64  ? 84  VAL E CA  1 
ATOM   3395 C C   . VAL E  1 84 ? -7.652  -14.207 42.299 1.00 32.86  ? 84  VAL E C   1 
ATOM   3396 O O   . VAL E  1 84 ? -8.240  -13.903 41.255 1.00 30.74  ? 84  VAL E O   1 
ATOM   3397 C CB  . VAL E  1 84 ? -5.315  -14.962 41.724 1.00 38.01  ? 84  VAL E CB  1 
ATOM   3398 C CG1 . VAL E  1 84 ? -4.957  -13.551 42.137 1.00 40.34  ? 84  VAL E CG1 1 
ATOM   3399 C CG2 . VAL E  1 84 ? -4.231  -15.949 42.142 1.00 39.36  ? 84  VAL E CG2 1 
ATOM   3400 N N   . VAL E  1 85 ? -7.838  -13.566 43.456 1.00 30.96  ? 85  VAL E N   1 
ATOM   3401 C CA  . VAL E  1 85 ? -8.862  -12.536 43.615 1.00 29.91  ? 85  VAL E CA  1 
ATOM   3402 C C   . VAL E  1 85 ? -8.240  -11.283 44.172 1.00 27.86  ? 85  VAL E C   1 
ATOM   3403 O O   . VAL E  1 85 ? -7.454  -11.343 45.110 1.00 28.49  ? 85  VAL E O   1 
ATOM   3404 C CB  . VAL E  1 85 ? -9.955  -13.005 44.595 1.00 33.03  ? 85  VAL E CB  1 
ATOM   3405 C CG1 . VAL E  1 85 ? -11.113 -11.999 44.632 1.00 29.69  ? 85  VAL E CG1 1 
ATOM   3406 C CG2 . VAL E  1 85 ? -10.443 -14.384 44.199 1.00 34.64  ? 85  VAL E CG2 1 
ATOM   3407 N N   . HIS E  1 86 ? -8.602  -10.140 43.585 1.00 24.16  ? 86  HIS E N   1 
ATOM   3408 C CA  . HIS E  1 86 ? -8.110  -8.851  44.044 1.00 24.81  ? 86  HIS E CA  1 
ATOM   3409 C C   . HIS E  1 86 ? -9.104  -8.334  45.066 1.00 28.85  ? 86  HIS E C   1 
ATOM   3410 O O   . HIS E  1 86 ? -10.298 -8.240  44.774 1.00 27.87  ? 86  HIS E O   1 
ATOM   3411 C CB  . HIS E  1 86 ? -8.024  -7.908  42.847 1.00 25.46  ? 86  HIS E CB  1 
ATOM   3412 C CG  . HIS E  1 86 ? -7.334  -6.619  43.144 1.00 26.11  ? 86  HIS E CG  1 
ATOM   3413 N ND1 . HIS E  1 86 ? -7.466  -5.507  42.343 1.00 29.76  ? 86  HIS E ND1 1 
ATOM   3414 C CD2 . HIS E  1 86 ? -6.484  -6.269  44.135 1.00 30.30  ? 86  HIS E CD2 1 
ATOM   3415 C CE1 . HIS E  1 86 ? -6.747  -4.515  42.841 1.00 30.70  ? 86  HIS E CE1 1 
ATOM   3416 N NE2 . HIS E  1 86 ? -6.144  -4.949  43.932 1.00 26.19  ? 86  HIS E NE2 1 
ATOM   3417 N N   . LEU E  1 87 ? -8.624  -8.084  46.286 1.00 26.90  ? 87  LEU E N   1 
ATOM   3418 C CA  . LEU E  1 87 ? -9.475  -7.581  47.363 1.00 25.16  ? 87  LEU E CA  1 
ATOM   3419 C C   . LEU E  1 87 ? -8.960  -6.235  47.820 1.00 26.16  ? 87  LEU E C   1 
ATOM   3420 O O   . LEU E  1 87 ? -7.750  -6.064  47.967 1.00 26.35  ? 87  LEU E O   1 
ATOM   3421 C CB  . LEU E  1 87 ? -9.436  -8.548  48.557 1.00 23.83  ? 87  LEU E CB  1 
ATOM   3422 C CG  . LEU E  1 87 ? -10.006 -9.939  48.266 1.00 30.51  ? 87  LEU E CG  1 
ATOM   3423 C CD1 . LEU E  1 87 ? -9.824  -10.879 49.445 1.00 32.13  ? 87  LEU E CD1 1 
ATOM   3424 C CD2 . LEU E  1 87 ? -11.477 -9.811  47.905 1.00 35.04  ? 87  LEU E CD2 1 
ATOM   3425 N N   . LEU E  1 88 ? -9.879  -5.280  48.021 1.00 24.05  ? 88  LEU E N   1 
ATOM   3426 C CA  . LEU E  1 88 ? -9.574  -3.965  48.590 1.00 23.88  ? 88  LEU E CA  1 
ATOM   3427 C C   . LEU E  1 88 ? -10.184 -3.932  49.970 1.00 25.71  ? 88  LEU E C   1 
ATOM   3428 O O   . LEU E  1 88 ? -11.372 -4.208  50.114 1.00 25.70  ? 88  LEU E O   1 
ATOM   3429 C CB  . LEU E  1 88 ? -10.238 -2.887  47.757 1.00 22.61  ? 88  LEU E CB  1 
ATOM   3430 C CG  . LEU E  1 88 ? -9.983  -1.442  48.170 1.00 26.18  ? 88  LEU E CG  1 
ATOM   3431 C CD1 . LEU E  1 88 ? -8.496  -1.134  48.024 1.00 25.80  ? 88  LEU E CD1 1 
ATOM   3432 C CD2 . LEU E  1 88 ? -10.817 -0.515  47.272 1.00 27.06  ? 88  LEU E CD2 1 
ATOM   3433 N N   . LEU E  1 89 ? -9.372  -3.609  50.968 1.00 23.63  ? 89  LEU E N   1 
ATOM   3434 C CA  . LEU E  1 89 ? -9.809  -3.662  52.368 1.00 24.38  ? 89  LEU E CA  1 
ATOM   3435 C C   . LEU E  1 89 ? -9.473  -2.405  53.142 1.00 26.31  ? 89  LEU E C   1 
ATOM   3436 O O   . LEU E  1 89 ? -8.631  -1.620  52.731 1.00 27.16  ? 89  LEU E O   1 
ATOM   3437 C CB  . LEU E  1 89 ? -9.174  -4.844  53.084 1.00 26.58  ? 89  LEU E CB  1 
ATOM   3438 C CG  . LEU E  1 89 ? -9.595  -6.194  52.528 1.00 24.32  ? 89  LEU E CG  1 
ATOM   3439 C CD1 . LEU E  1 89 ? -8.502  -6.752  51.658 1.00 26.02  ? 89  LEU E CD1 1 
ATOM   3440 C CD2 . LEU E  1 89 ? -9.877  -7.180  53.664 1.00 25.84  ? 89  LEU E CD2 1 
ATOM   3441 N N   . GLU E  1 90 ? -10.167 -2.225  54.255 1.00 29.11  ? 90  GLU E N   1 
ATOM   3442 C CA  . GLU E  1 90 ? -9.736  -1.268  55.271 1.00 29.13  ? 90  GLU E CA  1 
ATOM   3443 C C   . GLU E  1 90 ? -9.356  -2.084  56.495 1.00 28.74  ? 90  GLU E C   1 
ATOM   3444 O O   . GLU E  1 90 ? -10.124 -2.932  56.941 1.00 30.05  ? 90  GLU E O   1 
ATOM   3445 C CB  . GLU E  1 90 ? -10.855 -0.295  55.634 1.00 32.20  ? 90  GLU E CB  1 
ATOM   3446 C CG  . GLU E  1 90 ? -10.556 0.521   56.899 1.00 36.30  ? 90  GLU E CG  1 
ATOM   3447 C CD  . GLU E  1 90 ? -11.808 1.134   57.499 1.00 43.60  ? 90  GLU E CD  1 
ATOM   3448 O OE1 . GLU E  1 90 ? -12.874 1.035   56.859 1.00 47.10  ? 90  GLU E OE1 1 
ATOM   3449 O OE2 . GLU E  1 90 ? -11.725 1.722   58.604 1.00 43.94  ? 90  GLU E OE2 1 
ATOM   3450 N N   . LYS E  1 91 ? -8.161  -1.825  57.023 1.00 29.57  ? 91  LYS E N   1 
ATOM   3451 C CA  . LYS E  1 91 ? -7.687  -2.437  58.266 1.00 28.83  ? 91  LYS E CA  1 
ATOM   3452 C C   . LYS E  1 91 ? -8.608  -2.118  59.453 1.00 33.78  ? 91  LYS E C   1 
ATOM   3453 O O   . LYS E  1 91 ? -8.875  -0.950  59.771 1.00 36.07  ? 91  LYS E O   1 
ATOM   3454 C CB  . LYS E  1 91 ? -6.268  -1.955  58.566 1.00 32.34  ? 91  LYS E CB  1 
ATOM   3455 C CG  . LYS E  1 91 ? -5.664  -2.472  59.857 1.00 38.29  ? 91  LYS E CG  1 
ATOM   3456 C CD  . LYS E  1 91 ? -5.274  -3.906  59.717 1.00 39.53  ? 91  LYS E CD  1 
ATOM   3457 C CE  . LYS E  1 91 ? -4.611  -4.398  61.004 1.00 45.47  ? 91  LYS E CE  1 
ATOM   3458 N NZ  . LYS E  1 91 ? -4.443  -5.858  60.989 1.00 47.67  ? 91  LYS E NZ  1 
ATOM   3459 N N   . GLY E  1 92 ? -9.068  -3.164  60.124 1.00 33.01  ? 92  GLY E N   1 
ATOM   3460 C CA  . GLY E  1 92 ? -9.941  -3.021  61.278 1.00 36.62  ? 92  GLY E CA  1 
ATOM   3461 C C   . GLY E  1 92 ? -9.194  -2.761  62.570 1.00 40.97  ? 92  GLY E C   1 
ATOM   3462 O O   . GLY E  1 92 ? -7.969  -2.696  62.588 1.00 39.75  ? 92  GLY E O   1 
ATOM   3463 N N   . GLN E  1 93 ? -9.944  -2.609  63.654 1.00 46.21  ? 93  GLN E N   1 
ATOM   3464 C CA  . GLN E  1 93 ? -9.358  -2.445  64.981 1.00 56.39  ? 93  GLN E CA  1 
ATOM   3465 C C   . GLN E  1 93 ? -8.890  -3.786  65.541 1.00 59.97  ? 93  GLN E C   1 
ATOM   3466 O O   . GLN E  1 93 ? -9.504  -4.819  65.285 1.00 55.98  ? 93  GLN E O   1 
ATOM   3467 C CB  . GLN E  1 93 ? -10.368 -1.796  65.928 1.00 61.97  ? 93  GLN E CB  1 
ATOM   3468 C CG  . GLN E  1 93 ? -10.386 -0.286  65.830 1.00 64.26  ? 93  GLN E CG  1 
ATOM   3469 C CD  . GLN E  1 93 ? -9.081  0.327   66.298 1.00 67.17  ? 93  GLN E CD  1 
ATOM   3470 O OE1 . GLN E  1 93 ? -8.430  -0.186  67.215 1.00 70.38  ? 93  GLN E OE1 1 
ATOM   3471 N NE2 . GLN E  1 93 ? -8.692  1.430   65.674 1.00 65.75  ? 93  GLN E NE2 1 
ATOM   3472 N N   . SER E  1 94 ? -7.801  -3.773  66.302 1.00 68.42  ? 94  SER E N   1 
ATOM   3473 C CA  . SER E  1 94 ? -7.298  -5.012  66.888 1.00 75.68  ? 94  SER E CA  1 
ATOM   3474 C C   . SER E  1 94 ? -7.712  -5.163  68.349 1.00 80.39  ? 94  SER E C   1 
ATOM   3475 O O   . SER E  1 94 ? -8.807  -5.642  68.641 1.00 80.91  ? 94  SER E O   1 
ATOM   3476 C CB  . SER E  1 94 ? -5.777  -5.113  66.747 1.00 79.55  ? 94  SER E CB  1 
ATOM   3477 O OG  . SER E  1 94 ? -5.332  -6.416  67.091 1.00 82.08  ? 94  SER E OG  1 
ATOM   3478 N N   . PRO F  1 1  ? 12.787  -3.975  33.192 1.00 31.47  ? 1   PRO F N   1 
ATOM   3479 C CA  . PRO F  1 1  ? 13.430  -2.901  33.967 1.00 33.13  ? 1   PRO F CA  1 
ATOM   3480 C C   . PRO F  1 1  ? 14.921  -2.791  33.652 1.00 33.16  ? 1   PRO F C   1 
ATOM   3481 O O   . PRO F  1 1  ? 15.536  -3.767  33.198 1.00 37.81  ? 1   PRO F O   1 
ATOM   3482 C CB  . PRO F  1 1  ? 13.250  -3.350  35.423 1.00 31.07  ? 1   PRO F CB  1 
ATOM   3483 C CG  . PRO F  1 1  ? 12.241  -4.501  35.395 1.00 32.76  ? 1   PRO F CG  1 
ATOM   3484 C CD  . PRO F  1 1  ? 11.768  -4.687  33.973 1.00 32.91  ? 1   PRO F CD  1 
ATOM   3485 N N   . LYS F  1 2  ? 15.489  -1.611  33.890 1.00 31.18  ? 2   LYS F N   1 
ATOM   3486 C CA  . LYS F  1 2  ? 16.924  -1.382  33.779 1.00 32.79  ? 2   LYS F CA  1 
ATOM   3487 C C   . LYS F  1 2  ? 17.500  -1.626  35.157 1.00 32.82  ? 2   LYS F C   1 
ATOM   3488 O O   . LYS F  1 2  ? 16.787  -1.463  36.139 1.00 30.74  ? 2   LYS F O   1 
ATOM   3489 C CB  . LYS F  1 2  ? 17.187  0.077   33.398 1.00 37.04  ? 2   LYS F CB  1 
ATOM   3490 C CG  . LYS F  1 2  ? 17.313  0.355   31.926 1.00 45.71  ? 2   LYS F CG  1 
ATOM   3491 C CD  . LYS F  1 2  ? 17.237  1.858   31.670 1.00 50.83  ? 2   LYS F CD  1 
ATOM   3492 C CE  . LYS F  1 2  ? 18.136  2.646   32.627 1.00 54.18  ? 2   LYS F CE  1 
ATOM   3493 N NZ  . LYS F  1 2  ? 18.119  4.118   32.316 1.00 57.33  ? 2   LYS F NZ  1 
ATOM   3494 N N   . PRO F  1 3  ? 18.774  -2.046  35.247 1.00 34.36  ? 3   PRO F N   1 
ATOM   3495 C CA  . PRO F  1 3  ? 19.414  -2.145  36.563 1.00 34.85  ? 3   PRO F CA  1 
ATOM   3496 C C   . PRO F  1 3  ? 19.139  -0.896  37.404 1.00 34.73  ? 3   PRO F C   1 
ATOM   3497 O O   . PRO F  1 3  ? 19.238  0.230   36.900 1.00 35.50  ? 3   PRO F O   1 
ATOM   3498 C CB  . PRO F  1 3  ? 20.894  -2.247  36.211 1.00 39.11  ? 3   PRO F CB  1 
ATOM   3499 C CG  . PRO F  1 3  ? 20.890  -2.975  34.895 1.00 39.33  ? 3   PRO F CG  1 
ATOM   3500 C CD  . PRO F  1 3  ? 19.672  -2.486  34.162 1.00 38.57  ? 3   PRO F CD  1 
ATOM   3501 N N   . GLY F  1 4  ? 18.755  -1.106  38.663 1.00 32.75  ? 4   GLY F N   1 
ATOM   3502 C CA  . GLY F  1 4  ? 18.457  -0.015  39.574 1.00 34.75  ? 4   GLY F CA  1 
ATOM   3503 C C   . GLY F  1 4  ? 16.983  0.345   39.649 1.00 31.92  ? 4   GLY F C   1 
ATOM   3504 O O   . GLY F  1 4  ? 16.542  0.989   40.599 1.00 32.35  ? 4   GLY F O   1 
ATOM   3505 N N   . ASP F  1 5  ? 16.220  -0.042  38.633 1.00 28.04  ? 5   ASP F N   1 
ATOM   3506 C CA  . ASP F  1 5  ? 14.780  0.215   38.624 1.00 29.15  ? 5   ASP F CA  1 
ATOM   3507 C C   . ASP F  1 5  ? 14.037  -0.600  39.669 1.00 28.73  ? 5   ASP F C   1 
ATOM   3508 O O   . ASP F  1 5  ? 14.371  -1.756  39.918 1.00 30.16  ? 5   ASP F O   1 
ATOM   3509 C CB  . ASP F  1 5  ? 14.173  -0.131  37.268 1.00 29.84  ? 5   ASP F CB  1 
ATOM   3510 C CG  . ASP F  1 5  ? 14.460  0.908   36.205 1.00 30.07  ? 5   ASP F CG  1 
ATOM   3511 O OD1 . ASP F  1 5  ? 15.015  1.987   36.507 1.00 33.39  ? 5   ASP F OD1 1 
ATOM   3512 O OD2 . ASP F  1 5  ? 14.099  0.641   35.040 1.00 29.34  ? 5   ASP F OD2 1 
ATOM   3513 N N   . ILE F  1 6  ? 13.027  0.018   40.281 1.00 26.62  ? 6   ILE F N   1 
ATOM   3514 C CA  . ILE F  1 6  ? 12.117  -0.720  41.147 1.00 27.18  ? 6   ILE F CA  1 
ATOM   3515 C C   . ILE F  1 6  ? 11.126  -1.465  40.275 1.00 27.05  ? 6   ILE F C   1 
ATOM   3516 O O   . ILE F  1 6  ? 10.666  -0.928  39.271 1.00 27.70  ? 6   ILE F O   1 
ATOM   3517 C CB  . ILE F  1 6  ? 11.312  0.241   42.024 1.00 28.50  ? 6   ILE F CB  1 
ATOM   3518 C CG1 . ILE F  1 6  ? 12.248  1.067   42.907 1.00 31.07  ? 6   ILE F CG1 1 
ATOM   3519 C CG2 . ILE F  1 6  ? 10.278  -0.531  42.817 1.00 29.99  ? 6   ILE F CG2 1 
ATOM   3520 C CD1 . ILE F  1 6  ? 13.098  0.217   43.853 1.00 31.81  ? 6   ILE F CD1 1 
ATOM   3521 N N   . PHE F  1 7  ? 10.780  -2.689  40.659 1.00 25.88  ? 7   PHE F N   1 
ATOM   3522 C CA  . PHE F  1 7  ? 9.674   -3.405  40.010 1.00 23.48  ? 7   PHE F CA  1 
ATOM   3523 C C   . PHE F  1 7  ? 8.976   -4.325  41.009 1.00 29.68  ? 7   PHE F C   1 
ATOM   3524 O O   . PHE F  1 7  ? 9.548   -4.658  42.055 1.00 29.43  ? 7   PHE F O   1 
ATOM   3525 C CB  . PHE F  1 7  ? 10.117  -4.162  38.743 1.00 25.32  ? 7   PHE F CB  1 
ATOM   3526 C CG  . PHE F  1 7  ? 11.012  -5.356  38.997 1.00 28.32  ? 7   PHE F CG  1 
ATOM   3527 C CD1 . PHE F  1 7  ? 10.490  -6.639  38.985 1.00 28.03  ? 7   PHE F CD1 1 
ATOM   3528 C CD2 . PHE F  1 7  ? 12.374  -5.195  39.211 1.00 29.20  ? 7   PHE F CD2 1 
ATOM   3529 C CE1 . PHE F  1 7  ? 11.309  -7.750  39.199 1.00 29.45  ? 7   PHE F CE1 1 
ATOM   3530 C CE2 . PHE F  1 7  ? 13.196  -6.301  39.424 1.00 32.70  ? 7   PHE F CE2 1 
ATOM   3531 C CZ  . PHE F  1 7  ? 12.660  -7.575  39.420 1.00 32.29  ? 7   PHE F CZ  1 
ATOM   3532 N N   . GLU F  1 8  ? 7.745   -4.730  40.697 1.00 26.28  ? 8   GLU F N   1 
ATOM   3533 C CA  . GLU F  1 8  ? 7.013   -5.635  41.591 1.00 27.48  ? 8   GLU F CA  1 
ATOM   3534 C C   . GLU F  1 8  ? 6.388   -6.779  40.823 1.00 27.36  ? 8   GLU F C   1 
ATOM   3535 O O   . GLU F  1 8  ? 6.040   -6.639  39.646 1.00 27.64  ? 8   GLU F O   1 
ATOM   3536 C CB  . GLU F  1 8  ? 5.951   -4.902  42.408 1.00 31.19  ? 8   GLU F CB  1 
ATOM   3537 C CG  . GLU F  1 8  ? 5.020   -3.995  41.608 1.00 37.83  ? 8   GLU F CG  1 
ATOM   3538 C CD  . GLU F  1 8  ? 4.203   -3.065  42.509 1.00 44.92  ? 8   GLU F CD  1 
ATOM   3539 O OE1 . GLU F  1 8  ? 4.066   -1.863  42.174 1.00 47.78  ? 8   GLU F OE1 1 
ATOM   3540 O OE2 . GLU F  1 8  ? 3.699   -3.525  43.552 1.00 41.73  ? 8   GLU F OE2 1 
ATOM   3541 N N   . VAL F  1 9  ? 6.241   -7.901  41.524 1.00 27.02  ? 9   VAL F N   1 
ATOM   3542 C CA  . VAL F  1 9  ? 5.715   -9.118  40.956 1.00 29.16  ? 9   VAL F CA  1 
ATOM   3543 C C   . VAL F  1 9  ? 4.714   -9.738  41.916 1.00 32.69  ? 9   VAL F C   1 
ATOM   3544 O O   . VAL F  1 9  ? 4.874   -9.647  43.137 1.00 34.34  ? 9   VAL F O   1 
ATOM   3545 C CB  . VAL F  1 9  ? 6.867   -10.111 40.729 1.00 34.88  ? 9   VAL F CB  1 
ATOM   3546 C CG1 . VAL F  1 9  ? 6.348   -11.486 40.327 1.00 38.72  ? 9   VAL F CG1 1 
ATOM   3547 C CG2 . VAL F  1 9  ? 7.849   -9.553  39.707 1.00 32.34  ? 9   VAL F CG2 1 
ATOM   3548 N N   . GLU F  1 10 ? 3.678   -10.360 41.360 1.00 30.70  ? 10  GLU F N   1 
ATOM   3549 C CA  . GLU F  1 10 ? 2.827   -11.276 42.099 1.00 29.15  ? 10  GLU F CA  1 
ATOM   3550 C C   . GLU F  1 10 ? 3.206   -12.651 41.604 1.00 31.32  ? 10  GLU F C   1 
ATOM   3551 O O   . GLU F  1 10 ? 2.938   -12.999 40.454 1.00 34.01  ? 10  GLU F O   1 
ATOM   3552 C CB  . GLU F  1 10 ? 1.350   -11.028 41.811 1.00 29.94  ? 10  GLU F CB  1 
ATOM   3553 C CG  . GLU F  1 10 ? 0.792   -9.748  42.436 1.00 33.03  ? 10  GLU F CG  1 
ATOM   3554 C CD  . GLU F  1 10 ? 0.583   -9.884  43.932 1.00 37.98  ? 10  GLU F CD  1 
ATOM   3555 O OE1 . GLU F  1 10 ? 0.845   -10.976 44.482 1.00 39.16  ? 10  GLU F OE1 1 
ATOM   3556 O OE2 . GLU F  1 10 ? 0.143   -8.897  44.555 1.00 39.99  ? 10  GLU F OE2 1 
ATOM   3557 N N   . LEU F  1 11 ? 3.870   -13.413 42.455 1.00 31.96  ? 11  LEU F N   1 
ATOM   3558 C CA  . LEU F  1 11 ? 4.437   -14.689 42.037 1.00 34.47  ? 11  LEU F CA  1 
ATOM   3559 C C   . LEU F  1 11 ? 3.744   -15.855 42.709 1.00 38.60  ? 11  LEU F C   1 
ATOM   3560 O O   . LEU F  1 11 ? 3.718   -15.954 43.940 1.00 38.64  ? 11  LEU F O   1 
ATOM   3561 C CB  . LEU F  1 11 ? 5.929   -14.712 42.360 1.00 37.30  ? 11  LEU F CB  1 
ATOM   3562 C CG  . LEU F  1 11 ? 6.706   -15.972 41.992 1.00 39.81  ? 11  LEU F CG  1 
ATOM   3563 C CD1 . LEU F  1 11 ? 6.688   -16.138 40.478 1.00 40.35  ? 11  LEU F CD1 1 
ATOM   3564 C CD2 . LEU F  1 11 ? 8.126   -15.842 42.504 1.00 41.74  ? 11  LEU F CD2 1 
ATOM   3565 N N   . ALA F  1 12 ? 3.197   -16.758 41.896 1.00 42.79  ? 12  ALA F N   1 
ATOM   3566 C CA  . ALA F  1 12 ? 2.554   -17.960 42.398 1.00 46.31  ? 12  ALA F CA  1 
ATOM   3567 C C   . ALA F  1 12 ? 3.592   -19.042 42.636 1.00 46.26  ? 12  ALA F C   1 
ATOM   3568 O O   . ALA F  1 12 ? 4.475   -19.257 41.806 1.00 46.15  ? 12  ALA F O   1 
ATOM   3569 C CB  . ALA F  1 12 ? 1.504   -18.453 41.421 1.00 49.65  ? 12  ALA F CB  1 
ATOM   3570 N N   . LYS F  1 13 ? 3.494   -19.712 43.777 1.00 46.46  ? 13  LYS F N   1 
ATOM   3571 C CA  . LYS F  1 13 ? 4.410   -20.792 44.101 1.00 49.52  ? 13  LYS F CA  1 
ATOM   3572 C C   . LYS F  1 13 ? 4.198   -22.012 43.214 1.00 54.35  ? 13  LYS F C   1 
ATOM   3573 O O   . LYS F  1 13 ? 3.114   -22.220 42.657 1.00 57.95  ? 13  LYS F O   1 
ATOM   3574 C CB  . LYS F  1 13 ? 4.246   -21.211 45.564 1.00 54.13  ? 13  LYS F CB  1 
ATOM   3575 C CG  . LYS F  1 13 ? 4.700   -20.150 46.538 1.00 52.40  ? 13  LYS F CG  1 
ATOM   3576 C CD  . LYS F  1 13 ? 4.370   -20.525 47.966 1.00 54.86  ? 13  LYS F CD  1 
ATOM   3577 C CE  . LYS F  1 13 ? 4.775   -19.402 48.894 1.00 51.66  ? 13  LYS F CE  1 
ATOM   3578 N NZ  . LYS F  1 13 ? 4.480   -19.738 50.302 1.00 52.50  ? 13  LYS F NZ  1 
ATOM   3579 N N   . ASN F  1 14 ? 5.253   -22.810 43.090 1.00 51.56  ? 14  ASN F N   1 
ATOM   3580 C CA  . ASN F  1 14 ? 5.166   -24.111 42.446 1.00 57.13  ? 14  ASN F CA  1 
ATOM   3581 C C   . ASN F  1 14 ? 5.697   -25.118 43.441 1.00 61.82  ? 14  ASN F C   1 
ATOM   3582 O O   . ASN F  1 14 ? 6.820   -24.975 43.916 1.00 61.52  ? 14  ASN F O   1 
ATOM   3583 C CB  . ASN F  1 14 ? 6.013   -24.173 41.175 1.00 60.42  ? 14  ASN F CB  1 
ATOM   3584 C CG  . ASN F  1 14 ? 6.057   -25.576 40.572 1.00 70.90  ? 14  ASN F CG  1 
ATOM   3585 O OD1 . ASN F  1 14 ? 7.048   -26.304 40.714 1.00 73.44  ? 14  ASN F OD1 1 
ATOM   3586 N ND2 . ASN F  1 14 ? 4.969   -25.968 39.913 1.00 75.07  ? 14  ASN F ND2 1 
ATOM   3587 N N   . ASP F  1 15 ? 4.894   -26.121 43.766 1.00 67.79  ? 15  ASP F N   1 
ATOM   3588 C CA  . ASP F  1 15 ? 5.278   -27.089 44.794 1.00 74.80  ? 15  ASP F CA  1 
ATOM   3589 C C   . ASP F  1 15 ? 5.596   -26.372 46.102 1.00 74.47  ? 15  ASP F C   1 
ATOM   3590 O O   . ASP F  1 15 ? 6.529   -26.745 46.810 1.00 76.91  ? 15  ASP F O   1 
ATOM   3591 C CB  . ASP F  1 15 ? 6.503   -27.894 44.356 1.00 81.40  ? 15  ASP F CB  1 
ATOM   3592 C CG  . ASP F  1 15 ? 6.176   -28.938 43.306 1.00 91.11  ? 15  ASP F CG  1 
ATOM   3593 O OD1 . ASP F  1 15 ? 5.337   -28.660 42.422 1.00 93.54  ? 15  ASP F OD1 1 
ATOM   3594 O OD2 . ASP F  1 15 ? 6.769   -30.038 43.364 1.00 96.71  ? 15  ASP F OD2 1 
ATOM   3595 N N   . ASN F  1 16 ? 4.826   -25.332 46.404 1.00 72.81  ? 16  ASN F N   1 
ATOM   3596 C CA  . ASN F  1 16 ? 5.020   -24.546 47.619 1.00 72.66  ? 16  ASN F CA  1 
ATOM   3597 C C   . ASN F  1 16 ? 6.402   -23.881 47.721 1.00 65.71  ? 16  ASN F C   1 
ATOM   3598 O O   . ASN F  1 16 ? 6.917   -23.667 48.816 1.00 65.85  ? 16  ASN F O   1 
ATOM   3599 C CB  . ASN F  1 16 ? 4.732   -25.392 48.867 1.00 82.86  ? 16  ASN F CB  1 
ATOM   3600 C CG  . ASN F  1 16 ? 4.264   -24.551 50.042 1.00 89.42  ? 16  ASN F CG  1 
ATOM   3601 O OD1 . ASN F  1 16 ? 3.936   -23.372 49.884 1.00 89.22  ? 16  ASN F OD1 1 
ATOM   3602 N ND2 . ASN F  1 16 ? 4.231   -25.150 51.227 1.00 95.05  ? 16  ASN F ND2 1 
ATOM   3603 N N   . SER F  1 17 ? 6.993   -23.544 46.576 1.00 58.95  ? 17  SER F N   1 
ATOM   3604 C CA  . SER F  1 17 ? 8.276   -22.841 46.549 1.00 55.24  ? 17  SER F CA  1 
ATOM   3605 C C   . SER F  1 17 ? 8.246   -21.720 45.521 1.00 50.77  ? 17  SER F C   1 
ATOM   3606 O O   . SER F  1 17 ? 7.732   -21.901 44.417 1.00 52.22  ? 17  SER F O   1 
ATOM   3607 C CB  . SER F  1 17 ? 9.418   -23.809 46.219 1.00 57.17  ? 17  SER F CB  1 
ATOM   3608 O OG  . SER F  1 17 ? 10.600  -23.100 45.878 1.00 53.73  ? 17  SER F OG  1 
ATOM   3609 N N   . LEU F  1 18 ? 8.790   -20.559 45.879 1.00 46.97  ? 18  LEU F N   1 
ATOM   3610 C CA  . LEU F  1 18 ? 8.865   -19.451 44.928 1.00 42.06  ? 18  LEU F CA  1 
ATOM   3611 C C   . LEU F  1 18 ? 9.972   -19.696 43.892 1.00 44.59  ? 18  LEU F C   1 
ATOM   3612 O O   . LEU F  1 18 ? 10.068  -18.984 42.884 1.00 40.71  ? 18  LEU F O   1 
ATOM   3613 C CB  . LEU F  1 18 ? 9.045   -18.105 45.649 1.00 39.50  ? 18  LEU F CB  1 
ATOM   3614 C CG  . LEU F  1 18 ? 7.859   -17.635 46.503 1.00 40.22  ? 18  LEU F CG  1 
ATOM   3615 C CD1 . LEU F  1 18 ? 8.305   -16.603 47.531 1.00 43.70  ? 18  LEU F CD1 1 
ATOM   3616 C CD2 . LEU F  1 18 ? 6.736   -17.056 45.652 1.00 38.52  ? 18  LEU F CD2 1 
ATOM   3617 N N   . GLY F  1 19 ? 10.786  -20.720 44.125 1.00 47.54  ? 19  GLY F N   1 
ATOM   3618 C CA  . GLY F  1 19 ? 11.802  -21.111 43.169 1.00 49.02  ? 19  GLY F CA  1 
ATOM   3619 C C   . GLY F  1 19 ? 12.920  -20.095 43.051 1.00 49.07  ? 19  GLY F C   1 
ATOM   3620 O O   . GLY F  1 19 ? 13.453  -19.860 41.972 1.00 50.60  ? 19  GLY F O   1 
ATOM   3621 N N   . ILE F  1 20 ? 13.276  -19.495 44.175 1.00 49.48  ? 20  ILE F N   1 
ATOM   3622 C CA  . ILE F  1 20 ? 14.473  -18.673 44.263 1.00 53.04  ? 20  ILE F CA  1 
ATOM   3623 C C   . ILE F  1 20 ? 15.146  -18.930 45.600 1.00 55.13  ? 20  ILE F C   1 
ATOM   3624 O O   . ILE F  1 20 ? 14.478  -19.235 46.586 1.00 58.04  ? 20  ILE F O   1 
ATOM   3625 C CB  . ILE F  1 20 ? 14.148  -17.172 44.188 1.00 53.07  ? 20  ILE F CB  1 
ATOM   3626 C CG1 . ILE F  1 20 ? 13.244  -16.765 45.353 1.00 55.07  ? 20  ILE F CG1 1 
ATOM   3627 C CG2 . ILE F  1 20 ? 13.504  -16.825 42.866 1.00 53.08  ? 20  ILE F CG2 1 
ATOM   3628 C CD1 . ILE F  1 20 ? 12.733  -15.353 45.256 1.00 56.47  ? 20  ILE F CD1 1 
ATOM   3629 N N   . SER F  1 21 ? 16.468  -18.809 45.632 1.00 54.01  ? 21  SER F N   1 
ATOM   3630 C CA  . SER F  1 21 ? 17.194  -18.809 46.896 1.00 54.86  ? 21  SER F CA  1 
ATOM   3631 C C   . SER F  1 21 ? 17.850  -17.445 47.063 1.00 53.29  ? 21  SER F C   1 
ATOM   3632 O O   . SER F  1 21 ? 18.098  -16.735 46.078 1.00 53.27  ? 21  SER F O   1 
ATOM   3633 C CB  . SER F  1 21 ? 18.242  -19.920 46.936 1.00 58.40  ? 21  SER F CB  1 
ATOM   3634 O OG  . SER F  1 21 ? 19.246  -19.697 45.965 1.00 60.39  ? 21  SER F OG  1 
ATOM   3635 N N   . VAL F  1 22 ? 18.125  -17.076 48.305 1.00 53.15  ? 22  VAL F N   1 
ATOM   3636 C CA  . VAL F  1 22 ? 18.616  -15.739 48.589 1.00 50.57  ? 22  VAL F CA  1 
ATOM   3637 C C   . VAL F  1 22 ? 19.945  -15.715 49.340 1.00 51.57  ? 22  VAL F C   1 
ATOM   3638 O O   . VAL F  1 22 ? 20.320  -16.679 50.013 1.00 52.93  ? 22  VAL F O   1 
ATOM   3639 C CB  . VAL F  1 22 ? 17.559  -14.931 49.357 1.00 47.22  ? 22  VAL F CB  1 
ATOM   3640 C CG1 . VAL F  1 22 ? 16.362  -14.668 48.452 1.00 44.28  ? 22  VAL F CG1 1 
ATOM   3641 C CG2 . VAL F  1 22 ? 17.128  -15.684 50.605 1.00 50.68  ? 22  VAL F CG2 1 
ATOM   3642 N N   . THR F  1 23 ? 20.652  -14.599 49.194 1.00 50.40  ? 23  THR F N   1 
ATOM   3643 C CA  . THR F  1 23 ? 21.917  -14.360 49.869 1.00 51.15  ? 23  THR F CA  1 
ATOM   3644 C C   . THR F  1 23 ? 21.885  -12.995 50.553 1.00 52.53  ? 23  THR F C   1 
ATOM   3645 O O   . THR F  1 23 ? 21.261  -12.051 50.052 1.00 53.11  ? 23  THR F O   1 
ATOM   3646 C CB  . THR F  1 23 ? 23.115  -14.432 48.882 1.00 58.72  ? 23  THR F CB  1 
ATOM   3647 O OG1 . THR F  1 23 ? 24.351  -14.367 49.609 1.00 61.03  ? 23  THR F OG1 1 
ATOM   3648 C CG2 . THR F  1 23 ? 23.061  -13.298 47.870 1.00 54.28  ? 23  THR F CG2 1 
ATOM   3649 N N   . GLY F  1 24 ? 22.538  -12.898 51.708 1.00 63.43  ? 24  GLY F N   1 
ATOM   3650 C CA  . GLY F  1 24 ? 22.635  -11.635 52.411 1.00 60.70  ? 24  GLY F CA  1 
ATOM   3651 C C   . GLY F  1 24 ? 21.861  -11.564 53.712 1.00 60.32  ? 24  GLY F C   1 
ATOM   3652 O O   . GLY F  1 24 ? 21.334  -12.566 54.201 1.00 62.85  ? 24  GLY F O   1 
ATOM   3653 N N   . GLY F  1 25 ? 21.802  -10.359 54.272 1.00 57.60  ? 25  GLY F N   1 
ATOM   3654 C CA  . GLY F  1 25 ? 21.185  -10.121 55.564 1.00 59.44  ? 25  GLY F CA  1 
ATOM   3655 C C   . GLY F  1 25 ? 22.132  -9.311  56.440 1.00 59.76  ? 25  GLY F C   1 
ATOM   3656 O O   . GLY F  1 25 ? 23.327  -9.229  56.143 1.00 58.50  ? 25  GLY F O   1 
ATOM   3657 N N   . VAL F  1 26 ? 21.606  -8.706  57.504 1.00 61.27  ? 26  VAL F N   1 
ATOM   3658 C CA  . VAL F  1 26 ? 22.392  -7.771  58.311 1.00 69.08  ? 26  VAL F CA  1 
ATOM   3659 C C   . VAL F  1 26 ? 23.656  -8.414  58.864 1.00 72.74  ? 26  VAL F C   1 
ATOM   3660 O O   . VAL F  1 26 ? 24.721  -7.792  58.904 1.00 73.92  ? 26  VAL F O   1 
ATOM   3661 C CB  . VAL F  1 26 ? 21.578  -7.173  59.482 1.00 72.34  ? 26  VAL F CB  1 
ATOM   3662 C CG1 . VAL F  1 26 ? 20.668  -6.073  58.992 1.00 74.20  ? 26  VAL F CG1 1 
ATOM   3663 C CG2 . VAL F  1 26 ? 20.788  -8.258  60.201 1.00 74.09  ? 26  VAL F CG2 1 
ATOM   3664 N N   . ASN F  1 27 ? 23.527  -9.668  59.281 1.00 74.39  ? 27  ASN F N   1 
ATOM   3665 C CA  . ASN F  1 27 ? 24.624  -10.398 59.896 1.00 73.85  ? 27  ASN F CA  1 
ATOM   3666 C C   . ASN F  1 27 ? 25.721  -10.783 58.907 1.00 71.16  ? 27  ASN F C   1 
ATOM   3667 O O   . ASN F  1 27 ? 26.885  -10.902 59.282 1.00 67.48  ? 27  ASN F O   1 
ATOM   3668 C CB  . ASN F  1 27 ? 24.089  -11.645 60.606 1.00 76.85  ? 27  ASN F CB  1 
ATOM   3669 C CG  . ASN F  1 27 ? 23.278  -12.547 59.681 1.00 78.04  ? 27  ASN F CG  1 
ATOM   3670 O OD1 . ASN F  1 27 ? 22.455  -12.080 58.885 1.00 74.20  ? 27  ASN F OD1 1 
ATOM   3671 N ND2 . ASN F  1 27 ? 23.505  -13.853 59.793 1.00 81.15  ? 27  ASN F ND2 1 
ATOM   3672 N N   . THR F  1 28 ? 25.344  -10.969 57.644 1.00 69.67  ? 28  THR F N   1 
ATOM   3673 C CA  . THR F  1 28 ? 26.265  -11.455 56.614 1.00 69.71  ? 28  THR F CA  1 
ATOM   3674 C C   . THR F  1 28 ? 27.159  -10.357 56.049 1.00 72.71  ? 28  THR F C   1 
ATOM   3675 O O   . THR F  1 28 ? 26.852  -9.168  56.149 1.00 71.92  ? 28  THR F O   1 
ATOM   3676 C CB  . THR F  1 28 ? 25.508  -12.072 55.417 1.00 68.34  ? 28  THR F CB  1 
ATOM   3677 O OG1 . THR F  1 28 ? 25.091  -11.029 54.523 1.00 69.50  ? 28  THR F OG1 1 
ATOM   3678 C CG2 . THR F  1 28 ? 24.294  -12.861 55.889 1.00 68.29  ? 28  THR F CG2 1 
ATOM   3679 N N   . SER F  1 29 ? 28.252  -10.770 55.420 1.00 79.10  ? 29  SER F N   1 
ATOM   3680 C CA  . SER F  1 29 ? 29.180  -9.834  54.801 1.00 85.41  ? 29  SER F CA  1 
ATOM   3681 C C   . SER F  1 29 ? 28.813  -9.588  53.337 1.00 89.06  ? 29  SER F C   1 
ATOM   3682 O O   . SER F  1 29 ? 29.679  -9.576  52.460 1.00 90.50  ? 29  SER F O   1 
ATOM   3683 C CB  . SER F  1 29 ? 30.615  -10.352 54.929 1.00 89.21  ? 29  SER F CB  1 
ATOM   3684 O OG  . SER F  1 29 ? 30.981  -10.504 56.294 1.00 90.71  ? 29  SER F OG  1 
ATOM   3685 N N   . VAL F  1 30 ? 27.533  -9.377  53.044 1.00 90.32  ? 30  VAL F N   1 
ATOM   3686 C CA  . VAL F  1 30 ? 27.162  -9.124  51.650 1.00 91.53  ? 30  VAL F CA  1 
ATOM   3687 C C   . VAL F  1 30 ? 26.332  -7.870  51.337 1.00 94.59  ? 30  VAL F C   1 
ATOM   3688 O O   . VAL F  1 30 ? 25.233  -7.688  51.862 1.00 93.50  ? 30  VAL F O   1 
ATOM   3689 C CB  . VAL F  1 30 ? 26.435  -10.346 51.042 1.00 89.03  ? 30  VAL F CB  1 
ATOM   3690 C CG1 . VAL F  1 30 ? 25.993  -10.046 49.618 1.00 89.09  ? 30  VAL F CG1 1 
ATOM   3691 C CG2 . VAL F  1 30 ? 27.335  -11.571 51.082 1.00 88.76  ? 30  VAL F CG2 1 
ATOM   3692 N N   . ARG F  1 31 ? 26.867  -7.029  50.453 1.00 99.86  ? 31  ARG F N   1 
ATOM   3693 C CA  . ARG F  1 31 ? 26.132  -5.924  49.829 1.00 106.00 ? 31  ARG F CA  1 
ATOM   3694 C C   . ARG F  1 31 ? 25.363  -4.947  50.727 1.00 108.26 ? 31  ARG F C   1 
ATOM   3695 O O   . ARG F  1 31 ? 24.194  -4.673  50.452 1.00 108.95 ? 31  ARG F O   1 
ATOM   3696 C CB  . ARG F  1 31 ? 25.188  -6.471  48.752 1.00 109.45 ? 31  ARG F CB  1 
ATOM   3697 C CG  . ARG F  1 31 ? 25.892  -7.201  47.621 1.00 112.98 ? 31  ARG F CG  1 
ATOM   3698 C CD  . ARG F  1 31 ? 26.852  -6.282  46.884 1.00 116.76 ? 31  ARG F CD  1 
ATOM   3699 N NE  . ARG F  1 31 ? 26.169  -5.131  46.301 1.00 119.69 ? 31  ARG F NE  1 
ATOM   3700 C CZ  . ARG F  1 31 ? 25.646  -5.112  45.079 1.00 122.65 ? 31  ARG F CZ  1 
ATOM   3701 N NH1 . ARG F  1 31 ? 25.728  -6.185  44.304 1.00 124.24 ? 31  ARG F NH1 1 
ATOM   3702 N NH2 . ARG F  1 31 ? 25.041  -4.020  44.632 1.00 123.30 ? 31  ARG F NH2 1 
ATOM   3703 N N   . HIS F  1 32 ? 25.970  -4.426  51.788 1.00 108.79 ? 32  HIS F N   1 
ATOM   3704 C CA  . HIS F  1 32 ? 25.200  -3.541  52.663 1.00 108.32 ? 32  HIS F CA  1 
ATOM   3705 C C   . HIS F  1 32 ? 24.169  -4.293  53.507 1.00 100.01 ? 32  HIS F C   1 
ATOM   3706 O O   . HIS F  1 32 ? 23.259  -3.685  54.076 1.00 101.25 ? 32  HIS F O   1 
ATOM   3707 C CB  . HIS F  1 32 ? 24.497  -2.444  51.853 1.00 115.98 ? 32  HIS F CB  1 
ATOM   3708 C CG  . HIS F  1 32 ? 25.369  -1.788  50.827 1.00 122.70 ? 32  HIS F CG  1 
ATOM   3709 N ND1 . HIS F  1 32 ? 24.938  -1.527  49.543 1.00 125.10 ? 32  HIS F ND1 1 
ATOM   3710 C CD2 . HIS F  1 32 ? 26.647  -1.344  50.893 1.00 125.73 ? 32  HIS F CD2 1 
ATOM   3711 C CE1 . HIS F  1 32 ? 25.911  -0.946  48.864 1.00 127.29 ? 32  HIS F CE1 1 
ATOM   3712 N NE2 . HIS F  1 32 ? 26.959  -0.824  49.659 1.00 127.81 ? 32  HIS F NE2 1 
ATOM   3713 N N   . GLY F  1 33 ? 24.311  -5.614  53.578 1.00 78.22  ? 33  GLY F N   1 
ATOM   3714 C CA  . GLY F  1 33 ? 23.442  -6.443  54.396 1.00 71.34  ? 33  GLY F CA  1 
ATOM   3715 C C   . GLY F  1 33 ? 22.079  -6.719  53.786 1.00 63.70  ? 33  GLY F C   1 
ATOM   3716 O O   . GLY F  1 33 ? 21.250  -7.408  54.386 1.00 62.40  ? 33  GLY F O   1 
ATOM   3717 N N   . GLY F  1 34 ? 21.846  -6.179  52.592 1.00 55.64  ? 34  GLY F N   1 
ATOM   3718 C CA  . GLY F  1 34 ? 20.573  -6.355  51.916 1.00 51.58  ? 34  GLY F CA  1 
ATOM   3719 C C   . GLY F  1 34 ? 20.363  -7.788  51.469 1.00 50.72  ? 34  GLY F C   1 
ATOM   3720 O O   . GLY F  1 34 ? 21.286  -8.601  51.522 1.00 51.56  ? 34  GLY F O   1 
ATOM   3721 N N   . ILE F  1 35 ? 19.149  -8.094  51.011 1.00 46.35  ? 35  ILE F N   1 
ATOM   3722 C CA  . ILE F  1 35 ? 18.826  -9.443  50.556 1.00 46.21  ? 35  ILE F CA  1 
ATOM   3723 C C   . ILE F  1 35 ? 18.796  -9.486  49.041 1.00 45.41  ? 35  ILE F C   1 
ATOM   3724 O O   . ILE F  1 35 ? 18.071  -8.727  48.407 1.00 44.96  ? 35  ILE F O   1 
ATOM   3725 C CB  . ILE F  1 35 ? 17.456  -9.902  51.058 1.00 46.46  ? 35  ILE F CB  1 
ATOM   3726 C CG1 . ILE F  1 35 ? 17.355  -9.730  52.573 1.00 48.56  ? 35  ILE F CG1 1 
ATOM   3727 C CG2 . ILE F  1 35 ? 17.215  -11.344 50.656 1.00 45.31  ? 35  ILE F CG2 1 
ATOM   3728 C CD1 . ILE F  1 35 ? 18.418  -10.482 53.347 1.00 49.40  ? 35  ILE F CD1 1 
ATOM   3729 N N   . TYR F  1 36 ? 19.587  -10.379 48.464 1.00 46.12  ? 36  TYR F N   1 
ATOM   3730 C CA  . TYR F  1 36 ? 19.649  -10.512 47.017 1.00 47.14  ? 36  TYR F CA  1 
ATOM   3731 C C   . TYR F  1 36 ? 19.312  -11.922 46.564 1.00 48.01  ? 36  TYR F C   1 
ATOM   3732 O O   . TYR F  1 36 ? 19.567  -12.896 47.271 1.00 48.35  ? 36  TYR F O   1 
ATOM   3733 C CB  . TYR F  1 36 ? 21.032  -10.123 46.516 1.00 49.91  ? 36  TYR F CB  1 
ATOM   3734 C CG  . TYR F  1 36 ? 21.395  -8.709  46.868 1.00 51.70  ? 36  TYR F CG  1 
ATOM   3735 C CD1 . TYR F  1 36 ? 21.940  -8.403  48.109 1.00 55.63  ? 36  TYR F CD1 1 
ATOM   3736 C CD2 . TYR F  1 36 ? 21.187  -7.681  45.968 1.00 49.03  ? 36  TYR F CD2 1 
ATOM   3737 C CE1 . TYR F  1 36 ? 22.268  -7.106  48.438 1.00 58.05  ? 36  TYR F CE1 1 
ATOM   3738 C CE2 . TYR F  1 36 ? 21.511  -6.377  46.283 1.00 51.35  ? 36  TYR F CE2 1 
ATOM   3739 C CZ  . TYR F  1 36 ? 22.055  -6.096  47.522 1.00 56.64  ? 36  TYR F CZ  1 
ATOM   3740 O OH  . TYR F  1 36 ? 22.386  -4.800  47.849 1.00 60.21  ? 36  TYR F OH  1 
ATOM   3741 N N   . VAL F  1 37 ? 18.731  -12.018 45.374 1.00 46.51  ? 37  VAL F N   1 
ATOM   3742 C CA  . VAL F  1 37 ? 18.436  -13.302 44.767 1.00 45.79  ? 37  VAL F CA  1 
ATOM   3743 C C   . VAL F  1 37 ? 19.736  -14.001 44.401 1.00 48.85  ? 37  VAL F C   1 
ATOM   3744 O O   . VAL F  1 37 ? 20.539  -13.481 43.625 1.00 50.01  ? 37  VAL F O   1 
ATOM   3745 C CB  . VAL F  1 37 ? 17.572  -13.120 43.514 1.00 43.23  ? 37  VAL F CB  1 
ATOM   3746 C CG1 . VAL F  1 37 ? 17.511  -14.409 42.708 1.00 41.44  ? 37  VAL F CG1 1 
ATOM   3747 C CG2 . VAL F  1 37 ? 16.186  -12.642 43.898 1.00 41.47  ? 37  VAL F CG2 1 
ATOM   3748 N N   . LYS F  1 38 ? 19.944  -15.181 44.971 1.00 52.15  ? 38  LYS F N   1 
ATOM   3749 C CA  . LYS F  1 38 ? 21.164  -15.934 44.724 1.00 55.10  ? 38  LYS F CA  1 
ATOM   3750 C C   . LYS F  1 38 ? 21.045  -16.762 43.449 1.00 53.56  ? 38  LYS F C   1 
ATOM   3751 O O   . LYS F  1 38 ? 21.991  -16.831 42.663 1.00 56.44  ? 38  LYS F O   1 
ATOM   3752 C CB  . LYS F  1 38 ? 21.514  -16.809 45.930 1.00 61.40  ? 38  LYS F CB  1 
ATOM   3753 C CG  . LYS F  1 38 ? 22.785  -17.635 45.763 1.00 66.53  ? 38  LYS F CG  1 
ATOM   3754 C CD  . LYS F  1 38 ? 23.317  -18.082 47.115 1.00 72.82  ? 38  LYS F CD  1 
ATOM   3755 C CE  . LYS F  1 38 ? 22.227  -18.743 47.939 1.00 75.83  ? 38  LYS F CE  1 
ATOM   3756 N NZ  . LYS F  1 38 ? 22.683  -19.070 49.320 1.00 78.70  ? 38  LYS F NZ  1 
ATOM   3757 N N   . ALA F  1 39 ? 19.873  -17.360 43.236 1.00 50.97  ? 39  ALA F N   1 
ATOM   3758 C CA  . ALA F  1 39 ? 19.622  -18.203 42.065 1.00 53.69  ? 39  ALA F CA  1 
ATOM   3759 C C   . ALA F  1 39 ? 18.123  -18.405 41.820 1.00 55.11  ? 39  ALA F C   1 
ATOM   3760 O O   . ALA F  1 39 ? 17.327  -18.378 42.758 1.00 56.43  ? 39  ALA F O   1 
ATOM   3761 C CB  . ALA F  1 39 ? 20.325  -19.562 42.224 1.00 58.56  ? 39  ALA F CB  1 
ATOM   3762 N N   . VAL F  1 40 ? 17.738  -18.596 40.561 1.00 56.10  ? 40  VAL F N   1 
ATOM   3763 C CA  . VAL F  1 40 ? 16.367  -18.995 40.254 1.00 59.09  ? 40  VAL F CA  1 
ATOM   3764 C C   . VAL F  1 40 ? 16.362  -20.468 39.866 1.00 58.77  ? 40  VAL F C   1 
ATOM   3765 O O   . VAL F  1 40 ? 17.038  -20.877 38.924 1.00 63.63  ? 40  VAL F O   1 
ATOM   3766 C CB  . VAL F  1 40 ? 15.714  -18.136 39.152 1.00 63.98  ? 40  VAL F CB  1 
ATOM   3767 C CG1 . VAL F  1 40 ? 15.561  -16.698 39.628 1.00 64.35  ? 40  VAL F CG1 1 
ATOM   3768 C CG2 . VAL F  1 40 ? 16.514  -18.204 37.865 1.00 67.46  ? 40  VAL F CG2 1 
ATOM   3769 N N   . ILE F  1 41 ? 15.597  -21.259 40.603 1.00 54.65  ? 41  ILE F N   1 
ATOM   3770 C CA  . ILE F  1 41 ? 15.651  -22.710 40.464 1.00 58.82  ? 41  ILE F CA  1 
ATOM   3771 C C   . ILE F  1 41 ? 15.049  -23.162 39.135 1.00 59.83  ? 41  ILE F C   1 
ATOM   3772 O O   . ILE F  1 41 ? 13.971  -22.708 38.755 1.00 56.34  ? 41  ILE F O   1 
ATOM   3773 C CB  . ILE F  1 41 ? 14.899  -23.384 41.612 1.00 62.35  ? 41  ILE F CB  1 
ATOM   3774 C CG1 . ILE F  1 41 ? 15.146  -22.629 42.926 1.00 64.52  ? 41  ILE F CG1 1 
ATOM   3775 C CG2 . ILE F  1 41 ? 15.288  -24.848 41.713 1.00 64.45  ? 41  ILE F CG2 1 
ATOM   3776 C CD1 . ILE F  1 41 ? 16.610  -22.491 43.320 1.00 65.76  ? 41  ILE F CD1 1 
ATOM   3777 N N   . PRO F  1 42 ? 15.748  -24.056 38.418 1.00 64.23  ? 42  PRO F N   1 
ATOM   3778 C CA  . PRO F  1 42 ? 15.258  -24.538 37.120 1.00 65.28  ? 42  PRO F CA  1 
ATOM   3779 C C   . PRO F  1 42 ? 13.871  -25.162 37.234 1.00 65.11  ? 42  PRO F C   1 
ATOM   3780 O O   . PRO F  1 42 ? 13.611  -25.913 38.173 1.00 67.01  ? 42  PRO F O   1 
ATOM   3781 C CB  . PRO F  1 42 ? 16.290  -25.597 36.723 1.00 70.28  ? 42  PRO F CB  1 
ATOM   3782 C CG  . PRO F  1 42 ? 17.527  -25.229 37.480 1.00 71.29  ? 42  PRO F CG  1 
ATOM   3783 C CD  . PRO F  1 42 ? 17.056  -24.631 38.773 1.00 68.13  ? 42  PRO F CD  1 
ATOM   3784 N N   . GLN F  1 43 ? 12.997  -24.838 36.286 1.00 66.63  ? 43  GLN F N   1 
ATOM   3785 C CA  . GLN F  1 43 ? 11.606  -25.291 36.294 1.00 69.17  ? 43  GLN F CA  1 
ATOM   3786 C C   . GLN F  1 43 ? 10.767  -24.659 37.407 1.00 60.83  ? 43  GLN F C   1 
ATOM   3787 O O   . GLN F  1 43 ? 9.585   -24.979 37.551 1.00 62.09  ? 43  GLN F O   1 
ATOM   3788 C CB  . GLN F  1 43 ? 11.524  -26.815 36.414 1.00 79.59  ? 43  GLN F CB  1 
ATOM   3789 C CG  . GLN F  1 43 ? 12.061  -27.594 35.232 1.00 88.10  ? 43  GLN F CG  1 
ATOM   3790 C CD  . GLN F  1 43 ? 11.923  -29.098 35.441 1.00 97.60  ? 43  GLN F CD  1 
ATOM   3791 O OE1 . GLN F  1 43 ? 11.451  -29.551 36.488 1.00 99.75  ? 43  GLN F OE1 1 
ATOM   3792 N NE2 . GLN F  1 43 ? 12.334  -29.878 34.446 1.00 102.29 ? 43  GLN F NE2 1 
ATOM   3793 N N   . GLY F  1 44 ? 11.369  -23.765 38.190 1.00 51.22  ? 44  GLY F N   1 
ATOM   3794 C CA  . GLY F  1 44 ? 10.695  -23.204 39.349 1.00 44.66  ? 44  GLY F CA  1 
ATOM   3795 C C   . GLY F  1 44 ? 9.769   -22.051 39.004 1.00 45.54  ? 44  GLY F C   1 
ATOM   3796 O O   . GLY F  1 44 ? 9.690   -21.644 37.846 1.00 46.27  ? 44  GLY F O   1 
ATOM   3797 N N   . ALA F  1 45 ? 9.063   -21.540 40.011 1.00 40.59  ? 45  ALA F N   1 
ATOM   3798 C CA  . ALA F  1 45 ? 8.093   -20.465 39.812 1.00 38.89  ? 45  ALA F CA  1 
ATOM   3799 C C   . ALA F  1 45 ? 8.741   -19.208 39.245 1.00 39.25  ? 45  ALA F C   1 
ATOM   3800 O O   . ALA F  1 45 ? 8.296   -18.678 38.226 1.00 37.50  ? 45  ALA F O   1 
ATOM   3801 C CB  . ALA F  1 45 ? 7.367   -20.153 41.123 1.00 36.62  ? 45  ALA F CB  1 
ATOM   3802 N N   . ALA F  1 46 ? 9.791   -18.724 39.901 1.00 39.15  ? 46  ALA F N   1 
ATOM   3803 C CA  . ALA F  1 46 ? 10.428  -17.487 39.449 1.00 32.49  ? 46  ALA F CA  1 
ATOM   3804 C C   . ALA F  1 46 ? 10.983  -17.638 38.030 1.00 35.95  ? 46  ALA F C   1 
ATOM   3805 O O   . ALA F  1 46 ? 10.870  -16.710 37.220 1.00 38.18  ? 46  ALA F O   1 
ATOM   3806 C CB  . ALA F  1 46 ? 11.515  -17.059 40.410 1.00 34.44  ? 46  ALA F CB  1 
ATOM   3807 N N   . GLU F  1 47 ? 11.572  -18.798 37.728 1.00 39.95  ? 47  GLU F N   1 
ATOM   3808 C CA  . GLU F  1 47 ? 12.112  -19.004 36.382 1.00 44.46  ? 47  GLU F CA  1 
ATOM   3809 C C   . GLU F  1 47 ? 11.047  -18.921 35.286 1.00 41.64  ? 47  GLU F C   1 
ATOM   3810 O O   . GLU F  1 47 ? 11.245  -18.250 34.267 1.00 43.24  ? 47  GLU F O   1 
ATOM   3811 C CB  . GLU F  1 47 ? 12.862  -20.335 36.259 1.00 47.54  ? 47  GLU F CB  1 
ATOM   3812 C CG  . GLU F  1 47 ? 13.491  -20.498 34.888 1.00 50.85  ? 47  GLU F CG  1 
ATOM   3813 C CD  . GLU F  1 47 ? 14.124  -21.856 34.676 1.00 59.43  ? 47  GLU F CD  1 
ATOM   3814 O OE1 . GLU F  1 47 ? 13.390  -22.810 34.332 1.00 63.04  ? 47  GLU F OE1 1 
ATOM   3815 O OE2 . GLU F  1 47 ? 15.359  -21.967 34.845 1.00 61.10  ? 47  GLU F OE2 1 
ATOM   3816 N N   . SER F  1 48 ? 9.924   -19.608 35.490 1.00 41.44  ? 48  SER F N   1 
ATOM   3817 C CA  . SER F  1 48 ? 8.841   -19.624 34.507 1.00 41.09  ? 48  SER F CA  1 
ATOM   3818 C C   . SER F  1 48 ? 8.268   -18.234 34.263 1.00 37.95  ? 48  SER F C   1 
ATOM   3819 O O   . SER F  1 48 ? 7.909   -17.884 33.134 1.00 37.24  ? 48  SER F O   1 
ATOM   3820 C CB  . SER F  1 48 ? 7.712   -20.545 34.961 1.00 45.10  ? 48  SER F CB  1 
ATOM   3821 O OG  . SER F  1 48 ? 8.143   -21.894 35.000 1.00 51.22  ? 48  SER F OG  1 
ATOM   3822 N N   . ASP F  1 49 ? 8.166   -17.464 35.340 1.00 36.22  ? 49  ASP F N   1 
ATOM   3823 C CA  . ASP F  1 49 ? 7.614   -16.114 35.265 1.00 34.66  ? 49  ASP F CA  1 
ATOM   3824 C C   . ASP F  1 49 ? 8.550   -15.210 34.466 1.00 35.59  ? 49  ASP F C   1 
ATOM   3825 O O   . ASP F  1 49 ? 8.094   -14.428 33.626 1.00 35.97  ? 49  ASP F O   1 
ATOM   3826 C CB  . ASP F  1 49 ? 7.372   -15.577 36.670 1.00 33.53  ? 49  ASP F CB  1 
ATOM   3827 C CG  . ASP F  1 49 ? 6.984   -14.116 36.669 1.00 34.86  ? 49  ASP F CG  1 
ATOM   3828 O OD1 . ASP F  1 49 ? 7.880   -13.282 36.894 1.00 33.10  ? 49  ASP F OD1 1 
ATOM   3829 O OD2 . ASP F  1 49 ? 5.799   -13.808 36.434 1.00 36.52  ? 49  ASP F OD2 1 
ATOM   3830 N N   . GLY F  1 50 ? 9.852   -15.313 34.729 1.00 37.89  ? 50  GLY F N   1 
ATOM   3831 C CA  . GLY F  1 50 ? 10.859  -14.665 33.899 1.00 37.86  ? 50  GLY F CA  1 
ATOM   3832 C C   . GLY F  1 50 ? 11.245  -13.241 34.276 1.00 39.32  ? 50  GLY F C   1 
ATOM   3833 O O   . GLY F  1 50 ? 12.037  -12.611 33.570 1.00 41.94  ? 50  GLY F O   1 
ATOM   3834 N N   . ARG F  1 51 ? 10.692  -12.720 35.369 1.00 34.85  ? 51  ARG F N   1 
ATOM   3835 C CA  . ARG F  1 51 ? 10.949  -11.333 35.763 1.00 30.04  ? 51  ARG F CA  1 
ATOM   3836 C C   . ARG F  1 51 ? 12.020  -11.146 36.819 1.00 32.16  ? 51  ARG F C   1 
ATOM   3837 O O   . ARG F  1 51 ? 12.481  -10.029 37.043 1.00 34.73  ? 51  ARG F O   1 
ATOM   3838 C CB  . ARG F  1 51 ? 9.661   -10.655 36.234 1.00 27.56  ? 51  ARG F CB  1 
ATOM   3839 C CG  . ARG F  1 51 ? 8.736   -10.281 35.079 1.00 25.95  ? 51  ARG F CG  1 
ATOM   3840 C CD  . ARG F  1 51 ? 7.436   -9.683  35.588 1.00 25.05  ? 51  ARG F CD  1 
ATOM   3841 N NE  . ARG F  1 51 ? 6.564   -10.701 36.176 1.00 27.00  ? 51  ARG F NE  1 
ATOM   3842 C CZ  . ARG F  1 51 ? 5.375   -10.429 36.694 1.00 26.33  ? 51  ARG F CZ  1 
ATOM   3843 N NH1 . ARG F  1 51 ? 4.926   -9.177  36.683 1.00 27.61  ? 51  ARG F NH1 1 
ATOM   3844 N NH2 . ARG F  1 51 ? 4.616   -11.393 37.182 1.00 26.21  ? 51  ARG F NH2 1 
ATOM   3845 N N   . ILE F  1 52 ? 12.390  -12.226 37.499 1.00 32.13  ? 52  ILE F N   1 
ATOM   3846 C CA  . ILE F  1 52 ? 13.339  -12.128 38.592 1.00 33.90  ? 52  ILE F CA  1 
ATOM   3847 C C   . ILE F  1 52 ? 14.592  -12.898 38.226 1.00 38.90  ? 52  ILE F C   1 
ATOM   3848 O O   . ILE F  1 52 ? 14.512  -14.002 37.679 1.00 41.93  ? 52  ILE F O   1 
ATOM   3849 C CB  . ILE F  1 52 ? 12.733  -12.700 39.888 1.00 33.06  ? 52  ILE F CB  1 
ATOM   3850 C CG1 . ILE F  1 52 ? 11.557  -11.801 40.317 1.00 33.33  ? 52  ILE F CG1 1 
ATOM   3851 C CG2 . ILE F  1 52 ? 13.800  -12.805 40.978 1.00 35.53  ? 52  ILE F CG2 1 
ATOM   3852 C CD1 . ILE F  1 52 ? 10.671  -12.410 41.411 1.00 37.86  ? 52  ILE F CD1 1 
ATOM   3853 N N   . HIS F  1 53 ? 15.749  -12.321 38.526 1.00 38.56  ? 53  HIS F N   1 
ATOM   3854 C CA  . HIS F  1 53 ? 17.010  -12.979 38.213 1.00 41.09  ? 53  HIS F CA  1 
ATOM   3855 C C   . HIS F  1 53 ? 18.038  -12.823 39.314 1.00 42.79  ? 53  HIS F C   1 
ATOM   3856 O O   . HIS F  1 53 ? 17.918  -11.954 40.174 1.00 41.52  ? 53  HIS F O   1 
ATOM   3857 C CB  . HIS F  1 53 ? 17.552  -12.420 36.899 1.00 40.31  ? 53  HIS F CB  1 
ATOM   3858 C CG  . HIS F  1 53 ? 16.609  -12.579 35.753 1.00 42.82  ? 53  HIS F CG  1 
ATOM   3859 N ND1 . HIS F  1 53 ? 15.680  -11.619 35.415 1.00 41.13  ? 53  HIS F ND1 1 
ATOM   3860 C CD2 . HIS F  1 53 ? 16.435  -13.597 34.879 1.00 44.68  ? 53  HIS F CD2 1 
ATOM   3861 C CE1 . HIS F  1 53 ? 14.982  -12.034 34.372 1.00 42.37  ? 53  HIS F CE1 1 
ATOM   3862 N NE2 . HIS F  1 53 ? 15.419  -13.234 34.032 1.00 42.95  ? 53  HIS F NE2 1 
ATOM   3863 N N   . LYS F  1 54 ? 19.044  -13.695 39.305 1.00 44.93  ? 54  LYS F N   1 
ATOM   3864 C CA  . LYS F  1 54 ? 20.164  -13.544 40.212 1.00 45.97  ? 54  LYS F CA  1 
ATOM   3865 C C   . LYS F  1 54 ? 20.625  -12.091 40.239 1.00 44.81  ? 54  LYS F C   1 
ATOM   3866 O O   . LYS F  1 54 ? 20.733  -11.441 39.198 1.00 43.61  ? 54  LYS F O   1 
ATOM   3867 C CB  . LYS F  1 54 ? 21.313  -14.454 39.774 1.00 50.87  ? 54  LYS F CB  1 
ATOM   3868 C CG  . LYS F  1 54 ? 22.590  -14.262 40.573 1.00 54.22  ? 54  LYS F CG  1 
ATOM   3869 C CD  . LYS F  1 54 ? 23.658  -15.249 40.124 1.00 61.38  ? 54  LYS F CD  1 
ATOM   3870 C CE  . LYS F  1 54 ? 25.016  -14.885 40.689 1.00 66.84  ? 54  LYS F CE  1 
ATOM   3871 N NZ  . LYS F  1 54 ? 26.084  -15.774 40.164 1.00 72.11  ? 54  LYS F NZ  1 
ATOM   3872 N N   . GLY F  1 55 ? 20.906  -11.578 41.431 1.00 46.09  ? 55  GLY F N   1 
ATOM   3873 C CA  . GLY F  1 55 ? 21.398  -10.220 41.540 1.00 43.07  ? 55  GLY F CA  1 
ATOM   3874 C C   . GLY F  1 55 ? 20.317  -9.205  41.866 1.00 41.04  ? 55  GLY F C   1 
ATOM   3875 O O   . GLY F  1 55 ? 20.616  -8.124  42.369 1.00 41.58  ? 55  GLY F O   1 
ATOM   3876 N N   . ASP F  1 56 ? 19.061  -9.523  41.583 1.00 39.23  ? 56  ASP F N   1 
ATOM   3877 C CA  . ASP F  1 56 ? 17.998  -8.598  41.975 1.00 39.27  ? 56  ASP F CA  1 
ATOM   3878 C C   . ASP F  1 56 ? 17.948  -8.495  43.489 1.00 39.91  ? 56  ASP F C   1 
ATOM   3879 O O   . ASP F  1 56 ? 18.227  -9.471  44.187 1.00 41.37  ? 56  ASP F O   1 
ATOM   3880 C CB  . ASP F  1 56 ? 16.635  -9.044  41.450 1.00 39.50  ? 56  ASP F CB  1 
ATOM   3881 C CG  . ASP F  1 56 ? 16.533  -8.976  39.942 1.00 37.22  ? 56  ASP F CG  1 
ATOM   3882 O OD1 . ASP F  1 56 ? 15.618  -9.622  39.393 1.00 35.57  ? 56  ASP F OD1 1 
ATOM   3883 O OD2 . ASP F  1 56 ? 17.359  -8.289  39.299 1.00 38.40  ? 56  ASP F OD2 1 
ATOM   3884 N N   . ARG F  1 57 ? 17.599  -7.318  44.007 1.00 40.34  ? 57  ARG F N   1 
ATOM   3885 C CA  . ARG F  1 57 ? 17.476  -7.166  45.459 1.00 39.32  ? 57  ARG F CA  1 
ATOM   3886 C C   . ARG F  1 57 ? 16.013  -7.299  45.862 1.00 38.20  ? 57  ARG F C   1 
ATOM   3887 O O   . ARG F  1 57 ? 15.130  -6.751  45.204 1.00 37.78  ? 57  ARG F O   1 
ATOM   3888 C CB  . ARG F  1 57 ? 18.022  -5.813  45.925 1.00 44.26  ? 57  ARG F CB  1 
ATOM   3889 C CG  . ARG F  1 57 ? 18.103  -5.672  47.455 1.00 44.43  ? 57  ARG F CG  1 
ATOM   3890 C CD  . ARG F  1 57 ? 18.646  -4.308  47.857 1.00 48.44  ? 57  ARG F CD  1 
ATOM   3891 N NE  . ARG F  1 57 ? 18.715  -4.137  49.304 1.00 51.99  ? 57  ARG F NE  1 
ATOM   3892 C CZ  . ARG F  1 57 ? 19.477  -3.232  49.909 1.00 57.53  ? 57  ARG F CZ  1 
ATOM   3893 N NH1 . ARG F  1 57 ? 20.241  -2.422  49.187 1.00 55.76  ? 57  ARG F NH1 1 
ATOM   3894 N NH2 . ARG F  1 57 ? 19.490  -3.146  51.236 1.00 61.64  ? 57  ARG F NH2 1 
ATOM   3895 N N   . VAL F  1 58 ? 15.754  -8.031  46.940 1.00 35.48  ? 58  VAL F N   1 
ATOM   3896 C CA  . VAL F  1 58 ? 14.391  -8.187  47.428 1.00 36.41  ? 58  VAL F CA  1 
ATOM   3897 C C   . VAL F  1 58 ? 14.153  -7.143  48.497 1.00 38.65  ? 58  VAL F C   1 
ATOM   3898 O O   . VAL F  1 58 ? 14.758  -7.189  49.563 1.00 42.85  ? 58  VAL F O   1 
ATOM   3899 C CB  . VAL F  1 58 ? 14.164  -9.584  48.047 1.00 40.58  ? 58  VAL F CB  1 
ATOM   3900 C CG1 . VAL F  1 58 ? 12.711  -9.734  48.479 1.00 39.89  ? 58  VAL F CG1 1 
ATOM   3901 C CG2 . VAL F  1 58 ? 14.560  -10.672 47.072 1.00 40.66  ? 58  VAL F CG2 1 
ATOM   3902 N N   . LEU F  1 59 ? 13.278  -6.189  48.209 1.00 37.82  ? 59  LEU F N   1 
ATOM   3903 C CA  . LEU F  1 59 ? 13.086  -5.053  49.098 1.00 37.10  ? 59  LEU F CA  1 
ATOM   3904 C C   . LEU F  1 59 ? 11.995  -5.308  50.126 1.00 38.77  ? 59  LEU F C   1 
ATOM   3905 O O   . LEU F  1 59 ? 12.090  -4.856  51.265 1.00 38.50  ? 59  LEU F O   1 
ATOM   3906 C CB  . LEU F  1 59 ? 12.775  -3.788  48.286 1.00 36.72  ? 59  LEU F CB  1 
ATOM   3907 C CG  . LEU F  1 59 ? 13.936  -3.304  47.415 1.00 38.41  ? 59  LEU F CG  1 
ATOM   3908 C CD1 . LEU F  1 59 ? 13.502  -2.142  46.537 1.00 35.90  ? 59  LEU F CD1 1 
ATOM   3909 C CD2 . LEU F  1 59 ? 15.106  -2.899  48.307 1.00 39.90  ? 59  LEU F CD2 1 
ATOM   3910 N N   . ALA F  1 60 ? 10.963  -6.042  49.726 1.00 36.74  ? 60  ALA F N   1 
ATOM   3911 C CA  . ALA F  1 60 ? 9.812   -6.253  50.592 1.00 33.91  ? 60  ALA F CA  1 
ATOM   3912 C C   . ALA F  1 60 ? 9.033   -7.495  50.175 1.00 32.64  ? 60  ALA F C   1 
ATOM   3913 O O   . ALA F  1 60 ? 9.126   -7.935  49.033 1.00 31.81  ? 60  ALA F O   1 
ATOM   3914 C CB  . ALA F  1 60 ? 8.914   -5.042  50.583 1.00 33.13  ? 60  ALA F CB  1 
ATOM   3915 N N   . VAL F  1 61 ? 8.292   -8.063  51.126 1.00 33.28  ? 61  VAL F N   1 
ATOM   3916 C CA  . VAL F  1 61 ? 7.431   -9.220  50.876 1.00 32.62  ? 61  VAL F CA  1 
ATOM   3917 C C   . VAL F  1 61 ? 6.030   -8.977  51.446 1.00 31.99  ? 61  VAL F C   1 
ATOM   3918 O O   . VAL F  1 61 ? 5.875   -8.732  52.637 1.00 37.88  ? 61  VAL F O   1 
ATOM   3919 C CB  . VAL F  1 61 ? 8.026   -10.475 51.530 1.00 37.61  ? 61  VAL F CB  1 
ATOM   3920 C CG1 . VAL F  1 61 ? 7.114   -11.674 51.313 1.00 38.24  ? 61  VAL F CG1 1 
ATOM   3921 C CG2 . VAL F  1 61 ? 9.418   -10.734 50.979 1.00 38.26  ? 61  VAL F CG2 1 
ATOM   3922 N N   . ASN F  1 62 ? 5.012   -9.042  50.595 1.00 32.22  ? 62  ASN F N   1 
ATOM   3923 C CA  . ASN F  1 62 ? 3.632   -8.772  51.018 1.00 33.54  ? 62  ASN F CA  1 
ATOM   3924 C C   . ASN F  1 62 ? 3.466   -7.480  51.807 1.00 34.36  ? 62  ASN F C   1 
ATOM   3925 O O   . ASN F  1 62 ? 2.757   -7.416  52.818 1.00 34.90  ? 62  ASN F O   1 
ATOM   3926 C CB  . ASN F  1 62 ? 3.054   -9.957  51.795 1.00 33.81  ? 62  ASN F CB  1 
ATOM   3927 C CG  . ASN F  1 62 ? 2.789   -11.149 50.907 1.00 32.76  ? 62  ASN F CG  1 
ATOM   3928 O OD1 . ASN F  1 62 ? 2.762   -11.028 49.689 1.00 33.96  ? 62  ASN F OD1 1 
ATOM   3929 N ND2 . ASN F  1 62 ? 2.599   -12.321 51.524 1.00 36.57  ? 62  ASN F ND2 1 
ATOM   3930 N N   . GLY F  1 63 ? 4.131   -6.438  51.343 1.00 32.14  ? 63  GLY F N   1 
ATOM   3931 C CA  . GLY F  1 63 ? 3.936   -5.135  51.936 1.00 33.25  ? 63  GLY F CA  1 
ATOM   3932 C C   . GLY F  1 63 ? 4.900   -4.792  53.044 1.00 32.68  ? 63  GLY F C   1 
ATOM   3933 O O   . GLY F  1 63 ? 4.908   -3.650  53.486 1.00 35.47  ? 63  GLY F O   1 
ATOM   3934 N N   . VAL F  1 64 ? 5.696   -5.761  53.499 1.00 34.07  ? 64  VAL F N   1 
ATOM   3935 C CA  . VAL F  1 64 ? 6.591   -5.541  54.628 1.00 34.38  ? 64  VAL F CA  1 
ATOM   3936 C C   . VAL F  1 64 ? 8.063   -5.542  54.221 1.00 37.79  ? 64  VAL F C   1 
ATOM   3937 O O   . VAL F  1 64 ? 8.553   -6.500  53.627 1.00 37.67  ? 64  VAL F O   1 
ATOM   3938 C CB  . VAL F  1 64 ? 6.348   -6.595  55.712 1.00 35.89  ? 64  VAL F CB  1 
ATOM   3939 C CG1 . VAL F  1 64 ? 7.252   -6.335  56.931 1.00 38.88  ? 64  VAL F CG1 1 
ATOM   3940 C CG2 . VAL F  1 64 ? 4.885   -6.571  56.103 1.00 36.64  ? 64  VAL F CG2 1 
ATOM   3941 N N   . SER F  1 65 ? 8.771   -4.473  54.584 1.00 39.01  ? 65  SER F N   1 
ATOM   3942 C CA  . SER F  1 65 ? 10.187  -4.323  54.247 1.00 39.35  ? 65  SER F CA  1 
ATOM   3943 C C   . SER F  1 65 ? 11.060  -5.413  54.855 1.00 42.30  ? 65  SER F C   1 
ATOM   3944 O O   . SER F  1 65 ? 10.802  -5.902  55.962 1.00 46.78  ? 65  SER F O   1 
ATOM   3945 C CB  . SER F  1 65 ? 10.698  -2.943  54.688 1.00 45.71  ? 65  SER F CB  1 
ATOM   3946 O OG  . SER F  1 65 ? 12.105  -2.847  54.541 1.00 46.86  ? 65  SER F OG  1 
ATOM   3947 N N   . LEU F  1 66 ? 12.102  -5.802  54.125 1.00 45.05  ? 66  LEU F N   1 
ATOM   3948 C CA  . LEU F  1 66 ? 13.093  -6.736  54.657 1.00 48.54  ? 66  LEU F CA  1 
ATOM   3949 C C   . LEU F  1 66 ? 14.215  -5.994  55.391 1.00 53.03  ? 66  LEU F C   1 
ATOM   3950 O O   . LEU F  1 66 ? 15.251  -6.571  55.709 1.00 54.28  ? 66  LEU F O   1 
ATOM   3951 C CB  . LEU F  1 66 ? 13.679  -7.594  53.535 1.00 48.76  ? 66  LEU F CB  1 
ATOM   3952 C CG  . LEU F  1 66 ? 12.751  -8.622  52.898 1.00 47.06  ? 66  LEU F CG  1 
ATOM   3953 C CD1 . LEU F  1 66 ? 13.512  -9.436  51.867 1.00 48.41  ? 66  LEU F CD1 1 
ATOM   3954 C CD2 . LEU F  1 66 ? 12.154  -9.523  53.964 1.00 50.51  ? 66  LEU F CD2 1 
ATOM   3955 N N   . GLU F  1 67 ? 14.001  -4.712  55.658 1.00 55.65  ? 67  GLU F N   1 
ATOM   3956 C CA  . GLU F  1 67 ? 15.056  -3.865  56.195 1.00 60.32  ? 67  GLU F CA  1 
ATOM   3957 C C   . GLU F  1 67 ? 15.453  -4.296  57.597 1.00 61.65  ? 67  GLU F C   1 
ATOM   3958 O O   . GLU F  1 67 ? 14.603  -4.438  58.476 1.00 61.13  ? 67  GLU F O   1 
ATOM   3959 C CB  . GLU F  1 67 ? 14.618  -2.401  56.194 1.00 66.23  ? 67  GLU F CB  1 
ATOM   3960 C CG  . GLU F  1 67 ? 15.733  -1.411  56.477 1.00 72.92  ? 67  GLU F CG  1 
ATOM   3961 C CD  . GLU F  1 67 ? 15.566  -0.720  57.810 1.00 80.50  ? 67  GLU F CD  1 
ATOM   3962 O OE1 . GLU F  1 67 ? 16.323  0.236   58.080 1.00 83.39  ? 67  GLU F OE1 1 
ATOM   3963 O OE2 . GLU F  1 67 ? 14.676  -1.131  58.589 1.00 82.96  ? 67  GLU F OE2 1 
ATOM   3964 N N   . GLY F  1 68 ? 16.749  -4.508  57.796 1.00 62.41  ? 68  GLY F N   1 
ATOM   3965 C CA  . GLY F  1 68 ? 17.261  -4.918  59.089 1.00 63.33  ? 68  GLY F CA  1 
ATOM   3966 C C   . GLY F  1 68 ? 17.106  -6.405  59.349 1.00 62.97  ? 68  GLY F C   1 
ATOM   3967 O O   . GLY F  1 68 ? 17.472  -6.898  60.415 1.00 63.48  ? 68  GLY F O   1 
ATOM   3968 N N   . ALA F  1 69 ? 16.571  -7.127  58.369 1.00 60.10  ? 69  ALA F N   1 
ATOM   3969 C CA  . ALA F  1 69 ? 16.380  -8.567  58.509 1.00 58.42  ? 69  ALA F CA  1 
ATOM   3970 C C   . ALA F  1 69 ? 17.702  -9.313  58.405 1.00 60.70  ? 69  ALA F C   1 
ATOM   3971 O O   . ALA F  1 69 ? 18.544  -8.986  57.566 1.00 58.83  ? 69  ALA F O   1 
ATOM   3972 C CB  . ALA F  1 69 ? 15.403  -9.079  57.456 1.00 58.45  ? 69  ALA F CB  1 
ATOM   3973 N N   . THR F  1 70 ? 17.881  -10.312 59.266 1.00 62.42  ? 70  THR F N   1 
ATOM   3974 C CA  . THR F  1 70 ? 18.998  -11.239 59.142 1.00 65.47  ? 70  THR F CA  1 
ATOM   3975 C C   . THR F  1 70 ? 18.662  -12.237 58.046 1.00 63.30  ? 70  THR F C   1 
ATOM   3976 O O   . THR F  1 70 ? 17.523  -12.282 57.584 1.00 63.52  ? 70  THR F O   1 
ATOM   3977 C CB  . THR F  1 70 ? 19.250  -12.026 60.446 1.00 68.57  ? 70  THR F CB  1 
ATOM   3978 O OG1 . THR F  1 70 ? 18.137  -12.887 60.719 1.00 67.46  ? 70  THR F OG1 1 
ATOM   3979 C CG2 . THR F  1 70 ? 19.458  -11.083 61.624 1.00 71.48  ? 70  THR F CG2 1 
ATOM   3980 N N   . HIS F  1 71 ? 19.643  -13.038 57.639 1.00 64.74  ? 71  HIS F N   1 
ATOM   3981 C CA  . HIS F  1 71 ? 19.412  -14.072 56.633 1.00 66.11  ? 71  HIS F CA  1 
ATOM   3982 C C   . HIS F  1 71 ? 18.254  -14.995 57.017 1.00 62.84  ? 71  HIS F C   1 
ATOM   3983 O O   . HIS F  1 71 ? 17.263  -15.087 56.302 1.00 59.30  ? 71  HIS F O   1 
ATOM   3984 C CB  . HIS F  1 71 ? 20.678  -14.893 56.376 1.00 75.53  ? 71  HIS F CB  1 
ATOM   3985 C CG  . HIS F  1 71 ? 20.589  -15.767 55.163 1.00 83.31  ? 71  HIS F CG  1 
ATOM   3986 N ND1 . HIS F  1 71 ? 21.342  -15.548 54.028 1.00 85.92  ? 71  HIS F ND1 1 
ATOM   3987 C CD2 . HIS F  1 71 ? 19.819  -16.849 54.898 1.00 86.33  ? 71  HIS F CD2 1 
ATOM   3988 C CE1 . HIS F  1 71 ? 21.052  -16.467 53.125 1.00 87.21  ? 71  HIS F CE1 1 
ATOM   3989 N NE2 . HIS F  1 71 ? 20.131  -17.269 53.628 1.00 87.51  ? 71  HIS F NE2 1 
ATOM   3990 N N   . LYS F  1 72 ? 18.376  -15.677 58.152 1.00 62.27  ? 72  LYS F N   1 
ATOM   3991 C CA  . LYS F  1 72 ? 17.315  -16.574 58.600 1.00 65.27  ? 72  LYS F CA  1 
ATOM   3992 C C   . LYS F  1 72 ? 15.950  -15.889 58.549 1.00 62.47  ? 72  LYS F C   1 
ATOM   3993 O O   . LYS F  1 72 ? 14.967  -16.470 58.091 1.00 62.29  ? 72  LYS F O   1 
ATOM   3994 C CB  . LYS F  1 72 ? 17.590  -17.060 60.025 1.00 69.32  ? 72  LYS F CB  1 
ATOM   3995 C CG  . LYS F  1 72 ? 19.054  -17.145 60.368 1.00 74.64  ? 72  LYS F CG  1 
ATOM   3996 C CD  . LYS F  1 72 ? 19.262  -17.418 61.855 1.00 80.03  ? 72  LYS F CD  1 
ATOM   3997 C CE  . LYS F  1 72 ? 20.737  -17.417 62.221 1.00 83.45  ? 72  LYS F CE  1 
ATOM   3998 N NZ  . LYS F  1 72 ? 20.971  -17.847 63.640 1.00 87.24  ? 72  LYS F NZ  1 
ATOM   3999 N N   . GLN F  1 73 ? 15.899  -14.647 59.020 1.00 62.37  ? 73  GLN F N   1 
ATOM   4000 C CA  . GLN F  1 73 ? 14.639  -13.921 59.128 1.00 61.06  ? 73  GLN F CA  1 
ATOM   4001 C C   . GLN F  1 73 ? 14.019  -13.662 57.765 1.00 57.51  ? 73  GLN F C   1 
ATOM   4002 O O   . GLN F  1 73 ? 12.802  -13.709 57.611 1.00 57.21  ? 73  GLN F O   1 
ATOM   4003 C CB  . GLN F  1 73 ? 14.840  -12.593 59.856 1.00 64.23  ? 73  GLN F CB  1 
ATOM   4004 C CG  . GLN F  1 73 ? 15.154  -12.736 61.331 1.00 70.85  ? 73  GLN F CG  1 
ATOM   4005 C CD  . GLN F  1 73 ? 15.399  -11.399 61.995 1.00 71.80  ? 73  GLN F CD  1 
ATOM   4006 O OE1 . GLN F  1 73 ? 15.758  -10.423 61.339 1.00 67.73  ? 73  GLN F OE1 1 
ATOM   4007 N NE2 . GLN F  1 73 ? 15.218  -11.351 63.310 1.00 77.32  ? 73  GLN F NE2 1 
ATOM   4008 N N   . ALA F  1 74 ? 14.866  -13.370 56.786 1.00 54.30  ? 74  ALA F N   1 
ATOM   4009 C CA  . ALA F  1 74 ? 14.406  -13.111 55.429 1.00 54.24  ? 74  ALA F CA  1 
ATOM   4010 C C   . ALA F  1 74 ? 13.890  -14.402 54.802 1.00 55.32  ? 74  ALA F C   1 
ATOM   4011 O O   . ALA F  1 74 ? 12.843  -14.423 54.152 1.00 51.95  ? 74  ALA F O   1 
ATOM   4012 C CB  . ALA F  1 74 ? 15.537  -12.534 54.598 1.00 52.65  ? 74  ALA F CB  1 
ATOM   4013 N N   . VAL F  1 75 ? 14.640  -15.478 55.001 1.00 57.44  ? 75  VAL F N   1 
ATOM   4014 C CA  . VAL F  1 75 ? 14.277  -16.774 54.444 1.00 59.33  ? 75  VAL F CA  1 
ATOM   4015 C C   . VAL F  1 75 ? 12.940  -17.252 54.982 1.00 60.08  ? 75  VAL F C   1 
ATOM   4016 O O   . VAL F  1 75 ? 12.157  -17.859 54.257 1.00 56.23  ? 75  VAL F O   1 
ATOM   4017 C CB  . VAL F  1 75 ? 15.339  -17.831 54.763 1.00 60.36  ? 75  VAL F CB  1 
ATOM   4018 C CG1 . VAL F  1 75 ? 14.818  -19.226 54.418 1.00 61.52  ? 75  VAL F CG1 1 
ATOM   4019 C CG2 . VAL F  1 75 ? 16.627  -17.524 54.017 1.00 60.95  ? 75  VAL F CG2 1 
ATOM   4020 N N   . GLU F  1 76 ? 12.687  -16.999 56.263 1.00 62.79  ? 76  GLU F N   1 
ATOM   4021 C CA  . GLU F  1 76 ? 11.415  -17.391 56.850 1.00 66.28  ? 76  GLU F CA  1 
ATOM   4022 C C   . GLU F  1 76 ? 10.286  -16.444 56.438 1.00 61.94  ? 76  GLU F C   1 
ATOM   4023 O O   . GLU F  1 76 ? 9.150   -16.878 56.257 1.00 61.08  ? 76  GLU F O   1 
ATOM   4024 C CB  . GLU F  1 76 ? 11.514  -17.495 58.373 1.00 76.14  ? 76  GLU F CB  1 
ATOM   4025 C CG  . GLU F  1 76 ? 10.778  -18.705 58.947 1.00 84.56  ? 76  GLU F CG  1 
ATOM   4026 C CD  . GLU F  1 76 ? 11.268  -20.032 58.367 1.00 91.25  ? 76  GLU F CD  1 
ATOM   4027 O OE1 . GLU F  1 76 ? 12.497  -20.202 58.203 1.00 92.45  ? 76  GLU F OE1 1 
ATOM   4028 O OE2 . GLU F  1 76 ? 10.423  -20.909 58.080 1.00 94.16  ? 76  GLU F OE2 1 
ATOM   4029 N N   . THR F  1 77 ? 10.596  -15.157 56.293 1.00 59.12  ? 77  THR F N   1 
ATOM   4030 C CA  . THR F  1 77 ? 9.594   -14.187 55.863 1.00 55.76  ? 77  THR F CA  1 
ATOM   4031 C C   . THR F  1 77 ? 9.008   -14.627 54.522 1.00 53.95  ? 77  THR F C   1 
ATOM   4032 O O   . THR F  1 77 ? 7.807   -14.493 54.284 1.00 54.31  ? 77  THR F O   1 
ATOM   4033 C CB  . THR F  1 77 ? 10.176  -12.753 55.759 1.00 49.51  ? 77  THR F CB  1 
ATOM   4034 O OG1 . THR F  1 77 ? 10.465  -12.246 57.070 1.00 52.47  ? 77  THR F OG1 1 
ATOM   4035 C CG2 . THR F  1 77 ? 9.183   -11.806 55.047 1.00 48.02  ? 77  THR F CG2 1 
ATOM   4036 N N   . LEU F  1 78 ? 9.866   -15.166 53.660 1.00 54.20  ? 78  LEU F N   1 
ATOM   4037 C CA  . LEU F  1 78 ? 9.460   -15.630 52.332 1.00 51.98  ? 78  LEU F CA  1 
ATOM   4038 C C   . LEU F  1 78 ? 8.650   -16.925 52.387 1.00 55.54  ? 78  LEU F C   1 
ATOM   4039 O O   . LEU F  1 78 ? 7.801   -17.162 51.532 1.00 55.34  ? 78  LEU F O   1 
ATOM   4040 C CB  . LEU F  1 78 ? 10.684  -15.849 51.435 1.00 50.75  ? 78  LEU F CB  1 
ATOM   4041 C CG  . LEU F  1 78 ? 11.438  -14.637 50.881 1.00 47.45  ? 78  LEU F CG  1 
ATOM   4042 C CD1 . LEU F  1 78 ? 12.787  -15.051 50.316 1.00 48.75  ? 78  LEU F CD1 1 
ATOM   4043 C CD2 . LEU F  1 78 ? 10.605  -13.905 49.830 1.00 41.86  ? 78  LEU F CD2 1 
ATOM   4044 N N   . ARG F  1 79 ? 8.919   -17.760 53.386 1.00 60.35  ? 79  ARG F N   1 
ATOM   4045 C CA  . ARG F  1 79 ? 8.257   -19.059 53.492 1.00 64.96  ? 79  ARG F CA  1 
ATOM   4046 C C   . ARG F  1 79 ? 6.864   -18.963 54.103 1.00 61.82  ? 79  ARG F C   1 
ATOM   4047 O O   . ARG F  1 79 ? 5.965   -19.713 53.728 1.00 61.01  ? 79  ARG F O   1 
ATOM   4048 C CB  . ARG F  1 79 ? 9.111   -20.047 54.299 1.00 74.78  ? 79  ARG F CB  1 
ATOM   4049 C CG  . ARG F  1 79 ? 10.376  -20.504 53.587 1.00 82.90  ? 79  ARG F CG  1 
ATOM   4050 C CD  . ARG F  1 79 ? 10.944  -21.776 54.204 1.00 93.46  ? 79  ARG F CD  1 
ATOM   4051 N NE  . ARG F  1 79 ? 11.933  -22.404 53.328 1.00 99.93  ? 79  ARG F NE  1 
ATOM   4052 C CZ  . ARG F  1 79 ? 12.554  -23.552 53.591 1.00 107.48 ? 79  ARG F CZ  1 
ATOM   4053 N NH1 . ARG F  1 79 ? 12.296  -24.215 54.714 1.00 110.87 ? 79  ARG F NH1 1 
ATOM   4054 N NH2 . ARG F  1 79 ? 13.437  -24.039 52.728 1.00 109.37 ? 79  ARG F NH2 1 
ATOM   4055 N N   . ASN F  1 80 ? 6.696   -18.044 55.050 1.00 63.04  ? 80  ASN F N   1 
ATOM   4056 C CA  . ASN F  1 80 ? 5.429   -17.881 55.755 1.00 67.34  ? 80  ASN F CA  1 
ATOM   4057 C C   . ASN F  1 80 ? 4.489   -16.941 55.007 1.00 62.75  ? 80  ASN F C   1 
ATOM   4058 O O   . ASN F  1 80 ? 4.182   -15.829 55.449 1.00 60.57  ? 80  ASN F O   1 
ATOM   4059 C CB  . ASN F  1 80 ? 5.673   -17.419 57.192 1.00 77.06  ? 80  ASN F CB  1 
ATOM   4060 C CG  . ASN F  1 80 ? 6.468   -18.440 58.004 1.00 87.75  ? 80  ASN F CG  1 
ATOM   4061 O OD1 . ASN F  1 80 ? 7.373   -18.082 58.762 1.00 91.86  ? 80  ASN F OD1 1 
ATOM   4062 N ND2 . ASN F  1 80 ? 6.138   -19.719 57.839 1.00 91.82  ? 80  ASN F ND2 1 
ATOM   4063 N N   . THR F  1 81 ? 4.052   -17.414 53.848 1.00 57.38  ? 81  THR F N   1 
ATOM   4064 C CA  . THR F  1 81 ? 3.177   -16.667 52.965 1.00 48.95  ? 81  THR F CA  1 
ATOM   4065 C C   . THR F  1 81 ? 2.172   -17.649 52.379 1.00 44.97  ? 81  THR F C   1 
ATOM   4066 O O   . THR F  1 81 ? 2.228   -18.846 52.660 1.00 50.23  ? 81  THR F O   1 
ATOM   4067 C CB  . THR F  1 81 ? 3.974   -16.018 51.824 1.00 48.62  ? 81  THR F CB  1 
ATOM   4068 O OG1 . THR F  1 81 ? 4.866   -16.984 51.260 1.00 51.76  ? 81  THR F OG1 1 
ATOM   4069 C CG2 . THR F  1 81 ? 4.786   -14.830 52.330 1.00 49.28  ? 81  THR F CG2 1 
ATOM   4070 N N   . GLY F  1 82 ? 1.254   -17.144 51.569 1.00 44.92  ? 82  GLY F N   1 
ATOM   4071 C CA  . GLY F  1 82 ? 0.279   -17.997 50.924 1.00 44.02  ? 82  GLY F CA  1 
ATOM   4072 C C   . GLY F  1 82 ? 0.735   -18.402 49.536 1.00 44.94  ? 82  GLY F C   1 
ATOM   4073 O O   . GLY F  1 82 ? 1.902   -18.255 49.169 1.00 43.91  ? 82  GLY F O   1 
ATOM   4074 N N   . GLN F  1 83 ? -0.214  -18.879 48.750 1.00 43.92  ? 83  GLN F N   1 
ATOM   4075 C CA  . GLN F  1 83 ? 0.052   -19.409 47.428 1.00 44.18  ? 83  GLN F CA  1 
ATOM   4076 C C   . GLN F  1 83 ? 0.594   -18.367 46.409 1.00 39.96  ? 83  GLN F C   1 
ATOM   4077 O O   . GLN F  1 83 ? 1.437   -18.697 45.566 1.00 43.54  ? 83  GLN F O   1 
ATOM   4078 C CB  . GLN F  1 83 ? -1.210  -20.122 46.925 1.00 46.81  ? 83  GLN F CB  1 
ATOM   4079 C CG  . GLN F  1 83 ? -1.191  -20.475 45.449 1.00 53.29  ? 83  GLN F CG  1 
ATOM   4080 C CD  . GLN F  1 83 ? -0.006  -21.332 45.074 1.00 54.47  ? 83  GLN F CD  1 
ATOM   4081 O OE1 . GLN F  1 83 ? 0.581   -21.994 45.918 1.00 53.41  ? 83  GLN F OE1 1 
ATOM   4082 N NE2 . GLN F  1 83 ? 0.369   -21.299 43.801 1.00 54.66  ? 83  GLN F NE2 1 
ATOM   4083 N N   . VAL F  1 84 ? 0.138   -17.118 46.503 1.00 35.39  ? 84  VAL F N   1 
ATOM   4084 C CA  . VAL F  1 84 ? 0.652   -16.027 45.649 1.00 34.95  ? 84  VAL F CA  1 
ATOM   4085 C C   . VAL F  1 84 ? 1.278   -14.962 46.540 1.00 36.41  ? 84  VAL F C   1 
ATOM   4086 O O   . VAL F  1 84 ? 0.675   -14.554 47.525 1.00 40.81  ? 84  VAL F O   1 
ATOM   4087 C CB  . VAL F  1 84 ? -0.463  -15.386 44.806 1.00 37.54  ? 84  VAL F CB  1 
ATOM   4088 C CG1 . VAL F  1 84 ? 0.066   -14.167 44.051 1.00 37.69  ? 84  VAL F CG1 1 
ATOM   4089 C CG2 . VAL F  1 84 ? -1.040  -16.390 43.838 1.00 39.54  ? 84  VAL F CG2 1 
ATOM   4090 N N   . VAL F  1 85 ? 2.485   -14.529 46.195 1.00 31.87  ? 85  VAL F N   1 
ATOM   4091 C CA  . VAL F  1 85 ? 3.254   -13.633 47.042 1.00 33.08  ? 85  VAL F CA  1 
ATOM   4092 C C   . VAL F  1 85 ? 3.629   -12.355 46.304 1.00 32.76  ? 85  VAL F C   1 
ATOM   4093 O O   . VAL F  1 85 ? 4.133   -12.384 45.186 1.00 31.04  ? 85  VAL F O   1 
ATOM   4094 C CB  . VAL F  1 85 ? 4.539   -14.323 47.538 1.00 34.10  ? 85  VAL F CB  1 
ATOM   4095 C CG1 . VAL F  1 85 ? 5.243   -13.459 48.575 1.00 36.84  ? 85  VAL F CG1 1 
ATOM   4096 C CG2 . VAL F  1 85 ? 4.209   -15.707 48.121 1.00 34.73  ? 85  VAL F CG2 1 
ATOM   4097 N N   . HIS F  1 86 ? 3.383   -11.231 46.948 1.00 31.19  ? 86  HIS F N   1 
ATOM   4098 C CA  . HIS F  1 86 ? 3.711   -9.948  46.367 1.00 32.87  ? 86  HIS F CA  1 
ATOM   4099 C C   . HIS F  1 86 ? 5.144   -9.629  46.755 1.00 31.93  ? 86  HIS F C   1 
ATOM   4100 O O   . HIS F  1 86 ? 5.483   -9.609  47.934 1.00 33.71  ? 86  HIS F O   1 
ATOM   4101 C CB  . HIS F  1 86 ? 2.746   -8.909  46.917 1.00 31.04  ? 86  HIS F CB  1 
ATOM   4102 C CG  . HIS F  1 86 ? 2.857   -7.573  46.266 1.00 31.67  ? 86  HIS F CG  1 
ATOM   4103 N ND1 . HIS F  1 86 ? 2.356   -6.425  46.843 1.00 34.53  ? 86  HIS F ND1 1 
ATOM   4104 C CD2 . HIS F  1 86 ? 3.408   -7.198  45.088 1.00 31.56  ? 86  HIS F CD2 1 
ATOM   4105 C CE1 . HIS F  1 86 ? 2.589   -5.398  46.042 1.00 34.81  ? 86  HIS F CE1 1 
ATOM   4106 N NE2 . HIS F  1 86 ? 3.229   -5.838  44.973 1.00 33.04  ? 86  HIS F NE2 1 
ATOM   4107 N N   . LEU F  1 87 ? 5.985   -9.409  45.750 1.00 32.40  ? 87  LEU F N   1 
ATOM   4108 C CA  . LEU F  1 87 ? 7.395   -9.082  45.958 1.00 29.83  ? 87  LEU F CA  1 
ATOM   4109 C C   . LEU F  1 87 ? 7.786   -7.727  45.372 1.00 28.87  ? 87  LEU F C   1 
ATOM   4110 O O   . LEU F  1 87 ? 7.430   -7.399  44.243 1.00 28.96  ? 87  LEU F O   1 
ATOM   4111 C CB  . LEU F  1 87 ? 8.269   -10.162 45.336 1.00 30.24  ? 87  LEU F CB  1 
ATOM   4112 C CG  . LEU F  1 87 ? 8.106   -11.549 45.959 1.00 32.08  ? 87  LEU F CG  1 
ATOM   4113 C CD1 . LEU F  1 87 ? 8.667   -12.594 45.015 1.00 33.53  ? 87  LEU F CD1 1 
ATOM   4114 C CD2 . LEU F  1 87 ? 8.748   -11.640 47.355 1.00 35.07  ? 87  LEU F CD2 1 
ATOM   4115 N N   . LEU F  1 88 ? 8.538   -6.945  46.135 1.00 29.60  ? 88  LEU F N   1 
ATOM   4116 C CA  . LEU F  1 88 ? 9.056   -5.671  45.645 1.00 31.71  ? 88  LEU F CA  1 
ATOM   4117 C C   . LEU F  1 88 ? 10.549  -5.832  45.463 1.00 32.66  ? 88  LEU F C   1 
ATOM   4118 O O   . LEU F  1 88 ? 11.258  -6.223  46.410 1.00 32.43  ? 88  LEU F O   1 
ATOM   4119 C CB  . LEU F  1 88 ? 8.821   -4.573  46.676 1.00 31.89  ? 88  LEU F CB  1 
ATOM   4120 C CG  . LEU F  1 88 ? 9.192   -3.130  46.346 1.00 30.97  ? 88  LEU F CG  1 
ATOM   4121 C CD1 . LEU F  1 88 ? 8.388   -2.648  45.172 1.00 26.13  ? 88  LEU F CD1 1 
ATOM   4122 C CD2 . LEU F  1 88 ? 8.943   -2.261  47.582 1.00 29.95  ? 88  LEU F CD2 1 
ATOM   4123 N N   . LEU F  1 89 ? 11.032  -5.531  44.265 1.00 29.40  ? 89  LEU F N   1 
ATOM   4124 C CA  . LEU F  1 89 ? 12.442  -5.722  43.960 1.00 28.79  ? 89  LEU F CA  1 
ATOM   4125 C C   . LEU F  1 89 ? 13.129  -4.508  43.355 1.00 31.99  ? 89  LEU F C   1 
ATOM   4126 O O   . LEU F  1 89 ? 12.478  -3.582  42.860 1.00 28.90  ? 89  LEU F O   1 
ATOM   4127 C CB  . LEU F  1 89 ? 12.627  -6.902  43.024 1.00 30.80  ? 89  LEU F CB  1 
ATOM   4128 C CG  . LEU F  1 89 ? 12.099  -8.237  43.541 1.00 32.55  ? 89  LEU F CG  1 
ATOM   4129 C CD1 . LEU F  1 89 ? 10.759  -8.545  42.868 1.00 31.37  ? 89  LEU F CD1 1 
ATOM   4130 C CD2 . LEU F  1 89 ? 13.110  -9.326  43.248 1.00 37.33  ? 89  LEU F CD2 1 
ATOM   4131 N N   . GLU F  1 90 ? 14.460  -4.534  43.412 1.00 31.98  ? 90  GLU F N   1 
ATOM   4132 C CA  . GLU F  1 90 ? 15.296  -3.650  42.623 1.00 31.84  ? 90  GLU F CA  1 
ATOM   4133 C C   . GLU F  1 90 ? 16.073  -4.506  41.628 1.00 33.97  ? 90  GLU F C   1 
ATOM   4134 O O   . GLU F  1 90 ? 16.718  -5.484  41.995 1.00 34.38  ? 90  GLU F O   1 
ATOM   4135 C CB  . GLU F  1 90 ? 16.264  -2.864  43.510 1.00 33.46  ? 90  GLU F CB  1 
ATOM   4136 C CG  . GLU F  1 90 ? 17.314  -2.098  42.714 1.00 36.56  ? 90  GLU F CG  1 
ATOM   4137 C CD  . GLU F  1 90 ? 18.520  -1.716  43.540 1.00 43.04  ? 90  GLU F CD  1 
ATOM   4138 O OE1 . GLU F  1 90 ? 18.558  -2.076  44.736 1.00 43.11  ? 90  GLU F OE1 1 
ATOM   4139 O OE2 . GLU F  1 90 ? 19.438  -1.062  42.990 1.00 47.20  ? 90  GLU F OE2 1 
ATOM   4140 N N   . LYS F  1 91 ? 15.990  -4.136  40.362 1.00 31.43  ? 91  LYS F N   1 
ATOM   4141 C CA  . LYS F  1 91 ? 16.662  -4.848  39.294 1.00 32.52  ? 91  LYS F CA  1 
ATOM   4142 C C   . LYS F  1 91 ? 18.166  -4.762  39.482 1.00 34.98  ? 91  LYS F C   1 
ATOM   4143 O O   . LYS F  1 91 ? 18.727  -3.675  39.655 1.00 34.42  ? 91  LYS F O   1 
ATOM   4144 C CB  . LYS F  1 91 ? 16.240  -4.253  37.949 1.00 31.85  ? 91  LYS F CB  1 
ATOM   4145 C CG  . LYS F  1 91 ? 16.951  -4.813  36.747 1.00 40.27  ? 91  LYS F CG  1 
ATOM   4146 C CD  . LYS F  1 91 ? 16.407  -6.163  36.346 1.00 43.19  ? 91  LYS F CD  1 
ATOM   4147 C CE  . LYS F  1 91 ? 16.938  -6.536  34.969 1.00 48.69  ? 91  LYS F CE  1 
ATOM   4148 N NZ  . LYS F  1 91 ? 16.870  -8.000  34.735 1.00 48.60  ? 91  LYS F NZ  1 
ATOM   4149 N N   . GLY F  1 92 ? 18.829  -5.913  39.463 1.00 37.45  ? 92  GLY F N   1 
ATOM   4150 C CA  . GLY F  1 92 ? 20.255  -5.940  39.681 1.00 44.63  ? 92  GLY F CA  1 
ATOM   4151 C C   . GLY F  1 92 ? 21.057  -6.077  38.407 1.00 54.56  ? 92  GLY F C   1 
ATOM   4152 O O   . GLY F  1 92 ? 20.630  -5.632  37.332 1.00 52.68  ? 92  GLY F O   1 
ATOM   4153 N N   . GLN F  1 93 ? 22.228  -6.695  38.532 1.00 65.59  ? 93  GLN F N   1 
ATOM   4154 C CA  . GLN F  1 93 ? 23.133  -6.880  37.407 1.00 78.38  ? 93  GLN F CA  1 
ATOM   4155 C C   . GLN F  1 93 ? 23.282  -5.582  36.627 1.00 83.93  ? 93  GLN F C   1 
ATOM   4156 O O   . GLN F  1 93 ? 22.850  -5.487  35.478 1.00 85.64  ? 93  GLN F O   1 
ATOM   4157 C CB  . GLN F  1 93 ? 22.625  -7.992  36.487 1.00 81.70  ? 93  GLN F CB  1 
ATOM   4158 C CG  . GLN F  1 93 ? 23.518  -8.261  35.286 1.00 91.13  ? 93  GLN F CG  1 
ATOM   4159 C CD  . GLN F  1 93 ? 22.988  -9.373  34.403 1.00 94.11  ? 93  GLN F CD  1 
ATOM   4160 O OE1 . GLN F  1 93 ? 21.938  -9.953  34.679 1.00 91.42  ? 93  GLN F OE1 1 
ATOM   4161 N NE2 . GLN F  1 93 ? 23.714  -9.677  33.334 1.00 99.63  ? 93  GLN F NE2 1 
ATOM   4162 N N   . SER F  1 94 ? 23.891  -4.580  37.254 1.00 87.20  ? 94  SER F N   1 
ATOM   4163 C CA  . SER F  1 94 ? 24.039  -3.280  36.604 1.00 90.04  ? 94  SER F CA  1 
ATOM   4164 C C   . SER F  1 94 ? 24.581  -3.365  35.175 1.00 94.24  ? 94  SER F C   1 
ATOM   4165 O O   . SER F  1 94 ? 25.096  -4.399  34.749 1.00 97.28  ? 94  SER F O   1 
ATOM   4166 C CB  . SER F  1 94 ? 24.919  -2.361  37.452 1.00 94.00  ? 94  SER F CB  1 
ATOM   4167 O OG  . SER F  1 94 ? 26.194  -2.939  37.678 1.00 100.45 ? 94  SER F OG  1 
HETATM 4168 I I   . IOD G  2 .  ? -1.985  -18.975 27.872 1.00 28.77  ? 97  IOD A I   1 
HETATM 4169 I I   . IOD H  2 .  ? -2.214  -19.705 41.958 1.00 35.02  ? 98  IOD A I   1 
HETATM 4170 I I   . IOD I  2 .  ? -11.114 -5.066  12.624 1.00 45.23  ? 99  IOD A I   1 
HETATM 4171 I I   . IOD J  2 .  ? 0.154   -18.768 16.739 1.00 52.90  ? 100 IOD A I   1 
HETATM 4172 I I   . IOD K  2 .  ? -11.362 -20.827 38.391 1.00 110.38 ? 101 IOD A I   1 
HETATM 4173 I I   . IOD L  2 .  ? -16.155 -4.853  32.965 1.00 84.34  ? 102 IOD A I   1 
HETATM 4174 S S   . SCN M  3 .  ? 1.080   -6.024  32.366 1.00 25.69  ? 103 SCN A S   1 
HETATM 4175 C C   . SCN M  3 .  ? 1.473   -4.332  32.849 1.00 29.00  ? 103 SCN A C   1 
HETATM 4176 N N   . SCN M  3 .  ? 1.749   -3.238  33.186 1.00 24.29  ? 103 SCN A N   1 
HETATM 4177 I I   . IOD N  2 .  ? -0.196  19.753  27.487 1.00 28.25  ? 97  IOD B I   1 
HETATM 4178 I I   . IOD O  2 .  ? 1.122   20.387  41.460 1.00 25.14  ? 98  IOD B I   1 
HETATM 4179 I I   . IOD P  2 .  ? -2.813  19.743  16.624 1.00 106.59 ? 99  IOD B I   1 
HETATM 4180 I I   . IOD Q  2 .  ? 14.058  5.629   31.719 1.00 74.29  ? 100 IOD B I   1 
HETATM 4181 S S   . SCN R  3 .  ? -3.105  6.760   32.406 1.00 24.44  ? 101 SCN B S   1 
HETATM 4182 C C   . SCN R  3 .  ? -3.462  5.057   32.904 1.00 26.49  ? 101 SCN B C   1 
HETATM 4183 N N   . SCN R  3 .  ? -3.681  3.961   33.300 1.00 20.73  ? 101 SCN B N   1 
HETATM 4184 S S   . SCN S  3 .  ? -2.875  0.781   22.878 1.00 46.49  ? 102 SCN B S   1 
HETATM 4185 C C   . SCN S  3 .  ? -2.913  2.290   21.898 1.00 59.72  ? 102 SCN B C   1 
HETATM 4186 N N   . SCN S  3 .  ? -2.938  3.280   21.256 1.00 61.89  ? 102 SCN B N   1 
HETATM 4187 S S   . SCN T  3 .  ? 0.022   -2.397  21.031 1.00 64.75  ? 103 SCN B S   1 
HETATM 4188 C C   . SCN T  3 .  ? -0.009  -0.898  21.914 1.00 37.57  ? 103 SCN B C   1 
HETATM 4189 N N   . SCN T  3 .  ? -0.031  0.084   22.432 1.00 35.23  ? 103 SCN B N   1 
HETATM 4190 I I   . IOD U  2 .  ? -9.835  20.880  49.857 1.00 37.87  ? 97  IOD C I   1 
HETATM 4191 I I   . IOD V  2 .  ? -24.557 13.560  45.816 1.00 73.20  ? 98  IOD C I   1 
HETATM 4192 I I   . IOD W  2 .  ? -21.776 19.516  39.846 1.00 76.03  ? 99  IOD C I   1 
HETATM 4193 I I   . IOD X  2 .  ? -15.701 8.645   34.346 1.00 88.13  ? 100 IOD C I   1 
HETATM 4194 S S   . SCN Y  3 .  ? -6.464  7.192   48.872 1.00 28.05  ? 101 SCN C S   1 
HETATM 4195 C C   . SCN Y  3 .  ? -6.139  5.426   48.793 1.00 28.19  ? 101 SCN C C   1 
HETATM 4196 N N   . SCN Y  3 .  ? -5.858  4.282   48.731 1.00 24.84  ? 101 SCN C N   1 
HETATM 4197 S S   . SCN Z  3 .  ? -16.755 20.533  51.083 1.00 68.29  ? 102 SCN C S   1 
HETATM 4198 C C   . SCN Z  3 .  ? -18.284 20.986  51.900 1.00 46.10  ? 102 SCN C C   1 
HETATM 4199 N N   . SCN Z  3 .  ? -19.296 21.258  52.448 1.00 49.72  ? 102 SCN C N   1 
HETATM 4200 I I   . IOD AA 2 .  ? 13.687  18.882  47.104 1.00 41.49  ? 97  IOD D I   1 
HETATM 4201 I I   . IOD BA 2 .  ? 8.138   29.020  44.136 1.00 40.85  ? 98  IOD D I   1 
HETATM 4202 I I   . IOD CA 2 .  ? 9.991   21.600  37.677 1.00 56.78  ? 99  IOD D I   1 
HETATM 4203 I I   . IOD DA 2 .  ? 1.718   7.375   58.637 1.00 80.28  ? 100 IOD D I   1 
HETATM 4204 I I   . IOD EA 2 .  ? 1.484   22.070  50.648 1.00 60.25  ? 101 IOD D I   1 
HETATM 4205 S S   . SCN FA 3 .  ? 9.445   5.718   43.546 1.00 28.89  ? 102 SCN D S   1 
HETATM 4206 C C   . SCN FA 3 .  ? 8.930   4.047   43.180 1.00 24.87  ? 102 SCN D C   1 
HETATM 4207 N N   . SCN FA 3 .  ? 8.619   2.953   42.864 1.00 24.88  ? 102 SCN D N   1 
HETATM 4208 I I   . IOD GA 2 .  ? -22.070 -3.675  64.205 1.00 48.72  ? 97  IOD E I   1 
HETATM 4209 I I   . IOD HA 2 .  ? -14.655 -17.762 48.444 1.00 53.19  ? 98  IOD E I   1 
HETATM 4210 I I   . IOD IA 2 .  ? -23.588 -11.931 59.654 1.00 144.03 ? 99  IOD E I   1 
HETATM 4211 I I   . IOD JA 2 .  ? -1.474  -6.573  58.889 1.00 95.40  ? 100 IOD E I   1 
HETATM 4212 S S   . SCN KA 3 .  ? -15.875 2.105   53.605 1.00 140.14 ? 101 SCN E S   1 
HETATM 4213 C C   . SCN KA 3 .  ? -16.175 3.865   53.754 1.00 53.54  ? 101 SCN E C   1 
HETATM 4214 N N   . SCN KA 3 .  ? -16.354 5.019   53.876 1.00 55.39  ? 101 SCN E N   1 
HETATM 4215 S S   . SCN LA 3 .  ? -10.529 -4.868  44.404 1.00 28.74  ? 102 SCN E S   1 
HETATM 4216 C C   . SCN LA 3 .  ? -10.058 -3.168  44.005 1.00 25.87  ? 102 SCN E C   1 
HETATM 4217 N N   . SCN LA 3 .  ? -9.785  -2.052  43.718 1.00 24.67  ? 102 SCN E N   1 
HETATM 4218 S S   . SCN MA 3 .  ? -0.667  -21.540 51.448 1.00 55.93  ? 103 SCN E S   1 
HETATM 4219 C C   . SCN MA 3 .  ? -2.321  -21.810 50.805 1.00 66.80  ? 103 SCN E C   1 
HETATM 4220 N N   . SCN MA 3 .  ? -3.413  -21.936 50.374 1.00 67.19  ? 103 SCN E N   1 
HETATM 4221 S S   . SCN NA 3 .  ? -19.836 -0.936  51.367 1.00 95.77  ? 104 SCN E S   1 
HETATM 4222 C C   . SCN NA 3 .  ? -18.728 0.388   50.875 1.00 52.62  ? 104 SCN E C   1 
HETATM 4223 N N   . SCN NA 3 .  ? -18.017 1.280   50.552 1.00 51.68  ? 104 SCN E N   1 
HETATM 4224 I I   . IOD OA 2 .  ? 9.637   -19.989 49.352 1.00 55.51  ? 97  IOD F I   1 
HETATM 4225 I I   . IOD PA 2 .  ? 13.533  -8.287  33.334 1.00 103.11 ? 98  IOD F I   1 
HETATM 4226 S S   . SCN QA 3 .  ? 19.055  -19.807 57.166 1.00 60.45  ? 99  SCN F S   1 
HETATM 4227 C C   . SCN QA 3 .  ? 20.851  -19.691 57.336 1.00 38.70  ? 99  SCN F C   1 
HETATM 4228 N N   . SCN QA 3 .  ? 22.032  -19.603 57.387 1.00 35.57  ? 99  SCN F N   1 
HETATM 4229 S S   . SCN RA 3 .  ? 5.816   -6.354  48.442 1.00 32.60  ? 100 SCN F S   1 
HETATM 4230 C C   . SCN RA 3 .  ? 5.404   -4.603  48.347 1.00 31.74  ? 100 SCN F C   1 
HETATM 4231 N N   . SCN RA 3 .  ? 5.115   -3.463  48.352 1.00 29.33  ? 100 SCN F N   1 
HETATM 4232 S S   . SCN SA 3 .  ? 4.332   -22.134 35.658 1.00 83.95  ? 101 SCN F S   1 
HETATM 4233 C C   . SCN SA 3 .  ? 4.721   -22.806 37.281 1.00 71.08  ? 101 SCN F C   1 
HETATM 4234 N N   . SCN SA 3 .  ? 4.971   -23.257 38.344 1.00 70.67  ? 101 SCN F N   1 
HETATM 4235 O O   . HOH TA 4 .  ? -15.324 -5.796  26.989 1.00 35.15  ? 104 HOH A O   1 
HETATM 4236 O O   . HOH TA 4 .  ? -6.065  -12.895 13.944 1.00 28.10  ? 105 HOH A O   1 
HETATM 4237 O O   . HOH TA 4 .  ? -8.942  -14.548 14.404 1.00 27.45  ? 106 HOH A O   1 
HETATM 4238 O O   . HOH TA 4 .  ? -5.349  -17.304 20.773 1.00 28.47  ? 107 HOH A O   1 
HETATM 4239 O O   . HOH TA 4 .  ? -13.937 -6.267  30.019 1.00 30.54  ? 108 HOH A O   1 
HETATM 4240 O O   . HOH TA 4 .  ? 1.681   -14.305 13.156 1.00 34.25  ? 109 HOH A O   1 
HETATM 4241 O O   . HOH TA 4 .  ? 0.926   -3.012  17.105 1.00 48.61  ? 110 HOH A O   1 
HETATM 4242 O O   . HOH TA 4 .  ? -8.141  -21.392 31.516 1.00 28.39  ? 111 HOH A O   1 
HETATM 4243 O O   . HOH TA 4 .  ? -5.417  -26.095 29.652 1.00 39.54  ? 112 HOH A O   1 
HETATM 4244 O O   . HOH TA 4 .  ? -10.711 -13.646 40.176 1.00 28.30  ? 113 HOH A O   1 
HETATM 4245 O O   . HOH TA 4 .  ? -11.107 -11.998 33.348 1.00 25.86  ? 114 HOH A O   1 
HETATM 4246 O O   . HOH TA 4 .  ? -11.608 -18.331 30.175 1.00 27.90  ? 115 HOH A O   1 
HETATM 4247 O O   . HOH TA 4 .  ? -7.383  -15.590 38.692 1.00 28.36  ? 116 HOH A O   1 
HETATM 4248 O O   . HOH TA 4 .  ? -16.689 5.032   26.777 1.00 37.16  ? 117 HOH A O   1 
HETATM 4249 O O   . HOH TA 4 .  ? 4.089   -6.045  35.516 1.00 30.21  ? 118 HOH A O   1 
HETATM 4250 O O   . HOH TA 4 .  ? -9.282  -4.981  37.606 1.00 26.48  ? 119 HOH A O   1 
HETATM 4251 O O   . HOH TA 4 .  ? 8.564   -6.738  33.054 1.00 31.07  ? 120 HOH A O   1 
HETATM 4252 O O   . HOH TA 4 .  ? -10.544 3.867   22.241 1.00 50.68  ? 121 HOH A O   1 
HETATM 4253 O O   . HOH TA 4 .  ? -14.558 -12.882 32.141 1.00 31.77  ? 122 HOH A O   1 
HETATM 4254 O O   . HOH TA 4 .  ? -7.675  -1.981  37.010 1.00 24.40  ? 123 HOH A O   1 
HETATM 4255 O O   . HOH TA 4 .  ? 5.816   -3.763  13.945 1.00 55.47  ? 124 HOH A O   1 
HETATM 4256 O O   . HOH TA 4 .  ? -13.090 5.604   28.339 1.00 26.30  ? 125 HOH A O   1 
HETATM 4257 O O   . HOH TA 4 .  ? -2.576  -4.646  21.471 1.00 22.89  ? 136 HOH A O   1 
HETATM 4258 O O   . HOH TA 4 .  ? -9.184  -22.989 29.291 1.00 35.67  ? 162 HOH A O   1 
HETATM 4259 O O   . HOH TA 4 .  ? 4.101   -3.361  34.999 1.00 27.79  ? 165 HOH A O   1 
HETATM 4260 O O   . HOH TA 4 .  ? -9.425  -17.033 37.169 1.00 38.78  ? 166 HOH A O   1 
HETATM 4261 O O   . HOH TA 4 .  ? -0.354  -4.735  20.068 1.00 34.75  ? 168 HOH A O   1 
HETATM 4262 O O   . HOH TA 4 .  ? 1.099   -22.943 35.304 1.00 42.24  ? 171 HOH A O   1 
HETATM 4263 O O   . HOH TA 4 .  ? 0.518   -21.079 29.391 1.00 43.93  ? 180 HOH A O   1 
HETATM 4264 O O   . HOH TA 4 .  ? 6.202   -10.498 29.125 1.00 28.16  ? 183 HOH A O   1 
HETATM 4265 O O   . HOH TA 4 .  ? -17.043 -12.230 26.289 1.00 28.36  ? 193 HOH A O   1 
HETATM 4266 O O   . HOH TA 4 .  ? 0.224   -6.003  17.718 1.00 29.35  ? 207 HOH A O   1 
HETATM 4267 O O   . HOH TA 4 .  ? 5.748   -13.201 28.567 1.00 29.20  ? 219 HOH A O   1 
HETATM 4268 O O   . HOH TA 4 .  ? -12.983 -5.118  33.730 1.00 31.34  ? 223 HOH A O   1 
HETATM 4269 O O   . HOH TA 4 .  ? -16.622 -14.631 24.323 1.00 39.23  ? 226 HOH A O   1 
HETATM 4270 O O   . HOH TA 4 .  ? 1.120   -1.613  24.866 1.00 31.09  ? 228 HOH A O   1 
HETATM 4271 O O   . HOH TA 4 .  ? -12.790 -9.399  19.187 1.00 37.20  ? 233 HOH A O   1 
HETATM 4272 O O   . HOH TA 4 .  ? 2.728   -8.892  38.639 1.00 32.77  ? 243 HOH A O   1 
HETATM 4273 O O   . HOH TA 4 .  ? -8.702  3.411   34.207 1.00 34.58  ? 250 HOH A O   1 
HETATM 4274 O O   . HOH TA 4 .  ? -6.466  -2.497  39.611 1.00 37.50  ? 251 HOH A O   1 
HETATM 4275 O O   . HOH TA 4 .  ? -5.432  -5.273  39.355 1.00 39.30  ? 252 HOH A O   1 
HETATM 4276 O O   . HOH TA 4 .  ? -3.661  -17.220 23.269 1.00 39.37  ? 254 HOH A O   1 
HETATM 4277 O O   . HOH TA 4 .  ? -3.201  -20.690 22.027 1.00 37.37  ? 255 HOH A O   1 
HETATM 4278 O O   . HOH TA 4 .  ? -17.125 -13.613 31.692 1.00 46.54  ? 257 HOH A O   1 
HETATM 4279 O O   . HOH TA 4 .  ? 6.027   -13.792 14.188 1.00 41.90  ? 258 HOH A O   1 
HETATM 4280 O O   . HOH TA 4 .  ? -15.531 -5.245  24.103 1.00 39.31  ? 272 HOH A O   1 
HETATM 4281 O O   . HOH TA 4 .  ? 6.831   -13.678 21.663 1.00 38.74  ? 273 HOH A O   1 
HETATM 4282 O O   . HOH TA 4 .  ? 1.739   -11.854 38.111 1.00 31.17  ? 279 HOH A O   1 
HETATM 4283 O O   . HOH TA 4 .  ? 5.996   -7.933  23.188 1.00 42.73  ? 281 HOH A O   1 
HETATM 4284 O O   . HOH TA 4 .  ? 6.753   -6.840  20.487 1.00 53.03  ? 290 HOH A O   1 
HETATM 4285 O O   . HOH TA 4 .  ? 7.683   -4.802  23.663 1.00 36.36  ? 300 HOH A O   1 
HETATM 4286 O O   . HOH TA 4 .  ? 8.164   -10.336 31.233 1.00 42.90  ? 304 HOH A O   1 
HETATM 4287 O O   . HOH TA 4 .  ? 8.705   -3.956  32.434 1.00 44.53  ? 307 HOH A O   1 
HETATM 4288 O O   . HOH TA 4 .  ? 2.838   -18.423 18.936 1.00 36.58  ? 312 HOH A O   1 
HETATM 4289 O O   . HOH TA 4 .  ? 7.685   -14.622 24.239 1.00 51.08  ? 316 HOH A O   1 
HETATM 4290 O O   . HOH TA 4 .  ? 5.003   -10.152 21.943 1.00 31.19  ? 317 HOH A O   1 
HETATM 4291 O O   . HOH TA 4 .  ? -11.747 -26.722 29.505 1.00 38.14  ? 323 HOH A O   1 
HETATM 4292 O O   . HOH TA 4 .  ? -17.797 -8.169  24.647 1.00 38.55  ? 327 HOH A O   1 
HETATM 4293 O O   . HOH TA 4 .  ? -5.183  -18.468 26.830 1.00 39.69  ? 332 HOH A O   1 
HETATM 4294 O O   . HOH TA 4 .  ? -12.440 0.449   23.156 1.00 39.08  ? 343 HOH A O   1 
HETATM 4295 O O   . HOH TA 4 .  ? 8.828   -15.793 30.916 1.00 41.54  ? 353 HOH A O   1 
HETATM 4296 O O   . HOH TA 4 .  ? -2.427  -24.045 36.058 1.00 38.18  ? 367 HOH A O   1 
HETATM 4297 O O   . HOH TA 4 .  ? -10.758 -2.726  23.232 1.00 40.76  ? 369 HOH A O   1 
HETATM 4298 O O   . HOH TA 4 .  ? -18.997 -10.414 25.309 1.00 55.94  ? 382 HOH A O   1 
HETATM 4299 O O   . HOH TA 4 .  ? -1.449  -18.125 24.362 1.00 41.85  ? 383 HOH A O   1 
HETATM 4300 O O   . HOH TA 4 .  ? -17.019 -16.972 28.208 1.00 53.79  ? 390 HOH A O   1 
HETATM 4301 O O   . HOH TA 4 .  ? -1.876  -20.725 24.125 1.00 43.80  ? 391 HOH A O   1 
HETATM 4302 O O   . HOH TA 4 .  ? 7.851   -13.646 26.751 1.00 38.97  ? 398 HOH A O   1 
HETATM 4303 O O   . HOH TA 4 .  ? -11.766 -24.121 29.489 1.00 37.41  ? 425 HOH A O   1 
HETATM 4304 O O   . HOH TA 4 .  ? -10.666 -1.461  36.949 1.00 31.09  ? 456 HOH A O   1 
HETATM 4305 O O   . HOH TA 4 .  ? 8.028   -10.570 27.169 1.00 36.30  ? 458 HOH A O   1 
HETATM 4306 O O   . HOH TA 4 .  ? -3.238  -5.995  38.717 1.00 48.99  ? 465 HOH A O   1 
HETATM 4307 O O   . HOH TA 4 .  ? -12.825 10.265  27.757 1.00 42.14  ? 474 HOH A O   1 
HETATM 4308 O O   . HOH TA 4 .  ? -8.067  -19.092 37.641 1.00 36.45  ? 483 HOH A O   1 
HETATM 4309 O O   . HOH TA 4 .  ? -11.859 -7.174  17.944 1.00 55.96  ? 484 HOH A O   1 
HETATM 4310 O O   . HOH TA 4 .  ? -12.139 2.278   34.913 1.00 43.42  ? 485 HOH A O   1 
HETATM 4311 O O   . HOH TA 4 .  ? -11.584 -19.104 20.049 1.00 39.92  ? 488 HOH A O   1 
HETATM 4312 O O   . HOH TA 4 .  ? -4.805  -2.817  7.221  1.00 59.31  ? 496 HOH A O   1 
HETATM 4313 O O   . HOH TA 4 .  ? -16.739 -17.336 38.529 1.00 41.06  ? 500 HOH A O   1 
HETATM 4314 O O   . HOH TA 4 .  ? -18.186 -19.137 35.766 1.00 60.64  ? 501 HOH A O   1 
HETATM 4315 O O   . HOH TA 4 .  ? -14.943 -10.806 39.453 1.00 40.92  ? 502 HOH A O   1 
HETATM 4316 O O   . HOH TA 4 .  ? -4.216  -25.929 26.786 1.00 42.15  ? 513 HOH A O   1 
HETATM 4317 O O   . HOH TA 4 .  ? 6.470   -16.467 17.984 1.00 51.69  ? 514 HOH A O   1 
HETATM 4318 O O   . HOH TA 4 .  ? -10.466 0.400   35.119 1.00 38.66  ? 515 HOH A O   1 
HETATM 4319 O O   . HOH TA 4 .  ? 4.375   -14.510 11.978 1.00 46.75  ? 517 HOH A O   1 
HETATM 4320 O O   . HOH TA 4 .  ? -1.938  -14.726 11.890 1.00 45.98  ? 518 HOH A O   1 
HETATM 4321 O O   . HOH TA 4 .  ? -18.856 -5.435  30.377 1.00 47.48  ? 519 HOH A O   1 
HETATM 4322 O O   . HOH TA 4 .  ? -18.799 -1.097  30.196 1.00 46.33  ? 520 HOH A O   1 
HETATM 4323 O O   . HOH TA 4 .  ? 7.320   -15.556 15.236 1.00 45.31  ? 521 HOH A O   1 
HETATM 4324 O O   . HOH TA 4 .  ? -6.508  -19.951 23.936 1.00 41.07  ? 531 HOH A O   1 
HETATM 4325 O O   . HOH TA 4 .  ? 5.586   -19.105 18.137 1.00 43.94  ? 539 HOH A O   1 
HETATM 4326 O O   . HOH TA 4 .  ? -11.158 -10.350 14.351 1.00 43.63  ? 544 HOH A O   1 
HETATM 4327 O O   . HOH TA 4 .  ? -4.458  -14.460 12.721 1.00 43.60  ? 545 HOH A O   1 
HETATM 4328 O O   . HOH TA 4 .  ? -17.473 -13.627 28.879 1.00 56.32  ? 546 HOH A O   1 
HETATM 4329 O O   . HOH TA 4 .  ? 8.253   1.809   20.350 1.00 50.77  ? 549 HOH A O   1 
HETATM 4330 O O   . HOH TA 4 .  ? 7.328   -10.039 24.343 1.00 48.59  ? 556 HOH A O   1 
HETATM 4331 O O   . HOH TA 4 .  ? -15.313 -7.925  19.327 1.00 45.26  ? 558 HOH A O   1 
HETATM 4332 O O   . HOH TA 4 .  ? -1.750  0.492   17.507 1.00 56.18  ? 564 HOH A O   1 
HETATM 4333 O O   . HOH TA 4 .  ? 4.993   -23.908 23.035 1.00 53.93  ? 574 HOH A O   1 
HETATM 4334 O O   . HOH UA 4 .  ? -8.028  14.058  28.846 1.00 37.01  ? 104 HOH B O   1 
HETATM 4335 O O   . HOH UA 4 .  ? 9.323   14.473  39.288 1.00 23.73  ? 105 HOH B O   1 
HETATM 4336 O O   . HOH UA 4 .  ? 9.618   18.994  29.113 1.00 21.63  ? 106 HOH B O   1 
HETATM 4337 O O   . HOH UA 4 .  ? -5.260  15.298  13.273 1.00 28.74  ? 107 HOH B O   1 
HETATM 4338 O O   . HOH UA 4 .  ? 2.145   13.793  13.441 1.00 27.79  ? 108 HOH B O   1 
HETATM 4339 O O   . HOH UA 4 .  ? -0.484  5.444   21.346 1.00 20.30  ? 109 HOH B O   1 
HETATM 4340 O O   . HOH UA 4 .  ? 8.630   0.355   34.252 1.00 41.25  ? 110 HOH B O   1 
HETATM 4341 O O   . HOH UA 4 .  ? 10.537  -4.702  27.348 1.00 31.17  ? 111 HOH B O   1 
HETATM 4342 O O   . HOH UA 4 .  ? 6.183   22.163  30.757 1.00 21.96  ? 112 HOH B O   1 
HETATM 4343 O O   . HOH UA 4 .  ? 12.515  13.461  30.672 1.00 27.25  ? 113 HOH B O   1 
HETATM 4344 O O   . HOH UA 4 .  ? 9.195   12.787  32.432 1.00 23.48  ? 114 HOH B O   1 
HETATM 4345 O O   . HOH UA 4 .  ? 0.781   24.773  35.648 1.00 26.61  ? 115 HOH B O   1 
HETATM 4346 O O   . HOH UA 4 .  ? -4.090  2.198   25.030 1.00 34.68  ? 116 HOH B O   1 
HETATM 4347 O O   . HOH UA 4 .  ? 14.009  20.839  32.846 1.00 53.33  ? 117 HOH B O   1 
HETATM 4348 O O   . HOH UA 4 .  ? 12.936  6.391   25.941 1.00 35.04  ? 118 HOH B O   1 
HETATM 4349 O O   . HOH UA 4 .  ? 7.551   5.764   36.639 1.00 25.82  ? 119 HOH B O   1 
HETATM 4350 O O   . HOH UA 4 .  ? 14.359  12.977  24.880 1.00 26.51  ? 120 HOH B O   1 
HETATM 4351 O O   . HOH UA 4 .  ? -10.620 6.930   36.455 1.00 26.80  ? 121 HOH B O   1 
HETATM 4352 O O   . HOH UA 4 .  ? 5.942   16.242  38.020 1.00 23.77  ? 122 HOH B O   1 
HETATM 4353 O O   . HOH UA 4 .  ? 4.193   5.787   38.806 1.00 38.37  ? 123 HOH B O   1 
HETATM 4354 O O   . HOH UA 4 .  ? 11.061  5.974   32.684 1.00 32.11  ? 124 HOH B O   1 
HETATM 4355 O O   . HOH UA 4 .  ? 1.706   6.651   38.163 1.00 37.37  ? 125 HOH B O   1 
HETATM 4356 O O   . HOH UA 4 .  ? 5.287   11.727  39.908 1.00 25.33  ? 126 HOH B O   1 
HETATM 4357 O O   . HOH UA 4 .  ? 14.314  -4.120  25.629 1.00 42.05  ? 127 HOH B O   1 
HETATM 4358 O O   . HOH UA 4 .  ? 1.002   7.330   14.515 1.00 36.30  ? 141 HOH B O   1 
HETATM 4359 O O   . HOH UA 4 .  ? -2.656  21.917  29.310 1.00 36.85  ? 143 HOH B O   1 
HETATM 4360 O O   . HOH UA 4 .  ? 12.745  6.084   23.029 1.00 36.78  ? 172 HOH B O   1 
HETATM 4361 O O   . HOH UA 4 .  ? -4.247  9.593   38.854 1.00 25.60  ? 178 HOH B O   1 
HETATM 4362 O O   . HOH UA 4 .  ? 11.036  -6.939  26.232 1.00 46.27  ? 182 HOH B O   1 
HETATM 4363 O O   . HOH UA 4 .  ? 9.383   10.110  17.857 1.00 27.06  ? 195 HOH B O   1 
HETATM 4364 O O   . HOH UA 4 .  ? 13.712  15.295  22.985 1.00 29.26  ? 196 HOH B O   1 
HETATM 4365 O O   . HOH UA 4 .  ? 2.396   18.382  19.662 1.00 33.85  ? 199 HOH B O   1 
HETATM 4366 O O   . HOH UA 4 .  ? 1.646   2.638   16.366 1.00 33.86  ? 200 HOH B O   1 
HETATM 4367 O O   . HOH UA 4 .  ? -3.767  6.841   17.798 1.00 28.64  ? 202 HOH B O   1 
HETATM 4368 O O   . HOH UA 4 .  ? -5.815  6.812   35.841 1.00 25.91  ? 203 HOH B O   1 
HETATM 4369 O O   . HOH UA 4 .  ? 6.557   19.637  36.882 1.00 31.16  ? 210 HOH B O   1 
HETATM 4370 O O   . HOH UA 4 .  ? -3.363  12.630  38.238 1.00 26.92  ? 211 HOH B O   1 
HETATM 4371 O O   . HOH UA 4 .  ? 5.473   25.626  30.109 1.00 35.21  ? 212 HOH B O   1 
HETATM 4372 O O   . HOH UA 4 .  ? 9.504   24.791  28.463 1.00 30.04  ? 213 HOH B O   1 
HETATM 4373 O O   . HOH UA 4 .  ? 2.995   19.505  25.966 1.00 31.81  ? 214 HOH B O   1 
HETATM 4374 O O   . HOH UA 4 .  ? -5.810  4.114   35.370 1.00 28.31  ? 221 HOH B O   1 
HETATM 4375 O O   . HOH UA 4 .  ? -3.735  2.138   18.563 1.00 38.77  ? 224 HOH B O   1 
HETATM 4376 O O   . HOH UA 4 .  ? -10.418 7.470   33.786 1.00 25.03  ? 225 HOH B O   1 
HETATM 4377 O O   . HOH UA 4 .  ? 7.711   17.432  36.270 1.00 29.21  ? 229 HOH B O   1 
HETATM 4378 O O   . HOH UA 4 .  ? 16.578  6.492   28.694 1.00 48.30  ? 232 HOH B O   1 
HETATM 4379 O O   . HOH UA 4 .  ? 5.916   2.708   36.333 1.00 25.29  ? 238 HOH B O   1 
HETATM 4380 O O   . HOH UA 4 .  ? 15.162  8.804   23.237 1.00 41.90  ? 240 HOH B O   1 
HETATM 4381 O O   . HOH UA 4 .  ? -8.363  11.204  29.203 1.00 31.94  ? 241 HOH B O   1 
HETATM 4382 O O   . HOH UA 4 .  ? 11.540  6.959   28.820 1.00 29.20  ? 246 HOH B O   1 
HETATM 4383 O O   . HOH UA 4 .  ? -5.083  4.231   17.553 1.00 35.97  ? 259 HOH B O   1 
HETATM 4384 O O   . HOH UA 4 .  ? 7.683   3.464   22.101 1.00 43.32  ? 260 HOH B O   1 
HETATM 4385 O O   . HOH UA 4 .  ? 14.962  17.587  26.575 1.00 47.51  ? 261 HOH B O   1 
HETATM 4386 O O   . HOH UA 4 .  ? -6.054  19.996  38.775 1.00 38.23  ? 265 HOH B O   1 
HETATM 4387 O O   . HOH UA 4 .  ? -9.471  14.944  14.354 1.00 36.07  ? 266 HOH B O   1 
HETATM 4388 O O   . HOH UA 4 .  ? -2.985  5.469   20.046 1.00 33.22  ? 270 HOH B O   1 
HETATM 4389 O O   . HOH UA 4 .  ? -2.857  23.604  35.306 1.00 34.24  ? 284 HOH B O   1 
HETATM 4390 O O   . HOH UA 4 .  ? 6.826   -2.492  33.598 1.00 43.47  ? 286 HOH B O   1 
HETATM 4391 O O   . HOH UA 4 .  ? -9.804  10.853  31.895 1.00 38.30  ? 287 HOH B O   1 
HETATM 4392 O O   . HOH UA 4 .  ? -8.657  9.168   24.355 1.00 41.15  ? 289 HOH B O   1 
HETATM 4393 O O   . HOH UA 4 .  ? 9.861   4.537   19.605 1.00 39.13  ? 292 HOH B O   1 
HETATM 4394 O O   . HOH UA 4 .  ? -0.775  7.195   39.887 1.00 40.55  ? 308 HOH B O   1 
HETATM 4395 O O   . HOH UA 4 .  ? -9.603  14.973  22.121 1.00 36.91  ? 320 HOH B O   1 
HETATM 4396 O O   . HOH UA 4 .  ? 4.740   23.483  38.152 1.00 35.03  ? 329 HOH B O   1 
HETATM 4397 O O   . HOH UA 4 .  ? -3.178  27.677  29.656 1.00 34.62  ? 356 HOH B O   1 
HETATM 4398 O O   . HOH UA 4 .  ? -10.840 16.635  31.355 1.00 42.97  ? 361 HOH B O   1 
HETATM 4399 O O   . HOH UA 4 .  ? 3.070   26.050  36.691 1.00 35.26  ? 379 HOH B O   1 
HETATM 4400 O O   . HOH UA 4 .  ? -7.884  10.970  22.449 1.00 34.71  ? 380 HOH B O   1 
HETATM 4401 O O   . HOH UA 4 .  ? -5.706  22.943  35.532 1.00 40.12  ? 385 HOH B O   1 
HETATM 4402 O O   . HOH UA 4 .  ? 13.429  11.638  38.226 1.00 42.91  ? 406 HOH B O   1 
HETATM 4403 O O   . HOH UA 4 .  ? 10.445  -9.538  27.440 1.00 38.70  ? 461 HOH B O   1 
HETATM 4404 O O   . HOH UA 4 .  ? 11.485  18.102  17.305 1.00 40.74  ? 463 HOH B O   1 
HETATM 4405 O O   . HOH UA 4 .  ? 9.605   12.032  15.634 1.00 39.10  ? 469 HOH B O   1 
HETATM 4406 O O   . HOH UA 4 .  ? 17.926  24.872  27.819 1.00 36.61  ? 470 HOH B O   1 
HETATM 4407 O O   . HOH UA 4 .  ? 7.070   23.530  28.452 1.00 38.52  ? 471 HOH B O   1 
HETATM 4408 O O   . HOH UA 4 .  ? 11.763  8.492   17.880 1.00 48.19  ? 472 HOH B O   1 
HETATM 4409 O O   . HOH UA 4 .  ? 5.388   3.224   38.886 1.00 36.42  ? 489 HOH B O   1 
HETATM 4410 O O   . HOH UA 4 .  ? -10.564 4.826   33.337 1.00 40.24  ? 494 HOH B O   1 
HETATM 4411 O O   . HOH UA 4 .  ? 4.189   -0.505  15.972 1.00 44.55  ? 507 HOH B O   1 
HETATM 4412 O O   . HOH UA 4 .  ? 17.267  2.716   26.608 1.00 47.19  ? 508 HOH B O   1 
HETATM 4413 O O   . HOH UA 4 .  ? 16.227  11.122  24.079 1.00 52.71  ? 509 HOH B O   1 
HETATM 4414 O O   . HOH UA 4 .  ? 1.090   -0.450  17.479 1.00 47.06  ? 530 HOH B O   1 
HETATM 4415 O O   . HOH UA 4 .  ? -5.600  19.733  18.930 1.00 42.83  ? 532 HOH B O   1 
HETATM 4416 O O   . HOH UA 4 .  ? -6.876  24.837  34.472 1.00 55.94  ? 537 HOH B O   1 
HETATM 4417 O O   . HOH UA 4 .  ? 15.987  15.676  34.237 1.00 45.23  ? 541 HOH B O   1 
HETATM 4418 O O   . HOH UA 4 .  ? 1.005   17.945  22.882 1.00 47.51  ? 542 HOH B O   1 
HETATM 4419 O O   . HOH UA 4 .  ? 15.136  14.320  27.239 1.00 45.51  ? 554 HOH B O   1 
HETATM 4420 O O   . HOH UA 4 .  ? -3.458  16.948  12.315 1.00 41.17  ? 555 HOH B O   1 
HETATM 4421 O O   . HOH UA 4 .  ? 17.032  0.315   21.916 1.00 52.57  ? 557 HOH B O   1 
HETATM 4422 O O   . HOH UA 4 .  ? -0.619  15.091  11.939 1.00 41.73  ? 562 HOH B O   1 
HETATM 4423 O O   . HOH UA 4 .  ? 9.695   0.055   22.105 1.00 39.42  ? 568 HOH B O   1 
HETATM 4424 O O   . HOH UA 4 .  ? -12.459 8.881   32.912 1.00 48.93  ? 570 HOH B O   1 
HETATM 4425 O O   . HOH UA 4 .  ? 15.194  3.974   25.009 1.00 45.80  ? 573 HOH B O   1 
HETATM 4426 O O   . HOH UA 4 .  ? 7.951   7.335   16.295 1.00 30.00  ? 580 HOH B O   1 
HETATM 4427 O O   . HOH VA 4 .  ? -5.543  15.684  35.194 1.00 23.44  ? 103 HOH C O   1 
HETATM 4428 O O   . HOH VA 4 .  ? -16.669 9.903   37.954 1.00 29.70  ? 104 HOH C O   1 
HETATM 4429 O O   . HOH VA 4 .  ? -10.172 23.973  42.673 1.00 29.95  ? 105 HOH C O   1 
HETATM 4430 O O   . HOH VA 4 .  ? -2.242  6.512   49.530 1.00 29.87  ? 106 HOH C O   1 
HETATM 4431 O O   . HOH VA 4 .  ? -13.711 21.492  40.342 1.00 28.99  ? 107 HOH C O   1 
HETATM 4432 O O   . HOH VA 4 .  ? -19.853 9.899   38.296 1.00 50.20  ? 108 HOH C O   1 
HETATM 4433 O O   . HOH VA 4 .  ? -4.692  6.878   39.273 1.00 36.26  ? 109 HOH C O   1 
HETATM 4434 O O   . HOH VA 4 .  ? -1.590  23.821  48.004 1.00 35.01  ? 110 HOH C O   1 
HETATM 4435 O O   . HOH VA 4 .  ? -14.226 19.515  50.877 1.00 39.09  ? 111 HOH C O   1 
HETATM 4436 O O   . HOH VA 4 .  ? -13.167 8.397   36.553 1.00 29.04  ? 112 HOH C O   1 
HETATM 4437 O O   . HOH VA 4 .  ? -20.315 16.972  61.150 1.00 32.87  ? 113 HOH C O   1 
HETATM 4438 O O   . HOH VA 4 .  ? -9.122  13.631  32.175 1.00 33.57  ? 114 HOH C O   1 
HETATM 4439 O O   . HOH VA 4 .  ? -8.158  4.066   38.908 1.00 24.02  ? 115 HOH C O   1 
HETATM 4440 O O   . HOH VA 4 .  ? -14.653 16.339  36.680 1.00 33.70  ? 116 HOH C O   1 
HETATM 4441 O O   . HOH VA 4 .  ? -11.650 14.934  38.651 1.00 25.50  ? 117 HOH C O   1 
HETATM 4442 O O   . HOH VA 4 .  ? 0.123   9.143   46.802 1.00 27.41  ? 118 HOH C O   1 
HETATM 4443 O O   . HOH VA 4 .  ? -5.093  23.058  53.744 1.00 45.98  ? 119 HOH C O   1 
HETATM 4444 O O   . HOH VA 4 .  ? -22.671 -0.583  36.650 1.00 42.37  ? 120 HOH C O   1 
HETATM 4445 O O   . HOH VA 4 .  ? -1.552  6.669   54.550 1.00 31.36  ? 121 HOH C O   1 
HETATM 4446 O O   . HOH VA 4 .  ? -9.944  4.117   36.486 1.00 28.22  ? 122 HOH C O   1 
HETATM 4447 O O   . HOH VA 4 .  ? -22.221 10.008  39.865 1.00 45.54  ? 127 HOH C O   1 
HETATM 4448 O O   . HOH VA 4 .  ? -19.441 -1.656  38.699 1.00 32.12  ? 130 HOH C O   1 
HETATM 4449 O O   . HOH VA 4 .  ? -22.816 12.535  37.890 1.00 42.09  ? 131 HOH C O   1 
HETATM 4450 O O   . HOH VA 4 .  ? 0.640   5.912   53.392 1.00 31.10  ? 140 HOH C O   1 
HETATM 4451 O O   . HOH VA 4 .  ? -5.779  13.902  55.434 1.00 32.36  ? 145 HOH C O   1 
HETATM 4452 O O   . HOH VA 4 .  ? -11.582 2.352   37.487 1.00 32.11  ? 146 HOH C O   1 
HETATM 4453 O O   . HOH VA 4 .  ? -3.229  25.288  44.816 1.00 39.42  ? 150 HOH C O   1 
HETATM 4454 O O   . HOH VA 4 .  ? -26.930 8.039   57.474 1.00 49.61  ? 151 HOH C O   1 
HETATM 4455 O O   . HOH VA 4 .  ? -0.959  7.080   43.010 1.00 44.04  ? 152 HOH C O   1 
HETATM 4456 O O   . HOH VA 4 .  ? -8.054  7.378   37.336 1.00 24.92  ? 169 HOH C O   1 
HETATM 4457 O O   . HOH VA 4 .  ? -18.470 8.481   56.746 1.00 32.05  ? 181 HOH C O   1 
HETATM 4458 O O   . HOH VA 4 .  ? -20.488 16.775  38.055 1.00 28.87  ? 194 HOH C O   1 
HETATM 4459 O O   . HOH VA 4 .  ? -0.547  12.310  46.644 1.00 26.30  ? 204 HOH C O   1 
HETATM 4460 O O   . HOH VA 4 .  ? -4.805  17.349  38.943 1.00 25.65  ? 205 HOH C O   1 
HETATM 4461 O O   . HOH VA 4 .  ? -17.445 7.334   52.062 1.00 26.47  ? 215 HOH C O   1 
HETATM 4462 O O   . HOH VA 4 .  ? -5.747  11.028  55.277 1.00 27.81  ? 218 HOH C O   1 
HETATM 4463 O O   . HOH VA 4 .  ? -6.457  22.671  37.783 1.00 33.20  ? 235 HOH C O   1 
HETATM 4464 O O   . HOH VA 4 .  ? 1.026   23.687  41.696 1.00 45.12  ? 249 HOH C O   1 
HETATM 4465 O O   . HOH VA 4 .  ? -17.431 16.054  64.199 1.00 36.03  ? 256 HOH C O   1 
HETATM 4466 O O   . HOH VA 4 .  ? -29.138 9.730   50.466 1.00 48.26  ? 285 HOH C O   1 
HETATM 4467 O O   . HOH VA 4 .  ? -18.987 5.540   57.581 1.00 44.72  ? 293 HOH C O   1 
HETATM 4468 O O   . HOH VA 4 .  ? -2.253  22.264  50.128 1.00 42.26  ? 296 HOH C O   1 
HETATM 4469 O O   . HOH VA 4 .  ? -12.682 21.262  47.664 1.00 39.74  ? 301 HOH C O   1 
HETATM 4470 O O   . HOH VA 4 .  ? -10.538 14.819  60.460 1.00 39.63  ? 306 HOH C O   1 
HETATM 4471 O O   . HOH VA 4 .  ? -3.238  23.797  51.800 1.00 50.30  ? 315 HOH C O   1 
HETATM 4472 O O   . HOH VA 4 .  ? -25.347 9.794   41.678 1.00 46.23  ? 326 HOH C O   1 
HETATM 4473 O O   . HOH VA 4 .  ? -12.971 3.284   52.914 1.00 37.05  ? 331 HOH C O   1 
HETATM 4474 O O   . HOH VA 4 .  ? -14.531 20.620  58.947 1.00 39.17  ? 342 HOH C O   1 
HETATM 4475 O O   . HOH VA 4 .  ? -3.975  7.432   41.919 1.00 40.02  ? 345 HOH C O   1 
HETATM 4476 O O   . HOH VA 4 .  ? -3.027  24.172  40.147 1.00 35.85  ? 347 HOH C O   1 
HETATM 4477 O O   . HOH VA 4 .  ? -6.911  22.586  51.062 1.00 36.10  ? 348 HOH C O   1 
HETATM 4478 O O   . HOH VA 4 .  ? -2.184  3.831   54.505 1.00 48.07  ? 350 HOH C O   1 
HETATM 4479 O O   . HOH VA 4 .  ? -3.297  27.109  41.635 1.00 47.20  ? 355 HOH C O   1 
HETATM 4480 O O   . HOH VA 4 .  ? -10.282 5.773   59.193 1.00 41.58  ? 362 HOH C O   1 
HETATM 4481 O O   . HOH VA 4 .  ? -10.969 9.070   58.356 1.00 42.66  ? 364 HOH C O   1 
HETATM 4482 O O   . HOH VA 4 .  ? -9.632  20.543  31.500 1.00 39.89  ? 372 HOH C O   1 
HETATM 4483 O O   . HOH VA 4 .  ? -2.774  21.577  54.448 1.00 40.82  ? 394 HOH C O   1 
HETATM 4484 O O   . HOH VA 4 .  ? -22.490 3.488   42.770 1.00 45.44  ? 396 HOH C O   1 
HETATM 4485 O O   . HOH VA 4 .  ? -19.384 3.903   55.663 1.00 43.33  ? 400 HOH C O   1 
HETATM 4486 O O   . HOH VA 4 .  ? -22.615 22.338  47.394 1.00 42.09  ? 401 HOH C O   1 
HETATM 4487 O O   . HOH VA 4 .  ? -11.934 11.478  58.420 1.00 34.07  ? 437 HOH C O   1 
HETATM 4488 O O   . HOH VA 4 .  ? -26.107 12.449  43.098 1.00 56.30  ? 453 HOH C O   1 
HETATM 4489 O O   . HOH VA 4 .  ? -5.903  14.023  58.222 1.00 38.68  ? 462 HOH C O   1 
HETATM 4490 O O   . HOH VA 4 .  ? -6.443  10.869  57.883 1.00 37.08  ? 466 HOH C O   1 
HETATM 4491 O O   . HOH VA 4 .  ? -4.724  9.573   59.760 1.00 36.45  ? 467 HOH C O   1 
HETATM 4492 O O   . HOH VA 4 .  ? -5.387  4.504   38.288 1.00 35.61  ? 475 HOH C O   1 
HETATM 4493 O O   . HOH VA 4 .  ? -7.300  29.221  51.444 1.00 38.07  ? 476 HOH C O   1 
HETATM 4494 O O   . HOH VA 4 .  ? -2.987  3.872   49.544 1.00 30.79  ? 477 HOH C O   1 
HETATM 4495 O O   . HOH VA 4 .  ? -3.310  3.022   45.694 1.00 49.51  ? 492 HOH C O   1 
HETATM 4496 O O   . HOH VA 4 .  ? -5.544  1.809   47.001 1.00 46.65  ? 493 HOH C O   1 
HETATM 4497 O O   . HOH VA 4 .  ? -15.637 3.590   63.040 1.00 57.74  ? 497 HOH C O   1 
HETATM 4498 O O   . HOH VA 4 .  ? -20.110 5.305   33.408 1.00 58.26  ? 511 HOH C O   1 
HETATM 4499 O O   . HOH VA 4 .  ? -12.542 17.423  62.640 1.00 45.89  ? 535 HOH C O   1 
HETATM 4500 O O   . HOH VA 4 .  ? -23.105 5.282   52.605 1.00 46.08  ? 540 HOH C O   1 
HETATM 4501 O O   . HOH VA 4 .  ? -24.251 8.418   44.187 1.00 43.44  ? 543 HOH C O   1 
HETATM 4502 O O   . HOH VA 4 .  ? -18.752 17.848  36.231 1.00 50.71  ? 550 HOH C O   1 
HETATM 4503 O O   . HOH VA 4 .  ? -8.059  1.411   39.440 1.00 41.97  ? 560 HOH C O   1 
HETATM 4504 O O   . HOH VA 4 .  ? -8.389  24.446  37.734 1.00 53.67  ? 563 HOH C O   1 
HETATM 4505 O O   . HOH VA 4 .  ? -12.239 23.755  49.151 1.00 53.72  ? 565 HOH C O   1 
HETATM 4506 O O   . HOH VA 4 .  ? -30.022 7.265   55.251 1.00 54.93  ? 567 HOH C O   1 
HETATM 4507 O O   . HOH VA 4 .  ? -25.773 10.680  47.631 1.00 61.28  ? 579 HOH C O   1 
HETATM 4508 O O   . HOH WA 4 .  ? 5.610   7.914   57.907 1.00 35.29  ? 103 HOH D O   1 
HETATM 4509 O O   . HOH WA 4 .  ? 17.624  4.006   51.233 1.00 38.86  ? 104 HOH D O   1 
HETATM 4510 O O   . HOH WA 4 .  ? 4.358   13.366  53.555 1.00 30.48  ? 105 HOH D O   1 
HETATM 4511 O O   . HOH WA 4 .  ? 7.702   5.489   39.494 1.00 28.58  ? 106 HOH D O   1 
HETATM 4512 O O   . HOH WA 4 .  ? 20.736  -1.533  53.534 1.00 64.24  ? 107 HOH D O   1 
HETATM 4513 O O   . HOH WA 4 .  ? 6.104   15.247  61.580 1.00 49.74  ? 108 HOH D O   1 
HETATM 4514 O O   . HOH WA 4 .  ? 27.406  8.519   60.776 1.00 42.19  ? 109 HOH D O   1 
HETATM 4515 O O   . HOH WA 4 .  ? 10.942  21.143  40.794 1.00 33.58  ? 110 HOH D O   1 
HETATM 4516 O O   . HOH WA 4 .  ? 7.684   19.525  55.183 1.00 30.43  ? 111 HOH D O   1 
HETATM 4517 O O   . HOH WA 4 .  ? 1.424   16.691  47.803 1.00 29.95  ? 112 HOH D O   1 
HETATM 4518 O O   . HOH WA 4 .  ? 0.352   6.609   50.655 1.00 26.62  ? 113 HOH D O   1 
HETATM 4519 O O   . HOH WA 4 .  ? -1.534  15.399  50.137 1.00 24.62  ? 114 HOH D O   1 
HETATM 4520 O O   . HOH WA 4 .  ? 15.218  14.264  36.343 1.00 43.36  ? 115 HOH D O   1 
HETATM 4521 O O   . HOH WA 4 .  ? 17.009  20.696  39.510 1.00 52.00  ? 123 HOH D O   1 
HETATM 4522 O O   . HOH WA 4 .  ? 7.847   2.671   40.031 1.00 33.96  ? 137 HOH D O   1 
HETATM 4523 O O   . HOH WA 4 .  ? 13.458  20.929  44.085 1.00 40.30  ? 142 HOH D O   1 
HETATM 4524 O O   . HOH WA 4 .  ? 4.722   8.543   39.164 1.00 26.63  ? 144 HOH D O   1 
HETATM 4525 O O   . HOH WA 4 .  ? 0.179   6.288   46.665 1.00 47.61  ? 147 HOH D O   1 
HETATM 4526 O O   . HOH WA 4 .  ? 2.529   20.003  48.707 1.00 40.80  ? 148 HOH D O   1 
HETATM 4527 O O   . HOH WA 4 .  ? 16.418  11.480  36.014 1.00 51.36  ? 159 HOH D O   1 
HETATM 4528 O O   . HOH WA 4 .  ? 9.616   4.884   35.213 1.00 27.23  ? 164 HOH D O   1 
HETATM 4529 O O   . HOH WA 4 .  ? 11.831  5.245   36.511 1.00 28.10  ? 173 HOH D O   1 
HETATM 4530 O O   . HOH WA 4 .  ? 16.216  9.975   61.247 1.00 47.35  ? 198 HOH D O   1 
HETATM 4531 O O   . HOH WA 4 .  ? 8.531   13.860  61.709 1.00 37.83  ? 216 HOH D O   1 
HETATM 4532 O O   . HOH WA 4 .  ? 6.535   24.398  44.357 1.00 30.77  ? 217 HOH D O   1 
HETATM 4533 O O   . HOH WA 4 .  ? 5.738   -3.991  59.100 1.00 37.18  ? 230 HOH D O   1 
HETATM 4534 O O   . HOH WA 4 .  ? 8.256   22.353  51.195 1.00 29.73  ? 234 HOH D O   1 
HETATM 4535 O O   . HOH WA 4 .  ? 1.136   3.223   49.812 1.00 28.05  ? 239 HOH D O   1 
HETATM 4536 O O   . HOH WA 4 .  ? 2.151   17.936  49.938 1.00 52.69  ? 242 HOH D O   1 
HETATM 4537 O O   . HOH WA 4 .  ? 2.580   23.737  46.105 1.00 39.18  ? 248 HOH D O   1 
HETATM 4538 O O   . HOH WA 4 .  ? 13.476  25.219  46.766 1.00 34.74  ? 262 HOH D O   1 
HETATM 4539 O O   . HOH WA 4 .  ? 2.230   22.110  57.229 1.00 50.73  ? 280 HOH D O   1 
HETATM 4540 O O   . HOH WA 4 .  ? 8.174   23.340  41.188 1.00 37.87  ? 282 HOH D O   1 
HETATM 4541 O O   . HOH WA 4 .  ? 13.783  8.741   37.824 1.00 39.08  ? 288 HOH D O   1 
HETATM 4542 O O   . HOH WA 4 .  ? 2.401   7.008   55.448 1.00 38.83  ? 305 HOH D O   1 
HETATM 4543 O O   . HOH WA 4 .  ? 13.412  18.811  50.572 1.00 42.98  ? 310 HOH D O   1 
HETATM 4544 O O   . HOH WA 4 .  ? 24.552  12.099  56.214 1.00 43.04  ? 311 HOH D O   1 
HETATM 4545 O O   . HOH WA 4 .  ? 15.249  9.161   40.092 1.00 38.31  ? 313 HOH D O   1 
HETATM 4546 O O   . HOH WA 4 .  ? -2.875  13.285  54.503 1.00 36.68  ? 314 HOH D O   1 
HETATM 4547 O O   . HOH WA 4 .  ? 18.884  17.058  52.806 1.00 45.40  ? 319 HOH D O   1 
HETATM 4548 O O   . HOH WA 4 .  ? 28.199  12.597  50.005 1.00 50.57  ? 322 HOH D O   1 
HETATM 4549 O O   . HOH WA 4 .  ? 15.372  17.946  36.783 1.00 35.83  ? 340 HOH D O   1 
HETATM 4550 O O   . HOH WA 4 .  ? 15.697  0.793   47.142 1.00 47.71  ? 363 HOH D O   1 
HETATM 4551 O O   . HOH WA 4 .  ? 17.495  -0.198  49.332 1.00 51.80  ? 381 HOH D O   1 
HETATM 4552 O O   . HOH WA 4 .  ? 15.693  12.044  40.389 1.00 42.90  ? 387 HOH D O   1 
HETATM 4553 O O   . HOH WA 4 .  ? -1.988  19.522  56.323 1.00 42.78  ? 403 HOH D O   1 
HETATM 4554 O O   . HOH WA 4 .  ? 5.661   -3.035  62.955 1.00 46.31  ? 404 HOH D O   1 
HETATM 4555 O O   . HOH WA 4 .  ? 16.746  17.008  49.729 1.00 63.79  ? 409 HOH D O   1 
HETATM 4556 O O   . HOH WA 4 .  ? 19.458  7.230   41.664 1.00 60.03  ? 415 HOH D O   1 
HETATM 4557 O O   . HOH WA 4 .  ? 1.404   1.208   53.450 1.00 41.01  ? 427 HOH D O   1 
HETATM 4558 O O   . HOH WA 4 .  ? 7.459   7.426   60.614 1.00 46.65  ? 434 HOH D O   1 
HETATM 4559 O O   . HOH WA 4 .  ? -0.121  3.213   52.367 1.00 39.63  ? 449 HOH D O   1 
HETATM 4560 O O   . HOH WA 4 .  ? 10.127  23.184  52.889 1.00 33.39  ? 450 HOH D O   1 
HETATM 4561 O O   . HOH WA 4 .  ? 18.263  12.286  39.225 1.00 51.61  ? 451 HOH D O   1 
HETATM 4562 O O   . HOH WA 4 .  ? -0.695  4.090   47.890 1.00 33.99  ? 478 HOH D O   1 
HETATM 4563 O O   . HOH WA 4 .  ? 10.587  16.437  62.106 1.00 44.27  ? 481 HOH D O   1 
HETATM 4564 O O   . HOH WA 4 .  ? 14.308  19.978  38.498 1.00 42.64  ? 491 HOH D O   1 
HETATM 4565 O O   . HOH WA 4 .  ? 2.191   -4.718  58.378 1.00 50.33  ? 506 HOH D O   1 
HETATM 4566 O O   . HOH WA 4 .  ? 1.851   6.669   41.907 1.00 46.13  ? 512 HOH D O   1 
HETATM 4567 O O   . HOH WA 4 .  ? 7.834   30.826  47.174 1.00 37.31  ? 516 HOH D O   1 
HETATM 4568 O O   . HOH WA 4 .  ? 0.532   -0.282  55.086 1.00 45.46  ? 526 HOH D O   1 
HETATM 4569 O O   . HOH WA 4 .  ? 7.988   25.200  51.614 1.00 41.84  ? 534 HOH D O   1 
HETATM 4570 O O   . HOH WA 4 .  ? 12.591  23.807  52.271 1.00 50.45  ? 536 HOH D O   1 
HETATM 4571 O O   . HOH WA 4 .  ? 9.736   7.128   61.849 1.00 53.07  ? 538 HOH D O   1 
HETATM 4572 O O   . HOH WA 4 .  ? 11.221  0.737   60.359 1.00 50.09  ? 552 HOH D O   1 
HETATM 4573 O O   . HOH WA 4 .  ? 1.059   24.439  48.337 1.00 47.39  ? 553 HOH D O   1 
HETATM 4574 O O   . HOH WA 4 .  ? 3.464   15.883  59.531 1.00 47.17  ? 561 HOH D O   1 
HETATM 4575 O O   . HOH WA 4 .  ? 14.395  23.215  40.318 1.00 45.10  ? 572 HOH D O   1 
HETATM 4576 O O   . HOH WA 4 .  ? 4.410   21.709  70.487 1.00 55.02  ? 577 HOH D O   1 
HETATM 4577 O O   . HOH XA 4 .  ? -1.677  -2.469  49.994 1.00 31.17  ? 105 HOH E O   1 
HETATM 4578 O O   . HOH XA 4 .  ? -9.367  -4.682  40.328 1.00 31.33  ? 106 HOH E O   1 
HETATM 4579 O O   . HOH XA 4 .  ? -24.360 1.846   50.696 1.00 63.37  ? 107 HOH E O   1 
HETATM 4580 O O   . HOH XA 4 .  ? -2.142  -15.895 48.296 1.00 35.75  ? 108 HOH E O   1 
HETATM 4581 O O   . HOH XA 4 .  ? -22.099 -7.435  45.328 1.00 44.11  ? 109 HOH E O   1 
HETATM 4582 O O   . HOH XA 4 .  ? -18.027 -2.912  52.894 1.00 29.10  ? 110 HOH E O   1 
HETATM 4583 O O   . HOH XA 4 .  ? -7.114  -6.404  61.327 1.00 45.64  ? 111 HOH E O   1 
HETATM 4584 O O   . HOH XA 4 .  ? -13.577 -4.428  37.662 1.00 26.49  ? 112 HOH E O   1 
HETATM 4585 O O   . HOH XA 4 .  ? -5.470  -7.027  58.589 1.00 35.65  ? 113 HOH E O   1 
HETATM 4586 O O   . HOH XA 4 .  ? -16.626 -8.144  41.440 1.00 31.31  ? 115 HOH E O   1 
HETATM 4587 O O   . HOH XA 4 .  ? -4.572  -12.517 54.092 1.00 33.16  ? 116 HOH E O   1 
HETATM 4588 O O   . HOH XA 4 .  ? -6.701  -10.952 40.638 1.00 31.72  ? 126 HOH E O   1 
HETATM 4589 O O   . HOH XA 4 .  ? -8.465  -12.908 62.635 1.00 38.29  ? 129 HOH E O   1 
HETATM 4590 O O   . HOH XA 4 .  ? -1.159  -5.735  46.767 1.00 42.83  ? 135 HOH E O   1 
HETATM 4591 O O   . HOH XA 4 .  ? -0.804  -5.714  50.855 1.00 32.19  ? 138 HOH E O   1 
HETATM 4592 O O   . HOH XA 4 .  ? -11.489 -4.078  36.056 1.00 25.81  ? 153 HOH E O   1 
HETATM 4593 O O   . HOH XA 4 .  ? -5.337  4.746   59.583 1.00 32.42  ? 160 HOH E O   1 
HETATM 4594 O O   . HOH XA 4 .  ? 1.038   -14.473 50.428 1.00 34.85  ? 184 HOH E O   1 
HETATM 4595 O O   . HOH XA 4 .  ? -6.113  -7.871  39.680 1.00 28.99  ? 208 HOH E O   1 
HETATM 4596 O O   . HOH XA 4 .  ? -7.695  -18.480 56.019 1.00 35.26  ? 209 HOH E O   1 
HETATM 4597 O O   . HOH XA 4 .  ? -23.048 -3.398  51.871 1.00 44.15  ? 263 HOH E O   1 
HETATM 4598 O O   . HOH XA 4 .  ? -17.334 7.101   54.781 1.00 33.39  ? 271 HOH E O   1 
HETATM 4599 O O   . HOH XA 4 .  ? -7.590  -23.388 45.089 1.00 41.01  ? 278 HOH E O   1 
HETATM 4600 O O   . HOH XA 4 .  ? -16.080 -8.756  62.374 1.00 35.73  ? 283 HOH E O   1 
HETATM 4601 O O   . HOH XA 4 .  ? -17.027 -10.853 41.602 1.00 35.41  ? 318 HOH E O   1 
HETATM 4602 O O   . HOH XA 4 .  ? -2.561  -6.067  55.849 1.00 44.94  ? 330 HOH E O   1 
HETATM 4603 O O   . HOH XA 4 .  ? -9.181  -5.881  62.413 1.00 47.86  ? 337 HOH E O   1 
HETATM 4604 O O   . HOH XA 4 .  ? -23.929 -10.675 43.619 1.00 48.96  ? 341 HOH E O   1 
HETATM 4605 O O   . HOH XA 4 .  ? -16.287 0.326   48.378 1.00 37.48  ? 368 HOH E O   1 
HETATM 4606 O O   . HOH XA 4 .  ? -28.963 -10.402 55.702 1.00 51.59  ? 407 HOH E O   1 
HETATM 4607 O O   . HOH XA 4 .  ? -2.881  -6.073  42.126 1.00 51.51  ? 436 HOH E O   1 
HETATM 4608 O O   . HOH XA 4 .  ? -20.886 -1.897  42.745 1.00 45.40  ? 439 HOH E O   1 
HETATM 4609 O O   . HOH XA 4 .  ? -5.048  4.061   63.453 1.00 35.44  ? 444 HOH E O   1 
HETATM 4610 O O   . HOH XA 4 .  ? -26.892 -11.666 57.508 1.00 35.96  ? 448 HOH E O   1 
HETATM 4611 O O   . HOH XA 4 .  ? -1.107  -5.079  53.501 1.00 36.46  ? 454 HOH E O   1 
HETATM 4612 O O   . HOH XA 4 .  ? -0.210  -2.478  52.543 1.00 37.73  ? 459 HOH E O   1 
HETATM 4613 O O   . HOH XA 4 .  ? -0.056  -3.329  47.840 1.00 37.79  ? 479 HOH E O   1 
HETATM 4614 O O   . HOH XA 4 .  ? -19.553 -7.515  40.824 1.00 44.57  ? 486 HOH E O   1 
HETATM 4615 O O   . HOH XA 4 .  ? -29.089 -0.353  61.959 1.00 44.32  ? 495 HOH E O   1 
HETATM 4616 O O   . HOH XA 4 .  ? -9.879  3.421   62.511 1.00 51.45  ? 498 HOH E O   1 
HETATM 4617 O O   . HOH XA 4 .  ? -19.323 -15.703 54.629 1.00 47.11  ? 499 HOH E O   1 
HETATM 4618 O O   . HOH XA 4 .  ? -32.076 -4.382  52.644 1.00 57.61  ? 504 HOH E O   1 
HETATM 4619 O O   . HOH XA 4 .  ? -3.455  -22.973 46.660 1.00 47.61  ? 522 HOH E O   1 
HETATM 4620 O O   . HOH XA 4 .  ? -1.956  0.327   49.592 1.00 44.88  ? 523 HOH E O   1 
HETATM 4621 O O   . HOH XA 4 .  ? -1.743  -0.311  53.709 1.00 40.83  ? 524 HOH E O   1 
HETATM 4622 O O   . HOH XA 4 .  ? -17.808 -6.042  62.496 1.00 53.68  ? 547 HOH E O   1 
HETATM 4623 O O   . HOH XA 4 .  ? -1.757  -20.733 57.952 1.00 51.49  ? 569 HOH E O   1 
HETATM 4624 O O   . HOH XA 4 .  ? -9.277  -1.882  40.851 1.00 32.97  ? 578 HOH E O   1 
HETATM 4625 O O   . HOH YA 4 .  ? 6.492   -6.632  36.909 1.00 26.17  ? 102 HOH F O   1 
HETATM 4626 O O   . HOH YA 4 .  ? 15.361  -9.146  36.857 1.00 33.65  ? 103 HOH F O   1 
HETATM 4627 O O   . HOH YA 4 .  ? 3.855   -14.939 34.935 1.00 29.88  ? 104 HOH F O   1 
HETATM 4628 O O   . HOH YA 4 .  ? 8.926   -6.122  35.788 1.00 31.12  ? 105 HOH F O   1 
HETATM 4629 O O   . HOH YA 4 .  ? 17.725  2.633   37.171 1.00 40.83  ? 106 HOH F O   1 
HETATM 4630 O O   . HOH YA 4 .  ? 10.301  -14.099 38.144 1.00 33.12  ? 107 HOH F O   1 
HETATM 4631 O O   . HOH YA 4 .  ? 24.422  -14.838 53.143 1.00 51.04  ? 108 HOH F O   1 
HETATM 4632 O O   . HOH YA 4 .  ? 10.847  -22.690 33.015 1.00 65.24  ? 109 HOH F O   1 
HETATM 4633 O O   . HOH YA 4 .  ? 12.966  -15.490 35.775 1.00 40.66  ? 110 HOH F O   1 
HETATM 4634 O O   . HOH YA 4 .  ? 1.575   -5.676  49.429 1.00 39.44  ? 111 HOH F O   1 
HETATM 4635 O O   . HOH YA 4 .  ? 18.710  -7.013  55.230 1.00 48.13  ? 112 HOH F O   1 
HETATM 4636 O O   . HOH YA 4 .  ? 11.575  -25.830 41.196 1.00 49.46  ? 113 HOH F O   1 
HETATM 4637 O O   . HOH YA 4 .  ? 2.369   -3.077  49.372 1.00 36.38  ? 114 HOH F O   1 
HETATM 4638 O O   . HOH YA 4 .  ? -3.435  -18.769 49.402 1.00 58.91  ? 123 HOH F O   1 
HETATM 4639 O O   . HOH YA 4 .  ? 19.175  -15.638 36.996 1.00 38.99  ? 125 HOH F O   1 
HETATM 4640 O O   . HOH YA 4 .  ? 0.903   -22.995 48.349 1.00 45.45  ? 154 HOH F O   1 
HETATM 4641 O O   . HOH YA 4 .  ? 3.514   -16.860 38.951 1.00 36.59  ? 170 HOH F O   1 
HETATM 4642 O O   . HOH YA 4 .  ? 6.598   -3.377  38.318 1.00 26.96  ? 206 HOH F O   1 
HETATM 4643 O O   . HOH YA 4 .  ? 1.340   -5.863  54.500 1.00 36.42  ? 231 HOH F O   1 
HETATM 4644 O O   . HOH YA 4 .  ? 11.523  -7.652  35.718 1.00 32.58  ? 237 HOH F O   1 
HETATM 4645 O O   . HOH YA 4 .  ? -0.812  -8.351  47.003 1.00 33.29  ? 264 HOH F O   1 
HETATM 4646 O O   . HOH YA 4 .  ? 17.083  -6.140  50.758 1.00 35.59  ? 267 HOH F O   1 
HETATM 4647 O O   . HOH YA 4 .  ? 6.775   -12.963 31.817 1.00 40.73  ? 297 HOH F O   1 
HETATM 4648 O O   . HOH YA 4 .  ? -0.192  -11.570 46.859 1.00 33.56  ? 298 HOH F O   1 
HETATM 4649 O O   . HOH YA 4 .  ? 20.871  1.684   34.846 1.00 43.89  ? 321 HOH F O   1 
HETATM 4650 O O   . HOH YA 4 .  ? 8.242   -3.408  35.667 1.00 35.16  ? 328 HOH F O   1 
HETATM 4651 O O   . HOH YA 4 .  ? 3.120   -6.135  39.083 1.00 45.37  ? 336 HOH F O   1 
HETATM 4652 O O   . HOH YA 4 .  ? 9.895   -1.650  36.567 1.00 40.61  ? 384 HOH F O   1 
HETATM 4653 O O   . HOH YA 4 .  ? 9.699   1.406   38.405 1.00 40.85  ? 402 HOH F O   1 
HETATM 4654 O O   . HOH YA 4 .  ? 9.208   -23.149 42.379 1.00 40.54  ? 423 HOH F O   1 
HETATM 4655 O O   . HOH YA 4 .  ? 2.364   -3.122  54.523 1.00 41.75  ? 441 HOH F O   1 
HETATM 4656 O O   . HOH YA 4 .  ? 8.772   2.281   36.125 1.00 30.07  ? 452 HOH F O   1 
HETATM 4657 O O   . HOH YA 4 .  ? 3.817   -3.790  37.980 1.00 39.24  ? 455 HOH F O   1 
HETATM 4658 O O   . HOH YA 4 .  ? 15.779  -2.799  52.504 1.00 50.42  ? 482 HOH F O   1 
HETATM 4659 O O   . HOH YA 4 .  ? 23.893  -12.100 44.024 1.00 48.47  ? 490 HOH F O   1 
HETATM 4660 O O   . HOH YA 4 .  ? 23.515  -8.528  63.055 1.00 48.64  ? 503 HOH F O   1 
HETATM 4661 O O   . HOH YA 4 .  ? 14.508  -16.638 34.222 1.00 50.39  ? 505 HOH F O   1 
HETATM 4662 O O   . HOH YA 4 .  ? 1.233   -6.905  56.927 1.00 49.00  ? 527 HOH F O   1 
HETATM 4663 O O   . HOH YA 4 .  ? 29.278  -11.527 59.720 1.00 45.21  ? 533 HOH F O   1 
HETATM 4664 O O   . HOH YA 4 .  ? 19.756  -9.187  37.742 1.00 51.49  ? 551 HOH F O   1 
HETATM 4665 O O   . HOH YA 4 .  ? 2.960   -6.651  41.749 1.00 43.18  ? 566 HOH F O   1 
HETATM 4666 O O   . HOH YA 4 .  ? -0.083  -6.445  43.181 1.00 45.03  ? 571 HOH F O   1 
HETATM 4667 O O   . HOH YA 4 .  ? 6.421   -0.721  38.584 1.00 44.27  ? 576 HOH F O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 1  ? 0.3303 0.3880 0.3956 -0.0469 0.0377  -0.0236 1  PRO A N   
2    C CA  . PRO A 1  ? 0.2892 0.3508 0.3647 -0.0381 0.0300  -0.0194 1  PRO A CA  
3    C C   . PRO A 1  ? 0.2790 0.3625 0.3601 -0.0380 0.0289  -0.0234 1  PRO A C   
4    O O   . PRO A 1  ? 0.3259 0.4217 0.4041 -0.0467 0.0345  -0.0305 1  PRO A O   
5    C CB  . PRO A 1  ? 0.3273 0.3728 0.3994 -0.0389 0.0314  -0.0138 1  PRO A CB  
6    C CG  . PRO A 1  ? 0.4005 0.4286 0.4596 -0.0437 0.0376  -0.0139 1  PRO A CG  
7    C CD  . PRO A 1  ? 0.3814 0.4148 0.4357 -0.0476 0.0412  -0.0186 1  PRO A CD  
8    N N   . LYS A 2  ? 0.2491 0.3376 0.3372 -0.0283 0.0223  -0.0196 2  LYS A N   
9    C CA  . LYS A 2  ? 0.2445 0.3529 0.3350 -0.0246 0.0204  -0.0216 2  LYS A CA  
10   C C   . LYS A 2  ? 0.2266 0.3280 0.3158 -0.0248 0.0212  -0.0148 2  LYS A C   
11   O O   . LYS A 2  ? 0.2390 0.3210 0.3279 -0.0255 0.0215  -0.0083 2  LYS A O   
12   C CB  . LYS A 2  ? 0.3193 0.4331 0.4142 -0.0114 0.0132  -0.0195 2  LYS A CB  
13   C CG  . LYS A 2  ? 0.4151 0.5400 0.5125 -0.0084 0.0109  -0.0273 2  LYS A CG  
14   C CD  . LYS A 2  ? 0.4860 0.6126 0.5867 0.0069  0.0034  -0.0251 2  LYS A CD  
15   C CE  . LYS A 2  ? 0.5374 0.6370 0.6391 0.0118  0.0014  -0.0135 2  LYS A CE  
16   N NZ  . LYS A 2  ? 0.5865 0.6808 0.6887 0.0266  -0.0044 -0.0100 2  LYS A NZ  
17   N N   . PRO A 3  ? 0.2470 0.3675 0.3358 -0.0236 0.0215  -0.0173 3  PRO A N   
18   C CA  . PRO A 3  ? 0.2536 0.3700 0.3409 -0.0227 0.0221  -0.0106 3  PRO A CA  
19   C C   . PRO A 3  ? 0.2445 0.3424 0.3331 -0.0153 0.0187  0.0013  3  PRO A C   
20   O O   . PRO A 3  ? 0.2316 0.3269 0.3215 -0.0062 0.0145  0.0048  3  PRO A O   
21   C CB  . PRO A 3  ? 0.2795 0.4242 0.3662 -0.0175 0.0207  -0.0150 3  PRO A CB  
22   C CG  . PRO A 3  ? 0.2814 0.4463 0.3701 -0.0227 0.0225  -0.0286 3  PRO A CG  
23   C CD  . PRO A 3  ? 0.2690 0.4194 0.3590 -0.0222 0.0211  -0.0275 3  PRO A CD  
24   N N   . GLY A 4  ? 0.2064 0.2910 0.2946 -0.0195 0.0210  0.0062  4  GLY A N   
25   C CA  . GLY A 4  ? 0.1908 0.2593 0.2816 -0.0160 0.0197  0.0154  4  GLY A CA  
26   C C   . GLY A 4  ? 0.2052 0.2568 0.3001 -0.0189 0.0193  0.0143  4  GLY A C   
27   O O   . GLY A 4  ? 0.2301 0.2706 0.3286 -0.0195 0.0197  0.0187  4  GLY A O   
28   N N   . ASP A 5  ? 0.1950 0.2469 0.2892 -0.0205 0.0189  0.0077  5  ASP A N   
29   C CA  . ASP A 5  ? 0.1846 0.2237 0.2813 -0.0210 0.0180  0.0060  5  ASP A CA  
30   C C   . ASP A 5  ? 0.1868 0.2180 0.2801 -0.0250 0.0207  0.0056  5  ASP A C   
31   O O   . ASP A 5  ? 0.2196 0.2527 0.3063 -0.0292 0.0242  0.0038  5  ASP A O   
32   C CB  . ASP A 5  ? 0.1941 0.2366 0.2883 -0.0214 0.0178  -0.0004 5  ASP A CB  
33   C CG  . ASP A 5  ? 0.2559 0.3057 0.3548 -0.0151 0.0136  -0.0022 5  ASP A CG  
34   O OD1 . ASP A 5  ? 0.2653 0.3118 0.3688 -0.0092 0.0107  0.0023  5  ASP A OD1 
35   O OD2 . ASP A 5  ? 0.2849 0.3428 0.3818 -0.0159 0.0139  -0.0084 5  ASP A OD2 
36   N N   . ILE A 6  ? 0.1853 0.2082 0.2831 -0.0231 0.0190  0.0057  6  ILE A N   
37   C CA  . ILE A 6  ? 0.1740 0.1912 0.2679 -0.0234 0.0202  0.0036  6  ILE A CA  
38   C C   . ILE A 6  ? 0.2049 0.2163 0.2897 -0.0219 0.0208  -0.0003 6  ILE A C   
39   O O   . ILE A 6  ? 0.2252 0.2379 0.3122 -0.0195 0.0187  -0.0025 6  ILE A O   
40   C CB  . ILE A 6  ? 0.1821 0.1979 0.2857 -0.0213 0.0179  0.0028  6  ILE A CB  
41   C CG1 . ILE A 6  ? 0.1689 0.1874 0.2800 -0.0244 0.0192  0.0079  6  ILE A CG1 
42   C CG2 . ILE A 6  ? 0.2062 0.2204 0.3053 -0.0187 0.0179  -0.0011 6  ILE A CG2 
43   C CD1 . ILE A 6  ? 0.2121 0.2358 0.3178 -0.0271 0.0222  0.0106  6  ILE A CD1 
44   N N   . PHE A 7  ? 0.2183 0.2223 0.2916 -0.0229 0.0243  -0.0009 7  PHE A N   
45   C CA  . PHE A 7  ? 0.2118 0.2054 0.2728 -0.0200 0.0260  -0.0027 7  PHE A CA  
46   C C   . PHE A 7  ? 0.2273 0.2096 0.2778 -0.0154 0.0273  -0.0027 7  PHE A C   
47   O O   . PHE A 7  ? 0.2409 0.2251 0.2939 -0.0165 0.0277  -0.0024 7  PHE A O   
48   C CB  . PHE A 7  ? 0.2461 0.2378 0.2987 -0.0265 0.0312  -0.0036 7  PHE A CB  
49   C CG  . PHE A 7  ? 0.2318 0.2201 0.2780 -0.0340 0.0371  -0.0044 7  PHE A CG  
50   C CD1 . PHE A 7  ? 0.2804 0.2504 0.3103 -0.0363 0.0435  -0.0047 7  PHE A CD1 
51   C CD2 . PHE A 7  ? 0.2510 0.2536 0.3065 -0.0383 0.0366  -0.0051 7  PHE A CD2 
52   C CE1 . PHE A 7  ? 0.3083 0.2736 0.3331 -0.0444 0.0496  -0.0074 7  PHE A CE1 
53   C CE2 . PHE A 7  ? 0.2684 0.2711 0.3192 -0.0454 0.0419  -0.0082 7  PHE A CE2 
54   C CZ  . PHE A 7  ? 0.2702 0.2538 0.3066 -0.0492 0.0486  -0.0101 7  PHE A CZ  
55   N N   . GLU A 8  ? 0.2500 0.2221 0.2882 -0.0084 0.0276  -0.0032 8  GLU A N   
56   C CA  . GLU A 8  ? 0.2593 0.2187 0.2838 -0.0006 0.0284  -0.0032 8  GLU A CA  
57   C C   . GLU A 8  ? 0.2621 0.1998 0.2638 0.0012  0.0345  -0.0004 8  GLU A C   
58   O O   . GLU A 8  ? 0.3234 0.2598 0.3208 -0.0014 0.0368  0.0007  8  GLU A O   
59   C CB  . GLU A 8  ? 0.3592 0.3288 0.3898 0.0107  0.0218  -0.0070 8  GLU A CB  
60   C CG  . GLU A 8  ? 0.4433 0.4191 0.4751 0.0170  0.0183  -0.0095 8  GLU A CG  
61   C CD  . GLU A 8  ? 0.5060 0.4993 0.5504 0.0253  0.0116  -0.0167 8  GLU A CD  
62   O OE1 . GLU A 8  ? 0.5632 0.5692 0.6213 0.0246  0.0082  -0.0211 8  GLU A OE1 
63   O OE2 . GLU A 8  ? 0.4852 0.4810 0.5267 0.0323  0.0100  -0.0197 8  GLU A OE2 
64   N N   . VAL A 9  ? 0.2731 0.1928 0.2594 0.0055  0.0378  0.0007  9  VAL A N   
65   C CA  . VAL A 9  ? 0.3170 0.2090 0.2776 0.0076  0.0453  0.0047  9  VAL A CA  
66   C C   . VAL A 9  ? 0.3691 0.2450 0.3122 0.0238  0.0436  0.0056  9  VAL A C   
67   O O   . VAL A 9  ? 0.3918 0.2767 0.3428 0.0292  0.0387  0.0019  9  VAL A O   
68   C CB  . VAL A 9  ? 0.3698 0.2473 0.3245 -0.0068 0.0547  0.0047  9  VAL A CB  
69   C CG1 . VAL A 9  ? 0.3635 0.2618 0.3360 -0.0213 0.0557  0.0020  9  VAL A CG1 
70   C CG2 . VAL A 9  ? 0.3712 0.2445 0.3272 -0.0058 0.0543  0.0020  9  VAL A CG2 
71   N N   . GLU A 10 ? 0.3638 0.2167 0.2818 0.0326  0.0479  0.0105  10 GLU A N   
72   C CA  . GLU A 10 ? 0.3793 0.2077 0.2728 0.0490  0.0487  0.0130  10 GLU A CA  
73   C C   . GLU A 10 ? 0.4454 0.2358 0.3163 0.0398  0.0615  0.0182  10 GLU A C   
74   O O   . GLU A 10 ? 0.4943 0.2687 0.3506 0.0338  0.0697  0.0236  10 GLU A O   
75   C CB  . GLU A 10 ? 0.4325 0.2601 0.3099 0.0686  0.0445  0.0155  10 GLU A CB  
76   C CG  . GLU A 10 ? 0.4504 0.3160 0.3503 0.0776  0.0324  0.0075  10 GLU A CG  
77   C CD  . GLU A 10 ? 0.4584 0.3326 0.3599 0.0921  0.0256  0.0015  10 GLU A CD  
78   O OE1 . GLU A 10 ? 0.5221 0.3720 0.4071 0.0961  0.0295  0.0038  10 GLU A OE1 
79   O OE2 . GLU A 10 ? 0.5284 0.4346 0.4480 0.0990  0.0167  -0.0069 10 GLU A OE2 
80   N N   . LEU A 11 ? 0.4540 0.2305 0.3221 0.0383  0.0640  0.0156  11 LEU A N   
81   C CA  . LEU A 11 ? 0.4667 0.2093 0.3189 0.0254  0.0770  0.0174  11 LEU A CA  
82   C C   . LEU A 11 ? 0.5103 0.2134 0.3317 0.0420  0.0804  0.0211  11 LEU A C   
83   O O   . LEU A 11 ? 0.5220 0.2316 0.3455 0.0569  0.0723  0.0171  11 LEU A O   
84   C CB  . LEU A 11 ? 0.5132 0.2737 0.3891 0.0084  0.0774  0.0093  11 LEU A CB  
85   C CG  . LEU A 11 ? 0.5639 0.3025 0.4341 -0.0105 0.0903  0.0061  11 LEU A CG  
86   C CD1 . LEU A 11 ? 0.6158 0.3522 0.4837 -0.0267 0.0996  0.0082  11 LEU A CD1 
87   C CD2 . LEU A 11 ? 0.5299 0.2953 0.4253 -0.0214 0.0873  -0.0033 11 LEU A CD2 
88   N N   . ALA A 12 ? 0.5296 0.1908 0.3213 0.0396  0.0930  0.0287  12 ALA A N   
89   C CA  . ALA A 12 ? 0.6141 0.2281 0.3707 0.0555  0.0987  0.0342  12 ALA A CA  
90   C C   . ALA A 12 ? 0.6559 0.2449 0.4115 0.0406  0.1082  0.0286  12 ALA A C   
91   O O   . ALA A 12 ? 0.6727 0.2584 0.4362 0.0158  0.1188  0.0258  12 ALA A O   
92   C CB  . ALA A 12 ? 0.6413 0.2181 0.3631 0.0597  0.1096  0.0467  12 ALA A CB  
93   N N   . LYS A 13 ? 0.6446 0.2193 0.3919 0.0557  0.1042  0.0251  13 LYS A N   
94   C CA  . LYS A 13 ? 0.6530 0.2000 0.3967 0.0433  0.1137  0.0187  13 LYS A CA  
95   C C   . LYS A 13 ? 0.7219 0.2093 0.4326 0.0334  0.1328  0.0256  13 LYS A C   
96   O O   . LYS A 13 ? 0.7708 0.2231 0.4484 0.0475  0.1378  0.0379  13 LYS A O   
97   C CB  . LYS A 13 ? 0.6389 0.1811 0.3780 0.0641  0.1053  0.0130  13 LYS A CB  
98   C CG  . LYS A 13 ? 0.5790 0.1804 0.3532 0.0686  0.0892  0.0039  13 LYS A CG  
99   C CD  . LYS A 13 ? 0.6270 0.2247 0.3938 0.0912  0.0812  -0.0022 13 LYS A CD  
100  C CE  . LYS A 13 ? 0.6056 0.2632 0.4063 0.0944  0.0667  -0.0107 13 LYS A CE  
101  N NZ  . LYS A 13 ? 0.6284 0.2894 0.4236 0.1166  0.0585  -0.0182 13 LYS A NZ  
102  N N   . ASN A 14 ? 0.6855 0.1634 0.4058 0.0082  0.1440  0.0171  14 ASN A N   
103  C CA  . ASN A 14 ? 0.7667 0.1838 0.4571 -0.0034 0.1637  0.0201  14 ASN A CA  
104  C C   . ASN A 14 ? 0.8245 0.2139 0.5071 0.0043  0.1645  0.0123  14 ASN A C   
105  O O   . ASN A 14 ? 0.8062 0.2264 0.5175 -0.0065 0.1599  -0.0019 14 ASN A O   
106  C CB  . ASN A 14 ? 0.7844 0.2116 0.4922 -0.0387 0.1771  0.0123  14 ASN A CB  
107  C CG  . ASN A 14 ? 0.8861 0.3323 0.5961 -0.0475 0.1797  0.0201  14 ASN A CG  
108  O OD1 . ASN A 14 ? 0.9529 0.4014 0.6497 -0.0274 0.1723  0.0318  14 ASN A OD1 
109  N ND2 . ASN A 14 ? 0.8793 0.3425 0.6066 -0.0769 0.1899  0.0118  14 ASN A ND2 
110  N N   . ASP A 15 ? 0.8721 0.2041 0.5148 0.0246  0.1699  0.0213  15 ASP A N   
111  C CA  . ASP A 15 ? 0.9066 0.2048 0.5369 0.0352  0.1710  0.0141  15 ASP A CA  
112  C C   . ASP A 15 ? 0.8807 0.2313 0.5415 0.0476  0.1520  0.0020  15 ASP A C   
113  O O   . ASP A 15 ? 0.9062 0.2635 0.5837 0.0376  0.1527  -0.0123 15 ASP A O   
114  C CB  . ASP A 15 ? 0.9498 0.2144 0.5802 0.0053  0.1900  0.0042  15 ASP A CB  
115  C CG  . ASP A 15 ? 1.0894 0.2891 0.6823 -0.0051 0.2116  0.0163  15 ASP A CG  
116  O OD1 . ASP A 15 ? 1.1661 0.3184 0.7184 0.0202  0.2135  0.0317  15 ASP A OD1 
117  O OD2 . ASP A 15 ? 1.1485 0.3461 0.7518 -0.0383 0.2270  0.0102  15 ASP A OD2 
118  N N   . ASN A 16 ? 0.8166 0.2057 0.4849 0.0687  0.1358  0.0069  16 ASN A N   
119  C CA  . ASN A 16 ? 0.8137 0.2528 0.5082 0.0821  0.1183  -0.0032 16 ASN A CA  
120  C C   . ASN A 16 ? 0.7113 0.2066 0.4499 0.0583  0.1138  -0.0153 16 ASN A C   
121  O O   . ASN A 16 ? 0.7378 0.2677 0.4964 0.0654  0.1028  -0.0249 16 ASN A O   
122  C CB  . ASN A 16 ? 0.9150 0.3235 0.5908 0.1033  0.1161  -0.0093 16 ASN A CB  
123  C CG  . ASN A 16 ? 0.9452 0.3924 0.6285 0.1323  0.0974  -0.0129 16 ASN A CG  
124  O OD1 . ASN A 16 ? 0.9252 0.3977 0.6092 0.1456  0.0886  -0.0061 16 ASN A OD1 
125  N ND2 . ASN A 16 ? 0.9732 0.4272 0.6629 0.1418  0.0916  -0.0252 16 ASN A ND2 
126  N N   . SER A 17 ? 0.7118 0.2195 0.4649 0.0320  0.1217  -0.0145 17 SER A N   
127  C CA  . SER A 17 ? 0.6274 0.1898 0.4197 0.0124  0.1168  -0.0246 17 SER A CA  
128  C C   . SER A 17 ? 0.5949 0.1869 0.4019 0.0001  0.1160  -0.0185 17 SER A C   
129  O O   . SER A 17 ? 0.6176 0.1817 0.4068 -0.0073 0.1265  -0.0106 17 SER A O   
130  C CB  . SER A 17 ? 0.6791 0.2282 0.4778 -0.0108 0.1290  -0.0368 17 SER A CB  
131  O OG  . SER A 17 ? 0.6411 0.2438 0.4749 -0.0287 0.1248  -0.0456 17 SER A OG  
132  N N   . LEU A 18 ? 0.5318 0.1782 0.3693 -0.0017 0.1043  -0.0219 18 LEU A N   
133  C CA  . LEU A 18 ? 0.5058 0.1835 0.3600 -0.0122 0.1021  -0.0176 18 LEU A CA  
134  C C   . LEU A 18 ? 0.5191 0.2044 0.3857 -0.0391 0.1124  -0.0242 18 LEU A C   
135  O O   . LEU A 18 ? 0.4908 0.1927 0.3653 -0.0488 0.1137  -0.0210 18 LEU A O   
136  C CB  . LEU A 18 ? 0.4395 0.1681 0.3204 -0.0049 0.0872  -0.0187 18 LEU A CB  
137  C CG  . LEU A 18 ? 0.5206 0.2521 0.3936 0.0197  0.0767  -0.0140 18 LEU A CG  
138  C CD1 . LEU A 18 ? 0.4755 0.2550 0.3764 0.0225  0.0648  -0.0184 18 LEU A CD1 
139  C CD2 . LEU A 18 ? 0.5015 0.2202 0.3588 0.0277  0.0772  -0.0039 18 LEU A CD2 
140  N N   . GLY A 19 ? 0.5648 0.2412 0.4341 -0.0504 0.1193  -0.0351 19 GLY A N   
141  C CA  . GLY A 19 ? 0.5739 0.2616 0.4560 -0.0759 0.1293  -0.0448 19 GLY A CA  
142  C C   . GLY A 19 ? 0.5410 0.2866 0.4551 -0.0834 0.1206  -0.0509 19 GLY A C   
143  O O   . GLY A 19 ? 0.5090 0.2749 0.4348 -0.0998 0.1252  -0.0552 19 GLY A O   
144  N N   . ILE A 20 ? 0.5153 0.2884 0.4429 -0.0705 0.1081  -0.0514 20 ILE A N   
145  C CA  . ILE A 20 ? 0.4640 0.2876 0.4186 -0.0765 0.1010  -0.0566 20 ILE A CA  
146  C C   . ILE A 20 ? 0.4792 0.3190 0.4433 -0.0723 0.0965  -0.0655 20 ILE A C   
147  O O   . ILE A 20 ? 0.5311 0.3563 0.4863 -0.0576 0.0921  -0.0637 20 ILE A O   
148  C CB  . ILE A 20 ? 0.4918 0.3421 0.4569 -0.0666 0.0900  -0.0465 20 ILE A CB  
149  C CG1 . ILE A 20 ? 0.5273 0.3807 0.4917 -0.0482 0.0801  -0.0420 20 ILE A CG1 
150  C CG2 . ILE A 20 ? 0.4775 0.3104 0.4310 -0.0666 0.0930  -0.0374 20 ILE A CG2 
151  C CD1 . ILE A 20 ? 0.5126 0.4027 0.4953 -0.0434 0.0699  -0.0368 20 ILE A CD1 
152  N N   . SER A 21 ? 0.4022 0.2740 0.3838 -0.0844 0.0975  -0.0763 21 SER A N   
153  C CA  . SER A 21 ? 0.3741 0.2712 0.3673 -0.0798 0.0920  -0.0843 21 SER A CA  
154  C C   . SER A 21 ? 0.3182 0.2598 0.3291 -0.0752 0.0819  -0.0784 21 SER A C   
155  O O   . SER A 21 ? 0.3545 0.3112 0.3719 -0.0803 0.0812  -0.0737 21 SER A O   
156  C CB  . SER A 21 ? 0.4691 0.3730 0.4685 -0.0947 0.1001  -0.1019 21 SER A CB  
157  O OG  . SER A 21 ? 0.4670 0.3973 0.4784 -0.1093 0.1037  -0.1073 21 SER A OG  
158  N N   . VAL A 22 ? 0.3239 0.2855 0.3416 -0.0652 0.0745  -0.0782 22 VAL A N   
159  C CA  . VAL A 22 ? 0.2902 0.2886 0.3219 -0.0610 0.0666  -0.0708 22 VAL A CA  
160  C C   . VAL A 22 ? 0.2492 0.2842 0.2932 -0.0628 0.0646  -0.0790 22 VAL A C   
161  O O   . VAL A 22 ? 0.2551 0.2894 0.2982 -0.0644 0.0674  -0.0909 22 VAL A O   
162  C CB  . VAL A 22 ? 0.2752 0.2709 0.3052 -0.0474 0.0593  -0.0602 22 VAL A CB  
163  C CG1 . VAL A 22 ? 0.3275 0.2956 0.3470 -0.0442 0.0598  -0.0513 22 VAL A CG1 
164  C CG2 . VAL A 22 ? 0.3338 0.3220 0.3583 -0.0384 0.0578  -0.0662 22 VAL A CG2 
165  N N   . THR A 23 ? 0.2314 0.2977 0.2858 -0.0618 0.0600  -0.0726 23 THR A N   
166  C CA  . THR A 23 ? 0.2202 0.3239 0.2841 -0.0601 0.0572  -0.0766 23 THR A CA  
167  C C   . THR A 23 ? 0.2702 0.3895 0.3379 -0.0513 0.0510  -0.0630 23 THR A C   
168  O O   . THR A 23 ? 0.2627 0.3713 0.3296 -0.0492 0.0490  -0.0518 23 THR A O   
169  C CB  . THR A 23 ? 0.3103 0.4400 0.3810 -0.0677 0.0592  -0.0834 23 THR A CB  
170  O OG1 . THR A 23 ? 0.3506 0.5176 0.4281 -0.0640 0.0564  -0.0876 23 THR A OG1 
171  C CG2 . THR A 23 ? 0.3031 0.4355 0.3752 -0.0669 0.0569  -0.0720 23 THR A CG2 
172  N N   . GLY A 24 ? 0.3075 0.2804 0.3668 0.0037  -0.0874 -0.0896 24 GLY A N   
173  C CA  . GLY A 24 ? 0.3482 0.2819 0.3433 -0.0245 -0.0978 -0.0714 24 GLY A CA  
174  C C   . GLY A 24 ? 0.3158 0.2930 0.3021 -0.0531 -0.0676 -0.0566 24 GLY A C   
175  O O   . GLY A 24 ? 0.2950 0.3293 0.3254 -0.0476 -0.0424 -0.0657 24 GLY A O   
176  N N   . GLY A 25 ? 0.3478 0.2968 0.2794 -0.0841 -0.0762 -0.0367 25 GLY A N   
177  C CA  . GLY A 25 ? 0.4012 0.3930 0.3121 -0.1185 -0.0504 -0.0245 25 GLY A CA  
178  C C   . GLY A 25 ? 0.4451 0.4039 0.2665 -0.1607 -0.0680 -0.0071 25 GLY A C   
179  O O   . GLY A 25 ? 0.4769 0.3868 0.2605 -0.1596 -0.0968 -0.0065 25 GLY A O   
180  N N   . VAL A 26 ? 0.4386 0.4268 0.2227 -0.2036 -0.0533 0.0087  26 VAL A N   
181  C CA  . VAL A 26 ? 0.5780 0.5375 0.2648 -0.2598 -0.0749 0.0337  26 VAL A CA  
182  C C   . VAL A 26 ? 0.6374 0.6383 0.2947 -0.2773 -0.0657 0.0197  26 VAL A C   
183  O O   . VAL A 26 ? 0.7686 0.7346 0.3396 -0.3239 -0.0937 0.0422  26 VAL A O   
184  C CB  . VAL A 26 ? 0.6256 0.6239 0.2790 -0.3090 -0.0576 0.0524  26 VAL A CB  
185  C CG1 . VAL A 26 ? 0.6500 0.5929 0.3162 -0.2986 -0.0766 0.0705  26 VAL A CG1 
186  C CG2 . VAL A 26 ? 0.5831 0.6978 0.2972 -0.3036 -0.0042 0.0212  26 VAL A CG2 
187  N N   . ASN A 27 ? 0.5631 0.6378 0.2933 -0.2420 -0.0316 -0.0176 27 ASN A N   
188  C CA  . ASN A 27 ? 0.6142 0.7454 0.3337 -0.2514 -0.0189 -0.0428 27 ASN A CA  
189  C C   . ASN A 27 ? 0.6481 0.7164 0.3695 -0.2171 -0.0467 -0.0470 27 ASN A C   
190  O O   . ASN A 27 ? 0.6968 0.8027 0.4137 -0.2176 -0.0401 -0.0692 27 ASN A O   
191  C CB  . ASN A 27 ? 0.5195 0.7585 0.3290 -0.2253 0.0221  -0.0882 27 ASN A CB  
192  C CG  . ASN A 27 ? 0.4379 0.6573 0.3429 -0.1634 0.0211  -0.0998 27 ASN A CG  
193  O OD1 . ASN A 27 ? 0.3241 0.4886 0.2390 -0.1505 0.0091  -0.0761 27 ASN A OD1 
194  N ND2 . ASN A 27 ? 0.4606 0.7268 0.4346 -0.1286 0.0295  -0.1370 27 ASN A ND2 
195  N N   . THR A 28 ? 0.5704 0.5512 0.3024 -0.1874 -0.0781 -0.0313 28 THR A N   
196  C CA  . THR A 28 ? 0.5638 0.4837 0.3018 -0.1535 -0.1084 -0.0383 28 THR A CA  
197  C C   . THR A 28 ? 0.7092 0.5253 0.3689 -0.1780 -0.1647 -0.0083 28 THR A C   
198  O O   . THR A 28 ? 0.7710 0.5579 0.3723 -0.2222 -0.1825 0.0215  28 THR A O   
199  C CB  . THR A 28 ? 0.4615 0.3740 0.2874 -0.0960 -0.1059 -0.0556 28 THR A CB  
200  O OG1 . THR A 28 ? 0.5076 0.3626 0.3275 -0.0928 -0.1325 -0.0413 28 THR A OG1 
201  C CG2 . THR A 28 ? 0.4204 0.4169 0.3232 -0.0795 -0.0643 -0.0736 28 THR A CG2 
202  N N   . SER A 29 ? 0.7164 0.4729 0.3778 -0.1496 -0.1992 -0.0168 29 SER A N   
203  C CA  . SER A 29 ? 0.8410 0.4872 0.4455 -0.1623 -0.2665 0.0047  29 SER A CA  
204  C C   . SER A 29 ? 0.8124 0.4128 0.4822 -0.1084 -0.2935 -0.0170 29 SER A C   
205  O O   . SER A 29 ? 0.8981 0.4110 0.5519 -0.0971 -0.3549 -0.0187 29 SER A O   
206  C CB  . SER A 29 ? 0.9448 0.5507 0.4941 -0.1775 -0.2986 0.0098  29 SER A CB  
207  O OG  . SER A 29 ? 1.1276 0.6186 0.6128 -0.2018 -0.3749 0.0376  29 SER A OG  
208  N N   . VAL A 30 ? 0.7046 0.3704 0.4505 -0.0777 -0.2509 -0.0371 30 VAL A N   
209  C CA  . VAL A 30 ? 0.6568 0.3047 0.4609 -0.0389 -0.2702 -0.0602 30 VAL A CA  
210  C C   . VAL A 30 ? 0.8285 0.4107 0.5931 -0.0628 -0.3140 -0.0413 30 VAL A C   
211  O O   . VAL A 30 ? 0.8717 0.4598 0.5877 -0.1072 -0.3020 -0.0091 30 VAL A O   
212  C CB  . VAL A 30 ? 0.5879 0.3277 0.4707 -0.0158 -0.2155 -0.0779 30 VAL A CB  
213  C CG1 . VAL A 30 ? 0.6254 0.3686 0.5583 0.0080  -0.2292 -0.0997 30 VAL A CG1 
214  C CG2 . VAL A 30 ? 0.5643 0.3481 0.4897 0.0106  -0.1920 -0.0975 30 VAL A CG2 
215  N N   . ARG A 31 ? 0.8653 0.3864 0.6534 -0.0337 -0.3698 -0.0651 31 ARG A N   
216  C CA  . ARG A 31 ? 0.9048 0.3481 0.6653 -0.0490 -0.4295 -0.0545 31 ARG A CA  
217  C C   . ARG A 31 ? 0.8463 0.3241 0.5964 -0.0791 -0.3985 -0.0306 31 ARG A C   
218  O O   . ARG A 31 ? 0.7784 0.3426 0.5828 -0.0638 -0.3411 -0.0447 31 ARG A O   
219  C CB  . ARG A 31 ? 0.9787 0.4022 0.8118 0.0043  -0.4738 -0.1088 31 ARG A CB  
220  C CG  . ARG A 31 ? 0.9308 0.4593 0.8486 0.0458  -0.4179 -0.1521 31 ARG A CG  
221  C CD  . ARG A 31 ? 0.9936 0.5158 0.9784 0.0952  -0.4630 -0.2145 31 ARG A CD  
222  N NE  . ARG A 31 ? 1.0200 0.5254 1.0364 0.1068  -0.5041 -0.2432 31 ARG A NE  
223  C CZ  . ARG A 31 ? 1.1667 0.5688 1.1706 0.1141  -0.5918 -0.2553 31 ARG A CZ  
224  N NH1 . ARG A 31 ? 1.2285 0.5314 1.1822 0.1061  -0.6485 -0.2354 31 ARG A NH1 
225  N NH2 . ARG A 31 ? 1.2203 0.6164 1.2640 0.1282  -0.6287 -0.2883 31 ARG A NH2 
226  N N   . HIS A 32 ? 0.9262 0.3340 0.6022 -0.1269 -0.4403 0.0094  32 HIS A N   
227  C CA  . HIS A 32 ? 0.9352 0.3623 0.5946 -0.1589 -0.4219 0.0338  32 HIS A CA  
228  C C   . HIS A 32 ? 0.8690 0.4046 0.5341 -0.1777 -0.3355 0.0457  32 HIS A C   
229  O O   . HIS A 32 ? 0.9334 0.5007 0.5909 -0.2031 -0.3102 0.0633  32 HIS A O   
230  C CB  . HIS A 32 ? 0.9403 0.3615 0.6690 -0.1185 -0.4448 -0.0027 32 HIS A CB  
231  C CG  . HIS A 32 ? 1.0578 0.3913 0.8091 -0.0841 -0.5298 -0.0362 32 HIS A CG  
232  N ND1 . HIS A 32 ? 1.0367 0.4066 0.8697 -0.0254 -0.5300 -0.0963 32 HIS A ND1 
233  C CD2 . HIS A 32 ? 1.1887 0.3998 0.8921 -0.1028 -0.6231 -0.0192 32 HIS A CD2 
234  C CE1 . HIS A 32 ? 1.0718 0.3510 0.9151 -0.0027 -0.6180 -0.1231 32 HIS A CE1 
235  N NE2 . HIS A 32 ? 1.2224 0.3963 0.9880 -0.0481 -0.6800 -0.0751 32 HIS A NE2 
236  N N   . GLY A 33 ? 0.4857 0.5851 0.4084 -0.0995 -0.0148 0.0449  33 GLY A N   
237  C CA  . GLY A 33 ? 0.4317 0.5482 0.3638 -0.0987 0.0020  0.0320  33 GLY A CA  
238  C C   . GLY A 33 ? 0.3536 0.4581 0.3106 -0.0914 0.0061  0.0230  33 GLY A C   
239  O O   . GLY A 33 ? 0.3489 0.4631 0.3158 -0.0901 0.0178  0.0147  33 GLY A O   
240  N N   . GLY A 34 ? 0.3263 0.4106 0.2923 -0.0861 -0.0038 0.0243  34 GLY A N   
241  C CA  . GLY A 34 ? 0.2949 0.3656 0.2793 -0.0794 -0.0010 0.0193  34 GLY A CA  
242  C C   . GLY A 34 ? 0.2677 0.3408 0.2614 -0.0733 0.0092  0.0018  34 GLY A C   
243  O O   . GLY A 34 ? 0.2879 0.3738 0.2773 -0.0737 0.0125  -0.0085 34 GLY A O   
244  N N   . ILE A 35 ? 0.2637 0.3238 0.2699 -0.0673 0.0135  -0.0011 35 ILE A N   
245  C CA  . ILE A 35 ? 0.2343 0.2903 0.2502 -0.0618 0.0231  -0.0148 35 ILE A CA  
246  C C   . ILE A 35 ? 0.2529 0.2930 0.2751 -0.0582 0.0199  -0.0174 35 ILE A C   
247  O O   . ILE A 35 ? 0.2853 0.3124 0.3091 -0.0553 0.0158  -0.0104 35 ILE A O   
248  C CB  . ILE A 35 ? 0.2629 0.3125 0.2852 -0.0572 0.0299  -0.0146 35 ILE A CB  
249  C CG1 . ILE A 35 ? 0.2720 0.3405 0.2923 -0.0612 0.0334  -0.0139 35 ILE A CG1 
250  C CG2 . ILE A 35 ? 0.2526 0.2921 0.2838 -0.0515 0.0388  -0.0261 35 ILE A CG2 
251  C CD1 . ILE A 35 ? 0.3168 0.4060 0.3347 -0.0643 0.0393  -0.0255 35 ILE A CD1 
252  N N   . TYR A 36 ? 0.2534 0.2964 0.2811 -0.0582 0.0221  -0.0295 36 TYR A N   
253  C CA  . TYR A 36 ? 0.2730 0.3048 0.3097 -0.0561 0.0201  -0.0343 36 TYR A CA  
254  C C   . TYR A 36 ? 0.2619 0.2867 0.3117 -0.0542 0.0328  -0.0461 36 TYR A C   
255  O O   . TYR A 36 ? 0.2790 0.3096 0.3322 -0.0544 0.0399  -0.0534 36 TYR A O   
256  C CB  . TYR A 36 ? 0.2666 0.3073 0.3023 -0.0582 0.0087  -0.0391 36 TYR A CB  
257  C CG  . TYR A 36 ? 0.2745 0.3167 0.2969 -0.0604 -0.0055 -0.0252 36 TYR A CG  
258  C CD1 . TYR A 36 ? 0.3247 0.3788 0.3318 -0.0647 -0.0076 -0.0176 36 TYR A CD1 
259  C CD2 . TYR A 36 ? 0.3169 0.3485 0.3430 -0.0585 -0.0164 -0.0198 36 TYR A CD2 
260  C CE1 . TYR A 36 ? 0.3457 0.3984 0.3405 -0.0683 -0.0198 -0.0027 36 TYR A CE1 
261  C CE2 . TYR A 36 ? 0.3302 0.3602 0.3465 -0.0608 -0.0309 -0.0064 36 TYR A CE2 
262  C CZ  . TYR A 36 ? 0.3582 0.3973 0.3586 -0.0662 -0.0319 0.0033  36 TYR A CZ  
263  O OH  . TYR A 36 ? 0.4230 0.4578 0.4134 -0.0700 -0.0451 0.0187  36 TYR A OH  
264  N N   . VAL A 37 ? 0.2178 0.2300 0.2759 -0.0528 0.0361  -0.0481 37 VAL A N   
265  C CA  . VAL A 37 ? 0.2451 0.2487 0.3164 -0.0530 0.0494  -0.0579 37 VAL A CA  
266  C C   . VAL A 37 ? 0.2606 0.2766 0.3466 -0.0562 0.0486  -0.0741 37 VAL A C   
267  O O   . VAL A 37 ? 0.2950 0.3174 0.3864 -0.0570 0.0402  -0.0795 37 VAL A O   
268  C CB  . VAL A 37 ? 0.2493 0.2371 0.3232 -0.0517 0.0557  -0.0545 37 VAL A CB  
269  C CG1 . VAL A 37 ? 0.2827 0.2602 0.3704 -0.0542 0.0712  -0.0630 37 VAL A CG1 
270  C CG2 . VAL A 37 ? 0.2722 0.2482 0.3307 -0.0466 0.0549  -0.0402 37 VAL A CG2 
271  N N   . LYS A 38 ? 0.2514 0.2716 0.3455 -0.0568 0.0554  -0.0837 38 LYS A N   
272  C CA  . LYS A 38 ? 0.2710 0.3034 0.3824 -0.0587 0.0549  -0.1022 38 LYS A CA  
273  C C   . LYS A 38 ? 0.3345 0.3556 0.4689 -0.0615 0.0662  -0.1118 38 LYS A C   
274  O O   . LYS A 38 ? 0.3201 0.3497 0.4714 -0.0634 0.0633  -0.1257 38 LYS A O   
275  C CB  . LYS A 38 ? 0.2915 0.3347 0.4043 -0.0576 0.0571  -0.1103 38 LYS A CB  
276  C CG  . LYS A 38 ? 0.3423 0.3976 0.4765 -0.0582 0.0577  -0.1323 38 LYS A CG  
277  C CD  . LYS A 38 ? 0.3834 0.4491 0.5182 -0.0560 0.0601  -0.1398 38 LYS A CD  
278  C CE  . LYS A 38 ? 0.4734 0.5568 0.6269 -0.0550 0.0573  -0.1634 38 LYS A CE  
279  N NZ  . LYS A 38 ? 0.5478 0.6392 0.7069 -0.0522 0.0614  -0.1729 38 LYS A NZ  
280  N N   . ALA A 39 ? 0.3493 0.3507 0.4842 -0.0620 0.0791  -0.1043 39 ALA A N   
281  C CA  . ALA A 39 ? 0.3330 0.3209 0.4871 -0.0665 0.0929  -0.1099 39 ALA A CA  
282  C C   . ALA A 39 ? 0.3605 0.3242 0.5008 -0.0655 0.1035  -0.0932 39 ALA A C   
283  O O   . ALA A 39 ? 0.3500 0.3056 0.4742 -0.0607 0.1020  -0.0826 39 ALA A O   
284  C CB  . ALA A 39 ? 0.3363 0.3259 0.5147 -0.0691 0.0995  -0.1260 39 ALA A CB  
285  N N   . VAL A 40 ? 0.3599 0.3137 0.5065 -0.0695 0.1139  -0.0922 40 VAL A N   
286  C CA  . VAL A 40 ? 0.3753 0.3042 0.5094 -0.0695 0.1272  -0.0780 40 VAL A CA  
287  C C   . VAL A 40 ? 0.4132 0.3281 0.5681 -0.0760 0.1424  -0.0845 40 VAL A C   
288  O O   . VAL A 40 ? 0.4087 0.3291 0.5883 -0.0836 0.1507  -0.0971 40 VAL A O   
289  C CB  . VAL A 40 ? 0.3844 0.3130 0.5129 -0.0709 0.1313  -0.0742 40 VAL A CB  
290  C CG1 . VAL A 40 ? 0.4411 0.3445 0.5543 -0.0713 0.1467  -0.0602 40 VAL A CG1 
291  C CG2 . VAL A 40 ? 0.3712 0.3121 0.4824 -0.0640 0.1139  -0.0683 40 VAL A CG2 
292  N N   . ILE A 41 ? 0.3567 0.2542 0.5050 -0.0727 0.1447  -0.0775 41 ILE A N   
293  C CA  . ILE A 41 ? 0.3963 0.2793 0.5671 -0.0779 0.1557  -0.0843 41 ILE A CA  
294  C C   . ILE A 41 ? 0.4117 0.2728 0.5873 -0.0864 0.1752  -0.0775 41 ILE A C   
295  O O   . ILE A 41 ? 0.4284 0.2703 0.5774 -0.0843 0.1816  -0.0594 41 ILE A O   
296  C CB  . ILE A 41 ? 0.3933 0.2607 0.5553 -0.0709 0.1515  -0.0782 41 ILE A CB  
297  C CG1 . ILE A 41 ? 0.4263 0.3193 0.5840 -0.0639 0.1347  -0.0858 41 ILE A CG1 
298  C CG2 . ILE A 41 ? 0.4146 0.2653 0.6031 -0.0760 0.1611  -0.0860 41 ILE A CG2 
299  C CD1 . ILE A 41 ? 0.4263 0.3468 0.6091 -0.0673 0.1292  -0.1076 41 ILE A CD1 
300  N N   . PRO A 42 ? 0.4094 0.2748 0.6189 -0.0963 0.1851  -0.0927 42 PRO A N   
301  C CA  . PRO A 42 ? 0.4782 0.3241 0.6950 -0.1068 0.2065  -0.0864 42 PRO A CA  
302  C C   . PRO A 42 ? 0.5439 0.3517 0.7374 -0.1052 0.2158  -0.0644 42 PRO A C   
303  O O   . PRO A 42 ? 0.5086 0.3032 0.7028 -0.0998 0.2089  -0.0629 42 PRO A O   
304  C CB  . PRO A 42 ? 0.5019 0.3560 0.7647 -0.1165 0.2130  -0.1081 42 PRO A CB  
305  C CG  . PRO A 42 ? 0.4617 0.3508 0.7366 -0.1107 0.1937  -0.1281 42 PRO A CG  
306  C CD  . PRO A 42 ? 0.4259 0.3179 0.6678 -0.0984 0.1769  -0.1172 42 PRO A CD  
307  N N   . GLN A 43 ? 0.5609 0.3524 0.7327 -0.1088 0.2302  -0.0483 43 GLN A N   
308  C CA  . GLN A 43 ? 0.6090 0.3617 0.7533 -0.1076 0.2403  -0.0251 43 GLN A CA  
309  C C   . GLN A 43 ? 0.5951 0.3369 0.7027 -0.0918 0.2241  -0.0109 43 GLN A C   
310  O O   . GLN A 43 ? 0.6081 0.3161 0.6912 -0.0877 0.2281  0.0076  43 GLN A O   
311  C CB  . GLN A 43 ? 0.6974 0.4244 0.8672 -0.1159 0.2509  -0.0260 43 GLN A CB  
312  C CG  . GLN A 43 ? 0.7728 0.5011 0.9744 -0.1334 0.2729  -0.0341 43 GLN A CG  
313  C CD  . GLN A 43 ? 0.8844 0.5759 1.1017 -0.1428 0.2873  -0.0260 43 GLN A CD  
314  O OE1 . GLN A 43 ? 0.9214 0.6048 1.1591 -0.1393 0.2772  -0.0338 43 GLN A OE1 
315  N NE2 . GLN A 43 ? 0.9510 0.6198 1.1591 -0.1549 0.3114  -0.0103 43 GLN A NE2 
316  N N   . GLY A 44 ? 0.4950 0.2647 0.5994 -0.0830 0.2055  -0.0196 44 GLY A N   
317  C CA  . GLY A 44 ? 0.4758 0.2405 0.5522 -0.0688 0.1895  -0.0098 44 GLY A CA  
318  C C   . GLY A 44 ? 0.4928 0.2580 0.5355 -0.0622 0.1875  0.0029  44 GLY A C   
319  O O   . GLY A 44 ? 0.4663 0.2371 0.5061 -0.0685 0.1987  0.0039  44 GLY A O   
320  N N   . ALA A 45 ? 0.4584 0.2198 0.4781 -0.0491 0.1727  0.0106  45 ALA A N   
321  C CA  . ALA A 45 ? 0.4888 0.2478 0.4762 -0.0407 0.1689  0.0223  45 ALA A CA  
322  C C   . ALA A 45 ? 0.4780 0.2687 0.4713 -0.0425 0.1638  0.0132  45 ALA A C   
323  O O   . ALA A 45 ? 0.4696 0.2606 0.4479 -0.0426 0.1704  0.0180  45 ALA A O   
324  C CB  . ALA A 45 ? 0.5107 0.2602 0.4776 -0.0257 0.1527  0.0295  45 ALA A CB  
325  N N   . ALA A 46 ? 0.4089 0.2259 0.4229 -0.0435 0.1515  0.0000  46 ALA A N   
326  C CA  . ALA A 46 ? 0.3980 0.2419 0.4177 -0.0444 0.1437  -0.0077 46 ALA A CA  
327  C C   . ALA A 46 ? 0.3799 0.2314 0.4152 -0.0549 0.1575  -0.0158 46 ALA A C   
328  O O   . ALA A 46 ? 0.3962 0.2600 0.4273 -0.0540 0.1560  -0.0178 46 ALA A O   
329  C CB  . ALA A 46 ? 0.4017 0.2692 0.4376 -0.0442 0.1284  -0.0182 46 ALA A CB  
330  N N   . GLU A 47 ? 0.4076 0.2532 0.4644 -0.0647 0.1706  -0.0222 47 GLU A N   
331  C CA  . GLU A 47 ? 0.4322 0.2869 0.5091 -0.0755 0.1848  -0.0322 47 GLU A CA  
332  C C   . GLU A 47 ? 0.4435 0.2836 0.4990 -0.0771 0.2012  -0.0206 47 GLU A C   
333  O O   . GLU A 47 ? 0.4652 0.3217 0.5256 -0.0802 0.2059  -0.0278 47 GLU A O   
334  C CB  . GLU A 47 ? 0.4601 0.3105 0.5676 -0.0861 0.1960  -0.0423 47 GLU A CB  
335  C CG  . GLU A 47 ? 0.5143 0.3761 0.6478 -0.0980 0.2113  -0.0550 47 GLU A CG  
336  C CD  . GLU A 47 ? 0.5746 0.4273 0.7391 -0.1091 0.2250  -0.0634 47 GLU A CD  
337  O OE1 . GLU A 47 ? 0.6228 0.4457 0.7781 -0.1131 0.2397  -0.0494 47 GLU A OE1 
338  O OE2 . GLU A 47 ? 0.5554 0.4299 0.7540 -0.1133 0.2199  -0.0842 47 GLU A OE2 
339  N N   . SER A 48 ? 0.4524 0.2620 0.4833 -0.0742 0.2093  -0.0032 48 SER A N   
340  C CA  . SER A 48 ? 0.4860 0.2779 0.4901 -0.0755 0.2263  0.0106  48 SER A CA  
341  C C   . SER A 48 ? 0.4752 0.2817 0.4561 -0.0652 0.2163  0.0121  48 SER A C   
342  O O   . SER A 48 ? 0.4991 0.3118 0.4721 -0.0686 0.2290  0.0116  48 SER A O   
343  C CB  . SER A 48 ? 0.5536 0.3073 0.5304 -0.0708 0.2306  0.0306  48 SER A CB  
344  O OG  . SER A 48 ? 0.6439 0.3801 0.6431 -0.0822 0.2439  0.0302  48 SER A OG  
345  N N   . ASP A 49 ? 0.4276 0.2403 0.3996 -0.0529 0.1940  0.0128  49 ASP A N   
346  C CA  . ASP A 49 ? 0.4209 0.2473 0.3754 -0.0420 0.1806  0.0128  49 ASP A CA  
347  C C   . ASP A 49 ? 0.4195 0.2773 0.3975 -0.0465 0.1772  -0.0042 49 ASP A C   
348  O O   . ASP A 49 ? 0.4704 0.3378 0.4370 -0.0423 0.1778  -0.0061 49 ASP A O   
349  C CB  . ASP A 49 ? 0.4200 0.2462 0.3669 -0.0301 0.1584  0.0162  49 ASP A CB  
350  C CG  . ASP A 49 ? 0.3935 0.2350 0.3298 -0.0196 0.1427  0.0142  49 ASP A CG  
351  O OD1 . ASP A 49 ? 0.4023 0.2665 0.3591 -0.0205 0.1291  0.0036  49 ASP A OD1 
352  O OD2 . ASP A 49 ? 0.4662 0.2963 0.3735 -0.0101 0.1432  0.0231  49 ASP A OD2 
353  N N   . GLY A 50 ? 0.3763 0.2505 0.3867 -0.0535 0.1719  -0.0178 50 GLY A N   
354  C CA  . GLY A 50 ? 0.4123 0.3134 0.4484 -0.0584 0.1690  -0.0353 50 GLY A CA  
355  C C   . GLY A 50 ? 0.3924 0.3129 0.4329 -0.0502 0.1447  -0.0418 50 GLY A C   
356  O O   . GLY A 50 ? 0.4367 0.3780 0.4993 -0.0529 0.1391  -0.0568 50 GLY A O   
357  N N   . ARG A 51 ? 0.3545 0.2678 0.3762 -0.0404 0.1297  -0.0311 51 ARG A N   
358  C CA  . ARG A 51 ? 0.3265 0.2554 0.3517 -0.0332 0.1071  -0.0349 51 ARG A CA  
359  C C   . ARG A 51 ? 0.3487 0.2865 0.3891 -0.0355 0.0924  -0.0381 51 ARG A C   
360  O O   . ARG A 51 ? 0.3866 0.3385 0.4367 -0.0334 0.0753  -0.0434 51 ARG A O   
361  C CB  . ARG A 51 ? 0.3293 0.2486 0.3286 -0.0213 0.0984  -0.0233 51 ARG A CB  
362  C CG  . ARG A 51 ? 0.3520 0.2711 0.3355 -0.0156 0.1051  -0.0236 51 ARG A CG  
363  C CD  . ARG A 51 ? 0.3773 0.2865 0.3355 -0.0022 0.0946  -0.0137 51 ARG A CD  
364  N NE  . ARG A 51 ? 0.3529 0.2378 0.2878 0.0003  0.1043  0.0001  51 ARG A NE  
365  C CZ  . ARG A 51 ? 0.4043 0.2764 0.3140 0.0128  0.0975  0.0090  51 ARG A CZ  
366  N NH1 . ARG A 51 ? 0.4009 0.2842 0.3078 0.0233  0.0814  0.0047  51 ARG A NH1 
367  N NH2 . ARG A 51 ? 0.4135 0.2616 0.3029 0.0156  0.1051  0.0208  51 ARG A NH2 
368  N N   . ILE A 52 ? 0.3016 0.2305 0.3428 -0.0394 0.0985  -0.0346 52 ILE A N   
369  C CA  . ILE A 52 ? 0.3011 0.2396 0.3525 -0.0412 0.0862  -0.0375 52 ILE A CA  
370  C C   . ILE A 52 ? 0.3483 0.2972 0.4237 -0.0498 0.0913  -0.0516 52 ILE A C   
371  O O   . ILE A 52 ? 0.3626 0.3040 0.4464 -0.0556 0.1082  -0.0555 52 ILE A O   
372  C CB  . ILE A 52 ? 0.3120 0.2387 0.3514 -0.0382 0.0867  -0.0280 52 ILE A CB  
373  C CG1 . ILE A 52 ? 0.3412 0.2610 0.3607 -0.0285 0.0779  -0.0168 52 ILE A CG1 
374  C CG2 . ILE A 52 ? 0.3112 0.2512 0.3610 -0.0413 0.0772  -0.0328 52 ILE A CG2 
375  C CD1 . ILE A 52 ? 0.3768 0.2817 0.3836 -0.0236 0.0803  -0.0086 52 ILE A CD1 
376  N N   . HIS A 53 ? 0.3215 0.2867 0.4081 -0.0505 0.0761  -0.0591 53 HIS A N   
377  C CA  . HIS A 53 ? 0.2898 0.2669 0.3993 -0.0566 0.0769  -0.0746 53 HIS A CA  
378  C C   . HIS A 53 ? 0.3156 0.3029 0.4252 -0.0564 0.0635  -0.0763 53 HIS A C   
379  O O   . HIS A 53 ? 0.3093 0.2978 0.4035 -0.0526 0.0513  -0.0658 53 HIS A O   
380  C CB  . HIS A 53 ? 0.3160 0.3060 0.4420 -0.0572 0.0712  -0.0873 53 HIS A CB  
381  C CG  . HIS A 53 ? 0.3834 0.3686 0.5121 -0.0590 0.0872  -0.0893 53 HIS A CG  
382  N ND1 . HIS A 53 ? 0.4438 0.4259 0.5578 -0.0531 0.0845  -0.0820 53 HIS A ND1 
383  C CD2 . HIS A 53 ? 0.4060 0.3888 0.5492 -0.0663 0.1075  -0.0974 53 HIS A CD2 
384  C CE1 . HIS A 53 ? 0.4611 0.4408 0.5777 -0.0564 0.1025  -0.0857 53 HIS A CE1 
385  N NE2 . HIS A 53 ? 0.4401 0.4196 0.5746 -0.0653 0.1175  -0.0941 53 HIS A NE2 
386  N N   . LYS A 54 ? 0.3261 0.3218 0.4539 -0.0607 0.0661  -0.0904 54 LYS A N   
387  C CA  . LYS A 54 ? 0.2822 0.2907 0.4094 -0.0600 0.0534  -0.0950 54 LYS A CA  
388  C C   . LYS A 54 ? 0.2649 0.2810 0.3814 -0.0564 0.0332  -0.0894 54 LYS A C   
389  O O   . LYS A 54 ? 0.2817 0.3003 0.4065 -0.0550 0.0263  -0.0942 54 LYS A O   
390  C CB  . LYS A 54 ? 0.3018 0.3212 0.4543 -0.0636 0.0558  -0.1155 54 LYS A CB  
391  C CG  . LYS A 54 ? 0.3235 0.3580 0.4730 -0.0616 0.0417  -0.1222 54 LYS A CG  
392  C CD  . LYS A 54 ? 0.4380 0.4851 0.6148 -0.0632 0.0406  -0.1456 54 LYS A CD  
393  C CE  . LYS A 54 ? 0.4891 0.5519 0.6577 -0.0596 0.0249  -0.1523 54 LYS A CE  
394  N NZ  . LYS A 54 ? 0.5382 0.6120 0.7319 -0.0604 0.0284  -0.1750 54 LYS A NZ  
395  N N   . GLY A 55 ? 0.2681 0.2874 0.3671 -0.0551 0.0241  -0.0792 55 GLY A N   
396  C CA  . GLY A 55 ? 0.2809 0.3048 0.3691 -0.0530 0.0052  -0.0717 55 GLY A CA  
397  C C   . GLY A 55 ? 0.2732 0.2878 0.3480 -0.0509 0.0014  -0.0549 55 GLY A C   
398  O O   . GLY A 55 ? 0.2899 0.3061 0.3545 -0.0505 -0.0131 -0.0452 55 GLY A O   
399  N N   . ASP A 56 ? 0.2657 0.2697 0.3403 -0.0492 0.0137  -0.0513 56 ASP A N   
400  C CA  . ASP A 56 ? 0.2516 0.2478 0.3146 -0.0457 0.0095  -0.0376 56 ASP A CA  
401  C C   . ASP A 56 ? 0.2696 0.2685 0.3199 -0.0471 0.0076  -0.0272 56 ASP A C   
402  O O   . ASP A 56 ? 0.2881 0.2918 0.3372 -0.0495 0.0157  -0.0307 56 ASP A O   
403  C CB  . ASP A 56 ? 0.2666 0.2508 0.3279 -0.0424 0.0232  -0.0363 56 ASP A CB  
404  C CG  . ASP A 56 ? 0.2950 0.2788 0.3672 -0.0415 0.0261  -0.0456 56 ASP A CG  
405  O OD1 . ASP A 56 ? 0.3160 0.2907 0.3854 -0.0403 0.0403  -0.0454 56 ASP A OD1 
406  O OD2 . ASP A 56 ? 0.3159 0.3086 0.3990 -0.0418 0.0138  -0.0529 56 ASP A OD2 
407  N N   . ARG A 57 ? 0.2686 0.2662 0.3123 -0.0459 -0.0032 -0.0159 57 ARG A N   
408  C CA  . ARG A 57 ? 0.2546 0.2569 0.2890 -0.0484 -0.0031 -0.0069 57 ARG A CA  
409  C C   . ARG A 57 ? 0.2864 0.2805 0.3185 -0.0436 0.0044  -0.0026 57 ARG A C   
410  O O   . ARG A 57 ? 0.2799 0.2651 0.3131 -0.0383 0.0010  -0.0003 57 ARG A O   
411  C CB  . ARG A 57 ? 0.2664 0.2719 0.2969 -0.0516 -0.0185 0.0036  57 ARG A CB  
412  C CG  . ARG A 57 ? 0.2468 0.2608 0.2690 -0.0566 -0.0162 0.0121  57 ARG A CG  
413  C CD  . ARG A 57 ? 0.2807 0.2962 0.2980 -0.0620 -0.0301 0.0246  57 ARG A CD  
414  N NE  . ARG A 57 ? 0.2973 0.3231 0.3073 -0.0685 -0.0250 0.0328  57 ARG A NE  
415  C CZ  . ARG A 57 ? 0.3368 0.3663 0.3382 -0.0763 -0.0326 0.0453  57 ARG A CZ  
416  N NH1 . ARG A 57 ? 0.3717 0.3928 0.3702 -0.0774 -0.0478 0.0515  57 ARG A NH1 
417  N NH2 . ARG A 57 ? 0.3699 0.4116 0.3658 -0.0833 -0.0248 0.0515  57 ARG A NH2 
418  N N   . VAL A 58 ? 0.2260 0.2235 0.2550 -0.0442 0.0132  -0.0032 58 VAL A N   
419  C CA  . VAL A 58 ? 0.2179 0.2078 0.2448 -0.0383 0.0170  0.0003  58 VAL A CA  
420  C C   . VAL A 58 ? 0.2427 0.2407 0.2696 -0.0404 0.0091  0.0083  58 VAL A C   
421  O O   . VAL A 58 ? 0.2383 0.2501 0.2644 -0.0464 0.0109  0.0089  58 VAL A O   
422  C CB  . VAL A 58 ? 0.2315 0.2198 0.2586 -0.0366 0.0290  -0.0059 58 VAL A CB  
423  C CG1 . VAL A 58 ? 0.2758 0.2524 0.2996 -0.0280 0.0300  -0.0026 58 VAL A CG1 
424  C CG2 . VAL A 58 ? 0.2926 0.2728 0.3229 -0.0369 0.0379  -0.0135 58 VAL A CG2 
425  N N   . LEU A 59 ? 0.2368 0.2277 0.2657 -0.0357 0.0010  0.0135  59 LEU A N   
426  C CA  . LEU A 59 ? 0.2335 0.2312 0.2673 -0.0383 -0.0070 0.0207  59 LEU A CA  
427  C C   . LEU A 59 ? 0.2263 0.2252 0.2637 -0.0332 -0.0032 0.0189  59 LEU A C   
428  O O   . LEU A 59 ? 0.2416 0.2525 0.2855 -0.0385 -0.0044 0.0219  59 LEU A O   
429  C CB  . LEU A 59 ? 0.2419 0.2328 0.2816 -0.0358 -0.0207 0.0252  59 LEU A CB  
430  C CG  . LEU A 59 ? 0.2745 0.2642 0.3142 -0.0398 -0.0285 0.0260  59 LEU A CG  
431  C CD1 . LEU A 59 ? 0.2795 0.2620 0.3285 -0.0348 -0.0430 0.0275  59 LEU A CD1 
432  C CD2 . LEU A 59 ? 0.3305 0.3297 0.3670 -0.0504 -0.0315 0.0328  59 LEU A CD2 
433  N N   . ALA A 60 ? 0.2251 0.2116 0.2584 -0.0230 0.0010  0.0140  60 ALA A N   
434  C CA  . ALA A 60 ? 0.2316 0.2169 0.2682 -0.0155 0.0013  0.0111  60 ALA A CA  
435  C C   . ALA A 60 ? 0.2257 0.1949 0.2524 -0.0058 0.0083  0.0066  60 ALA A C   
436  O O   . ALA A 60 ? 0.2337 0.1905 0.2512 -0.0039 0.0124  0.0073  60 ALA A O   
437  C CB  . ALA A 60 ? 0.2384 0.2218 0.2826 -0.0097 -0.0108 0.0136  60 ALA A CB  
438  N N   . VAL A 61 ? 0.2411 0.2106 0.2710 0.0000  0.0096  0.0021  61 VAL A N   
439  C CA  . VAL A 61 ? 0.2795 0.2305 0.2998 0.0103  0.0143  -0.0010 61 VAL A CA  
440  C C   . VAL A 61 ? 0.2660 0.2114 0.2876 0.0231  0.0053  -0.0034 61 VAL A C   
441  O O   . VAL A 61 ? 0.2573 0.2177 0.2937 0.0227  0.0015  -0.0088 61 VAL A O   
442  C CB  . VAL A 61 ? 0.2358 0.1925 0.2616 0.0061  0.0231  -0.0078 61 VAL A CB  
443  C CG1 . VAL A 61 ? 0.3044 0.2381 0.3222 0.0172  0.0261  -0.0102 61 VAL A CG1 
444  C CG2 . VAL A 61 ? 0.2646 0.2283 0.2906 -0.0053 0.0307  -0.0079 61 VAL A CG2 
445  N N   . ASN A 62 ? 0.2580 0.1825 0.2637 0.0348  0.0021  -0.0002 62 ASN A N   
446  C CA  . ASN A 62 ? 0.2876 0.2046 0.2912 0.0499  -0.0089 -0.0033 62 ASN A CA  
447  C C   . ASN A 62 ? 0.3022 0.2391 0.3263 0.0488  -0.0198 -0.0075 62 ASN A C   
448  O O   . ASN A 62 ? 0.3293 0.2724 0.3659 0.0557  -0.0265 -0.0152 62 ASN A O   
449  C CB  . ASN A 62 ? 0.3239 0.2303 0.3259 0.0584  -0.0078 -0.0086 62 ASN A CB  
450  C CG  . ASN A 62 ? 0.3430 0.2216 0.3223 0.0629  0.0003  -0.0024 62 ASN A CG  
451  O OD1 . ASN A 62 ? 0.3592 0.2260 0.3213 0.0627  0.0043  0.0054  62 ASN A OD1 
452  N ND2 . ASN A 62 ? 0.3678 0.2359 0.3484 0.0671  0.0025  -0.0064 62 ASN A ND2 
453  N N   . GLY A 63 ? 0.2605 0.2072 0.2905 0.0397  -0.0218 -0.0030 63 GLY A N   
454  C CA  . GLY A 63 ? 0.2622 0.2235 0.3121 0.0382  -0.0326 -0.0052 63 GLY A CA  
455  C C   . GLY A 63 ? 0.2810 0.2645 0.3513 0.0234  -0.0286 -0.0058 63 GLY A C   
456  O O   . GLY A 63 ? 0.2562 0.2520 0.3454 0.0189  -0.0357 -0.0060 63 GLY A O   
457  N N   . VAL A 64 ? 0.2656 0.2549 0.3326 0.0155  -0.0169 -0.0063 64 VAL A N   
458  C CA  . VAL A 64 ? 0.2421 0.2550 0.3245 0.0015  -0.0111 -0.0074 64 VAL A CA  
459  C C   . VAL A 64 ? 0.1970 0.2149 0.2709 -0.0123 -0.0042 0.0003  64 VAL A C   
460  O O   . VAL A 64 ? 0.2173 0.2262 0.2776 -0.0116 0.0022  0.0002  64 VAL A O   
461  C CB  . VAL A 64 ? 0.2679 0.2893 0.3566 0.0045  -0.0045 -0.0184 64 VAL A CB  
462  C CG1 . VAL A 64 ? 0.2715 0.3214 0.3753 -0.0104 0.0031  -0.0208 64 VAL A CG1 
463  C CG2 . VAL A 64 ? 0.2878 0.3025 0.3848 0.0205  -0.0139 -0.0277 64 VAL A CG2 
464  N N   . SER A 65 ? 0.2153 0.2458 0.2978 -0.0244 -0.0067 0.0073  65 SER A N   
465  C CA  . SER A 65 ? 0.2234 0.2584 0.2967 -0.0367 -0.0031 0.0153  65 SER A CA  
466  C C   . SER A 65 ? 0.2441 0.2914 0.3107 -0.0423 0.0090  0.0102  65 SER A C   
467  O O   . SER A 65 ? 0.2401 0.3023 0.3154 -0.0432 0.0152  0.0026  65 SER A O   
468  C CB  . SER A 65 ? 0.2126 0.2588 0.2962 -0.0492 -0.0075 0.0247  65 SER A CB  
469  O OG  . SER A 65 ? 0.2634 0.3122 0.3352 -0.0602 -0.0063 0.0336  65 SER A OG  
470  N N   . LEU A 66 ? 0.2195 0.2628 0.2733 -0.0459 0.0116  0.0126  66 LEU A N   
471  C CA  . LEU A 66 ? 0.2289 0.2880 0.2772 -0.0533 0.0210  0.0081  66 LEU A CA  
472  C C   . LEU A 66 ? 0.2917 0.3687 0.3363 -0.0671 0.0218  0.0163  66 LEU A C   
473  O O   . LEU A 66 ? 0.2874 0.3780 0.3232 -0.0727 0.0284  0.0128  66 LEU A O   
474  C CB  . LEU A 66 ? 0.2391 0.2881 0.2774 -0.0509 0.0234  0.0045  66 LEU A CB  
475  C CG  . LEU A 66 ? 0.2649 0.2957 0.3039 -0.0394 0.0261  -0.0024 66 LEU A CG  
476  C CD1 . LEU A 66 ? 0.2713 0.2955 0.3050 -0.0399 0.0310  -0.0071 66 LEU A CD1 
477  C CD2 . LEU A 66 ? 0.3516 0.3875 0.3988 -0.0337 0.0310  -0.0118 66 LEU A CD2 
478  N N   . GLU A 67 ? 0.2556 0.3323 0.3064 -0.0725 0.0151  0.0270  67 GLU A N   
479  C CA  . GLU A 67 ? 0.3241 0.4142 0.3688 -0.0871 0.0162  0.0383  67 GLU A CA  
480  C C   . GLU A 67 ? 0.3026 0.4188 0.3455 -0.0943 0.0296  0.0319  67 GLU A C   
481  O O   . GLU A 67 ? 0.3012 0.4296 0.3593 -0.0922 0.0360  0.0223  67 GLU A O   
482  C CB  . GLU A 67 ? 0.4109 0.4973 0.4685 -0.0927 0.0086  0.0497  67 GLU A CB  
483  C CG  . GLU A 67 ? 0.5354 0.6236 0.5816 -0.1070 0.0055  0.0666  67 GLU A CG  
484  C CD  . GLU A 67 ? 0.6098 0.7054 0.6705 -0.1185 0.0064  0.0765  67 GLU A CD  
485  O OE1 . GLU A 67 ? 0.6381 0.7365 0.6874 -0.1321 0.0069  0.0918  67 GLU A OE1 
486  O OE2 . GLU A 67 ? 0.6680 0.7667 0.7515 -0.1142 0.0068  0.0691  67 GLU A OE2 
487  N N   . GLY A 68 ? 0.3234 0.4494 0.3478 -0.1020 0.0331  0.0359  68 GLY A N   
488  C CA  . GLY A 68 ? 0.3123 0.4663 0.3312 -0.1097 0.0461  0.0299  68 GLY A CA  
489  C C   . GLY A 68 ? 0.3262 0.4911 0.3485 -0.1011 0.0538  0.0096  68 GLY A C   
490  O O   . GLY A 68 ? 0.3479 0.5391 0.3698 -0.1058 0.0647  0.0005  68 GLY A O   
491  N N   . ALA A 69 ? 0.2877 0.4330 0.3140 -0.0891 0.0486  0.0022  69 ALA A N   
492  C CA  . ALA A 69 ? 0.2335 0.3842 0.2662 -0.0807 0.0548  -0.0164 69 ALA A CA  
493  C C   . ALA A 69 ? 0.2622 0.4260 0.2811 -0.0836 0.0582  -0.0230 69 ALA A C   
494  O O   . ALA A 69 ? 0.2974 0.4524 0.3022 -0.0860 0.0519  -0.0148 69 ALA A O   
495  C CB  . ALA A 69 ? 0.2333 0.3561 0.2731 -0.0683 0.0492  -0.0199 69 ALA A CB  
496  N N   . THR A 70 ? 0.2712 0.4571 0.2959 -0.0823 0.0669  -0.0396 70 THR A N   
497  C CA  . THR A 70 ? 0.2712 0.4684 0.2882 -0.0810 0.0691  -0.0519 70 THR A CA  
498  C C   . THR A 70 ? 0.2545 0.4269 0.2818 -0.0707 0.0648  -0.0594 70 THR A C   
499  O O   . THR A 70 ? 0.2777 0.4280 0.3158 -0.0645 0.0623  -0.0564 70 THR A O   
500  C CB  . THR A 70 ? 0.3093 0.5375 0.3349 -0.0803 0.0789  -0.0719 70 THR A CB  
501  O OG1 . THR A 70 ? 0.2624 0.4824 0.3117 -0.0707 0.0798  -0.0845 70 THR A OG1 
502  C CG2 . THR A 70 ? 0.3223 0.5789 0.3403 -0.0915 0.0868  -0.0664 70 THR A CG2 
503  N N   . HIS A 71 ? 0.2600 0.4364 0.2840 -0.0690 0.0644  -0.0699 71 HIS A N   
504  C CA  . HIS A 71 ? 0.2851 0.4401 0.3217 -0.0612 0.0627  -0.0785 71 HIS A CA  
505  C C   . HIS A 71 ? 0.2356 0.3823 0.2918 -0.0533 0.0668  -0.0891 71 HIS A C   
506  O O   . HIS A 71 ? 0.2410 0.3598 0.3038 -0.0477 0.0650  -0.0844 71 HIS A O   
507  C CB  . HIS A 71 ? 0.2534 0.4215 0.2890 -0.0608 0.0624  -0.0933 71 HIS A CB  
508  C CG  . HIS A 71 ? 0.2453 0.3915 0.2950 -0.0555 0.0610  -0.1008 71 HIS A CG  
509  N ND1 . HIS A 71 ? 0.2822 0.4108 0.3276 -0.0567 0.0555  -0.0921 71 HIS A ND1 
510  C CD2 . HIS A 71 ? 0.2956 0.4343 0.3656 -0.0497 0.0649  -0.1163 71 HIS A CD2 
511  C CE1 . HIS A 71 ? 0.2881 0.4010 0.3504 -0.0529 0.0578  -0.1017 71 HIS A CE1 
512  N NE2 . HIS A 71 ? 0.2879 0.4049 0.3649 -0.0489 0.0635  -0.1154 71 HIS A NE2 
513  N N   . LYS A 72 ? 0.2746 0.4458 0.3390 -0.0524 0.0719  -0.1037 72 LYS A N   
514  C CA  . LYS A 72 ? 0.2818 0.4473 0.3665 -0.0438 0.0737  -0.1164 72 LYS A CA  
515  C C   . LYS A 72 ? 0.2556 0.4028 0.3426 -0.0403 0.0707  -0.1045 72 LYS A C   
516  O O   . LYS A 72 ? 0.2805 0.4021 0.3766 -0.0315 0.0681  -0.1054 72 LYS A O   
517  C CB  . LYS A 72 ? 0.3015 0.5020 0.3961 -0.0437 0.0789  -0.1360 72 LYS A CB  
518  C CG  . LYS A 72 ? 0.3855 0.6052 0.4818 -0.0438 0.0807  -0.1535 72 LYS A CG  
519  C CD  . LYS A 72 ? 0.4235 0.6786 0.5330 -0.0417 0.0858  -0.1764 72 LYS A CD  
520  C CE  . LYS A 72 ? 0.4888 0.7662 0.5988 -0.0410 0.0866  -0.1957 72 LYS A CE  
521  N NZ  . LYS A 72 ? 0.4732 0.7923 0.5918 -0.0400 0.0924  -0.2185 72 LYS A NZ  
522  N N   . GLN A 73 ? 0.2573 0.4166 0.3356 -0.0471 0.0707  -0.0928 73 GLN A N   
523  C CA  . GLN A 73 ? 0.2629 0.4079 0.3456 -0.0434 0.0666  -0.0832 73 GLN A CA  
524  C C   . GLN A 73 ? 0.2770 0.3866 0.3525 -0.0385 0.0604  -0.0700 73 GLN A C   
525  O O   . GLN A 73 ? 0.2696 0.3586 0.3505 -0.0292 0.0565  -0.0689 73 GLN A O   
526  C CB  . GLN A 73 ? 0.2742 0.4388 0.3517 -0.0535 0.0680  -0.0730 73 GLN A CB  
527  C CG  . GLN A 73 ? 0.2928 0.4934 0.3809 -0.0579 0.0760  -0.0866 73 GLN A CG  
528  C CD  . GLN A 73 ? 0.3307 0.5531 0.4093 -0.0721 0.0808  -0.0747 73 GLN A CD  
529  O OE1 . GLN A 73 ? 0.3445 0.5542 0.4079 -0.0785 0.0765  -0.0559 73 GLN A OE1 
530  N NE2 . GLN A 73 ? 0.3847 0.6403 0.4733 -0.0775 0.0899  -0.0858 73 GLN A NE2 
531  N N   . ALA A 74 ? 0.2285 0.3317 0.2911 -0.0440 0.0591  -0.0609 74 ALA A N   
532  C CA  . ALA A 74 ? 0.2415 0.3155 0.2982 -0.0403 0.0546  -0.0502 74 ALA A CA  
533  C C   . ALA A 74 ? 0.2448 0.2967 0.3080 -0.0318 0.0570  -0.0574 74 ALA A C   
534  O O   . ALA A 74 ? 0.2540 0.2813 0.3145 -0.0249 0.0546  -0.0505 74 ALA A O   
535  C CB  . ALA A 74 ? 0.2813 0.3554 0.3267 -0.0474 0.0519  -0.0424 74 ALA A CB  
536  N N   . VAL A 75 ? 0.2437 0.3038 0.3148 -0.0324 0.0617  -0.0709 75 VAL A N   
537  C CA  . VAL A 75 ? 0.2584 0.2966 0.3388 -0.0257 0.0644  -0.0780 75 VAL A CA  
538  C C   . VAL A 75 ? 0.2502 0.2753 0.3368 -0.0157 0.0620  -0.0800 75 VAL A C   
539  O O   . VAL A 75 ? 0.2961 0.2908 0.3798 -0.0091 0.0615  -0.0740 75 VAL A O   
540  C CB  . VAL A 75 ? 0.2582 0.3106 0.3509 -0.0279 0.0684  -0.0951 75 VAL A CB  
541  C CG1 . VAL A 75 ? 0.2680 0.2976 0.3755 -0.0210 0.0707  -0.1037 75 VAL A CG1 
542  C CG2 . VAL A 75 ? 0.2566 0.3130 0.3438 -0.0349 0.0689  -0.0933 75 VAL A CG2 
543  N N   . GLU A 76 ? 0.2654 0.3132 0.3594 -0.0146 0.0604  -0.0878 76 GLU A N   
544  C CA  . GLU A 76 ? 0.3414 0.3797 0.4440 -0.0039 0.0558  -0.0925 76 GLU A CA  
545  C C   . GLU A 76 ? 0.3111 0.3278 0.4017 0.0016  0.0497  -0.0772 76 GLU A C   
546  O O   . GLU A 76 ? 0.3262 0.3173 0.4155 0.0127  0.0450  -0.0756 76 GLU A O   
547  C CB  . GLU A 76 ? 0.3626 0.4353 0.4787 -0.0051 0.0563  -0.1064 76 GLU A CB  
548  C CG  . GLU A 76 ? 0.5070 0.5962 0.6405 -0.0031 0.0593  -0.1278 76 GLU A CG  
549  C CD  . GLU A 76 ? 0.6089 0.6754 0.7567 0.0106  0.0533  -0.1375 76 GLU A CD  
550  O OE1 . GLU A 76 ? 0.6231 0.6530 0.7615 0.0176  0.0486  -0.1247 76 GLU A OE1 
551  O OE2 . GLU A 76 ? 0.6538 0.7394 0.8216 0.0147  0.0527  -0.1581 76 GLU A OE2 
552  N N   . THR A 77 ? 0.2857 0.3125 0.3673 -0.0055 0.0487  -0.0662 77 THR A N   
553  C CA  . THR A 77 ? 0.2512 0.2613 0.3233 -0.0004 0.0419  -0.0536 77 THR A CA  
554  C C   . THR A 77 ? 0.3203 0.2968 0.3785 0.0052  0.0421  -0.0445 77 THR A C   
555  O O   . THR A 77 ? 0.3712 0.3263 0.4219 0.0158  0.0366  -0.0394 77 THR A O   
556  C CB  . THR A 77 ? 0.2536 0.2799 0.3211 -0.0104 0.0405  -0.0441 77 THR A CB  
557  O OG1 . THR A 77 ? 0.2582 0.3142 0.3376 -0.0161 0.0418  -0.0509 77 THR A OG1 
558  C CG2 . THR A 77 ? 0.2780 0.2867 0.3377 -0.0044 0.0325  -0.0329 77 THR A CG2 
559  N N   . LEU A 78 ? 0.2956 0.2684 0.3506 -0.0018 0.0488  -0.0433 78 LEU A N   
560  C CA  . LEU A 78 ? 0.3176 0.2612 0.3620 0.0012  0.0522  -0.0358 78 LEU A CA  
561  C C   . LEU A 78 ? 0.3405 0.2601 0.3865 0.0107  0.0531  -0.0392 78 LEU A C   
562  O O   . LEU A 78 ? 0.3897 0.2817 0.4216 0.0182  0.0521  -0.0297 78 LEU A O   
563  C CB  . LEU A 78 ? 0.3434 0.2916 0.3900 -0.0089 0.0594  -0.0372 78 LEU A CB  
564  C CG  . LEU A 78 ? 0.2818 0.2428 0.3221 -0.0157 0.0561  -0.0301 78 LEU A CG  
565  C CD1 . LEU A 78 ? 0.3271 0.3021 0.3730 -0.0252 0.0597  -0.0358 78 LEU A CD1 
566  C CD2 . LEU A 78 ? 0.2803 0.2210 0.3075 -0.0113 0.0543  -0.0188 78 LEU A CD2 
567  N N   A ARG A 79 ? 0.3168 0.2465 0.3791 0.0108  0.0544  -0.0527 79 ARG A N   
568  N N   B ARG A 79 ? 0.3120 0.2425 0.3745 0.0108  0.0542  -0.0529 79 ARG A N   
569  C CA  A ARG A 79 ? 0.3383 0.2436 0.4055 0.0196  0.0537  -0.0570 79 ARG A CA  
570  C CA  B ARG A 79 ? 0.3354 0.2431 0.4043 0.0193  0.0537  -0.0584 79 ARG A CA  
571  C C   A ARG A 79 ? 0.3715 0.2634 0.4326 0.0334  0.0433  -0.0547 79 ARG A C   
572  C C   B ARG A 79 ? 0.3692 0.2644 0.4350 0.0333  0.0434  -0.0583 79 ARG A C   
573  O O   A ARG A 79 ? 0.3792 0.2371 0.4284 0.0427  0.0409  -0.0470 79 ARG A O   
574  O O   B ARG A 79 ? 0.4089 0.2736 0.4708 0.0427  0.0405  -0.0561 79 ARG A O   
575  C CB  A ARG A 79 ? 0.3652 0.2888 0.4553 0.0170  0.0558  -0.0755 79 ARG A CB  
576  C CB  B ARG A 79 ? 0.3726 0.3005 0.4641 0.0157  0.0564  -0.0768 79 ARG A CB  
577  C CG  A ARG A 79 ? 0.3860 0.3205 0.4825 0.0054  0.0644  -0.0796 79 ARG A CG  
578  C CG  B ARG A 79 ? 0.4016 0.3332 0.4992 0.0053  0.0651  -0.0801 79 ARG A CG  
579  C CD  A ARG A 79 ? 0.4095 0.3703 0.5278 0.0032  0.0653  -0.1004 79 ARG A CD  
580  C CD  B ARG A 79 ? 0.4249 0.3801 0.5453 0.0034  0.0661  -0.1011 79 ARG A CD  
581  N NE  A ARG A 79 ? 0.4247 0.3658 0.5594 0.0098  0.0644  -0.1103 79 ARG A NE  
582  N NE  B ARG A 79 ? 0.4247 0.3614 0.5601 0.0126  0.0628  -0.1106 79 ARG A NE  
583  C CZ  A ARG A 79 ? 0.4433 0.3838 0.5891 0.0198  0.0573  -0.1204 79 ARG A CZ  
584  C CZ  B ARG A 79 ? 0.4280 0.3359 0.5710 0.0129  0.0663  -0.1101 79 ARG A CZ  
585  N NH1 A ARG A 79 ? 0.4599 0.4210 0.6034 0.0237  0.0519  -0.1228 79 ARG A NH1 
586  N NH1 B ARG A 79 ? 0.4323 0.3220 0.5898 0.0219  0.0611  -0.1184 79 ARG A NH1 
587  N NH2 A ARG A 79 ? 0.4206 0.3400 0.5825 0.0260  0.0551  -0.1292 79 ARG A NH2 
588  N NH2 B ARG A 79 ? 0.4233 0.3203 0.5615 0.0042  0.0746  -0.1018 79 ARG A NH2 
589  N N   . ASN A 80 ? 0.3878 0.3060 0.4565 0.0347  0.0372  -0.0611 80 ASN A N   
590  C CA  . ASN A 80 ? 0.4600 0.3722 0.5305 0.0483  0.0259  -0.0646 80 ASN A CA  
591  C C   . ASN A 80 ? 0.4757 0.3683 0.5243 0.0552  0.0200  -0.0497 80 ASN A C   
592  O O   . ASN A 80 ? 0.5246 0.4322 0.5756 0.0575  0.0132  -0.0503 80 ASN A O   
593  C CB  . ASN A 80 ? 0.5267 0.4778 0.6177 0.0453  0.0234  -0.0788 80 ASN A CB  
594  C CG  . ASN A 80 ? 0.6053 0.5544 0.7062 0.0598  0.0114  -0.0882 80 ASN A CG  
595  O OD1 . ASN A 80 ? 0.6506 0.5744 0.7513 0.0725  0.0045  -0.0918 80 ASN A OD1 
596  N ND2 . ASN A 80 ? 0.6038 0.5792 0.7150 0.0579  0.0080  -0.0926 80 ASN A ND2 
597  N N   . THR A 81 ? 0.4322 0.2922 0.4605 0.0578  0.0235  -0.0369 81 THR A N   
598  C CA  . THR A 81 ? 0.4444 0.2851 0.4481 0.0646  0.0195  -0.0229 81 THR A CA  
599  C C   . THR A 81 ? 0.4647 0.2645 0.4488 0.0763  0.0177  -0.0147 81 THR A C   
600  O O   . THR A 81 ? 0.4826 0.2683 0.4744 0.0764  0.0208  -0.0184 81 THR A O   
601  C CB  . THR A 81 ? 0.4313 0.2762 0.4253 0.0524  0.0294  -0.0131 81 THR A CB  
602  O OG1 . THR A 81 ? 0.4161 0.2546 0.4146 0.0425  0.0416  -0.0132 81 THR A OG1 
603  C CG2 . THR A 81 ? 0.3875 0.2672 0.3949 0.0429  0.0278  -0.0174 81 THR A CG2 
604  N N   . GLY A 82 ? 0.4683 0.2485 0.4267 0.0865  0.0121  -0.0036 82 GLY A N   
605  C CA  . GLY A 82 ? 0.5207 0.2592 0.4533 0.0973  0.0111  0.0079  82 GLY A CA  
606  C C   . GLY A 82 ? 0.5364 0.2588 0.4528 0.0859  0.0279  0.0215  82 GLY A C   
607  O O   . GLY A 82 ? 0.5058 0.2484 0.4379 0.0704  0.0392  0.0181  82 GLY A O   
608  N N   . GLN A 83 ? 0.5615 0.2485 0.4461 0.0938  0.0296  0.0364  83 GLN A N   
609  C CA  . GLN A 83 ? 0.5440 0.2122 0.4134 0.0828  0.0477  0.0496  83 GLN A CA  
610  C C   . GLN A 83 ? 0.5633 0.2522 0.4273 0.0730  0.0570  0.0523  83 GLN A C   
611  O O   . GLN A 83 ? 0.5851 0.2783 0.4573 0.0580  0.0727  0.0537  83 GLN A O   
612  C CB  . GLN A 83 ? 0.6586 0.2810 0.4925 0.0940  0.0473  0.0663  83 GLN A CB  
613  C CG  . GLN A 83 ? 0.6865 0.2888 0.4988 0.0832  0.0673  0.0822  83 GLN A CG  
614  C CD  . GLN A 83 ? 0.6780 0.2832 0.5180 0.0646  0.0838  0.0787  83 GLN A CD  
615  O OE1 . GLN A 83 ? 0.6527 0.2643 0.5228 0.0624  0.0793  0.0668  83 GLN A OE1 
616  N NE2 . GLN A 83 ? 0.6873 0.2897 0.5195 0.0514  0.1029  0.0870  83 GLN A NE2 
617  N N   . VAL A 84 ? 0.5058 0.2086 0.3594 0.0819  0.0462  0.0510  84 VAL A N   
618  C CA  . VAL A 84 ? 0.4587 0.1834 0.3114 0.0746  0.0511  0.0506  84 VAL A CA  
619  C C   . VAL A 84 ? 0.4551 0.2155 0.3359 0.0718  0.0404  0.0374  84 VAL A C   
620  O O   . VAL A 84 ? 0.5147 0.2810 0.4016 0.0823  0.0258  0.0312  84 VAL A O   
621  C CB  . VAL A 84 ? 0.5202 0.2325 0.3385 0.0870  0.0472  0.0593  84 VAL A CB  
622  C CG1 . VAL A 84 ? 0.5611 0.3014 0.3860 0.0823  0.0465  0.0539  84 VAL A CG1 
623  C CG2 . VAL A 84 ? 0.5646 0.2438 0.3523 0.0857  0.0624  0.0747  84 VAL A CG2 
624  N N   . VAL A 85 ? 0.4236 0.2071 0.3221 0.0574  0.0477  0.0331  85 VAL A N   
625  C CA  . VAL A 85 ? 0.3672 0.1822 0.2913 0.0519  0.0396  0.0230  85 VAL A CA  
626  C C   . VAL A 85 ? 0.3859 0.2184 0.3111 0.0478  0.0372  0.0229  85 VAL A C   
627  O O   . VAL A 85 ? 0.3910 0.2217 0.3108 0.0410  0.0470  0.0258  85 VAL A O   
628  C CB  . VAL A 85 ? 0.3560 0.1838 0.3030 0.0386  0.0476  0.0162  85 VAL A CB  
629  C CG1 . VAL A 85 ? 0.3258 0.1855 0.2944 0.0324  0.0402  0.0079  85 VAL A CG1 
630  C CG2 . VAL A 85 ? 0.3926 0.2033 0.3426 0.0428  0.0492  0.0141  85 VAL A CG2 
631  N N   . HIS A 86 ? 0.3502 0.1996 0.2850 0.0522  0.0237  0.0185  86 HIS A N   
632  C CA  . HIS A 86 ? 0.3497 0.2153 0.2902 0.0488  0.0184  0.0174  86 HIS A CA  
633  C C   . HIS A 86 ? 0.3298 0.2173 0.2931 0.0338  0.0202  0.0135  86 HIS A C   
634  O O   . HIS A 86 ? 0.3394 0.2391 0.3171 0.0306  0.0168  0.0098  86 HIS A O   
635  C CB  . HIS A 86 ? 0.3800 0.2512 0.3225 0.0604  0.0022  0.0143  86 HIS A CB  
636  C CG  . HIS A 86 ? 0.3760 0.2603 0.3246 0.0596  -0.0056 0.0126  86 HIS A CG  
637  N ND1 . HIS A 86 ? 0.4199 0.3159 0.3821 0.0652  -0.0208 0.0079  86 HIS A ND1 
638  C CD2 . HIS A 86 ? 0.4290 0.3165 0.3748 0.0543  -0.0012 0.0133  86 HIS A CD2 
639  C CE1 . HIS A 86 ? 0.4457 0.3499 0.4128 0.0638  -0.0263 0.0065  86 HIS A CE1 
640  N NE2 . HIS A 86 ? 0.4394 0.3395 0.3966 0.0575  -0.0149 0.0092  86 HIS A NE2 
641  N N   . LEU A 87 ? 0.3085 0.2016 0.2742 0.0252  0.0255  0.0136  87 LEU A N   
642  C CA  . LEU A 87 ? 0.2508 0.1628 0.2342 0.0125  0.0252  0.0105  87 LEU A CA  
643  C C   . LEU A 87 ? 0.2770 0.2000 0.2670 0.0105  0.0157  0.0101  87 LEU A C   
644  O O   . LEU A 87 ? 0.2921 0.2096 0.2747 0.0149  0.0158  0.0097  87 LEU A O   
645  C CB  . LEU A 87 ? 0.2861 0.1953 0.2716 0.0037  0.0385  0.0081  87 LEU A CB  
646  C CG  . LEU A 87 ? 0.2967 0.1934 0.2795 0.0047  0.0479  0.0075  87 LEU A CG  
647  C CD1 . LEU A 87 ? 0.3462 0.2384 0.3335 -0.0038 0.0612  0.0044  87 LEU A CD1 
648  C CD2 . LEU A 87 ? 0.3235 0.2331 0.3179 0.0032  0.0434  0.0032  87 LEU A CD2 
649  N N   . LEU A 88 ? 0.2470 0.1853 0.2509 0.0040  0.0073  0.0102  88 LEU A N   
650  C CA  . LEU A 88 ? 0.2404 0.1876 0.2537 0.0009  -0.0039 0.0105  88 LEU A CA  
651  C C   . LEU A 88 ? 0.2549 0.2114 0.2751 -0.0107 -0.0016 0.0094  88 LEU A C   
652  O O   . LEU A 88 ? 0.2529 0.2172 0.2757 -0.0175 0.0016  0.0103  88 LEU A O   
653  C CB  . LEU A 88 ? 0.2347 0.1899 0.2587 0.0014  -0.0162 0.0133  88 LEU A CB  
654  C CG  . LEU A 88 ? 0.2711 0.2325 0.3074 -0.0015 -0.0302 0.0149  88 LEU A CG  
655  C CD1 . LEU A 88 ? 0.2705 0.2255 0.3043 0.0086  -0.0363 0.0103  88 LEU A CD1 
656  C CD2 . LEU A 88 ? 0.3110 0.2798 0.3606 -0.0036 -0.0394 0.0185  88 LEU A CD2 
657  N N   . LEU A 89 ? 0.1849 0.1944 0.3185 -0.0224 0.0483  -0.0096 89 LEU A N   
658  C CA  . LEU A 89 ? 0.1914 0.1978 0.3043 -0.0206 0.0391  -0.0079 89 LEU A CA  
659  C C   . LEU A 89 ? 0.1954 0.2118 0.3238 -0.0125 0.0311  -0.0072 89 LEU A C   
660  O O   . LEU A 89 ? 0.1765 0.2046 0.3306 -0.0079 0.0281  -0.0114 89 LEU A O   
661  C CB  . LEU A 89 ? 0.1744 0.1940 0.2763 -0.0320 0.0277  -0.0144 89 LEU A CB  
662  C CG  . LEU A 89 ? 0.2368 0.2373 0.3140 -0.0412 0.0275  -0.0157 89 LEU A CG  
663  C CD1 . LEU A 89 ? 0.2458 0.2655 0.3453 -0.0512 0.0291  -0.0212 89 LEU A CD1 
664  C CD2 . LEU A 89 ? 0.2764 0.2672 0.3231 -0.0503 0.0104  -0.0150 89 LEU A CD2 
665  N N   . GLU A 90 ? 0.1788 0.1871 0.2877 -0.0090 0.0257  -0.0027 90 GLU A N   
666  C CA  . GLU A 90 ? 0.1784 0.1963 0.2959 -0.0012 0.0149  -0.0035 90 GLU A CA  
667  C C   . GLU A 90 ? 0.2327 0.2697 0.3378 -0.0065 0.0046  -0.0082 90 GLU A C   
668  O O   . GLU A 90 ? 0.2506 0.2737 0.3286 -0.0131 0.0035  -0.0048 90 GLU A O   
669  C CB  . GLU A 90 ? 0.2006 0.1958 0.3061 0.0057  0.0162  0.0089  90 GLU A CB  
670  C CG  . GLU A 90 ? 0.2445 0.2452 0.3524 0.0136  0.0029  0.0075  90 GLU A CG  
671  C CD  . GLU A 90 ? 0.3510 0.3317 0.4421 0.0176  0.0033  0.0208  90 GLU A CD  
672  O OE1 . GLU A 90 ? 0.3688 0.3365 0.4446 0.0158  0.0146  0.0315  90 GLU A OE1 
673  O OE2 . GLU A 90 ? 0.3528 0.3340 0.4453 0.0245  -0.0083 0.0207  90 GLU A OE2 
674  N N   A LYS A 91 ? 0.2046 0.2753 0.3280 -0.0024 -0.0050 -0.0153 91 LYS A N   
675  N N   B LYS A 91 ? 0.1974 0.2682 0.3209 -0.0026 -0.0049 -0.0154 91 LYS A N   
676  C CA  A LYS A 91 ? 0.2126 0.3124 0.3284 -0.0084 -0.0162 -0.0157 91 LYS A CA  
677  C CA  B LYS A 91 ? 0.2094 0.3093 0.3255 -0.0083 -0.0161 -0.0158 91 LYS A CA  
678  C C   A LYS A 91 ? 0.2423 0.3246 0.3364 -0.0048 -0.0215 -0.0099 91 LYS A C   
679  C C   B LYS A 91 ? 0.2496 0.3326 0.3439 -0.0047 -0.0217 -0.0100 91 LYS A C   
680  O O   A LYS A 91 ? 0.2342 0.3043 0.3314 0.0085  -0.0224 -0.0091 91 LYS A O   
681  O O   B LYS A 91 ? 0.2207 0.2923 0.3180 0.0087  -0.0230 -0.0092 91 LYS A O   
682  C CB  A LYS A 91 ? 0.2169 0.3660 0.3572 0.0015  -0.0244 -0.0233 91 LYS A CB  
683  C CB  B LYS A 91 ? 0.1997 0.3483 0.3409 0.0019  -0.0240 -0.0236 91 LYS A CB  
684  C CG  A LYS A 91 ? 0.2665 0.4603 0.4037 -0.0050 -0.0361 -0.0198 91 LYS A CG  
685  C CG  B LYS A 91 ? 0.2488 0.4429 0.3879 -0.0024 -0.0359 -0.0208 91 LYS A CG  
686  C CD  A LYS A 91 ? 0.2829 0.5025 0.4221 -0.0266 -0.0384 -0.0148 91 LYS A CD  
687  C CD  B LYS A 91 ? 0.2862 0.5027 0.4230 -0.0255 -0.0389 -0.0144 91 LYS A CD  
688  C CE  A LYS A 91 ? 0.3151 0.5736 0.4472 -0.0401 -0.0532 -0.0044 91 LYS A CE  
689  C CE  B LYS A 91 ? 0.3176 0.5936 0.4589 -0.0312 -0.0529 -0.0074 91 LYS A CE  
690  N NZ  A LYS A 91 ? 0.3144 0.6272 0.4614 -0.0220 -0.0598 -0.0065 91 LYS A NZ  
691  N NZ  B LYS A 91 ? 0.3104 0.6046 0.4468 -0.0597 -0.0619 0.0045  91 LYS A NZ  
692  N N   . GLY A 92 ? 0.2614 0.3398 0.3322 -0.0176 -0.0277 -0.0052 92 GLY A N   
693  C CA  . GLY A 92 ? 0.2979 0.3595 0.3458 -0.0147 -0.0337 -0.0001 92 GLY A CA  
694  C C   . GLY A 92 ? 0.3122 0.4104 0.3682 -0.0111 -0.0459 -0.0001 92 GLY A C   
695  O O   . GLY A 92 ? 0.3179 0.4608 0.3972 -0.0085 -0.0501 -0.0042 92 GLY A O   
696  N N   . GLN A 93 ? 0.4045 0.4869 0.4394 -0.0093 -0.0517 0.0047  93 GLN A N   
697  C CA  . GLN A 93 ? 0.5298 0.6458 0.5690 -0.0050 -0.0634 0.0058  93 GLN A CA  
698  C C   . GLN A 93 ? 0.6028 0.7557 0.6395 -0.0239 -0.0768 0.0121  93 GLN A C   
699  O O   . GLN A 93 ? 0.5774 0.7126 0.5988 -0.0422 -0.0807 0.0166  93 GLN A O   
700  C CB  . GLN A 93 ? 0.6189 0.7043 0.6361 0.0021  -0.0653 0.0101  93 GLN A CB  
701  C CG  . GLN A 93 ? 0.6826 0.7368 0.7033 0.0177  -0.0558 0.0096  93 GLN A CG  
702  C CD  . GLN A 93 ? 0.7268 0.8010 0.7755 0.0328  -0.0581 0.0024  93 GLN A CD  
703  O OE1 . GLN A 93 ? 0.7480 0.8038 0.8087 0.0381  -0.0517 0.0014  93 GLN A OE1 
704  N NE2 . GLN A 93 ? 0.7240 0.8367 0.7814 0.0414  -0.0694 -0.0024 93 GLN A NE2 
705  N N   . SER A 94 ? 0.7024 0.9081 0.7535 -0.0190 -0.0860 0.0138  94 SER A N   
706  C CA  . SER A 94 ? 0.8099 1.0596 0.8590 -0.0381 -0.1018 0.0259  94 SER A CA  
707  C C   . SER A 94 ? 0.8718 1.1204 0.9161 -0.0654 -0.1088 0.0342  94 SER A C   
708  O O   . SER A 94 ? 0.9159 1.1780 0.9485 -0.0881 -0.1267 0.0481  94 SER A O   
709  C CB  . SER A 94 ? 0.8526 1.0816 0.8763 -0.0423 -0.1122 0.0330  94 SER A CB  
710  O OG  . SER A 94 ? 0.8884 1.0470 0.8814 -0.0463 -0.1091 0.0318  94 SER A OG  
711  N N   . PRO B 1  ? 0.2560 0.3803 0.4343 0.0418  -0.0343 0.0056  1  PRO B N   
712  C CA  . PRO B 1  ? 0.2568 0.3693 0.4391 0.0443  -0.0285 0.0054  1  PRO B CA  
713  C C   . PRO B 1  ? 0.2699 0.3891 0.4653 0.0436  -0.0239 -0.0016 1  PRO B C   
714  O O   . PRO B 1  ? 0.2821 0.4128 0.4800 0.0391  -0.0248 -0.0067 1  PRO B O   
715  C CB  . PRO B 1  ? 0.2724 0.3735 0.4418 0.0370  -0.0257 0.0038  1  PRO B CB  
716  C CG  . PRO B 1  ? 0.2830 0.3865 0.4414 0.0332  -0.0300 0.0056  1  PRO B CG  
717  C CD  . PRO B 1  ? 0.2841 0.4010 0.4469 0.0365  -0.0356 0.0073  1  PRO B CD  
718  N N   . LYS B 2  ? 0.2163 0.3284 0.4200 0.0473  -0.0184 -0.0025 2  LYS B N   
719  C CA  . LYS B 2  ? 0.2050 0.3209 0.4194 0.0448  -0.0121 -0.0107 2  LYS B CA  
720  C C   . LYS B 2  ? 0.1943 0.2998 0.3993 0.0361  -0.0064 -0.0156 2  LYS B C   
721  O O   . LYS B 2  ? 0.1805 0.2754 0.3744 0.0344  -0.0069 -0.0120 2  LYS B O   
722  C CB  . LYS B 2  ? 0.2703 0.3857 0.5014 0.0538  -0.0083 -0.0097 2  LYS B CB  
723  C CG  . LYS B 2  ? 0.3461 0.4442 0.5751 0.0568  -0.0034 -0.0067 2  LYS B CG  
724  C CD  . LYS B 2  ? 0.4206 0.5170 0.6672 0.0665  0.0012  -0.0053 2  LYS B CD  
725  C CE  . LYS B 2  ? 0.4512 0.5285 0.6946 0.0690  0.0068  -0.0020 2  LYS B CE  
726  N NZ  . LYS B 2  ? 0.4692 0.5418 0.7301 0.0790  0.0126  -0.0002 2  LYS B NZ  
727  N N   . PRO B 3  ? 0.2217 0.3313 0.4308 0.0302  -0.0011 -0.0238 3  PRO B N   
728  C CA  . PRO B 3  ? 0.1892 0.2910 0.3885 0.0213  0.0036  -0.0281 3  PRO B CA  
729  C C   . PRO B 3  ? 0.1934 0.2821 0.3908 0.0232  0.0072  -0.0260 3  PRO B C   
730  O O   . PRO B 3  ? 0.2096 0.2943 0.4180 0.0297  0.0110  -0.0258 3  PRO B O   
731  C CB  . PRO B 3  ? 0.2045 0.3129 0.4121 0.0166  0.0100  -0.0373 3  PRO B CB  
732  C CG  . PRO B 3  ? 0.2354 0.3577 0.4517 0.0196  0.0063  -0.0378 3  PRO B CG  
733  C CD  . PRO B 3  ? 0.2489 0.3722 0.4708 0.0302  0.0005  -0.0297 3  PRO B CD  
734  N N   . GLY B 4  ? 0.2147 0.2966 0.3990 0.0177  0.0062  -0.0243 4  GLY B N   
735  C CA  . GLY B 4  ? 0.1946 0.2650 0.3760 0.0178  0.0097  -0.0230 4  GLY B CA  
736  C C   . GLY B 4  ? 0.1773 0.2413 0.3538 0.0236  0.0049  -0.0144 4  GLY B C   
737  O O   . GLY B 4  ? 0.2154 0.2705 0.3863 0.0219  0.0068  -0.0128 4  GLY B O   
738  N N   . ASP B 5  ? 0.1927 0.2619 0.3709 0.0296  -0.0009 -0.0092 5  ASP B N   
739  C CA  . ASP B 5  ? 0.1794 0.2429 0.3519 0.0345  -0.0051 -0.0013 5  ASP B CA  
740  C C   . ASP B 5  ? 0.1720 0.2334 0.3314 0.0289  -0.0081 0.0006  5  ASP B C   
741  O O   . ASP B 5  ? 0.2017 0.2695 0.3571 0.0238  -0.0100 -0.0018 5  ASP B O   
742  C CB  . ASP B 5  ? 0.1863 0.2581 0.3628 0.0411  -0.0111 0.0034  5  ASP B CB  
743  C CG  . ASP B 5  ? 0.2612 0.3341 0.4516 0.0498  -0.0094 0.0050  5  ASP B CG  
744  O OD1 . ASP B 5  ? 0.2719 0.3359 0.4684 0.0515  -0.0027 0.0032  5  ASP B OD1 
745  O OD2 . ASP B 5  ? 0.2901 0.3735 0.4857 0.0550  -0.0147 0.0084  5  ASP B OD2 
746  N N   . ILE B 6  ? 0.1617 0.2140 0.3154 0.0303  -0.0080 0.0053  6  ILE B N   
747  C CA  . ILE B 6  ? 0.1611 0.2113 0.3042 0.0272  -0.0109 0.0083  6  ILE B CA  
748  C C   . ILE B 6  ? 0.1535 0.2083 0.2932 0.0303  -0.0165 0.0125  6  ILE B C   
749  O O   . ILE B 6  ? 0.2123 0.2679 0.3553 0.0365  -0.0186 0.0162  6  ILE B O   
750  C CB  . ILE B 6  ? 0.1711 0.2104 0.3105 0.0280  -0.0083 0.0116  6  ILE B CB  
751  C CG1 . ILE B 6  ? 0.1874 0.2229 0.3295 0.0233  -0.0024 0.0066  6  ILE B CG1 
752  C CG2 . ILE B 6  ? 0.2396 0.2775 0.3700 0.0254  -0.0108 0.0147  6  ILE B CG2 
753  C CD1 . ILE B 6  ? 0.2176 0.2595 0.3560 0.0156  -0.0029 0.0027  6  ILE B CD1 
754  N N   . PHE B 7  ? 0.1654 0.2232 0.2984 0.0260  -0.0187 0.0121  7  PHE B N   
755  C CA  . PHE B 7  ? 0.1639 0.2239 0.2911 0.0273  -0.0229 0.0155  7  PHE B CA  
756  C C   . PHE B 7  ? 0.1735 0.2295 0.2924 0.0229  -0.0224 0.0161  7  PHE B C   
757  O O   . PHE B 7  ? 0.1726 0.2273 0.2912 0.0190  -0.0202 0.0141  7  PHE B O   
758  C CB  . PHE B 7  ? 0.1895 0.2607 0.3203 0.0273  -0.0260 0.0132  7  PHE B CB  
759  C CG  . PHE B 7  ? 0.1950 0.2712 0.3257 0.0213  -0.0248 0.0080  7  PHE B CG  
760  C CD1 . PHE B 7  ? 0.1986 0.2766 0.3227 0.0173  -0.0262 0.0074  7  PHE B CD1 
761  C CD2 . PHE B 7  ? 0.1887 0.2673 0.3256 0.0192  -0.0218 0.0035  7  PHE B CD2 
762  C CE1 . PHE B 7  ? 0.1831 0.2641 0.3065 0.0117  -0.0245 0.0033  7  PHE B CE1 
763  C CE2 . PHE B 7  ? 0.1682 0.2509 0.3037 0.0133  -0.0206 -0.0007 7  PHE B CE2 
764  C CZ  . PHE B 7  ? 0.1660 0.2495 0.2947 0.0097  -0.0220 -0.0003 7  PHE B CZ  
765  N N   . GLU B 8  ? 0.1833 0.2378 0.2958 0.0236  -0.0244 0.0191  8  GLU B N   
766  C CA  . GLU B 8  ? 0.1836 0.2338 0.2895 0.0201  -0.0231 0.0196  8  GLU B CA  
767  C C   . GLU B 8  ? 0.1673 0.2216 0.2683 0.0180  -0.0249 0.0186  8  GLU B C   
768  O O   . GLU B 8  ? 0.2386 0.2983 0.3389 0.0197  -0.0281 0.0191  8  GLU B O   
769  C CB  . GLU B 8  ? 0.2982 0.3399 0.4001 0.0215  -0.0212 0.0232  8  GLU B CB  
770  C CG  . GLU B 8  ? 0.4025 0.4421 0.5011 0.0253  -0.0229 0.0269  8  GLU B CG  
771  C CD  . GLU B 8  ? 0.4721 0.5024 0.5662 0.0257  -0.0200 0.0301  8  GLU B CD  
772  O OE1 . GLU B 8  ? 0.5441 0.5705 0.6357 0.0291  -0.0206 0.0340  8  GLU B OE1 
773  O OE2 . GLU B 8  ? 0.3838 0.4108 0.4773 0.0229  -0.0171 0.0291  8  GLU B OE2 
774  N N   . VAL B 9  ? 0.1614 0.2133 0.2593 0.0140  -0.0228 0.0171  9  VAL B N   
775  C CA  . VAL B 9  ? 0.1716 0.2251 0.2641 0.0107  -0.0228 0.0152  9  VAL B CA  
776  C C   . VAL B 9  ? 0.2199 0.2650 0.3074 0.0088  -0.0190 0.0161  9  VAL B C   
777  O O   . VAL B 9  ? 0.2812 0.3215 0.3712 0.0094  -0.0167 0.0179  9  VAL B O   
778  C CB  . VAL B 9  ? 0.1977 0.2571 0.2928 0.0071  -0.0227 0.0111  9  VAL B CB  
779  C CG1 . VAL B 9  ? 0.2144 0.2829 0.3165 0.0091  -0.0256 0.0094  9  VAL B CG1 
780  C CG2 . VAL B 9  ? 0.2370 0.2915 0.3331 0.0049  -0.0195 0.0112  9  VAL B CG2 
781  N N   . GLU B 10 ? 0.2066 0.2508 0.2877 0.0062  -0.0181 0.0148  10 GLU B N   
782  C CA  . GLU B 10 ? 0.2203 0.2565 0.2977 0.0035  -0.0131 0.0142  10 GLU B CA  
783  C C   . GLU B 10 ? 0.2253 0.2632 0.3011 -0.0013 -0.0114 0.0099  10 GLU B C   
784  O O   . GLU B 10 ? 0.2521 0.2957 0.3235 -0.0044 -0.0129 0.0066  10 GLU B O   
785  C CB  . GLU B 10 ? 0.2513 0.2838 0.3213 0.0028  -0.0117 0.0147  10 GLU B CB  
786  C CG  . GLU B 10 ? 0.2570 0.2857 0.3275 0.0068  -0.0120 0.0189  10 GLU B CG  
787  C CD  . GLU B 10 ? 0.2650 0.2867 0.3397 0.0077  -0.0074 0.0202  10 GLU B CD  
788  O OE1 . GLU B 10 ? 0.3089 0.3280 0.3859 0.0060  -0.0041 0.0188  10 GLU B OE1 
789  O OE2 . GLU B 10 ? 0.3103 0.3291 0.3860 0.0099  -0.0067 0.0229  10 GLU B OE2 
790  N N   . LEU B 11 ? 0.2137 0.2473 0.2928 -0.0021 -0.0083 0.0100  11 LEU B N   
791  C CA  . LEU B 11 ? 0.1940 0.2283 0.2722 -0.0067 -0.0063 0.0064  11 LEU B CA  
792  C C   . LEU B 11 ? 0.2312 0.2547 0.3069 -0.0089 0.0005  0.0060  11 LEU B C   
793  O O   . LEU B 11 ? 0.2342 0.2510 0.3134 -0.0058 0.0030  0.0100  11 LEU B O   
794  C CB  . LEU B 11 ? 0.2334 0.2707 0.3168 -0.0059 -0.0078 0.0076  11 LEU B CB  
795  C CG  . LEU B 11 ? 0.2584 0.2965 0.3410 -0.0109 -0.0056 0.0041  11 LEU B CG  
796  C CD1 . LEU B 11 ? 0.2792 0.3269 0.3602 -0.0144 -0.0079 -0.0014 11 LEU B CD1 
797  C CD2 . LEU B 11 ? 0.2364 0.2773 0.3231 -0.0102 -0.0071 0.0060  11 LEU B CD2 
798  N N   . ALA B 12 ? 0.2073 0.2294 0.2774 -0.0144 0.0038  0.0008  12 ALA B N   
799  C CA  . ALA B 12 ? 0.2252 0.2355 0.2932 -0.0175 0.0120  -0.0008 12 ALA B CA  
800  C C   . ALA B 12 ? 0.2340 0.2399 0.3044 -0.0193 0.0151  -0.0006 12 ALA B C   
801  O O   . ALA B 12 ? 0.2473 0.2594 0.3166 -0.0232 0.0133  -0.0040 12 ALA B O   
802  C CB  . ALA B 12 ? 0.2446 0.2548 0.3045 -0.0242 0.0154  -0.0076 12 ALA B CB  
803  N N   . LYS B 13 ? 0.2301 0.2253 0.3040 -0.0166 0.0200  0.0037  13 LYS B N   
804  C CA  . LYS B 13 ? 0.2178 0.2066 0.2926 -0.0185 0.0239  0.0049  13 LYS B CA  
805  C C   . LYS B 13 ? 0.2553 0.2379 0.3244 -0.0262 0.0308  -0.0021 13 LYS B C   
806  O O   . LYS B 13 ? 0.2834 0.2627 0.3485 -0.0298 0.0351  -0.0073 13 LYS B O   
807  C CB  . LYS B 13 ? 0.2475 0.2265 0.3280 -0.0129 0.0275  0.0123  13 LYS B CB  
808  C CG  . LYS B 13 ? 0.2617 0.2484 0.3478 -0.0067 0.0206  0.0189  13 LYS B CG  
809  C CD  . LYS B 13 ? 0.2677 0.2477 0.3606 -0.0012 0.0232  0.0267  13 LYS B CD  
810  C CE  . LYS B 13 ? 0.2608 0.2502 0.3593 0.0039  0.0166  0.0320  13 LYS B CE  
811  N NZ  . LYS B 13 ? 0.2923 0.2770 0.3989 0.0095  0.0194  0.0393  13 LYS B NZ  
812  N N   . ASN B 14 ? 0.2467 0.2278 0.3150 -0.0296 0.0323  -0.0025 14 ASN B N   
813  C CA  . ASN B 14 ? 0.2792 0.2517 0.3427 -0.0374 0.0405  -0.0085 14 ASN B CA  
814  C C   . ASN B 14 ? 0.2944 0.2514 0.3602 -0.0350 0.0471  -0.0021 14 ASN B C   
815  O O   . ASN B 14 ? 0.3089 0.2675 0.3767 -0.0321 0.0436  0.0041  14 ASN B O   
816  C CB  . ASN B 14 ? 0.3200 0.3037 0.3807 -0.0439 0.0373  -0.0142 14 ASN B CB  
817  C CG  . ASN B 14 ? 0.4415 0.4407 0.5003 -0.0470 0.0317  -0.0208 14 ASN B CG  
818  O OD1 . ASN B 14 ? 0.4325 0.4328 0.4899 -0.0452 0.0306  -0.0213 14 ASN B OD1 
819  N ND2 . ASN B 14 ? 0.4884 0.5002 0.5472 -0.0517 0.0281  -0.0257 14 ASN B ND2 
820  N N   . ASP B 15 ? 0.3171 0.2590 0.3824 -0.0362 0.0569  -0.0034 15 ASP B N   
821  C CA  . ASP B 15 ? 0.3191 0.2449 0.3880 -0.0323 0.0637  0.0041  15 ASP B CA  
822  C C   . ASP B 15 ? 0.2855 0.2162 0.3614 -0.0226 0.0565  0.0153  15 ASP B C   
823  O O   . ASP B 15 ? 0.3063 0.2339 0.3832 -0.0203 0.0555  0.0229  15 ASP B O   
824  C CB  . ASP B 15 ? 0.3563 0.2745 0.4204 -0.0388 0.0690  0.0025  15 ASP B CB  
825  C CG  . ASP B 15 ? 0.4339 0.3391 0.4932 -0.0473 0.0809  -0.0066 15 ASP B CG  
826  O OD1 . ASP B 15 ? 0.4717 0.3793 0.5292 -0.0504 0.0828  -0.0141 15 ASP B OD1 
827  O OD2 . ASP B 15 ? 0.4349 0.3271 0.4913 -0.0515 0.0887  -0.0066 15 ASP B OD2 
828  N N   . ASN B 16 ? 0.2677 0.2066 0.3475 -0.0179 0.0515  0.0160  16 ASN B N   
829  C CA  . ASN B 16 ? 0.2859 0.2306 0.3729 -0.0094 0.0452  0.0251  16 ASN B CA  
830  C C   . ASN B 16 ? 0.2743 0.2306 0.3604 -0.0089 0.0363  0.0293  16 ASN B C   
831  O O   . ASN B 16 ? 0.2681 0.2271 0.3591 -0.0034 0.0326  0.0379  16 ASN B O   
832  C CB  . ASN B 16 ? 0.3558 0.2877 0.4502 -0.0032 0.0515  0.0334  16 ASN B CB  
833  C CG  . ASN B 16 ? 0.3938 0.3320 0.4974 0.0049  0.0475  0.0396  16 ASN B CG  
834  O OD1 . ASN B 16 ? 0.4284 0.3753 0.5321 0.0049  0.0437  0.0356  16 ASN B OD1 
835  N ND2 . ASN B 16 ? 0.4124 0.3471 0.5239 0.0117  0.0480  0.0498  16 ASN B ND2 
836  N N   . SER B 17 ? 0.2665 0.2306 0.3468 -0.0150 0.0333  0.0228  17 SER B N   
837  C CA  . SER B 17 ? 0.2499 0.2259 0.3296 -0.0153 0.0256  0.0247  17 SER B CA  
838  C C   . SER B 17 ? 0.2342 0.2232 0.3129 -0.0173 0.0200  0.0178  17 SER B C   
839  O O   . SER B 17 ? 0.2331 0.2228 0.3085 -0.0218 0.0222  0.0104  17 SER B O   
840  C CB  . SER B 17 ? 0.2782 0.2503 0.3527 -0.0210 0.0284  0.0240  17 SER B CB  
841  O OG  . SER B 17 ? 0.2869 0.2707 0.3605 -0.0221 0.0219  0.0247  17 SER B OG  
842  N N   . LEU B 18 ? 0.2233 0.2227 0.3047 -0.0143 0.0130  0.0203  18 LEU B N   
843  C CA  . LEU B 18 ? 0.2282 0.2396 0.3098 -0.0152 0.0078  0.0149  18 LEU B CA  
844  C C   . LEU B 18 ? 0.2286 0.2460 0.3077 -0.0209 0.0073  0.0098  18 LEU B C   
845  O O   . LEU B 18 ? 0.2275 0.2549 0.3077 -0.0221 0.0039  0.0047  18 LEU B O   
846  C CB  . LEU B 18 ? 0.2041 0.2229 0.2900 -0.0105 0.0020  0.0189  18 LEU B CB  
847  C CG  . LEU B 18 ? 0.2520 0.2678 0.3414 -0.0053 0.0020  0.0226  18 LEU B CG  
848  C CD1 . LEU B 18 ? 0.2723 0.2946 0.3659 -0.0018 -0.0026 0.0270  18 LEU B CD1 
849  C CD2 . LEU B 18 ? 0.2432 0.2600 0.3310 -0.0053 0.0021  0.0179  18 LEU B CD2 
850  N N   . GLY B 19 ? 0.2347 0.2465 0.3111 -0.0242 0.0107  0.0117  19 GLY B N   
851  C CA  . GLY B 19 ? 0.2472 0.2643 0.3212 -0.0304 0.0112  0.0065  19 GLY B CA  
852  C C   . GLY B 19 ? 0.2396 0.2684 0.3163 -0.0298 0.0059  0.0062  19 GLY B C   
853  O O   . GLY B 19 ? 0.2377 0.2759 0.3159 -0.0333 0.0048  -0.0001 19 GLY B O   
854  N N   . ILE B 20 ? 0.2436 0.2726 0.3217 -0.0257 0.0029  0.0125  20 ILE B N   
855  C CA  . ILE B 20 ? 0.2506 0.2890 0.3300 -0.0268 -0.0006 0.0116  20 ILE B CA  
856  C C   . ILE B 20 ? 0.2731 0.3085 0.3486 -0.0277 -0.0007 0.0185  20 ILE B C   
857  O O   . ILE B 20 ? 0.3176 0.3474 0.3931 -0.0238 -0.0010 0.0258  20 ILE B O   
858  C CB  . ILE B 20 ? 0.3175 0.3633 0.4024 -0.0220 -0.0051 0.0110  20 ILE B CB  
859  C CG1 . ILE B 20 ? 0.3386 0.3798 0.4247 -0.0170 -0.0065 0.0178  20 ILE B CG1 
860  C CG2 . ILE B 20 ? 0.3623 0.4124 0.4505 -0.0207 -0.0061 0.0055  20 ILE B CG2 
861  C CD1 . ILE B 20 ? 0.3807 0.4286 0.4710 -0.0139 -0.0103 0.0178  20 ILE B CD1 
862  N N   . SER B 21 ? 0.2152 0.2555 0.2877 -0.0328 -0.0004 0.0163  21 SER B N   
863  C CA  . SER B 21 ? 0.2125 0.2532 0.2806 -0.0341 -0.0019 0.0228  21 SER B CA  
864  C C   . SER B 21 ? 0.2235 0.2747 0.2950 -0.0336 -0.0059 0.0203  21 SER B C   
865  O O   . SER B 21 ? 0.2402 0.2980 0.3164 -0.0340 -0.0060 0.0128  21 SER B O   
866  C CB  . SER B 21 ? 0.3082 0.3460 0.3685 -0.0412 0.0017  0.0229  21 SER B CB  
867  O OG  . SER B 21 ? 0.3835 0.4291 0.4447 -0.0465 0.0030  0.0137  21 SER B OG  
868  N N   . VAL B 22 ? 0.2623 0.3157 0.3324 -0.0323 -0.0089 0.0268  22 VAL B N   
869  C CA  . VAL B 22 ? 0.2276 0.2904 0.3002 -0.0331 -0.0117 0.0238  22 VAL B CA  
870  C C   . VAL B 22 ? 0.2649 0.3328 0.3301 -0.0395 -0.0124 0.0259  22 VAL B C   
871  O O   . VAL B 22 ? 0.2752 0.3393 0.3333 -0.0418 -0.0121 0.0325  22 VAL B O   
872  C CB  . VAL B 22 ? 0.2335 0.2977 0.3118 -0.0272 -0.0150 0.0273  22 VAL B CB  
873  C CG1 . VAL B 22 ? 0.2191 0.2789 0.3032 -0.0218 -0.0141 0.0246  22 VAL B CG1 
874  C CG2 . VAL B 22 ? 0.3143 0.3763 0.3905 -0.0250 -0.0169 0.0375  22 VAL B CG2 
875  N N   . THR B 23 ? 0.2346 0.3105 0.3010 -0.0428 -0.0128 0.0200  23 THR B N   
876  C CA  . THR B 23 ? 0.2574 0.3398 0.3164 -0.0502 -0.0133 0.0203  23 THR B CA  
877  C C   . THR B 23 ? 0.2744 0.3641 0.3373 -0.0498 -0.0156 0.0184  23 THR B C   
878  O O   . THR B 23 ? 0.2425 0.3313 0.3138 -0.0448 -0.0154 0.0147  23 THR B O   
879  C CB  . THR B 23 ? 0.3030 0.3877 0.3592 -0.0573 -0.0087 0.0116  23 THR B CB  
880  O OG1 . THR B 23 ? 0.3701 0.4610 0.4170 -0.0655 -0.0088 0.0121  23 THR B OG1 
881  C CG2 . THR B 23 ? 0.3183 0.4064 0.3843 -0.0553 -0.0066 0.0019  23 THR B CG2 
882  N N   . GLY B 24 ? 0.2517 0.4294 0.3104 -0.1227 -0.0534 0.0704  24 GLY B N   
883  C CA  . GLY B 24 ? 0.2575 0.3934 0.3027 -0.0834 -0.0612 0.0640  24 GLY B CA  
884  C C   . GLY B 24 ? 0.3094 0.3584 0.3158 -0.0822 -0.0907 0.0786  24 GLY B C   
885  O O   . GLY B 24 ? 0.3894 0.4040 0.3754 -0.1065 -0.1077 0.0964  24 GLY B O   
886  N N   . GLY B 25 ? 0.3180 0.3328 0.3147 -0.0531 -0.0955 0.0677  25 GLY B N   
887  C CA  . GLY B 25 ? 0.3544 0.3020 0.3127 -0.0535 -0.1196 0.0724  25 GLY B CA  
888  C C   . GLY B 25 ? 0.3829 0.3093 0.3006 -0.0473 -0.1067 0.0544  25 GLY B C   
889  O O   . GLY B 25 ? 0.3721 0.3275 0.2778 -0.0526 -0.0806 0.0451  25 GLY B O   
890  N N   . VAL B 26 ? 0.4163 0.2988 0.3131 -0.0390 -0.1233 0.0455  26 VAL B N   
891  C CA  . VAL B 26 ? 0.4852 0.3545 0.3479 -0.0352 -0.1089 0.0212  26 VAL B CA  
892  C C   . VAL B 26 ? 0.4982 0.3753 0.3071 -0.0561 -0.1033 0.0252  26 VAL B C   
893  O O   . VAL B 26 ? 0.4865 0.3731 0.2712 -0.0561 -0.0827 0.0048  26 VAL B O   
894  C CB  . VAL B 26 ? 0.5716 0.4015 0.4213 -0.0293 -0.1259 0.0041  26 VAL B CB  
895  C CG1 . VAL B 26 ? 0.5597 0.3717 0.4493 -0.0085 -0.1203 -0.0039 26 VAL B CG1 
896  C CG2 . VAL B 26 ? 0.5749 0.3890 0.4037 -0.0402 -0.1614 0.0190  26 VAL B CG2 
897  N N   . ASN B 27 ? 0.5035 0.3713 0.2889 -0.0737 -0.1200 0.0517  27 ASN B N   
898  C CA  . ASN B 27 ? 0.5638 0.4250 0.2845 -0.0919 -0.1159 0.0622  27 ASN B CA  
899  C C   . ASN B 27 ? 0.5491 0.4473 0.2702 -0.1100 -0.0821 0.0656  27 ASN B C   
900  O O   . ASN B 27 ? 0.6457 0.5391 0.3094 -0.1281 -0.0714 0.0742  27 ASN B O   
901  C CB  . ASN B 27 ? 0.6544 0.4753 0.3393 -0.1011 -0.1439 0.0914  27 ASN B CB  
902  C CG  . ASN B 27 ? 0.6735 0.4971 0.3954 -0.1159 -0.1419 0.1120  27 ASN B CG  
903  O OD1 . ASN B 27 ? 0.5852 0.4271 0.3699 -0.1057 -0.1470 0.1063  27 ASN B OD1 
904  N ND2 . ASN B 27 ? 0.7928 0.5973 0.4714 -0.1421 -0.1319 0.1350  27 ASN B ND2 
905  N N   . THR B 28 ? 0.4953 0.4347 0.2789 -0.1041 -0.0649 0.0580  28 THR B N   
906  C CA  . THR B 28 ? 0.4767 0.4685 0.2708 -0.1222 -0.0324 0.0557  28 THR B CA  
907  C C   . THR B 28 ? 0.4520 0.4843 0.2683 -0.1017 -0.0055 0.0251  28 THR B C   
908  O O   . THR B 28 ? 0.4524 0.4644 0.2796 -0.0744 -0.0103 0.0074  28 THR B O   
909  C CB  . THR B 28 ? 0.4375 0.4697 0.2912 -0.1286 -0.0301 0.0635  28 THR B CB  
910  O OG1 . THR B 28 ? 0.3802 0.4446 0.2966 -0.0922 -0.0294 0.0458  28 THR B OG1 
911  C CG2 . THR B 28 ? 0.5084 0.4953 0.3525 -0.1431 -0.0582 0.0893  28 THR B CG2 
912  N N   . SER B 29 ? 0.4746 0.5631 0.2969 -0.1165 0.0255  0.0165  29 SER B N   
913  C CA  . SER B 29 ? 0.5254 0.6602 0.3754 -0.0929 0.0531  -0.0146 29 SER B CA  
914  C C   . SER B 29 ? 0.5219 0.7160 0.4460 -0.0676 0.0606  -0.0238 29 SER B C   
915  O O   . SER B 29 ? 0.5493 0.7957 0.5012 -0.0453 0.0855  -0.0488 29 SER B O   
916  C CB  . SER B 29 ? 0.6510 0.8235 0.4635 -0.1202 0.0838  -0.0244 29 SER B CB  
917  O OG  . SER B 29 ? 0.6902 0.8949 0.4999 -0.1583 0.0938  -0.0078 29 SER B OG  
918  N N   . VAL B 30 ? 0.4570 0.6478 0.4122 -0.0681 0.0384  -0.0053 30 VAL B N   
919  C CA  . VAL B 30 ? 0.4299 0.6860 0.4533 -0.0415 0.0417  -0.0137 30 VAL B CA  
920  C C   . VAL B 30 ? 0.4206 0.6522 0.4650 0.0142  0.0394  -0.0278 30 VAL B C   
921  O O   . VAL B 30 ? 0.3690 0.5258 0.3950 0.0254  0.0195  -0.0196 30 VAL B O   
922  C CB  . VAL B 30 ? 0.3558 0.6151 0.4042 -0.0585 0.0183  0.0079  30 VAL B CB  
923  C CG1 . VAL B 30 ? 0.3314 0.6770 0.4505 -0.0309 0.0216  -0.0041 30 VAL B CG1 
924  C CG2 . VAL B 30 ? 0.3747 0.6327 0.3875 -0.1166 0.0248  0.0230  30 VAL B CG2 
925  N N   . ARG B 31 ? 0.4492 0.7415 0.5270 0.0486  0.0622  -0.0508 31 ARG B N   
926  C CA  . ARG B 31 ? 0.4942 0.7567 0.5853 0.1071  0.0656  -0.0635 31 ARG B CA  
927  C C   . ARG B 31 ? 0.5279 0.6836 0.5703 0.1081  0.0608  -0.0644 31 ARG B C   
928  O O   . ARG B 31 ? 0.5613 0.6973 0.5651 0.0895  0.0765  -0.0790 31 ARG B O   
929  C CB  . ARG B 31 ? 0.5215 0.8068 0.6588 0.1419  0.0465  -0.0516 31 ARG B CB  
930  C CG  . ARG B 31 ? 0.5617 0.9721 0.7553 0.1576  0.0563  -0.0640 31 ARG B CG  
931  C CD  . ARG B 31 ? 0.5788 1.0515 0.7941 0.1037  0.0462  -0.0526 31 ARG B CD  
932  N NE  . ARG B 31 ? 0.5705 1.1552 0.8483 0.1279  0.0445  -0.0632 31 ARG B NE  
933  C CZ  . ARG B 31 ? 0.5049 1.1577 0.8137 0.0889  0.0373  -0.0600 31 ARG B CZ  
934  N NH1 . ARG B 31 ? 0.4535 1.0618 0.7321 0.0245  0.0322  -0.0426 31 ARG B NH1 
935  N NH2 . ARG B 31 ? 0.4904 1.2572 0.8582 0.1165  0.0360  -0.0761 31 ARG B NH2 
936  N N   . HIS B 32 ? 0.5006 0.5938 0.5439 0.1267  0.0407  -0.0522 32 HIS B N   
937  C CA  . HIS B 32 ? 0.5517 0.5516 0.5516 0.1208  0.0373  -0.0579 32 HIS B CA  
938  C C   . HIS B 32 ? 0.5113 0.4748 0.4987 0.0896  0.0046  -0.0370 32 HIS B C   
939  O O   . HIS B 32 ? 0.5314 0.4274 0.4986 0.0915  -0.0041 -0.0403 32 HIS B O   
940  C CB  . HIS B 32 ? 0.6841 0.6242 0.6825 0.1689  0.0502  -0.0691 32 HIS B CB  
941  C CG  . HIS B 32 ? 0.8280 0.7626 0.8127 0.1955  0.0858  -0.0980 32 HIS B CG  
942  N ND1 . HIS B 32 ? 0.8790 0.8721 0.8948 0.2393  0.1029  -0.1061 32 HIS B ND1 
943  C CD2 . HIS B 32 ? 0.9143 0.7964 0.8582 0.1855  0.1081  -0.1243 32 HIS B CD2 
944  C CE1 . HIS B 32 ? 0.9682 0.9383 0.9617 0.2572  0.1344  -0.1345 32 HIS B CE1 
945  N NE2 . HIS B 32 ? 0.9900 0.8908 0.9394 0.2228  0.1391  -0.1463 32 HIS B NE2 
946  N N   . GLY B 33 ? 0.3710 0.3652 0.3205 -0.0711 0.0002  0.0036  33 GLY B N   
947  C CA  . GLY B 33 ? 0.3830 0.3957 0.3467 -0.0684 -0.0107 0.0090  33 GLY B CA  
948  C C   . GLY B 33 ? 0.3300 0.3562 0.3189 -0.0598 -0.0097 0.0098  33 GLY B C   
949  O O   . GLY B 33 ? 0.3069 0.3471 0.3091 -0.0564 -0.0164 0.0143  33 GLY B O   
950  N N   . GLY B 34 ? 0.3033 0.3248 0.2983 -0.0563 -0.0012 0.0058  34 GLY B N   
951  C CA  . GLY B 34 ? 0.2656 0.2979 0.2811 -0.0490 -0.0006 0.0060  34 GLY B CA  
952  C C   . GLY B 34 ? 0.2369 0.2741 0.2629 -0.0428 -0.0002 0.0089  34 GLY B C   
953  O O   . GLY B 34 ? 0.2662 0.2968 0.2846 -0.0431 0.0020  0.0103  34 GLY B O   
954  N N   . ILE B 35 ? 0.2153 0.2620 0.2571 -0.0377 -0.0014 0.0094  35 ILE B N   
955  C CA  . ILE B 35 ? 0.1861 0.2365 0.2377 -0.0328 -0.0005 0.0112  35 ILE B CA  
956  C C   . ILE B 35 ? 0.2136 0.2621 0.2723 -0.0298 0.0055  0.0077  35 ILE B C   
957  O O   . ILE B 35 ? 0.2263 0.2780 0.2911 -0.0279 0.0056  0.0055  35 ILE B O   
958  C CB  . ILE B 35 ? 0.1876 0.2481 0.2506 -0.0297 -0.0051 0.0139  35 ILE B CB  
959  C CG1 . ILE B 35 ? 0.2475 0.3136 0.3076 -0.0324 -0.0118 0.0183  35 ILE B CG1 
960  C CG2 . ILE B 35 ? 0.1962 0.2576 0.2674 -0.0251 -0.0030 0.0153  35 ILE B CG2 
961  C CD1 . ILE B 35 ? 0.2681 0.3311 0.3189 -0.0336 -0.0141 0.0227  35 ILE B CD1 
962  N N   . TYR B 36 ? 0.1958 0.2397 0.2544 -0.0293 0.0102  0.0075  36 TYR B N   
963  C CA  . TYR B 36 ? 0.1923 0.2370 0.2602 -0.0271 0.0154  0.0047  36 TYR B CA  
964  C C   . TYR B 36 ? 0.2026 0.2507 0.2800 -0.0256 0.0161  0.0049  36 TYR B C   
965  O O   . TYR B 36 ? 0.2202 0.2653 0.2939 -0.0261 0.0160  0.0073  36 TYR B O   
966  C CB  . TYR B 36 ? 0.2150 0.2502 0.2756 -0.0289 0.0230  0.0036  36 TYR B CB  
967  C CG  . TYR B 36 ? 0.2399 0.2685 0.2892 -0.0311 0.0242  0.0024  36 TYR B CG  
968  C CD1 . TYR B 36 ? 0.2416 0.2635 0.2745 -0.0360 0.0212  0.0034  36 TYR B CD1 
969  C CD2 . TYR B 36 ? 0.2535 0.2820 0.3076 -0.0287 0.0283  0.0006  36 TYR B CD2 
970  C CE1 . TYR B 36 ? 0.2687 0.2828 0.2895 -0.0397 0.0227  0.0015  36 TYR B CE1 
971  C CE2 . TYR B 36 ? 0.2768 0.2963 0.3189 -0.0310 0.0310  -0.0007 36 TYR B CE2 
972  C CZ  . TYR B 36 ? 0.3110 0.3229 0.3361 -0.0372 0.0285  -0.0008 36 TYR B CZ  
973  O OH  . TYR B 36 ? 0.3642 0.3657 0.3759 -0.0412 0.0316  -0.0029 36 TYR B OH  
974  N N   . VAL B 37 ? 0.1728 0.2269 0.2623 -0.0240 0.0169  0.0025  37 VAL B N   
975  C CA  . VAL B 37 ? 0.1829 0.2395 0.2809 -0.0244 0.0181  0.0017  37 VAL B CA  
976  C C   . VAL B 37 ? 0.1868 0.2380 0.2851 -0.0264 0.0254  0.0016  37 VAL B C   
977  O O   . VAL B 37 ? 0.2155 0.2672 0.3182 -0.0262 0.0300  0.0005  37 VAL B O   
978  C CB  . VAL B 37 ? 0.1813 0.2468 0.2913 -0.0233 0.0154  -0.0009 37 VAL B CB  
979  C CG1 . VAL B 37 ? 0.1890 0.2566 0.3070 -0.0258 0.0164  -0.0027 37 VAL B CG1 
980  C CG2 . VAL B 37 ? 0.1942 0.2622 0.3015 -0.0212 0.0095  -0.0007 37 VAL B CG2 
981  N N   . LYS B 38 ? 0.1890 0.2339 0.2823 -0.0277 0.0276  0.0031  38 LYS B N   
982  C CA  . LYS B 38 ? 0.2156 0.2531 0.3076 -0.0298 0.0358  0.0032  38 LYS B CA  
983  C C   . LYS B 38 ? 0.2462 0.2897 0.3542 -0.0318 0.0389  0.0001  38 LYS B C   
984  O O   . LYS B 38 ? 0.2715 0.3153 0.3872 -0.0333 0.0457  -0.0011 38 LYS B O   
985  C CB  . LYS B 38 ? 0.2458 0.2731 0.3247 -0.0299 0.0368  0.0068  38 LYS B CB  
986  C CG  . LYS B 38 ? 0.3058 0.3223 0.3801 -0.0320 0.0462  0.0073  38 LYS B CG  
987  C CD  . LYS B 38 ? 0.3249 0.3303 0.3824 -0.0309 0.0459  0.0123  38 LYS B CD  
988  C CE  . LYS B 38 ? 0.4259 0.4175 0.4752 -0.0328 0.0562  0.0132  38 LYS B CE  
989  N NZ  . LYS B 38 ? 0.5267 0.5070 0.5581 -0.0309 0.0553  0.0192  38 LYS B NZ  
990  N N   . ALA B 39 ? 0.2289 0.2770 0.3420 -0.0323 0.0344  -0.0012 39 ALA B N   
991  C CA  . ALA B 39 ? 0.2466 0.3003 0.3731 -0.0360 0.0357  -0.0047 39 ALA B CA  
992  C C   . ALA B 39 ? 0.2161 0.2756 0.3450 -0.0361 0.0282  -0.0066 39 ALA B C   
993  O O   . ALA B 39 ? 0.2238 0.2787 0.3431 -0.0336 0.0251  -0.0048 39 ALA B O   
994  C CB  . ALA B 39 ? 0.2481 0.2914 0.3715 -0.0393 0.0433  -0.0047 39 ALA B CB  
995  N N   . VAL B 40 ? 0.2321 0.3016 0.3739 -0.0393 0.0256  -0.0101 40 VAL B N   
996  C CA  . VAL B 40 ? 0.2121 0.2846 0.3546 -0.0418 0.0197  -0.0130 40 VAL B CA  
997  C C   . VAL B 40 ? 0.2213 0.2879 0.3657 -0.0485 0.0245  -0.0162 40 VAL B C   
998  O O   . VAL B 40 ? 0.2731 0.3454 0.4297 -0.0532 0.0277  -0.0182 40 VAL B O   
999  C CB  . VAL B 40 ? 0.2553 0.3426 0.4091 -0.0418 0.0125  -0.0145 40 VAL B CB  
1000 C CG1 . VAL B 40 ? 0.2599 0.3485 0.4111 -0.0454 0.0060  -0.0179 40 VAL B CG1 
1001 C CG2 . VAL B 40 ? 0.2639 0.3531 0.4133 -0.0349 0.0099  -0.0112 40 VAL B CG2 
1002 N N   . ILE B 41 ? 0.1923 0.2468 0.3251 -0.0487 0.0264  -0.0162 41 ILE B N   
1003 C CA  . ILE B 41 ? 0.2040 0.2481 0.3351 -0.0545 0.0336  -0.0186 41 ILE B CA  
1004 C C   . ILE B 41 ? 0.2453 0.2955 0.3845 -0.0634 0.0303  -0.0249 41 ILE B C   
1005 O O   . ILE B 41 ? 0.2603 0.3136 0.3962 -0.0645 0.0231  -0.0272 41 ILE B O   
1006 C CB  . ILE B 41 ? 0.2520 0.2803 0.3684 -0.0513 0.0376  -0.0161 41 ILE B CB  
1007 C CG1 . ILE B 41 ? 0.2897 0.3144 0.3991 -0.0433 0.0390  -0.0093 41 ILE B CG1 
1008 C CG2 . ILE B 41 ? 0.2965 0.3109 0.4094 -0.0572 0.0467  -0.0186 41 ILE B CG2 
1009 C CD1 . ILE B 41 ? 0.3542 0.3769 0.4648 -0.0433 0.0446  -0.0070 41 ILE B CD1 
1010 N N   . PRO B 42 ? 0.2279 0.2794 0.3770 -0.0704 0.0357  -0.0278 42 PRO B N   
1011 C CA  . PRO B 42 ? 0.2454 0.3050 0.4031 -0.0804 0.0309  -0.0340 42 PRO B CA  
1012 C C   . PRO B 42 ? 0.3086 0.3543 0.4505 -0.0846 0.0300  -0.0377 42 PRO B C   
1013 O O   . PRO B 42 ? 0.2956 0.3224 0.4237 -0.0823 0.0385  -0.0363 42 PRO B O   
1014 C CB  . PRO B 42 ? 0.2802 0.3389 0.4490 -0.0878 0.0399  -0.0363 42 PRO B CB  
1015 C CG  . PRO B 42 ? 0.3052 0.3626 0.4762 -0.0803 0.0466  -0.0308 42 PRO B CG  
1016 C CD  . PRO B 42 ? 0.2698 0.3164 0.4229 -0.0706 0.0457  -0.0258 42 PRO B CD  
1017 N N   . GLN B 43 ? 0.2915 0.3457 0.4345 -0.0900 0.0202  -0.0419 43 GLN B N   
1018 C CA  . GLN B 43 ? 0.3278 0.3678 0.4541 -0.0957 0.0194  -0.0466 43 GLN B CA  
1019 C C   . GLN B 43 ? 0.3381 0.3663 0.4476 -0.0862 0.0197  -0.0428 43 GLN B C   
1020 O O   . GLN B 43 ? 0.3868 0.4001 0.4802 -0.0890 0.0211  -0.0458 43 GLN B O   
1021 C CB  . GLN B 43 ? 0.4319 0.4543 0.5523 -0.1047 0.0306  -0.0509 43 GLN B CB  
1022 C CG  . GLN B 43 ? 0.5024 0.5369 0.6418 -0.1144 0.0319  -0.0544 43 GLN B CG  
1023 C CD  . GLN B 43 ? 0.5976 0.6130 0.7315 -0.1229 0.0452  -0.0582 43 GLN B CD  
1024 O OE1 . GLN B 43 ? 0.6211 0.6411 0.7689 -0.1267 0.0516  -0.0585 43 GLN B OE1 
1025 N NE2 . GLN B 43 ? 0.6041 0.5966 0.7172 -0.1258 0.0508  -0.0612 43 GLN B NE2 
1026 N N   . GLY B 44 ? 0.2885 0.3230 0.4016 -0.0755 0.0190  -0.0365 44 GLY B N   
1027 C CA  . GLY B 44 ? 0.2533 0.2792 0.3541 -0.0668 0.0196  -0.0325 44 GLY B CA  
1028 C C   . GLY B 44 ? 0.2450 0.2793 0.3433 -0.0643 0.0096  -0.0326 44 GLY B C   
1029 O O   . GLY B 44 ? 0.2503 0.2986 0.3565 -0.0681 0.0010  -0.0350 44 GLY B O   
1030 N N   . ALA B 45 ? 0.2287 0.2549 0.3167 -0.0572 0.0111  -0.0294 45 ALA B N   
1031 C CA  . ALA B 45 ? 0.2495 0.2794 0.3317 -0.0545 0.0037  -0.0294 45 ALA B CA  
1032 C C   . ALA B 45 ? 0.2603 0.3087 0.3544 -0.0506 -0.0042 -0.0269 45 ALA B C   
1033 O O   . ALA B 45 ? 0.2419 0.2985 0.3363 -0.0524 -0.0126 -0.0286 45 ALA B O   
1034 C CB  . ALA B 45 ? 0.2524 0.2706 0.3244 -0.0474 0.0088  -0.0258 45 ALA B CB  
1035 N N   . ALA B 46 ? 0.2020 0.2557 0.3043 -0.0451 -0.0012 -0.0225 46 ALA B N   
1036 C CA  . ALA B 46 ? 0.1857 0.2535 0.2975 -0.0409 -0.0061 -0.0199 46 ALA B CA  
1037 C C   . ALA B 46 ? 0.2074 0.2887 0.3322 -0.0459 -0.0110 -0.0223 46 ALA B C   
1038 O O   . ALA B 46 ? 0.2287 0.3212 0.3590 -0.0435 -0.0176 -0.0211 46 ALA B O   
1039 C CB  . ALA B 46 ? 0.1877 0.2557 0.3032 -0.0360 -0.0008 -0.0155 46 ALA B CB  
1040 N N   . GLU B 47 ? 0.1919 0.2726 0.3228 -0.0525 -0.0074 -0.0251 47 GLU B N   
1041 C CA  . GLU B 47 ? 0.2304 0.3263 0.3774 -0.0580 -0.0116 -0.0271 47 GLU B CA  
1042 C C   . GLU B 47 ? 0.2324 0.3344 0.3767 -0.0630 -0.0220 -0.0304 47 GLU B C   
1043 O O   . GLU B 47 ? 0.2589 0.3779 0.4156 -0.0625 -0.0299 -0.0291 47 GLU B O   
1044 C CB  . GLU B 47 ? 0.2847 0.3773 0.4384 -0.0653 -0.0043 -0.0299 47 GLU B CB  
1045 C CG  . GLU B 47 ? 0.3079 0.4188 0.4829 -0.0709 -0.0076 -0.0314 47 GLU B CG  
1046 C CD  . GLU B 47 ? 0.3702 0.4765 0.5511 -0.0800 0.0000  -0.0352 47 GLU B CD  
1047 O OE1 . GLU B 47 ? 0.4078 0.5049 0.5796 -0.0884 -0.0003 -0.0403 47 GLU B OE1 
1048 O OE2 . GLU B 47 ? 0.4253 0.5355 0.6188 -0.0791 0.0073  -0.0332 47 GLU B OE2 
1049 N N   . SER B 48 ? 0.2297 0.3169 0.3570 -0.0678 -0.0217 -0.0343 48 SER B N   
1050 C CA  . SER B 48 ? 0.2593 0.3478 0.3783 -0.0740 -0.0313 -0.0381 48 SER B CA  
1051 C C   . SER B 48 ? 0.2346 0.3301 0.3501 -0.0665 -0.0396 -0.0343 48 SER B C   
1052 O O   . SER B 48 ? 0.2715 0.3789 0.3895 -0.0693 -0.0506 -0.0348 48 SER B O   
1053 C CB  . SER B 48 ? 0.2926 0.3582 0.3892 -0.0788 -0.0264 -0.0424 48 SER B CB  
1054 O OG  . SER B 48 ? 0.3716 0.4292 0.4695 -0.0874 -0.0193 -0.0467 48 SER B OG  
1055 N N   . ASP B 49 ? 0.2199 0.3075 0.3286 -0.0572 -0.0344 -0.0304 49 ASP B N   
1056 C CA  . ASP B 49 ? 0.2181 0.3083 0.3210 -0.0498 -0.0398 -0.0268 49 ASP B CA  
1057 C C   . ASP B 49 ? 0.2457 0.3556 0.3670 -0.0450 -0.0447 -0.0226 49 ASP B C   
1058 O O   . ASP B 49 ? 0.2832 0.4004 0.4033 -0.0417 -0.0528 -0.0202 49 ASP B O   
1059 C CB  . ASP B 49 ? 0.2286 0.3058 0.3215 -0.0425 -0.0321 -0.0241 49 ASP B CB  
1060 C CG  . ASP B 49 ? 0.2653 0.3450 0.3544 -0.0348 -0.0355 -0.0202 49 ASP B CG  
1061 O OD1 . ASP B 49 ? 0.2349 0.3222 0.3343 -0.0290 -0.0335 -0.0164 49 ASP B OD1 
1062 O OD2 . ASP B 49 ? 0.2930 0.3647 0.3670 -0.0348 -0.0392 -0.0212 49 ASP B OD2 
1063 N N   . GLY B 50 ? 0.2278 0.3447 0.3651 -0.0441 -0.0388 -0.0210 50 GLY B N   
1064 C CA  . GLY B 50 ? 0.2236 0.3588 0.3810 -0.0407 -0.0413 -0.0174 50 GLY B CA  
1065 C C   . GLY B 50 ? 0.2169 0.3528 0.3754 -0.0304 -0.0383 -0.0120 50 GLY B C   
1066 O O   . GLY B 50 ? 0.2541 0.4028 0.4289 -0.0265 -0.0380 -0.0084 50 GLY B O   
1067 N N   . ARG B 51 ? 0.1770 0.2989 0.3191 -0.0262 -0.0351 -0.0113 51 ARG B N   
1068 C CA  . ARG B 51 ? 0.1723 0.2927 0.3131 -0.0177 -0.0317 -0.0069 51 ARG B CA  
1069 C C   . ARG B 51 ? 0.1930 0.3078 0.3359 -0.0158 -0.0221 -0.0058 51 ARG B C   
1070 O O   . ARG B 51 ? 0.2105 0.3258 0.3557 -0.0104 -0.0185 -0.0026 51 ARG B O   
1071 C CB  . ARG B 51 ? 0.1803 0.2891 0.3029 -0.0145 -0.0333 -0.0066 51 ARG B CB  
1072 C CG  . ARG B 51 ? 0.1813 0.2948 0.2992 -0.0133 -0.0429 -0.0057 51 ARG B CG  
1073 C CD  . ARG B 51 ? 0.2078 0.3067 0.3055 -0.0107 -0.0427 -0.0057 51 ARG B CD  
1074 N NE  . ARG B 51 ? 0.1903 0.2774 0.2755 -0.0168 -0.0415 -0.0102 51 ARG B NE  
1075 C CZ  . ARG B 51 ? 0.2057 0.2786 0.2734 -0.0157 -0.0398 -0.0109 51 ARG B CZ  
1076 N NH1 . ARG B 51 ? 0.2254 0.2944 0.2859 -0.0093 -0.0395 -0.0076 51 ARG B NH1 
1077 N NH2 . ARG B 51 ? 0.2098 0.2709 0.2670 -0.0206 -0.0369 -0.0146 51 ARG B NH2 
1078 N N   . ILE B 52 ? 0.1507 0.2589 0.2910 -0.0204 -0.0177 -0.0082 52 ILE B N   
1079 C CA  . ILE B 52 ? 0.1398 0.2411 0.2779 -0.0193 -0.0099 -0.0069 52 ILE B CA  
1080 C C   . ILE B 52 ? 0.1411 0.2472 0.2914 -0.0222 -0.0052 -0.0073 52 ILE B C   
1081 O O   . ILE B 52 ? 0.1805 0.2910 0.3377 -0.0275 -0.0068 -0.0098 52 ILE B O   
1082 C CB  . ILE B 52 ? 0.1730 0.2630 0.2992 -0.0211 -0.0078 -0.0079 52 ILE B CB  
1083 C CG1 . ILE B 52 ? 0.1893 0.2740 0.3047 -0.0179 -0.0103 -0.0071 52 ILE B CG1 
1084 C CG2 . ILE B 52 ? 0.1576 0.2420 0.2816 -0.0210 -0.0015 -0.0062 52 ILE B CG2 
1085 C CD1 . ILE B 52 ? 0.2351 0.3104 0.3415 -0.0192 -0.0085 -0.0077 52 ILE B CD1 
1086 N N   . HIS B 53 ? 0.1608 0.2651 0.3131 -0.0195 0.0010  -0.0051 53 HIS B N   
1087 C CA  . HIS B 53 ? 0.1733 0.2797 0.3359 -0.0218 0.0076  -0.0051 53 HIS B CA  
1088 C C   . HIS B 53 ? 0.1584 0.2525 0.3106 -0.0216 0.0154  -0.0040 53 HIS B C   
1089 O O   . HIS B 53 ? 0.1728 0.2595 0.3127 -0.0192 0.0155  -0.0028 53 HIS B O   
1090 C CB  . HIS B 53 ? 0.1892 0.3081 0.3689 -0.0187 0.0085  -0.0030 53 HIS B CB  
1091 C CG  . HIS B 53 ? 0.2239 0.3572 0.4146 -0.0195 -0.0009 -0.0034 53 HIS B CG  
1092 N ND1 . HIS B 53 ? 0.2841 0.4199 0.4695 -0.0152 -0.0082 -0.0019 53 HIS B ND1 
1093 C CD2 . HIS B 53 ? 0.2655 0.4102 0.4698 -0.0251 -0.0049 -0.0055 53 HIS B CD2 
1094 C CE1 . HIS B 53 ? 0.2721 0.4205 0.4665 -0.0177 -0.0169 -0.0026 53 HIS B CE1 
1095 N NE2 . HIS B 53 ? 0.2721 0.4268 0.4787 -0.0242 -0.0155 -0.0050 53 HIS B NE2 
1096 N N   . LYS B 54 ? 0.1914 0.2834 0.3484 -0.0247 0.0220  -0.0045 54 LYS B N   
1097 C CA  . LYS B 54 ? 0.1956 0.2749 0.3412 -0.0249 0.0297  -0.0032 54 LYS B CA  
1098 C C   . LYS B 54 ? 0.2013 0.2769 0.3416 -0.0209 0.0326  -0.0014 54 LYS B C   
1099 O O   . LYS B 54 ? 0.2265 0.3097 0.3787 -0.0176 0.0343  -0.0004 54 LYS B O   
1100 C CB  . LYS B 54 ? 0.2357 0.3140 0.3902 -0.0279 0.0382  -0.0037 54 LYS B CB  
1101 C CG  . LYS B 54 ? 0.2732 0.3367 0.4140 -0.0281 0.0471  -0.0022 54 LYS B CG  
1102 C CD  . LYS B 54 ? 0.3497 0.4094 0.4968 -0.0316 0.0563  -0.0027 54 LYS B CD  
1103 C CE  . LYS B 54 ? 0.4306 0.4719 0.5587 -0.0321 0.0650  -0.0011 54 LYS B CE  
1104 N NZ  . LYS B 54 ? 0.4998 0.5359 0.6344 -0.0348 0.0766  -0.0014 54 LYS B NZ  
1105 N N   . GLY B 55 ? 0.1941 0.2581 0.3166 -0.0213 0.0334  -0.0007 55 GLY B N   
1106 C CA  . GLY B 55 ? 0.2348 0.2918 0.3486 -0.0193 0.0372  0.0001  55 GLY B CA  
1107 C C   . GLY B 55 ? 0.2361 0.2947 0.3448 -0.0171 0.0310  0.0003  55 GLY B C   
1108 O O   . GLY B 55 ? 0.2432 0.2932 0.3408 -0.0168 0.0341  0.0005  55 GLY B O   
1109 N N   . ASP B 56 ? 0.2127 0.2806 0.3282 -0.0160 0.0233  -0.0002 56 ASP B N   
1110 C CA  . ASP B 56 ? 0.1742 0.2420 0.2837 -0.0141 0.0183  0.0000  56 ASP B CA  
1111 C C   . ASP B 56 ? 0.1919 0.2522 0.2875 -0.0173 0.0168  0.0001  56 ASP B C   
1112 O O   . ASP B 56 ? 0.2346 0.2930 0.3272 -0.0201 0.0162  0.0005  56 ASP B O   
1113 C CB  . ASP B 56 ? 0.1687 0.2454 0.2855 -0.0130 0.0111  -0.0006 56 ASP B CB  
1114 C CG  . ASP B 56 ? 0.1993 0.2859 0.3295 -0.0099 0.0098  -0.0001 56 ASP B CG  
1115 O OD1 . ASP B 56 ? 0.1937 0.2872 0.3288 -0.0105 0.0034  -0.0011 56 ASP B OD1 
1116 O OD2 . ASP B 56 ? 0.2304 0.3177 0.3660 -0.0069 0.0150  0.0015  56 ASP B OD2 
1117 N N   . ARG B 57 ? 0.1981 0.2545 0.2859 -0.0170 0.0160  0.0002  57 ARG B N   
1118 C CA  . ARG B 57 ? 0.2107 0.2630 0.2879 -0.0208 0.0134  0.0006  57 ARG B CA  
1119 C C   . ARG B 57 ? 0.2057 0.2638 0.2864 -0.0196 0.0077  0.0011  57 ARG B C   
1120 O O   . ARG B 57 ? 0.2026 0.2626 0.2863 -0.0166 0.0069  0.0005  57 ARG B O   
1121 C CB  . ARG B 57 ? 0.2336 0.2772 0.2995 -0.0231 0.0169  -0.0002 57 ARG B CB  
1122 C CG  . ARG B 57 ? 0.2581 0.2995 0.3141 -0.0286 0.0131  0.0003  57 ARG B CG  
1123 C CD  . ARG B 57 ? 0.3225 0.3533 0.3649 -0.0331 0.0169  -0.0015 57 ARG B CD  
1124 N NE  . ARG B 57 ? 0.3164 0.3489 0.3521 -0.0392 0.0110  -0.0008 57 ARG B NE  
1125 C CZ  . ARG B 57 ? 0.3975 0.4212 0.4185 -0.0463 0.0120  -0.0025 57 ARG B CZ  
1126 N NH1 . ARG B 57 ? 0.4504 0.4600 0.4600 -0.0477 0.0203  -0.0050 57 ARG B NH1 
1127 N NH2 . ARG B 57 ? 0.4264 0.4552 0.4442 -0.0522 0.0049  -0.0014 57 ARG B NH2 
1128 N N   . VAL B 58 ? 0.1575 0.2176 0.2374 -0.0214 0.0044  0.0027  58 VAL B N   
1129 C CA  . VAL B 58 ? 0.1371 0.2012 0.2206 -0.0199 0.0010  0.0036  58 VAL B CA  
1130 C C   . VAL B 58 ? 0.1759 0.2397 0.2547 -0.0226 -0.0004 0.0044  58 VAL B C   
1131 O O   . VAL B 58 ? 0.1884 0.2530 0.2636 -0.0261 -0.0024 0.0064  58 VAL B O   
1132 C CB  . VAL B 58 ? 0.1420 0.2085 0.2292 -0.0195 -0.0005 0.0058  58 VAL B CB  
1133 C CG1 . VAL B 58 ? 0.1598 0.2285 0.2508 -0.0173 -0.0019 0.0068  58 VAL B CG1 
1134 C CG2 . VAL B 58 ? 0.2246 0.2903 0.3157 -0.0188 0.0015  0.0044  58 VAL B CG2 
1135 N N   . LEU B 59 ? 0.1625 0.2251 0.2411 -0.0214 0.0006  0.0032  59 LEU B N   
1136 C CA  . LEU B 59 ? 0.1727 0.2343 0.2473 -0.0250 0.0005  0.0032  59 LEU B CA  
1137 C C   . LEU B 59 ? 0.1554 0.2234 0.2369 -0.0249 -0.0020 0.0055  59 LEU B C   
1138 O O   . LEU B 59 ? 0.1669 0.2385 0.2488 -0.0294 -0.0039 0.0068  59 LEU B O   
1139 C CB  . LEU B 59 ? 0.1985 0.2535 0.2686 -0.0237 0.0045  0.0009  59 LEU B CB  
1140 C CG  . LEU B 59 ? 0.2322 0.2803 0.2967 -0.0228 0.0088  -0.0005 59 LEU B CG  
1141 C CD1 . LEU B 59 ? 0.2484 0.2904 0.3101 -0.0192 0.0129  -0.0013 59 LEU B CD1 
1142 C CD2 . LEU B 59 ? 0.2766 0.3191 0.3319 -0.0290 0.0104  -0.0014 59 LEU B CD2 
1143 N N   . ALA B 60 ? 0.1544 0.2234 0.2413 -0.0203 -0.0015 0.0061  60 ALA B N   
1144 C CA  . ALA B 60 ? 0.1363 0.2094 0.2300 -0.0193 -0.0014 0.0086  60 ALA B CA  
1145 C C   . ALA B 60 ? 0.1403 0.2120 0.2373 -0.0149 -0.0002 0.0094  60 ALA B C   
1146 O O   . ALA B 60 ? 0.1527 0.2203 0.2460 -0.0133 0.0001  0.0069  60 ALA B O   
1147 C CB  . ALA B 60 ? 0.1501 0.2201 0.2426 -0.0196 0.0017  0.0073  60 ALA B CB  
1148 N N   . VAL B 61 ? 0.1487 0.2238 0.2528 -0.0133 0.0010  0.0128  61 VAL B N   
1149 C CA  . VAL B 61 ? 0.1443 0.2151 0.2499 -0.0095 0.0040  0.0136  61 VAL B CA  
1150 C C   . VAL B 61 ? 0.1597 0.2293 0.2697 -0.0073 0.0086  0.0153  61 VAL B C   
1151 O O   . VAL B 61 ? 0.1578 0.2355 0.2773 -0.0079 0.0086  0.0192  61 VAL B O   
1152 C CB  . VAL B 61 ? 0.1510 0.2258 0.2618 -0.0085 0.0032  0.0178  61 VAL B CB  
1153 C CG1 . VAL B 61 ? 0.1753 0.2427 0.2864 -0.0048 0.0084  0.0184  61 VAL B CG1 
1154 C CG2 . VAL B 61 ? 0.1806 0.2552 0.2863 -0.0109 0.0001  0.0162  61 VAL B CG2 
1155 N N   . ASN B 62 ? 0.1479 0.2072 0.2507 -0.0053 0.0125  0.0125  62 ASN B N   
1156 C CA  . ASN B 62 ? 0.1605 0.2147 0.2647 -0.0029 0.0189  0.0137  62 ASN B CA  
1157 C C   . ASN B 62 ? 0.1717 0.2323 0.2824 -0.0048 0.0195  0.0151  62 ASN B C   
1158 O O   . ASN B 62 ? 0.1785 0.2434 0.3000 -0.0037 0.0239  0.0188  62 ASN B O   
1159 C CB  . ASN B 62 ? 0.1793 0.2324 0.2908 0.0005  0.0242  0.0178  62 ASN B CB  
1160 C CG  . ASN B 62 ? 0.2140 0.2554 0.3155 0.0015  0.0263  0.0151  62 ASN B CG  
1161 O OD1 . ASN B 62 ? 0.2125 0.2466 0.3018 -0.0004 0.0241  0.0101  62 ASN B OD1 
1162 N ND2 . ASN B 62 ? 0.2175 0.2569 0.3241 0.0043  0.0309  0.0187  62 ASN B ND2 
1163 N N   . GLY B 63 ? 0.1586 0.2198 0.2636 -0.0079 0.0158  0.0122  63 GLY B N   
1164 C CA  . GLY B 63 ? 0.1776 0.2407 0.2849 -0.0108 0.0177  0.0121  63 GLY B CA  
1165 C C   . GLY B 63 ? 0.1705 0.2467 0.2881 -0.0158 0.0136  0.0145  63 GLY B C   
1166 O O   . GLY B 63 ? 0.1750 0.2529 0.2949 -0.0198 0.0153  0.0139  63 GLY B O   
1167 N N   . VAL B 64 ? 0.1421 0.2264 0.2645 -0.0162 0.0085  0.0171  64 VAL B N   
1168 C CA  . VAL B 64 ? 0.1210 0.2180 0.2513 -0.0212 0.0028  0.0200  64 VAL B CA  
1169 C C   . VAL B 64 ? 0.1586 0.2537 0.2785 -0.0243 -0.0024 0.0177  64 VAL B C   
1170 O O   . VAL B 64 ? 0.1343 0.2259 0.2500 -0.0211 -0.0031 0.0177  64 VAL B O   
1171 C CB  . VAL B 64 ? 0.1734 0.2815 0.3183 -0.0180 0.0016  0.0268  64 VAL B CB  
1172 C CG1 . VAL B 64 ? 0.1680 0.2912 0.3208 -0.0236 -0.0063 0.0307  64 VAL B CG1 
1173 C CG2 . VAL B 64 ? 0.2099 0.3181 0.3659 -0.0141 0.0093  0.0293  64 VAL B CG2 
1174 N N   . SER B 65 ? 0.1486 0.2449 0.2639 -0.0311 -0.0049 0.0157  65 SER B N   
1175 C CA  . SER B 65 ? 0.1639 0.2566 0.2678 -0.0348 -0.0084 0.0136  65 SER B CA  
1176 C C   . SER B 65 ? 0.1519 0.2517 0.2581 -0.0347 -0.0140 0.0179  65 SER B C   
1177 O O   . SER B 65 ? 0.1585 0.2699 0.2758 -0.0348 -0.0177 0.0231  65 SER B O   
1178 C CB  . SER B 65 ? 0.1750 0.2669 0.2728 -0.0436 -0.0097 0.0111  65 SER B CB  
1179 O OG  . SER B 65 ? 0.2351 0.3207 0.3194 -0.0478 -0.0117 0.0089  65 SER B OG  
1180 N N   . LEU B 66 ? 0.1411 0.2337 0.2369 -0.0344 -0.0142 0.0161  66 LEU B N   
1181 C CA  . LEU B 66 ? 0.1806 0.2761 0.2736 -0.0351 -0.0188 0.0196  66 LEU B CA  
1182 C C   . LEU B 66 ? 0.2290 0.3248 0.3116 -0.0436 -0.0239 0.0192  66 LEU B C   
1183 O O   . LEU B 66 ? 0.2605 0.3554 0.3357 -0.0450 -0.0274 0.0216  66 LEU B O   
1184 C CB  . LEU B 66 ? 0.2141 0.3005 0.3004 -0.0315 -0.0154 0.0177  66 LEU B CB  
1185 C CG  . LEU B 66 ? 0.1995 0.2854 0.2941 -0.0246 -0.0118 0.0183  66 LEU B CG  
1186 C CD1 . LEU B 66 ? 0.1867 0.2658 0.2764 -0.0228 -0.0093 0.0167  66 LEU B CD1 
1187 C CD2 . LEU B 66 ? 0.3002 0.3944 0.4053 -0.0215 -0.0136 0.0246  66 LEU B CD2 
1188 N N   . GLU B 67 ? 0.2400 0.3353 0.3201 -0.0499 -0.0238 0.0161  67 GLU B N   
1189 C CA  . GLU B 67 ? 0.2732 0.3662 0.3402 -0.0597 -0.0282 0.0146  67 GLU B CA  
1190 C C   . GLU B 67 ? 0.2777 0.3843 0.3493 -0.0628 -0.0381 0.0208  67 GLU B C   
1191 O O   . GLU B 67 ? 0.2774 0.3993 0.3667 -0.0605 -0.0417 0.0259  67 GLU B O   
1192 C CB  . GLU B 67 ? 0.2965 0.3859 0.3602 -0.0669 -0.0257 0.0099  67 GLU B CB  
1193 C CG  . GLU B 67 ? 0.3410 0.4305 0.3927 -0.0790 -0.0319 0.0088  67 GLU B CG  
1194 C CD  . GLU B 67 ? 0.4098 0.4923 0.4554 -0.0874 -0.0279 0.0032  67 GLU B CD  
1195 O OE1 . GLU B 67 ? 0.4585 0.5458 0.5000 -0.0988 -0.0341 0.0025  67 GLU B OE1 
1196 O OE2 . GLU B 67 ? 0.3685 0.4400 0.4125 -0.0830 -0.0186 -0.0004 67 GLU B OE2 
1197 N N   . GLY B 68 ? 0.2710 0.3718 0.3264 -0.0673 -0.0421 0.0212  68 GLY B N   
1198 C CA  . GLY B 68 ? 0.3011 0.4142 0.3580 -0.0700 -0.0527 0.0280  68 GLY B CA  
1199 C C   . GLY B 68 ? 0.2844 0.4021 0.3489 -0.0601 -0.0537 0.0350  68 GLY B C   
1200 O O   . GLY B 68 ? 0.3197 0.4474 0.3856 -0.0603 -0.0624 0.0422  68 GLY B O   
1201 N N   . ALA B 69 ? 0.2385 0.3486 0.3073 -0.0516 -0.0449 0.0334  69 ALA B N   
1202 C CA  . ALA B 69 ? 0.2463 0.3578 0.3210 -0.0429 -0.0440 0.0393  69 ALA B CA  
1203 C C   . ALA B 69 ? 0.2591 0.3600 0.3156 -0.0441 -0.0449 0.0404  69 ALA B C   
1204 O O   . ALA B 69 ? 0.2777 0.3642 0.3189 -0.0476 -0.0401 0.0344  69 ALA B O   
1205 C CB  . ALA B 69 ? 0.2512 0.3565 0.3339 -0.0353 -0.0345 0.0362  69 ALA B CB  
1206 N N   . THR B 70 ? 0.2658 0.3727 0.3244 -0.0400 -0.0498 0.0486  70 THR B N   
1207 C CA  . THR B 70 ? 0.2735 0.3676 0.3158 -0.0387 -0.0480 0.0504  70 THR B CA  
1208 C C   . THR B 70 ? 0.2391 0.3243 0.2870 -0.0312 -0.0374 0.0482  70 THR B C   
1209 O O   . THR B 70 ? 0.2646 0.3544 0.3281 -0.0268 -0.0332 0.0467  70 THR B O   
1210 C CB  . THR B 70 ? 0.3155 0.4178 0.3574 -0.0355 -0.0563 0.0610  70 THR B CB  
1211 O OG1 . THR B 70 ? 0.3020 0.4139 0.3648 -0.0257 -0.0539 0.0673  70 THR B OG1 
1212 C CG2 . THR B 70 ? 0.3678 0.4836 0.4078 -0.0434 -0.0692 0.0642  70 THR B CG2 
1213 N N   . HIS B 71 ? 0.2602 0.3317 0.2944 -0.0304 -0.0328 0.0480  71 HIS B N   
1214 C CA  . HIS B 71 ? 0.2859 0.3493 0.3254 -0.0248 -0.0232 0.0461  71 HIS B CA  
1215 C C   . HIS B 71 ? 0.2932 0.3641 0.3487 -0.0168 -0.0222 0.0520  71 HIS B C   
1216 O O   . HIS B 71 ? 0.2616 0.3323 0.3283 -0.0137 -0.0164 0.0486  71 HIS B O   
1217 C CB  . HIS B 71 ? 0.3354 0.3838 0.3585 -0.0251 -0.0184 0.0467  71 HIS B CB  
1218 C CG  . HIS B 71 ? 0.3629 0.4028 0.3915 -0.0217 -0.0080 0.0433  71 HIS B CG  
1219 N ND1 . HIS B 71 ? 0.4209 0.4575 0.4537 -0.0158 -0.0040 0.0480  71 HIS B ND1 
1220 C CD2 . HIS B 71 ? 0.3776 0.4128 0.4097 -0.0235 -0.0011 0.0356  71 HIS B CD2 
1221 C CE1 . HIS B 71 ? 0.4137 0.4434 0.4514 -0.0156 0.0049  0.0425  71 HIS B CE1 
1222 N NE2 . HIS B 71 ? 0.4282 0.4584 0.4666 -0.0201 0.0060  0.0353  71 HIS B NE2 
1223 N N   . LYS B 72 ? 0.3288 0.4049 0.3842 -0.0132 -0.0275 0.0614  72 LYS B N   
1224 C CA  . LYS B 72 ? 0.3134 0.3950 0.3839 -0.0045 -0.0249 0.0681  72 LYS B CA  
1225 C C   . LYS B 72 ? 0.3022 0.3955 0.3908 -0.0035 -0.0251 0.0664  72 LYS B C   
1226 O O   . LYS B 72 ? 0.3018 0.3920 0.4002 0.0016  -0.0175 0.0657  72 LYS B O   
1227 C CB  . LYS B 72 ? 0.3507 0.4398 0.4204 -0.0003 -0.0323 0.0801  72 LYS B CB  
1228 C CG  . LYS B 72 ? 0.4796 0.5706 0.5629 0.0103  -0.0272 0.0887  72 LYS B CG  
1229 C CD  . LYS B 72 ? 0.5436 0.6463 0.6487 0.0137  -0.0251 0.0889  72 LYS B CD  
1230 C CE  . LYS B 72 ? 0.5771 0.7018 0.6959 0.0132  -0.0361 0.0958  72 LYS B CE  
1231 N NZ  . LYS B 72 ? 0.5750 0.7086 0.7125 0.0139  -0.0325 0.0928  72 LYS B NZ  
1232 N N   . GLN B 73 ? 0.2693 0.3745 0.3610 -0.0089 -0.0330 0.0656  73 GLN B N   
1233 C CA  . GLN B 73 ? 0.2489 0.3647 0.3571 -0.0085 -0.0325 0.0641  73 GLN B CA  
1234 C C   . GLN B 73 ? 0.2350 0.3408 0.3432 -0.0089 -0.0240 0.0547  73 GLN B C   
1235 O O   . GLN B 73 ? 0.2624 0.3698 0.3822 -0.0047 -0.0190 0.0547  73 GLN B O   
1236 C CB  . GLN B 73 ? 0.3189 0.4470 0.4282 -0.0162 -0.0418 0.0635  73 GLN B CB  
1237 C CG  . GLN B 73 ? 0.3682 0.5113 0.4825 -0.0157 -0.0521 0.0738  73 GLN B CG  
1238 C CD  . GLN B 73 ? 0.4239 0.5781 0.5359 -0.0260 -0.0624 0.0723  73 GLN B CD  
1239 O OE1 . GLN B 73 ? 0.3981 0.5438 0.4978 -0.0341 -0.0613 0.0632  73 GLN B OE1 
1240 N NE2 . GLN B 73 ? 0.4789 0.6523 0.6031 -0.0260 -0.0724 0.0814  73 GLN B NE2 
1241 N N   . ALA B 74 ? 0.2194 0.3147 0.3141 -0.0137 -0.0222 0.0475  74 ALA B N   
1242 C CA  . ALA B 74 ? 0.2027 0.2904 0.2975 -0.0142 -0.0157 0.0394  74 ALA B CA  
1243 C C   . ALA B 74 ? 0.2450 0.3252 0.3435 -0.0088 -0.0084 0.0395  74 ALA B C   
1244 O O   . ALA B 74 ? 0.2411 0.3196 0.3455 -0.0070 -0.0043 0.0363  74 ALA B O   
1245 C CB  . ALA B 74 ? 0.2094 0.2890 0.2915 -0.0195 -0.0149 0.0333  74 ALA B CB  
1246 N N   . VAL B 75 ? 0.2376 0.3116 0.3305 -0.0068 -0.0066 0.0432  75 VAL B N   
1247 C CA  . VAL B 75 ? 0.2562 0.3210 0.3507 -0.0027 0.0012  0.0432  75 VAL B CA  
1248 C C   . VAL B 75 ? 0.2700 0.3381 0.3756 0.0031  0.0040  0.0477  75 VAL B C   
1249 O O   . VAL B 75 ? 0.2575 0.3187 0.3652 0.0042  0.0102  0.0439  75 VAL B O   
1250 C CB  . VAL B 75 ? 0.2432 0.2999 0.3290 -0.0012 0.0034  0.0477  75 VAL B CB  
1251 C CG1 . VAL B 75 ? 0.2773 0.3239 0.3654 0.0035  0.0122  0.0493  75 VAL B CG1 
1252 C CG2 . VAL B 75 ? 0.2514 0.3014 0.3265 -0.0069 0.0042  0.0420  75 VAL B CG2 
1253 N N   . GLU B 76 ? 0.2457 0.3247 0.3586 0.0064  -0.0007 0.0559  76 GLU B N   
1254 C CA  . GLU B 76 ? 0.2857 0.3689 0.4119 0.0128  0.0032  0.0612  76 GLU B CA  
1255 C C   . GLU B 76 ? 0.2681 0.3545 0.4009 0.0109  0.0046  0.0558  76 GLU B C   
1256 O O   . GLU B 76 ? 0.2485 0.3299 0.3869 0.0151  0.0121  0.0563  76 GLU B O   
1257 C CB  . GLU B 76 ? 0.3634 0.4606 0.4993 0.0171  -0.0027 0.0724  76 GLU B CB  
1258 C CG  . GLU B 76 ? 0.4796 0.5714 0.6084 0.0213  -0.0026 0.0797  76 GLU B CG  
1259 C CD  . GLU B 76 ? 0.6058 0.6811 0.7329 0.0275  0.0098  0.0805  76 GLU B CD  
1260 O OE1 . GLU B 76 ? 0.6425 0.7044 0.7567 0.0265  0.0135  0.0788  76 GLU B OE1 
1261 O OE2 . GLU B 76 ? 0.6266 0.7008 0.7643 0.0328  0.0170  0.0827  76 GLU B OE2 
1262 N N   . THR B 77 ? 0.2257 0.3183 0.3559 0.0047  -0.0016 0.0509  77 THR B N   
1263 C CA  . THR B 77 ? 0.2215 0.3151 0.3555 0.0029  0.0001  0.0459  77 THR B CA  
1264 C C   . THR B 77 ? 0.2361 0.3158 0.3625 0.0027  0.0067  0.0387  77 THR B C   
1265 O O   . THR B 77 ? 0.2645 0.3398 0.3933 0.0046  0.0119  0.0369  77 THR B O   
1266 C CB  . THR B 77 ? 0.2310 0.3316 0.3618 -0.0039 -0.0067 0.0421  77 THR B CB  
1267 O OG1 . THR B 77 ? 0.2425 0.3573 0.3819 -0.0049 -0.0131 0.0486  77 THR B OG1 
1268 C CG2 . THR B 77 ? 0.2466 0.3441 0.3776 -0.0055 -0.0035 0.0360  77 THR B CG2 
1269 N N   . LEU B 78 ? 0.2207 0.2930 0.3376 0.0002  0.0067  0.0348  78 LEU B N   
1270 C CA  . LEU B 78 ? 0.2298 0.2910 0.3406 -0.0011 0.0114  0.0282  78 LEU B CA  
1271 C C   . LEU B 78 ? 0.2763 0.3274 0.3876 0.0029  0.0194  0.0301  78 LEU B C   
1272 O O   . LEU B 78 ? 0.3030 0.3456 0.4104 0.0022  0.0237  0.0255  78 LEU B O   
1273 C CB  . LEU B 78 ? 0.2559 0.3137 0.3597 -0.0052 0.0099  0.0240  78 LEU B CB  
1274 C CG  . LEU B 78 ? 0.2626 0.3260 0.3640 -0.0091 0.0048  0.0204  78 LEU B CG  
1275 C CD1 . LEU B 78 ? 0.2856 0.3467 0.3819 -0.0120 0.0045  0.0189  78 LEU B CD1 
1276 C CD2 . LEU B 78 ? 0.2204 0.2823 0.3210 -0.0103 0.0049  0.0146  78 LEU B CD2 
1277 N N   . ARG B 79 ? 0.2458 0.2965 0.3602 0.0070  0.0218  0.0371  79 ARG B N   
1278 C CA  . ARG B 79 ? 0.2873 0.3263 0.4016 0.0117  0.0313  0.0400  79 ARG B CA  
1279 C C   . ARG B 79 ? 0.3418 0.3809 0.4638 0.0166  0.0365  0.0434  79 ARG B C   
1280 O O   . ARG B 79 ? 0.3317 0.3565 0.4494 0.0183  0.0459  0.0417  79 ARG B O   
1281 C CB  . ARG B 79 ? 0.3336 0.3719 0.4492 0.0163  0.0328  0.0481  79 ARG B CB  
1282 C CG  . ARG B 79 ? 0.3908 0.4232 0.4969 0.0121  0.0317  0.0450  79 ARG B CG  
1283 C CD  . ARG B 79 ? 0.5249 0.5505 0.6294 0.0177  0.0368  0.0531  79 ARG B CD  
1284 N NE  . ARG B 79 ? 0.6154 0.6286 0.7097 0.0134  0.0409  0.0486  79 ARG B NE  
1285 C CZ  . ARG B 79 ? 0.6600 0.6598 0.7493 0.0168  0.0493  0.0526  79 ARG B CZ  
1286 N NH1 . ARG B 79 ? 0.6785 0.6754 0.7720 0.0255  0.0545  0.0620  79 ARG B NH1 
1287 N NH2 . ARG B 79 ? 0.6889 0.6780 0.7698 0.0115  0.0534  0.0475  79 ARG B NH2 
1288 N N   . ASN B 80 ? 0.3254 0.3797 0.4585 0.0185  0.0313  0.0482  80 ASN B N   
1289 C CA  . ASN B 80 ? 0.3774 0.4344 0.5215 0.0235  0.0368  0.0527  80 ASN B CA  
1290 C C   . ASN B 80 ? 0.3702 0.4228 0.5098 0.0199  0.0384  0.0454  80 ASN B C   
1291 O O   . ASN B 80 ? 0.3634 0.4267 0.5111 0.0191  0.0353  0.0462  80 ASN B O   
1292 C CB  . ASN B 80 ? 0.4670 0.5441 0.6276 0.0265  0.0305  0.0619  80 ASN B CB  
1293 C CG  . ASN B 80 ? 0.5708 0.6507 0.7354 0.0322  0.0301  0.0712  80 ASN B CG  
1294 O OD1 . ASN B 80 ? 0.5912 0.6565 0.7507 0.0366  0.0391  0.0728  80 ASN B OD1 
1295 N ND2 . ASN B 80 ? 0.6175 0.7149 0.7896 0.0317  0.0198  0.0775  80 ASN B ND2 
1296 N N   . THR B 81 ? 0.3300 0.3660 0.4556 0.0172  0.0432  0.0382  81 THR B N   
1297 C CA  . THR B 81 ? 0.2869 0.3156 0.4034 0.0136  0.0440  0.0309  81 THR B CA  
1298 C C   . THR B 81 ? 0.3157 0.3236 0.4209 0.0144  0.0546  0.0280  81 THR B C   
1299 O O   . THR B 81 ? 0.3562 0.3558 0.4607 0.0170  0.0609  0.0309  81 THR B O   
1300 C CB  . THR B 81 ? 0.2821 0.3130 0.3892 0.0069  0.0351  0.0236  81 THR B CB  
1301 O OG1 . THR B 81 ? 0.3332 0.3583 0.4345 0.0046  0.0350  0.0215  81 THR B OG1 
1302 C CG2 . THR B 81 ? 0.2441 0.2915 0.3586 0.0051  0.0261  0.0252  81 THR B CG2 
1303 N N   . GLY B 82 ? 0.2829 0.2805 0.3773 0.0120  0.0572  0.0225  82 GLY B N   
1304 C CA  . GLY B 82 ? 0.3116 0.2870 0.3902 0.0106  0.0663  0.0181  82 GLY B CA  
1305 C C   . GLY B 82 ? 0.2911 0.2602 0.3554 0.0029  0.0604  0.0100  82 GLY B C   
1306 O O   . GLY B 82 ? 0.2665 0.2477 0.3359 0.0003  0.0518  0.0093  82 GLY B O   
1307 N N   . GLN B 83 ? 0.2996 0.2499 0.3459 -0.0011 0.0650  0.0039  83 GLN B N   
1308 C CA  . GLN B 83 ? 0.3196 0.2630 0.3530 -0.0093 0.0604  -0.0036 83 GLN B CA  
1309 C C   . GLN B 83 ? 0.3038 0.2601 0.3357 -0.0140 0.0470  -0.0081 83 GLN B C   
1310 O O   . GLN B 83 ? 0.3273 0.2890 0.3591 -0.0196 0.0402  -0.0119 83 GLN B O   
1311 C CB  . GLN B 83 ? 0.3767 0.2941 0.3895 -0.0132 0.0699  -0.0086 83 GLN B CB  
1312 C CG  . GLN B 83 ? 0.3441 0.2555 0.3413 -0.0236 0.0627  -0.0175 83 GLN B CG  
1313 C CD  . GLN B 83 ? 0.3855 0.3037 0.3894 -0.0284 0.0589  -0.0193 83 GLN B CD  
1314 O OE1 . GLN B 83 ? 0.3721 0.2924 0.3871 -0.0241 0.0646  -0.0142 83 GLN B OE1 
1315 N NE2 . GLN B 83 ? 0.3876 0.3088 0.3845 -0.0376 0.0495  -0.0262 83 GLN B NE2 
1316 N N   A VAL B 84 ? 0.2451 0.2064 0.2774 -0.0112 0.0443  -0.0069 84 VAL B N   
1317 N N   B VAL B 84 ? 0.2479 0.2088 0.2795 -0.0115 0.0440  -0.0072 84 VAL B N   
1318 C CA  A VAL B 84 ? 0.2207 0.1945 0.2534 -0.0134 0.0329  -0.0092 84 VAL B CA  
1319 C CA  B VAL B 84 ? 0.2177 0.1916 0.2500 -0.0139 0.0323  -0.0096 84 VAL B CA  
1320 C C   A VAL B 84 ? 0.2236 0.2137 0.2724 -0.0085 0.0304  -0.0038 84 VAL B C   
1321 C C   B VAL B 84 ? 0.2201 0.2096 0.2669 -0.0089 0.0297  -0.0045 84 VAL B C   
1322 O O   A VAL B 84 ? 0.2173 0.2069 0.2721 -0.0039 0.0367  0.0007  84 VAL B O   
1323 O O   B VAL B 84 ? 0.2460 0.2333 0.2953 -0.0048 0.0352  -0.0012 84 VAL B O   
1324 C CB  A VAL B 84 ? 0.2630 0.2252 0.2780 -0.0153 0.0319  -0.0130 84 VAL B CB  
1325 C CB  B VAL B 84 ? 0.2652 0.2282 0.2786 -0.0173 0.0294  -0.0145 84 VAL B CB  
1326 C CG1 A VAL B 84 ? 0.2486 0.2234 0.2656 -0.0146 0.0221  -0.0130 84 VAL B CG1 
1327 C CG1 B VAL B 84 ? 0.2756 0.2271 0.2818 -0.0128 0.0374  -0.0124 84 VAL B CG1 
1328 C CG2 A VAL B 84 ? 0.2299 0.1789 0.2284 -0.0225 0.0308  -0.0192 84 VAL B CG2 
1329 C CG2 B VAL B 84 ? 0.2367 0.2140 0.2526 -0.0188 0.0172  -0.0159 84 VAL B CG2 
1330 N N   . VAL B 85 ? 0.1945 0.1989 0.2506 -0.0101 0.0219  -0.0042 85 VAL B N   
1331 C CA  . VAL B 85 ? 0.1726 0.1908 0.2416 -0.0071 0.0195  0.0002  85 VAL B CA  
1332 C C   . VAL B 85 ? 0.1957 0.2206 0.2630 -0.0079 0.0128  -0.0016 85 VAL B C   
1333 O O   . VAL B 85 ? 0.2082 0.2357 0.2725 -0.0106 0.0072  -0.0048 85 VAL B O   
1334 C CB  . VAL B 85 ? 0.1697 0.1963 0.2484 -0.0076 0.0179  0.0026  85 VAL B CB  
1335 C CG1 . VAL B 85 ? 0.1941 0.2335 0.2831 -0.0058 0.0149  0.0068  85 VAL B CG1 
1336 C CG2 . VAL B 85 ? 0.1855 0.2034 0.2650 -0.0059 0.0257  0.0052  85 VAL B CG2 
1337 N N   . HIS B 86 ? 0.1768 0.2049 0.2471 -0.0055 0.0139  0.0008  86 HIS B N   
1338 C CA  . HIS B 86 ? 0.1957 0.2286 0.2643 -0.0055 0.0094  -0.0001 86 HIS B CA  
1339 C C   . HIS B 86 ? 0.1878 0.2321 0.2660 -0.0066 0.0060  0.0014  86 HIS B C   
1340 O O   . HIS B 86 ? 0.1799 0.2293 0.2660 -0.0065 0.0076  0.0046  86 HIS B O   
1341 C CB  . HIS B 86 ? 0.2042 0.2329 0.2707 -0.0033 0.0138  0.0014  86 HIS B CB  
1342 C CG  . HIS B 86 ? 0.2347 0.2634 0.2958 -0.0028 0.0111  0.0004  86 HIS B CG  
1343 N ND1 . HIS B 86 ? 0.2834 0.3099 0.3442 -0.0018 0.0151  0.0017  86 HIS B ND1 
1344 C CD2 . HIS B 86 ? 0.2895 0.3198 0.3459 -0.0026 0.0056  -0.0013 86 HIS B CD2 
1345 C CE1 . HIS B 86 ? 0.3170 0.3415 0.3710 -0.0008 0.0128  0.0008  86 HIS B CE1 
1346 N NE2 . HIS B 86 ? 0.2923 0.3197 0.3441 -0.0007 0.0069  -0.0006 86 HIS B NE2 
1347 N N   . LEU B 87 ? 0.1621 0.2104 0.2397 -0.0076 0.0015  -0.0004 87 LEU B N   
1348 C CA  . LEU B 87 ? 0.1199 0.1760 0.2040 -0.0089 -0.0002 0.0007  87 LEU B CA  
1349 C C   . LEU B 87 ? 0.1739 0.2310 0.2555 -0.0080 -0.0014 0.0001  87 LEU B C   
1350 O O   . LEU B 87 ? 0.1750 0.2302 0.2523 -0.0062 -0.0034 -0.0012 87 LEU B O   
1351 C CB  . LEU B 87 ? 0.1227 0.1817 0.2102 -0.0108 -0.0019 -0.0005 87 LEU B CB  
1352 C CG  . LEU B 87 ? 0.1414 0.1972 0.2302 -0.0117 0.0005  0.0001  87 LEU B CG  
1353 C CD1 . LEU B 87 ? 0.2076 0.2646 0.2986 -0.0144 -0.0005 -0.0021 87 LEU B CD1 
1354 C CD2 . LEU B 87 ? 0.1879 0.2467 0.2813 -0.0110 0.0023  0.0043  87 LEU B CD2 
1355 N N   . LEU B 88 ? 0.1499 0.2091 0.2330 -0.0092 -0.0002 0.0012  88 LEU B N   
1356 C CA  . LEU B 88 ? 0.1504 0.2079 0.2300 -0.0084 0.0007  0.0008  88 LEU B CA  
1357 C C   . LEU B 88 ? 0.1481 0.2086 0.2305 -0.0102 0.0006  0.0006  88 LEU B C   
1358 O O   . LEU B 88 ? 0.1616 0.2241 0.2453 -0.0134 0.0006  0.0015  88 LEU B O   
1359 C CB  . LEU B 88 ? 0.1826 0.2372 0.2597 -0.0102 0.0036  0.0014  88 LEU B CB  
1360 C CG  . LEU B 88 ? 0.2062 0.2555 0.2775 -0.0102 0.0066  0.0007  88 LEU B CG  
1361 C CD1 . LEU B 88 ? 0.2373 0.2816 0.3037 -0.0049 0.0073  0.0008  88 LEU B CD1 
1362 C CD2 . LEU B 88 ? 0.2378 0.2851 0.3077 -0.0144 0.0094  0.0008  88 LEU B CD2 
1363 N N   . LEU B 89 ? 0.1089 0.1994 0.3141 -0.0068 -0.0147 -0.0346 89 LEU B N   
1364 C CA  . LEU B 89 ? 0.1289 0.2043 0.3141 0.0048  -0.0114 -0.0184 89 LEU B CA  
1365 C C   . LEU B 89 ? 0.1610 0.2307 0.3089 0.0085  -0.0152 -0.0143 89 LEU B C   
1366 O O   . LEU B 89 ? 0.1531 0.2346 0.2963 0.0014  -0.0195 -0.0223 89 LEU B O   
1367 C CB  . LEU B 89 ? 0.1127 0.1946 0.3226 0.0026  0.0039  -0.0188 89 LEU B CB  
1368 C CG  . LEU B 89 ? 0.1073 0.1900 0.3603 0.0007  0.0116  -0.0210 89 LEU B CG  
1369 C CD1 . LEU B 89 ? 0.1102 0.2130 0.3947 -0.0160 0.0215  -0.0428 89 LEU B CD1 
1370 C CD2 . LEU B 89 ? 0.1423 0.2153 0.4030 0.0088  0.0210  -0.0064 89 LEU B CD2 
1371 N N   . GLU B 90 ? 0.1535 0.2059 0.2774 0.0182  -0.0127 -0.0017 90 GLU B N   
1372 C CA  . GLU B 90 ? 0.1771 0.2224 0.2751 0.0222  -0.0088 0.0009  90 GLU B CA  
1373 C C   . GLU B 90 ? 0.2099 0.2540 0.3167 0.0262  0.0060  0.0079  90 GLU B C   
1374 O O   . GLU B 90 ? 0.2213 0.2578 0.3308 0.0299  0.0106  0.0163  90 GLU B O   
1375 C CB  . GLU B 90 ? 0.2507 0.2761 0.3100 0.0270  -0.0144 0.0059  90 GLU B CB  
1376 C CG  . GLU B 90 ? 0.3267 0.3408 0.3657 0.0316  -0.0030 0.0078  90 GLU B CG  
1377 C CD  . GLU B 90 ? 0.4337 0.4269 0.4330 0.0333  -0.0017 0.0115  90 GLU B CD  
1378 O OE1 . GLU B 90 ? 0.4627 0.4521 0.4487 0.0303  -0.0127 0.0164  90 GLU B OE1 
1379 O OE2 . GLU B 90 ? 0.4326 0.4141 0.4156 0.0359  0.0109  0.0097  90 GLU B OE2 
1380 N N   . LYS B 91 ? 0.2012 0.2556 0.3171 0.0243  0.0124  0.0065  91 LYS B N   
1381 C CA  . LYS B 91 ? 0.2070 0.2624 0.3338 0.0277  0.0265  0.0134  91 LYS B CA  
1382 C C   . LYS B 91 ? 0.2564 0.2893 0.3558 0.0373  0.0357  0.0215  91 LYS B C   
1383 O O   . LYS B 91 ? 0.2681 0.2884 0.3433 0.0404  0.0361  0.0202  91 LYS B O   
1384 C CB  . LYS B 91 ? 0.2299 0.3042 0.3747 0.0219  0.0282  0.0131  91 LYS B CB  
1385 C CG  . LYS B 91 ? 0.3001 0.3777 0.4593 0.0251  0.0421  0.0219  91 LYS B CG  
1386 C CD  . LYS B 91 ? 0.3073 0.3988 0.4910 0.0182  0.0472  0.0207  91 LYS B CD  
1387 C CE  . LYS B 91 ? 0.3309 0.4335 0.5339 0.0177  0.0581  0.0297  91 LYS B CE  
1388 N NZ  . LYS B 91 ? 0.3418 0.4468 0.5609 0.0156  0.0674  0.0299  91 LYS B NZ  
1389 N N   . GLY B 92 ? 0.2421 0.2706 0.3462 0.0401  0.0443  0.0290  92 GLY B N   
1390 C CA  . GLY B 92 ? 0.2593 0.2695 0.3362 0.0454  0.0541  0.0367  92 GLY B CA  
1391 C C   . GLY B 92 ? 0.3310 0.3392 0.4108 0.0495  0.0704  0.0376  92 GLY B C   
1392 O O   . GLY B 92 ? 0.3501 0.3736 0.4576 0.0485  0.0725  0.0363  92 GLY B O   
1393 N N   . GLN B 93 ? 0.4852 0.4761 0.5375 0.0522  0.0823  0.0408  93 GLN B N   
1394 C CA  . GLN B 93 ? 0.6146 0.6009 0.6722 0.0565  0.1020  0.0414  93 GLN B CA  
1395 C C   . GLN B 93 ? 0.6582 0.6554 0.7433 0.0582  0.1110  0.0500  93 GLN B C   
1396 O O   . GLN B 93 ? 0.6201 0.6211 0.7098 0.0560  0.1057  0.0559  93 GLN B O   
1397 C CB  . GLN B 93 ? 0.7143 0.6785 0.7307 0.0553  0.1146  0.0386  93 GLN B CB  
1398 C CG  . GLN B 93 ? 0.7735 0.7257 0.7606 0.0517  0.1073  0.0286  93 GLN B CG  
1399 C CD  . GLN B 93 ? 0.7802 0.7352 0.7907 0.0558  0.1096  0.0212  93 GLN B CD  
1400 O OE1 . GLN B 93 ? 0.7707 0.7291 0.8099 0.0609  0.1245  0.0230  93 GLN B OE1 
1401 N NE2 . GLN B 93 ? 0.7883 0.7430 0.7902 0.0531  0.0943  0.0151  93 GLN B NE2 
1402 N N   . SER B 94 ? 0.7349 0.7373 0.8427 0.0618  0.1250  0.0519  94 SER B N   
1403 C CA  . SER B 94 ? 0.8061 0.8201 0.9415 0.0626  0.1341  0.0601  94 SER B CA  
1404 C C   . SER B 94 ? 0.8474 0.8464 0.9649 0.0656  0.1530  0.0648  94 SER B C   
1405 O O   . SER B 94 ? 0.8651 0.8664 0.9858 0.0644  0.1551  0.0724  94 SER B O   
1406 C CB  . SER B 94 ? 0.8337 0.8662 1.0082 0.0629  0.1372  0.0633  94 SER B CB  
1407 O OG  . SER B 94 ? 0.8769 0.8996 1.0516 0.0681  0.1480  0.0616  94 SER B OG  
1408 N N   . PRO C 1  ? 0.2841 0.4108 0.3585 -0.0507 0.0326  -0.0277 1  PRO C N   
1409 C CA  . PRO C 1  ? 0.2779 0.3896 0.3543 -0.0499 0.0345  -0.0326 1  PRO C CA  
1410 C C   . PRO C 1  ? 0.2882 0.4113 0.3639 -0.0534 0.0353  -0.0283 1  PRO C C   
1411 O O   . PRO C 1  ? 0.3037 0.4415 0.3773 -0.0535 0.0341  -0.0180 1  PRO C O   
1412 C CB  . PRO C 1  ? 0.2942 0.3818 0.3677 -0.0414 0.0329  -0.0258 1  PRO C CB  
1413 C CG  . PRO C 1  ? 0.3001 0.3881 0.3705 -0.0387 0.0305  -0.0202 1  PRO C CG  
1414 C CD  . PRO C 1  ? 0.3036 0.4146 0.3763 -0.0444 0.0306  -0.0234 1  PRO C CD  
1415 N N   . LYS C 2  ? 0.2606 0.3775 0.3397 -0.0562 0.0376  -0.0350 2  LYS C N   
1416 C CA  . LYS C 2  ? 0.2837 0.4095 0.3629 -0.0595 0.0383  -0.0309 2  LYS C CA  
1417 C C   . LYS C 2  ? 0.2759 0.3805 0.3533 -0.0511 0.0380  -0.0219 2  LYS C C   
1418 O O   . LYS C 2  ? 0.2745 0.3581 0.3516 -0.0450 0.0378  -0.0227 2  LYS C O   
1419 C CB  . LYS C 2  ? 0.3443 0.4737 0.4290 -0.0682 0.0418  -0.0442 2  LYS C CB  
1420 C CG  . LYS C 2  ? 0.4047 0.5591 0.4901 -0.0794 0.0433  -0.0554 2  LYS C CG  
1421 C CD  . LYS C 2  ? 0.4804 0.6379 0.5710 -0.0893 0.0476  -0.0682 2  LYS C CD  
1422 C CE  . LYS C 2  ? 0.5277 0.6546 0.6250 -0.0836 0.0505  -0.0704 2  LYS C CE  
1423 N NZ  . LYS C 2  ? 0.6042 0.7302 0.7094 -0.0937 0.0565  -0.0851 2  LYS C NZ  
1424 N N   . PRO C 3  ? 0.2625 0.3746 0.3388 -0.0509 0.0382  -0.0128 3  PRO C N   
1425 C CA  . PRO C 3  ? 0.2924 0.3855 0.3670 -0.0434 0.0389  -0.0055 3  PRO C CA  
1426 C C   . PRO C 3  ? 0.3172 0.3910 0.3952 -0.0425 0.0401  -0.0130 3  PRO C C   
1427 O O   . PRO C 3  ? 0.3008 0.3786 0.3852 -0.0494 0.0422  -0.0225 3  PRO C O   
1428 C CB  . PRO C 3  ? 0.3041 0.4134 0.3802 -0.0463 0.0399  0.0021  3  PRO C CB  
1429 C CG  . PRO C 3  ? 0.3096 0.4456 0.3861 -0.0510 0.0387  0.0059  3  PRO C CG  
1430 C CD  . PRO C 3  ? 0.3008 0.4413 0.3778 -0.0568 0.0379  -0.0070 3  PRO C CD  
1431 N N   . GLY C 4  ? 0.3006 0.3547 0.3754 -0.0346 0.0395  -0.0087 4  GLY C N   
1432 C CA  . GLY C 4  ? 0.2847 0.3224 0.3639 -0.0325 0.0406  -0.0123 4  GLY C CA  
1433 C C   . GLY C 4  ? 0.2906 0.3212 0.3732 -0.0314 0.0400  -0.0188 4  GLY C C   
1434 O O   . GLY C 4  ? 0.2888 0.3061 0.3752 -0.0274 0.0405  -0.0180 4  GLY C O   
1435 N N   . ASP C 5  ? 0.2601 0.3016 0.3422 -0.0347 0.0391  -0.0239 5  ASP C N   
1436 C CA  . ASP C 5  ? 0.2252 0.2619 0.3111 -0.0335 0.0389  -0.0294 5  ASP C CA  
1437 C C   . ASP C 5  ? 0.2257 0.2522 0.3053 -0.0269 0.0355  -0.0224 5  ASP C C   
1438 O O   . ASP C 5  ? 0.2508 0.2780 0.3218 -0.0250 0.0335  -0.0160 5  ASP C O   
1439 C CB  . ASP C 5  ? 0.2189 0.2723 0.3049 -0.0389 0.0388  -0.0358 5  ASP C CB  
1440 C CG  . ASP C 5  ? 0.2493 0.3139 0.3422 -0.0475 0.0429  -0.0472 5  ASP C CG  
1441 O OD1 . ASP C 5  ? 0.2892 0.3463 0.3892 -0.0495 0.0466  -0.0516 5  ASP C OD1 
1442 O OD2 . ASP C 5  ? 0.2741 0.3564 0.3657 -0.0531 0.0429  -0.0524 5  ASP C OD2 
1443 N N   . ILE C 6  ? 0.2271 0.2454 0.3122 -0.0240 0.0354  -0.0240 6  ILE C N   
1444 C CA  . ILE C 6  ? 0.2146 0.2275 0.2944 -0.0198 0.0318  -0.0190 6  ILE C CA  
1445 C C   . ILE C 6  ? 0.2411 0.2632 0.3196 -0.0221 0.0302  -0.0225 6  ILE C C   
1446 O O   . ILE C 6  ? 0.2445 0.2747 0.3304 -0.0253 0.0324  -0.0299 6  ILE C O   
1447 C CB  . ILE C 6  ? 0.2373 0.2425 0.3259 -0.0160 0.0324  -0.0174 6  ILE C CB  
1448 C CG1 . ILE C 6  ? 0.2560 0.2529 0.3474 -0.0135 0.0342  -0.0123 6  ILE C CG1 
1449 C CG2 . ILE C 6  ? 0.2698 0.2739 0.3531 -0.0134 0.0280  -0.0126 6  ILE C CG2 
1450 C CD1 . ILE C 6  ? 0.2804 0.2734 0.3588 -0.0113 0.0316  -0.0047 6  ILE C CD1 
1451 N N   . PHE C 7  ? 0.2229 0.2440 0.2924 -0.0211 0.0270  -0.0177 7  PHE C N   
1452 C CA  . PHE C 7  ? 0.1882 0.2168 0.2576 -0.0228 0.0252  -0.0195 7  PHE C CA  
1453 C C   . PHE C 7  ? 0.2289 0.2505 0.2917 -0.0210 0.0217  -0.0150 7  PHE C C   
1454 O O   . PHE C 7  ? 0.2602 0.2724 0.3160 -0.0191 0.0212  -0.0109 7  PHE C O   
1455 C CB  . PHE C 7  ? 0.1976 0.2392 0.2652 -0.0266 0.0259  -0.0198 7  PHE C CB  
1456 C CG  . PHE C 7  ? 0.2212 0.2599 0.2813 -0.0255 0.0260  -0.0126 7  PHE C CG  
1457 C CD1 . PHE C 7  ? 0.2342 0.2729 0.2905 -0.0256 0.0249  -0.0085 7  PHE C CD1 
1458 C CD2 . PHE C 7  ? 0.2530 0.2889 0.3114 -0.0243 0.0281  -0.0095 7  PHE C CD2 
1459 C CE1 . PHE C 7  ? 0.2406 0.2753 0.2927 -0.0241 0.0268  -0.0017 7  PHE C CE1 
1460 C CE2 . PHE C 7  ? 0.2276 0.2611 0.2812 -0.0225 0.0295  -0.0022 7  PHE C CE2 
1461 C CZ  . PHE C 7  ? 0.2369 0.2685 0.2876 -0.0220 0.0294  0.0016  7  PHE C CZ  
1462 N N   . GLU C 8  ? 0.2128 0.2400 0.2774 -0.0224 0.0197  -0.0162 8  GLU C N   
1463 C CA  . GLU C 8  ? 0.2216 0.2441 0.2796 -0.0227 0.0163  -0.0128 8  GLU C CA  
1464 C C   . GLU C 8  ? 0.2129 0.2417 0.2695 -0.0259 0.0154  -0.0128 8  GLU C C   
1465 O O   . GLU C 8  ? 0.2446 0.2847 0.3072 -0.0274 0.0164  -0.0154 8  GLU C O   
1466 C CB  . GLU C 8  ? 0.3161 0.3394 0.3791 -0.0212 0.0138  -0.0119 8  GLU C CB  
1467 C CG  . GLU C 8  ? 0.3830 0.4157 0.4579 -0.0208 0.0148  -0.0152 8  GLU C CG  
1468 C CD  . GLU C 8  ? 0.4526 0.4861 0.5357 -0.0175 0.0138  -0.0118 8  GLU C CD  
1469 O OE1 . GLU C 8  ? 0.5122 0.5505 0.6083 -0.0155 0.0169  -0.0143 8  GLU C OE1 
1470 O OE2 . GLU C 8  ? 0.4367 0.4673 0.5140 -0.0172 0.0104  -0.0062 8  GLU C OE2 
1471 N N   . VAL C 9  ? 0.2031 0.2249 0.2520 -0.0275 0.0141  -0.0103 9  VAL C N   
1472 C CA  . VAL C 9  ? 0.2326 0.2582 0.2811 -0.0309 0.0137  -0.0092 9  VAL C CA  
1473 C C   . VAL C 9  ? 0.2472 0.2681 0.2909 -0.0341 0.0107  -0.0092 9  VAL C C   
1474 O O   . VAL C 9  ? 0.2914 0.3040 0.3281 -0.0343 0.0096  -0.0095 9  VAL C O   
1475 C CB  . VAL C 9  ? 0.2978 0.3192 0.3436 -0.0308 0.0176  -0.0056 9  VAL C CB  
1476 C CG1 . VAL C 9  ? 0.2725 0.3032 0.3230 -0.0290 0.0201  -0.0046 9  VAL C CG1 
1477 C CG2 . VAL C 9  ? 0.3861 0.3915 0.4231 -0.0300 0.0196  -0.0048 9  VAL C CG2 
1478 N N   . GLU C 10 ? 0.2004 0.2286 0.2476 -0.0374 0.0092  -0.0089 10 GLU C N   
1479 C CA  . GLU C 10 ? 0.2255 0.2495 0.2678 -0.0425 0.0068  -0.0092 10 GLU C CA  
1480 C C   . GLU C 10 ? 0.2588 0.2767 0.3004 -0.0450 0.0107  -0.0073 10 GLU C C   
1481 O O   . GLU C 10 ? 0.2573 0.2847 0.3062 -0.0453 0.0116  -0.0044 10 GLU C O   
1482 C CB  . GLU C 10 ? 0.2172 0.2545 0.2660 -0.0447 0.0027  -0.0091 10 GLU C CB  
1483 C CG  . GLU C 10 ? 0.2359 0.2794 0.2883 -0.0417 -0.0003 -0.0089 10 GLU C CG  
1484 C CD  . GLU C 10 ? 0.2859 0.3257 0.3303 -0.0447 -0.0037 -0.0081 10 GLU C CD  
1485 O OE1 . GLU C 10 ? 0.3335 0.3640 0.3680 -0.0497 -0.0032 -0.0101 10 GLU C OE1 
1486 O OE2 . GLU C 10 ? 0.3442 0.3918 0.3931 -0.0424 -0.0064 -0.0054 10 GLU C OE2 
1487 N N   . LEU C 11 ? 0.2518 0.2545 0.2856 -0.0465 0.0138  -0.0084 11 LEU C N   
1488 C CA  . LEU C 11 ? 0.2703 0.2641 0.3058 -0.0471 0.0198  -0.0054 11 LEU C CA  
1489 C C   . LEU C 11 ? 0.2927 0.2772 0.3249 -0.0544 0.0206  -0.0085 11 LEU C C   
1490 O O   . LEU C 11 ? 0.2926 0.2681 0.3151 -0.0583 0.0201  -0.0143 11 LEU C O   
1491 C CB  . LEU C 11 ? 0.2982 0.2801 0.3295 -0.0426 0.0253  -0.0045 11 LEU C CB  
1492 C CG  . LEU C 11 ? 0.3071 0.2808 0.3433 -0.0407 0.0332  0.0010  11 LEU C CG  
1493 C CD1 . LEU C 11 ? 0.3319 0.3216 0.3797 -0.0384 0.0336  0.0092  11 LEU C CD1 
1494 C CD2 . LEU C 11 ? 0.3202 0.2837 0.3522 -0.0357 0.0383  0.0018  11 LEU C CD2 
1495 N N   . ALA C 12 ? 0.2507 0.2386 0.2909 -0.0570 0.0222  -0.0048 12 ALA C N   
1496 C CA  . ALA C 12 ? 0.2820 0.2590 0.3212 -0.0648 0.0247  -0.0076 12 ALA C CA  
1497 C C   . ALA C 12 ? 0.3323 0.2893 0.3718 -0.0640 0.0345  -0.0070 12 ALA C C   
1498 O O   . ALA C 12 ? 0.3510 0.3087 0.3988 -0.0577 0.0396  0.0010  12 ALA C O   
1499 C CB  . ALA C 12 ? 0.2717 0.2607 0.3211 -0.0682 0.0227  -0.0029 12 ALA C CB  
1500 N N   . LYS C 13 ? 0.3359 0.2764 0.3670 -0.0706 0.0378  -0.0154 13 LYS C N   
1501 C CA  . LYS C 13 ? 0.3314 0.2502 0.3640 -0.0705 0.0491  -0.0165 13 LYS C CA  
1502 C C   . LYS C 13 ? 0.3729 0.2869 0.4202 -0.0719 0.0556  -0.0095 13 LYS C C   
1503 O O   . LYS C 13 ? 0.3722 0.2965 0.4252 -0.0768 0.0511  -0.0073 13 LYS C O   
1504 C CB  . LYS C 13 ? 0.3583 0.2616 0.3774 -0.0792 0.0516  -0.0297 13 LYS C CB  
1505 C CG  . LYS C 13 ? 0.3736 0.2811 0.3786 -0.0773 0.0469  -0.0349 13 LYS C CG  
1506 C CD  . LYS C 13 ? 0.3920 0.2892 0.3822 -0.0876 0.0487  -0.0481 13 LYS C CD  
1507 C CE  . LYS C 13 ? 0.4208 0.3262 0.3979 -0.0856 0.0435  -0.0509 13 LYS C CE  
1508 N NZ  . LYS C 13 ? 0.4317 0.3342 0.3934 -0.0978 0.0435  -0.0635 13 LYS C NZ  
1509 N N   . ASN C 14 ? 0.3599 0.2587 0.4146 -0.0670 0.0667  -0.0047 14 ASN C N   
1510 C CA  . ASN C 14 ? 0.3905 0.2804 0.4611 -0.0680 0.0757  0.0027  14 ASN C CA  
1511 C C   . ASN C 14 ? 0.3882 0.2491 0.4564 -0.0718 0.0879  -0.0063 14 ASN C C   
1512 O O   . ASN C 14 ? 0.3997 0.2502 0.4628 -0.0663 0.0936  -0.0086 14 ASN C O   
1513 C CB  . ASN C 14 ? 0.4178 0.3184 0.5030 -0.0572 0.0796  0.0194  14 ASN C CB  
1514 C CG  . ASN C 14 ? 0.4885 0.3818 0.5928 -0.0568 0.0895  0.0304  14 ASN C CG  
1515 O OD1 . ASN C 14 ? 0.5246 0.4289 0.6371 -0.0610 0.0861  0.0356  14 ASN C OD1 
1516 N ND2 . ASN C 14 ? 0.5182 0.3929 0.6311 -0.0516 0.1027  0.0349  14 ASN C ND2 
1517 N N   . ASP C 15 ? 0.4281 0.2759 0.5001 -0.0818 0.0924  -0.0123 15 ASP C N   
1518 C CA  . ASP C 15 ? 0.4955 0.3141 0.5651 -0.0878 0.1053  -0.0240 15 ASP C CA  
1519 C C   . ASP C 15 ? 0.5109 0.3247 0.5593 -0.0900 0.1032  -0.0384 15 ASP C C   
1520 O O   . ASP C 15 ? 0.5392 0.3343 0.5855 -0.0868 0.1144  -0.0432 15 ASP C O   
1521 C CB  . ASP C 15 ? 0.5724 0.3741 0.6608 -0.0788 0.1211  -0.0129 15 ASP C CB  
1522 C CG  . ASP C 15 ? 0.6466 0.4534 0.7578 -0.0776 0.1244  0.0026  15 ASP C CG  
1523 O OD1 . ASP C 15 ? 0.6890 0.4960 0.8181 -0.0669 0.1328  0.0192  15 ASP C OD1 
1524 O OD2 . ASP C 15 ? 0.6318 0.4445 0.7435 -0.0873 0.1184  -0.0004 15 ASP C OD2 
1525 N N   . ASN C 16 ? 0.4590 0.2918 0.4933 -0.0948 0.0891  -0.0438 16 ASN C N   
1526 C CA  . ASN C 16 ? 0.4781 0.3117 0.4921 -0.0983 0.0851  -0.0560 16 ASN C CA  
1527 C C   . ASN C 16 ? 0.4769 0.3116 0.4868 -0.0864 0.0866  -0.0516 16 ASN C C   
1528 O O   . ASN C 16 ? 0.4960 0.3267 0.4905 -0.0888 0.0872  -0.0615 16 ASN C O   
1529 C CB  . ASN C 16 ? 0.5865 0.3992 0.5909 -0.1112 0.0941  -0.0734 16 ASN C CB  
1530 C CG  . ASN C 16 ? 0.7174 0.5382 0.6996 -0.1184 0.0874  -0.0861 16 ASN C CG  
1531 O OD1 . ASN C 16 ? 0.7574 0.6018 0.7327 -0.1189 0.0736  -0.0830 16 ASN C OD1 
1532 N ND2 . ASN C 16 ? 0.7893 0.5916 0.7609 -0.1238 0.0980  -0.0999 16 ASN C ND2 
1533 N N   . SER C 17 ? 0.4260 0.2687 0.4492 -0.0745 0.0868  -0.0367 17 SER C N   
1534 C CA  . SER C 17 ? 0.4068 0.2531 0.4279 -0.0636 0.0877  -0.0310 17 SER C CA  
1535 C C   . SER C 17 ? 0.3634 0.2344 0.3892 -0.0565 0.0769  -0.0197 17 SER C C   
1536 O O   . SER C 17 ? 0.3553 0.2376 0.3930 -0.0556 0.0740  -0.0109 17 SER C O   
1537 C CB  . SER C 17 ? 0.4606 0.2901 0.4948 -0.0556 0.1026  -0.0237 17 SER C CB  
1538 O OG  . SER C 17 ? 0.4798 0.3170 0.5146 -0.0448 0.1026  -0.0156 17 SER C OG  
1539 N N   . LEU C 18 ? 0.3672 0.2468 0.3843 -0.0518 0.0717  -0.0201 18 LEU C N   
1540 C CA  . LEU C 18 ? 0.3311 0.2320 0.3531 -0.0454 0.0634  -0.0110 18 LEU C CA  
1541 C C   . LEU C 18 ? 0.3599 0.2639 0.3952 -0.0363 0.0696  0.0017  18 LEU C C   
1542 O O   . LEU C 18 ? 0.3477 0.2704 0.3890 -0.0322 0.0642  0.0095  18 LEU C O   
1543 C CB  . LEU C 18 ? 0.3547 0.2635 0.3649 -0.0440 0.0562  -0.0153 18 LEU C CB  
1544 C CG  . LEU C 18 ? 0.3416 0.2563 0.3407 -0.0517 0.0477  -0.0238 18 LEU C CG  
1545 C CD1 . LEU C 18 ? 0.3464 0.2655 0.3350 -0.0494 0.0438  -0.0263 18 LEU C CD1 
1546 C CD2 . LEU C 18 ? 0.3339 0.2656 0.3398 -0.0538 0.0391  -0.0206 18 LEU C CD2 
1547 N N   . GLY C 19 ? 0.3747 0.2616 0.4151 -0.0334 0.0816  0.0038  19 GLY C N   
1548 C CA  . GLY C 19 ? 0.3786 0.2705 0.4341 -0.0249 0.0882  0.0183  19 GLY C CA  
1549 C C   . GLY C 19 ? 0.3601 0.2608 0.4126 -0.0178 0.0869  0.0224  19 GLY C C   
1550 O O   . GLY C 19 ? 0.3794 0.2961 0.4423 -0.0121 0.0868  0.0349  19 GLY C O   
1551 N N   . ILE C 20 ? 0.3971 0.2894 0.4353 -0.0190 0.0856  0.0123  20 ILE C N   
1552 C CA  . ILE C 20 ? 0.3810 0.2799 0.4170 -0.0125 0.0855  0.0163  20 ILE C CA  
1553 C C   . ILE C 20 ? 0.4245 0.3045 0.4524 -0.0109 0.0944  0.0100  20 ILE C C   
1554 O O   . ILE C 20 ? 0.5007 0.3659 0.5180 -0.0170 0.0967  -0.0020 20 ILE C O   
1555 C CB  . ILE C 20 ? 0.4157 0.3303 0.4438 -0.0142 0.0735  0.0129  20 ILE C CB  
1556 C CG1 . ILE C 20 ? 0.4041 0.3116 0.4177 -0.0208 0.0686  0.0003  20 ILE C CG1 
1557 C CG2 . ILE C 20 ? 0.4026 0.3365 0.4388 -0.0156 0.0661  0.0182  20 ILE C CG2 
1558 C CD1 . ILE C 20 ? 0.4790 0.3967 0.4855 -0.0198 0.0609  -0.0015 20 ILE C CD1 
1559 N N   . SER C 21 ? 0.3462 0.2288 0.3791 -0.0031 0.0997  0.0182  21 SER C N   
1560 C CA  . SER C 21 ? 0.3402 0.2081 0.3644 -0.0008 0.1075  0.0123  21 SER C CA  
1561 C C   . SER C 21 ? 0.3887 0.2701 0.4061 0.0017  0.1001  0.0138  21 SER C C   
1562 O O   . SER C 21 ? 0.4069 0.3061 0.4325 0.0052  0.0950  0.0235  21 SER C O   
1563 C CB  . SER C 21 ? 0.4416 0.2976 0.4785 0.0066  0.1227  0.0205  21 SER C CB  
1564 O OG  . SER C 21 ? 0.5103 0.3829 0.5592 0.0147  0.1229  0.0359  21 SER C OG  
1565 N N   . VAL C 22 ? 0.4044 0.2792 0.4069 -0.0012 0.0991  0.0037  22 VAL C N   
1566 C CA  . VAL C 22 ? 0.3423 0.2290 0.3390 0.0008  0.0923  0.0054  22 VAL C CA  
1567 C C   . VAL C 22 ? 0.3689 0.2478 0.3614 0.0058  0.1014  0.0058  22 VAL C C   
1568 O O   . VAL C 22 ? 0.4156 0.2777 0.4058 0.0064  0.1127  0.0010  22 VAL C O   
1569 C CB  . VAL C 22 ? 0.4016 0.2935 0.3860 -0.0062 0.0818  -0.0033 22 VAL C CB  
1570 C CG1 . VAL C 22 ? 0.3892 0.2905 0.3794 -0.0102 0.0733  -0.0027 22 VAL C CG1 
1571 C CG2 . VAL C 22 ? 0.4485 0.3266 0.4189 -0.0122 0.0863  -0.0154 22 VAL C CG2 
1572 N N   . THR C 23 ? 0.3714 0.2625 0.3643 0.0095  0.0971  0.0117  23 THR C N   
1573 C CA  . THR C 23 ? 0.3677 0.2553 0.3572 0.0145  0.1043  0.0137  23 THR C CA  
1574 C C   . THR C 23 ? 0.3705 0.2685 0.3514 0.0126  0.0953  0.0123  23 THR C C   
1575 O O   . THR C 23 ? 0.3770 0.2866 0.3606 0.0099  0.0850  0.0137  23 THR C O   
1576 C CB  . THR C 23 ? 0.4725 0.3670 0.4774 0.0227  0.1103  0.0275  23 THR C CB  
1577 O OG1 . THR C 23 ? 0.5044 0.3945 0.5066 0.0281  0.1188  0.0295  23 THR C OG1 
1578 C CG2 . THR C 23 ? 0.4159 0.3317 0.4289 0.0225  0.0999  0.0357  23 THR C CG2 
1579 N N   . GLY C 24 ? 0.4592 0.4027 0.4563 -0.0461 0.2964  -0.0431 24 GLY C N   
1580 C CA  . GLY C 24 ? 0.4934 0.4316 0.4965 -0.0701 0.2718  -0.0473 24 GLY C CA  
1581 C C   . GLY C 24 ? 0.4630 0.3535 0.4486 -0.0723 0.2741  -0.0621 24 GLY C C   
1582 O O   . GLY C 24 ? 0.5277 0.3941 0.4973 -0.0592 0.2964  -0.0688 24 GLY C O   
1583 N N   . GLY C 25 ? 0.4585 0.3341 0.4429 -0.0898 0.2522  -0.0681 25 GLY C N   
1584 C CA  . GLY C 25 ? 0.4728 0.3128 0.4399 -0.0902 0.2517  -0.0773 25 GLY C CA  
1585 C C   . GLY C 25 ? 0.4823 0.3271 0.4493 -0.1013 0.2474  -0.0587 25 GLY C C   
1586 O O   . GLY C 25 ? 0.4841 0.3653 0.4663 -0.1069 0.2514  -0.0380 25 GLY C O   
1587 N N   . VAL C 26 ? 0.4729 0.2850 0.4223 -0.1043 0.2397  -0.0655 26 VAL C N   
1588 C CA  . VAL C 26 ? 0.5154 0.3232 0.4597 -0.1160 0.2363  -0.0491 26 VAL C CA  
1589 C C   . VAL C 26 ? 0.5269 0.3576 0.4759 -0.1118 0.2587  -0.0258 26 VAL C C   
1590 O O   . VAL C 26 ? 0.5331 0.3783 0.4880 -0.1245 0.2589  -0.0084 26 VAL C O   
1591 C CB  . VAL C 26 ? 0.5806 0.3457 0.4993 -0.1151 0.2248  -0.0588 26 VAL C CB  
1592 C CG1 . VAL C 26 ? 0.5960 0.3395 0.5097 -0.1167 0.2043  -0.0772 26 VAL C CG1 
1593 C CG2 . VAL C 26 ? 0.5893 0.3439 0.4925 -0.1007 0.2362  -0.0671 26 VAL C CG2 
1594 N N   . ASN C 27 ? 0.5402 0.3720 0.4843 -0.0949 0.2806  -0.0260 27 ASN C N   
1595 C CA  . ASN C 27 ? 0.5868 0.4313 0.5291 -0.0857 0.3076  -0.0042 27 ASN C CA  
1596 C C   . ASN C 27 ? 0.5909 0.4878 0.5587 -0.0795 0.3191  0.0183  27 ASN C C   
1597 O O   . ASN C 27 ? 0.6476 0.5640 0.6177 -0.0682 0.3430  0.0409  27 ASN C O   
1598 C CB  . ASN C 27 ? 0.6377 0.4544 0.5566 -0.0712 0.3316  -0.0148 27 ASN C CB  
1599 C CG  . ASN C 27 ? 0.7091 0.5259 0.6302 -0.0625 0.3371  -0.0311 27 ASN C CG  
1600 O OD1 . ASN C 27 ? 0.6918 0.5015 0.6164 -0.0691 0.3155  -0.0524 27 ASN C OD1 
1601 N ND2 . ASN C 27 ? 0.7273 0.5481 0.6428 -0.0456 0.3692  -0.0200 27 ASN C ND2 
1602 N N   . THR C 28 ? 0.5385 0.4613 0.5241 -0.0846 0.3031  0.0126  28 THR C N   
1603 C CA  . THR C 28 ? 0.5172 0.4990 0.5261 -0.0760 0.3115  0.0326  28 THR C CA  
1604 C C   . THR C 28 ? 0.5050 0.5321 0.5360 -0.1013 0.2914  0.0422  28 THR C C   
1605 O O   . THR C 28 ? 0.5068 0.5063 0.5301 -0.1248 0.2734  0.0315  28 THR C O   
1606 C CB  . THR C 28 ? 0.5179 0.5027 0.5286 -0.0657 0.3088  0.0192  28 THR C CB  
1607 O OG1 . THR C 28 ? 0.5200 0.4972 0.5353 -0.0879 0.2783  -0.0003 28 THR C OG1 
1608 C CG2 . THR C 28 ? 0.5320 0.4643 0.5166 -0.0490 0.3281  0.0017  28 THR C CG2 
1609 N N   . SER C 29 ? 0.5361 0.6333 0.5914 -0.0965 0.2960  0.0621  29 SER C N   
1610 C CA  . SER C 29 ? 0.5963 0.7499 0.6737 -0.1257 0.2775  0.0686  29 SER C CA  
1611 C C   . SER C 29 ? 0.5844 0.7553 0.6676 -0.1387 0.2560  0.0529  29 SER C C   
1612 O O   . SER C 29 ? 0.5533 0.7784 0.6529 -0.1651 0.2417  0.0562  29 SER C O   
1613 C CB  . SER C 29 ? 0.6668 0.9042 0.7703 -0.1152 0.2937  0.1008  29 SER C CB  
1614 O OG  . SER C 29 ? 0.7231 1.0245 0.8486 -0.1494 0.2760  0.1045  29 SER C OG  
1615 N N   . VAL C 30 ? 0.5491 0.6748 0.6172 -0.1228 0.2551  0.0346  30 VAL C N   
1616 C CA  . VAL C 30 ? 0.5523 0.6850 0.6219 -0.1324 0.2369  0.0183  30 VAL C CA  
1617 C C   . VAL C 30 ? 0.5778 0.6772 0.6376 -0.1694 0.2130  -0.0020 30 VAL C C   
1618 O O   . VAL C 30 ? 0.5874 0.6195 0.6271 -0.1721 0.2093  -0.0173 30 VAL C O   
1619 C CB  . VAL C 30 ? 0.5392 0.6237 0.5925 -0.1074 0.2448  0.0016  30 VAL C CB  
1620 C CG1 . VAL C 30 ? 0.5633 0.6544 0.6172 -0.1157 0.2280  -0.0143 30 VAL C CG1 
1621 C CG2 . VAL C 30 ? 0.5461 0.6456 0.5981 -0.0709 0.2756  0.0205  30 VAL C CG2 
1622 N N   . ARG C 31 ? 0.5722 0.7191 0.6427 -0.1975 0.1986  -0.0015 31 ARG C N   
1623 C CA  . ARG C 31 ? 0.6654 0.7738 0.7190 -0.2344 0.1805  -0.0222 31 ARG C CA  
1624 C C   . ARG C 31 ? 0.6972 0.7419 0.7305 -0.2464 0.1823  -0.0266 31 ARG C C   
1625 O O   . ARG C 31 ? 0.7216 0.7866 0.7616 -0.2531 0.1915  -0.0103 31 ARG C O   
1626 C CB  . ARG C 31 ? 0.7179 0.7803 0.7564 -0.2267 0.1710  -0.0455 31 ARG C CB  
1627 C CG  . ARG C 31 ? 0.7466 0.8561 0.7989 -0.2040 0.1743  -0.0405 31 ARG C CG  
1628 C CD  . ARG C 31 ? 0.8053 0.9879 0.8699 -0.2292 0.1626  -0.0353 31 ARG C CD  
1629 N NE  . ARG C 31 ? 0.8706 1.0149 0.9151 -0.2642 0.1460  -0.0593 31 ARG C NE  
1630 C CZ  . ARG C 31 ? 0.8801 1.0054 0.9136 -0.2621 0.1381  -0.0760 31 ARG C CZ  
1631 N NH1 . ARG C 31 ? 0.8594 1.0017 0.9004 -0.2273 0.1451  -0.0715 31 ARG C NH1 
1632 N NH2 . ARG C 31 ? 0.9115 0.9952 0.9222 -0.2948 0.1265  -0.0971 31 ARG C NH2 
1633 N N   . HIS C 32 ? 0.7059 0.6746 0.7129 -0.2465 0.1747  -0.0475 32 HIS C N   
1634 C CA  . HIS C 32 ? 0.7690 0.6720 0.7510 -0.2486 0.1770  -0.0508 32 HIS C CA  
1635 C C   . HIS C 32 ? 0.6907 0.5544 0.6648 -0.2125 0.1819  -0.0561 32 HIS C C   
1636 O O   . HIS C 32 ? 0.7182 0.5224 0.6675 -0.2070 0.1782  -0.0662 32 HIS C O   
1637 C CB  . HIS C 32 ? 0.9259 0.7715 0.8777 -0.2758 0.1677  -0.0677 32 HIS C CB  
1638 C CG  . HIS C 32 ? 1.0479 0.9218 0.9984 -0.3205 0.1672  -0.0645 32 HIS C CG  
1639 N ND1 . HIS C 32 ? 1.0643 1.0218 1.0425 -0.3374 0.1635  -0.0584 32 HIS C ND1 
1640 C CD2 . HIS C 32 ? 1.1329 0.9643 1.0549 -0.3536 0.1716  -0.0675 32 HIS C CD2 
1641 C CE1 . HIS C 32 ? 1.1148 1.0875 1.0848 -0.3828 0.1639  -0.0596 32 HIS C CE1 
1642 N NE2 . HIS C 32 ? 1.1594 1.0511 1.0937 -0.3949 0.1706  -0.0658 32 HIS C NE2 
1643 N N   . GLY C 33 ? 0.4028 0.3772 0.4942 -0.0476 0.1847  -0.0158 33 GLY C N   
1644 C CA  . GLY C 33 ? 0.3996 0.3521 0.4589 -0.0437 0.1831  -0.0163 33 GLY C CA  
1645 C C   . GLY C 33 ? 0.3988 0.3505 0.4498 -0.0431 0.1655  -0.0172 33 GLY C C   
1646 O O   . GLY C 33 ? 0.4268 0.3623 0.4535 -0.0411 0.1621  -0.0184 33 GLY C O   
1647 N N   . GLY C 34 ? 0.3687 0.3386 0.4400 -0.0452 0.1546  -0.0173 34 GLY C N   
1648 C CA  . GLY C 34 ? 0.3859 0.3570 0.4511 -0.0444 0.1391  -0.0176 34 GLY C CA  
1649 C C   . GLY C 34 ? 0.3721 0.3436 0.4368 -0.0379 0.1358  -0.0179 34 GLY C C   
1650 O O   . GLY C 34 ? 0.3523 0.3265 0.4264 -0.0328 0.1447  -0.0179 34 GLY C O   
1651 N N   . ILE C 35 ? 0.2967 0.2653 0.3517 -0.0380 0.1236  -0.0177 35 ILE C N   
1652 C CA  . ILE C 35 ? 0.2855 0.2522 0.3395 -0.0330 0.1199  -0.0172 35 ILE C CA  
1653 C C   . ILE C 35 ? 0.3105 0.2995 0.3860 -0.0302 0.1106  -0.0148 35 ILE C C   
1654 O O   . ILE C 35 ? 0.3255 0.3220 0.4015 -0.0335 0.1007  -0.0147 35 ILE C O   
1655 C CB  . ILE C 35 ? 0.3109 0.2609 0.3408 -0.0357 0.1127  -0.0183 35 ILE C CB  
1656 C CG1 . ILE C 35 ? 0.3425 0.2720 0.3475 -0.0386 0.1197  -0.0210 35 ILE C CG1 
1657 C CG2 . ILE C 35 ? 0.3194 0.2660 0.3502 -0.0318 0.1099  -0.0178 35 ILE C CG2 
1658 C CD1 . ILE C 35 ? 0.4140 0.3340 0.4164 -0.0349 0.1343  -0.0232 35 ILE C CD1 
1659 N N   . TYR C 36 ? 0.2948 0.2946 0.3872 -0.0234 0.1141  -0.0127 36 TYR C N   
1660 C CA  . TYR C 36 ? 0.2690 0.2924 0.3810 -0.0198 0.1053  -0.0097 36 TYR C CA  
1661 C C   . TYR C 36 ? 0.2494 0.2707 0.3619 -0.0123 0.1034  -0.0052 36 TYR C C   
1662 O O   . TYR C 36 ? 0.2701 0.2753 0.3763 -0.0084 0.1119  -0.0048 36 TYR C O   
1663 C CB  . TYR C 36 ? 0.2655 0.3114 0.4030 -0.0177 0.1095  -0.0098 36 TYR C CB  
1664 C CG  . TYR C 36 ? 0.3107 0.3601 0.4518 -0.0261 0.1118  -0.0140 36 TYR C CG  
1665 C CD1 . TYR C 36 ? 0.3441 0.3788 0.4777 -0.0290 0.1244  -0.0155 36 TYR C CD1 
1666 C CD2 . TYR C 36 ? 0.3116 0.3769 0.4621 -0.0310 0.1024  -0.0164 36 TYR C CD2 
1667 C CE1 . TYR C 36 ? 0.3597 0.3953 0.4965 -0.0367 0.1280  -0.0180 36 TYR C CE1 
1668 C CE2 . TYR C 36 ? 0.3304 0.3957 0.4847 -0.0392 0.1058  -0.0202 36 TYR C CE2 
1669 C CZ  . TYR C 36 ? 0.3673 0.4174 0.5153 -0.0420 0.1189  -0.0203 36 TYR C CZ  
1670 O OH  . TYR C 36 ? 0.3792 0.4269 0.5309 -0.0501 0.1240  -0.0228 36 TYR C OH  
1671 N N   . VAL C 37 ? 0.2026 0.2388 0.3217 -0.0101 0.0930  -0.0017 37 VAL C N   
1672 C CA  . VAL C 37 ? 0.2350 0.2704 0.3561 -0.0024 0.0916  0.0045  37 VAL C CA  
1673 C C   . VAL C 37 ? 0.2613 0.3110 0.4027 0.0073  0.0974  0.0087  37 VAL C C   
1674 O O   . VAL C 37 ? 0.2490 0.3248 0.4086 0.0096  0.0932  0.0095  37 VAL C O   
1675 C CB  . VAL C 37 ? 0.2405 0.2897 0.3620 -0.0023 0.0794  0.0080  37 VAL C CB  
1676 C CG1 . VAL C 37 ? 0.2051 0.2536 0.3293 0.0064  0.0794  0.0163  37 VAL C CG1 
1677 C CG2 . VAL C 37 ? 0.2510 0.2876 0.3547 -0.0107 0.0743  0.0045  37 VAL C CG2 
1678 N N   . LYS C 38 ? 0.2398 0.2724 0.3786 0.0131  0.1074  0.0106  38 LYS C N   
1679 C CA  . LYS C 38 ? 0.2535 0.2984 0.4123 0.0244  0.1140  0.0157  38 LYS C CA  
1680 C C   . LYS C 38 ? 0.2818 0.3380 0.4490 0.0341  0.1081  0.0253  38 LYS C C   
1681 O O   . LYS C 38 ? 0.3059 0.3875 0.4936 0.0428  0.1061  0.0305  38 LYS C O   
1682 C CB  . LYS C 38 ? 0.2845 0.3049 0.4370 0.0278  0.1289  0.0135  38 LYS C CB  
1683 C CG  . LYS C 38 ? 0.3845 0.4187 0.5597 0.0392  0.1381  0.0173  38 LYS C CG  
1684 C CD  . LYS C 38 ? 0.4566 0.4656 0.6233 0.0413  0.1543  0.0128  38 LYS C CD  
1685 C CE  . LYS C 38 ? 0.5219 0.5453 0.7130 0.0538  0.1650  0.0169  38 LYS C CE  
1686 N NZ  . LYS C 38 ? 0.5855 0.5989 0.7736 0.0516  0.1798  0.0100  38 LYS C NZ  
1687 N N   . ALA C 39 ? 0.2697 0.3079 0.4216 0.0328  0.1054  0.0281  39 ALA C N   
1688 C CA  . ALA C 39 ? 0.2753 0.3212 0.4322 0.0417  0.1008  0.0387  39 ALA C CA  
1689 C C   . ALA C 39 ? 0.2869 0.3192 0.4265 0.0346  0.0949  0.0393  39 ALA C C   
1690 O O   . ALA C 39 ? 0.2760 0.2872 0.4003 0.0250  0.0969  0.0322  39 ALA C O   
1691 C CB  . ALA C 39 ? 0.2959 0.3278 0.4594 0.0536  0.1122  0.0455  39 ALA C CB  
1692 N N   . VAL C 40 ? 0.2967 0.3428 0.4389 0.0396  0.0875  0.0480  40 VAL C N   
1693 C CA  . VAL C 40 ? 0.2992 0.3315 0.4277 0.0348  0.0847  0.0509  40 VAL C CA  
1694 C C   . VAL C 40 ? 0.4040 0.4234 0.5356 0.0448  0.0918  0.0621  40 VAL C C   
1695 O O   . VAL C 40 ? 0.4788 0.5139 0.6227 0.0574  0.0920  0.0716  40 VAL C O   
1696 C CB  . VAL C 40 ? 0.3751 0.4296 0.5013 0.0325  0.0728  0.0528  40 VAL C CB  
1697 C CG1 . VAL C 40 ? 0.3723 0.4404 0.4987 0.0243  0.0666  0.0420  40 VAL C CG1 
1698 C CG2 . VAL C 40 ? 0.4269 0.5044 0.5633 0.0449  0.0688  0.0639  40 VAL C CG2 
1699 N N   . ILE C 41 ? 0.4143 0.4048 0.5352 0.0393  0.0979  0.0609  41 ILE C N   
1700 C CA  . ILE C 41 ? 0.4598 0.4307 0.5832 0.0472  0.1073  0.0701  41 ILE C CA  
1701 C C   . ILE C 41 ? 0.4708 0.4520 0.5956 0.0532  0.1031  0.0839  41 ILE C C   
1702 O O   . ILE C 41 ? 0.4238 0.4075 0.5402 0.0450  0.0970  0.0836  41 ILE C O   
1703 C CB  . ILE C 41 ? 0.4954 0.4315 0.6069 0.0370  0.1148  0.0620  41 ILE C CB  
1704 C CG1 . ILE C 41 ? 0.4717 0.3999 0.5787 0.0319  0.1186  0.0487  41 ILE C CG1 
1705 C CG2 . ILE C 41 ? 0.5412 0.4526 0.6556 0.0443  0.1261  0.0704  41 ILE C CG2 
1706 C CD1 . ILE C 41 ? 0.5016 0.3985 0.5941 0.0212  0.1243  0.0383  41 ILE C CD1 
1707 N N   . PRO C 42 ? 0.4993 0.4878 0.6346 0.0686  0.1066  0.0970  42 PRO C N   
1708 C CA  . PRO C 42 ? 0.4834 0.4821 0.6181 0.0760  0.1034  0.1119  42 PRO C CA  
1709 C C   . PRO C 42 ? 0.4881 0.4628 0.6121 0.0666  0.1072  0.1139  42 PRO C C   
1710 O O   . PRO C 42 ? 0.4894 0.4328 0.6106 0.0606  0.1166  0.1093  42 PRO C O   
1711 C CB  . PRO C 42 ? 0.5409 0.5375 0.6872 0.0938  0.1113  0.1254  42 PRO C CB  
1712 C CG  . PRO C 42 ? 0.5362 0.5419 0.6935 0.0972  0.1128  0.1169  42 PRO C CG  
1713 C CD  . PRO C 42 ? 0.5360 0.5246 0.6842 0.0807  0.1143  0.0993  42 PRO C CD  
1714 N N   . GLN C 43 ? 0.5103 0.5005 0.6287 0.0645  0.1000  0.1197  43 GLN C N   
1715 C CA  . GLN C 43 ? 0.5776 0.5506 0.6883 0.0556  0.1032  0.1228  43 GLN C CA  
1716 C C   . GLN C 43 ? 0.5254 0.4821 0.6300 0.0381  0.1028  0.1072  43 GLN C C   
1717 O O   . GLN C 43 ? 0.5314 0.4718 0.6324 0.0292  0.1063  0.1082  43 GLN C O   
1718 C CB  . GLN C 43 ? 0.7062 0.6537 0.8202 0.0629  0.1159  0.1364  43 GLN C CB  
1719 C CG  . GLN C 43 ? 0.7986 0.7622 0.9147 0.0791  0.1158  0.1561  43 GLN C CG  
1720 C CD  . GLN C 43 ? 0.8656 0.8513 0.9902 0.0947  0.1120  0.1601  43 GLN C CD  
1721 O OE1 . GLN C 43 ? 0.9007 0.8720 1.0338 0.1031  0.1203  0.1623  43 GLN C OE1 
1722 N NE2 . GLN C 43 ? 0.8719 0.8934 0.9951 0.0985  0.0996  0.1604  43 GLN C NE2 
1723 N N   . GLY C 44 ? 0.4258 0.3875 0.5294 0.0331  0.0984  0.0935  44 GLY C N   
1724 C CA  . GLY C 44 ? 0.4021 0.3505 0.4981 0.0179  0.0969  0.0794  44 GLY C CA  
1725 C C   . GLY C 44 ? 0.3646 0.3333 0.4556 0.0103  0.0861  0.0748  44 GLY C C   
1726 O O   . GLY C 44 ? 0.3606 0.3530 0.4530 0.0163  0.0801  0.0812  44 GLY C O   
1727 N N   . ALA C 45 ? 0.3403 0.3000 0.4247 -0.0023 0.0835  0.0633  45 ALA C N   
1728 C CA  . ALA C 45 ? 0.3352 0.3119 0.4154 -0.0092 0.0742  0.0589  45 ALA C CA  
1729 C C   . ALA C 45 ? 0.3101 0.3121 0.3912 -0.0043 0.0665  0.0566  45 ALA C C   
1730 O O   . ALA C 45 ? 0.3173 0.3380 0.3981 -0.0024 0.0610  0.0605  45 ALA C O   
1731 C CB  . ALA C 45 ? 0.3324 0.2962 0.4058 -0.0220 0.0722  0.0473  45 ALA C CB  
1732 N N   . ALA C 46 ? 0.2889 0.2911 0.3711 -0.0027 0.0668  0.0497  46 ALA C N   
1733 C CA  . ALA C 46 ? 0.2535 0.2784 0.3385 0.0003  0.0602  0.0463  46 ALA C CA  
1734 C C   . ALA C 46 ? 0.2797 0.3259 0.3716 0.0111  0.0576  0.0558  46 ALA C C   
1735 O O   . ALA C 46 ? 0.2671 0.3344 0.3587 0.0119  0.0501  0.0545  46 ALA C O   
1736 C CB  . ALA C 46 ? 0.2377 0.2581 0.3250 0.0000  0.0631  0.0387  46 ALA C CB  
1737 N N   . GLU C 47 ? 0.3014 0.3420 0.3987 0.0199  0.0637  0.0653  47 GLU C N   
1738 C CA  . GLU C 47 ? 0.3336 0.3952 0.4362 0.0316  0.0608  0.0759  47 GLU C CA  
1739 C C   . GLU C 47 ? 0.2971 0.3682 0.3924 0.0313  0.0568  0.0823  47 GLU C C   
1740 O O   . GLU C 47 ? 0.3367 0.4322 0.4311 0.0360  0.0496  0.0840  47 GLU C O   
1741 C CB  . GLU C 47 ? 0.3886 0.4399 0.4980 0.0425  0.0692  0.0869  47 GLU C CB  
1742 C CG  . GLU C 47 ? 0.4276 0.5038 0.5428 0.0563  0.0651  0.0982  47 GLU C CG  
1743 C CD  . GLU C 47 ? 0.5336 0.5977 0.6539 0.0684  0.0739  0.1126  47 GLU C CD  
1744 O OE1 . GLU C 47 ? 0.5295 0.5825 0.6439 0.0700  0.0781  0.1232  47 GLU C OE1 
1745 O OE2 . GLU C 47 ? 0.5815 0.6470 0.7127 0.0768  0.0775  0.1138  47 GLU C OE2 
1746 N N   . SER C 48 ? 0.3117 0.3643 0.4022 0.0255  0.0619  0.0856  48 SER C N   
1747 C CA  . SER C 48 ? 0.3430 0.4036 0.4278 0.0253  0.0604  0.0930  48 SER C CA  
1748 C C   . SER C 48 ? 0.2780 0.3559 0.3577 0.0195  0.0518  0.0838  48 SER C C   
1749 O O   . SER C 48 ? 0.3036 0.4001 0.3787 0.0238  0.0478  0.0880  48 SER C O   
1750 C CB  . SER C 48 ? 0.4288 0.4658 0.5126 0.0180  0.0681  0.0967  48 SER C CB  
1751 O OG  . SER C 48 ? 0.4974 0.5161 0.5858 0.0239  0.0771  0.1054  48 SER C OG  
1752 N N   . ASP C 49 ? 0.2700 0.3408 0.3495 0.0105  0.0496  0.0712  49 ASP C N   
1753 C CA  . ASP C 49 ? 0.2624 0.3461 0.3378 0.0052  0.0424  0.0619  49 ASP C CA  
1754 C C   . ASP C 49 ? 0.2906 0.3970 0.3670 0.0109  0.0357  0.0582  49 ASP C C   
1755 O O   . ASP C 49 ? 0.2981 0.4192 0.3699 0.0104  0.0306  0.0549  49 ASP C O   
1756 C CB  . ASP C 49 ? 0.2793 0.3483 0.3535 -0.0046 0.0423  0.0511  49 ASP C CB  
1757 C CG  . ASP C 49 ? 0.3417 0.4216 0.4125 -0.0087 0.0358  0.0423  49 ASP C CG  
1758 O OD1 . ASP C 49 ? 0.3007 0.3866 0.3732 -0.0083 0.0329  0.0353  49 ASP C OD1 
1759 O OD2 . ASP C 49 ? 0.3710 0.4540 0.4386 -0.0120 0.0344  0.0428  49 ASP C OD2 
1760 N N   . GLY C 50 ? 0.2466 0.3564 0.3301 0.0157  0.0359  0.0577  50 GLY C N   
1761 C CA  . GLY C 50 ? 0.2863 0.4205 0.3735 0.0215  0.0293  0.0555  50 GLY C CA  
1762 C C   . GLY C 50 ? 0.2575 0.3994 0.3472 0.0151  0.0241  0.0417  50 GLY C C   
1763 O O   . GLY C 50 ? 0.2800 0.4429 0.3742 0.0181  0.0180  0.0379  50 GLY C O   
1764 N N   . ARG C 51 ? 0.1992 0.3248 0.2860 0.0061  0.0261  0.0342  51 ARG C N   
1765 C CA  . ARG C 51 ? 0.2014 0.3305 0.2899 -0.0001 0.0228  0.0224  51 ARG C CA  
1766 C C   . ARG C 51 ? 0.1987 0.3199 0.2952 -0.0027 0.0268  0.0177  51 ARG C C   
1767 O O   . ARG C 51 ? 0.2783 0.4066 0.3799 -0.0064 0.0246  0.0094  51 ARG C O   
1768 C CB  . ARG C 51 ? 0.1900 0.3084 0.2699 -0.0072 0.0223  0.0175  51 ARG C CB  
1769 C CG  . ARG C 51 ? 0.1930 0.3236 0.2662 -0.0049 0.0183  0.0191  51 ARG C CG  
1770 C CD  . ARG C 51 ? 0.2284 0.3484 0.2955 -0.0108 0.0188  0.0157  51 ARG C CD  
1771 N NE  . ARG C 51 ? 0.2148 0.3216 0.2800 -0.0125 0.0229  0.0228  51 ARG C NE  
1772 C CZ  . ARG C 51 ? 0.2129 0.3123 0.2750 -0.0173 0.0231  0.0216  51 ARG C CZ  
1773 N NH1 . ARG C 51 ? 0.2084 0.3113 0.2680 -0.0192 0.0201  0.0148  51 ARG C NH1 
1774 N NH2 . ARG C 51 ? 0.2386 0.3277 0.3008 -0.0201 0.0263  0.0272  51 ARG C NH2 
1775 N N   . ILE C 52 ? 0.2060 0.3114 0.3033 -0.0014 0.0335  0.0224  52 ILE C N   
1776 C CA  . ILE C 52 ? 0.2019 0.2982 0.3049 -0.0035 0.0390  0.0180  52 ILE C CA  
1777 C C   . ILE C 52 ? 0.2348 0.3422 0.3506 0.0053  0.0415  0.0236  52 ILE C C   
1778 O O   . ILE C 52 ? 0.2697 0.3764 0.3856 0.0126  0.0431  0.0329  52 ILE C O   
1779 C CB  . ILE C 52 ? 0.2373 0.3072 0.3310 -0.0081 0.0453  0.0177  52 ILE C CB  
1780 C CG1 . ILE C 52 ? 0.2407 0.3030 0.3236 -0.0161 0.0419  0.0123  52 ILE C CG1 
1781 C CG2 . ILE C 52 ? 0.2349 0.2947 0.3327 -0.0084 0.0529  0.0144  52 ILE C CG2 
1782 C CD1 . ILE C 52 ? 0.3052 0.3456 0.3780 -0.0208 0.0454  0.0124  52 ILE C CD1 
1783 N N   . HIS C 53 ? 0.2136 0.3315 0.3411 0.0049  0.0424  0.0185  53 HIS C N   
1784 C CA  . HIS C 53 ? 0.2104 0.3424 0.3531 0.0138  0.0445  0.0234  53 HIS C CA  
1785 C C   . HIS C 53 ? 0.1990 0.3250 0.3511 0.0118  0.0527  0.0188  53 HIS C C   
1786 O O   . HIS C 53 ? 0.2137 0.3288 0.3609 0.0029  0.0552  0.0111  53 HIS C O   
1787 C CB  . HIS C 53 ? 0.2716 0.4353 0.4244 0.0171  0.0349  0.0226  53 HIS C CB  
1788 C CG  . HIS C 53 ? 0.2853 0.4566 0.4271 0.0197  0.0275  0.0269  53 HIS C CG  
1789 N ND1 . HIS C 53 ? 0.2997 0.4707 0.4310 0.0124  0.0223  0.0201  53 HIS C ND1 
1790 C CD2 . HIS C 53 ? 0.3387 0.5161 0.4774 0.0294  0.0259  0.0382  53 HIS C CD2 
1791 C CE1 . HIS C 53 ? 0.2985 0.4770 0.4210 0.0173  0.0178  0.0263  53 HIS C CE1 
1792 N NE2 . HIS C 53 ? 0.3281 0.5104 0.4544 0.0274  0.0199  0.0377  53 HIS C NE2 
1793 N N   . LYS C 54 ? 0.1897 0.3234 0.3554 0.0209  0.0572  0.0244  54 LYS C N   
1794 C CA  . LYS C 54 ? 0.2069 0.3382 0.3839 0.0207  0.0663  0.0209  54 LYS C CA  
1795 C C   . LYS C 54 ? 0.2251 0.3704 0.4106 0.0116  0.0634  0.0114  54 LYS C C   
1796 O O   . LYS C 54 ? 0.2320 0.4018 0.4260 0.0105  0.0538  0.0090  54 LYS C O   
1797 C CB  . LYS C 54 ? 0.2355 0.3828 0.4310 0.0333  0.0693  0.0286  54 LYS C CB  
1798 C CG  . LYS C 54 ? 0.2630 0.4128 0.4741 0.0340  0.0793  0.0251  54 LYS C CG  
1799 C CD  . LYS C 54 ? 0.2925 0.4566 0.5218 0.0489  0.0828  0.0344  54 LYS C CD  
1800 C CE  . LYS C 54 ? 0.3712 0.5536 0.6243 0.0504  0.0891  0.0311  54 LYS C CE  
1801 N NZ  . LYS C 54 ? 0.4439 0.6431 0.7163 0.0666  0.0916  0.0413  54 LYS C NZ  
1802 N N   . GLY C 55 ? 0.1841 0.3125 0.3658 0.0048  0.0722  0.0059  55 GLY C N   
1803 C CA  . GLY C 55 ? 0.1977 0.3349 0.3873 -0.0043 0.0720  -0.0023 55 GLY C CA  
1804 C C   . GLY C 55 ? 0.1964 0.3188 0.3689 -0.0144 0.0686  -0.0079 55 GLY C C   
1805 O O   . GLY C 55 ? 0.2157 0.3367 0.3915 -0.0224 0.0717  -0.0140 55 GLY C O   
1806 N N   . ASP C 56 ? 0.1762 0.2880 0.3317 -0.0138 0.0629  -0.0055 56 ASP C N   
1807 C CA  . ASP C 56 ? 0.1988 0.2957 0.3382 -0.0218 0.0604  -0.0098 56 ASP C CA  
1808 C C   . ASP C 56 ? 0.2359 0.3080 0.3633 -0.0259 0.0701  -0.0112 56 ASP C C   
1809 O O   . ASP C 56 ? 0.2500 0.3112 0.3748 -0.0219 0.0776  -0.0083 56 ASP C O   
1810 C CB  . ASP C 56 ? 0.2259 0.3182 0.3516 -0.0200 0.0532  -0.0064 56 ASP C CB  
1811 C CG  . ASP C 56 ? 0.2418 0.3577 0.3748 -0.0164 0.0438  -0.0055 56 ASP C CG  
1812 O OD1 . ASP C 56 ? 0.2526 0.3680 0.3770 -0.0129 0.0395  -0.0006 56 ASP C OD1 
1813 O OD2 . ASP C 56 ? 0.1982 0.3338 0.3453 -0.0175 0.0407  -0.0099 56 ASP C OD2 
1814 N N   . ARG C 57 ? 0.2380 0.3010 0.3574 -0.0332 0.0703  -0.0156 57 ARG C N   
1815 C CA  . ARG C 57 ? 0.2508 0.2911 0.3557 -0.0367 0.0786  -0.0162 57 ARG C CA  
1816 C C   . ARG C 57 ? 0.2596 0.2839 0.3435 -0.0383 0.0736  -0.0152 57 ARG C C   
1817 O O   . ARG C 57 ? 0.2530 0.2821 0.3347 -0.0399 0.0656  -0.0159 57 ARG C O   
1818 C CB  . ARG C 57 ? 0.2795 0.3197 0.3897 -0.0432 0.0832  -0.0202 57 ARG C CB  
1819 C CG  . ARG C 57 ? 0.3126 0.3301 0.4063 -0.0460 0.0930  -0.0196 57 ARG C CG  
1820 C CD  . ARG C 57 ? 0.3698 0.3853 0.4688 -0.0524 0.0989  -0.0218 57 ARG C CD  
1821 N NE  . ARG C 57 ? 0.4343 0.4285 0.5154 -0.0537 0.1091  -0.0198 57 ARG C NE  
1822 C CZ  . ARG C 57 ? 0.5072 0.4965 0.5920 -0.0579 0.1197  -0.0197 57 ARG C CZ  
1823 N NH1 . ARG C 57 ? 0.5420 0.5463 0.6501 -0.0624 0.1215  -0.0225 57 ARG C NH1 
1824 N NH2 . ARG C 57 ? 0.5476 0.5173 0.6125 -0.0580 0.1289  -0.0169 57 ARG C NH2 
1825 N N   . VAL C 58 ? 0.2442 0.2503 0.3132 -0.0377 0.0783  -0.0140 58 VAL C N   
1826 C CA  . VAL C 58 ? 0.2160 0.2089 0.2664 -0.0400 0.0731  -0.0136 58 VAL C CA  
1827 C C   . VAL C 58 ? 0.2478 0.2278 0.2848 -0.0444 0.0764  -0.0152 58 VAL C C   
1828 O O   . VAL C 58 ? 0.2951 0.2636 0.3245 -0.0449 0.0853  -0.0159 58 VAL C O   
1829 C CB  . VAL C 58 ? 0.2555 0.2353 0.2960 -0.0382 0.0755  -0.0127 58 VAL C CB  
1830 C CG1 . VAL C 58 ? 0.3144 0.2838 0.3382 -0.0418 0.0690  -0.0131 58 VAL C CG1 
1831 C CG2 . VAL C 58 ? 0.2996 0.2897 0.3538 -0.0327 0.0745  -0.0093 58 VAL C CG2 
1832 N N   . LEU C 59 ? 0.2788 0.2605 0.3125 -0.0466 0.0698  -0.0152 59 LEU C N   
1833 C CA  . LEU C 59 ? 0.2580 0.2279 0.2798 -0.0495 0.0725  -0.0150 59 LEU C CA  
1834 C C   . LEU C 59 ? 0.2918 0.2484 0.2923 -0.0498 0.0688  -0.0135 59 LEU C C   
1835 O O   . LEU C 59 ? 0.3415 0.2851 0.3268 -0.0509 0.0731  -0.0123 59 LEU C O   
1836 C CB  . LEU C 59 ? 0.2714 0.2486 0.3015 -0.0509 0.0682  -0.0158 59 LEU C CB  
1837 C CG  . LEU C 59 ? 0.2864 0.2773 0.3375 -0.0526 0.0710  -0.0191 59 LEU C CG  
1838 C CD1 . LEU C 59 ? 0.3062 0.3030 0.3634 -0.0542 0.0655  -0.0218 59 LEU C CD1 
1839 C CD2 . LEU C 59 ? 0.3611 0.3456 0.4154 -0.0554 0.0823  -0.0193 59 LEU C CD2 
1840 N N   . ALA C 60 ? 0.2888 0.2496 0.2879 -0.0490 0.0608  -0.0132 60 ALA C N   
1841 C CA  . ALA C 60 ? 0.2852 0.2372 0.2667 -0.0503 0.0555  -0.0125 60 ALA C CA  
1842 C C   . ALA C 60 ? 0.2990 0.2552 0.2827 -0.0507 0.0496  -0.0130 60 ALA C C   
1843 O O   . ALA C 60 ? 0.2870 0.2546 0.2855 -0.0491 0.0479  -0.0121 60 ALA C O   
1844 C CB  . ALA C 60 ? 0.3088 0.2626 0.2869 -0.0498 0.0499  -0.0101 60 ALA C CB  
1845 N N   . VAL C 61 ? 0.2824 0.2300 0.2513 -0.0533 0.0463  -0.0143 61 VAL C N   
1846 C CA  . VAL C 61 ? 0.2997 0.2492 0.2707 -0.0555 0.0413  -0.0153 61 VAL C CA  
1847 C C   . VAL C 61 ? 0.3199 0.2716 0.2817 -0.0581 0.0320  -0.0150 61 VAL C C   
1848 O O   . VAL C 61 ? 0.3572 0.3005 0.3020 -0.0592 0.0311  -0.0163 61 VAL C O   
1849 C CB  . VAL C 61 ? 0.3438 0.2790 0.3062 -0.0576 0.0472  -0.0196 61 VAL C CB  
1850 C CG1 . VAL C 61 ? 0.3450 0.2797 0.3106 -0.0614 0.0428  -0.0211 61 VAL C CG1 
1851 C CG2 . VAL C 61 ? 0.3590 0.2923 0.3307 -0.0538 0.0573  -0.0194 61 VAL C CG2 
1852 N N   . ASN C 62 ? 0.2926 0.2568 0.2654 -0.0585 0.0253  -0.0129 62 ASN C N   
1853 C CA  . ASN C 62 ? 0.2984 0.2685 0.2664 -0.0605 0.0161  -0.0122 62 ASN C CA  
1854 C C   . ASN C 62 ? 0.3226 0.2907 0.2789 -0.0575 0.0139  -0.0102 62 ASN C C   
1855 O O   . ASN C 62 ? 0.3507 0.3172 0.2941 -0.0591 0.0080  -0.0107 62 ASN C O   
1856 C CB  . ASN C 62 ? 0.3142 0.2786 0.2747 -0.0669 0.0128  -0.0166 62 ASN C CB  
1857 C CG  . ASN C 62 ? 0.3240 0.2917 0.2987 -0.0699 0.0139  -0.0168 62 ASN C CG  
1858 O OD1 . ASN C 62 ? 0.2845 0.2628 0.2741 -0.0667 0.0150  -0.0123 62 ASN C OD1 
1859 N ND2 . ASN C 62 ? 0.3491 0.3069 0.3184 -0.0762 0.0142  -0.0219 62 ASN C ND2 
1860 N N   . GLY C 63 ? 0.3152 0.2834 0.2763 -0.0532 0.0185  -0.0077 63 GLY C N   
1861 C CA  . GLY C 63 ? 0.3157 0.2813 0.2688 -0.0495 0.0175  -0.0042 63 GLY C CA  
1862 C C   . GLY C 63 ? 0.3373 0.2874 0.2731 -0.0494 0.0240  -0.0041 63 GLY C C   
1863 O O   . GLY C 63 ? 0.3462 0.2916 0.2740 -0.0459 0.0246  0.0002  63 GLY C O   
1864 N N   . VAL C 64 ? 0.3316 0.2731 0.2618 -0.0524 0.0300  -0.0080 64 VAL C N   
1865 C CA  . VAL C 64 ? 0.3856 0.3124 0.2976 -0.0521 0.0375  -0.0081 64 VAL C CA  
1866 C C   . VAL C 64 ? 0.3560 0.2784 0.2773 -0.0520 0.0492  -0.0095 64 VAL C C   
1867 O O   . VAL C 64 ? 0.3643 0.2901 0.2970 -0.0533 0.0516  -0.0128 64 VAL C O   
1868 C CB  . VAL C 64 ? 0.4284 0.3475 0.3217 -0.0554 0.0352  -0.0127 64 VAL C CB  
1869 C CG1 . VAL C 64 ? 0.4500 0.3539 0.3218 -0.0544 0.0440  -0.0126 64 VAL C CG1 
1870 C CG2 . VAL C 64 ? 0.4511 0.3783 0.3376 -0.0563 0.0222  -0.0119 64 VAL C CG2 
1871 N N   . SER C 65 ? 0.3587 0.2744 0.2764 -0.0504 0.0567  -0.0062 65 SER C N   
1872 C CA  . SER C 65 ? 0.3810 0.2954 0.3108 -0.0508 0.0680  -0.0073 65 SER C CA  
1873 C C   . SER C 65 ? 0.3875 0.2940 0.3098 -0.0517 0.0761  -0.0110 65 SER C C   
1874 O O   . SER C 65 ? 0.4209 0.3168 0.3211 -0.0522 0.0762  -0.0123 65 SER C O   
1875 C CB  . SER C 65 ? 0.4333 0.3400 0.3596 -0.0500 0.0754  -0.0028 65 SER C CB  
1876 O OG  . SER C 65 ? 0.4472 0.3526 0.3841 -0.0515 0.0874  -0.0041 65 SER C OG  
1877 N N   . LEU C 66 ? 0.3757 0.2878 0.3160 -0.0516 0.0829  -0.0131 66 LEU C N   
1878 C CA  . LEU C 66 ? 0.4107 0.3151 0.3465 -0.0511 0.0930  -0.0163 66 LEU C CA  
1879 C C   . LEU C 66 ? 0.4216 0.3190 0.3537 -0.0509 0.1061  -0.0142 66 LEU C C   
1880 O O   . LEU C 66 ? 0.4386 0.3325 0.3726 -0.0498 0.1169  -0.0163 66 LEU C O   
1881 C CB  . LEU C 66 ? 0.3882 0.3031 0.3460 -0.0494 0.0943  -0.0184 66 LEU C CB  
1882 C CG  . LEU C 66 ? 0.3803 0.3001 0.3417 -0.0496 0.0841  -0.0195 66 LEU C CG  
1883 C CD1 . LEU C 66 ? 0.3796 0.3084 0.3612 -0.0465 0.0870  -0.0196 66 LEU C CD1 
1884 C CD2 . LEU C 66 ? 0.4235 0.3289 0.3629 -0.0517 0.0824  -0.0233 66 LEU C CD2 
1885 N N   . GLU C 67 ? 0.4300 0.3247 0.3575 -0.0517 0.1062  -0.0096 67 GLU C N   
1886 C CA  . GLU C 67 ? 0.5114 0.3976 0.4342 -0.0521 0.1198  -0.0065 67 GLU C CA  
1887 C C   . GLU C 67 ? 0.4937 0.3658 0.3924 -0.0508 0.1286  -0.0080 67 GLU C C   
1888 O O   . GLU C 67 ? 0.5440 0.4075 0.4179 -0.0501 0.1222  -0.0089 67 GLU C O   
1889 C CB  . GLU C 67 ? 0.5776 0.4577 0.4926 -0.0525 0.1185  -0.0003 67 GLU C CB  
1890 C CG  . GLU C 67 ? 0.6621 0.5275 0.5603 -0.0523 0.1322  0.0046  67 GLU C CG  
1891 C CD  . GLU C 67 ? 0.7294 0.5934 0.6419 -0.0547 0.1398  0.0095  67 GLU C CD  
1892 O OE1 . GLU C 67 ? 0.7749 0.6273 0.6775 -0.0552 0.1533  0.0144  67 GLU C OE1 
1893 O OE2 . GLU C 67 ? 0.7241 0.5979 0.6572 -0.0564 0.1330  0.0081  67 GLU C OE2 
1894 N N   . GLY C 68 ? 0.4464 0.3175 0.3528 -0.0505 0.1432  -0.0088 68 GLY C N   
1895 C CA  . GLY C 68 ? 0.4661 0.3234 0.3500 -0.0488 0.1549  -0.0104 68 GLY C CA  
1896 C C   . GLY C 68 ? 0.4967 0.3501 0.3731 -0.0469 0.1535  -0.0179 68 GLY C C   
1897 O O   . GLY C 68 ? 0.5722 0.4121 0.4258 -0.0454 0.1622  -0.0212 68 GLY C O   
1898 N N   . ALA C 69 ? 0.4535 0.3175 0.3482 -0.0470 0.1433  -0.0209 69 ALA C N   
1899 C CA  . ALA C 69 ? 0.4675 0.3265 0.3577 -0.0458 0.1413  -0.0275 69 ALA C CA  
1900 C C   . ALA C 69 ? 0.4728 0.3314 0.3757 -0.0420 0.1560  -0.0300 69 ALA C C   
1901 O O   . ALA C 69 ? 0.4729 0.3457 0.4031 -0.0403 0.1610  -0.0269 69 ALA C O   
1902 C CB  . ALA C 69 ? 0.4664 0.3366 0.3730 -0.0468 0.1270  -0.0279 69 ALA C CB  
1903 N N   . THR C 70 ? 0.5130 0.3561 0.3966 -0.0403 0.1628  -0.0362 70 THR C N   
1904 C CA  . THR C 70 ? 0.5010 0.3428 0.3978 -0.0353 0.1754  -0.0393 70 THR C CA  
1905 C C   . THR C 70 ? 0.4665 0.3155 0.3831 -0.0339 0.1663  -0.0402 70 THR C C   
1906 O O   . THR C 70 ? 0.4447 0.2966 0.3594 -0.0377 0.1516  -0.0398 70 THR C O   
1907 C CB  . THR C 70 ? 0.5840 0.4043 0.4523 -0.0339 0.1853  -0.0471 70 THR C CB  
1908 O OG1 . THR C 70 ? 0.5977 0.4072 0.4488 -0.0374 0.1735  -0.0535 70 THR C OG1 
1909 C CG2 . THR C 70 ? 0.5874 0.3988 0.4292 -0.0351 0.1936  -0.0455 70 THR C CG2 
1910 N N   . HIS C 71 ? 0.4581 0.3102 0.3938 -0.0279 0.1756  -0.0408 71 HIS C N   
1911 C CA  . HIS C 71 ? 0.4634 0.3212 0.4171 -0.0253 0.1684  -0.0399 71 HIS C CA  
1912 C C   . HIS C 71 ? 0.4444 0.2843 0.3775 -0.0291 0.1613  -0.0461 71 HIS C C   
1913 O O   . HIS C 71 ? 0.4462 0.2914 0.3861 -0.0317 0.1489  -0.0442 71 HIS C O   
1914 C CB  . HIS C 71 ? 0.4952 0.3561 0.4693 -0.0165 0.1811  -0.0392 71 HIS C CB  
1915 C CG  . HIS C 71 ? 0.4798 0.3486 0.4744 -0.0123 0.1745  -0.0356 71 HIS C CG  
1916 N ND1 . HIS C 71 ? 0.4880 0.3389 0.4755 -0.0103 0.1756  -0.0393 71 HIS C ND1 
1917 C CD2 . HIS C 71 ? 0.4417 0.3338 0.4623 -0.0097 0.1666  -0.0285 71 HIS C CD2 
1918 C CE1 . HIS C 71 ? 0.4552 0.3176 0.4638 -0.0060 0.1696  -0.0331 71 HIS C CE1 
1919 N NE2 . HIS C 71 ? 0.4604 0.3486 0.4882 -0.0054 0.1635  -0.0266 71 HIS C NE2 
1920 N N   . LYS C 72 ? 0.4913 0.3102 0.3992 -0.0298 0.1695  -0.0539 72 LYS C N   
1921 C CA  . LYS C 72 ? 0.5198 0.3205 0.4095 -0.0342 0.1641  -0.0620 72 LYS C CA  
1922 C C   . LYS C 72 ? 0.5389 0.3444 0.4156 -0.0424 0.1474  -0.0616 72 LYS C C   
1923 O O   . LYS C 72 ? 0.5316 0.3363 0.4109 -0.0468 0.1367  -0.0631 72 LYS C O   
1924 C CB  . LYS C 72 ? 0.6093 0.3864 0.4732 -0.0333 0.1770  -0.0721 72 LYS C CB  
1925 C CG  . LYS C 72 ? 0.7097 0.4801 0.5890 -0.0241 0.1935  -0.0731 72 LYS C CG  
1926 C CD  . LYS C 72 ? 0.7464 0.5274 0.6574 -0.0198 0.1892  -0.0664 72 LYS C CD  
1927 C CE  . LYS C 72 ? 0.7388 0.5079 0.6438 -0.0260 0.1784  -0.0706 72 LYS C CE  
1928 N NZ  . LYS C 72 ? 0.6038 0.3849 0.5369 -0.0225 0.1727  -0.0619 72 LYS C NZ  
1929 N N   . GLN C 73 ? 0.5028 0.3140 0.3676 -0.0441 0.1457  -0.0585 73 GLN C N   
1930 C CA  . GLN C 73 ? 0.4980 0.3166 0.3540 -0.0498 0.1301  -0.0562 73 GLN C CA  
1931 C C   . GLN C 73 ? 0.4587 0.2954 0.3409 -0.0504 0.1189  -0.0496 73 GLN C C   
1932 O O   . GLN C 73 ? 0.4987 0.3377 0.3786 -0.0551 0.1064  -0.0507 73 GLN C O   
1933 C CB  . GLN C 73 ? 0.5298 0.3511 0.3716 -0.0496 0.1322  -0.0516 73 GLN C CB  
1934 C CG  . GLN C 73 ? 0.5888 0.3925 0.3977 -0.0498 0.1406  -0.0578 73 GLN C CG  
1935 C CD  . GLN C 73 ? 0.5916 0.3968 0.3876 -0.0484 0.1455  -0.0512 73 GLN C CD  
1936 O OE1 . GLN C 73 ? 0.5845 0.4021 0.4007 -0.0468 0.1477  -0.0428 73 GLN C OE1 
1937 N NE2 . GLN C 73 ? 0.7021 0.4943 0.4634 -0.0492 0.1475  -0.0549 73 GLN C NE2 
1938 N N   . ALA C 74 ? 0.4277 0.2782 0.3349 -0.0457 0.1233  -0.0432 74 ALA C N   
1939 C CA  . ALA C 74 ? 0.4014 0.2697 0.3323 -0.0454 0.1136  -0.0374 74 ALA C CA  
1940 C C   . ALA C 74 ? 0.3858 0.2506 0.3239 -0.0459 0.1093  -0.0390 74 ALA C C   
1941 O O   . ALA C 74 ? 0.3904 0.2633 0.3337 -0.0491 0.0979  -0.0368 74 ALA C O   
1942 C CB  . ALA C 74 ? 0.3965 0.2802 0.3518 -0.0403 0.1197  -0.0319 74 ALA C CB  
1943 N N   . VAL C 75 ? 0.3978 0.2502 0.3374 -0.0423 0.1195  -0.0424 75 VAL C N   
1944 C CA  . VAL C 75 ? 0.4094 0.2542 0.3552 -0.0427 0.1177  -0.0437 75 VAL C CA  
1945 C C   . VAL C 75 ? 0.4364 0.2703 0.3638 -0.0518 0.1087  -0.0502 75 VAL C C   
1946 O O   . VAL C 75 ? 0.4182 0.2564 0.3542 -0.0552 0.1004  -0.0481 75 VAL C O   
1947 C CB  . VAL C 75 ? 0.4358 0.2652 0.3842 -0.0365 0.1321  -0.0468 75 VAL C CB  
1948 C CG1 . VAL C 75 ? 0.4943 0.3102 0.4464 -0.0376 0.1318  -0.0486 75 VAL C CG1 
1949 C CG2 . VAL C 75 ? 0.4254 0.2710 0.3971 -0.0272 0.1393  -0.0393 75 VAL C CG2 
1950 N N   . GLU C 76 ? 0.4426 0.2644 0.3450 -0.0557 0.1099  -0.0578 76 GLU C N   
1951 C CA  . GLU C 76 ? 0.4764 0.2903 0.3610 -0.0647 0.1001  -0.0651 76 GLU C CA  
1952 C C   . GLU C 76 ? 0.4599 0.2929 0.3501 -0.0686 0.0852  -0.0594 76 GLU C C   
1953 O O   . GLU C 76 ? 0.4802 0.3147 0.3720 -0.0751 0.0759  -0.0616 76 GLU C O   
1954 C CB  . GLU C 76 ? 0.5563 0.3549 0.4103 -0.0672 0.1040  -0.0744 76 GLU C CB  
1955 C CG  . GLU C 76 ? 0.6758 0.4516 0.5224 -0.0654 0.1177  -0.0833 76 GLU C CG  
1956 C CD  . GLU C 76 ? 0.7734 0.5381 0.6292 -0.0702 0.1157  -0.0882 76 GLU C CD  
1957 O OE1 . GLU C 76 ? 0.7783 0.5377 0.6529 -0.0643 0.1250  -0.0847 76 GLU C OE1 
1958 O OE2 . GLU C 76 ? 0.8150 0.5771 0.6603 -0.0798 0.1049  -0.0948 76 GLU C OE2 
1959 N N   . THR C 77 ? 0.4406 0.2877 0.3351 -0.0646 0.0839  -0.0522 77 THR C N   
1960 C CA  . THR C 77 ? 0.4208 0.2853 0.3216 -0.0664 0.0716  -0.0464 77 THR C CA  
1961 C C   . THR C 77 ? 0.4221 0.2981 0.3465 -0.0662 0.0670  -0.0415 77 THR C C   
1962 O O   . THR C 77 ? 0.4429 0.3275 0.3706 -0.0706 0.0566  -0.0405 77 THR C O   
1963 C CB  . THR C 77 ? 0.4254 0.2990 0.3269 -0.0619 0.0735  -0.0402 77 THR C CB  
1964 O OG1 . THR C 77 ? 0.4578 0.3207 0.3339 -0.0627 0.0763  -0.0435 77 THR C OG1 
1965 C CG2 . THR C 77 ? 0.4163 0.3072 0.3283 -0.0623 0.0623  -0.0340 77 THR C CG2 
1966 N N   . LEU C 78 ? 0.3807 0.2576 0.3216 -0.0607 0.0751  -0.0381 78 LEU C N   
1967 C CA  . LEU C 78 ? 0.3920 0.2789 0.3529 -0.0595 0.0717  -0.0325 78 LEU C CA  
1968 C C   . LEU C 78 ? 0.4049 0.2804 0.3641 -0.0656 0.0697  -0.0364 78 LEU C C   
1969 O O   . LEU C 78 ? 0.4248 0.3098 0.3947 -0.0683 0.0631  -0.0325 78 LEU C O   
1970 C CB  . LEU C 78 ? 0.3783 0.2695 0.3560 -0.0512 0.0804  -0.0274 78 LEU C CB  
1971 C CG  . LEU C 78 ? 0.3645 0.2728 0.3513 -0.0468 0.0799  -0.0228 78 LEU C CG  
1972 C CD1 . LEU C 78 ? 0.3732 0.2841 0.3724 -0.0394 0.0900  -0.0206 78 LEU C CD1 
1973 C CD2 . LEU C 78 ? 0.3483 0.2758 0.3473 -0.0467 0.0702  -0.0171 78 LEU C CD2 
1974 N N   . ARG C 79 ? 0.4083 0.2632 0.3544 -0.0680 0.0765  -0.0445 79 ARG C N   
1975 C CA  . ARG C 79 ? 0.4586 0.2991 0.4041 -0.0747 0.0765  -0.0498 79 ARG C CA  
1976 C C   . ARG C 79 ? 0.5006 0.3442 0.4358 -0.0852 0.0646  -0.0556 79 ARG C C   
1977 O O   . ARG C 79 ? 0.5123 0.3552 0.4561 -0.0919 0.0607  -0.0563 79 ARG C O   
1978 C CB  . ARG C 79 ? 0.5376 0.3531 0.4724 -0.0737 0.0886  -0.0581 79 ARG C CB  
1979 C CG  . ARG C 79 ? 0.5586 0.3703 0.5087 -0.0633 0.1006  -0.0518 79 ARG C CG  
1980 C CD  . ARG C 79 ? 0.6559 0.4419 0.5949 -0.0614 0.1136  -0.0605 79 ARG C CD  
1981 N NE  . ARG C 79 ? 0.7077 0.4920 0.6639 -0.0498 0.1251  -0.0533 79 ARG C NE  
1982 C CZ  . ARG C 79 ? 0.7510 0.5190 0.7029 -0.0434 0.1388  -0.0576 79 ARG C CZ  
1983 N NH1 . ARG C 79 ? 0.7592 0.5095 0.6879 -0.0479 0.1433  -0.0700 79 ARG C NH1 
1984 N NH2 . ARG C 79 ? 0.7713 0.5416 0.7419 -0.0318 0.1480  -0.0494 79 ARG C NH2 
1985 N N   . ASN C 80 ? 0.4647 0.3126 0.3826 -0.0865 0.0591  -0.0590 80 ASN C N   
1986 C CA  . ASN C 80 ? 0.4910 0.3440 0.3978 -0.0953 0.0469  -0.0645 80 ASN C CA  
1987 C C   . ASN C 80 ? 0.4495 0.3261 0.3704 -0.0953 0.0362  -0.0562 80 ASN C C   
1988 O O   . ASN C 80 ? 0.4447 0.3332 0.3578 -0.0938 0.0287  -0.0539 80 ASN C O   
1989 C CB  . ASN C 80 ? 0.5943 0.4409 0.4740 -0.0954 0.0458  -0.0709 80 ASN C CB  
1990 C CG  . ASN C 80 ? 0.7104 0.5323 0.5726 -0.0980 0.0551  -0.0825 80 ASN C CG  
1991 O OD1 . ASN C 80 ? 0.7196 0.5282 0.5887 -0.1024 0.0593  -0.0879 80 ASN C OD1 
1992 N ND2 . ASN C 80 ? 0.7737 0.5881 0.6128 -0.0948 0.0594  -0.0861 80 ASN C ND2 
1993 N N   . THR C 81 ? 0.4346 0.3173 0.3765 -0.0958 0.0368  -0.0507 81 THR C N   
1994 C CA  . THR C 81 ? 0.3669 0.2718 0.3243 -0.0942 0.0294  -0.0421 81 THR C CA  
1995 C C   . THR C 81 ? 0.3733 0.2801 0.3458 -0.1013 0.0275  -0.0416 81 THR C C   
1996 O O   . THR C 81 ? 0.4003 0.2897 0.3719 -0.1069 0.0328  -0.0474 81 THR C O   
1997 C CB  . THR C 81 ? 0.3716 0.2845 0.3411 -0.0841 0.0353  -0.0329 81 THR C CB  
1998 O OG1 . THR C 81 ? 0.3643 0.2650 0.3411 -0.0811 0.0455  -0.0317 81 THR C OG1 
1999 C CG2 . THR C 81 ? 0.3696 0.2834 0.3280 -0.0780 0.0370  -0.0325 81 THR C CG2 
2000 N N   . GLY C 82 ? 0.3764 0.3033 0.3629 -0.1012 0.0212  -0.0348 82 GLY C N   
2001 C CA  . GLY C 82 ? 0.3445 0.2760 0.3472 -0.1077 0.0204  -0.0325 82 GLY C CA  
2002 C C   . GLY C 82 ? 0.3318 0.2633 0.3489 -0.1011 0.0291  -0.0229 82 GLY C C   
2003 O O   . GLY C 82 ? 0.3782 0.3039 0.3925 -0.0924 0.0358  -0.0199 82 GLY C O   
2004 N N   . GLN C 83 ? 0.3178 0.2580 0.3505 -0.1048 0.0289  -0.0174 83 GLN C N   
2005 C CA  . GLN C 83 ? 0.3221 0.2612 0.3670 -0.0993 0.0374  -0.0076 83 GLN C CA  
2006 C C   . GLN C 83 ? 0.2998 0.2563 0.3476 -0.0877 0.0369  0.0009  83 GLN C C   
2007 O O   . GLN C 83 ? 0.2938 0.2482 0.3455 -0.0797 0.0436  0.0078  83 GLN C O   
2008 C CB  . GLN C 83 ? 0.3289 0.2717 0.3885 -0.1080 0.0380  -0.0043 83 GLN C CB  
2009 C CG  . GLN C 83 ? 0.3463 0.2951 0.4189 -0.1019 0.0451  0.0088  83 GLN C CG  
2010 C CD  . GLN C 83 ? 0.3848 0.3165 0.4554 -0.0937 0.0554  0.0138  83 GLN C CD  
2011 O OE1 . GLN C 83 ? 0.4477 0.3582 0.5105 -0.0951 0.0596  0.0070  83 GLN C OE1 
2012 N NE2 . GLN C 83 ? 0.4029 0.3443 0.4800 -0.0842 0.0596  0.0259  83 GLN C NE2 
2013 N N   . VAL C 84 ? 0.2592 0.2326 0.3049 -0.0865 0.0288  0.0000  84 VAL C N   
2014 C CA  . VAL C 84 ? 0.2535 0.2415 0.3002 -0.0766 0.0278  0.0051  84 VAL C CA  
2015 C C   . VAL C 84 ? 0.2910 0.2770 0.3250 -0.0742 0.0242  -0.0007 84 VAL C C   
2016 O O   . VAL C 84 ? 0.3076 0.2938 0.3345 -0.0791 0.0180  -0.0059 84 VAL C O   
2017 C CB  . VAL C 84 ? 0.2562 0.2653 0.3130 -0.0761 0.0235  0.0104  84 VAL C CB  
2018 C CG1 . VAL C 84 ? 0.3656 0.3877 0.4197 -0.0678 0.0206  0.0115  84 VAL C CG1 
2019 C CG2 . VAL C 84 ? 0.3085 0.3203 0.3766 -0.0753 0.0298  0.0188  84 VAL C CG2 
2020 N N   . VAL C 85 ? 0.2594 0.2441 0.2909 -0.0668 0.0282  0.0006  85 VAL C N   
2021 C CA  . VAL C 85 ? 0.2706 0.2499 0.2909 -0.0649 0.0278  -0.0042 85 VAL C CA  
2022 C C   . VAL C 85 ? 0.2745 0.2675 0.2983 -0.0584 0.0261  -0.0015 85 VAL C C   
2023 O O   . VAL C 85 ? 0.2426 0.2440 0.2752 -0.0533 0.0287  0.0027  85 VAL C O   
2024 C CB  . VAL C 85 ? 0.2822 0.2454 0.2977 -0.0629 0.0359  -0.0067 85 VAL C CB  
2025 C CG1 . VAL C 85 ? 0.2953 0.2525 0.2986 -0.0617 0.0370  -0.0114 85 VAL C CG1 
2026 C CG2 . VAL C 85 ? 0.2769 0.2235 0.2893 -0.0692 0.0391  -0.0104 85 VAL C CG2 
2027 N N   . HIS C 86 ? 0.2525 0.2474 0.2690 -0.0586 0.0218  -0.0039 86 HIS C N   
2028 C CA  . HIS C 86 ? 0.2519 0.2560 0.2711 -0.0535 0.0210  -0.0027 86 HIS C CA  
2029 C C   . HIS C 86 ? 0.2805 0.2762 0.2957 -0.0513 0.0269  -0.0050 86 HIS C C   
2030 O O   . HIS C 86 ? 0.3048 0.2879 0.3087 -0.0534 0.0290  -0.0081 86 HIS C O   
2031 C CB  . HIS C 86 ? 0.2386 0.2468 0.2527 -0.0539 0.0149  -0.0031 86 HIS C CB  
2032 C CG  . HIS C 86 ? 0.2836 0.2995 0.3014 -0.0489 0.0145  -0.0023 86 HIS C CG  
2033 N ND1 . HIS C 86 ? 0.3255 0.3397 0.3371 -0.0473 0.0118  -0.0024 86 HIS C ND1 
2034 C CD2 . HIS C 86 ? 0.3056 0.3304 0.3323 -0.0451 0.0166  -0.0017 86 HIS C CD2 
2035 C CE1 . HIS C 86 ? 0.3377 0.3572 0.3548 -0.0432 0.0131  -0.0025 86 HIS C CE1 
2036 N NE2 . HIS C 86 ? 0.3291 0.3558 0.3550 -0.0423 0.0156  -0.0028 86 HIS C NE2 
2037 N N   . LEU C 87 ? 0.2613 0.2649 0.2859 -0.0471 0.0298  -0.0037 87 LEU C N   
2038 C CA  . LEU C 87 ? 0.2330 0.2321 0.2581 -0.0454 0.0356  -0.0058 87 LEU C CA  
2039 C C   . LEU C 87 ? 0.2373 0.2459 0.2680 -0.0434 0.0347  -0.0070 87 LEU C C   
2040 O O   . LEU C 87 ? 0.2352 0.2570 0.2732 -0.0412 0.0309  -0.0060 87 LEU C O   
2041 C CB  . LEU C 87 ? 0.2139 0.2152 0.2477 -0.0423 0.0402  -0.0037 87 LEU C CB  
2042 C CG  . LEU C 87 ? 0.2388 0.2272 0.2685 -0.0440 0.0435  -0.0031 87 LEU C CG  
2043 C CD1 . LEU C 87 ? 0.2730 0.2657 0.3135 -0.0387 0.0478  0.0010  87 LEU C CD1 
2044 C CD2 . LEU C 87 ? 0.2823 0.2542 0.2998 -0.0468 0.0481  -0.0079 87 LEU C CD2 
2045 N N   . LEU C 88 ? 0.2436 0.2446 0.2704 -0.0445 0.0388  -0.0095 88 LEU C N   
2046 C CA  . LEU C 88 ? 0.2242 0.2313 0.2578 -0.0440 0.0394  -0.0117 88 LEU C CA  
2047 C C   . LEU C 88 ? 0.2407 0.2508 0.2838 -0.0437 0.0456  -0.0134 88 LEU C C   
2048 O O   . LEU C 88 ? 0.2489 0.2484 0.2872 -0.0446 0.0520  -0.0134 88 LEU C O   
2049 C CB  . LEU C 88 ? 0.2605 0.2556 0.2836 -0.0458 0.0407  -0.0121 88 LEU C CB  
2050 C CG  . LEU C 88 ? 0.2401 0.2358 0.2690 -0.0465 0.0432  -0.0146 88 LEU C CG  
2051 C CD1 . LEU C 88 ? 0.2534 0.2604 0.2889 -0.0445 0.0372  -0.0160 88 LEU C CD1 
2052 C CD2 . LEU C 88 ? 0.3066 0.2862 0.3228 -0.0475 0.0467  -0.0126 88 LEU C CD2 
2053 N N   . LEU C 89 ? 0.4136 0.2311 0.2716 -0.0836 -0.0067 0.0141  89 LEU C N   
2054 C CA  . LEU C 89 ? 0.4254 0.2447 0.2947 -0.0764 0.0197  -0.0073 89 LEU C CA  
2055 C C   . LEU C 89 ? 0.3958 0.2358 0.2957 -0.0725 0.0315  -0.0132 89 LEU C C   
2056 O O   . LEU C 89 ? 0.3793 0.2272 0.2962 -0.0694 0.0244  -0.0065 89 LEU C O   
2057 C CB  . LEU C 89 ? 0.3878 0.2317 0.2865 -0.0607 0.0227  -0.0138 89 LEU C CB  
2058 C CG  . LEU C 89 ? 0.4338 0.2437 0.2933 -0.0686 0.0198  -0.0126 89 LEU C CG  
2059 C CD1 . LEU C 89 ? 0.4033 0.2347 0.2804 -0.0665 -0.0079 -0.0006 89 LEU C CD1 
2060 C CD2 . LEU C 89 ? 0.4614 0.2585 0.3211 -0.0551 0.0522  -0.0221 89 LEU C CD2 
2061 N N   . GLU C 90 ? 0.3720 0.2183 0.2769 -0.0743 0.0539  -0.0241 90 GLU C N   
2062 C CA  . GLU C 90 ? 0.3533 0.2327 0.2902 -0.0785 0.0635  -0.0308 90 GLU C CA  
2063 C C   . GLU C 90 ? 0.3212 0.2555 0.3004 -0.0687 0.0684  -0.0315 90 GLU C C   
2064 O O   . GLU C 90 ? 0.3464 0.2833 0.3287 -0.0572 0.0840  -0.0271 90 GLU C O   
2065 C CB  . GLU C 90 ? 0.4407 0.3022 0.3599 -0.0920 0.0838  -0.0342 90 GLU C CB  
2066 C CG  . GLU C 90 ? 0.4387 0.3419 0.3893 -0.1053 0.0934  -0.0403 90 GLU C CG  
2067 C CD  . GLU C 90 ? 0.5319 0.4283 0.4736 -0.1184 0.1155  -0.0413 90 GLU C CD  
2068 O OE1 . GLU C 90 ? 0.6047 0.4559 0.5107 -0.1150 0.1249  -0.0387 90 GLU C OE1 
2069 O OE2 . GLU C 90 ? 0.5168 0.4537 0.4830 -0.1369 0.1231  -0.0436 90 GLU C OE2 
2070 N N   . LYS C 91 ? 0.2936 0.2689 0.3019 -0.0738 0.0590  -0.0339 91 LYS C N   
2071 C CA  . LYS C 91 ? 0.2706 0.3123 0.3223 -0.0673 0.0586  -0.0272 91 LYS C CA  
2072 C C   . LYS C 91 ? 0.2892 0.3758 0.3662 -0.0752 0.0780  -0.0187 91 LYS C C   
2073 O O   . LYS C 91 ? 0.2950 0.3821 0.3636 -0.0996 0.0833  -0.0246 91 LYS C O   
2074 C CB  . LYS C 91 ? 0.2487 0.3175 0.3107 -0.0799 0.0425  -0.0326 91 LYS C CB  
2075 C CG  . LYS C 91 ? 0.2591 0.4104 0.3631 -0.0845 0.0376  -0.0222 91 LYS C CG  
2076 C CD  . LYS C 91 ? 0.3052 0.4762 0.4338 -0.0538 0.0329  -0.0091 91 LYS C CD  
2077 C CE  . LYS C 91 ? 0.3023 0.5630 0.4738 -0.0588 0.0244  0.0071  91 LYS C CE  
2078 N NZ  . LYS C 91 ? 0.3063 0.5851 0.5058 -0.0240 0.0271  0.0248  91 LYS C NZ  
2079 N N   . GLY C 92 ? 0.2835 0.4046 0.3920 -0.0527 0.0935  -0.0009 92 GLY C N   
2080 C CA  . GLY C 92 ? 0.3034 0.4728 0.4456 -0.0521 0.1180  0.0175  92 GLY C CA  
2081 C C   . GLY C 92 ? 0.3550 0.6290 0.5500 -0.0723 0.1059  0.0346  92 GLY C C   
2082 O O   . GLY C 92 ? 0.3440 0.6465 0.5433 -0.0850 0.0807  0.0299  92 GLY C O   
2083 N N   . GLN C 93 ? 0.4537 0.7872 0.6859 -0.0792 0.1242  0.0569  93 GLN C N   
2084 C CA  . GLN C 93 ? 0.5458 0.9958 0.8299 -0.1075 0.1099  0.0812  93 GLN C CA  
2085 C C   . GLN C 93 ? 0.6190 1.1487 0.9583 -0.0813 0.1054  0.1145  93 GLN C C   
2086 O O   . GLN C 93 ? 0.6099 1.1253 0.9707 -0.0341 0.1329  0.1340  93 GLN C O   
2087 C CB  . GLN C 93 ? 0.5849 1.0914 0.9042 -0.1211 0.1310  0.1055  93 GLN C CB  
2088 C CG  . GLN C 93 ? 0.6277 1.1056 0.9048 -0.1729 0.1211  0.0785  93 GLN C CG  
2089 C CD  . GLN C 93 ? 0.6566 1.1748 0.9178 -0.2268 0.0875  0.0661  93 GLN C CD  
2090 O OE1 . GLN C 93 ? 0.6390 1.2343 0.9322 -0.2304 0.0680  0.0851  93 GLN C OE1 
2091 N NE2 . GLN C 93 ? 0.6977 1.1565 0.9024 -0.2707 0.0847  0.0345  93 GLN C NE2 
2092 N N   . SER C 94 ? 0.7171 1.3229 1.0714 -0.1146 0.0740  0.1207  94 SER C N   
2093 C CA  . SER C 94 ? 0.7764 1.4537 1.1736 -0.0944 0.0627  0.1493  94 SER C CA  
2094 C C   . SER C 94 ? 0.8114 1.3937 1.1670 -0.0650 0.0587  0.1207  94 SER C C   
2095 O O   . SER C 94 ? 0.8359 1.3218 1.1296 -0.0773 0.0506  0.0795  94 SER C O   
2096 C CB  . SER C 94 ? 0.7873 1.5482 1.2649 -0.0511 0.0938  0.2071  94 SER C CB  
2097 O OG  . SER C 94 ? 0.7670 1.6193 1.2950 -0.0367 0.0815  0.2446  94 SER C OG  
2098 N N   . PRO D 1  ? 0.5684 0.5007 0.3347 -0.0591 -0.0770 0.0545  1  PRO D N   
2099 C CA  . PRO D 1  ? 0.5665 0.4991 0.3381 -0.0532 -0.0874 0.0634  1  PRO D CA  
2100 C C   . PRO D 1  ? 0.5753 0.5038 0.3235 -0.0539 -0.0975 0.0697  1  PRO D C   
2101 O O   . PRO D 1  ? 0.6072 0.5372 0.3391 -0.0587 -0.0993 0.0653  1  PRO D O   
2102 C CB  . PRO D 1  ? 0.5344 0.4817 0.3296 -0.0499 -0.0950 0.0584  1  PRO D CB  
2103 C CG  . PRO D 1  ? 0.5413 0.4936 0.3490 -0.0528 -0.0852 0.0488  1  PRO D CG  
2104 C CD  . PRO D 1  ? 0.5592 0.5027 0.3475 -0.0588 -0.0751 0.0456  1  PRO D CD  
2105 N N   . LYS D 2  ? 0.5818 0.5053 0.3292 -0.0488 -0.1044 0.0798  2  LYS D N   
2106 C CA  . LYS D 2  ? 0.6051 0.5257 0.3333 -0.0478 -0.1165 0.0870  2  LYS D CA  
2107 C C   . LYS D 2  ? 0.5566 0.4905 0.3014 -0.0430 -0.1307 0.0856  2  LYS D C   
2108 O O   . LYS D 2  ? 0.5753 0.5177 0.3468 -0.0392 -0.1307 0.0824  2  LYS D O   
2109 C CB  . LYS D 2  ? 0.6829 0.5894 0.4009 -0.0446 -0.1168 0.0997  2  LYS D CB  
2110 C CG  . LYS D 2  ? 0.7345 0.6272 0.4354 -0.0495 -0.1028 0.1021  2  LYS D CG  
2111 C CD  . LYS D 2  ? 0.8107 0.6890 0.5002 -0.0467 -0.1040 0.1153  2  LYS D CD  
2112 C CE  . LYS D 2  ? 0.8527 0.7176 0.5104 -0.0531 -0.0965 0.1193  2  LYS D CE  
2113 N NZ  . LYS D 2  ? 0.8216 0.6818 0.4803 -0.0583 -0.0793 0.1136  2  LYS D NZ  
2114 N N   . PRO D 3  ? 0.5587 0.4950 0.2881 -0.0430 -0.1429 0.0878  3  PRO D N   
2115 C CA  . PRO D 3  ? 0.5547 0.5040 0.3005 -0.0380 -0.1571 0.0867  3  PRO D CA  
2116 C C   . PRO D 3  ? 0.5841 0.5328 0.3505 -0.0303 -0.1607 0.0935  3  PRO D C   
2117 O O   . PRO D 3  ? 0.5945 0.5302 0.3515 -0.0276 -0.1595 0.1036  3  PRO D O   
2118 C CB  . PRO D 3  ? 0.6334 0.5802 0.3539 -0.0384 -0.1692 0.0917  3  PRO D CB  
2119 C CG  . PRO D 3  ? 0.6576 0.5964 0.3519 -0.0461 -0.1600 0.0890  3  PRO D CG  
2120 C CD  . PRO D 3  ? 0.6059 0.5342 0.3026 -0.0477 -0.1442 0.0906  3  PRO D CD  
2121 N N   . GLY D 4  ? 0.5596 0.5221 0.3538 -0.0268 -0.1648 0.0877  4  GLY D N   
2122 C CA  . GLY D 4  ? 0.5754 0.5396 0.3923 -0.0195 -0.1680 0.0922  4  GLY D CA  
2123 C C   . GLY D 4  ? 0.5511 0.5152 0.3874 -0.0195 -0.1548 0.0883  4  GLY D C   
2124 O O   . GLY D 4  ? 0.5660 0.5364 0.4269 -0.0141 -0.1566 0.0880  4  GLY D O   
2125 N N   . ASP D 5  ? 0.5098 0.4673 0.3355 -0.0254 -0.1415 0.0850  5  ASP D N   
2126 C CA  . ASP D 5  ? 0.4515 0.4086 0.2940 -0.0255 -0.1288 0.0811  5  ASP D CA  
2127 C C   . ASP D 5  ? 0.4119 0.3848 0.2779 -0.0257 -0.1281 0.0709  5  ASP D C   
2128 O O   . ASP D 5  ? 0.4907 0.4718 0.3536 -0.0294 -0.1315 0.0644  5  ASP D O   
2129 C CB  . ASP D 5  ? 0.4519 0.3989 0.2772 -0.0318 -0.1153 0.0792  5  ASP D CB  
2130 C CG  . ASP D 5  ? 0.5675 0.4979 0.3731 -0.0320 -0.1119 0.0889  5  ASP D CG  
2131 O OD1 . ASP D 5  ? 0.6104 0.5357 0.4167 -0.0269 -0.1191 0.0980  5  ASP D OD1 
2132 O OD2 . ASP D 5  ? 0.5979 0.5202 0.3873 -0.0375 -0.1016 0.0874  5  ASP D OD2 
2133 N N   . ILE D 6  ? 0.4034 0.3802 0.2925 -0.0221 -0.1232 0.0692  6  ILE D N   
2134 C CA  . ILE D 6  ? 0.4011 0.3911 0.3111 -0.0229 -0.1196 0.0598  6  ILE D CA  
2135 C C   . ILE D 6  ? 0.4050 0.3908 0.3080 -0.0286 -0.1065 0.0541  6  ILE D C   
2136 O O   . ILE D 6  ? 0.4174 0.3916 0.3109 -0.0295 -0.0979 0.0573  6  ILE D O   
2137 C CB  . ILE D 6  ? 0.3722 0.3671 0.3080 -0.0170 -0.1180 0.0599  6  ILE D CB  
2138 C CG1 . ILE D 6  ? 0.4345 0.4342 0.3808 -0.0106 -0.1310 0.0649  6  ILE D CG1 
2139 C CG2 . ILE D 6  ? 0.3621 0.3693 0.3171 -0.0185 -0.1123 0.0505  6  ILE D CG2 
2140 C CD1 . ILE D 6  ? 0.4705 0.4849 0.4253 -0.0107 -0.1411 0.0598  6  ILE D CD1 
2141 N N   . PHE D 7  ? 0.3906 0.3854 0.2984 -0.0324 -0.1048 0.0457  7  PHE D N   
2142 C CA  . PHE D 7  ? 0.3619 0.3541 0.2685 -0.0367 -0.0924 0.0397  7  PHE D CA  
2143 C C   . PHE D 7  ? 0.3603 0.3652 0.2855 -0.0377 -0.0909 0.0314  7  PHE D C   
2144 O O   . PHE D 7  ? 0.3678 0.3833 0.3028 -0.0368 -0.0995 0.0295  7  PHE D O   
2145 C CB  . PHE D 7  ? 0.3926 0.3761 0.2739 -0.0428 -0.0889 0.0386  7  PHE D CB  
2146 C CG  . PHE D 7  ? 0.3946 0.3845 0.2682 -0.0466 -0.0963 0.0343  7  PHE D CG  
2147 C CD1 . PHE D 7  ? 0.3992 0.3940 0.2755 -0.0513 -0.0916 0.0256  7  PHE D CD1 
2148 C CD2 . PHE D 7  ? 0.4638 0.4544 0.3270 -0.0455 -0.1080 0.0388  7  PHE D CD2 
2149 C CE1 . PHE D 7  ? 0.4065 0.4069 0.2762 -0.0552 -0.0981 0.0210  7  PHE D CE1 
2150 C CE2 . PHE D 7  ? 0.4558 0.4529 0.3119 -0.0492 -0.1151 0.0340  7  PHE D CE2 
2151 C CZ  . PHE D 7  ? 0.4382 0.4404 0.2981 -0.0542 -0.1100 0.0250  7  PHE D CZ  
2152 N N   . GLU D 8  ? 0.3301 0.3338 0.2605 -0.0395 -0.0801 0.0267  8  GLU D N   
2153 C CA  . GLU D 8  ? 0.3049 0.3191 0.2512 -0.0408 -0.0777 0.0195  8  GLU D CA  
2154 C C   . GLU D 8  ? 0.3599 0.3698 0.2961 -0.0465 -0.0695 0.0138  8  GLU D C   
2155 O O   . GLU D 8  ? 0.3832 0.3825 0.3053 -0.0482 -0.0628 0.0148  8  GLU D O   
2156 C CB  . GLU D 8  ? 0.3311 0.3507 0.2987 -0.0361 -0.0736 0.0191  8  GLU D CB  
2157 C CG  . GLU D 8  ? 0.4292 0.4394 0.3947 -0.0342 -0.0649 0.0217  8  GLU D CG  
2158 C CD  . GLU D 8  ? 0.4818 0.4986 0.4691 -0.0293 -0.0621 0.0208  8  GLU D CD  
2159 O OE1 . GLU D 8  ? 0.5041 0.5146 0.4931 -0.0261 -0.0584 0.0244  8  GLU D OE1 
2160 O OE2 . GLU D 8  ? 0.4554 0.4835 0.4579 -0.0288 -0.0634 0.0164  8  GLU D OE2 
2161 N N   . VAL D 9  ? 0.3285 0.3465 0.2723 -0.0494 -0.0700 0.0077  9  VAL D N   
2162 C CA  . VAL D 9  ? 0.3353 0.3495 0.2716 -0.0545 -0.0629 0.0019  9  VAL D CA  
2163 C C   . VAL D 9  ? 0.3347 0.3573 0.2887 -0.0548 -0.0594 -0.0033 9  VAL D C   
2164 O O   . VAL D 9  ? 0.3696 0.4028 0.3386 -0.0530 -0.0647 -0.0037 9  VAL D O   
2165 C CB  . VAL D 9  ? 0.3992 0.4124 0.3200 -0.0597 -0.0682 -0.0007 9  VAL D CB  
2166 C CG1 . VAL D 9  ? 0.4113 0.4171 0.3136 -0.0593 -0.0729 0.0050  9  VAL D CG1 
2167 C CG2 . VAL D 9  ? 0.4393 0.4646 0.3716 -0.0605 -0.0765 -0.0036 9  VAL D CG2 
2168 N N   . GLU D 10 ? 0.3125 0.3304 0.2647 -0.0570 -0.0504 -0.0072 10 GLU D N   
2169 C CA  . GLU D 10 ? 0.2913 0.3153 0.2560 -0.0587 -0.0471 -0.0122 10 GLU D CA  
2170 C C   . GLU D 10 ? 0.3283 0.3488 0.2818 -0.0648 -0.0467 -0.0171 10 GLU D C   
2171 O O   . GLU D 10 ? 0.3476 0.3587 0.2884 -0.0670 -0.0411 -0.0188 10 GLU D O   
2172 C CB  . GLU D 10 ? 0.2913 0.3120 0.2619 -0.0564 -0.0376 -0.0131 10 GLU D CB  
2173 C CG  . GLU D 10 ? 0.2636 0.2888 0.2477 -0.0506 -0.0370 -0.0097 10 GLU D CG  
2174 C CD  . GLU D 10 ? 0.2892 0.3270 0.2915 -0.0491 -0.0405 -0.0108 10 GLU D CD  
2175 O OE1 . GLU D 10 ? 0.3507 0.3936 0.3557 -0.0529 -0.0428 -0.0142 10 GLU D OE1 
2176 O OE2 . GLU D 10 ? 0.3513 0.3937 0.3654 -0.0443 -0.0406 -0.0086 10 GLU D OE2 
2177 N N   . LEU D 11 ? 0.3173 0.3455 0.2756 -0.0677 -0.0529 -0.0198 11 LEU D N   
2178 C CA  . LEU D 11 ? 0.3223 0.3478 0.2697 -0.0736 -0.0542 -0.0246 11 LEU D CA  
2179 C C   . LEU D 11 ? 0.3410 0.3694 0.2986 -0.0769 -0.0500 -0.0298 11 LEU D C   
2180 O O   . LEU D 11 ? 0.3159 0.3541 0.2887 -0.0766 -0.0525 -0.0304 11 LEU D O   
2181 C CB  . LEU D 11 ? 0.3350 0.3666 0.2790 -0.0749 -0.0650 -0.0241 11 LEU D CB  
2182 C CG  . LEU D 11 ? 0.4001 0.4301 0.3324 -0.0811 -0.0680 -0.0294 11 LEU D CG  
2183 C CD1 . LEU D 11 ? 0.4600 0.4778 0.3722 -0.0829 -0.0630 -0.0298 11 LEU D CD1 
2184 C CD2 . LEU D 11 ? 0.3852 0.4231 0.3159 -0.0814 -0.0799 -0.0287 11 LEU D CD2 
2185 N N   . ALA D 12 ? 0.3402 0.3601 0.2898 -0.0801 -0.0433 -0.0336 12 ALA D N   
2186 C CA  . ALA D 12 ? 0.3397 0.3602 0.2965 -0.0839 -0.0395 -0.0385 12 ALA D CA  
2187 C C   . ALA D 12 ? 0.3371 0.3602 0.2904 -0.0898 -0.0449 -0.0434 12 ALA D C   
2188 O O   . ALA D 12 ? 0.3423 0.3613 0.2814 -0.0921 -0.0478 -0.0450 12 ALA D O   
2189 C CB  . ALA D 12 ? 0.3508 0.3606 0.3014 -0.0843 -0.0304 -0.0407 12 ALA D CB  
2190 N N   . LYS D 13 ? 0.3086 0.3389 0.2751 -0.0925 -0.0459 -0.0461 13 LYS D N   
2191 C CA  . LYS D 13 ? 0.2722 0.3058 0.2377 -0.0984 -0.0509 -0.0514 13 LYS D CA  
2192 C C   . LYS D 13 ? 0.3210 0.3443 0.2770 -0.1031 -0.0455 -0.0567 13 LYS D C   
2193 O O   . LYS D 13 ? 0.3731 0.3883 0.3282 -0.1019 -0.0375 -0.0565 13 LYS D O   
2194 C CB  . LYS D 13 ? 0.2881 0.3322 0.2717 -0.1003 -0.0525 -0.0530 13 LYS D CB  
2195 C CG  . LYS D 13 ? 0.3346 0.3906 0.3288 -0.0964 -0.0591 -0.0494 13 LYS D CG  
2196 C CD  . LYS D 13 ? 0.3403 0.4067 0.3534 -0.0981 -0.0587 -0.0510 13 LYS D CD  
2197 C CE  . LYS D 13 ? 0.3339 0.4126 0.3590 -0.0937 -0.0651 -0.0479 13 LYS D CE  
2198 N NZ  . LYS D 13 ? 0.2848 0.3746 0.3291 -0.0957 -0.0640 -0.0501 13 LYS D NZ  
2199 N N   . ASN D 14 ? 0.3437 0.3677 0.2928 -0.1081 -0.0504 -0.0618 14 ASN D N   
2200 C CA  . ASN D 14 ? 0.3922 0.4085 0.3360 -0.1135 -0.0463 -0.0683 14 ASN D CA  
2201 C C   . ASN D 14 ? 0.3954 0.4193 0.3491 -0.1192 -0.0508 -0.0735 14 ASN D C   
2202 O O   . ASN D 14 ? 0.3986 0.4322 0.3543 -0.1198 -0.0594 -0.0739 14 ASN D O   
2203 C CB  . ASN D 14 ? 0.5106 0.5198 0.4352 -0.1150 -0.0473 -0.0709 14 ASN D CB  
2204 C CG  . ASN D 14 ? 0.6478 0.6460 0.5666 -0.1183 -0.0398 -0.0765 14 ASN D CG  
2205 O OD1 . ASN D 14 ? 0.7060 0.6988 0.6317 -0.1169 -0.0326 -0.0758 14 ASN D OD1 
2206 N ND2 . ASN D 14 ? 0.6736 0.6685 0.5800 -0.1225 -0.0418 -0.0824 14 ASN D ND2 
2207 N N   . ASP D 15 ? 0.4414 0.4608 0.4017 -0.1232 -0.0452 -0.0775 15 ASP D N   
2208 C CA  . ASP D 15 ? 0.4288 0.4550 0.4003 -0.1291 -0.0484 -0.0826 15 ASP D CA  
2209 C C   . ASP D 15 ? 0.3603 0.4001 0.3467 -0.1271 -0.0529 -0.0790 15 ASP D C   
2210 O O   . ASP D 15 ? 0.3785 0.4284 0.3721 -0.1306 -0.0597 -0.0826 15 ASP D O   
2211 C CB  . ASP D 15 ? 0.5193 0.5472 0.4817 -0.1339 -0.0549 -0.0892 15 ASP D CB  
2212 C CG  . ASP D 15 ? 0.5991 0.6144 0.5476 -0.1364 -0.0503 -0.0940 15 ASP D CG  
2213 O OD1 . ASP D 15 ? 0.5973 0.6045 0.5500 -0.1390 -0.0432 -0.0967 15 ASP D OD1 
2214 O OD2 . ASP D 15 ? 0.6529 0.6662 0.5859 -0.1357 -0.0535 -0.0949 15 ASP D OD2 
2215 N N   . ASN D 16 ? 0.3209 0.3612 0.3118 -0.1213 -0.0494 -0.0725 16 ASN D N   
2216 C CA  . ASN D 16 ? 0.3218 0.3744 0.3272 -0.1183 -0.0525 -0.0687 16 ASN D CA  
2217 C C   . ASN D 16 ? 0.3465 0.4096 0.3515 -0.1167 -0.0632 -0.0684 16 ASN D C   
2218 O O   . ASN D 16 ? 0.3704 0.4459 0.3895 -0.1164 -0.0677 -0.0682 16 ASN D O   
2219 C CB  . ASN D 16 ? 0.3328 0.3908 0.3545 -0.1230 -0.0495 -0.0714 16 ASN D CB  
2220 C CG  . ASN D 16 ? 0.3755 0.4441 0.4121 -0.1193 -0.0492 -0.0672 16 ASN D CG  
2221 O OD1 . ASN D 16 ? 0.3879 0.4544 0.4236 -0.1135 -0.0458 -0.0618 16 ASN D OD1 
2222 N ND2 . ASN D 16 ? 0.4149 0.4956 0.4659 -0.1229 -0.0528 -0.0701 16 ASN D ND2 
2223 N N   . SER D 17 ? 0.3433 0.4014 0.3319 -0.1153 -0.0670 -0.0679 17 SER D N   
2224 C CA  . SER D 17 ? 0.3693 0.4354 0.3546 -0.1129 -0.0773 -0.0664 17 SER D CA  
2225 C C   . SER D 17 ? 0.3854 0.4449 0.3567 -0.1071 -0.0776 -0.0602 17 SER D C   
2226 O O   . SER D 17 ? 0.3450 0.3929 0.3035 -0.1071 -0.0713 -0.0599 17 SER D O   
2227 C CB  . SER D 17 ? 0.4100 0.4776 0.3873 -0.1184 -0.0837 -0.0730 17 SER D CB  
2228 O OG  . SER D 17 ? 0.4241 0.4972 0.3939 -0.1157 -0.0939 -0.0711 17 SER D OG  
2229 N N   . LEU D 18 ? 0.3603 0.4270 0.3342 -0.1022 -0.0847 -0.0555 18 LEU D N   
2230 C CA  . LEU D 18 ? 0.3657 0.4257 0.3254 -0.0972 -0.0857 -0.0494 18 LEU D CA  
2231 C C   . LEU D 18 ? 0.3875 0.4426 0.3271 -0.0997 -0.0907 -0.0512 18 LEU D C   
2232 O O   . LEU D 18 ? 0.3950 0.4419 0.3194 -0.0970 -0.0897 -0.0468 18 LEU D O   
2233 C CB  . LEU D 18 ? 0.3471 0.4150 0.3160 -0.0909 -0.0918 -0.0434 18 LEU D CB  
2234 C CG  . LEU D 18 ? 0.3495 0.4214 0.3360 -0.0873 -0.0861 -0.0408 18 LEU D CG  
2235 C CD1 . LEU D 18 ? 0.3714 0.4540 0.3698 -0.0822 -0.0939 -0.0371 18 LEU D CD1 
2236 C CD2 . LEU D 18 ? 0.3694 0.4305 0.3501 -0.0842 -0.0764 -0.0370 18 LEU D CD2 
2237 N N   . GLY D 19 ? 0.3559 0.4158 0.2950 -0.1050 -0.0960 -0.0577 19 GLY D N   
2238 C CA  . GLY D 19 ? 0.4086 0.4639 0.3279 -0.1078 -0.1001 -0.0603 19 GLY D CA  
2239 C C   . GLY D 19 ? 0.4141 0.4740 0.3252 -0.1039 -0.1110 -0.0555 19 GLY D C   
2240 O O   . GLY D 19 ? 0.4463 0.4997 0.3373 -0.1041 -0.1130 -0.0541 19 GLY D O   
2241 N N   . ILE D 20 ? 0.4446 0.5157 0.3713 -0.1004 -0.1179 -0.0529 20 ILE D N   
2242 C CA  . ILE D 20 ? 0.5090 0.5859 0.4303 -0.0967 -0.1300 -0.0491 20 ILE D CA  
2243 C C   . ILE D 20 ? 0.5280 0.6203 0.4659 -0.0978 -0.1398 -0.0537 20 ILE D C   
2244 O O   . ILE D 20 ? 0.5453 0.6449 0.5033 -0.0996 -0.1366 -0.0574 20 ILE D O   
2245 C CB  . ILE D 20 ? 0.5120 0.5867 0.4351 -0.0891 -0.1305 -0.0394 20 ILE D CB  
2246 C CG1 . ILE D 20 ? 0.5243 0.6076 0.4725 -0.0862 -0.1283 -0.0387 20 ILE D CG1 
2247 C CG2 . ILE D 20 ? 0.5382 0.5984 0.4458 -0.0879 -0.1211 -0.0349 20 ILE D CG2 
2248 C CD1 . ILE D 20 ? 0.5619 0.6444 0.5142 -0.0786 -0.1296 -0.0302 20 ILE D CD1 
2249 N N   . SER D 21 ? 0.5225 0.6199 0.4519 -0.0968 -0.1517 -0.0535 21 SER D N   
2250 C CA  . SER D 21 ? 0.5389 0.6519 0.4850 -0.0959 -0.1627 -0.0564 21 SER D CA  
2251 C C   . SER D 21 ? 0.5228 0.6385 0.4695 -0.0877 -0.1712 -0.0478 21 SER D C   
2252 O O   . SER D 21 ? 0.5125 0.6179 0.4407 -0.0843 -0.1716 -0.0406 21 SER D O   
2253 C CB  . SER D 21 ? 0.5701 0.6891 0.5091 -0.1012 -0.1711 -0.0644 21 SER D CB  
2254 O OG  . SER D 21 ? 0.6031 0.7146 0.5163 -0.1004 -0.1761 -0.0616 21 SER D OG  
2255 N N   . VAL D 22 ? 0.4907 0.6198 0.4595 -0.0846 -0.1774 -0.0484 22 VAL D N   
2256 C CA  . VAL D 22 ? 0.4800 0.6115 0.4515 -0.0764 -0.1856 -0.0405 22 VAL D CA  
2257 C C   . VAL D 22 ? 0.4963 0.6413 0.4739 -0.0748 -0.2011 -0.0433 22 VAL D C   
2258 O O   . VAL D 22 ? 0.5105 0.6664 0.4982 -0.0797 -0.2045 -0.0522 22 VAL D O   
2259 C CB  . VAL D 22 ? 0.5147 0.6492 0.5073 -0.0719 -0.1796 -0.0371 22 VAL D CB  
2260 C CG1 . VAL D 22 ? 0.4741 0.5940 0.4570 -0.0715 -0.1665 -0.0322 22 VAL D CG1 
2261 C CG2 . VAL D 22 ? 0.5255 0.6731 0.5430 -0.0758 -0.1766 -0.0451 22 VAL D CG2 
2262 N N   . THR D 23 ? 0.4899 0.6336 0.4608 -0.0677 -0.2106 -0.0355 23 THR D N   
2263 C CA  . THR D 23 ? 0.4755 0.6315 0.4522 -0.0643 -0.2266 -0.0367 23 THR D CA  
2264 C C   . THR D 23 ? 0.4865 0.6454 0.4772 -0.0555 -0.2310 -0.0293 23 THR D C   
2265 O O   . THR D 23 ? 0.5114 0.6591 0.4974 -0.0520 -0.2235 -0.0217 23 THR D O   
2266 C CB  . THR D 23 ? 0.5236 0.6730 0.4723 -0.0641 -0.2357 -0.0337 23 THR D CB  
2267 O OG1 . THR D 23 ? 0.5453 0.7087 0.5011 -0.0617 -0.2517 -0.0369 23 THR D OG1 
2268 C CG2 . THR D 23 ? 0.5138 0.6486 0.4442 -0.0581 -0.2351 -0.0214 23 THR D CG2 
2269 N N   . GLY D 24 ? 0.4861 1.2639 0.8253 -0.1346 -0.4453 -0.0929 24 GLY D N   
2270 C CA  . GLY D 24 ? 0.4871 1.3234 0.8191 -0.1389 -0.3881 -0.1062 24 GLY D CA  
2271 C C   . GLY D 24 ? 0.4483 1.4032 0.8303 -0.1649 -0.3787 -0.0671 24 GLY D C   
2272 O O   . GLY D 24 ? 0.4767 1.4747 0.9059 -0.1887 -0.4166 -0.0180 24 GLY D O   
2273 N N   . GLY D 25 ? 0.3821 1.3932 0.7523 -0.1580 -0.3325 -0.0882 25 GLY D N   
2274 C CA  . GLY D 25 ? 0.3674 1.5092 0.7774 -0.1699 -0.3193 -0.0583 25 GLY D CA  
2275 C C   . GLY D 25 ? 0.3762 1.5400 0.7791 -0.1490 -0.2997 -0.0762 25 GLY D C   
2276 O O   . GLY D 25 ? 0.3815 1.4543 0.7630 -0.1342 -0.3091 -0.0944 25 GLY D O   
2277 N N   . VAL D 26 ? 0.3668 1.6544 0.7843 -0.1421 -0.2745 -0.0743 26 VAL D N   
2278 C CA  . VAL D 26 ? 0.3766 1.6940 0.7832 -0.1125 -0.2586 -0.1001 26 VAL D CA  
2279 C C   . VAL D 26 ? 0.4113 1.7339 0.8567 -0.1173 -0.2888 -0.0603 26 VAL D C   
2280 O O   . VAL D 26 ? 0.4410 1.7289 0.8684 -0.0918 -0.2857 -0.0876 26 VAL D O   
2281 C CB  . VAL D 26 ? 0.3641 1.8349 0.7796 -0.0944 -0.2322 -0.1069 26 VAL D CB  
2282 C CG1 . VAL D 26 ? 0.3654 1.8091 0.7333 -0.0795 -0.2056 -0.1630 26 VAL D CG1 
2283 C CG2 . VAL D 26 ? 0.3479 1.9615 0.8235 -0.1235 -0.2438 -0.0356 26 VAL D CG2 
2284 N N   . ASN D 27 ? 0.4223 1.7844 0.9228 -0.1519 -0.3238 0.0060  27 ASN D N   
2285 C CA  . ASN D 27 ? 0.4591 1.8270 1.0078 -0.1655 -0.3634 0.0548  27 ASN D CA  
2286 C C   . ASN D 27 ? 0.4708 1.6673 0.9902 -0.1567 -0.3919 0.0308  27 ASN D C   
2287 O O   . ASN D 27 ? 0.4659 1.6384 1.0167 -0.1622 -0.4285 0.0600  27 ASN D O   
2288 C CB  . ASN D 27 ? 0.4834 1.9333 1.1026 -0.2118 -0.4041 0.1391  27 ASN D CB  
2289 C CG  . ASN D 27 ? 0.5031 1.8624 1.1112 -0.2320 -0.4302 0.1429  27 ASN D CG  
2290 O OD1 . ASN D 27 ? 0.4823 1.7599 1.0326 -0.2117 -0.4044 0.0845  27 ASN D OD1 
2291 N ND2 . ASN D 27 ? 0.5463 1.9225 1.2123 -0.2724 -0.4867 0.2142  27 ASN D ND2 
2292 N N   . THR D 28 ? 0.4886 1.5750 0.9484 -0.1419 -0.3759 -0.0208 28 THR D N   
2293 C CA  . THR D 28 ? 0.5257 1.4630 0.9514 -0.1294 -0.4018 -0.0432 28 THR D CA  
2294 C C   . THR D 28 ? 0.5426 1.4056 0.9065 -0.0972 -0.3690 -0.1021 28 THR D C   
2295 O O   . THR D 28 ? 0.5100 1.4152 0.8504 -0.0852 -0.3290 -0.1339 28 THR D O   
2296 C CB  . THR D 28 ? 0.5348 1.4072 0.9392 -0.1355 -0.4163 -0.0508 28 THR D CB  
2297 O OG1 . THR D 28 ? 0.5276 1.3817 0.8773 -0.1212 -0.3684 -0.1014 28 THR D OG1 
2298 C CG2 . THR D 28 ? 0.5162 1.4709 0.9738 -0.1685 -0.4410 0.0013  28 THR D CG2 
2299 N N   . SER D 29 ? 0.5928 1.3418 0.9296 -0.0821 -0.3927 -0.1157 29 SER D N   
2300 C CA  . SER D 29 ? 0.6657 1.3320 0.9411 -0.0561 -0.3684 -0.1636 29 SER D CA  
2301 C C   . SER D 29 ? 0.7404 1.3446 0.9660 -0.0527 -0.3533 -0.1905 29 SER D C   
2302 O O   . SER D 29 ? 0.7592 1.2989 0.9325 -0.0381 -0.3336 -0.2226 29 SER D O   
2303 C CB  . SER D 29 ? 0.7107 1.2984 0.9812 -0.0390 -0.4008 -0.1617 29 SER D CB  
2304 O OG  . SER D 29 ? 0.7488 1.2596 0.9595 -0.0162 -0.3792 -0.2025 29 SER D OG  
2305 N N   . VAL D 30 ? 0.7964 1.4269 1.0406 -0.0672 -0.3658 -0.1732 30 VAL D N   
2306 C CA  . VAL D 30 ? 0.8552 1.4599 1.0599 -0.0642 -0.3476 -0.1968 30 VAL D CA  
2307 C C   . VAL D 30 ? 0.9119 1.5370 1.0866 -0.0672 -0.2987 -0.2262 30 VAL D C   
2308 O O   . VAL D 30 ? 0.8991 1.5935 1.0964 -0.0754 -0.2819 -0.2250 30 VAL D O   
2309 C CB  . VAL D 30 ? 0.8379 1.4952 1.0748 -0.0818 -0.3629 -0.1749 30 VAL D CB  
2310 C CG1 . VAL D 30 ? 0.8412 1.4860 1.0387 -0.0761 -0.3413 -0.2020 30 VAL D CG1 
2311 C CG2 . VAL D 30 ? 0.8514 1.4773 1.1227 -0.0816 -0.4266 -0.1425 30 VAL D CG2 
2312 N N   . ARG D 31 ? 0.9873 1.5562 1.1118 -0.0591 -0.2811 -0.2510 31 ARG D N   
2313 C CA  . ARG D 31 ? 1.0516 1.6148 1.1465 -0.0649 -0.2479 -0.2754 31 ARG D CA  
2314 C C   . ARG D 31 ? 1.0389 1.6773 1.1584 -0.0770 -0.2301 -0.2822 31 ARG D C   
2315 O O   . ARG D 31 ? 1.0264 1.7192 1.1598 -0.0908 -0.2191 -0.2797 31 ARG D O   
2316 C CB  . ARG D 31 ? 1.1093 1.6472 1.1649 -0.0697 -0.2307 -0.2858 31 ARG D CB  
2317 C CG  . ARG D 31 ? 1.1833 1.6577 1.2026 -0.0490 -0.2442 -0.2846 31 ARG D CG  
2318 C CD  . ARG D 31 ? 1.2325 1.7069 1.2130 -0.0549 -0.2216 -0.2897 31 ARG D CD  
2319 N NE  . ARG D 31 ? 1.2211 1.7591 1.2170 -0.0651 -0.2113 -0.2893 31 ARG D NE  
2320 C CZ  . ARG D 31 ? 1.2484 1.8145 1.2215 -0.0726 -0.1909 -0.2901 31 ARG D CZ  
2321 N NH1 . ARG D 31 ? 1.2981 1.8385 1.2331 -0.0748 -0.1787 -0.2852 31 ARG D NH1 
2322 N NH2 . ARG D 31 ? 1.2232 1.8500 1.2133 -0.0792 -0.1840 -0.2918 31 ARG D NH2 
2323 N N   . HIS D 32 ? 1.0410 1.6846 1.1628 -0.0659 -0.2301 -0.2943 32 HIS D N   
2324 C CA  . HIS D 32 ? 1.0147 1.7285 1.1490 -0.0638 -0.2172 -0.3116 32 HIS D CA  
2325 C C   . HIS D 32 ? 0.8840 1.7107 1.0656 -0.0712 -0.2163 -0.2870 32 HIS D C   
2326 O O   . HIS D 32 ? 0.8749 1.7782 1.0660 -0.0651 -0.2049 -0.3003 32 HIS D O   
2327 C CB  . HIS D 32 ? 1.0943 1.7803 1.1974 -0.0748 -0.2016 -0.3382 32 HIS D CB  
2328 C CG  . HIS D 32 ? 1.1899 1.7736 1.2502 -0.0794 -0.2040 -0.3468 32 HIS D CG  
2329 N ND1 . HIS D 32 ? 1.2194 1.7773 1.2596 -0.1005 -0.1928 -0.3407 32 HIS D ND1 
2330 C CD2 . HIS D 32 ? 1.2503 1.7601 1.2846 -0.0663 -0.2170 -0.3565 32 HIS D CD2 
2331 C CE1 . HIS D 32 ? 1.2741 1.7537 1.2787 -0.1029 -0.1978 -0.3413 32 HIS D CE1 
2332 N NE2 . HIS D 32 ? 1.2952 1.7369 1.2941 -0.0827 -0.2138 -0.3517 32 HIS D NE2 
2333 N N   . GLY D 33 ? 0.8433 1.1110 1.0836 0.0730  -0.4185 0.0189  33 GLY D N   
2334 C CA  . GLY D 33 ? 0.7126 1.0228 0.9892 0.0673  -0.3866 0.0070  33 GLY D CA  
2335 C C   . GLY D 33 ? 0.6050 0.8957 0.8471 0.0550  -0.3519 0.0091  33 GLY D C   
2336 O O   . GLY D 33 ? 0.5541 0.8730 0.8196 0.0490  -0.3252 0.0005  33 GLY D O   
2337 N N   . GLY D 34 ? 0.5510 0.7935 0.7376 0.0500  -0.3532 0.0203  34 GLY D N   
2338 C CA  . GLY D 34 ? 0.5345 0.7576 0.6891 0.0391  -0.3231 0.0226  34 GLY D CA  
2339 C C   . GLY D 34 ? 0.5088 0.7437 0.6566 0.0177  -0.3044 0.0189  34 GLY D C   
2340 O O   . GLY D 34 ? 0.4895 0.7377 0.6428 0.0072  -0.3173 0.0172  34 GLY D O   
2341 N N   . ILE D 35 ? 0.4595 0.6876 0.5949 0.0112  -0.2757 0.0177  35 ILE D N   
2342 C CA  . ILE D 35 ? 0.4232 0.6538 0.5463 -0.0083 -0.2576 0.0147  35 ILE D CA  
2343 C C   . ILE D 35 ? 0.4293 0.6199 0.4981 -0.0202 -0.2542 0.0219  35 ILE D C   
2344 O O   . ILE D 35 ? 0.4045 0.5718 0.4516 -0.0158 -0.2446 0.0267  35 ILE D O   
2345 C CB  . ILE D 35 ? 0.3878 0.6334 0.5299 -0.0091 -0.2290 0.0087  35 ILE D CB  
2346 C CG1 . ILE D 35 ? 0.3746 0.6604 0.5692 0.0025  -0.2275 0.0002  35 ILE D CG1 
2347 C CG2 . ILE D 35 ? 0.3942 0.6394 0.5238 -0.0288 -0.2146 0.0056  35 ILE D CG2 
2348 C CD1 . ILE D 35 ? 0.3476 0.6683 0.5752 -0.0021 -0.2419 -0.0060 35 ILE D CD1 
2349 N N   . TYR D 36 ? 0.4493 0.6332 0.4968 -0.0359 -0.2615 0.0216  36 TYR D N   
2350 C CA  . TYR D 36 ? 0.4537 0.6023 0.4496 -0.0489 -0.2590 0.0262  36 TYR D CA  
2351 C C   . TYR D 36 ? 0.4617 0.6102 0.4466 -0.0655 -0.2420 0.0196  36 TYR D C   
2352 O O   . TYR D 36 ? 0.4548 0.6267 0.4645 -0.0710 -0.2414 0.0133  36 TYR D O   
2353 C CB  . TYR D 36 ? 0.5072 0.6381 0.4764 -0.0532 -0.2876 0.0324  36 TYR D CB  
2354 C CG  . TYR D 36 ? 0.5494 0.6716 0.5227 -0.0368 -0.3075 0.0399  36 TYR D CG  
2355 C CD1 . TYR D 36 ? 0.5604 0.7106 0.5800 -0.0211 -0.3237 0.0374  36 TYR D CD1 
2356 C CD2 . TYR D 36 ? 0.5963 0.6825 0.5285 -0.0371 -0.3101 0.0485  36 TYR D CD2 
2357 C CE1 . TYR D 36 ? 0.5730 0.7130 0.5979 -0.0039 -0.3431 0.0429  36 TYR D CE1 
2358 C CE2 . TYR D 36 ? 0.6092 0.6828 0.5426 -0.0221 -0.3299 0.0556  36 TYR D CE2 
2359 C CZ  . TYR D 36 ? 0.6259 0.7253 0.6060 -0.0045 -0.3470 0.0525  36 TYR D CZ  
2360 O OH  . TYR D 36 ? 0.6744 0.7592 0.6573 0.0124  -0.3683 0.0584  36 TYR D OH  
2361 N N   . VAL D 37 ? 0.4864 0.6083 0.4341 -0.0737 -0.2285 0.0204  37 VAL D N   
2362 C CA  . VAL D 37 ? 0.4823 0.5991 0.4162 -0.0881 -0.2136 0.0130  37 VAL D CA  
2363 C C   . VAL D 37 ? 0.5139 0.6241 0.4260 -0.1021 -0.2299 0.0112  37 VAL D C   
2364 O O   . VAL D 37 ? 0.5798 0.6679 0.4558 -0.1079 -0.2420 0.0158  37 VAL D O   
2365 C CB  . VAL D 37 ? 0.4566 0.5498 0.3612 -0.0915 -0.1944 0.0126  37 VAL D CB  
2366 C CG1 . VAL D 37 ? 0.5143 0.5995 0.4025 -0.1055 -0.1821 0.0032  37 VAL D CG1 
2367 C CG2 . VAL D 37 ? 0.4248 0.5250 0.3525 -0.0794 -0.1783 0.0140  37 VAL D CG2 
2368 N N   . LYS D 38 ? 0.4913 0.6192 0.4228 -0.1092 -0.2307 0.0047  38 LYS D N   
2369 C CA  . LYS D 38 ? 0.5727 0.6952 0.4851 -0.1234 -0.2473 0.0027  38 LYS D CA  
2370 C C   . LYS D 38 ? 0.6211 0.7172 0.4928 -0.1380 -0.2337 -0.0038 38 LYS D C   
2371 O O   . LYS D 38 ? 0.6613 0.7365 0.4944 -0.1495 -0.2440 -0.0034 38 LYS D O   
2372 C CB  . LYS D 38 ? 0.5734 0.7258 0.5229 -0.1269 -0.2534 -0.0020 38 LYS D CB  
2373 C CG  . LYS D 38 ? 0.6651 0.8154 0.5999 -0.1410 -0.2750 -0.0029 38 LYS D CG  
2374 C CD  . LYS D 38 ? 0.7102 0.8909 0.6817 -0.1471 -0.2780 -0.0083 38 LYS D CD  
2375 C CE  . LYS D 38 ? 0.8187 0.9985 0.7775 -0.1613 -0.3020 -0.0085 38 LYS D CE  
2376 N NZ  . LYS D 38 ? 0.8542 1.0615 0.8442 -0.1713 -0.3027 -0.0146 38 LYS D NZ  
2377 N N   . ALA D 39 ? 0.6107 0.7068 0.4908 -0.1374 -0.2107 -0.0104 39 ALA D N   
2378 C CA  . ALA D 39 ? 0.6163 0.6908 0.4667 -0.1485 -0.1957 -0.0196 39 ALA D CA  
2379 C C   . ALA D 39 ? 0.5920 0.6659 0.4567 -0.1410 -0.1722 -0.0238 39 ALA D C   
2380 O O   . ALA D 39 ? 0.5453 0.6369 0.4443 -0.1330 -0.1679 -0.0219 39 ALA D O   
2381 C CB  . ALA D 39 ? 0.6580 0.7338 0.5061 -0.1622 -0.2023 -0.0270 39 ALA D CB  
2382 N N   . VAL D 40 ? 0.6147 0.6686 0.4531 -0.1443 -0.1573 -0.0298 40 VAL D N   
2383 C CA  . VAL D 40 ? 0.5950 0.6457 0.4458 -0.1390 -0.1370 -0.0361 40 VAL D CA  
2384 C C   . VAL D 40 ? 0.5810 0.6212 0.4237 -0.1491 -0.1323 -0.0486 40 VAL D C   
2385 O O   . VAL D 40 ? 0.5970 0.6224 0.4086 -0.1600 -0.1343 -0.0556 40 VAL D O   
2386 C CB  . VAL D 40 ? 0.6452 0.6841 0.4789 -0.1351 -0.1228 -0.0366 40 VAL D CB  
2387 C CG1 . VAL D 40 ? 0.6308 0.6744 0.4646 -0.1276 -0.1306 -0.0238 40 VAL D CG1 
2388 C CG2 . VAL D 40 ? 0.6851 0.7056 0.4802 -0.1472 -0.1179 -0.0460 40 VAL D CG2 
2389 N N   . ILE D 41 ? 0.5236 0.5690 0.3917 -0.1466 -0.1271 -0.0514 41 ILE D N   
2390 C CA  . ILE D 41 ? 0.4974 0.5311 0.3598 -0.1562 -0.1261 -0.0621 41 ILE D CA  
2391 C C   . ILE D 41 ? 0.4803 0.4927 0.3259 -0.1551 -0.1103 -0.0744 41 ILE D C   
2392 O O   . ILE D 41 ? 0.4884 0.5000 0.3460 -0.1448 -0.0980 -0.0746 41 ILE D O   
2393 C CB  . ILE D 41 ? 0.5212 0.5647 0.4140 -0.1555 -0.1266 -0.0600 41 ILE D CB  
2394 C CG1 . ILE D 41 ? 0.5238 0.5946 0.4402 -0.1544 -0.1386 -0.0492 41 ILE D CG1 
2395 C CG2 . ILE D 41 ? 0.5635 0.5917 0.4477 -0.1673 -0.1287 -0.0699 41 ILE D CG2 
2396 C CD1 . ILE D 41 ? 0.5865 0.6650 0.4915 -0.1624 -0.1558 -0.0472 41 ILE D CD1 
2397 N N   . PRO D 42 ? 0.5467 0.5424 0.3651 -0.1655 -0.1107 -0.0858 42 PRO D N   
2398 C CA  . PRO D 42 ? 0.5611 0.5386 0.3659 -0.1637 -0.0946 -0.1006 42 PRO D CA  
2399 C C   . PRO D 42 ? 0.5669 0.5404 0.3987 -0.1532 -0.0852 -0.1046 42 PRO D C   
2400 O O   . PRO D 42 ? 0.5511 0.5234 0.3991 -0.1547 -0.0922 -0.1022 42 PRO D O   
2401 C CB  . PRO D 42 ? 0.6005 0.5603 0.3776 -0.1775 -0.0996 -0.1125 42 PRO D CB  
2402 C CG  . PRO D 42 ? 0.6256 0.5950 0.3910 -0.1877 -0.1180 -0.1019 42 PRO D CG  
2403 C CD  . PRO D 42 ? 0.5622 0.5553 0.3627 -0.1797 -0.1261 -0.0867 42 PRO D CD  
2404 N N   . GLN D 43 ? 0.5911 0.5622 0.4268 -0.1437 -0.0705 -0.1103 43 GLN D N   
2405 C CA  . GLN D 43 ? 0.6444 0.6100 0.5053 -0.1324 -0.0626 -0.1143 43 GLN D CA  
2406 C C   . GLN D 43 ? 0.5769 0.5532 0.4653 -0.1266 -0.0688 -0.0994 43 GLN D C   
2407 O O   . GLN D 43 ? 0.5944 0.5620 0.5012 -0.1201 -0.0668 -0.1010 43 GLN D O   
2408 C CB  . GLN D 43 ? 0.7851 0.7281 0.6413 -0.1349 -0.0622 -0.1300 43 GLN D CB  
2409 C CG  . GLN D 43 ? 0.9161 0.8478 0.7414 -0.1431 -0.0567 -0.1456 43 GLN D CG  
2410 C CD  . GLN D 43 ? 1.0450 0.9527 0.8605 -0.1489 -0.0615 -0.1588 43 GLN D CD  
2411 O OE1 . GLN D 43 ? 1.0787 0.9736 0.9125 -0.1428 -0.0640 -0.1616 43 GLN D OE1 
2412 N NE2 . GLN D 43 ? 1.1067 1.0050 0.8906 -0.1618 -0.0643 -0.1667 43 GLN D NE2 
2413 N N   . GLY D 44 ? 0.5061 0.5000 0.3967 -0.1289 -0.0768 -0.0857 44 GLY D N   
2414 C CA  . GLY D 44 ? 0.4458 0.4523 0.3608 -0.1237 -0.0804 -0.0728 44 GLY D CA  
2415 C C   . GLY D 44 ? 0.4329 0.4461 0.3581 -0.1123 -0.0718 -0.0665 44 GLY D C   
2416 O O   . GLY D 44 ? 0.4167 0.4270 0.3309 -0.1093 -0.0631 -0.0719 44 GLY D O   
2417 N N   . ALA D 45 ? 0.3479 0.3704 0.2927 -0.1076 -0.0738 -0.0557 45 ALA D N   
2418 C CA  . ALA D 45 ? 0.3445 0.3708 0.2994 -0.0975 -0.0668 -0.0490 45 ALA D CA  
2419 C C   . ALA D 45 ? 0.3804 0.4154 0.3219 -0.0955 -0.0656 -0.0445 45 ALA D C   
2420 O O   . ALA D 45 ? 0.3750 0.4072 0.3121 -0.0912 -0.0568 -0.0464 45 ALA D O   
2421 C CB  . ALA D 45 ? 0.3416 0.3753 0.3153 -0.0952 -0.0700 -0.0385 45 ALA D CB  
2422 N N   . ALA D 46 ? 0.4132 0.4584 0.3483 -0.0992 -0.0756 -0.0383 46 ALA D N   
2423 C CA  . ALA D 46 ? 0.4163 0.4652 0.3356 -0.0980 -0.0780 -0.0323 46 ALA D CA  
2424 C C   . ALA D 46 ? 0.4330 0.4713 0.3260 -0.1041 -0.0713 -0.0413 46 ALA D C   
2425 O O   . ALA D 46 ? 0.3984 0.4351 0.2791 -0.1030 -0.0659 -0.0386 46 ALA D O   
2426 C CB  . ALA D 46 ? 0.4330 0.4927 0.3509 -0.1006 -0.0931 -0.0255 46 ALA D CB  
2427 N N   . GLU D 47 ? 0.4303 0.4607 0.3129 -0.1118 -0.0710 -0.0525 47 GLU D N   
2428 C CA  . GLU D 47 ? 0.4533 0.4741 0.3084 -0.1191 -0.0634 -0.0629 47 GLU D CA  
2429 C C   . GLU D 47 ? 0.4339 0.4524 0.2971 -0.1132 -0.0465 -0.0711 47 GLU D C   
2430 O O   . GLU D 47 ? 0.4963 0.5145 0.3424 -0.1166 -0.0375 -0.0741 47 GLU D O   
2431 C CB  . GLU D 47 ? 0.5020 0.5128 0.3431 -0.1287 -0.0667 -0.0745 47 GLU D CB  
2432 C CG  . GLU D 47 ? 0.5713 0.5715 0.3814 -0.1374 -0.0570 -0.0872 47 GLU D CG  
2433 C CD  . GLU D 47 ? 0.6943 0.6815 0.4892 -0.1466 -0.0592 -0.1003 47 GLU D CD  
2434 O OE1 . GLU D 47 ? 0.7397 0.7197 0.5493 -0.1420 -0.0524 -0.1115 47 GLU D OE1 
2435 O OE2 . GLU D 47 ? 0.7240 0.7060 0.4913 -0.1585 -0.0693 -0.0990 47 GLU D OE2 
2436 N N   . SER D 48 ? 0.4124 0.4291 0.3016 -0.1053 -0.0429 -0.0748 48 SER D N   
2437 C CA  . SER D 48 ? 0.4347 0.4501 0.3374 -0.0981 -0.0292 -0.0836 48 SER D CA  
2438 C C   . SER D 48 ? 0.4122 0.4374 0.3207 -0.0932 -0.0246 -0.0734 48 SER D C   
2439 O O   . SER D 48 ? 0.4267 0.4555 0.3352 -0.0922 -0.0123 -0.0803 48 SER D O   
2440 C CB  . SER D 48 ? 0.4551 0.4628 0.3837 -0.0906 -0.0311 -0.0869 48 SER D CB  
2441 O OG  . SER D 48 ? 0.5489 0.5441 0.4701 -0.0960 -0.0352 -0.0973 48 SER D OG  
2442 N N   . ASP D 49 ? 0.3620 0.3920 0.2766 -0.0904 -0.0342 -0.0579 49 ASP D N   
2443 C CA  . ASP D 49 ? 0.3766 0.4127 0.2945 -0.0859 -0.0321 -0.0469 49 ASP D CA  
2444 C C   . ASP D 49 ? 0.4482 0.4850 0.3370 -0.0940 -0.0299 -0.0451 49 ASP D C   
2445 O O   . ASP D 49 ? 0.4960 0.5357 0.3823 -0.0940 -0.0216 -0.0435 49 ASP D O   
2446 C CB  . ASP D 49 ? 0.3514 0.3911 0.2809 -0.0811 -0.0431 -0.0327 49 ASP D CB  
2447 C CG  . ASP D 49 ? 0.3768 0.4194 0.3063 -0.0766 -0.0426 -0.0211 49 ASP D CG  
2448 O OD1 . ASP D 49 ? 0.4116 0.4546 0.3235 -0.0792 -0.0493 -0.0136 49 ASP D OD1 
2449 O OD2 . ASP D 49 ? 0.3901 0.4323 0.3359 -0.0708 -0.0370 -0.0195 49 ASP D OD2 
2450 N N   . GLY D 50 ? 0.4071 0.4401 0.2728 -0.1022 -0.0388 -0.0443 50 GLY D N   
2451 C CA  . GLY D 50 ? 0.4850 0.5133 0.3163 -0.1134 -0.0383 -0.0440 50 GLY D CA  
2452 C C   . GLY D 50 ? 0.5055 0.5313 0.3216 -0.1142 -0.0487 -0.0283 50 GLY D C   
2453 O O   . GLY D 50 ? 0.5737 0.5916 0.3569 -0.1253 -0.0492 -0.0270 50 GLY D O   
2454 N N   . ARG D 51 ? 0.4634 0.4935 0.3006 -0.1035 -0.0573 -0.0169 51 ARG D N   
2455 C CA  . ARG D 51 ? 0.4705 0.4960 0.2958 -0.1018 -0.0677 -0.0028 51 ARG D CA  
2456 C C   . ARG D 51 ? 0.5068 0.5311 0.3277 -0.1003 -0.0876 0.0046  51 ARG D C   
2457 O O   . ARG D 51 ? 0.5270 0.5430 0.3313 -0.1003 -0.0998 0.0149  51 ARG D O   
2458 C CB  . ARG D 51 ? 0.4219 0.4517 0.2713 -0.0906 -0.0640 0.0043  51 ARG D CB  
2459 C CG  . ARG D 51 ? 0.3988 0.4287 0.2476 -0.0930 -0.0486 0.0011  51 ARG D CG  
2460 C CD  . ARG D 51 ? 0.3766 0.4090 0.2486 -0.0827 -0.0469 0.0086  51 ARG D CD  
2461 N NE  . ARG D 51 ? 0.3576 0.3964 0.2598 -0.0750 -0.0437 0.0034  51 ARG D NE  
2462 C CZ  . ARG D 51 ? 0.3648 0.4044 0.2876 -0.0672 -0.0423 0.0085  51 ARG D CZ  
2463 N NH1 . ARG D 51 ? 0.3777 0.4129 0.2956 -0.0649 -0.0436 0.0184  51 ARG D NH1 
2464 N NH2 . ARG D 51 ? 0.3265 0.3682 0.2716 -0.0628 -0.0408 0.0040  51 ARG D NH2 
2465 N N   . ILE D 52 ? 0.4448 0.4769 0.2813 -0.0993 -0.0919 -0.0009 52 ILE D N   
2466 C CA  . ILE D 52 ? 0.4244 0.4608 0.2644 -0.0974 -0.1107 0.0045  52 ILE D CA  
2467 C C   . ILE D 52 ? 0.4710 0.5013 0.2872 -0.1101 -0.1177 -0.0018 52 ILE D C   
2468 O O   . ILE D 52 ? 0.5065 0.5359 0.3207 -0.1165 -0.1074 -0.0132 52 ILE D O   
2469 C CB  . ILE D 52 ? 0.3955 0.4482 0.2735 -0.0884 -0.1113 0.0038  52 ILE D CB  
2470 C CG1 . ILE D 52 ? 0.3875 0.4438 0.2851 -0.0769 -0.1053 0.0103  52 ILE D CG1 
2471 C CG2 . ILE D 52 ? 0.4171 0.4799 0.3037 -0.0877 -0.1294 0.0066  52 ILE D CG2 
2472 C CD1 . ILE D 52 ? 0.3806 0.4505 0.3114 -0.0710 -0.1014 0.0085  52 ILE D CD1 
2473 N N   . HIS D 53 ? 0.4819 0.5059 0.2792 -0.1137 -0.1366 0.0055  53 HIS D N   
2474 C CA  . HIS D 53 ? 0.5474 0.5628 0.3176 -0.1272 -0.1467 0.0013  53 HIS D CA  
2475 C C   . HIS D 53 ? 0.5328 0.5553 0.3134 -0.1240 -0.1715 0.0081  53 HIS D C   
2476 O O   . HIS D 53 ? 0.5129 0.5446 0.3166 -0.1110 -0.1811 0.0163  53 HIS D O   
2477 C CB  . HIS D 53 ? 0.6282 0.6221 0.3511 -0.1407 -0.1453 0.0025  53 HIS D CB  
2478 C CG  . HIS D 53 ? 0.6564 0.6477 0.3716 -0.1450 -0.1202 -0.0063 53 HIS D CG  
2479 N ND1 . HIS D 53 ? 0.6662 0.6583 0.3875 -0.1389 -0.1103 -0.0012 53 HIS D ND1 
2480 C CD2 . HIS D 53 ? 0.6816 0.6712 0.3868 -0.1538 -0.1032 -0.0209 53 HIS D CD2 
2481 C CE1 . HIS D 53 ? 0.6541 0.6476 0.3718 -0.1441 -0.0886 -0.0120 53 HIS D CE1 
2482 N NE2 . HIS D 53 ? 0.6793 0.6715 0.3882 -0.1522 -0.0835 -0.0247 53 HIS D NE2 
2483 N N   . LYS D 54 ? 0.5860 0.6052 0.3517 -0.1354 -0.1816 0.0034  54 LYS D N   
2484 C CA  . LYS D 54 ? 0.5890 0.6147 0.3619 -0.1347 -0.2078 0.0093  54 LYS D CA  
2485 C C   . LYS D 54 ? 0.6000 0.6137 0.3582 -0.1295 -0.2255 0.0219  54 LYS D C   
2486 O O   . LYS D 54 ? 0.6780 0.6683 0.3961 -0.1382 -0.2234 0.0253  54 LYS D O   
2487 C CB  . LYS D 54 ? 0.6467 0.6614 0.3901 -0.1520 -0.2171 0.0037  54 LYS D CB  
2488 C CG  . LYS D 54 ? 0.7070 0.7282 0.4574 -0.1526 -0.2470 0.0100  54 LYS D CG  
2489 C CD  . LYS D 54 ? 0.7813 0.7902 0.5008 -0.1716 -0.2561 0.0042  54 LYS D CD  
2490 C CE  . LYS D 54 ? 0.8389 0.8569 0.5700 -0.1721 -0.2879 0.0107  54 LYS D CE  
2491 N NZ  . LYS D 54 ? 0.9073 0.9113 0.6059 -0.1919 -0.2989 0.0057  54 LYS D NZ  
2492 N N   . GLY D 55 ? 0.6032 0.6324 0.3937 -0.1156 -0.2428 0.0282  55 GLY D N   
2493 C CA  . GLY D 55 ? 0.6203 0.6354 0.3985 -0.1087 -0.2631 0.0398  55 GLY D CA  
2494 C C   . GLY D 55 ? 0.6041 0.6232 0.4039 -0.0919 -0.2556 0.0446  55 GLY D C   
2495 O O   . GLY D 55 ? 0.6257 0.6383 0.4285 -0.0813 -0.2750 0.0530  55 GLY D O   
2496 N N   . ASP D 56 ? 0.5656 0.5931 0.3792 -0.0894 -0.2289 0.0392  56 ASP D N   
2497 C CA  . ASP D 56 ? 0.5379 0.5695 0.3721 -0.0747 -0.2202 0.0430  56 ASP D CA  
2498 C C   . ASP D 56 ? 0.5014 0.5591 0.3827 -0.0586 -0.2290 0.0421  56 ASP D C   
2499 O O   . ASP D 56 ? 0.4979 0.5778 0.4045 -0.0602 -0.2299 0.0356  56 ASP D O   
2500 C CB  . ASP D 56 ? 0.4838 0.5194 0.3240 -0.0768 -0.1916 0.0368  56 ASP D CB  
2501 C CG  . ASP D 56 ? 0.5145 0.5289 0.3137 -0.0912 -0.1798 0.0358  56 ASP D CG  
2502 O OD1 . ASP D 56 ? 0.5274 0.5458 0.3317 -0.0941 -0.1580 0.0287  56 ASP D OD1 
2503 O OD2 . ASP D 56 ? 0.5485 0.5422 0.3104 -0.1003 -0.1929 0.0415  56 ASP D OD2 
2504 N N   . ARG D 57 ? 0.5250 0.5798 0.4172 -0.0440 -0.2357 0.0480  57 ARG D N   
2505 C CA  . ARG D 57 ? 0.4976 0.5786 0.4363 -0.0274 -0.2412 0.0453  57 ARG D CA  
2506 C C   . ARG D 57 ? 0.4202 0.5141 0.3824 -0.0216 -0.2163 0.0409  57 ARG D C   
2507 O O   . ARG D 57 ? 0.4491 0.5253 0.3941 -0.0205 -0.2054 0.0450  57 ARG D O   
2508 C CB  . ARG D 57 ? 0.5425 0.6109 0.4804 -0.0130 -0.2633 0.0526  57 ARG D CB  
2509 C CG  . ARG D 57 ? 0.6025 0.7007 0.5912 0.0054  -0.2700 0.0473  57 ARG D CG  
2510 C CD  . ARG D 57 ? 0.6787 0.7625 0.6680 0.0215  -0.2951 0.0532  57 ARG D CD  
2511 N NE  . ARG D 57 ? 0.7310 0.8470 0.7735 0.0405  -0.2990 0.0452  57 ARG D NE  
2512 C CZ  . ARG D 57 ? 0.8426 0.9590 0.9030 0.0572  -0.3249 0.0459  57 ARG D CZ  
2513 N NH1 . ARG D 57 ? 0.9062 0.9882 0.9315 0.0564  -0.3518 0.0561  57 ARG D NH1 
2514 N NH2 . ARG D 57 ? 0.8598 1.0105 0.9728 0.0744  -0.3245 0.0359  57 ARG D NH2 
2515 N N   . VAL D 58 ? 0.3572 0.4808 0.3563 -0.0199 -0.2082 0.0331  58 VAL D N   
2516 C CA  . VAL D 58 ? 0.3132 0.4480 0.3335 -0.0157 -0.1868 0.0293  58 VAL D CA  
2517 C C   . VAL D 58 ? 0.3303 0.4761 0.3773 0.0017  -0.1917 0.0293  58 VAL D C   
2518 O O   . VAL D 58 ? 0.3738 0.5451 0.4528 0.0088  -0.2018 0.0243  58 VAL D O   
2519 C CB  . VAL D 58 ? 0.3843 0.5435 0.4285 -0.0246 -0.1753 0.0209  58 VAL D CB  
2520 C CG1 . VAL D 58 ? 0.3307 0.4935 0.3873 -0.0234 -0.1538 0.0186  58 VAL D CG1 
2521 C CG2 . VAL D 58 ? 0.4209 0.5691 0.4404 -0.0407 -0.1740 0.0190  58 VAL D CG2 
2522 N N   . LEU D 59 ? 0.3167 0.4439 0.3512 0.0087  -0.1849 0.0340  59 LEU D N   
2523 C CA  . LEU D 59 ? 0.3449 0.4764 0.3993 0.0262  -0.1906 0.0336  59 LEU D CA  
2524 C C   . LEU D 59 ? 0.3062 0.4587 0.3899 0.0297  -0.1709 0.0264  59 LEU D C   
2525 O O   . LEU D 59 ? 0.3241 0.4960 0.4384 0.0426  -0.1734 0.0203  59 LEU D O   
2526 C CB  . LEU D 59 ? 0.3566 0.4536 0.3792 0.0313  -0.1955 0.0428  59 LEU D CB  
2527 C CG  . LEU D 59 ? 0.4025 0.4734 0.3910 0.0279  -0.2174 0.0512  59 LEU D CG  
2528 C CD1 . LEU D 59 ? 0.4518 0.4883 0.4059 0.0282  -0.2171 0.0603  59 LEU D CD1 
2529 C CD2 . LEU D 59 ? 0.4341 0.5139 0.4416 0.0402  -0.2437 0.0501  59 LEU D CD2 
2530 N N   . ALA D 60 ? 0.2843 0.4320 0.3580 0.0181  -0.1516 0.0263  60 ALA D N   
2531 C CA  . ALA D 60 ? 0.2553 0.4167 0.3491 0.0185  -0.1333 0.0210  60 ALA D CA  
2532 C C   . ALA D 60 ? 0.2620 0.4221 0.3486 0.0026  -0.1178 0.0199  60 ALA D C   
2533 O O   . ALA D 60 ? 0.2629 0.4061 0.3258 -0.0061 -0.1180 0.0237  60 ALA D O   
2534 C CB  . ALA D 60 ? 0.2564 0.3986 0.3401 0.0282  -0.1281 0.0248  60 ALA D CB  
2535 N N   . VAL D 61 ? 0.2383 0.4158 0.3454 -0.0012 -0.1046 0.0140  61 VAL D N   
2536 C CA  . VAL D 61 ? 0.2495 0.4232 0.3509 -0.0158 -0.0915 0.0131  61 VAL D CA  
2537 C C   . VAL D 61 ? 0.2212 0.3895 0.3240 -0.0158 -0.0768 0.0131  61 VAL D C   
2538 O O   . VAL D 61 ? 0.2261 0.4131 0.3494 -0.0119 -0.0715 0.0075  61 VAL D O   
2539 C CB  . VAL D 61 ? 0.2468 0.4460 0.3680 -0.0265 -0.0917 0.0060  61 VAL D CB  
2540 C CG1 . VAL D 61 ? 0.2749 0.4646 0.3873 -0.0418 -0.0796 0.0054  61 VAL D CG1 
2541 C CG2 . VAL D 61 ? 0.2367 0.4405 0.3550 -0.0277 -0.1080 0.0059  61 VAL D CG2 
2542 N N   . ASN D 62 ? 0.2071 0.3503 0.2885 -0.0206 -0.0702 0.0187  62 ASN D N   
2543 C CA  . ASN D 62 ? 0.2025 0.3362 0.2809 -0.0232 -0.0578 0.0199  62 ASN D CA  
2544 C C   . ASN D 62 ? 0.2165 0.3537 0.3017 -0.0104 -0.0567 0.0187  62 ASN D C   
2545 O O   . ASN D 62 ? 0.2503 0.3952 0.3444 -0.0124 -0.0463 0.0143  62 ASN D O   
2546 C CB  . ASN D 62 ? 0.2187 0.3636 0.3071 -0.0373 -0.0484 0.0149  62 ASN D CB  
2547 C CG  . ASN D 62 ? 0.2324 0.3621 0.3081 -0.0491 -0.0485 0.0171  62 ASN D CG  
2548 O OD1 . ASN D 62 ? 0.2227 0.3334 0.2831 -0.0464 -0.0521 0.0217  62 ASN D OD1 
2549 N ND2 . ASN D 62 ? 0.2343 0.3721 0.3166 -0.0626 -0.0445 0.0130  62 ASN D ND2 
2550 N N   . GLY D 63 ? 0.2431 0.3728 0.3221 0.0019  -0.0679 0.0221  63 GLY D N   
2551 C CA  . GLY D 63 ? 0.2719 0.3956 0.3514 0.0152  -0.0688 0.0220  63 GLY D CA  
2552 C C   . GLY D 63 ? 0.2515 0.4013 0.3590 0.0269  -0.0741 0.0131  63 GLY D C   
2553 O O   . GLY D 63 ? 0.2393 0.3847 0.3501 0.0402  -0.0758 0.0110  63 GLY D O   
2554 N N   . VAL D 64 ? 0.2417 0.4187 0.3705 0.0222  -0.0772 0.0072  64 VAL D N   
2555 C CA  . VAL D 64 ? 0.2236 0.4321 0.3861 0.0326  -0.0828 -0.0027 64 VAL D CA  
2556 C C   . VAL D 64 ? 0.2294 0.4442 0.3974 0.0383  -0.1035 -0.0010 64 VAL D C   
2557 O O   . VAL D 64 ? 0.2205 0.4364 0.3811 0.0266  -0.1078 0.0018  64 VAL D O   
2558 C CB  . VAL D 64 ? 0.2276 0.4693 0.4161 0.0208  -0.0691 -0.0128 64 VAL D CB  
2559 C CG1 . VAL D 64 ? 0.1946 0.4735 0.4232 0.0325  -0.0735 -0.0248 64 VAL D CG1 
2560 C CG2 . VAL D 64 ? 0.2350 0.4670 0.4127 0.0118  -0.0492 -0.0137 64 VAL D CG2 
2561 N N   . SER D 65 ? 0.2320 0.4490 0.4119 0.0563  -0.1176 -0.0031 65 SER D N   
2562 C CA  . SER D 65 ? 0.2629 0.4835 0.4475 0.0626  -0.1409 -0.0010 65 SER D CA  
2563 C C   . SER D 65 ? 0.2650 0.5225 0.4797 0.0551  -0.1437 -0.0085 65 SER D C   
2564 O O   . SER D 65 ? 0.2593 0.5491 0.5053 0.0528  -0.1309 -0.0190 65 SER D O   
2565 C CB  . SER D 65 ? 0.2531 0.4709 0.4509 0.0848  -0.1567 -0.0036 65 SER D CB  
2566 O OG  . SER D 65 ? 0.3504 0.5758 0.5586 0.0908  -0.1813 -0.0028 65 SER D OG  
2567 N N   . LEU D 66 ? 0.2741 0.5263 0.4775 0.0499  -0.1606 -0.0033 66 LEU D N   
2568 C CA  . LEU D 66 ? 0.2910 0.5760 0.5215 0.0433  -0.1682 -0.0094 66 LEU D CA  
2569 C C   . LEU D 66 ? 0.3601 0.6648 0.6219 0.0608  -0.1903 -0.0142 66 LEU D C   
2570 O O   . LEU D 66 ? 0.3671 0.7012 0.6557 0.0575  -0.2007 -0.0194 66 LEU D O   
2571 C CB  . LEU D 66 ? 0.2997 0.5684 0.5010 0.0273  -0.1751 -0.0024 66 LEU D CB  
2572 C CG  . LEU D 66 ? 0.3495 0.6053 0.5288 0.0101  -0.1544 -0.0005 66 LEU D CG  
2573 C CD1 . LEU D 66 ? 0.3290 0.5729 0.4847 -0.0045 -0.1612 0.0031  66 LEU D CD1 
2574 C CD2 . LEU D 66 ? 0.3628 0.6478 0.5705 0.0026  -0.1363 -0.0095 66 LEU D CD2 
2575 N N   . GLU D 67 ? 0.3852 0.6728 0.6444 0.0794  -0.1990 -0.0126 67 GLU D N   
2576 C CA  . GLU D 67 ? 0.4390 0.7420 0.7294 0.0987  -0.2227 -0.0176 67 GLU D CA  
2577 C C   . GLU D 67 ? 0.3927 0.7504 0.7411 0.1026  -0.2157 -0.0336 67 GLU D C   
2578 O O   . GLU D 67 ? 0.3532 0.7301 0.7203 0.1027  -0.1918 -0.0432 67 GLU D O   
2579 C CB  . GLU D 67 ? 0.5142 0.7902 0.7956 0.1192  -0.2303 -0.0157 67 GLU D CB  
2580 C CG  . GLU D 67 ? 0.6031 0.8892 0.9150 0.1411  -0.2591 -0.0203 67 GLU D CG  
2581 C CD  . GLU D 67 ? 0.6739 0.9531 1.0007 0.1644  -0.2588 -0.0273 67 GLU D CD  
2582 O OE1 . GLU D 67 ? 0.7031 1.0226 1.0810 0.1773  -0.2524 -0.0435 67 GLU D OE1 
2583 O OE2 . GLU D 67 ? 0.7084 0.9422 0.9958 0.1691  -0.2642 -0.0174 67 GLU D OE2 
2584 N N   . GLY D 68 ? 0.3724 0.7554 0.7481 0.1043  -0.2366 -0.0367 68 GLY D N   
2585 C CA  . GLY D 68 ? 0.3274 0.7665 0.7627 0.1082  -0.2335 -0.0524 68 GLY D CA  
2586 C C   . GLY D 68 ? 0.3136 0.7804 0.7562 0.0831  -0.2194 -0.0551 68 GLY D C   
2587 O O   . GLY D 68 ? 0.3132 0.8293 0.8038 0.0811  -0.2163 -0.0675 68 GLY D O   
2588 N N   . ALA D 69 ? 0.3039 0.7391 0.6997 0.0638  -0.2113 -0.0441 69 ALA D N   
2589 C CA  . ALA D 69 ? 0.3183 0.7714 0.7145 0.0394  -0.1990 -0.0459 69 ALA D CA  
2590 C C   . ALA D 69 ? 0.3492 0.8193 0.7581 0.0326  -0.2225 -0.0452 69 ALA D C   
2591 O O   . ALA D 69 ? 0.3743 0.8181 0.7597 0.0371  -0.2464 -0.0362 69 ALA D O   
2592 C CB  . ALA D 69 ? 0.3181 0.7307 0.6623 0.0231  -0.1843 -0.0358 69 ALA D CB  
2593 N N   . THR D 70 ? 0.3636 0.8767 0.8074 0.0197  -0.2158 -0.0545 70 THR D N   
2594 C CA  . THR D 70 ? 0.4061 0.9320 0.8545 0.0063  -0.2341 -0.0530 70 THR D CA  
2595 C C   . THR D 70 ? 0.3965 0.8857 0.7929 -0.0156 -0.2257 -0.0438 70 THR D C   
2596 O O   . THR D 70 ? 0.3573 0.8221 0.7260 -0.0209 -0.2040 -0.0410 70 THR D O   
2597 C CB  . THR D 70 ? 0.4306 1.0152 0.9323 -0.0035 -0.2276 -0.0662 70 THR D CB  
2598 O OG1 . THR D 70 ? 0.4174 1.0059 0.9095 -0.0237 -0.1981 -0.0693 70 THR D OG1 
2599 C CG2 . THR D 70 ? 0.4453 1.0712 1.0039 0.0190  -0.2299 -0.0789 70 THR D CG2 
2600 N N   . HIS D 71 ? 0.3860 0.8705 0.7696 -0.0281 -0.2434 -0.0399 71 HIS D N   
2601 C CA  . HIS D 71 ? 0.3988 0.8484 0.7345 -0.0479 -0.2364 -0.0333 71 HIS D CA  
2602 C C   . HIS D 71 ? 0.3881 0.8462 0.7250 -0.0647 -0.2089 -0.0382 71 HIS D C   
2603 O O   . HIS D 71 ? 0.3585 0.7825 0.6592 -0.0706 -0.1935 -0.0336 71 HIS D O   
2604 C CB  . HIS D 71 ? 0.4187 0.8676 0.7450 -0.0607 -0.2589 -0.0309 71 HIS D CB  
2605 C CG  . HIS D 71 ? 0.4481 0.8568 0.7222 -0.0782 -0.2537 -0.0254 71 HIS D CG  
2606 N ND1 . HIS D 71 ? 0.4724 0.8850 0.7410 -0.0996 -0.2423 -0.0291 71 HIS D ND1 
2607 C CD2 . HIS D 71 ? 0.4798 0.8437 0.7052 -0.0775 -0.2574 -0.0175 71 HIS D CD2 
2608 C CE1 . HIS D 71 ? 0.4844 0.8559 0.7050 -0.1092 -0.2398 -0.0246 71 HIS D CE1 
2609 N NE2 . HIS D 71 ? 0.4990 0.8425 0.6936 -0.0965 -0.2476 -0.0180 71 HIS D NE2 
2610 N N   . LYS D 72 ? 0.4000 0.9033 0.7789 -0.0732 -0.2038 -0.0475 72 LYS D N   
2611 C CA  . LYS D 72 ? 0.4221 0.9344 0.8018 -0.0925 -0.1798 -0.0520 72 LYS D CA  
2612 C C   . LYS D 72 ? 0.3717 0.8642 0.7366 -0.0857 -0.1575 -0.0508 72 LYS D C   
2613 O O   . LYS D 72 ? 0.3390 0.8059 0.6744 -0.0997 -0.1423 -0.0477 72 LYS D O   
2614 C CB  . LYS D 72 ? 0.4704 1.0404 0.9029 -0.1005 -0.1761 -0.0635 72 LYS D CB  
2615 C CG  . LYS D 72 ? 0.5564 1.1492 1.0043 -0.1145 -0.1954 -0.0653 72 LYS D CG  
2616 C CD  . LYS D 72 ? 0.5889 1.2448 1.0950 -0.1216 -0.1906 -0.0778 72 LYS D CD  
2617 C CE  . LYS D 72 ? 0.6168 1.2998 1.1446 -0.1328 -0.2139 -0.0795 72 LYS D CE  
2618 N NZ  . LYS D 72 ? 0.6078 1.3579 1.1979 -0.1395 -0.2093 -0.0929 72 LYS D NZ  
2619 N N   . GLN D 73 ? 0.3493 0.8521 0.7345 -0.0639 -0.1573 -0.0533 73 GLN D N   
2620 C CA  . GLN D 73 ? 0.3239 0.8106 0.6981 -0.0564 -0.1373 -0.0530 73 GLN D CA  
2621 C C   . GLN D 73 ? 0.2737 0.7068 0.5975 -0.0536 -0.1368 -0.0415 73 GLN D C   
2622 O O   . GLN D 73 ? 0.2632 0.6748 0.5653 -0.0599 -0.1189 -0.0390 73 GLN D O   
2623 C CB  . GLN D 73 ? 0.3666 0.8760 0.7750 -0.0326 -0.1397 -0.0596 73 GLN D CB  
2624 C CG  . GLN D 73 ? 0.3977 0.9659 0.8626 -0.0332 -0.1364 -0.0739 73 GLN D CG  
2625 C CD  . GLN D 73 ? 0.4246 1.0135 0.9250 -0.0065 -0.1402 -0.0822 73 GLN D CD  
2626 O OE1 . GLN D 73 ? 0.4418 0.9998 0.9243 0.0129  -0.1520 -0.0757 73 GLN D OE1 
2627 N NE2 . GLN D 73 ? 0.4452 1.0866 0.9963 -0.0060 -0.1301 -0.0976 73 GLN D NE2 
2628 N N   . ALA D 74 ? 0.2495 0.6614 0.5548 -0.0450 -0.1568 -0.0346 74 ALA D N   
2629 C CA  . ALA D 74 ? 0.2603 0.6250 0.5192 -0.0439 -0.1564 -0.0249 74 ALA D CA  
2630 C C   . ALA D 74 ? 0.2867 0.6319 0.5188 -0.0642 -0.1452 -0.0232 74 ALA D C   
2631 O O   . ALA D 74 ? 0.2804 0.5990 0.4887 -0.0661 -0.1314 -0.0196 74 ALA D O   
2632 C CB  . ALA D 74 ? 0.2937 0.6412 0.5355 -0.0358 -0.1798 -0.0187 74 ALA D CB  
2633 N N   . VAL D 75 ? 0.3150 0.6725 0.5515 -0.0791 -0.1527 -0.0261 75 VAL D N   
2634 C CA  . VAL D 75 ? 0.3171 0.6566 0.5308 -0.0986 -0.1438 -0.0261 75 VAL D CA  
2635 C C   . VAL D 75 ? 0.3272 0.6683 0.5453 -0.1069 -0.1227 -0.0283 75 VAL D C   
2636 O O   . VAL D 75 ? 0.3339 0.6434 0.5243 -0.1129 -0.1131 -0.0250 75 VAL D O   
2637 C CB  . VAL D 75 ? 0.3420 0.6997 0.5652 -0.1142 -0.1558 -0.0300 75 VAL D CB  
2638 C CG1 . VAL D 75 ? 0.3529 0.6961 0.5589 -0.1355 -0.1453 -0.0317 75 VAL D CG1 
2639 C CG2 . VAL D 75 ? 0.3731 0.7149 0.5763 -0.1107 -0.1761 -0.0262 75 VAL D CG2 
2640 N N   . GLU D 76 ? 0.3369 0.7144 0.5897 -0.1071 -0.1158 -0.0345 76 GLU D N   
2641 C CA  . GLU D 76 ? 0.3597 0.7407 0.6154 -0.1174 -0.0957 -0.0371 76 GLU D CA  
2642 C C   . GLU D 76 ? 0.3233 0.6764 0.5599 -0.1059 -0.0846 -0.0322 76 GLU D C   
2643 O O   . GLU D 76 ? 0.3385 0.6691 0.5549 -0.1165 -0.0724 -0.0296 76 GLU D O   
2644 C CB  . GLU D 76 ? 0.4425 0.8729 0.7414 -0.1197 -0.0897 -0.0467 76 GLU D CB  
2645 C CG  . GLU D 76 ? 0.5406 0.9872 0.8452 -0.1464 -0.0801 -0.0513 76 GLU D CG  
2646 C CD  . GLU D 76 ? 0.6169 1.0477 0.9024 -0.1621 -0.0923 -0.0482 76 GLU D CD  
2647 O OE1 . GLU D 76 ? 0.6476 1.0967 0.9485 -0.1591 -0.1091 -0.0499 76 GLU D OE1 
2648 O OE2 . GLU D 76 ? 0.6489 1.0471 0.9033 -0.1772 -0.0864 -0.0443 76 GLU D OE2 
2649 N N   . THR D 77 ? 0.2322 0.5853 0.4745 -0.0848 -0.0907 -0.0305 77 THR D N   
2650 C CA  . THR D 77 ? 0.2609 0.5861 0.4834 -0.0732 -0.0831 -0.0251 77 THR D CA  
2651 C C   . THR D 77 ? 0.2535 0.5371 0.4381 -0.0785 -0.0829 -0.0174 77 THR D C   
2652 O O   . THR D 77 ? 0.2636 0.5250 0.4314 -0.0811 -0.0715 -0.0140 77 THR D O   
2653 C CB  . THR D 77 ? 0.2886 0.6167 0.5201 -0.0505 -0.0941 -0.0239 77 THR D CB  
2654 O OG1 . THR D 77 ? 0.3104 0.6759 0.5798 -0.0429 -0.0910 -0.0329 77 THR D OG1 
2655 C CG2 . THR D 77 ? 0.2779 0.5728 0.4837 -0.0407 -0.0887 -0.0169 77 THR D CG2 
2656 N N   . LEU D 78 ? 0.2756 0.5494 0.4475 -0.0804 -0.0957 -0.0154 78 LEU D N   
2657 C CA  . LEU D 78 ? 0.2415 0.4796 0.3809 -0.0846 -0.0949 -0.0108 78 LEU D CA  
2658 C C   . LEU D 78 ? 0.2898 0.5164 0.4206 -0.1018 -0.0857 -0.0124 78 LEU D C   
2659 O O   . LEU D 78 ? 0.3370 0.5345 0.4471 -0.1029 -0.0799 -0.0092 78 LEU D O   
2660 C CB  . LEU D 78 ? 0.2594 0.4910 0.3860 -0.0848 -0.1095 -0.0104 78 LEU D CB  
2661 C CG  . LEU D 78 ? 0.2619 0.4907 0.3844 -0.0689 -0.1202 -0.0062 78 LEU D CG  
2662 C CD1 . LEU D 78 ? 0.3116 0.5446 0.4293 -0.0708 -0.1381 -0.0067 78 LEU D CD1 
2663 C CD2 . LEU D 78 ? 0.2995 0.4971 0.3953 -0.0627 -0.1136 -0.0006 78 LEU D CD2 
2664 N N   . ARG D 79 ? 0.2613 0.5102 0.4084 -0.1156 -0.0856 -0.0174 79 ARG D N   
2665 C CA  . ARG D 79 ? 0.3278 0.5629 0.4640 -0.1343 -0.0791 -0.0184 79 ARG D CA  
2666 C C   . ARG D 79 ? 0.3626 0.5914 0.4974 -0.1385 -0.0651 -0.0166 79 ARG D C   
2667 O O   . ARG D 79 ? 0.3884 0.5882 0.5031 -0.1478 -0.0612 -0.0139 79 ARG D O   
2668 C CB  . ARG D 79 ? 0.3427 0.6024 0.4938 -0.1509 -0.0839 -0.0239 79 ARG D CB  
2669 C CG  . ARG D 79 ? 0.3780 0.6359 0.5228 -0.1510 -0.0988 -0.0252 79 ARG D CG  
2670 C CD  . ARG D 79 ? 0.4066 0.6868 0.5645 -0.1695 -0.1047 -0.0301 79 ARG D CD  
2671 N NE  . ARG D 79 ? 0.4709 0.7413 0.6154 -0.1711 -0.1192 -0.0310 79 ARG D NE  
2672 C CZ  . ARG D 79 ? 0.5030 0.7919 0.6571 -0.1843 -0.1295 -0.0347 79 ARG D CZ  
2673 N NH1 . ARG D 79 ? 0.5155 0.8373 0.6958 -0.1974 -0.1263 -0.0383 79 ARG D NH1 
2674 N NH2 . ARG D 79 ? 0.5286 0.8032 0.6648 -0.1856 -0.1426 -0.0353 79 ARG D NH2 
2675 N N   . ASN D 80 ? 0.3636 0.6179 0.5191 -0.1314 -0.0585 -0.0186 80 ASN D N   
2676 C CA  . ASN D 80 ? 0.3709 0.6218 0.5243 -0.1366 -0.0443 -0.0180 80 ASN D CA  
2677 C C   . ASN D 80 ? 0.3201 0.5398 0.4538 -0.1236 -0.0416 -0.0112 80 ASN D C   
2678 O O   . ASN D 80 ? 0.3055 0.5312 0.4453 -0.1127 -0.0354 -0.0110 80 ASN D O   
2679 C CB  . ASN D 80 ? 0.4620 0.7545 0.6468 -0.1334 -0.0372 -0.0253 80 ASN D CB  
2680 C CG  . ASN D 80 ? 0.5709 0.8632 0.7523 -0.1434 -0.0204 -0.0269 80 ASN D CG  
2681 O OD1 . ASN D 80 ? 0.6241 0.9008 0.7882 -0.1641 -0.0146 -0.0251 80 ASN D OD1 
2682 N ND2 . ASN D 80 ? 0.5859 0.8935 0.7817 -0.1294 -0.0131 -0.0305 80 ASN D ND2 
2683 N N   . THR D 81 ? 0.3009 0.4879 0.4120 -0.1244 -0.0468 -0.0064 81 THR D N   
2684 C CA  . THR D 81 ? 0.2847 0.4436 0.3789 -0.1131 -0.0459 -0.0002 81 THR D CA  
2685 C C   . THR D 81 ? 0.2761 0.4021 0.3501 -0.1242 -0.0458 0.0029  81 THR D C   
2686 O O   . THR D 81 ? 0.3098 0.4320 0.3804 -0.1391 -0.0484 0.0004  81 THR D O   
2687 C CB  . THR D 81 ? 0.3035 0.4583 0.3939 -0.0980 -0.0548 0.0012  81 THR D CB  
2688 O OG1 . THR D 81 ? 0.2641 0.4156 0.3496 -0.1046 -0.0626 -0.0019 81 THR D OG1 
2689 C CG2 . THR D 81 ? 0.2601 0.4407 0.3677 -0.0849 -0.0584 -0.0004 81 THR D CG2 
2690 N N   . GLY D 82 ? 0.2866 0.3880 0.3477 -0.1170 -0.0442 0.0084  82 GLY D N   
2691 C CA  . GLY D 82 ? 0.2826 0.3510 0.3272 -0.1236 -0.0470 0.0114  82 GLY D CA  
2692 C C   . GLY D 82 ? 0.3044 0.3598 0.3443 -0.1161 -0.0542 0.0093  82 GLY D C   
2693 O O   . GLY D 82 ? 0.2804 0.3514 0.3259 -0.1104 -0.0574 0.0055  82 GLY D O   
2694 N N   . GLN D 83 ? 0.3019 0.3284 0.3315 -0.1164 -0.0571 0.0112  83 GLN D N   
2695 C CA  . GLN D 83 ? 0.3276 0.3415 0.3540 -0.1110 -0.0624 0.0064  83 GLN D CA  
2696 C C   . GLN D 83 ? 0.2942 0.3159 0.3227 -0.0958 -0.0605 0.0063  83 GLN D C   
2697 O O   . GLN D 83 ? 0.3115 0.3349 0.3381 -0.0920 -0.0624 0.0004  83 GLN D O   
2698 C CB  . GLN D 83 ? 0.3673 0.3485 0.3858 -0.1156 -0.0674 0.0070  83 GLN D CB  
2699 C CG  . GLN D 83 ? 0.3821 0.3488 0.4012 -0.1054 -0.0709 0.0013  83 GLN D CG  
2700 C CD  . GLN D 83 ? 0.3975 0.3697 0.4155 -0.1062 -0.0729 -0.0082 83 GLN D CD  
2701 O OE1 . GLN D 83 ? 0.3964 0.3741 0.4113 -0.1175 -0.0754 -0.0105 83 GLN D OE1 
2702 N NE2 . GLN D 83 ? 0.3846 0.3552 0.4041 -0.0956 -0.0713 -0.0145 83 GLN D NE2 
2703 N N   . VAL D 84 ? 0.2435 0.2692 0.2734 -0.0886 -0.0565 0.0125  84 VAL D N   
2704 C CA  . VAL D 84 ? 0.2659 0.2997 0.2950 -0.0767 -0.0551 0.0136  84 VAL D CA  
2705 C C   . VAL D 84 ? 0.2785 0.3320 0.3119 -0.0729 -0.0537 0.0167  84 VAL D C   
2706 O O   . VAL D 84 ? 0.2754 0.3311 0.3119 -0.0750 -0.0503 0.0203  84 VAL D O   
2707 C CB  . VAL D 84 ? 0.2704 0.2888 0.2966 -0.0701 -0.0533 0.0180  84 VAL D CB  
2708 C CG1 . VAL D 84 ? 0.3433 0.3705 0.3661 -0.0609 -0.0515 0.0209  84 VAL D CG1 
2709 C CG2 . VAL D 84 ? 0.3153 0.3178 0.3423 -0.0703 -0.0555 0.0125  84 VAL D CG2 
2710 N N   . VAL D 85 ? 0.2572 0.3235 0.2899 -0.0676 -0.0570 0.0148  85 VAL D N   
2711 C CA  . VAL D 85 ? 0.2354 0.3204 0.2746 -0.0623 -0.0592 0.0165  85 VAL D CA  
2712 C C   . VAL D 85 ? 0.2307 0.3124 0.2608 -0.0519 -0.0616 0.0209  85 VAL D C   
2713 O O   . VAL D 85 ? 0.2525 0.3272 0.2711 -0.0513 -0.0636 0.0199  85 VAL D O   
2714 C CB  . VAL D 85 ? 0.2380 0.3408 0.2842 -0.0669 -0.0654 0.0110  85 VAL D CB  
2715 C CG1 . VAL D 85 ? 0.2618 0.3864 0.3210 -0.0603 -0.0692 0.0116  85 VAL D CG1 
2716 C CG2 . VAL D 85 ? 0.2387 0.3413 0.2900 -0.0800 -0.0636 0.0068  85 VAL D CG2 
2717 N N   . HIS D 86 ? 0.2338 0.3195 0.2673 -0.0447 -0.0611 0.0251  86 HIS D N   
2718 C CA  . HIS D 86 ? 0.2202 0.3003 0.2431 -0.0356 -0.0654 0.0299  86 HIS D CA  
2719 C C   . HIS D 86 ? 0.2264 0.3211 0.2534 -0.0312 -0.0756 0.0281  86 HIS D C   
2720 O O   . HIS D 86 ? 0.2661 0.3787 0.3108 -0.0290 -0.0774 0.0249  86 HIS D O   
2721 C CB  . HIS D 86 ? 0.2584 0.3318 0.2813 -0.0296 -0.0614 0.0348  86 HIS D CB  
2722 C CG  . HIS D 86 ? 0.3033 0.3643 0.3112 -0.0222 -0.0657 0.0409  86 HIS D CG  
2723 N ND1 . HIS D 86 ? 0.3505 0.4047 0.3562 -0.0149 -0.0652 0.0448  86 HIS D ND1 
2724 C CD2 . HIS D 86 ? 0.3604 0.4127 0.3522 -0.0226 -0.0703 0.0436  86 HIS D CD2 
2725 C CE1 . HIS D 86 ? 0.3794 0.4199 0.3680 -0.0109 -0.0708 0.0505  86 HIS D CE1 
2726 N NE2 . HIS D 86 ? 0.3926 0.4324 0.3722 -0.0164 -0.0735 0.0501  86 HIS D NE2 
2727 N N   . LEU D 87 ? 0.2361 0.3239 0.2471 -0.0311 -0.0826 0.0296  87 LEU D N   
2728 C CA  . LEU D 87 ? 0.2239 0.3208 0.2346 -0.0278 -0.0958 0.0292  87 LEU D CA  
2729 C C   . LEU D 87 ? 0.2815 0.3628 0.2720 -0.0217 -0.1037 0.0361  87 LEU D C   
2730 O O   . LEU D 87 ? 0.3233 0.3881 0.2936 -0.0257 -0.0991 0.0395  87 LEU D O   
2731 C CB  . LEU D 87 ? 0.2777 0.3777 0.2817 -0.0374 -0.0997 0.0243  87 LEU D CB  
2732 C CG  . LEU D 87 ? 0.2920 0.4030 0.3113 -0.0457 -0.0939 0.0175  87 LEU D CG  
2733 C CD1 . LEU D 87 ? 0.2904 0.3959 0.2962 -0.0554 -0.0957 0.0125  87 LEU D CD1 
2734 C CD2 . LEU D 87 ? 0.2877 0.4229 0.3321 -0.0440 -0.0988 0.0147  87 LEU D CD2 
2735 N N   . LEU D 88 ? 0.2771 0.3639 0.2739 -0.0125 -0.1162 0.0378  88 LEU D N   
2736 C CA  . LEU D 88 ? 0.2840 0.3528 0.2597 -0.0070 -0.1281 0.0449  88 LEU D CA  
2737 C C   . LEU D 88 ? 0.3206 0.3914 0.2883 -0.0092 -0.1450 0.0448  88 LEU D C   
2738 O O   . LEU D 88 ? 0.3441 0.4351 0.3351 -0.0052 -0.1530 0.0401  88 LEU D O   
2739 C CB  . LEU D 88 ? 0.3193 0.3888 0.3084 0.0074  -0.1325 0.0465  88 LEU D CB  
2740 C CG  . LEU D 88 ? 0.3796 0.4261 0.3473 0.0150  -0.1470 0.0542  88 LEU D CG  
2741 C CD1 . LEU D 88 ? 0.3757 0.3975 0.3135 0.0074  -0.1395 0.0614  88 LEU D CD1 
2742 C CD2 . LEU D 88 ? 0.3440 0.3953 0.3324 0.0312  -0.1506 0.0520  88 LEU D CD2 
2743 N N   . LEU D 89 ? 0.5340 0.3621 0.2559 0.0769  -0.0665 0.0288  89 LEU D N   
2744 C CA  . LEU D 89 ? 0.5310 0.3759 0.2721 0.0604  -0.0698 0.0317  89 LEU D CA  
2745 C C   . LEU D 89 ? 0.5293 0.3942 0.2826 0.0365  -0.0981 0.0463  89 LEU D C   
2746 O O   . LEU D 89 ? 0.5456 0.4188 0.2946 0.0309  -0.1145 0.0549  89 LEU D O   
2747 C CB  . LEU D 89 ? 0.5199 0.3975 0.2578 0.0619  -0.0549 0.0280  89 LEU D CB  
2748 C CG  . LEU D 89 ? 0.5063 0.3683 0.2433 0.0843  -0.0265 0.0163  89 LEU D CG  
2749 C CD1 . LEU D 89 ? 0.5737 0.4459 0.2902 0.0964  -0.0189 0.0183  89 LEU D CD1 
2750 C CD2 . LEU D 89 ? 0.5196 0.4002 0.2771 0.0825  -0.0144 0.0062  89 LEU D CD2 
2751 N N   . GLU D 90 ? 0.5049 0.3786 0.2774 0.0230  -0.1040 0.0503  90 GLU D N   
2752 C CA  . GLU D 90 ? 0.5770 0.4837 0.3635 -0.0001 -0.1276 0.0693  90 GLU D CA  
2753 C C   . GLU D 90 ? 0.5734 0.5280 0.3573 -0.0067 -0.1209 0.0705  90 GLU D C   
2754 O O   . GLU D 90 ? 0.5754 0.5288 0.3637 -0.0002 -0.1061 0.0564  90 GLU D O   
2755 C CB  . GLU D 90 ? 0.6474 0.5347 0.4602 -0.0114 -0.1429 0.0759  90 GLU D CB  
2756 C CG  . GLU D 90 ? 0.6824 0.6101 0.5144 -0.0350 -0.1650 0.0999  90 GLU D CG  
2757 C CD  . GLU D 90 ? 0.7251 0.6415 0.5833 -0.0448 -0.1741 0.1050  90 GLU D CD  
2758 O OE1 . GLU D 90 ? 0.7832 0.6558 0.6453 -0.0335 -0.1647 0.0887  90 GLU D OE1 
2759 O OE2 . GLU D 90 ? 0.6323 0.5856 0.5081 -0.0630 -0.1903 0.1266  90 GLU D OE2 
2760 N N   . LYS D 91 ? 0.4829 0.4817 0.2620 -0.0183 -0.1319 0.0858  91 LYS D N   
2761 C CA  . LYS D 91 ? 0.4736 0.5277 0.2486 -0.0239 -0.1273 0.0868  91 LYS D CA  
2762 C C   . LYS D 91 ? 0.4983 0.5740 0.2909 -0.0356 -0.1352 0.0920  91 LYS D C   
2763 O O   . LYS D 91 ? 0.5244 0.6051 0.3339 -0.0511 -0.1552 0.1137  91 LYS D O   
2764 C CB  . LYS D 91 ? 0.5402 0.6379 0.3091 -0.0350 -0.1399 0.1070  91 LYS D CB  
2765 C CG  . LYS D 91 ? 0.5160 0.6806 0.2802 -0.0417 -0.1381 0.1114  91 LYS D CG  
2766 C CD  . LYS D 91 ? 0.5742 0.7493 0.3220 -0.0257 -0.1161 0.0869  91 LYS D CD  
2767 C CE  . LYS D 91 ? 0.6263 0.8732 0.3699 -0.0309 -0.1150 0.0875  91 LYS D CE  
2768 N NZ  . LYS D 91 ? 0.6507 0.9040 0.3858 -0.0140 -0.0936 0.0593  91 LYS D NZ  
2769 N N   . GLY D 92 ? 0.5060 0.5957 0.2984 -0.0277 -0.1204 0.0719  92 GLY D N   
2770 C CA  . GLY D 92 ? 0.5356 0.6476 0.3438 -0.0362 -0.1271 0.0725  92 GLY D CA  
2771 C C   . GLY D 92 ? 0.6326 0.8192 0.4391 -0.0497 -0.1391 0.0886  92 GLY D C   
2772 O O   . GLY D 92 ? 0.5501 0.7735 0.3441 -0.0535 -0.1420 0.1006  92 GLY D O   
2773 N N   . GLN D 93 ? 0.7629 0.9739 0.5827 -0.0562 -0.1461 0.0896  93 GLN D N   
2774 C CA  . GLN D 93 ? 0.9395 1.2296 0.7579 -0.0660 -0.1560 0.1021  93 GLN D CA  
2775 C C   . GLN D 93 ? 1.1512 1.4705 0.9803 -0.0861 -0.1791 0.1459  93 GLN D C   
2776 O O   . GLN D 93 ? 1.1561 1.5478 0.9815 -0.0945 -0.1871 0.1654  93 GLN D O   
2777 C CB  . GLN D 93 ? 0.8965 1.2385 0.6962 -0.0575 -0.1443 0.0862  93 GLN D CB  
2778 C CG  . GLN D 93 ? 0.8755 1.3078 0.6697 -0.0672 -0.1551 0.1040  93 GLN D CG  
2779 C CD  . GLN D 93 ? 0.8686 1.3561 0.6504 -0.0548 -0.1422 0.0739  93 GLN D CD  
2780 O OE1 . GLN D 93 ? 0.8557 1.3548 0.6245 -0.0495 -0.1336 0.0688  93 GLN D OE1 
2781 N NE2 . GLN D 93 ? 0.8683 1.3930 0.6567 -0.0498 -0.1419 0.0521  93 GLN D NE2 
2782 N N   . SER D 94 ? 1.3412 1.6066 1.1879 -0.0931 -0.1898 0.1617  94 SER D N   
2783 C CA  . SER D 94 ? 1.5089 1.7949 1.3773 -0.1122 -0.2127 0.2039  94 SER D CA  
2784 C C   . SER D 94 ? 1.5764 1.9055 1.4619 -0.1231 -0.2252 0.2225  94 SER D C   
2785 O O   . SER D 94 ? 1.6081 1.9612 1.4844 -0.1156 -0.2167 0.2007  94 SER D O   
2786 C CB  . SER D 94 ? 1.5859 1.8017 1.4743 -0.1151 -0.2219 0.2105  94 SER D CB  
2787 O OG  . SER D 94 ? 1.6232 1.7822 1.5186 -0.1071 -0.2156 0.1878  94 SER D OG  
2788 N N   . PRO E 1  ? 0.6385 0.6255 0.4122 0.0145  -0.0304 0.0873  1  PRO E N   
2789 C CA  . PRO E 1  ? 0.5996 0.5623 0.3743 -0.0100 -0.0293 0.0731  1  PRO E CA  
2790 C C   . PRO E 1  ? 0.6058 0.5562 0.3547 -0.0141 -0.0284 0.0727  1  PRO E C   
2791 O O   . PRO E 1  ? 0.6146 0.5596 0.3466 0.0035  -0.0238 0.0842  1  PRO E O   
2792 C CB  . PRO E 1  ? 0.6058 0.5259 0.3904 -0.0084 -0.0146 0.0703  1  PRO E CB  
2793 C CG  . PRO E 1  ? 0.6324 0.5624 0.4301 0.0070  -0.0121 0.0767  1  PRO E CG  
2794 C CD  . PRO E 1  ? 0.6544 0.6187 0.4414 0.0268  -0.0193 0.0897  1  PRO E CD  
2795 N N   . LYS E 2  ? 0.5712 0.5165 0.3149 -0.0360 -0.0319 0.0603  2  LYS E N   
2796 C CA  . LYS E 2  ? 0.5855 0.5127 0.3045 -0.0416 -0.0286 0.0572  2  LYS E CA  
2797 C C   . LYS E 2  ? 0.5643 0.4452 0.2850 -0.0428 -0.0144 0.0524  2  LYS E C   
2798 O O   . LYS E 2  ? 0.5358 0.4051 0.2767 -0.0458 -0.0097 0.0487  2  LYS E O   
2799 C CB  . LYS E 2  ? 0.6533 0.5938 0.3602 -0.0656 -0.0370 0.0447  2  LYS E CB  
2800 C CG  . LYS E 2  ? 0.7302 0.7241 0.4383 -0.0737 -0.0519 0.0457  2  LYS E CG  
2801 C CD  . LYS E 2  ? 0.8079 0.8135 0.4897 -0.0980 -0.0579 0.0348  2  LYS E CD  
2802 C CE  . LYS E 2  ? 0.8411 0.7936 0.5116 -0.1139 -0.0476 0.0199  2  LYS E CE  
2803 N NZ  . LYS E 2  ? 0.8288 0.7631 0.5176 -0.1240 -0.0454 0.0126  2  LYS E NZ  
2804 N N   . PRO E 3  ? 0.5584 0.4183 0.2578 -0.0414 -0.0077 0.0527  3  PRO E N   
2805 C CA  . PRO E 3  ? 0.5763 0.4001 0.2771 -0.0433 0.0059  0.0485  3  PRO E CA  
2806 C C   . PRO E 3  ? 0.5709 0.3869 0.2841 -0.0571 0.0070  0.0369  3  PRO E C   
2807 O O   . PRO E 3  ? 0.5986 0.4206 0.3029 -0.0697 0.0004  0.0285  3  PRO E O   
2808 C CB  . PRO E 3  ? 0.5836 0.3955 0.2566 -0.0433 0.0096  0.0484  3  PRO E CB  
2809 C CG  . PRO E 3  ? 0.6129 0.4493 0.2737 -0.0320 0.0021  0.0600  3  PRO E CG  
2810 C CD  . PRO E 3  ? 0.5729 0.4455 0.2467 -0.0369 -0.0114 0.0584  3  PRO E CD  
2811 N N   . GLY E 4  ? 0.5287 0.3321 0.2601 -0.0556 0.0161  0.0367  4  GLY E N   
2812 C CA  . GLY E 4  ? 0.5263 0.3243 0.2704 -0.0644 0.0189  0.0291  4  GLY E CA  
2813 C C   . GLY E 4  ? 0.4908 0.3082 0.2606 -0.0679 0.0123  0.0292  4  GLY E C   
2814 O O   . GLY E 4  ? 0.5187 0.3337 0.3045 -0.0714 0.0171  0.0267  4  GLY E O   
2815 N N   . ASP E 5  ? 0.4991 0.3397 0.2728 -0.0653 0.0017  0.0331  5  ASP E N   
2816 C CA  . ASP E 5  ? 0.4619 0.3258 0.2596 -0.0676 -0.0051 0.0337  5  ASP E CA  
2817 C C   . ASP E 5  ? 0.4438 0.3041 0.2621 -0.0617 0.0037  0.0369  5  ASP E C   
2818 O O   . ASP E 5  ? 0.4740 0.3206 0.2862 -0.0529 0.0124  0.0417  5  ASP E O   
2819 C CB  . ASP E 5  ? 0.5078 0.4021 0.3030 -0.0617 -0.0167 0.0394  5  ASP E CB  
2820 C CG  . ASP E 5  ? 0.5409 0.4548 0.3207 -0.0747 -0.0284 0.0345  5  ASP E CG  
2821 O OD1 . ASP E 5  ? 0.5538 0.4500 0.3231 -0.0897 -0.0267 0.0253  5  ASP E OD1 
2822 O OD2 . ASP E 5  ? 0.5644 0.5127 0.3405 -0.0701 -0.0382 0.0402  5  ASP E OD2 
2823 N N   . ILE E 6  ? 0.4366 0.3096 0.2774 -0.0685 0.0021  0.0341  6  ILE E N   
2824 C CA  . ILE E 6  ? 0.4305 0.3096 0.2921 -0.0660 0.0084  0.0360  6  ILE E CA  
2825 C C   . ILE E 6  ? 0.4256 0.3215 0.2922 -0.0573 0.0027  0.0402  6  ILE E C   
2826 O O   . ILE E 6  ? 0.4081 0.3273 0.2758 -0.0576 -0.0096 0.0408  6  ILE E O   
2827 C CB  . ILE E 6  ? 0.4204 0.3134 0.3044 -0.0755 0.0076  0.0327  6  ILE E CB  
2828 C CG1 . ILE E 6  ? 0.4396 0.3161 0.3178 -0.0790 0.0158  0.0309  6  ILE E CG1 
2829 C CG2 . ILE E 6  ? 0.3943 0.3008 0.2999 -0.0755 0.0129  0.0336  6  ILE E CG2 
2830 C CD1 . ILE E 6  ? 0.4329 0.2988 0.3077 -0.0751 0.0294  0.0329  6  ILE E CD1 
2831 N N   . PHE E 7  ? 0.4154 0.2998 0.2824 -0.0498 0.0127  0.0431  7  PHE E N   
2832 C CA  . PHE E 7  ? 0.4067 0.3040 0.2798 -0.0393 0.0106  0.0469  7  PHE E CA  
2833 C C   . PHE E 7  ? 0.4210 0.3060 0.3030 -0.0416 0.0239  0.0443  7  PHE E C   
2834 O O   . PHE E 7  ? 0.4010 0.2679 0.2798 -0.0506 0.0351  0.0413  7  PHE E O   
2835 C CB  . PHE E 7  ? 0.4400 0.3313 0.2906 -0.0212 0.0095  0.0558  7  PHE E CB  
2836 C CG  . PHE E 7  ? 0.4664 0.3180 0.2941 -0.0144 0.0242  0.0598  7  PHE E CG  
2837 C CD1 . PHE E 7  ? 0.4914 0.3197 0.3099 -0.0028 0.0369  0.0642  7  PHE E CD1 
2838 C CD2 . PHE E 7  ? 0.4963 0.3316 0.3087 -0.0200 0.0265  0.0591  7  PHE E CD2 
2839 C CE1 . PHE E 7  ? 0.5184 0.3055 0.3114 0.0012  0.0519  0.0683  7  PHE E CE1 
2840 C CE2 . PHE E 7  ? 0.5158 0.3164 0.3059 -0.0152 0.0401  0.0635  7  PHE E CE2 
2841 C CZ  . PHE E 7  ? 0.5225 0.2984 0.3026 -0.0058 0.0527  0.0682  7  PHE E CZ  
2842 N N   . GLU E 8  ? 0.4096 0.3087 0.3025 -0.0355 0.0229  0.0447  8  GLU E N   
2843 C CA  . GLU E 8  ? 0.4082 0.2938 0.3057 -0.0398 0.0368  0.0404  8  GLU E CA  
2844 C C   . GLU E 8  ? 0.4649 0.3329 0.3466 -0.0205 0.0440  0.0456  8  GLU E C   
2845 O O   . GLU E 8  ? 0.4822 0.3672 0.3607 -0.0030 0.0346  0.0530  8  GLU E O   
2846 C CB  . GLU E 8  ? 0.4285 0.3460 0.3556 -0.0535 0.0325  0.0340  8  GLU E CB  
2847 C CG  . GLU E 8  ? 0.4806 0.4350 0.4241 -0.0491 0.0163  0.0357  8  GLU E CG  
2848 C CD  . GLU E 8  ? 0.4987 0.4840 0.4706 -0.0640 0.0119  0.0305  8  GLU E CD  
2849 O OE1 . GLU E 8  ? 0.5417 0.5558 0.5261 -0.0673 -0.0020 0.0315  8  GLU E OE1 
2850 O OE2 . GLU E 8  ? 0.4470 0.4297 0.4271 -0.0741 0.0227  0.0256  8  GLU E OE2 
2851 N N   . VAL E 9  ? 0.4500 0.2840 0.3189 -0.0237 0.0622  0.0422  9  VAL E N   
2852 C CA  . VAL E 9  ? 0.4919 0.2968 0.3399 -0.0042 0.0741  0.0469  9  VAL E CA  
2853 C C   . VAL E 9  ? 0.5119 0.3013 0.3619 -0.0166 0.0895  0.0367  9  VAL E C   
2854 O O   . VAL E 9  ? 0.5437 0.3317 0.3998 -0.0416 0.0962  0.0276  9  VAL E O   
2855 C CB  . VAL E 9  ? 0.5874 0.3438 0.3993 0.0069  0.0868  0.0549  9  VAL E CB  
2856 C CG1 . VAL E 9  ? 0.5166 0.2904 0.3245 0.0172  0.0723  0.0642  9  VAL E CG1 
2857 C CG2 . VAL E 9  ? 0.6446 0.3678 0.4441 -0.0168 0.1025  0.0470  9  VAL E CG2 
2858 N N   . GLU E 10 ? 0.5180 0.3000 0.3623 0.0007  0.0956  0.0382  10 GLU E N   
2859 C CA  . GLU E 10 ? 0.4932 0.2449 0.3271 -0.0092 0.1154  0.0281  10 GLU E CA  
2860 C C   . GLU E 10 ? 0.5750 0.2611 0.3653 0.0100  0.1361  0.0350  10 GLU E C   
2861 O O   . GLU E 10 ? 0.6400 0.3210 0.4192 0.0423  0.1360  0.0463  10 GLU E O   
2862 C CB  . GLU E 10 ? 0.4906 0.2742 0.3446 -0.0010 0.1108  0.0247  10 GLU E CB  
2863 C CG  . GLU E 10 ? 0.4716 0.3157 0.3663 -0.0213 0.0933  0.0179  10 GLU E CG  
2864 C CD  . GLU E 10 ? 0.4423 0.2861 0.3447 -0.0537 0.1034  0.0046  10 GLU E CD  
2865 O OE1 . GLU E 10 ? 0.5658 0.3629 0.4408 -0.0639 0.1243  -0.0015 10 GLU E OE1 
2866 O OE2 . GLU E 10 ? 0.4702 0.3620 0.4041 -0.0695 0.0908  0.0011  10 GLU E OE2 
2867 N N   . LEU E 11 ? 0.5691 0.2076 0.3338 -0.0096 0.1546  0.0290  11 LEU E N   
2868 C CA  . LEU E 11 ? 0.6741 0.2431 0.3927 0.0048  0.1753  0.0367  11 LEU E CA  
2869 C C   . LEU E 11 ? 0.7494 0.2629 0.4393 -0.0063 0.2029  0.0254  11 LEU E C   
2870 O O   . LEU E 11 ? 0.7662 0.2807 0.4598 -0.0421 0.2108  0.0099  11 LEU E O   
2871 C CB  . LEU E 11 ? 0.6866 0.2401 0.3924 -0.0123 0.1766  0.0386  11 LEU E CB  
2872 C CG  . LEU E 11 ? 0.8274 0.3152 0.4868 0.0034  0.1941  0.0500  11 LEU E CG  
2873 C CD1 . LEU E 11 ? 0.8528 0.3445 0.5058 0.0471  0.1865  0.0685  11 LEU E CD1 
2874 C CD2 . LEU E 11 ? 0.8212 0.3071 0.4743 -0.0154 0.1919  0.0512  11 LEU E CD2 
2875 N N   . ALA E 12 ? 0.8020 0.2682 0.4613 0.0246  0.2186  0.0333  12 ALA E N   
2876 C CA  . ALA E 12 ? 0.8520 0.2491 0.4732 0.0157  0.2493  0.0227  12 ALA E CA  
2877 C C   . ALA E 12 ? 0.9202 0.2417 0.4928 0.0048  0.2722  0.0250  12 ALA E C   
2878 O O   . ALA E 12 ? 0.9513 0.2528 0.5062 0.0302  0.2709  0.0426  12 ALA E O   
2879 C CB  . ALA E 12 ? 0.8948 0.2687 0.5002 0.0571  0.2592  0.0311  12 ALA E CB  
2880 N N   . LYS E 13 ? 0.8973 0.1798 0.4472 -0.0347 0.2933  0.0074  13 LYS E N   
2881 C CA  . LYS E 13 ? 0.9858 0.1926 0.4849 -0.0501 0.3178  0.0081  13 LYS E CA  
2882 C C   . LYS E 13 ? 1.1379 0.2534 0.5821 -0.0151 0.3450  0.0195  13 LYS E C   
2883 O O   . LYS E 13 ? 1.1306 0.2291 0.5683 0.0087  0.3541  0.0187  13 LYS E O   
2884 C CB  . LYS E 13 ? 1.0156 0.2095 0.5022 -0.1059 0.3345  -0.0149 13 LYS E CB  
2885 C CG  . LYS E 13 ? 0.9585 0.2370 0.4911 -0.1393 0.3117  -0.0221 13 LYS E CG  
2886 C CD  . LYS E 13 ? 1.0332 0.3120 0.5553 -0.1931 0.3284  -0.0442 13 LYS E CD  
2887 C CE  . LYS E 13 ? 0.9604 0.3341 0.5327 -0.2198 0.3057  -0.0493 13 LYS E CE  
2888 N NZ  . LYS E 13 ? 1.0235 0.4084 0.5860 -0.2720 0.3221  -0.0699 13 LYS E NZ  
2889 N N   . ASN E 14 ? 1.1604 0.2184 0.5646 -0.0098 0.3584  0.0314  14 ASN E N   
2890 C CA  . ASN E 14 ? 1.2956 0.2510 0.6366 0.0171  0.3908  0.0421  14 ASN E CA  
2891 C C   . ASN E 14 ? 1.3592 0.2395 0.6509 -0.0302 0.4206  0.0271  14 ASN E C   
2892 O O   . ASN E 14 ? 1.3303 0.2274 0.6253 -0.0594 0.4139  0.0260  14 ASN E O   
2893 C CB  . ASN E 14 ? 1.3710 0.3201 0.7014 0.0602  0.3833  0.0705  14 ASN E CB  
2894 C CG  . ASN E 14 ? 1.5808 0.4152 0.8384 0.0796  0.4199  0.0832  14 ASN E CG  
2895 O OD1 . ASN E 14 ? 1.6865 0.4461 0.9033 0.0850  0.4499  0.0767  14 ASN E OD1 
2896 N ND2 . ASN E 14 ? 1.6412 0.4584 0.8799 0.0904  0.4190  0.1015  14 ASN E ND2 
2897 N N   . ASP E 15 ? 1.4601 0.2585 0.7042 -0.0393 0.4542  0.0148  15 ASP E N   
2898 C CA  . ASP E 15 ? 1.5639 0.2877 0.7555 -0.0905 0.4852  -0.0021 15 ASP E CA  
2899 C C   . ASP E 15 ? 1.4799 0.2793 0.7082 -0.1493 0.4687  -0.0213 15 ASP E C   
2900 O O   . ASP E 15 ? 1.4994 0.2797 0.7042 -0.1868 0.4779  -0.0255 15 ASP E O   
2901 C CB  . ASP E 15 ? 1.7286 0.3700 0.8650 -0.0778 0.5049  0.0161  15 ASP E CB  
2902 C CG  . ASP E 15 ? 1.9149 0.4481 0.9906 -0.0334 0.5378  0.0294  15 ASP E CG  
2903 O OD1 . ASP E 15 ? 1.9911 0.4763 1.0420 -0.0377 0.5607  0.0142  15 ASP E OD1 
2904 O OD2 . ASP E 15 ? 1.9826 0.4793 1.0341 0.0072  0.5417  0.0557  15 ASP E OD2 
2905 N N   . ASN E 16 ? 1.3710 0.2591 0.6567 -0.1554 0.4448  -0.0317 16 ASN E N   
2906 C CA  . ASN E 16 ? 1.3592 0.3282 0.6840 -0.2055 0.4291  -0.0486 16 ASN E CA  
2907 C C   . ASN E 16 ? 1.2734 0.3031 0.6286 -0.2117 0.4052  -0.0378 16 ASN E C   
2908 O O   . ASN E 16 ? 1.2604 0.3338 0.6278 -0.2568 0.4022  -0.0498 16 ASN E O   
2909 C CB  . ASN E 16 ? 1.4523 0.3740 0.7330 -0.2644 0.4600  -0.0728 16 ASN E CB  
2910 C CG  . ASN E 16 ? 1.4403 0.4517 0.7646 -0.3070 0.4467  -0.0928 16 ASN E CG  
2911 O OD1 . ASN E 16 ? 1.4018 0.4801 0.7760 -0.2883 0.4248  -0.0930 16 ASN E OD1 
2912 N ND2 . ASN E 16 ? 1.4902 0.5084 0.7958 -0.3649 0.4598  -0.1087 16 ASN E ND2 
2913 N N   . SER E 17 ? 1.2724 0.3080 0.6385 -0.1664 0.3889  -0.0150 17 SER E N   
2914 C CA  . SER E 17 ? 1.1789 0.2738 0.5752 -0.1683 0.3651  -0.0050 17 SER E CA  
2915 C C   . SER E 17 ? 1.0894 0.2455 0.5323 -0.1231 0.3337  0.0111  17 SER E C   
2916 O O   . SER E 17 ? 1.0995 0.2298 0.5341 -0.0812 0.3349  0.0230  17 SER E O   
2917 C CB  . SER E 17 ? 1.2654 0.2925 0.6118 -0.1697 0.3826  0.0062  17 SER E CB  
2918 O OG  . SER E 17 ? 1.2802 0.3628 0.6536 -0.1688 0.3604  0.0161  17 SER E OG  
2919 N N   . LEU E 18 ? 0.9747 0.2121 0.4641 -0.1324 0.3070  0.0114  18 LEU E N   
2920 C CA  . LEU E 18 ? 0.8941 0.1895 0.4240 -0.0970 0.2773  0.0252  18 LEU E CA  
2921 C C   . LEU E 18 ? 0.9582 0.2261 0.4660 -0.0682 0.2753  0.0451  18 LEU E C   
2922 O O   . LEU E 18 ? 0.9478 0.2529 0.4784 -0.0355 0.2544  0.0583  18 LEU E O   
2923 C CB  . LEU E 18 ? 0.8839 0.2661 0.4647 -0.1173 0.2530  0.0184  18 LEU E CB  
2924 C CG  . LEU E 18 ? 0.8691 0.2923 0.4783 -0.1410 0.2512  0.0019  18 LEU E CG  
2925 C CD1 . LEU E 18 ? 0.7842 0.2843 0.4347 -0.1633 0.2333  -0.0031 18 LEU E CD1 
2926 C CD2 . LEU E 18 ? 0.8548 0.2931 0.4844 -0.1111 0.2410  0.0047  18 LEU E CD2 
2927 N N   . GLY E 19 ? 1.0500 0.2560 0.5124 -0.0826 0.2971  0.0471  19 GLY E N   
2928 C CA  . GLY E 19 ? 1.1323 0.3093 0.5697 -0.0573 0.2976  0.0666  19 GLY E CA  
2929 C C   . GLY E 19 ? 1.0848 0.3239 0.5521 -0.0610 0.2737  0.0713  19 GLY E C   
2930 O O   . GLY E 19 ? 1.0781 0.3253 0.5445 -0.0310 0.2623  0.0880  19 GLY E O   
2931 N N   . ILE E 20 ? 1.0615 0.3469 0.5541 -0.0968 0.2668  0.0569  20 ILE E N   
2932 C CA  . ILE E 20 ? 1.0261 0.3625 0.5409 -0.1019 0.2488  0.0603  20 ILE E CA  
2933 C C   . ILE E 20 ? 1.0497 0.3888 0.5536 -0.1440 0.2608  0.0497  20 ILE E C   
2934 O O   . ILE E 20 ? 1.1212 0.4531 0.6191 -0.1749 0.2751  0.0356  20 ILE E O   
2935 C CB  . ILE E 20 ? 0.9962 0.4110 0.5648 -0.0944 0.2210  0.0567  20 ILE E CB  
2936 C CG1 . ILE E 20 ? 0.8774 0.3224 0.4706 -0.1200 0.2224  0.0404  20 ILE E CG1 
2937 C CG2 . ILE E 20 ? 1.0319 0.4572 0.6126 -0.0551 0.2060  0.0682  20 ILE E CG2 
2938 C CD1 . ILE E 20 ? 0.8749 0.3917 0.5180 -0.1141 0.1976  0.0377  20 ILE E CD1 
2939 N N   . SER E 21 ? 1.0032 0.3552 0.5026 -0.1462 0.2557  0.0564  21 SER E N   
2940 C CA  . SER E 21 ? 0.9951 0.3690 0.4914 -0.1837 0.2632  0.0476  21 SER E CA  
2941 C C   . SER E 21 ? 0.8974 0.3471 0.4367 -0.1784 0.2398  0.0477  21 SER E C   
2942 O O   . SER E 21 ? 0.9014 0.3663 0.4562 -0.1483 0.2221  0.0568  21 SER E O   
2943 C CB  . SER E 21 ? 1.0607 0.3811 0.5093 -0.1933 0.2812  0.0552  21 SER E CB  
2944 O OG  . SER E 21 ? 1.0629 0.3813 0.5082 -0.1627 0.2695  0.0711  21 SER E OG  
2945 N N   . VAL E 22 ? 0.8977 0.3962 0.4548 -0.2071 0.2405  0.0379  22 VAL E N   
2946 C CA  . VAL E 22 ? 0.8399 0.4062 0.4356 -0.1989 0.2209  0.0386  22 VAL E CA  
2947 C C   . VAL E 22 ? 0.8182 0.4101 0.4061 -0.2156 0.2255  0.0397  22 VAL E C   
2948 O O   . VAL E 22 ? 0.8616 0.4357 0.4212 -0.2440 0.2438  0.0364  22 VAL E O   
2949 C CB  . VAL E 22 ? 0.7888 0.4088 0.4231 -0.2076 0.2132  0.0293  22 VAL E CB  
2950 C CG1 . VAL E 22 ? 0.7711 0.3753 0.4180 -0.1874 0.2052  0.0291  22 VAL E CG1 
2951 C CG2 . VAL E 22 ? 0.8061 0.4396 0.4315 -0.2473 0.2310  0.0185  22 VAL E CG2 
2952 N N   . THR E 23 ? 0.7860 0.4189 0.3970 -0.1981 0.2096  0.0439  23 THR E N   
2953 C CA  . THR E 23 ? 0.7609 0.4284 0.3702 -0.2084 0.2122  0.0452  23 THR E CA  
2954 C C   . THR E 23 ? 0.7143 0.4499 0.3634 -0.2048 0.2014  0.0419  23 THR E C   
2955 O O   . THR E 23 ? 0.7016 0.4477 0.3759 -0.1865 0.1879  0.0415  23 THR E O   
2956 C CB  . THR E 23 ? 0.8445 0.4916 0.4380 -0.1864 0.2056  0.0547  23 THR E CB  
2957 O OG1 . THR E 23 ? 0.8838 0.5629 0.4726 -0.1971 0.2102  0.0555  23 THR E OG1 
2958 C CG2 . THR E 23 ? 0.7969 0.4571 0.4145 -0.1559 0.1854  0.0574  23 THR E CG2 
2959 N N   . GLY E 24 ? 0.6382 0.4909 0.4231 -0.1626 0.2091  0.0024  24 GLY E N   
2960 C CA  . GLY E 24 ? 0.6349 0.4712 0.3886 -0.1458 0.2151  0.0053  24 GLY E CA  
2961 C C   . GLY E 24 ? 0.6121 0.4660 0.3560 -0.1264 0.2094  0.0031  24 GLY E C   
2962 O O   . GLY E 24 ? 0.6568 0.5406 0.4190 -0.1317 0.1995  -0.0066 24 GLY E O   
2963 N N   . GLY E 25 ? 0.5919 0.4306 0.3059 -0.1046 0.2196  0.0124  25 GLY E N   
2964 C CA  . GLY E 25 ? 0.6035 0.4756 0.3072 -0.0807 0.2150  0.0162  25 GLY E CA  
2965 C C   . GLY E 25 ? 0.6336 0.5141 0.3230 -0.0532 0.2247  0.0316  25 GLY E C   
2966 O O   . GLY E 25 ? 0.6573 0.5280 0.3543 -0.0580 0.2290  0.0332  25 GLY E O   
2967 N N   . VAL E 26 ? 0.6806 0.5839 0.3496 -0.0222 0.2297  0.0454  26 VAL E N   
2968 C CA  . VAL E 26 ? 0.7434 0.6549 0.3955 0.0136  0.2456  0.0679  26 VAL E CA  
2969 C C   . VAL E 26 ? 0.7561 0.7259 0.4337 0.0134  0.2310  0.0654  26 VAL E C   
2970 O O   . VAL E 26 ? 0.8230 0.7924 0.4923 0.0382  0.2455  0.0832  26 VAL E O   
2971 C CB  . VAL E 26 ? 0.7982 0.7413 0.4261 0.0522  0.2532  0.0885  26 VAL E CB  
2972 C CG1 . VAL E 26 ? 0.8130 0.6855 0.4091 0.0589  0.2765  0.0957  26 VAL E CG1 
2973 C CG2 . VAL E 26 ? 0.7927 0.8204 0.4387 0.0427  0.2255  0.0749  26 VAL E CG2 
2974 N N   . ASN E 27 ? 0.6990 0.7153 0.4061 -0.0146 0.2067  0.0433  27 ASN E N   
2975 C CA  . ASN E 27 ? 0.6849 0.7535 0.4182 -0.0229 0.1938  0.0354  27 ASN E CA  
2976 C C   . ASN E 27 ? 0.6772 0.7055 0.4300 -0.0486 0.1938  0.0256  27 ASN E C   
2977 O O   . ASN E 27 ? 0.6886 0.7526 0.4642 -0.0586 0.1844  0.0176  27 ASN E O   
2978 C CB  . ASN E 27 ? 0.6969 0.8434 0.4489 -0.0410 0.1745  0.0148  27 ASN E CB  
2979 C CG  . ASN E 27 ? 0.6711 0.7905 0.4333 -0.0752 0.1701  -0.0083 27 ASN E CG  
2980 O OD1 . ASN E 27 ? 0.5781 0.6324 0.3322 -0.0801 0.1780  -0.0053 27 ASN E OD1 
2981 N ND2 . ASN E 27 ? 0.7259 0.8985 0.5049 -0.1000 0.1610  -0.0323 27 ASN E ND2 
2982 N N   . THR E 28 ? 0.6185 0.5797 0.3618 -0.0601 0.2053  0.0264  28 THR E N   
2983 C CA  . THR E 28 ? 0.5926 0.5258 0.3517 -0.0830 0.2069  0.0206  28 THR E CA  
2984 C C   . THR E 28 ? 0.6433 0.5285 0.3786 -0.0733 0.2297  0.0328  28 THR E C   
2985 O O   . THR E 28 ? 0.7096 0.5765 0.4167 -0.0456 0.2479  0.0476  28 THR E O   
2986 C CB  . THR E 28 ? 0.5787 0.4880 0.3492 -0.1108 0.2035  0.0101  28 THR E CB  
2987 O OG1 . THR E 28 ? 0.6056 0.4688 0.3494 -0.1096 0.2186  0.0159  28 THR E OG1 
2988 C CG2 . THR E 28 ? 0.5616 0.5016 0.3470 -0.1190 0.1912  -0.0022 28 THR E CG2 
2989 N N   . SER E 29 ? 0.6676 0.5333 0.4132 -0.0964 0.2327  0.0270  29 SER E N   
2990 C CA  . SER E 29 ? 0.7406 0.5582 0.4616 -0.0979 0.2589  0.0319  29 SER E CA  
2991 C C   . SER E 29 ? 0.7319 0.5171 0.4433 -0.1277 0.2680  0.0229  29 SER E C   
2992 O O   . SER E 29 ? 0.7567 0.5144 0.4545 -0.1462 0.2871  0.0185  29 SER E O   
2993 C CB  . SER E 29 ? 0.7080 0.5373 0.4434 -0.1030 0.2589  0.0314  29 SER E CB  
2994 O OG  . SER E 29 ? 0.7774 0.6494 0.5248 -0.0775 0.2485  0.0390  29 SER E OG  
2995 N N   . VAL E 30 ? 0.6683 0.4631 0.3867 -0.1346 0.2556  0.0191  30 VAL E N   
2996 C CA  . VAL E 30 ? 0.6629 0.4384 0.3720 -0.1597 0.2638  0.0130  30 VAL E CA  
2997 C C   . VAL E 30 ? 0.7634 0.4845 0.4294 -0.1542 0.2950  0.0140  30 VAL E C   
2998 O O   . VAL E 30 ? 0.7988 0.5016 0.4459 -0.1242 0.3041  0.0236  30 VAL E O   
2999 C CB  . VAL E 30 ? 0.6667 0.4634 0.3932 -0.1631 0.2462  0.0114  30 VAL E CB  
3000 C CG1 . VAL E 30 ? 0.7244 0.5047 0.4368 -0.1833 0.2567  0.0081  30 VAL E CG1 
3001 C CG2 . VAL E 30 ? 0.6680 0.5061 0.4345 -0.1723 0.2268  0.0104  30 VAL E CG2 
3002 N N   . ARG E 31 ? 0.8056 0.5043 0.4548 -0.1842 0.3149  0.0043  31 ARG E N   
3003 C CA  . ARG E 31 ? 0.8618 0.4982 0.4658 -0.1861 0.3545  0.0008  31 ARG E CA  
3004 C C   . ARG E 31 ? 0.9138 0.5182 0.4945 -0.1597 0.3645  0.0091  31 ARG E C   
3005 O O   . ARG E 31 ? 0.8309 0.4558 0.4224 -0.1616 0.3451  0.0083  31 ARG E O   
3006 C CB  . ARG E 31 ? 0.9370 0.5697 0.5279 -0.2327 0.3713  -0.0172 31 ARG E CB  
3007 C CG  . ARG E 31 ? 0.9892 0.6475 0.5876 -0.2486 0.3571  -0.0211 31 ARG E CG  
3008 C CD  . ARG E 31 ? 1.0788 0.7464 0.6606 -0.2966 0.3769  -0.0392 31 ARG E CD  
3009 N NE  . ARG E 31 ? 1.0702 0.8014 0.6816 -0.3190 0.3590  -0.0406 31 ARG E NE  
3010 C CZ  . ARG E 31 ? 1.0697 0.8656 0.7202 -0.3171 0.3267  -0.0294 31 ARG E CZ  
3011 N NH1 . ARG E 31 ? 1.0236 0.8244 0.6872 -0.2972 0.3100  -0.0195 31 ARG E NH1 
3012 N NH2 . ARG E 31 ? 1.0757 0.9294 0.7512 -0.3337 0.3150  -0.0268 31 ARG E NH2 
3013 N N   . HIS E 32 ? 0.9630 0.5157 0.5106 -0.1330 0.3984  0.0195  32 HIS E N   
3014 C CA  . HIS E 32 ? 1.0521 0.5709 0.5724 -0.1030 0.4155  0.0319  32 HIS E CA  
3015 C C   . HIS E 32 ? 1.0495 0.6237 0.5945 -0.0723 0.3785  0.0451  32 HIS E C   
3016 O O   . HIS E 32 ? 1.1089 0.6713 0.6360 -0.0476 0.3856  0.0560  32 HIS E O   
3017 C CB  . HIS E 32 ? 1.0818 0.5645 0.5782 -0.1333 0.4338  0.0166  32 HIS E CB  
3018 C CG  . HIS E 32 ? 1.1530 0.6068 0.6315 -0.1799 0.4629  -0.0053 32 HIS E CG  
3019 N ND1 . HIS E 32 ? 1.1519 0.6380 0.6407 -0.2254 0.4504  -0.0247 32 HIS E ND1 
3020 C CD2 . HIS E 32 ? 1.1901 0.5928 0.6407 -0.1901 0.5058  -0.0115 32 HIS E CD2 
3021 C CE1 . HIS E 32 ? 1.1486 0.6136 0.6163 -0.2650 0.4820  -0.0441 32 HIS E CE1 
3022 N NE2 . HIS E 32 ? 1.1977 0.6061 0.6410 -0.2464 0.5174  -0.0385 32 HIS E NE2 
3023 N N   . GLY E 33 ? 0.6954 0.6461 0.5097 -0.1605 0.1939  -0.0716 33 GLY E N   
3024 C CA  . GLY E 33 ? 0.6913 0.6446 0.5068 -0.1729 0.2014  -0.0709 33 GLY E CA  
3025 C C   . GLY E 33 ? 0.6855 0.6115 0.5012 -0.1683 0.1939  -0.0620 33 GLY E C   
3026 O O   . GLY E 33 ? 0.7374 0.6659 0.5591 -0.1758 0.1983  -0.0621 33 GLY E O   
3027 N N   . GLY E 34 ? 0.6235 0.5260 0.4325 -0.1561 0.1827  -0.0549 34 GLY E N   
3028 C CA  . GLY E 34 ? 0.5703 0.4485 0.3780 -0.1490 0.1746  -0.0458 34 GLY E CA  
3029 C C   . GLY E 34 ? 0.5704 0.4169 0.3520 -0.1597 0.1822  -0.0399 34 GLY E C   
3030 O O   . GLY E 34 ? 0.5901 0.4273 0.3489 -0.1739 0.1932  -0.0415 34 GLY E O   
3031 N N   . ILE E 35 ? 0.5727 0.4023 0.3574 -0.1527 0.1766  -0.0333 35 ILE E N   
3032 C CA  . ILE E 35 ? 0.5947 0.3866 0.3533 -0.1581 0.1824  -0.0262 35 ILE E CA  
3033 C C   . ILE E 35 ? 0.6148 0.3798 0.3569 -0.1431 0.1723  -0.0143 35 ILE E C   
3034 O O   . ILE E 35 ? 0.6080 0.3816 0.3673 -0.1279 0.1596  -0.0108 35 ILE E O   
3035 C CB  . ILE E 35 ? 0.5699 0.3627 0.3433 -0.1588 0.1835  -0.0275 35 ILE E CB  
3036 C CG1 . ILE E 35 ? 0.5736 0.4016 0.3674 -0.1725 0.1922  -0.0391 35 ILE E CG1 
3037 C CG2 . ILE E 35 ? 0.6017 0.3503 0.3458 -0.1637 0.1910  -0.0210 35 ILE E CG2 
3038 C CD1 . ILE E 35 ? 0.6022 0.4281 0.3750 -0.1937 0.2075  -0.0449 35 ILE E CD1 
3039 N N   . TYR E 36 ? 0.6298 0.3655 0.3386 -0.1477 0.1780  -0.0077 36 TYR E N   
3040 C CA  . TYR E 36 ? 0.6344 0.3476 0.3241 -0.1337 0.1697  0.0047  36 TYR E CA  
3041 C C   . TYR E 36 ? 0.7003 0.3700 0.3601 -0.1335 0.1764  0.0155  36 TYR E C   
3042 O O   . TYR E 36 ? 0.7244 0.3752 0.3688 -0.1491 0.1901  0.0129  36 TYR E O   
3043 C CB  . TYR E 36 ? 0.6564 0.3760 0.3324 -0.1359 0.1689  0.0047  36 TYR E CB  
3044 C CG  . TYR E 36 ? 0.6247 0.3818 0.3278 -0.1327 0.1617  -0.0053 36 TYR E CG  
3045 C CD1 . TYR E 36 ? 0.6477 0.4301 0.3659 -0.1438 0.1692  -0.0176 36 TYR E CD1 
3046 C CD2 . TYR E 36 ? 0.6517 0.4190 0.3644 -0.1184 0.1478  -0.0024 36 TYR E CD2 
3047 C CE1 . TYR E 36 ? 0.6405 0.4534 0.3819 -0.1388 0.1635  -0.0262 36 TYR E CE1 
3048 C CE2 . TYR E 36 ? 0.6500 0.4460 0.3851 -0.1160 0.1423  -0.0119 36 TYR E CE2 
3049 C CZ  . TYR E 36 ? 0.6356 0.4523 0.3847 -0.1251 0.1504  -0.0235 36 TYR E CZ  
3050 O OH  . TYR E 36 ? 0.6185 0.4601 0.3884 -0.1205 0.1457  -0.0323 36 TYR E OH  
3051 N N   . VAL E 37 ? 0.6960 0.3497 0.3464 -0.1159 0.1672  0.0276  37 VAL E N   
3052 C CA  . VAL E 37 ? 0.7381 0.3475 0.3573 -0.1116 0.1734  0.0398  37 VAL E CA  
3053 C C   . VAL E 37 ? 0.7817 0.3695 0.3670 -0.1197 0.1815  0.0464  37 VAL E C   
3054 O O   . VAL E 37 ? 0.8010 0.4003 0.3804 -0.1129 0.1742  0.0513  37 VAL E O   
3055 C CB  . VAL E 37 ? 0.7281 0.3324 0.3473 -0.0878 0.1608  0.0518  37 VAL E CB  
3056 C CG1 . VAL E 37 ? 0.8057 0.3625 0.3901 -0.0802 0.1679  0.0658  37 VAL E CG1 
3057 C CG2 . VAL E 37 ? 0.6655 0.2938 0.3187 -0.0802 0.1522  0.0456  37 VAL E CG2 
3058 N N   . LYS E 38 ? 0.8044 0.3618 0.3670 -0.1358 0.1970  0.0459  38 LYS E N   
3059 C CA  . LYS E 38 ? 0.8832 0.4195 0.4126 -0.1471 0.2065  0.0518  38 LYS E CA  
3060 C C   . LYS E 38 ? 0.9258 0.4217 0.4229 -0.1316 0.2059  0.0708  38 LYS E C   
3061 O O   . LYS E 38 ? 0.9695 0.4617 0.4460 -0.1281 0.2043  0.0804  38 LYS E O   
3062 C CB  . LYS E 38 ? 0.9402 0.4597 0.4571 -0.1726 0.2239  0.0437  38 LYS E CB  
3063 C CG  . LYS E 38 ? 1.0264 0.5270 0.5096 -0.1889 0.2352  0.0482  38 LYS E CG  
3064 C CD  . LYS E 38 ? 1.0597 0.5476 0.5322 -0.2164 0.2524  0.0388  38 LYS E CD  
3065 C CE  . LYS E 38 ? 1.1586 0.6353 0.6002 -0.2354 0.2634  0.0418  38 LYS E CE  
3066 N NZ  . LYS E 38 ? 1.2185 0.6774 0.6439 -0.2639 0.2811  0.0342  38 LYS E NZ  
3067 N N   . ALA E 39 ? 0.9303 0.3967 0.4225 -0.1216 0.2077  0.0762  39 ALA E N   
3068 C CA  . ALA E 39 ? 1.0072 0.4332 0.4694 -0.1033 0.2080  0.0949  39 ALA E CA  
3069 C C   . ALA E 39 ? 0.9973 0.4145 0.4720 -0.0854 0.2030  0.0967  39 ALA E C   
3070 O O   . ALA E 39 ? 0.9825 0.4075 0.4783 -0.0940 0.2058  0.0840  39 ALA E O   
3071 C CB  . ALA E 39 ? 1.0672 0.4417 0.4895 -0.1177 0.2258  0.1014  39 ALA E CB  
3072 N N   . VAL E 40 ? 1.0315 0.4364 0.4936 -0.0601 0.1954  0.1128  40 VAL E N   
3073 C CA  . VAL E 40 ? 1.0548 0.4409 0.5185 -0.0410 0.1934  0.1179  40 VAL E CA  
3074 C C   . VAL E 40 ? 1.1202 0.4432 0.5402 -0.0340 0.2067  0.1330  40 VAL E C   
3075 O O   . VAL E 40 ? 1.2165 0.5248 0.6099 -0.0220 0.2059  0.1497  40 VAL E O   
3076 C CB  . VAL E 40 ? 1.0642 0.4871 0.5479 -0.0154 0.1745  0.1246  40 VAL E CB  
3077 C CG1 . VAL E 40 ? 0.9787 0.4584 0.5016 -0.0241 0.1626  0.1102  40 VAL E CG1 
3078 C CG2 . VAL E 40 ? 1.0920 0.5100 0.5501 0.0015  0.1696  0.1433  40 VAL E CG2 
3079 N N   . ILE E 41 ? 1.1396 0.4252 0.5513 -0.0423 0.2196  0.1270  41 ILE E N   
3080 C CA  . ILE E 41 ? 1.2137 0.4315 0.5818 -0.0395 0.2353  0.1391  41 ILE E CA  
3081 C C   . ILE E 41 ? 1.2284 0.4253 0.5791 -0.0043 0.2296  0.1589  41 ILE E C   
3082 O O   . ILE E 41 ? 1.2165 0.4291 0.5869 0.0149  0.2207  0.1577  41 ILE E O   
3083 C CB  . ILE E 41 ? 1.2207 0.4044 0.5859 -0.0548 0.2497  0.1263  41 ILE E CB  
3084 C CG1 . ILE E 41 ? 1.2318 0.4569 0.6294 -0.0834 0.2504  0.1040  41 ILE E CG1 
3085 C CG2 . ILE E 41 ? 1.3062 0.4178 0.6233 -0.0639 0.2696  0.1349  41 ILE E CG2 
3086 C CD1 . ILE E 41 ? 1.2721 0.5044 0.6601 -0.1103 0.2577  0.0995  41 ILE E CD1 
3087 N N   . PRO E 42 ? 1.2590 0.4209 0.5717 0.0046  0.2353  0.1779  42 PRO E N   
3088 C CA  . PRO E 42 ? 1.2776 0.4165 0.5691 0.0396  0.2319  0.1990  42 PRO E CA  
3089 C C   . PRO E 42 ? 1.3043 0.4092 0.5935 0.0547  0.2375  0.1972  42 PRO E C   
3090 O O   . PRO E 42 ? 1.2962 0.3573 0.5732 0.0372  0.2533  0.1873  42 PRO E O   
3091 C CB  . PRO E 42 ? 1.3466 0.4343 0.5911 0.0372  0.2452  0.2164  42 PRO E CB  
3092 C CG  . PRO E 42 ? 1.3374 0.4538 0.5892 0.0072  0.2455  0.2069  42 PRO E CG  
3093 C CD  . PRO E 42 ? 1.2800 0.4235 0.5669 -0.0174 0.2457  0.1813  42 PRO E CD  
3094 N N   . GLN E 43 ? 1.3246 0.4529 0.6257 0.0865  0.2245  0.2059  43 GLN E N   
3095 C CA  . GLN E 43 ? 1.3716 0.4742 0.6715 0.1066  0.2277  0.2058  43 GLN E CA  
3096 C C   . GLN E 43 ? 1.3075 0.4284 0.6409 0.0882  0.2280  0.1818  43 GLN E C   
3097 O O   . GLN E 43 ? 1.3561 0.4529 0.6882 0.0993  0.2331  0.1780  43 GLN E O   
3098 C CB  . GLN E 43 ? 1.5239 0.5440 0.7749 0.1154  0.2471  0.2191  43 GLN E CB  
3099 C CG  . GLN E 43 ? 1.6242 0.6278 0.8422 0.1409  0.2459  0.2460  43 GLN E CG  
3100 C CD  . GLN E 43 ? 1.7909 0.7089 0.9594 0.1527  0.2656  0.2606  43 GLN E CD  
3101 O OE1 . GLN E 43 ? 1.8471 0.7222 1.0081 0.1549  0.2766  0.2529  43 GLN E OE1 
3102 N NE2 . GLN E 43 ? 1.8590 0.7504 0.9921 0.1603  0.2706  0.2819  43 GLN E NE2 
3103 N N   . GLY E 44 ? 1.2230 0.3885 0.5863 0.0614  0.2226  0.1658  44 GLY E N   
3104 C CA  . GLY E 44 ? 1.1467 0.3380 0.5442 0.0441  0.2217  0.1440  44 GLY E CA  
3105 C C   . GLY E 44 ? 1.1056 0.3562 0.5427 0.0616  0.2025  0.1406  44 GLY E C   
3106 O O   . GLY E 44 ? 1.1009 0.3760 0.5398 0.0863  0.1892  0.1543  44 GLY E O   
3107 N N   . ALA E 45 ? 1.0566 0.3331 0.5255 0.0476  0.2011  0.1224  45 ALA E N   
3108 C CA  . ALA E 45 ? 1.0192 0.3510 0.5266 0.0611  0.1839  0.1179  45 ALA E CA  
3109 C C   . ALA E 45 ? 0.9479 0.3363 0.4779 0.0630  0.1665  0.1211  45 ALA E C   
3110 O O   . ALA E 45 ? 0.9379 0.3547 0.4763 0.0862  0.1523  0.1308  45 ALA E O   
3111 C CB  . ALA E 45 ? 0.9926 0.3421 0.5289 0.0422  0.1870  0.0977  45 ALA E CB  
3112 N N   . ALA E 46 ? 0.9300 0.3355 0.4690 0.0385  0.1678  0.1125  46 ALA E N   
3113 C CA  . ALA E 46 ? 0.8910 0.3461 0.4495 0.0386  0.1528  0.1138  46 ALA E CA  
3114 C C   . ALA E 46 ? 0.9140 0.3655 0.4490 0.0594  0.1463  0.1328  46 ALA E C   
3115 O O   . ALA E 46 ? 0.8785 0.3729 0.4299 0.0715  0.1305  0.1370  46 ALA E O   
3116 C CB  . ALA E 46 ? 0.8811 0.3485 0.4474 0.0101  0.1579  0.1019  46 ALA E CB  
3117 N N   . GLU E 47 ? 0.9740 0.3754 0.4697 0.0634  0.1586  0.1448  47 GLU E N   
3118 C CA  . GLU E 47 ? 1.0417 0.4406 0.5132 0.0833  0.1534  0.1642  47 GLU E CA  
3119 C C   . GLU E 47 ? 1.0522 0.4610 0.5238 0.1159  0.1438  0.1766  47 GLU E C   
3120 O O   . GLU E 47 ? 1.0613 0.5049 0.5349 0.1317  0.1308  0.1872  47 GLU E O   
3121 C CB  . GLU E 47 ? 1.1585 0.4995 0.5863 0.0796  0.1698  0.1754  47 GLU E CB  
3122 C CG  . GLU E 47 ? 1.2327 0.5790 0.6374 0.0954  0.1645  0.1948  47 GLU E CG  
3123 C CD  . GLU E 47 ? 1.3740 0.6568 0.7323 0.1035  0.1799  0.2116  47 GLU E CD  
3124 O OE1 . GLU E 47 ? 1.4315 0.6754 0.7742 0.1216  0.1867  0.2185  47 GLU E OE1 
3125 O OE2 . GLU E 47 ? 1.4094 0.6803 0.7459 0.0923  0.1855  0.2182  47 GLU E OE2 
3126 N N   . SER E 48 ? 1.0789 0.4586 0.5472 0.1258  0.1507  0.1749  48 SER E N   
3127 C CA  . SER E 48 ? 1.0719 0.4629 0.5416 0.1576  0.1422  0.1854  48 SER E CA  
3128 C C   . SER E 48 ? 0.9789 0.4389 0.4890 0.1599  0.1229  0.1782  48 SER E C   
3129 O O   . SER E 48 ? 0.9769 0.4688 0.4891 0.1829  0.1103  0.1898  48 SER E O   
3130 C CB  . SER E 48 ? 1.1292 0.4781 0.5915 0.1645  0.1539  0.1808  48 SER E CB  
3131 O OG  . SER E 48 ? 1.2426 0.5220 0.6631 0.1649  0.1724  0.1891  48 SER E OG  
3132 N N   . ASP E 49 ? 0.9059 0.3894 0.4471 0.1355  0.1211  0.1595  49 ASP E N   
3133 C CA  . ASP E 49 ? 0.8653 0.4100 0.4452 0.1343  0.1041  0.1516  49 ASP E CA  
3134 C C   . ASP E 49 ? 0.8719 0.4560 0.4558 0.1330  0.0916  0.1570  49 ASP E C   
3135 O O   . ASP E 49 ? 0.9307 0.5607 0.5321 0.1441  0.0762  0.1600  49 ASP E O   
3136 C CB  . ASP E 49 ? 0.8334 0.3900 0.4432 0.1088  0.1070  0.1315  49 ASP E CB  
3137 C CG  . ASP E 49 ? 0.7965 0.4124 0.4450 0.1064  0.0904  0.1240  49 ASP E CG  
3138 O OD1 . ASP E 49 ? 0.7802 0.4224 0.4411 0.0920  0.0845  0.1192  49 ASP E OD1 
3139 O OD2 . ASP E 49 ? 0.7481 0.3828 0.4133 0.1190  0.0838  0.1231  49 ASP E OD2 
3140 N N   . GLY E 50 ? 0.8709 0.4387 0.4388 0.1175  0.0984  0.1572  50 GLY E N   
3141 C CA  . GLY E 50 ? 0.8910 0.4877 0.4542 0.1178  0.0892  0.1639  50 GLY E CA  
3142 C C   . GLY E 50 ? 0.8440 0.4865 0.4380 0.0991  0.0789  0.1502  50 GLY E C   
3143 O O   . GLY E 50 ? 0.8691 0.5362 0.4593 0.0971  0.0716  0.1536  50 GLY E O   
3144 N N   . ARG E 51 ? 0.7840 0.4376 0.4073 0.0856  0.0788  0.1347  51 ARG E N   
3145 C CA  . ARG E 51 ? 0.7257 0.4208 0.3792 0.0703  0.0693  0.1221  51 ARG E CA  
3146 C C   . ARG E 51 ? 0.7281 0.4148 0.3845 0.0459  0.0781  0.1100  51 ARG E C   
3147 O O   . ARG E 51 ? 0.7313 0.4474 0.4048 0.0347  0.0715  0.1016  51 ARG E O   
3148 C CB  . ARG E 51 ? 0.6561 0.3762 0.3424 0.0714  0.0621  0.1137  51 ARG E CB  
3149 C CG  . ARG E 51 ? 0.6704 0.4204 0.3626 0.0921  0.0481  0.1231  51 ARG E CG  
3150 C CD  . ARG E 51 ? 0.6488 0.4244 0.3736 0.0913  0.0416  0.1145  51 ARG E CD  
3151 N NE  . ARG E 51 ? 0.6504 0.3964 0.3722 0.0963  0.0518  0.1128  51 ARG E NE  
3152 C CZ  . ARG E 51 ? 0.6367 0.3998 0.3831 0.0978  0.0483  0.1063  51 ARG E CZ  
3153 N NH1 . ARG E 51 ? 0.6083 0.4167 0.3837 0.0948  0.0348  0.1021  51 ARG E NH1 
3154 N NH2 . ARG E 51 ? 0.6686 0.4029 0.4093 0.1017  0.0588  0.1041  51 ARG E NH2 
3155 N N   . ILE E 52 ? 0.7122 0.3587 0.3511 0.0376  0.0935  0.1087  52 ILE E N   
3156 C CA  . ILE E 52 ? 0.7238 0.3631 0.3639 0.0144  0.1034  0.0973  52 ILE E CA  
3157 C C   . ILE E 52 ? 0.7717 0.3840 0.3769 0.0111  0.1118  0.1059  52 ILE E C   
3158 O O   . ILE E 52 ? 0.8544 0.4335 0.4305 0.0234  0.1175  0.1195  52 ILE E O   
3159 C CB  . ILE E 52 ? 0.7520 0.3705 0.3994 0.0026  0.1156  0.0873  52 ILE E CB  
3160 C CG1 . ILE E 52 ? 0.7093 0.3605 0.3936 0.0036  0.1071  0.0779  52 ILE E CG1 
3161 C CG2 . ILE E 52 ? 0.7854 0.3946 0.4281 -0.0210 0.1278  0.0773  52 ILE E CG2 
3162 C CD1 . ILE E 52 ? 0.6842 0.3188 0.3756 -0.0057 0.1183  0.0689  52 ILE E CD1 
3163 N N   . HIS E 53 ? 0.7376 0.3645 0.3452 -0.0044 0.1127  0.0986  53 HIS E N   
3164 C CA  . HIS E 53 ? 0.7956 0.4024 0.3718 -0.0095 0.1202  0.1060  53 HIS E CA  
3165 C C   . HIS E 53 ? 0.7837 0.3911 0.3628 -0.0335 0.1300  0.0928  53 HIS E C   
3166 O O   . HIS E 53 ? 0.7603 0.3939 0.3683 -0.0438 0.1277  0.0783  53 HIS E O   
3167 C CB  . HIS E 53 ? 0.8509 0.4842 0.4213 0.0007  0.1082  0.1140  53 HIS E CB  
3168 C CG  . HIS E 53 ? 0.9108 0.5498 0.4760 0.0247  0.0984  0.1282  53 HIS E CG  
3169 N ND1 . HIS E 53 ? 0.9436 0.6185 0.5352 0.0333  0.0843  0.1250  53 HIS E ND1 
3170 C CD2 . HIS E 53 ? 0.9947 0.6097 0.5310 0.0425  0.1008  0.1462  53 HIS E CD2 
3171 C CE1 . HIS E 53 ? 0.9800 0.6561 0.5598 0.0551  0.0782  0.1398  53 HIS E CE1 
3172 N NE2 . HIS E 53 ? 1.0066 0.6465 0.5529 0.0623  0.0880  0.1532  53 HIS E NE2 
3173 N N   . LYS E 54 ? 0.8410 0.4206 0.3894 -0.0416 0.1412  0.0987  54 LYS E N   
3174 C CA  . LYS E 54 ? 0.8214 0.4057 0.3688 -0.0637 0.1502  0.0876  54 LYS E CA  
3175 C C   . LYS E 54 ? 0.7701 0.3994 0.3437 -0.0681 0.1403  0.0756  54 LYS E C   
3176 O O   . LYS E 54 ? 0.7690 0.4186 0.3438 -0.0573 0.1287  0.0804  54 LYS E O   
3177 C CB  . LYS E 54 ? 0.8672 0.4242 0.3764 -0.0684 0.1594  0.0987  54 LYS E CB  
3178 C CG  . LYS E 54 ? 0.8967 0.4629 0.4029 -0.0907 0.1679  0.0881  54 LYS E CG  
3179 C CD  . LYS E 54 ? 0.9829 0.5178 0.4490 -0.0963 0.1783  0.1005  54 LYS E CD  
3180 C CE  . LYS E 54 ? 1.0201 0.5759 0.4835 -0.1146 0.1827  0.0914  54 LYS E CE  
3181 N NZ  . LYS E 54 ? 1.0886 0.6161 0.5125 -0.1205 0.1923  0.1046  54 LYS E NZ  
3182 N N   . GLY E 55 ? 0.7242 0.3693 0.3177 -0.0838 0.1453  0.0601  55 GLY E N   
3183 C CA  . GLY E 55 ? 0.6759 0.3590 0.2933 -0.0875 0.1378  0.0480  55 GLY E CA  
3184 C C   . GLY E 55 ? 0.6451 0.3541 0.2984 -0.0812 0.1278  0.0401  55 GLY E C   
3185 O O   . GLY E 55 ? 0.6569 0.3928 0.3317 -0.0862 0.1247  0.0284  55 GLY E O   
3186 N N   . ASP E 56 ? 0.6685 0.3693 0.3274 -0.0692 0.1228  0.0471  56 ASP E N   
3187 C CA  . ASP E 56 ? 0.6137 0.3375 0.3058 -0.0644 0.1145  0.0406  56 ASP E CA  
3188 C C   . ASP E 56 ? 0.6490 0.3809 0.3601 -0.0784 0.1236  0.0277  56 ASP E C   
3189 O O   . ASP E 56 ? 0.6653 0.3780 0.3621 -0.0897 0.1367  0.0261  56 ASP E O   
3190 C CB  . ASP E 56 ? 0.6541 0.3655 0.3457 -0.0501 0.1100  0.0503  56 ASP E CB  
3191 C CG  . ASP E 56 ? 0.6751 0.3909 0.3554 -0.0336 0.0984  0.0626  56 ASP E CG  
3192 O OD1 . ASP E 56 ? 0.6926 0.3976 0.3674 -0.0195 0.0952  0.0724  56 ASP E OD1 
3193 O OD2 . ASP E 56 ? 0.6841 0.4164 0.3607 -0.0346 0.0925  0.0621  56 ASP E OD2 
3194 N N   . ARG E 57 ? 0.5998 0.3613 0.3418 -0.0783 0.1172  0.0186  57 ARG E N   
3195 C CA  . ARG E 57 ? 0.6017 0.3768 0.3637 -0.0894 0.1251  0.0074  57 ARG E CA  
3196 C C   . ARG E 57 ? 0.5541 0.3322 0.3345 -0.0849 0.1230  0.0081  57 ARG E C   
3197 O O   . ARG E 57 ? 0.5210 0.3078 0.3136 -0.0726 0.1112  0.0129  57 ARG E O   
3198 C CB  . ARG E 57 ? 0.5658 0.3712 0.3505 -0.0911 0.1207  -0.0025 57 ARG E CB  
3199 C CG  . ARG E 57 ? 0.5728 0.3973 0.3780 -0.1009 0.1293  -0.0132 57 ARG E CG  
3200 C CD  . ARG E 57 ? 0.5534 0.4027 0.3754 -0.1007 0.1271  -0.0221 57 ARG E CD  
3201 N NE  . ARG E 57 ? 0.5679 0.4394 0.4086 -0.1081 0.1358  -0.0313 57 ARG E NE  
3202 C CZ  . ARG E 57 ? 0.6095 0.5019 0.4624 -0.1082 0.1376  -0.0397 57 ARG E CZ  
3203 N NH1 . ARG E 57 ? 0.5982 0.4884 0.4451 -0.1030 0.1319  -0.0411 57 ARG E NH1 
3204 N NH2 . ARG E 57 ? 0.6128 0.5289 0.4824 -0.1133 0.1457  -0.0469 57 ARG E NH2 
3205 N N   . VAL E 58 ? 0.5161 0.2887 0.2975 -0.0960 0.1346  0.0030  58 VAL E N   
3206 C CA  . VAL E 58 ? 0.4878 0.2674 0.2884 -0.0939 0.1339  0.0014  58 VAL E CA  
3207 C C   . VAL E 58 ? 0.4859 0.3039 0.3204 -0.0981 0.1322  -0.0085 58 VAL E C   
3208 O O   . VAL E 58 ? 0.4910 0.3209 0.3286 -0.1109 0.1421  -0.0168 58 VAL E O   
3209 C CB  . VAL E 58 ? 0.5410 0.2944 0.3238 -0.1051 0.1482  0.0002  58 VAL E CB  
3210 C CG1 . VAL E 58 ? 0.5443 0.3052 0.3459 -0.1024 0.1471  -0.0020 58 VAL E CG1 
3211 C CG2 . VAL E 58 ? 0.6343 0.3451 0.3798 -0.1010 0.1519  0.0110  58 VAL E CG2 
3212 N N   . LEU E 59 ? 0.4248 0.2635 0.2834 -0.0869 0.1196  -0.0069 59 LEU E N   
3213 C CA  . LEU E 59 ? 0.4023 0.2758 0.2926 -0.0881 0.1170  -0.0140 59 LEU E CA  
3214 C C   . LEU E 59 ? 0.4088 0.2982 0.3184 -0.0929 0.1216  -0.0180 59 LEU E C   
3215 O O   . LEU E 59 ? 0.3901 0.3060 0.3185 -0.0996 0.1267  -0.0252 59 LEU E O   
3216 C CB  . LEU E 59 ? 0.3846 0.2725 0.2915 -0.0757 0.1017  -0.0102 59 LEU E CB  
3217 C CG  . LEU E 59 ? 0.4279 0.3052 0.3175 -0.0724 0.0969  -0.0080 59 LEU E CG  
3218 C CD1 . LEU E 59 ? 0.4530 0.3430 0.3561 -0.0626 0.0822  -0.0046 59 LEU E CD1 
3219 C CD2 . LEU E 59 ? 0.4584 0.3432 0.3472 -0.0807 0.1051  -0.0167 59 LEU E CD2 
3220 N N   . ALA E 60 ? 0.4080 0.2833 0.3129 -0.0887 0.1199  -0.0133 60 ALA E N   
3221 C CA  . ALA E 60 ? 0.3666 0.2588 0.2907 -0.0923 0.1228  -0.0173 60 ALA E CA  
3222 C C   . ALA E 60 ? 0.3878 0.2511 0.2937 -0.0907 0.1264  -0.0137 60 ALA E C   
3223 O O   . ALA E 60 ? 0.4098 0.2450 0.2942 -0.0810 0.1224  -0.0055 60 ALA E O   
3224 C CB  . ALA E 60 ? 0.3330 0.2584 0.2900 -0.0827 0.1103  -0.0158 60 ALA E CB  
3225 N N   . VAL E 61 ? 0.3723 0.2433 0.2863 -0.1000 0.1347  -0.0202 61 VAL E N   
3226 C CA  . VAL E 61 ? 0.4230 0.2662 0.3211 -0.0991 0.1397  -0.0190 61 VAL E CA  
3227 C C   . VAL E 61 ? 0.3721 0.2463 0.2993 -0.0974 0.1357  -0.0229 61 VAL E C   
3228 O O   . VAL E 61 ? 0.3773 0.2842 0.3254 -0.1089 0.1405  -0.0311 61 VAL E O   
3229 C CB  . VAL E 61 ? 0.4516 0.2675 0.3240 -0.1176 0.1578  -0.0253 61 VAL E CB  
3230 C CG1 . VAL E 61 ? 0.4535 0.2360 0.3083 -0.1161 0.1639  -0.0248 61 VAL E CG1 
3231 C CG2 . VAL E 61 ? 0.4925 0.2817 0.3369 -0.1214 0.1624  -0.0215 61 VAL E CG2 
3232 N N   . ASN E 62 ? 0.3677 0.2358 0.2969 -0.0826 0.1268  -0.0169 62 ASN E N   
3233 C CA  . ASN E 62 ? 0.3164 0.2140 0.2721 -0.0803 0.1226  -0.0203 62 ASN E CA  
3234 C C   . ASN E 62 ? 0.3255 0.2723 0.3164 -0.0834 0.1164  -0.0231 62 ASN E C   
3235 O O   . ASN E 62 ? 0.3125 0.2885 0.3237 -0.0919 0.1205  -0.0300 62 ASN E O   
3236 C CB  . ASN E 62 ? 0.3468 0.2299 0.2922 -0.0934 0.1374  -0.0293 62 ASN E CB  
3237 C CG  . ASN E 62 ? 0.4147 0.2494 0.3288 -0.0852 0.1417  -0.0252 62 ASN E CG  
3238 O OD1 . ASN E 62 ? 0.4489 0.2697 0.3544 -0.0669 0.1316  -0.0147 62 ASN E OD1 
3239 N ND2 . ASN E 62 ? 0.4444 0.2537 0.3407 -0.0983 0.1569  -0.0331 62 ASN E ND2 
3240 N N   . GLY E 63 ? 0.3026 0.2584 0.2998 -0.0763 0.1069  -0.0177 63 GLY E N   
3241 C CA  . GLY E 63 ? 0.2733 0.2708 0.3026 -0.0754 0.0995  -0.0181 63 GLY E CA  
3242 C C   . GLY E 63 ? 0.2732 0.2885 0.3100 -0.0868 0.1081  -0.0245 63 GLY E C   
3243 O O   . GLY E 63 ? 0.2629 0.3108 0.3253 -0.0841 0.1027  -0.0239 63 GLY E O   
3244 N N   . VAL E 64 ? 0.2913 0.2870 0.3064 -0.0991 0.1216  -0.0301 64 VAL E N   
3245 C CA  . VAL E 64 ? 0.2921 0.3075 0.3122 -0.1110 0.1314  -0.0370 64 VAL E CA  
3246 C C   . VAL E 64 ? 0.3539 0.3463 0.3518 -0.1122 0.1344  -0.0362 64 VAL E C   
3247 O O   . VAL E 64 ? 0.3683 0.3236 0.3366 -0.1155 0.1394  -0.0348 64 VAL E O   
3248 C CB  . VAL E 64 ? 0.3285 0.3494 0.3435 -0.1285 0.1462  -0.0461 64 VAL E CB  
3249 C CG1 . VAL E 64 ? 0.3694 0.4192 0.3914 -0.1404 0.1559  -0.0529 64 VAL E CG1 
3250 C CG2 . VAL E 64 ? 0.3265 0.3730 0.3641 -0.1275 0.1431  -0.0476 64 VAL E CG2 
3251 N N   . SER E 65 ? 0.3128 0.3275 0.3245 -0.1095 0.1322  -0.0371 65 SER E N   
3252 C CA  . SER E 65 ? 0.3476 0.3458 0.3406 -0.1105 0.1350  -0.0376 65 SER E CA  
3253 C C   . SER E 65 ? 0.3914 0.3799 0.3631 -0.1270 0.1504  -0.0441 65 SER E C   
3254 O O   . SER E 65 ? 0.3942 0.4036 0.3735 -0.1391 0.1601  -0.0506 65 SER E O   
3255 C CB  . SER E 65 ? 0.3155 0.3406 0.3286 -0.1038 0.1310  -0.0387 65 SER E CB  
3256 O OG  . SER E 65 ? 0.3917 0.4044 0.3861 -0.1071 0.1365  -0.0416 65 SER E OG  
3257 N N   . LEU E 66 ? 0.4243 0.3826 0.3687 -0.1286 0.1528  -0.0424 66 LEU E N   
3258 C CA  . LEU E 66 ? 0.4653 0.4135 0.3872 -0.1451 0.1672  -0.0478 66 LEU E CA  
3259 C C   . LEU E 66 ? 0.5148 0.4902 0.4438 -0.1483 0.1717  -0.0536 66 LEU E C   
3260 O O   . LEU E 66 ? 0.5594 0.5310 0.4698 -0.1618 0.1830  -0.0582 66 LEU E O   
3261 C CB  . LEU E 66 ? 0.4753 0.3769 0.3621 -0.1455 0.1684  -0.0420 66 LEU E CB  
3262 C CG  . LEU E 66 ? 0.5202 0.3905 0.3933 -0.1440 0.1684  -0.0371 66 LEU E CG  
3263 C CD1 . LEU E 66 ? 0.5404 0.3654 0.3766 -0.1437 0.1712  -0.0302 66 LEU E CD1 
3264 C CD2 . LEU E 66 ? 0.5728 0.4498 0.4473 -0.1606 0.1809  -0.0450 66 LEU E CD2 
3265 N N   . GLU E 67 ? 0.4849 0.4877 0.4401 -0.1359 0.1635  -0.0532 67 GLU E N   
3266 C CA  . GLU E 67 ? 0.5224 0.5514 0.4854 -0.1356 0.1679  -0.0586 67 GLU E CA  
3267 C C   . GLU E 67 ? 0.5023 0.5613 0.4684 -0.1507 0.1818  -0.0665 67 GLU E C   
3268 O O   . GLU E 67 ? 0.4738 0.5582 0.4579 -0.1548 0.1842  -0.0683 67 GLU E O   
3269 C CB  . GLU E 67 ? 0.5645 0.6182 0.5566 -0.1198 0.1586  -0.0569 67 GLU E CB  
3270 C CG  . GLU E 67 ? 0.6347 0.7172 0.6351 -0.1183 0.1655  -0.0630 67 GLU E CG  
3271 C CD  . GLU E 67 ? 0.6832 0.7730 0.7015 -0.1010 0.1566  -0.0608 67 GLU E CD  
3272 O OE1 . GLU E 67 ? 0.6899 0.7610 0.7116 -0.0925 0.1448  -0.0548 67 GLU E OE1 
3273 O OE2 . GLU E 67 ? 0.7035 0.8172 0.7310 -0.0961 0.1620  -0.0652 67 GLU E OE2 
3274 N N   . GLY E 68 ? 0.5396 0.5991 0.4882 -0.1594 0.1909  -0.0713 68 GLY E N   
3275 C CA  . GLY E 68 ? 0.5207 0.6131 0.4701 -0.1749 0.2046  -0.0792 68 GLY E CA  
3276 C C   . GLY E 68 ? 0.5508 0.6259 0.4775 -0.1968 0.2153  -0.0820 68 GLY E C   
3277 O O   . GLY E 68 ? 0.5760 0.6792 0.5013 -0.2133 0.2273  -0.0893 68 GLY E O   
3278 N N   . ALA E 69 ? 0.5002 0.5297 0.4082 -0.1972 0.2116  -0.0763 69 ALA E N   
3279 C CA  . ALA E 69 ? 0.5517 0.5566 0.4350 -0.2173 0.2225  -0.0786 69 ALA E CA  
3280 C C   . ALA E 69 ? 0.5858 0.5758 0.4389 -0.2320 0.2330  -0.0810 69 ALA E C   
3281 O O   . ALA E 69 ? 0.5850 0.5586 0.4267 -0.2231 0.2282  -0.0768 69 ALA E O   
3282 C CB  . ALA E 69 ? 0.5903 0.5487 0.4605 -0.2103 0.2160  -0.0709 69 ALA E CB  
3283 N N   . THR E 70 ? 0.6501 0.6483 0.4905 -0.2557 0.2473  -0.0881 70 THR E N   
3284 C CA  . THR E 70 ? 0.6744 0.6507 0.4811 -0.2734 0.2582  -0.0894 70 THR E CA  
3285 C C   . THR E 70 ? 0.6908 0.6037 0.4677 -0.2735 0.2575  -0.0811 70 THR E C   
3286 O O   . THR E 70 ? 0.6927 0.5864 0.4767 -0.2630 0.2507  -0.0768 70 THR E O   
3287 C CB  . THR E 70 ? 0.7235 0.7263 0.5239 -0.3013 0.2742  -0.0996 70 THR E CB  
3288 O OG1 . THR E 70 ? 0.7495 0.7293 0.5427 -0.3131 0.2793  -0.1011 70 THR E OG1 
3289 C CG2 . THR E 70 ? 0.7117 0.7830 0.5457 -0.2985 0.2746  -0.1069 70 THR E CG2 
3290 N N   . HIS E 71 ? 0.7091 0.5907 0.4526 -0.2842 0.2644  -0.0781 71 HIS E N   
3291 C CA  . HIS E 71 ? 0.7159 0.5361 0.4288 -0.2823 0.2645  -0.0685 71 HIS E CA  
3292 C C   . HIS E 71 ? 0.7541 0.5494 0.4593 -0.2931 0.2717  -0.0705 71 HIS E C   
3293 O O   . HIS E 71 ? 0.7630 0.5232 0.4640 -0.2790 0.2653  -0.0630 71 HIS E O   
3294 C CB  . HIS E 71 ? 0.7595 0.5528 0.4359 -0.2960 0.2734  -0.0652 71 HIS E CB  
3295 C CG  . HIS E 71 ? 0.7860 0.5171 0.4306 -0.2897 0.2724  -0.0527 71 HIS E CG  
3296 N ND1 . HIS E 71 ? 0.8819 0.5681 0.4962 -0.3060 0.2847  -0.0509 71 HIS E ND1 
3297 C CD2 . HIS E 71 ? 0.7460 0.4530 0.3840 -0.2680 0.2609  -0.0410 71 HIS E CD2 
3298 C CE1 . HIS E 71 ? 0.9158 0.5520 0.5060 -0.2927 0.2810  -0.0377 71 HIS E CE1 
3299 N NE2 . HIS E 71 ? 0.8723 0.5228 0.4769 -0.2697 0.2662  -0.0314 71 HIS E NE2 
3300 N N   . LYS E 72 ? 0.7695 0.5848 0.4727 -0.3183 0.2853  -0.0812 72 LYS E N   
3301 C CA  . LYS E 72 ? 0.8648 0.6540 0.5567 -0.3323 0.2943  -0.0851 72 LYS E CA  
3302 C C   . LYS E 72 ? 0.8097 0.6172 0.5338 -0.3157 0.2842  -0.0862 72 LYS E C   
3303 O O   . LYS E 72 ? 0.8247 0.5959 0.5395 -0.3130 0.2850  -0.0841 72 LYS E O   
3304 C CB  . LYS E 72 ? 0.9437 0.7545 0.6253 -0.3662 0.3117  -0.0976 72 LYS E CB  
3305 C CG  . LYS E 72 ? 1.0680 0.8442 0.7082 -0.3875 0.3246  -0.0958 72 LYS E CG  
3306 C CD  . LYS E 72 ? 1.1486 0.8470 0.7514 -0.3891 0.3300  -0.0876 72 LYS E CD  
3307 C CE  . LYS E 72 ? 1.1656 0.8251 0.7511 -0.3674 0.3210  -0.0721 72 LYS E CE  
3308 N NZ  . LYS E 72 ? 1.2022 0.7907 0.7585 -0.3597 0.3232  -0.0622 72 LYS E NZ  
3309 N N   . GLN E 73 ? 0.7748 0.6378 0.5360 -0.3037 0.2748  -0.0888 73 GLN E N   
3310 C CA  . GLN E 73 ? 0.7395 0.6242 0.5329 -0.2875 0.2642  -0.0888 73 GLN E CA  
3311 C C   . GLN E 73 ? 0.7219 0.5702 0.5141 -0.2615 0.2502  -0.0769 73 GLN E C   
3312 O O   . GLN E 73 ? 0.6910 0.5279 0.4908 -0.2534 0.2460  -0.0756 73 GLN E O   
3313 C CB  . GLN E 73 ? 0.7418 0.6916 0.5731 -0.2793 0.2576  -0.0925 73 GLN E CB  
3314 C CG  . GLN E 73 ? 0.7815 0.7781 0.6186 -0.3026 0.2706  -0.1040 73 GLN E CG  
3315 C CD  . GLN E 73 ? 0.7764 0.8363 0.6500 -0.2908 0.2643  -0.1060 73 GLN E CD  
3316 O OE1 . GLN E 73 ? 0.7372 0.8005 0.6223 -0.2696 0.2533  -0.0996 73 GLN E OE1 
3317 N NE2 . GLN E 73 ? 0.8091 0.9197 0.7004 -0.3043 0.2718  -0.1147 73 GLN E NE2 
3318 N N   . ALA E 74 ? 0.6714 0.5053 0.4545 -0.2484 0.2429  -0.0687 74 ALA E N   
3319 C CA  . ALA E 74 ? 0.6805 0.4823 0.4596 -0.2251 0.2301  -0.0571 74 ALA E CA  
3320 C C   . ALA E 74 ? 0.7233 0.4691 0.4716 -0.2278 0.2365  -0.0524 74 ALA E C   
3321 O O   . ALA E 74 ? 0.7204 0.4522 0.4750 -0.2126 0.2290  -0.0477 74 ALA E O   
3322 C CB  . ALA E 74 ? 0.6684 0.4642 0.4383 -0.2144 0.2232  -0.0501 74 ALA E CB  
3323 N N   . VAL E 75 ? 0.7564 0.4705 0.4711 -0.2473 0.2510  -0.0537 75 VAL E N   
3324 C CA  . VAL E 75 ? 0.7753 0.4297 0.4562 -0.2506 0.2594  -0.0489 75 VAL E CA  
3325 C C   . VAL E 75 ? 0.8149 0.4699 0.5065 -0.2553 0.2635  -0.0565 75 VAL E C   
3326 O O   . VAL E 75 ? 0.8366 0.4569 0.5196 -0.2415 0.2607  -0.0508 75 VAL E O   
3327 C CB  . VAL E 75 ? 0.8247 0.4478 0.4678 -0.2757 0.2764  -0.0506 75 VAL E CB  
3328 C CG1 . VAL E 75 ? 0.8966 0.4555 0.5047 -0.2811 0.2875  -0.0471 75 VAL E CG1 
3329 C CG2 . VAL E 75 ? 0.8271 0.4444 0.4552 -0.2702 0.2727  -0.0417 75 VAL E CG2 
3330 N N   . GLU E 76 ? 0.8007 0.4984 0.5113 -0.2745 0.2702  -0.0697 76 GLU E N   
3331 C CA  . GLU E 76 ? 0.8238 0.5296 0.5463 -0.2816 0.2747  -0.0787 76 GLU E CA  
3332 C C   . GLU E 76 ? 0.7595 0.4876 0.5147 -0.2557 0.2583  -0.0746 76 GLU E C   
3333 O O   . GLU E 76 ? 0.7553 0.4643 0.5094 -0.2510 0.2589  -0.0759 76 GLU E O   
3334 C CB  . GLU E 76 ? 0.8882 0.6432 0.6250 -0.3081 0.2851  -0.0932 76 GLU E CB  
3335 C CG  . GLU E 76 ? 1.0192 0.7497 0.7207 -0.3382 0.3035  -0.0990 76 GLU E CG  
3336 C CD  . GLU E 76 ? 1.1482 0.8119 0.8130 -0.3486 0.3158  -0.0996 76 GLU E CD  
3337 O OE1 . GLU E 76 ? 1.2152 0.8321 0.8416 -0.3616 0.3266  -0.0960 76 GLU E OE1 
3338 O OE2 . GLU E 76 ? 1.1613 0.8181 0.8348 -0.3433 0.3150  -0.1034 76 GLU E OE2 
3339 N N   . THR E 77 ? 0.6704 0.4370 0.4529 -0.2394 0.2441  -0.0698 77 THR E N   
3340 C CA  . THR E 77 ? 0.6278 0.4167 0.4405 -0.2161 0.2280  -0.0651 77 THR E CA  
3341 C C   . THR E 77 ? 0.6665 0.4074 0.4607 -0.1962 0.2213  -0.0540 77 THR E C   
3342 O O   . THR E 77 ? 0.6427 0.3862 0.4505 -0.1835 0.2145  -0.0528 77 THR E O   
3343 C CB  . THR E 77 ? 0.5964 0.4285 0.4371 -0.2034 0.2151  -0.0616 77 THR E CB  
3344 O OG1 . THR E 77 ? 0.6173 0.5002 0.4800 -0.2178 0.2206  -0.0715 77 THR E OG1 
3345 C CG2 . THR E 77 ? 0.5307 0.3780 0.3975 -0.1796 0.1981  -0.0549 77 THR E CG2 
3346 N N   . LEU E 78 ? 0.6887 0.3892 0.4522 -0.1927 0.2232  -0.0454 78 LEU E N   
3347 C CA  . LEU E 78 ? 0.6976 0.3517 0.4392 -0.1735 0.2186  -0.0336 78 LEU E CA  
3348 C C   . LEU E 78 ? 0.7544 0.3672 0.4746 -0.1795 0.2305  -0.0370 78 LEU E C   
3349 O O   . LEU E 78 ? 0.7767 0.3720 0.4963 -0.1608 0.2246  -0.0315 78 LEU E O   
3350 C CB  . LEU E 78 ? 0.6994 0.3216 0.4111 -0.1703 0.2196  -0.0234 78 LEU E CB  
3351 C CG  . LEU E 78 ? 0.6804 0.3352 0.4102 -0.1577 0.2053  -0.0181 78 LEU E CG  
3352 C CD1 . LEU E 78 ? 0.7499 0.3793 0.4498 -0.1613 0.2095  -0.0113 78 LEU E CD1 
3353 C CD2 . LEU E 78 ? 0.6304 0.2925 0.3755 -0.1316 0.1887  -0.0093 78 LEU E CD2 
3354 N N   . ARG E 79 ? 0.7763 0.3742 0.4783 -0.2060 0.2478  -0.0466 79 ARG E N   
3355 C CA  . ARG E 79 ? 0.8716 0.4219 0.5470 -0.2150 0.2618  -0.0509 79 ARG E CA  
3356 C C   . ARG E 79 ? 0.8484 0.4260 0.5498 -0.2159 0.2607  -0.0615 79 ARG E C   
3357 O O   . ARG E 79 ? 0.8375 0.3793 0.5250 -0.2095 0.2653  -0.0621 79 ARG E O   
3358 C CB  . ARG E 79 ? 0.9867 0.5125 0.6325 -0.2465 0.2813  -0.0586 79 ARG E CB  
3359 C CG  . ARG E 79 ? 1.1350 0.5863 0.7364 -0.2512 0.2961  -0.0561 79 ARG E CG  
3360 C CD  . ARG E 79 ? 1.2579 0.6898 0.8329 -0.2879 0.3168  -0.0673 79 ARG E CD  
3361 N NE  . ARG E 79 ? 1.3187 0.7766 0.8928 -0.3032 0.3182  -0.0670 79 ARG E NE  
3362 C CZ  . ARG E 79 ? 1.3946 0.8194 0.9406 -0.3006 0.3198  -0.0552 79 ARG E CZ  
3363 N NH1 . ARG E 79 ? 1.4614 0.8260 0.9780 -0.2820 0.3199  -0.0414 79 ARG E NH1 
3364 N NH2 . ARG E 79 ? 1.3807 0.8349 0.9281 -0.3154 0.3212  -0.0567 79 ARG E NH2 
3365 N N   . ASN E 80 ? 0.8091 0.4506 0.5480 -0.2227 0.2549  -0.0695 80 ASN E N   
3366 C CA  . ASN E 80 ? 0.8110 0.4870 0.5762 -0.2278 0.2551  -0.0805 80 ASN E CA  
3367 C C   . ASN E 80 ? 0.7247 0.4232 0.5182 -0.1998 0.2371  -0.0736 80 ASN E C   
3368 O O   . ASN E 80 ? 0.6977 0.4529 0.5285 -0.1961 0.2269  -0.0757 80 ASN E O   
3369 C CB  . ASN E 80 ? 0.8391 0.5749 0.6292 -0.2497 0.2591  -0.0919 80 ASN E CB  
3370 C CG  . ASN E 80 ? 0.9728 0.6911 0.7356 -0.2824 0.2793  -0.1028 80 ASN E CG  
3371 O OD1 . ASN E 80 ? 1.0531 0.7216 0.7857 -0.2932 0.2922  -0.1072 80 ASN E OD1 
3372 N ND2 . ASN E 80 ? 1.0006 0.7595 0.7729 -0.2985 0.2827  -0.1074 80 ASN E ND2 
3373 N N   . THR E 81 ? 0.7144 0.3674 0.4881 -0.1800 0.2340  -0.0645 81 THR E N   
3374 C CA  . THR E 81 ? 0.6378 0.3049 0.4308 -0.1514 0.2167  -0.0552 81 THR E CA  
3375 C C   . THR E 81 ? 0.6852 0.3067 0.4567 -0.1401 0.2219  -0.0544 81 THR E C   
3376 O O   . THR E 81 ? 0.7361 0.3102 0.4757 -0.1542 0.2390  -0.0603 81 THR E O   
3377 C CB  . THR E 81 ? 0.6516 0.3108 0.4384 -0.1324 0.2045  -0.0400 81 THR E CB  
3378 O OG1 . THR E 81 ? 0.7190 0.3192 0.4636 -0.1338 0.2148  -0.0336 81 THR E OG1 
3379 C CG2 . THR E 81 ? 0.5845 0.2892 0.3943 -0.1396 0.1979  -0.0407 81 THR E CG2 
3380 N N   . GLY E 82 ? 0.6529 0.2886 0.4408 -0.1152 0.2078  -0.0476 82 GLY E N   
3381 C CA  . GLY E 82 ? 0.6634 0.2595 0.4324 -0.0988 0.2108  -0.0452 82 GLY E CA  
3382 C C   . GLY E 82 ? 0.6752 0.2253 0.4140 -0.0759 0.2076  -0.0289 82 GLY E C   
3383 O O   . GLY E 82 ? 0.7099 0.2509 0.4366 -0.0772 0.2060  -0.0206 82 GLY E O   
3384 N N   . GLN E 83 ? 0.6904 0.2142 0.4172 -0.0541 0.2066  -0.0242 83 GLN E N   
3385 C CA  . GLN E 83 ? 0.7708 0.2477 0.4654 -0.0299 0.2057  -0.0083 83 GLN E CA  
3386 C C   . GLN E 83 ? 0.7166 0.2264 0.4256 -0.0098 0.1863  0.0065  83 GLN E C   
3387 O O   . GLN E 83 ? 0.7585 0.2392 0.4420 0.0022  0.1856  0.0200  83 GLN E O   
3388 C CB  . GLN E 83 ? 0.8372 0.2824 0.5175 -0.0110 0.2105  -0.0088 83 GLN E CB  
3389 C CG  . GLN E 83 ? 0.8756 0.2848 0.5293 0.0221  0.2064  0.0091  83 GLN E CG  
3390 C CD  . GLN E 83 ? 0.9561 0.3104 0.5692 0.0216  0.2159  0.0209  83 GLN E CD  
3391 O OE1 . GLN E 83 ? 0.9572 0.2772 0.5495 -0.0036 0.2318  0.0140  83 GLN E OE1 
3392 N NE2 . GLN E 83 ? 0.9594 0.3076 0.5603 0.0496  0.2062  0.0391  83 GLN E NE2 
3393 N N   . VAL E 84 ? 0.6632 0.2345 0.4124 -0.0075 0.1710  0.0038  84 VAL E N   
3394 C CA  . VAL E 84 ? 0.6349 0.2425 0.4007 0.0048  0.1532  0.0148  84 VAL E CA  
3395 C C   . VAL E 84 ? 0.6011 0.2523 0.3952 -0.0159 0.1492  0.0073  84 VAL E C   
3396 O O   . VAL E 84 ? 0.5556 0.2375 0.3749 -0.0301 0.1510  -0.0046 84 VAL E O   
3397 C CB  . VAL E 84 ? 0.6725 0.3133 0.4584 0.0292  0.1370  0.0211  84 VAL E CB  
3398 C CG1 . VAL E 84 ? 0.6773 0.3669 0.4887 0.0331  0.1191  0.0274  84 VAL E CG1 
3399 C CG2 . VAL E 84 ? 0.7133 0.3139 0.4682 0.0555  0.1385  0.0331  84 VAL E CG2 
3400 N N   . VAL E 85 ? 0.5776 0.2321 0.3667 -0.0171 0.1442  0.0144  85 VAL E N   
3401 C CA  . VAL E 85 ? 0.5462 0.2342 0.3562 -0.0358 0.1428  0.0077  85 VAL E CA  
3402 C C   . VAL E 85 ? 0.5030 0.2249 0.3305 -0.0245 0.1256  0.0157  85 VAL E C   
3403 O O   . VAL E 85 ? 0.5222 0.2287 0.3317 -0.0096 0.1196  0.0272  85 VAL E O   
3404 C CB  . VAL E 85 ? 0.6057 0.2607 0.3885 -0.0533 0.1570  0.0057  85 VAL E CB  
3405 C CG1 . VAL E 85 ? 0.5434 0.2360 0.3486 -0.0725 0.1572  -0.0029 85 VAL E CG1 
3406 C CG2 . VAL E 85 ? 0.6491 0.2605 0.4066 -0.0646 0.1751  -0.0008 85 VAL E CG2 
3407 N N   . HIS E 86 ? 0.4292 0.1978 0.2910 -0.0320 0.1181  0.0096  86 HIS E N   
3408 C CA  . HIS E 86 ? 0.4211 0.2212 0.3003 -0.0245 0.1028  0.0154  86 HIS E CA  
3409 C C   . HIS E 86 ? 0.4756 0.2726 0.3480 -0.0376 0.1076  0.0130  86 HIS E C   
3410 O O   . HIS E 86 ? 0.4577 0.2632 0.3381 -0.0547 0.1171  0.0035  86 HIS E O   
3411 C CB  . HIS E 86 ? 0.4005 0.2484 0.3184 -0.0257 0.0937  0.0105  86 HIS E CB  
3412 C CG  . HIS E 86 ? 0.3928 0.2709 0.3284 -0.0174 0.0775  0.0166  86 HIS E CG  
3413 N ND1 . HIS E 86 ? 0.4142 0.3335 0.3832 -0.0212 0.0697  0.0132  86 HIS E ND1 
3414 C CD2 . HIS E 86 ? 0.4516 0.3246 0.3749 -0.0063 0.0681  0.0258  86 HIS E CD2 
3415 C CE1 . HIS E 86 ? 0.4187 0.3535 0.3943 -0.0140 0.0567  0.0195  86 HIS E CE1 
3416 N NE2 . HIS E 86 ? 0.3792 0.2883 0.3277 -0.0055 0.0553  0.0266  86 HIS E NE2 
3417 N N   . LEU E 87 ? 0.4603 0.2457 0.3159 -0.0296 0.1020  0.0216  87 LEU E N   
3418 C CA  . LEU E 87 ? 0.4420 0.2246 0.2893 -0.0405 0.1059  0.0196  87 LEU E CA  
3419 C C   . LEU E 87 ? 0.4398 0.2512 0.3029 -0.0342 0.0916  0.0226  87 LEU E C   
3420 O O   . LEU E 87 ? 0.4408 0.2575 0.3028 -0.0195 0.0800  0.0310  87 LEU E O   
3421 C CB  . LEU E 87 ? 0.4524 0.1921 0.2608 -0.0386 0.1138  0.0269  87 LEU E CB  
3422 C CG  . LEU E 87 ? 0.5570 0.2590 0.3432 -0.0471 0.1301  0.0240  87 LEU E CG  
3423 C CD1 . LEU E 87 ? 0.6058 0.2629 0.3520 -0.0428 0.1370  0.0338  87 LEU E CD1 
3424 C CD2 . LEU E 87 ? 0.6074 0.3205 0.4034 -0.0700 0.1415  0.0111  87 LEU E CD2 
3425 N N   . LEU E 88 ? 0.4019 0.2326 0.2792 -0.0454 0.0930  0.0154  88 LEU E N   
3426 C CA  . LEU E 88 ? 0.3889 0.2408 0.2775 -0.0422 0.0820  0.0164  88 LEU E CA  
3427 C C   . LEU E 88 ? 0.4252 0.2602 0.2914 -0.0487 0.0881  0.0158  88 LEU E C   
3428 O O   . LEU E 88 ? 0.4290 0.2574 0.2900 -0.0613 0.1003  0.0091  88 LEU E O   
3429 C CB  . LEU E 88 ? 0.3511 0.2359 0.2720 -0.0488 0.0804  0.0085  88 LEU E CB  
3430 C CG  . LEU E 88 ? 0.3853 0.2898 0.3197 -0.0463 0.0702  0.0082  88 LEU E CG  
3431 C CD1 . LEU E 88 ? 0.3762 0.2893 0.3146 -0.0344 0.0554  0.0162  88 LEU E CD1 
3432 C CD2 . LEU E 88 ? 0.3770 0.3098 0.3415 -0.0521 0.0716  0.0011  88 LEU E CD2 
3433 N N   . LEU E 89 ? 0.3818 0.2221 0.2940 0.0095  0.0726  0.0207  89 LEU E N   
3434 C CA  . LEU E 89 ? 0.4018 0.2225 0.3020 -0.0111 0.0766  0.0249  89 LEU E CA  
3435 C C   . LEU E 89 ? 0.4457 0.2465 0.3074 -0.0333 0.0864  0.0259  89 LEU E C   
3436 O O   . LEU E 89 ? 0.4571 0.2620 0.3127 -0.0397 0.0848  0.0296  89 LEU E O   
3437 C CB  . LEU E 89 ? 0.4174 0.2567 0.3359 -0.0181 0.0616  0.0358  89 LEU E CB  
3438 C CG  . LEU E 89 ? 0.3693 0.2198 0.3348 0.0028  0.0457  0.0327  89 LEU E CG  
3439 C CD1 . LEU E 89 ? 0.3772 0.2527 0.3586 0.0188  0.0321  0.0289  89 LEU E CD1 
3440 C CD2 . LEU E 89 ? 0.3785 0.2335 0.3698 -0.0085 0.0376  0.0494  89 LEU E CD2 
3441 N N   . GLU E 90 ? 0.4956 0.2762 0.3344 -0.0426 0.0951  0.0235  90 GLU E N   
3442 C CA  . GLU E 90 ? 0.5174 0.2768 0.3127 -0.0625 0.0968  0.0189  90 GLU E CA  
3443 C C   . GLU E 90 ? 0.5119 0.2860 0.2941 -0.0743 0.0883  0.0292  90 GLU E C   
3444 O O   . GLU E 90 ? 0.5203 0.3063 0.3151 -0.0663 0.0942  0.0382  90 GLU E O   
3445 C CB  . GLU E 90 ? 0.5767 0.3023 0.3446 -0.0575 0.1158  0.0044  90 GLU E CB  
3446 C CG  . GLU E 90 ? 0.6551 0.3545 0.3695 -0.0722 0.1142  -0.0080 90 GLU E CG  
3447 C CD  . GLU E 90 ? 0.7665 0.4396 0.4505 -0.0590 0.1368  -0.0224 90 GLU E CD  
3448 O OE1 . GLU E 90 ? 0.8009 0.4755 0.5130 -0.0421 0.1535  -0.0189 90 GLU E OE1 
3449 O OE2 . GLU E 90 ? 0.7957 0.4470 0.4269 -0.0632 0.1367  -0.0380 90 GLU E OE2 
3450 N N   . LYS E 91 ? 0.5278 0.3045 0.2912 -0.0939 0.0724  0.0327  91 LYS E N   
3451 C CA  . LYS E 91 ? 0.5202 0.3115 0.2636 -0.1076 0.0616  0.0438  91 LYS E CA  
3452 C C   . LYS E 91 ? 0.6048 0.3805 0.2981 -0.1045 0.0757  0.0352  91 LYS E C   
3453 O O   . LYS E 91 ? 0.6602 0.4011 0.3092 -0.1050 0.0814  0.0129  91 LYS E O   
3454 C CB  . LYS E 91 ? 0.5691 0.3599 0.2996 -0.1305 0.0389  0.0471  91 LYS E CB  
3455 C CG  . LYS E 91 ? 0.6478 0.4541 0.3530 -0.1469 0.0231  0.0587  91 LYS E CG  
3456 C CD  . LYS E 91 ? 0.6331 0.4816 0.3874 -0.1443 0.0169  0.0851  91 LYS E CD  
3457 C CE  . LYS E 91 ? 0.7085 0.5775 0.4416 -0.1623 -0.0002 0.1024  91 LYS E CE  
3458 N NZ  . LYS E 91 ? 0.7049 0.6139 0.4923 -0.1580 -0.0048 0.1305  91 LYS E NZ  
3459 N N   . GLY E 92 ? 0.5823 0.3866 0.2853 -0.0991 0.0809  0.0550  92 GLY E N   
3460 C CA  . GLY E 92 ? 0.6427 0.4480 0.3007 -0.0907 0.0984  0.0559  92 GLY E CA  
3461 C C   . GLY E 92 ? 0.7178 0.5261 0.3129 -0.1042 0.0854  0.0532  92 GLY E C   
3462 O O   . GLY E 92 ? 0.7032 0.5107 0.2963 -0.1243 0.0596  0.0526  92 GLY E O   
3463 N N   . GLN E 93 ? 0.7991 0.6142 0.3423 -0.0910 0.1028  0.0530  93 GLN E N   
3464 C CA  . GLN E 93 ? 0.9488 0.7723 0.4216 -0.0982 0.0901  0.0499  93 GLN E CA  
3465 C C   . GLN E 93 ? 0.9652 0.8447 0.4688 -0.1078 0.0796  0.0929  93 GLN E C   
3466 O O   . GLN E 93 ? 0.8818 0.7964 0.4489 -0.0994 0.0924  0.1265  93 GLN E O   
3467 C CB  . GLN E 93 ? 1.0463 0.8628 0.4453 -0.0728 0.1159  0.0335  93 GLN E CB  
3468 C CG  . GLN E 93 ? 1.1148 0.8681 0.4588 -0.0683 0.1123  -0.0175 93 GLN E CG  
3469 C CD  . GLN E 93 ? 1.1766 0.9014 0.4742 -0.0914 0.0718  -0.0423 93 GLN E CD  
3470 O OE1 . GLN E 93 ? 1.2185 0.9724 0.4834 -0.1008 0.0539  -0.0288 93 GLN E OE1 
3471 N NE2 . GLN E 93 ? 1.1758 0.8456 0.4768 -0.1016 0.0545  -0.0748 93 GLN E NE2 
3472 N N   . SER E 94 ? 1.0824 0.9695 0.5478 -0.1261 0.0527  0.0938  94 SER E N   
3473 C CA  . SER E 94 ? 1.1456 1.0878 0.6420 -0.1363 0.0410  0.1376  94 SER E CA  
3474 C C   . SER E 94 ? 1.2154 1.1948 0.6441 -0.1238 0.0515  0.1539  94 SER E C   
3475 O O   . SER E 94 ? 1.2063 1.2194 0.6485 -0.1022 0.0812  0.1799  94 SER E O   
3476 C CB  . SER E 94 ? 1.1898 1.1298 0.7029 -0.1650 0.0038  0.1400  94 SER E CB  
3477 O OG  . SER E 94 ? 1.1871 1.1802 0.7513 -0.1738 -0.0064 0.1856  94 SER E OG  
3478 N N   . PRO F 1  ? 0.3230 0.4418 0.4308 0.0892  -0.0339 0.0466  1  PRO F N   
3479 C CA  . PRO F 1  ? 0.3328 0.4569 0.4691 0.0757  -0.0460 0.0560  1  PRO F CA  
3480 C C   . PRO F 1  ? 0.3067 0.4735 0.4798 0.0838  -0.0510 0.0746  1  PRO F C   
3481 O O   . PRO F 1  ? 0.3626 0.5467 0.5273 0.1035  -0.0470 0.0772  1  PRO F O   
3482 C CB  . PRO F 1  ? 0.3308 0.4132 0.4365 0.0706  -0.0575 0.0421  1  PRO F CB  
3483 C CG  . PRO F 1  ? 0.3758 0.4281 0.4408 0.0758  -0.0479 0.0291  1  PRO F CG  
3484 C CD  . PRO F 1  ? 0.3693 0.4421 0.4389 0.0827  -0.0346 0.0295  1  PRO F CD  
3485 N N   . LYS F 2  ? 0.2619 0.4457 0.4771 0.0692  -0.0607 0.0877  2  LYS F N   
3486 C CA  . LYS F 2  ? 0.2527 0.4806 0.5124 0.0711  -0.0686 0.1080  2  LYS F CA  
3487 C C   . LYS F 2  ? 0.2633 0.4698 0.5139 0.0662  -0.0895 0.0963  2  LYS F C   
3488 O O   . LYS F 2  ? 0.2612 0.4231 0.4837 0.0570  -0.0986 0.0774  2  LYS F O   
3489 C CB  . LYS F 2  ? 0.2796 0.5319 0.5958 0.0530  -0.0715 0.1287  2  LYS F CB  
3490 C CG  . LYS F 2  ? 0.3630 0.6652 0.7084 0.0635  -0.0514 0.1549  2  LYS F CG  
3491 C CD  . LYS F 2  ? 0.4090 0.7183 0.8039 0.0427  -0.0530 0.1743  2  LYS F CD  
3492 C CE  . LYS F 2  ? 0.4379 0.7425 0.8782 0.0189  -0.0788 0.1794  2  LYS F CE  
3493 N NZ  . LYS F 2  ? 0.4591 0.7656 0.9534 -0.0025 -0.0821 0.2005  2  LYS F NZ  
3494 N N   . PRO F 3  ? 0.2640 0.5062 0.5355 0.0759  -0.0968 0.1078  3  PRO F N   
3495 C CA  . PRO F 3  ? 0.2755 0.5052 0.5436 0.0721  -0.1193 0.0978  3  PRO F CA  
3496 C C   . PRO F 3  ? 0.2763 0.4809 0.5625 0.0476  -0.1393 0.0882  3  PRO F C   
3497 O O   . PRO F 3  ? 0.2646 0.4858 0.5984 0.0304  -0.1418 0.1017  3  PRO F O   
3498 C CB  . PRO F 3  ? 0.2937 0.5851 0.6073 0.0801  -0.1242 0.1204  3  PRO F CB  
3499 C CG  . PRO F 3  ? 0.2895 0.6103 0.5946 0.1032  -0.0998 0.1337  3  PRO F CG  
3500 C CD  . PRO F 3  ? 0.2900 0.5897 0.5857 0.0952  -0.0847 0.1304  3  PRO F CD  
3501 N N   . GLY F 4  ? 0.2784 0.4415 0.5246 0.0486  -0.1529 0.0654  4  GLY F N   
3502 C CA  . GLY F 4  ? 0.3115 0.4457 0.5633 0.0323  -0.1747 0.0504  4  GLY F CA  
3503 C C   . GLY F 4  ? 0.3023 0.3926 0.5178 0.0291  -0.1645 0.0367  4  GLY F C   
3504 O O   . GLY F 4  ? 0.3242 0.3820 0.5228 0.0247  -0.1810 0.0186  4  GLY F O   
3505 N N   . ASP F 5  ? 0.2565 0.3490 0.4598 0.0333  -0.1386 0.0445  5  ASP F N   
3506 C CA  . ASP F 5  ? 0.2927 0.3516 0.4631 0.0314  -0.1270 0.0335  5  ASP F CA  
3507 C C   . ASP F 5  ? 0.3180 0.3426 0.4309 0.0422  -0.1260 0.0165  5  ASP F C   
3508 O O   . ASP F 5  ? 0.3430 0.3686 0.4343 0.0543  -0.1222 0.0171  5  ASP F O   
3509 C CB  . ASP F 5  ? 0.2958 0.3711 0.4669 0.0352  -0.1012 0.0447  5  ASP F CB  
3510 C CG  . ASP F 5  ? 0.2719 0.3771 0.4934 0.0260  -0.0968 0.0638  5  ASP F CG  
3511 O OD1 . ASP F 5  ? 0.3008 0.4075 0.5603 0.0122  -0.1137 0.0690  5  ASP F OD1 
3512 O OD2 . ASP F 5  ? 0.2548 0.3817 0.4781 0.0333  -0.0766 0.0741  5  ASP F OD2 
3513 N N   . ILE F 6  ? 0.3093 0.3046 0.3977 0.0398  -0.1285 0.0037  6  ILE F N   
3514 C CA  . ILE F 6  ? 0.3425 0.3119 0.3783 0.0507  -0.1218 -0.0064 6  ILE F CA  
3515 C C   . ILE F 6  ? 0.3453 0.3153 0.3672 0.0505  -0.0961 -0.0002 6  ILE F C   
3516 O O   . ILE F 6  ? 0.3434 0.3246 0.3846 0.0432  -0.0860 0.0045  6  ILE F O   
3517 C CB  . ILE F 6  ? 0.3748 0.3195 0.3884 0.0522  -0.1317 -0.0208 6  ILE F CB  
3518 C CG1 . ILE F 6  ? 0.4047 0.3441 0.4317 0.0526  -0.1626 -0.0327 6  ILE F CG1 
3519 C CG2 . ILE F 6  ? 0.4164 0.3443 0.3789 0.0647  -0.1196 -0.0247 6  ILE F CG2 
3520 C CD1 . ILE F 6  ? 0.4183 0.3624 0.4278 0.0654  -0.1748 -0.0362 6  ILE F CD1 
3521 N N   . PHE F 7  ? 0.3454 0.3029 0.3352 0.0586  -0.0868 0.0002  7  PHE F N   
3522 C CA  . PHE F 7  ? 0.3213 0.2736 0.2973 0.0558  -0.0665 0.0028  7  PHE F CA  
3523 C C   . PHE F 7  ? 0.4203 0.3493 0.3581 0.0616  -0.0606 0.0032  7  PHE F C   
3524 O O   . PHE F 7  ? 0.4262 0.3456 0.3464 0.0719  -0.0700 0.0034  7  PHE F O   
3525 C CB  . PHE F 7  ? 0.3334 0.3015 0.3273 0.0571  -0.0579 0.0087  7  PHE F CB  
3526 C CG  . PHE F 7  ? 0.3769 0.3384 0.3607 0.0686  -0.0612 0.0117  7  PHE F CG  
3527 C CD1 . PHE F 7  ? 0.3889 0.3274 0.3488 0.0722  -0.0519 0.0115  7  PHE F CD1 
3528 C CD2 . PHE F 7  ? 0.3767 0.3553 0.3776 0.0758  -0.0743 0.0157  7  PHE F CD2 
3529 C CE1 . PHE F 7  ? 0.4145 0.3415 0.3628 0.0856  -0.0549 0.0148  7  PHE F CE1 
3530 C CE2 . PHE F 7  ? 0.4261 0.4009 0.4154 0.0901  -0.0766 0.0192  7  PHE F CE2 
3531 C CZ  . PHE F 7  ? 0.4400 0.3863 0.4006 0.0964  -0.0665 0.0185  7  PHE F CZ  
3532 N N   . GLU F 8  ? 0.3825 0.3062 0.3099 0.0553  -0.0452 0.0052  8  GLU F N   
3533 C CA  . GLU F 8  ? 0.4135 0.3189 0.3119 0.0582  -0.0371 0.0118  8  GLU F CA  
3534 C C   . GLU F 8  ? 0.4133 0.3105 0.3158 0.0491  -0.0243 0.0164  8  GLU F C   
3535 O O   . GLU F 8  ? 0.4063 0.3161 0.3278 0.0409  -0.0198 0.0112  8  GLU F O   
3536 C CB  . GLU F 8  ? 0.4660 0.3739 0.3453 0.0603  -0.0332 0.0118  8  GLU F CB  
3537 C CG  . GLU F 8  ? 0.5402 0.4641 0.4331 0.0513  -0.0264 0.0072  8  GLU F CG  
3538 C CD  . GLU F 8  ? 0.6364 0.5635 0.5070 0.0604  -0.0264 0.0049  8  GLU F CD  
3539 O OE1 . GLU F 8  ? 0.6676 0.6010 0.5467 0.0611  -0.0315 -0.0036 8  GLU F OE1 
3540 O OE2 . GLU F 8  ? 0.6061 0.5296 0.4497 0.0695  -0.0210 0.0129  8  GLU F OE2 
3541 N N   . VAL F 9  ? 0.4222 0.2975 0.3068 0.0518  -0.0198 0.0263  9  VAL F N   
3542 C CA  . VAL F 9  ? 0.4537 0.3112 0.3429 0.0423  -0.0118 0.0305  9  VAL F CA  
3543 C C   . VAL F 9  ? 0.5076 0.3522 0.3824 0.0371  -0.0010 0.0472  9  VAL F C   
3544 O O   . VAL F 9  ? 0.5364 0.3789 0.3894 0.0494  -0.0006 0.0576  9  VAL F O   
3545 C CB  . VAL F 9  ? 0.5339 0.3705 0.4209 0.0528  -0.0186 0.0298  9  VAL F CB  
3546 C CG1 . VAL F 9  ? 0.5928 0.3980 0.4804 0.0448  -0.0138 0.0331  9  VAL F CG1 
3547 C CG2 . VAL F 9  ? 0.4885 0.3468 0.3934 0.0595  -0.0269 0.0180  9  VAL F CG2 
3548 N N   . GLU F 10 ? 0.4793 0.3190 0.3680 0.0198  0.0071  0.0506  10 GLU F N   
3549 C CA  . GLU F 10 ? 0.4661 0.2903 0.3512 0.0110  0.0176  0.0715  10 GLU F CA  
3550 C C   . GLU F 10 ? 0.5043 0.2889 0.3970 0.0057  0.0132  0.0714  10 GLU F C   
3551 O O   . GLU F 10 ? 0.5338 0.3126 0.4457 -0.0063 0.0084  0.0571  10 GLU F O   
3552 C CB  . GLU F 10 ? 0.4622 0.3105 0.3648 -0.0078 0.0277  0.0763  10 GLU F CB  
3553 C CG  . GLU F 10 ? 0.4933 0.3782 0.3836 0.0010  0.0339  0.0793  10 GLU F CG  
3554 C CD  . GLU F 10 ? 0.5634 0.4503 0.4293 0.0143  0.0429  0.1027  10 GLU F CD  
3555 O OE1 . GLU F 10 ? 0.5885 0.4496 0.4497 0.0148  0.0460  0.1201  10 GLU F OE1 
3556 O OE2 . GLU F 10 ? 0.5853 0.4996 0.4345 0.0271  0.0468  0.1043  10 GLU F OE2 
3557 N N   . LEU F 11 ? 0.5276 0.2843 0.4025 0.0182  0.0132  0.0857  11 LEU F N   
3558 C CA  . LEU F 11 ? 0.5737 0.2861 0.4499 0.0196  0.0069  0.0841  11 LEU F CA  
3559 C C   . LEU F 11 ? 0.6362 0.3147 0.5156 0.0081  0.0158  0.1103  11 LEU F C   
3560 O O   . LEU F 11 ? 0.6420 0.3216 0.5046 0.0177  0.0255  0.1354  11 LEU F O   
3561 C CB  . LEU F 11 ? 0.6192 0.3242 0.4738 0.0463  -0.0014 0.0802  11 LEU F CB  
3562 C CG  . LEU F 11 ? 0.6680 0.3280 0.5166 0.0566  -0.0084 0.0780  11 LEU F CG  
3563 C CD1 . LEU F 11 ? 0.6706 0.3261 0.5363 0.0503  -0.0174 0.0530  11 LEU F CD1 
3564 C CD2 . LEU F 11 ? 0.6975 0.3636 0.5248 0.0849  -0.0148 0.0781  11 LEU F CD2 
3565 N N   . ALA F 12 ? 0.6920 0.3399 0.5940 -0.0115 0.0114  0.1051  12 ALA F N   
3566 C CA  . ALA F 12 ? 0.7456 0.3540 0.6598 -0.0272 0.0173  0.1308  12 ALA F CA  
3567 C C   . ALA F 12 ? 0.7697 0.3230 0.6650 -0.0091 0.0112  0.1356  12 ALA F C   
3568 O O   . ALA F 12 ? 0.7777 0.3117 0.6642 0.0050  -0.0027 0.1101  12 ALA F O   
3569 C CB  . ALA F 12 ? 0.7797 0.3763 0.7303 -0.0582 0.0108  0.1205  12 ALA F CB  
3570 N N   . LYS F 13 ? 0.7822 0.3136 0.6696 -0.0058 0.0227  0.1704  13 LYS F N   
3571 C CA  . LYS F 13 ? 0.8456 0.3222 0.7137 0.0132  0.0187  0.1798  13 LYS F CA  
3572 C C   . LYS F 13 ? 0.9215 0.3335 0.8101 -0.0031 0.0059  0.1695  13 LYS F C   
3573 O O   . LYS F 13 ? 0.9572 0.3640 0.8807 -0.0351 0.0030  0.1665  13 LYS F O   
3574 C CB  . LYS F 13 ? 0.9099 0.3813 0.7654 0.0216  0.0364  0.2244  13 LYS F CB  
3575 C CG  . LYS F 13 ? 0.8801 0.4060 0.7050 0.0477  0.0443  0.2306  13 LYS F CG  
3576 C CD  . LYS F 13 ? 0.9146 0.4442 0.7257 0.0586  0.0631  0.2758  13 LYS F CD  
3577 C CE  . LYS F 13 ? 0.8666 0.4520 0.6443 0.0871  0.0668  0.2752  13 LYS F CE  
3578 N NZ  . LYS F 13 ? 0.8801 0.4761 0.6384 0.1049  0.0854  0.3189  13 LYS F NZ  
3579 N N   . ASN F 14 ? 0.9098 0.2732 0.7759 0.0209  -0.0035 0.1627  14 ASN F N   
3580 C CA  . ASN F 14 ? 1.0015 0.2898 0.8794 0.0122  -0.0172 0.1550  14 ASN F CA  
3581 C C   . ASN F 14 ? 1.0847 0.3210 0.9430 0.0302  -0.0099 0.1880  14 ASN F C   
3582 O O   . ASN F 14 ? 1.0896 0.3355 0.9122 0.0656  -0.0075 0.1901  14 ASN F O   
3583 C CB  . ASN F 14 ? 1.0526 0.3270 0.9160 0.0324  -0.0376 0.1109  14 ASN F CB  
3584 C CG  . ASN F 14 ? 1.2131 0.4013 1.0794 0.0319  -0.0551 0.0992  14 ASN F CG  
3585 O OD1 . ASN F 14 ? 1.2700 0.4134 1.1070 0.0626  -0.0601 0.0997  14 ASN F OD1 
3586 N ND2 . ASN F 14 ? 1.2622 0.4258 1.1642 -0.0023 -0.0661 0.0881  14 ASN F ND2 
3587 N N   . ASP F 15 ? 1.1692 0.3532 1.0533 0.0057  -0.0065 0.2157  15 ASP F N   
3588 C CA  . ASP F 15 ? 1.2798 0.4140 1.1482 0.0216  0.0038  0.2551  15 ASP F CA  
3589 C C   . ASP F 15 ? 1.2649 0.4582 1.1066 0.0445  0.0257  0.2864  15 ASP F C   
3590 O O   . ASP F 15 ? 1.3129 0.4896 1.1199 0.0788  0.0305  0.3022  15 ASP F O   
3591 C CB  . ASP F 15 ? 1.3948 0.4676 1.2303 0.0558  -0.0120 0.2343  15 ASP F CB  
3592 C CG  . ASP F 15 ? 1.5375 0.5301 1.3943 0.0384  -0.0345 0.2106  15 ASP F CG  
3593 O OD1 . ASP F 15 ? 1.5533 0.5583 1.4426 0.0073  -0.0460 0.1856  15 ASP F OD1 
3594 O OD2 . ASP F 15 ? 1.6398 0.5558 1.4789 0.0580  -0.0423 0.2155  15 ASP F OD2 
3595 N N   . ASN F 16 ? 1.2160 0.4792 1.0714 0.0288  0.0374  0.2929  16 ASN F N   
3596 C CA  . ASN F 16 ? 1.2032 0.5260 1.0317 0.0518  0.0552  0.3173  16 ASN F CA  
3597 C C   . ASN F 16 ? 1.1201 0.4710 0.9057 0.0918  0.0469  0.2922  16 ASN F C   
3598 O O   . ASN F 16 ? 1.1237 0.4997 0.8786 0.1207  0.0566  0.3130  16 ASN F O   
3599 C CB  . ASN F 16 ? 1.3410 0.6408 1.1666 0.0579  0.0754  0.3736  16 ASN F CB  
3600 C CG  . ASN F 16 ? 1.4044 0.7759 1.2172 0.0688  0.0964  0.4035  16 ASN F CG  
3601 O OD1 . ASN F 16 ? 1.3815 0.8137 1.1947 0.0644  0.0955  0.3826  16 ASN F OD1 
3602 N ND2 . ASN F 16 ? 1.4826 0.8470 1.2818 0.0863  0.1155  0.4529  16 ASN F ND2 
3603 N N   . SER F 17 ? 1.0342 0.3859 0.8198 0.0942  0.0285  0.2487  17 SER F N   
3604 C CA  . SER F 17 ? 0.9857 0.3720 0.7413 0.1271  0.0195  0.2254  17 SER F CA  
3605 C C   . SER F 17 ? 0.9089 0.3408 0.6793 0.1156  0.0089  0.1876  17 SER F C   
3606 O O   . SER F 17 ? 0.9253 0.3393 0.7195 0.0939  0.0010  0.1673  17 SER F O   
3607 C CB  . SER F 17 ? 1.0341 0.3695 0.7687 0.1544  0.0086  0.2172  17 SER F CB  
3608 O OG  . SER F 17 ? 0.9828 0.3586 0.7000 0.1803  -0.0025 0.1906  17 SER F OG  
3609 N N   . LEU F 18 ? 0.8458 0.3359 0.6029 0.1306  0.0076  0.1782  18 LEU F N   
3610 C CA  . LEU F 18 ? 0.7644 0.2971 0.5364 0.1219  -0.0017 0.1462  18 LEU F CA  
3611 C C   . LEU F 18 ? 0.8010 0.3237 0.5697 0.1390  -0.0163 0.1205  18 LEU F C   
3612 O O   . LEU F 18 ? 0.7370 0.2890 0.5209 0.1330  -0.0236 0.0958  18 LEU F O   
3613 C CB  . LEU F 18 ? 0.7151 0.3078 0.4780 0.1302  -0.0006 0.1448  18 LEU F CB  
3614 C CG  . LEU F 18 ? 0.7163 0.3307 0.4810 0.1166  0.0133  0.1648  18 LEU F CG  
3615 C CD1 . LEU F 18 ? 0.7532 0.4124 0.4948 0.1380  0.0114  0.1654  18 LEU F CD1 
3616 C CD2 . LEU F 18 ? 0.6792 0.3109 0.4733 0.0863  0.0156  0.1524  18 LEU F CD2 
3617 N N   . GLY F 19 ? 0.8583 0.3413 0.6066 0.1628  -0.0192 0.1286  19 GLY F N   
3618 C CA  . GLY F 19 ? 0.8831 0.3545 0.6248 0.1840  -0.0317 0.1071  19 GLY F CA  
3619 C C   . GLY F 19 ? 0.8639 0.3974 0.6031 0.2033  -0.0386 0.0942  19 GLY F C   
3620 O O   . GLY F 19 ? 0.8741 0.4266 0.6219 0.2108  -0.0468 0.0732  19 GLY F O   
3621 N N   . ILE F 20 ? 0.8613 0.4285 0.5901 0.2123  -0.0358 0.1079  20 ILE F N   
3622 C CA  . ILE F 20 ? 0.8884 0.5099 0.6168 0.2317  -0.0454 0.0992  20 ILE F CA  
3623 C C   . ILE F 20 ? 0.9225 0.5480 0.6242 0.2570  -0.0454 0.1178  20 ILE F C   
3624 O O   . ILE F 20 ? 0.9712 0.5761 0.6579 0.2543  -0.0356 0.1379  20 ILE F O   
3625 C CB  . ILE F 20 ? 0.8633 0.5389 0.6144 0.2120  -0.0481 0.0882  20 ILE F CB  
3626 C CG1 . ILE F 20 ? 0.8909 0.5687 0.6327 0.2007  -0.0402 0.1023  20 ILE F CG1 
3627 C CG2 . ILE F 20 ? 0.8536 0.5331 0.6301 0.1901  -0.0474 0.0710  20 ILE F CG2 
3628 C CD1 . ILE F 20 ? 0.8885 0.6079 0.6491 0.1817  -0.0427 0.0904  20 ILE F CD1 
3629 N N   . SER F 21 ? 0.8995 0.5566 0.5962 0.2832  -0.0559 0.1130  21 SER F N   
3630 C CA  . SER F 21 ? 0.9113 0.5881 0.5852 0.3084  -0.0597 0.1263  21 SER F CA  
3631 C C   . SER F 21 ? 0.8622 0.6073 0.5553 0.3065  -0.0742 0.1122  21 SER F C   
3632 O O   . SER F 21 ? 0.8416 0.6171 0.5653 0.2932  -0.0808 0.0962  21 SER F O   
3633 C CB  . SER F 21 ? 0.9706 0.6267 0.6218 0.3439  -0.0618 0.1348  21 SER F CB  
3634 O OG  . SER F 21 ? 0.9787 0.6689 0.6468 0.3550  -0.0721 0.1188  21 SER F OG  
3635 N N   . VAL F 22 ? 0.8582 0.6270 0.5342 0.3202  -0.0802 0.1187  22 VAL F N   
3636 C CA  . VAL F 22 ? 0.8000 0.6262 0.4953 0.3151  -0.0977 0.1032  22 VAL F CA  
3637 C C   . VAL F 22 ? 0.8027 0.6679 0.4890 0.3452  -0.1144 0.1035  22 VAL F C   
3638 O O   . VAL F 22 ? 0.8363 0.6846 0.4903 0.3742  -0.1100 0.1192  22 VAL F O   
3639 C CB  . VAL F 22 ? 0.7594 0.5874 0.4472 0.3000  -0.0958 0.1014  22 VAL F CB  
3640 C CG1 . VAL F 22 ? 0.7227 0.5294 0.4304 0.2674  -0.0833 0.0969  22 VAL F CG1 
3641 C CG2 . VAL F 22 ? 0.8255 0.6291 0.4711 0.3211  -0.0849 0.1231  22 VAL F CG2 
3642 N N   . THR F 23 ? 0.7595 0.6778 0.4777 0.3372  -0.1342 0.0872  23 THR F N   
3643 C CA  . THR F 23 ? 0.7522 0.7186 0.4727 0.3600  -0.1552 0.0838  23 THR F CA  
3644 C C   . THR F 23 ? 0.7532 0.7542 0.4884 0.3474  -0.1771 0.0659  23 THR F C   
3645 O O   . THR F 23 ? 0.7519 0.7529 0.5133 0.3177  -0.1787 0.0541  23 THR F O   
3646 C CB  . THR F 23 ? 0.8235 0.8284 0.5791 0.3649  -0.1625 0.0827  23 THR F CB  
3647 O OG1 . THR F 23 ? 0.8360 0.8898 0.5930 0.3896  -0.1824 0.0826  23 THR F OG1 
3648 C CG2 . THR F 23 ? 0.7402 0.7744 0.5479 0.3321  -0.1687 0.0706  23 THR F CG2 
3649 N N   . GLY F 24 ? 0.5818 1.2290 0.5991 0.2891  -0.1729 0.2693  24 GLY F N   
3650 C CA  . GLY F 24 ? 0.5471 1.2091 0.5503 0.2949  -0.1244 0.2695  24 GLY F CA  
3651 C C   . GLY F 24 ? 0.5296 1.2254 0.5370 0.2874  -0.1239 0.3058  24 GLY F C   
3652 O O   . GLY F 24 ? 0.5506 1.2612 0.5763 0.2726  -0.1610 0.3348  24 GLY F O   
3653 N N   . GLY F 25 ? 0.4964 1.2055 0.4866 0.2991  -0.0828 0.3048  25 GLY F N   
3654 C CA  . GLY F 25 ? 0.5076 1.2556 0.4953 0.3007  -0.0767 0.3330  25 GLY F CA  
3655 C C   . GLY F 25 ? 0.5180 1.2571 0.4954 0.3117  -0.0529 0.3017  25 GLY F C   
3656 O O   . GLY F 25 ? 0.5119 1.2169 0.4938 0.3107  -0.0498 0.2616  25 GLY F O   
3657 N N   . VAL F 26 ? 0.5300 1.3033 0.4947 0.3243  -0.0374 0.3188  26 VAL F N   
3658 C CA  . VAL F 26 ? 0.6365 1.3994 0.5889 0.3399  -0.0155 0.2868  26 VAL F CA  
3659 C C   . VAL F 26 ? 0.6838 1.4276 0.6523 0.3310  -0.0360 0.2561  26 VAL F C   
3660 O O   . VAL F 26 ? 0.7081 1.4228 0.6776 0.3357  -0.0222 0.2148  26 VAL F O   
3661 C CB  . VAL F 26 ? 0.6684 1.4784 0.6017 0.3609  -0.0032 0.3097  26 VAL F CB  
3662 C CG1 . VAL F 26 ? 0.6971 1.5144 0.6076 0.3796  0.0253  0.3206  26 VAL F CG1 
3663 C CG2 . VAL F 26 ? 0.6691 1.5324 0.6136 0.3512  -0.0294 0.3559  26 VAL F CG2 
3664 N N   . ASN F 27 ? 0.6946 1.4544 0.6775 0.3172  -0.0711 0.2776  27 ASN F N   
3665 C CA  . ASN F 27 ? 0.6888 1.4330 0.6843 0.3112  -0.0958 0.2524  27 ASN F CA  
3666 C C   . ASN F 27 ? 0.6642 1.3652 0.6745 0.3020  -0.1065 0.2125  27 ASN F C   
3667 O O   . ASN F 27 ? 0.6203 1.3049 0.6386 0.3036  -0.1135 0.1752  27 ASN F O   
3668 C CB  . ASN F 27 ? 0.7148 1.4853 0.7197 0.2986  -0.1330 0.2930  27 ASN F CB  
3669 C CG  . ASN F 27 ? 0.7255 1.4939 0.7457 0.2791  -0.1588 0.3265  27 ASN F CG  
3670 O OD1 . ASN F 27 ? 0.6753 1.4525 0.6915 0.2805  -0.1418 0.3424  27 ASN F OD1 
3671 N ND2 . ASN F 27 ? 0.7639 1.5178 0.8017 0.2620  -0.2036 0.3364  27 ASN F ND2 
3672 N N   . THR F 28 ? 0.6486 1.3366 0.6618 0.2956  -0.1080 0.2194  28 THR F N   
3673 C CA  . THR F 28 ? 0.6558 1.3127 0.6803 0.2915  -0.1211 0.1853  28 THR F CA  
3674 C C   . THR F 28 ? 0.6999 1.3412 0.7217 0.2993  -0.0834 0.1471  28 THR F C   
3675 O O   . THR F 28 ? 0.6928 1.3375 0.7022 0.3065  -0.0477 0.1513  28 THR F O   
3676 C CB  . THR F 28 ? 0.6399 1.2907 0.6659 0.2863  -0.1393 0.2056  28 THR F CB  
3677 O OG1 . THR F 28 ? 0.6596 1.3102 0.6710 0.2950  -0.1015 0.2076  28 THR F OG1 
3678 C CG2 . THR F 28 ? 0.6301 1.3024 0.6621 0.2748  -0.1687 0.2556  28 THR F CG2 
3679 N N   . SER F 29 ? 0.7817 1.4074 0.8162 0.2982  -0.0933 0.1113  29 SER F N   
3680 C CA  . SER F 29 ? 0.8629 1.4807 0.9016 0.3015  -0.0591 0.0787  29 SER F CA  
3681 C C   . SER F 29 ? 0.9139 1.5272 0.9426 0.3051  -0.0427 0.0868  29 SER F C   
3682 O O   . SER F 29 ? 0.9301 1.5424 0.9660 0.3078  -0.0347 0.0606  29 SER F O   
3683 C CB  . SER F 29 ? 0.9046 1.5207 0.9642 0.3009  -0.0750 0.0353  29 SER F CB  
3684 O OG  . SER F 29 ? 0.9203 1.5397 0.9865 0.3004  -0.0891 0.0261  29 SER F OG  
3685 N N   . VAL F 30 ? 0.9346 1.5510 0.9461 0.3073  -0.0375 0.1237  30 VAL F N   
3686 C CA  . VAL F 30 ? 0.9560 1.5685 0.9534 0.3140  -0.0239 0.1346  30 VAL F CA  
3687 C C   . VAL F 30 ? 1.0024 1.6101 0.9815 0.3191  0.0206  0.1491  30 VAL F C   
3688 O O   . VAL F 30 ? 0.9897 1.6029 0.9600 0.3208  0.0292  0.1691  30 VAL F O   
3689 C CB  . VAL F 30 ? 0.9240 1.5421 0.9167 0.3141  -0.0581 0.1651  30 VAL F CB  
3690 C CG1 . VAL F 30 ? 0.9316 1.5499 0.9037 0.3238  -0.0362 0.1855  30 VAL F CG1 
3691 C CG2 . VAL F 30 ? 0.9188 1.5292 0.9244 0.3141  -0.1037 0.1461  30 VAL F CG2 
3692 N N   . ARG F 31 ? 1.0746 1.6732 1.0466 0.3237  0.0476  0.1391  31 ARG F N   
3693 C CA  . ARG F 31 ? 1.1637 1.7511 1.1128 0.3308  0.0841  0.1582  31 ARG F CA  
3694 C C   . ARG F 31 ? 1.1978 1.7826 1.1329 0.3349  0.0961  0.1801  31 ARG F C   
3695 O O   . ARG F 31 ? 1.2100 1.8032 1.1265 0.3439  0.0940  0.2089  31 ARG F O   
3696 C CB  . ARG F 31 ? 1.2123 1.8036 1.1428 0.3421  0.0779  0.1757  31 ARG F CB  
3697 C CG  . ARG F 31 ? 1.2571 1.8493 1.1865 0.3480  0.0881  0.1568  31 ARG F CG  
3698 C CD  . ARG F 31 ? 1.3154 1.8937 1.2272 0.3515  0.1345  0.1656  31 ARG F CD  
3699 N NE  . ARG F 31 ? 1.3645 1.9379 1.2451 0.3669  0.1415  0.1934  31 ARG F NE  
3700 C CZ  . ARG F 31 ? 1.4055 1.9861 1.2687 0.3821  0.1423  0.1955  31 ARG F CZ  
3701 N NH1 . ARG F 31 ? 1.4169 2.0136 1.2902 0.3855  0.1374  0.1718  31 ARG F NH1 
3702 N NH2 . ARG F 31 ? 1.4250 2.0007 1.2593 0.3976  0.1472  0.2197  31 ARG F NH2 
3703 N N   . HIS F 32 ? 1.2047 1.7806 1.1483 0.3313  0.1074  0.1646  32 HIS F N   
3704 C CA  . HIS F 32 ? 1.2052 1.7787 1.1318 0.3419  0.1188  0.1789  32 HIS F CA  
3705 C C   . HIS F 32 ? 1.0901 1.6975 1.0125 0.3474  0.0934  0.2035  32 HIS F C   
3706 O O   . HIS F 32 ? 1.1081 1.7273 1.0115 0.3617  0.1016  0.2222  32 HIS F O   
3707 C CB  . HIS F 32 ? 1.3182 1.8716 1.2169 0.3537  0.1475  0.1968  32 HIS F CB  
3708 C CG  . HIS F 32 ? 1.4119 1.9368 1.3135 0.3464  0.1730  0.1839  32 HIS F CG  
3709 N ND1 . HIS F 32 ? 1.4520 1.9683 1.3329 0.3530  0.1893  0.2011  32 HIS F ND1 
3710 C CD2 . HIS F 32 ? 1.4482 1.9563 1.3727 0.3326  0.1854  0.1582  32 HIS F CD2 
3711 C CE1 . HIS F 32 ? 1.4834 1.9805 1.3726 0.3436  0.2124  0.1896  32 HIS F CE1 
3712 N NE2 . HIS F 32 ? 1.4816 1.9747 1.4000 0.3294  0.2105  0.1641  32 HIS F NE2 
3713 N N   . GLY F 33 ? 0.8918 1.2188 0.8614 0.2768  -0.3351 0.0391  33 GLY F N   
3714 C CA  . GLY F 33 ? 0.8381 1.1195 0.7531 0.2902  -0.3249 0.0480  33 GLY F CA  
3715 C C   . GLY F 33 ? 0.7648 0.9895 0.6661 0.2751  -0.3026 0.0535  33 GLY F C   
3716 O O   . GLY F 33 ? 0.7759 0.9603 0.6346 0.2826  -0.2916 0.0621  33 GLY F O   
3717 N N   . GLY F 34 ? 0.6506 0.8749 0.5887 0.2539  -0.2956 0.0491  34 GLY F N   
3718 C CA  . GLY F 34 ? 0.6172 0.7953 0.5474 0.2381  -0.2757 0.0524  34 GLY F CA  
3719 C C   . GLY F 34 ? 0.6291 0.7676 0.5304 0.2546  -0.2597 0.0691  34 GLY F C   
3720 O O   . GLY F 34 ? 0.6400 0.7876 0.5315 0.2791  -0.2634 0.0787  34 GLY F O   
3721 N N   . ILE F 35 ? 0.5926 0.6874 0.4810 0.2411  -0.2420 0.0720  35 ILE F N   
3722 C CA  . ILE F 35 ? 0.6145 0.6653 0.4761 0.2528  -0.2260 0.0855  35 ILE F CA  
3723 C C   . ILE F 35 ? 0.5951 0.6448 0.4853 0.2434  -0.2173 0.0837  35 ILE F C   
3724 O O   . ILE F 35 ? 0.5813 0.6330 0.4941 0.2200  -0.2121 0.0754  35 ILE F O   
3725 C CB  . ILE F 35 ? 0.6455 0.6475 0.4722 0.2438  -0.2111 0.0905  35 ILE F CB  
3726 C CG1 . ILE F 35 ? 0.6803 0.6866 0.4783 0.2521  -0.2188 0.0919  35 ILE F CG1 
3727 C CG2 . ILE F 35 ? 0.6560 0.6101 0.4555 0.2557  -0.1957 0.1041  35 ILE F CG2 
3728 C CD1 . ILE F 35 ? 0.6955 0.7115 0.4699 0.2835  -0.2277 0.1027  35 ILE F CD1 
3729 N N   . TYR F 36 ? 0.6056 0.6535 0.4934 0.2637  -0.2154 0.0916  36 TYR F N   
3730 C CA  . TYR F 36 ? 0.6100 0.6594 0.5218 0.2592  -0.2075 0.0898  36 TYR F CA  
3731 C C   . TYR F 36 ? 0.6481 0.6467 0.5294 0.2719  -0.1928 0.0978  36 TYR F C   
3732 O O   . TYR F 36 ? 0.6727 0.6447 0.5196 0.2931  -0.1916 0.1081  36 TYR F O   
3733 C CB  . TYR F 36 ? 0.6157 0.7191 0.5616 0.2712  -0.2196 0.0892  36 TYR F CB  
3734 C CG  . TYR F 36 ? 0.6105 0.7626 0.5913 0.2557  -0.2341 0.0801  36 TYR F CG  
3735 C CD1 . TYR F 36 ? 0.6555 0.8296 0.6285 0.2634  -0.2492 0.0784  36 TYR F CD1 
3736 C CD2 . TYR F 36 ? 0.5555 0.7307 0.5767 0.2335  -0.2326 0.0728  36 TYR F CD2 
3737 C CE1 . TYR F 36 ? 0.6614 0.8773 0.6669 0.2476  -0.2632 0.0674  36 TYR F CE1 
3738 C CE2 . TYR F 36 ? 0.5608 0.7752 0.6150 0.2181  -0.2452 0.0643  36 TYR F CE2 
3739 C CZ  . TYR F 36 ? 0.6239 0.8575 0.6705 0.2244  -0.2609 0.0605  36 TYR F CZ  
3740 O OH  . TYR F 36 ? 0.6459 0.9160 0.7257 0.2078  -0.2744 0.0495  36 TYR F OH  
3741 N N   . VAL F 37 ? 0.6293 0.6143 0.5234 0.2592  -0.1818 0.0928  37 VAL F N   
3742 C CA  . VAL F 37 ? 0.6439 0.5819 0.5139 0.2691  -0.1686 0.0966  37 VAL F CA  
3743 C C   . VAL F 37 ? 0.6788 0.6297 0.5477 0.3000  -0.1732 0.1025  37 VAL F C   
3744 O O   . VAL F 37 ? 0.6673 0.6642 0.5688 0.3044  -0.1794 0.0991  37 VAL F O   
3745 C CB  . VAL F 37 ? 0.6081 0.5387 0.4958 0.2482  -0.1580 0.0870  37 VAL F CB  
3746 C CG1 . VAL F 37 ? 0.6055 0.4953 0.4738 0.2608  -0.1471 0.0872  37 VAL F CG1 
3747 C CG2 . VAL F 37 ? 0.5937 0.5055 0.4765 0.2204  -0.1513 0.0826  37 VAL F CG2 
3748 N N   . LYS F 38 ? 0.7465 0.6573 0.5778 0.3224  -0.1692 0.1127  38 LYS F N   
3749 C CA  . LYS F 38 ? 0.7830 0.7025 0.6080 0.3560  -0.1728 0.1195  38 LYS F CA  
3750 C C   . LYS F 38 ? 0.7743 0.6644 0.5963 0.3622  -0.1614 0.1149  38 LYS F C   
3751 O O   . LYS F 38 ? 0.7947 0.7164 0.6335 0.3805  -0.1651 0.1139  38 LYS F O   
3752 C CB  . LYS F 38 ? 0.8856 0.7766 0.6706 0.3811  -0.1739 0.1338  38 LYS F CB  
3753 C CG  . LYS F 38 ? 0.9512 0.8505 0.7263 0.4198  -0.1773 0.1425  38 LYS F CG  
3754 C CD  . LYS F 38 ? 1.0423 0.9380 0.7867 0.4448  -0.1832 0.1572  38 LYS F CD  
3755 C CE  . LYS F 38 ? 1.1157 0.9454 0.8202 0.4373  -0.1711 0.1655  38 LYS F CE  
3756 N NZ  . LYS F 38 ? 1.1617 0.9927 0.8358 0.4613  -0.1768 0.1811  38 LYS F NZ  
3757 N N   . ALA F 39 ? 0.7674 0.6002 0.5691 0.3465  -0.1479 0.1112  39 ALA F N   
3758 C CA  . ALA F 39 ? 0.8152 0.6139 0.6107 0.3501  -0.1372 0.1036  39 ALA F CA  
3759 C C   . ALA F 39 ? 0.8516 0.6042 0.6380 0.3200  -0.1248 0.0954  39 ALA F C   
3760 O O   . ALA F 39 ? 0.8821 0.6092 0.6526 0.3046  -0.1213 0.1008  39 ALA F O   
3761 C CB  . ALA F 39 ? 0.9021 0.6595 0.6636 0.3851  -0.1335 0.1127  39 ALA F CB  
3762 N N   . VAL F 40 ? 0.8627 0.6090 0.6598 0.3119  -0.1184 0.0823  40 VAL F N   
3763 C CA  . VAL F 40 ? 0.9193 0.6198 0.7059 0.2858  -0.1066 0.0734  40 VAL F CA  
3764 C C   . VAL F 40 ? 0.9467 0.5835 0.7029 0.3012  -0.0974 0.0708  40 VAL F C   
3765 O O   . VAL F 40 ? 1.0053 0.6478 0.7644 0.3211  -0.0981 0.0636  40 VAL F O   
3766 C CB  . VAL F 40 ? 0.9586 0.6951 0.7774 0.2617  -0.1055 0.0585  40 VAL F CB  
3767 C CG1 . VAL F 40 ? 0.9369 0.7252 0.7830 0.2442  -0.1129 0.0614  40 VAL F CG1 
3768 C CG2 . VAL F 40 ? 0.9872 0.7533 0.8225 0.2799  -0.1078 0.0501  40 VAL F CG2 
3769 N N   . ILE F 41 ? 0.9246 0.5002 0.6516 0.2922  -0.0883 0.0770  41 ILE F N   
3770 C CA  . ILE F 41 ? 1.0114 0.5174 0.7062 0.3080  -0.0792 0.0775  41 ILE F CA  
3771 C C   . ILE F 41 ? 1.0294 0.5142 0.7298 0.2954  -0.0729 0.0563  41 ILE F C   
3772 O O   . ILE F 41 ? 0.9772 0.4702 0.6933 0.2632  -0.0695 0.0451  41 ILE F O   
3773 C CB  . ILE F 41 ? 1.0860 0.5321 0.7508 0.2979  -0.0696 0.0915  41 ILE F CB  
3774 C CG1 . ILE F 41 ? 1.1026 0.5820 0.7668 0.3006  -0.0764 0.1089  41 ILE F CG1 
3775 C CG2 . ILE F 41 ? 1.1481 0.5233 0.7775 0.3229  -0.0616 0.0982  41 ILE F CG2 
3776 C CD1 . ILE F 41 ? 1.1072 0.6220 0.7694 0.3372  -0.0878 0.1196  41 ILE F CD1 
3777 N N   . PRO F 42 ? 1.0978 0.5576 0.7850 0.3221  -0.0716 0.0496  42 PRO F N   
3778 C CA  . PRO F 42 ? 1.1167 0.5570 0.8068 0.3135  -0.0668 0.0267  42 PRO F CA  
3779 C C   . PRO F 42 ? 1.1390 0.5186 0.8161 0.2810  -0.0559 0.0193  42 PRO F C   
3780 O O   . PRO F 42 ? 1.1912 0.5125 0.8423 0.2802  -0.0486 0.0326  42 PRO F O   
3781 C CB  . PRO F 42 ? 1.1986 0.6061 0.8657 0.3528  -0.0660 0.0254  42 PRO F CB  
3782 C CG  . PRO F 42 ? 1.1986 0.6441 0.8660 0.3831  -0.0742 0.0456  42 PRO F CG  
3783 C CD  . PRO F 42 ? 1.1558 0.6085 0.8243 0.3636  -0.0752 0.0624  42 PRO F CD  
3784 N N   . GLN F 43 ? 1.1461 0.5430 0.8425 0.2547  -0.0546 -0.0009 43 GLN F N   
3785 C CA  . GLN F 43 ? 1.1950 0.5472 0.8861 0.2192  -0.0454 -0.0103 43 GLN F CA  
3786 C C   . GLN F 43 ? 1.0845 0.4457 0.7811 0.1920  -0.0424 0.0052  43 GLN F C   
3787 O O   . GLN F 43 ? 1.1120 0.4413 0.8060 0.1613  -0.0340 0.0009  43 GLN F O   
3788 C CB  . GLN F 43 ? 1.3679 0.6304 1.0257 0.2265  -0.0362 -0.0124 43 GLN F CB  
3789 C CG  . GLN F 43 ? 1.4858 0.7268 1.1348 0.2482  -0.0373 -0.0334 43 GLN F CG  
3790 C CD  . GLN F 43 ? 1.6498 0.7938 1.2649 0.2537  -0.0275 -0.0351 43 GLN F CD  
3791 O OE1 . GLN F 43 ? 1.6988 0.7932 1.2979 0.2414  -0.0191 -0.0179 43 GLN F OE1 
3792 N NE2 . GLN F 43 ? 1.7225 0.8381 1.3261 0.2730  -0.0279 -0.0556 43 GLN F NE2 
3793 N N   . GLY F 44 ? 0.9452 0.3513 0.6498 0.2031  -0.0493 0.0225  44 GLY F N   
3794 C CA  . GLY F 44 ? 0.8596 0.2726 0.5647 0.1831  -0.0469 0.0378  44 GLY F CA  
3795 C C   . GLY F 44 ? 0.8432 0.3090 0.5783 0.1528  -0.0486 0.0285  44 GLY F C   
3796 O O   . GLY F 44 ? 0.8337 0.3342 0.5903 0.1481  -0.0519 0.0112  44 GLY F O   
3797 N N   . ALA F 45 ? 0.7784 0.2505 0.5133 0.1343  -0.0457 0.0405  45 ALA F N   
3798 C CA  . ALA F 45 ? 0.7330 0.2511 0.4935 0.1063  -0.0460 0.0335  45 ALA F CA  
3799 C C   . ALA F 45 ? 0.7045 0.2927 0.4941 0.1155  -0.0572 0.0284  45 ALA F C   
3800 O O   . ALA F 45 ? 0.6634 0.2855 0.4759 0.1029  -0.0578 0.0139  45 ALA F O   
3801 C CB  . ALA F 45 ? 0.7092 0.2217 0.4606 0.0908  -0.0411 0.0495  45 ALA F CB  
3802 N N   . ALA F 46 ? 0.6955 0.3070 0.4850 0.1374  -0.0658 0.0409  46 ALA F N   
3803 C CA  . ALA F 46 ? 0.5791 0.2564 0.3988 0.1440  -0.0761 0.0379  46 ALA F CA  
3804 C C   . ALA F 46 ? 0.6119 0.3080 0.4461 0.1561  -0.0783 0.0246  46 ALA F C   
3805 O O   . ALA F 46 ? 0.6142 0.3595 0.4769 0.1486  -0.0812 0.0168  46 ALA F O   
3806 C CB  . ALA F 46 ? 0.5981 0.2952 0.4152 0.1651  -0.0857 0.0522  46 ALA F CB  
3807 N N   . GLU F 47 ? 0.6823 0.3395 0.4962 0.1762  -0.0764 0.0226  47 GLU F N   
3808 C CA  . GLU F 47 ? 0.7299 0.4047 0.5545 0.1906  -0.0782 0.0092  47 GLU F CA  
3809 C C   . GLU F 47 ? 0.6873 0.3701 0.5247 0.1677  -0.0730 -0.0095 47 GLU F C   
3810 O O   . GLU F 47 ? 0.6829 0.4156 0.5445 0.1705  -0.0762 -0.0177 47 GLU F O   
3811 C CB  . GLU F 47 ? 0.7945 0.4203 0.5914 0.2176  -0.0763 0.0086  47 GLU F CB  
3812 C CG  . GLU F 47 ? 0.8252 0.4746 0.6322 0.2360  -0.0786 -0.0053 47 GLU F CG  
3813 C CD  . GLU F 47 ? 0.9613 0.5578 0.7391 0.2630  -0.0758 -0.0089 47 GLU F CD  
3814 O OE1 . GLU F 47 ? 1.0312 0.5731 0.7908 0.2526  -0.0684 -0.0222 47 GLU F OE1 
3815 O OE2 . GLU F 47 ? 0.9792 0.5893 0.7529 0.2946  -0.0811 0.0011  47 GLU F OE2 
3816 N N   . SER F 48 ? 0.7055 0.3416 0.5274 0.1454  -0.0646 -0.0155 48 SER F N   
3817 C CA  . SER F 48 ? 0.6951 0.3382 0.5279 0.1222  -0.0601 -0.0345 48 SER F CA  
3818 C C   . SER F 48 ? 0.6242 0.3305 0.4873 0.1048  -0.0622 -0.0348 48 SER F C   
3819 O O   . SER F 48 ? 0.5977 0.3388 0.4784 0.0990  -0.0622 -0.0489 48 SER F O   
3820 C CB  . SER F 48 ? 0.7721 0.3560 0.5856 0.0978  -0.0508 -0.0383 48 SER F CB  
3821 O OG  . SER F 48 ? 0.8801 0.3999 0.6660 0.1125  -0.0474 -0.0407 48 SER F OG  
3822 N N   . ASP F 49 ? 0.5964 0.3160 0.4638 0.0978  -0.0636 -0.0192 49 ASP F N   
3823 C CA  . ASP F 49 ? 0.5498 0.3233 0.4438 0.0824  -0.0651 -0.0178 49 ASP F CA  
3824 C C   . ASP F 49 ? 0.5342 0.3641 0.4539 0.0998  -0.0722 -0.0176 49 ASP F C   
3825 O O   . ASP F 49 ? 0.5171 0.3900 0.4597 0.0909  -0.0714 -0.0243 49 ASP F O   
3826 C CB  . ASP F 49 ? 0.5386 0.3079 0.4274 0.0740  -0.0654 -0.0023 49 ASP F CB  
3827 C CG  . ASP F 49 ? 0.5288 0.3516 0.4441 0.0629  -0.0678 -0.0001 49 ASP F CG  
3828 O OD1 . ASP F 49 ? 0.4915 0.3457 0.4206 0.0764  -0.0757 0.0077  49 ASP F OD1 
3829 O OD2 . ASP F 49 ? 0.5438 0.3772 0.4666 0.0410  -0.0619 -0.0063 49 ASP F OD2 
3830 N N   . GLY F 50 ? 0.5637 0.3955 0.4803 0.1249  -0.0787 -0.0087 50 GLY F N   
3831 C CA  . GLY F 50 ? 0.5386 0.4209 0.4789 0.1433  -0.0845 -0.0078 50 GLY F CA  
3832 C C   . GLY F 50 ? 0.5313 0.4633 0.4993 0.1412  -0.0905 0.0036  50 GLY F C   
3833 O O   . GLY F 50 ? 0.5415 0.5187 0.5334 0.1536  -0.0944 0.0060  50 GLY F O   
3834 N N   . ARG F 51 ? 0.4782 0.4024 0.4434 0.1256  -0.0910 0.0104  51 ARG F N   
3835 C CA  . ARG F 51 ? 0.3948 0.3612 0.3855 0.1212  -0.0968 0.0185  51 ARG F CA  
3836 C C   . ARG F 51 ? 0.4220 0.3901 0.4100 0.1351  -0.1063 0.0296  51 ARG F C   
3837 O O   . ARG F 51 ? 0.4341 0.4393 0.4462 0.1340  -0.1129 0.0348  51 ARG F O   
3838 C CB  . ARG F 51 ? 0.3626 0.3288 0.3556 0.0964  -0.0921 0.0173  51 ARG F CB  
3839 C CG  . ARG F 51 ? 0.3287 0.3191 0.3380 0.0833  -0.0851 0.0080  51 ARG F CG  
3840 C CD  . ARG F 51 ? 0.3172 0.3076 0.3268 0.0607  -0.0800 0.0074  51 ARG F CD  
3841 N NE  . ARG F 51 ? 0.3665 0.3115 0.3480 0.0488  -0.0739 0.0040  51 ARG F NE  
3842 C CZ  . ARG F 51 ? 0.3609 0.3014 0.3380 0.0294  -0.0682 0.0038  51 ARG F CZ  
3843 N NH1 . ARG F 51 ? 0.3584 0.3350 0.3555 0.0217  -0.0680 0.0057  51 ARG F NH1 
3844 N NH2 . ARG F 51 ? 0.3804 0.2812 0.3343 0.0177  -0.0617 0.0023  51 ARG F NH2 
3845 N N   . ILE F 52 ? 0.4449 0.3725 0.4035 0.1476  -0.1070 0.0332  52 ILE F N   
3846 C CA  . ILE F 52 ? 0.4687 0.3984 0.4210 0.1618  -0.1162 0.0436  52 ILE F CA  
3847 C C   . ILE F 52 ? 0.5336 0.4637 0.4806 0.1897  -0.1202 0.0466  52 ILE F C   
3848 O O   . ILE F 52 ? 0.5893 0.4866 0.5173 0.1987  -0.1140 0.0419  52 ILE F O   
3849 C CB  . ILE F 52 ? 0.4841 0.3684 0.4037 0.1562  -0.1135 0.0489  52 ILE F CB  
3850 C CG1 . ILE F 52 ? 0.4826 0.3744 0.4092 0.1306  -0.1102 0.0467  52 ILE F CG1 
3851 C CG2 . ILE F 52 ? 0.5188 0.4044 0.4267 0.1760  -0.1233 0.0595  52 ILE F CG2 
3852 C CD1 . ILE F 52 ? 0.5652 0.4132 0.4601 0.1213  -0.1038 0.0516  52 ILE F CD1 
3853 N N   . HIS F 53 ? 0.5110 0.4789 0.4752 0.2036  -0.1307 0.0537  53 HIS F N   
3854 C CA  . HIS F 53 ? 0.5412 0.5177 0.5025 0.2323  -0.1350 0.0579  53 HIS F CA  
3855 C C   . HIS F 53 ? 0.5584 0.5503 0.5173 0.2475  -0.1465 0.0680  53 HIS F C   
3856 O O   . HIS F 53 ? 0.5338 0.5420 0.5018 0.2350  -0.1531 0.0702  53 HIS F O   
3857 C CB  . HIS F 53 ? 0.5034 0.5295 0.4987 0.2370  -0.1353 0.0550  53 HIS F CB  
3858 C CG  . HIS F 53 ? 0.5374 0.5548 0.5346 0.2252  -0.1250 0.0442  53 HIS F CG  
3859 N ND1 . HIS F 53 ? 0.5030 0.5392 0.5204 0.2008  -0.1214 0.0401  53 HIS F ND1 
3860 C CD2 . HIS F 53 ? 0.5750 0.5674 0.5554 0.2352  -0.1179 0.0357  53 HIS F CD2 
3861 C CE1 . HIS F 53 ? 0.5228 0.5504 0.5366 0.1964  -0.1129 0.0299  53 HIS F CE1 
3862 N NE2 . HIS F 53 ? 0.5467 0.5470 0.5382 0.2161  -0.1110 0.0260  53 HIS F NE2 
3863 N N   . LYS F 54 ? 0.5918 0.5787 0.5368 0.2760  -0.1491 0.0734  54 LYS F N   
3864 C CA  . LYS F 54 ? 0.5958 0.6085 0.5422 0.2939  -0.1611 0.0828  54 LYS F CA  
3865 C C   . LYS F 54 ? 0.5463 0.6213 0.5351 0.2810  -0.1714 0.0826  54 LYS F C   
3866 O O   . LYS F 54 ? 0.5084 0.6189 0.5298 0.2737  -0.1698 0.0794  54 LYS F O   
3867 C CB  . LYS F 54 ? 0.6590 0.6767 0.5971 0.3277  -0.1622 0.0878  54 LYS F CB  
3868 C CG  . LYS F 54 ? 0.6864 0.7429 0.6308 0.3483  -0.1756 0.0975  54 LYS F CG  
3869 C CD  . LYS F 54 ? 0.7799 0.8392 0.7129 0.3844  -0.1752 0.1030  54 LYS F CD  
3870 C CE  . LYS F 54 ? 0.8246 0.9405 0.7745 0.4039  -0.1893 0.1119  54 LYS F CE  
3871 N NZ  . LYS F 54 ? 0.8906 1.0169 0.8325 0.4408  -0.1886 0.1177  54 LYS F NZ  
3872 N N   . GLY F 55 ? 0.5583 0.6463 0.5467 0.2787  -0.1821 0.0861  55 GLY F N   
3873 C CA  . GLY F 55 ? 0.4882 0.6315 0.5168 0.2659  -0.1930 0.0845  55 GLY F CA  
3874 C C   . GLY F 55 ? 0.4613 0.5987 0.4992 0.2358  -0.1917 0.0776  55 GLY F C   
3875 O O   . GLY F 55 ? 0.4491 0.6196 0.5113 0.2247  -0.2022 0.0753  55 GLY F O   
3876 N N   . ASP F 56 ? 0.4580 0.5546 0.4778 0.2224  -0.1792 0.0735  56 ASP F N   
3877 C CA  . ASP F 56 ? 0.4585 0.5496 0.4840 0.1964  -0.1775 0.0677  56 ASP F CA  
3878 C C   . ASP F 56 ? 0.4778 0.5572 0.4813 0.1969  -0.1858 0.0687  56 ASP F C   
3879 O O   . ASP F 56 ? 0.5151 0.5702 0.4865 0.2147  -0.1867 0.0747  56 ASP F O   
3880 C CB  . ASP F 56 ? 0.4800 0.5321 0.4886 0.1827  -0.1625 0.0636  56 ASP F CB  
3881 C CG  . ASP F 56 ? 0.4382 0.5066 0.4693 0.1799  -0.1547 0.0603  56 ASP F CG  
3882 O OD1 . ASP F 56 ? 0.4329 0.4707 0.4479 0.1740  -0.1435 0.0560  56 ASP F OD1 
3883 O OD2 . ASP F 56 ? 0.4269 0.5403 0.4920 0.1836  -0.1597 0.0621  56 ASP F OD2 
3884 N N   . ARG F 57 ? 0.4723 0.5687 0.4919 0.1792  -0.1916 0.0628  57 ARG F N   
3885 C CA  . ARG F 57 ? 0.4699 0.5573 0.4669 0.1800  -0.1996 0.0618  57 ARG F CA  
3886 C C   . ARG F 57 ? 0.4776 0.5254 0.4484 0.1656  -0.1882 0.0601  57 ARG F C   
3887 O O   . ARG F 57 ? 0.4680 0.5140 0.4534 0.1471  -0.1798 0.0551  57 ARG F O   
3888 C CB  . ARG F 57 ? 0.5084 0.6372 0.5360 0.1708  -0.2144 0.0543  57 ARG F CB  
3889 C CG  . ARG F 57 ? 0.5192 0.6460 0.5230 0.1759  -0.2256 0.0513  57 ARG F CG  
3890 C CD  . ARG F 57 ? 0.5459 0.7125 0.5820 0.1651  -0.2413 0.0405  57 ARG F CD  
3891 N NE  . ARG F 57 ? 0.5983 0.7660 0.6109 0.1706  -0.2532 0.0349  57 ARG F NE  
3892 C CZ  . ARG F 57 ? 0.6495 0.8533 0.6829 0.1679  -0.2709 0.0246  57 ARG F CZ  
3893 N NH1 . ARG F 57 ? 0.5994 0.8395 0.6796 0.1581  -0.2779 0.0205  57 ARG F NH1 
3894 N NH2 . ARG F 57 ? 0.7098 0.9148 0.7175 0.1750  -0.2817 0.0183  57 ARG F NH2 
3895 N N   . VAL F 58 ? 0.4657 0.4845 0.3979 0.1749  -0.1873 0.0654  58 VAL F N   
3896 C CA  . VAL F 58 ? 0.4973 0.4818 0.4043 0.1618  -0.1761 0.0657  58 VAL F CA  
3897 C C   . VAL F 58 ? 0.5202 0.5213 0.4269 0.1543  -0.1851 0.0591  58 VAL F C   
3898 O O   . VAL F 58 ? 0.5759 0.5854 0.4667 0.1681  -0.1959 0.0608  58 VAL F O   
3899 C CB  . VAL F 58 ? 0.5791 0.5200 0.4428 0.1757  -0.1680 0.0774  58 VAL F CB  
3900 C CG1 . VAL F 58 ? 0.5883 0.4974 0.4300 0.1595  -0.1549 0.0789  58 VAL F CG1 
3901 C CG2 . VAL F 58 ? 0.5873 0.5088 0.4487 0.1869  -0.1609 0.0823  58 VAL F CG2 
3902 N N   . LEU F 59 ? 0.5020 0.5092 0.4258 0.1341  -0.1809 0.0510  59 LEU F N   
3903 C CA  . LEU F 59 ? 0.4860 0.5102 0.4136 0.1270  -0.1900 0.0418  59 LEU F CA  
3904 C C   . LEU F 59 ? 0.5281 0.5261 0.4190 0.1248  -0.1825 0.0443  59 LEU F C   
3905 O O   . LEU F 59 ? 0.5265 0.5332 0.4033 0.1299  -0.1919 0.0399  59 LEU F O   
3906 C CB  . LEU F 59 ? 0.4614 0.5065 0.4273 0.1086  -0.1896 0.0323  59 LEU F CB  
3907 C CG  . LEU F 59 ? 0.4583 0.5366 0.4644 0.1100  -0.1984 0.0305  59 LEU F CG  
3908 C CD1 . LEU F 59 ? 0.4096 0.5032 0.4514 0.0922  -0.1943 0.0247  59 LEU F CD1 
3909 C CD2 . LEU F 59 ? 0.4667 0.5709 0.4785 0.1198  -0.2174 0.0257  59 LEU F CD2 
3910 N N   . ALA F 60 ? 0.5173 0.4856 0.3931 0.1171  -0.1658 0.0511  60 ALA F N   
3911 C CA  . ALA F 60 ? 0.4990 0.4455 0.3441 0.1122  -0.1562 0.0551  60 ALA F CA  
3912 C C   . ALA F 60 ? 0.5013 0.4115 0.3275 0.1077  -0.1389 0.0661  60 ALA F C   
3913 O O   . ALA F 60 ? 0.4876 0.3917 0.3294 0.1036  -0.1336 0.0661  60 ALA F O   
3914 C CB  . ALA F 60 ? 0.4794 0.4401 0.3391 0.0959  -0.1543 0.0446  60 ALA F CB  
3915 N N   . VAL F 61 ? 0.5282 0.4154 0.3209 0.1089  -0.1304 0.0753  61 VAL F N   
3916 C CA  . VAL F 61 ? 0.5383 0.3884 0.3126 0.1013  -0.1131 0.0861  61 VAL F CA  
3917 C C   . VAL F 61 ? 0.5363 0.3818 0.2973 0.0866  -0.1015 0.0884  61 VAL F C   
3918 O O   . VAL F 61 ? 0.6167 0.4667 0.3557 0.0942  -0.1037 0.0923  61 VAL F O   
3919 C CB  . VAL F 61 ? 0.6220 0.4423 0.3646 0.1204  -0.1116 0.1012  61 VAL F CB  
3920 C CG1 . VAL F 61 ? 0.6505 0.4275 0.3750 0.1103  -0.0931 0.1125  61 VAL F CG1 
3921 C CG2 . VAL F 61 ? 0.6235 0.4517 0.3785 0.1373  -0.1229 0.0995  61 VAL F CG2 
3922 N N   . ASN F 62 ? 0.5367 0.3768 0.3109 0.0667  -0.0892 0.0856  62 ASN F N   
3923 C CA  . ASN F 62 ? 0.5556 0.3974 0.3214 0.0518  -0.0774 0.0876  62 ASN F CA  
3924 C C   . ASN F 62 ? 0.5558 0.4274 0.3224 0.0551  -0.0852 0.0799  62 ASN F C   
3925 O O   . ASN F 62 ? 0.5705 0.4415 0.3142 0.0558  -0.0795 0.0859  62 ASN F O   
3926 C CB  . ASN F 62 ? 0.5814 0.3894 0.3140 0.0516  -0.0641 0.1048  62 ASN F CB  
3927 C CG  . ASN F 62 ? 0.5782 0.3534 0.3130 0.0406  -0.0528 0.1096  62 ASN F CG  
3928 O OD1 . ASN F 62 ? 0.5825 0.3648 0.3430 0.0306  -0.0532 0.0987  62 ASN F OD1 
3929 N ND2 . ASN F 62 ? 0.6482 0.3862 0.3550 0.0433  -0.0425 0.1261  62 ASN F ND2 
3930 N N   . GLY F 63 ? 0.5102 0.4077 0.3033 0.0575  -0.0980 0.0666  63 GLY F N   
3931 C CA  . GLY F 63 ? 0.5143 0.4368 0.3121 0.0585  -0.1053 0.0563  63 GLY F CA  
3932 C C   . GLY F 63 ? 0.5090 0.4404 0.2924 0.0766  -0.1210 0.0532  63 GLY F C   
3933 O O   . GLY F 63 ? 0.5355 0.4870 0.3253 0.0781  -0.1298 0.0411  63 GLY F O   
3934 N N   . VAL F 64 ? 0.5380 0.4548 0.3016 0.0911  -0.1247 0.0632  64 VAL F N   
3935 C CA  . VAL F 64 ? 0.5438 0.4724 0.2902 0.1101  -0.1397 0.0610  64 VAL F CA  
3936 C C   . VAL F 64 ? 0.5765 0.5175 0.3420 0.1206  -0.1553 0.0565  64 VAL F C   
3937 O O   . VAL F 64 ? 0.5797 0.5053 0.3462 0.1251  -0.1518 0.0658  64 VAL F O   
3938 C CB  . VAL F 64 ? 0.5839 0.4918 0.2878 0.1230  -0.1320 0.0783  64 VAL F CB  
3939 C CG1 . VAL F 64 ? 0.6226 0.5482 0.3063 0.1450  -0.1484 0.0754  64 VAL F CG1 
3940 C CG2 . VAL F 64 ? 0.6013 0.5017 0.2890 0.1116  -0.1158 0.0839  64 VAL F CG2 
3941 N N   . SER F 65 ? 0.5776 0.5470 0.3577 0.1250  -0.1725 0.0419  65 SER F N   
3942 C CA  . SER F 65 ? 0.5677 0.5570 0.3704 0.1334  -0.1886 0.0366  65 SER F CA  
3943 C C   . SER F 65 ? 0.6157 0.5990 0.3926 0.1553  -0.1933 0.0488  65 SER F C   
3944 O O   . SER F 65 ? 0.6879 0.6616 0.4278 0.1678  -0.1912 0.0570  65 SER F O   
3945 C CB  . SER F 65 ? 0.6315 0.6517 0.4534 0.1319  -0.2065 0.0175  65 SER F CB  
3946 O OG  . SER F 65 ? 0.6315 0.6752 0.4737 0.1405  -0.2229 0.0133  65 SER F OG  
3947 N N   . LEU F 66 ? 0.6417 0.6323 0.4377 0.1618  -0.1990 0.0513  66 LEU F N   
3948 C CA  . LEU F 66 ? 0.6930 0.6833 0.4679 0.1856  -0.2056 0.0620  66 LEU F CA  
3949 C C   . LEU F 66 ? 0.7335 0.7644 0.5171 0.1972  -0.2282 0.0504  66 LEU F C   
3950 O O   . LEU F 66 ? 0.7481 0.7910 0.5232 0.2175  -0.2372 0.0567  66 LEU F O   
3951 C CB  . LEU F 66 ? 0.6950 0.6741 0.4835 0.1899  -0.2003 0.0706  66 LEU F CB  
3952 C CG  . LEU F 66 ? 0.6928 0.6283 0.4671 0.1827  -0.1795 0.0824  66 LEU F CG  
3953 C CD1 . LEU F 66 ? 0.7087 0.6361 0.4947 0.1914  -0.1774 0.0879  66 LEU F CD1 
3954 C CD2 . LEU F 66 ? 0.7619 0.6660 0.4911 0.1926  -0.1696 0.0975  66 LEU F CD2 
3955 N N   . GLU F 67 ? 0.7538 0.8061 0.5545 0.1846  -0.2374 0.0328  67 GLU F N   
3956 C CA  . GLU F 67 ? 0.7941 0.8863 0.6114 0.1901  -0.2600 0.0176  67 GLU F CA  
3957 C C   . GLU F 67 ? 0.8205 0.9227 0.5992 0.2135  -0.2698 0.0205  67 GLU F C   
3958 O O   . GLU F 67 ? 0.8308 0.9174 0.5743 0.2180  -0.2631 0.0238  67 GLU F O   
3959 C CB  . GLU F 67 ? 0.8566 0.9615 0.6983 0.1706  -0.2662 -0.0028 67 GLU F CB  
3960 C CG  . GLU F 67 ? 0.9185 1.0632 0.7888 0.1696  -0.2895 -0.0212 67 GLU F CG  
3961 C CD  . GLU F 67 ? 1.0178 1.1744 0.8665 0.1746  -0.3024 -0.0375 67 GLU F CD  
3962 O OE1 . GLU F 67 ? 1.0362 1.2228 0.9094 0.1698  -0.3219 -0.0567 67 GLU F OE1 
3963 O OE2 . GLU F 67 ? 1.0692 1.2061 0.8769 0.1831  -0.2931 -0.0315 67 GLU F OE2 
3964 N N   . GLY F 68 ? 0.8181 0.9498 0.6035 0.2295  -0.2854 0.0202  68 GLY F N   
3965 C CA  . GLY F 68 ? 0.8360 0.9842 0.5862 0.2547  -0.2965 0.0232  68 GLY F CA  
3966 C C   . GLY F 68 ? 0.8551 0.9729 0.5646 0.2762  -0.2819 0.0492  68 GLY F C   
3967 O O   . GLY F 68 ? 0.8695 0.9975 0.5449 0.3004  -0.2880 0.0566  68 GLY F O   
3968 N N   . ALA F 69 ? 0.8302 0.9103 0.5430 0.2680  -0.2626 0.0631  69 ALA F N   
3969 C CA  . ALA F 69 ? 0.8333 0.8765 0.5100 0.2857  -0.2470 0.0876  69 ALA F CA  
3970 C C   . ALA F 69 ? 0.8572 0.9156 0.5335 0.3107  -0.2555 0.0970  69 ALA F C   
3971 O O   . ALA F 69 ? 0.8129 0.8963 0.5261 0.3069  -0.2647 0.0888  69 ALA F O   
3972 C CB  . ALA F 69 ? 0.8466 0.8452 0.5292 0.2672  -0.2251 0.0961  69 ALA F CB  
3973 N N   . THR F 70 ? 0.8974 0.9425 0.5319 0.3376  -0.2518 0.1155  70 THR F N   
3974 C CA  . THR F 70 ? 0.9367 0.9867 0.5641 0.3650  -0.2553 0.1290  70 THR F CA  
3975 C C   . THR F 70 ? 0.9255 0.9257 0.5538 0.3611  -0.2355 0.1429  70 THR F C   
3976 O O   . THR F 70 ? 0.9405 0.9035 0.5694 0.3387  -0.2194 0.1435  70 THR F O   
3977 C CB  . THR F 70 ? 0.9926 1.0413 0.5713 0.3978  -0.2560 0.1469  70 THR F CB  
3978 O OG1 . THR F 70 ? 1.0094 1.0019 0.5520 0.3972  -0.2330 0.1667  70 THR F OG1 
3979 C CG2 . THR F 70 ? 1.0159 1.1127 0.5875 0.4027  -0.2752 0.1319  70 THR F CG2 
3980 N N   . HIS F 71 ? 0.9437 0.9444 0.5718 0.3835  -0.2370 0.1530  71 HIS F N   
3981 C CA  . HIS F 71 ? 0.9784 0.9297 0.6038 0.3837  -0.2191 0.1650  71 HIS F CA  
3982 C C   . HIS F 71 ? 0.9708 0.8595 0.5573 0.3815  -0.1973 0.1825  71 HIS F C   
3983 O O   . HIS F 71 ? 0.9351 0.7882 0.5297 0.3568  -0.1827 0.1802  71 HIS F O   
3984 C CB  . HIS F 71 ? 1.0959 1.0561 0.7177 0.4155  -0.2240 0.1754  71 HIS F CB  
3985 C CG  . HIS F 71 ? 1.2072 1.1242 0.8341 0.4148  -0.2090 0.1813  71 HIS F CG  
3986 N ND1 . HIS F 71 ? 1.2197 1.1623 0.8826 0.4138  -0.2149 0.1717  71 HIS F ND1 
3987 C CD2 . HIS F 71 ? 1.2763 1.1266 0.8771 0.4142  -0.1883 0.1948  71 HIS F CD2 
3988 C CE1 . HIS F 71 ? 1.2544 1.1484 0.9108 0.4149  -0.1992 0.1778  71 HIS F CE1 
3989 N NE2 . HIS F 71 ? 1.2897 1.1259 0.9094 0.4141  -0.1833 0.1910  71 HIS F NE2 
3990 N N   . LYS F 72 ? 0.9811 0.8586 0.5262 0.4071  -0.1950 0.2009  72 LYS F N   
3991 C CA  . LYS F 72 ? 1.0508 0.8699 0.5591 0.4054  -0.1734 0.2207  72 LYS F CA  
3992 C C   . LYS F 72 ? 1.0156 0.8248 0.5330 0.3705  -0.1647 0.2110  72 LYS F C   
3993 O O   . LYS F 72 ? 1.0315 0.7917 0.5436 0.3531  -0.1455 0.2184  72 LYS F O   
3994 C CB  . LYS F 72 ? 1.1155 0.9386 0.5798 0.4365  -0.1746 0.2403  72 LYS F CB  
3995 C CG  . LYS F 72 ? 1.1693 1.0355 0.6310 0.4708  -0.1927 0.2419  72 LYS F CG  
3996 C CD  . LYS F 72 ? 1.2468 1.1280 0.6658 0.5007  -0.1961 0.2586  72 LYS F CD  
3997 C CE  . LYS F 72 ? 1.2728 1.2066 0.6914 0.5350  -0.2163 0.2582  72 LYS F CE  
3998 N NZ  . LYS F 72 ? 1.3318 1.2785 0.7044 0.5691  -0.2183 0.2775  72 LYS F NZ  
3999 N N   . GLN F 73 ? 0.9937 0.8505 0.5256 0.3606  -0.1792 0.1936  73 GLN F N   
4000 C CA  . GLN F 73 ? 0.9765 0.8295 0.5139 0.3321  -0.1721 0.1846  73 GLN F CA  
4001 C C   . GLN F 73 ? 0.9256 0.7619 0.4978 0.3015  -0.1638 0.1726  73 GLN F C   
4002 O O   . GLN F 73 ? 0.9317 0.7411 0.5010 0.2799  -0.1485 0.1748  73 GLN F O   
4003 C CB  . GLN F 73 ? 0.9953 0.9027 0.5423 0.3301  -0.1913 0.1654  73 GLN F CB  
4004 C CG  . GLN F 73 ? 1.0857 1.0123 0.5941 0.3574  -0.1984 0.1751  73 GLN F CG  
4005 C CD  . GLN F 73 ? 1.0761 1.0565 0.5956 0.3548  -0.2193 0.1518  73 GLN F CD  
4006 O OE1 . GLN F 73 ? 1.0018 1.0102 0.5614 0.3383  -0.2325 0.1293  73 GLN F OE1 
4007 N NE2 . GLN F 73 ? 1.1532 1.1479 0.6368 0.3718  -0.2223 0.1571  73 GLN F NE2 
4008 N N   . ALA F 74 ? 0.8668 0.7238 0.4727 0.3005  -0.1741 0.1604  74 ALA F N   
4009 C CA  . ALA F 74 ? 0.8580 0.7052 0.4977 0.2751  -0.1675 0.1491  74 ALA F CA  
4010 C C   . ALA F 74 ? 0.8957 0.6857 0.5204 0.2731  -0.1478 0.1630  74 ALA F C   
4011 O O   . ALA F 74 ? 0.8578 0.6242 0.4918 0.2484  -0.1348 0.1594  74 ALA F O   
4012 C CB  . ALA F 74 ? 0.8121 0.6988 0.4895 0.2782  -0.1829 0.1355  74 ALA F CB  
4013 N N   . VAL F 75 ? 0.9375 0.7058 0.5391 0.2998  -0.1460 0.1784  75 VAL F N   
4014 C CA  . VAL F 75 ? 0.9865 0.6955 0.5722 0.3008  -0.1281 0.1911  75 VAL F CA  
4015 C C   . VAL F 75 ? 1.0184 0.6849 0.5793 0.2850  -0.1096 0.2035  75 VAL F C   
4016 O O   . VAL F 75 ? 0.9828 0.6076 0.5462 0.2669  -0.0945 0.2045  75 VAL F O   
4017 C CB  . VAL F 75 ? 1.0139 0.7056 0.5740 0.3368  -0.1293 0.2077  75 VAL F CB  
4018 C CG1 . VAL F 75 ? 1.0602 0.6802 0.5969 0.3377  -0.1088 0.2228  75 VAL F CG1 
4019 C CG2 . VAL F 75 ? 0.9992 0.7301 0.5866 0.3514  -0.1448 0.1965  75 VAL F CG2 
4020 N N   . GLU F 76 ? 1.0566 0.7357 0.5935 0.2923  -0.1108 0.2130  76 GLU F N   
4021 C CA  . GLU F 76 ? 1.1196 0.7651 0.6338 0.2778  -0.0927 0.2266  76 GLU F CA  
4022 C C   . GLU F 76 ? 1.0507 0.7129 0.5900 0.2436  -0.0895 0.2104  76 GLU F C   
4023 O O   . GLU F 76 ? 1.0521 0.6813 0.5872 0.2225  -0.0722 0.2166  76 GLU F O   
4024 C CB  . GLU F 76 ? 1.2537 0.9084 0.7307 0.3001  -0.0936 0.2442  76 GLU F CB  
4025 C CG  . GLU F 76 ? 1.3910 0.9897 0.8322 0.3028  -0.0712 0.2721  76 GLU F CG  
4026 C CD  . GLU F 76 ? 1.4971 1.0419 0.9281 0.3160  -0.0616 0.2855  76 GLU F CD  
4027 O OE1 . GLU F 76 ? 1.5081 1.0653 0.9393 0.3424  -0.0740 0.2839  76 GLU F OE1 
4028 O OE2 . GLU F 76 ? 1.5550 1.0448 0.9780 0.3001  -0.0418 0.2972  76 GLU F OE2 
4029 N N   . THR F 77 ? 0.9890 0.7023 0.5549 0.2382  -0.1060 0.1900  77 THR F N   
4030 C CA  . THR F 77 ? 0.9324 0.6634 0.5229 0.2088  -0.1036 0.1744  77 THR F CA  
4031 C C   . THR F 77 ? 0.9117 0.6146 0.5234 0.1866  -0.0917 0.1694  77 THR F C   
4032 O O   . THR F 77 ? 0.9174 0.6112 0.5350 0.1623  -0.0797 0.1674  77 THR F O   
4033 C CB  . THR F 77 ? 0.8253 0.6111 0.4448 0.2075  -0.1237 0.1528  77 THR F CB  
4034 O OG1 . THR F 77 ? 0.8605 0.6735 0.4596 0.2236  -0.1343 0.1539  77 THR F OG1 
4035 C CG2 . THR F 77 ? 0.7923 0.5915 0.4408 0.1781  -0.1198 0.1370  77 THR F CG2 
4036 N N   . LEU F 78 ? 0.9151 0.6068 0.5375 0.1963  -0.0953 0.1671  78 LEU F N   
4037 C CA  . LEU F 78 ? 0.8890 0.5558 0.5302 0.1790  -0.0860 0.1601  78 LEU F CA  
4038 C C   . LEU F 78 ? 0.9617 0.5698 0.5789 0.1714  -0.0664 0.1751  78 LEU F C   
4039 O O   . LEU F 78 ? 0.9608 0.5503 0.5915 0.1479  -0.0561 0.1682  78 LEU F O   
4040 C CB  . LEU F 78 ? 0.8658 0.5397 0.5228 0.1953  -0.0958 0.1533  78 LEU F CB  
4041 C CG  . LEU F 78 ? 0.7937 0.5230 0.4863 0.1956  -0.1127 0.1363  78 LEU F CG  
4042 C CD1 . LEU F 78 ? 0.8052 0.5418 0.5051 0.2189  -0.1216 0.1360  78 LEU F CD1 
4043 C CD2 . LEU F 78 ? 0.7074 0.4513 0.4318 0.1676  -0.1088 0.1208  78 LEU F CD2 
4044 N N   . ARG F 79 ? 1.0437 0.6233 0.6260 0.1913  -0.0613 0.1957  79 ARG F N   
4045 C CA  . ARG F 79 ? 1.1303 0.6487 0.6892 0.1856  -0.0420 0.2127  79 ARG F CA  
4046 C C   . ARG F 79 ? 1.0956 0.6070 0.6464 0.1620  -0.0278 0.2210  79 ARG F C   
4047 O O   . ARG F 79 ? 1.0990 0.5703 0.6487 0.1411  -0.0117 0.2257  79 ARG F O   
4048 C CB  . ARG F 79 ? 1.2767 0.7641 0.8004 0.2185  -0.0403 0.2347  79 ARG F CB  
4049 C CG  . ARG F 79 ? 1.3803 0.8610 0.9084 0.2421  -0.0494 0.2299  79 ARG F CG  
4050 C CD  . ARG F 79 ? 1.5425 0.9749 1.0337 0.2712  -0.0415 0.2539  79 ARG F CD  
4051 N NE  . ARG F 79 ? 1.6292 1.0435 1.1243 0.2905  -0.0458 0.2486  79 ARG F NE  
4052 C CZ  . ARG F 79 ? 1.7495 1.1186 1.2157 0.3185  -0.0395 0.2665  79 ARG F CZ  
4053 N NH1 . ARG F 79 ? 1.8151 1.1514 1.2462 0.3302  -0.0280 0.2926  79 ARG F NH1 
4054 N NH2 . ARG F 79 ? 1.7756 1.1327 1.2472 0.3366  -0.0439 0.2593  79 ARG F NH2 
4055 N N   . ASN F 80 ? 1.0994 0.6512 0.6447 0.1654  -0.0339 0.2222  80 ASN F N   
4056 C CA  . ASN F 80 ? 1.1569 0.7096 0.6922 0.1473  -0.0208 0.2315  80 ASN F CA  
4057 C C   . ASN F 80 ? 1.0780 0.6604 0.6457 0.1174  -0.0207 0.2116  80 ASN F C   
4058 O O   . ASN F 80 ? 1.0341 0.6592 0.6082 0.1144  -0.0273 0.2035  80 ASN F O   
4059 C CB  . ASN F 80 ? 1.2796 0.8599 0.7886 0.1686  -0.0265 0.2428  80 ASN F CB  
4060 C CG  . ASN F 80 ? 1.4368 0.9873 0.9101 0.1992  -0.0239 0.2665  80 ASN F CG  
4061 O OD1 . ASN F 80 ? 1.4840 1.0631 0.9430 0.2264  -0.0377 0.2682  80 ASN F OD1 
4062 N ND2 . ASN F 80 ? 1.5123 1.0048 0.9715 0.1950  -0.0062 0.2845  80 ASN F ND2 
4063 N N   . THR F 81 ? 1.0113 0.5702 0.5985 0.0967  -0.0133 0.2033  81 THR F N   
4064 C CA  . THR F 81 ? 0.8855 0.4704 0.5040 0.0692  -0.0122 0.1849  81 THR F CA  
4065 C C   . THR F 81 ? 0.8474 0.3924 0.4689 0.0437  0.0054  0.1888  81 THR F C   
4066 O O   . THR F 81 ? 0.9378 0.4330 0.5379 0.0476  0.0160  0.2051  81 THR F O   
4067 C CB  . THR F 81 ? 0.8626 0.4738 0.5110 0.0727  -0.0274 0.1632  81 THR F CB  
4068 O OG1 . THR F 81 ? 0.9153 0.4925 0.5589 0.0865  -0.0289 0.1648  81 THR F OG1 
4069 C CG2 . THR F 81 ? 0.8536 0.5114 0.5074 0.0904  -0.0450 0.1559  81 THR F CG2 
4070 N N   . GLY F 82 ? 0.8307 0.3973 0.4788 0.0176  0.0085  0.1739  82 GLY F N   
4071 C CA  . GLY F 82 ? 0.8272 0.3628 0.4827 -0.0094 0.0232  0.1736  82 GLY F CA  
4072 C C   . GLY F 82 ? 0.8376 0.3581 0.5117 -0.0127 0.0181  0.1558  82 GLY F C   
4073 O O   . GLY F 82 ? 0.8222 0.3474 0.4986 0.0091  0.0053  0.1488  82 GLY F O   
4074 N N   . GLN F 83 ? 0.8245 0.3314 0.5130 -0.0403 0.0279  0.1476  83 GLN F N   
4075 C CA  . GLN F 83 ? 0.8288 0.3176 0.5322 -0.0456 0.0250  0.1299  83 GLN F CA  
4076 C C   . GLN F 83 ? 0.7501 0.2880 0.4802 -0.0383 0.0100  0.1086  83 GLN F C   
4077 O O   . GLN F 83 ? 0.7976 0.3243 0.5323 -0.0257 0.0029  0.0981  83 GLN F O   
4078 C CB  . GLN F 83 ? 0.8661 0.3334 0.5791 -0.0796 0.0388  0.1252  83 GLN F CB  
4079 C CG  . GLN F 83 ? 0.9437 0.4049 0.6763 -0.0898 0.0351  0.1014  83 GLN F CG  
4080 C CD  . GLN F 83 ? 0.9783 0.3945 0.6967 -0.0668 0.0301  0.0992  83 GLN F CD  
4081 O OE1 . GLN F 83 ? 0.9874 0.3626 0.6795 -0.0492 0.0336  0.1177  83 GLN F OE1 
4082 N NE2 . GLN F 83 ? 0.9717 0.3984 0.7066 -0.0644 0.0219  0.0772  83 GLN F NE2 
4083 N N   . VAL F 84 ? 0.6689 0.2602 0.4155 -0.0443 0.0059  0.1036  84 VAL F N   
4084 C CA  . VAL F 84 ? 0.6392 0.2776 0.4110 -0.0367 -0.0072 0.0872  84 VAL F CA  
4085 C C   . VAL F 84 ? 0.6484 0.3183 0.4166 -0.0179 -0.0172 0.0934  84 VAL F C   
4086 O O   . VAL F 84 ? 0.7040 0.3845 0.4622 -0.0220 -0.0129 0.1029  84 VAL F O   
4087 C CB  . VAL F 84 ? 0.6507 0.3265 0.4490 -0.0607 -0.0036 0.0731  84 VAL F CB  
4088 C CG1 . VAL F 84 ? 0.6281 0.3528 0.4513 -0.0509 -0.0157 0.0603  84 VAL F CG1 
4089 C CG2 . VAL F 84 ? 0.6826 0.3327 0.4870 -0.0798 0.0039  0.0628  84 VAL F CG2 
4090 N N   . VAL F 85 ? 0.5828 0.2686 0.3595 0.0026  -0.0305 0.0877  85 VAL F N   
4091 C CA  . VAL F 85 ? 0.5905 0.3023 0.3639 0.0211  -0.0419 0.0921  85 VAL F CA  
4092 C C   . VAL F 85 ? 0.5603 0.3198 0.3646 0.0227  -0.0529 0.0782  85 VAL F C   
4093 O O   . VAL F 85 ? 0.5295 0.2973 0.3524 0.0254  -0.0570 0.0687  85 VAL F O   
4094 C CB  . VAL F 85 ? 0.6185 0.3054 0.3717 0.0473  -0.0486 0.1016  85 VAL F CB  
4095 C CG1 . VAL F 85 ? 0.6460 0.3607 0.3932 0.0648  -0.0606 0.1060  85 VAL F CG1 
4096 C CG2 . VAL F 85 ? 0.6548 0.2873 0.3776 0.0468  -0.0360 0.1169  85 VAL F CG2 
4097 N N   . HIS F 86 ? 0.5286 0.3189 0.3377 0.0219  -0.0572 0.0775  86 HIS F N   
4098 C CA  . HIS F 86 ? 0.5261 0.3584 0.3643 0.0229  -0.0668 0.0662  86 HIS F CA  
4099 C C   . HIS F 86 ? 0.5107 0.3528 0.3498 0.0446  -0.0816 0.0671  86 HIS F C   
4100 O O   . HIS F 86 ? 0.5417 0.3788 0.3605 0.0559  -0.0865 0.0741  86 HIS F O   
4101 C CB  . HIS F 86 ? 0.4938 0.3502 0.3353 0.0124  -0.0640 0.0643  86 HIS F CB  
4102 C CG  . HIS F 86 ? 0.4788 0.3739 0.3508 0.0107  -0.0708 0.0534  86 HIS F CG  
4103 N ND1 . HIS F 86 ? 0.5062 0.4239 0.3820 0.0081  -0.0724 0.0503  86 HIS F ND1 
4104 C CD2 . HIS F 86 ? 0.4619 0.3759 0.3615 0.0120  -0.0756 0.0459  86 HIS F CD2 
4105 C CE1 . HIS F 86 ? 0.4905 0.4363 0.3957 0.0072  -0.0776 0.0418  86 HIS F CE1 
4106 N NE2 . HIS F 86 ? 0.4629 0.4088 0.3835 0.0093  -0.0794 0.0399  86 HIS F NE2 
4107 N N   . LEU F 87 ? 0.5032 0.3620 0.3659 0.0508  -0.0888 0.0603  87 LEU F N   
4108 C CA  . LEU F 87 ? 0.4628 0.3378 0.3327 0.0699  -0.1031 0.0605  87 LEU F CA  
4109 C C   . LEU F 87 ? 0.4249 0.3421 0.3301 0.0672  -0.1118 0.0515  87 LEU F C   
4110 O O   . LEU F 87 ? 0.4133 0.3454 0.3415 0.0576  -0.1072 0.0457  87 LEU F O   
4111 C CB  . LEU F 87 ? 0.4757 0.3321 0.3412 0.0837  -0.1038 0.0634  87 LEU F CB  
4112 C CG  . LEU F 87 ? 0.5266 0.3357 0.3565 0.0901  -0.0959 0.0741  87 LEU F CG  
4113 C CD1 . LEU F 87 ? 0.5526 0.3400 0.3815 0.0996  -0.0934 0.0732  87 LEU F CD1 
4114 C CD2 . LEU F 87 ? 0.5742 0.3784 0.3800 0.1077  -0.1033 0.0845  87 LEU F CD2 
4115 N N   . LEU F 88 ? 0.4260 0.3628 0.3359 0.0760  -0.1245 0.0504  88 LEU F N   
4116 C CA  . LEU F 88 ? 0.4287 0.4023 0.3737 0.0735  -0.1334 0.0429  88 LEU F CA  
4117 C C   . LEU F 88 ? 0.4318 0.4204 0.3889 0.0896  -0.1452 0.0446  88 LEU F C   
4118 O O   . LEU F 88 ? 0.4368 0.4200 0.3753 0.1037  -0.1537 0.0485  88 LEU F O   
4119 C CB  . LEU F 88 ? 0.4272 0.4133 0.3713 0.0699  -0.1403 0.0378  88 LEU F CB  
4120 C CG  . LEU F 88 ? 0.3932 0.4111 0.3725 0.0644  -0.1487 0.0294  88 LEU F CG  
4121 C CD1 . LEU F 88 ? 0.3213 0.3484 0.3232 0.0512  -0.1379 0.0275  88 LEU F CD1 
4122 C CD2 . LEU F 88 ? 0.3827 0.4037 0.3516 0.0634  -0.1560 0.0227  88 LEU F CD2 
4123 N N   . LEU F 89 ? 0.4288 0.3162 0.3719 0.0697  -0.0965 0.0359  89 LEU F N   
4124 C CA  . LEU F 89 ? 0.3920 0.3238 0.3779 0.0759  -0.1136 0.0417  89 LEU F CA  
4125 C C   . LEU F 89 ? 0.3992 0.3799 0.4362 0.0627  -0.1131 0.0605  89 LEU F C   
4126 O O   . LEU F 89 ? 0.3599 0.3421 0.3961 0.0529  -0.0992 0.0717  89 LEU F O   
4127 C CB  . LEU F 89 ? 0.3984 0.3749 0.3969 0.0952  -0.1042 0.0339  89 LEU F CB  
4128 C CG  . LEU F 89 ? 0.4582 0.3809 0.3977 0.1063  -0.1083 0.0156  89 LEU F CG  
4129 C CD1 . LEU F 89 ? 0.4507 0.3756 0.3655 0.1039  -0.0799 0.0123  89 LEU F CD1 
4130 C CD2 . LEU F 89 ? 0.5056 0.4523 0.4604 0.1298  -0.1242 0.0058  89 LEU F CD2 
4131 N N   . GLU F 90 ? 0.3722 0.3907 0.4521 0.0618  -0.1307 0.0620  90 GLU F N   
4132 C CA  . GLU F 90 ? 0.3314 0.4136 0.4648 0.0450  -0.1249 0.0766  90 GLU F CA  
4133 C C   . GLU F 90 ? 0.3152 0.4782 0.4972 0.0590  -0.1126 0.0681  90 GLU F C   
4134 O O   . GLU F 90 ? 0.3104 0.4862 0.5098 0.0799  -0.1291 0.0513  90 GLU F O   
4135 C CB  . GLU F 90 ? 0.3487 0.4203 0.5023 0.0263  -0.1530 0.0824  90 GLU F CB  
4136 C CG  . GLU F 90 ? 0.3427 0.4898 0.5565 0.0029  -0.1464 0.0940  90 GLU F CG  
4137 C CD  . GLU F 90 ? 0.4078 0.5677 0.6600 -0.0120 -0.1781 0.0930  90 GLU F CD  
4138 O OE1 . GLU F 90 ? 0.4361 0.5387 0.6632 -0.0011 -0.2093 0.0843  90 GLU F OE1 
4139 O OE2 . GLU F 90 ? 0.4212 0.6464 0.7257 -0.0379 -0.1727 0.1004  90 GLU F OE2 
4140 N N   . LYS F 91 ? 0.2620 0.4725 0.4598 0.0486  -0.0848 0.0781  91 LYS F N   
4141 C CA  . LYS F 91 ? 0.2370 0.5237 0.4751 0.0585  -0.0651 0.0692  91 LYS F CA  
4142 C C   . LYS F 91 ? 0.2217 0.5758 0.5315 0.0524  -0.0761 0.0609  91 LYS F C   
4143 O O   . LYS F 91 ? 0.2018 0.5702 0.5357 0.0215  -0.0815 0.0732  91 LYS F O   
4144 C CB  . LYS F 91 ? 0.2258 0.5333 0.4511 0.0396  -0.0341 0.0845  91 LYS F CB  
4145 C CG  . LYS F 91 ? 0.2958 0.6793 0.5550 0.0418  -0.0065 0.0761  91 LYS F CG  
4146 C CD  . LYS F 91 ? 0.3429 0.7205 0.5778 0.0749  0.0023  0.0608  91 LYS F CD  
4147 C CE  . LYS F 91 ? 0.3847 0.8270 0.6382 0.0729  0.0361  0.0550  91 LYS F CE  
4148 N NZ  . LYS F 91 ? 0.3845 0.8327 0.6293 0.1099  0.0399  0.0335  91 LYS F NZ  
4149 N N   . GLY F 92 ? 0.2272 0.6229 0.5728 0.0823  -0.0820 0.0381  92 GLY F N   
4150 C CA  . GLY F 92 ? 0.2662 0.7362 0.6934 0.0833  -0.0965 0.0237  92 GLY F CA  
4151 C C   . GLY F 92 ? 0.3358 0.9114 0.8257 0.0783  -0.0601 0.0132  92 GLY F C   
4152 O O   . GLY F 92 ? 0.3166 0.9030 0.7820 0.0557  -0.0229 0.0269  92 GLY F O   
4153 N N   . GLN F 93 ? 0.4249 1.0745 0.9929 0.1011  -0.0727 -0.0136 93 GLN F N   
4154 C CA  . GLN F 93 ? 0.5209 1.2885 1.1685 0.0976  -0.0380 -0.0325 93 GLN F CA  
4155 C C   . GLN F 93 ? 0.5747 1.3841 1.2300 0.0401  0.0013  -0.0128 93 GLN F C   
4156 O O   . GLN F 93 ? 0.5999 1.4259 1.2281 0.0272  0.0450  -0.0086 93 GLN F O   
4157 C CB  . GLN F 93 ? 0.5661 1.3442 1.1939 0.1349  -0.0130 -0.0506 93 GLN F CB  
4158 C CG  . GLN F 93 ? 0.6134 1.5167 1.3323 0.1420  0.0191  -0.0803 93 GLN F CG  
4159 C CD  . GLN F 93 ? 0.6573 1.5623 1.3562 0.1882  0.0350  -0.1035 93 GLN F CD  
4160 O OE1 . GLN F 93 ? 0.6836 1.4999 1.2900 0.2004  0.0353  -0.0905 93 GLN F OE1 
4161 N NE2 . GLN F 93 ? 0.6635 1.6713 1.4508 0.2142  0.0482  -0.1403 93 GLN F NE2 
4162 N N   . SER F 94 ? 0.6040 1.4214 1.2877 0.0034  -0.0167 -0.0008 94 SER F N   
4163 C CA  . SER F 94 ? 0.6375 1.4720 1.3115 -0.0578 0.0128  0.0212  94 SER F CA  
4164 C C   . SER F 94 ? 0.6501 1.5751 1.3554 -0.0796 0.0690  0.0095  94 SER F C   
4165 O O   . SER F 94 ? 0.6457 1.6444 1.4061 -0.0460 0.0854  -0.0211 94 SER F O   
4166 C CB  . SER F 94 ? 0.6614 1.5222 1.3881 -0.0921 -0.0152 0.0250  94 SER F CB  
4167 O OG  . SER F 94 ? 0.6675 1.6400 1.5091 -0.0756 -0.0252 -0.0085 94 SER F OG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  1  1  PRO PRO A . n 
A 1 2  LYS 2  2  2  LYS LYS A . n 
A 1 3  PRO 3  3  3  PRO PRO A . n 
A 1 4  GLY 4  4  4  GLY GLY A . n 
A 1 5  ASP 5  5  5  ASP ASP A . n 
A 1 6  ILE 6  6  6  ILE ILE A . n 
A 1 7  PHE 7  7  7  PHE PHE A . n 
A 1 8  GLU 8  8  8  GLU GLU A . n 
A 1 9  VAL 9  9  9  VAL VAL A . n 
A 1 10 GLU 10 10 10 GLU GLU A . n 
A 1 11 LEU 11 11 11 LEU LEU A . n 
A 1 12 ALA 12 12 12 ALA ALA A . n 
A 1 13 LYS 13 13 13 LYS LYS A . n 
A 1 14 ASN 14 14 14 ASN ASN A . n 
A 1 15 ASP 15 15 15 ASP ASP A . n 
A 1 16 ASN 16 16 16 ASN ASN A . n 
A 1 17 SER 17 17 17 SER SER A . n 
A 1 18 LEU 18 18 18 LEU LEU A . n 
A 1 19 GLY 19 19 19 GLY GLY A . n 
A 1 20 ILE 20 20 20 ILE ILE A . n 
A 1 21 SER 21 21 21 SER SER A . n 
A 1 22 VAL 22 22 22 VAL VAL A . n 
A 1 23 THR 23 23 23 THR THR A . n 
A 1 24 GLY 24 24 24 GLY GLY A . n 
A 1 25 GLY 25 25 25 GLY GLY A . n 
A 1 26 VAL 26 26 26 VAL VAL A . n 
A 1 27 ASN 27 27 27 ASN ASN A . n 
A 1 28 THR 28 28 28 THR THR A . n 
A 1 29 SER 29 29 29 SER SER A . n 
A 1 30 VAL 30 30 30 VAL VAL A . n 
A 1 31 ARG 31 31 31 ARG ARG A . n 
A 1 32 HIS 32 32 32 HIS HIS A . n 
A 1 33 GLY 33 33 33 GLY GLY A . n 
A 1 34 GLY 34 34 34 GLY GLY A . n 
A 1 35 ILE 35 35 35 ILE ILE A . n 
A 1 36 TYR 36 36 36 TYR TYR A . n 
A 1 37 VAL 37 37 37 VAL VAL A . n 
A 1 38 LYS 38 38 38 LYS LYS A . n 
A 1 39 ALA 39 39 39 ALA ALA A . n 
A 1 40 VAL 40 40 40 VAL VAL A . n 
A 1 41 ILE 41 41 41 ILE ILE A . n 
A 1 42 PRO 42 42 42 PRO PRO A . n 
A 1 43 GLN 43 43 43 GLN GLN A . n 
A 1 44 GLY 44 44 44 GLY GLY A . n 
A 1 45 ALA 45 45 45 ALA ALA A . n 
A 1 46 ALA 46 46 46 ALA ALA A . n 
A 1 47 GLU 47 47 47 GLU GLU A . n 
A 1 48 SER 48 48 48 SER SER A . n 
A 1 49 ASP 49 49 49 ASP ASP A . n 
A 1 50 GLY 50 50 50 GLY GLY A . n 
A 1 51 ARG 51 51 51 ARG ARG A . n 
A 1 52 ILE 52 52 52 ILE ILE A . n 
A 1 53 HIS 53 53 53 HIS HIS A . n 
A 1 54 LYS 54 54 54 LYS LYS A . n 
A 1 55 GLY 55 55 55 GLY GLY A . n 
A 1 56 ASP 56 56 56 ASP ASP A . n 
A 1 57 ARG 57 57 57 ARG ARG A . n 
A 1 58 VAL 58 58 58 VAL VAL A . n 
A 1 59 LEU 59 59 59 LEU LEU A . n 
A 1 60 ALA 60 60 60 ALA ALA A . n 
A 1 61 VAL 61 61 61 VAL VAL A . n 
A 1 62 ASN 62 62 62 ASN ASN A . n 
A 1 63 GLY 63 63 63 GLY GLY A . n 
A 1 64 VAL 64 64 64 VAL VAL A . n 
A 1 65 SER 65 65 65 SER SER A . n 
A 1 66 LEU 66 66 66 LEU LEU A . n 
A 1 67 GLU 67 67 67 GLU GLU A . n 
A 1 68 GLY 68 68 68 GLY GLY A . n 
A 1 69 ALA 69 69 69 ALA ALA A . n 
A 1 70 THR 70 70 70 THR THR A . n 
A 1 71 HIS 71 71 71 HIS HIS A . n 
A 1 72 LYS 72 72 72 LYS LYS A . n 
A 1 73 GLN 73 73 73 GLN GLN A . n 
A 1 74 ALA 74 74 74 ALA ALA A . n 
A 1 75 VAL 75 75 75 VAL VAL A . n 
A 1 76 GLU 76 76 76 GLU GLU A . n 
A 1 77 THR 77 77 77 THR THR A . n 
A 1 78 LEU 78 78 78 LEU LEU A . n 
A 1 79 ARG 79 79 79 ARG ARG A . n 
A 1 80 ASN 80 80 80 ASN ASN A . n 
A 1 81 THR 81 81 81 THR THR A . n 
A 1 82 GLY 82 82 82 GLY GLY A . n 
A 1 83 GLN 83 83 83 GLN GLN A . n 
A 1 84 VAL 84 84 84 VAL VAL A . n 
A 1 85 VAL 85 85 85 VAL VAL A . n 
A 1 86 HIS 86 86 86 HIS HIS A . n 
A 1 87 LEU 87 87 87 LEU LEU A . n 
A 1 88 LEU 88 88 88 LEU LEU A . n 
A 1 89 LEU 89 89 89 LEU LEU A . n 
A 1 90 GLU 90 90 90 GLU GLU A . n 
A 1 91 LYS 91 91 91 LYS LYS A . n 
A 1 92 GLY 92 92 92 GLY GLY A . n 
A 1 93 GLN 93 93 93 GLN GLN A . n 
A 1 94 SER 94 94 94 SER SER A . n 
A 1 95 PRO 95 95 ?  ?   ?   A . n 
A 1 96 THR 96 96 ?  ?   ?   A . n 
B 1 1  PRO 1  1  1  PRO PRO B . n 
B 1 2  LYS 2  2  2  LYS LYS B . n 
B 1 3  PRO 3  3  3  PRO PRO B . n 
B 1 4  GLY 4  4  4  GLY GLY B . n 
B 1 5  ASP 5  5  5  ASP ASP B . n 
B 1 6  ILE 6  6  6  ILE ILE B . n 
B 1 7  PHE 7  7  7  PHE PHE B . n 
B 1 8  GLU 8  8  8  GLU GLU B . n 
B 1 9  VAL 9  9  9  VAL VAL B . n 
B 1 10 GLU 10 10 10 GLU GLU B . n 
B 1 11 LEU 11 11 11 LEU LEU B . n 
B 1 12 ALA 12 12 12 ALA ALA B . n 
B 1 13 LYS 13 13 13 LYS LYS B . n 
B 1 14 ASN 14 14 14 ASN ASN B . n 
B 1 15 ASP 15 15 15 ASP ASP B . n 
B 1 16 ASN 16 16 16 ASN ASN B . n 
B 1 17 SER 17 17 17 SER SER B . n 
B 1 18 LEU 18 18 18 LEU LEU B . n 
B 1 19 GLY 19 19 19 GLY GLY B . n 
B 1 20 ILE 20 20 20 ILE ILE B . n 
B 1 21 SER 21 21 21 SER SER B . n 
B 1 22 VAL 22 22 22 VAL VAL B . n 
B 1 23 THR 23 23 23 THR THR B . n 
B 1 24 GLY 24 24 24 GLY GLY B . n 
B 1 25 GLY 25 25 25 GLY GLY B . n 
B 1 26 VAL 26 26 26 VAL VAL B . n 
B 1 27 ASN 27 27 27 ASN ASN B . n 
B 1 28 THR 28 28 28 THR THR B . n 
B 1 29 SER 29 29 29 SER SER B . n 
B 1 30 VAL 30 30 30 VAL VAL B . n 
B 1 31 ARG 31 31 31 ARG ARG B . n 
B 1 32 HIS 32 32 32 HIS HIS B . n 
B 1 33 GLY 33 33 33 GLY GLY B . n 
B 1 34 GLY 34 34 34 GLY GLY B . n 
B 1 35 ILE 35 35 35 ILE ILE B . n 
B 1 36 TYR 36 36 36 TYR TYR B . n 
B 1 37 VAL 37 37 37 VAL VAL B . n 
B 1 38 LYS 38 38 38 LYS LYS B . n 
B 1 39 ALA 39 39 39 ALA ALA B . n 
B 1 40 VAL 40 40 40 VAL VAL B . n 
B 1 41 ILE 41 41 41 ILE ILE B . n 
B 1 42 PRO 42 42 42 PRO PRO B . n 
B 1 43 GLN 43 43 43 GLN GLN B . n 
B 1 44 GLY 44 44 44 GLY GLY B . n 
B 1 45 ALA 45 45 45 ALA ALA B . n 
B 1 46 ALA 46 46 46 ALA ALA B . n 
B 1 47 GLU 47 47 47 GLU GLU B . n 
B 1 48 SER 48 48 48 SER SER B . n 
B 1 49 ASP 49 49 49 ASP ASP B . n 
B 1 50 GLY 50 50 50 GLY GLY B . n 
B 1 51 ARG 51 51 51 ARG ARG B . n 
B 1 52 ILE 52 52 52 ILE ILE B . n 
B 1 53 HIS 53 53 53 HIS HIS B . n 
B 1 54 LYS 54 54 54 LYS LYS B . n 
B 1 55 GLY 55 55 55 GLY GLY B . n 
B 1 56 ASP 56 56 56 ASP ASP B . n 
B 1 57 ARG 57 57 57 ARG ARG B . n 
B 1 58 VAL 58 58 58 VAL VAL B . n 
B 1 59 LEU 59 59 59 LEU LEU B . n 
B 1 60 ALA 60 60 60 ALA ALA B . n 
B 1 61 VAL 61 61 61 VAL VAL B . n 
B 1 62 ASN 62 62 62 ASN ASN B . n 
B 1 63 GLY 63 63 63 GLY GLY B . n 
B 1 64 VAL 64 64 64 VAL VAL B . n 
B 1 65 SER 65 65 65 SER SER B . n 
B 1 66 LEU 66 66 66 LEU LEU B . n 
B 1 67 GLU 67 67 67 GLU GLU B . n 
B 1 68 GLY 68 68 68 GLY GLY B . n 
B 1 69 ALA 69 69 69 ALA ALA B . n 
B 1 70 THR 70 70 70 THR THR B . n 
B 1 71 HIS 71 71 71 HIS HIS B . n 
B 1 72 LYS 72 72 72 LYS LYS B . n 
B 1 73 GLN 73 73 73 GLN GLN B . n 
B 1 74 ALA 74 74 74 ALA ALA B . n 
B 1 75 VAL 75 75 75 VAL VAL B . n 
B 1 76 GLU 76 76 76 GLU GLU B . n 
B 1 77 THR 77 77 77 THR THR B . n 
B 1 78 LEU 78 78 78 LEU LEU B . n 
B 1 79 ARG 79 79 79 ARG ARG B . n 
B 1 80 ASN 80 80 80 ASN ASN B . n 
B 1 81 THR 81 81 81 THR THR B . n 
B 1 82 GLY 82 82 82 GLY GLY B . n 
B 1 83 GLN 83 83 83 GLN GLN B . n 
B 1 84 VAL 84 84 84 VAL VAL B . n 
B 1 85 VAL 85 85 85 VAL VAL B . n 
B 1 86 HIS 86 86 86 HIS HIS B . n 
B 1 87 LEU 87 87 87 LEU LEU B . n 
B 1 88 LEU 88 88 88 LEU LEU B . n 
B 1 89 LEU 89 89 89 LEU LEU B . n 
B 1 90 GLU 90 90 90 GLU GLU B . n 
B 1 91 LYS 91 91 91 LYS LYS B . n 
B 1 92 GLY 92 92 92 GLY GLY B . n 
B 1 93 GLN 93 93 93 GLN GLN B . n 
B 1 94 SER 94 94 94 SER SER B . n 
B 1 95 PRO 95 95 ?  ?   ?   B . n 
B 1 96 THR 96 96 ?  ?   ?   B . n 
C 1 1  PRO 1  1  1  PRO PRO C . n 
C 1 2  LYS 2  2  2  LYS LYS C . n 
C 1 3  PRO 3  3  3  PRO PRO C . n 
C 1 4  GLY 4  4  4  GLY GLY C . n 
C 1 5  ASP 5  5  5  ASP ASP C . n 
C 1 6  ILE 6  6  6  ILE ILE C . n 
C 1 7  PHE 7  7  7  PHE PHE C . n 
C 1 8  GLU 8  8  8  GLU GLU C . n 
C 1 9  VAL 9  9  9  VAL VAL C . n 
C 1 10 GLU 10 10 10 GLU GLU C . n 
C 1 11 LEU 11 11 11 LEU LEU C . n 
C 1 12 ALA 12 12 12 ALA ALA C . n 
C 1 13 LYS 13 13 13 LYS LYS C . n 
C 1 14 ASN 14 14 14 ASN ASN C . n 
C 1 15 ASP 15 15 15 ASP ASP C . n 
C 1 16 ASN 16 16 16 ASN ASN C . n 
C 1 17 SER 17 17 17 SER SER C . n 
C 1 18 LEU 18 18 18 LEU LEU C . n 
C 1 19 GLY 19 19 19 GLY GLY C . n 
C 1 20 ILE 20 20 20 ILE ILE C . n 
C 1 21 SER 21 21 21 SER SER C . n 
C 1 22 VAL 22 22 22 VAL VAL C . n 
C 1 23 THR 23 23 23 THR THR C . n 
C 1 24 GLY 24 24 24 GLY GLY C . n 
C 1 25 GLY 25 25 25 GLY GLY C . n 
C 1 26 VAL 26 26 26 VAL VAL C . n 
C 1 27 ASN 27 27 27 ASN ASN C . n 
C 1 28 THR 28 28 28 THR THR C . n 
C 1 29 SER 29 29 29 SER SER C . n 
C 1 30 VAL 30 30 30 VAL VAL C . n 
C 1 31 ARG 31 31 31 ARG ARG C . n 
C 1 32 HIS 32 32 32 HIS HIS C . n 
C 1 33 GLY 33 33 33 GLY GLY C . n 
C 1 34 GLY 34 34 34 GLY GLY C . n 
C 1 35 ILE 35 35 35 ILE ILE C . n 
C 1 36 TYR 36 36 36 TYR TYR C . n 
C 1 37 VAL 37 37 37 VAL VAL C . n 
C 1 38 LYS 38 38 38 LYS LYS C . n 
C 1 39 ALA 39 39 39 ALA ALA C . n 
C 1 40 VAL 40 40 40 VAL VAL C . n 
C 1 41 ILE 41 41 41 ILE ILE C . n 
C 1 42 PRO 42 42 42 PRO PRO C . n 
C 1 43 GLN 43 43 43 GLN GLN C . n 
C 1 44 GLY 44 44 44 GLY GLY C . n 
C 1 45 ALA 45 45 45 ALA ALA C . n 
C 1 46 ALA 46 46 46 ALA ALA C . n 
C 1 47 GLU 47 47 47 GLU GLU C . n 
C 1 48 SER 48 48 48 SER SER C . n 
C 1 49 ASP 49 49 49 ASP ASP C . n 
C 1 50 GLY 50 50 50 GLY GLY C . n 
C 1 51 ARG 51 51 51 ARG ARG C . n 
C 1 52 ILE 52 52 52 ILE ILE C . n 
C 1 53 HIS 53 53 53 HIS HIS C . n 
C 1 54 LYS 54 54 54 LYS LYS C . n 
C 1 55 GLY 55 55 55 GLY GLY C . n 
C 1 56 ASP 56 56 56 ASP ASP C . n 
C 1 57 ARG 57 57 57 ARG ARG C . n 
C 1 58 VAL 58 58 58 VAL VAL C . n 
C 1 59 LEU 59 59 59 LEU LEU C . n 
C 1 60 ALA 60 60 60 ALA ALA C . n 
C 1 61 VAL 61 61 61 VAL VAL C . n 
C 1 62 ASN 62 62 62 ASN ASN C . n 
C 1 63 GLY 63 63 63 GLY GLY C . n 
C 1 64 VAL 64 64 64 VAL VAL C . n 
C 1 65 SER 65 65 65 SER SER C . n 
C 1 66 LEU 66 66 66 LEU LEU C . n 
C 1 67 GLU 67 67 67 GLU GLU C . n 
C 1 68 GLY 68 68 68 GLY GLY C . n 
C 1 69 ALA 69 69 69 ALA ALA C . n 
C 1 70 THR 70 70 70 THR THR C . n 
C 1 71 HIS 71 71 71 HIS HIS C . n 
C 1 72 LYS 72 72 72 LYS LYS C . n 
C 1 73 GLN 73 73 73 GLN GLN C . n 
C 1 74 ALA 74 74 74 ALA ALA C . n 
C 1 75 VAL 75 75 75 VAL VAL C . n 
C 1 76 GLU 76 76 76 GLU GLU C . n 
C 1 77 THR 77 77 77 THR THR C . n 
C 1 78 LEU 78 78 78 LEU LEU C . n 
C 1 79 ARG 79 79 79 ARG ARG C . n 
C 1 80 ASN 80 80 80 ASN ASN C . n 
C 1 81 THR 81 81 81 THR THR C . n 
C 1 82 GLY 82 82 82 GLY GLY C . n 
C 1 83 GLN 83 83 83 GLN GLN C . n 
C 1 84 VAL 84 84 84 VAL VAL C . n 
C 1 85 VAL 85 85 85 VAL VAL C . n 
C 1 86 HIS 86 86 86 HIS HIS C . n 
C 1 87 LEU 87 87 87 LEU LEU C . n 
C 1 88 LEU 88 88 88 LEU LEU C . n 
C 1 89 LEU 89 89 89 LEU LEU C . n 
C 1 90 GLU 90 90 90 GLU GLU C . n 
C 1 91 LYS 91 91 91 LYS LYS C . n 
C 1 92 GLY 92 92 92 GLY GLY C . n 
C 1 93 GLN 93 93 93 GLN GLN C . n 
C 1 94 SER 94 94 94 SER SER C . n 
C 1 95 PRO 95 95 ?  ?   ?   C . n 
C 1 96 THR 96 96 ?  ?   ?   C . n 
D 1 1  PRO 1  1  1  PRO PRO D . n 
D 1 2  LYS 2  2  2  LYS LYS D . n 
D 1 3  PRO 3  3  3  PRO PRO D . n 
D 1 4  GLY 4  4  4  GLY GLY D . n 
D 1 5  ASP 5  5  5  ASP ASP D . n 
D 1 6  ILE 6  6  6  ILE ILE D . n 
D 1 7  PHE 7  7  7  PHE PHE D . n 
D 1 8  GLU 8  8  8  GLU GLU D . n 
D 1 9  VAL 9  9  9  VAL VAL D . n 
D 1 10 GLU 10 10 10 GLU GLU D . n 
D 1 11 LEU 11 11 11 LEU LEU D . n 
D 1 12 ALA 12 12 12 ALA ALA D . n 
D 1 13 LYS 13 13 13 LYS LYS D . n 
D 1 14 ASN 14 14 14 ASN ASN D . n 
D 1 15 ASP 15 15 15 ASP ASP D . n 
D 1 16 ASN 16 16 16 ASN ASN D . n 
D 1 17 SER 17 17 17 SER SER D . n 
D 1 18 LEU 18 18 18 LEU LEU D . n 
D 1 19 GLY 19 19 19 GLY GLY D . n 
D 1 20 ILE 20 20 20 ILE ILE D . n 
D 1 21 SER 21 21 21 SER SER D . n 
D 1 22 VAL 22 22 22 VAL VAL D . n 
D 1 23 THR 23 23 23 THR THR D . n 
D 1 24 GLY 24 24 24 GLY GLY D . n 
D 1 25 GLY 25 25 25 GLY GLY D . n 
D 1 26 VAL 26 26 26 VAL VAL D . n 
D 1 27 ASN 27 27 27 ASN ASN D . n 
D 1 28 THR 28 28 28 THR THR D . n 
D 1 29 SER 29 29 29 SER SER D . n 
D 1 30 VAL 30 30 30 VAL VAL D . n 
D 1 31 ARG 31 31 31 ARG ARG D . n 
D 1 32 HIS 32 32 32 HIS HIS D . n 
D 1 33 GLY 33 33 33 GLY GLY D . n 
D 1 34 GLY 34 34 34 GLY GLY D . n 
D 1 35 ILE 35 35 35 ILE ILE D . n 
D 1 36 TYR 36 36 36 TYR TYR D . n 
D 1 37 VAL 37 37 37 VAL VAL D . n 
D 1 38 LYS 38 38 38 LYS LYS D . n 
D 1 39 ALA 39 39 39 ALA ALA D . n 
D 1 40 VAL 40 40 40 VAL VAL D . n 
D 1 41 ILE 41 41 41 ILE ILE D . n 
D 1 42 PRO 42 42 42 PRO PRO D . n 
D 1 43 GLN 43 43 43 GLN GLN D . n 
D 1 44 GLY 44 44 44 GLY GLY D . n 
D 1 45 ALA 45 45 45 ALA ALA D . n 
D 1 46 ALA 46 46 46 ALA ALA D . n 
D 1 47 GLU 47 47 47 GLU GLU D . n 
D 1 48 SER 48 48 48 SER SER D . n 
D 1 49 ASP 49 49 49 ASP ASP D . n 
D 1 50 GLY 50 50 50 GLY GLY D . n 
D 1 51 ARG 51 51 51 ARG ARG D . n 
D 1 52 ILE 52 52 52 ILE ILE D . n 
D 1 53 HIS 53 53 53 HIS HIS D . n 
D 1 54 LYS 54 54 54 LYS LYS D . n 
D 1 55 GLY 55 55 55 GLY GLY D . n 
D 1 56 ASP 56 56 56 ASP ASP D . n 
D 1 57 ARG 57 57 57 ARG ARG D . n 
D 1 58 VAL 58 58 58 VAL VAL D . n 
D 1 59 LEU 59 59 59 LEU LEU D . n 
D 1 60 ALA 60 60 60 ALA ALA D . n 
D 1 61 VAL 61 61 61 VAL VAL D . n 
D 1 62 ASN 62 62 62 ASN ASN D . n 
D 1 63 GLY 63 63 63 GLY GLY D . n 
D 1 64 VAL 64 64 64 VAL VAL D . n 
D 1 65 SER 65 65 65 SER SER D . n 
D 1 66 LEU 66 66 66 LEU LEU D . n 
D 1 67 GLU 67 67 67 GLU GLU D . n 
D 1 68 GLY 68 68 68 GLY GLY D . n 
D 1 69 ALA 69 69 69 ALA ALA D . n 
D 1 70 THR 70 70 70 THR THR D . n 
D 1 71 HIS 71 71 71 HIS HIS D . n 
D 1 72 LYS 72 72 72 LYS LYS D . n 
D 1 73 GLN 73 73 73 GLN GLN D . n 
D 1 74 ALA 74 74 74 ALA ALA D . n 
D 1 75 VAL 75 75 75 VAL VAL D . n 
D 1 76 GLU 76 76 76 GLU GLU D . n 
D 1 77 THR 77 77 77 THR THR D . n 
D 1 78 LEU 78 78 78 LEU LEU D . n 
D 1 79 ARG 79 79 79 ARG ARG D . n 
D 1 80 ASN 80 80 80 ASN ASN D . n 
D 1 81 THR 81 81 81 THR THR D . n 
D 1 82 GLY 82 82 82 GLY GLY D . n 
D 1 83 GLN 83 83 83 GLN GLN D . n 
D 1 84 VAL 84 84 84 VAL VAL D . n 
D 1 85 VAL 85 85 85 VAL VAL D . n 
D 1 86 HIS 86 86 86 HIS HIS D . n 
D 1 87 LEU 87 87 87 LEU LEU D . n 
D 1 88 LEU 88 88 88 LEU LEU D . n 
D 1 89 LEU 89 89 89 LEU LEU D . n 
D 1 90 GLU 90 90 90 GLU GLU D . n 
D 1 91 LYS 91 91 91 LYS LYS D . n 
D 1 92 GLY 92 92 92 GLY GLY D . n 
D 1 93 GLN 93 93 93 GLN GLN D . n 
D 1 94 SER 94 94 94 SER SER D . n 
D 1 95 PRO 95 95 ?  ?   ?   D . n 
D 1 96 THR 96 96 ?  ?   ?   D . n 
E 1 1  PRO 1  1  1  PRO PRO E . n 
E 1 2  LYS 2  2  2  LYS LYS E . n 
E 1 3  PRO 3  3  3  PRO PRO E . n 
E 1 4  GLY 4  4  4  GLY GLY E . n 
E 1 5  ASP 5  5  5  ASP ASP E . n 
E 1 6  ILE 6  6  6  ILE ILE E . n 
E 1 7  PHE 7  7  7  PHE PHE E . n 
E 1 8  GLU 8  8  8  GLU GLU E . n 
E 1 9  VAL 9  9  9  VAL VAL E . n 
E 1 10 GLU 10 10 10 GLU GLU E . n 
E 1 11 LEU 11 11 11 LEU LEU E . n 
E 1 12 ALA 12 12 12 ALA ALA E . n 
E 1 13 LYS 13 13 13 LYS LYS E . n 
E 1 14 ASN 14 14 14 ASN ASN E . n 
E 1 15 ASP 15 15 15 ASP ASP E . n 
E 1 16 ASN 16 16 16 ASN ASN E . n 
E 1 17 SER 17 17 17 SER SER E . n 
E 1 18 LEU 18 18 18 LEU LEU E . n 
E 1 19 GLY 19 19 19 GLY GLY E . n 
E 1 20 ILE 20 20 20 ILE ILE E . n 
E 1 21 SER 21 21 21 SER SER E . n 
E 1 22 VAL 22 22 22 VAL VAL E . n 
E 1 23 THR 23 23 23 THR THR E . n 
E 1 24 GLY 24 24 24 GLY GLY E . n 
E 1 25 GLY 25 25 25 GLY GLY E . n 
E 1 26 VAL 26 26 26 VAL VAL E . n 
E 1 27 ASN 27 27 27 ASN ASN E . n 
E 1 28 THR 28 28 28 THR THR E . n 
E 1 29 SER 29 29 29 SER SER E . n 
E 1 30 VAL 30 30 30 VAL VAL E . n 
E 1 31 ARG 31 31 31 ARG ARG E . n 
E 1 32 HIS 32 32 32 HIS HIS E . n 
E 1 33 GLY 33 33 33 GLY GLY E . n 
E 1 34 GLY 34 34 34 GLY GLY E . n 
E 1 35 ILE 35 35 35 ILE ILE E . n 
E 1 36 TYR 36 36 36 TYR TYR E . n 
E 1 37 VAL 37 37 37 VAL VAL E . n 
E 1 38 LYS 38 38 38 LYS LYS E . n 
E 1 39 ALA 39 39 39 ALA ALA E . n 
E 1 40 VAL 40 40 40 VAL VAL E . n 
E 1 41 ILE 41 41 41 ILE ILE E . n 
E 1 42 PRO 42 42 42 PRO PRO E . n 
E 1 43 GLN 43 43 43 GLN GLN E . n 
E 1 44 GLY 44 44 44 GLY GLY E . n 
E 1 45 ALA 45 45 45 ALA ALA E . n 
E 1 46 ALA 46 46 46 ALA ALA E . n 
E 1 47 GLU 47 47 47 GLU GLU E . n 
E 1 48 SER 48 48 48 SER SER E . n 
E 1 49 ASP 49 49 49 ASP ASP E . n 
E 1 50 GLY 50 50 50 GLY GLY E . n 
E 1 51 ARG 51 51 51 ARG ARG E . n 
E 1 52 ILE 52 52 52 ILE ILE E . n 
E 1 53 HIS 53 53 53 HIS HIS E . n 
E 1 54 LYS 54 54 54 LYS LYS E . n 
E 1 55 GLY 55 55 55 GLY GLY E . n 
E 1 56 ASP 56 56 56 ASP ASP E . n 
E 1 57 ARG 57 57 57 ARG ARG E . n 
E 1 58 VAL 58 58 58 VAL VAL E . n 
E 1 59 LEU 59 59 59 LEU LEU E . n 
E 1 60 ALA 60 60 60 ALA ALA E . n 
E 1 61 VAL 61 61 61 VAL VAL E . n 
E 1 62 ASN 62 62 62 ASN ASN E . n 
E 1 63 GLY 63 63 63 GLY GLY E . n 
E 1 64 VAL 64 64 64 VAL VAL E . n 
E 1 65 SER 65 65 65 SER SER E . n 
E 1 66 LEU 66 66 66 LEU LEU E . n 
E 1 67 GLU 67 67 67 GLU GLU E . n 
E 1 68 GLY 68 68 68 GLY GLY E . n 
E 1 69 ALA 69 69 69 ALA ALA E . n 
E 1 70 THR 70 70 70 THR THR E . n 
E 1 71 HIS 71 71 71 HIS HIS E . n 
E 1 72 LYS 72 72 72 LYS LYS E . n 
E 1 73 GLN 73 73 73 GLN GLN E . n 
E 1 74 ALA 74 74 74 ALA ALA E . n 
E 1 75 VAL 75 75 75 VAL VAL E . n 
E 1 76 GLU 76 76 76 GLU GLU E . n 
E 1 77 THR 77 77 77 THR THR E . n 
E 1 78 LEU 78 78 78 LEU LEU E . n 
E 1 79 ARG 79 79 79 ARG ARG E . n 
E 1 80 ASN 80 80 80 ASN ASN E . n 
E 1 81 THR 81 81 81 THR THR E . n 
E 1 82 GLY 82 82 82 GLY GLY E . n 
E 1 83 GLN 83 83 83 GLN GLN E . n 
E 1 84 VAL 84 84 84 VAL VAL E . n 
E 1 85 VAL 85 85 85 VAL VAL E . n 
E 1 86 HIS 86 86 86 HIS HIS E . n 
E 1 87 LEU 87 87 87 LEU LEU E . n 
E 1 88 LEU 88 88 88 LEU LEU E . n 
E 1 89 LEU 89 89 89 LEU LEU E . n 
E 1 90 GLU 90 90 90 GLU GLU E . n 
E 1 91 LYS 91 91 91 LYS LYS E . n 
E 1 92 GLY 92 92 92 GLY GLY E . n 
E 1 93 GLN 93 93 93 GLN GLN E . n 
E 1 94 SER 94 94 94 SER SER E . n 
E 1 95 PRO 95 95 ?  ?   ?   E . n 
E 1 96 THR 96 96 ?  ?   ?   E . n 
F 1 1  PRO 1  1  1  PRO PRO F . n 
F 1 2  LYS 2  2  2  LYS LYS F . n 
F 1 3  PRO 3  3  3  PRO PRO F . n 
F 1 4  GLY 4  4  4  GLY GLY F . n 
F 1 5  ASP 5  5  5  ASP ASP F . n 
F 1 6  ILE 6  6  6  ILE ILE F . n 
F 1 7  PHE 7  7  7  PHE PHE F . n 
F 1 8  GLU 8  8  8  GLU GLU F . n 
F 1 9  VAL 9  9  9  VAL VAL F . n 
F 1 10 GLU 10 10 10 GLU GLU F . n 
F 1 11 LEU 11 11 11 LEU LEU F . n 
F 1 12 ALA 12 12 12 ALA ALA F . n 
F 1 13 LYS 13 13 13 LYS LYS F . n 
F 1 14 ASN 14 14 14 ASN ASN F . n 
F 1 15 ASP 15 15 15 ASP ASP F . n 
F 1 16 ASN 16 16 16 ASN ASN F . n 
F 1 17 SER 17 17 17 SER SER F . n 
F 1 18 LEU 18 18 18 LEU LEU F . n 
F 1 19 GLY 19 19 19 GLY GLY F . n 
F 1 20 ILE 20 20 20 ILE ILE F . n 
F 1 21 SER 21 21 21 SER SER F . n 
F 1 22 VAL 22 22 22 VAL VAL F . n 
F 1 23 THR 23 23 23 THR THR F . n 
F 1 24 GLY 24 24 24 GLY GLY F . n 
F 1 25 GLY 25 25 25 GLY GLY F . n 
F 1 26 VAL 26 26 26 VAL VAL F . n 
F 1 27 ASN 27 27 27 ASN ASN F . n 
F 1 28 THR 28 28 28 THR THR F . n 
F 1 29 SER 29 29 29 SER SER F . n 
F 1 30 VAL 30 30 30 VAL VAL F . n 
F 1 31 ARG 31 31 31 ARG ARG F . n 
F 1 32 HIS 32 32 32 HIS HIS F . n 
F 1 33 GLY 33 33 33 GLY GLY F . n 
F 1 34 GLY 34 34 34 GLY GLY F . n 
F 1 35 ILE 35 35 35 ILE ILE F . n 
F 1 36 TYR 36 36 36 TYR TYR F . n 
F 1 37 VAL 37 37 37 VAL VAL F . n 
F 1 38 LYS 38 38 38 LYS LYS F . n 
F 1 39 ALA 39 39 39 ALA ALA F . n 
F 1 40 VAL 40 40 40 VAL VAL F . n 
F 1 41 ILE 41 41 41 ILE ILE F . n 
F 1 42 PRO 42 42 42 PRO PRO F . n 
F 1 43 GLN 43 43 43 GLN GLN F . n 
F 1 44 GLY 44 44 44 GLY GLY F . n 
F 1 45 ALA 45 45 45 ALA ALA F . n 
F 1 46 ALA 46 46 46 ALA ALA F . n 
F 1 47 GLU 47 47 47 GLU GLU F . n 
F 1 48 SER 48 48 48 SER SER F . n 
F 1 49 ASP 49 49 49 ASP ASP F . n 
F 1 50 GLY 50 50 50 GLY GLY F . n 
F 1 51 ARG 51 51 51 ARG ARG F . n 
F 1 52 ILE 52 52 52 ILE ILE F . n 
F 1 53 HIS 53 53 53 HIS HIS F . n 
F 1 54 LYS 54 54 54 LYS LYS F . n 
F 1 55 GLY 55 55 55 GLY GLY F . n 
F 1 56 ASP 56 56 56 ASP ASP F . n 
F 1 57 ARG 57 57 57 ARG ARG F . n 
F 1 58 VAL 58 58 58 VAL VAL F . n 
F 1 59 LEU 59 59 59 LEU LEU F . n 
F 1 60 ALA 60 60 60 ALA ALA F . n 
F 1 61 VAL 61 61 61 VAL VAL F . n 
F 1 62 ASN 62 62 62 ASN ASN F . n 
F 1 63 GLY 63 63 63 GLY GLY F . n 
F 1 64 VAL 64 64 64 VAL VAL F . n 
F 1 65 SER 65 65 65 SER SER F . n 
F 1 66 LEU 66 66 66 LEU LEU F . n 
F 1 67 GLU 67 67 67 GLU GLU F . n 
F 1 68 GLY 68 68 68 GLY GLY F . n 
F 1 69 ALA 69 69 69 ALA ALA F . n 
F 1 70 THR 70 70 70 THR THR F . n 
F 1 71 HIS 71 71 71 HIS HIS F . n 
F 1 72 LYS 72 72 72 LYS LYS F . n 
F 1 73 GLN 73 73 73 GLN GLN F . n 
F 1 74 ALA 74 74 74 ALA ALA F . n 
F 1 75 VAL 75 75 75 VAL VAL F . n 
F 1 76 GLU 76 76 76 GLU GLU F . n 
F 1 77 THR 77 77 77 THR THR F . n 
F 1 78 LEU 78 78 78 LEU LEU F . n 
F 1 79 ARG 79 79 79 ARG ARG F . n 
F 1 80 ASN 80 80 80 ASN ASN F . n 
F 1 81 THR 81 81 81 THR THR F . n 
F 1 82 GLY 82 82 82 GLY GLY F . n 
F 1 83 GLN 83 83 83 GLN GLN F . n 
F 1 84 VAL 84 84 84 VAL VAL F . n 
F 1 85 VAL 85 85 85 VAL VAL F . n 
F 1 86 HIS 86 86 86 HIS HIS F . n 
F 1 87 LEU 87 87 87 LEU LEU F . n 
F 1 88 LEU 88 88 88 LEU LEU F . n 
F 1 89 LEU 89 89 89 LEU LEU F . n 
F 1 90 GLU 90 90 90 GLU GLU F . n 
F 1 91 LYS 91 91 91 LYS LYS F . n 
F 1 92 GLY 92 92 92 GLY GLY F . n 
F 1 93 GLN 93 93 93 GLN GLN F . n 
F 1 94 SER 94 94 94 SER SER F . n 
F 1 95 PRO 95 95 ?  ?   ?   F . n 
F 1 96 THR 96 96 ?  ?   ?   F . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Center for Eukaryotic Structural Genomics' 
_pdbx_SG_project.initial_of_center     CESG 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G  2 IOD 1  97  97  IOD IOD A . 
H  2 IOD 1  98  98  IOD IOD A . 
I  2 IOD 1  99  99  IOD IOD A . 
J  2 IOD 1  100 100 IOD IOD A . 
K  2 IOD 1  101 101 IOD IOD A . 
L  2 IOD 1  102 102 IOD IOD A . 
M  3 SCN 1  103 103 SCN SCN A . 
N  2 IOD 1  97  97  IOD IOD B . 
O  2 IOD 1  98  98  IOD IOD B . 
P  2 IOD 1  99  99  IOD IOD B . 
Q  2 IOD 1  100 100 IOD IOD B . 
R  3 SCN 1  101 101 SCN SCN B . 
S  3 SCN 1  102 102 SCN SCN B . 
T  3 SCN 1  103 103 SCN SCN B . 
U  2 IOD 1  97  97  IOD IOD C . 
V  2 IOD 1  98  98  IOD IOD C . 
W  2 IOD 1  99  99  IOD IOD C . 
X  2 IOD 1  100 100 IOD IOD C . 
Y  3 SCN 1  101 101 SCN SCN C . 
Z  3 SCN 1  102 102 SCN SCN C . 
AA 2 IOD 1  97  97  IOD IOD D . 
BA 2 IOD 1  98  98  IOD IOD D . 
CA 2 IOD 1  99  99  IOD IOD D . 
DA 2 IOD 1  100 100 IOD IOD D . 
EA 2 IOD 1  101 101 IOD IOD D . 
FA 3 SCN 1  102 102 SCN SCN D . 
GA 2 IOD 1  97  97  IOD IOD E . 
HA 2 IOD 1  98  98  IOD IOD E . 
IA 2 IOD 1  99  99  IOD IOD E . 
JA 2 IOD 1  100 100 IOD IOD E . 
KA 3 SCN 1  101 101 SCN SCN E . 
LA 3 SCN 1  102 102 SCN SCN E . 
MA 3 SCN 1  103 103 SCN SCN E . 
NA 3 SCN 1  104 104 SCN SCN E . 
OA 2 IOD 1  97  97  IOD IOD F . 
PA 2 IOD 1  98  98  IOD IOD F . 
QA 3 SCN 1  99  99  SCN SCN F . 
RA 3 SCN 1  100 100 SCN SCN F . 
SA 3 SCN 1  101 101 SCN SCN F . 
TA 4 HOH 1  104 104 HOH HOH A . 
TA 4 HOH 2  105 105 HOH HOH A . 
TA 4 HOH 3  106 106 HOH HOH A . 
TA 4 HOH 4  107 107 HOH HOH A . 
TA 4 HOH 5  108 108 HOH HOH A . 
TA 4 HOH 6  109 109 HOH HOH A . 
TA 4 HOH 7  110 110 HOH HOH A . 
TA 4 HOH 8  111 111 HOH HOH A . 
TA 4 HOH 9  112 112 HOH HOH A . 
TA 4 HOH 10 113 113 HOH HOH A . 
TA 4 HOH 11 114 114 HOH HOH A . 
TA 4 HOH 12 115 115 HOH HOH A . 
TA 4 HOH 13 116 116 HOH HOH A . 
TA 4 HOH 14 117 117 HOH HOH A . 
TA 4 HOH 15 118 118 HOH HOH A . 
TA 4 HOH 16 119 119 HOH HOH A . 
TA 4 HOH 17 120 120 HOH HOH A . 
TA 4 HOH 18 121 121 HOH HOH A . 
TA 4 HOH 19 122 122 HOH HOH A . 
TA 4 HOH 20 123 123 HOH HOH A . 
TA 4 HOH 21 124 124 HOH HOH A . 
TA 4 HOH 22 125 125 HOH HOH A . 
TA 4 HOH 23 136 136 HOH HOH A . 
TA 4 HOH 24 162 162 HOH HOH A . 
TA 4 HOH 25 165 165 HOH HOH A . 
TA 4 HOH 26 166 166 HOH HOH A . 
TA 4 HOH 27 168 168 HOH HOH A . 
TA 4 HOH 28 171 171 HOH HOH A . 
TA 4 HOH 29 180 180 HOH HOH A . 
TA 4 HOH 30 183 183 HOH HOH A . 
TA 4 HOH 31 193 193 HOH HOH A . 
TA 4 HOH 32 207 207 HOH HOH A . 
TA 4 HOH 33 219 219 HOH HOH A . 
TA 4 HOH 34 223 223 HOH HOH A . 
TA 4 HOH 35 226 226 HOH HOH A . 
TA 4 HOH 36 228 228 HOH HOH A . 
TA 4 HOH 37 233 233 HOH HOH A . 
TA 4 HOH 38 243 243 HOH HOH A . 
TA 4 HOH 39 250 250 HOH HOH A . 
TA 4 HOH 40 251 251 HOH HOH A . 
TA 4 HOH 41 252 252 HOH HOH A . 
TA 4 HOH 42 254 254 HOH HOH A . 
TA 4 HOH 43 255 255 HOH HOH A . 
TA 4 HOH 44 257 257 HOH HOH A . 
TA 4 HOH 45 258 258 HOH HOH A . 
TA 4 HOH 46 272 272 HOH HOH A . 
TA 4 HOH 47 273 273 HOH HOH A . 
TA 4 HOH 48 279 279 HOH HOH A . 
TA 4 HOH 49 281 281 HOH HOH A . 
TA 4 HOH 50 290 290 HOH HOH A . 
TA 4 HOH 51 300 300 HOH HOH A . 
TA 4 HOH 52 304 304 HOH HOH A . 
TA 4 HOH 53 307 307 HOH HOH A . 
TA 4 HOH 54 312 312 HOH HOH A . 
TA 4 HOH 55 316 316 HOH HOH A . 
TA 4 HOH 56 317 317 HOH HOH A . 
TA 4 HOH 57 323 323 HOH HOH A . 
TA 4 HOH 58 327 327 HOH HOH A . 
TA 4 HOH 59 332 332 HOH HOH A . 
TA 4 HOH 60 343 343 HOH HOH A . 
TA 4 HOH 61 353 353 HOH HOH A . 
TA 4 HOH 62 367 367 HOH HOH A . 
TA 4 HOH 63 369 369 HOH HOH A . 
TA 4 HOH 64 382 382 HOH HOH A . 
TA 4 HOH 65 383 383 HOH HOH A . 
TA 4 HOH 66 390 390 HOH HOH A . 
TA 4 HOH 67 391 391 HOH HOH A . 
TA 4 HOH 68 398 398 HOH HOH A . 
TA 4 HOH 69 425 425 HOH HOH A . 
TA 4 HOH 70 456 456 HOH HOH A . 
TA 4 HOH 71 458 458 HOH HOH A . 
TA 4 HOH 72 465 465 HOH HOH A . 
TA 4 HOH 73 474 474 HOH HOH A . 
TA 4 HOH 74 483 483 HOH HOH A . 
TA 4 HOH 75 484 484 HOH HOH A . 
TA 4 HOH 76 485 485 HOH HOH A . 
TA 4 HOH 77 488 488 HOH HOH A . 
TA 4 HOH 78 496 496 HOH HOH A . 
TA 4 HOH 79 500 500 HOH HOH A . 
TA 4 HOH 80 501 501 HOH HOH A . 
TA 4 HOH 81 502 502 HOH HOH A . 
TA 4 HOH 82 513 513 HOH HOH A . 
TA 4 HOH 83 514 514 HOH HOH A . 
TA 4 HOH 84 515 515 HOH HOH A . 
TA 4 HOH 85 517 517 HOH HOH A . 
TA 4 HOH 86 518 518 HOH HOH A . 
TA 4 HOH 87 519 519 HOH HOH A . 
TA 4 HOH 88 520 520 HOH HOH A . 
TA 4 HOH 89 521 521 HOH HOH A . 
TA 4 HOH 90 531 531 HOH HOH A . 
TA 4 HOH 91 539 539 HOH HOH A . 
TA 4 HOH 92 544 544 HOH HOH A . 
TA 4 HOH 93 545 545 HOH HOH A . 
TA 4 HOH 94 546 546 HOH HOH A . 
TA 4 HOH 95 549 549 HOH HOH A . 
TA 4 HOH 96 556 556 HOH HOH A . 
TA 4 HOH 97 558 558 HOH HOH A . 
TA 4 HOH 98 564 564 HOH HOH A . 
TA 4 HOH 99 574 574 HOH HOH A . 
UA 4 HOH 1  104 104 HOH HOH B . 
UA 4 HOH 2  105 105 HOH HOH B . 
UA 4 HOH 3  106 106 HOH HOH B . 
UA 4 HOH 4  107 107 HOH HOH B . 
UA 4 HOH 5  108 108 HOH HOH B . 
UA 4 HOH 6  109 109 HOH HOH B . 
UA 4 HOH 7  110 110 HOH HOH B . 
UA 4 HOH 8  111 111 HOH HOH B . 
UA 4 HOH 9  112 112 HOH HOH B . 
UA 4 HOH 10 113 113 HOH HOH B . 
UA 4 HOH 11 114 114 HOH HOH B . 
UA 4 HOH 12 115 115 HOH HOH B . 
UA 4 HOH 13 116 116 HOH HOH B . 
UA 4 HOH 14 117 117 HOH HOH B . 
UA 4 HOH 15 118 118 HOH HOH B . 
UA 4 HOH 16 119 119 HOH HOH B . 
UA 4 HOH 17 120 120 HOH HOH B . 
UA 4 HOH 18 121 121 HOH HOH B . 
UA 4 HOH 19 122 122 HOH HOH B . 
UA 4 HOH 20 123 123 HOH HOH B . 
UA 4 HOH 21 124 124 HOH HOH B . 
UA 4 HOH 22 125 125 HOH HOH B . 
UA 4 HOH 23 126 126 HOH HOH B . 
UA 4 HOH 24 127 127 HOH HOH B . 
UA 4 HOH 25 141 141 HOH HOH B . 
UA 4 HOH 26 143 143 HOH HOH B . 
UA 4 HOH 27 172 172 HOH HOH B . 
UA 4 HOH 28 178 178 HOH HOH B . 
UA 4 HOH 29 182 182 HOH HOH B . 
UA 4 HOH 30 195 195 HOH HOH B . 
UA 4 HOH 31 196 196 HOH HOH B . 
UA 4 HOH 32 199 199 HOH HOH B . 
UA 4 HOH 33 200 200 HOH HOH B . 
UA 4 HOH 34 202 202 HOH HOH B . 
UA 4 HOH 35 203 203 HOH HOH B . 
UA 4 HOH 36 210 210 HOH HOH B . 
UA 4 HOH 37 211 211 HOH HOH B . 
UA 4 HOH 38 212 212 HOH HOH B . 
UA 4 HOH 39 213 213 HOH HOH B . 
UA 4 HOH 40 214 214 HOH HOH B . 
UA 4 HOH 41 221 221 HOH HOH B . 
UA 4 HOH 42 224 224 HOH HOH B . 
UA 4 HOH 43 225 225 HOH HOH B . 
UA 4 HOH 44 229 229 HOH HOH B . 
UA 4 HOH 45 232 232 HOH HOH B . 
UA 4 HOH 46 238 238 HOH HOH B . 
UA 4 HOH 47 240 240 HOH HOH B . 
UA 4 HOH 48 241 241 HOH HOH B . 
UA 4 HOH 49 246 246 HOH HOH B . 
UA 4 HOH 50 259 259 HOH HOH B . 
UA 4 HOH 51 260 260 HOH HOH B . 
UA 4 HOH 52 261 261 HOH HOH B . 
UA 4 HOH 53 265 265 HOH HOH B . 
UA 4 HOH 54 266 266 HOH HOH B . 
UA 4 HOH 55 270 270 HOH HOH B . 
UA 4 HOH 56 284 284 HOH HOH B . 
UA 4 HOH 57 286 286 HOH HOH B . 
UA 4 HOH 58 287 287 HOH HOH B . 
UA 4 HOH 59 289 289 HOH HOH B . 
UA 4 HOH 60 292 292 HOH HOH B . 
UA 4 HOH 61 308 308 HOH HOH B . 
UA 4 HOH 62 320 320 HOH HOH B . 
UA 4 HOH 63 329 329 HOH HOH B . 
UA 4 HOH 64 356 356 HOH HOH B . 
UA 4 HOH 65 361 361 HOH HOH B . 
UA 4 HOH 66 379 379 HOH HOH B . 
UA 4 HOH 67 380 380 HOH HOH B . 
UA 4 HOH 68 385 385 HOH HOH B . 
UA 4 HOH 69 406 406 HOH HOH B . 
UA 4 HOH 70 461 461 HOH HOH B . 
UA 4 HOH 71 463 463 HOH HOH B . 
UA 4 HOH 72 469 469 HOH HOH B . 
UA 4 HOH 73 470 470 HOH HOH B . 
UA 4 HOH 74 471 471 HOH HOH B . 
UA 4 HOH 75 472 472 HOH HOH B . 
UA 4 HOH 76 489 489 HOH HOH B . 
UA 4 HOH 77 494 494 HOH HOH B . 
UA 4 HOH 78 507 507 HOH HOH B . 
UA 4 HOH 79 508 508 HOH HOH B . 
UA 4 HOH 80 509 509 HOH HOH B . 
UA 4 HOH 81 530 530 HOH HOH B . 
UA 4 HOH 82 532 532 HOH HOH B . 
UA 4 HOH 83 537 537 HOH HOH B . 
UA 4 HOH 84 541 541 HOH HOH B . 
UA 4 HOH 85 542 542 HOH HOH B . 
UA 4 HOH 86 554 554 HOH HOH B . 
UA 4 HOH 87 555 555 HOH HOH B . 
UA 4 HOH 88 557 557 HOH HOH B . 
UA 4 HOH 89 562 562 HOH HOH B . 
UA 4 HOH 90 568 568 HOH HOH B . 
UA 4 HOH 91 570 570 HOH HOH B . 
UA 4 HOH 92 573 573 HOH HOH B . 
UA 4 HOH 93 580 580 HOH HOH B . 
VA 4 HOH 1  103 103 HOH HOH C . 
VA 4 HOH 2  104 104 HOH HOH C . 
VA 4 HOH 3  105 105 HOH HOH C . 
VA 4 HOH 4  106 106 HOH HOH C . 
VA 4 HOH 5  107 107 HOH HOH C . 
VA 4 HOH 6  108 108 HOH HOH C . 
VA 4 HOH 7  109 109 HOH HOH C . 
VA 4 HOH 8  110 110 HOH HOH C . 
VA 4 HOH 9  111 111 HOH HOH C . 
VA 4 HOH 10 112 112 HOH HOH C . 
VA 4 HOH 11 113 113 HOH HOH C . 
VA 4 HOH 12 114 114 HOH HOH C . 
VA 4 HOH 13 115 115 HOH HOH C . 
VA 4 HOH 14 116 116 HOH HOH C . 
VA 4 HOH 15 117 117 HOH HOH C . 
VA 4 HOH 16 118 118 HOH HOH C . 
VA 4 HOH 17 119 119 HOH HOH C . 
VA 4 HOH 18 120 120 HOH HOH C . 
VA 4 HOH 19 121 121 HOH HOH C . 
VA 4 HOH 20 122 122 HOH HOH C . 
VA 4 HOH 21 127 127 HOH HOH C . 
VA 4 HOH 22 130 130 HOH HOH C . 
VA 4 HOH 23 131 131 HOH HOH C . 
VA 4 HOH 24 140 140 HOH HOH C . 
VA 4 HOH 25 145 145 HOH HOH C . 
VA 4 HOH 26 146 146 HOH HOH C . 
VA 4 HOH 27 150 150 HOH HOH C . 
VA 4 HOH 28 151 151 HOH HOH C . 
VA 4 HOH 29 152 152 HOH HOH C . 
VA 4 HOH 30 169 169 HOH HOH C . 
VA 4 HOH 31 181 181 HOH HOH C . 
VA 4 HOH 32 194 194 HOH HOH C . 
VA 4 HOH 33 204 204 HOH HOH C . 
VA 4 HOH 34 205 205 HOH HOH C . 
VA 4 HOH 35 215 215 HOH HOH C . 
VA 4 HOH 36 218 218 HOH HOH C . 
VA 4 HOH 37 235 235 HOH HOH C . 
VA 4 HOH 38 249 249 HOH HOH C . 
VA 4 HOH 39 256 256 HOH HOH C . 
VA 4 HOH 40 285 285 HOH HOH C . 
VA 4 HOH 41 293 293 HOH HOH C . 
VA 4 HOH 42 296 296 HOH HOH C . 
VA 4 HOH 43 301 301 HOH HOH C . 
VA 4 HOH 44 306 306 HOH HOH C . 
VA 4 HOH 45 315 315 HOH HOH C . 
VA 4 HOH 46 326 326 HOH HOH C . 
VA 4 HOH 47 331 331 HOH HOH C . 
VA 4 HOH 48 342 342 HOH HOH C . 
VA 4 HOH 49 345 345 HOH HOH C . 
VA 4 HOH 50 347 347 HOH HOH C . 
VA 4 HOH 51 348 348 HOH HOH C . 
VA 4 HOH 52 350 350 HOH HOH C . 
VA 4 HOH 53 355 355 HOH HOH C . 
VA 4 HOH 54 362 362 HOH HOH C . 
VA 4 HOH 55 364 364 HOH HOH C . 
VA 4 HOH 56 372 372 HOH HOH C . 
VA 4 HOH 57 394 394 HOH HOH C . 
VA 4 HOH 58 396 396 HOH HOH C . 
VA 4 HOH 59 400 400 HOH HOH C . 
VA 4 HOH 60 401 401 HOH HOH C . 
VA 4 HOH 61 437 437 HOH HOH C . 
VA 4 HOH 62 453 453 HOH HOH C . 
VA 4 HOH 63 462 462 HOH HOH C . 
VA 4 HOH 64 466 466 HOH HOH C . 
VA 4 HOH 65 467 467 HOH HOH C . 
VA 4 HOH 66 475 475 HOH HOH C . 
VA 4 HOH 67 476 476 HOH HOH C . 
VA 4 HOH 68 477 477 HOH HOH C . 
VA 4 HOH 69 492 492 HOH HOH C . 
VA 4 HOH 70 493 493 HOH HOH C . 
VA 4 HOH 71 497 497 HOH HOH C . 
VA 4 HOH 72 511 511 HOH HOH C . 
VA 4 HOH 73 535 535 HOH HOH C . 
VA 4 HOH 74 540 540 HOH HOH C . 
VA 4 HOH 75 543 543 HOH HOH C . 
VA 4 HOH 76 550 550 HOH HOH C . 
VA 4 HOH 77 560 560 HOH HOH C . 
VA 4 HOH 78 563 563 HOH HOH C . 
VA 4 HOH 79 565 565 HOH HOH C . 
VA 4 HOH 80 567 567 HOH HOH C . 
VA 4 HOH 81 579 579 HOH HOH C . 
WA 4 HOH 1  103 103 HOH HOH D . 
WA 4 HOH 2  104 104 HOH HOH D . 
WA 4 HOH 3  105 105 HOH HOH D . 
WA 4 HOH 4  106 106 HOH HOH D . 
WA 4 HOH 5  107 107 HOH HOH D . 
WA 4 HOH 6  108 108 HOH HOH D . 
WA 4 HOH 7  109 109 HOH HOH D . 
WA 4 HOH 8  110 110 HOH HOH D . 
WA 4 HOH 9  111 111 HOH HOH D . 
WA 4 HOH 10 112 112 HOH HOH D . 
WA 4 HOH 11 113 113 HOH HOH D . 
WA 4 HOH 12 114 114 HOH HOH D . 
WA 4 HOH 13 115 115 HOH HOH D . 
WA 4 HOH 14 123 123 HOH HOH D . 
WA 4 HOH 15 137 137 HOH HOH D . 
WA 4 HOH 16 142 142 HOH HOH D . 
WA 4 HOH 17 144 144 HOH HOH D . 
WA 4 HOH 18 147 147 HOH HOH D . 
WA 4 HOH 19 148 148 HOH HOH D . 
WA 4 HOH 20 159 159 HOH HOH D . 
WA 4 HOH 21 164 164 HOH HOH D . 
WA 4 HOH 22 173 173 HOH HOH D . 
WA 4 HOH 23 198 198 HOH HOH D . 
WA 4 HOH 24 216 216 HOH HOH D . 
WA 4 HOH 25 217 217 HOH HOH D . 
WA 4 HOH 26 230 230 HOH HOH D . 
WA 4 HOH 27 234 234 HOH HOH D . 
WA 4 HOH 28 239 239 HOH HOH D . 
WA 4 HOH 29 242 242 HOH HOH D . 
WA 4 HOH 30 248 248 HOH HOH D . 
WA 4 HOH 31 262 262 HOH HOH D . 
WA 4 HOH 32 280 280 HOH HOH D . 
WA 4 HOH 33 282 282 HOH HOH D . 
WA 4 HOH 34 288 288 HOH HOH D . 
WA 4 HOH 35 305 305 HOH HOH D . 
WA 4 HOH 36 310 310 HOH HOH D . 
WA 4 HOH 37 311 311 HOH HOH D . 
WA 4 HOH 38 313 313 HOH HOH D . 
WA 4 HOH 39 314 314 HOH HOH D . 
WA 4 HOH 40 319 319 HOH HOH D . 
WA 4 HOH 41 322 322 HOH HOH D . 
WA 4 HOH 42 340 340 HOH HOH D . 
WA 4 HOH 43 363 363 HOH HOH D . 
WA 4 HOH 44 381 381 HOH HOH D . 
WA 4 HOH 45 387 387 HOH HOH D . 
WA 4 HOH 46 403 403 HOH HOH D . 
WA 4 HOH 47 404 404 HOH HOH D . 
WA 4 HOH 48 409 409 HOH HOH D . 
WA 4 HOH 49 415 415 HOH HOH D . 
WA 4 HOH 50 427 427 HOH HOH D . 
WA 4 HOH 51 434 434 HOH HOH D . 
WA 4 HOH 52 449 449 HOH HOH D . 
WA 4 HOH 53 450 450 HOH HOH D . 
WA 4 HOH 54 451 451 HOH HOH D . 
WA 4 HOH 55 478 478 HOH HOH D . 
WA 4 HOH 56 481 481 HOH HOH D . 
WA 4 HOH 57 491 491 HOH HOH D . 
WA 4 HOH 58 506 506 HOH HOH D . 
WA 4 HOH 59 512 512 HOH HOH D . 
WA 4 HOH 60 516 516 HOH HOH D . 
WA 4 HOH 61 526 526 HOH HOH D . 
WA 4 HOH 62 534 534 HOH HOH D . 
WA 4 HOH 63 536 536 HOH HOH D . 
WA 4 HOH 64 538 538 HOH HOH D . 
WA 4 HOH 65 552 552 HOH HOH D . 
WA 4 HOH 66 553 553 HOH HOH D . 
WA 4 HOH 67 561 561 HOH HOH D . 
WA 4 HOH 68 572 572 HOH HOH D . 
WA 4 HOH 69 577 577 HOH HOH D . 
XA 4 HOH 1  105 105 HOH HOH E . 
XA 4 HOH 2  106 106 HOH HOH E . 
XA 4 HOH 3  107 107 HOH HOH E . 
XA 4 HOH 4  108 108 HOH HOH E . 
XA 4 HOH 5  109 109 HOH HOH E . 
XA 4 HOH 6  110 110 HOH HOH E . 
XA 4 HOH 7  111 111 HOH HOH E . 
XA 4 HOH 8  112 112 HOH HOH E . 
XA 4 HOH 9  113 113 HOH HOH E . 
XA 4 HOH 10 115 115 HOH HOH E . 
XA 4 HOH 11 116 116 HOH HOH E . 
XA 4 HOH 12 126 126 HOH HOH E . 
XA 4 HOH 13 129 129 HOH HOH E . 
XA 4 HOH 14 135 135 HOH HOH E . 
XA 4 HOH 15 138 138 HOH HOH E . 
XA 4 HOH 16 153 153 HOH HOH E . 
XA 4 HOH 17 160 160 HOH HOH E . 
XA 4 HOH 18 184 184 HOH HOH E . 
XA 4 HOH 19 208 208 HOH HOH E . 
XA 4 HOH 20 209 209 HOH HOH E . 
XA 4 HOH 21 263 263 HOH HOH E . 
XA 4 HOH 22 271 271 HOH HOH E . 
XA 4 HOH 23 278 278 HOH HOH E . 
XA 4 HOH 24 283 283 HOH HOH E . 
XA 4 HOH 25 318 318 HOH HOH E . 
XA 4 HOH 26 330 330 HOH HOH E . 
XA 4 HOH 27 337 337 HOH HOH E . 
XA 4 HOH 28 341 341 HOH HOH E . 
XA 4 HOH 29 368 368 HOH HOH E . 
XA 4 HOH 30 407 407 HOH HOH E . 
XA 4 HOH 31 436 436 HOH HOH E . 
XA 4 HOH 32 439 439 HOH HOH E . 
XA 4 HOH 33 444 444 HOH HOH E . 
XA 4 HOH 34 448 448 HOH HOH E . 
XA 4 HOH 35 454 454 HOH HOH E . 
XA 4 HOH 36 459 459 HOH HOH E . 
XA 4 HOH 37 479 479 HOH HOH E . 
XA 4 HOH 38 486 486 HOH HOH E . 
XA 4 HOH 39 495 495 HOH HOH E . 
XA 4 HOH 40 498 498 HOH HOH E . 
XA 4 HOH 41 499 499 HOH HOH E . 
XA 4 HOH 42 504 504 HOH HOH E . 
XA 4 HOH 43 522 522 HOH HOH E . 
XA 4 HOH 44 523 523 HOH HOH E . 
XA 4 HOH 45 524 524 HOH HOH E . 
XA 4 HOH 46 547 547 HOH HOH E . 
XA 4 HOH 47 569 569 HOH HOH E . 
XA 4 HOH 48 578 578 HOH HOH E . 
YA 4 HOH 1  102 102 HOH HOH F . 
YA 4 HOH 2  103 103 HOH HOH F . 
YA 4 HOH 3  104 104 HOH HOH F . 
YA 4 HOH 4  105 105 HOH HOH F . 
YA 4 HOH 5  106 106 HOH HOH F . 
YA 4 HOH 6  107 107 HOH HOH F . 
YA 4 HOH 7  108 108 HOH HOH F . 
YA 4 HOH 8  109 109 HOH HOH F . 
YA 4 HOH 9  110 110 HOH HOH F . 
YA 4 HOH 10 111 111 HOH HOH F . 
YA 4 HOH 11 112 112 HOH HOH F . 
YA 4 HOH 12 113 113 HOH HOH F . 
YA 4 HOH 13 114 114 HOH HOH F . 
YA 4 HOH 14 123 123 HOH HOH F . 
YA 4 HOH 15 125 125 HOH HOH F . 
YA 4 HOH 16 154 154 HOH HOH F . 
YA 4 HOH 17 170 170 HOH HOH F . 
YA 4 HOH 18 206 206 HOH HOH F . 
YA 4 HOH 19 231 231 HOH HOH F . 
YA 4 HOH 20 237 237 HOH HOH F . 
YA 4 HOH 21 264 264 HOH HOH F . 
YA 4 HOH 22 267 267 HOH HOH F . 
YA 4 HOH 23 297 297 HOH HOH F . 
YA 4 HOH 24 298 298 HOH HOH F . 
YA 4 HOH 25 321 321 HOH HOH F . 
YA 4 HOH 26 328 328 HOH HOH F . 
YA 4 HOH 27 336 336 HOH HOH F . 
YA 4 HOH 28 384 384 HOH HOH F . 
YA 4 HOH 29 402 402 HOH HOH F . 
YA 4 HOH 30 423 423 HOH HOH F . 
YA 4 HOH 31 441 441 HOH HOH F . 
YA 4 HOH 32 452 452 HOH HOH F . 
YA 4 HOH 33 455 455 HOH HOH F . 
YA 4 HOH 34 482 482 HOH HOH F . 
YA 4 HOH 35 490 490 HOH HOH F . 
YA 4 HOH 36 503 503 HOH HOH F . 
YA 4 HOH 37 505 505 HOH HOH F . 
YA 4 HOH 38 527 527 HOH HOH F . 
YA 4 HOH 39 533 533 HOH HOH F . 
YA 4 HOH 40 551 551 HOH HOH F . 
YA 4 HOH 41 566 566 HOH HOH F . 
YA 4 HOH 42 571 571 HOH HOH F . 
YA 4 HOH 43 576 576 HOH HOH F . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      
A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA,RA,SA,TA,UA,VA,WA,XA,YA 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-02-23 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2016-09-28 
4 'Structure model' 1 3 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data reduction'  http://www.hkl-xray.com/ 
?   ? 
2 SCALEPACK   .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data scaling'    http://www.hkl-xray.com/ 
?   ? 
3 PHENIX      1.5_2 ?               package 'Paul D. Adams'      PDAdams@lbl.gov       refinement        
http://www.phenix-online.org/             C++ ? 
4 PDB_EXTRACT 3.005 'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
5 HKL-2000    .     ?               ?       ?                    ?                     'data collection' ? ?   ? 
6 HKL-2000    .     ?               ?       ?                    ?                     'data reduction'  ? ?   ? 
7 HKL-2000    .     ?               ?       ?                    ?                     'data scaling'    ? ?   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 32 ? ? 58.57  2.31    
2 1 ARG B 31 ? ? 37.33  -124.61 
3 1 ARG C 31 ? ? 46.35  -125.22 
4 1 HIS D 32 ? ? 55.79  4.15    
5 1 GLN D 43 ? ? 58.82  14.84   
6 1 GLN D 93 ? ? 83.71  15.85   
7 1 SER F 29 ? ? -91.29 44.91   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 95 ? A PRO 95 
2  1 Y 1 A THR 96 ? A THR 96 
3  1 Y 1 B PRO 95 ? B PRO 95 
4  1 Y 1 B THR 96 ? B THR 96 
5  1 Y 1 C PRO 95 ? C PRO 95 
6  1 Y 1 C THR 96 ? C THR 96 
7  1 Y 1 D PRO 95 ? D PRO 95 
8  1 Y 1 D THR 96 ? D THR 96 
9  1 Y 1 E PRO 95 ? E PRO 95 
10 1 Y 1 E THR 96 ? E THR 96 
11 1 Y 1 F PRO 95 ? F PRO 95 
12 1 Y 1 F THR 96 ? F THR 96 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'IODIDE ION'      IOD 
3 'THIOCYANATE ION' SCN 
4 water             HOH 
#