data_3MI9
# 
_entry.id   3MI9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3MI9         
RCSB  RCSB058578   
WWPDB D_1000058578 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3MIA 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3MI9 
_pdbx_database_status.recvd_initial_deposition_date   2010-04-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tahirov, T.H.'  1 
'Babayeva, N.D.' 2 
'Varzavand, K.'  3 
'Cooper, J.J.'   4 
'Sedore, S.C.'   5 
'Price, D.H.'    6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of HIV-1 Tat complexed with human P-TEFb.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            465 
_citation.page_first                747 
_citation.page_last                 751 
_citation.year                      2010 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20535204 
_citation.pdbx_database_id_DOI      10.1038/nature09131 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tahirov, T.H.'  1 
primary 'Babayeva, N.D.' 2 
primary 'Varzavand, K.'  3 
primary 'Cooper, J.J.'   4 
primary 'Sedore, S.C.'   5 
primary 'Price, D.H.'    6 
# 
_cell.entry_id           3MI9 
_cell.length_a           132.306 
_cell.length_b           132.306 
_cell.length_c           95.358 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3MI9 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cell division protein kinase 9' 40692.152 1   '2.7.11.22, 2.7.11.23' ? 
'UNP residues 1-345, Protein kinase domain' ? 
2 polymer     man Cyclin-T1                        30877.320 1   ?                      ? 'UNP residues 1-266' ? 
3 polymer     man 'Protein Tat'                    9848.327  1   ?                      ? ? ? 
4 non-polymer syn 'ZINC ION'                       65.409    2   ?                      ? ? ? 
5 water       nat water                            18.015    341 ?                      ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Cyclin-dependent kinase 9, Serine/threonine-protein kinase PITALRE, Cell division cycle 2-like protein kinase 4, C-2K' 
2 'Cyclin-T, CycT1'                                                                                                       
3 'Transactivating regulatory protein'                                                                                    
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVN
LIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRD
GVLKLADFGLARAFSLAKNSQPNRY(TPO)NRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQH
QLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFW
SDPMPSDLKGMLSTHLTSMFEYLAPPRRKHHHHHH
;
;MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVN
LIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRD
GVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPM
PSDLKGMLSTHLTSMFEYLAPPRRKHHHHHH
;
A ? 
2 'polypeptide(L)' no no  
;MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPG
NSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKC
TQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHE
FLQILEKTPNRLKRIWNWRACEAAKK
;
;MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPG
NSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKC
TQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHE
FLQILEKTPNRLKRIWNWRACEAAKK
;
B ? 
3 'polypeptide(L)' no no  
;MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQSRGD
PTGPKE
;
;MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQSRGD
PTGPKE
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LYS n 
1 4   GLN n 
1 5   TYR n 
1 6   ASP n 
1 7   SER n 
1 8   VAL n 
1 9   GLU n 
1 10  CYS n 
1 11  PRO n 
1 12  PHE n 
1 13  CYS n 
1 14  ASP n 
1 15  GLU n 
1 16  VAL n 
1 17  SER n 
1 18  LYS n 
1 19  TYR n 
1 20  GLU n 
1 21  LYS n 
1 22  LEU n 
1 23  ALA n 
1 24  LYS n 
1 25  ILE n 
1 26  GLY n 
1 27  GLN n 
1 28  GLY n 
1 29  THR n 
1 30  PHE n 
1 31  GLY n 
1 32  GLU n 
1 33  VAL n 
1 34  PHE n 
1 35  LYS n 
1 36  ALA n 
1 37  ARG n 
1 38  HIS n 
1 39  ARG n 
1 40  LYS n 
1 41  THR n 
1 42  GLY n 
1 43  GLN n 
1 44  LYS n 
1 45  VAL n 
1 46  ALA n 
1 47  LEU n 
1 48  LYS n 
1 49  LYS n 
1 50  VAL n 
1 51  LEU n 
1 52  MET n 
1 53  GLU n 
1 54  ASN n 
1 55  GLU n 
1 56  LYS n 
1 57  GLU n 
1 58  GLY n 
1 59  PHE n 
1 60  PRO n 
1 61  ILE n 
1 62  THR n 
1 63  ALA n 
1 64  LEU n 
1 65  ARG n 
1 66  GLU n 
1 67  ILE n 
1 68  LYS n 
1 69  ILE n 
1 70  LEU n 
1 71  GLN n 
1 72  LEU n 
1 73  LEU n 
1 74  LYS n 
1 75  HIS n 
1 76  GLU n 
1 77  ASN n 
1 78  VAL n 
1 79  VAL n 
1 80  ASN n 
1 81  LEU n 
1 82  ILE n 
1 83  GLU n 
1 84  ILE n 
1 85  CYS n 
1 86  ARG n 
1 87  THR n 
1 88  LYS n 
1 89  ALA n 
1 90  SER n 
1 91  PRO n 
1 92  TYR n 
1 93  ASN n 
1 94  ARG n 
1 95  CYS n 
1 96  LYS n 
1 97  GLY n 
1 98  SER n 
1 99  ILE n 
1 100 TYR n 
1 101 LEU n 
1 102 VAL n 
1 103 PHE n 
1 104 ASP n 
1 105 PHE n 
1 106 CYS n 
1 107 GLU n 
1 108 HIS n 
1 109 ASP n 
1 110 LEU n 
1 111 ALA n 
1 112 GLY n 
1 113 LEU n 
1 114 LEU n 
1 115 SER n 
1 116 ASN n 
1 117 VAL n 
1 118 LEU n 
1 119 VAL n 
1 120 LYS n 
1 121 PHE n 
1 122 THR n 
1 123 LEU n 
1 124 SER n 
1 125 GLU n 
1 126 ILE n 
1 127 LYS n 
1 128 ARG n 
1 129 VAL n 
1 130 MET n 
1 131 GLN n 
1 132 MET n 
1 133 LEU n 
1 134 LEU n 
1 135 ASN n 
1 136 GLY n 
1 137 LEU n 
1 138 TYR n 
1 139 TYR n 
1 140 ILE n 
1 141 HIS n 
1 142 ARG n 
1 143 ASN n 
1 144 LYS n 
1 145 ILE n 
1 146 LEU n 
1 147 HIS n 
1 148 ARG n 
1 149 ASP n 
1 150 MET n 
1 151 LYS n 
1 152 ALA n 
1 153 ALA n 
1 154 ASN n 
1 155 VAL n 
1 156 LEU n 
1 157 ILE n 
1 158 THR n 
1 159 ARG n 
1 160 ASP n 
1 161 GLY n 
1 162 VAL n 
1 163 LEU n 
1 164 LYS n 
1 165 LEU n 
1 166 ALA n 
1 167 ASP n 
1 168 PHE n 
1 169 GLY n 
1 170 LEU n 
1 171 ALA n 
1 172 ARG n 
1 173 ALA n 
1 174 PHE n 
1 175 SER n 
1 176 LEU n 
1 177 ALA n 
1 178 LYS n 
1 179 ASN n 
1 180 SER n 
1 181 GLN n 
1 182 PRO n 
1 183 ASN n 
1 184 ARG n 
1 185 TYR n 
1 186 TPO n 
1 187 ASN n 
1 188 ARG n 
1 189 VAL n 
1 190 VAL n 
1 191 THR n 
1 192 LEU n 
1 193 TRP n 
1 194 TYR n 
1 195 ARG n 
1 196 PRO n 
1 197 PRO n 
1 198 GLU n 
1 199 LEU n 
1 200 LEU n 
1 201 LEU n 
1 202 GLY n 
1 203 GLU n 
1 204 ARG n 
1 205 ASP n 
1 206 TYR n 
1 207 GLY n 
1 208 PRO n 
1 209 PRO n 
1 210 ILE n 
1 211 ASP n 
1 212 LEU n 
1 213 TRP n 
1 214 GLY n 
1 215 ALA n 
1 216 GLY n 
1 217 CYS n 
1 218 ILE n 
1 219 MET n 
1 220 ALA n 
1 221 GLU n 
1 222 MET n 
1 223 TRP n 
1 224 THR n 
1 225 ARG n 
1 226 SER n 
1 227 PRO n 
1 228 ILE n 
1 229 MET n 
1 230 GLN n 
1 231 GLY n 
1 232 ASN n 
1 233 THR n 
1 234 GLU n 
1 235 GLN n 
1 236 HIS n 
1 237 GLN n 
1 238 LEU n 
1 239 ALA n 
1 240 LEU n 
1 241 ILE n 
1 242 SER n 
1 243 GLN n 
1 244 LEU n 
1 245 CYS n 
1 246 GLY n 
1 247 SER n 
1 248 ILE n 
1 249 THR n 
1 250 PRO n 
1 251 GLU n 
1 252 VAL n 
1 253 TRP n 
1 254 PRO n 
1 255 ASN n 
1 256 VAL n 
1 257 ASP n 
1 258 ASN n 
1 259 TYR n 
1 260 GLU n 
1 261 LEU n 
1 262 TYR n 
1 263 GLU n 
1 264 LYS n 
1 265 LEU n 
1 266 GLU n 
1 267 LEU n 
1 268 VAL n 
1 269 LYS n 
1 270 GLY n 
1 271 GLN n 
1 272 LYS n 
1 273 ARG n 
1 274 LYS n 
1 275 VAL n 
1 276 LYS n 
1 277 ASP n 
1 278 ARG n 
1 279 LEU n 
1 280 LYS n 
1 281 ALA n 
1 282 TYR n 
1 283 VAL n 
1 284 ARG n 
1 285 ASP n 
1 286 PRO n 
1 287 TYR n 
1 288 ALA n 
1 289 LEU n 
1 290 ASP n 
1 291 LEU n 
1 292 ILE n 
1 293 ASP n 
1 294 LYS n 
1 295 LEU n 
1 296 LEU n 
1 297 VAL n 
1 298 LEU n 
1 299 ASP n 
1 300 PRO n 
1 301 ALA n 
1 302 GLN n 
1 303 ARG n 
1 304 ILE n 
1 305 ASP n 
1 306 SER n 
1 307 ASP n 
1 308 ASP n 
1 309 ALA n 
1 310 LEU n 
1 311 ASN n 
1 312 HIS n 
1 313 ASP n 
1 314 PHE n 
1 315 PHE n 
1 316 TRP n 
1 317 SER n 
1 318 ASP n 
1 319 PRO n 
1 320 MET n 
1 321 PRO n 
1 322 SER n 
1 323 ASP n 
1 324 LEU n 
1 325 LYS n 
1 326 GLY n 
1 327 MET n 
1 328 LEU n 
1 329 SER n 
1 330 THR n 
1 331 HIS n 
1 332 LEU n 
1 333 THR n 
1 334 SER n 
1 335 MET n 
1 336 PHE n 
1 337 GLU n 
1 338 TYR n 
1 339 LEU n 
1 340 ALA n 
1 341 PRO n 
1 342 PRO n 
1 343 ARG n 
1 344 ARG n 
1 345 LYS n 
1 346 HIS n 
1 347 HIS n 
1 348 HIS n 
1 349 HIS n 
1 350 HIS n 
1 351 HIS n 
2 1   MET n 
2 2   GLU n 
2 3   GLY n 
2 4   GLU n 
2 5   ARG n 
2 6   LYS n 
2 7   ASN n 
2 8   ASN n 
2 9   ASN n 
2 10  LYS n 
2 11  ARG n 
2 12  TRP n 
2 13  TYR n 
2 14  PHE n 
2 15  THR n 
2 16  ARG n 
2 17  GLU n 
2 18  GLN n 
2 19  LEU n 
2 20  GLU n 
2 21  ASN n 
2 22  SER n 
2 23  PRO n 
2 24  SER n 
2 25  ARG n 
2 26  ARG n 
2 27  PHE n 
2 28  GLY n 
2 29  VAL n 
2 30  ASP n 
2 31  PRO n 
2 32  ASP n 
2 33  LYS n 
2 34  GLU n 
2 35  LEU n 
2 36  SER n 
2 37  TYR n 
2 38  ARG n 
2 39  GLN n 
2 40  GLN n 
2 41  ALA n 
2 42  ALA n 
2 43  ASN n 
2 44  LEU n 
2 45  LEU n 
2 46  GLN n 
2 47  ASP n 
2 48  MET n 
2 49  GLY n 
2 50  GLN n 
2 51  ARG n 
2 52  LEU n 
2 53  ASN n 
2 54  VAL n 
2 55  SER n 
2 56  GLN n 
2 57  LEU n 
2 58  THR n 
2 59  ILE n 
2 60  ASN n 
2 61  THR n 
2 62  ALA n 
2 63  ILE n 
2 64  VAL n 
2 65  TYR n 
2 66  MET n 
2 67  HIS n 
2 68  ARG n 
2 69  PHE n 
2 70  TYR n 
2 71  MET n 
2 72  ILE n 
2 73  GLN n 
2 74  SER n 
2 75  PHE n 
2 76  THR n 
2 77  GLN n 
2 78  PHE n 
2 79  PRO n 
2 80  GLY n 
2 81  ASN n 
2 82  SER n 
2 83  VAL n 
2 84  ALA n 
2 85  PRO n 
2 86  ALA n 
2 87  ALA n 
2 88  LEU n 
2 89  PHE n 
2 90  LEU n 
2 91  ALA n 
2 92  ALA n 
2 93  LYS n 
2 94  VAL n 
2 95  GLU n 
2 96  GLU n 
2 97  GLN n 
2 98  PRO n 
2 99  LYS n 
2 100 LYS n 
2 101 LEU n 
2 102 GLU n 
2 103 HIS n 
2 104 VAL n 
2 105 ILE n 
2 106 LYS n 
2 107 VAL n 
2 108 ALA n 
2 109 HIS n 
2 110 THR n 
2 111 CYS n 
2 112 LEU n 
2 113 HIS n 
2 114 PRO n 
2 115 GLN n 
2 116 GLU n 
2 117 SER n 
2 118 LEU n 
2 119 PRO n 
2 120 ASP n 
2 121 THR n 
2 122 ARG n 
2 123 SER n 
2 124 GLU n 
2 125 ALA n 
2 126 TYR n 
2 127 LEU n 
2 128 GLN n 
2 129 GLN n 
2 130 VAL n 
2 131 GLN n 
2 132 ASP n 
2 133 LEU n 
2 134 VAL n 
2 135 ILE n 
2 136 LEU n 
2 137 GLU n 
2 138 SER n 
2 139 ILE n 
2 140 ILE n 
2 141 LEU n 
2 142 GLN n 
2 143 THR n 
2 144 LEU n 
2 145 GLY n 
2 146 PHE n 
2 147 GLU n 
2 148 LEU n 
2 149 THR n 
2 150 ILE n 
2 151 ASP n 
2 152 HIS n 
2 153 PRO n 
2 154 HIS n 
2 155 THR n 
2 156 HIS n 
2 157 VAL n 
2 158 VAL n 
2 159 LYS n 
2 160 CYS n 
2 161 THR n 
2 162 GLN n 
2 163 LEU n 
2 164 VAL n 
2 165 ARG n 
2 166 ALA n 
2 167 SER n 
2 168 LYS n 
2 169 ASP n 
2 170 LEU n 
2 171 ALA n 
2 172 GLN n 
2 173 THR n 
2 174 SER n 
2 175 TYR n 
2 176 PHE n 
2 177 MET n 
2 178 ALA n 
2 179 THR n 
2 180 ASN n 
2 181 SER n 
2 182 LEU n 
2 183 HIS n 
2 184 LEU n 
2 185 THR n 
2 186 THR n 
2 187 PHE n 
2 188 SER n 
2 189 LEU n 
2 190 GLN n 
2 191 TYR n 
2 192 THR n 
2 193 PRO n 
2 194 PRO n 
2 195 VAL n 
2 196 VAL n 
2 197 ALA n 
2 198 CYS n 
2 199 VAL n 
2 200 CYS n 
2 201 ILE n 
2 202 HIS n 
2 203 LEU n 
2 204 ALA n 
2 205 CYS n 
2 206 LYS n 
2 207 TRP n 
2 208 SER n 
2 209 ASN n 
2 210 TRP n 
2 211 GLU n 
2 212 ILE n 
2 213 PRO n 
2 214 VAL n 
2 215 SER n 
2 216 THR n 
2 217 ASP n 
2 218 GLY n 
2 219 LYS n 
2 220 HIS n 
2 221 TRP n 
2 222 TRP n 
2 223 GLU n 
2 224 TYR n 
2 225 VAL n 
2 226 ASP n 
2 227 ALA n 
2 228 THR n 
2 229 VAL n 
2 230 THR n 
2 231 LEU n 
2 232 GLU n 
2 233 LEU n 
2 234 LEU n 
2 235 ASP n 
2 236 GLU n 
2 237 LEU n 
2 238 THR n 
2 239 HIS n 
2 240 GLU n 
2 241 PHE n 
2 242 LEU n 
2 243 GLN n 
2 244 ILE n 
2 245 LEU n 
2 246 GLU n 
2 247 LYS n 
2 248 THR n 
2 249 PRO n 
2 250 ASN n 
2 251 ARG n 
2 252 LEU n 
2 253 LYS n 
2 254 ARG n 
2 255 ILE n 
2 256 TRP n 
2 257 ASN n 
2 258 TRP n 
2 259 ARG n 
2 260 ALA n 
2 261 CYS n 
2 262 GLU n 
2 263 ALA n 
2 264 ALA n 
2 265 LYS n 
2 266 LYS n 
3 1   MET n 
3 2   GLU n 
3 3   PRO n 
3 4   VAL n 
3 5   ASP n 
3 6   PRO n 
3 7   ARG n 
3 8   LEU n 
3 9   GLU n 
3 10  PRO n 
3 11  TRP n 
3 12  LYS n 
3 13  HIS n 
3 14  PRO n 
3 15  GLY n 
3 16  SER n 
3 17  GLN n 
3 18  PRO n 
3 19  LYS n 
3 20  THR n 
3 21  ALA n 
3 22  CYS n 
3 23  THR n 
3 24  ASN n 
3 25  CYS n 
3 26  TYR n 
3 27  CYS n 
3 28  LYS n 
3 29  LYS n 
3 30  CYS n 
3 31  CYS n 
3 32  PHE n 
3 33  HIS n 
3 34  CYS n 
3 35  GLN n 
3 36  VAL n 
3 37  CYS n 
3 38  PHE n 
3 39  ILE n 
3 40  THR n 
3 41  LYS n 
3 42  ALA n 
3 43  LEU n 
3 44  GLY n 
3 45  ILE n 
3 46  SER n 
3 47  TYR n 
3 48  GLY n 
3 49  ARG n 
3 50  LYS n 
3 51  LYS n 
3 52  ARG n 
3 53  ARG n 
3 54  GLN n 
3 55  ARG n 
3 56  ARG n 
3 57  ARG n 
3 58  ALA n 
3 59  HIS n 
3 60  GLN n 
3 61  ASN n 
3 62  SER n 
3 63  GLN n 
3 64  THR n 
3 65  HIS n 
3 66  GLN n 
3 67  ALA n 
3 68  SER n 
3 69  LEU n 
3 70  SER n 
3 71  LYS n 
3 72  GLN n 
3 73  PRO n 
3 74  THR n 
3 75  SER n 
3 76  GLN n 
3 77  SER n 
3 78  ARG n 
3 79  GLY n 
3 80  ASP n 
3 81  PRO n 
3 82  THR n 
3 83  GLY n 
3 84  PRO n 
3 85  LYS n 
3 86  GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'CDC2L4, CDK9'     ? ?                                ? ? ? ? 'Homo sapiens'                        9606  
? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' ? ? ? ? ? ? ? SF9 ? 'BL21 insect cells' ? ? ? ? ? 'BACULO VIRUS' ? ? ? 
'pENTR/SD/D-TOPO vector (Invitrogen K2420)' ? ? 
2 1 sample ? ? ? human ? 'CCNT1, Cyclin T1' ? ?                                ? ? ? ? 'Homo sapiens'                        9606  
? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' ? ? ? ? ? ? ? SF9 ? 'BL21 insect cells' ? ? ? ? ? 'BACULO VIRUS' ? ? ? 
'pENTR/SD/D-TOPO vector (Invitrogen K2420)' ? ? 
3 1 sample ? ? ? HIV-1 ? tat                ? 'isolate HXB2 group M subtype B' ? ? ? ? 'Human immunodeficiency virus type 1' 11706 
? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' ? ? ? ? ? ? ? SF9 ? 'BL21 insect cells' ? ? ? ? ? 'BACULO VIRUS' ? ? ? 
'pENTR/SD/D-TOPO vector (Invitrogen K2420)' ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CDK9_HUMAN  P50750 1 
;MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVN
LIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRD
GVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPM
PSDLKGMLSTHLTSMFEYLAPPRRK
;
1 ? 
2 UNP CCNT1_HUMAN O60563 2 
;MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPG
NSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKC
TQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHE
FLQILEKTPNRLKRIWNWRACEAAKK
;
1 ? 
3 UNP TAT_HV1H2   P04608 3 
;MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGD
PTGPKE
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3MI9 A 1 ? 345 ? P50750 1 ? 345 ? 1 345 
2 2 3MI9 B 1 ? 266 ? O60563 1 ? 266 ? 1 266 
3 3 3MI9 C 1 ? 86  ? P04608 1 ? 86  ? 1 86  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3MI9 HIS A 346 ? UNP P50750 ?   ?  'EXPRESSION TAG' 346 1 
1 3MI9 HIS A 347 ? UNP P50750 ?   ?  'EXPRESSION TAG' 347 2 
1 3MI9 HIS A 348 ? UNP P50750 ?   ?  'EXPRESSION TAG' 348 3 
1 3MI9 HIS A 349 ? UNP P50750 ?   ?  'EXPRESSION TAG' 349 4 
1 3MI9 HIS A 350 ? UNP P50750 ?   ?  'EXPRESSION TAG' 350 5 
1 3MI9 HIS A 351 ? UNP P50750 ?   ?  'EXPRESSION TAG' 351 6 
3 3MI9 SER C 77  ? UNP P04608 PRO 77 VARIANT          77  7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?                  'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ?                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                  'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                  'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                  'C4 H9 N O3'     119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                  'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'       ?                  'Zn 2'           65.409  
# 
_exptl.entry_id          3MI9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.96 
_exptl_crystal.density_percent_sol   58.43 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;50 mM HEPES buffer (pH 7.5), 4.25-5% PEG 20,000, 1 mM TCEP, and 20 mM glycyl-glycyl-glycine , VAPOR DIFFUSION, SITTING DROP, temperature 295.0K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-10-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
# 
_reflns.entry_id                     3MI9 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   -2.0 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   51839 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.9 
_reflns.pdbx_Rmerge_I_obs            0.055 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        35.0 
_reflns.B_iso_Wilson_estimate        31.7 
_reflns.pdbx_redundancy              2.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.14 
_reflns_shell.percent_possible_all   89.0 
_reflns_shell.Rmerge_I_obs           0.520 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.7 
_reflns_shell.pdbx_redundancy        2.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2531 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3MI9 
_refine.ls_number_reflns_obs                     48306 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2384386.28 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.63 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    85.6 
_refine.ls_R_factor_obs                          0.219 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.219 
_refine.ls_R_factor_R_free                       0.264 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2443 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               46.7 
_refine.aniso_B[1][1]                            -0.14 
_refine.aniso_B[2][2]                            -0.14 
_refine.aniso_B[3][3]                            0.29 
_refine.aniso_B[1][2]                            1.87 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.36834 
_refine.solvent_model_param_bsol                 58.0275 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3blh' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3MI9 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.38 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.43 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5055 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             341 
_refine_hist.number_atoms_total               5398 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        30.63 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.1  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.88  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             4.54  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            5.80  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             6.68  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            7.85  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   NONE 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.23 
_refine_ls_shell.number_reflns_R_work             6931 
_refine_ls_shell.R_factor_R_work                  0.356 
_refine_ls_shell.percent_reflns_obs               78.2 
_refine_ls_shell.R_factor_R_free                  0.386 
_refine_ls_shell.R_factor_R_free_error            0.020 
_refine_ls_shell.percent_reflns_R_free            4.9 
_refine_ls_shell.number_reflns_R_free             355 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
3 ion.param         ion.top     'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3MI9 
_struct.title                     'Crystal structure of HIV-1 Tat complexed with human P-TEFb' 
_struct.pdbx_descriptor           'Cell division protein kinase 9 (E.C.2.7.11.22, 2.7.11.23), Cyclin-T1, Protein Tat' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3MI9 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'P-TEFb, Tat, HIV-1, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 15  ? SER A 17  ? GLU A 15  SER A 17  5 ? 3  
HELX_P HELX_P2  2  PRO A 60  ? LEU A 73  ? PRO A 60  LEU A 73  1 ? 14 
HELX_P HELX_P3  3  LEU A 110 ? ASN A 116 ? LEU A 110 ASN A 116 1 ? 7  
HELX_P HELX_P4  4  THR A 122 ? ASN A 143 ? THR A 122 ASN A 143 1 ? 22 
HELX_P HELX_P5  5  LYS A 151 ? ALA A 153 ? LYS A 151 ALA A 153 5 ? 3  
HELX_P HELX_P6  6  THR A 191 ? ARG A 195 ? THR A 191 ARG A 195 5 ? 5  
HELX_P HELX_P7  7  PRO A 196 ? LEU A 201 ? PRO A 196 LEU A 201 1 ? 6  
HELX_P HELX_P8  8  PRO A 208 ? ARG A 225 ? PRO A 208 ARG A 225 1 ? 18 
HELX_P HELX_P9  9  THR A 233 ? GLY A 246 ? THR A 233 GLY A 246 1 ? 14 
HELX_P HELX_P10 10 ASN A 255 ? GLU A 263 ? ASN A 255 GLU A 263 5 ? 9  
HELX_P HELX_P11 11 LYS A 274 ? ARG A 284 ? LYS A 274 ARG A 284 1 ? 11 
HELX_P HELX_P12 12 ASP A 285 ? LEU A 296 ? ASP A 285 LEU A 296 1 ? 12 
HELX_P HELX_P13 13 ASP A 299 ? ARG A 303 ? ASP A 299 ARG A 303 5 ? 5  
HELX_P HELX_P14 14 ASP A 305 ? ASN A 311 ? ASP A 305 ASN A 311 1 ? 7  
HELX_P HELX_P15 15 HIS A 312 ? SER A 317 ? HIS A 312 SER A 317 5 ? 6  
HELX_P HELX_P16 16 LEU A 324 ? THR A 330 ? LEU A 324 THR A 330 1 ? 7  
HELX_P HELX_P17 17 SER A 334 ? ALA A 340 ? SER A 334 ALA A 340 1 ? 7  
HELX_P HELX_P18 18 THR B 15  ? ASN B 21  ? THR B 15  ASN B 21  1 ? 7  
HELX_P HELX_P19 19 SER B 24  ? GLY B 28  ? SER B 24  GLY B 28  5 ? 5  
HELX_P HELX_P20 20 ASP B 30  ? ASN B 53  ? ASP B 30  ASN B 53  1 ? 24 
HELX_P HELX_P21 21 SER B 55  ? TYR B 70  ? SER B 55  TYR B 70  1 ? 16 
HELX_P HELX_P22 22 PRO B 79  ? GLU B 95  ? PRO B 79  GLU B 95  1 ? 17 
HELX_P HELX_P23 23 LYS B 100 ? HIS B 113 ? LYS B 100 HIS B 113 1 ? 14 
HELX_P HELX_P24 24 SER B 123 ? LEU B 144 ? SER B 123 LEU B 144 1 ? 22 
HELX_P HELX_P25 25 HIS B 152 ? VAL B 164 ? HIS B 152 VAL B 164 1 ? 13 
HELX_P HELX_P26 26 SER B 167 ? THR B 185 ? SER B 167 THR B 185 1 ? 19 
HELX_P HELX_P27 27 THR B 186 ? GLN B 190 ? THR B 186 GLN B 190 5 ? 5  
HELX_P HELX_P28 28 THR B 192 ? SER B 208 ? THR B 192 SER B 208 1 ? 17 
HELX_P HELX_P29 29 HIS B 220 ? VAL B 225 ? HIS B 220 VAL B 225 5 ? 6  
HELX_P HELX_P30 30 THR B 230 ? LYS B 247 ? THR B 230 LYS B 247 1 ? 18 
HELX_P HELX_P31 31 THR B 248 ? LEU B 252 ? THR B 248 LEU B 252 5 ? 5  
HELX_P HELX_P32 32 GLU C 9   ? HIS C 13  ? GLU C 9   HIS C 13  5 ? 5  
HELX_P HELX_P33 33 LYS C 29  ? HIS C 33  ? LYS C 29  HIS C 33  5 ? 5  
HELX_P HELX_P34 34 CYS C 34  ? LYS C 41  ? CYS C 34  LYS C 41  1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A TYR 185 C   ? ? ? 1_555 A TPO 186 N  ? ? A TYR 185 A TPO 186 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2 covale ? ? A TPO 186 C   ? ? ? 1_555 A ASN 187 N  ? ? A TPO 186 A ASN 187 1_555 ? ? ? ? ? ? ? 1.328 ? 
metalc1 metalc ? ? C HIS 33  ND1 ? ? ? 1_555 D ZN  .   ZN ? ? C HIS 33  C ZN  87  1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc2 metalc ? ? C CYS 37  SG  ? ? ? 1_555 D ZN  .   ZN ? ? C CYS 37  C ZN  87  1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc3 metalc ? ? C CYS 25  SG  ? ? ? 1_555 E ZN  .   ZN ? ? C CYS 25  C ZN  88  1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc4 metalc ? ? C CYS 27  SG  ? ? ? 1_555 E ZN  .   ZN ? ? C CYS 27  C ZN  88  1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc5 metalc ? ? C CYS 22  SG  ? ? ? 1_555 D ZN  .   ZN ? ? C CYS 22  C ZN  87  1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc6 metalc ? ? C CYS 30  SG  ? ? ? 1_555 E ZN  .   ZN ? ? C CYS 30  C ZN  88  1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc7 metalc ? ? B CYS 261 SG  ? ? ? 1_555 E ZN  .   ZN ? ? B CYS 261 C ZN  88  1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc8 metalc ? ? C CYS 34  SG  ? ? ? 1_555 D ZN  .   ZN ? ? C CYS 34  C ZN  87  1_555 ? ? ? ? ? ? ? 2.325 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           318 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            318 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    319 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     319 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.41 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 19  ? LYS A 24  ? TYR A 19  LYS A 24  
A 2 VAL A 33  ? HIS A 38  ? VAL A 33  HIS A 38  
A 3 LYS A 44  ? LYS A 49  ? LYS A 44  LYS A 49  
A 4 SER A 98  ? ASP A 104 ? SER A 98  ASP A 104 
A 5 LEU A 81  ? THR A 87  ? LEU A 81  THR A 87  
B 1 HIS A 108 ? ASP A 109 ? HIS A 108 ASP A 109 
B 2 VAL A 155 ? ILE A 157 ? VAL A 155 ILE A 157 
B 3 LEU A 163 ? LEU A 165 ? LEU A 163 LEU A 165 
C 1 ILE A 145 ? LEU A 146 ? ILE A 145 LEU A 146 
C 2 ARG A 172 ? ALA A 173 ? ARG A 172 ALA A 173 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 23  ? N ALA A 23  O LYS A 35  ? O LYS A 35  
A 2 3 N PHE A 34  ? N PHE A 34  O LEU A 47  ? O LEU A 47  
A 3 4 N LYS A 48  ? N LYS A 48  O LEU A 101 ? O LEU A 101 
A 4 5 O TYR A 100 ? O TYR A 100 N CYS A 85  ? N CYS A 85  
B 1 2 N HIS A 108 ? N HIS A 108 O ILE A 157 ? O ILE A 157 
B 2 3 N LEU A 156 ? N LEU A 156 O LYS A 164 ? O LYS A 164 
C 1 2 N LEU A 146 ? N LEU A 146 O ARG A 172 ? O ARG A 172 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 87' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 88' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS C 22  ? CYS C 22  . ? 1_555 ? 
2 AC1 4 HIS C 33  ? HIS C 33  . ? 1_555 ? 
3 AC1 4 CYS C 34  ? CYS C 34  . ? 1_555 ? 
4 AC1 4 CYS C 37  ? CYS C 37  . ? 1_555 ? 
5 AC2 4 CYS B 261 ? CYS B 261 . ? 1_555 ? 
6 AC2 4 CYS C 25  ? CYS C 25  . ? 1_555 ? 
7 AC2 4 CYS C 27  ? CYS C 27  . ? 1_555 ? 
8 AC2 4 CYS C 30  ? CYS C 30  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3MI9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3MI9 
_atom_sites.fract_transf_matrix[1][1]   0.007558 
_atom_sites.fract_transf_matrix[1][2]   0.004364 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008727 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010487 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 8   ? 44.299  27.806 5.731  1.00 62.23  ? 8   VAL A N   1 
ATOM   2    C  CA  . VAL A 1 8   ? 43.715  28.292 7.017  1.00 58.66  ? 8   VAL A CA  1 
ATOM   3    C  C   . VAL A 1 8   ? 44.633  29.276 7.728  1.00 54.79  ? 8   VAL A C   1 
ATOM   4    O  O   . VAL A 1 8   ? 45.702  28.906 8.208  1.00 51.38  ? 8   VAL A O   1 
ATOM   5    C  CB  . VAL A 1 8   ? 43.455  27.144 7.993  1.00 58.66  ? 8   VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 8   ? 42.439  27.586 9.033  1.00 61.36  ? 8   VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 8   ? 42.981  25.917 7.244  1.00 66.73  ? 8   VAL A CG2 1 
ATOM   8    N  N   . GLU A 1 9   ? 44.194  30.528 7.804  1.00 55.62  ? 9   GLU A N   1 
ATOM   9    C  CA  . GLU A 1 9   ? 44.951  31.583 8.463  1.00 51.34  ? 9   GLU A CA  1 
ATOM   10   C  C   . GLU A 1 9   ? 45.121  31.298 9.952  1.00 48.54  ? 9   GLU A C   1 
ATOM   11   O  O   . GLU A 1 9   ? 44.164  30.914 10.629 1.00 40.55  ? 9   GLU A O   1 
ATOM   12   C  CB  . GLU A 1 9   ? 44.247  32.931 8.269  1.00 60.16  ? 9   GLU A CB  1 
ATOM   13   C  CG  . GLU A 1 9   ? 44.519  33.562 6.925  1.00 62.54  ? 9   GLU A CG  1 
ATOM   14   C  CD  . GLU A 1 9   ? 46.006  33.729 6.682  1.00 76.66  ? 9   GLU A CD  1 
ATOM   15   O  OE1 . GLU A 1 9   ? 46.631  34.589 7.346  1.00 77.36  ? 9   GLU A OE1 1 
ATOM   16   O  OE2 . GLU A 1 9   ? 46.554  32.985 5.839  1.00 74.75  ? 9   GLU A OE2 1 
ATOM   17   N  N   . CYS A 1 10  ? 46.342  31.490 10.447 1.00 48.20  ? 10  CYS A N   1 
ATOM   18   C  CA  . CYS A 1 10  ? 46.662  31.261 11.855 1.00 46.77  ? 10  CYS A CA  1 
ATOM   19   C  C   . CYS A 1 10  ? 47.746  32.241 12.325 1.00 45.31  ? 10  CYS A C   1 
ATOM   20   O  O   . CYS A 1 10  ? 48.838  31.844 12.727 1.00 48.83  ? 10  CYS A O   1 
ATOM   21   C  CB  . CYS A 1 10  ? 47.142  29.828 12.041 1.00 42.81  ? 10  CYS A CB  1 
ATOM   22   S  SG  . CYS A 1 10  ? 47.252  29.344 13.747 1.00 51.49  ? 10  CYS A SG  1 
ATOM   23   N  N   . PRO A 1 11  ? 47.433  33.542 12.317 1.00 39.39  ? 11  PRO A N   1 
ATOM   24   C  CA  . PRO A 1 11  ? 48.372  34.588 12.726 1.00 40.44  ? 11  PRO A CA  1 
ATOM   25   C  C   . PRO A 1 11  ? 48.856  34.576 14.175 1.00 35.01  ? 11  PRO A C   1 
ATOM   26   O  O   . PRO A 1 11  ? 49.845  35.216 14.498 1.00 36.53  ? 11  PRO A O   1 
ATOM   27   C  CB  . PRO A 1 11  ? 47.601  35.865 12.407 1.00 35.07  ? 11  PRO A CB  1 
ATOM   28   C  CG  . PRO A 1 11  ? 46.204  35.480 12.777 1.00 35.69  ? 11  PRO A CG  1 
ATOM   29   C  CD  . PRO A 1 11  ? 46.073  34.095 12.165 1.00 31.25  ? 11  PRO A CD  1 
ATOM   30   N  N   . PHE A 1 12  ? 48.198  33.832 15.045 1.00 36.85  ? 12  PHE A N   1 
ATOM   31   C  CA  . PHE A 1 12  ? 48.604  33.882 16.440 1.00 37.53  ? 12  PHE A CA  1 
ATOM   32   C  C   . PHE A 1 12  ? 49.159  32.613 17.086 1.00 35.56  ? 12  PHE A C   1 
ATOM   33   O  O   . PHE A 1 12  ? 49.299  32.529 18.311 1.00 40.77  ? 12  PHE A O   1 
ATOM   34   C  CB  . PHE A 1 12  ? 47.439  34.464 17.240 1.00 28.70  ? 12  PHE A CB  1 
ATOM   35   C  CG  . PHE A 1 12  ? 46.914  35.775 16.674 1.00 32.61  ? 12  PHE A CG  1 
ATOM   36   C  CD1 . PHE A 1 12  ? 47.782  36.832 16.413 1.00 34.18  ? 12  PHE A CD1 1 
ATOM   37   C  CD2 . PHE A 1 12  ? 45.556  35.960 16.438 1.00 27.83  ? 12  PHE A CD2 1 
ATOM   38   C  CE1 . PHE A 1 12  ? 47.302  38.064 15.928 1.00 37.13  ? 12  PHE A CE1 1 
ATOM   39   C  CE2 . PHE A 1 12  ? 45.063  37.184 15.954 1.00 33.45  ? 12  PHE A CE2 1 
ATOM   40   C  CZ  . PHE A 1 12  ? 45.939  38.237 15.701 1.00 35.08  ? 12  PHE A CZ  1 
ATOM   41   N  N   . CYS A 1 13  ? 49.502  31.636 16.258 1.00 33.08  ? 13  CYS A N   1 
ATOM   42   C  CA  . CYS A 1 13  ? 50.086  30.389 16.729 1.00 35.74  ? 13  CYS A CA  1 
ATOM   43   C  C   . CYS A 1 13  ? 51.092  29.968 15.674 1.00 38.16  ? 13  CYS A C   1 
ATOM   44   O  O   . CYS A 1 13  ? 50.743  29.222 14.768 1.00 39.94  ? 13  CYS A O   1 
ATOM   45   C  CB  . CYS A 1 13  ? 49.022  29.296 16.875 1.00 27.75  ? 13  CYS A CB  1 
ATOM   46   S  SG  . CYS A 1 13  ? 49.666  27.704 17.512 1.00 37.51  ? 13  CYS A SG  1 
ATOM   47   N  N   . ASP A 1 14  ? 52.329  30.446 15.801 1.00 36.87  ? 14  ASP A N   1 
ATOM   48   C  CA  . ASP A 1 14  ? 53.395  30.143 14.841 1.00 32.94  ? 14  ASP A CA  1 
ATOM   49   C  C   . ASP A 1 14  ? 53.845  28.678 14.803 1.00 42.14  ? 14  ASP A C   1 
ATOM   50   O  O   . ASP A 1 14  ? 53.684  27.920 15.766 1.00 33.99  ? 14  ASP A O   1 
ATOM   51   C  CB  . ASP A 1 14  ? 54.630  31.006 15.119 1.00 33.01  ? 14  ASP A CB  1 
ATOM   52   C  CG  . ASP A 1 14  ? 54.360  32.490 14.995 1.00 42.68  ? 14  ASP A CG  1 
ATOM   53   O  OD1 . ASP A 1 14  ? 53.252  32.880 14.578 1.00 39.91  ? 14  ASP A OD1 1 
ATOM   54   O  OD2 . ASP A 1 14  ? 55.272  33.276 15.316 1.00 41.47  ? 14  ASP A OD2 1 
ATOM   55   N  N   . GLU A 1 15  ? 54.437  28.301 13.678 1.00 36.34  ? 15  GLU A N   1 
ATOM   56   C  CA  . GLU A 1 15  ? 54.933  26.957 13.493 1.00 34.88  ? 15  GLU A CA  1 
ATOM   57   C  C   . GLU A 1 15  ? 56.226  26.832 14.276 1.00 31.02  ? 15  GLU A C   1 
ATOM   58   O  O   . GLU A 1 15  ? 57.048  27.741 14.285 1.00 32.63  ? 15  GLU A O   1 
ATOM   59   C  CB  . GLU A 1 15  ? 55.195  26.680 12.005 1.00 43.14  ? 15  GLU A CB  1 
ATOM   60   C  CG  . GLU A 1 15  ? 53.987  26.880 11.112 1.00 57.73  ? 15  GLU A CG  1 
ATOM   61   C  CD  . GLU A 1 15  ? 54.331  26.760 9.639  1.00 66.88  ? 15  GLU A CD  1 
ATOM   62   O  OE1 . GLU A 1 15  ? 54.302  25.630 9.105  1.00 69.70  ? 15  GLU A OE1 1 
ATOM   63   O  OE2 . GLU A 1 15  ? 54.646  27.800 9.019  1.00 65.14  ? 15  GLU A OE2 1 
ATOM   64   N  N   . VAL A 1 16  ? 56.402  25.701 14.940 1.00 31.59  ? 16  VAL A N   1 
ATOM   65   C  CA  . VAL A 1 16  ? 57.599  25.475 15.720 1.00 36.00  ? 16  VAL A CA  1 
ATOM   66   C  C   . VAL A 1 16  ? 58.869  25.577 14.862 1.00 36.91  ? 16  VAL A C   1 
ATOM   67   O  O   . VAL A 1 16  ? 59.966  25.644 15.399 1.00 41.02  ? 16  VAL A O   1 
ATOM   68   C  CB  . VAL A 1 16  ? 57.533  24.102 16.410 1.00 43.61  ? 16  VAL A CB  1 
ATOM   69   C  CG1 . VAL A 1 16  ? 57.694  23.005 15.383 1.00 48.80  ? 16  VAL A CG1 1 
ATOM   70   C  CG2 . VAL A 1 16  ? 58.576  24.017 17.506 1.00 45.88  ? 16  VAL A CG2 1 
ATOM   71   N  N   . SER A 1 17  ? 58.706  25.598 13.538 1.00 35.04  ? 17  SER A N   1 
ATOM   72   C  CA  . SER A 1 17  ? 59.826  25.725 12.591 1.00 39.94  ? 17  SER A CA  1 
ATOM   73   C  C   . SER A 1 17  ? 60.759  26.887 12.953 1.00 38.33  ? 17  SER A C   1 
ATOM   74   O  O   . SER A 1 17  ? 61.949  26.851 12.652 1.00 35.63  ? 17  SER A O   1 
ATOM   75   C  CB  . SER A 1 17  ? 59.314  25.979 11.156 1.00 34.69  ? 17  SER A CB  1 
ATOM   76   O  OG  . SER A 1 17  ? 58.557  24.890 10.655 1.00 56.37  ? 17  SER A OG  1 
ATOM   77   N  N   . LYS A 1 18  ? 60.215  27.928 13.572 1.00 29.99  ? 18  LYS A N   1 
ATOM   78   C  CA  . LYS A 1 18  ? 61.027  29.085 13.941 1.00 30.29  ? 18  LYS A CA  1 
ATOM   79   C  C   . LYS A 1 18  ? 62.144  28.694 14.909 1.00 27.23  ? 18  LYS A C   1 
ATOM   80   O  O   . LYS A 1 18  ? 63.119  29.412 15.059 1.00 36.47  ? 18  LYS A O   1 
ATOM   81   C  CB  . LYS A 1 18  ? 60.137  30.177 14.550 1.00 26.75  ? 18  LYS A CB  1 
ATOM   82   C  CG  . LYS A 1 18  ? 59.441  29.730 15.817 1.00 28.04  ? 18  LYS A CG  1 
ATOM   83   C  CD  . LYS A 1 18  ? 58.231  30.590 16.139 1.00 37.37  ? 18  LYS A CD  1 
ATOM   84   C  CE  . LYS A 1 18  ? 58.595  31.885 16.841 1.00 38.18  ? 18  LYS A CE  1 
ATOM   85   N  NZ  . LYS A 1 18  ? 57.362  32.688 17.131 1.00 29.33  ? 18  LYS A NZ  1 
ATOM   86   N  N   . TYR A 1 19  ? 62.005  27.558 15.579 1.00 28.58  ? 19  TYR A N   1 
ATOM   87   C  CA  . TYR A 1 19  ? 63.065  27.119 16.478 1.00 32.44  ? 19  TYR A CA  1 
ATOM   88   C  C   . TYR A 1 19  ? 63.772  25.948 15.833 1.00 25.18  ? 19  TYR A C   1 
ATOM   89   O  O   . TYR A 1 19  ? 63.206  25.244 15.018 1.00 31.78  ? 19  TYR A O   1 
ATOM   90   C  CB  . TYR A 1 19  ? 62.511  26.674 17.832 1.00 24.57  ? 19  TYR A CB  1 
ATOM   91   C  CG  . TYR A 1 19  ? 61.843  27.780 18.596 1.00 28.39  ? 19  TYR A CG  1 
ATOM   92   C  CD1 . TYR A 1 19  ? 62.589  28.696 19.331 1.00 29.36  ? 19  TYR A CD1 1 
ATOM   93   C  CD2 . TYR A 1 19  ? 60.457  27.941 18.548 1.00 26.35  ? 19  TYR A CD2 1 
ATOM   94   C  CE1 . TYR A 1 19  ? 61.962  29.756 20.008 1.00 32.63  ? 19  TYR A CE1 1 
ATOM   95   C  CE2 . TYR A 1 19  ? 59.826  28.991 19.215 1.00 26.38  ? 19  TYR A CE2 1 
ATOM   96   C  CZ  . TYR A 1 19  ? 60.582  29.886 19.939 1.00 29.17  ? 19  TYR A CZ  1 
ATOM   97   O  OH  . TYR A 1 19  ? 59.940  30.898 20.601 1.00 28.72  ? 19  TYR A OH  1 
ATOM   98   N  N   . GLU A 1 20  ? 65.023  25.767 16.200 1.00 27.90  ? 20  GLU A N   1 
ATOM   99   C  CA  . GLU A 1 20  ? 65.808  24.674 15.695 1.00 29.89  ? 20  GLU A CA  1 
ATOM   100  C  C   . GLU A 1 20  ? 65.987  23.745 16.900 1.00 33.44  ? 20  GLU A C   1 
ATOM   101  O  O   . GLU A 1 20  ? 66.518  24.157 17.921 1.00 30.16  ? 20  GLU A O   1 
ATOM   102  C  CB  . GLU A 1 20  ? 67.169  25.191 15.214 1.00 36.77  ? 20  GLU A CB  1 
ATOM   103  C  CG  . GLU A 1 20  ? 67.982  24.161 14.471 1.00 50.27  ? 20  GLU A CG  1 
ATOM   104  C  CD  . GLU A 1 20  ? 69.453  24.169 14.847 1.00 55.56  ? 20  GLU A CD  1 
ATOM   105  O  OE1 . GLU A 1 20  ? 70.082  25.250 14.863 1.00 60.43  ? 20  GLU A OE1 1 
ATOM   106  O  OE2 . GLU A 1 20  ? 69.982  23.072 15.118 1.00 69.85  ? 20  GLU A OE2 1 
ATOM   107  N  N   . LYS A 1 21  ? 65.515  22.509 16.791 1.00 32.10  ? 21  LYS A N   1 
ATOM   108  C  CA  . LYS A 1 21  ? 65.665  21.565 17.882 1.00 36.36  ? 21  LYS A CA  1 
ATOM   109  C  C   . LYS A 1 21  ? 67.131  21.226 18.008 1.00 38.37  ? 21  LYS A C   1 
ATOM   110  O  O   . LYS A 1 21  ? 67.810  20.996 17.012 1.00 46.24  ? 21  LYS A O   1 
ATOM   111  C  CB  . LYS A 1 21  ? 64.821  20.322 17.625 1.00 38.66  ? 21  LYS A CB  1 
ATOM   112  C  CG  . LYS A 1 21  ? 63.325  20.638 17.651 1.00 48.89  ? 21  LYS A CG  1 
ATOM   113  C  CD  . LYS A 1 21  ? 62.448  19.430 17.373 1.00 61.37  ? 21  LYS A CD  1 
ATOM   114  C  CE  . LYS A 1 21  ? 60.975  19.802 17.519 1.00 58.87  ? 21  LYS A CE  1 
ATOM   115  N  NZ  . LYS A 1 21  ? 60.054  18.650 17.307 1.00 71.81  ? 21  LYS A NZ  1 
ATOM   116  N  N   . LEU A 1 22  ? 67.626  21.232 19.239 1.00 38.33  ? 22  LEU A N   1 
ATOM   117  C  CA  . LEU A 1 22  ? 69.030  20.947 19.499 1.00 39.73  ? 22  LEU A CA  1 
ATOM   118  C  C   . LEU A 1 22  ? 69.242  19.581 20.122 1.00 43.47  ? 22  LEU A C   1 
ATOM   119  O  O   . LEU A 1 22  ? 70.177  18.862 19.770 1.00 51.74  ? 22  LEU A O   1 
ATOM   120  C  CB  . LEU A 1 22  ? 69.615  22.009 20.430 1.00 39.87  ? 22  LEU A CB  1 
ATOM   121  C  CG  . LEU A 1 22  ? 69.459  23.463 19.969 1.00 46.67  ? 22  LEU A CG  1 
ATOM   122  C  CD1 . LEU A 1 22  ? 69.928  24.427 21.056 1.00 40.40  ? 22  LEU A CD1 1 
ATOM   123  C  CD2 . LEU A 1 22  ? 70.249  23.660 18.695 1.00 41.37  ? 22  LEU A CD2 1 
ATOM   124  N  N   . ALA A 1 23  ? 68.369  19.215 21.045 1.00 41.38  ? 23  ALA A N   1 
ATOM   125  C  CA  . ALA A 1 23  ? 68.520  17.947 21.728 1.00 39.33  ? 23  ALA A CA  1 
ATOM   126  C  C   . ALA A 1 23  ? 67.307  17.630 22.565 1.00 38.82  ? 23  ALA A C   1 
ATOM   127  O  O   . ALA A 1 23  ? 66.477  18.492 22.843 1.00 37.66  ? 23  ALA A O   1 
ATOM   128  C  CB  . ALA A 1 23  ? 69.755  17.999 22.614 1.00 35.66  ? 23  ALA A CB  1 
ATOM   129  N  N   . LYS A 1 24  ? 67.197  16.373 22.958 1.00 41.17  ? 24  LYS A N   1 
ATOM   130  C  CA  . LYS A 1 24  ? 66.101  15.948 23.795 1.00 36.12  ? 24  LYS A CA  1 
ATOM   131  C  C   . LYS A 1 24  ? 66.499  16.308 25.215 1.00 40.19  ? 24  LYS A C   1 
ATOM   132  O  O   . LYS A 1 24  ? 67.686  16.365 25.545 1.00 42.65  ? 24  LYS A O   1 
ATOM   133  C  CB  . LYS A 1 24  ? 65.896  14.442 23.675 1.00 35.46  ? 24  LYS A CB  1 
ATOM   134  C  CG  . LYS A 1 24  ? 65.042  13.853 24.772 1.00 48.76  ? 24  LYS A CG  1 
ATOM   135  C  CD  . LYS A 1 24  ? 64.872  12.348 24.590 1.00 59.34  ? 24  LYS A CD  1 
ATOM   136  C  CE  . LYS A 1 24  ? 66.219  11.633 24.561 1.00 54.51  ? 24  LYS A CE  1 
ATOM   137  N  NZ  . LYS A 1 24  ? 66.064  10.177 24.270 1.00 79.29  ? 24  LYS A NZ  1 
ATOM   138  N  N   . ILE A 1 25  ? 65.508  16.583 26.046 1.00 36.80  ? 25  ILE A N   1 
ATOM   139  C  CA  . ILE A 1 25  ? 65.764  16.909 27.433 1.00 34.46  ? 25  ILE A CA  1 
ATOM   140  C  C   . ILE A 1 25  ? 65.195  15.750 28.238 1.00 38.75  ? 25  ILE A C   1 
ATOM   141  O  O   . ILE A 1 25  ? 63.995  15.475 28.194 1.00 39.15  ? 25  ILE A O   1 
ATOM   142  C  CB  . ILE A 1 25  ? 65.076  18.227 27.827 1.00 33.19  ? 25  ILE A CB  1 
ATOM   143  C  CG1 . ILE A 1 25  ? 65.655  19.366 26.991 1.00 30.93  ? 25  ILE A CG1 1 
ATOM   144  C  CG2 . ILE A 1 25  ? 65.271  18.502 29.310 1.00 39.41  ? 25  ILE A CG2 1 
ATOM   145  C  CD1 . ILE A 1 25  ? 65.082  20.736 27.297 1.00 30.10  ? 25  ILE A CD1 1 
ATOM   146  N  N   . GLY A 1 26  ? 66.071  15.061 28.955 1.00 38.37  ? 26  GLY A N   1 
ATOM   147  C  CA  . GLY A 1 26  ? 65.649  13.921 29.738 1.00 47.08  ? 26  GLY A CA  1 
ATOM   148  C  C   . GLY A 1 26  ? 65.336  12.728 28.857 1.00 46.19  ? 26  GLY A C   1 
ATOM   149  O  O   . GLY A 1 26  ? 65.598  12.731 27.657 1.00 45.95  ? 26  GLY A O   1 
ATOM   150  N  N   . GLN A 1 27  ? 64.766  11.701 29.469 1.00 53.48  ? 27  GLN A N   1 
ATOM   151  C  CA  . GLN A 1 27  ? 64.405  10.479 28.773 1.00 56.40  ? 27  GLN A CA  1 
ATOM   152  C  C   . GLN A 1 27  ? 62.910  10.248 28.906 1.00 63.35  ? 27  GLN A C   1 
ATOM   153  O  O   . GLN A 1 27  ? 62.486  9.327  29.607 1.00 60.88  ? 27  GLN A O   1 
ATOM   154  C  CB  . GLN A 1 27  ? 65.151  9.295  29.384 1.00 54.95  ? 27  GLN A CB  1 
ATOM   155  C  CG  . GLN A 1 27  ? 66.642  9.278  29.115 1.00 40.96  ? 27  GLN A CG  1 
ATOM   156  C  CD  . GLN A 1 27  ? 66.938  9.003  27.655 1.00 56.01  ? 27  GLN A CD  1 
ATOM   157  O  OE1 . GLN A 1 27  ? 66.261  8.186  27.016 1.00 52.44  ? 27  GLN A OE1 1 
ATOM   158  N  NE2 . GLN A 1 27  ? 67.956  9.671  27.117 1.00 47.44  ? 27  GLN A NE2 1 
ATOM   159  N  N   . GLY A 1 28  ? 62.118  11.091 28.244 1.00 63.74  ? 28  GLY A N   1 
ATOM   160  C  CA  . GLY A 1 28  ? 60.669  10.959 28.298 1.00 70.76  ? 28  GLY A CA  1 
ATOM   161  C  C   . GLY A 1 28  ? 60.147  10.076 27.178 1.00 76.45  ? 28  GLY A C   1 
ATOM   162  O  O   . GLY A 1 28  ? 60.490  8.899  27.108 1.00 79.32  ? 28  GLY A O   1 
ATOM   163  N  N   . THR A 1 29  ? 59.308  10.629 26.306 1.00 80.58  ? 29  THR A N   1 
ATOM   164  C  CA  . THR A 1 29  ? 58.771  9.864  25.179 1.00 82.65  ? 29  THR A CA  1 
ATOM   165  C  C   . THR A 1 29  ? 59.546  10.266 23.925 1.00 79.60  ? 29  THR A C   1 
ATOM   166  O  O   . THR A 1 29  ? 60.549  10.981 24.023 1.00 77.92  ? 29  THR A O   1 
ATOM   167  C  CB  . THR A 1 29  ? 57.249  10.132 24.957 1.00 83.65  ? 29  THR A CB  1 
ATOM   168  O  OG1 . THR A 1 29  ? 57.040  11.501 24.583 1.00 83.64  ? 29  THR A OG1 1 
ATOM   169  C  CG2 . THR A 1 29  ? 56.466  9.837  26.230 1.00 81.59  ? 29  THR A CG2 1 
ATOM   170  N  N   . PHE A 1 30  ? 59.085  9.811  22.760 1.00 76.38  ? 30  PHE A N   1 
ATOM   171  C  CA  . PHE A 1 30  ? 59.744  10.121 21.486 1.00 81.22  ? 30  PHE A CA  1 
ATOM   172  C  C   . PHE A 1 30  ? 60.129  11.602 21.407 1.00 82.12  ? 30  PHE A C   1 
ATOM   173  O  O   . PHE A 1 30  ? 61.304  11.960 21.562 1.00 88.09  ? 30  PHE A O   1 
ATOM   174  C  CB  . PHE A 1 30  ? 58.822  9.748  20.307 1.00 80.97  ? 30  PHE A CB  1 
ATOM   175  C  CG  . PHE A 1 30  ? 59.429  9.985  18.932 1.00 77.98  ? 30  PHE A CG  1 
ATOM   176  C  CD1 . PHE A 1 30  ? 58.643  9.841  17.786 1.00 80.11  ? 30  PHE A CD1 1 
ATOM   177  C  CD2 . PHE A 1 30  ? 60.767  10.354 18.779 1.00 76.88  ? 30  PHE A CD2 1 
ATOM   178  C  CE1 . PHE A 1 30  ? 59.176  10.063 16.513 1.00 78.34  ? 30  PHE A CE1 1 
ATOM   179  C  CE2 . PHE A 1 30  ? 61.311  10.579 17.511 1.00 82.04  ? 30  PHE A CE2 1 
ATOM   180  C  CZ  . PHE A 1 30  ? 60.513  10.433 16.377 1.00 81.47  ? 30  PHE A CZ  1 
ATOM   181  N  N   . GLY A 1 31  ? 59.139  12.455 21.159 1.00 77.66  ? 31  GLY A N   1 
ATOM   182  C  CA  . GLY A 1 31  ? 59.396  13.880 21.070 1.00 71.47  ? 31  GLY A CA  1 
ATOM   183  C  C   . GLY A 1 31  ? 58.560  14.633 22.085 1.00 68.81  ? 31  GLY A C   1 
ATOM   184  O  O   . GLY A 1 31  ? 57.652  15.377 21.714 1.00 71.41  ? 31  GLY A O   1 
ATOM   185  N  N   . GLU A 1 32  ? 58.869  14.431 23.365 1.00 60.14  ? 32  GLU A N   1 
ATOM   186  C  CA  . GLU A 1 32  ? 58.153  15.075 24.461 1.00 51.53  ? 32  GLU A CA  1 
ATOM   187  C  C   . GLU A 1 32  ? 58.752  16.434 24.836 1.00 42.97  ? 32  GLU A C   1 
ATOM   188  O  O   . GLU A 1 32  ? 58.051  17.441 24.806 1.00 51.34  ? 32  GLU A O   1 
ATOM   189  C  CB  . GLU A 1 32  ? 58.149  14.163 25.681 1.00 40.87  ? 32  GLU A CB  1 
ATOM   190  C  CG  . GLU A 1 32  ? 57.325  14.672 26.829 1.00 64.46  ? 32  GLU A CG  1 
ATOM   191  C  CD  . GLU A 1 32  ? 57.648  13.962 28.120 1.00 70.08  ? 32  GLU A CD  1 
ATOM   192  O  OE1 . GLU A 1 32  ? 58.783  14.125 28.616 1.00 80.04  ? 32  GLU A OE1 1 
ATOM   193  O  OE2 . GLU A 1 32  ? 56.774  13.237 28.636 1.00 79.02  ? 32  GLU A OE2 1 
ATOM   194  N  N   . VAL A 1 33  ? 60.035  16.466 25.194 1.00 37.60  ? 33  VAL A N   1 
ATOM   195  C  CA  . VAL A 1 33  ? 60.692  17.716 25.553 1.00 32.59  ? 33  VAL A CA  1 
ATOM   196  C  C   . VAL A 1 33  ? 62.000  17.918 24.782 1.00 35.40  ? 33  VAL A C   1 
ATOM   197  O  O   . VAL A 1 33  ? 62.869  17.061 24.786 1.00 33.72  ? 33  VAL A O   1 
ATOM   198  C  CB  . VAL A 1 33  ? 60.983  17.784 27.060 1.00 42.05  ? 33  VAL A CB  1 
ATOM   199  C  CG1 . VAL A 1 33  ? 61.505  19.169 27.419 1.00 31.65  ? 33  VAL A CG1 1 
ATOM   200  C  CG2 . VAL A 1 33  ? 59.727  17.483 27.845 1.00 32.39  ? 33  VAL A CG2 1 
ATOM   201  N  N   . PHE A 1 34  ? 62.126  19.065 24.116 1.00 34.02  ? 34  PHE A N   1 
ATOM   202  C  CA  . PHE A 1 34  ? 63.313  19.385 23.324 1.00 32.37  ? 34  PHE A CA  1 
ATOM   203  C  C   . PHE A 1 34  ? 63.958  20.694 23.759 1.00 30.13  ? 34  PHE A C   1 
ATOM   204  O  O   . PHE A 1 34  ? 63.268  21.657 24.069 1.00 28.65  ? 34  PHE A O   1 
ATOM   205  C  CB  . PHE A 1 34  ? 62.975  19.614 21.843 1.00 38.31  ? 34  PHE A CB  1 
ATOM   206  C  CG  . PHE A 1 34  ? 62.417  18.431 21.123 1.00 51.64  ? 34  PHE A CG  1 
ATOM   207  C  CD1 . PHE A 1 34  ? 63.257  17.434 20.635 1.00 56.10  ? 34  PHE A CD1 1 
ATOM   208  C  CD2 . PHE A 1 34  ? 61.054  18.370 20.831 1.00 48.84  ? 34  PHE A CD2 1 
ATOM   209  C  CE1 . PHE A 1 34  ? 62.749  16.396 19.852 1.00 64.57  ? 34  PHE A CE1 1 
ATOM   210  C  CE2 . PHE A 1 34  ? 60.533  17.337 20.049 1.00 58.54  ? 34  PHE A CE2 1 
ATOM   211  C  CZ  . PHE A 1 34  ? 61.384  16.349 19.557 1.00 62.37  ? 34  PHE A CZ  1 
ATOM   212  N  N   . LYS A 1 35  ? 65.281  20.717 23.745 1.00 28.94  ? 35  LYS A N   1 
ATOM   213  C  CA  . LYS A 1 35  ? 66.032  21.931 23.999 1.00 30.86  ? 35  LYS A CA  1 
ATOM   214  C  C   . LYS A 1 35  ? 66.131  22.486 22.562 1.00 36.72  ? 35  LYS A C   1 
ATOM   215  O  O   . LYS A 1 35  ? 66.336  21.716 21.617 1.00 28.89  ? 35  LYS A O   1 
ATOM   216  C  CB  . LYS A 1 35  ? 67.418  21.599 24.521 1.00 35.38  ? 35  LYS A CB  1 
ATOM   217  C  CG  . LYS A 1 35  ? 68.286  22.808 24.797 1.00 37.49  ? 35  LYS A CG  1 
ATOM   218  C  CD  . LYS A 1 35  ? 69.649  22.370 25.296 1.00 37.36  ? 35  LYS A CD  1 
ATOM   219  C  CE  . LYS A 1 35  ? 70.534  23.573 25.561 1.00 59.95  ? 35  LYS A CE  1 
ATOM   220  N  NZ  . LYS A 1 35  ? 71.927  23.189 25.930 1.00 67.12  ? 35  LYS A NZ  1 
ATOM   221  N  N   . ALA A 1 36  ? 65.956  23.794 22.393 1.00 29.72  ? 36  ALA A N   1 
ATOM   222  C  CA  . ALA A 1 36  ? 66.006  24.413 21.072 1.00 29.26  ? 36  ALA A CA  1 
ATOM   223  C  C   . ALA A 1 36  ? 66.447  25.866 21.154 1.00 30.56  ? 36  ALA A C   1 
ATOM   224  O  O   . ALA A 1 36  ? 66.658  26.404 22.242 1.00 25.67  ? 36  ALA A O   1 
ATOM   225  C  CB  . ALA A 1 36  ? 64.624  24.318 20.395 1.00 18.47  ? 36  ALA A CB  1 
ATOM   226  N  N   . ARG A 1 37  ? 66.593  26.499 19.995 1.00 30.62  ? 37  ARG A N   1 
ATOM   227  C  CA  . ARG A 1 37  ? 67.006  27.900 19.951 1.00 25.37  ? 37  ARG A CA  1 
ATOM   228  C  C   . ARG A 1 37  ? 66.223  28.647 18.879 1.00 28.67  ? 37  ARG A C   1 
ATOM   229  O  O   . ARG A 1 37  ? 65.867  28.083 17.839 1.00 34.03  ? 37  ARG A O   1 
ATOM   230  C  CB  . ARG A 1 37  ? 68.509  28.022 19.665 1.00 34.25  ? 37  ARG A CB  1 
ATOM   231  C  CG  . ARG A 1 37  ? 68.907  27.740 18.203 1.00 26.53  ? 37  ARG A CG  1 
ATOM   232  C  CD  . ARG A 1 37  ? 70.407  27.719 18.016 1.00 24.07  ? 37  ARG A CD  1 
ATOM   233  N  NE  . ARG A 1 37  ? 71.045  29.022 18.201 1.00 28.03  ? 37  ARG A NE  1 
ATOM   234  C  CZ  . ARG A 1 37  ? 71.145  29.970 17.268 1.00 26.23  ? 37  ARG A CZ  1 
ATOM   235  N  NH1 . ARG A 1 37  ? 70.645  29.797 16.033 1.00 26.50  ? 37  ARG A NH1 1 
ATOM   236  N  NH2 . ARG A 1 37  ? 71.765  31.095 17.569 1.00 19.34  ? 37  ARG A NH2 1 
ATOM   237  N  N   . HIS A 1 38  ? 65.929  29.910 19.144 1.00 26.53  ? 38  HIS A N   1 
ATOM   238  C  CA  . HIS A 1 38  ? 65.222  30.723 18.174 1.00 26.92  ? 38  HIS A CA  1 
ATOM   239  C  C   . HIS A 1 38  ? 66.223  30.957 17.026 1.00 32.45  ? 38  HIS A C   1 
ATOM   240  O  O   . HIS A 1 38  ? 67.347  31.392 17.247 1.00 33.68  ? 38  HIS A O   1 
ATOM   241  C  CB  . HIS A 1 38  ? 64.795  32.040 18.818 1.00 23.76  ? 38  HIS A CB  1 
ATOM   242  C  CG  . HIS A 1 38  ? 63.821  32.818 18.000 1.00 33.40  ? 38  HIS A CG  1 
ATOM   243  N  ND1 . HIS A 1 38  ? 64.205  33.593 16.927 1.00 31.40  ? 38  HIS A ND1 1 
ATOM   244  C  CD2 . HIS A 1 38  ? 62.471  32.892 18.056 1.00 31.11  ? 38  HIS A CD2 1 
ATOM   245  C  CE1 . HIS A 1 38  ? 63.133  34.108 16.355 1.00 33.51  ? 38  HIS A CE1 1 
ATOM   246  N  NE2 . HIS A 1 38  ? 62.067  33.698 17.020 1.00 37.15  ? 38  HIS A NE2 1 
ATOM   247  N  N   . ARG A 1 39  ? 65.808  30.657 15.806 1.00 31.29  ? 39  ARG A N   1 
ATOM   248  C  CA  . ARG A 1 39  ? 66.688  30.793 14.654 1.00 36.58  ? 39  ARG A CA  1 
ATOM   249  C  C   . ARG A 1 39  ? 67.220  32.193 14.392 1.00 37.77  ? 39  ARG A C   1 
ATOM   250  O  O   . ARG A 1 39  ? 68.251  32.344 13.752 1.00 29.15  ? 39  ARG A O   1 
ATOM   251  C  CB  . ARG A 1 39  ? 65.996  30.262 13.405 1.00 28.91  ? 39  ARG A CB  1 
ATOM   252  C  CG  . ARG A 1 39  ? 65.702  28.764 13.466 1.00 32.30  ? 39  ARG A CG  1 
ATOM   253  C  CD  . ARG A 1 39  ? 64.966  28.320 12.217 1.00 38.47  ? 39  ARG A CD  1 
ATOM   254  N  NE  . ARG A 1 39  ? 64.624  26.908 12.270 1.00 37.66  ? 39  ARG A NE  1 
ATOM   255  C  CZ  . ARG A 1 39  ? 65.471  25.920 12.007 1.00 49.02  ? 39  ARG A CZ  1 
ATOM   256  N  NH1 . ARG A 1 39  ? 66.726  26.189 11.657 1.00 40.05  ? 39  ARG A NH1 1 
ATOM   257  N  NH2 . ARG A 1 39  ? 65.066  24.659 12.123 1.00 39.86  ? 39  ARG A NH2 1 
ATOM   258  N  N   . LYS A 1 40  ? 66.541  33.214 14.899 1.00 33.22  ? 40  LYS A N   1 
ATOM   259  C  CA  . LYS A 1 40  ? 67.010  34.572 14.682 1.00 33.40  ? 40  LYS A CA  1 
ATOM   260  C  C   . LYS A 1 40  ? 67.679  35.219 15.889 1.00 34.51  ? 40  LYS A C   1 
ATOM   261  O  O   . LYS A 1 40  ? 68.710  35.870 15.744 1.00 35.77  ? 40  LYS A O   1 
ATOM   262  C  CB  . LYS A 1 40  ? 65.860  35.430 14.160 1.00 39.83  ? 40  LYS A CB  1 
ATOM   263  C  CG  . LYS A 1 40  ? 65.354  34.898 12.823 1.00 49.29  ? 40  LYS A CG  1 
ATOM   264  C  CD  . LYS A 1 40  ? 64.095  35.578 12.329 1.00 61.84  ? 40  LYS A CD  1 
ATOM   265  C  CE  . LYS A 1 40  ? 63.569  34.856 11.092 1.00 64.54  ? 40  LYS A CE  1 
ATOM   266  N  NZ  . LYS A 1 40  ? 62.344  35.475 10.533 1.00 73.65  ? 40  LYS A NZ  1 
ATOM   267  N  N   . THR A 1 41  ? 67.114  35.036 17.077 1.00 26.81  ? 41  THR A N   1 
ATOM   268  C  CA  . THR A 1 41  ? 67.706  35.624 18.276 1.00 28.91  ? 41  THR A CA  1 
ATOM   269  C  C   . THR A 1 41  ? 68.670  34.681 18.964 1.00 28.79  ? 41  THR A C   1 
ATOM   270  O  O   . THR A 1 41  ? 69.544  35.126 19.697 1.00 34.23  ? 41  THR A O   1 
ATOM   271  C  CB  . THR A 1 41  ? 66.646  35.999 19.323 1.00 29.90  ? 41  THR A CB  1 
ATOM   272  O  OG1 . THR A 1 41  ? 65.866  34.838 19.633 1.00 32.87  ? 41  THR A OG1 1 
ATOM   273  C  CG2 . THR A 1 41  ? 65.746  37.111 18.814 1.00 25.91  ? 41  THR A CG2 1 
ATOM   274  N  N   . GLY A 1 42  ? 68.501  33.379 18.748 1.00 29.95  ? 42  GLY A N   1 
ATOM   275  C  CA  . GLY A 1 42  ? 69.364  32.407 19.404 1.00 33.16  ? 42  GLY A CA  1 
ATOM   276  C  C   . GLY A 1 42  ? 68.876  32.094 20.818 1.00 24.61  ? 42  GLY A C   1 
ATOM   277  O  O   . GLY A 1 42  ? 69.529  31.391 21.576 1.00 35.17  ? 42  GLY A O   1 
ATOM   278  N  N   . GLN A 1 43  ? 67.717  32.632 21.168 1.00 32.49  ? 43  GLN A N   1 
ATOM   279  C  CA  . GLN A 1 43  ? 67.113  32.435 22.482 1.00 28.30  ? 43  GLN A CA  1 
ATOM   280  C  C   . GLN A 1 43  ? 66.895  30.958 22.817 1.00 34.69  ? 43  GLN A C   1 
ATOM   281  O  O   . GLN A 1 43  ? 66.153  30.245 22.131 1.00 29.30  ? 43  GLN A O   1 
ATOM   282  C  CB  . GLN A 1 43  ? 65.778  33.171 22.544 1.00 28.56  ? 43  GLN A CB  1 
ATOM   283  C  CG  . GLN A 1 43  ? 65.014  33.001 23.849 1.00 26.27  ? 43  GLN A CG  1 
ATOM   284  C  CD  . GLN A 1 43  ? 63.631  33.614 23.787 1.00 32.31  ? 43  GLN A CD  1 
ATOM   285  O  OE1 . GLN A 1 43  ? 62.888  33.413 22.817 1.00 47.88  ? 43  GLN A OE1 1 
ATOM   286  N  NE2 . GLN A 1 43  ? 63.264  34.347 24.833 1.00 40.96  ? 43  GLN A NE2 1 
ATOM   287  N  N   . LYS A 1 44  ? 67.552  30.510 23.878 1.00 33.47  ? 44  LYS A N   1 
ATOM   288  C  CA  . LYS A 1 44  ? 67.448  29.131 24.335 1.00 35.71  ? 44  LYS A CA  1 
ATOM   289  C  C   . LYS A 1 44  ? 66.058  28.868 24.908 1.00 35.79  ? 44  LYS A C   1 
ATOM   290  O  O   . LYS A 1 44  ? 65.600  29.597 25.782 1.00 41.07  ? 44  LYS A O   1 
ATOM   291  C  CB  . LYS A 1 44  ? 68.501  28.869 25.411 1.00 33.69  ? 44  LYS A CB  1 
ATOM   292  C  CG  . LYS A 1 44  ? 69.787  28.294 24.885 1.00 58.75  ? 44  LYS A CG  1 
ATOM   293  C  CD  . LYS A 1 44  ? 69.520  26.967 24.186 1.00 64.36  ? 44  LYS A CD  1 
ATOM   294  C  CE  . LYS A 1 44  ? 70.795  26.382 23.621 1.00 56.83  ? 44  LYS A CE  1 
ATOM   295  N  NZ  . LYS A 1 44  ? 71.773  26.111 24.707 1.00 74.16  ? 44  LYS A NZ  1 
ATOM   296  N  N   . VAL A 1 45  ? 65.389  27.827 24.429 1.00 34.72  ? 45  VAL A N   1 
ATOM   297  C  CA  . VAL A 1 45  ? 64.051  27.507 24.932 1.00 29.34  ? 45  VAL A CA  1 
ATOM   298  C  C   . VAL A 1 45  ? 63.885  25.996 25.087 1.00 29.97  ? 45  VAL A C   1 
ATOM   299  O  O   . VAL A 1 45  ? 64.746  25.219 24.682 1.00 35.91  ? 45  VAL A O   1 
ATOM   300  C  CB  . VAL A 1 45  ? 62.957  27.975 23.961 1.00 29.70  ? 45  VAL A CB  1 
ATOM   301  C  CG1 . VAL A 1 45  ? 63.156  29.446 23.583 1.00 27.54  ? 45  VAL A CG1 1 
ATOM   302  C  CG2 . VAL A 1 45  ? 62.969  27.090 22.749 1.00 26.65  ? 45  VAL A CG2 1 
ATOM   303  N  N   . ALA A 1 46  ? 62.770  25.587 25.673 1.00 31.65  ? 46  ALA A N   1 
ATOM   304  C  CA  . ALA A 1 46  ? 62.459  24.170 25.822 1.00 26.66  ? 46  ALA A CA  1 
ATOM   305  C  C   . ALA A 1 46  ? 61.071  24.029 25.240 1.00 27.53  ? 46  ALA A C   1 
ATOM   306  O  O   . ALA A 1 46  ? 60.160  24.769 25.610 1.00 30.97  ? 46  ALA A O   1 
ATOM   307  C  CB  . ALA A 1 46  ? 62.475  23.748 27.293 1.00 25.71  ? 46  ALA A CB  1 
ATOM   308  N  N   . LEU A 1 47  ? 60.927  23.096 24.309 1.00 23.47  ? 47  LEU A N   1 
ATOM   309  C  CA  . LEU A 1 47  ? 59.659  22.826 23.651 1.00 25.16  ? 47  LEU A CA  1 
ATOM   310  C  C   . LEU A 1 47  ? 59.028  21.617 24.322 1.00 29.91  ? 47  LEU A C   1 
ATOM   311  O  O   . LEU A 1 47  ? 59.648  20.547 24.419 1.00 33.47  ? 47  LEU A O   1 
ATOM   312  C  CB  . LEU A 1 47  ? 59.892  22.526 22.162 1.00 22.32  ? 47  LEU A CB  1 
ATOM   313  C  CG  . LEU A 1 47  ? 60.818  23.538 21.477 1.00 22.05  ? 47  LEU A CG  1 
ATOM   314  C  CD1 . LEU A 1 47  ? 61.222  23.017 20.081 1.00 32.52  ? 47  LEU A CD1 1 
ATOM   315  C  CD2 . LEU A 1 47  ? 60.130  24.882 21.383 1.00 15.66  ? 47  LEU A CD2 1 
ATOM   316  N  N   . LYS A 1 48  ? 57.790  21.776 24.774 1.00 27.60  ? 48  LYS A N   1 
ATOM   317  C  CA  . LYS A 1 48  ? 57.114  20.686 25.447 1.00 28.35  ? 48  LYS A CA  1 
ATOM   318  C  C   . LYS A 1 48  ? 55.818  20.387 24.730 1.00 33.73  ? 48  LYS A C   1 
ATOM   319  O  O   . LYS A 1 48  ? 54.886  21.187 24.722 1.00 35.63  ? 48  LYS A O   1 
ATOM   320  C  CB  . LYS A 1 48  ? 56.892  21.051 26.917 1.00 34.44  ? 48  LYS A CB  1 
ATOM   321  C  CG  . LYS A 1 48  ? 56.054  20.077 27.717 1.00 50.20  ? 48  LYS A CG  1 
ATOM   322  C  CD  . LYS A 1 48  ? 55.960  20.567 29.158 1.00 60.44  ? 48  LYS A CD  1 
ATOM   323  C  CE  . LYS A 1 48  ? 54.626  20.213 29.790 1.00 57.02  ? 48  LYS A CE  1 
ATOM   324  N  NZ  . LYS A 1 48  ? 54.572  20.663 31.207 1.00 55.59  ? 48  LYS A NZ  1 
ATOM   325  N  N   . LYS A 1 49  ? 55.787  19.221 24.104 1.00 33.92  ? 49  LYS A N   1 
ATOM   326  C  CA  . LYS A 1 49  ? 54.640  18.781 23.339 1.00 33.95  ? 49  LYS A CA  1 
ATOM   327  C  C   . LYS A 1 49  ? 53.449  18.425 24.201 1.00 35.49  ? 49  LYS A C   1 
ATOM   328  O  O   . LYS A 1 49  ? 53.574  17.748 25.223 1.00 37.02  ? 49  LYS A O   1 
ATOM   329  C  CB  . LYS A 1 49  ? 55.025  17.580 22.479 1.00 38.05  ? 49  LYS A CB  1 
ATOM   330  C  CG  . LYS A 1 49  ? 53.890  16.999 21.656 1.00 50.61  ? 49  LYS A CG  1 
ATOM   331  C  CD  . LYS A 1 49  ? 54.378  15.803 20.861 1.00 57.08  ? 49  LYS A CD  1 
ATOM   332  C  CE  . LYS A 1 49  ? 53.259  15.142 20.076 1.00 62.84  ? 49  LYS A CE  1 
ATOM   333  N  NZ  . LYS A 1 49  ? 53.781  14.022 19.230 1.00 63.29  ? 49  LYS A NZ  1 
ATOM   334  N  N   . VAL A 1 50  ? 52.290  18.915 23.791 1.00 35.15  ? 50  VAL A N   1 
ATOM   335  C  CA  . VAL A 1 50  ? 51.060  18.621 24.491 1.00 43.99  ? 50  VAL A CA  1 
ATOM   336  C  C   . VAL A 1 50  ? 50.771  17.181 24.107 1.00 44.81  ? 50  VAL A C   1 
ATOM   337  O  O   . VAL A 1 50  ? 50.488  16.894 22.943 1.00 44.91  ? 50  VAL A O   1 
ATOM   338  C  CB  . VAL A 1 50  ? 49.923  19.540 24.007 1.00 46.01  ? 50  VAL A CB  1 
ATOM   339  C  CG1 . VAL A 1 50  ? 48.577  19.007 24.487 1.00 40.66  ? 50  VAL A CG1 1 
ATOM   340  C  CG2 . VAL A 1 50  ? 50.156  20.958 24.525 1.00 36.15  ? 50  VAL A CG2 1 
ATOM   341  N  N   . LEU A 1 51  ? 50.870  16.269 25.069 1.00 37.21  ? 51  LEU A N   1 
ATOM   342  C  CA  . LEU A 1 51  ? 50.631  14.869 24.768 1.00 46.58  ? 51  LEU A CA  1 
ATOM   343  C  C   . LEU A 1 51  ? 49.145  14.598 24.681 1.00 47.75  ? 51  LEU A C   1 
ATOM   344  O  O   . LEU A 1 51  ? 48.374  15.017 25.551 1.00 48.81  ? 51  LEU A O   1 
ATOM   345  C  CB  . LEU A 1 51  ? 51.274  13.959 25.826 1.00 47.99  ? 51  LEU A CB  1 
ATOM   346  C  CG  . LEU A 1 51  ? 52.797  14.065 25.977 1.00 58.41  ? 51  LEU A CG  1 
ATOM   347  C  CD1 . LEU A 1 51  ? 53.270  13.165 27.103 1.00 58.30  ? 51  LEU A CD1 1 
ATOM   348  C  CD2 . LEU A 1 51  ? 53.480  13.688 24.673 1.00 45.53  ? 51  LEU A CD2 1 
ATOM   349  N  N   . MET A 1 52  ? 48.751  13.897 23.622 1.00 50.48  ? 52  MET A N   1 
ATOM   350  C  CA  . MET A 1 52  ? 47.353  13.545 23.406 1.00 66.39  ? 52  MET A CA  1 
ATOM   351  C  C   . MET A 1 52  ? 47.164  12.099 22.940 1.00 71.72  ? 52  MET A C   1 
ATOM   352  O  O   . MET A 1 52  ? 46.416  11.844 21.998 1.00 76.11  ? 52  MET A O   1 
ATOM   353  C  CB  . MET A 1 52  ? 46.727  14.498 22.384 1.00 68.65  ? 52  MET A CB  1 
ATOM   354  C  CG  . MET A 1 52  ? 46.712  15.947 22.834 1.00 69.75  ? 52  MET A CG  1 
ATOM   355  S  SD  . MET A 1 52  ? 45.891  17.010 21.659 1.00 85.94  ? 52  MET A SD  1 
ATOM   356  C  CE  . MET A 1 52  ? 47.289  17.703 20.735 1.00 72.13  ? 52  MET A CE  1 
ATOM   357  N  N   . GLU A 1 53  ? 47.835  11.152 23.590 1.00 73.92  ? 53  GLU A N   1 
ATOM   358  C  CA  . GLU A 1 53  ? 47.684  9.756  23.195 1.00 81.48  ? 53  GLU A CA  1 
ATOM   359  C  C   . GLU A 1 53  ? 46.247  9.349  23.481 1.00 82.60  ? 53  GLU A C   1 
ATOM   360  O  O   . GLU A 1 53  ? 45.642  8.588  22.724 1.00 85.60  ? 53  GLU A O   1 
ATOM   361  C  CB  . GLU A 1 53  ? 48.647  8.852  23.967 1.00 82.20  ? 53  GLU A CB  1 
ATOM   362  C  CG  . GLU A 1 53  ? 48.654  7.419  23.454 1.00 88.41  ? 53  GLU A CG  1 
ATOM   363  C  CD  . GLU A 1 53  ? 49.729  6.568  24.101 1.00 96.01  ? 53  GLU A CD  1 
ATOM   364  O  OE1 . GLU A 1 53  ? 50.915  6.958  24.024 1.00 92.93  ? 53  GLU A OE1 1 
ATOM   365  O  OE2 . GLU A 1 53  ? 49.389  5.508  24.681 1.00 95.83  ? 53  GLU A OE2 1 
ATOM   366  N  N   . ASN A 1 54  ? 45.711  9.863  24.584 1.00 83.15  ? 54  ASN A N   1 
ATOM   367  C  CA  . ASN A 1 54  ? 44.332  9.594  24.965 1.00 81.97  ? 54  ASN A CA  1 
ATOM   368  C  C   . ASN A 1 54  ? 43.476  10.677 24.317 1.00 81.17  ? 54  ASN A C   1 
ATOM   369  O  O   . ASN A 1 54  ? 43.463  11.832 24.758 1.00 77.91  ? 54  ASN A O   1 
ATOM   370  C  CB  . ASN A 1 54  ? 44.168  9.644  26.485 1.00 83.13  ? 54  ASN A CB  1 
ATOM   371  C  CG  . ASN A 1 54  ? 42.756  9.306  26.930 1.00 85.26  ? 54  ASN A CG  1 
ATOM   372  O  OD1 . ASN A 1 54  ? 42.429  9.387  28.115 1.00 95.10  ? 54  ASN A OD1 1 
ATOM   373  N  ND2 . ASN A 1 54  ? 41.911  8.921  25.980 1.00 87.77  ? 54  ASN A ND2 1 
ATOM   374  N  N   . GLU A 1 55  ? 42.773  10.297 23.257 1.00 83.77  ? 55  GLU A N   1 
ATOM   375  C  CA  . GLU A 1 55  ? 41.927  11.227 22.527 1.00 84.80  ? 55  GLU A CA  1 
ATOM   376  C  C   . GLU A 1 55  ? 40.463  10.820 22.582 1.00 85.59  ? 55  GLU A C   1 
ATOM   377  O  O   . GLU A 1 55  ? 40.089  9.739  22.127 1.00 89.84  ? 55  GLU A O   1 
ATOM   378  C  CB  . GLU A 1 55  ? 42.378  11.302 21.067 1.00 88.13  ? 55  GLU A CB  1 
ATOM   379  C  CG  . GLU A 1 55  ? 43.848  11.643 20.894 1.00 88.25  ? 55  GLU A CG  1 
ATOM   380  C  CD  . GLU A 1 55  ? 44.612  10.572 20.134 1.00 94.45  ? 55  GLU A CD  1 
ATOM   381  O  OE1 . GLU A 1 55  ? 44.587  9.398  20.566 1.00 92.43  ? 55  GLU A OE1 1 
ATOM   382  O  OE2 . GLU A 1 55  ? 45.239  10.906 19.105 1.00 97.26  ? 55  GLU A OE2 1 
ATOM   383  N  N   . LYS A 1 56  ? 39.642  11.697 23.145 1.00 83.03  ? 56  LYS A N   1 
ATOM   384  C  CA  . LYS A 1 56  ? 38.210  11.470 23.265 1.00 80.08  ? 56  LYS A CA  1 
ATOM   385  C  C   . LYS A 1 56  ? 37.647  12.836 23.595 1.00 74.86  ? 56  LYS A C   1 
ATOM   386  O  O   . LYS A 1 56  ? 36.953  13.445 22.786 1.00 84.44  ? 56  LYS A O   1 
ATOM   387  C  CB  . LYS A 1 56  ? 37.902  10.503 24.408 1.00 87.59  ? 56  LYS A CB  1 
ATOM   388  C  CG  . LYS A 1 56  ? 36.569  9.743  24.282 1.00 91.98  ? 56  LYS A CG  1 
ATOM   389  C  CD  . LYS A 1 56  ? 35.362  10.636 23.969 1.00 83.09  ? 56  LYS A CD  1 
ATOM   390  C  CE  . LYS A 1 56  ? 35.011  10.596 22.484 1.00 77.16  ? 56  LYS A CE  1 
ATOM   391  N  NZ  . LYS A 1 56  ? 33.643  11.132 22.207 1.00 74.32  ? 56  LYS A NZ  1 
ATOM   392  N  N   . GLU A 1 57  ? 37.970  13.317 24.790 1.00 57.61  ? 57  GLU A N   1 
ATOM   393  C  CA  . GLU A 1 57  ? 37.522  14.626 25.237 1.00 50.71  ? 57  GLU A CA  1 
ATOM   394  C  C   . GLU A 1 57  ? 38.294  15.770 24.577 1.00 41.13  ? 57  GLU A C   1 
ATOM   395  O  O   . GLU A 1 57  ? 38.425  16.838 25.161 1.00 47.69  ? 57  GLU A O   1 
ATOM   396  C  CB  . GLU A 1 57  ? 37.664  14.739 26.757 1.00 41.76  ? 57  GLU A CB  1 
ATOM   397  C  CG  . GLU A 1 57  ? 36.743  13.823 27.526 1.00 57.62  ? 57  GLU A CG  1 
ATOM   398  C  CD  . GLU A 1 57  ? 35.323  13.898 27.011 1.00 61.98  ? 57  GLU A CD  1 
ATOM   399  O  OE1 . GLU A 1 57  ? 35.056  13.384 25.902 1.00 67.18  ? 57  GLU A OE1 1 
ATOM   400  O  OE2 . GLU A 1 57  ? 34.479  14.486 27.710 1.00 66.71  ? 57  GLU A OE2 1 
ATOM   401  N  N   . GLY A 1 58  ? 38.807  15.534 23.373 1.00 39.08  ? 58  GLY A N   1 
ATOM   402  C  CA  . GLY A 1 58  ? 39.554  16.556 22.661 1.00 43.09  ? 58  GLY A CA  1 
ATOM   403  C  C   . GLY A 1 58  ? 40.769  17.067 23.419 1.00 50.32  ? 58  GLY A C   1 
ATOM   404  O  O   . GLY A 1 58  ? 41.367  16.325 24.205 1.00 48.29  ? 58  GLY A O   1 
ATOM   405  N  N   . PHE A 1 59  ? 41.125  18.334 23.194 1.00 39.73  ? 59  PHE A N   1 
ATOM   406  C  CA  . PHE A 1 59  ? 42.280  18.943 23.849 1.00 38.07  ? 59  PHE A CA  1 
ATOM   407  C  C   . PHE A 1 59  ? 42.133  18.764 25.356 1.00 44.82  ? 59  PHE A C   1 
ATOM   408  O  O   . PHE A 1 59  ? 41.132  19.150 25.944 1.00 45.84  ? 59  PHE A O   1 
ATOM   409  C  CB  . PHE A 1 59  ? 42.378  20.431 23.500 1.00 37.87  ? 59  PHE A CB  1 
ATOM   410  C  CG  . PHE A 1 59  ? 43.783  20.983 23.558 1.00 30.02  ? 59  PHE A CG  1 
ATOM   411  C  CD1 . PHE A 1 59  ? 44.629  20.884 22.467 1.00 29.09  ? 59  PHE A CD1 1 
ATOM   412  C  CD2 . PHE A 1 59  ? 44.254  21.605 24.706 1.00 26.86  ? 59  PHE A CD2 1 
ATOM   413  C  CE1 . PHE A 1 59  ? 45.930  21.399 22.516 1.00 34.16  ? 59  PHE A CE1 1 
ATOM   414  C  CE2 . PHE A 1 59  ? 45.541  22.121 24.768 1.00 32.30  ? 59  PHE A CE2 1 
ATOM   415  C  CZ  . PHE A 1 59  ? 46.383  22.018 23.669 1.00 29.28  ? 59  PHE A CZ  1 
ATOM   416  N  N   . PRO A 1 60  ? 43.145  18.180 26.001 1.00 38.86  ? 60  PRO A N   1 
ATOM   417  C  CA  . PRO A 1 60  ? 43.158  17.918 27.444 1.00 39.88  ? 60  PRO A CA  1 
ATOM   418  C  C   . PRO A 1 60  ? 42.883  19.116 28.358 1.00 39.96  ? 60  PRO A C   1 
ATOM   419  O  O   . PRO A 1 60  ? 43.598  20.115 28.324 1.00 43.19  ? 60  PRO A O   1 
ATOM   420  C  CB  . PRO A 1 60  ? 44.554  17.320 27.672 1.00 32.68  ? 60  PRO A CB  1 
ATOM   421  C  CG  . PRO A 1 60  ? 44.906  16.739 26.301 1.00 27.28  ? 60  PRO A CG  1 
ATOM   422  C  CD  . PRO A 1 60  ? 44.431  17.810 25.385 1.00 35.22  ? 60  PRO A CD  1 
ATOM   423  N  N   . ILE A 1 61  ? 41.855  19.000 29.190 1.00 41.01  ? 61  ILE A N   1 
ATOM   424  C  CA  . ILE A 1 61  ? 41.513  20.069 30.109 1.00 42.42  ? 61  ILE A CA  1 
ATOM   425  C  C   . ILE A 1 61  ? 42.728  20.325 30.983 1.00 40.86  ? 61  ILE A C   1 
ATOM   426  O  O   . ILE A 1 61  ? 42.923  21.421 31.513 1.00 40.33  ? 61  ILE A O   1 
ATOM   427  C  CB  . ILE A 1 61  ? 40.302  19.692 31.003 1.00 45.54  ? 61  ILE A CB  1 
ATOM   428  C  CG1 . ILE A 1 61  ? 39.879  20.909 31.838 1.00 53.11  ? 61  ILE A CG1 1 
ATOM   429  C  CG2 . ILE A 1 61  ? 40.660  18.524 31.913 1.00 41.76  ? 61  ILE A CG2 1 
ATOM   430  C  CD1 . ILE A 1 61  ? 38.610  20.719 32.660 1.00 51.50  ? 61  ILE A CD1 1 
ATOM   431  N  N   . THR A 1 62  ? 43.554  19.298 31.118 1.00 38.23  ? 62  THR A N   1 
ATOM   432  C  CA  . THR A 1 62  ? 44.753  19.396 31.918 1.00 36.98  ? 62  THR A CA  1 
ATOM   433  C  C   . THR A 1 62  ? 45.736  20.340 31.240 1.00 30.44  ? 62  THR A C   1 
ATOM   434  O  O   . THR A 1 62  ? 46.425  21.113 31.901 1.00 36.57  ? 62  THR A O   1 
ATOM   435  C  CB  . THR A 1 62  ? 45.395  18.011 32.105 1.00 39.94  ? 62  THR A CB  1 
ATOM   436  O  OG1 . THR A 1 62  ? 46.555  18.136 32.932 1.00 60.26  ? 62  THR A OG1 1 
ATOM   437  C  CG2 . THR A 1 62  ? 45.784  17.413 30.774 1.00 43.05  ? 62  THR A CG2 1 
ATOM   438  N  N   . ALA A 1 63  ? 45.806  20.258 29.918 1.00 27.56  ? 63  ALA A N   1 
ATOM   439  C  CA  . ALA A 1 63  ? 46.679  21.123 29.138 1.00 33.28  ? 63  ALA A CA  1 
ATOM   440  C  C   . ALA A 1 63  ? 46.123  22.563 29.170 1.00 24.31  ? 63  ALA A C   1 
ATOM   441  O  O   . ALA A 1 63  ? 46.865  23.512 29.356 1.00 28.28  ? 63  ALA A O   1 
ATOM   442  C  CB  . ALA A 1 63  ? 46.746  20.617 27.700 1.00 28.69  ? 63  ALA A CB  1 
ATOM   443  N  N   . LEU A 1 64  ? 44.810  22.708 28.992 1.00 29.52  ? 64  LEU A N   1 
ATOM   444  C  CA  . LEU A 1 64  ? 44.186  24.024 29.010 1.00 31.06  ? 64  LEU A CA  1 
ATOM   445  C  C   . LEU A 1 64  ? 44.440  24.699 30.356 1.00 32.52  ? 64  LEU A C   1 
ATOM   446  O  O   . LEU A 1 64  ? 44.704  25.902 30.415 1.00 35.14  ? 64  LEU A O   1 
ATOM   447  C  CB  . LEU A 1 64  ? 42.692  23.897 28.765 1.00 31.48  ? 64  LEU A CB  1 
ATOM   448  C  CG  . LEU A 1 64  ? 42.345  23.294 27.409 1.00 31.38  ? 64  LEU A CG  1 
ATOM   449  C  CD1 . LEU A 1 64  ? 40.863  22.968 27.365 1.00 36.42  ? 64  LEU A CD1 1 
ATOM   450  C  CD2 . LEU A 1 64  ? 42.731  24.258 26.308 1.00 29.95  ? 64  LEU A CD2 1 
ATOM   451  N  N   . ARG A 1 65  ? 44.386  23.927 31.437 1.00 30.99  ? 65  ARG A N   1 
ATOM   452  C  CA  . ARG A 1 65  ? 44.649  24.501 32.753 1.00 33.33  ? 65  ARG A CA  1 
ATOM   453  C  C   . ARG A 1 65  ? 46.063  24.988 32.854 1.00 27.99  ? 65  ARG A C   1 
ATOM   454  O  O   . ARG A 1 65  ? 46.320  26.074 33.395 1.00 31.90  ? 65  ARG A O   1 
ATOM   455  C  CB  . ARG A 1 65  ? 44.443  23.488 33.873 1.00 28.16  ? 65  ARG A CB  1 
ATOM   456  C  CG  . ARG A 1 65  ? 43.021  23.267 34.246 1.00 37.05  ? 65  ARG A CG  1 
ATOM   457  C  CD  . ARG A 1 65  ? 42.952  22.266 35.354 1.00 44.54  ? 65  ARG A CD  1 
ATOM   458  N  NE  . ARG A 1 65  ? 41.580  22.063 35.789 1.00 49.82  ? 65  ARG A NE  1 
ATOM   459  C  CZ  . ARG A 1 65  ? 41.203  21.106 36.626 1.00 46.96  ? 65  ARG A CZ  1 
ATOM   460  N  NH1 . ARG A 1 65  ? 42.099  20.257 37.115 1.00 42.42  ? 65  ARG A NH1 1 
ATOM   461  N  NH2 . ARG A 1 65  ? 39.933  21.006 36.975 1.00 39.75  ? 65  ARG A NH2 1 
ATOM   462  N  N   . GLU A 1 66  ? 46.991  24.177 32.347 1.00 29.99  ? 66  GLU A N   1 
ATOM   463  C  CA  . GLU A 1 66  ? 48.399  24.536 32.427 1.00 26.85  ? 66  GLU A CA  1 
ATOM   464  C  C   . GLU A 1 66  ? 48.625  25.832 31.665 1.00 24.42  ? 66  GLU A C   1 
ATOM   465  O  O   . GLU A 1 66  ? 49.266  26.764 32.161 1.00 30.51  ? 66  GLU A O   1 
ATOM   466  C  CB  . GLU A 1 66  ? 49.281  23.408 31.847 1.00 33.66  ? 66  GLU A CB  1 
ATOM   467  C  CG  . GLU A 1 66  ? 50.779  23.534 32.182 1.00 29.80  ? 66  GLU A CG  1 
ATOM   468  C  CD  . GLU A 1 66  ? 51.674  22.497 31.474 1.00 30.75  ? 66  GLU A CD  1 
ATOM   469  O  OE1 . GLU A 1 66  ? 51.166  21.461 30.991 1.00 34.34  ? 66  GLU A OE1 1 
ATOM   470  O  OE2 . GLU A 1 66  ? 52.899  22.722 31.416 1.00 36.72  ? 66  GLU A OE2 1 
ATOM   471  N  N   . ILE A 1 67  ? 48.097  25.882 30.447 1.00 30.36  ? 67  ILE A N   1 
ATOM   472  C  CA  . ILE A 1 67  ? 48.264  27.055 29.594 1.00 21.11  ? 67  ILE A CA  1 
ATOM   473  C  C   . ILE A 1 67  ? 47.706  28.322 30.240 1.00 23.69  ? 67  ILE A C   1 
ATOM   474  O  O   . ILE A 1 67  ? 48.378  29.358 30.308 1.00 30.38  ? 67  ILE A O   1 
ATOM   475  C  CB  . ILE A 1 67  ? 47.580  26.813 28.219 1.00 25.68  ? 67  ILE A CB  1 
ATOM   476  C  CG1 . ILE A 1 67  ? 48.337  25.696 27.467 1.00 20.44  ? 67  ILE A CG1 1 
ATOM   477  C  CG2 . ILE A 1 67  ? 47.573  28.108 27.407 1.00 18.89  ? 67  ILE A CG2 1 
ATOM   478  C  CD1 . ILE A 1 67  ? 47.557  25.083 26.330 1.00 28.56  ? 67  ILE A CD1 1 
ATOM   479  N  N   . LYS A 1 68  ? 46.474  28.221 30.722 1.00 24.79  ? 68  LYS A N   1 
ATOM   480  C  CA  . LYS A 1 68  ? 45.803  29.340 31.359 1.00 36.66  ? 68  LYS A CA  1 
ATOM   481  C  C   . LYS A 1 68  ? 46.612  29.794 32.578 1.00 29.90  ? 68  LYS A C   1 
ATOM   482  O  O   . LYS A 1 68  ? 46.868  30.993 32.759 1.00 27.73  ? 68  LYS A O   1 
ATOM   483  C  CB  . LYS A 1 68  ? 44.381  28.919 31.749 1.00 37.46  ? 68  LYS A CB  1 
ATOM   484  C  CG  . LYS A 1 68  ? 43.478  30.047 32.128 1.00 41.82  ? 68  LYS A CG  1 
ATOM   485  C  CD  . LYS A 1 68  ? 42.031  29.571 32.247 1.00 48.68  ? 68  LYS A CD  1 
ATOM   486  C  CE  . LYS A 1 68  ? 41.077  30.726 32.589 1.00 56.42  ? 68  LYS A CE  1 
ATOM   487  N  NZ  . LYS A 1 68  ? 41.312  31.335 33.941 1.00 55.72  ? 68  LYS A NZ  1 
ATOM   488  N  N   . ILE A 1 69  ? 47.039  28.836 33.398 1.00 31.98  ? 69  ILE A N   1 
ATOM   489  C  CA  . ILE A 1 69  ? 47.829  29.162 34.583 1.00 20.82  ? 69  ILE A CA  1 
ATOM   490  C  C   . ILE A 1 69  ? 49.191  29.748 34.197 1.00 27.14  ? 69  ILE A C   1 
ATOM   491  O  O   . ILE A 1 69  ? 49.632  30.735 34.782 1.00 30.49  ? 69  ILE A O   1 
ATOM   492  C  CB  . ILE A 1 69  ? 47.979  27.906 35.497 1.00 25.08  ? 69  ILE A CB  1 
ATOM   493  C  CG1 . ILE A 1 69  ? 46.604  27.572 36.110 1.00 21.37  ? 69  ILE A CG1 1 
ATOM   494  C  CG2 . ILE A 1 69  ? 49.004  28.173 36.601 1.00 27.13  ? 69  ILE A CG2 1 
ATOM   495  C  CD1 . ILE A 1 69  ? 46.502  26.230 36.776 1.00 31.61  ? 69  ILE A CD1 1 
ATOM   496  N  N   . LEU A 1 70  ? 49.840  29.175 33.186 1.00 29.21  ? 70  LEU A N   1 
ATOM   497  C  CA  . LEU A 1 70  ? 51.141  29.679 32.759 1.00 25.45  ? 70  LEU A CA  1 
ATOM   498  C  C   . LEU A 1 70  ? 51.046  31.116 32.234 1.00 29.66  ? 70  LEU A C   1 
ATOM   499  O  O   . LEU A 1 70  ? 51.942  31.943 32.460 1.00 26.30  ? 70  LEU A O   1 
ATOM   500  C  CB  . LEU A 1 70  ? 51.739  28.764 31.672 1.00 32.02  ? 70  LEU A CB  1 
ATOM   501  C  CG  . LEU A 1 70  ? 52.283  27.422 32.174 1.00 34.23  ? 70  LEU A CG  1 
ATOM   502  C  CD1 . LEU A 1 70  ? 52.533  26.448 31.032 1.00 19.80  ? 70  LEU A CD1 1 
ATOM   503  C  CD2 . LEU A 1 70  ? 53.544  27.684 32.952 1.00 27.75  ? 70  LEU A CD2 1 
ATOM   504  N  N   . GLN A 1 71  ? 49.949  31.411 31.550 1.00 28.51  ? 71  GLN A N   1 
ATOM   505  C  CA  . GLN A 1 71  ? 49.742  32.731 30.994 1.00 27.82  ? 71  GLN A CA  1 
ATOM   506  C  C   . GLN A 1 71  ? 49.416  33.719 32.102 1.00 31.63  ? 71  GLN A C   1 
ATOM   507  O  O   . GLN A 1 71  ? 49.677  34.906 31.966 1.00 27.70  ? 71  GLN A O   1 
ATOM   508  C  CB  . GLN A 1 71  ? 48.625  32.686 29.944 1.00 30.40  ? 71  GLN A CB  1 
ATOM   509  C  CG  . GLN A 1 71  ? 48.984  31.824 28.725 1.00 35.31  ? 71  GLN A CG  1 
ATOM   510  C  CD  . GLN A 1 71  ? 47.828  31.648 27.733 1.00 41.40  ? 71  GLN A CD  1 
ATOM   511  O  OE1 . GLN A 1 71  ? 46.686  31.387 28.118 1.00 45.32  ? 71  GLN A OE1 1 
ATOM   512  N  NE2 . GLN A 1 71  ? 48.133  31.768 26.453 1.00 45.41  ? 71  GLN A NE2 1 
ATOM   513  N  N   . LEU A 1 72  ? 48.880  33.224 33.214 1.00 31.54  ? 72  LEU A N   1 
ATOM   514  C  CA  . LEU A 1 72  ? 48.546  34.105 34.328 1.00 30.01  ? 72  LEU A CA  1 
ATOM   515  C  C   . LEU A 1 72  ? 49.764  34.410 35.179 1.00 30.85  ? 72  LEU A C   1 
ATOM   516  O  O   . LEU A 1 72  ? 50.026  35.556 35.509 1.00 34.46  ? 72  LEU A O   1 
ATOM   517  C  CB  . LEU A 1 72  ? 47.473  33.473 35.214 1.00 25.69  ? 72  LEU A CB  1 
ATOM   518  C  CG  . LEU A 1 72  ? 47.177  34.279 36.475 1.00 40.75  ? 72  LEU A CG  1 
ATOM   519  C  CD1 . LEU A 1 72  ? 46.334  35.525 36.092 1.00 30.98  ? 72  LEU A CD1 1 
ATOM   520  C  CD2 . LEU A 1 72  ? 46.439  33.399 37.502 1.00 35.23  ? 72  LEU A CD2 1 
ATOM   521  N  N   . LEU A 1 73  ? 50.518  33.367 35.516 1.00 40.73  ? 73  LEU A N   1 
ATOM   522  C  CA  . LEU A 1 73  ? 51.688  33.497 36.375 1.00 32.24  ? 73  LEU A CA  1 
ATOM   523  C  C   . LEU A 1 73  ? 52.950  34.026 35.707 1.00 30.82  ? 73  LEU A C   1 
ATOM   524  O  O   . LEU A 1 73  ? 53.544  33.377 34.854 1.00 35.99  ? 73  LEU A O   1 
ATOM   525  C  CB  . LEU A 1 73  ? 51.974  32.150 37.044 1.00 29.84  ? 73  LEU A CB  1 
ATOM   526  C  CG  . LEU A 1 73  ? 50.781  31.529 37.787 1.00 30.24  ? 73  LEU A CG  1 
ATOM   527  C  CD1 . LEU A 1 73  ? 51.153  30.160 38.283 1.00 25.05  ? 73  LEU A CD1 1 
ATOM   528  C  CD2 . LEU A 1 73  ? 50.338  32.430 38.952 1.00 25.60  ? 73  LEU A CD2 1 
ATOM   529  N  N   . LYS A 1 74  ? 53.352  35.219 36.118 1.00 29.15  ? 74  LYS A N   1 
ATOM   530  C  CA  . LYS A 1 74  ? 54.540  35.869 35.603 1.00 23.45  ? 74  LYS A CA  1 
ATOM   531  C  C   . LYS A 1 74  ? 55.335  36.388 36.791 1.00 27.07  ? 74  LYS A C   1 
ATOM   532  O  O   . LYS A 1 74  ? 54.967  37.368 37.425 1.00 34.48  ? 74  LYS A O   1 
ATOM   533  C  CB  . LYS A 1 74  ? 54.125  36.983 34.635 1.00 31.84  ? 74  LYS A CB  1 
ATOM   534  C  CG  . LYS A 1 74  ? 53.371  36.437 33.407 1.00 39.87  ? 74  LYS A CG  1 
ATOM   535  C  CD  . LYS A 1 74  ? 54.203  35.334 32.689 1.00 38.86  ? 74  LYS A CD  1 
ATOM   536  C  CE  . LYS A 1 74  ? 53.517  34.802 31.428 1.00 43.36  ? 74  LYS A CE  1 
ATOM   537  N  NZ  . LYS A 1 74  ? 54.341  33.776 30.710 1.00 43.45  ? 74  LYS A NZ  1 
ATOM   538  N  N   . HIS A 1 75  ? 56.428  35.701 37.097 1.00 27.69  ? 75  HIS A N   1 
ATOM   539  C  CA  . HIS A 1 75  ? 57.248  36.029 38.251 1.00 25.03  ? 75  HIS A CA  1 
ATOM   540  C  C   . HIS A 1 75  ? 58.619  35.394 38.094 1.00 19.72  ? 75  HIS A C   1 
ATOM   541  O  O   . HIS A 1 75  ? 58.755  34.311 37.503 1.00 28.90  ? 75  HIS A O   1 
ATOM   542  C  CB  . HIS A 1 75  ? 56.531  35.508 39.509 1.00 25.85  ? 75  HIS A CB  1 
ATOM   543  C  CG  . HIS A 1 75  ? 57.299  35.669 40.780 1.00 25.38  ? 75  HIS A CG  1 
ATOM   544  N  ND1 . HIS A 1 75  ? 58.347  34.842 41.131 1.00 26.50  ? 75  HIS A ND1 1 
ATOM   545  C  CD2 . HIS A 1 75  ? 57.129  36.523 41.821 1.00 32.46  ? 75  HIS A CD2 1 
ATOM   546  C  CE1 . HIS A 1 75  ? 58.787  35.179 42.335 1.00 26.67  ? 75  HIS A CE1 1 
ATOM   547  N  NE2 . HIS A 1 75  ? 58.064  36.194 42.773 1.00 26.12  ? 75  HIS A NE2 1 
ATOM   548  N  N   . GLU A 1 76  ? 59.630  36.081 38.618 1.00 26.31  ? 76  GLU A N   1 
ATOM   549  C  CA  . GLU A 1 76  ? 61.013  35.639 38.550 1.00 28.03  ? 76  GLU A CA  1 
ATOM   550  C  C   . GLU A 1 76  ? 61.253  34.186 38.932 1.00 33.05  ? 76  GLU A C   1 
ATOM   551  O  O   . GLU A 1 76  ? 62.135  33.548 38.368 1.00 25.25  ? 76  GLU A O   1 
ATOM   552  C  CB  . GLU A 1 76  ? 61.896  36.523 39.430 1.00 32.12  ? 76  GLU A CB  1 
ATOM   553  C  CG  . GLU A 1 76  ? 62.828  37.437 38.642 1.00 60.67  ? 76  GLU A CG  1 
ATOM   554  C  CD  . GLU A 1 76  ? 64.106  36.743 38.180 1.00 66.93  ? 76  GLU A CD  1 
ATOM   555  O  OE1 . GLU A 1 76  ? 65.032  36.581 39.008 1.00 62.18  ? 76  GLU A OE1 1 
ATOM   556  O  OE2 . GLU A 1 76  ? 64.181  36.359 36.990 1.00 71.27  ? 76  GLU A OE2 1 
ATOM   557  N  N   . ASN A 1 77  ? 60.478  33.661 39.879 1.00 26.08  ? 77  ASN A N   1 
ATOM   558  C  CA  . ASN A 1 77  ? 60.680  32.288 40.304 1.00 27.33  ? 77  ASN A CA  1 
ATOM   559  C  C   . ASN A 1 77  ? 59.641  31.276 39.786 1.00 22.71  ? 77  ASN A C   1 
ATOM   560  O  O   . ASN A 1 77  ? 59.410  30.233 40.382 1.00 27.73  ? 77  ASN A O   1 
ATOM   561  C  CB  . ASN A 1 77  ? 60.797  32.250 41.838 1.00 24.06  ? 77  ASN A CB  1 
ATOM   562  C  CG  . ASN A 1 77  ? 61.862  33.218 42.366 1.00 24.29  ? 77  ASN A CG  1 
ATOM   563  O  OD1 . ASN A 1 77  ? 61.588  34.067 43.212 1.00 35.51  ? 77  ASN A OD1 1 
ATOM   564  N  ND2 . ASN A 1 77  ? 63.084  33.085 41.867 1.00 25.37  ? 77  ASN A ND2 1 
ATOM   565  N  N   . VAL A 1 78  ? 59.000  31.603 38.680 1.00 24.32  ? 78  VAL A N   1 
ATOM   566  C  CA  . VAL A 1 78  ? 58.046  30.703 38.060 1.00 20.48  ? 78  VAL A CA  1 
ATOM   567  C  C   . VAL A 1 78  ? 58.498  30.545 36.601 1.00 22.90  ? 78  VAL A C   1 
ATOM   568  O  O   . VAL A 1 78  ? 58.985  31.498 35.983 1.00 29.58  ? 78  VAL A O   1 
ATOM   569  C  CB  . VAL A 1 78  ? 56.613  31.251 38.135 1.00 25.42  ? 78  VAL A CB  1 
ATOM   570  C  CG1 . VAL A 1 78  ? 55.668  30.402 37.280 1.00 21.71  ? 78  VAL A CG1 1 
ATOM   571  C  CG2 . VAL A 1 78  ? 56.143  31.226 39.585 1.00 29.97  ? 78  VAL A CG2 1 
ATOM   572  N  N   . VAL A 1 79  ? 58.359  29.342 36.066 1.00 24.32  ? 79  VAL A N   1 
ATOM   573  C  CA  . VAL A 1 79  ? 58.780  29.080 34.690 1.00 22.36  ? 79  VAL A CA  1 
ATOM   574  C  C   . VAL A 1 79  ? 58.058  30.023 33.712 1.00 25.61  ? 79  VAL A C   1 
ATOM   575  O  O   . VAL A 1 79  ? 56.873  30.315 33.870 1.00 35.33  ? 79  VAL A O   1 
ATOM   576  C  CB  . VAL A 1 79  ? 58.563  27.564 34.339 1.00 23.59  ? 79  VAL A CB  1 
ATOM   577  C  CG1 . VAL A 1 79  ? 57.096  27.251 34.133 1.00 18.76  ? 79  VAL A CG1 1 
ATOM   578  C  CG2 . VAL A 1 79  ? 59.392  27.188 33.142 1.00 33.98  ? 79  VAL A CG2 1 
ATOM   579  N  N   . ASN A 1 80  ? 58.780  30.536 32.727 1.00 27.92  ? 80  ASN A N   1 
ATOM   580  C  CA  . ASN A 1 80  ? 58.165  31.446 31.784 1.00 30.86  ? 80  ASN A CA  1 
ATOM   581  C  C   . ASN A 1 80  ? 57.770  30.866 30.441 1.00 24.34  ? 80  ASN A C   1 
ATOM   582  O  O   . ASN A 1 80  ? 58.622  30.437 29.661 1.00 28.84  ? 80  ASN A O   1 
ATOM   583  C  CB  . ASN A 1 80  ? 59.058  32.664 31.537 1.00 30.52  ? 80  ASN A CB  1 
ATOM   584  C  CG  . ASN A 1 80  ? 58.389  33.685 30.630 1.00 33.21  ? 80  ASN A CG  1 
ATOM   585  O  OD1 . ASN A 1 80  ? 57.401  34.315 31.008 1.00 32.94  ? 80  ASN A OD1 1 
ATOM   586  N  ND2 . ASN A 1 80  ? 58.912  33.835 29.418 1.00 27.95  ? 80  ASN A ND2 1 
ATOM   587  N  N   . LEU A 1 81  ? 56.466  30.857 30.179 1.00 26.58  ? 81  LEU A N   1 
ATOM   588  C  CA  . LEU A 1 81  ? 55.940  30.384 28.911 1.00 28.27  ? 81  LEU A CA  1 
ATOM   589  C  C   . LEU A 1 81  ? 56.009  31.544 27.905 1.00 31.21  ? 81  LEU A C   1 
ATOM   590  O  O   . LEU A 1 81  ? 55.386  32.589 28.104 1.00 23.84  ? 81  LEU A O   1 
ATOM   591  C  CB  . LEU A 1 81  ? 54.492  29.927 29.064 1.00 20.87  ? 81  LEU A CB  1 
ATOM   592  C  CG  . LEU A 1 81  ? 53.758  29.458 27.808 1.00 32.13  ? 81  LEU A CG  1 
ATOM   593  C  CD1 . LEU A 1 81  ? 54.473  28.235 27.204 1.00 25.95  ? 81  LEU A CD1 1 
ATOM   594  C  CD2 . LEU A 1 81  ? 52.325  29.113 28.163 1.00 34.55  ? 81  LEU A CD2 1 
ATOM   595  N  N   . ILE A 1 82  ? 56.777  31.350 26.835 1.00 29.09  ? 82  ILE A N   1 
ATOM   596  C  CA  . ILE A 1 82  ? 56.939  32.365 25.801 1.00 26.94  ? 82  ILE A CA  1 
ATOM   597  C  C   . ILE A 1 82  ? 55.750  32.388 24.852 1.00 30.38  ? 82  ILE A C   1 
ATOM   598  O  O   . ILE A 1 82  ? 55.154  33.428 24.604 1.00 29.02  ? 82  ILE A O   1 
ATOM   599  C  CB  . ILE A 1 82  ? 58.232  32.119 24.977 1.00 33.21  ? 82  ILE A CB  1 
ATOM   600  C  CG1 . ILE A 1 82  ? 59.449  32.094 25.907 1.00 22.77  ? 82  ILE A CG1 1 
ATOM   601  C  CG2 . ILE A 1 82  ? 58.403  33.215 23.958 1.00 26.27  ? 82  ILE A CG2 1 
ATOM   602  C  CD1 . ILE A 1 82  ? 60.754  31.565 25.283 1.00 20.60  ? 82  ILE A CD1 1 
ATOM   603  N  N   . GLU A 1 83  ? 55.387  31.229 24.331 1.00 28.96  ? 83  GLU A N   1 
ATOM   604  C  CA  . GLU A 1 83  ? 54.288  31.173 23.391 1.00 30.32  ? 83  GLU A CA  1 
ATOM   605  C  C   . GLU A 1 83  ? 53.902  29.722 23.229 1.00 32.86  ? 83  GLU A C   1 
ATOM   606  O  O   . GLU A 1 83  ? 54.516  28.843 23.819 1.00 34.15  ? 83  GLU A O   1 
ATOM   607  C  CB  . GLU A 1 83  ? 54.752  31.728 22.037 1.00 30.97  ? 83  GLU A CB  1 
ATOM   608  C  CG  . GLU A 1 83  ? 55.863  30.883 21.396 1.00 28.03  ? 83  GLU A CG  1 
ATOM   609  C  CD  . GLU A 1 83  ? 56.397  31.457 20.090 1.00 32.76  ? 83  GLU A CD  1 
ATOM   610  O  OE1 . GLU A 1 83  ? 55.592  31.874 19.237 1.00 34.17  ? 83  GLU A OE1 1 
ATOM   611  O  OE2 . GLU A 1 83  ? 57.628  31.476 19.914 1.00 37.88  ? 83  GLU A OE2 1 
ATOM   612  N  N   . ILE A 1 84  ? 52.878  29.488 22.424 1.00 29.42  ? 84  ILE A N   1 
ATOM   613  C  CA  . ILE A 1 84  ? 52.413  28.154 22.119 1.00 27.12  ? 84  ILE A CA  1 
ATOM   614  C  C   . ILE A 1 84  ? 52.516  28.047 20.597 1.00 32.18  ? 84  ILE A C   1 
ATOM   615  O  O   . ILE A 1 84  ? 51.935  28.842 19.880 1.00 28.77  ? 84  ILE A O   1 
ATOM   616  C  CB  . ILE A 1 84  ? 50.950  27.951 22.574 1.00 25.34  ? 84  ILE A CB  1 
ATOM   617  C  CG1 . ILE A 1 84  ? 50.894  28.014 24.108 1.00 33.82  ? 84  ILE A CG1 1 
ATOM   618  C  CG2 . ILE A 1 84  ? 50.411  26.628 22.050 1.00 22.74  ? 84  ILE A CG2 1 
ATOM   619  C  CD1 . ILE A 1 84  ? 49.586  27.660 24.695 1.00 34.54  ? 84  ILE A CD1 1 
ATOM   620  N  N   . CYS A 1 85  ? 53.285  27.074 20.121 1.00 35.31  ? 85  CYS A N   1 
ATOM   621  C  CA  . CYS A 1 85  ? 53.472  26.859 18.698 1.00 29.23  ? 85  CYS A CA  1 
ATOM   622  C  C   . CYS A 1 85  ? 52.837  25.566 18.222 1.00 33.25  ? 85  CYS A C   1 
ATOM   623  O  O   . CYS A 1 85  ? 52.366  24.737 19.004 1.00 28.63  ? 85  CYS A O   1 
ATOM   624  C  CB  . CYS A 1 85  ? 54.953  26.811 18.346 1.00 21.86  ? 85  CYS A CB  1 
ATOM   625  S  SG  . CYS A 1 85  ? 55.839  28.295 18.658 1.00 32.93  ? 85  CYS A SG  1 
ATOM   626  N  N   . ARG A 1 86  ? 52.869  25.383 16.914 1.00 28.90  ? 86  ARG A N   1 
ATOM   627  C  CA  . ARG A 1 86  ? 52.286  24.203 16.310 1.00 34.39  ? 86  ARG A CA  1 
ATOM   628  C  C   . ARG A 1 86  ? 53.153  23.706 15.175 1.00 32.31  ? 86  ARG A C   1 
ATOM   629  O  O   . ARG A 1 86  ? 54.013  24.421 14.668 1.00 38.80  ? 86  ARG A O   1 
ATOM   630  C  CB  . ARG A 1 86  ? 50.928  24.555 15.735 1.00 30.34  ? 86  ARG A CB  1 
ATOM   631  C  CG  . ARG A 1 86  ? 51.058  25.617 14.675 1.00 42.33  ? 86  ARG A CG  1 
ATOM   632  C  CD  . ARG A 1 86  ? 49.762  25.883 13.977 1.00 34.65  ? 86  ARG A CD  1 
ATOM   633  N  NE  . ARG A 1 86  ? 49.977  26.741 12.829 1.00 43.02  ? 86  ARG A NE  1 
ATOM   634  C  CZ  . ARG A 1 86  ? 49.216  26.703 11.745 1.00 51.52  ? 86  ARG A CZ  1 
ATOM   635  N  NH1 . ARG A 1 86  ? 48.205  25.845 11.694 1.00 40.86  ? 86  ARG A NH1 1 
ATOM   636  N  NH2 . ARG A 1 86  ? 49.467  27.509 10.721 1.00 42.90  ? 86  ARG A NH2 1 
ATOM   637  N  N   . THR A 1 87  ? 52.914  22.466 14.792 1.00 48.40  ? 87  THR A N   1 
ATOM   638  C  CA  . THR A 1 87  ? 53.598  21.854 13.672 1.00 50.35  ? 87  THR A CA  1 
ATOM   639  C  C   . THR A 1 87  ? 52.439  21.615 12.726 1.00 55.66  ? 87  THR A C   1 
ATOM   640  O  O   . THR A 1 87  ? 51.526  20.863 13.056 1.00 61.02  ? 87  THR A O   1 
ATOM   641  C  CB  . THR A 1 87  ? 54.192  20.503 14.044 1.00 41.25  ? 87  THR A CB  1 
ATOM   642  O  OG1 . THR A 1 87  ? 53.175  19.701 14.655 1.00 64.12  ? 87  THR A OG1 1 
ATOM   643  C  CG2 . THR A 1 87  ? 55.339  20.673 15.003 1.00 42.84  ? 87  THR A CG2 1 
ATOM   644  N  N   . LYS A 1 88  ? 52.454  22.277 11.575 1.00 65.74  ? 88  LYS A N   1 
ATOM   645  C  CA  . LYS A 1 88  ? 51.384  22.125 10.589 1.00 69.12  ? 88  LYS A CA  1 
ATOM   646  C  C   . LYS A 1 88  ? 51.072  20.656 10.296 1.00 71.06  ? 88  LYS A C   1 
ATOM   647  O  O   . LYS A 1 88  ? 51.943  19.891 9.875  1.00 69.64  ? 88  LYS A O   1 
ATOM   648  C  CB  . LYS A 1 88  ? 51.775  22.841 9.296  1.00 66.84  ? 88  LYS A CB  1 
ATOM   649  C  CG  . LYS A 1 88  ? 53.231  22.624 8.913  1.00 76.77  ? 88  LYS A CG  1 
ATOM   650  C  CD  . LYS A 1 88  ? 53.535  23.164 7.531  1.00 75.36  ? 88  LYS A CD  1 
ATOM   651  C  CE  . LYS A 1 88  ? 54.949  22.801 7.106  1.00 71.71  ? 88  LYS A CE  1 
ATOM   652  N  NZ  . LYS A 1 88  ? 55.174  23.067 5.656  1.00 63.05  ? 88  LYS A NZ  1 
ATOM   653  N  N   . GLY A 1 97  ? 49.338  16.347 13.622 1.00 59.22  ? 97  GLY A N   1 
ATOM   654  C  CA  . GLY A 1 97  ? 49.702  17.695 14.030 1.00 64.16  ? 97  GLY A CA  1 
ATOM   655  C  C   . GLY A 1 97  ? 49.929  17.798 15.526 1.00 61.47  ? 97  GLY A C   1 
ATOM   656  O  O   . GLY A 1 97  ? 49.217  17.165 16.304 1.00 65.55  ? 97  GLY A O   1 
ATOM   657  N  N   . SER A 1 98  ? 50.915  18.590 15.938 1.00 52.89  ? 98  SER A N   1 
ATOM   658  C  CA  . SER A 1 98  ? 51.211  18.741 17.359 1.00 49.99  ? 98  SER A CA  1 
ATOM   659  C  C   . SER A 1 98  ? 51.176  20.186 17.848 1.00 46.56  ? 98  SER A C   1 
ATOM   660  O  O   . SER A 1 98  ? 51.267  21.130 17.067 1.00 37.86  ? 98  SER A O   1 
ATOM   661  C  CB  . SER A 1 98  ? 52.586  18.146 17.678 1.00 47.05  ? 98  SER A CB  1 
ATOM   662  O  OG  . SER A 1 98  ? 52.648  16.780 17.316 1.00 58.22  ? 98  SER A OG  1 
ATOM   663  N  N   . ILE A 1 99  ? 51.047  20.334 19.161 1.00 42.99  ? 99  ILE A N   1 
ATOM   664  C  CA  . ILE A 1 99  ? 51.015  21.627 19.813 1.00 33.92  ? 99  ILE A CA  1 
ATOM   665  C  C   . ILE A 1 99  ? 52.163  21.633 20.818 1.00 31.28  ? 99  ILE A C   1 
ATOM   666  O  O   . ILE A 1 99  ? 52.386  20.653 21.521 1.00 29.32  ? 99  ILE A O   1 
ATOM   667  C  CB  . ILE A 1 99  ? 49.648  21.848 20.503 1.00 34.27  ? 99  ILE A CB  1 
ATOM   668  C  CG1 . ILE A 1 99  ? 48.556  21.967 19.432 1.00 29.46  ? 99  ILE A CG1 1 
ATOM   669  C  CG2 . ILE A 1 99  ? 49.692  23.068 21.429 1.00 32.21  ? 99  ILE A CG2 1 
ATOM   670  C  CD1 . ILE A 1 99  ? 48.797  23.073 18.355 1.00 24.10  ? 99  ILE A CD1 1 
ATOM   671  N  N   . TYR A 1 100 ? 52.917  22.726 20.851 1.00 33.18  ? 100 TYR A N   1 
ATOM   672  C  CA  . TYR A 1 100 ? 54.054  22.836 21.741 1.00 28.28  ? 100 TYR A CA  1 
ATOM   673  C  C   . TYR A 1 100 ? 54.026  24.078 22.607 1.00 30.85  ? 100 TYR A C   1 
ATOM   674  O  O   . TYR A 1 100 ? 53.773  25.179 22.126 1.00 28.54  ? 100 TYR A O   1 
ATOM   675  C  CB  . TYR A 1 100 ? 55.363  22.867 20.951 1.00 40.28  ? 100 TYR A CB  1 
ATOM   676  C  CG  . TYR A 1 100 ? 55.768  21.566 20.295 1.00 48.02  ? 100 TYR A CG  1 
ATOM   677  C  CD1 . TYR A 1 100 ? 56.580  20.649 20.961 1.00 42.95  ? 100 TYR A CD1 1 
ATOM   678  C  CD2 . TYR A 1 100 ? 55.391  21.281 18.981 1.00 50.43  ? 100 TYR A CD2 1 
ATOM   679  C  CE1 . TYR A 1 100 ? 57.015  19.481 20.327 1.00 42.31  ? 100 TYR A CE1 1 
ATOM   680  C  CE2 . TYR A 1 100 ? 55.820  20.121 18.341 1.00 46.44  ? 100 TYR A CE2 1 
ATOM   681  C  CZ  . TYR A 1 100 ? 56.631  19.231 19.017 1.00 46.58  ? 100 TYR A CZ  1 
ATOM   682  O  OH  . TYR A 1 100 ? 57.073  18.107 18.371 1.00 52.05  ? 100 TYR A OH  1 
ATOM   683  N  N   . LEU A 1 101 ? 54.275  23.874 23.892 1.00 28.67  ? 101 LEU A N   1 
ATOM   684  C  CA  . LEU A 1 101 ? 54.379  24.958 24.843 1.00 25.80  ? 101 LEU A CA  1 
ATOM   685  C  C   . LEU A 1 101 ? 55.863  25.277 24.768 1.00 26.63  ? 101 LEU A C   1 
ATOM   686  O  O   . LEU A 1 101 ? 56.685  24.370 24.896 1.00 28.92  ? 101 LEU A O   1 
ATOM   687  C  CB  . LEU A 1 101 ? 54.016  24.473 26.255 1.00 25.94  ? 101 LEU A CB  1 
ATOM   688  C  CG  . LEU A 1 101 ? 52.548  24.581 26.681 1.00 18.88  ? 101 LEU A CG  1 
ATOM   689  C  CD1 . LEU A 1 101 ? 51.658  23.745 25.808 1.00 27.56  ? 101 LEU A CD1 1 
ATOM   690  C  CD2 . LEU A 1 101 ? 52.438  24.129 28.132 1.00 28.29  ? 101 LEU A CD2 1 
ATOM   691  N  N   . VAL A 1 102 ? 56.205  26.543 24.528 1.00 28.09  ? 102 VAL A N   1 
ATOM   692  C  CA  . VAL A 1 102 ? 57.596  26.975 24.445 1.00 23.20  ? 102 VAL A CA  1 
ATOM   693  C  C   . VAL A 1 102 ? 57.983  27.736 25.709 1.00 22.95  ? 102 VAL A C   1 
ATOM   694  O  O   . VAL A 1 102 ? 57.337  28.711 26.052 1.00 29.20  ? 102 VAL A O   1 
ATOM   695  C  CB  . VAL A 1 102 ? 57.824  27.909 23.236 1.00 28.05  ? 102 VAL A CB  1 
ATOM   696  C  CG1 . VAL A 1 102 ? 59.277  28.278 23.164 1.00 27.68  ? 102 VAL A CG1 1 
ATOM   697  C  CG2 . VAL A 1 102 ? 57.360  27.233 21.937 1.00 24.67  ? 102 VAL A CG2 1 
ATOM   698  N  N   . PHE A 1 103 ? 59.041  27.292 26.383 1.00 24.34  ? 103 PHE A N   1 
ATOM   699  C  CA  . PHE A 1 103 ? 59.502  27.911 27.626 1.00 33.52  ? 103 PHE A CA  1 
ATOM   700  C  C   . PHE A 1 103 ? 60.916  28.470 27.568 1.00 23.06  ? 103 PHE A C   1 
ATOM   701  O  O   . PHE A 1 103 ? 61.745  28.046 26.773 1.00 31.16  ? 103 PHE A O   1 
ATOM   702  C  CB  . PHE A 1 103 ? 59.519  26.892 28.780 1.00 33.85  ? 103 PHE A CB  1 
ATOM   703  C  CG  . PHE A 1 103 ? 58.191  26.320 29.132 1.00 31.91  ? 103 PHE A CG  1 
ATOM   704  C  CD1 . PHE A 1 103 ? 57.427  26.875 30.157 1.00 25.42  ? 103 PHE A CD1 1 
ATOM   705  C  CD2 . PHE A 1 103 ? 57.735  25.168 28.508 1.00 26.25  ? 103 PHE A CD2 1 
ATOM   706  C  CE1 . PHE A 1 103 ? 56.225  26.276 30.560 1.00 33.07  ? 103 PHE A CE1 1 
ATOM   707  C  CE2 . PHE A 1 103 ? 56.531  24.556 28.906 1.00 25.52  ? 103 PHE A CE2 1 
ATOM   708  C  CZ  . PHE A 1 103 ? 55.778  25.110 29.932 1.00 26.87  ? 103 PHE A CZ  1 
ATOM   709  N  N   . ASP A 1 104 ? 61.191  29.422 28.441 1.00 32.43  ? 104 ASP A N   1 
ATOM   710  C  CA  . ASP A 1 104 ? 62.543  29.920 28.543 1.00 31.41  ? 104 ASP A CA  1 
ATOM   711  C  C   . ASP A 1 104 ? 63.242  28.707 29.115 1.00 29.70  ? 104 ASP A C   1 
ATOM   712  O  O   . ASP A 1 104 ? 62.713  28.057 30.006 1.00 36.32  ? 104 ASP A O   1 
ATOM   713  C  CB  . ASP A 1 104 ? 62.605  31.106 29.491 1.00 37.82  ? 104 ASP A CB  1 
ATOM   714  C  CG  . ASP A 1 104 ? 62.455  32.421 28.759 1.00 31.91  ? 104 ASP A CG  1 
ATOM   715  O  OD1 . ASP A 1 104 ? 63.381  32.781 27.994 1.00 54.80  ? 104 ASP A OD1 1 
ATOM   716  O  OD2 . ASP A 1 104 ? 61.417  33.082 28.927 1.00 49.34  ? 104 ASP A OD2 1 
ATOM   717  N  N   . PHE A 1 105 ? 64.410  28.383 28.579 1.00 29.40  ? 105 PHE A N   1 
ATOM   718  C  CA  . PHE A 1 105 ? 65.147  27.202 28.990 1.00 24.16  ? 105 PHE A CA  1 
ATOM   719  C  C   . PHE A 1 105 ? 65.956  27.369 30.275 1.00 29.16  ? 105 PHE A C   1 
ATOM   720  O  O   . PHE A 1 105 ? 66.631  28.366 30.459 1.00 27.08  ? 105 PHE A O   1 
ATOM   721  C  CB  . PHE A 1 105 ? 66.084  26.776 27.852 1.00 20.89  ? 105 PHE A CB  1 
ATOM   722  C  CG  . PHE A 1 105 ? 66.937  25.567 28.175 1.00 24.74  ? 105 PHE A CG  1 
ATOM   723  C  CD1 . PHE A 1 105 ? 66.387  24.289 28.179 1.00 25.45  ? 105 PHE A CD1 1 
ATOM   724  C  CD2 . PHE A 1 105 ? 68.283  25.717 28.476 1.00 25.35  ? 105 PHE A CD2 1 
ATOM   725  C  CE1 . PHE A 1 105 ? 67.168  23.172 28.478 1.00 28.35  ? 105 PHE A CE1 1 
ATOM   726  C  CE2 . PHE A 1 105 ? 69.081  24.616 28.781 1.00 30.29  ? 105 PHE A CE2 1 
ATOM   727  C  CZ  . PHE A 1 105 ? 68.522  23.334 28.781 1.00 22.07  ? 105 PHE A CZ  1 
ATOM   728  N  N   . CYS A 1 106 ? 65.875  26.374 31.151 1.00 22.13  ? 106 CYS A N   1 
ATOM   729  C  CA  . CYS A 1 106 ? 66.626  26.369 32.401 1.00 32.36  ? 106 CYS A CA  1 
ATOM   730  C  C   . CYS A 1 106 ? 67.523  25.143 32.304 1.00 31.66  ? 106 CYS A C   1 
ATOM   731  O  O   . CYS A 1 106 ? 67.064  24.031 32.014 1.00 30.52  ? 106 CYS A O   1 
ATOM   732  C  CB  . CYS A 1 106 ? 65.694  26.236 33.594 1.00 23.30  ? 106 CYS A CB  1 
ATOM   733  S  SG  . CYS A 1 106 ? 64.385  27.453 33.597 1.00 33.06  ? 106 CYS A SG  1 
ATOM   734  N  N   . GLU A 1 107 ? 68.801  25.354 32.554 1.00 27.97  ? 107 GLU A N   1 
ATOM   735  C  CA  . GLU A 1 107 ? 69.777  24.295 32.442 1.00 31.00  ? 107 GLU A CA  1 
ATOM   736  C  C   . GLU A 1 107 ? 69.637  23.139 33.415 1.00 33.85  ? 107 GLU A C   1 
ATOM   737  O  O   . GLU A 1 107 ? 69.843  21.999 33.025 1.00 33.65  ? 107 GLU A O   1 
ATOM   738  C  CB  . GLU A 1 107 ? 71.191  24.891 32.543 1.00 27.89  ? 107 GLU A CB  1 
ATOM   739  C  CG  . GLU A 1 107 ? 72.330  23.875 32.356 1.00 62.27  ? 107 GLU A CG  1 
ATOM   740  C  CD  . GLU A 1 107 ? 72.437  23.327 30.930 1.00 75.82  ? 107 GLU A CD  1 
ATOM   741  O  OE1 . GLU A 1 107 ? 72.811  24.096 30.014 1.00 78.34  ? 107 GLU A OE1 1 
ATOM   742  O  OE2 . GLU A 1 107 ? 72.148  22.124 30.726 1.00 72.28  ? 107 GLU A OE2 1 
ATOM   743  N  N   . HIS A 1 108 ? 69.273  23.404 34.667 1.00 36.98  ? 108 HIS A N   1 
ATOM   744  C  CA  . HIS A 1 108 ? 69.203  22.314 35.643 1.00 30.02  ? 108 HIS A CA  1 
ATOM   745  C  C   . HIS A 1 108 ? 67.918  22.131 36.411 1.00 30.19  ? 108 HIS A C   1 
ATOM   746  O  O   . HIS A 1 108 ? 67.178  23.082 36.625 1.00 32.73  ? 108 HIS A O   1 
ATOM   747  C  CB  . HIS A 1 108 ? 70.269  22.484 36.722 1.00 35.39  ? 108 HIS A CB  1 
ATOM   748  C  CG  . HIS A 1 108 ? 71.590  22.980 36.226 1.00 47.61  ? 108 HIS A CG  1 
ATOM   749  N  ND1 . HIS A 1 108 ? 71.861  24.320 36.049 1.00 42.86  ? 108 HIS A ND1 1 
ATOM   750  C  CD2 . HIS A 1 108 ? 72.738  22.321 35.940 1.00 41.50  ? 108 HIS A CD2 1 
ATOM   751  C  CE1 . HIS A 1 108 ? 73.120  24.466 35.680 1.00 40.09  ? 108 HIS A CE1 1 
ATOM   752  N  NE2 . HIS A 1 108 ? 73.675  23.269 35.607 1.00 39.77  ? 108 HIS A NE2 1 
ATOM   753  N  N   . ASP A 1 109 ? 67.668  20.896 36.843 1.00 29.40  ? 109 ASP A N   1 
ATOM   754  C  CA  . ASP A 1 109 ? 66.530  20.639 37.709 1.00 29.55  ? 109 ASP A CA  1 
ATOM   755  C  C   . ASP A 1 109 ? 67.188  20.266 39.044 1.00 35.54  ? 109 ASP A C   1 
ATOM   756  O  O   . ASP A 1 109 ? 68.318  19.782 39.081 1.00 26.86  ? 109 ASP A O   1 
ATOM   757  C  CB  . ASP A 1 109 ? 65.607  19.538 37.188 1.00 33.43  ? 109 ASP A CB  1 
ATOM   758  C  CG  . ASP A 1 109 ? 66.274  18.197 37.101 1.00 37.61  ? 109 ASP A CG  1 
ATOM   759  O  OD1 . ASP A 1 109 ? 67.018  17.977 36.132 1.00 44.04  ? 109 ASP A OD1 1 
ATOM   760  O  OD2 . ASP A 1 109 ? 66.050  17.362 38.003 1.00 41.64  ? 109 ASP A OD2 1 
ATOM   761  N  N   . LEU A 1 110 ? 66.499  20.532 40.142 1.00 33.13  ? 110 LEU A N   1 
ATOM   762  C  CA  . LEU A 1 110 ? 67.053  20.271 41.456 1.00 33.44  ? 110 LEU A CA  1 
ATOM   763  C  C   . LEU A 1 110 ? 67.314  18.801 41.712 1.00 27.97  ? 110 LEU A C   1 
ATOM   764  O  O   . LEU A 1 110 ? 68.318  18.446 42.318 1.00 35.58  ? 110 LEU A O   1 
ATOM   765  C  CB  . LEU A 1 110 ? 66.125  20.850 42.519 1.00 31.03  ? 110 LEU A CB  1 
ATOM   766  C  CG  . LEU A 1 110 ? 66.590  20.895 43.968 1.00 28.06  ? 110 LEU A CG  1 
ATOM   767  C  CD1 . LEU A 1 110 ? 67.975  21.543 44.084 1.00 20.43  ? 110 LEU A CD1 1 
ATOM   768  C  CD2 . LEU A 1 110 ? 65.553  21.676 44.755 1.00 27.85  ? 110 LEU A CD2 1 
ATOM   769  N  N   . ALA A 1 111 ? 66.412  17.943 41.251 1.00 28.87  ? 111 ALA A N   1 
ATOM   770  C  CA  . ALA A 1 111 ? 66.583  16.505 41.423 1.00 20.36  ? 111 ALA A CA  1 
ATOM   771  C  C   . ALA A 1 111 ? 67.943  16.052 40.867 1.00 29.40  ? 111 ALA A C   1 
ATOM   772  O  O   . ALA A 1 111 ? 68.628  15.238 41.478 1.00 32.93  ? 111 ALA A O   1 
ATOM   773  C  CB  . ALA A 1 111 ? 65.457  15.755 40.715 1.00 28.67  ? 111 ALA A CB  1 
ATOM   774  N  N   . GLY A 1 112 ? 68.314  16.582 39.704 1.00 34.39  ? 112 GLY A N   1 
ATOM   775  C  CA  . GLY A 1 112 ? 69.582  16.233 39.073 1.00 30.65  ? 112 GLY A CA  1 
ATOM   776  C  C   . GLY A 1 112 ? 70.798  16.803 39.783 1.00 37.98  ? 112 GLY A C   1 
ATOM   777  O  O   . GLY A 1 112 ? 71.829  16.129 39.902 1.00 34.96  ? 112 GLY A O   1 
ATOM   778  N  N   . LEU A 1 113 ? 70.699  18.049 40.245 1.00 28.46  ? 113 LEU A N   1 
ATOM   779  C  CA  . LEU A 1 113 ? 71.801  18.654 40.972 1.00 32.44  ? 113 LEU A CA  1 
ATOM   780  C  C   . LEU A 1 113 ? 72.031  17.941 42.310 1.00 29.77  ? 113 LEU A C   1 
ATOM   781  O  O   . LEU A 1 113 ? 73.179  17.776 42.740 1.00 30.30  ? 113 LEU A O   1 
ATOM   782  C  CB  . LEU A 1 113 ? 71.525  20.135 41.225 1.00 34.70  ? 113 LEU A CB  1 
ATOM   783  C  CG  . LEU A 1 113 ? 71.703  21.053 40.023 1.00 36.42  ? 113 LEU A CG  1 
ATOM   784  C  CD1 . LEU A 1 113 ? 71.234  22.468 40.360 1.00 30.10  ? 113 LEU A CD1 1 
ATOM   785  C  CD2 . LEU A 1 113 ? 73.162  21.044 39.630 1.00 35.83  ? 113 LEU A CD2 1 
ATOM   786  N  N   . LEU A 1 114 ? 70.954  17.500 42.959 1.00 27.45  ? 114 LEU A N   1 
ATOM   787  C  CA  . LEU A 1 114 ? 71.092  16.835 44.255 1.00 30.14  ? 114 LEU A CA  1 
ATOM   788  C  C   . LEU A 1 114 ? 71.569  15.387 44.126 1.00 34.82  ? 114 LEU A C   1 
ATOM   789  O  O   . LEU A 1 114 ? 72.321  14.904 44.970 1.00 39.49  ? 114 LEU A O   1 
ATOM   790  C  CB  . LEU A 1 114 ? 69.781  16.885 45.032 1.00 28.77  ? 114 LEU A CB  1 
ATOM   791  C  CG  . LEU A 1 114 ? 69.213  18.266 45.388 1.00 32.16  ? 114 LEU A CG  1 
ATOM   792  C  CD1 . LEU A 1 114 ? 67.846  18.092 46.034 1.00 29.22  ? 114 LEU A CD1 1 
ATOM   793  C  CD2 . LEU A 1 114 ? 70.156  19.015 46.317 1.00 28.85  ? 114 LEU A CD2 1 
ATOM   794  N  N   . SER A 1 115 ? 71.127  14.693 43.084 1.00 36.72  ? 115 SER A N   1 
ATOM   795  C  CA  . SER A 1 115 ? 71.556  13.314 42.863 1.00 44.00  ? 115 SER A CA  1 
ATOM   796  C  C   . SER A 1 115 ? 73.060  13.297 42.633 1.00 34.83  ? 115 SER A C   1 
ATOM   797  O  O   . SER A 1 115 ? 73.766  12.419 43.124 1.00 35.48  ? 115 SER A O   1 
ATOM   798  C  CB  . SER A 1 115 ? 70.876  12.717 41.629 1.00 45.26  ? 115 SER A CB  1 
ATOM   799  O  OG  . SER A 1 115 ? 69.530  12.386 41.893 1.00 64.45  ? 115 SER A OG  1 
ATOM   800  N  N   . ASN A 1 116 ? 73.538  14.271 41.868 1.00 35.76  ? 116 ASN A N   1 
ATOM   801  C  CA  . ASN A 1 116 ? 74.958  14.366 41.555 1.00 38.95  ? 116 ASN A CA  1 
ATOM   802  C  C   . ASN A 1 116 ? 75.699  14.891 42.773 1.00 38.22  ? 116 ASN A C   1 
ATOM   803  O  O   . ASN A 1 116 ? 76.037  16.068 42.854 1.00 33.64  ? 116 ASN A O   1 
ATOM   804  C  CB  . ASN A 1 116 ? 75.171  15.278 40.336 1.00 29.92  ? 116 ASN A CB  1 
ATOM   805  C  CG  . ASN A 1 116 ? 76.649  15.507 39.999 1.00 32.56  ? 116 ASN A CG  1 
ATOM   806  O  OD1 . ASN A 1 116 ? 77.551  14.949 40.625 1.00 35.73  ? 116 ASN A OD1 1 
ATOM   807  N  ND2 . ASN A 1 116 ? 76.891  16.344 39.000 1.00 37.25  ? 116 ASN A ND2 1 
ATOM   808  N  N   . VAL A 1 117 ? 75.936  13.988 43.717 1.00 34.65  ? 117 VAL A N   1 
ATOM   809  C  CA  . VAL A 1 117 ? 76.638  14.293 44.962 1.00 34.90  ? 117 VAL A CA  1 
ATOM   810  C  C   . VAL A 1 117 ? 78.026  14.923 44.774 1.00 44.86  ? 117 VAL A C   1 
ATOM   811  O  O   . VAL A 1 117 ? 78.697  15.253 45.749 1.00 43.18  ? 117 VAL A O   1 
ATOM   812  C  CB  . VAL A 1 117 ? 76.755  13.018 45.821 1.00 41.58  ? 117 VAL A CB  1 
ATOM   813  C  CG1 . VAL A 1 117 ? 77.543  13.290 47.080 1.00 66.44  ? 117 VAL A CG1 1 
ATOM   814  C  CG2 . VAL A 1 117 ? 75.365  12.530 46.185 1.00 40.90  ? 117 VAL A CG2 1 
ATOM   815  N  N   . LEU A 1 118 ? 78.474  15.087 43.534 1.00 43.87  ? 118 LEU A N   1 
ATOM   816  C  CA  . LEU A 1 118 ? 79.766  15.725 43.328 1.00 45.79  ? 118 LEU A CA  1 
ATOM   817  C  C   . LEU A 1 118 ? 79.572  17.227 43.383 1.00 41.67  ? 118 LEU A C   1 
ATOM   818  O  O   . LEU A 1 118 ? 80.516  17.967 43.636 1.00 41.19  ? 118 LEU A O   1 
ATOM   819  C  CB  . LEU A 1 118 ? 80.389  15.321 41.989 1.00 48.04  ? 118 LEU A CB  1 
ATOM   820  C  CG  . LEU A 1 118 ? 80.963  13.902 41.985 1.00 48.46  ? 118 LEU A CG  1 
ATOM   821  C  CD1 . LEU A 1 118 ? 81.606  13.597 40.648 1.00 57.75  ? 118 LEU A CD1 1 
ATOM   822  C  CD2 . LEU A 1 118 ? 81.982  13.780 43.087 1.00 54.98  ? 118 LEU A CD2 1 
ATOM   823  N  N   . VAL A 1 119 ? 78.336  17.669 43.151 1.00 40.80  ? 119 VAL A N   1 
ATOM   824  C  CA  . VAL A 1 119 ? 77.991  19.092 43.202 1.00 39.79  ? 119 VAL A CA  1 
ATOM   825  C  C   . VAL A 1 119 ? 77.873  19.437 44.678 1.00 34.83  ? 119 VAL A C   1 
ATOM   826  O  O   . VAL A 1 119 ? 77.292  18.683 45.440 1.00 35.68  ? 119 VAL A O   1 
ATOM   827  C  CB  . VAL A 1 119 ? 76.637  19.367 42.513 1.00 43.03  ? 119 VAL A CB  1 
ATOM   828  C  CG1 . VAL A 1 119 ? 76.258  20.828 42.668 1.00 40.65  ? 119 VAL A CG1 1 
ATOM   829  C  CG2 . VAL A 1 119 ? 76.723  18.999 41.030 1.00 38.25  ? 119 VAL A CG2 1 
ATOM   830  N  N   . LYS A 1 120 ? 78.427  20.571 45.080 1.00 37.89  ? 120 LYS A N   1 
ATOM   831  C  CA  . LYS A 1 120 ? 78.394  20.966 46.485 1.00 35.67  ? 120 LYS A CA  1 
ATOM   832  C  C   . LYS A 1 120 ? 77.498  22.163 46.781 1.00 31.32  ? 120 LYS A C   1 
ATOM   833  O  O   . LYS A 1 120 ? 77.466  23.132 46.023 1.00 44.06  ? 120 LYS A O   1 
ATOM   834  C  CB  . LYS A 1 120 ? 79.823  21.264 46.950 1.00 40.31  ? 120 LYS A CB  1 
ATOM   835  C  CG  . LYS A 1 120 ? 80.786  20.115 46.703 1.00 41.89  ? 120 LYS A CG  1 
ATOM   836  C  CD  . LYS A 1 120 ? 80.340  18.888 47.501 1.00 44.42  ? 120 LYS A CD  1 
ATOM   837  C  CE  . LYS A 1 120 ? 81.128  17.639 47.136 1.00 53.05  ? 120 LYS A CE  1 
ATOM   838  N  NZ  . LYS A 1 120 ? 80.535  16.410 47.754 1.00 56.13  ? 120 LYS A NZ  1 
ATOM   839  N  N   . PHE A 1 121 ? 76.771  22.089 47.889 1.00 35.66  ? 121 PHE A N   1 
ATOM   840  C  CA  . PHE A 1 121 ? 75.884  23.175 48.307 1.00 44.21  ? 121 PHE A CA  1 
ATOM   841  C  C   . PHE A 1 121 ? 76.328  23.769 49.649 1.00 38.44  ? 121 PHE A C   1 
ATOM   842  O  O   . PHE A 1 121 ? 76.406  23.046 50.639 1.00 42.18  ? 121 PHE A O   1 
ATOM   843  C  CB  . PHE A 1 121 ? 74.444  22.655 48.443 1.00 42.21  ? 121 PHE A CB  1 
ATOM   844  C  CG  . PHE A 1 121 ? 73.700  22.550 47.132 1.00 56.09  ? 121 PHE A CG  1 
ATOM   845  C  CD1 . PHE A 1 121 ? 73.038  23.657 46.597 1.00 53.83  ? 121 PHE A CD1 1 
ATOM   846  C  CD2 . PHE A 1 121 ? 73.662  21.349 46.432 1.00 44.64  ? 121 PHE A CD2 1 
ATOM   847  C  CE1 . PHE A 1 121 ? 72.345  23.567 45.381 1.00 57.67  ? 121 PHE A CE1 1 
ATOM   848  C  CE2 . PHE A 1 121 ? 72.973  21.246 45.213 1.00 55.90  ? 121 PHE A CE2 1 
ATOM   849  C  CZ  . PHE A 1 121 ? 72.313  22.356 44.687 1.00 39.08  ? 121 PHE A CZ  1 
ATOM   850  N  N   . THR A 1 122 ? 76.647  25.063 49.689 1.00 43.52  ? 122 THR A N   1 
ATOM   851  C  CA  . THR A 1 122 ? 77.016  25.684 50.969 1.00 44.41  ? 122 THR A CA  1 
ATOM   852  C  C   . THR A 1 122 ? 75.700  25.991 51.674 1.00 40.72  ? 122 THR A C   1 
ATOM   853  O  O   . THR A 1 122 ? 74.677  26.171 51.009 1.00 39.34  ? 122 THR A O   1 
ATOM   854  C  CB  . THR A 1 122 ? 77.794  27.018 50.807 1.00 37.35  ? 122 THR A CB  1 
ATOM   855  O  OG1 . THR A 1 122 ? 76.965  28.000 50.178 1.00 40.54  ? 122 THR A OG1 1 
ATOM   856  C  CG2 . THR A 1 122 ? 79.051  26.811 49.995 1.00 46.74  ? 122 THR A CG2 1 
ATOM   857  N  N   . LEU A 1 123 ? 75.710  26.029 53.004 1.00 39.27  ? 123 LEU A N   1 
ATOM   858  C  CA  . LEU A 1 123 ? 74.492  26.315 53.766 1.00 37.18  ? 123 LEU A CA  1 
ATOM   859  C  C   . LEU A 1 123 ? 73.838  27.585 53.227 1.00 36.03  ? 123 LEU A C   1 
ATOM   860  O  O   . LEU A 1 123 ? 72.621  27.678 53.119 1.00 32.99  ? 123 LEU A O   1 
ATOM   861  C  CB  . LEU A 1 123 ? 74.823  26.491 55.252 1.00 38.43  ? 123 LEU A CB  1 
ATOM   862  C  CG  . LEU A 1 123 ? 73.695  26.947 56.190 1.00 41.65  ? 123 LEU A CG  1 
ATOM   863  C  CD1 . LEU A 1 123 ? 72.503  26.019 56.075 1.00 36.56  ? 123 LEU A CD1 1 
ATOM   864  C  CD2 . LEU A 1 123 ? 74.203  26.954 57.626 1.00 40.72  ? 123 LEU A CD2 1 
ATOM   865  N  N   . SER A 1 124 ? 74.676  28.549 52.877 1.00 34.86  ? 124 SER A N   1 
ATOM   866  C  CA  . SER A 1 124 ? 74.246  29.829 52.349 1.00 34.13  ? 124 SER A CA  1 
ATOM   867  C  C   . SER A 1 124 ? 73.489  29.707 51.025 1.00 42.54  ? 124 SER A C   1 
ATOM   868  O  O   . SER A 1 124 ? 72.501  30.409 50.796 1.00 40.64  ? 124 SER A O   1 
ATOM   869  C  CB  . SER A 1 124 ? 75.469  30.712 52.147 1.00 33.30  ? 124 SER A CB  1 
ATOM   870  O  OG  . SER A 1 124 ? 75.115  31.955 51.572 1.00 49.24  ? 124 SER A OG  1 
ATOM   871  N  N   . GLU A 1 125 ? 73.981  28.831 50.152 1.00 34.05  ? 125 GLU A N   1 
ATOM   872  C  CA  . GLU A 1 125 ? 73.371  28.592 48.853 1.00 40.62  ? 125 GLU A CA  1 
ATOM   873  C  C   . GLU A 1 125 ? 72.057  27.845 49.039 1.00 31.37  ? 125 GLU A C   1 
ATOM   874  O  O   . GLU A 1 125 ? 71.075  28.101 48.351 1.00 42.95  ? 125 GLU A O   1 
ATOM   875  C  CB  . GLU A 1 125 ? 74.332  27.791 47.975 1.00 42.19  ? 125 GLU A CB  1 
ATOM   876  C  CG  . GLU A 1 125 ? 75.653  28.513 47.770 1.00 42.49  ? 125 GLU A CG  1 
ATOM   877  C  CD  . GLU A 1 125 ? 76.694  27.648 47.107 1.00 41.84  ? 125 GLU A CD  1 
ATOM   878  O  OE1 . GLU A 1 125 ? 76.868  26.498 47.561 1.00 45.09  ? 125 GLU A OE1 1 
ATOM   879  O  OE2 . GLU A 1 125 ? 77.335  28.119 46.144 1.00 46.04  ? 125 GLU A OE2 1 
ATOM   880  N  N   . ILE A 1 126 ? 72.036  26.922 49.981 1.00 33.84  ? 126 ILE A N   1 
ATOM   881  C  CA  . ILE A 1 126 ? 70.808  26.213 50.244 1.00 36.95  ? 126 ILE A CA  1 
ATOM   882  C  C   . ILE A 1 126 ? 69.767  27.257 50.667 1.00 38.76  ? 126 ILE A C   1 
ATOM   883  O  O   . ILE A 1 126 ? 68.624  27.233 50.209 1.00 36.74  ? 126 ILE A O   1 
ATOM   884  C  CB  . ILE A 1 126 ? 71.021  25.146 51.324 1.00 28.76  ? 126 ILE A CB  1 
ATOM   885  C  CG1 . ILE A 1 126 ? 71.925  24.040 50.750 1.00 35.25  ? 126 ILE A CG1 1 
ATOM   886  C  CG2 . ILE A 1 126 ? 69.696  24.569 51.770 1.00 22.91  ? 126 ILE A CG2 1 
ATOM   887  C  CD1 . ILE A 1 126 ? 72.383  22.982 51.749 1.00 39.65  ? 126 ILE A CD1 1 
ATOM   888  N  N   . LYS A 1 127 ? 70.173  28.202 51.504 1.00 30.75  ? 127 LYS A N   1 
ATOM   889  C  CA  . LYS A 1 127 ? 69.246  29.235 51.931 1.00 33.64  ? 127 LYS A CA  1 
ATOM   890  C  C   . LYS A 1 127 ? 68.649  29.948 50.723 1.00 28.63  ? 127 LYS A C   1 
ATOM   891  O  O   . LYS A 1 127 ? 67.438  30.091 50.618 1.00 30.99  ? 127 LYS A O   1 
ATOM   892  C  CB  . LYS A 1 127 ? 69.947  30.231 52.862 1.00 29.74  ? 127 LYS A CB  1 
ATOM   893  C  CG  . LYS A 1 127 ? 70.189  29.630 54.256 1.00 33.25  ? 127 LYS A CG  1 
ATOM   894  C  CD  . LYS A 1 127 ? 70.836  30.584 55.233 1.00 32.34  ? 127 LYS A CD  1 
ATOM   895  C  CE  . LYS A 1 127 ? 70.772  29.971 56.632 1.00 40.33  ? 127 LYS A CE  1 
ATOM   896  N  NZ  . LYS A 1 127 ? 71.040  30.962 57.693 1.00 37.20  ? 127 LYS A NZ  1 
ATOM   897  N  N   . ARG A 1 128 ? 69.502  30.375 49.803 1.00 32.23  ? 128 ARG A N   1 
ATOM   898  C  CA  . ARG A 1 128 ? 69.028  31.069 48.613 1.00 30.92  ? 128 ARG A CA  1 
ATOM   899  C  C   . ARG A 1 128 ? 68.073  30.194 47.789 1.00 33.24  ? 128 ARG A C   1 
ATOM   900  O  O   . ARG A 1 128 ? 67.105  30.690 47.214 1.00 28.93  ? 128 ARG A O   1 
ATOM   901  C  CB  . ARG A 1 128 ? 70.214  31.493 47.753 1.00 24.70  ? 128 ARG A CB  1 
ATOM   902  C  CG  . ARG A 1 128 ? 69.841  32.325 46.544 1.00 25.47  ? 128 ARG A CG  1 
ATOM   903  C  CD  . ARG A 1 128 ? 69.253  33.670 46.950 1.00 35.52  ? 128 ARG A CD  1 
ATOM   904  N  NE  . ARG A 1 128 ? 68.939  34.475 45.776 1.00 42.60  ? 128 ARG A NE  1 
ATOM   905  C  CZ  . ARG A 1 128 ? 67.762  35.053 45.549 1.00 38.38  ? 128 ARG A CZ  1 
ATOM   906  N  NH1 . ARG A 1 128 ? 66.764  34.933 46.422 1.00 30.49  ? 128 ARG A NH1 1 
ATOM   907  N  NH2 . ARG A 1 128 ? 67.571  35.714 44.419 1.00 37.90  ? 128 ARG A NH2 1 
ATOM   908  N  N   . VAL A 1 129 ? 68.353  28.897 47.729 1.00 34.54  ? 129 VAL A N   1 
ATOM   909  C  CA  . VAL A 1 129 ? 67.504  27.987 46.980 1.00 32.90  ? 129 VAL A CA  1 
ATOM   910  C  C   . VAL A 1 129 ? 66.121  27.947 47.594 1.00 29.93  ? 129 VAL A C   1 
ATOM   911  O  O   . VAL A 1 129 ? 65.127  28.134 46.900 1.00 28.82  ? 129 VAL A O   1 
ATOM   912  C  CB  . VAL A 1 129 ? 68.102  26.555 46.935 1.00 32.85  ? 129 VAL A CB  1 
ATOM   913  C  CG1 . VAL A 1 129 ? 67.075  25.555 46.375 1.00 30.02  ? 129 VAL A CG1 1 
ATOM   914  C  CG2 . VAL A 1 129 ? 69.335  26.555 46.054 1.00 29.48  ? 129 VAL A CG2 1 
ATOM   915  N  N   . MET A 1 130 ? 66.048  27.699 48.896 1.00 32.77  ? 130 MET A N   1 
ATOM   916  C  CA  . MET A 1 130 ? 64.755  27.657 49.575 1.00 25.23  ? 130 MET A CA  1 
ATOM   917  C  C   . MET A 1 130 ? 64.014  28.999 49.552 1.00 28.53  ? 130 MET A C   1 
ATOM   918  O  O   . MET A 1 130 ? 62.787  29.031 49.489 1.00 25.98  ? 130 MET A O   1 
ATOM   919  C  CB  . MET A 1 130 ? 64.929  27.184 51.015 1.00 36.53  ? 130 MET A CB  1 
ATOM   920  C  CG  . MET A 1 130 ? 65.325  25.729 51.110 1.00 31.19  ? 130 MET A CG  1 
ATOM   921  S  SD  . MET A 1 130 ? 64.182  24.649 50.239 1.00 33.88  ? 130 MET A SD  1 
ATOM   922  C  CE  . MET A 1 130 ? 62.642  24.992 51.119 1.00 37.11  ? 130 MET A CE  1 
ATOM   923  N  N   . GLN A 1 131 ? 64.757  30.103 49.606 1.00 30.24  ? 131 GLN A N   1 
ATOM   924  C  CA  . GLN A 1 131 ? 64.151  31.434 49.575 1.00 27.25  ? 131 GLN A CA  1 
ATOM   925  C  C   . GLN A 1 131 ? 63.402  31.658 48.254 1.00 32.84  ? 131 GLN A C   1 
ATOM   926  O  O   . GLN A 1 131 ? 62.262  32.119 48.247 1.00 29.03  ? 131 GLN A O   1 
ATOM   927  C  CB  . GLN A 1 131 ? 65.235  32.496 49.733 1.00 24.62  ? 131 GLN A CB  1 
ATOM   928  C  CG  . GLN A 1 131 ? 64.722  33.922 49.865 1.00 26.63  ? 131 GLN A CG  1 
ATOM   929  C  CD  . GLN A 1 131 ? 65.837  34.885 50.209 1.00 30.61  ? 131 GLN A CD  1 
ATOM   930  O  OE1 . GLN A 1 131 ? 66.759  35.094 49.423 1.00 37.04  ? 131 GLN A OE1 1 
ATOM   931  N  NE2 . GLN A 1 131 ? 65.768  35.467 51.393 1.00 31.94  ? 131 GLN A NE2 1 
ATOM   932  N  N   . MET A 1 132 ? 64.049  31.320 47.139 1.00 23.26  ? 132 MET A N   1 
ATOM   933  C  CA  . MET A 1 132 ? 63.446  31.506 45.817 1.00 26.19  ? 132 MET A CA  1 
ATOM   934  C  C   . MET A 1 132 ? 62.220  30.603 45.665 1.00 17.10  ? 132 MET A C   1 
ATOM   935  O  O   . MET A 1 132 ? 61.185  31.033 45.190 1.00 24.61  ? 132 MET A O   1 
ATOM   936  C  CB  . MET A 1 132 ? 64.480  31.215 44.710 1.00 20.33  ? 132 MET A CB  1 
ATOM   937  C  CG  . MET A 1 132 ? 65.642  32.209 44.657 1.00 29.87  ? 132 MET A CG  1 
ATOM   938  S  SD  . MET A 1 132 ? 66.726  32.103 43.204 1.00 31.72  ? 132 MET A SD  1 
ATOM   939  C  CE  . MET A 1 132 ? 67.922  30.960 43.771 1.00 31.46  ? 132 MET A CE  1 
ATOM   940  N  N   . LEU A 1 133 ? 62.357  29.360 46.106 1.00 19.76  ? 133 LEU A N   1 
ATOM   941  C  CA  . LEU A 1 133 ? 61.292  28.382 46.057 1.00 20.99  ? 133 LEU A CA  1 
ATOM   942  C  C   . LEU A 1 133 ? 60.069  28.886 46.842 1.00 27.35  ? 133 LEU A C   1 
ATOM   943  O  O   . LEU A 1 133 ? 58.956  28.851 46.338 1.00 24.64  ? 133 LEU A O   1 
ATOM   944  C  CB  . LEU A 1 133 ? 61.790  27.048 46.636 1.00 17.65  ? 133 LEU A CB  1 
ATOM   945  C  CG  . LEU A 1 133 ? 60.834  25.847 46.807 1.00 29.26  ? 133 LEU A CG  1 
ATOM   946  C  CD1 . LEU A 1 133 ? 59.991  25.677 45.577 1.00 38.80  ? 133 LEU A CD1 1 
ATOM   947  C  CD2 . LEU A 1 133 ? 61.658  24.556 47.041 1.00 28.17  ? 133 LEU A CD2 1 
ATOM   948  N  N   . LEU A 1 134 ? 60.281  29.335 48.077 1.00 30.19  ? 134 LEU A N   1 
ATOM   949  C  CA  . LEU A 1 134 ? 59.183  29.831 48.912 1.00 24.77  ? 134 LEU A CA  1 
ATOM   950  C  C   . LEU A 1 134 ? 58.588  31.126 48.350 1.00 21.61  ? 134 LEU A C   1 
ATOM   951  O  O   . LEU A 1 134 ? 57.405  31.369 48.494 1.00 25.50  ? 134 LEU A O   1 
ATOM   952  C  CB  . LEU A 1 134 ? 59.666  30.042 50.354 1.00 28.12  ? 134 LEU A CB  1 
ATOM   953  C  CG  . LEU A 1 134 ? 60.008  28.733 51.099 1.00 28.79  ? 134 LEU A CG  1 
ATOM   954  C  CD1 . LEU A 1 134 ? 60.764  29.012 52.406 1.00 26.43  ? 134 LEU A CD1 1 
ATOM   955  C  CD2 . LEU A 1 134 ? 58.730  27.979 51.363 1.00 22.07  ? 134 LEU A CD2 1 
ATOM   956  N  N   . ASN A 1 135 ? 59.415  31.948 47.714 1.00 21.53  ? 135 ASN A N   1 
ATOM   957  C  CA  . ASN A 1 135 ? 58.933  33.173 47.112 1.00 21.04  ? 135 ASN A CA  1 
ATOM   958  C  C   . ASN A 1 135 ? 58.085  32.804 45.910 1.00 25.24  ? 135 ASN A C   1 
ATOM   959  O  O   . ASN A 1 135 ? 57.071  33.446 45.636 1.00 26.74  ? 135 ASN A O   1 
ATOM   960  C  CB  . ASN A 1 135 ? 60.102  34.078 46.706 1.00 25.00  ? 135 ASN A CB  1 
ATOM   961  C  CG  . ASN A 1 135 ? 59.679  35.534 46.499 1.00 32.21  ? 135 ASN A CG  1 
ATOM   962  O  OD1 . ASN A 1 135 ? 58.854  36.080 47.243 1.00 27.36  ? 135 ASN A OD1 1 
ATOM   963  N  ND2 . ASN A 1 135 ? 60.265  36.174 45.498 1.00 27.81  ? 135 ASN A ND2 1 
ATOM   964  N  N   . GLY A 1 136 ? 58.486  31.750 45.201 1.00 29.89  ? 136 GLY A N   1 
ATOM   965  C  CA  . GLY A 1 136 ? 57.707  31.314 44.059 1.00 22.30  ? 136 GLY A CA  1 
ATOM   966  C  C   . GLY A 1 136 ? 56.366  30.773 44.522 1.00 28.77  ? 136 GLY A C   1 
ATOM   967  O  O   . GLY A 1 136 ? 55.333  31.047 43.906 1.00 24.10  ? 136 GLY A O   1 
ATOM   968  N  N   . LEU A 1 137 ? 56.365  30.000 45.608 1.00 26.72  ? 137 LEU A N   1 
ATOM   969  C  CA  . LEU A 1 137 ? 55.111  29.444 46.105 1.00 31.79  ? 137 LEU A CA  1 
ATOM   970  C  C   . LEU A 1 137 ? 54.174  30.538 46.619 1.00 26.96  ? 137 LEU A C   1 
ATOM   971  O  O   . LEU A 1 137 ? 52.971  30.431 46.457 1.00 24.53  ? 137 LEU A O   1 
ATOM   972  C  CB  . LEU A 1 137 ? 55.354  28.400 47.203 1.00 26.87  ? 137 LEU A CB  1 
ATOM   973  C  CG  . LEU A 1 137 ? 55.884  27.017 46.791 1.00 33.45  ? 137 LEU A CG  1 
ATOM   974  C  CD1 . LEU A 1 137 ? 56.296  26.255 48.042 1.00 28.94  ? 137 LEU A CD1 1 
ATOM   975  C  CD2 . LEU A 1 137 ? 54.833  26.231 46.015 1.00 22.39  ? 137 LEU A CD2 1 
ATOM   976  N  N   . TYR A 1 138 ? 54.723  31.579 47.245 1.00 29.52  ? 138 TYR A N   1 
ATOM   977  C  CA  . TYR A 1 138 ? 53.906  32.693 47.733 1.00 28.91  ? 138 TYR A CA  1 
ATOM   978  C  C   . TYR A 1 138 ? 53.138  33.279 46.549 1.00 22.29  ? 138 TYR A C   1 
ATOM   979  O  O   . TYR A 1 138 ? 51.918  33.456 46.572 1.00 25.01  ? 138 TYR A O   1 
ATOM   980  C  CB  . TYR A 1 138 ? 54.793  33.813 48.298 1.00 29.64  ? 138 TYR A CB  1 
ATOM   981  C  CG  . TYR A 1 138 ? 54.012  35.019 48.801 1.00 21.71  ? 138 TYR A CG  1 
ATOM   982  C  CD1 . TYR A 1 138 ? 53.445  35.006 50.082 1.00 31.25  ? 138 TYR A CD1 1 
ATOM   983  C  CD2 . TYR A 1 138 ? 53.832  36.161 48.004 1.00 13.97  ? 138 TYR A CD2 1 
ATOM   984  C  CE1 . TYR A 1 138 ? 52.720  36.083 50.560 1.00 23.95  ? 138 TYR A CE1 1 
ATOM   985  C  CE2 . TYR A 1 138 ? 53.109  37.257 48.472 1.00 23.58  ? 138 TYR A CE2 1 
ATOM   986  C  CZ  . TYR A 1 138 ? 52.551  37.203 49.760 1.00 36.84  ? 138 TYR A CZ  1 
ATOM   987  O  OH  . TYR A 1 138 ? 51.809  38.239 50.271 1.00 37.94  ? 138 TYR A OH  1 
ATOM   988  N  N   . TYR A 1 139 ? 53.898  33.602 45.515 1.00 27.61  ? 139 TYR A N   1 
ATOM   989  C  CA  . TYR A 1 139 ? 53.333  34.182 44.323 1.00 20.97  ? 139 TYR A CA  1 
ATOM   990  C  C   . TYR A 1 139 ? 52.222  33.341 43.724 1.00 22.22  ? 139 TYR A C   1 
ATOM   991  O  O   . TYR A 1 139 ? 51.127  33.843 43.479 1.00 26.15  ? 139 TYR A O   1 
ATOM   992  C  CB  . TYR A 1 139 ? 54.427  34.438 43.281 1.00 22.23  ? 139 TYR A CB  1 
ATOM   993  C  CG  . TYR A 1 139 ? 53.862  34.938 41.977 1.00 28.53  ? 139 TYR A CG  1 
ATOM   994  C  CD1 . TYR A 1 139 ? 53.430  36.260 41.842 1.00 34.21  ? 139 TYR A CD1 1 
ATOM   995  C  CD2 . TYR A 1 139 ? 53.702  34.076 40.895 1.00 27.08  ? 139 TYR A CD2 1 
ATOM   996  C  CE1 . TYR A 1 139 ? 52.846  36.712 40.655 1.00 29.30  ? 139 TYR A CE1 1 
ATOM   997  C  CE2 . TYR A 1 139 ? 53.112  34.516 39.689 1.00 24.75  ? 139 TYR A CE2 1 
ATOM   998  C  CZ  . TYR A 1 139 ? 52.687  35.831 39.580 1.00 31.77  ? 139 TYR A CZ  1 
ATOM   999  O  OH  . TYR A 1 139 ? 52.112  36.269 38.403 1.00 27.96  ? 139 TYR A OH  1 
ATOM   1000 N  N   . ILE A 1 140 ? 52.455  32.060 43.498 1.00 21.04  ? 140 ILE A N   1 
ATOM   1001 C  CA  . ILE A 1 140 ? 51.381  31.290 42.895 1.00 26.16  ? 140 ILE A CA  1 
ATOM   1002 C  C   . ILE A 1 140 ? 50.154  31.135 43.810 1.00 27.37  ? 140 ILE A C   1 
ATOM   1003 O  O   . ILE A 1 140 ? 49.021  31.151 43.339 1.00 24.02  ? 140 ILE A O   1 
ATOM   1004 C  CB  . ILE A 1 140 ? 51.869  29.889 42.387 1.00 30.43  ? 140 ILE A CB  1 
ATOM   1005 C  CG1 . ILE A 1 140 ? 51.986  28.902 43.533 1.00 31.04  ? 140 ILE A CG1 1 
ATOM   1006 C  CG2 . ILE A 1 140 ? 53.232  30.025 41.692 1.00 31.86  ? 140 ILE A CG2 1 
ATOM   1007 C  CD1 . ILE A 1 140 ? 52.241  27.473 43.047 1.00 27.24  ? 140 ILE A CD1 1 
ATOM   1008 N  N   . HIS A 1 141 ? 50.367  31.016 45.116 1.00 28.74  ? 141 HIS A N   1 
ATOM   1009 C  CA  . HIS A 1 141 ? 49.229  30.876 46.032 1.00 22.57  ? 141 HIS A CA  1 
ATOM   1010 C  C   . HIS A 1 141 ? 48.467  32.200 46.104 1.00 23.54  ? 141 HIS A C   1 
ATOM   1011 O  O   . HIS A 1 141 ? 47.248  32.217 46.099 1.00 23.64  ? 141 HIS A O   1 
ATOM   1012 C  CB  . HIS A 1 141 ? 49.736  30.421 47.391 1.00 22.93  ? 141 HIS A CB  1 
ATOM   1013 C  CG  . HIS A 1 141 ? 50.271  29.024 47.373 1.00 32.97  ? 141 HIS A CG  1 
ATOM   1014 N  ND1 . HIS A 1 141 ? 51.177  28.558 48.299 1.00 31.59  ? 141 HIS A ND1 1 
ATOM   1015 C  CD2 . HIS A 1 141 ? 50.041  27.997 46.519 1.00 26.14  ? 141 HIS A CD2 1 
ATOM   1016 C  CE1 . HIS A 1 141 ? 51.486  27.306 48.010 1.00 26.08  ? 141 HIS A CE1 1 
ATOM   1017 N  NE2 . HIS A 1 141 ? 50.810  26.941 46.937 1.00 26.43  ? 141 HIS A NE2 1 
ATOM   1018 N  N   . ARG A 1 142 ? 49.201  33.307 46.132 1.00 27.35  ? 142 ARG A N   1 
ATOM   1019 C  CA  . ARG A 1 142 ? 48.586  34.638 46.137 1.00 29.83  ? 142 ARG A CA  1 
ATOM   1020 C  C   . ARG A 1 142 ? 47.647  34.742 44.921 1.00 31.86  ? 142 ARG A C   1 
ATOM   1021 O  O   . ARG A 1 142 ? 46.583  35.343 44.997 1.00 27.92  ? 142 ARG A O   1 
ATOM   1022 C  CB  . ARG A 1 142 ? 49.667  35.699 46.001 1.00 41.07  ? 142 ARG A CB  1 
ATOM   1023 C  CG  . ARG A 1 142 ? 49.215  37.097 46.300 1.00 58.16  ? 142 ARG A CG  1 
ATOM   1024 C  CD  . ARG A 1 142 ? 49.333  37.377 47.786 1.00 64.38  ? 142 ARG A CD  1 
ATOM   1025 N  NE  . ARG A 1 142 ? 49.030  38.766 48.106 1.00 64.57  ? 142 ARG A NE  1 
ATOM   1026 C  CZ  . ARG A 1 142 ? 49.499  39.804 47.423 1.00 69.70  ? 142 ARG A CZ  1 
ATOM   1027 N  NH1 . ARG A 1 142 ? 49.174  41.036 47.790 1.00 71.07  ? 142 ARG A NH1 1 
ATOM   1028 N  NH2 . ARG A 1 142 ? 50.281  39.615 46.365 1.00 66.66  ? 142 ARG A NH2 1 
ATOM   1029 N  N   . ASN A 1 143 ? 48.056  34.155 43.795 1.00 31.41  ? 143 ASN A N   1 
ATOM   1030 C  CA  . ASN A 1 143 ? 47.250  34.183 42.576 1.00 24.56  ? 143 ASN A CA  1 
ATOM   1031 C  C   . ASN A 1 143 ? 46.238  33.060 42.485 1.00 24.51  ? 143 ASN A C   1 
ATOM   1032 O  O   . ASN A 1 143 ? 45.676  32.796 41.426 1.00 28.46  ? 143 ASN A O   1 
ATOM   1033 C  CB  . ASN A 1 143 ? 48.147  34.180 41.349 1.00 29.58  ? 143 ASN A CB  1 
ATOM   1034 C  CG  . ASN A 1 143 ? 48.709  35.548 41.057 1.00 25.72  ? 143 ASN A CG  1 
ATOM   1035 O  OD1 . ASN A 1 143 ? 48.105  36.318 40.330 1.00 35.62  ? 143 ASN A OD1 1 
ATOM   1036 N  ND2 . ASN A 1 143 ? 49.862  35.865 41.645 1.00 23.44  ? 143 ASN A ND2 1 
ATOM   1037 N  N   . LYS A 1 144 ? 46.009  32.405 43.619 1.00 32.59  ? 144 LYS A N   1 
ATOM   1038 C  CA  . LYS A 1 144 ? 45.023  31.339 43.719 1.00 25.24  ? 144 LYS A CA  1 
ATOM   1039 C  C   . LYS A 1 144 ? 45.285  30.094 42.882 1.00 29.02  ? 144 LYS A C   1 
ATOM   1040 O  O   . LYS A 1 144 ? 44.365  29.499 42.326 1.00 21.61  ? 144 LYS A O   1 
ATOM   1041 C  CB  . LYS A 1 144 ? 43.637  31.903 43.402 1.00 35.34  ? 144 LYS A CB  1 
ATOM   1042 C  CG  . LYS A 1 144 ? 43.222  32.990 44.360 1.00 34.87  ? 144 LYS A CG  1 
ATOM   1043 C  CD  . LYS A 1 144 ? 42.438  34.090 43.668 1.00 46.69  ? 144 LYS A CD  1 
ATOM   1044 C  CE  . LYS A 1 144 ? 40.997  33.705 43.428 1.00 49.02  ? 144 LYS A CE  1 
ATOM   1045 N  NZ  . LYS A 1 144 ? 40.272  34.787 42.705 1.00 46.66  ? 144 LYS A NZ  1 
ATOM   1046 N  N   . ILE A 1 145 ? 46.543  29.683 42.829 1.00 24.48  ? 145 ILE A N   1 
ATOM   1047 C  CA  . ILE A 1 145 ? 46.904  28.489 42.098 1.00 27.49  ? 145 ILE A CA  1 
ATOM   1048 C  C   . ILE A 1 145 ? 47.585  27.517 43.043 1.00 19.54  ? 145 ILE A C   1 
ATOM   1049 O  O   . ILE A 1 145 ? 48.369  27.918 43.907 1.00 25.08  ? 145 ILE A O   1 
ATOM   1050 C  CB  . ILE A 1 145 ? 47.890  28.813 40.910 1.00 24.89  ? 145 ILE A CB  1 
ATOM   1051 C  CG1 . ILE A 1 145 ? 47.215  29.731 39.865 1.00 20.72  ? 145 ILE A CG1 1 
ATOM   1052 C  CG2 . ILE A 1 145 ? 48.397  27.548 40.303 1.00 23.88  ? 145 ILE A CG2 1 
ATOM   1053 C  CD1 . ILE A 1 145 ? 45.804  29.339 39.480 1.00 17.73  ? 145 ILE A CD1 1 
ATOM   1054 N  N   . LEU A 1 146 ? 47.267  26.238 42.892 1.00 26.64  ? 146 LEU A N   1 
ATOM   1055 C  CA  . LEU A 1 146 ? 47.915  25.181 43.680 1.00 33.73  ? 146 LEU A CA  1 
ATOM   1056 C  C   . LEU A 1 146 ? 48.766  24.447 42.667 1.00 29.68  ? 146 LEU A C   1 
ATOM   1057 O  O   . LEU A 1 146 ? 48.272  24.099 41.599 1.00 24.83  ? 146 LEU A O   1 
ATOM   1058 C  CB  . LEU A 1 146 ? 46.902  24.191 44.244 1.00 24.59  ? 146 LEU A CB  1 
ATOM   1059 C  CG  . LEU A 1 146 ? 45.891  24.774 45.218 1.00 25.92  ? 146 LEU A CG  1 
ATOM   1060 C  CD1 . LEU A 1 146 ? 44.864  23.689 45.569 1.00 29.85  ? 146 LEU A CD1 1 
ATOM   1061 C  CD2 . LEU A 1 146 ? 46.626  25.307 46.432 1.00 21.64  ? 146 LEU A CD2 1 
ATOM   1062 N  N   . HIS A 1 147 ? 50.030  24.212 42.990 1.00 27.38  ? 147 HIS A N   1 
ATOM   1063 C  CA  . HIS A 1 147 ? 50.908  23.514 42.069 1.00 23.55  ? 147 HIS A CA  1 
ATOM   1064 C  C   . HIS A 1 147 ? 50.551  22.029 41.905 1.00 27.50  ? 147 HIS A C   1 
ATOM   1065 O  O   . HIS A 1 147 ? 50.428  21.529 40.791 1.00 22.71  ? 147 HIS A O   1 
ATOM   1066 C  CB  . HIS A 1 147 ? 52.355  23.661 42.520 1.00 25.79  ? 147 HIS A CB  1 
ATOM   1067 C  CG  . HIS A 1 147 ? 53.337  23.111 41.534 1.00 33.99  ? 147 HIS A CG  1 
ATOM   1068 N  ND1 . HIS A 1 147 ? 53.547  21.759 41.371 1.00 29.90  ? 147 HIS A ND1 1 
ATOM   1069 C  CD2 . HIS A 1 147 ? 54.148  23.730 40.646 1.00 23.69  ? 147 HIS A CD2 1 
ATOM   1070 C  CE1 . HIS A 1 147 ? 54.451  21.570 40.427 1.00 28.30  ? 147 HIS A CE1 1 
ATOM   1071 N  NE2 . HIS A 1 147 ? 54.832  22.751 39.973 1.00 31.11  ? 147 HIS A NE2 1 
ATOM   1072 N  N   . ARG A 1 148 ? 50.412  21.322 43.025 1.00 28.86  ? 148 ARG A N   1 
ATOM   1073 C  CA  . ARG A 1 148 ? 50.052  19.900 43.010 1.00 32.98  ? 148 ARG A CA  1 
ATOM   1074 C  C   . ARG A 1 148 ? 51.015  18.876 42.391 1.00 33.29  ? 148 ARG A C   1 
ATOM   1075 O  O   . ARG A 1 148 ? 50.620  17.745 42.113 1.00 33.17  ? 148 ARG A O   1 
ATOM   1076 C  CB  . ARG A 1 148 ? 48.670  19.725 42.384 1.00 25.21  ? 148 ARG A CB  1 
ATOM   1077 C  CG  . ARG A 1 148 ? 47.667  20.711 42.943 1.00 40.19  ? 148 ARG A CG  1 
ATOM   1078 C  CD  . ARG A 1 148 ? 46.247  20.228 42.771 1.00 30.43  ? 148 ARG A CD  1 
ATOM   1079 N  NE  . ARG A 1 148 ? 45.874  20.079 41.371 1.00 33.92  ? 148 ARG A NE  1 
ATOM   1080 C  CZ  . ARG A 1 148 ? 44.685  19.629 40.984 1.00 31.10  ? 148 ARG A CZ  1 
ATOM   1081 N  NH1 . ARG A 1 148 ? 43.781  19.298 41.897 1.00 29.37  ? 148 ARG A NH1 1 
ATOM   1082 N  NH2 . ARG A 1 148 ? 44.405  19.495 39.701 1.00 22.57  ? 148 ARG A NH2 1 
ATOM   1083 N  N   . ASP A 1 149 ? 52.266  19.251 42.173 1.00 29.40  ? 149 ASP A N   1 
ATOM   1084 C  CA  . ASP A 1 149 ? 53.228  18.295 41.644 1.00 30.37  ? 149 ASP A CA  1 
ATOM   1085 C  C   . ASP A 1 149 ? 54.612  18.706 42.100 1.00 31.80  ? 149 ASP A C   1 
ATOM   1086 O  O   . ASP A 1 149 ? 55.581  18.648 41.347 1.00 34.63  ? 149 ASP A O   1 
ATOM   1087 C  CB  . ASP A 1 149 ? 53.148  18.221 40.113 1.00 40.38  ? 149 ASP A CB  1 
ATOM   1088 C  CG  . ASP A 1 149 ? 53.948  17.050 39.537 1.00 41.95  ? 149 ASP A CG  1 
ATOM   1089 O  OD1 . ASP A 1 149 ? 53.976  15.989 40.183 1.00 27.93  ? 149 ASP A OD1 1 
ATOM   1090 O  OD2 . ASP A 1 149 ? 54.532  17.186 38.432 1.00 39.28  ? 149 ASP A OD2 1 
ATOM   1091 N  N   . MET A 1 150 ? 54.698  19.153 43.346 1.00 22.94  ? 150 MET A N   1 
ATOM   1092 C  CA  . MET A 1 150 ? 55.986  19.550 43.888 1.00 26.38  ? 150 MET A CA  1 
ATOM   1093 C  C   . MET A 1 150 ? 56.878  18.314 43.984 1.00 30.50  ? 150 MET A C   1 
ATOM   1094 O  O   . MET A 1 150 ? 56.418  17.207 44.264 1.00 35.88  ? 150 MET A O   1 
ATOM   1095 C  CB  . MET A 1 150 ? 55.826  20.173 45.276 1.00 30.24  ? 150 MET A CB  1 
ATOM   1096 C  CG  . MET A 1 150 ? 55.223  21.576 45.301 1.00 26.71  ? 150 MET A CG  1 
ATOM   1097 S  SD  . MET A 1 150 ? 56.251  22.848 44.516 1.00 34.12  ? 150 MET A SD  1 
ATOM   1098 C  CE  . MET A 1 150 ? 57.577  22.934 45.649 1.00 24.43  ? 150 MET A CE  1 
ATOM   1099 N  N   . LYS A 1 151 ? 58.156  18.511 43.720 1.00 35.20  ? 151 LYS A N   1 
ATOM   1100 C  CA  . LYS A 1 151 ? 59.138  17.443 43.789 1.00 29.34  ? 151 LYS A CA  1 
ATOM   1101 C  C   . LYS A 1 151 ? 60.394  18.092 43.262 1.00 27.32  ? 151 LYS A C   1 
ATOM   1102 O  O   . LYS A 1 151 ? 60.322  19.065 42.506 1.00 27.96  ? 151 LYS A O   1 
ATOM   1103 C  CB  . LYS A 1 151 ? 58.733  16.247 42.916 1.00 33.11  ? 151 LYS A CB  1 
ATOM   1104 C  CG  . LYS A 1 151 ? 58.561  16.568 41.454 1.00 27.80  ? 151 LYS A CG  1 
ATOM   1105 C  CD  . LYS A 1 151 ? 58.527  15.310 40.624 1.00 31.79  ? 151 LYS A CD  1 
ATOM   1106 C  CE  . LYS A 1 151 ? 57.407  15.326 39.622 1.00 33.23  ? 151 LYS A CE  1 
ATOM   1107 N  NZ  . LYS A 1 151 ? 57.497  14.187 38.679 1.00 48.23  ? 151 LYS A NZ  1 
ATOM   1108 N  N   . ALA A 1 152 ? 61.540  17.562 43.663 1.00 24.73  ? 152 ALA A N   1 
ATOM   1109 C  CA  . ALA A 1 152 ? 62.812  18.113 43.245 1.00 27.47  ? 152 ALA A CA  1 
ATOM   1110 C  C   . ALA A 1 152 ? 62.969  18.266 41.734 1.00 23.07  ? 152 ALA A C   1 
ATOM   1111 O  O   . ALA A 1 152 ? 63.533  19.242 41.278 1.00 30.93  ? 152 ALA A O   1 
ATOM   1112 C  CB  . ALA A 1 152 ? 63.954  17.267 43.822 1.00 30.98  ? 152 ALA A CB  1 
ATOM   1113 N  N   . ALA A 1 153 ? 62.457  17.330 40.945 1.00 28.73  ? 153 ALA A N   1 
ATOM   1114 C  CA  . ALA A 1 153 ? 62.608  17.441 39.495 1.00 28.15  ? 153 ALA A CA  1 
ATOM   1115 C  C   . ALA A 1 153 ? 61.836  18.612 38.874 1.00 31.35  ? 153 ALA A C   1 
ATOM   1116 O  O   . ALA A 1 153 ? 62.147  19.039 37.762 1.00 31.03  ? 153 ALA A O   1 
ATOM   1117 C  CB  . ALA A 1 153 ? 62.190  16.137 38.819 1.00 29.05  ? 153 ALA A CB  1 
ATOM   1118 N  N   . ASN A 1 154 ? 60.835  19.128 39.579 1.00 28.81  ? 154 ASN A N   1 
ATOM   1119 C  CA  . ASN A 1 154 ? 60.044  20.249 39.059 1.00 25.50  ? 154 ASN A CA  1 
ATOM   1120 C  C   . ASN A 1 154 ? 60.509  21.611 39.577 1.00 23.44  ? 154 ASN A C   1 
ATOM   1121 O  O   . ASN A 1 154 ? 59.766  22.577 39.570 1.00 31.66  ? 154 ASN A O   1 
ATOM   1122 C  CB  . ASN A 1 154 ? 58.565  20.038 39.371 1.00 29.00  ? 154 ASN A CB  1 
ATOM   1123 C  CG  . ASN A 1 154 ? 57.929  18.992 38.475 1.00 22.03  ? 154 ASN A CG  1 
ATOM   1124 O  OD1 . ASN A 1 154 ? 58.454  18.680 37.403 1.00 25.90  ? 154 ASN A OD1 1 
ATOM   1125 N  ND2 . ASN A 1 154 ? 56.779  18.471 38.889 1.00 21.70  ? 154 ASN A ND2 1 
ATOM   1126 N  N   . VAL A 1 155 ? 61.759  21.667 40.010 1.00 26.36  ? 155 VAL A N   1 
ATOM   1127 C  CA  . VAL A 1 155 ? 62.361  22.889 40.518 1.00 21.89  ? 155 VAL A CA  1 
ATOM   1128 C  C   . VAL A 1 155 ? 63.574  23.094 39.639 1.00 28.36  ? 155 VAL A C   1 
ATOM   1129 O  O   . VAL A 1 155 ? 64.553  22.381 39.741 1.00 29.69  ? 155 VAL A O   1 
ATOM   1130 C  CB  . VAL A 1 155 ? 62.810  22.738 41.984 1.00 23.03  ? 155 VAL A CB  1 
ATOM   1131 C  CG1 . VAL A 1 155 ? 63.417  24.030 42.478 1.00 27.24  ? 155 VAL A CG1 1 
ATOM   1132 C  CG2 . VAL A 1 155 ? 61.620  22.325 42.854 1.00 25.56  ? 155 VAL A CG2 1 
ATOM   1133 N  N   . LEU A 1 156 ? 63.502  24.069 38.757 1.00 28.35  ? 156 LEU A N   1 
ATOM   1134 C  CA  . LEU A 1 156 ? 64.603  24.305 37.866 1.00 24.21  ? 156 LEU A CA  1 
ATOM   1135 C  C   . LEU A 1 156 ? 65.525  25.392 38.374 1.00 30.01  ? 156 LEU A C   1 
ATOM   1136 O  O   . LEU A 1 156 ? 65.136  26.232 39.178 1.00 27.42  ? 156 LEU A O   1 
ATOM   1137 C  CB  . LEU A 1 156 ? 64.062  24.687 36.499 1.00 20.34  ? 156 LEU A CB  1 
ATOM   1138 C  CG  . LEU A 1 156 ? 62.950  23.770 35.971 1.00 34.55  ? 156 LEU A CG  1 
ATOM   1139 C  CD1 . LEU A 1 156 ? 62.555  24.218 34.580 1.00 36.12  ? 156 LEU A CD1 1 
ATOM   1140 C  CD2 . LEU A 1 156 ? 63.412  22.329 35.954 1.00 32.41  ? 156 LEU A CD2 1 
ATOM   1141 N  N   . ILE A 1 157 ? 66.776  25.332 37.940 1.00 27.00  ? 157 ILE A N   1 
ATOM   1142 C  CA  . ILE A 1 157 ? 67.731  26.360 38.277 1.00 20.99  ? 157 ILE A CA  1 
ATOM   1143 C  C   . ILE A 1 157 ? 68.433  26.728 36.974 1.00 26.93  ? 157 ILE A C   1 
ATOM   1144 O  O   . ILE A 1 157 ? 68.881  25.853 36.228 1.00 28.83  ? 157 ILE A O   1 
ATOM   1145 C  CB  . ILE A 1 157 ? 68.719  25.909 39.352 1.00 28.05  ? 157 ILE A CB  1 
ATOM   1146 C  CG1 . ILE A 1 157 ? 67.953  25.650 40.663 1.00 23.97  ? 157 ILE A CG1 1 
ATOM   1147 C  CG2 . ILE A 1 157 ? 69.733  27.011 39.603 1.00 36.22  ? 157 ILE A CG2 1 
ATOM   1148 C  CD1 . ILE A 1 157 ? 68.838  25.335 41.864 1.00 30.20  ? 157 ILE A CD1 1 
ATOM   1149 N  N   . THR A 1 158 ? 68.479  28.021 36.664 1.00 30.17  ? 158 THR A N   1 
ATOM   1150 C  CA  . THR A 1 158 ? 69.126  28.465 35.430 1.00 31.89  ? 158 THR A CA  1 
ATOM   1151 C  C   . THR A 1 158 ? 70.636  28.573 35.623 1.00 32.03  ? 158 THR A C   1 
ATOM   1152 O  O   . THR A 1 158 ? 71.154  28.616 36.742 1.00 32.23  ? 158 THR A O   1 
ATOM   1153 C  CB  . THR A 1 158 ? 68.683  29.873 34.988 1.00 30.16  ? 158 THR A CB  1 
ATOM   1154 O  OG1 . THR A 1 158 ? 69.134  30.818 35.968 1.00 30.97  ? 158 THR A OG1 1 
ATOM   1155 C  CG2 . THR A 1 158 ? 67.178  29.966 34.831 1.00 22.34  ? 158 THR A CG2 1 
ATOM   1156 N  N   . ARG A 1 159 ? 71.319  28.650 34.500 1.00 33.98  ? 159 ARG A N   1 
ATOM   1157 C  CA  . ARG A 1 159 ? 72.756  28.798 34.453 1.00 38.96  ? 159 ARG A CA  1 
ATOM   1158 C  C   . ARG A 1 159 ? 73.134  30.038 35.263 1.00 41.35  ? 159 ARG A C   1 
ATOM   1159 O  O   . ARG A 1 159 ? 74.172  30.066 35.917 1.00 45.34  ? 159 ARG A O   1 
ATOM   1160 C  CB  . ARG A 1 159 ? 73.152  28.926 32.978 1.00 46.87  ? 159 ARG A CB  1 
ATOM   1161 C  CG  . ARG A 1 159 ? 74.529  29.429 32.657 1.00 56.86  ? 159 ARG A CG  1 
ATOM   1162 C  CD  . ARG A 1 159 ? 74.755  29.317 31.146 1.00 54.59  ? 159 ARG A CD  1 
ATOM   1163 N  NE  . ARG A 1 159 ? 75.953  30.026 30.713 1.00 56.91  ? 159 ARG A NE  1 
ATOM   1164 C  CZ  . ARG A 1 159 ? 76.071  31.350 30.699 1.00 67.11  ? 159 ARG A CZ  1 
ATOM   1165 N  NH1 . ARG A 1 159 ? 75.059  32.113 31.093 1.00 71.22  ? 159 ARG A NH1 1 
ATOM   1166 N  NH2 . ARG A 1 159 ? 77.201  31.914 30.292 1.00 67.91  ? 159 ARG A NH2 1 
ATOM   1167 N  N   . ASP A 1 160 ? 72.278  31.056 35.235 1.00 35.84  ? 160 ASP A N   1 
ATOM   1168 C  CA  . ASP A 1 160 ? 72.530  32.295 35.972 1.00 39.48  ? 160 ASP A CA  1 
ATOM   1169 C  C   . ASP A 1 160 ? 72.175  32.183 37.450 1.00 31.28  ? 160 ASP A C   1 
ATOM   1170 O  O   . ASP A 1 160 ? 72.263  33.149 38.178 1.00 36.93  ? 160 ASP A O   1 
ATOM   1171 C  CB  . ASP A 1 160 ? 71.732  33.450 35.365 1.00 52.67  ? 160 ASP A CB  1 
ATOM   1172 C  CG  . ASP A 1 160 ? 72.244  33.862 34.001 1.00 63.83  ? 160 ASP A CG  1 
ATOM   1173 O  OD1 . ASP A 1 160 ? 71.450  34.446 33.230 1.00 71.21  ? 160 ASP A OD1 1 
ATOM   1174 O  OD2 . ASP A 1 160 ? 73.437  33.618 33.708 1.00 56.97  ? 160 ASP A OD2 1 
ATOM   1175 N  N   . GLY A 1 161 ? 71.756  31.008 37.891 1.00 34.94  ? 161 GLY A N   1 
ATOM   1176 C  CA  . GLY A 1 161 ? 71.428  30.851 39.293 1.00 31.60  ? 161 GLY A CA  1 
ATOM   1177 C  C   . GLY A 1 161 ? 70.031  31.252 39.766 1.00 34.25  ? 161 GLY A C   1 
ATOM   1178 O  O   . GLY A 1 161 ? 69.832  31.480 40.955 1.00 31.73  ? 161 GLY A O   1 
ATOM   1179 N  N   . VAL A 1 162 ? 69.060  31.352 38.867 1.00 28.56  ? 162 VAL A N   1 
ATOM   1180 C  CA  . VAL A 1 162 ? 67.714  31.707 39.302 1.00 29.69  ? 162 VAL A CA  1 
ATOM   1181 C  C   . VAL A 1 162 ? 66.821  30.465 39.304 1.00 28.96  ? 162 VAL A C   1 
ATOM   1182 O  O   . VAL A 1 162 ? 66.724  29.752 38.302 1.00 29.40  ? 162 VAL A O   1 
ATOM   1183 C  CB  . VAL A 1 162 ? 67.077  32.782 38.393 1.00 31.28  ? 162 VAL A CB  1 
ATOM   1184 C  CG1 . VAL A 1 162 ? 65.638  33.023 38.831 1.00 33.02  ? 162 VAL A CG1 1 
ATOM   1185 C  CG2 . VAL A 1 162 ? 67.893  34.109 38.462 1.00 23.70  ? 162 VAL A CG2 1 
ATOM   1186 N  N   . LEU A 1 163 ? 66.170  30.206 40.428 1.00 28.63  ? 163 LEU A N   1 
ATOM   1187 C  CA  . LEU A 1 163 ? 65.284  29.051 40.542 1.00 26.27  ? 163 LEU A CA  1 
ATOM   1188 C  C   . LEU A 1 163 ? 63.895  29.340 39.971 1.00 23.88  ? 163 LEU A C   1 
ATOM   1189 O  O   . LEU A 1 163 ? 63.368  30.438 40.124 1.00 24.46  ? 163 LEU A O   1 
ATOM   1190 C  CB  . LEU A 1 163 ? 65.177  28.644 42.011 1.00 26.85  ? 163 LEU A CB  1 
ATOM   1191 C  CG  . LEU A 1 163 ? 64.207  27.561 42.473 1.00 26.58  ? 163 LEU A CG  1 
ATOM   1192 C  CD1 . LEU A 1 163 ? 64.655  27.121 43.853 1.00 30.69  ? 163 LEU A CD1 1 
ATOM   1193 C  CD2 . LEU A 1 163 ? 62.766  28.066 42.536 1.00 26.47  ? 163 LEU A CD2 1 
ATOM   1194 N  N   . LYS A 1 164 ? 63.305  28.345 39.310 1.00 29.10  ? 164 LYS A N   1 
ATOM   1195 C  CA  . LYS A 1 164 ? 61.980  28.494 38.719 1.00 25.12  ? 164 LYS A CA  1 
ATOM   1196 C  C   . LYS A 1 164 ? 61.110  27.304 39.038 1.00 26.81  ? 164 LYS A C   1 
ATOM   1197 O  O   . LYS A 1 164 ? 61.514  26.156 38.810 1.00 30.63  ? 164 LYS A O   1 
ATOM   1198 C  CB  . LYS A 1 164 ? 62.052  28.568 37.183 1.00 26.75  ? 164 LYS A CB  1 
ATOM   1199 C  CG  . LYS A 1 164 ? 63.140  29.434 36.607 1.00 32.34  ? 164 LYS A CG  1 
ATOM   1200 C  CD  . LYS A 1 164 ? 62.746  30.879 36.555 1.00 29.04  ? 164 LYS A CD  1 
ATOM   1201 C  CE  . LYS A 1 164 ? 63.829  31.728 35.887 1.00 25.58  ? 164 LYS A CE  1 
ATOM   1202 N  NZ  . LYS A 1 164 ? 63.311  33.102 35.730 1.00 27.41  ? 164 LYS A NZ  1 
ATOM   1203 N  N   . LEU A 1 165 ? 59.911  27.565 39.546 1.00 21.04  ? 165 LEU A N   1 
ATOM   1204 C  CA  . LEU A 1 165 ? 58.980  26.492 39.796 1.00 17.18  ? 165 LEU A CA  1 
ATOM   1205 C  C   . LEU A 1 165 ? 58.530  26.100 38.398 1.00 23.10  ? 165 LEU A C   1 
ATOM   1206 O  O   . LEU A 1 165 ? 58.218  26.976 37.591 1.00 20.41  ? 165 LEU A O   1 
ATOM   1207 C  CB  . LEU A 1 165 ? 57.763  26.976 40.585 1.00 19.31  ? 165 LEU A CB  1 
ATOM   1208 C  CG  . LEU A 1 165 ? 58.099  27.374 42.018 1.00 33.79  ? 165 LEU A CG  1 
ATOM   1209 C  CD1 . LEU A 1 165 ? 56.812  27.698 42.794 1.00 36.06  ? 165 LEU A CD1 1 
ATOM   1210 C  CD2 . LEU A 1 165 ? 58.860  26.240 42.668 1.00 35.71  ? 165 LEU A CD2 1 
ATOM   1211 N  N   . ALA A 1 166 ? 58.499  24.805 38.109 1.00 26.21  ? 166 ALA A N   1 
ATOM   1212 C  CA  . ALA A 1 166 ? 58.105  24.363 36.780 1.00 25.59  ? 166 ALA A CA  1 
ATOM   1213 C  C   . ALA A 1 166 ? 57.071  23.260 36.767 1.00 21.03  ? 166 ALA A C   1 
ATOM   1214 O  O   . ALA A 1 166 ? 56.689  22.726 37.794 1.00 24.29  ? 166 ALA A O   1 
ATOM   1215 C  CB  . ALA A 1 166 ? 59.319  23.908 36.001 1.00 21.69  ? 166 ALA A CB  1 
ATOM   1216 N  N   . ASP A 1 167 ? 56.657  22.922 35.559 1.00 25.43  ? 167 ASP A N   1 
ATOM   1217 C  CA  . ASP A 1 167 ? 55.684  21.888 35.332 1.00 26.68  ? 167 ASP A CA  1 
ATOM   1218 C  C   . ASP A 1 167 ? 54.377  22.126 36.075 1.00 35.11  ? 167 ASP A C   1 
ATOM   1219 O  O   . ASP A 1 167 ? 54.148  21.557 37.153 1.00 29.25  ? 167 ASP A O   1 
ATOM   1220 C  CB  . ASP A 1 167 ? 56.287  20.532 35.715 1.00 37.25  ? 167 ASP A CB  1 
ATOM   1221 C  CG  . ASP A 1 167 ? 55.381  19.377 35.365 1.00 30.04  ? 167 ASP A CG  1 
ATOM   1222 O  OD1 . ASP A 1 167 ? 54.510  19.540 34.473 1.00 37.34  ? 167 ASP A OD1 1 
ATOM   1223 O  OD2 . ASP A 1 167 ? 55.551  18.301 35.965 1.00 48.66  ? 167 ASP A OD2 1 
ATOM   1224 N  N   . PHE A 1 168 ? 53.528  22.977 35.488 1.00 30.10  ? 168 PHE A N   1 
ATOM   1225 C  CA  . PHE A 1 168 ? 52.215  23.277 36.051 1.00 25.67  ? 168 PHE A CA  1 
ATOM   1226 C  C   . PHE A 1 168 ? 51.184  22.406 35.376 1.00 27.46  ? 168 PHE A C   1 
ATOM   1227 O  O   . PHE A 1 168 ? 49.986  22.719 35.358 1.00 30.48  ? 168 PHE A O   1 
ATOM   1228 C  CB  . PHE A 1 168 ? 51.885  24.761 35.869 1.00 18.93  ? 168 PHE A CB  1 
ATOM   1229 C  CG  . PHE A 1 168 ? 52.600  25.621 36.826 1.00 23.77  ? 168 PHE A CG  1 
ATOM   1230 C  CD1 . PHE A 1 168 ? 51.965  26.072 37.993 1.00 19.69  ? 168 PHE A CD1 1 
ATOM   1231 C  CD2 . PHE A 1 168 ? 53.951  25.870 36.658 1.00 16.78  ? 168 PHE A CD2 1 
ATOM   1232 C  CE1 . PHE A 1 168 ? 52.661  26.735 38.961 1.00 20.56  ? 168 PHE A CE1 1 
ATOM   1233 C  CE2 . PHE A 1 168 ? 54.671  26.542 37.635 1.00 16.43  ? 168 PHE A CE2 1 
ATOM   1234 C  CZ  . PHE A 1 168 ? 54.018  26.977 38.801 1.00 28.36  ? 168 PHE A CZ  1 
ATOM   1235 N  N   . GLY A 1 169 ? 51.658  21.292 34.828 1.00 26.81  ? 169 GLY A N   1 
ATOM   1236 C  CA  . GLY A 1 169 ? 50.763  20.393 34.127 1.00 22.47  ? 169 GLY A CA  1 
ATOM   1237 C  C   . GLY A 1 169 ? 49.658  19.792 34.972 1.00 26.64  ? 169 GLY A C   1 
ATOM   1238 O  O   . GLY A 1 169 ? 48.705  19.251 34.427 1.00 28.42  ? 169 GLY A O   1 
ATOM   1239 N  N   . LEU A 1 170 ? 49.765  19.869 36.296 1.00 31.12  ? 170 LEU A N   1 
ATOM   1240 C  CA  . LEU A 1 170 ? 48.717  19.302 37.141 1.00 27.60  ? 170 LEU A CA  1 
ATOM   1241 C  C   . LEU A 1 170 ? 48.186  20.346 38.121 1.00 33.64  ? 170 LEU A C   1 
ATOM   1242 O  O   . LEU A 1 170 ? 47.547  20.024 39.116 1.00 29.63  ? 170 LEU A O   1 
ATOM   1243 C  CB  . LEU A 1 170 ? 49.248  18.078 37.897 1.00 30.62  ? 170 LEU A CB  1 
ATOM   1244 C  CG  . LEU A 1 170 ? 49.789  16.935 37.021 1.00 47.60  ? 170 LEU A CG  1 
ATOM   1245 C  CD1 . LEU A 1 170 ? 50.621  15.978 37.867 1.00 47.31  ? 170 LEU A CD1 1 
ATOM   1246 C  CD2 . LEU A 1 170 ? 48.633  16.195 36.340 1.00 44.81  ? 170 LEU A CD2 1 
ATOM   1247 N  N   . ALA A 1 171 ? 48.451  21.612 37.825 1.00 33.71  ? 171 ALA A N   1 
ATOM   1248 C  CA  . ALA A 1 171 ? 48.000  22.693 38.691 1.00 26.54  ? 171 ALA A CA  1 
ATOM   1249 C  C   . ALA A 1 171 ? 46.546  23.045 38.413 1.00 26.80  ? 171 ALA A C   1 
ATOM   1250 O  O   . ALA A 1 171 ? 46.010  22.701 37.368 1.00 26.71  ? 171 ALA A O   1 
ATOM   1251 C  CB  . ALA A 1 171 ? 48.864  23.908 38.475 1.00 21.39  ? 171 ALA A CB  1 
ATOM   1252 N  N   . ARG A 1 172 ? 45.912  23.721 39.362 1.00 31.66  ? 172 ARG A N   1 
ATOM   1253 C  CA  . ARG A 1 172 ? 44.532  24.184 39.209 1.00 25.87  ? 172 ARG A CA  1 
ATOM   1254 C  C   . ARG A 1 172 ? 44.344  25.408 40.094 1.00 27.73  ? 172 ARG A C   1 
ATOM   1255 O  O   . ARG A 1 172 ? 45.179  25.699 40.947 1.00 26.09  ? 172 ARG A O   1 
ATOM   1256 C  CB  . ARG A 1 172 ? 43.521  23.108 39.610 1.00 28.93  ? 172 ARG A CB  1 
ATOM   1257 C  CG  . ARG A 1 172 ? 43.501  22.796 41.096 1.00 29.14  ? 172 ARG A CG  1 
ATOM   1258 C  CD  . ARG A 1 172 ? 42.153  22.200 41.451 1.00 41.53  ? 172 ARG A CD  1 
ATOM   1259 N  NE  . ARG A 1 172 ? 41.088  23.188 41.283 1.00 39.97  ? 172 ARG A NE  1 
ATOM   1260 C  CZ  . ARG A 1 172 ? 39.837  22.899 40.931 1.00 45.90  ? 172 ARG A CZ  1 
ATOM   1261 N  NH1 . ARG A 1 172 ? 38.941  23.875 40.811 1.00 43.56  ? 172 ARG A NH1 1 
ATOM   1262 N  NH2 . ARG A 1 172 ? 39.483  21.642 40.689 1.00 37.94  ? 172 ARG A NH2 1 
ATOM   1263 N  N   . ALA A 1 173 ? 43.255  26.133 39.879 1.00 30.06  ? 173 ALA A N   1 
ATOM   1264 C  CA  . ALA A 1 173 ? 42.975  27.317 40.667 1.00 32.99  ? 173 ALA A CA  1 
ATOM   1265 C  C   . ALA A 1 173 ? 42.175  26.900 41.890 1.00 33.72  ? 173 ALA A C   1 
ATOM   1266 O  O   . ALA A 1 173 ? 41.458  25.911 41.857 1.00 27.66  ? 173 ALA A O   1 
ATOM   1267 C  CB  . ALA A 1 173 ? 42.185  28.319 39.843 1.00 32.45  ? 173 ALA A CB  1 
ATOM   1268 N  N   . PHE A 1 174 ? 42.318  27.626 42.987 1.00 32.03  ? 174 PHE A N   1 
ATOM   1269 C  CA  . PHE A 1 174 ? 41.544  27.266 44.163 1.00 38.18  ? 174 PHE A CA  1 
ATOM   1270 C  C   . PHE A 1 174 ? 40.785  28.482 44.634 1.00 35.43  ? 174 PHE A C   1 
ATOM   1271 O  O   . PHE A 1 174 ? 41.086  29.609 44.228 1.00 37.19  ? 174 PHE A O   1 
ATOM   1272 C  CB  . PHE A 1 174 ? 42.428  26.699 45.290 1.00 26.83  ? 174 PHE A CB  1 
ATOM   1273 C  CG  . PHE A 1 174 ? 43.370  27.693 45.904 1.00 28.20  ? 174 PHE A CG  1 
ATOM   1274 C  CD1 . PHE A 1 174 ? 44.523  28.085 45.238 1.00 25.57  ? 174 PHE A CD1 1 
ATOM   1275 C  CD2 . PHE A 1 174 ? 43.114  28.218 47.166 1.00 29.95  ? 174 PHE A CD2 1 
ATOM   1276 C  CE1 . PHE A 1 174 ? 45.416  28.990 45.831 1.00 35.22  ? 174 PHE A CE1 1 
ATOM   1277 C  CE2 . PHE A 1 174 ? 44.000  29.123 47.767 1.00 31.84  ? 174 PHE A CE2 1 
ATOM   1278 C  CZ  . PHE A 1 174 ? 45.156  29.508 47.095 1.00 29.64  ? 174 PHE A CZ  1 
ATOM   1279 N  N   . SER A 1 175 ? 39.792  28.250 45.485 1.00 42.89  ? 175 SER A N   1 
ATOM   1280 C  CA  . SER A 1 175 ? 38.974  29.339 45.992 1.00 44.17  ? 175 SER A CA  1 
ATOM   1281 C  C   . SER A 1 175 ? 39.383  29.787 47.369 1.00 48.60  ? 175 SER A C   1 
ATOM   1282 O  O   . SER A 1 175 ? 39.636  28.973 48.250 1.00 46.56  ? 175 SER A O   1 
ATOM   1283 C  CB  . SER A 1 175 ? 37.501  28.938 46.021 1.00 42.15  ? 175 SER A CB  1 
ATOM   1284 O  OG  . SER A 1 175 ? 36.723  29.971 46.591 1.00 51.87  ? 175 SER A OG  1 
ATOM   1285 N  N   . LEU A 1 176 ? 39.455  31.101 47.534 1.00 56.68  ? 176 LEU A N   1 
ATOM   1286 C  CA  . LEU A 1 176 ? 39.805  31.705 48.805 1.00 64.16  ? 176 LEU A CA  1 
ATOM   1287 C  C   . LEU A 1 176 ? 38.487  31.784 49.562 1.00 68.29  ? 176 LEU A C   1 
ATOM   1288 O  O   . LEU A 1 176 ? 37.896  32.850 49.703 1.00 72.74  ? 176 LEU A O   1 
ATOM   1289 C  CB  . LEU A 1 176 ? 40.379  33.103 48.571 1.00 60.76  ? 176 LEU A CB  1 
ATOM   1290 C  CG  . LEU A 1 176 ? 41.640  33.150 47.706 1.00 59.61  ? 176 LEU A CG  1 
ATOM   1291 C  CD1 . LEU A 1 176 ? 42.016  34.589 47.406 1.00 58.76  ? 176 LEU A CD1 1 
ATOM   1292 C  CD2 . LEU A 1 176 ? 42.771  32.437 48.424 1.00 64.08  ? 176 LEU A CD2 1 
ATOM   1293 N  N   . ALA A 1 177 ? 38.022  30.637 50.038 1.00 79.32  ? 177 ALA A N   1 
ATOM   1294 C  CA  . ALA A 1 177 ? 36.755  30.583 50.743 1.00 84.95  ? 177 ALA A CA  1 
ATOM   1295 C  C   . ALA A 1 177 ? 36.873  30.248 52.223 1.00 91.80  ? 177 ALA A C   1 
ATOM   1296 O  O   . ALA A 1 177 ? 36.930  29.074 52.595 1.00 99.70  ? 177 ALA A O   1 
ATOM   1297 C  CB  . ALA A 1 177 ? 35.831  29.579 50.055 1.00 77.58  ? 177 ALA A CB  1 
ATOM   1298 N  N   . LYS A 1 178 ? 36.930  31.282 53.062 1.00 94.25  ? 178 LYS A N   1 
ATOM   1299 C  CA  . LYS A 1 178 ? 36.981  31.093 54.513 1.00 93.15  ? 178 LYS A CA  1 
ATOM   1300 C  C   . LYS A 1 178 ? 35.508  31.021 54.867 1.00 91.09  ? 178 LYS A C   1 
ATOM   1301 O  O   . LYS A 1 178 ? 35.108  30.514 55.915 1.00 89.38  ? 178 LYS A O   1 
ATOM   1302 C  CB  . LYS A 1 178 ? 37.571  32.319 55.225 1.00 91.95  ? 178 LYS A CB  1 
ATOM   1303 C  CG  . LYS A 1 178 ? 39.068  32.547 55.088 1.00 89.63  ? 178 LYS A CG  1 
ATOM   1304 C  CD  . LYS A 1 178 ? 39.464  33.728 55.962 1.00 87.87  ? 178 LYS A CD  1 
ATOM   1305 C  CE  . LYS A 1 178 ? 40.962  33.950 56.007 1.00 87.69  ? 178 LYS A CE  1 
ATOM   1306 N  NZ  . LYS A 1 178 ? 41.291  35.069 56.940 1.00 88.41  ? 178 LYS A NZ  1 
ATOM   1307 N  N   . ASN A 1 179 ? 34.720  31.538 53.933 1.00 93.05  ? 179 ASN A N   1 
ATOM   1308 C  CA  . ASN A 1 179 ? 33.276  31.654 54.042 1.00 96.70  ? 179 ASN A CA  1 
ATOM   1309 C  C   . ASN A 1 179 ? 32.391  30.409 54.120 1.00 96.51  ? 179 ASN A C   1 
ATOM   1310 O  O   . ASN A 1 179 ? 32.359  29.691 55.123 1.00 96.25  ? 179 ASN A O   1 
ATOM   1311 C  CB  . ASN A 1 179 ? 32.765  32.528 52.887 1.00 95.76  ? 179 ASN A CB  1 
ATOM   1312 C  CG  . ASN A 1 179 ? 33.689  33.700 52.580 1.00 99.60  ? 179 ASN A CG  1 
ATOM   1313 O  OD1 . ASN A 1 179 ? 33.876  34.602 53.401 1.00 93.93  ? 179 ASN A OD1 1 
ATOM   1314 N  ND2 . ASN A 1 179 ? 34.273  33.687 51.387 1.00 98.70  ? 179 ASN A ND2 1 
ATOM   1315 N  N   . SER A 1 180 ? 31.671  30.192 53.023 1.00 97.70  ? 180 SER A N   1 
ATOM   1316 C  CA  . SER A 1 180 ? 30.673  29.139 52.866 1.00 93.95  ? 180 SER A CA  1 
ATOM   1317 C  C   . SER A 1 180 ? 30.995  27.664 52.671 1.00 91.63  ? 180 SER A C   1 
ATOM   1318 O  O   . SER A 1 180 ? 31.582  27.002 53.526 1.00 90.87  ? 180 SER A O   1 
ATOM   1319 C  CB  . SER A 1 180 ? 29.728  29.553 51.737 1.00 93.15  ? 180 SER A CB  1 
ATOM   1320 O  OG  . SER A 1 180 ? 30.450  29.728 50.527 1.00 80.91  ? 180 SER A OG  1 
ATOM   1321 N  N   . GLN A 1 181 ? 30.548  27.169 51.521 1.00 88.76  ? 181 GLN A N   1 
ATOM   1322 C  CA  . GLN A 1 181 ? 30.667  25.775 51.136 1.00 86.87  ? 181 GLN A CA  1 
ATOM   1323 C  C   . GLN A 1 181 ? 32.047  25.180 50.961 1.00 87.60  ? 181 GLN A C   1 
ATOM   1324 O  O   . GLN A 1 181 ? 33.035  25.888 50.732 1.00 85.10  ? 181 GLN A O   1 
ATOM   1325 C  CB  . GLN A 1 181 ? 29.840  25.529 49.872 1.00 86.57  ? 181 GLN A CB  1 
ATOM   1326 C  CG  . GLN A 1 181 ? 28.420  26.030 50.014 1.00 90.45  ? 181 GLN A CG  1 
ATOM   1327 C  CD  . GLN A 1 181 ? 27.941  25.959 51.455 1.00 93.75  ? 181 GLN A CD  1 
ATOM   1328 O  OE1 . GLN A 1 181 ? 27.897  24.883 52.055 1.00 93.63  ? 181 GLN A OE1 1 
ATOM   1329 N  NE2 . GLN A 1 181 ? 27.594  27.110 52.021 1.00 95.29  ? 181 GLN A NE2 1 
ATOM   1330 N  N   . PRO A 1 182 ? 32.122  23.843 51.074 1.00 85.68  ? 182 PRO A N   1 
ATOM   1331 C  CA  . PRO A 1 182 ? 33.338  23.043 50.947 1.00 82.77  ? 182 PRO A CA  1 
ATOM   1332 C  C   . PRO A 1 182 ? 33.679  22.812 49.489 1.00 78.64  ? 182 PRO A C   1 
ATOM   1333 O  O   . PRO A 1 182 ? 32.806  22.490 48.682 1.00 77.49  ? 182 PRO A O   1 
ATOM   1334 C  CB  . PRO A 1 182 ? 32.970  21.723 51.636 1.00 83.83  ? 182 PRO A CB  1 
ATOM   1335 C  CG  . PRO A 1 182 ? 31.724  22.047 52.435 1.00 88.44  ? 182 PRO A CG  1 
ATOM   1336 C  CD  . PRO A 1 182 ? 31.011  22.997 51.536 1.00 84.11  ? 182 PRO A CD  1 
ATOM   1337 N  N   . ASN A 1 183 ? 34.947  22.990 49.150 1.00 66.64  ? 183 ASN A N   1 
ATOM   1338 C  CA  . ASN A 1 183 ? 35.381  22.739 47.794 1.00 61.02  ? 183 ASN A CA  1 
ATOM   1339 C  C   . ASN A 1 183 ? 35.665  21.252 47.743 1.00 51.11  ? 183 ASN A C   1 
ATOM   1340 O  O   . ASN A 1 183 ? 36.029  20.657 48.762 1.00 47.08  ? 183 ASN A O   1 
ATOM   1341 C  CB  . ASN A 1 183 ? 36.637  23.542 47.480 1.00 53.82  ? 183 ASN A CB  1 
ATOM   1342 C  CG  . ASN A 1 183 ? 36.322  24.958 47.097 1.00 57.79  ? 183 ASN A CG  1 
ATOM   1343 O  OD1 . ASN A 1 183 ? 35.711  25.204 46.054 1.00 47.72  ? 183 ASN A OD1 1 
ATOM   1344 N  ND2 . ASN A 1 183 ? 36.719  25.904 47.941 1.00 64.18  ? 183 ASN A ND2 1 
ATOM   1345 N  N   . ARG A 1 184 ? 35.471  20.661 46.567 1.00 48.85  ? 184 ARG A N   1 
ATOM   1346 C  CA  . ARG A 1 184 ? 35.696  19.232 46.345 1.00 51.96  ? 184 ARG A CA  1 
ATOM   1347 C  C   . ARG A 1 184 ? 36.679  19.066 45.180 1.00 54.71  ? 184 ARG A C   1 
ATOM   1348 O  O   . ARG A 1 184 ? 36.268  18.790 44.049 1.00 58.12  ? 184 ARG A O   1 
ATOM   1349 C  CB  . ARG A 1 184 ? 34.370  18.551 45.997 1.00 55.96  ? 184 ARG A CB  1 
ATOM   1350 C  CG  . ARG A 1 184 ? 34.034  17.328 46.837 1.00 71.15  ? 184 ARG A CG  1 
ATOM   1351 C  CD  . ARG A 1 184 ? 32.734  16.677 46.361 1.00 76.83  ? 184 ARG A CD  1 
ATOM   1352 N  NE  . ARG A 1 184 ? 32.322  15.558 47.208 1.00 85.55  ? 184 ARG A NE  1 
ATOM   1353 C  CZ  . ARG A 1 184 ? 31.245  14.806 46.985 1.00 94.92  ? 184 ARG A CZ  1 
ATOM   1354 N  NH1 . ARG A 1 184 ? 30.466  15.047 45.936 1.00 93.54  ? 184 ARG A NH1 1 
ATOM   1355 N  NH2 . ARG A 1 184 ? 30.937  13.815 47.817 1.00 95.13  ? 184 ARG A NH2 1 
ATOM   1356 N  N   . TYR A 1 185 ? 37.971  19.238 45.459 1.00 45.20  ? 185 TYR A N   1 
ATOM   1357 C  CA  . TYR A 1 185 ? 38.999  19.134 44.432 1.00 44.22  ? 185 TYR A CA  1 
ATOM   1358 C  C   . TYR A 1 185 ? 39.501  17.699 44.248 1.00 47.54  ? 185 TYR A C   1 
ATOM   1359 O  O   . TYR A 1 185 ? 39.350  16.859 45.133 1.00 41.89  ? 185 TYR A O   1 
ATOM   1360 C  CB  . TYR A 1 185 ? 40.193  20.040 44.771 1.00 39.79  ? 185 TYR A CB  1 
ATOM   1361 C  CG  . TYR A 1 185 ? 39.866  21.505 45.038 1.00 36.93  ? 185 TYR A CG  1 
ATOM   1362 C  CD1 . TYR A 1 185 ? 39.011  22.219 44.207 1.00 35.24  ? 185 TYR A CD1 1 
ATOM   1363 C  CD2 . TYR A 1 185 ? 40.457  22.181 46.105 1.00 34.53  ? 185 TYR A CD2 1 
ATOM   1364 C  CE1 . TYR A 1 185 ? 38.751  23.584 44.436 1.00 41.52  ? 185 TYR A CE1 1 
ATOM   1365 C  CE2 . TYR A 1 185 ? 40.209  23.540 46.344 1.00 36.82  ? 185 TYR A CE2 1 
ATOM   1366 C  CZ  . TYR A 1 185 ? 39.354  24.230 45.505 1.00 30.46  ? 185 TYR A CZ  1 
ATOM   1367 O  OH  . TYR A 1 185 ? 39.086  25.548 45.760 1.00 35.86  ? 185 TYR A OH  1 
HETATM 1368 N  N   . TPO A 1 186 ? 40.105  17.433 43.091 1.00 43.86  ? 186 TPO A N   1 
HETATM 1369 C  CA  . TPO A 1 186 ? 40.638  16.114 42.782 1.00 41.58  ? 186 TPO A CA  1 
HETATM 1370 C  CB  . TPO A 1 186 ? 41.375  16.154 41.446 1.00 30.44  ? 186 TPO A CB  1 
HETATM 1371 C  CG2 . TPO A 1 186 ? 41.841  14.762 41.077 1.00 33.83  ? 186 TPO A CG2 1 
HETATM 1372 O  OG1 . TPO A 1 186 ? 40.472  16.610 40.427 1.00 43.86  ? 186 TPO A OG1 1 
HETATM 1373 P  P   . TPO A 1 186 ? 40.982  18.004 39.772 1.00 33.21  ? 186 TPO A P   1 
HETATM 1374 O  O1P . TPO A 1 186 ? 42.428  17.800 39.120 1.00 42.12  ? 186 TPO A O1P 1 
HETATM 1375 O  O2P . TPO A 1 186 ? 39.940  18.462 38.638 1.00 32.77  ? 186 TPO A O2P 1 
HETATM 1376 O  O3P . TPO A 1 186 ? 41.061  19.145 40.895 1.00 32.71  ? 186 TPO A O3P 1 
HETATM 1377 C  C   . TPO A 1 186 ? 41.576  15.634 43.897 1.00 42.61  ? 186 TPO A C   1 
HETATM 1378 O  O   . TPO A 1 186 ? 42.582  16.272 44.193 1.00 35.79  ? 186 TPO A O   1 
ATOM   1379 N  N   . ASN A 1 187 ? 41.255  14.507 44.522 1.00 50.68  ? 187 ASN A N   1 
ATOM   1380 C  CA  . ASN A 1 187 ? 42.092  14.039 45.622 1.00 49.04  ? 187 ASN A CA  1 
ATOM   1381 C  C   . ASN A 1 187 ? 43.406  13.369 45.277 1.00 50.83  ? 187 ASN A C   1 
ATOM   1382 O  O   . ASN A 1 187 ? 44.387  13.557 45.993 1.00 49.65  ? 187 ASN A O   1 
ATOM   1383 C  CB  . ASN A 1 187 ? 41.318  13.114 46.559 1.00 47.24  ? 187 ASN A CB  1 
ATOM   1384 C  CG  . ASN A 1 187 ? 42.229  12.425 47.571 1.00 48.60  ? 187 ASN A CG  1 
ATOM   1385 O  OD1 . ASN A 1 187 ? 42.767  11.350 47.307 1.00 46.28  ? 187 ASN A OD1 1 
ATOM   1386 N  ND2 . ASN A 1 187 ? 42.423  13.056 48.724 1.00 32.78  ? 187 ASN A ND2 1 
ATOM   1387 N  N   . ARG A 1 188 ? 43.453  12.595 44.201 1.00 47.05  ? 188 ARG A N   1 
ATOM   1388 C  CA  . ARG A 1 188 ? 44.708  11.932 43.884 1.00 53.92  ? 188 ARG A CA  1 
ATOM   1389 C  C   . ARG A 1 188 ? 45.651  12.854 43.139 1.00 48.55  ? 188 ARG A C   1 
ATOM   1390 O  O   . ARG A 1 188 ? 45.728  12.827 41.914 1.00 52.36  ? 188 ARG A O   1 
ATOM   1391 C  CB  . ARG A 1 188 ? 44.482  10.655 43.072 1.00 53.76  ? 188 ARG A CB  1 
ATOM   1392 C  CG  . ARG A 1 188 ? 45.716  9.767  43.081 1.00 60.26  ? 188 ARG A CG  1 
ATOM   1393 C  CD  . ARG A 1 188 ? 45.466  8.384  42.507 1.00 69.74  ? 188 ARG A CD  1 
ATOM   1394 N  NE  . ARG A 1 188 ? 46.369  7.408  43.117 1.00 78.14  ? 188 ARG A NE  1 
ATOM   1395 C  CZ  . ARG A 1 188 ? 47.695  7.443  43.018 1.00 85.23  ? 188 ARG A CZ  1 
ATOM   1396 N  NH1 . ARG A 1 188 ? 48.290  8.403  42.321 1.00 86.23  ? 188 ARG A NH1 1 
ATOM   1397 N  NH2 . ARG A 1 188 ? 48.433  6.533  43.642 1.00 88.05  ? 188 ARG A NH2 1 
ATOM   1398 N  N   . VAL A 1 189 ? 46.372  13.670 43.896 1.00 45.10  ? 189 VAL A N   1 
ATOM   1399 C  CA  . VAL A 1 189 ? 47.311  14.610 43.316 1.00 35.81  ? 189 VAL A CA  1 
ATOM   1400 C  C   . VAL A 1 189 ? 48.615  14.583 44.075 1.00 38.53  ? 189 VAL A C   1 
ATOM   1401 O  O   . VAL A 1 189 ? 48.660  14.202 45.249 1.00 33.76  ? 189 VAL A O   1 
ATOM   1402 C  CB  . VAL A 1 189 ? 46.747  16.049 43.338 1.00 29.22  ? 189 VAL A CB  1 
ATOM   1403 C  CG1 . VAL A 1 189 ? 45.624  16.169 42.331 1.00 34.93  ? 189 VAL A CG1 1 
ATOM   1404 C  CG2 . VAL A 1 189 ? 46.213  16.386 44.735 1.00 31.25  ? 189 VAL A CG2 1 
ATOM   1405 N  N   . VAL A 1 190 ? 49.669  15.011 43.389 1.00 33.64  ? 190 VAL A N   1 
ATOM   1406 C  CA  . VAL A 1 190 ? 51.011  15.056 43.931 1.00 29.31  ? 190 VAL A CA  1 
ATOM   1407 C  C   . VAL A 1 190 ? 51.651  13.666 43.953 1.00 35.75  ? 190 VAL A C   1 
ATOM   1408 O  O   . VAL A 1 190 ? 51.018  12.673 44.320 1.00 35.37  ? 190 VAL A O   1 
ATOM   1409 C  CB  . VAL A 1 190 ? 51.052  15.584 45.392 1.00 35.92  ? 190 VAL A CB  1 
ATOM   1410 C  CG1 . VAL A 1 190 ? 52.473  15.948 45.739 1.00 22.05  ? 190 VAL A CG1 1 
ATOM   1411 C  CG2 . VAL A 1 190 ? 50.116  16.781 45.584 1.00 35.29  ? 190 VAL A CG2 1 
ATOM   1412 N  N   . THR A 1 191 ? 52.914  13.615 43.559 1.00 32.55  ? 191 THR A N   1 
ATOM   1413 C  CA  . THR A 1 191 ? 53.696  12.387 43.576 1.00 41.16  ? 191 THR A CA  1 
ATOM   1414 C  C   . THR A 1 191 ? 53.674  11.837 45.005 1.00 40.47  ? 191 THR A C   1 
ATOM   1415 O  O   . THR A 1 191 ? 53.776  12.595 45.975 1.00 37.82  ? 191 THR A O   1 
ATOM   1416 C  CB  . THR A 1 191 ? 55.152  12.684 43.158 1.00 41.80  ? 191 THR A CB  1 
ATOM   1417 O  OG1 . THR A 1 191 ? 55.240  12.707 41.728 1.00 57.40  ? 191 THR A OG1 1 
ATOM   1418 C  CG2 . THR A 1 191 ? 56.097  11.654 43.713 1.00 63.29  ? 191 THR A CG2 1 
ATOM   1419 N  N   . LEU A 1 192 ? 53.549  10.519 45.124 1.00 38.49  ? 192 LEU A N   1 
ATOM   1420 C  CA  . LEU A 1 192 ? 53.487  9.849  46.423 1.00 28.89  ? 192 LEU A CA  1 
ATOM   1421 C  C   . LEU A 1 192 ? 54.514  10.303 47.459 1.00 27.71  ? 192 LEU A C   1 
ATOM   1422 O  O   . LEU A 1 192 ? 54.157  10.691 48.569 1.00 30.69  ? 192 LEU A O   1 
ATOM   1423 C  CB  . LEU A 1 192 ? 53.618  8.336  46.239 1.00 37.11  ? 192 LEU A CB  1 
ATOM   1424 C  CG  . LEU A 1 192 ? 53.439  7.513  47.520 1.00 45.18  ? 192 LEU A CG  1 
ATOM   1425 C  CD1 . LEU A 1 192 ? 52.003  7.703  48.021 1.00 40.08  ? 192 LEU A CD1 1 
ATOM   1426 C  CD2 . LEU A 1 192 ? 53.718  6.022  47.257 1.00 33.91  ? 192 LEU A CD2 1 
ATOM   1427 N  N   . TRP A 1 193 ? 55.788  10.252 47.097 1.00 30.52  ? 193 TRP A N   1 
ATOM   1428 C  CA  . TRP A 1 193 ? 56.849  10.628 48.024 1.00 29.57  ? 193 TRP A CA  1 
ATOM   1429 C  C   . TRP A 1 193 ? 56.741  12.054 48.550 1.00 34.54  ? 193 TRP A C   1 
ATOM   1430 O  O   . TRP A 1 193 ? 57.338  12.388 49.583 1.00 36.47  ? 193 TRP A O   1 
ATOM   1431 C  CB  . TRP A 1 193 ? 58.218  10.420 47.363 1.00 26.57  ? 193 TRP A CB  1 
ATOM   1432 C  CG  . TRP A 1 193 ? 58.458  9.000  46.935 1.00 37.62  ? 193 TRP A CG  1 
ATOM   1433 C  CD1 . TRP A 1 193 ? 57.640  7.925  47.156 1.00 37.83  ? 193 TRP A CD1 1 
ATOM   1434 C  CD2 . TRP A 1 193 ? 59.590  8.499  46.211 1.00 35.03  ? 193 TRP A CD2 1 
ATOM   1435 N  NE1 . TRP A 1 193 ? 58.193  6.787  46.612 1.00 42.17  ? 193 TRP A NE1 1 
ATOM   1436 C  CE2 . TRP A 1 193 ? 59.390  7.111  46.028 1.00 46.13  ? 193 TRP A CE2 1 
ATOM   1437 C  CE3 . TRP A 1 193 ? 60.753  9.087  45.703 1.00 30.19  ? 193 TRP A CE3 1 
ATOM   1438 C  CZ2 . TRP A 1 193 ? 60.315  6.302  45.356 1.00 41.53  ? 193 TRP A CZ2 1 
ATOM   1439 C  CZ3 . TRP A 1 193 ? 61.667  8.290  45.038 1.00 34.25  ? 193 TRP A CZ3 1 
ATOM   1440 C  CH2 . TRP A 1 193 ? 61.444  6.909  44.871 1.00 42.95  ? 193 TRP A CH2 1 
ATOM   1441 N  N   . TYR A 1 194 ? 55.973  12.890 47.855 1.00 40.55  ? 194 TYR A N   1 
ATOM   1442 C  CA  . TYR A 1 194 ? 55.821  14.282 48.258 1.00 38.61  ? 194 TYR A CA  1 
ATOM   1443 C  C   . TYR A 1 194 ? 54.389  14.640 48.636 1.00 34.13  ? 194 TYR A C   1 
ATOM   1444 O  O   . TYR A 1 194 ? 54.060  15.803 48.829 1.00 31.32  ? 194 TYR A O   1 
ATOM   1445 C  CB  . TYR A 1 194 ? 56.285  15.195 47.123 1.00 39.14  ? 194 TYR A CB  1 
ATOM   1446 C  CG  . TYR A 1 194 ? 57.741  15.047 46.754 1.00 31.86  ? 194 TYR A CG  1 
ATOM   1447 C  CD1 . TYR A 1 194 ? 58.698  15.883 47.310 1.00 30.35  ? 194 TYR A CD1 1 
ATOM   1448 C  CD2 . TYR A 1 194 ? 58.156  14.090 45.827 1.00 28.28  ? 194 TYR A CD2 1 
ATOM   1449 C  CE1 . TYR A 1 194 ? 60.029  15.786 46.956 1.00 34.18  ? 194 TYR A CE1 1 
ATOM   1450 C  CE2 . TYR A 1 194 ? 59.500  13.982 45.460 1.00 35.11  ? 194 TYR A CE2 1 
ATOM   1451 C  CZ  . TYR A 1 194 ? 60.428  14.838 46.026 1.00 33.70  ? 194 TYR A CZ  1 
ATOM   1452 O  OH  . TYR A 1 194 ? 61.748  14.798 45.643 1.00 30.08  ? 194 TYR A OH  1 
ATOM   1453 N  N   . ARG A 1 195 ? 53.538  13.639 48.758 1.00 32.80  ? 195 ARG A N   1 
ATOM   1454 C  CA  . ARG A 1 195 ? 52.153  13.894 49.096 1.00 29.71  ? 195 ARG A CA  1 
ATOM   1455 C  C   . ARG A 1 195 ? 51.901  14.120 50.586 1.00 34.83  ? 195 ARG A C   1 
ATOM   1456 O  O   . ARG A 1 195 ? 52.247  13.291 51.411 1.00 38.56  ? 195 ARG A O   1 
ATOM   1457 C  CB  . ARG A 1 195 ? 51.307  12.740 48.603 1.00 20.33  ? 195 ARG A CB  1 
ATOM   1458 C  CG  . ARG A 1 195 ? 49.835  13.079 48.508 1.00 36.29  ? 195 ARG A CG  1 
ATOM   1459 C  CD  . ARG A 1 195 ? 49.088  11.924 47.906 1.00 27.46  ? 195 ARG A CD  1 
ATOM   1460 N  NE  . ARG A 1 195 ? 49.742  11.469 46.691 1.00 37.46  ? 195 ARG A NE  1 
ATOM   1461 C  CZ  . ARG A 1 195 ? 49.455  10.326 46.079 1.00 44.36  ? 195 ARG A CZ  1 
ATOM   1462 N  NH1 . ARG A 1 195 ? 48.511  9.529  46.565 1.00 49.41  ? 195 ARG A NH1 1 
ATOM   1463 N  NH2 . ARG A 1 195 ? 50.147  9.956  45.011 1.00 42.03  ? 195 ARG A NH2 1 
ATOM   1464 N  N   . PRO A 1 196 ? 51.281  15.257 50.948 1.00 40.73  ? 196 PRO A N   1 
ATOM   1465 C  CA  . PRO A 1 196 ? 50.995  15.548 52.360 1.00 36.68  ? 196 PRO A CA  1 
ATOM   1466 C  C   . PRO A 1 196 ? 49.962  14.564 52.913 1.00 36.83  ? 196 PRO A C   1 
ATOM   1467 O  O   . PRO A 1 196 ? 49.163  13.996 52.159 1.00 27.80  ? 196 PRO A O   1 
ATOM   1468 C  CB  . PRO A 1 196 ? 50.474  16.979 52.321 1.00 33.37  ? 196 PRO A CB  1 
ATOM   1469 C  CG  . PRO A 1 196 ? 49.745  17.008 50.996 1.00 35.52  ? 196 PRO A CG  1 
ATOM   1470 C  CD  . PRO A 1 196 ? 50.742  16.314 50.079 1.00 29.74  ? 196 PRO A CD  1 
ATOM   1471 N  N   . PRO A 1 197 ? 49.967  14.357 54.243 1.00 33.90  ? 197 PRO A N   1 
ATOM   1472 C  CA  . PRO A 1 197 ? 49.051  13.444 54.929 1.00 37.69  ? 197 PRO A CA  1 
ATOM   1473 C  C   . PRO A 1 197 ? 47.575  13.670 54.627 1.00 40.10  ? 197 PRO A C   1 
ATOM   1474 O  O   . PRO A 1 197 ? 46.846  12.715 54.397 1.00 37.50  ? 197 PRO A O   1 
ATOM   1475 C  CB  . PRO A 1 197 ? 49.349  13.683 56.416 1.00 38.86  ? 197 PRO A CB  1 
ATOM   1476 C  CG  . PRO A 1 197 ? 50.730  14.216 56.431 1.00 42.08  ? 197 PRO A CG  1 
ATOM   1477 C  CD  . PRO A 1 197 ? 50.759  15.123 55.225 1.00 37.98  ? 197 PRO A CD  1 
ATOM   1478 N  N   . GLU A 1 198 ? 47.133  14.926 54.641 1.00 42.81  ? 198 GLU A N   1 
ATOM   1479 C  CA  . GLU A 1 198 ? 45.720  15.213 54.406 1.00 40.59  ? 198 GLU A CA  1 
ATOM   1480 C  C   . GLU A 1 198 ? 45.192  14.566 53.130 1.00 36.71  ? 198 GLU A C   1 
ATOM   1481 O  O   . GLU A 1 198 ? 44.065  14.075 53.102 1.00 38.15  ? 198 GLU A O   1 
ATOM   1482 C  CB  . GLU A 1 198 ? 45.453  16.736 54.375 1.00 41.24  ? 198 GLU A CB  1 
ATOM   1483 C  CG  . GLU A 1 198 ? 46.152  17.501 53.254 1.00 34.14  ? 198 GLU A CG  1 
ATOM   1484 C  CD  . GLU A 1 198 ? 47.364  18.266 53.742 1.00 46.07  ? 198 GLU A CD  1 
ATOM   1485 O  OE1 . GLU A 1 198 ? 48.101  17.715 54.587 1.00 40.24  ? 198 GLU A OE1 1 
ATOM   1486 O  OE2 . GLU A 1 198 ? 47.593  19.411 53.275 1.00 40.08  ? 198 GLU A OE2 1 
ATOM   1487 N  N   . LEU A 1 199 ? 46.002  14.563 52.078 1.00 40.17  ? 199 LEU A N   1 
ATOM   1488 C  CA  . LEU A 1 199 ? 45.583  13.971 50.804 1.00 46.41  ? 199 LEU A CA  1 
ATOM   1489 C  C   . LEU A 1 199 ? 45.527  12.449 50.882 1.00 44.64  ? 199 LEU A C   1 
ATOM   1490 O  O   . LEU A 1 199 ? 44.615  11.820 50.349 1.00 39.12  ? 199 LEU A O   1 
ATOM   1491 C  CB  . LEU A 1 199 ? 46.536  14.391 49.674 1.00 40.52  ? 199 LEU A CB  1 
ATOM   1492 C  CG  . LEU A 1 199 ? 46.485  15.851 49.211 1.00 43.02  ? 199 LEU A CG  1 
ATOM   1493 C  CD1 . LEU A 1 199 ? 47.478  16.084 48.079 1.00 47.56  ? 199 LEU A CD1 1 
ATOM   1494 C  CD2 . LEU A 1 199 ? 45.081  16.183 48.747 1.00 44.20  ? 199 LEU A CD2 1 
ATOM   1495 N  N   . LEU A 1 200 ? 46.510  11.854 51.544 1.00 45.69  ? 200 LEU A N   1 
ATOM   1496 C  CA  . LEU A 1 200 ? 46.539  10.405 51.676 1.00 51.16  ? 200 LEU A CA  1 
ATOM   1497 C  C   . LEU A 1 200 ? 45.307  9.979  52.478 1.00 53.33  ? 200 LEU A C   1 
ATOM   1498 O  O   . LEU A 1 200 ? 44.814  8.858  52.327 1.00 50.12  ? 200 LEU A O   1 
ATOM   1499 C  CB  . LEU A 1 200 ? 47.845  9.965  52.363 1.00 45.68  ? 200 LEU A CB  1 
ATOM   1500 C  CG  . LEU A 1 200 ? 49.091  10.224 51.496 1.00 38.81  ? 200 LEU A CG  1 
ATOM   1501 C  CD1 . LEU A 1 200 ? 50.377  10.136 52.304 1.00 40.21  ? 200 LEU A CD1 1 
ATOM   1502 C  CD2 . LEU A 1 200 ? 49.097  9.229  50.343 1.00 51.19  ? 200 LEU A CD2 1 
ATOM   1503 N  N   . LEU A 1 201 ? 44.790  10.903 53.290 1.00 47.59  ? 201 LEU A N   1 
ATOM   1504 C  CA  . LEU A 1 201 ? 43.622  10.641 54.122 1.00 49.23  ? 201 LEU A CA  1 
ATOM   1505 C  C   . LEU A 1 201 ? 42.299  10.944 53.453 1.00 47.30  ? 201 LEU A C   1 
ATOM   1506 O  O   . LEU A 1 201 ? 41.262  10.927 54.113 1.00 45.98  ? 201 LEU A O   1 
ATOM   1507 C  CB  . LEU A 1 201 ? 43.700  11.422 55.436 1.00 37.95  ? 201 LEU A CB  1 
ATOM   1508 C  CG  . LEU A 1 201 ? 44.777  10.945 56.418 1.00 53.37  ? 201 LEU A CG  1 
ATOM   1509 C  CD1 . LEU A 1 201 ? 44.681  11.741 57.701 1.00 58.32  ? 201 LEU A CD1 1 
ATOM   1510 C  CD2 . LEU A 1 201 ? 44.595  9.476  56.713 1.00 51.00  ? 201 LEU A CD2 1 
ATOM   1511 N  N   . GLY A 1 202 ? 42.326  11.239 52.156 1.00 42.39  ? 202 GLY A N   1 
ATOM   1512 C  CA  . GLY A 1 202 ? 41.081  11.500 51.450 1.00 37.16  ? 202 GLY A CA  1 
ATOM   1513 C  C   . GLY A 1 202 ? 40.592  12.934 51.307 1.00 40.36  ? 202 GLY A C   1 
ATOM   1514 O  O   . GLY A 1 202 ? 39.582  13.167 50.652 1.00 41.94  ? 202 GLY A O   1 
ATOM   1515 N  N   . GLU A 1 203 ? 41.297  13.894 51.896 1.00 42.28  ? 203 GLU A N   1 
ATOM   1516 C  CA  . GLU A 1 203 ? 40.893  15.298 51.814 1.00 41.64  ? 203 GLU A CA  1 
ATOM   1517 C  C   . GLU A 1 203 ? 40.667  15.795 50.384 1.00 44.80  ? 203 GLU A C   1 
ATOM   1518 O  O   . GLU A 1 203 ? 41.473  15.533 49.495 1.00 43.25  ? 203 GLU A O   1 
ATOM   1519 C  CB  . GLU A 1 203 ? 41.944  16.182 52.478 1.00 41.78  ? 203 GLU A CB  1 
ATOM   1520 C  CG  . GLU A 1 203 ? 41.549  17.638 52.572 1.00 37.36  ? 203 GLU A CG  1 
ATOM   1521 C  CD  . GLU A 1 203 ? 40.301  17.837 53.415 1.00 44.89  ? 203 GLU A CD  1 
ATOM   1522 O  OE1 . GLU A 1 203 ? 39.236  18.129 52.838 1.00 40.11  ? 203 GLU A OE1 1 
ATOM   1523 O  OE2 . GLU A 1 203 ? 40.390  17.690 54.655 1.00 38.86  ? 203 GLU A OE2 1 
ATOM   1524 N  N   . ARG A 1 204 ? 39.567  16.514 50.171 1.00 42.54  ? 204 ARG A N   1 
ATOM   1525 C  CA  . ARG A 1 204 ? 39.254  17.065 48.854 1.00 40.05  ? 204 ARG A CA  1 
ATOM   1526 C  C   . ARG A 1 204 ? 39.080  18.577 48.940 1.00 39.47  ? 204 ARG A C   1 
ATOM   1527 O  O   . ARG A 1 204 ? 38.852  19.249 47.943 1.00 43.83  ? 204 ARG A O   1 
ATOM   1528 C  CB  . ARG A 1 204 ? 37.987  16.444 48.287 1.00 42.18  ? 204 ARG A CB  1 
ATOM   1529 C  CG  . ARG A 1 204 ? 38.159  15.017 47.809 1.00 50.44  ? 204 ARG A CG  1 
ATOM   1530 C  CD  . ARG A 1 204 ? 37.195  14.740 46.671 1.00 40.97  ? 204 ARG A CD  1 
ATOM   1531 N  NE  . ARG A 1 204 ? 37.847  13.998 45.599 1.00 65.62  ? 204 ARG A NE  1 
ATOM   1532 C  CZ  . ARG A 1 204 ? 37.375  13.907 44.359 1.00 70.49  ? 204 ARG A CZ  1 
ATOM   1533 N  NH1 . ARG A 1 204 ? 36.237  14.516 44.037 1.00 57.44  ? 204 ARG A NH1 1 
ATOM   1534 N  NH2 . ARG A 1 204 ? 38.050  13.221 43.439 1.00 57.90  ? 204 ARG A NH2 1 
ATOM   1535 N  N   . ASP A 1 205 ? 39.192  19.105 50.148 1.00 40.89  ? 205 ASP A N   1 
ATOM   1536 C  CA  . ASP A 1 205 ? 39.064  20.530 50.366 1.00 38.24  ? 205 ASP A CA  1 
ATOM   1537 C  C   . ASP A 1 205 ? 40.409  20.964 50.910 1.00 45.83  ? 205 ASP A C   1 
ATOM   1538 O  O   . ASP A 1 205 ? 40.523  21.366 52.069 1.00 45.66  ? 205 ASP A O   1 
ATOM   1539 C  CB  . ASP A 1 205 ? 37.963  20.805 51.386 1.00 45.98  ? 205 ASP A CB  1 
ATOM   1540 C  CG  . ASP A 1 205 ? 37.492  22.246 51.363 1.00 59.38  ? 205 ASP A CG  1 
ATOM   1541 O  OD1 . ASP A 1 205 ? 36.587  22.584 52.155 1.00 71.19  ? 205 ASP A OD1 1 
ATOM   1542 O  OD2 . ASP A 1 205 ? 38.021  23.036 50.553 1.00 70.47  ? 205 ASP A OD2 1 
ATOM   1543 N  N   . TYR A 1 206 ? 41.432  20.856 50.069 1.00 36.92  ? 206 TYR A N   1 
ATOM   1544 C  CA  . TYR A 1 206 ? 42.779  21.212 50.467 1.00 34.82  ? 206 TYR A CA  1 
ATOM   1545 C  C   . TYR A 1 206 ? 43.184  22.570 49.885 1.00 34.28  ? 206 TYR A C   1 
ATOM   1546 O  O   . TYR A 1 206 ? 42.457  23.156 49.106 1.00 30.94  ? 206 TYR A O   1 
ATOM   1547 C  CB  . TYR A 1 206 ? 43.750  20.110 50.027 1.00 38.63  ? 206 TYR A CB  1 
ATOM   1548 C  CG  . TYR A 1 206 ? 43.619  19.707 48.569 1.00 30.72  ? 206 TYR A CG  1 
ATOM   1549 C  CD1 . TYR A 1 206 ? 42.787  18.651 48.178 1.00 29.81  ? 206 TYR A CD1 1 
ATOM   1550 C  CD2 . TYR A 1 206 ? 44.318  20.394 47.583 1.00 30.65  ? 206 TYR A CD2 1 
ATOM   1551 C  CE1 . TYR A 1 206 ? 42.661  18.285 46.819 1.00 27.85  ? 206 TYR A CE1 1 
ATOM   1552 C  CE2 . TYR A 1 206 ? 44.200  20.050 46.229 1.00 35.69  ? 206 TYR A CE2 1 
ATOM   1553 C  CZ  . TYR A 1 206 ? 43.377  19.002 45.853 1.00 31.32  ? 206 TYR A CZ  1 
ATOM   1554 O  OH  . TYR A 1 206 ? 43.270  18.699 44.514 1.00 34.00  ? 206 TYR A OH  1 
ATOM   1555 N  N   . GLY A 1 207 ? 44.347  23.070 50.278 1.00 36.74  ? 207 GLY A N   1 
ATOM   1556 C  CA  . GLY A 1 207 ? 44.783  24.359 49.776 1.00 29.17  ? 207 GLY A CA  1 
ATOM   1557 C  C   . GLY A 1 207 ? 46.280  24.466 49.686 1.00 25.25  ? 207 GLY A C   1 
ATOM   1558 O  O   . GLY A 1 207 ? 46.969  23.452 49.602 1.00 33.50  ? 207 GLY A O   1 
ATOM   1559 N  N   . PRO A 1 208 ? 46.822  25.690 49.699 1.00 29.27  ? 208 PRO A N   1 
ATOM   1560 C  CA  . PRO A 1 208 ? 48.260  25.912 49.620 1.00 27.34  ? 208 PRO A CA  1 
ATOM   1561 C  C   . PRO A 1 208 ? 49.152  25.006 50.488 1.00 30.76  ? 208 PRO A C   1 
ATOM   1562 O  O   . PRO A 1 208 ? 50.293  24.741 50.125 1.00 33.74  ? 208 PRO A O   1 
ATOM   1563 C  CB  . PRO A 1 208 ? 48.393  27.389 49.990 1.00 27.17  ? 208 PRO A CB  1 
ATOM   1564 C  CG  . PRO A 1 208 ? 47.204  27.963 49.340 1.00 28.67  ? 208 PRO A CG  1 
ATOM   1565 C  CD  . PRO A 1 208 ? 46.103  26.975 49.704 1.00 28.22  ? 208 PRO A CD  1 
ATOM   1566 N  N   . PRO A 1 209 ? 48.648  24.519 51.633 1.00 37.36  ? 209 PRO A N   1 
ATOM   1567 C  CA  . PRO A 1 209 ? 49.516  23.663 52.454 1.00 29.98  ? 209 PRO A CA  1 
ATOM   1568 C  C   . PRO A 1 209 ? 50.064  22.393 51.787 1.00 27.70  ? 209 PRO A C   1 
ATOM   1569 O  O   . PRO A 1 209 ? 51.131  21.922 52.151 1.00 26.18  ? 209 PRO A O   1 
ATOM   1570 C  CB  . PRO A 1 209 ? 48.639  23.357 53.665 1.00 35.98  ? 209 PRO A CB  1 
ATOM   1571 C  CG  . PRO A 1 209 ? 47.860  24.643 53.815 1.00 34.31  ? 209 PRO A CG  1 
ATOM   1572 C  CD  . PRO A 1 209 ? 47.433  24.897 52.386 1.00 28.68  ? 209 PRO A CD  1 
ATOM   1573 N  N   . ILE A 1 210 ? 49.340  21.821 50.834 1.00 22.54  ? 210 ILE A N   1 
ATOM   1574 C  CA  . ILE A 1 210 ? 49.844  20.627 50.176 1.00 29.68  ? 210 ILE A CA  1 
ATOM   1575 C  C   . ILE A 1 210 ? 51.161  20.909 49.441 1.00 28.76  ? 210 ILE A C   1 
ATOM   1576 O  O   . ILE A 1 210 ? 51.987  20.012 49.262 1.00 30.45  ? 210 ILE A O   1 
ATOM   1577 C  CB  . ILE A 1 210 ? 48.832  20.056 49.152 1.00 31.01  ? 210 ILE A CB  1 
ATOM   1578 C  CG1 . ILE A 1 210 ? 48.693  21.016 47.966 1.00 34.91  ? 210 ILE A CG1 1 
ATOM   1579 C  CG2 . ILE A 1 210 ? 47.503  19.802 49.833 1.00 27.09  ? 210 ILE A CG2 1 
ATOM   1580 C  CD1 . ILE A 1 210 ? 48.090  20.392 46.741 1.00 21.69  ? 210 ILE A CD1 1 
ATOM   1581 N  N   . ASP A 1 211 ? 51.354  22.155 49.023 1.00 30.23  ? 211 ASP A N   1 
ATOM   1582 C  CA  . ASP A 1 211 ? 52.558  22.532 48.306 1.00 28.52  ? 211 ASP A CA  1 
ATOM   1583 C  C   . ASP A 1 211 ? 53.691  22.779 49.271 1.00 35.50  ? 211 ASP A C   1 
ATOM   1584 O  O   . ASP A 1 211 ? 54.844  22.470 48.976 1.00 25.28  ? 211 ASP A O   1 
ATOM   1585 C  CB  . ASP A 1 211 ? 52.323  23.787 47.453 1.00 24.55  ? 211 ASP A CB  1 
ATOM   1586 C  CG  . ASP A 1 211 ? 51.496  23.507 46.197 1.00 23.86  ? 211 ASP A CG  1 
ATOM   1587 O  OD1 . ASP A 1 211 ? 51.460  22.354 45.738 1.00 27.25  ? 211 ASP A OD1 1 
ATOM   1588 O  OD2 . ASP A 1 211 ? 50.905  24.461 45.647 1.00 32.01  ? 211 ASP A OD2 1 
ATOM   1589 N  N   . LEU A 1 212 ? 53.368  23.334 50.436 1.00 32.89  ? 212 LEU A N   1 
ATOM   1590 C  CA  . LEU A 1 212 ? 54.405  23.581 51.411 1.00 24.53  ? 212 LEU A CA  1 
ATOM   1591 C  C   . LEU A 1 212 ? 54.928  22.280 52.013 1.00 28.05  ? 212 LEU A C   1 
ATOM   1592 O  O   . LEU A 1 212 ? 56.097  22.188 52.406 1.00 28.33  ? 212 LEU A O   1 
ATOM   1593 C  CB  . LEU A 1 212 ? 53.919  24.561 52.487 1.00 24.61  ? 212 LEU A CB  1 
ATOM   1594 C  CG  . LEU A 1 212 ? 54.206  25.941 51.911 1.00 32.89  ? 212 LEU A CG  1 
ATOM   1595 C  CD1 . LEU A 1 212 ? 52.908  26.639 51.576 1.00 36.69  ? 212 LEU A CD1 1 
ATOM   1596 C  CD2 . LEU A 1 212 ? 55.067  26.729 52.849 1.00 26.23  ? 212 LEU A CD2 1 
ATOM   1597 N  N   . TRP A 1 213 ? 54.082  21.264 52.069 1.00 28.65  ? 213 TRP A N   1 
ATOM   1598 C  CA  . TRP A 1 213 ? 54.544  19.993 52.593 1.00 39.37  ? 213 TRP A CA  1 
ATOM   1599 C  C   . TRP A 1 213 ? 55.663  19.606 51.634 1.00 33.87  ? 213 TRP A C   1 
ATOM   1600 O  O   . TRP A 1 213 ? 56.763  19.265 52.057 1.00 35.48  ? 213 TRP A O   1 
ATOM   1601 C  CB  . TRP A 1 213 ? 53.415  18.955 52.570 1.00 29.87  ? 213 TRP A CB  1 
ATOM   1602 C  CG  . TRP A 1 213 ? 53.863  17.555 52.904 1.00 42.13  ? 213 TRP A CG  1 
ATOM   1603 C  CD1 . TRP A 1 213 ? 54.243  16.587 52.024 1.00 34.11  ? 213 TRP A CD1 1 
ATOM   1604 C  CD2 . TRP A 1 213 ? 53.995  16.981 54.215 1.00 38.22  ? 213 TRP A CD2 1 
ATOM   1605 N  NE1 . TRP A 1 213 ? 54.606  15.446 52.700 1.00 29.60  ? 213 TRP A NE1 1 
ATOM   1606 C  CE2 . TRP A 1 213 ? 54.463  15.662 54.046 1.00 41.81  ? 213 TRP A CE2 1 
ATOM   1607 C  CE3 . TRP A 1 213 ? 53.765  17.458 55.514 1.00 35.68  ? 213 TRP A CE3 1 
ATOM   1608 C  CZ2 . TRP A 1 213 ? 54.707  14.808 55.131 1.00 39.46  ? 213 TRP A CZ2 1 
ATOM   1609 C  CZ3 . TRP A 1 213 ? 54.005  16.615 56.590 1.00 42.57  ? 213 TRP A CZ3 1 
ATOM   1610 C  CH2 . TRP A 1 213 ? 54.472  15.303 56.391 1.00 42.25  ? 213 TRP A CH2 1 
ATOM   1611 N  N   . GLY A 1 214 ? 55.363  19.685 50.339 1.00 31.07  ? 214 GLY A N   1 
ATOM   1612 C  CA  . GLY A 1 214 ? 56.345  19.369 49.318 1.00 34.03  ? 214 GLY A CA  1 
ATOM   1613 C  C   . GLY A 1 214 ? 57.615  20.194 49.464 1.00 31.85  ? 214 GLY A C   1 
ATOM   1614 O  O   . GLY A 1 214 ? 58.715  19.668 49.279 1.00 33.78  ? 214 GLY A O   1 
ATOM   1615 N  N   . ALA A 1 215 ? 57.477  21.479 49.807 1.00 20.79  ? 215 ALA A N   1 
ATOM   1616 C  CA  . ALA A 1 215 ? 58.642  22.347 49.980 1.00 29.17  ? 215 ALA A CA  1 
ATOM   1617 C  C   . ALA A 1 215 ? 59.453  21.836 51.170 1.00 26.83  ? 215 ALA A C   1 
ATOM   1618 O  O   . ALA A 1 215 ? 60.668  22.014 51.220 1.00 27.39  ? 215 ALA A O   1 
ATOM   1619 C  CB  . ALA A 1 215 ? 58.215  23.824 50.205 1.00 25.57  ? 215 ALA A CB  1 
ATOM   1620 N  N   . GLY A 1 216 ? 58.767  21.195 52.114 1.00 31.97  ? 216 GLY A N   1 
ATOM   1621 C  CA  . GLY A 1 216 ? 59.439  20.631 53.274 1.00 31.21  ? 216 GLY A CA  1 
ATOM   1622 C  C   . GLY A 1 216 ? 60.240  19.389 52.877 1.00 27.77  ? 216 GLY A C   1 
ATOM   1623 O  O   . GLY A 1 216 ? 61.408  19.251 53.230 1.00 33.94  ? 216 GLY A O   1 
ATOM   1624 N  N   . CYS A 1 217 ? 59.615  18.489 52.128 1.00 33.68  ? 217 CYS A N   1 
ATOM   1625 C  CA  . CYS A 1 217 ? 60.295  17.279 51.665 1.00 27.47  ? 217 CYS A CA  1 
ATOM   1626 C  C   . CYS A 1 217 ? 61.522  17.651 50.847 1.00 29.74  ? 217 CYS A C   1 
ATOM   1627 O  O   . CYS A 1 217 ? 62.590  17.052 51.009 1.00 34.68  ? 217 CYS A O   1 
ATOM   1628 C  CB  . CYS A 1 217 ? 59.358  16.434 50.815 1.00 26.86  ? 217 CYS A CB  1 
ATOM   1629 S  SG  . CYS A 1 217 ? 57.982  15.777 51.732 1.00 36.81  ? 217 CYS A SG  1 
ATOM   1630 N  N   . ILE A 1 218 ? 61.369  18.653 49.977 1.00 32.36  ? 218 ILE A N   1 
ATOM   1631 C  CA  . ILE A 1 218 ? 62.470  19.109 49.144 1.00 25.76  ? 218 ILE A CA  1 
ATOM   1632 C  C   . ILE A 1 218 ? 63.575  19.728 49.987 1.00 34.75  ? 218 ILE A C   1 
ATOM   1633 O  O   . ILE A 1 218 ? 64.752  19.506 49.728 1.00 32.79  ? 218 ILE A O   1 
ATOM   1634 C  CB  . ILE A 1 218 ? 61.995  20.151 48.104 1.00 32.90  ? 218 ILE A CB  1 
ATOM   1635 C  CG1 . ILE A 1 218 ? 61.153  19.458 47.024 1.00 32.03  ? 218 ILE A CG1 1 
ATOM   1636 C  CG2 . ILE A 1 218 ? 63.192  20.877 47.483 1.00 30.10  ? 218 ILE A CG2 1 
ATOM   1637 C  CD1 . ILE A 1 218 ? 60.508  20.414 46.023 1.00 33.66  ? 218 ILE A CD1 1 
ATOM   1638 N  N   . MET A 1 219 ? 63.201  20.493 51.007 1.00 27.41  ? 219 MET A N   1 
ATOM   1639 C  CA  . MET A 1 219 ? 64.207  21.140 51.832 1.00 30.36  ? 219 MET A CA  1 
ATOM   1640 C  C   . MET A 1 219 ? 65.095  20.072 52.494 1.00 29.56  ? 219 MET A C   1 
ATOM   1641 O  O   . MET A 1 219 ? 66.322  20.192 52.512 1.00 25.52  ? 219 MET A O   1 
ATOM   1642 C  CB  . MET A 1 219 ? 63.544  22.046 52.886 1.00 32.79  ? 219 MET A CB  1 
ATOM   1643 C  CG  . MET A 1 219 ? 64.538  22.970 53.563 1.00 42.39  ? 219 MET A CG  1 
ATOM   1644 S  SD  . MET A 1 219 ? 63.860  24.087 54.810 1.00 32.77  ? 219 MET A SD  1 
ATOM   1645 C  CE  . MET A 1 219 ? 65.404  24.656 55.560 1.00 32.41  ? 219 MET A CE  1 
ATOM   1646 N  N   . ALA A 1 220 ? 64.473  19.015 53.001 1.00 27.58  ? 220 ALA A N   1 
ATOM   1647 C  CA  . ALA A 1 220 ? 65.228  17.933 53.634 1.00 34.72  ? 220 ALA A CA  1 
ATOM   1648 C  C   . ALA A 1 220 ? 66.264  17.403 52.645 1.00 33.08  ? 220 ALA A C   1 
ATOM   1649 O  O   . ALA A 1 220 ? 67.438  17.266 52.991 1.00 30.57  ? 220 ALA A O   1 
ATOM   1650 C  CB  . ALA A 1 220 ? 64.288  16.812 54.064 1.00 34.00  ? 220 ALA A CB  1 
ATOM   1651 N  N   . GLU A 1 221 ? 65.829  17.136 51.412 1.00 36.74  ? 221 GLU A N   1 
ATOM   1652 C  CA  . GLU A 1 221 ? 66.719  16.622 50.372 1.00 33.48  ? 221 GLU A CA  1 
ATOM   1653 C  C   . GLU A 1 221 ? 67.916  17.494 50.086 1.00 34.56  ? 221 GLU A C   1 
ATOM   1654 O  O   . GLU A 1 221 ? 68.907  17.001 49.559 1.00 36.74  ? 221 GLU A O   1 
ATOM   1655 C  CB  . GLU A 1 221 ? 65.992  16.416 49.042 1.00 26.19  ? 221 GLU A CB  1 
ATOM   1656 C  CG  . GLU A 1 221 ? 64.850  15.472 49.105 1.00 27.71  ? 221 GLU A CG  1 
ATOM   1657 C  CD  . GLU A 1 221 ? 64.234  15.196 47.736 1.00 30.88  ? 221 GLU A CD  1 
ATOM   1658 O  OE1 . GLU A 1 221 ? 63.039  14.842 47.688 1.00 31.77  ? 221 GLU A OE1 1 
ATOM   1659 O  OE2 . GLU A 1 221 ? 64.948  15.316 46.725 1.00 35.45  ? 221 GLU A OE2 1 
ATOM   1660 N  N   . MET A 1 222 ? 67.836  18.785 50.397 1.00 31.82  ? 222 MET A N   1 
ATOM   1661 C  CA  . MET A 1 222 ? 68.974  19.656 50.139 1.00 33.11  ? 222 MET A CA  1 
ATOM   1662 C  C   . MET A 1 222 ? 70.179  19.136 50.932 1.00 33.51  ? 222 MET A C   1 
ATOM   1663 O  O   . MET A 1 222 ? 71.323  19.391 50.581 1.00 35.86  ? 222 MET A O   1 
ATOM   1664 C  CB  . MET A 1 222 ? 68.671  21.113 50.527 1.00 37.62  ? 222 MET A CB  1 
ATOM   1665 C  CG  . MET A 1 222 ? 67.608  21.808 49.669 1.00 38.61  ? 222 MET A CG  1 
ATOM   1666 S  SD  . MET A 1 222 ? 67.900  21.780 47.873 1.00 33.98  ? 222 MET A SD  1 
ATOM   1667 C  CE  . MET A 1 222 ? 69.228  22.776 47.700 1.00 15.87  ? 222 MET A CE  1 
ATOM   1668 N  N   . TRP A 1 223 ? 69.917  18.423 52.018 1.00 34.41  ? 223 TRP A N   1 
ATOM   1669 C  CA  . TRP A 1 223 ? 71.005  17.865 52.795 1.00 40.97  ? 223 TRP A CA  1 
ATOM   1670 C  C   . TRP A 1 223 ? 71.122  16.365 52.534 1.00 37.29  ? 223 TRP A C   1 
ATOM   1671 O  O   . TRP A 1 223 ? 72.207  15.884 52.202 1.00 39.82  ? 223 TRP A O   1 
ATOM   1672 C  CB  . TRP A 1 223 ? 70.799  18.155 54.288 1.00 39.36  ? 223 TRP A CB  1 
ATOM   1673 C  CG  . TRP A 1 223 ? 71.087  19.610 54.635 1.00 30.60  ? 223 TRP A CG  1 
ATOM   1674 C  CD1 . TRP A 1 223 ? 72.307  20.170 54.882 1.00 26.75  ? 223 TRP A CD1 1 
ATOM   1675 C  CD2 . TRP A 1 223 ? 70.133  20.674 54.733 1.00 31.02  ? 223 TRP A CD2 1 
ATOM   1676 N  NE1 . TRP A 1 223 ? 72.176  21.517 55.129 1.00 36.12  ? 223 TRP A NE1 1 
ATOM   1677 C  CE2 . TRP A 1 223 ? 70.849  21.852 55.043 1.00 34.02  ? 223 TRP A CE2 1 
ATOM   1678 C  CE3 . TRP A 1 223 ? 68.740  20.746 54.588 1.00 37.57  ? 223 TRP A CE3 1 
ATOM   1679 C  CZ2 . TRP A 1 223 ? 70.217  23.094 55.211 1.00 35.15  ? 223 TRP A CZ2 1 
ATOM   1680 C  CZ3 . TRP A 1 223 ? 68.111  21.985 54.755 1.00 40.00  ? 223 TRP A CZ3 1 
ATOM   1681 C  CH2 . TRP A 1 223 ? 68.855  23.140 55.064 1.00 29.93  ? 223 TRP A CH2 1 
ATOM   1682 N  N   . THR A 1 224 ? 70.010  15.635 52.640 1.00 38.00  ? 224 THR A N   1 
ATOM   1683 C  CA  . THR A 1 224 ? 70.028  14.186 52.441 1.00 35.48  ? 224 THR A CA  1 
ATOM   1684 C  C   . THR A 1 224 ? 70.429  13.728 51.037 1.00 41.54  ? 224 THR A C   1 
ATOM   1685 O  O   . THR A 1 224 ? 71.007  12.657 50.884 1.00 35.88  ? 224 THR A O   1 
ATOM   1686 C  CB  . THR A 1 224 ? 68.677  13.549 52.805 1.00 25.40  ? 224 THR A CB  1 
ATOM   1687 O  OG1 . THR A 1 224 ? 67.667  13.998 51.901 1.00 44.37  ? 224 THR A OG1 1 
ATOM   1688 C  CG2 . THR A 1 224 ? 68.280  13.931 54.221 1.00 39.56  ? 224 THR A CG2 1 
ATOM   1689 N  N   . ARG A 1 225 ? 70.121  14.540 50.027 1.00 36.35  ? 225 ARG A N   1 
ATOM   1690 C  CA  . ARG A 1 225 ? 70.461  14.250 48.636 1.00 33.45  ? 225 ARG A CA  1 
ATOM   1691 C  C   . ARG A 1 225 ? 69.569  13.245 47.925 1.00 35.75  ? 225 ARG A C   1 
ATOM   1692 O  O   . ARG A 1 225 ? 69.868  12.835 46.810 1.00 40.92  ? 225 ARG A O   1 
ATOM   1693 C  CB  . ARG A 1 225 ? 71.919  13.806 48.528 1.00 38.75  ? 225 ARG A CB  1 
ATOM   1694 C  CG  . ARG A 1 225 ? 72.909  14.908 48.820 1.00 35.80  ? 225 ARG A CG  1 
ATOM   1695 C  CD  . ARG A 1 225 ? 72.821  15.992 47.776 1.00 42.40  ? 225 ARG A CD  1 
ATOM   1696 N  NE  . ARG A 1 225 ? 73.963  16.876 47.887 1.00 42.65  ? 225 ARG A NE  1 
ATOM   1697 C  CZ  . ARG A 1 225 ? 74.593  17.419 46.859 1.00 38.12  ? 225 ARG A CZ  1 
ATOM   1698 N  NH1 . ARG A 1 225 ? 74.199  17.175 45.617 1.00 46.60  ? 225 ARG A NH1 1 
ATOM   1699 N  NH2 . ARG A 1 225 ? 75.628  18.207 47.079 1.00 45.77  ? 225 ARG A NH2 1 
ATOM   1700 N  N   . SER A 1 226 ? 68.484  12.842 48.574 1.00 42.54  ? 226 SER A N   1 
ATOM   1701 C  CA  . SER A 1 226 ? 67.525  11.922 47.971 1.00 34.27  ? 226 SER A CA  1 
ATOM   1702 C  C   . SER A 1 226 ? 66.243  11.967 48.788 1.00 32.32  ? 226 SER A C   1 
ATOM   1703 O  O   . SER A 1 226 ? 66.278  12.225 49.989 1.00 39.26  ? 226 SER A O   1 
ATOM   1704 C  CB  . SER A 1 226 ? 68.084  10.491 47.908 1.00 41.57  ? 226 SER A CB  1 
ATOM   1705 O  OG  . SER A 1 226 ? 68.483  10.014 49.181 1.00 39.47  ? 226 SER A OG  1 
ATOM   1706 N  N   . PRO A 1 227 ? 65.090  11.728 48.146 1.00 34.06  ? 227 PRO A N   1 
ATOM   1707 C  CA  . PRO A 1 227 ? 63.785  11.750 48.821 1.00 36.24  ? 227 PRO A CA  1 
ATOM   1708 C  C   . PRO A 1 227 ? 63.806  11.045 50.169 1.00 40.67  ? 227 PRO A C   1 
ATOM   1709 O  O   . PRO A 1 227 ? 64.231  9.898  50.253 1.00 48.19  ? 227 PRO A O   1 
ATOM   1710 C  CB  . PRO A 1 227 ? 62.877  11.067 47.817 1.00 34.16  ? 227 PRO A CB  1 
ATOM   1711 C  CG  . PRO A 1 227 ? 63.446  11.527 46.503 1.00 35.93  ? 227 PRO A CG  1 
ATOM   1712 C  CD  . PRO A 1 227 ? 64.937  11.376 46.722 1.00 29.33  ? 227 PRO A CD  1 
ATOM   1713 N  N   . ILE A 1 228 ? 63.324  11.725 51.207 1.00 39.63  ? 228 ILE A N   1 
ATOM   1714 C  CA  . ILE A 1 228 ? 63.329  11.184 52.563 1.00 39.42  ? 228 ILE A CA  1 
ATOM   1715 C  C   . ILE A 1 228 ? 62.236  10.167 52.894 1.00 44.03  ? 228 ILE A C   1 
ATOM   1716 O  O   . ILE A 1 228 ? 62.385  9.384  53.824 1.00 41.29  ? 228 ILE A O   1 
ATOM   1717 C  CB  . ILE A 1 228 ? 63.266  12.308 53.603 1.00 38.66  ? 228 ILE A CB  1 
ATOM   1718 C  CG1 . ILE A 1 228 ? 61.928  13.041 53.495 1.00 49.81  ? 228 ILE A CG1 1 
ATOM   1719 C  CG2 . ILE A 1 228 ? 64.433  13.244 53.408 1.00 36.39  ? 228 ILE A CG2 1 
ATOM   1720 C  CD1 . ILE A 1 228 ? 61.675  14.020 54.619 1.00 43.67  ? 228 ILE A CD1 1 
ATOM   1721 N  N   . MET A 1 229 ? 61.141  10.180 52.146 1.00 41.02  ? 229 MET A N   1 
ATOM   1722 C  CA  . MET A 1 229 ? 60.060  9.235  52.387 1.00 45.68  ? 229 MET A CA  1 
ATOM   1723 C  C   . MET A 1 229 ? 59.614  8.631  51.066 1.00 45.32  ? 229 MET A C   1 
ATOM   1724 O  O   . MET A 1 229 ? 58.745  9.175  50.390 1.00 40.79  ? 229 MET A O   1 
ATOM   1725 C  CB  . MET A 1 229 ? 58.879  9.930  53.069 1.00 40.91  ? 229 MET A CB  1 
ATOM   1726 C  CG  . MET A 1 229 ? 59.251  10.589 54.379 1.00 50.00  ? 229 MET A CG  1 
ATOM   1727 S  SD  . MET A 1 229 ? 57.836  11.284 55.232 1.00 53.68  ? 229 MET A SD  1 
ATOM   1728 C  CE  . MET A 1 229 ? 57.504  12.765 54.231 1.00 56.33  ? 229 MET A CE  1 
ATOM   1729 N  N   . GLN A 1 230 ? 60.219  7.499  50.714 1.00 50.23  ? 230 GLN A N   1 
ATOM   1730 C  CA  . GLN A 1 230 ? 59.926  6.803  49.464 1.00 50.56  ? 230 GLN A CA  1 
ATOM   1731 C  C   . GLN A 1 230 ? 58.952  5.642  49.631 1.00 51.04  ? 230 GLN A C   1 
ATOM   1732 O  O   . GLN A 1 230 ? 59.342  4.477  49.549 1.00 52.88  ? 230 GLN A O   1 
ATOM   1733 C  CB  . GLN A 1 230 ? 61.236  6.301  48.860 1.00 47.83  ? 230 GLN A CB  1 
ATOM   1734 C  CG  . GLN A 1 230 ? 62.257  7.415  48.680 1.00 49.47  ? 230 GLN A CG  1 
ATOM   1735 C  CD  . GLN A 1 230 ? 63.555  6.940  48.078 1.00 41.14  ? 230 GLN A CD  1 
ATOM   1736 O  OE1 . GLN A 1 230 ? 63.563  6.066  47.217 1.00 43.79  ? 230 GLN A OE1 1 
ATOM   1737 N  NE2 . GLN A 1 230 ? 64.664  7.531  48.512 1.00 46.35  ? 230 GLN A NE2 1 
ATOM   1738 N  N   . GLY A 1 231 ? 57.683  5.968  49.846 1.00 49.36  ? 231 GLY A N   1 
ATOM   1739 C  CA  . GLY A 1 231 ? 56.670  4.944  50.029 1.00 49.70  ? 231 GLY A CA  1 
ATOM   1740 C  C   . GLY A 1 231 ? 56.407  4.135  48.774 1.00 49.18  ? 231 GLY A C   1 
ATOM   1741 O  O   . GLY A 1 231 ? 56.534  4.646  47.662 1.00 43.08  ? 231 GLY A O   1 
ATOM   1742 N  N   . ASN A 1 232 ? 56.049  2.868  48.953 1.00 46.44  ? 232 ASN A N   1 
ATOM   1743 C  CA  . ASN A 1 232 ? 55.768  1.988  47.824 1.00 54.18  ? 232 ASN A CA  1 
ATOM   1744 C  C   . ASN A 1 232 ? 54.300  2.076  47.451 1.00 52.46  ? 232 ASN A C   1 
ATOM   1745 O  O   . ASN A 1 232 ? 53.921  1.819  46.307 1.00 56.65  ? 232 ASN A O   1 
ATOM   1746 C  CB  . ASN A 1 232 ? 56.097  0.530  48.166 1.00 55.63  ? 232 ASN A CB  1 
ATOM   1747 C  CG  . ASN A 1 232 ? 57.585  0.278  48.306 1.00 66.15  ? 232 ASN A CG  1 
ATOM   1748 O  OD1 . ASN A 1 232 ? 58.062  -0.094 49.378 1.00 66.58  ? 232 ASN A OD1 1 
ATOM   1749 N  ND2 . ASN A 1 232 ? 58.327  0.470  47.220 1.00 58.62  ? 232 ASN A ND2 1 
ATOM   1750 N  N   . THR A 1 233 ? 53.476  2.429  48.428 1.00 45.84  ? 233 THR A N   1 
ATOM   1751 C  CA  . THR A 1 233 ? 52.037  2.539  48.225 1.00 48.19  ? 233 THR A CA  1 
ATOM   1752 C  C   . THR A 1 233 ? 51.527  3.643  49.128 1.00 49.59  ? 233 THR A C   1 
ATOM   1753 O  O   . THR A 1 233 ? 52.266  4.168  49.957 1.00 43.71  ? 233 THR A O   1 
ATOM   1754 C  CB  . THR A 1 233 ? 51.310  1.251  48.632 1.00 52.33  ? 233 THR A CB  1 
ATOM   1755 O  OG1 . THR A 1 233 ? 51.457  1.056  50.044 1.00 56.37  ? 233 THR A OG1 1 
ATOM   1756 C  CG2 . THR A 1 233 ? 51.883  0.043  47.892 1.00 55.51  ? 233 THR A CG2 1 
ATOM   1757 N  N   . GLU A 1 234 ? 50.256  3.987  48.979 1.00 45.06  ? 234 GLU A N   1 
ATOM   1758 C  CA  . GLU A 1 234 ? 49.686  5.033  49.798 1.00 52.29  ? 234 GLU A CA  1 
ATOM   1759 C  C   . GLU A 1 234 ? 49.739  4.646  51.263 1.00 53.18  ? 234 GLU A C   1 
ATOM   1760 O  O   . GLU A 1 234 ? 50.065  5.467  52.116 1.00 57.73  ? 234 GLU A O   1 
ATOM   1761 C  CB  . GLU A 1 234 ? 48.257  5.319  49.352 1.00 46.16  ? 234 GLU A CB  1 
ATOM   1762 C  CG  . GLU A 1 234 ? 48.221  6.085  48.047 1.00 57.21  ? 234 GLU A CG  1 
ATOM   1763 C  CD  . GLU A 1 234 ? 46.829  6.478  47.623 1.00 63.49  ? 234 GLU A CD  1 
ATOM   1764 O  OE1 . GLU A 1 234 ? 46.017  6.841  48.505 1.00 74.90  ? 234 GLU A OE1 1 
ATOM   1765 O  OE2 . GLU A 1 234 ? 46.556  6.440  46.404 1.00 71.04  ? 234 GLU A OE2 1 
ATOM   1766 N  N   . GLN A 1 235 ? 49.448  3.380  51.544 1.00 59.20  ? 235 GLN A N   1 
ATOM   1767 C  CA  . GLN A 1 235 ? 49.462  2.879  52.910 1.00 59.67  ? 235 GLN A CA  1 
ATOM   1768 C  C   . GLN A 1 235 ? 50.876  2.906  53.466 1.00 58.18  ? 235 GLN A C   1 
ATOM   1769 O  O   . GLN A 1 235 ? 51.092  3.175  54.650 1.00 55.45  ? 235 GLN A O   1 
ATOM   1770 C  CB  . GLN A 1 235 ? 48.910  1.454  52.945 1.00 66.34  ? 235 GLN A CB  1 
ATOM   1771 C  CG  . GLN A 1 235 ? 48.870  0.842  54.326 1.00 66.56  ? 235 GLN A CG  1 
ATOM   1772 C  CD  . GLN A 1 235 ? 47.907  -0.317 54.400 1.00 75.58  ? 235 GLN A CD  1 
ATOM   1773 O  OE1 . GLN A 1 235 ? 46.693  -0.135 54.281 1.00 76.84  ? 235 GLN A OE1 1 
ATOM   1774 N  NE2 . GLN A 1 235 ? 48.440  -1.521 54.586 1.00 72.89  ? 235 GLN A NE2 1 
ATOM   1775 N  N   . HIS A 1 236 ? 51.838  2.625  52.601 1.00 54.77  ? 236 HIS A N   1 
ATOM   1776 C  CA  . HIS A 1 236 ? 53.237  2.624  52.998 1.00 58.05  ? 236 HIS A CA  1 
ATOM   1777 C  C   . HIS A 1 236 ? 53.717  4.066  53.208 1.00 59.46  ? 236 HIS A C   1 
ATOM   1778 O  O   . HIS A 1 236 ? 54.468  4.356  54.148 1.00 48.90  ? 236 HIS A O   1 
ATOM   1779 C  CB  . HIS A 1 236 ? 54.087  1.945  51.917 1.00 54.98  ? 236 HIS A CB  1 
ATOM   1780 C  CG  . HIS A 1 236 ? 55.534  1.832  52.274 1.00 50.57  ? 236 HIS A CG  1 
ATOM   1781 N  ND1 . HIS A 1 236 ? 56.508  1.540  51.346 1.00 50.60  ? 236 HIS A ND1 1 
ATOM   1782 C  CD2 . HIS A 1 236 ? 56.173  1.970  53.460 1.00 48.19  ? 236 HIS A CD2 1 
ATOM   1783 C  CE1 . HIS A 1 236 ? 57.685  1.503  51.943 1.00 46.74  ? 236 HIS A CE1 1 
ATOM   1784 N  NE2 . HIS A 1 236 ? 57.510  1.761  53.227 1.00 45.64  ? 236 HIS A NE2 1 
ATOM   1785 N  N   . GLN A 1 237 ? 53.278  4.965  52.327 1.00 54.93  ? 237 GLN A N   1 
ATOM   1786 C  CA  . GLN A 1 237 ? 53.662  6.370  52.413 1.00 51.74  ? 237 GLN A CA  1 
ATOM   1787 C  C   . GLN A 1 237 ? 53.206  6.943  53.755 1.00 51.20  ? 237 GLN A C   1 
ATOM   1788 O  O   . GLN A 1 237 ? 53.936  7.697  54.410 1.00 53.53  ? 237 GLN A O   1 
ATOM   1789 C  CB  . GLN A 1 237 ? 53.042  7.168  51.253 1.00 44.23  ? 237 GLN A CB  1 
ATOM   1790 C  CG  . GLN A 1 237 ? 53.642  8.568  51.059 1.00 37.79  ? 237 GLN A CG  1 
ATOM   1791 C  CD  . GLN A 1 237 ? 55.159  8.543  50.847 1.00 35.50  ? 237 GLN A CD  1 
ATOM   1792 O  OE1 . GLN A 1 237 ? 55.671  7.782  50.022 1.00 38.62  ? 237 GLN A OE1 1 
ATOM   1793 N  NE2 . GLN A 1 237 ? 55.876  9.378  51.588 1.00 29.86  ? 237 GLN A NE2 1 
ATOM   1794 N  N   . LEU A 1 238 ? 51.995  6.578  54.161 1.00 56.09  ? 238 LEU A N   1 
ATOM   1795 C  CA  . LEU A 1 238 ? 51.446  7.038  55.434 1.00 44.53  ? 238 LEU A CA  1 
ATOM   1796 C  C   . LEU A 1 238 ? 52.269  6.475  56.574 1.00 52.13  ? 238 LEU A C   1 
ATOM   1797 O  O   . LEU A 1 238 ? 52.478  7.135  57.597 1.00 56.84  ? 238 LEU A O   1 
ATOM   1798 C  CB  . LEU A 1 238 ? 50.000  6.581  55.560 1.00 48.53  ? 238 LEU A CB  1 
ATOM   1799 C  CG  . LEU A 1 238 ? 49.016  7.401  54.726 1.00 39.61  ? 238 LEU A CG  1 
ATOM   1800 C  CD1 . LEU A 1 238 ? 47.813  6.568  54.328 1.00 36.50  ? 238 LEU A CD1 1 
ATOM   1801 C  CD2 . LEU A 1 238 ? 48.612  8.631  55.533 1.00 54.34  ? 238 LEU A CD2 1 
ATOM   1802 N  N   . ALA A 1 239 ? 52.743  5.248  56.384 1.00 58.56  ? 239 ALA A N   1 
ATOM   1803 C  CA  . ALA A 1 239 ? 53.554  4.574  57.387 1.00 58.05  ? 239 ALA A CA  1 
ATOM   1804 C  C   . ALA A 1 239 ? 54.800  5.383  57.706 1.00 54.86  ? 239 ALA A C   1 
ATOM   1805 O  O   . ALA A 1 239 ? 55.069  5.695  58.872 1.00 58.24  ? 239 ALA A O   1 
ATOM   1806 C  CB  . ALA A 1 239 ? 53.946  3.181  56.892 1.00 50.85  ? 239 ALA A CB  1 
ATOM   1807 N  N   . LEU A 1 240 ? 55.551  5.728  56.662 1.00 49.04  ? 240 LEU A N   1 
ATOM   1808 C  CA  . LEU A 1 240 ? 56.792  6.490  56.814 1.00 57.17  ? 240 LEU A CA  1 
ATOM   1809 C  C   . LEU A 1 240 ? 56.596  7.897  57.391 1.00 53.77  ? 240 LEU A C   1 
ATOM   1810 O  O   . LEU A 1 240 ? 57.472  8.430  58.081 1.00 51.42  ? 240 LEU A O   1 
ATOM   1811 C  CB  . LEU A 1 240 ? 57.507  6.574  55.463 1.00 51.40  ? 240 LEU A CB  1 
ATOM   1812 C  CG  . LEU A 1 240 ? 57.846  5.227  54.814 1.00 51.35  ? 240 LEU A CG  1 
ATOM   1813 C  CD1 . LEU A 1 240 ? 58.235  5.432  53.379 1.00 47.42  ? 240 LEU A CD1 1 
ATOM   1814 C  CD2 . LEU A 1 240 ? 58.970  4.549  55.578 1.00 43.82  ? 240 LEU A CD2 1 
ATOM   1815 N  N   . ILE A 1 241 ? 55.452  8.503  57.097 1.00 55.73  ? 241 ILE A N   1 
ATOM   1816 C  CA  . ILE A 1 241 ? 55.158  9.837  57.600 1.00 46.74  ? 241 ILE A CA  1 
ATOM   1817 C  C   . ILE A 1 241 ? 54.918  9.736  59.098 1.00 43.47  ? 241 ILE A C   1 
ATOM   1818 O  O   . ILE A 1 241 ? 55.332  10.602 59.868 1.00 48.28  ? 241 ILE A O   1 
ATOM   1819 C  CB  . ILE A 1 241 ? 53.924  10.413 56.890 1.00 38.29  ? 241 ILE A CB  1 
ATOM   1820 C  CG1 . ILE A 1 241 ? 54.304  10.765 55.445 1.00 48.99  ? 241 ILE A CG1 1 
ATOM   1821 C  CG2 . ILE A 1 241 ? 53.401  11.621 57.647 1.00 41.42  ? 241 ILE A CG2 1 
ATOM   1822 C  CD1 . ILE A 1 241 ? 53.137  10.893 54.504 1.00 39.68  ? 241 ILE A CD1 1 
ATOM   1823 N  N   . SER A 1 242 ? 54.254  8.661  59.506 1.00 48.58  ? 242 SER A N   1 
ATOM   1824 C  CA  . SER A 1 242 ? 53.983  8.423  60.914 1.00 52.49  ? 242 SER A CA  1 
ATOM   1825 C  C   . SER A 1 242 ? 55.325  8.155  61.594 1.00 49.32  ? 242 SER A C   1 
ATOM   1826 O  O   . SER A 1 242 ? 55.628  8.695  62.657 1.00 43.45  ? 242 SER A O   1 
ATOM   1827 C  CB  . SER A 1 242 ? 53.068  7.209  61.064 1.00 57.60  ? 242 SER A CB  1 
ATOM   1828 O  OG  . SER A 1 242 ? 51.883  7.370  60.302 1.00 64.37  ? 242 SER A OG  1 
ATOM   1829 N  N   . GLN A 1 243 ? 56.133  7.328  60.947 1.00 49.50  ? 243 GLN A N   1 
ATOM   1830 C  CA  . GLN A 1 243 ? 57.443  6.970  61.466 1.00 52.32  ? 243 GLN A CA  1 
ATOM   1831 C  C   . GLN A 1 243 ? 58.369  8.160  61.633 1.00 52.31  ? 243 GLN A C   1 
ATOM   1832 O  O   . GLN A 1 243 ? 59.199  8.174  62.537 1.00 57.70  ? 243 GLN A O   1 
ATOM   1833 C  CB  . GLN A 1 243 ? 58.102  5.944  60.545 1.00 50.05  ? 243 GLN A CB  1 
ATOM   1834 C  CG  . GLN A 1 243 ? 57.490  4.560  60.642 1.00 66.00  ? 243 GLN A CG  1 
ATOM   1835 C  CD  . GLN A 1 243 ? 57.970  3.631  59.544 1.00 77.51  ? 243 GLN A CD  1 
ATOM   1836 O  OE1 . GLN A 1 243 ? 59.040  3.838  58.964 1.00 78.73  ? 243 GLN A OE1 1 
ATOM   1837 N  NE2 . GLN A 1 243 ? 57.185  2.591  59.260 1.00 67.84  ? 243 GLN A NE2 1 
ATOM   1838 N  N   . LEU A 1 244 ? 58.238  9.157  60.762 1.00 51.42  ? 244 LEU A N   1 
ATOM   1839 C  CA  . LEU A 1 244 ? 59.099  10.332 60.843 1.00 42.42  ? 244 LEU A CA  1 
ATOM   1840 C  C   . LEU A 1 244 ? 58.475  11.536 61.531 1.00 40.65  ? 244 LEU A C   1 
ATOM   1841 O  O   . LEU A 1 244 ? 59.157  12.258 62.261 1.00 48.86  ? 244 LEU A O   1 
ATOM   1842 C  CB  . LEU A 1 244 ? 59.553  10.753 59.447 1.00 42.73  ? 244 LEU A CB  1 
ATOM   1843 C  CG  . LEU A 1 244 ? 60.217  12.124 59.336 1.00 31.42  ? 244 LEU A CG  1 
ATOM   1844 C  CD1 . LEU A 1 244 ? 61.609  12.084 59.943 1.00 42.65  ? 244 LEU A CD1 1 
ATOM   1845 C  CD2 . LEU A 1 244 ? 60.304  12.522 57.878 1.00 50.66  ? 244 LEU A CD2 1 
ATOM   1846 N  N   . CYS A 1 245 ? 57.188  11.767 61.299 1.00 37.37  ? 245 CYS A N   1 
ATOM   1847 C  CA  . CYS A 1 245 ? 56.529  12.931 61.884 1.00 44.49  ? 245 CYS A CA  1 
ATOM   1848 C  C   . CYS A 1 245 ? 55.758  12.687 63.169 1.00 49.56  ? 245 CYS A C   1 
ATOM   1849 O  O   . CYS A 1 245 ? 55.468  13.630 63.903 1.00 60.53  ? 245 CYS A O   1 
ATOM   1850 C  CB  . CYS A 1 245 ? 55.598  13.576 60.849 1.00 48.05  ? 245 CYS A CB  1 
ATOM   1851 S  SG  . CYS A 1 245 ? 56.455  14.186 59.362 1.00 47.67  ? 245 CYS A SG  1 
ATOM   1852 N  N   . GLY A 1 246 ? 55.428  11.431 63.442 1.00 53.83  ? 246 GLY A N   1 
ATOM   1853 C  CA  . GLY A 1 246 ? 54.675  11.106 64.643 1.00 54.27  ? 246 GLY A CA  1 
ATOM   1854 C  C   . GLY A 1 246 ? 53.341  10.530 64.219 1.00 56.69  ? 246 GLY A C   1 
ATOM   1855 O  O   . GLY A 1 246 ? 52.793  10.952 63.201 1.00 54.23  ? 246 GLY A O   1 
ATOM   1856 N  N   . SER A 1 247 ? 52.823  9.562  64.972 1.00 53.56  ? 247 SER A N   1 
ATOM   1857 C  CA  . SER A 1 247 ? 51.544  8.957  64.621 1.00 50.63  ? 247 SER A CA  1 
ATOM   1858 C  C   . SER A 1 247 ? 50.522  10.059 64.375 1.00 51.61  ? 247 SER A C   1 
ATOM   1859 O  O   . SER A 1 247 ? 50.600  11.141 64.964 1.00 46.05  ? 247 SER A O   1 
ATOM   1860 C  CB  . SER A 1 247 ? 51.053  8.019  65.735 1.00 58.70  ? 247 SER A CB  1 
ATOM   1861 O  OG  . SER A 1 247 ? 51.675  6.741  65.664 1.00 54.88  ? 247 SER A OG  1 
ATOM   1862 N  N   . ILE A 1 248 ? 49.575  9.772  63.489 1.00 47.18  ? 248 ILE A N   1 
ATOM   1863 C  CA  . ILE A 1 248 ? 48.532  10.717 63.123 1.00 51.81  ? 248 ILE A CA  1 
ATOM   1864 C  C   . ILE A 1 248 ? 47.331  10.545 64.047 1.00 52.25  ? 248 ILE A C   1 
ATOM   1865 O  O   . ILE A 1 248 ? 46.493  9.663  63.852 1.00 57.91  ? 248 ILE A O   1 
ATOM   1866 C  CB  . ILE A 1 248 ? 48.096  10.497 61.649 1.00 46.24  ? 248 ILE A CB  1 
ATOM   1867 C  CG1 . ILE A 1 248 ? 49.296  10.678 60.716 1.00 45.07  ? 248 ILE A CG1 1 
ATOM   1868 C  CG2 . ILE A 1 248 ? 46.999  11.469 61.278 1.00 46.53  ? 248 ILE A CG2 1 
ATOM   1869 C  CD1 . ILE A 1 248 ? 49.060  10.183 59.285 1.00 40.30  ? 248 ILE A CD1 1 
ATOM   1870 N  N   . THR A 1 249 ? 47.251  11.403 65.052 1.00 56.05  ? 249 THR A N   1 
ATOM   1871 C  CA  . THR A 1 249 ? 46.167  11.334 66.013 1.00 54.56  ? 249 THR A CA  1 
ATOM   1872 C  C   . THR A 1 249 ? 45.468  12.674 66.117 1.00 52.05  ? 249 THR A C   1 
ATOM   1873 O  O   . THR A 1 249 ? 46.029  13.709 65.751 1.00 64.71  ? 249 THR A O   1 
ATOM   1874 C  CB  . THR A 1 249 ? 46.690  10.987 67.415 1.00 53.82  ? 249 THR A CB  1 
ATOM   1875 O  OG1 . THR A 1 249 ? 47.340  12.139 67.975 1.00 45.30  ? 249 THR A OG1 1 
ATOM   1876 C  CG2 . THR A 1 249 ? 47.686  9.833  67.342 1.00 60.49  ? 249 THR A CG2 1 
ATOM   1877 N  N   . PRO A 1 250 ? 44.227  12.671 66.624 1.00 52.43  ? 250 PRO A N   1 
ATOM   1878 C  CA  . PRO A 1 250 ? 43.405  13.873 66.809 1.00 49.30  ? 250 PRO A CA  1 
ATOM   1879 C  C   . PRO A 1 250 ? 44.036  14.808 67.842 1.00 54.66  ? 250 PRO A C   1 
ATOM   1880 O  O   . PRO A 1 250 ? 43.572  15.922 68.068 1.00 61.28  ? 250 PRO A O   1 
ATOM   1881 C  CB  . PRO A 1 250 ? 42.076  13.305 67.283 1.00 54.27  ? 250 PRO A CB  1 
ATOM   1882 C  CG  . PRO A 1 250 ? 42.018  11.981 66.586 1.00 49.18  ? 250 PRO A CG  1 
ATOM   1883 C  CD  . PRO A 1 250 ? 43.414  11.453 66.778 1.00 38.86  ? 250 PRO A CD  1 
ATOM   1884 N  N   . GLU A 1 251 ? 45.110  14.345 68.460 1.00 58.75  ? 251 GLU A N   1 
ATOM   1885 C  CA  . GLU A 1 251 ? 45.803  15.130 69.464 1.00 64.48  ? 251 GLU A CA  1 
ATOM   1886 C  C   . GLU A 1 251 ? 46.688  16.191 68.806 1.00 66.82  ? 251 GLU A C   1 
ATOM   1887 O  O   . GLU A 1 251 ? 46.777  17.331 69.275 1.00 58.26  ? 251 GLU A O   1 
ATOM   1888 C  CB  . GLU A 1 251 ? 46.652  14.201 70.324 1.00 70.19  ? 251 GLU A CB  1 
ATOM   1889 C  CG  . GLU A 1 251 ? 46.967  14.737 71.693 1.00 73.77  ? 251 GLU A CG  1 
ATOM   1890 C  CD  . GLU A 1 251 ? 47.630  13.694 72.559 1.00 80.50  ? 251 GLU A CD  1 
ATOM   1891 O  OE1 . GLU A 1 251 ? 47.114  12.557 72.606 1.00 83.93  ? 251 GLU A OE1 1 
ATOM   1892 O  OE2 . GLU A 1 251 ? 48.659  14.010 73.193 1.00 87.41  ? 251 GLU A OE2 1 
ATOM   1893 N  N   . VAL A 1 252 ? 47.340  15.813 67.714 1.00 63.22  ? 252 VAL A N   1 
ATOM   1894 C  CA  . VAL A 1 252 ? 48.214  16.739 67.008 1.00 58.78  ? 252 VAL A CA  1 
ATOM   1895 C  C   . VAL A 1 252 ? 47.504  17.293 65.777 1.00 58.88  ? 252 VAL A C   1 
ATOM   1896 O  O   . VAL A 1 252 ? 47.927  18.293 65.195 1.00 59.45  ? 252 VAL A O   1 
ATOM   1897 C  CB  . VAL A 1 252 ? 49.530  16.039 66.588 1.00 51.00  ? 252 VAL A CB  1 
ATOM   1898 C  CG1 . VAL A 1 252 ? 49.236  14.903 65.638 1.00 47.94  ? 252 VAL A CG1 1 
ATOM   1899 C  CG2 . VAL A 1 252 ? 50.472  17.041 65.956 1.00 61.24  ? 252 VAL A CG2 1 
ATOM   1900 N  N   . TRP A 1 253 ? 46.405  16.648 65.405 1.00 54.78  ? 253 TRP A N   1 
ATOM   1901 C  CA  . TRP A 1 253 ? 45.624  17.052 64.242 1.00 52.41  ? 253 TRP A CA  1 
ATOM   1902 C  C   . TRP A 1 253 ? 44.124  16.979 64.573 1.00 51.67  ? 253 TRP A C   1 
ATOM   1903 O  O   . TRP A 1 253 ? 43.431  16.028 64.197 1.00 48.17  ? 253 TRP A O   1 
ATOM   1904 C  CB  . TRP A 1 253 ? 45.975  16.126 63.077 1.00 54.49  ? 253 TRP A CB  1 
ATOM   1905 C  CG  . TRP A 1 253 ? 45.361  16.472 61.764 1.00 52.65  ? 253 TRP A CG  1 
ATOM   1906 C  CD1 . TRP A 1 253 ? 44.345  17.354 61.533 1.00 52.15  ? 253 TRP A CD1 1 
ATOM   1907 C  CD2 . TRP A 1 253 ? 45.658  15.860 60.503 1.00 53.27  ? 253 TRP A CD2 1 
ATOM   1908 N  NE1 . TRP A 1 253 ? 43.984  17.322 60.209 1.00 49.51  ? 253 TRP A NE1 1 
ATOM   1909 C  CE2 . TRP A 1 253 ? 44.772  16.414 59.553 1.00 52.64  ? 253 TRP A CE2 1 
ATOM   1910 C  CE3 . TRP A 1 253 ? 46.582  14.891 60.087 1.00 57.28  ? 253 TRP A CE3 1 
ATOM   1911 C  CZ2 . TRP A 1 253 ? 44.780  16.031 58.207 1.00 50.09  ? 253 TRP A CZ2 1 
ATOM   1912 C  CZ3 . TRP A 1 253 ? 46.590  14.510 58.750 1.00 59.66  ? 253 TRP A CZ3 1 
ATOM   1913 C  CH2 . TRP A 1 253 ? 45.691  15.081 57.825 1.00 58.90  ? 253 TRP A CH2 1 
ATOM   1914 N  N   . PRO A 1 254 ? 43.604  18.000 65.273 1.00 49.46  ? 254 PRO A N   1 
ATOM   1915 C  CA  . PRO A 1 254 ? 42.192  18.042 65.657 1.00 51.67  ? 254 PRO A CA  1 
ATOM   1916 C  C   . PRO A 1 254 ? 41.188  17.753 64.555 1.00 52.34  ? 254 PRO A C   1 
ATOM   1917 O  O   . PRO A 1 254 ? 41.203  18.367 63.496 1.00 57.63  ? 254 PRO A O   1 
ATOM   1918 C  CB  . PRO A 1 254 ? 42.031  19.440 66.260 1.00 52.76  ? 254 PRO A CB  1 
ATOM   1919 C  CG  . PRO A 1 254 ? 43.157  20.230 65.648 1.00 58.50  ? 254 PRO A CG  1 
ATOM   1920 C  CD  . PRO A 1 254 ? 44.289  19.243 65.664 1.00 54.66  ? 254 PRO A CD  1 
ATOM   1921 N  N   . ASN A 1 255 ? 40.324  16.787 64.829 1.00 50.39  ? 255 ASN A N   1 
ATOM   1922 C  CA  . ASN A 1 255 ? 39.276  16.384 63.915 1.00 53.17  ? 255 ASN A CA  1 
ATOM   1923 C  C   . ASN A 1 255 ? 39.748  15.515 62.767 1.00 57.83  ? 255 ASN A C   1 
ATOM   1924 O  O   . ASN A 1 255 ? 38.998  15.290 61.817 1.00 51.82  ? 255 ASN A O   1 
ATOM   1925 C  CB  . ASN A 1 255 ? 38.548  17.609 63.360 1.00 63.91  ? 255 ASN A CB  1 
ATOM   1926 C  CG  . ASN A 1 255 ? 37.053  17.548 63.593 1.00 69.96  ? 255 ASN A CG  1 
ATOM   1927 O  OD1 . ASN A 1 255 ? 36.309  18.429 63.164 1.00 80.93  ? 255 ASN A OD1 1 
ATOM   1928 N  ND2 . ASN A 1 255 ? 36.603  16.503 64.279 1.00 74.50  ? 255 ASN A ND2 1 
ATOM   1929 N  N   . VAL A 1 256 ? 40.983  15.027 62.842 1.00 58.30  ? 256 VAL A N   1 
ATOM   1930 C  CA  . VAL A 1 256 ? 41.488  14.160 61.786 1.00 62.64  ? 256 VAL A CA  1 
ATOM   1931 C  C   . VAL A 1 256 ? 40.603  12.916 61.794 1.00 63.38  ? 256 VAL A C   1 
ATOM   1932 O  O   . VAL A 1 256 ? 40.587  12.129 60.843 1.00 61.07  ? 256 VAL A O   1 
ATOM   1933 C  CB  . VAL A 1 256 ? 42.966  13.766 62.029 1.00 60.25  ? 256 VAL A CB  1 
ATOM   1934 C  CG1 . VAL A 1 256 ? 43.106  13.008 63.336 1.00 62.52  ? 256 VAL A CG1 1 
ATOM   1935 C  CG2 . VAL A 1 256 ? 43.476  12.938 60.855 1.00 65.81  ? 256 VAL A CG2 1 
ATOM   1936 N  N   . ASP A 1 257 ? 39.851  12.789 62.887 1.00 70.13  ? 257 ASP A N   1 
ATOM   1937 C  CA  . ASP A 1 257 ? 38.912  11.697 63.145 1.00 72.08  ? 257 ASP A CA  1 
ATOM   1938 C  C   . ASP A 1 257 ? 37.889  11.533 62.034 1.00 68.75  ? 257 ASP A C   1 
ATOM   1939 O  O   . ASP A 1 257 ? 37.673  10.431 61.530 1.00 75.68  ? 257 ASP A O   1 
ATOM   1940 C  CB  . ASP A 1 257 ? 38.143  11.965 64.447 1.00 76.31  ? 257 ASP A CB  1 
ATOM   1941 C  CG  . ASP A 1 257 ? 39.043  12.040 65.660 1.00 76.79  ? 257 ASP A CG  1 
ATOM   1942 O  OD1 . ASP A 1 257 ? 39.565  10.986 66.070 1.00 89.26  ? 257 ASP A OD1 1 
ATOM   1943 O  OD2 . ASP A 1 257 ? 39.230  13.149 66.206 1.00 79.09  ? 257 ASP A OD2 1 
ATOM   1944 N  N   . ASN A 1 258 ? 37.256  12.645 61.677 1.00 64.25  ? 258 ASN A N   1 
ATOM   1945 C  CA  . ASN A 1 258 ? 36.221  12.669 60.657 1.00 65.82  ? 258 ASN A CA  1 
ATOM   1946 C  C   . ASN A 1 258 ? 36.574  12.071 59.302 1.00 63.01  ? 258 ASN A C   1 
ATOM   1947 O  O   . ASN A 1 258 ? 35.686  11.619 58.576 1.00 64.80  ? 258 ASN A O   1 
ATOM   1948 C  CB  . ASN A 1 258 ? 35.718  14.103 60.467 1.00 74.03  ? 258 ASN A CB  1 
ATOM   1949 C  CG  . ASN A 1 258 ? 34.982  14.628 61.688 1.00 85.17  ? 258 ASN A CG  1 
ATOM   1950 O  OD1 . ASN A 1 258 ? 35.566  14.788 62.764 1.00 81.43  ? 258 ASN A OD1 1 
ATOM   1951 N  ND2 . ASN A 1 258 ? 33.688  14.892 61.528 1.00 92.90  ? 258 ASN A ND2 1 
ATOM   1952 N  N   . TYR A 1 259 ? 37.850  12.066 58.937 1.00 62.02  ? 259 TYR A N   1 
ATOM   1953 C  CA  . TYR A 1 259 ? 38.206  11.494 57.645 1.00 53.53  ? 259 TYR A CA  1 
ATOM   1954 C  C   . TYR A 1 259 ? 37.654  10.079 57.546 1.00 57.17  ? 259 TYR A C   1 
ATOM   1955 O  O   . TYR A 1 259 ? 37.798  9.271  58.466 1.00 53.32  ? 259 TYR A O   1 
ATOM   1956 C  CB  . TYR A 1 259 ? 39.722  11.485 57.449 1.00 55.75  ? 259 TYR A CB  1 
ATOM   1957 C  CG  . TYR A 1 259 ? 40.301  12.834 57.094 1.00 53.98  ? 259 TYR A CG  1 
ATOM   1958 C  CD1 . TYR A 1 259 ? 39.939  13.483 55.913 1.00 55.09  ? 259 TYR A CD1 1 
ATOM   1959 C  CD2 . TYR A 1 259 ? 41.220  13.459 57.934 1.00 59.27  ? 259 TYR A CD2 1 
ATOM   1960 C  CE1 . TYR A 1 259 ? 40.482  14.725 55.578 1.00 51.78  ? 259 TYR A CE1 1 
ATOM   1961 C  CE2 . TYR A 1 259 ? 41.768  14.700 57.611 1.00 53.30  ? 259 TYR A CE2 1 
ATOM   1962 C  CZ  . TYR A 1 259 ? 41.398  15.329 56.434 1.00 52.86  ? 259 TYR A CZ  1 
ATOM   1963 O  OH  . TYR A 1 259 ? 41.948  16.558 56.125 1.00 47.56  ? 259 TYR A OH  1 
ATOM   1964 N  N   . GLU A 1 260 ? 37.003  9.795  56.425 1.00 57.12  ? 260 GLU A N   1 
ATOM   1965 C  CA  . GLU A 1 260 ? 36.419  8.488  56.178 1.00 63.22  ? 260 GLU A CA  1 
ATOM   1966 C  C   . GLU A 1 260 ? 37.492  7.427  56.345 1.00 65.97  ? 260 GLU A C   1 
ATOM   1967 O  O   . GLU A 1 260 ? 37.332  6.466  57.097 1.00 69.59  ? 260 GLU A O   1 
ATOM   1968 C  CB  . GLU A 1 260 ? 35.883  8.426  54.748 1.00 69.69  ? 260 GLU A CB  1 
ATOM   1969 C  CG  . GLU A 1 260 ? 34.620  7.619  54.593 1.00 76.69  ? 260 GLU A CG  1 
ATOM   1970 C  CD  . GLU A 1 260 ? 33.444  8.288  55.272 1.00 90.66  ? 260 GLU A CD  1 
ATOM   1971 O  OE1 . GLU A 1 260 ? 33.150  9.457  54.932 1.00 84.91  ? 260 GLU A OE1 1 
ATOM   1972 O  OE2 . GLU A 1 260 ? 32.817  7.647  56.145 1.00 96.08  ? 260 GLU A OE2 1 
ATOM   1973 N  N   . LEU A 1 261 ? 38.595  7.627  55.633 1.00 62.53  ? 261 LEU A N   1 
ATOM   1974 C  CA  . LEU A 1 261 ? 39.722  6.705  55.638 1.00 58.23  ? 261 LEU A CA  1 
ATOM   1975 C  C   . LEU A 1 261 ? 40.515  6.671  56.940 1.00 57.90  ? 261 LEU A C   1 
ATOM   1976 O  O   . LEU A 1 261 ? 41.455  5.895  57.068 1.00 58.26  ? 261 LEU A O   1 
ATOM   1977 C  CB  . LEU A 1 261 ? 40.670  7.054  54.487 1.00 60.89  ? 261 LEU A CB  1 
ATOM   1978 C  CG  . LEU A 1 261 ? 40.043  7.224  53.100 1.00 68.69  ? 261 LEU A CG  1 
ATOM   1979 C  CD1 . LEU A 1 261 ? 41.095  7.758  52.134 1.00 66.32  ? 261 LEU A CD1 1 
ATOM   1980 C  CD2 . LEU A 1 261 ? 39.472  5.895  52.609 1.00 63.64  ? 261 LEU A CD2 1 
ATOM   1981 N  N   . TYR A 1 262 ? 40.154  7.501  57.909 1.00 61.66  ? 262 TYR A N   1 
ATOM   1982 C  CA  . TYR A 1 262 ? 40.900  7.505  59.157 1.00 68.01  ? 262 TYR A CA  1 
ATOM   1983 C  C   . TYR A 1 262 ? 40.824  6.155  59.842 1.00 75.82  ? 262 TYR A C   1 
ATOM   1984 O  O   . TYR A 1 262 ? 41.787  5.706  60.469 1.00 74.24  ? 262 TYR A O   1 
ATOM   1985 C  CB  . TYR A 1 262 ? 40.372  8.565  60.121 1.00 66.71  ? 262 TYR A CB  1 
ATOM   1986 C  CG  . TYR A 1 262 ? 41.278  8.728  61.316 1.00 58.25  ? 262 TYR A CG  1 
ATOM   1987 C  CD1 . TYR A 1 262 ? 42.636  8.966  61.138 1.00 63.95  ? 262 TYR A CD1 1 
ATOM   1988 C  CD2 . TYR A 1 262 ? 40.790  8.644  62.617 1.00 63.41  ? 262 TYR A CD2 1 
ATOM   1989 C  CE1 . TYR A 1 262 ? 43.488  9.121  62.216 1.00 66.12  ? 262 TYR A CE1 1 
ATOM   1990 C  CE2 . TYR A 1 262 ? 41.641  8.799  63.712 1.00 60.75  ? 262 TYR A CE2 1 
ATOM   1991 C  CZ  . TYR A 1 262 ? 42.991  9.041  63.498 1.00 61.55  ? 262 TYR A CZ  1 
ATOM   1992 O  OH  . TYR A 1 262 ? 43.857  9.234  64.551 1.00 52.27  ? 262 TYR A OH  1 
ATOM   1993 N  N   . GLU A 1 263 ? 39.665  5.519  59.720 1.00 79.47  ? 263 GLU A N   1 
ATOM   1994 C  CA  . GLU A 1 263 ? 39.418  4.220  60.329 1.00 82.46  ? 263 GLU A CA  1 
ATOM   1995 C  C   . GLU A 1 263 ? 39.909  3.107  59.409 1.00 81.49  ? 263 GLU A C   1 
ATOM   1996 O  O   . GLU A 1 263 ? 40.848  2.377  59.738 1.00 80.92  ? 263 GLU A O   1 
ATOM   1997 C  CB  . GLU A 1 263 ? 37.915  4.075  60.597 1.00 83.29  ? 263 GLU A CB  1 
ATOM   1998 C  CG  . GLU A 1 263 ? 37.491  2.861  61.413 1.00 90.21  ? 263 GLU A CG  1 
ATOM   1999 C  CD  . GLU A 1 263 ? 37.370  1.593  60.583 1.00 93.75  ? 263 GLU A CD  1 
ATOM   2000 O  OE1 . GLU A 1 263 ? 36.785  1.657  59.480 1.00 95.04  ? 263 GLU A OE1 1 
ATOM   2001 O  OE2 . GLU A 1 263 ? 37.844  0.530  61.042 1.00 91.75  ? 263 GLU A OE2 1 
ATOM   2002 N  N   . LYS A 1 264 ? 39.276  3.015  58.243 1.00 77.57  ? 264 LYS A N   1 
ATOM   2003 C  CA  . LYS A 1 264 ? 39.579  2.004  57.238 1.00 73.10  ? 264 LYS A CA  1 
ATOM   2004 C  C   . LYS A 1 264 ? 41.022  1.955  56.749 1.00 74.58  ? 264 LYS A C   1 
ATOM   2005 O  O   . LYS A 1 264 ? 41.298  1.376  55.699 1.00 77.94  ? 264 LYS A O   1 
ATOM   2006 C  CB  . LYS A 1 264 ? 38.646  2.198  56.040 1.00 68.27  ? 264 LYS A CB  1 
ATOM   2007 C  CG  . LYS A 1 264 ? 37.182  2.271  56.431 1.00 74.10  ? 264 LYS A CG  1 
ATOM   2008 C  CD  . LYS A 1 264 ? 36.286  2.551  55.238 1.00 78.89  ? 264 LYS A CD  1 
ATOM   2009 C  CE  . LYS A 1 264 ? 34.820  2.581  55.659 1.00 81.29  ? 264 LYS A CE  1 
ATOM   2010 N  NZ  . LYS A 1 264 ? 33.913  2.881  54.514 1.00 85.51  ? 264 LYS A NZ  1 
ATOM   2011 N  N   . LEU A 1 265 ? 41.947  2.548  57.496 1.00 75.78  ? 265 LEU A N   1 
ATOM   2012 C  CA  . LEU A 1 265 ? 43.349  2.538  57.083 1.00 79.69  ? 265 LEU A CA  1 
ATOM   2013 C  C   . LEU A 1 265 ? 44.300  2.098  58.185 1.00 80.84  ? 265 LEU A C   1 
ATOM   2014 O  O   . LEU A 1 265 ? 44.212  2.571  59.323 1.00 82.32  ? 265 LEU A O   1 
ATOM   2015 C  CB  . LEU A 1 265 ? 43.780  3.927  56.586 1.00 81.79  ? 265 LEU A CB  1 
ATOM   2016 C  CG  . LEU A 1 265 ? 43.365  4.377  55.180 1.00 78.85  ? 265 LEU A CG  1 
ATOM   2017 C  CD1 . LEU A 1 265 ? 43.744  5.832  54.974 1.00 74.15  ? 265 LEU A CD1 1 
ATOM   2018 C  CD2 . LEU A 1 265 ? 44.044  3.499  54.143 1.00 79.77  ? 265 LEU A CD2 1 
ATOM   2019 N  N   . GLU A 1 266 ? 45.203  1.183  57.841 1.00 74.08  ? 266 GLU A N   1 
ATOM   2020 C  CA  . GLU A 1 266 ? 46.196  0.711  58.795 1.00 74.87  ? 266 GLU A CA  1 
ATOM   2021 C  C   . GLU A 1 266 ? 46.922  1.973  59.220 1.00 74.06  ? 266 GLU A C   1 
ATOM   2022 O  O   . GLU A 1 266 ? 47.416  2.710  58.372 1.00 83.49  ? 266 GLU A O   1 
ATOM   2023 C  CB  . GLU A 1 266 ? 47.178  -0.254 58.120 1.00 71.35  ? 266 GLU A CB  1 
ATOM   2024 C  CG  . GLU A 1 266 ? 48.481  -0.463 58.899 1.00 86.85  ? 266 GLU A CG  1 
ATOM   2025 C  CD  . GLU A 1 266 ? 49.464  0.701  58.753 1.00 94.33  ? 266 GLU A CD  1 
ATOM   2026 O  OE1 . GLU A 1 266 ? 50.369  0.834  59.607 1.00 90.22  ? 266 GLU A OE1 1 
ATOM   2027 O  OE2 . GLU A 1 266 ? 49.340  1.474  57.776 1.00 95.12  ? 266 GLU A OE2 1 
ATOM   2028 N  N   . LEU A 1 267 ? 46.991  2.234  60.518 1.00 68.99  ? 267 LEU A N   1 
ATOM   2029 C  CA  . LEU A 1 267 ? 47.650  3.446  60.973 1.00 67.91  ? 267 LEU A CA  1 
ATOM   2030 C  C   . LEU A 1 267 ? 48.339  3.299  62.326 1.00 69.64  ? 267 LEU A C   1 
ATOM   2031 O  O   . LEU A 1 267 ? 47.682  3.310  63.367 1.00 73.75  ? 267 LEU A O   1 
ATOM   2032 C  CB  . LEU A 1 267 ? 46.619  4.577  61.024 1.00 66.88  ? 267 LEU A CB  1 
ATOM   2033 C  CG  . LEU A 1 267 ? 46.995  5.882  60.316 1.00 71.35  ? 267 LEU A CG  1 
ATOM   2034 C  CD1 . LEU A 1 267 ? 45.747  6.725  60.100 1.00 68.03  ? 267 LEU A CD1 1 
ATOM   2035 C  CD2 . LEU A 1 267 ? 48.045  6.629  61.132 1.00 67.60  ? 267 LEU A CD2 1 
ATOM   2036 N  N   . VAL A 1 268 ? 49.665  3.171  62.309 1.00 69.62  ? 268 VAL A N   1 
ATOM   2037 C  CA  . VAL A 1 268 ? 50.440  3.026  63.542 1.00 74.42  ? 268 VAL A CA  1 
ATOM   2038 C  C   . VAL A 1 268 ? 50.079  4.113  64.561 1.00 73.97  ? 268 VAL A C   1 
ATOM   2039 O  O   . VAL A 1 268 ? 50.035  5.296  64.227 1.00 75.98  ? 268 VAL A O   1 
ATOM   2040 C  CB  . VAL A 1 268 ? 51.947  3.077  63.249 1.00 76.17  ? 268 VAL A CB  1 
ATOM   2041 C  CG1 . VAL A 1 268 ? 52.278  4.325  62.466 1.00 78.10  ? 268 VAL A CG1 1 
ATOM   2042 C  CG2 . VAL A 1 268 ? 52.727  3.032  64.552 1.00 81.13  ? 268 VAL A CG2 1 
ATOM   2043 N  N   . LYS A 1 269 ? 49.850  3.707  65.809 1.00 73.11  ? 269 LYS A N   1 
ATOM   2044 C  CA  . LYS A 1 269 ? 49.428  4.632  66.862 1.00 75.98  ? 269 LYS A CA  1 
ATOM   2045 C  C   . LYS A 1 269 ? 50.459  5.109  67.895 1.00 72.42  ? 269 LYS A C   1 
ATOM   2046 O  O   . LYS A 1 269 ? 50.238  6.124  68.560 1.00 73.02  ? 269 LYS A O   1 
ATOM   2047 C  CB  . LYS A 1 269 ? 48.227  4.013  67.599 1.00 79.81  ? 269 LYS A CB  1 
ATOM   2048 C  CG  . LYS A 1 269 ? 47.623  4.852  68.729 1.00 81.72  ? 269 LYS A CG  1 
ATOM   2049 C  CD  . LYS A 1 269 ? 46.708  5.950  68.211 1.00 76.31  ? 269 LYS A CD  1 
ATOM   2050 C  CE  . LYS A 1 269 ? 46.092  6.738  69.360 1.00 74.28  ? 269 LYS A CE  1 
ATOM   2051 N  NZ  . LYS A 1 269 ? 45.214  7.841  68.876 1.00 60.60  ? 269 LYS A NZ  1 
ATOM   2052 N  N   . GLY A 1 270 ? 51.579  4.409  68.036 1.00 69.95  ? 270 GLY A N   1 
ATOM   2053 C  CA  . GLY A 1 270 ? 52.550  4.825  69.041 1.00 68.86  ? 270 GLY A CA  1 
ATOM   2054 C  C   . GLY A 1 270 ? 53.740  5.670  68.618 1.00 74.77  ? 270 GLY A C   1 
ATOM   2055 O  O   . GLY A 1 270 ? 54.616  5.954  69.438 1.00 73.98  ? 270 GLY A O   1 
ATOM   2056 N  N   . GLN A 1 271 ? 53.763  6.089  67.354 1.00 75.45  ? 271 GLN A N   1 
ATOM   2057 C  CA  . GLN A 1 271 ? 54.865  6.879  66.801 1.00 70.58  ? 271 GLN A CA  1 
ATOM   2058 C  C   . GLN A 1 271 ? 55.042  8.284  67.377 1.00 67.90  ? 271 GLN A C   1 
ATOM   2059 O  O   . GLN A 1 271 ? 54.080  9.028  67.560 1.00 65.15  ? 271 GLN A O   1 
ATOM   2060 C  CB  . GLN A 1 271 ? 54.699  6.984  65.285 1.00 73.17  ? 271 GLN A CB  1 
ATOM   2061 C  CG  . GLN A 1 271 ? 54.453  5.651  64.608 1.00 69.56  ? 271 GLN A CG  1 
ATOM   2062 C  CD  . GLN A 1 271 ? 55.730  4.920  64.256 1.00 71.27  ? 271 GLN A CD  1 
ATOM   2063 O  OE1 . GLN A 1 271 ? 56.708  4.946  65.006 1.00 73.08  ? 271 GLN A OE1 1 
ATOM   2064 N  NE2 . GLN A 1 271 ? 55.724  4.250  63.110 1.00 66.34  ? 271 GLN A NE2 1 
ATOM   2065 N  N   . LYS A 1 272 ? 56.292  8.643  67.640 1.00 64.56  ? 272 LYS A N   1 
ATOM   2066 C  CA  . LYS A 1 272 ? 56.625  9.958  68.172 1.00 72.17  ? 272 LYS A CA  1 
ATOM   2067 C  C   . LYS A 1 272 ? 57.337  10.744 67.067 1.00 73.31  ? 272 LYS A C   1 
ATOM   2068 O  O   . LYS A 1 272 ? 58.047  10.161 66.251 1.00 78.12  ? 272 LYS A O   1 
ATOM   2069 C  CB  . LYS A 1 272 ? 57.541  9.798  69.385 1.00 71.86  ? 272 LYS A CB  1 
ATOM   2070 C  CG  . LYS A 1 272 ? 56.964  8.877  70.448 1.00 78.42  ? 272 LYS A CG  1 
ATOM   2071 C  CD  . LYS A 1 272 ? 57.954  8.621  71.567 1.00 79.83  ? 272 LYS A CD  1 
ATOM   2072 C  CE  . LYS A 1 272 ? 57.355  7.711  72.627 1.00 71.92  ? 272 LYS A CE  1 
ATOM   2073 N  NZ  . LYS A 1 272 ? 58.339  7.427  73.703 1.00 70.13  ? 272 LYS A NZ  1 
ATOM   2074 N  N   . ARG A 1 273 ? 57.148  12.059 67.034 1.00 70.60  ? 273 ARG A N   1 
ATOM   2075 C  CA  . ARG A 1 273 ? 57.783  12.885 66.007 1.00 65.73  ? 273 ARG A CA  1 
ATOM   2076 C  C   . ARG A 1 273 ? 59.309  12.835 66.129 1.00 63.47  ? 273 ARG A C   1 
ATOM   2077 O  O   . ARG A 1 273 ? 59.874  13.254 67.141 1.00 61.81  ? 273 ARG A O   1 
ATOM   2078 C  CB  . ARG A 1 273 ? 57.292  14.331 66.122 1.00 62.43  ? 273 ARG A CB  1 
ATOM   2079 C  CG  . ARG A 1 273 ? 57.619  15.207 64.926 1.00 52.15  ? 273 ARG A CG  1 
ATOM   2080 C  CD  . ARG A 1 273 ? 57.135  16.630 65.145 1.00 45.41  ? 273 ARG A CD  1 
ATOM   2081 N  NE  . ARG A 1 273 ? 57.435  17.507 64.017 1.00 50.93  ? 273 ARG A NE  1 
ATOM   2082 C  CZ  . ARG A 1 273 ? 56.855  17.423 62.823 1.00 48.61  ? 273 ARG A CZ  1 
ATOM   2083 N  NH1 . ARG A 1 273 ? 55.933  16.495 62.584 1.00 47.74  ? 273 ARG A NH1 1 
ATOM   2084 N  NH2 . ARG A 1 273 ? 57.192  18.280 61.868 1.00 63.42  ? 273 ARG A NH2 1 
ATOM   2085 N  N   . LYS A 1 274 ? 59.965  12.334 65.084 1.00 56.87  ? 274 LYS A N   1 
ATOM   2086 C  CA  . LYS A 1 274 ? 61.418  12.187 65.062 1.00 54.50  ? 274 LYS A CA  1 
ATOM   2087 C  C   . LYS A 1 274 ? 62.059  13.027 63.959 1.00 53.72  ? 274 LYS A C   1 
ATOM   2088 O  O   . LYS A 1 274 ? 63.200  12.790 63.570 1.00 51.74  ? 274 LYS A O   1 
ATOM   2089 C  CB  . LYS A 1 274 ? 61.763  10.713 64.833 1.00 61.97  ? 274 LYS A CB  1 
ATOM   2090 C  CG  . LYS A 1 274 ? 60.928  9.763  65.665 1.00 60.95  ? 274 LYS A CG  1 
ATOM   2091 C  CD  . LYS A 1 274 ? 60.777  8.394  65.010 1.00 67.76  ? 274 LYS A CD  1 
ATOM   2092 C  CE  . LYS A 1 274 ? 59.592  7.647  65.621 1.00 65.32  ? 274 LYS A CE  1 
ATOM   2093 N  NZ  . LYS A 1 274 ? 59.249  6.373  64.936 1.00 63.72  ? 274 LYS A NZ  1 
ATOM   2094 N  N   . VAL A 1 275 ? 61.325  14.017 63.465 1.00 57.70  ? 275 VAL A N   1 
ATOM   2095 C  CA  . VAL A 1 275 ? 61.816  14.864 62.389 1.00 48.51  ? 275 VAL A CA  1 
ATOM   2096 C  C   . VAL A 1 275 ? 63.221  15.417 62.573 1.00 52.14  ? 275 VAL A C   1 
ATOM   2097 O  O   . VAL A 1 275 ? 64.087  15.219 61.715 1.00 53.47  ? 275 VAL A O   1 
ATOM   2098 C  CB  . VAL A 1 275 ? 60.835  16.037 62.118 1.00 47.62  ? 275 VAL A CB  1 
ATOM   2099 C  CG1 . VAL A 1 275 ? 61.462  17.064 61.170 1.00 43.03  ? 275 VAL A CG1 1 
ATOM   2100 C  CG2 . VAL A 1 275 ? 59.564  15.496 61.504 1.00 34.07  ? 275 VAL A CG2 1 
ATOM   2101 N  N   . LYS A 1 276 ? 63.464  16.103 63.682 1.00 52.66  ? 276 LYS A N   1 
ATOM   2102 C  CA  . LYS A 1 276 ? 64.776  16.695 63.897 1.00 51.80  ? 276 LYS A CA  1 
ATOM   2103 C  C   . LYS A 1 276 ? 65.889  15.692 64.211 1.00 57.07  ? 276 LYS A C   1 
ATOM   2104 O  O   . LYS A 1 276 ? 67.045  15.890 63.824 1.00 55.00  ? 276 LYS A O   1 
ATOM   2105 C  CB  . LYS A 1 276 ? 64.679  17.776 64.980 1.00 62.75  ? 276 LYS A CB  1 
ATOM   2106 C  CG  . LYS A 1 276 ? 63.912  19.007 64.503 1.00 68.87  ? 276 LYS A CG  1 
ATOM   2107 C  CD  . LYS A 1 276 ? 63.778  20.080 65.567 1.00 68.86  ? 276 LYS A CD  1 
ATOM   2108 C  CE  . LYS A 1 276 ? 62.795  19.658 66.636 1.00 70.80  ? 276 LYS A CE  1 
ATOM   2109 N  NZ  . LYS A 1 276 ? 62.621  20.730 67.644 1.00 78.00  ? 276 LYS A NZ  1 
ATOM   2110 N  N   . ASP A 1 277 ? 65.551  14.611 64.897 1.00 53.81  ? 277 ASP A N   1 
ATOM   2111 C  CA  . ASP A 1 277 ? 66.560  13.614 65.213 1.00 59.58  ? 277 ASP A CA  1 
ATOM   2112 C  C   . ASP A 1 277 ? 67.072  12.958 63.941 1.00 61.82  ? 277 ASP A C   1 
ATOM   2113 O  O   . ASP A 1 277 ? 68.278  12.943 63.686 1.00 66.84  ? 277 ASP A O   1 
ATOM   2114 C  CB  . ASP A 1 277 ? 65.986  12.557 66.151 1.00 64.08  ? 277 ASP A CB  1 
ATOM   2115 C  CG  . ASP A 1 277 ? 65.686  13.112 67.526 1.00 68.18  ? 277 ASP A CG  1 
ATOM   2116 O  OD1 . ASP A 1 277 ? 66.604  13.706 68.132 1.00 73.83  ? 277 ASP A OD1 1 
ATOM   2117 O  OD2 . ASP A 1 277 ? 64.541  12.958 68.001 1.00 74.26  ? 277 ASP A OD2 1 
ATOM   2118 N  N   . ARG A 1 278 ? 66.154  12.432 63.136 1.00 60.23  ? 278 ARG A N   1 
ATOM   2119 C  CA  . ARG A 1 278 ? 66.527  11.766 61.893 1.00 53.50  ? 278 ARG A CA  1 
ATOM   2120 C  C   . ARG A 1 278 ? 67.313  12.641 60.923 1.00 48.59  ? 278 ARG A C   1 
ATOM   2121 O  O   . ARG A 1 278 ? 68.207  12.150 60.234 1.00 46.68  ? 278 ARG A O   1 
ATOM   2122 C  CB  . ARG A 1 278 ? 65.285  11.203 61.202 1.00 58.52  ? 278 ARG A CB  1 
ATOM   2123 C  CG  . ARG A 1 278 ? 64.706  9.986  61.909 1.00 66.50  ? 278 ARG A CG  1 
ATOM   2124 C  CD  . ARG A 1 278 ? 63.544  9.374  61.138 1.00 79.42  ? 278 ARG A CD  1 
ATOM   2125 N  NE  . ARG A 1 278 ? 63.910  9.024  59.765 1.00 81.91  ? 278 ARG A NE  1 
ATOM   2126 C  CZ  . ARG A 1 278 ? 63.120  8.354  58.930 1.00 82.76  ? 278 ARG A CZ  1 
ATOM   2127 N  NH1 . ARG A 1 278 ? 61.918  7.954  59.326 1.00 76.57  ? 278 ARG A NH1 1 
ATOM   2128 N  NH2 . ARG A 1 278 ? 63.529  8.089  57.696 1.00 78.88  ? 278 ARG A NH2 1 
ATOM   2129 N  N   . LEU A 1 279 ? 67.002  13.934 60.873 1.00 46.92  ? 279 LEU A N   1 
ATOM   2130 C  CA  . LEU A 1 279 ? 67.710  14.836 59.962 1.00 45.41  ? 279 LEU A CA  1 
ATOM   2131 C  C   . LEU A 1 279 ? 68.925  15.476 60.612 1.00 50.01  ? 279 LEU A C   1 
ATOM   2132 O  O   . LEU A 1 279 ? 69.764  16.069 59.931 1.00 43.40  ? 279 LEU A O   1 
ATOM   2133 C  CB  . LEU A 1 279 ? 66.774  15.931 59.465 1.00 41.06  ? 279 LEU A CB  1 
ATOM   2134 C  CG  . LEU A 1 279 ? 65.564  15.456 58.663 1.00 36.75  ? 279 LEU A CG  1 
ATOM   2135 C  CD1 . LEU A 1 279 ? 64.718  16.674 58.251 1.00 39.54  ? 279 LEU A CD1 1 
ATOM   2136 C  CD2 . LEU A 1 279 ? 66.037  14.690 57.440 1.00 47.18  ? 279 LEU A CD2 1 
ATOM   2137 N  N   . LYS A 1 280 ? 68.998  15.348 61.936 1.00 52.33  ? 280 LYS A N   1 
ATOM   2138 C  CA  . LYS A 1 280 ? 70.081  15.895 62.747 1.00 51.65  ? 280 LYS A CA  1 
ATOM   2139 C  C   . LYS A 1 280 ? 71.452  15.712 62.086 1.00 55.08  ? 280 LYS A C   1 
ATOM   2140 O  O   . LYS A 1 280 ? 72.127  16.686 61.743 1.00 55.92  ? 280 LYS A O   1 
ATOM   2141 C  CB  . LYS A 1 280 ? 70.057  15.213 64.120 1.00 56.87  ? 280 LYS A CB  1 
ATOM   2142 C  CG  . LYS A 1 280 ? 71.027  15.775 65.153 1.00 65.86  ? 280 LYS A CG  1 
ATOM   2143 C  CD  . LYS A 1 280 ? 70.931  15.008 66.472 1.00 59.14  ? 280 LYS A CD  1 
ATOM   2144 C  CE  . LYS A 1 280 ? 69.511  15.040 67.036 1.00 56.54  ? 280 LYS A CE  1 
ATOM   2145 N  NZ  . LYS A 1 280 ? 69.383  14.290 68.319 1.00 57.05  ? 280 LYS A NZ  1 
ATOM   2146 N  N   . ALA A 1 281 ? 71.854  14.460 61.901 1.00 52.38  ? 281 ALA A N   1 
ATOM   2147 C  CA  . ALA A 1 281 ? 73.142  14.145 61.289 1.00 54.67  ? 281 ALA A CA  1 
ATOM   2148 C  C   . ALA A 1 281 ? 73.360  14.869 59.967 1.00 55.26  ? 281 ALA A C   1 
ATOM   2149 O  O   . ALA A 1 281 ? 74.462  15.326 59.669 1.00 57.10  ? 281 ALA A O   1 
ATOM   2150 C  CB  . ALA A 1 281 ? 73.253  12.647 61.068 1.00 59.00  ? 281 ALA A CB  1 
ATOM   2151 N  N   . TYR A 1 282 ? 72.299  14.971 59.177 1.00 57.29  ? 282 TYR A N   1 
ATOM   2152 C  CA  . TYR A 1 282 ? 72.376  15.612 57.871 1.00 54.22  ? 282 TYR A CA  1 
ATOM   2153 C  C   . TYR A 1 282 ? 72.403  17.133 57.873 1.00 51.07  ? 282 TYR A C   1 
ATOM   2154 O  O   . TYR A 1 282 ? 73.322  17.743 57.327 1.00 50.25  ? 282 TYR A O   1 
ATOM   2155 C  CB  . TYR A 1 282 ? 71.206  15.155 56.997 1.00 42.88  ? 282 TYR A CB  1 
ATOM   2156 C  CG  . TYR A 1 282 ? 71.162  13.671 56.748 1.00 45.72  ? 282 TYR A CG  1 
ATOM   2157 C  CD1 . TYR A 1 282 ? 70.613  12.800 57.686 1.00 47.96  ? 282 TYR A CD1 1 
ATOM   2158 C  CD2 . TYR A 1 282 ? 71.649  13.138 55.562 1.00 48.89  ? 282 TYR A CD2 1 
ATOM   2159 C  CE1 . TYR A 1 282 ? 70.544  11.435 57.440 1.00 53.23  ? 282 TYR A CE1 1 
ATOM   2160 C  CE2 . TYR A 1 282 ? 71.587  11.780 55.308 1.00 52.90  ? 282 TYR A CE2 1 
ATOM   2161 C  CZ  . TYR A 1 282 ? 71.033  10.932 56.246 1.00 60.20  ? 282 TYR A CZ  1 
ATOM   2162 O  OH  . TYR A 1 282 ? 70.954  9.586  55.973 1.00 63.87  ? 282 TYR A OH  1 
ATOM   2163 N  N   . VAL A 1 283 ? 71.394  17.743 58.487 1.00 57.73  ? 283 VAL A N   1 
ATOM   2164 C  CA  . VAL A 1 283 ? 71.276  19.200 58.502 1.00 56.39  ? 283 VAL A CA  1 
ATOM   2165 C  C   . VAL A 1 283 ? 72.273  19.965 59.363 1.00 62.11  ? 283 VAL A C   1 
ATOM   2166 O  O   . VAL A 1 283 ? 73.060  20.749 58.834 1.00 68.00  ? 283 VAL A O   1 
ATOM   2167 C  CB  . VAL A 1 283 ? 69.840  19.618 58.880 1.00 52.40  ? 283 VAL A CB  1 
ATOM   2168 C  CG1 . VAL A 1 283 ? 69.741  21.130 58.990 1.00 58.36  ? 283 VAL A CG1 1 
ATOM   2169 C  CG2 . VAL A 1 283 ? 68.870  19.118 57.817 1.00 41.92  ? 283 VAL A CG2 1 
ATOM   2170 N  N   . ARG A 1 284 ? 72.231  19.751 60.676 1.00 60.35  ? 284 ARG A N   1 
ATOM   2171 C  CA  . ARG A 1 284 ? 73.133  20.428 61.608 1.00 67.81  ? 284 ARG A CA  1 
ATOM   2172 C  C   . ARG A 1 284 ? 72.631  21.795 62.090 1.00 65.05  ? 284 ARG A C   1 
ATOM   2173 O  O   . ARG A 1 284 ? 72.272  21.936 63.257 1.00 67.46  ? 284 ARG A O   1 
ATOM   2174 C  CB  . ARG A 1 284 ? 74.529  20.582 60.995 1.00 74.43  ? 284 ARG A CB  1 
ATOM   2175 C  CG  . ARG A 1 284 ? 75.226  19.264 60.683 1.00 76.31  ? 284 ARG A CG  1 
ATOM   2176 C  CD  . ARG A 1 284 ? 76.641  19.517 60.196 1.00 74.72  ? 284 ARG A CD  1 
ATOM   2177 N  NE  . ARG A 1 284 ? 77.408  18.285 60.032 1.00 88.51  ? 284 ARG A NE  1 
ATOM   2178 C  CZ  . ARG A 1 284 ? 78.711  18.249 59.763 1.00 90.12  ? 284 ARG A CZ  1 
ATOM   2179 N  NH1 . ARG A 1 284 ? 79.396  19.380 59.629 1.00 88.93  ? 284 ARG A NH1 1 
ATOM   2180 N  NH2 . ARG A 1 284 ? 79.332  17.082 59.629 1.00 82.72  ? 284 ARG A NH2 1 
ATOM   2181 N  N   . ASP A 1 285 ? 72.623  22.800 61.212 1.00 59.98  ? 285 ASP A N   1 
ATOM   2182 C  CA  . ASP A 1 285 ? 72.146  24.140 61.586 1.00 52.38  ? 285 ASP A CA  1 
ATOM   2183 C  C   . ASP A 1 285 ? 70.720  24.082 62.149 1.00 52.82  ? 285 ASP A C   1 
ATOM   2184 O  O   . ASP A 1 285 ? 69.791  23.663 61.457 1.00 57.19  ? 285 ASP A O   1 
ATOM   2185 C  CB  . ASP A 1 285 ? 72.180  25.071 60.375 1.00 52.65  ? 285 ASP A CB  1 
ATOM   2186 C  CG  . ASP A 1 285 ? 71.548  26.426 60.655 1.00 55.48  ? 285 ASP A CG  1 
ATOM   2187 O  OD1 . ASP A 1 285 ? 70.322  26.484 60.891 1.00 58.26  ? 285 ASP A OD1 1 
ATOM   2188 O  OD2 . ASP A 1 285 ? 72.282  27.436 60.637 1.00 54.56  ? 285 ASP A OD2 1 
ATOM   2189 N  N   . PRO A 1 286 ? 70.530  24.525 63.410 1.00 53.64  ? 286 PRO A N   1 
ATOM   2190 C  CA  . PRO A 1 286 ? 69.240  24.536 64.113 1.00 50.02  ? 286 PRO A CA  1 
ATOM   2191 C  C   . PRO A 1 286 ? 68.102  25.304 63.428 1.00 42.92  ? 286 PRO A C   1 
ATOM   2192 O  O   . PRO A 1 286 ? 66.944  24.867 63.460 1.00 49.64  ? 286 PRO A O   1 
ATOM   2193 C  CB  . PRO A 1 286 ? 69.593  25.127 65.486 1.00 43.35  ? 286 PRO A CB  1 
ATOM   2194 C  CG  . PRO A 1 286 ? 71.024  24.779 65.653 1.00 54.94  ? 286 PRO A CG  1 
ATOM   2195 C  CD  . PRO A 1 286 ? 71.589  25.057 64.287 1.00 55.71  ? 286 PRO A CD  1 
ATOM   2196 N  N   . TYR A 1 287 ? 68.412  26.442 62.820 1.00 39.56  ? 287 TYR A N   1 
ATOM   2197 C  CA  . TYR A 1 287 ? 67.362  27.207 62.147 1.00 45.37  ? 287 TYR A CA  1 
ATOM   2198 C  C   . TYR A 1 287 ? 66.798  26.374 61.000 1.00 44.79  ? 287 TYR A C   1 
ATOM   2199 O  O   . TYR A 1 287 ? 65.581  26.278 60.839 1.00 42.67  ? 287 TYR A O   1 
ATOM   2200 C  CB  . TYR A 1 287 ? 67.909  28.536 61.617 1.00 43.87  ? 287 TYR A CB  1 
ATOM   2201 C  CG  . TYR A 1 287 ? 68.391  29.472 62.703 1.00 52.77  ? 287 TYR A CG  1 
ATOM   2202 C  CD1 . TYR A 1 287 ? 67.522  29.933 63.691 1.00 47.78  ? 287 TYR A CD1 1 
ATOM   2203 C  CD2 . TYR A 1 287 ? 69.716  29.899 62.742 1.00 59.65  ? 287 TYR A CD2 1 
ATOM   2204 C  CE1 . TYR A 1 287 ? 67.961  30.798 64.689 1.00 51.42  ? 287 TYR A CE1 1 
ATOM   2205 C  CE2 . TYR A 1 287 ? 70.166  30.763 63.736 1.00 63.00  ? 287 TYR A CE2 1 
ATOM   2206 C  CZ  . TYR A 1 287 ? 69.282  31.208 64.704 1.00 59.21  ? 287 TYR A CZ  1 
ATOM   2207 O  OH  . TYR A 1 287 ? 69.723  32.064 65.685 1.00 70.06  ? 287 TYR A OH  1 
ATOM   2208 N  N   . ALA A 1 288 ? 67.694  25.747 60.236 1.00 41.66  ? 288 ALA A N   1 
ATOM   2209 C  CA  . ALA A 1 288 ? 67.310  24.904 59.100 1.00 45.73  ? 288 ALA A CA  1 
ATOM   2210 C  C   . ALA A 1 288 ? 66.434  23.732 59.542 1.00 42.40  ? 288 ALA A C   1 
ATOM   2211 O  O   . ALA A 1 288 ? 65.469  23.366 58.866 1.00 44.70  ? 288 ALA A O   1 
ATOM   2212 C  CB  . ALA A 1 288 ? 68.569  24.380 58.380 1.00 41.97  ? 288 ALA A CB  1 
ATOM   2213 N  N   . LEU A 1 289 ? 66.774  23.150 60.684 1.00 42.41  ? 289 LEU A N   1 
ATOM   2214 C  CA  . LEU A 1 289 ? 66.021  22.028 61.224 1.00 37.53  ? 289 LEU A CA  1 
ATOM   2215 C  C   . LEU A 1 289 ? 64.682  22.480 61.775 1.00 33.95  ? 289 LEU A C   1 
ATOM   2216 O  O   . LEU A 1 289 ? 63.708  21.733 61.787 1.00 44.01  ? 289 LEU A O   1 
ATOM   2217 C  CB  . LEU A 1 289 ? 66.813  21.359 62.345 1.00 46.00  ? 289 LEU A CB  1 
ATOM   2218 C  CG  . LEU A 1 289 ? 67.919  20.401 61.932 1.00 43.39  ? 289 LEU A CG  1 
ATOM   2219 C  CD1 . LEU A 1 289 ? 68.832  20.129 63.119 1.00 55.27  ? 289 LEU A CD1 1 
ATOM   2220 C  CD2 . LEU A 1 289 ? 67.281  19.121 61.422 1.00 52.53  ? 289 LEU A CD2 1 
ATOM   2221 N  N   . ASP A 1 290 ? 64.635  23.706 62.261 1.00 43.03  ? 290 ASP A N   1 
ATOM   2222 C  CA  . ASP A 1 290 ? 63.385  24.203 62.796 1.00 43.04  ? 290 ASP A CA  1 
ATOM   2223 C  C   . ASP A 1 290 ? 62.378  24.433 61.649 1.00 37.06  ? 290 ASP A C   1 
ATOM   2224 O  O   . ASP A 1 290 ? 61.230  23.978 61.715 1.00 34.82  ? 290 ASP A O   1 
ATOM   2225 C  CB  . ASP A 1 290 ? 63.654  25.480 63.602 1.00 41.20  ? 290 ASP A CB  1 
ATOM   2226 C  CG  . ASP A 1 290 ? 62.406  26.023 64.266 1.00 32.18  ? 290 ASP A CG  1 
ATOM   2227 O  OD1 . ASP A 1 290 ? 61.627  25.227 64.834 1.00 45.88  ? 290 ASP A OD1 1 
ATOM   2228 O  OD2 . ASP A 1 290 ? 62.213  27.249 64.218 1.00 43.13  ? 290 ASP A OD2 1 
ATOM   2229 N  N   . LEU A 1 291 ? 62.819  25.106 60.589 1.00 38.00  ? 291 LEU A N   1 
ATOM   2230 C  CA  . LEU A 1 291 ? 61.953  25.370 59.431 1.00 33.92  ? 291 LEU A CA  1 
ATOM   2231 C  C   . LEU A 1 291 ? 61.424  24.057 58.831 1.00 36.50  ? 291 LEU A C   1 
ATOM   2232 O  O   . LEU A 1 291 ? 60.227  23.914 58.570 1.00 35.54  ? 291 LEU A O   1 
ATOM   2233 C  CB  . LEU A 1 291 ? 62.734  26.177 58.386 1.00 41.24  ? 291 LEU A CB  1 
ATOM   2234 C  CG  . LEU A 1 291 ? 62.010  26.604 57.107 1.00 36.75  ? 291 LEU A CG  1 
ATOM   2235 C  CD1 . LEU A 1 291 ? 60.704  27.331 57.450 1.00 32.07  ? 291 LEU A CD1 1 
ATOM   2236 C  CD2 . LEU A 1 291 ? 62.919  27.503 56.320 1.00 27.52  ? 291 LEU A CD2 1 
ATOM   2237 N  N   . ILE A 1 292 ? 62.308  23.080 58.633 1.00 35.70  ? 292 ILE A N   1 
ATOM   2238 C  CA  . ILE A 1 292 ? 61.876  21.785 58.105 1.00 35.66  ? 292 ILE A CA  1 
ATOM   2239 C  C   . ILE A 1 292 ? 60.817  21.182 59.024 1.00 42.48  ? 292 ILE A C   1 
ATOM   2240 O  O   . ILE A 1 292 ? 59.830  20.595 58.570 1.00 42.86  ? 292 ILE A O   1 
ATOM   2241 C  CB  . ILE A 1 292 ? 63.056  20.804 58.012 1.00 38.72  ? 292 ILE A CB  1 
ATOM   2242 C  CG1 . ILE A 1 292 ? 64.037  21.290 56.943 1.00 39.49  ? 292 ILE A CG1 1 
ATOM   2243 C  CG2 . ILE A 1 292 ? 62.542  19.403 57.734 1.00 35.88  ? 292 ILE A CG2 1 
ATOM   2244 C  CD1 . ILE A 1 292 ? 65.408  20.640 56.990 1.00 39.65  ? 292 ILE A CD1 1 
ATOM   2245 N  N   . ASP A 1 293 ? 61.038  21.333 60.327 1.00 39.97  ? 293 ASP A N   1 
ATOM   2246 C  CA  . ASP A 1 293 ? 60.128  20.819 61.332 1.00 40.47  ? 293 ASP A CA  1 
ATOM   2247 C  C   . ASP A 1 293 ? 58.740  21.487 61.192 1.00 41.94  ? 293 ASP A C   1 
ATOM   2248 O  O   . ASP A 1 293 ? 57.706  20.827 61.300 1.00 42.05  ? 293 ASP A O   1 
ATOM   2249 C  CB  . ASP A 1 293 ? 60.738  21.071 62.720 1.00 40.62  ? 293 ASP A CB  1 
ATOM   2250 C  CG  . ASP A 1 293 ? 60.078  20.256 63.815 1.00 45.87  ? 293 ASP A CG  1 
ATOM   2251 O  OD1 . ASP A 1 293 ? 59.626  19.126 63.534 1.00 55.71  ? 293 ASP A OD1 1 
ATOM   2252 O  OD2 . ASP A 1 293 ? 60.031  20.741 64.967 1.00 51.93  ? 293 ASP A OD2 1 
ATOM   2253 N  N   . LYS A 1 294 ? 58.726  22.791 60.928 1.00 36.52  ? 294 LYS A N   1 
ATOM   2254 C  CA  . LYS A 1 294 ? 57.474  23.522 60.762 1.00 37.25  ? 294 LYS A CA  1 
ATOM   2255 C  C   . LYS A 1 294 ? 56.795  23.239 59.410 1.00 40.30  ? 294 LYS A C   1 
ATOM   2256 O  O   . LYS A 1 294 ? 55.576  23.343 59.291 1.00 38.03  ? 294 LYS A O   1 
ATOM   2257 C  CB  . LYS A 1 294 ? 57.735  25.020 60.949 1.00 35.41  ? 294 LYS A CB  1 
ATOM   2258 C  CG  . LYS A 1 294 ? 58.310  25.343 62.337 1.00 40.39  ? 294 LYS A CG  1 
ATOM   2259 C  CD  . LYS A 1 294 ? 58.533  26.836 62.557 1.00 47.96  ? 294 LYS A CD  1 
ATOM   2260 C  CE  . LYS A 1 294 ? 59.307  27.118 63.844 1.00 50.67  ? 294 LYS A CE  1 
ATOM   2261 N  NZ  . LYS A 1 294 ? 58.670  26.512 65.046 1.00 47.90  ? 294 LYS A NZ  1 
ATOM   2262 N  N   . LEU A 1 295 ? 57.589  22.885 58.399 1.00 41.56  ? 295 LEU A N   1 
ATOM   2263 C  CA  . LEU A 1 295 ? 57.059  22.554 57.080 1.00 28.92  ? 295 LEU A CA  1 
ATOM   2264 C  C   . LEU A 1 295 ? 56.497  21.129 57.092 1.00 35.39  ? 295 LEU A C   1 
ATOM   2265 O  O   . LEU A 1 295 ? 55.547  20.829 56.379 1.00 32.72  ? 295 LEU A O   1 
ATOM   2266 C  CB  . LEU A 1 295 ? 58.157  22.675 56.011 1.00 27.36  ? 295 LEU A CB  1 
ATOM   2267 C  CG  . LEU A 1 295 ? 58.570  24.108 55.658 1.00 31.95  ? 295 LEU A CG  1 
ATOM   2268 C  CD1 . LEU A 1 295 ? 59.946  24.145 55.033 1.00 29.28  ? 295 LEU A CD1 1 
ATOM   2269 C  CD2 . LEU A 1 295 ? 57.507  24.710 54.723 1.00 22.34  ? 295 LEU A CD2 1 
ATOM   2270 N  N   . LEU A 1 296 ? 57.060  20.256 57.926 1.00 35.36  ? 296 LEU A N   1 
ATOM   2271 C  CA  . LEU A 1 296 ? 56.578  18.880 57.976 1.00 32.30  ? 296 LEU A CA  1 
ATOM   2272 C  C   . LEU A 1 296 ? 55.659  18.610 59.151 1.00 44.87  ? 296 LEU A C   1 
ATOM   2273 O  O   . LEU A 1 296 ? 55.893  17.703 59.945 1.00 42.02  ? 296 LEU A O   1 
ATOM   2274 C  CB  . LEU A 1 296 ? 57.755  17.903 57.986 1.00 32.06  ? 296 LEU A CB  1 
ATOM   2275 C  CG  . LEU A 1 296 ? 58.646  18.005 56.748 1.00 34.05  ? 296 LEU A CG  1 
ATOM   2276 C  CD1 . LEU A 1 296 ? 59.848  17.081 56.890 1.00 27.76  ? 296 LEU A CD1 1 
ATOM   2277 C  CD2 . LEU A 1 296 ? 57.802  17.681 55.481 1.00 32.96  ? 296 LEU A CD2 1 
ATOM   2278 N  N   . VAL A 1 297 ? 54.601  19.411 59.228 1.00 45.44  ? 297 VAL A N   1 
ATOM   2279 C  CA  . VAL A 1 297 ? 53.583  19.322 60.262 1.00 35.69  ? 297 VAL A CA  1 
ATOM   2280 C  C   . VAL A 1 297 ? 52.405  18.604 59.619 1.00 44.80  ? 297 VAL A C   1 
ATOM   2281 O  O   . VAL A 1 297 ? 51.980  18.959 58.519 1.00 44.30  ? 297 VAL A O   1 
ATOM   2282 C  CB  . VAL A 1 297 ? 53.184  20.749 60.742 1.00 29.69  ? 297 VAL A CB  1 
ATOM   2283 C  CG1 . VAL A 1 297 ? 51.984  20.699 61.661 1.00 33.92  ? 297 VAL A CG1 1 
ATOM   2284 C  CG2 . VAL A 1 297 ? 54.355  21.385 61.450 1.00 36.53  ? 297 VAL A CG2 1 
ATOM   2285 N  N   . LEU A 1 298 ? 51.902  17.580 60.304 1.00 46.03  ? 298 LEU A N   1 
ATOM   2286 C  CA  . LEU A 1 298 ? 50.800  16.757 59.813 1.00 46.49  ? 298 LEU A CA  1 
ATOM   2287 C  C   . LEU A 1 298 ? 49.519  17.510 59.492 1.00 45.98  ? 298 LEU A C   1 
ATOM   2288 O  O   . LEU A 1 298 ? 48.973  17.377 58.398 1.00 44.65  ? 298 LEU A O   1 
ATOM   2289 C  CB  . LEU A 1 298 ? 50.496  15.645 60.819 1.00 47.92  ? 298 LEU A CB  1 
ATOM   2290 C  CG  . LEU A 1 298 ? 51.614  14.627 61.083 1.00 49.14  ? 298 LEU A CG  1 
ATOM   2291 C  CD1 . LEU A 1 298 ? 51.208  13.697 62.222 1.00 49.81  ? 298 LEU A CD1 1 
ATOM   2292 C  CD2 . LEU A 1 298 ? 51.891  13.832 59.807 1.00 47.85  ? 298 LEU A CD2 1 
ATOM   2293 N  N   . ASP A 1 299 ? 49.040  18.287 60.458 1.00 47.98  ? 299 ASP A N   1 
ATOM   2294 C  CA  . ASP A 1 299 ? 47.819  19.072 60.301 1.00 42.02  ? 299 ASP A CA  1 
ATOM   2295 C  C   . ASP A 1 299 ? 48.072  20.312 59.434 1.00 37.30  ? 299 ASP A C   1 
ATOM   2296 O  O   . ASP A 1 299 ? 48.759  21.242 59.849 1.00 42.60  ? 299 ASP A O   1 
ATOM   2297 C  CB  . ASP A 1 299 ? 47.299  19.484 61.682 1.00 45.59  ? 299 ASP A CB  1 
ATOM   2298 C  CG  . ASP A 1 299 ? 46.147  20.467 61.607 1.00 53.92  ? 299 ASP A CG  1 
ATOM   2299 O  OD1 . ASP A 1 299 ? 45.250  20.280 60.760 1.00 57.60  ? 299 ASP A OD1 1 
ATOM   2300 O  OD2 . ASP A 1 299 ? 46.134  21.427 62.407 1.00 60.05  ? 299 ASP A OD2 1 
ATOM   2301 N  N   . PRO A 1 300 ? 47.509  20.339 58.217 1.00 34.73  ? 300 PRO A N   1 
ATOM   2302 C  CA  . PRO A 1 300 ? 47.695  21.476 57.312 1.00 33.95  ? 300 PRO A CA  1 
ATOM   2303 C  C   . PRO A 1 300 ? 47.446  22.862 57.909 1.00 35.43  ? 300 PRO A C   1 
ATOM   2304 O  O   . PRO A 1 300 ? 48.171  23.804 57.604 1.00 35.11  ? 300 PRO A O   1 
ATOM   2305 C  CB  . PRO A 1 300 ? 46.755  21.148 56.144 1.00 34.00  ? 300 PRO A CB  1 
ATOM   2306 C  CG  . PRO A 1 300 ? 45.759  20.242 56.728 1.00 27.89  ? 300 PRO A CG  1 
ATOM   2307 C  CD  . PRO A 1 300 ? 46.587  19.359 57.623 1.00 28.83  ? 300 PRO A CD  1 
ATOM   2308 N  N   . ALA A 1 301 ? 46.443  22.986 58.771 1.00 40.10  ? 301 ALA A N   1 
ATOM   2309 C  CA  . ALA A 1 301 ? 46.136  24.274 59.386 1.00 42.36  ? 301 ALA A CA  1 
ATOM   2310 C  C   . ALA A 1 301 ? 47.273  24.751 60.279 1.00 41.55  ? 301 ALA A C   1 
ATOM   2311 O  O   . ALA A 1 301 ? 47.424  25.945 60.524 1.00 44.91  ? 301 ALA A O   1 
ATOM   2312 C  CB  . ALA A 1 301 ? 44.846  24.179 60.188 1.00 44.01  ? 301 ALA A CB  1 
ATOM   2313 N  N   . GLN A 1 302 ? 48.095  23.822 60.741 1.00 42.16  ? 302 GLN A N   1 
ATOM   2314 C  CA  . GLN A 1 302 ? 49.206  24.186 61.608 1.00 42.34  ? 302 GLN A CA  1 
ATOM   2315 C  C   . GLN A 1 302 ? 50.544  24.249 60.873 1.00 39.38  ? 302 GLN A C   1 
ATOM   2316 O  O   . GLN A 1 302 ? 51.542  24.730 61.410 1.00 34.15  ? 302 GLN A O   1 
ATOM   2317 C  CB  . GLN A 1 302 ? 49.283  23.204 62.779 1.00 42.59  ? 302 GLN A CB  1 
ATOM   2318 C  CG  . GLN A 1 302 ? 48.044  23.213 63.665 1.00 42.18  ? 302 GLN A CG  1 
ATOM   2319 C  CD  . GLN A 1 302 ? 48.096  22.129 64.731 1.00 42.59  ? 302 GLN A CD  1 
ATOM   2320 O  OE1 . GLN A 1 302 ? 48.961  22.145 65.591 1.00 38.86  ? 302 GLN A OE1 1 
ATOM   2321 N  NE2 . GLN A 1 302 ? 47.175  21.179 64.664 1.00 45.04  ? 302 GLN A NE2 1 
ATOM   2322 N  N   . ARG A 1 303 ? 50.555  23.763 59.638 1.00 42.82  ? 303 ARG A N   1 
ATOM   2323 C  CA  . ARG A 1 303 ? 51.756  23.775 58.806 1.00 35.02  ? 303 ARG A CA  1 
ATOM   2324 C  C   . ARG A 1 303 ? 52.114  25.238 58.499 1.00 30.54  ? 303 ARG A C   1 
ATOM   2325 O  O   . ARG A 1 303 ? 51.232  26.057 58.284 1.00 37.72  ? 303 ARG A O   1 
ATOM   2326 C  CB  . ARG A 1 303 ? 51.456  23.011 57.513 1.00 38.71  ? 303 ARG A CB  1 
ATOM   2327 C  CG  . ARG A 1 303 ? 52.660  22.450 56.787 1.00 29.67  ? 303 ARG A CG  1 
ATOM   2328 C  CD  . ARG A 1 303 ? 52.177  21.588 55.647 1.00 35.34  ? 303 ARG A CD  1 
ATOM   2329 N  NE  . ARG A 1 303 ? 51.420  20.449 56.140 1.00 26.67  ? 303 ARG A NE  1 
ATOM   2330 C  CZ  . ARG A 1 303 ? 50.491  19.812 55.438 1.00 36.14  ? 303 ARG A CZ  1 
ATOM   2331 N  NH1 . ARG A 1 303 ? 50.190  20.214 54.211 1.00 32.76  ? 303 ARG A NH1 1 
ATOM   2332 N  NH2 . ARG A 1 303 ? 49.882  18.750 55.953 1.00 35.51  ? 303 ARG A NH2 1 
ATOM   2333 N  N   . ILE A 1 304 ? 53.396  25.573 58.486 1.00 23.70  ? 304 ILE A N   1 
ATOM   2334 C  CA  . ILE A 1 304 ? 53.808  26.933 58.214 1.00 27.62  ? 304 ILE A CA  1 
ATOM   2335 C  C   . ILE A 1 304 ? 53.523  27.289 56.747 1.00 34.84  ? 304 ILE A C   1 
ATOM   2336 O  O   . ILE A 1 304 ? 53.529  26.407 55.888 1.00 31.68  ? 304 ILE A O   1 
ATOM   2337 C  CB  . ILE A 1 304 ? 55.326  27.133 58.562 1.00 25.22  ? 304 ILE A CB  1 
ATOM   2338 C  CG1 . ILE A 1 304 ? 55.625  28.629 58.740 1.00 29.89  ? 304 ILE A CG1 1 
ATOM   2339 C  CG2 . ILE A 1 304 ? 56.213  26.579 57.485 1.00 34.65  ? 304 ILE A CG2 1 
ATOM   2340 C  CD1 . ILE A 1 304 ? 57.026  28.926 59.232 1.00 34.15  ? 304 ILE A CD1 1 
ATOM   2341 N  N   . ASP A 1 305 ? 53.244  28.565 56.469 1.00 33.68  ? 305 ASP A N   1 
ATOM   2342 C  CA  . ASP A 1 305 ? 52.971  28.994 55.095 1.00 36.98  ? 305 ASP A CA  1 
ATOM   2343 C  C   . ASP A 1 305 ? 54.198  29.661 54.489 1.00 35.89  ? 305 ASP A C   1 
ATOM   2344 O  O   . ASP A 1 305 ? 55.197  29.909 55.181 1.00 31.81  ? 305 ASP A O   1 
ATOM   2345 C  CB  . ASP A 1 305 ? 51.745  29.928 54.995 1.00 32.85  ? 305 ASP A CB  1 
ATOM   2346 C  CG  . ASP A 1 305 ? 51.927  31.246 55.734 1.00 35.59  ? 305 ASP A CG  1 
ATOM   2347 O  OD1 . ASP A 1 305 ? 53.075  31.681 55.953 1.00 40.91  ? 305 ASP A OD1 1 
ATOM   2348 O  OD2 . ASP A 1 305 ? 50.903  31.862 56.082 1.00 47.15  ? 305 ASP A OD2 1 
ATOM   2349 N  N   . SER A 1 306 ? 54.129  29.965 53.198 1.00 27.94  ? 306 SER A N   1 
ATOM   2350 C  CA  . SER A 1 306 ? 55.295  30.525 52.539 1.00 28.54  ? 306 SER A CA  1 
ATOM   2351 C  C   . SER A 1 306 ? 55.737  31.863 53.107 1.00 28.63  ? 306 SER A C   1 
ATOM   2352 O  O   . SER A 1 306 ? 56.934  32.119 53.266 1.00 31.26  ? 306 SER A O   1 
ATOM   2353 C  CB  . SER A 1 306 ? 55.053  30.597 51.029 1.00 19.03  ? 306 SER A CB  1 
ATOM   2354 O  OG  . SER A 1 306 ? 54.061  31.540 50.696 1.00 33.96  ? 306 SER A OG  1 
ATOM   2355 N  N   . ASP A 1 307 ? 54.766  32.704 53.430 1.00 29.05  ? 307 ASP A N   1 
ATOM   2356 C  CA  . ASP A 1 307 ? 55.025  34.015 53.992 1.00 27.41  ? 307 ASP A CA  1 
ATOM   2357 C  C   . ASP A 1 307 ? 55.843  33.934 55.293 1.00 30.19  ? 307 ASP A C   1 
ATOM   2358 O  O   . ASP A 1 307 ? 56.904  34.556 55.419 1.00 33.58  ? 307 ASP A O   1 
ATOM   2359 C  CB  . ASP A 1 307 ? 53.698  34.711 54.291 1.00 39.18  ? 307 ASP A CB  1 
ATOM   2360 C  CG  . ASP A 1 307 ? 53.885  36.100 54.879 1.00 30.76  ? 307 ASP A CG  1 
ATOM   2361 O  OD1 . ASP A 1 307 ? 52.930  36.612 55.488 1.00 45.55  ? 307 ASP A OD1 1 
ATOM   2362 O  OD2 . ASP A 1 307 ? 54.977  36.686 54.715 1.00 46.01  ? 307 ASP A OD2 1 
ATOM   2363 N  N   . ASP A 1 308 ? 55.345  33.189 56.270 1.00 25.54  ? 308 ASP A N   1 
ATOM   2364 C  CA  . ASP A 1 308 ? 56.088  33.073 57.527 1.00 35.28  ? 308 ASP A CA  1 
ATOM   2365 C  C   . ASP A 1 308 ? 57.408  32.340 57.290 1.00 42.47  ? 308 ASP A C   1 
ATOM   2366 O  O   . ASP A 1 308 ? 58.436  32.735 57.835 1.00 49.06  ? 308 ASP A O   1 
ATOM   2367 C  CB  . ASP A 1 308 ? 55.274  32.336 58.605 1.00 36.93  ? 308 ASP A CB  1 
ATOM   2368 C  CG  . ASP A 1 308 ? 54.024  33.115 59.045 1.00 32.95  ? 308 ASP A CG  1 
ATOM   2369 O  OD1 . ASP A 1 308 ? 54.098  34.351 59.206 1.00 38.37  ? 308 ASP A OD1 1 
ATOM   2370 O  OD2 . ASP A 1 308 ? 52.970  32.486 59.231 1.00 27.03  ? 308 ASP A OD2 1 
ATOM   2371 N  N   . ALA A 1 309 ? 57.387  31.291 56.463 1.00 37.60  ? 309 ALA A N   1 
ATOM   2372 C  CA  . ALA A 1 309 ? 58.606  30.533 56.196 1.00 28.30  ? 309 ALA A CA  1 
ATOM   2373 C  C   . ALA A 1 309 ? 59.702  31.445 55.697 1.00 29.25  ? 309 ALA A C   1 
ATOM   2374 O  O   . ALA A 1 309 ? 60.872  31.256 56.026 1.00 32.78  ? 309 ALA A O   1 
ATOM   2375 C  CB  . ALA A 1 309 ? 58.339  29.421 55.181 1.00 32.66  ? 309 ALA A CB  1 
ATOM   2376 N  N   . LEU A 1 310 ? 59.319  32.445 54.911 1.00 27.89  ? 310 LEU A N   1 
ATOM   2377 C  CA  . LEU A 1 310 ? 60.280  33.381 54.351 1.00 27.45  ? 310 LEU A CA  1 
ATOM   2378 C  C   . LEU A 1 310 ? 60.842  34.322 55.400 1.00 28.43  ? 310 LEU A C   1 
ATOM   2379 O  O   . LEU A 1 310 ? 61.929  34.885 55.231 1.00 27.88  ? 310 LEU A O   1 
ATOM   2380 C  CB  . LEU A 1 310 ? 59.639  34.209 53.213 1.00 29.95  ? 310 LEU A CB  1 
ATOM   2381 C  CG  . LEU A 1 310 ? 59.490  33.507 51.853 1.00 28.81  ? 310 LEU A CG  1 
ATOM   2382 C  CD1 . LEU A 1 310 ? 58.542  34.282 50.960 1.00 24.10  ? 310 LEU A CD1 1 
ATOM   2383 C  CD2 . LEU A 1 310 ? 60.850  33.360 51.204 1.00 22.90  ? 310 LEU A CD2 1 
ATOM   2384 N  N   . ASN A 1 311 ? 60.095  34.512 56.476 1.00 31.37  ? 311 ASN A N   1 
ATOM   2385 C  CA  . ASN A 1 311 ? 60.544  35.409 57.525 1.00 30.66  ? 311 ASN A CA  1 
ATOM   2386 C  C   . ASN A 1 311 ? 61.116  34.670 58.724 1.00 33.65  ? 311 ASN A C   1 
ATOM   2387 O  O   . ASN A 1 311 ? 61.372  35.260 59.778 1.00 38.80  ? 311 ASN A O   1 
ATOM   2388 C  CB  . ASN A 1 311 ? 59.383  36.316 57.912 1.00 34.68  ? 311 ASN A CB  1 
ATOM   2389 C  CG  . ASN A 1 311 ? 59.142  37.393 56.876 1.00 40.57  ? 311 ASN A CG  1 
ATOM   2390 O  OD1 . ASN A 1 311 ? 59.853  38.398 56.840 1.00 33.11  ? 311 ASN A OD1 1 
ATOM   2391 N  ND2 . ASN A 1 311 ? 58.165  37.176 56.003 1.00 35.25  ? 311 ASN A ND2 1 
ATOM   2392 N  N   . HIS A 1 312 ? 61.317  33.370 58.539 1.00 38.15  ? 312 HIS A N   1 
ATOM   2393 C  CA  . HIS A 1 312 ? 61.869  32.491 59.561 1.00 33.63  ? 312 HIS A CA  1 
ATOM   2394 C  C   . HIS A 1 312 ? 63.340  32.835 59.711 1.00 33.61  ? 312 HIS A C   1 
ATOM   2395 O  O   . HIS A 1 312 ? 63.994  33.213 58.734 1.00 32.20  ? 312 HIS A O   1 
ATOM   2396 C  CB  . HIS A 1 312 ? 61.700  31.042 59.121 1.00 30.13  ? 312 HIS A CB  1 
ATOM   2397 C  CG  . HIS A 1 312 ? 62.068  30.038 60.169 1.00 37.50  ? 312 HIS A CG  1 
ATOM   2398 N  ND1 . HIS A 1 312 ? 63.375  29.747 60.501 1.00 33.86  ? 312 HIS A ND1 1 
ATOM   2399 C  CD2 . HIS A 1 312 ? 61.295  29.252 60.954 1.00 26.51  ? 312 HIS A CD2 1 
ATOM   2400 C  CE1 . HIS A 1 312 ? 63.388  28.822 61.443 1.00 36.09  ? 312 HIS A CE1 1 
ATOM   2401 N  NE2 . HIS A 1 312 ? 62.141  28.503 61.735 1.00 38.13  ? 312 HIS A NE2 1 
ATOM   2402 N  N   . ASP A 1 313 ? 63.857  32.724 60.933 1.00 35.75  ? 313 ASP A N   1 
ATOM   2403 C  CA  . ASP A 1 313 ? 65.262  33.051 61.212 1.00 37.93  ? 313 ASP A CA  1 
ATOM   2404 C  C   . ASP A 1 313 ? 66.275  32.403 60.262 1.00 34.70  ? 313 ASP A C   1 
ATOM   2405 O  O   . ASP A 1 313 ? 67.354  32.960 59.999 1.00 28.86  ? 313 ASP A O   1 
ATOM   2406 C  CB  . ASP A 1 313 ? 65.608  32.691 62.662 1.00 45.86  ? 313 ASP A CB  1 
ATOM   2407 C  CG  . ASP A 1 313 ? 64.964  33.639 63.664 1.00 54.34  ? 313 ASP A CG  1 
ATOM   2408 O  OD1 . ASP A 1 313 ? 64.859  34.840 63.336 1.00 46.13  ? 313 ASP A OD1 1 
ATOM   2409 O  OD2 . ASP A 1 313 ? 64.583  33.196 64.772 1.00 49.62  ? 313 ASP A OD2 1 
ATOM   2410 N  N   . PHE A 1 314 ? 65.929  31.227 59.757 1.00 30.74  ? 314 PHE A N   1 
ATOM   2411 C  CA  . PHE A 1 314 ? 66.791  30.511 58.814 1.00 34.94  ? 314 PHE A CA  1 
ATOM   2412 C  C   . PHE A 1 314 ? 67.319  31.454 57.745 1.00 29.51  ? 314 PHE A C   1 
ATOM   2413 O  O   . PHE A 1 314 ? 68.513  31.464 57.472 1.00 33.33  ? 314 PHE A O   1 
ATOM   2414 C  CB  . PHE A 1 314 ? 66.021  29.358 58.151 1.00 28.72  ? 314 PHE A CB  1 
ATOM   2415 C  CG  . PHE A 1 314 ? 66.813  28.616 57.108 1.00 43.61  ? 314 PHE A CG  1 
ATOM   2416 C  CD1 . PHE A 1 314 ? 67.971  27.924 57.451 1.00 40.27  ? 314 PHE A CD1 1 
ATOM   2417 C  CD2 . PHE A 1 314 ? 66.395  28.600 55.779 1.00 29.77  ? 314 PHE A CD2 1 
ATOM   2418 C  CE1 . PHE A 1 314 ? 68.701  27.222 56.479 1.00 41.12  ? 314 PHE A CE1 1 
ATOM   2419 C  CE2 . PHE A 1 314 ? 67.114  27.907 54.811 1.00 42.37  ? 314 PHE A CE2 1 
ATOM   2420 C  CZ  . PHE A 1 314 ? 68.271  27.215 55.163 1.00 42.54  ? 314 PHE A CZ  1 
ATOM   2421 N  N   . PHE A 1 315 ? 66.436  32.271 57.174 1.00 37.72  ? 315 PHE A N   1 
ATOM   2422 C  CA  . PHE A 1 315 ? 66.813  33.212 56.111 1.00 29.85  ? 315 PHE A CA  1 
ATOM   2423 C  C   . PHE A 1 315 ? 67.378  34.536 56.573 1.00 34.88  ? 315 PHE A C   1 
ATOM   2424 O  O   . PHE A 1 315 ? 67.800  35.349 55.751 1.00 41.47  ? 315 PHE A O   1 
ATOM   2425 C  CB  . PHE A 1 315 ? 65.612  33.528 55.210 1.00 36.11  ? 315 PHE A CB  1 
ATOM   2426 C  CG  . PHE A 1 315 ? 65.063  32.333 54.476 1.00 39.73  ? 315 PHE A CG  1 
ATOM   2427 C  CD1 . PHE A 1 315 ? 63.914  31.688 54.928 1.00 30.68  ? 315 PHE A CD1 1 
ATOM   2428 C  CD2 . PHE A 1 315 ? 65.725  31.824 53.356 1.00 39.16  ? 315 PHE A CD2 1 
ATOM   2429 C  CE1 . PHE A 1 315 ? 63.432  30.552 54.282 1.00 35.54  ? 315 PHE A CE1 1 
ATOM   2430 C  CE2 . PHE A 1 315 ? 65.252  30.685 52.702 1.00 32.31  ? 315 PHE A CE2 1 
ATOM   2431 C  CZ  . PHE A 1 315 ? 64.102  30.044 53.166 1.00 29.12  ? 315 PHE A CZ  1 
ATOM   2432 N  N   . TRP A 1 316 ? 67.404  34.763 57.877 1.00 38.23  ? 316 TRP A N   1 
ATOM   2433 C  CA  . TRP A 1 316 ? 67.881  36.039 58.372 1.00 44.07  ? 316 TRP A CA  1 
ATOM   2434 C  C   . TRP A 1 316 ? 68.957  35.941 59.418 1.00 50.33  ? 316 TRP A C   1 
ATOM   2435 O  O   . TRP A 1 316 ? 69.129  36.847 60.229 1.00 50.19  ? 316 TRP A O   1 
ATOM   2436 C  CB  . TRP A 1 316 ? 66.703  36.827 58.925 1.00 39.59  ? 316 TRP A CB  1 
ATOM   2437 C  CG  . TRP A 1 316 ? 65.644  36.980 57.911 1.00 34.78  ? 316 TRP A CG  1 
ATOM   2438 C  CD1 . TRP A 1 316 ? 64.522  36.217 57.772 1.00 26.28  ? 316 TRP A CD1 1 
ATOM   2439 C  CD2 . TRP A 1 316 ? 65.648  37.896 56.823 1.00 24.95  ? 316 TRP A CD2 1 
ATOM   2440 N  NE1 . TRP A 1 316 ? 63.831  36.602 56.658 1.00 23.85  ? 316 TRP A NE1 1 
ATOM   2441 C  CE2 . TRP A 1 316 ? 64.501  37.633 56.056 1.00 26.73  ? 316 TRP A CE2 1 
ATOM   2442 C  CE3 . TRP A 1 316 ? 66.517  38.919 56.417 1.00 34.65  ? 316 TRP A CE3 1 
ATOM   2443 C  CZ2 . TRP A 1 316 ? 64.194  38.356 54.903 1.00 27.39  ? 316 TRP A CZ2 1 
ATOM   2444 C  CZ3 . TRP A 1 316 ? 66.211  39.638 55.269 1.00 40.83  ? 316 TRP A CZ3 1 
ATOM   2445 C  CH2 . TRP A 1 316 ? 65.053  39.348 54.525 1.00 27.20  ? 316 TRP A CH2 1 
ATOM   2446 N  N   . SER A 1 317 ? 69.684  34.837 59.396 1.00 54.79  ? 317 SER A N   1 
ATOM   2447 C  CA  . SER A 1 317 ? 70.744  34.615 60.354 1.00 47.21  ? 317 SER A CA  1 
ATOM   2448 C  C   . SER A 1 317 ? 71.970  34.116 59.620 1.00 52.14  ? 317 SER A C   1 
ATOM   2449 O  O   . SER A 1 317 ? 71.855  33.410 58.618 1.00 53.23  ? 317 SER A O   1 
ATOM   2450 C  CB  . SER A 1 317 ? 70.293  33.583 61.378 1.00 49.76  ? 317 SER A CB  1 
ATOM   2451 O  OG  . SER A 1 317 ? 69.871  32.403 60.719 1.00 59.99  ? 317 SER A OG  1 
ATOM   2452 N  N   . ASP A 1 318 ? 73.142  34.492 60.118 1.00 49.54  ? 318 ASP A N   1 
ATOM   2453 C  CA  . ASP A 1 318 ? 74.399  34.075 59.514 1.00 54.17  ? 318 ASP A CA  1 
ATOM   2454 C  C   . ASP A 1 318 ? 74.520  32.546 59.507 1.00 45.06  ? 318 ASP A C   1 
ATOM   2455 O  O   . ASP A 1 318 ? 74.169  31.879 60.481 1.00 52.23  ? 318 ASP A O   1 
ATOM   2456 C  CB  . ASP A 1 318 ? 75.563  34.694 60.289 1.00 62.24  ? 318 ASP A CB  1 
ATOM   2457 C  CG  . ASP A 1 318 ? 75.585  36.215 60.199 1.00 67.91  ? 318 ASP A CG  1 
ATOM   2458 O  OD1 . ASP A 1 318 ? 76.184  36.852 61.092 1.00 74.13  ? 318 ASP A OD1 1 
ATOM   2459 O  OD2 . ASP A 1 318 ? 75.021  36.773 59.233 1.00 67.39  ? 318 ASP A OD2 1 
ATOM   2460 N  N   . PRO A 1 319 ? 74.972  31.969 58.384 1.00 46.13  ? 319 PRO A N   1 
ATOM   2461 C  CA  . PRO A 1 319 ? 75.354  32.674 57.155 1.00 44.91  ? 319 PRO A CA  1 
ATOM   2462 C  C   . PRO A 1 319 ? 74.092  33.057 56.372 1.00 46.06  ? 319 PRO A C   1 
ATOM   2463 O  O   . PRO A 1 319 ? 73.116  32.311 56.354 1.00 50.10  ? 319 PRO A O   1 
ATOM   2464 C  CB  . PRO A 1 319 ? 76.217  31.646 56.433 1.00 42.15  ? 319 PRO A CB  1 
ATOM   2465 C  CG  . PRO A 1 319 ? 75.547  30.356 56.797 1.00 48.74  ? 319 PRO A CG  1 
ATOM   2466 C  CD  . PRO A 1 319 ? 75.255  30.526 58.271 1.00 49.45  ? 319 PRO A CD  1 
ATOM   2467 N  N   . MET A 1 320 ? 74.125  34.221 55.736 1.00 45.83  ? 320 MET A N   1 
ATOM   2468 C  CA  . MET A 1 320 ? 72.991  34.745 54.982 1.00 48.03  ? 320 MET A CA  1 
ATOM   2469 C  C   . MET A 1 320 ? 72.875  34.178 53.572 1.00 47.92  ? 320 MET A C   1 
ATOM   2470 O  O   . MET A 1 320 ? 73.843  33.664 53.032 1.00 47.20  ? 320 MET A O   1 
ATOM   2471 C  CB  . MET A 1 320 ? 73.116  36.264 54.894 1.00 43.88  ? 320 MET A CB  1 
ATOM   2472 C  CG  . MET A 1 320 ? 72.840  36.996 56.186 1.00 58.82  ? 320 MET A CG  1 
ATOM   2473 S  SD  . MET A 1 320 ? 71.093  37.024 56.563 1.00 56.54  ? 320 MET A SD  1 
ATOM   2474 C  CE  . MET A 1 320 ? 70.545  38.349 55.539 1.00 52.84  ? 320 MET A CE  1 
ATOM   2475 N  N   . PRO A 1 321 ? 71.684  34.278 52.952 1.00 45.96  ? 321 PRO A N   1 
ATOM   2476 C  CA  . PRO A 1 321 ? 71.527  33.753 51.591 1.00 39.05  ? 321 PRO A CA  1 
ATOM   2477 C  C   . PRO A 1 321 ? 72.601  34.319 50.659 1.00 37.25  ? 321 PRO A C   1 
ATOM   2478 O  O   . PRO A 1 321 ? 72.923  35.498 50.733 1.00 40.95  ? 321 PRO A O   1 
ATOM   2479 C  CB  . PRO A 1 321 ? 70.124  34.218 51.210 1.00 36.60  ? 321 PRO A CB  1 
ATOM   2480 C  CG  . PRO A 1 321 ? 69.383  34.127 52.523 1.00 33.41  ? 321 PRO A CG  1 
ATOM   2481 C  CD  . PRO A 1 321 ? 70.392  34.750 53.483 1.00 43.65  ? 321 PRO A CD  1 
ATOM   2482 N  N   . SER A 1 322 ? 73.161  33.477 49.793 1.00 31.46  ? 322 SER A N   1 
ATOM   2483 C  CA  . SER A 1 322 ? 74.183  33.913 48.848 1.00 41.66  ? 322 SER A CA  1 
ATOM   2484 C  C   . SER A 1 322 ? 73.762  33.446 47.467 1.00 40.93  ? 322 SER A C   1 
ATOM   2485 O  O   . SER A 1 322 ? 72.861  32.623 47.353 1.00 46.69  ? 322 SER A O   1 
ATOM   2486 C  CB  . SER A 1 322 ? 75.531  33.285 49.189 1.00 46.04  ? 322 SER A CB  1 
ATOM   2487 O  OG  . SER A 1 322 ? 75.469  31.871 49.054 1.00 49.08  ? 322 SER A OG  1 
ATOM   2488 N  N   . ASP A 1 323 ? 74.395  33.960 46.416 1.00 44.73  ? 323 ASP A N   1 
ATOM   2489 C  CA  . ASP A 1 323 ? 74.038  33.515 45.076 1.00 37.79  ? 323 ASP A CA  1 
ATOM   2490 C  C   . ASP A 1 323 ? 74.509  32.076 44.914 1.00 41.00  ? 323 ASP A C   1 
ATOM   2491 O  O   . ASP A 1 323 ? 75.179  31.532 45.798 1.00 38.72  ? 323 ASP A O   1 
ATOM   2492 C  CB  . ASP A 1 323 ? 74.664  34.394 43.998 1.00 39.65  ? 323 ASP A CB  1 
ATOM   2493 C  CG  . ASP A 1 323 ? 76.176  34.368 44.024 1.00 65.49  ? 323 ASP A CG  1 
ATOM   2494 O  OD1 . ASP A 1 323 ? 76.786  34.538 42.948 1.00 70.64  ? 323 ASP A OD1 1 
ATOM   2495 O  OD2 . ASP A 1 323 ? 76.757  34.192 45.117 1.00 76.84  ? 323 ASP A OD2 1 
ATOM   2496 N  N   . LEU A 1 324 ? 74.157  31.467 43.786 1.00 37.80  ? 324 LEU A N   1 
ATOM   2497 C  CA  . LEU A 1 324 ? 74.504  30.083 43.510 1.00 44.72  ? 324 LEU A CA  1 
ATOM   2498 C  C   . LEU A 1 324 ? 75.677  29.929 42.536 1.00 52.47  ? 324 LEU A C   1 
ATOM   2499 O  O   . LEU A 1 324 ? 75.744  28.953 41.787 1.00 55.14  ? 324 LEU A O   1 
ATOM   2500 C  CB  . LEU A 1 324 ? 73.271  29.357 42.961 1.00 40.91  ? 324 LEU A CB  1 
ATOM   2501 C  CG  . LEU A 1 324 ? 72.024  29.383 43.852 1.00 34.56  ? 324 LEU A CG  1 
ATOM   2502 C  CD1 . LEU A 1 324 ? 70.896  28.593 43.192 1.00 26.59  ? 324 LEU A CD1 1 
ATOM   2503 C  CD2 . LEU A 1 324 ? 72.355  28.798 45.206 1.00 29.92  ? 324 LEU A CD2 1 
ATOM   2504 N  N   . LYS A 1 325 ? 76.595  30.892 42.542 1.00 55.10  ? 325 LYS A N   1 
ATOM   2505 C  CA  . LYS A 1 325 ? 77.761  30.838 41.658 1.00 58.48  ? 325 LYS A CA  1 
ATOM   2506 C  C   . LYS A 1 325 ? 78.668  29.685 42.054 1.00 57.61  ? 325 LYS A C   1 
ATOM   2507 O  O   . LYS A 1 325 ? 79.144  28.931 41.204 1.00 59.63  ? 325 LYS A O   1 
ATOM   2508 C  CB  . LYS A 1 325 ? 78.559  32.146 41.722 1.00 63.44  ? 325 LYS A CB  1 
ATOM   2509 C  CG  . LYS A 1 325 ? 78.095  33.243 40.756 1.00 71.60  ? 325 LYS A CG  1 
ATOM   2510 C  CD  . LYS A 1 325 ? 79.079  34.420 40.768 1.00 72.18  ? 325 LYS A CD  1 
ATOM   2511 C  CE  . LYS A 1 325 ? 78.773  35.465 39.692 1.00 75.46  ? 325 LYS A CE  1 
ATOM   2512 N  NZ  . LYS A 1 325 ? 77.575  36.305 39.986 1.00 71.77  ? 325 LYS A NZ  1 
ATOM   2513 N  N   . GLY A 1 326 ? 78.906  29.561 43.355 1.00 58.68  ? 326 GLY A N   1 
ATOM   2514 C  CA  . GLY A 1 326 ? 79.749  28.497 43.858 1.00 54.76  ? 326 GLY A CA  1 
ATOM   2515 C  C   . GLY A 1 326 ? 79.211  27.136 43.472 1.00 55.54  ? 326 GLY A C   1 
ATOM   2516 O  O   . GLY A 1 326 ? 79.866  26.388 42.751 1.00 67.06  ? 326 GLY A O   1 
ATOM   2517 N  N   . MET A 1 327 ? 78.018  26.809 43.950 1.00 49.47  ? 327 MET A N   1 
ATOM   2518 C  CA  . MET A 1 327 ? 77.411  25.526 43.640 1.00 40.36  ? 327 MET A CA  1 
ATOM   2519 C  C   . MET A 1 327 ? 77.478  25.274 42.140 1.00 44.96  ? 327 MET A C   1 
ATOM   2520 O  O   . MET A 1 327 ? 77.711  24.159 41.708 1.00 40.33  ? 327 MET A O   1 
ATOM   2521 C  CB  . MET A 1 327 ? 75.949  25.509 44.097 1.00 38.18  ? 327 MET A CB  1 
ATOM   2522 C  CG  . MET A 1 327 ? 75.157  24.267 43.702 1.00 35.20  ? 327 MET A CG  1 
ATOM   2523 S  SD  . MET A 1 327 ? 74.583  24.267 41.982 1.00 48.69  ? 327 MET A SD  1 
ATOM   2524 C  CE  . MET A 1 327 ? 73.022  25.183 42.108 1.00 42.58  ? 327 MET A CE  1 
ATOM   2525 N  N   . LEU A 1 328 ? 77.287  26.318 41.343 1.00 50.15  ? 328 LEU A N   1 
ATOM   2526 C  CA  . LEU A 1 328 ? 77.303  26.144 39.900 1.00 50.59  ? 328 LEU A CA  1 
ATOM   2527 C  C   . LEU A 1 328 ? 78.672  25.853 39.302 1.00 54.58  ? 328 LEU A C   1 
ATOM   2528 O  O   . LEU A 1 328 ? 78.772  25.321 38.193 1.00 51.38  ? 328 LEU A O   1 
ATOM   2529 C  CB  . LEU A 1 328 ? 76.660  27.351 39.220 1.00 45.17  ? 328 LEU A CB  1 
ATOM   2530 C  CG  . LEU A 1 328 ? 75.133  27.334 39.370 1.00 50.47  ? 328 LEU A CG  1 
ATOM   2531 C  CD1 . LEU A 1 328 ? 74.503  28.434 38.508 1.00 45.25  ? 328 LEU A CD1 1 
ATOM   2532 C  CD2 . LEU A 1 328 ? 74.608  25.968 38.957 1.00 29.30  ? 328 LEU A CD2 1 
ATOM   2533 N  N   . SER A 1 329 ? 79.724  26.178 40.045 1.00 55.89  ? 329 SER A N   1 
ATOM   2534 C  CA  . SER A 1 329 ? 81.078  25.919 39.574 1.00 59.87  ? 329 SER A CA  1 
ATOM   2535 C  C   . SER A 1 329 ? 81.445  24.454 39.830 1.00 54.52  ? 329 SER A C   1 
ATOM   2536 O  O   . SER A 1 329 ? 82.284  23.899 39.123 1.00 56.94  ? 329 SER A O   1 
ATOM   2537 C  CB  . SER A 1 329 ? 82.082  26.833 40.282 1.00 55.20  ? 329 SER A CB  1 
ATOM   2538 O  OG  . SER A 1 329 ? 82.322  26.388 41.607 1.00 57.60  ? 329 SER A OG  1 
ATOM   2539 N  N   . THR A 1 330 ? 80.820  23.837 40.837 1.00 49.60  ? 330 THR A N   1 
ATOM   2540 C  CA  . THR A 1 330 ? 81.086  22.433 41.171 1.00 48.36  ? 330 THR A CA  1 
ATOM   2541 C  C   . THR A 1 330 ? 80.392  21.495 40.184 1.00 48.31  ? 330 THR A C   1 
ATOM   2542 O  O   . THR A 1 330 ? 80.605  20.286 40.198 1.00 46.03  ? 330 THR A O   1 
ATOM   2543 C  CB  . THR A 1 330 ? 80.644  22.079 42.610 1.00 46.41  ? 330 THR A CB  1 
ATOM   2544 O  OG1 . THR A 1 330 ? 79.232  22.270 42.748 1.00 44.72  ? 330 THR A OG1 1 
ATOM   2545 C  CG2 . THR A 1 330 ? 81.390  22.946 43.619 1.00 43.39  ? 330 THR A CG2 1 
ATOM   2546 N  N   . HIS A 1 331 ? 79.541  22.063 39.342 1.00 44.41  ? 331 HIS A N   1 
ATOM   2547 C  CA  . HIS A 1 331 ? 78.880  21.283 38.309 1.00 50.36  ? 331 HIS A CA  1 
ATOM   2548 C  C   . HIS A 1 331 ? 79.940  21.348 37.217 1.00 54.16  ? 331 HIS A C   1 
ATOM   2549 O  O   . HIS A 1 331 ? 80.321  22.443 36.800 1.00 47.10  ? 331 HIS A O   1 
ATOM   2550 C  CB  . HIS A 1 331 ? 77.613  21.974 37.825 1.00 32.12  ? 331 HIS A CB  1 
ATOM   2551 C  CG  . HIS A 1 331 ? 76.884  21.197 36.786 1.00 43.55  ? 331 HIS A CG  1 
ATOM   2552 N  ND1 . HIS A 1 331 ? 75.956  20.228 37.099 1.00 41.80  ? 331 HIS A ND1 1 
ATOM   2553 C  CD2 . HIS A 1 331 ? 77.001  21.191 35.436 1.00 36.45  ? 331 HIS A CD2 1 
ATOM   2554 C  CE1 . HIS A 1 331 ? 75.536  19.656 35.986 1.00 43.23  ? 331 HIS A CE1 1 
ATOM   2555 N  NE2 . HIS A 1 331 ? 76.156  20.220 34.965 1.00 38.13  ? 331 HIS A NE2 1 
ATOM   2556 N  N   . LEU A 1 332 ? 80.414  20.195 36.755 1.00 54.13  ? 332 LEU A N   1 
ATOM   2557 C  CA  . LEU A 1 332 ? 81.484  20.180 35.768 1.00 56.52  ? 332 LEU A CA  1 
ATOM   2558 C  C   . LEU A 1 332 ? 81.149  19.672 34.369 1.00 62.56  ? 332 LEU A C   1 
ATOM   2559 O  O   . LEU A 1 332 ? 80.008  19.290 34.086 1.00 63.88  ? 332 LEU A O   1 
ATOM   2560 C  CB  . LEU A 1 332 ? 82.677  19.418 36.346 1.00 51.12  ? 332 LEU A CB  1 
ATOM   2561 C  CG  . LEU A 1 332 ? 83.167  20.057 37.654 1.00 51.77  ? 332 LEU A CG  1 
ATOM   2562 C  CD1 . LEU A 1 332 ? 84.257  19.204 38.299 1.00 31.80  ? 332 LEU A CD1 1 
ATOM   2563 C  CD2 . LEU A 1 332 ? 83.670  21.471 37.360 1.00 47.26  ? 332 LEU A CD2 1 
ATOM   2564 N  N   . THR A 1 333 ? 82.165  19.675 33.504 1.00 60.52  ? 333 THR A N   1 
ATOM   2565 C  CA  . THR A 1 333 ? 82.026  19.282 32.100 1.00 61.91  ? 333 THR A CA  1 
ATOM   2566 C  C   . THR A 1 333 ? 82.293  17.829 31.705 1.00 61.80  ? 333 THR A C   1 
ATOM   2567 O  O   . THR A 1 333 ? 82.059  17.454 30.551 1.00 57.19  ? 333 THR A O   1 
ATOM   2568 C  CB  . THR A 1 333 ? 82.900  20.185 31.204 1.00 66.46  ? 333 THR A CB  1 
ATOM   2569 O  OG1 . THR A 1 333 ? 84.179  20.387 31.827 1.00 67.37  ? 333 THR A OG1 1 
ATOM   2570 C  CG2 . THR A 1 333 ? 82.216  21.529 30.973 1.00 59.83  ? 333 THR A CG2 1 
ATOM   2571 N  N   . SER A 1 334 ? 82.789  17.017 32.635 1.00 65.59  ? 334 SER A N   1 
ATOM   2572 C  CA  . SER A 1 334 ? 83.049  15.609 32.340 1.00 70.25  ? 334 SER A CA  1 
ATOM   2573 C  C   . SER A 1 334 ? 83.817  14.866 33.419 1.00 67.71  ? 334 SER A C   1 
ATOM   2574 O  O   . SER A 1 334 ? 84.246  15.444 34.421 1.00 64.40  ? 334 SER A O   1 
ATOM   2575 C  CB  . SER A 1 334 ? 83.788  15.448 31.002 1.00 76.32  ? 334 SER A CB  1 
ATOM   2576 O  OG  . SER A 1 334 ? 85.034  16.123 30.997 1.00 72.98  ? 334 SER A OG  1 
ATOM   2577 N  N   . MET A 1 335 ? 83.982  13.569 33.177 1.00 69.82  ? 335 MET A N   1 
ATOM   2578 C  CA  . MET A 1 335 ? 84.667  12.653 34.082 1.00 67.59  ? 335 MET A CA  1 
ATOM   2579 C  C   . MET A 1 335 ? 86.019  13.135 34.629 1.00 64.29  ? 335 MET A C   1 
ATOM   2580 O  O   . MET A 1 335 ? 86.199  13.204 35.851 1.00 53.65  ? 335 MET A O   1 
ATOM   2581 C  CB  . MET A 1 335 ? 84.827  11.292 33.388 1.00 69.50  ? 335 MET A CB  1 
ATOM   2582 C  CG  . MET A 1 335 ? 85.388  10.177 34.265 1.00 63.13  ? 335 MET A CG  1 
ATOM   2583 S  SD  . MET A 1 335 ? 87.123  10.415 34.656 1.00 65.92  ? 335 MET A SD  1 
ATOM   2584 C  CE  . MET A 1 335 ? 87.888  10.039 33.039 1.00 71.96  ? 335 MET A CE  1 
ATOM   2585 N  N   . PHE A 1 336 ? 86.967  13.465 33.751 1.00 61.73  ? 336 PHE A N   1 
ATOM   2586 C  CA  . PHE A 1 336 ? 88.273  13.903 34.240 1.00 65.15  ? 336 PHE A CA  1 
ATOM   2587 C  C   . PHE A 1 336 ? 88.240  15.130 35.164 1.00 58.66  ? 336 PHE A C   1 
ATOM   2588 O  O   . PHE A 1 336 ? 88.990  15.173 36.150 1.00 50.50  ? 336 PHE A O   1 
ATOM   2589 C  CB  . PHE A 1 336 ? 89.285  14.106 33.083 1.00 69.40  ? 336 PHE A CB  1 
ATOM   2590 C  CG  . PHE A 1 336 ? 88.844  15.071 32.001 1.00 81.30  ? 336 PHE A CG  1 
ATOM   2591 C  CD1 . PHE A 1 336 ? 88.179  14.617 30.867 1.00 89.72  ? 336 PHE A CD1 1 
ATOM   2592 C  CD2 . PHE A 1 336 ? 89.160  16.423 32.081 1.00 82.11  ? 336 PHE A CD2 1 
ATOM   2593 C  CE1 . PHE A 1 336 ? 87.840  15.496 29.824 1.00 91.00  ? 336 PHE A CE1 1 
ATOM   2594 C  CE2 . PHE A 1 336 ? 88.831  17.309 31.051 1.00 86.65  ? 336 PHE A CE2 1 
ATOM   2595 C  CZ  . PHE A 1 336 ? 88.169  16.844 29.919 1.00 88.27  ? 336 PHE A CZ  1 
ATOM   2596 N  N   . GLU A 1 337 ? 87.368  16.103 34.874 1.00 53.21  ? 337 GLU A N   1 
ATOM   2597 C  CA  . GLU A 1 337 ? 87.265  17.306 35.712 1.00 59.11  ? 337 GLU A CA  1 
ATOM   2598 C  C   . GLU A 1 337 ? 86.678  16.951 37.067 1.00 61.01  ? 337 GLU A C   1 
ATOM   2599 O  O   . GLU A 1 337 ? 87.122  17.465 38.100 1.00 59.37  ? 337 GLU A O   1 
ATOM   2600 C  CB  . GLU A 1 337 ? 86.380  18.382 35.071 1.00 62.40  ? 337 GLU A CB  1 
ATOM   2601 C  CG  . GLU A 1 337 ? 86.861  18.889 33.732 1.00 74.48  ? 337 GLU A CG  1 
ATOM   2602 C  CD  . GLU A 1 337 ? 86.293  18.080 32.592 1.00 83.90  ? 337 GLU A CD  1 
ATOM   2603 O  OE1 . GLU A 1 337 ? 86.070  16.867 32.790 1.00 78.94  ? 337 GLU A OE1 1 
ATOM   2604 O  OE2 . GLU A 1 337 ? 86.082  18.652 31.501 1.00 90.26  ? 337 GLU A OE2 1 
ATOM   2605 N  N   . TYR A 1 338 ? 85.671  16.079 37.057 1.00 55.02  ? 338 TYR A N   1 
ATOM   2606 C  CA  . TYR A 1 338 ? 85.033  15.650 38.293 1.00 54.17  ? 338 TYR A CA  1 
ATOM   2607 C  C   . TYR A 1 338 ? 85.993  14.826 39.133 1.00 54.52  ? 338 TYR A C   1 
ATOM   2608 O  O   . TYR A 1 338 ? 86.176  15.082 40.319 1.00 53.89  ? 338 TYR A O   1 
ATOM   2609 C  CB  . TYR A 1 338 ? 83.781  14.801 38.004 1.00 56.24  ? 338 TYR A CB  1 
ATOM   2610 C  CG  . TYR A 1 338 ? 82.514  15.596 37.728 1.00 59.73  ? 338 TYR A CG  1 
ATOM   2611 C  CD1 . TYR A 1 338 ? 81.952  15.637 36.449 1.00 58.38  ? 338 TYR A CD1 1 
ATOM   2612 C  CD2 . TYR A 1 338 ? 81.877  16.308 38.750 1.00 59.12  ? 338 TYR A CD2 1 
ATOM   2613 C  CE1 . TYR A 1 338 ? 80.789  16.365 36.195 1.00 57.32  ? 338 TYR A CE1 1 
ATOM   2614 C  CE2 . TYR A 1 338 ? 80.713  17.037 38.508 1.00 57.93  ? 338 TYR A CE2 1 
ATOM   2615 C  CZ  . TYR A 1 338 ? 80.174  17.064 37.230 1.00 62.26  ? 338 TYR A CZ  1 
ATOM   2616 O  OH  . TYR A 1 338 ? 79.033  17.800 36.986 1.00 55.88  ? 338 TYR A OH  1 
ATOM   2617 N  N   . LEU A 1 339 ? 86.636  13.855 38.498 1.00 64.73  ? 339 LEU A N   1 
ATOM   2618 C  CA  . LEU A 1 339 ? 87.531  12.942 39.201 1.00 65.18  ? 339 LEU A CA  1 
ATOM   2619 C  C   . LEU A 1 339 ? 89.003  13.312 39.429 1.00 64.16  ? 339 LEU A C   1 
ATOM   2620 O  O   . LEU A 1 339 ? 89.672  12.680 40.250 1.00 61.13  ? 339 LEU A O   1 
ATOM   2621 C  CB  . LEU A 1 339 ? 87.437  11.573 38.525 1.00 57.21  ? 339 LEU A CB  1 
ATOM   2622 C  CG  . LEU A 1 339 ? 86.000  11.044 38.514 1.00 50.66  ? 339 LEU A CG  1 
ATOM   2623 C  CD1 . LEU A 1 339 ? 85.894  9.852  37.606 1.00 52.35  ? 339 LEU A CD1 1 
ATOM   2624 C  CD2 . LEU A 1 339 ? 85.578  10.697 39.936 1.00 57.04  ? 339 LEU A CD2 1 
ATOM   2625 N  N   . ALA A 1 340 ? 89.514  14.324 38.739 1.00 63.64  ? 340 ALA A N   1 
ATOM   2626 C  CA  . ALA A 1 340 ? 90.918  14.695 38.917 1.00 73.92  ? 340 ALA A CA  1 
ATOM   2627 C  C   . ALA A 1 340 ? 91.160  15.616 40.119 1.00 76.17  ? 340 ALA A C   1 
ATOM   2628 O  O   . ALA A 1 340 ? 90.371  16.522 40.387 1.00 75.63  ? 340 ALA A O   1 
ATOM   2629 C  CB  . ALA A 1 340 ? 91.453  15.348 37.643 1.00 67.27  ? 340 ALA A CB  1 
ATOM   2630 N  N   . PRO A 1 341 ? 92.257  15.382 40.872 1.00 80.32  ? 341 PRO A N   1 
ATOM   2631 C  CA  . PRO A 1 341 ? 92.593  16.207 42.044 1.00 82.41  ? 341 PRO A CA  1 
ATOM   2632 C  C   . PRO A 1 341 ? 92.934  17.627 41.591 1.00 87.21  ? 341 PRO A C   1 
ATOM   2633 O  O   . PRO A 1 341 ? 93.224  17.855 40.419 1.00 90.84  ? 341 PRO A O   1 
ATOM   2634 C  CB  . PRO A 1 341 ? 93.809  15.500 42.636 1.00 76.25  ? 341 PRO A CB  1 
ATOM   2635 C  CG  . PRO A 1 341 ? 93.605  14.077 42.226 1.00 81.60  ? 341 PRO A CG  1 
ATOM   2636 C  CD  . PRO A 1 341 ? 93.157  14.219 40.791 1.00 77.09  ? 341 PRO A CD  1 
ATOM   2637 N  N   . PRO A 1 342 ? 92.900  18.602 42.510 1.00 88.62  ? 342 PRO A N   1 
ATOM   2638 C  CA  . PRO A 1 342 ? 93.218  19.982 42.104 1.00 91.38  ? 342 PRO A CA  1 
ATOM   2639 C  C   . PRO A 1 342 ? 94.653  20.424 42.445 1.00 91.50  ? 342 PRO A C   1 
ATOM   2640 O  O   . PRO A 1 342 ? 94.837  21.229 43.361 1.00 92.20  ? 342 PRO A O   1 
ATOM   2641 C  CB  . PRO A 1 342 ? 92.178  20.782 42.875 1.00 92.59  ? 342 PRO A CB  1 
ATOM   2642 C  CG  . PRO A 1 342 ? 92.160  20.047 44.204 1.00 85.73  ? 342 PRO A CG  1 
ATOM   2643 C  CD  . PRO A 1 342 ? 92.166  18.577 43.795 1.00 88.20  ? 342 PRO A CD  1 
ATOM   2644 N  N   . ARG A 1 343 ? 95.645  19.960 41.681 1.00 89.58  ? 343 ARG A N   1 
ATOM   2645 C  CA  . ARG A 1 343 ? 97.040  20.277 41.979 1.00 87.69  ? 343 ARG A CA  1 
ATOM   2646 C  C   . ARG A 1 343 ? 98.039  19.613 41.043 1.00 87.44  ? 343 ARG A C   1 
ATOM   2647 O  O   . ARG A 1 343 ? 97.734  19.188 39.924 1.00 86.22  ? 343 ARG A O   1 
ATOM   2648 C  CB  . ARG A 1 343 ? 97.421  19.762 43.366 1.00 83.84  ? 343 ARG A CB  1 
ATOM   2649 C  CG  . ARG A 1 343 ? 97.202  20.707 44.518 1.00 85.35  ? 343 ARG A CG  1 
ATOM   2650 C  CD  . ARG A 1 343 ? 96.853  19.936 45.787 1.00 87.93  ? 343 ARG A CD  1 
ATOM   2651 N  NE  . ARG A 1 343 ? 95.409  19.933 46.055 1.00 82.25  ? 343 ARG A NE  1 
ATOM   2652 C  CZ  . ARG A 1 343 ? 94.702  18.824 46.261 1.00 88.51  ? 343 ARG A CZ  1 
ATOM   2653 N  NH1 . ARG A 1 343 ? 95.312  17.646 46.223 1.00 86.36  ? 343 ARG A NH1 1 
ATOM   2654 N  NH2 . ARG A 1 343 ? 93.400  18.878 46.503 1.00 82.83  ? 343 ARG A NH2 1 
ATOM   2655 N  N   . ARG A 1 344 ? 99.241  19.487 41.606 1.00 86.67  ? 344 ARG A N   1 
ATOM   2656 C  CA  . ARG A 1 344 ? 100.395 18.866 40.990 1.00 86.11  ? 344 ARG A CA  1 
ATOM   2657 C  C   . ARG A 1 344 ? 100.926 17.817 41.988 1.00 87.28  ? 344 ARG A C   1 
ATOM   2658 O  O   . ARG A 1 344 ? 100.364 17.690 43.101 1.00 83.42  ? 344 ARG A O   1 
ATOM   2659 C  CB  . ARG A 1 344 ? 101.474 19.912 40.736 1.00 88.22  ? 344 ARG A CB  1 
ATOM   2660 C  CG  . ARG A 1 344 ? 102.635 19.427 39.863 1.00 78.84  ? 344 ARG A CG  1 
ATOM   2661 C  CD  . ARG A 1 344 ? 102.208 19.385 38.411 1.00 82.13  ? 344 ARG A CD  1 
ATOM   2662 N  NE  . ARG A 1 344 ? 103.214 20.000 37.549 1.00 85.44  ? 344 ARG A NE  1 
ATOM   2663 C  CZ  . ARG A 1 344 ? 102.963 20.508 36.344 1.00 88.93  ? 344 ARG A CZ  1 
ATOM   2664 N  NH1 . ARG A 1 344 ? 101.733 20.476 35.847 1.00 83.06  ? 344 ARG A NH1 1 
ATOM   2665 N  NH2 . ARG A 1 344 ? 103.940 21.070 35.639 1.00 90.63  ? 344 ARG A NH2 1 
ATOM   2666 N  N   . ASN B 2 7   ? 50.213  46.080 21.700 1.00 82.73  ? 7   ASN B N   1 
ATOM   2667 C  CA  . ASN B 2 7   ? 49.193  45.512 20.772 1.00 84.63  ? 7   ASN B CA  1 
ATOM   2668 C  C   . ASN B 2 7   ? 48.703  44.154 21.267 1.00 80.96  ? 7   ASN B C   1 
ATOM   2669 O  O   . ASN B 2 7   ? 47.668  43.669 20.816 1.00 82.58  ? 7   ASN B O   1 
ATOM   2670 C  CB  . ASN B 2 7   ? 49.784  45.354 19.364 1.00 89.65  ? 7   ASN B CB  1 
ATOM   2671 C  CG  . ASN B 2 7   ? 48.739  44.976 18.320 1.00 88.50  ? 7   ASN B CG  1 
ATOM   2672 O  OD1 . ASN B 2 7   ? 49.080  44.589 17.201 1.00 94.67  ? 7   ASN B OD1 1 
ATOM   2673 N  ND2 . ASN B 2 7   ? 47.466  45.102 18.676 1.00 94.71  ? 7   ASN B ND2 1 
ATOM   2674 N  N   . ASN B 2 8   ? 49.444  43.540 22.187 1.00 75.77  ? 8   ASN B N   1 
ATOM   2675 C  CA  . ASN B 2 8   ? 49.051  42.233 22.709 1.00 74.86  ? 8   ASN B CA  1 
ATOM   2676 C  C   . ASN B 2 8   ? 47.765  42.363 23.523 1.00 72.61  ? 8   ASN B C   1 
ATOM   2677 O  O   . ASN B 2 8   ? 46.933  41.449 23.549 1.00 75.65  ? 8   ASN B O   1 
ATOM   2678 C  CB  . ASN B 2 8   ? 50.171  41.638 23.564 1.00 75.82  ? 8   ASN B CB  1 
ATOM   2679 C  CG  . ASN B 2 8   ? 50.187  40.118 23.525 1.00 79.48  ? 8   ASN B CG  1 
ATOM   2680 O  OD1 . ASN B 2 8   ? 51.189  39.492 23.873 1.00 82.64  ? 8   ASN B OD1 1 
ATOM   2681 N  ND2 . ASN B 2 8   ? 49.073  39.516 23.102 1.00 66.23  ? 8   ASN B ND2 1 
ATOM   2682 N  N   . ASN B 2 9   ? 47.613  43.507 24.184 1.00 69.43  ? 9   ASN B N   1 
ATOM   2683 C  CA  . ASN B 2 9   ? 46.418  43.793 24.969 1.00 66.62  ? 9   ASN B CA  1 
ATOM   2684 C  C   . ASN B 2 9   ? 45.396  44.394 24.006 1.00 58.57  ? 9   ASN B C   1 
ATOM   2685 O  O   . ASN B 2 9   ? 44.206  44.455 24.302 1.00 51.87  ? 9   ASN B O   1 
ATOM   2686 C  CB  . ASN B 2 9   ? 46.723  44.801 26.082 1.00 76.03  ? 9   ASN B CB  1 
ATOM   2687 C  CG  . ASN B 2 9   ? 47.674  44.252 27.132 1.00 83.11  ? 9   ASN B CG  1 
ATOM   2688 O  OD1 . ASN B 2 9   ? 48.070  44.968 28.054 1.00 84.45  ? 9   ASN B OD1 1 
ATOM   2689 N  ND2 . ASN B 2 9   ? 48.043  42.979 27.002 1.00 73.41  ? 9   ASN B ND2 1 
ATOM   2690 N  N   . LYS B 2 10  ? 45.881  44.841 22.852 1.00 49.10  ? 10  LYS B N   1 
ATOM   2691 C  CA  . LYS B 2 10  ? 45.027  45.428 21.833 1.00 51.03  ? 10  LYS B CA  1 
ATOM   2692 C  C   . LYS B 2 10  ? 44.708  44.462 20.708 1.00 43.77  ? 10  LYS B C   1 
ATOM   2693 O  O   . LYS B 2 10  ? 43.917  44.783 19.845 1.00 46.74  ? 10  LYS B O   1 
ATOM   2694 C  CB  . LYS B 2 10  ? 45.671  46.678 21.236 1.00 60.12  ? 10  LYS B CB  1 
ATOM   2695 C  CG  . LYS B 2 10  ? 45.453  47.947 22.045 1.00 68.21  ? 10  LYS B CG  1 
ATOM   2696 C  CD  . LYS B 2 10  ? 45.898  49.168 21.258 1.00 73.02  ? 10  LYS B CD  1 
ATOM   2697 C  CE  . LYS B 2 10  ? 45.146  49.271 19.932 1.00 77.89  ? 10  LYS B CE  1 
ATOM   2698 N  NZ  . LYS B 2 10  ? 45.510  50.494 19.159 1.00 71.28  ? 10  LYS B NZ  1 
ATOM   2699 N  N   . ARG B 2 11  ? 45.311  43.280 20.722 1.00 40.01  ? 11  ARG B N   1 
ATOM   2700 C  CA  . ARG B 2 11  ? 45.081  42.292 19.668 1.00 32.21  ? 11  ARG B CA  1 
ATOM   2701 C  C   . ARG B 2 11  ? 43.622  42.009 19.324 1.00 33.33  ? 11  ARG B C   1 
ATOM   2702 O  O   . ARG B 2 11  ? 43.256  41.920 18.152 1.00 31.48  ? 11  ARG B O   1 
ATOM   2703 C  CB  . ARG B 2 11  ? 45.750  40.961 20.033 1.00 29.67  ? 11  ARG B CB  1 
ATOM   2704 C  CG  . ARG B 2 11  ? 45.362  39.826 19.111 1.00 28.76  ? 11  ARG B CG  1 
ATOM   2705 C  CD  . ARG B 2 11  ? 46.139  38.567 19.421 1.00 38.11  ? 11  ARG B CD  1 
ATOM   2706 N  NE  . ARG B 2 11  ? 47.574  38.726 19.220 1.00 36.30  ? 11  ARG B NE  1 
ATOM   2707 C  CZ  . ARG B 2 11  ? 48.476  37.805 19.554 1.00 40.55  ? 11  ARG B CZ  1 
ATOM   2708 N  NH1 . ARG B 2 11  ? 48.084  36.669 20.108 1.00 39.17  ? 11  ARG B NH1 1 
ATOM   2709 N  NH2 . ARG B 2 11  ? 49.767  38.010 19.329 1.00 31.43  ? 11  ARG B NH2 1 
ATOM   2710 N  N   . TRP B 2 12  ? 42.777  41.848 20.333 1.00 30.73  ? 12  TRP B N   1 
ATOM   2711 C  CA  . TRP B 2 12  ? 41.393  41.538 20.024 1.00 31.38  ? 12  TRP B CA  1 
ATOM   2712 C  C   . TRP B 2 12  ? 40.405  42.689 20.051 1.00 31.84  ? 12  TRP B C   1 
ATOM   2713 O  O   . TRP B 2 12  ? 39.208  42.488 20.254 1.00 31.33  ? 12  TRP B O   1 
ATOM   2714 C  CB  . TRP B 2 12  ? 40.912  40.380 20.902 1.00 36.06  ? 12  TRP B CB  1 
ATOM   2715 C  CG  . TRP B 2 12  ? 41.754  39.165 20.696 1.00 30.84  ? 12  TRP B CG  1 
ATOM   2716 C  CD1 . TRP B 2 12  ? 42.791  38.751 21.477 1.00 30.14  ? 12  TRP B CD1 1 
ATOM   2717 C  CD2 . TRP B 2 12  ? 41.695  38.256 19.591 1.00 26.46  ? 12  TRP B CD2 1 
ATOM   2718 N  NE1 . TRP B 2 12  ? 43.380  37.647 20.930 1.00 32.16  ? 12  TRP B NE1 1 
ATOM   2719 C  CE2 . TRP B 2 12  ? 42.728  37.318 19.770 1.00 27.47  ? 12  TRP B CE2 1 
ATOM   2720 C  CE3 . TRP B 2 12  ? 40.870  38.146 18.462 1.00 37.64  ? 12  TRP B CE3 1 
ATOM   2721 C  CZ2 . TRP B 2 12  ? 42.963  36.274 18.861 1.00 32.45  ? 12  TRP B CZ2 1 
ATOM   2722 C  CZ3 . TRP B 2 12  ? 41.103  37.104 17.554 1.00 34.37  ? 12  TRP B CZ3 1 
ATOM   2723 C  CH2 . TRP B 2 12  ? 42.136  36.186 17.762 1.00 31.21  ? 12  TRP B CH2 1 
ATOM   2724 N  N   . TYR B 2 13  ? 40.901  43.901 19.843 1.00 34.87  ? 13  TYR B N   1 
ATOM   2725 C  CA  . TYR B 2 13  ? 40.020  45.056 19.771 1.00 39.44  ? 13  TYR B CA  1 
ATOM   2726 C  C   . TYR B 2 13  ? 40.187  45.606 18.367 1.00 41.07  ? 13  TYR B C   1 
ATOM   2727 O  O   . TYR B 2 13  ? 41.302  45.710 17.868 1.00 40.23  ? 13  TYR B O   1 
ATOM   2728 C  CB  . TYR B 2 13  ? 40.372  46.064 20.856 1.00 32.74  ? 13  TYR B CB  1 
ATOM   2729 C  CG  . TYR B 2 13  ? 39.949  45.522 22.199 1.00 37.73  ? 13  TYR B CG  1 
ATOM   2730 C  CD1 . TYR B 2 13  ? 38.602  45.506 22.562 1.00 29.03  ? 13  TYR B CD1 1 
ATOM   2731 C  CD2 . TYR B 2 13  ? 40.875  44.931 23.058 1.00 30.41  ? 13  TYR B CD2 1 
ATOM   2732 C  CE1 . TYR B 2 13  ? 38.184  44.914 23.742 1.00 31.43  ? 13  TYR B CE1 1 
ATOM   2733 C  CE2 . TYR B 2 13  ? 40.468  44.324 24.250 1.00 31.84  ? 13  TYR B CE2 1 
ATOM   2734 C  CZ  . TYR B 2 13  ? 39.121  44.317 24.581 1.00 36.01  ? 13  TYR B CZ  1 
ATOM   2735 O  OH  . TYR B 2 13  ? 38.691  43.682 25.717 1.00 37.23  ? 13  TYR B OH  1 
ATOM   2736 N  N   . PHE B 2 14  ? 39.067  45.941 17.732 1.00 39.48  ? 14  PHE B N   1 
ATOM   2737 C  CA  . PHE B 2 14  ? 39.075  46.398 16.347 1.00 40.80  ? 14  PHE B CA  1 
ATOM   2738 C  C   . PHE B 2 14  ? 38.378  47.731 16.067 1.00 31.73  ? 14  PHE B C   1 
ATOM   2739 O  O   . PHE B 2 14  ? 37.356  48.041 16.679 1.00 34.48  ? 14  PHE B O   1 
ATOM   2740 C  CB  . PHE B 2 14  ? 38.429  45.301 15.497 1.00 36.42  ? 14  PHE B CB  1 
ATOM   2741 C  CG  . PHE B 2 14  ? 39.076  43.948 15.665 1.00 35.56  ? 14  PHE B CG  1 
ATOM   2742 C  CD1 . PHE B 2 14  ? 40.135  43.562 14.849 1.00 27.89  ? 14  PHE B CD1 1 
ATOM   2743 C  CD2 . PHE B 2 14  ? 38.650  43.080 16.661 1.00 29.63  ? 14  PHE B CD2 1 
ATOM   2744 C  CE1 . PHE B 2 14  ? 40.772  42.330 15.017 1.00 30.81  ? 14  PHE B CE1 1 
ATOM   2745 C  CE2 . PHE B 2 14  ? 39.275  41.840 16.842 1.00 33.01  ? 14  PHE B CE2 1 
ATOM   2746 C  CZ  . PHE B 2 14  ? 40.344  41.466 16.013 1.00 29.69  ? 14  PHE B CZ  1 
ATOM   2747 N  N   . THR B 2 15  ? 38.941  48.504 15.136 1.00 40.56  ? 15  THR B N   1 
ATOM   2748 C  CA  . THR B 2 15  ? 38.364  49.795 14.712 1.00 46.78  ? 15  THR B CA  1 
ATOM   2749 C  C   . THR B 2 15  ? 37.081  49.508 13.923 1.00 46.63  ? 15  THR B C   1 
ATOM   2750 O  O   . THR B 2 15  ? 36.887  48.395 13.431 1.00 45.54  ? 15  THR B O   1 
ATOM   2751 C  CB  . THR B 2 15  ? 39.300  50.561 13.749 1.00 46.19  ? 15  THR B CB  1 
ATOM   2752 O  OG1 . THR B 2 15  ? 39.455  49.800 12.540 1.00 50.09  ? 15  THR B OG1 1 
ATOM   2753 C  CG2 . THR B 2 15  ? 40.663  50.800 14.377 1.00 41.71  ? 15  THR B CG2 1 
ATOM   2754 N  N   . ARG B 2 16  ? 36.215  50.509 13.787 1.00 48.74  ? 16  ARG B N   1 
ATOM   2755 C  CA  . ARG B 2 16  ? 34.965  50.323 13.051 1.00 50.26  ? 16  ARG B CA  1 
ATOM   2756 C  C   . ARG B 2 16  ? 35.272  49.895 11.621 1.00 56.22  ? 16  ARG B C   1 
ATOM   2757 O  O   . ARG B 2 16  ? 34.483  49.204 10.978 1.00 51.30  ? 16  ARG B O   1 
ATOM   2758 C  CB  . ARG B 2 16  ? 34.150  51.618 13.022 1.00 56.81  ? 16  ARG B CB  1 
ATOM   2759 C  CG  . ARG B 2 16  ? 33.884  52.223 14.388 1.00 58.88  ? 16  ARG B CG  1 
ATOM   2760 C  CD  . ARG B 2 16  ? 32.397  52.414 14.664 1.00 58.57  ? 16  ARG B CD  1 
ATOM   2761 N  NE  . ARG B 2 16  ? 31.988  51.634 15.827 1.00 65.15  ? 16  ARG B NE  1 
ATOM   2762 C  CZ  . ARG B 2 16  ? 31.064  52.014 16.705 1.00 61.54  ? 16  ARG B CZ  1 
ATOM   2763 N  NH1 . ARG B 2 16  ? 30.768  51.232 17.731 1.00 60.53  ? 16  ARG B NH1 1 
ATOM   2764 N  NH2 . ARG B 2 16  ? 30.441  53.177 16.563 1.00 65.75  ? 16  ARG B NH2 1 
ATOM   2765 N  N   . GLU B 2 17  ? 36.438  50.307 11.140 1.00 60.73  ? 17  GLU B N   1 
ATOM   2766 C  CA  . GLU B 2 17  ? 36.876  49.996 9.791  1.00 60.69  ? 17  GLU B CA  1 
ATOM   2767 C  C   . GLU B 2 17  ? 37.227  48.513 9.658  1.00 63.52  ? 17  GLU B C   1 
ATOM   2768 O  O   . GLU B 2 17  ? 36.783  47.839 8.725  1.00 60.19  ? 17  GLU B O   1 
ATOM   2769 C  CB  . GLU B 2 17  ? 38.091  50.857 9.436  1.00 59.74  ? 17  GLU B CB  1 
ATOM   2770 C  CG  . GLU B 2 17  ? 37.901  52.371 9.631  1.00 71.54  ? 17  GLU B CG  1 
ATOM   2771 C  CD  . GLU B 2 17  ? 37.925  52.827 11.094 1.00 74.58  ? 17  GLU B CD  1 
ATOM   2772 O  OE1 . GLU B 2 17  ? 36.875  52.765 11.776 1.00 69.08  ? 17  GLU B OE1 1 
ATOM   2773 O  OE2 . GLU B 2 17  ? 39.005  53.253 11.561 1.00 71.91  ? 17  GLU B OE2 1 
ATOM   2774 N  N   . GLN B 2 18  ? 38.023  48.006 10.594 1.00 59.09  ? 18  GLN B N   1 
ATOM   2775 C  CA  . GLN B 2 18  ? 38.419  46.600 10.571 1.00 51.66  ? 18  GLN B CA  1 
ATOM   2776 C  C   . GLN B 2 18  ? 37.209  45.690 10.754 1.00 47.38  ? 18  GLN B C   1 
ATOM   2777 O  O   . GLN B 2 18  ? 37.133  44.620 10.159 1.00 48.55  ? 18  GLN B O   1 
ATOM   2778 C  CB  . GLN B 2 18  ? 39.441  46.334 11.667 1.00 49.69  ? 18  GLN B CB  1 
ATOM   2779 C  CG  . GLN B 2 18  ? 40.633  47.252 11.595 1.00 48.12  ? 18  GLN B CG  1 
ATOM   2780 C  CD  . GLN B 2 18  ? 41.454  47.206 12.854 1.00 59.44  ? 18  GLN B CD  1 
ATOM   2781 O  OE1 . GLN B 2 18  ? 40.934  47.403 13.952 1.00 53.11  ? 18  GLN B OE1 1 
ATOM   2782 N  NE2 . GLN B 2 18  ? 42.747  46.946 12.709 1.00 64.16  ? 18  GLN B NE2 1 
ATOM   2783 N  N   . LEU B 2 19  ? 36.266  46.104 11.589 1.00 46.12  ? 19  LEU B N   1 
ATOM   2784 C  CA  . LEU B 2 19  ? 35.072  45.307 11.789 1.00 42.64  ? 19  LEU B CA  1 
ATOM   2785 C  C   . LEU B 2 19  ? 34.360  45.212 10.447 1.00 51.67  ? 19  LEU B C   1 
ATOM   2786 O  O   . LEU B 2 19  ? 33.623  44.261 10.187 1.00 53.48  ? 19  LEU B O   1 
ATOM   2787 C  CB  . LEU B 2 19  ? 34.145  45.962 12.811 1.00 39.18  ? 19  LEU B CB  1 
ATOM   2788 C  CG  . LEU B 2 19  ? 34.464  45.781 14.296 1.00 49.21  ? 19  LEU B CG  1 
ATOM   2789 C  CD1 . LEU B 2 19  ? 33.655  46.780 15.098 1.00 30.96  ? 19  LEU B CD1 1 
ATOM   2790 C  CD2 . LEU B 2 19  ? 34.158  44.352 14.736 1.00 37.35  ? 19  LEU B CD2 1 
ATOM   2791 N  N   . GLU B 2 20  ? 34.584  46.215 9.601  1.00 53.30  ? 20  GLU B N   1 
ATOM   2792 C  CA  . GLU B 2 20  ? 33.978  46.270 8.275  1.00 53.81  ? 20  GLU B CA  1 
ATOM   2793 C  C   . GLU B 2 20  ? 34.681  45.294 7.352  1.00 51.75  ? 20  GLU B C   1 
ATOM   2794 O  O   . GLU B 2 20  ? 34.063  44.398 6.787  1.00 55.09  ? 20  GLU B O   1 
ATOM   2795 C  CB  . GLU B 2 20  ? 34.097  47.688 7.708  1.00 67.26  ? 20  GLU B CB  1 
ATOM   2796 C  CG  . GLU B 2 20  ? 33.693  47.831 6.250  1.00 71.18  ? 20  GLU B CG  1 
ATOM   2797 C  CD  . GLU B 2 20  ? 32.206  47.659 6.034  1.00 71.78  ? 20  GLU B CD  1 
ATOM   2798 O  OE1 . GLU B 2 20  ? 31.429  48.431 6.640  1.00 68.84  ? 20  GLU B OE1 1 
ATOM   2799 O  OE2 . GLU B 2 20  ? 31.820  46.756 5.257  1.00 58.39  ? 20  GLU B OE2 1 
ATOM   2800 N  N   . ASN B 2 21  ? 35.986  45.480 7.209  1.00 48.82  ? 21  ASN B N   1 
ATOM   2801 C  CA  . ASN B 2 21  ? 36.803  44.629 6.362  1.00 54.39  ? 21  ASN B CA  1 
ATOM   2802 C  C   . ASN B 2 21  ? 37.091  43.300 7.070  1.00 54.08  ? 21  ASN B C   1 
ATOM   2803 O  O   . ASN B 2 21  ? 38.245  42.944 7.297  1.00 49.43  ? 21  ASN B O   1 
ATOM   2804 C  CB  . ASN B 2 21  ? 38.119  45.340 6.045  1.00 63.46  ? 21  ASN B CB  1 
ATOM   2805 C  CG  . ASN B 2 21  ? 38.811  44.764 4.828  1.00 74.58  ? 21  ASN B CG  1 
ATOM   2806 O  OD1 . ASN B 2 21  ? 38.887  43.544 4.658  1.00 80.51  ? 21  ASN B OD1 1 
ATOM   2807 N  ND2 . ASN B 2 21  ? 39.329  45.640 3.973  1.00 92.23  ? 21  ASN B ND2 1 
ATOM   2808 N  N   . SER B 2 22  ? 36.028  42.578 7.412  1.00 55.75  ? 22  SER B N   1 
ATOM   2809 C  CA  . SER B 2 22  ? 36.123  41.295 8.103  1.00 59.86  ? 22  SER B CA  1 
ATOM   2810 C  C   . SER B 2 22  ? 36.474  40.154 7.159  1.00 60.02  ? 22  SER B C   1 
ATOM   2811 O  O   . SER B 2 22  ? 36.338  40.283 5.944  1.00 67.78  ? 22  SER B O   1 
ATOM   2812 C  CB  . SER B 2 22  ? 34.790  40.971 8.755  1.00 52.35  ? 22  SER B CB  1 
ATOM   2813 O  OG  . SER B 2 22  ? 33.828  40.695 7.754  1.00 41.92  ? 22  SER B OG  1 
ATOM   2814 N  N   . PRO B 2 23  ? 36.935  39.016 7.710  1.00 58.92  ? 23  PRO B N   1 
ATOM   2815 C  CA  . PRO B 2 23  ? 37.287  37.869 6.867  1.00 55.74  ? 23  PRO B CA  1 
ATOM   2816 C  C   . PRO B 2 23  ? 36.099  37.423 6.005  1.00 56.71  ? 23  PRO B C   1 
ATOM   2817 O  O   . PRO B 2 23  ? 36.264  37.100 4.829  1.00 55.21  ? 23  PRO B O   1 
ATOM   2818 C  CB  . PRO B 2 23  ? 37.702  36.810 7.887  1.00 54.65  ? 23  PRO B CB  1 
ATOM   2819 C  CG  . PRO B 2 23  ? 38.346  37.628 8.959  1.00 48.05  ? 23  PRO B CG  1 
ATOM   2820 C  CD  . PRO B 2 23  ? 37.384  38.798 9.100  1.00 47.81  ? 23  PRO B CD  1 
ATOM   2821 N  N   . SER B 2 24  ? 34.907  37.419 6.595  1.00 46.72  ? 24  SER B N   1 
ATOM   2822 C  CA  . SER B 2 24  ? 33.699  37.023 5.885  1.00 46.66  ? 24  SER B CA  1 
ATOM   2823 C  C   . SER B 2 24  ? 33.394  38.013 4.757  1.00 57.10  ? 24  SER B C   1 
ATOM   2824 O  O   . SER B 2 24  ? 32.946  37.620 3.685  1.00 62.48  ? 24  SER B O   1 
ATOM   2825 C  CB  . SER B 2 24  ? 32.505  36.966 6.839  1.00 39.38  ? 24  SER B CB  1 
ATOM   2826 O  OG  . SER B 2 24  ? 32.656  35.960 7.811  1.00 48.67  ? 24  SER B OG  1 
ATOM   2827 N  N   . ARG B 2 25  ? 33.636  39.295 5.005  1.00 53.89  ? 25  ARG B N   1 
ATOM   2828 C  CA  . ARG B 2 25  ? 33.390  40.328 4.007  1.00 55.58  ? 25  ARG B CA  1 
ATOM   2829 C  C   . ARG B 2 25  ? 34.192  40.018 2.745  1.00 63.24  ? 25  ARG B C   1 
ATOM   2830 O  O   . ARG B 2 25  ? 33.668  40.089 1.633  1.00 65.89  ? 25  ARG B O   1 
ATOM   2831 C  CB  . ARG B 2 25  ? 33.807  41.695 4.551  1.00 58.59  ? 25  ARG B CB  1 
ATOM   2832 C  CG  . ARG B 2 25  ? 33.176  42.885 3.846  1.00 58.86  ? 25  ARG B CG  1 
ATOM   2833 C  CD  . ARG B 2 25  ? 31.661  42.816 3.948  1.00 68.23  ? 25  ARG B CD  1 
ATOM   2834 N  NE  . ARG B 2 25  ? 31.223  42.252 5.226  1.00 76.23  ? 25  ARG B NE  1 
ATOM   2835 C  CZ  . ARG B 2 25  ? 31.350  42.852 6.407  1.00 68.92  ? 25  ARG B CZ  1 
ATOM   2836 N  NH1 . ARG B 2 25  ? 31.900  44.052 6.499  1.00 65.61  ? 25  ARG B NH1 1 
ATOM   2837 N  NH2 . ARG B 2 25  ? 30.930  42.243 7.501  1.00 63.73  ? 25  ARG B NH2 1 
ATOM   2838 N  N   . ARG B 2 26  ? 35.462  39.668 2.925  1.00 63.15  ? 26  ARG B N   1 
ATOM   2839 C  CA  . ARG B 2 26  ? 36.337  39.346 1.803  1.00 60.24  ? 26  ARG B CA  1 
ATOM   2840 C  C   . ARG B 2 26  ? 35.807  38.157 1.012  1.00 58.12  ? 26  ARG B C   1 
ATOM   2841 O  O   . ARG B 2 26  ? 36.287  37.862 -0.082 1.00 64.28  ? 26  ARG B O   1 
ATOM   2842 C  CB  . ARG B 2 26  ? 37.750  39.051 2.303  1.00 66.79  ? 26  ARG B CB  1 
ATOM   2843 C  CG  . ARG B 2 26  ? 38.767  38.800 1.202  1.00 72.08  ? 26  ARG B CG  1 
ATOM   2844 C  CD  . ARG B 2 26  ? 40.178  38.662 1.758  1.00 74.97  ? 26  ARG B CD  1 
ATOM   2845 N  NE  . ARG B 2 26  ? 40.604  39.856 2.490  1.00 83.89  ? 26  ARG B NE  1 
ATOM   2846 C  CZ  . ARG B 2 26  ? 40.320  40.105 3.767  1.00 84.00  ? 26  ARG B CZ  1 
ATOM   2847 N  NH1 . ARG B 2 26  ? 39.605  39.240 4.477  1.00 88.31  ? 26  ARG B NH1 1 
ATOM   2848 N  NH2 . ARG B 2 26  ? 40.748  41.223 4.338  1.00 80.79  ? 26  ARG B NH2 1 
ATOM   2849 N  N   . PHE B 2 27  ? 34.819  37.470 1.571  1.00 55.30  ? 27  PHE B N   1 
ATOM   2850 C  CA  . PHE B 2 27  ? 34.216  36.330 0.893  1.00 56.75  ? 27  PHE B CA  1 
ATOM   2851 C  C   . PHE B 2 27  ? 32.771  36.655 0.534  1.00 55.83  ? 27  PHE B C   1 
ATOM   2852 O  O   . PHE B 2 27  ? 31.882  35.806 0.598  1.00 64.40  ? 27  PHE B O   1 
ATOM   2853 C  CB  . PHE B 2 27  ? 34.291  35.083 1.776  1.00 61.04  ? 27  PHE B CB  1 
ATOM   2854 C  CG  . PHE B 2 27  ? 35.635  34.413 1.759  1.00 60.94  ? 27  PHE B CG  1 
ATOM   2855 C  CD1 . PHE B 2 27  ? 35.982  33.554 0.726  1.00 62.98  ? 27  PHE B CD1 1 
ATOM   2856 C  CD2 . PHE B 2 27  ? 36.566  34.665 2.758  1.00 65.13  ? 27  PHE B CD2 1 
ATOM   2857 C  CE1 . PHE B 2 27  ? 37.236  32.956 0.686  1.00 57.80  ? 27  PHE B CE1 1 
ATOM   2858 C  CE2 . PHE B 2 27  ? 37.826  34.070 2.727  1.00 58.05  ? 27  PHE B CE2 1 
ATOM   2859 C  CZ  . PHE B 2 27  ? 38.160  33.215 1.689  1.00 60.39  ? 27  PHE B CZ  1 
ATOM   2860 N  N   . GLY B 2 28  ? 32.545  37.911 0.170  1.00 56.68  ? 28  GLY B N   1 
ATOM   2861 C  CA  . GLY B 2 28  ? 31.220  38.338 -0.222 1.00 57.82  ? 28  GLY B CA  1 
ATOM   2862 C  C   . GLY B 2 28  ? 30.102  38.177 0.789  1.00 59.99  ? 28  GLY B C   1 
ATOM   2863 O  O   . GLY B 2 28  ? 28.955  37.944 0.406  1.00 58.70  ? 28  GLY B O   1 
ATOM   2864 N  N   . VAL B 2 29  ? 30.413  38.278 2.076  1.00 54.59  ? 29  VAL B N   1 
ATOM   2865 C  CA  . VAL B 2 29  ? 29.360  38.189 3.076  1.00 52.60  ? 29  VAL B CA  1 
ATOM   2866 C  C   . VAL B 2 29  ? 29.046  39.632 3.423  1.00 54.38  ? 29  VAL B C   1 
ATOM   2867 O  O   . VAL B 2 29  ? 29.944  40.404 3.735  1.00 57.99  ? 29  VAL B O   1 
ATOM   2868 C  CB  . VAL B 2 29  ? 29.800  37.444 4.356  1.00 44.24  ? 29  VAL B CB  1 
ATOM   2869 C  CG1 . VAL B 2 29  ? 28.641  37.407 5.356  1.00 43.23  ? 29  VAL B CG1 1 
ATOM   2870 C  CG2 . VAL B 2 29  ? 30.224  36.027 4.018  1.00 49.89  ? 29  VAL B CG2 1 
ATOM   2871 N  N   . ASP B 2 30  ? 27.775  40.005 3.335  1.00 62.57  ? 30  ASP B N   1 
ATOM   2872 C  CA  . ASP B 2 30  ? 27.382  41.367 3.645  1.00 63.19  ? 30  ASP B CA  1 
ATOM   2873 C  C   . ASP B 2 30  ? 27.407  41.638 5.139  1.00 60.68  ? 30  ASP B C   1 
ATOM   2874 O  O   . ASP B 2 30  ? 27.101  40.765 5.955  1.00 60.87  ? 30  ASP B O   1 
ATOM   2875 C  CB  . ASP B 2 30  ? 25.993  41.669 3.074  1.00 68.58  ? 30  ASP B CB  1 
ATOM   2876 C  CG  . ASP B 2 30  ? 26.060  42.389 1.736  1.00 78.69  ? 30  ASP B CG  1 
ATOM   2877 O  OD1 . ASP B 2 30  ? 26.714  41.871 0.802  1.00 82.44  ? 30  ASP B OD1 1 
ATOM   2878 O  OD2 . ASP B 2 30  ? 25.460  43.478 1.618  1.00 80.79  ? 30  ASP B OD2 1 
ATOM   2879 N  N   . PRO B 2 31  ? 27.788  42.865 5.511  1.00 58.77  ? 31  PRO B N   1 
ATOM   2880 C  CA  . PRO B 2 31  ? 27.887  43.346 6.886  1.00 56.47  ? 31  PRO B CA  1 
ATOM   2881 C  C   . PRO B 2 31  ? 26.764  42.896 7.798  1.00 53.45  ? 31  PRO B C   1 
ATOM   2882 O  O   . PRO B 2 31  ? 27.010  42.213 8.792  1.00 58.06  ? 31  PRO B O   1 
ATOM   2883 C  CB  . PRO B 2 31  ? 27.922  44.852 6.709  1.00 48.74  ? 31  PRO B CB  1 
ATOM   2884 C  CG  . PRO B 2 31  ? 28.755  44.979 5.476  1.00 51.81  ? 31  PRO B CG  1 
ATOM   2885 C  CD  . PRO B 2 31  ? 28.168  43.929 4.565  1.00 57.23  ? 31  PRO B CD  1 
ATOM   2886 N  N   . ASP B 2 32  ? 25.534  43.274 7.466  1.00 46.73  ? 32  ASP B N   1 
ATOM   2887 C  CA  . ASP B 2 32  ? 24.403  42.905 8.301  1.00 48.36  ? 32  ASP B CA  1 
ATOM   2888 C  C   . ASP B 2 32  ? 24.193  41.405 8.307  1.00 42.70  ? 32  ASP B C   1 
ATOM   2889 O  O   . ASP B 2 32  ? 23.638  40.844 9.251  1.00 43.70  ? 32  ASP B O   1 
ATOM   2890 C  CB  . ASP B 2 32  ? 23.135  43.619 7.839  1.00 56.05  ? 32  ASP B CB  1 
ATOM   2891 C  CG  . ASP B 2 32  ? 23.174  45.105 8.135  1.00 70.33  ? 32  ASP B CG  1 
ATOM   2892 O  OD1 . ASP B 2 32  ? 23.450  45.474 9.300  1.00 71.19  ? 32  ASP B OD1 1 
ATOM   2893 O  OD2 . ASP B 2 32  ? 22.929  45.904 7.208  1.00 85.53  ? 32  ASP B OD2 1 
ATOM   2894 N  N   . LYS B 2 33  ? 24.651  40.752 7.250  1.00 38.98  ? 33  LYS B N   1 
ATOM   2895 C  CA  . LYS B 2 33  ? 24.509  39.311 7.169  1.00 45.83  ? 33  LYS B CA  1 
ATOM   2896 C  C   . LYS B 2 33  ? 25.462  38.711 8.217  1.00 41.14  ? 33  LYS B C   1 
ATOM   2897 O  O   . LYS B 2 33  ? 25.081  37.831 8.998  1.00 34.07  ? 33  LYS B O   1 
ATOM   2898 C  CB  . LYS B 2 33  ? 24.873  38.835 5.761  1.00 42.13  ? 33  LYS B CB  1 
ATOM   2899 C  CG  . LYS B 2 33  ? 24.405  37.441 5.432  1.00 53.09  ? 33  LYS B CG  1 
ATOM   2900 C  CD  . LYS B 2 33  ? 23.015  37.443 4.811  1.00 65.03  ? 33  LYS B CD  1 
ATOM   2901 C  CE  . LYS B 2 33  ? 22.687  36.079 4.213  1.00 64.19  ? 33  LYS B CE  1 
ATOM   2902 N  NZ  . LYS B 2 33  ? 21.390  36.065 3.479  1.00 72.48  ? 33  LYS B NZ  1 
ATOM   2903 N  N   . GLU B 2 34  ? 26.695  39.210 8.248  1.00 43.43  ? 34  GLU B N   1 
ATOM   2904 C  CA  . GLU B 2 34  ? 27.649  38.697 9.214  1.00 46.87  ? 34  GLU B CA  1 
ATOM   2905 C  C   . GLU B 2 34  ? 27.114  38.894 10.622 1.00 48.43  ? 34  GLU B C   1 
ATOM   2906 O  O   . GLU B 2 34  ? 27.174  37.988 11.456 1.00 53.68  ? 34  GLU B O   1 
ATOM   2907 C  CB  . GLU B 2 34  ? 28.994  39.398 9.098  1.00 44.89  ? 34  GLU B CB  1 
ATOM   2908 C  CG  . GLU B 2 34  ? 30.072  38.700 9.906  1.00 52.34  ? 34  GLU B CG  1 
ATOM   2909 C  CD  . GLU B 2 34  ? 31.405  39.396 9.828  1.00 55.15  ? 34  GLU B CD  1 
ATOM   2910 O  OE1 . GLU B 2 34  ? 31.735  39.896 8.737  1.00 48.01  ? 34  GLU B OE1 1 
ATOM   2911 O  OE2 . GLU B 2 34  ? 32.126  39.432 10.849 1.00 57.51  ? 34  GLU B OE2 1 
ATOM   2912 N  N   . LEU B 2 35  ? 26.567  40.074 10.880 1.00 35.78  ? 35  LEU B N   1 
ATOM   2913 C  CA  . LEU B 2 35  ? 26.058  40.375 12.208 1.00 44.49  ? 35  LEU B CA  1 
ATOM   2914 C  C   . LEU B 2 35  ? 24.936  39.446 12.659 1.00 45.17  ? 35  LEU B C   1 
ATOM   2915 O  O   . LEU B 2 35  ? 24.834  39.130 13.846 1.00 46.28  ? 35  LEU B O   1 
ATOM   2916 C  CB  . LEU B 2 35  ? 25.636  41.842 12.267 1.00 50.67  ? 35  LEU B CB  1 
ATOM   2917 C  CG  . LEU B 2 35  ? 26.844  42.721 11.912 1.00 51.15  ? 35  LEU B CG  1 
ATOM   2918 C  CD1 . LEU B 2 35  ? 26.397  44.122 11.537 1.00 42.20  ? 35  LEU B CD1 1 
ATOM   2919 C  CD2 . LEU B 2 35  ? 27.807  42.741 13.082 1.00 45.67  ? 35  LEU B CD2 1 
ATOM   2920 N  N   . SER B 2 36  ? 24.093  39.007 11.729 1.00 41.92  ? 36  SER B N   1 
ATOM   2921 C  CA  . SER B 2 36  ? 23.026  38.078 12.092 1.00 43.68  ? 36  SER B CA  1 
ATOM   2922 C  C   . SER B 2 36  ? 23.660  36.728 12.398 1.00 32.32  ? 36  SER B C   1 
ATOM   2923 O  O   . SER B 2 36  ? 23.239  36.037 13.321 1.00 39.95  ? 36  SER B O   1 
ATOM   2924 C  CB  . SER B 2 36  ? 22.005  37.920 10.963 1.00 51.23  ? 36  SER B CB  1 
ATOM   2925 O  OG  . SER B 2 36  ? 21.061  38.975 10.972 1.00 62.89  ? 36  SER B OG  1 
ATOM   2926 N  N   . TYR B 2 37  ? 24.681  36.367 11.630 1.00 32.33  ? 37  TYR B N   1 
ATOM   2927 C  CA  . TYR B 2 37  ? 25.392  35.098 11.844 1.00 35.79  ? 37  TYR B CA  1 
ATOM   2928 C  C   . TYR B 2 37  ? 25.939  35.034 13.271 1.00 39.97  ? 37  TYR B C   1 
ATOM   2929 O  O   . TYR B 2 37  ? 25.839  34.002 13.946 1.00 41.48  ? 37  TYR B O   1 
ATOM   2930 C  CB  . TYR B 2 37  ? 26.560  34.955 10.869 1.00 42.43  ? 37  TYR B CB  1 
ATOM   2931 C  CG  . TYR B 2 37  ? 26.172  34.729 9.432  1.00 38.03  ? 37  TYR B CG  1 
ATOM   2932 C  CD1 . TYR B 2 37  ? 25.048  33.973 9.105  1.00 52.96  ? 37  TYR B CD1 1 
ATOM   2933 C  CD2 . TYR B 2 37  ? 26.966  35.215 8.393  1.00 53.66  ? 37  TYR B CD2 1 
ATOM   2934 C  CE1 . TYR B 2 37  ? 24.723  33.707 7.779  1.00 55.72  ? 37  TYR B CE1 1 
ATOM   2935 C  CE2 . TYR B 2 37  ? 26.651  34.951 7.062  1.00 39.61  ? 37  TYR B CE2 1 
ATOM   2936 C  CZ  . TYR B 2 37  ? 25.528  34.199 6.764  1.00 54.92  ? 37  TYR B CZ  1 
ATOM   2937 O  OH  . TYR B 2 37  ? 25.202  33.941 5.452  1.00 54.89  ? 37  TYR B OH  1 
ATOM   2938 N  N   . ARG B 2 38  ? 26.526  36.144 13.717 1.00 35.81  ? 38  ARG B N   1 
ATOM   2939 C  CA  . ARG B 2 38  ? 27.066  36.223 15.064 1.00 35.54  ? 38  ARG B CA  1 
ATOM   2940 C  C   . ARG B 2 38  ? 25.920  36.012 16.053 1.00 34.92  ? 38  ARG B C   1 
ATOM   2941 O  O   . ARG B 2 38  ? 26.007  35.174 16.947 1.00 42.03  ? 38  ARG B O   1 
ATOM   2942 C  CB  . ARG B 2 38  ? 27.727  37.589 15.281 1.00 26.46  ? 38  ARG B CB  1 
ATOM   2943 C  CG  . ARG B 2 38  ? 28.955  37.797 14.412 1.00 24.08  ? 38  ARG B CG  1 
ATOM   2944 C  CD  . ARG B 2 38  ? 29.537  39.219 14.569 1.00 25.36  ? 38  ARG B CD  1 
ATOM   2945 N  NE  . ARG B 2 38  ? 30.774  39.367 13.796 1.00 30.01  ? 38  ARG B NE  1 
ATOM   2946 C  CZ  . ARG B 2 38  ? 31.947  38.854 14.142 1.00 31.66  ? 38  ARG B CZ  1 
ATOM   2947 N  NH1 . ARG B 2 38  ? 32.059  38.160 15.271 1.00 42.25  ? 38  ARG B NH1 1 
ATOM   2948 N  NH2 . ARG B 2 38  ? 33.002  38.999 13.349 1.00 29.23  ? 38  ARG B NH2 1 
ATOM   2949 N  N   . GLN B 2 39  ? 24.836  36.757 15.866 1.00 33.76  ? 39  GLN B N   1 
ATOM   2950 C  CA  . GLN B 2 39  ? 23.670  36.665 16.744 1.00 28.59  ? 39  GLN B CA  1 
ATOM   2951 C  C   . GLN B 2 39  ? 23.046  35.284 16.719 1.00 32.20  ? 39  GLN B C   1 
ATOM   2952 O  O   . GLN B 2 39  ? 22.493  34.843 17.720 1.00 38.08  ? 39  GLN B O   1 
ATOM   2953 C  CB  . GLN B 2 39  ? 22.604  37.715 16.366 1.00 29.66  ? 39  GLN B CB  1 
ATOM   2954 C  CG  . GLN B 2 39  ? 23.160  39.143 16.236 1.00 34.19  ? 39  GLN B CG  1 
ATOM   2955 C  CD  . GLN B 2 39  ? 22.098  40.205 15.959 1.00 41.66  ? 39  GLN B CD  1 
ATOM   2956 O  OE1 . GLN B 2 39  ? 21.054  39.924 15.366 1.00 50.17  ? 39  GLN B OE1 1 
ATOM   2957 N  NE2 . GLN B 2 39  ? 22.378  41.444 16.369 1.00 39.74  ? 39  GLN B NE2 1 
ATOM   2958 N  N   . GLN B 2 40  ? 23.129  34.605 15.578 1.00 35.25  ? 40  GLN B N   1 
ATOM   2959 C  CA  . GLN B 2 40  ? 22.570  33.259 15.460 1.00 44.04  ? 40  GLN B CA  1 
ATOM   2960 C  C   . GLN B 2 40  ? 23.503  32.288 16.188 1.00 42.77  ? 40  GLN B C   1 
ATOM   2961 O  O   . GLN B 2 40  ? 23.059  31.382 16.901 1.00 36.33  ? 40  GLN B O   1 
ATOM   2962 C  CB  . GLN B 2 40  ? 22.410  32.882 13.978 1.00 50.80  ? 40  GLN B CB  1 
ATOM   2963 C  CG  . GLN B 2 40  ? 21.498  33.858 13.230 1.00 50.82  ? 40  GLN B CG  1 
ATOM   2964 C  CD  . GLN B 2 40  ? 21.356  33.569 11.743 1.00 49.26  ? 40  GLN B CD  1 
ATOM   2965 O  OE1 . GLN B 2 40  ? 22.338  33.344 11.036 1.00 52.52  ? 40  GLN B OE1 1 
ATOM   2966 N  NE2 . GLN B 2 40  ? 20.123  33.596 11.262 1.00 45.92  ? 40  GLN B NE2 1 
ATOM   2967 N  N   . ALA B 2 41  ? 24.804  32.499 16.031 1.00 34.07  ? 41  ALA B N   1 
ATOM   2968 C  CA  . ALA B 2 41  ? 25.751  31.643 16.712 1.00 40.52  ? 41  ALA B CA  1 
ATOM   2969 C  C   . ALA B 2 41  ? 25.553  31.789 18.223 1.00 37.76  ? 41  ALA B C   1 
ATOM   2970 O  O   . ALA B 2 41  ? 25.537  30.797 18.952 1.00 49.09  ? 41  ALA B O   1 
ATOM   2971 C  CB  . ALA B 2 41  ? 27.171  32.019 16.313 1.00 35.53  ? 41  ALA B CB  1 
ATOM   2972 N  N   . ALA B 2 42  ? 25.369  33.023 18.690 1.00 39.81  ? 42  ALA B N   1 
ATOM   2973 C  CA  . ALA B 2 42  ? 25.190  33.277 20.126 1.00 35.95  ? 42  ALA B CA  1 
ATOM   2974 C  C   . ALA B 2 42  ? 23.927  32.652 20.714 1.00 37.13  ? 42  ALA B C   1 
ATOM   2975 O  O   . ALA B 2 42  ? 23.899  32.215 21.879 1.00 32.99  ? 42  ALA B O   1 
ATOM   2976 C  CB  . ALA B 2 42  ? 25.185  34.770 20.388 1.00 35.87  ? 42  ALA B CB  1 
ATOM   2977 N  N   . ASN B 2 43  ? 22.874  32.633 19.908 1.00 32.92  ? 43  ASN B N   1 
ATOM   2978 C  CA  . ASN B 2 43  ? 21.596  32.065 20.311 1.00 35.36  ? 43  ASN B CA  1 
ATOM   2979 C  C   . ASN B 2 43  ? 21.796  30.547 20.440 1.00 36.52  ? 43  ASN B C   1 
ATOM   2980 O  O   . ASN B 2 43  ? 21.390  29.927 21.436 1.00 38.12  ? 43  ASN B O   1 
ATOM   2981 C  CB  . ASN B 2 43  ? 20.539  32.427 19.255 1.00 41.06  ? 43  ASN B CB  1 
ATOM   2982 C  CG  . ASN B 2 43  ? 19.178  31.840 19.552 1.00 36.63  ? 43  ASN B CG  1 
ATOM   2983 O  OD1 . ASN B 2 43  ? 18.731  31.808 20.701 1.00 50.24  ? 43  ASN B OD1 1 
ATOM   2984 N  ND2 . ASN B 2 43  ? 18.493  31.405 18.506 1.00 43.40  ? 43  ASN B ND2 1 
ATOM   2985 N  N   . LEU B 2 44  ? 22.447  29.950 19.447 1.00 31.33  ? 44  LEU B N   1 
ATOM   2986 C  CA  . LEU B 2 44  ? 22.740  28.520 19.513 1.00 45.88  ? 44  LEU B CA  1 
ATOM   2987 C  C   . LEU B 2 44  ? 23.548  28.242 20.786 1.00 46.85  ? 44  LEU B C   1 
ATOM   2988 O  O   . LEU B 2 44  ? 23.178  27.390 21.591 1.00 51.33  ? 44  LEU B O   1 
ATOM   2989 C  CB  . LEU B 2 44  ? 23.558  28.076 18.296 1.00 36.89  ? 44  LEU B CB  1 
ATOM   2990 C  CG  . LEU B 2 44  ? 23.883  26.580 18.208 1.00 42.76  ? 44  LEU B CG  1 
ATOM   2991 C  CD1 . LEU B 2 44  ? 22.607  25.761 18.183 1.00 38.68  ? 44  LEU B CD1 1 
ATOM   2992 C  CD2 . LEU B 2 44  ? 24.681  26.313 16.953 1.00 30.92  ? 44  LEU B CD2 1 
ATOM   2993 N  N   . LEU B 2 45  ? 24.650  28.968 20.964 1.00 41.81  ? 45  LEU B N   1 
ATOM   2994 C  CA  . LEU B 2 45  ? 25.499  28.781 22.137 1.00 40.77  ? 45  LEU B CA  1 
ATOM   2995 C  C   . LEU B 2 45  ? 24.694  28.882 23.426 1.00 37.16  ? 45  LEU B C   1 
ATOM   2996 O  O   . LEU B 2 45  ? 24.926  28.139 24.369 1.00 39.74  ? 45  LEU B O   1 
ATOM   2997 C  CB  . LEU B 2 45  ? 26.633  29.817 22.159 1.00 30.06  ? 45  LEU B CB  1 
ATOM   2998 C  CG  . LEU B 2 45  ? 27.695  29.672 21.066 1.00 33.45  ? 45  LEU B CG  1 
ATOM   2999 C  CD1 . LEU B 2 45  ? 28.548  30.938 20.970 1.00 28.31  ? 45  LEU B CD1 1 
ATOM   3000 C  CD2 . LEU B 2 45  ? 28.563  28.464 21.387 1.00 34.30  ? 45  LEU B CD2 1 
ATOM   3001 N  N   . GLN B 2 46  ? 23.738  29.801 23.456 1.00 38.07  ? 46  GLN B N   1 
ATOM   3002 C  CA  . GLN B 2 46  ? 22.928  29.992 24.643 1.00 31.68  ? 46  GLN B CA  1 
ATOM   3003 C  C   . GLN B 2 46  ? 21.954  28.839 24.824 1.00 32.73  ? 46  GLN B C   1 
ATOM   3004 O  O   . GLN B 2 46  ? 21.675  28.427 25.952 1.00 37.57  ? 46  GLN B O   1 
ATOM   3005 C  CB  . GLN B 2 46  ? 22.158  31.313 24.540 1.00 30.22  ? 46  GLN B CB  1 
ATOM   3006 C  CG  . GLN B 2 46  ? 21.304  31.655 25.750 1.00 34.80  ? 46  GLN B CG  1 
ATOM   3007 C  CD  . GLN B 2 46  ? 22.097  32.274 26.868 1.00 38.17  ? 46  GLN B CD  1 
ATOM   3008 O  OE1 . GLN B 2 46  ? 22.971  33.114 26.634 1.00 40.81  ? 46  GLN B OE1 1 
ATOM   3009 N  NE2 . GLN B 2 46  ? 21.786  31.890 28.099 1.00 32.00  ? 46  GLN B NE2 1 
ATOM   3010 N  N   . ASP B 2 47  ? 21.439  28.334 23.702 1.00 44.73  ? 47  ASP B N   1 
ATOM   3011 C  CA  . ASP B 2 47  ? 20.466  27.242 23.688 1.00 47.72  ? 47  ASP B CA  1 
ATOM   3012 C  C   . ASP B 2 47  ? 21.120  25.940 24.148 1.00 48.66  ? 47  ASP B C   1 
ATOM   3013 O  O   . ASP B 2 47  ? 20.656  25.317 25.100 1.00 50.99  ? 47  ASP B O   1 
ATOM   3014 C  CB  . ASP B 2 47  ? 19.886  27.074 22.277 1.00 48.99  ? 47  ASP B CB  1 
ATOM   3015 C  CG  . ASP B 2 47  ? 18.564  26.317 22.268 1.00 51.01  ? 47  ASP B CG  1 
ATOM   3016 O  OD1 . ASP B 2 47  ? 18.058  26.014 21.166 1.00 36.36  ? 47  ASP B OD1 1 
ATOM   3017 O  OD2 . ASP B 2 47  ? 18.029  26.031 23.362 1.00 38.69  ? 47  ASP B OD2 1 
ATOM   3018 N  N   . MET B 2 48  ? 22.192  25.528 23.474 1.00 46.52  ? 48  MET B N   1 
ATOM   3019 C  CA  . MET B 2 48  ? 22.892  24.311 23.874 1.00 42.91  ? 48  MET B CA  1 
ATOM   3020 C  C   . MET B 2 48  ? 23.380  24.500 25.304 1.00 44.72  ? 48  MET B C   1 
ATOM   3021 O  O   . MET B 2 48  ? 23.274  23.601 26.138 1.00 42.57  ? 48  MET B O   1 
ATOM   3022 C  CB  . MET B 2 48  ? 24.077  24.049 22.956 1.00 31.72  ? 48  MET B CB  1 
ATOM   3023 C  CG  . MET B 2 48  ? 23.697  23.913 21.500 1.00 37.45  ? 48  MET B CG  1 
ATOM   3024 S  SD  . MET B 2 48  ? 25.128  23.485 20.506 1.00 47.78  ? 48  MET B SD  1 
ATOM   3025 C  CE  . MET B 2 48  ? 26.191  24.821 20.865 1.00 48.68  ? 48  MET B CE  1 
ATOM   3026 N  N   . GLY B 2 49  ? 23.892  25.690 25.589 1.00 44.19  ? 49  GLY B N   1 
ATOM   3027 C  CA  . GLY B 2 49  ? 24.386  25.973 26.924 1.00 46.15  ? 49  GLY B CA  1 
ATOM   3028 C  C   . GLY B 2 49  ? 23.391  25.639 28.019 1.00 49.02  ? 49  GLY B C   1 
ATOM   3029 O  O   . GLY B 2 49  ? 23.730  24.950 28.980 1.00 57.06  ? 49  GLY B O   1 
ATOM   3030 N  N   . GLN B 2 50  ? 22.166  26.138 27.890 1.00 45.87  ? 50  GLN B N   1 
ATOM   3031 C  CA  . GLN B 2 50  ? 21.135  25.871 28.888 1.00 47.95  ? 50  GLN B CA  1 
ATOM   3032 C  C   . GLN B 2 50  ? 20.737  24.392 28.875 1.00 47.31  ? 50  GLN B C   1 
ATOM   3033 O  O   . GLN B 2 50  ? 20.416  23.830 29.923 1.00 41.66  ? 50  GLN B O   1 
ATOM   3034 C  CB  . GLN B 2 50  ? 19.914  26.760 28.643 1.00 49.47  ? 50  GLN B CB  1 
ATOM   3035 C  CG  . GLN B 2 50  ? 20.195  28.239 28.839 1.00 53.37  ? 50  GLN B CG  1 
ATOM   3036 C  CD  . GLN B 2 50  ? 18.967  29.108 28.619 1.00 60.16  ? 50  GLN B CD  1 
ATOM   3037 O  OE1 . GLN B 2 50  ? 19.054  30.333 28.627 1.00 47.95  ? 50  GLN B OE1 1 
ATOM   3038 N  NE2 . GLN B 2 50  ? 17.816  28.474 28.425 1.00 55.15  ? 50  GLN B NE2 1 
ATOM   3039 N  N   . ARG B 2 51  ? 20.754  23.768 27.696 1.00 41.28  ? 51  ARG B N   1 
ATOM   3040 C  CA  . ARG B 2 51  ? 20.435  22.341 27.587 1.00 48.20  ? 51  ARG B CA  1 
ATOM   3041 C  C   . ARG B 2 51  ? 21.429  21.586 28.475 1.00 54.16  ? 51  ARG B C   1 
ATOM   3042 O  O   . ARG B 2 51  ? 21.044  20.762 29.309 1.00 55.83  ? 51  ARG B O   1 
ATOM   3043 C  CB  . ARG B 2 51  ? 20.633  21.821 26.154 1.00 49.00  ? 51  ARG B CB  1 
ATOM   3044 C  CG  . ARG B 2 51  ? 19.919  22.557 25.044 1.00 52.07  ? 51  ARG B CG  1 
ATOM   3045 C  CD  . ARG B 2 51  ? 18.459  22.226 24.984 1.00 49.15  ? 51  ARG B CD  1 
ATOM   3046 N  NE  . ARG B 2 51  ? 17.857  22.713 23.745 1.00 58.73  ? 51  ARG B NE  1 
ATOM   3047 C  CZ  . ARG B 2 51  ? 16.629  22.397 23.341 1.00 66.44  ? 51  ARG B CZ  1 
ATOM   3048 N  NH1 . ARG B 2 51  ? 16.149  22.884 22.204 1.00 62.65  ? 51  ARG B NH1 1 
ATOM   3049 N  NH2 . ARG B 2 51  ? 15.883  21.579 24.072 1.00 56.63  ? 51  ARG B NH2 1 
ATOM   3050 N  N   . LEU B 2 52  ? 22.717  21.873 28.271 1.00 47.36  ? 52  LEU B N   1 
ATOM   3051 C  CA  . LEU B 2 52  ? 23.792  21.230 29.023 1.00 43.85  ? 52  LEU B CA  1 
ATOM   3052 C  C   . LEU B 2 52  ? 23.846  21.726 30.473 1.00 42.87  ? 52  LEU B C   1 
ATOM   3053 O  O   . LEU B 2 52  ? 24.500  21.131 31.336 1.00 40.49  ? 52  LEU B O   1 
ATOM   3054 C  CB  . LEU B 2 52  ? 25.124  21.489 28.309 1.00 34.57  ? 52  LEU B CB  1 
ATOM   3055 C  CG  . LEU B 2 52  ? 25.195  20.945 26.871 1.00 39.31  ? 52  LEU B CG  1 
ATOM   3056 C  CD1 . LEU B 2 52  ? 26.261  21.681 26.096 1.00 45.40  ? 52  LEU B CD1 1 
ATOM   3057 C  CD2 . LEU B 2 52  ? 25.482  19.435 26.873 1.00 35.81  ? 52  LEU B CD2 1 
ATOM   3058 N  N   . ASN B 2 53  ? 23.131  22.808 30.742 1.00 36.15  ? 53  ASN B N   1 
ATOM   3059 C  CA  . ASN B 2 53  ? 23.110  23.395 32.070 1.00 42.51  ? 53  ASN B CA  1 
ATOM   3060 C  C   . ASN B 2 53  ? 24.510  23.865 32.468 1.00 44.72  ? 53  ASN B C   1 
ATOM   3061 O  O   . ASN B 2 53  ? 24.903  23.755 33.633 1.00 45.45  ? 53  ASN B O   1 
ATOM   3062 C  CB  . ASN B 2 53  ? 22.558  22.402 33.113 1.00 36.57  ? 53  ASN B CB  1 
ATOM   3063 C  CG  . ASN B 2 53  ? 22.196  23.078 34.436 1.00 52.20  ? 53  ASN B CG  1 
ATOM   3064 O  OD1 . ASN B 2 53  ? 21.686  24.200 34.450 1.00 47.54  ? 53  ASN B OD1 1 
ATOM   3065 N  ND2 . ASN B 2 53  ? 22.444  22.389 35.551 1.00 43.88  ? 53  ASN B ND2 1 
ATOM   3066 N  N   . VAL B 2 54  ? 25.273  24.367 31.490 1.00 49.25  ? 54  VAL B N   1 
ATOM   3067 C  CA  . VAL B 2 54  ? 26.601  24.922 31.782 1.00 38.76  ? 54  VAL B CA  1 
ATOM   3068 C  C   . VAL B 2 54  ? 26.273  26.296 32.342 1.00 37.60  ? 54  VAL B C   1 
ATOM   3069 O  O   . VAL B 2 54  ? 25.183  26.815 32.095 1.00 44.22  ? 54  VAL B O   1 
ATOM   3070 C  CB  . VAL B 2 54  ? 27.464  25.087 30.523 1.00 38.12  ? 54  VAL B CB  1 
ATOM   3071 C  CG1 . VAL B 2 54  ? 27.684  23.734 29.874 1.00 47.50  ? 54  VAL B CG1 1 
ATOM   3072 C  CG2 . VAL B 2 54  ? 26.797  26.031 29.537 1.00 40.35  ? 54  VAL B CG2 1 
ATOM   3073 N  N   . SER B 2 55  ? 27.176  26.884 33.112 1.00 43.09  ? 55  SER B N   1 
ATOM   3074 C  CA  . SER B 2 55  ? 26.898  28.199 33.681 1.00 40.84  ? 55  SER B CA  1 
ATOM   3075 C  C   . SER B 2 55  ? 26.817  29.268 32.583 1.00 42.33  ? 55  SER B C   1 
ATOM   3076 O  O   . SER B 2 55  ? 27.209  29.022 31.425 1.00 38.83  ? 55  SER B O   1 
ATOM   3077 C  CB  . SER B 2 55  ? 27.980  28.577 34.699 1.00 41.30  ? 55  SER B CB  1 
ATOM   3078 O  OG  . SER B 2 55  ? 29.242  28.733 34.078 1.00 35.09  ? 55  SER B OG  1 
ATOM   3079 N  N   . GLN B 2 56  ? 26.293  30.445 32.941 1.00 39.47  ? 56  GLN B N   1 
ATOM   3080 C  CA  . GLN B 2 56  ? 26.188  31.550 31.984 1.00 36.80  ? 56  GLN B CA  1 
ATOM   3081 C  C   . GLN B 2 56  ? 27.603  31.996 31.644 1.00 26.67  ? 56  GLN B C   1 
ATOM   3082 O  O   . GLN B 2 56  ? 27.882  32.373 30.510 1.00 36.51  ? 56  GLN B O   1 
ATOM   3083 C  CB  . GLN B 2 56  ? 25.405  32.726 32.570 1.00 34.55  ? 56  GLN B CB  1 
ATOM   3084 C  CG  . GLN B 2 56  ? 25.176  33.876 31.571 1.00 34.23  ? 56  GLN B CG  1 
ATOM   3085 C  CD  . GLN B 2 56  ? 24.379  33.440 30.342 1.00 30.11  ? 56  GLN B CD  1 
ATOM   3086 O  OE1 . GLN B 2 56  ? 23.351  32.786 30.468 1.00 41.63  ? 56  GLN B OE1 1 
ATOM   3087 N  NE2 . GLN B 2 56  ? 24.850  33.808 29.154 1.00 25.98  ? 56  GLN B NE2 1 
ATOM   3088 N  N   . LEU B 2 57  ? 28.496  31.940 32.629 1.00 31.85  ? 57  LEU B N   1 
ATOM   3089 C  CA  . LEU B 2 57  ? 29.898  32.305 32.417 1.00 33.73  ? 57  LEU B CA  1 
ATOM   3090 C  C   . LEU B 2 57  ? 30.498  31.527 31.240 1.00 41.10  ? 57  LEU B C   1 
ATOM   3091 O  O   . LEU B 2 57  ? 31.290  32.078 30.474 1.00 32.53  ? 57  LEU B O   1 
ATOM   3092 C  CB  . LEU B 2 57  ? 30.721  32.032 33.681 1.00 33.64  ? 57  LEU B CB  1 
ATOM   3093 C  CG  . LEU B 2 57  ? 32.254  32.081 33.570 1.00 34.78  ? 57  LEU B CG  1 
ATOM   3094 C  CD1 . LEU B 2 57  ? 32.711  33.422 32.994 1.00 30.60  ? 57  LEU B CD1 1 
ATOM   3095 C  CD2 . LEU B 2 57  ? 32.858  31.879 34.959 1.00 27.96  ? 57  LEU B CD2 1 
ATOM   3096 N  N   . THR B 2 58  ? 30.104  30.257 31.104 1.00 40.62  ? 58  THR B N   1 
ATOM   3097 C  CA  . THR B 2 58  ? 30.569  29.369 30.029 1.00 37.35  ? 58  THR B CA  1 
ATOM   3098 C  C   . THR B 2 58  ? 30.041  29.817 28.668 1.00 31.68  ? 58  THR B C   1 
ATOM   3099 O  O   . THR B 2 58  ? 30.770  29.856 27.683 1.00 34.78  ? 58  THR B O   1 
ATOM   3100 C  CB  . THR B 2 58  ? 30.108  27.902 30.283 1.00 40.10  ? 58  THR B CB  1 
ATOM   3101 O  OG1 . THR B 2 58  ? 30.697  27.427 31.498 1.00 38.75  ? 58  THR B OG1 1 
ATOM   3102 C  CG2 . THR B 2 58  ? 30.512  26.979 29.128 1.00 26.66  ? 58  THR B CG2 1 
ATOM   3103 N  N   . ILE B 2 59  ? 28.759  30.145 28.623 1.00 37.68  ? 59  ILE B N   1 
ATOM   3104 C  CA  . ILE B 2 59  ? 28.131  30.602 27.399 1.00 32.61  ? 59  ILE B CA  1 
ATOM   3105 C  C   . ILE B 2 59  ? 28.738  31.948 26.974 1.00 29.07  ? 59  ILE B C   1 
ATOM   3106 O  O   . ILE B 2 59  ? 29.051  32.147 25.795 1.00 33.72  ? 59  ILE B O   1 
ATOM   3107 C  CB  . ILE B 2 59  ? 26.592  30.740 27.600 1.00 39.25  ? 59  ILE B CB  1 
ATOM   3108 C  CG1 . ILE B 2 59  ? 26.018  29.414 28.115 1.00 34.16  ? 59  ILE B CG1 1 
ATOM   3109 C  CG2 . ILE B 2 59  ? 25.921  31.099 26.284 1.00 31.96  ? 59  ILE B CG2 1 
ATOM   3110 C  CD1 . ILE B 2 59  ? 24.560  29.496 28.619 1.00 35.28  ? 59  ILE B CD1 1 
ATOM   3111 N  N   . ASN B 2 60  ? 28.923  32.858 27.933 1.00 30.81  ? 60  ASN B N   1 
ATOM   3112 C  CA  . ASN B 2 60  ? 29.500  34.183 27.644 1.00 35.59  ? 60  ASN B CA  1 
ATOM   3113 C  C   . ASN B 2 60  ? 30.908  34.058 27.070 1.00 34.18  ? 60  ASN B C   1 
ATOM   3114 O  O   . ASN B 2 60  ? 31.255  34.732 26.098 1.00 36.93  ? 60  ASN B O   1 
ATOM   3115 C  CB  . ASN B 2 60  ? 29.569  35.082 28.897 1.00 21.11  ? 60  ASN B CB  1 
ATOM   3116 C  CG  . ASN B 2 60  ? 28.194  35.486 29.428 1.00 37.10  ? 60  ASN B CG  1 
ATOM   3117 O  OD1 . ASN B 2 60  ? 27.188  35.347 28.746 1.00 31.93  ? 60  ASN B OD1 1 
ATOM   3118 N  ND2 . ASN B 2 60  ? 28.159  35.995 30.664 1.00 28.73  ? 60  ASN B ND2 1 
ATOM   3119 N  N   . THR B 2 61  ? 31.724  33.211 27.692 1.00 34.07  ? 61  THR B N   1 
ATOM   3120 C  CA  . THR B 2 61  ? 33.085  32.993 27.224 1.00 26.34  ? 61  THR B CA  1 
ATOM   3121 C  C   . THR B 2 61  ? 33.065  32.367 25.844 1.00 28.57  ? 61  THR B C   1 
ATOM   3122 O  O   . THR B 2 61  ? 33.890  32.710 24.995 1.00 30.78  ? 61  THR B O   1 
ATOM   3123 C  CB  . THR B 2 61  ? 33.871  32.066 28.186 1.00 29.88  ? 61  THR B CB  1 
ATOM   3124 O  OG1 . THR B 2 61  ? 34.256  32.801 29.355 1.00 34.29  ? 61  THR B OG1 1 
ATOM   3125 C  CG2 . THR B 2 61  ? 35.105  31.527 27.507 1.00 26.70  ? 61  THR B CG2 1 
ATOM   3126 N  N   . ALA B 2 62  ? 32.113  31.458 25.621 1.00 26.61  ? 62  ALA B N   1 
ATOM   3127 C  CA  . ALA B 2 62  ? 31.983  30.783 24.335 1.00 30.08  ? 62  ALA B CA  1 
ATOM   3128 C  C   . ALA B 2 62  ? 31.624  31.766 23.220 1.00 31.72  ? 62  ALA B C   1 
ATOM   3129 O  O   . ALA B 2 62  ? 32.081  31.629 22.085 1.00 34.73  ? 62  ALA B O   1 
ATOM   3130 C  CB  . ALA B 2 62  ? 30.921  29.663 24.434 1.00 28.45  ? 62  ALA B CB  1 
ATOM   3131 N  N   . ILE B 2 63  ? 30.790  32.752 23.554 1.00 38.18  ? 63  ILE B N   1 
ATOM   3132 C  CA  . ILE B 2 63  ? 30.376  33.771 22.594 1.00 32.16  ? 63  ILE B CA  1 
ATOM   3133 C  C   . ILE B 2 63  ? 31.540  34.671 22.190 1.00 30.75  ? 63  ILE B C   1 
ATOM   3134 O  O   . ILE B 2 63  ? 31.652  35.054 21.020 1.00 31.88  ? 63  ILE B O   1 
ATOM   3135 C  CB  . ILE B 2 63  ? 29.221  34.642 23.147 1.00 32.29  ? 63  ILE B CB  1 
ATOM   3136 C  CG1 . ILE B 2 63  ? 27.950  33.795 23.245 1.00 25.61  ? 63  ILE B CG1 1 
ATOM   3137 C  CG2 . ILE B 2 63  ? 28.956  35.850 22.204 1.00 26.36  ? 63  ILE B CG2 1 
ATOM   3138 C  CD1 . ILE B 2 63  ? 26.876  34.400 24.135 1.00 28.99  ? 63  ILE B CD1 1 
ATOM   3139 N  N   . VAL B 2 64  ? 32.405  35.009 23.150 1.00 26.58  ? 64  VAL B N   1 
ATOM   3140 C  CA  . VAL B 2 64  ? 33.561  35.834 22.835 1.00 24.88  ? 64  VAL B CA  1 
ATOM   3141 C  C   . VAL B 2 64  ? 34.514  35.010 21.971 1.00 25.29  ? 64  VAL B C   1 
ATOM   3142 O  O   . VAL B 2 64  ? 35.095  35.532 21.025 1.00 24.62  ? 64  VAL B O   1 
ATOM   3143 C  CB  . VAL B 2 64  ? 34.297  36.306 24.102 1.00 25.46  ? 64  VAL B CB  1 
ATOM   3144 C  CG1 . VAL B 2 64  ? 35.531  37.085 23.712 1.00 21.44  ? 64  VAL B CG1 1 
ATOM   3145 C  CG2 . VAL B 2 64  ? 33.373  37.178 24.953 1.00 25.89  ? 64  VAL B CG2 1 
ATOM   3146 N  N   . TYR B 2 65  ? 34.678  33.724 22.297 1.00 26.06  ? 65  TYR B N   1 
ATOM   3147 C  CA  . TYR B 2 65  ? 35.538  32.865 21.484 1.00 23.47  ? 65  TYR B CA  1 
ATOM   3148 C  C   . TYR B 2 65  ? 35.000  32.941 20.040 1.00 26.79  ? 65  TYR B C   1 
ATOM   3149 O  O   . TYR B 2 65  ? 35.762  33.087 19.081 1.00 27.19  ? 65  TYR B O   1 
ATOM   3150 C  CB  . TYR B 2 65  ? 35.498  31.409 21.974 1.00 25.57  ? 65  TYR B CB  1 
ATOM   3151 C  CG  . TYR B 2 65  ? 36.297  31.093 23.243 1.00 30.57  ? 65  TYR B CG  1 
ATOM   3152 C  CD1 . TYR B 2 65  ? 37.200  32.006 23.791 1.00 22.81  ? 65  TYR B CD1 1 
ATOM   3153 C  CD2 . TYR B 2 65  ? 36.157  29.866 23.872 1.00 23.52  ? 65  TYR B CD2 1 
ATOM   3154 C  CE1 . TYR B 2 65  ? 37.935  31.694 24.937 1.00 35.79  ? 65  TYR B CE1 1 
ATOM   3155 C  CE2 . TYR B 2 65  ? 36.881  29.543 25.016 1.00 27.30  ? 65  TYR B CE2 1 
ATOM   3156 C  CZ  . TYR B 2 65  ? 37.764  30.456 25.544 1.00 31.89  ? 65  TYR B CZ  1 
ATOM   3157 O  OH  . TYR B 2 65  ? 38.450  30.142 26.688 1.00 35.18  ? 65  TYR B OH  1 
ATOM   3158 N  N   . MET B 2 66  ? 33.675  32.864 19.910 1.00 31.27  ? 66  MET B N   1 
ATOM   3159 C  CA  . MET B 2 66  ? 33.002  32.937 18.611 1.00 34.32  ? 66  MET B CA  1 
ATOM   3160 C  C   . MET B 2 66  ? 33.270  34.270 17.896 1.00 31.71  ? 66  MET B C   1 
ATOM   3161 O  O   . MET B 2 66  ? 33.701  34.279 16.742 1.00 32.41  ? 66  MET B O   1 
ATOM   3162 C  CB  . MET B 2 66  ? 31.490  32.723 18.810 1.00 31.88  ? 66  MET B CB  1 
ATOM   3163 C  CG  . MET B 2 66  ? 30.629  32.780 17.542 1.00 33.94  ? 66  MET B CG  1 
ATOM   3164 S  SD  . MET B 2 66  ? 30.268  34.463 16.910 1.00 32.91  ? 66  MET B SD  1 
ATOM   3165 C  CE  . MET B 2 66  ? 29.112  35.026 18.088 1.00 19.19  ? 66  MET B CE  1 
ATOM   3166 N  N   . HIS B 2 67  ? 33.027  35.389 18.585 1.00 32.72  ? 67  HIS B N   1 
ATOM   3167 C  CA  . HIS B 2 67  ? 33.244  36.710 17.988 1.00 30.02  ? 67  HIS B CA  1 
ATOM   3168 C  C   . HIS B 2 67  ? 34.679  36.920 17.549 1.00 29.24  ? 67  HIS B C   1 
ATOM   3169 O  O   . HIS B 2 67  ? 34.916  37.520 16.510 1.00 30.87  ? 67  HIS B O   1 
ATOM   3170 C  CB  . HIS B 2 67  ? 32.850  37.844 18.946 1.00 27.68  ? 67  HIS B CB  1 
ATOM   3171 C  CG  . HIS B 2 67  ? 31.383  38.148 18.960 1.00 32.88  ? 67  HIS B CG  1 
ATOM   3172 N  ND1 . HIS B 2 67  ? 30.677  38.466 17.819 1.00 32.36  ? 67  HIS B ND1 1 
ATOM   3173 C  CD2 . HIS B 2 67  ? 30.496  38.205 19.981 1.00 24.07  ? 67  HIS B CD2 1 
ATOM   3174 C  CE1 . HIS B 2 67  ? 29.420  38.704 18.139 1.00 27.75  ? 67  HIS B CE1 1 
ATOM   3175 N  NE2 . HIS B 2 67  ? 29.282  38.554 19.444 1.00 32.45  ? 67  HIS B NE2 1 
ATOM   3176 N  N   . ARG B 2 68  ? 35.634  36.429 18.335 1.00 29.65  ? 68  ARG B N   1 
ATOM   3177 C  CA  . ARG B 2 68  ? 37.032  36.571 17.970 1.00 27.66  ? 68  ARG B CA  1 
ATOM   3178 C  C   . ARG B 2 68  ? 37.399  35.649 16.825 1.00 26.10  ? 68  ARG B C   1 
ATOM   3179 O  O   . ARG B 2 68  ? 38.142  36.035 15.922 1.00 28.18  ? 68  ARG B O   1 
ATOM   3180 C  CB  . ARG B 2 68  ? 37.937  36.285 19.164 1.00 27.35  ? 68  ARG B CB  1 
ATOM   3181 C  CG  . ARG B 2 68  ? 37.861  37.386 20.189 1.00 32.49  ? 68  ARG B CG  1 
ATOM   3182 C  CD  . ARG B 2 68  ? 38.830  37.184 21.314 1.00 27.73  ? 68  ARG B CD  1 
ATOM   3183 N  NE  . ARG B 2 68  ? 38.666  38.234 22.305 1.00 30.09  ? 68  ARG B NE  1 
ATOM   3184 C  CZ  . ARG B 2 68  ? 39.370  38.308 23.424 1.00 24.82  ? 68  ARG B CZ  1 
ATOM   3185 N  NH1 . ARG B 2 68  ? 40.276  37.380 23.695 1.00 23.90  ? 68  ARG B NH1 1 
ATOM   3186 N  NH2 . ARG B 2 68  ? 39.201  39.339 24.243 1.00 32.79  ? 68  ARG B NH2 1 
ATOM   3187 N  N   . PHE B 2 69  ? 36.889  34.424 16.879 1.00 31.00  ? 69  PHE B N   1 
ATOM   3188 C  CA  . PHE B 2 69  ? 37.154  33.445 15.835 1.00 29.79  ? 69  PHE B CA  1 
ATOM   3189 C  C   . PHE B 2 69  ? 36.877  34.096 14.482 1.00 32.47  ? 69  PHE B C   1 
ATOM   3190 O  O   . PHE B 2 69  ? 37.707  34.066 13.574 1.00 33.98  ? 69  PHE B O   1 
ATOM   3191 C  CB  . PHE B 2 69  ? 36.236  32.239 16.017 1.00 34.43  ? 69  PHE B CB  1 
ATOM   3192 C  CG  . PHE B 2 69  ? 36.461  31.145 15.012 1.00 39.13  ? 69  PHE B CG  1 
ATOM   3193 C  CD1 . PHE B 2 69  ? 37.466  30.200 15.206 1.00 33.69  ? 69  PHE B CD1 1 
ATOM   3194 C  CD2 . PHE B 2 69  ? 35.659  31.051 13.876 1.00 28.61  ? 69  PHE B CD2 1 
ATOM   3195 C  CE1 . PHE B 2 69  ? 37.668  29.175 14.288 1.00 38.19  ? 69  PHE B CE1 1 
ATOM   3196 C  CE2 . PHE B 2 69  ? 35.851  30.034 12.954 1.00 41.24  ? 69  PHE B CE2 1 
ATOM   3197 C  CZ  . PHE B 2 69  ? 36.861  29.089 13.160 1.00 45.26  ? 69  PHE B CZ  1 
ATOM   3198 N  N   . TYR B 2 70  ? 35.708  34.717 14.375 1.00 32.21  ? 70  TYR B N   1 
ATOM   3199 C  CA  . TYR B 2 70  ? 35.292  35.356 13.137 1.00 33.10  ? 70  TYR B CA  1 
ATOM   3200 C  C   . TYR B 2 70  ? 35.906  36.684 12.741 1.00 31.42  ? 70  TYR B C   1 
ATOM   3201 O  O   . TYR B 2 70  ? 35.439  37.319 11.803 1.00 36.57  ? 70  TYR B O   1 
ATOM   3202 C  CB  . TYR B 2 70  ? 33.770  35.430 13.094 1.00 32.81  ? 70  TYR B CB  1 
ATOM   3203 C  CG  . TYR B 2 70  ? 33.197  34.054 12.890 1.00 38.90  ? 70  TYR B CG  1 
ATOM   3204 C  CD1 . TYR B 2 70  ? 33.474  33.345 11.721 1.00 31.83  ? 70  TYR B CD1 1 
ATOM   3205 C  CD2 . TYR B 2 70  ? 32.436  33.435 13.882 1.00 32.06  ? 70  TYR B CD2 1 
ATOM   3206 C  CE1 . TYR B 2 70  ? 33.017  32.063 11.541 1.00 35.12  ? 70  TYR B CE1 1 
ATOM   3207 C  CE2 . TYR B 2 70  ? 31.972  32.147 13.710 1.00 40.51  ? 70  TYR B CE2 1 
ATOM   3208 C  CZ  . TYR B 2 70  ? 32.264  31.466 12.537 1.00 28.65  ? 70  TYR B CZ  1 
ATOM   3209 O  OH  . TYR B 2 70  ? 31.781  30.201 12.341 1.00 36.06  ? 70  TYR B OH  1 
ATOM   3210 N  N   . MET B 2 71  ? 36.944  37.116 13.451 1.00 34.11  ? 71  MET B N   1 
ATOM   3211 C  CA  . MET B 2 71  ? 37.634  38.331 13.054 1.00 31.06  ? 71  MET B CA  1 
ATOM   3212 C  C   . MET B 2 71  ? 38.832  37.799 12.311 1.00 29.85  ? 71  MET B C   1 
ATOM   3213 O  O   . MET B 2 71  ? 39.582  38.553 11.696 1.00 29.43  ? 71  MET B O   1 
ATOM   3214 C  CB  . MET B 2 71  ? 38.110  39.162 14.247 1.00 37.82  ? 71  MET B CB  1 
ATOM   3215 C  CG  . MET B 2 71  ? 37.051  40.047 14.875 1.00 34.78  ? 71  MET B CG  1 
ATOM   3216 S  SD  . MET B 2 71  ? 35.978  40.829 13.644 1.00 43.79  ? 71  MET B SD  1 
ATOM   3217 C  CE  . MET B 2 71  ? 37.116  41.923 12.828 1.00 28.03  ? 71  MET B CE  1 
ATOM   3218 N  N   . ILE B 2 72  ? 39.000  36.478 12.360 1.00 28.42  ? 72  ILE B N   1 
ATOM   3219 C  CA  . ILE B 2 72  ? 40.140  35.842 11.696 1.00 34.52  ? 72  ILE B CA  1 
ATOM   3220 C  C   . ILE B 2 72  ? 39.697  34.872 10.595 1.00 37.09  ? 72  ILE B C   1 
ATOM   3221 O  O   . ILE B 2 72  ? 40.265  34.865 9.516  1.00 35.06  ? 72  ILE B O   1 
ATOM   3222 C  CB  . ILE B 2 72  ? 41.012  35.064 12.709 1.00 42.49  ? 72  ILE B CB  1 
ATOM   3223 C  CG1 . ILE B 2 72  ? 41.471  35.992 13.840 1.00 36.05  ? 72  ILE B CG1 1 
ATOM   3224 C  CG2 . ILE B 2 72  ? 42.215  34.459 11.996 1.00 32.06  ? 72  ILE B CG2 1 
ATOM   3225 C  CD1 . ILE B 2 72  ? 42.582  36.935 13.457 1.00 37.25  ? 72  ILE B CD1 1 
ATOM   3226 N  N   . GLN B 2 73  ? 38.697  34.050 10.895 1.00 42.02  ? 73  GLN B N   1 
ATOM   3227 C  CA  . GLN B 2 73  ? 38.163  33.090 9.943  1.00 39.17  ? 73  GLN B CA  1 
ATOM   3228 C  C   . GLN B 2 73  ? 36.833  33.632 9.436  1.00 41.76  ? 73  GLN B C   1 
ATOM   3229 O  O   . GLN B 2 73  ? 36.195  34.463 10.091 1.00 49.06  ? 73  GLN B O   1 
ATOM   3230 C  CB  . GLN B 2 73  ? 37.929  31.720 10.591 1.00 37.78  ? 73  GLN B CB  1 
ATOM   3231 C  CG  . GLN B 2 73  ? 39.118  31.105 11.340 1.00 35.48  ? 73  GLN B CG  1 
ATOM   3232 C  CD  . GLN B 2 73  ? 40.356  30.965 10.493 1.00 42.11  ? 73  GLN B CD  1 
ATOM   3233 O  OE1 . GLN B 2 73  ? 40.284  30.887 9.265  1.00 48.79  ? 73  GLN B OE1 1 
ATOM   3234 N  NE2 . GLN B 2 73  ? 41.508  30.909 11.147 1.00 44.47  ? 73  GLN B NE2 1 
ATOM   3235 N  N   . SER B 2 74  ? 36.411  33.129 8.281  1.00 49.54  ? 74  SER B N   1 
ATOM   3236 C  CA  . SER B 2 74  ? 35.174  33.552 7.622  1.00 48.71  ? 74  SER B CA  1 
ATOM   3237 C  C   . SER B 2 74  ? 33.981  32.620 7.843  1.00 40.63  ? 74  SER B C   1 
ATOM   3238 O  O   . SER B 2 74  ? 34.147  31.407 7.884  1.00 40.62  ? 74  SER B O   1 
ATOM   3239 C  CB  . SER B 2 74  ? 35.433  33.679 6.122  1.00 38.34  ? 74  SER B CB  1 
ATOM   3240 O  OG  . SER B 2 74  ? 34.213  33.781 5.421  1.00 55.47  ? 74  SER B OG  1 
ATOM   3241 N  N   . PHE B 2 75  ? 32.784  33.193 7.985  1.00 40.25  ? 75  PHE B N   1 
ATOM   3242 C  CA  . PHE B 2 75  ? 31.561  32.405 8.169  1.00 44.84  ? 75  PHE B CA  1 
ATOM   3243 C  C   . PHE B 2 75  ? 31.358  31.488 6.964  1.00 49.68  ? 75  PHE B C   1 
ATOM   3244 O  O   . PHE B 2 75  ? 30.597  30.522 7.017  1.00 40.68  ? 75  PHE B O   1 
ATOM   3245 C  CB  . PHE B 2 75  ? 30.346  33.326 8.320  1.00 42.23  ? 75  PHE B CB  1 
ATOM   3246 C  CG  . PHE B 2 75  ? 30.028  33.673 9.743  1.00 37.23  ? 75  PHE B CG  1 
ATOM   3247 C  CD1 . PHE B 2 75  ? 29.531  32.701 10.606 1.00 35.48  ? 75  PHE B CD1 1 
ATOM   3248 C  CD2 . PHE B 2 75  ? 30.273  34.956 10.237 1.00 45.82  ? 75  PHE B CD2 1 
ATOM   3249 C  CE1 . PHE B 2 75  ? 29.285  32.989 11.943 1.00 31.05  ? 75  PHE B CE1 1 
ATOM   3250 C  CE2 . PHE B 2 75  ? 30.029  35.266 11.582 1.00 30.38  ? 75  PHE B CE2 1 
ATOM   3251 C  CZ  . PHE B 2 75  ? 29.536  34.281 12.437 1.00 36.57  ? 75  PHE B CZ  1 
ATOM   3252 N  N   . THR B 2 76  ? 32.036  31.824 5.871  1.00 50.24  ? 76  THR B N   1 
ATOM   3253 C  CA  . THR B 2 76  ? 31.982  31.046 4.649  1.00 50.97  ? 76  THR B CA  1 
ATOM   3254 C  C   . THR B 2 76  ? 32.588  29.681 4.918  1.00 56.07  ? 76  THR B C   1 
ATOM   3255 O  O   . THR B 2 76  ? 31.901  28.661 4.872  1.00 61.35  ? 76  THR B O   1 
ATOM   3256 C  CB  . THR B 2 76  ? 32.803  31.712 3.539  1.00 43.17  ? 76  THR B CB  1 
ATOM   3257 O  OG1 . THR B 2 76  ? 32.118  32.879 3.072  1.00 52.51  ? 76  THR B OG1 1 
ATOM   3258 C  CG2 . THR B 2 76  ? 33.037  30.746 2.394  1.00 60.45  ? 76  THR B CG2 1 
ATOM   3259 N  N   . GLN B 2 77  ? 33.884  29.681 5.207  1.00 55.48  ? 77  GLN B N   1 
ATOM   3260 C  CA  . GLN B 2 77  ? 34.632  28.459 5.468  1.00 51.66  ? 77  GLN B CA  1 
ATOM   3261 C  C   . GLN B 2 77  ? 34.261  27.736 6.762  1.00 54.00  ? 77  GLN B C   1 
ATOM   3262 O  O   . GLN B 2 77  ? 34.508  26.543 6.899  1.00 50.27  ? 77  GLN B O   1 
ATOM   3263 C  CB  . GLN B 2 77  ? 36.122  28.777 5.480  1.00 51.47  ? 77  GLN B CB  1 
ATOM   3264 C  CG  . GLN B 2 77  ? 37.025  27.569 5.645  1.00 54.12  ? 77  GLN B CG  1 
ATOM   3265 C  CD  . GLN B 2 77  ? 38.494  27.953 5.741  1.00 63.83  ? 77  GLN B CD  1 
ATOM   3266 O  OE1 . GLN B 2 77  ? 39.366  27.094 5.886  1.00 71.87  ? 77  GLN B OE1 1 
ATOM   3267 N  NE2 . GLN B 2 77  ? 38.773  29.251 5.660  1.00 65.52  ? 77  GLN B NE2 1 
ATOM   3268 N  N   . PHE B 2 78  ? 33.669  28.452 7.710  1.00 57.31  ? 78  PHE B N   1 
ATOM   3269 C  CA  . PHE B 2 78  ? 33.308  27.850 8.986  1.00 52.58  ? 78  PHE B CA  1 
ATOM   3270 C  C   . PHE B 2 78  ? 31.908  28.246 9.426  1.00 53.87  ? 78  PHE B C   1 
ATOM   3271 O  O   . PHE B 2 78  ? 31.716  29.270 10.077 1.00 55.44  ? 78  PHE B O   1 
ATOM   3272 C  CB  . PHE B 2 78  ? 34.307  28.274 10.066 1.00 51.23  ? 78  PHE B CB  1 
ATOM   3273 C  CG  . PHE B 2 78  ? 35.708  27.797 9.832  1.00 33.28  ? 78  PHE B CG  1 
ATOM   3274 C  CD1 . PHE B 2 78  ? 36.085  26.504 10.176 1.00 45.10  ? 78  PHE B CD1 1 
ATOM   3275 C  CD2 . PHE B 2 78  ? 36.660  28.644 9.275  1.00 49.89  ? 78  PHE B CD2 1 
ATOM   3276 C  CE1 . PHE B 2 78  ? 37.395  26.060 9.971  1.00 39.96  ? 78  PHE B CE1 1 
ATOM   3277 C  CE2 . PHE B 2 78  ? 37.974  28.214 9.061  1.00 35.49  ? 78  PHE B CE2 1 
ATOM   3278 C  CZ  . PHE B 2 78  ? 38.341  26.921 9.411  1.00 37.48  ? 78  PHE B CZ  1 
ATOM   3279 N  N   . PRO B 2 79  ? 30.908  27.428 9.089  1.00 59.38  ? 79  PRO B N   1 
ATOM   3280 C  CA  . PRO B 2 79  ? 29.525  27.723 9.467  1.00 55.72  ? 79  PRO B CA  1 
ATOM   3281 C  C   . PRO B 2 79  ? 29.358  27.920 10.972 1.00 54.53  ? 79  PRO B C   1 
ATOM   3282 O  O   . PRO B 2 79  ? 29.826  27.105 11.779 1.00 52.70  ? 79  PRO B O   1 
ATOM   3283 C  CB  . PRO B 2 79  ? 28.764  26.500 8.962  1.00 56.78  ? 79  PRO B CB  1 
ATOM   3284 C  CG  . PRO B 2 79  ? 29.575  26.068 7.781  1.00 62.64  ? 79  PRO B CG  1 
ATOM   3285 C  CD  . PRO B 2 79  ? 30.984  26.191 8.293  1.00 62.08  ? 79  PRO B CD  1 
ATOM   3286 N  N   . GLY B 2 80  ? 28.686  29.002 11.346 1.00 49.36  ? 80  GLY B N   1 
ATOM   3287 C  CA  . GLY B 2 80  ? 28.458  29.266 12.754 1.00 46.19  ? 80  GLY B CA  1 
ATOM   3288 C  C   . GLY B 2 80  ? 27.888  28.065 13.491 1.00 52.30  ? 80  GLY B C   1 
ATOM   3289 O  O   . GLY B 2 80  ? 28.184  27.853 14.670 1.00 52.17  ? 80  GLY B O   1 
ATOM   3290 N  N   . ASN B 2 81  ? 27.079  27.261 12.808 1.00 51.25  ? 81  ASN B N   1 
ATOM   3291 C  CA  . ASN B 2 81  ? 26.479  26.093 13.447 1.00 53.36  ? 81  ASN B CA  1 
ATOM   3292 C  C   . ASN B 2 81  ? 27.453  24.946 13.703 1.00 50.27  ? 81  ASN B C   1 
ATOM   3293 O  O   . ASN B 2 81  ? 27.132  23.999 14.418 1.00 50.77  ? 81  ASN B O   1 
ATOM   3294 C  CB  . ASN B 2 81  ? 25.286  25.590 12.631 1.00 55.06  ? 81  ASN B CB  1 
ATOM   3295 C  CG  . ASN B 2 81  ? 24.154  26.592 12.587 1.00 59.68  ? 81  ASN B CG  1 
ATOM   3296 O  OD1 . ASN B 2 81  ? 24.076  27.422 11.683 1.00 63.87  ? 81  ASN B OD1 1 
ATOM   3297 N  ND2 . ASN B 2 81  ? 23.279  26.534 13.581 1.00 59.81  ? 81  ASN B ND2 1 
ATOM   3298 N  N   . SER B 2 82  ? 28.642  25.024 13.119 1.00 58.41  ? 82  SER B N   1 
ATOM   3299 C  CA  . SER B 2 82  ? 29.644  23.986 13.339 1.00 62.92  ? 82  SER B CA  1 
ATOM   3300 C  C   . SER B 2 82  ? 30.509  24.457 14.493 1.00 59.86  ? 82  SER B C   1 
ATOM   3301 O  O   . SER B 2 82  ? 30.677  23.764 15.497 1.00 64.21  ? 82  SER B O   1 
ATOM   3302 C  CB  . SER B 2 82  ? 30.522  23.798 12.096 1.00 59.97  ? 82  SER B CB  1 
ATOM   3303 O  OG  . SER B 2 82  ? 29.769  23.299 11.004 1.00 71.85  ? 82  SER B OG  1 
ATOM   3304 N  N   . VAL B 2 83  ? 31.037  25.662 14.333 1.00 51.98  ? 83  VAL B N   1 
ATOM   3305 C  CA  . VAL B 2 83  ? 31.908  26.281 15.313 1.00 43.78  ? 83  VAL B CA  1 
ATOM   3306 C  C   . VAL B 2 83  ? 31.304  26.387 16.713 1.00 46.59  ? 83  VAL B C   1 
ATOM   3307 O  O   . VAL B 2 83  ? 31.987  26.188 17.715 1.00 42.45  ? 83  VAL B O   1 
ATOM   3308 C  CB  . VAL B 2 83  ? 32.315  27.687 14.830 1.00 46.78  ? 83  VAL B CB  1 
ATOM   3309 C  CG1 . VAL B 2 83  ? 33.140  28.402 15.910 1.00 37.73  ? 83  VAL B CG1 1 
ATOM   3310 C  CG2 . VAL B 2 83  ? 33.083  27.572 13.517 1.00 34.17  ? 83  VAL B CG2 1 
ATOM   3311 N  N   . ALA B 2 84  ? 30.022  26.700 16.780 1.00 47.14  ? 84  ALA B N   1 
ATOM   3312 C  CA  . ALA B 2 84  ? 29.367  26.860 18.063 1.00 41.30  ? 84  ALA B CA  1 
ATOM   3313 C  C   . ALA B 2 84  ? 29.561  25.660 18.997 1.00 41.60  ? 84  ALA B C   1 
ATOM   3314 O  O   . ALA B 2 84  ? 30.030  25.814 20.134 1.00 38.04  ? 84  ALA B O   1 
ATOM   3315 C  CB  . ALA B 2 84  ? 27.877  27.150 17.846 1.00 42.82  ? 84  ALA B CB  1 
ATOM   3316 N  N   . PRO B 2 85  ? 29.184  24.450 18.547 1.00 47.62  ? 85  PRO B N   1 
ATOM   3317 C  CA  . PRO B 2 85  ? 29.347  23.266 19.399 1.00 47.99  ? 85  PRO B CA  1 
ATOM   3318 C  C   . PRO B 2 85  ? 30.760  23.179 19.972 1.00 39.28  ? 85  PRO B C   1 
ATOM   3319 O  O   . PRO B 2 85  ? 30.954  22.990 21.176 1.00 40.82  ? 85  PRO B O   1 
ATOM   3320 C  CB  . PRO B 2 85  ? 29.042  22.119 18.444 1.00 44.96  ? 85  PRO B CB  1 
ATOM   3321 C  CG  . PRO B 2 85  ? 27.973  22.710 17.579 1.00 46.87  ? 85  PRO B CG  1 
ATOM   3322 C  CD  . PRO B 2 85  ? 28.525  24.091 17.278 1.00 47.34  ? 85  PRO B CD  1 
ATOM   3323 N  N   . ALA B 2 86  ? 31.736  23.328 19.088 1.00 36.73  ? 86  ALA B N   1 
ATOM   3324 C  CA  . ALA B 2 86  ? 33.133  23.269 19.469 1.00 43.62  ? 86  ALA B CA  1 
ATOM   3325 C  C   . ALA B 2 86  ? 33.532  24.364 20.471 1.00 37.98  ? 86  ALA B C   1 
ATOM   3326 O  O   . ALA B 2 86  ? 34.162  24.080 21.488 1.00 34.01  ? 86  ALA B O   1 
ATOM   3327 C  CB  . ALA B 2 86  ? 34.007  23.343 18.218 1.00 39.50  ? 86  ALA B CB  1 
ATOM   3328 N  N   . ALA B 2 87  ? 33.163  25.608 20.201 1.00 45.17  ? 87  ALA B N   1 
ATOM   3329 C  CA  . ALA B 2 87  ? 33.527  26.700 21.107 1.00 33.46  ? 87  ALA B CA  1 
ATOM   3330 C  C   . ALA B 2 87  ? 32.968  26.437 22.489 1.00 36.31  ? 87  ALA B C   1 
ATOM   3331 O  O   . ALA B 2 87  ? 33.646  26.642 23.514 1.00 31.53  ? 87  ALA B O   1 
ATOM   3332 C  CB  . ALA B 2 87  ? 32.989  28.005 20.576 1.00 35.73  ? 87  ALA B CB  1 
ATOM   3333 N  N   . LEU B 2 88  ? 31.723  25.975 22.518 1.00 31.80  ? 88  LEU B N   1 
ATOM   3334 C  CA  . LEU B 2 88  ? 31.060  25.693 23.781 1.00 30.51  ? 88  LEU B CA  1 
ATOM   3335 C  C   . LEU B 2 88  ? 31.738  24.515 24.514 1.00 30.41  ? 88  LEU B C   1 
ATOM   3336 O  O   . LEU B 2 88  ? 31.880  24.532 25.741 1.00 33.22  ? 88  LEU B O   1 
ATOM   3337 C  CB  . LEU B 2 88  ? 29.580  25.407 23.531 1.00 35.02  ? 88  LEU B CB  1 
ATOM   3338 C  CG  . LEU B 2 88  ? 28.712  25.339 24.785 1.00 32.38  ? 88  LEU B CG  1 
ATOM   3339 C  CD1 . LEU B 2 88  ? 28.650  26.712 25.453 1.00 35.65  ? 88  LEU B CD1 1 
ATOM   3340 C  CD2 . LEU B 2 88  ? 27.319  24.877 24.396 1.00 46.80  ? 88  LEU B CD2 1 
ATOM   3341 N  N   . PHE B 2 89  ? 32.165  23.501 23.761 1.00 38.57  ? 89  PHE B N   1 
ATOM   3342 C  CA  . PHE B 2 89  ? 32.845  22.358 24.369 1.00 39.03  ? 89  PHE B CA  1 
ATOM   3343 C  C   . PHE B 2 89  ? 34.107  22.893 25.043 1.00 36.99  ? 89  PHE B C   1 
ATOM   3344 O  O   . PHE B 2 89  ? 34.363  22.649 26.217 1.00 29.73  ? 89  PHE B O   1 
ATOM   3345 C  CB  . PHE B 2 89  ? 33.237  21.329 23.308 1.00 40.38  ? 89  PHE B CB  1 
ATOM   3346 C  CG  . PHE B 2 89  ? 33.870  20.093 23.875 1.00 39.31  ? 89  PHE B CG  1 
ATOM   3347 C  CD1 . PHE B 2 89  ? 35.093  19.639 23.397 1.00 43.89  ? 89  PHE B CD1 1 
ATOM   3348 C  CD2 . PHE B 2 89  ? 33.245  19.382 24.895 1.00 38.43  ? 89  PHE B CD2 1 
ATOM   3349 C  CE1 . PHE B 2 89  ? 35.688  18.492 23.928 1.00 43.28  ? 89  PHE B CE1 1 
ATOM   3350 C  CE2 . PHE B 2 89  ? 33.831  18.238 25.426 1.00 43.11  ? 89  PHE B CE2 1 
ATOM   3351 C  CZ  . PHE B 2 89  ? 35.057  17.793 24.942 1.00 35.13  ? 89  PHE B CZ  1 
ATOM   3352 N  N   . LEU B 2 90  ? 34.894  23.635 24.279 1.00 33.01  ? 90  LEU B N   1 
ATOM   3353 C  CA  . LEU B 2 90  ? 36.112  24.231 24.803 1.00 28.23  ? 90  LEU B CA  1 
ATOM   3354 C  C   . LEU B 2 90  ? 35.868  25.133 26.018 1.00 34.17  ? 90  LEU B C   1 
ATOM   3355 O  O   . LEU B 2 90  ? 36.609  25.070 27.014 1.00 30.05  ? 90  LEU B O   1 
ATOM   3356 C  CB  . LEU B 2 90  ? 36.787  25.042 23.698 1.00 28.09  ? 90  LEU B CB  1 
ATOM   3357 C  CG  . LEU B 2 90  ? 38.023  25.858 24.080 1.00 34.83  ? 90  LEU B CG  1 
ATOM   3358 C  CD1 . LEU B 2 90  ? 39.103  24.961 24.723 1.00 37.61  ? 90  LEU B CD1 1 
ATOM   3359 C  CD2 . LEU B 2 90  ? 38.547  26.531 22.832 1.00 25.95  ? 90  LEU B CD2 1 
ATOM   3360 N  N   . ALA B 2 91  ? 34.830  25.968 25.934 1.00 30.01  ? 91  ALA B N   1 
ATOM   3361 C  CA  . ALA B 2 91  ? 34.517  26.923 26.994 1.00 30.23  ? 91  ALA B CA  1 
ATOM   3362 C  C   . ALA B 2 91  ? 34.115  26.264 28.297 1.00 28.37  ? 91  ALA B C   1 
ATOM   3363 O  O   . ALA B 2 91  ? 34.490  26.735 29.390 1.00 31.12  ? 91  ALA B O   1 
ATOM   3364 C  CB  . ALA B 2 91  ? 33.413  27.892 26.526 1.00 31.76  ? 91  ALA B CB  1 
ATOM   3365 N  N   . ALA B 2 92  ? 33.357  25.178 28.183 1.00 34.65  ? 92  ALA B N   1 
ATOM   3366 C  CA  . ALA B 2 92  ? 32.905  24.449 29.366 1.00 36.44  ? 92  ALA B CA  1 
ATOM   3367 C  C   . ALA B 2 92  ? 34.141  23.919 30.090 1.00 33.55  ? 92  ALA B C   1 
ATOM   3368 O  O   . ALA B 2 92  ? 34.213  23.953 31.323 1.00 32.70  ? 92  ALA B O   1 
ATOM   3369 C  CB  . ALA B 2 92  ? 31.957  23.308 28.971 1.00 32.07  ? 92  ALA B CB  1 
ATOM   3370 N  N   . LYS B 2 93  ? 35.119  23.449 29.316 1.00 33.58  ? 93  LYS B N   1 
ATOM   3371 C  CA  . LYS B 2 93  ? 36.379  22.977 29.888 1.00 28.87  ? 93  LYS B CA  1 
ATOM   3372 C  C   . LYS B 2 93  ? 37.075  24.150 30.560 1.00 36.63  ? 93  LYS B C   1 
ATOM   3373 O  O   . LYS B 2 93  ? 37.416  24.083 31.736 1.00 31.88  ? 93  LYS B O   1 
ATOM   3374 C  CB  . LYS B 2 93  ? 37.316  22.461 28.801 1.00 34.03  ? 93  LYS B CB  1 
ATOM   3375 C  CG  . LYS B 2 93  ? 36.858  21.224 28.064 1.00 38.55  ? 93  LYS B CG  1 
ATOM   3376 C  CD  . LYS B 2 93  ? 37.750  21.027 26.849 1.00 34.13  ? 93  LYS B CD  1 
ATOM   3377 C  CE  . LYS B 2 93  ? 37.543  19.702 26.194 1.00 39.61  ? 93  LYS B CE  1 
ATOM   3378 N  NZ  . LYS B 2 93  ? 38.504  19.564 25.074 1.00 37.43  ? 93  LYS B NZ  1 
ATOM   3379 N  N   . VAL B 2 94  ? 37.278  25.231 29.803 1.00 35.25  ? 94  VAL B N   1 
ATOM   3380 C  CA  . VAL B 2 94  ? 37.965  26.420 30.310 1.00 28.98  ? 94  VAL B CA  1 
ATOM   3381 C  C   . VAL B 2 94  ? 37.338  27.030 31.554 1.00 28.97  ? 94  VAL B C   1 
ATOM   3382 O  O   . VAL B 2 94  ? 38.044  27.428 32.481 1.00 34.64  ? 94  VAL B O   1 
ATOM   3383 C  CB  . VAL B 2 94  ? 38.058  27.523 29.216 1.00 38.40  ? 94  VAL B CB  1 
ATOM   3384 C  CG1 . VAL B 2 94  ? 38.628  28.801 29.805 1.00 28.23  ? 94  VAL B CG1 1 
ATOM   3385 C  CG2 . VAL B 2 94  ? 38.923  27.054 28.077 1.00 33.88  ? 94  VAL B CG2 1 
ATOM   3386 N  N   . GLU B 2 95  ? 36.015  27.133 31.580 1.00 43.56  ? 95  GLU B N   1 
ATOM   3387 C  CA  . GLU B 2 95  ? 35.372  27.693 32.753 1.00 30.75  ? 95  GLU B CA  1 
ATOM   3388 C  C   . GLU B 2 95  ? 35.078  26.633 33.839 1.00 40.24  ? 95  GLU B C   1 
ATOM   3389 O  O   . GLU B 2 95  ? 34.208  26.811 34.696 1.00 34.32  ? 95  GLU B O   1 
ATOM   3390 C  CB  . GLU B 2 95  ? 34.113  28.471 32.358 1.00 36.79  ? 95  GLU B CB  1 
ATOM   3391 C  CG  . GLU B 2 95  ? 34.385  29.739 31.508 1.00 31.10  ? 95  GLU B CG  1 
ATOM   3392 C  CD  . GLU B 2 95  ? 35.303  30.772 32.188 1.00 42.49  ? 95  GLU B CD  1 
ATOM   3393 O  OE1 . GLU B 2 95  ? 35.553  30.696 33.418 1.00 41.00  ? 95  GLU B OE1 1 
ATOM   3394 O  OE2 . GLU B 2 95  ? 35.768  31.683 31.479 1.00 46.46  ? 95  GLU B OE2 1 
ATOM   3395 N  N   . GLU B 2 96  ? 35.826  25.532 33.794 1.00 39.63  ? 96  GLU B N   1 
ATOM   3396 C  CA  . GLU B 2 96  ? 35.730  24.478 34.800 1.00 38.16  ? 96  GLU B CA  1 
ATOM   3397 C  C   . GLU B 2 96  ? 34.350  23.855 35.059 1.00 39.50  ? 96  GLU B C   1 
ATOM   3398 O  O   . GLU B 2 96  ? 33.923  23.737 36.204 1.00 36.37  ? 96  GLU B O   1 
ATOM   3399 C  CB  . GLU B 2 96  ? 36.302  25.003 36.126 1.00 27.64  ? 96  GLU B CB  1 
ATOM   3400 C  CG  . GLU B 2 96  ? 37.776  25.419 36.058 1.00 26.58  ? 96  GLU B CG  1 
ATOM   3401 C  CD  . GLU B 2 96  ? 38.731  24.225 36.055 1.00 40.22  ? 96  GLU B CD  1 
ATOM   3402 O  OE1 . GLU B 2 96  ? 39.921  24.413 35.708 1.00 33.02  ? 96  GLU B OE1 1 
ATOM   3403 O  OE2 . GLU B 2 96  ? 38.295  23.105 36.413 1.00 37.15  ? 96  GLU B OE2 1 
ATOM   3404 N  N   . GLN B 2 97  ? 33.670  23.470 33.986 1.00 39.95  ? 97  GLN B N   1 
ATOM   3405 C  CA  . GLN B 2 97  ? 32.368  22.822 34.053 1.00 41.07  ? 97  GLN B CA  1 
ATOM   3406 C  C   . GLN B 2 97  ? 32.255  22.045 32.758 1.00 40.33  ? 97  GLN B C   1 
ATOM   3407 O  O   . GLN B 2 97  ? 31.290  22.204 32.012 1.00 32.97  ? 97  GLN B O   1 
ATOM   3408 C  CB  . GLN B 2 97  ? 31.227  23.840 34.137 1.00 46.33  ? 97  GLN B CB  1 
ATOM   3409 C  CG  . GLN B 2 97  ? 31.221  24.672 35.413 1.00 48.38  ? 97  GLN B CG  1 
ATOM   3410 C  CD  . GLN B 2 97  ? 29.867  25.289 35.709 1.00 51.50  ? 97  GLN B CD  1 
ATOM   3411 O  OE1 . GLN B 2 97  ? 29.090  25.588 34.797 1.00 49.04  ? 97  GLN B OE1 1 
ATOM   3412 N  NE2 . GLN B 2 97  ? 29.585  25.498 36.989 1.00 48.79  ? 97  GLN B NE2 1 
ATOM   3413 N  N   . PRO B 2 98  ? 33.266  21.201 32.472 1.00 38.60  ? 98  PRO B N   1 
ATOM   3414 C  CA  . PRO B 2 98  ? 33.315  20.387 31.263 1.00 37.36  ? 98  PRO B CA  1 
ATOM   3415 C  C   . PRO B 2 98  ? 32.150  19.454 31.126 1.00 39.00  ? 98  PRO B C   1 
ATOM   3416 O  O   . PRO B 2 98  ? 31.606  18.960 32.108 1.00 36.24  ? 98  PRO B O   1 
ATOM   3417 C  CB  . PRO B 2 98  ? 34.641  19.645 31.398 1.00 43.32  ? 98  PRO B CB  1 
ATOM   3418 C  CG  . PRO B 2 98  ? 34.786  19.505 32.868 1.00 32.31  ? 98  PRO B CG  1 
ATOM   3419 C  CD  . PRO B 2 98  ? 34.389  20.860 33.361 1.00 40.76  ? 98  PRO B CD  1 
ATOM   3420 N  N   . LYS B 2 99  ? 31.769  19.236 29.881 1.00 40.29  ? 99  LYS B N   1 
ATOM   3421 C  CA  . LYS B 2 99  ? 30.674  18.356 29.545 1.00 42.48  ? 99  LYS B CA  1 
ATOM   3422 C  C   . LYS B 2 99  ? 31.338  17.373 28.615 1.00 44.24  ? 99  LYS B C   1 
ATOM   3423 O  O   . LYS B 2 99  ? 32.205  17.761 27.839 1.00 44.81  ? 99  LYS B O   1 
ATOM   3424 C  CB  . LYS B 2 99  ? 29.575  19.117 28.791 1.00 39.82  ? 99  LYS B CB  1 
ATOM   3425 C  CG  . LYS B 2 99  ? 28.944  20.252 29.584 1.00 42.81  ? 99  LYS B CG  1 
ATOM   3426 C  CD  . LYS B 2 99  ? 28.146  19.746 30.783 1.00 46.59  ? 99  LYS B CD  1 
ATOM   3427 C  CE  . LYS B 2 99  ? 28.096  20.820 31.872 1.00 59.37  ? 99  LYS B CE  1 
ATOM   3428 N  NZ  . LYS B 2 99  ? 27.303  20.457 33.077 1.00 57.45  ? 99  LYS B NZ  1 
ATOM   3429 N  N   . LYS B 2 100 ? 30.954  16.105 28.695 1.00 46.15  ? 100 LYS B N   1 
ATOM   3430 C  CA  . LYS B 2 100 ? 31.555  15.114 27.826 1.00 36.57  ? 100 LYS B CA  1 
ATOM   3431 C  C   . LYS B 2 100 ? 31.281  15.490 26.383 1.00 40.61  ? 100 LYS B C   1 
ATOM   3432 O  O   . LYS B 2 100 ? 30.304  16.169 26.082 1.00 40.72  ? 100 LYS B O   1 
ATOM   3433 C  CB  . LYS B 2 100 ? 31.012  13.717 28.137 1.00 53.37  ? 100 LYS B CB  1 
ATOM   3434 C  CG  . LYS B 2 100 ? 31.306  13.260 29.554 1.00 59.12  ? 100 LYS B CG  1 
ATOM   3435 C  CD  . LYS B 2 100 ? 31.336  11.746 29.656 1.00 72.27  ? 100 LYS B CD  1 
ATOM   3436 C  CE  . LYS B 2 100 ? 31.637  11.299 31.082 1.00 75.35  ? 100 LYS B CE  1 
ATOM   3437 N  NZ  . LYS B 2 100 ? 31.606  9.813  31.229 1.00 65.55  ? 100 LYS B NZ  1 
ATOM   3438 N  N   . LEU B 2 101 ? 32.165  15.047 25.498 1.00 38.25  ? 101 LEU B N   1 
ATOM   3439 C  CA  . LEU B 2 101 ? 32.061  15.334 24.086 1.00 38.68  ? 101 LEU B CA  1 
ATOM   3440 C  C   . LEU B 2 101 ? 30.796  14.781 23.460 1.00 52.33  ? 101 LEU B C   1 
ATOM   3441 O  O   . LEU B 2 101 ? 30.255  15.366 22.519 1.00 52.27  ? 101 LEU B O   1 
ATOM   3442 C  CB  . LEU B 2 101 ? 33.291  14.782 23.368 1.00 40.86  ? 101 LEU B CB  1 
ATOM   3443 C  CG  . LEU B 2 101 ? 33.378  14.901 21.847 1.00 40.16  ? 101 LEU B CG  1 
ATOM   3444 C  CD1 . LEU B 2 101 ? 32.918  16.268 21.397 1.00 43.02  ? 101 LEU B CD1 1 
ATOM   3445 C  CD2 . LEU B 2 101 ? 34.805  14.657 21.418 1.00 42.71  ? 101 LEU B CD2 1 
ATOM   3446 N  N   . GLU B 2 102 ? 30.324  13.651 23.978 1.00 57.42  ? 102 GLU B N   1 
ATOM   3447 C  CA  . GLU B 2 102 ? 29.120  13.027 23.444 1.00 59.52  ? 102 GLU B CA  1 
ATOM   3448 C  C   . GLU B 2 102 ? 27.888  13.806 23.857 1.00 50.81  ? 102 GLU B C   1 
ATOM   3449 O  O   . GLU B 2 102 ? 26.954  13.954 23.080 1.00 43.59  ? 102 GLU B O   1 
ATOM   3450 C  CB  . GLU B 2 102 ? 29.010  11.573 23.916 1.00 64.47  ? 102 GLU B CB  1 
ATOM   3451 C  CG  . GLU B 2 102 ? 30.045  10.652 23.275 1.00 79.83  ? 102 GLU B CG  1 
ATOM   3452 C  CD  . GLU B 2 102 ? 29.948  9.215  23.762 1.00 88.32  ? 102 GLU B CD  1 
ATOM   3453 O  OE1 . GLU B 2 102 ? 28.897  8.567  23.530 1.00 77.30  ? 102 GLU B OE1 1 
ATOM   3454 O  OE2 . GLU B 2 102 ? 30.927  8.737  24.379 1.00 84.56  ? 102 GLU B OE2 1 
ATOM   3455 N  N   . HIS B 2 103 ? 27.903  14.306 25.086 1.00 52.84  ? 103 HIS B N   1 
ATOM   3456 C  CA  . HIS B 2 103 ? 26.799  15.088 25.619 1.00 50.98  ? 103 HIS B CA  1 
ATOM   3457 C  C   . HIS B 2 103 ? 26.562  16.293 24.704 1.00 57.06  ? 103 HIS B C   1 
ATOM   3458 O  O   . HIS B 2 103 ? 25.441  16.536 24.246 1.00 60.72  ? 103 HIS B O   1 
ATOM   3459 C  CB  . HIS B 2 103 ? 27.160  15.550 27.030 1.00 53.89  ? 103 HIS B CB  1 
ATOM   3460 C  CG  . HIS B 2 103 ? 25.997  16.044 27.827 1.00 51.12  ? 103 HIS B CG  1 
ATOM   3461 N  ND1 . HIS B 2 103 ? 26.136  16.549 29.103 1.00 62.69  ? 103 HIS B ND1 1 
ATOM   3462 C  CD2 . HIS B 2 103 ? 24.674  16.091 27.546 1.00 51.51  ? 103 HIS B CD2 1 
ATOM   3463 C  CE1 . HIS B 2 103 ? 24.950  16.884 29.574 1.00 56.52  ? 103 HIS B CE1 1 
ATOM   3464 N  NE2 . HIS B 2 103 ? 24.045  16.617 28.649 1.00 67.35  ? 103 HIS B NE2 1 
ATOM   3465 N  N   . VAL B 2 104 ? 27.637  17.030 24.429 1.00 53.35  ? 104 VAL B N   1 
ATOM   3466 C  CA  . VAL B 2 104 ? 27.589  18.216 23.577 1.00 46.66  ? 104 VAL B CA  1 
ATOM   3467 C  C   . VAL B 2 104 ? 27.121  17.895 22.161 1.00 47.36  ? 104 VAL B C   1 
ATOM   3468 O  O   . VAL B 2 104 ? 26.356  18.659 21.566 1.00 38.55  ? 104 VAL B O   1 
ATOM   3469 C  CB  . VAL B 2 104 ? 28.990  18.909 23.499 1.00 44.32  ? 104 VAL B CB  1 
ATOM   3470 C  CG1 . VAL B 2 104 ? 29.042  19.895 22.327 1.00 33.03  ? 104 VAL B CG1 1 
ATOM   3471 C  CG2 . VAL B 2 104 ? 29.281  19.639 24.814 1.00 37.61  ? 104 VAL B CG2 1 
ATOM   3472 N  N   . ILE B 2 105 ? 27.586  16.771 21.628 1.00 44.87  ? 105 ILE B N   1 
ATOM   3473 C  CA  . ILE B 2 105 ? 27.225  16.357 20.280 1.00 46.83  ? 105 ILE B CA  1 
ATOM   3474 C  C   . ILE B 2 105 ? 25.749  15.997 20.190 1.00 55.09  ? 105 ILE B C   1 
ATOM   3475 O  O   . ILE B 2 105 ? 25.105  16.174 19.141 1.00 48.40  ? 105 ILE B O   1 
ATOM   3476 C  CB  . ILE B 2 105 ? 28.062  15.147 19.838 1.00 54.46  ? 105 ILE B CB  1 
ATOM   3477 C  CG1 . ILE B 2 105 ? 29.519  15.576 19.665 1.00 52.41  ? 105 ILE B CG1 1 
ATOM   3478 C  CG2 . ILE B 2 105 ? 27.514  14.587 18.528 1.00 56.08  ? 105 ILE B CG2 1 
ATOM   3479 C  CD1 . ILE B 2 105 ? 30.495  14.432 19.591 1.00 61.76  ? 105 ILE B CD1 1 
ATOM   3480 N  N   . LYS B 2 106 ? 25.220  15.480 21.293 1.00 46.77  ? 106 LYS B N   1 
ATOM   3481 C  CA  . LYS B 2 106 ? 23.819  15.110 21.344 1.00 56.00  ? 106 LYS B CA  1 
ATOM   3482 C  C   . LYS B 2 106 ? 22.999  16.400 21.323 1.00 51.96  ? 106 LYS B C   1 
ATOM   3483 O  O   . LYS B 2 106 ? 22.201  16.629 20.406 1.00 55.60  ? 106 LYS B O   1 
ATOM   3484 C  CB  . LYS B 2 106 ? 23.518  14.321 22.620 1.00 56.85  ? 106 LYS B CB  1 
ATOM   3485 C  CG  . LYS B 2 106 ? 22.032  14.092 22.846 1.00 62.48  ? 106 LYS B CG  1 
ATOM   3486 C  CD  . LYS B 2 106 ? 21.732  13.745 24.287 1.00 54.61  ? 106 LYS B CD  1 
ATOM   3487 C  CE  . LYS B 2 106 ? 20.233  13.815 24.548 1.00 70.70  ? 106 LYS B CE  1 
ATOM   3488 N  NZ  . LYS B 2 106 ? 19.883  13.439 25.948 1.00 79.21  ? 106 LYS B NZ  1 
ATOM   3489 N  N   . VAL B 2 107 ? 23.216  17.239 22.335 1.00 49.15  ? 107 VAL B N   1 
ATOM   3490 C  CA  . VAL B 2 107 ? 22.521  18.515 22.457 1.00 48.24  ? 107 VAL B CA  1 
ATOM   3491 C  C   . VAL B 2 107 ? 22.573  19.294 21.143 1.00 43.71  ? 107 VAL B C   1 
ATOM   3492 O  O   . VAL B 2 107 ? 21.566  19.820 20.680 1.00 49.32  ? 107 VAL B O   1 
ATOM   3493 C  CB  . VAL B 2 107 ? 23.127  19.357 23.605 1.00 56.13  ? 107 VAL B CB  1 
ATOM   3494 C  CG1 . VAL B 2 107 ? 22.645  20.804 23.522 1.00 61.58  ? 107 VAL B CG1 1 
ATOM   3495 C  CG2 . VAL B 2 107 ? 22.727  18.751 24.948 1.00 47.75  ? 107 VAL B CG2 1 
ATOM   3496 N  N   . ALA B 2 108 ? 23.744  19.347 20.533 1.00 44.48  ? 108 ALA B N   1 
ATOM   3497 C  CA  . ALA B 2 108 ? 23.902  20.048 19.271 1.00 51.80  ? 108 ALA B CA  1 
ATOM   3498 C  C   . ALA B 2 108 ? 22.982  19.466 18.194 1.00 54.14  ? 108 ALA B C   1 
ATOM   3499 O  O   . ALA B 2 108 ? 22.343  20.208 17.449 1.00 52.38  ? 108 ALA B O   1 
ATOM   3500 C  CB  . ALA B 2 108 ? 25.345  19.969 18.821 1.00 46.12  ? 108 ALA B CB  1 
ATOM   3501 N  N   . HIS B 2 109 ? 22.917  18.138 18.112 1.00 64.13  ? 109 HIS B N   1 
ATOM   3502 C  CA  . HIS B 2 109 ? 22.073  17.482 17.115 1.00 58.85  ? 109 HIS B CA  1 
ATOM   3503 C  C   . HIS B 2 109 ? 20.597  17.752 17.392 1.00 54.93  ? 109 HIS B C   1 
ATOM   3504 O  O   . HIS B 2 109 ? 19.816  17.991 16.475 1.00 53.71  ? 109 HIS B O   1 
ATOM   3505 C  CB  . HIS B 2 109 ? 22.327  15.969 17.092 1.00 63.81  ? 109 HIS B CB  1 
ATOM   3506 C  CG  . HIS B 2 109 ? 21.550  15.252 16.033 1.00 72.95  ? 109 HIS B CG  1 
ATOM   3507 N  ND1 . HIS B 2 109 ? 20.205  14.975 16.157 1.00 72.29  ? 109 HIS B ND1 1 
ATOM   3508 C  CD2 . HIS B 2 109 ? 21.908  14.829 14.796 1.00 71.05  ? 109 HIS B CD2 1 
ATOM   3509 C  CE1 . HIS B 2 109 ? 19.767  14.418 15.041 1.00 70.34  ? 109 HIS B CE1 1 
ATOM   3510 N  NE2 . HIS B 2 109 ? 20.780  14.319 14.199 1.00 74.88  ? 109 HIS B NE2 1 
ATOM   3511 N  N   . THR B 2 110 ? 20.218  17.712 18.662 1.00 54.73  ? 110 THR B N   1 
ATOM   3512 C  CA  . THR B 2 110 ? 18.843  17.975 19.038 1.00 54.72  ? 110 THR B CA  1 
ATOM   3513 C  C   . THR B 2 110 ? 18.451  19.380 18.575 1.00 60.34  ? 110 THR B C   1 
ATOM   3514 O  O   . THR B 2 110 ? 17.350  19.591 18.062 1.00 55.20  ? 110 THR B O   1 
ATOM   3515 C  CB  . THR B 2 110 ? 18.671  17.878 20.556 1.00 58.29  ? 110 THR B CB  1 
ATOM   3516 O  OG1 . THR B 2 110 ? 18.869  16.521 20.970 1.00 62.97  ? 110 THR B OG1 1 
ATOM   3517 C  CG2 . THR B 2 110 ? 17.286  18.343 20.969 1.00 59.62  ? 110 THR B CG2 1 
ATOM   3518 N  N   . CYS B 2 111 ? 19.359  20.338 18.755 1.00 58.63  ? 111 CYS B N   1 
ATOM   3519 C  CA  . CYS B 2 111 ? 19.099  21.719 18.349 1.00 52.24  ? 111 CYS B CA  1 
ATOM   3520 C  C   . CYS B 2 111 ? 19.083  21.906 16.834 1.00 48.69  ? 111 CYS B C   1 
ATOM   3521 O  O   . CYS B 2 111 ? 18.147  22.479 16.296 1.00 56.06  ? 111 CYS B O   1 
ATOM   3522 C  CB  . CYS B 2 111 ? 20.132  22.670 18.983 1.00 39.59  ? 111 CYS B CB  1 
ATOM   3523 S  SG  . CYS B 2 111 ? 19.957  22.872 20.803 1.00 57.17  ? 111 CYS B SG  1 
ATOM   3524 N  N   . LEU B 2 112 ? 20.103  21.413 16.141 1.00 50.98  ? 112 LEU B N   1 
ATOM   3525 C  CA  . LEU B 2 112 ? 20.173  21.574 14.690 1.00 57.07  ? 112 LEU B CA  1 
ATOM   3526 C  C   . LEU B 2 112 ? 19.369  20.563 13.880 1.00 61.94  ? 112 LEU B C   1 
ATOM   3527 O  O   . LEU B 2 112 ? 19.218  20.723 12.669 1.00 55.23  ? 112 LEU B O   1 
ATOM   3528 C  CB  . LEU B 2 112 ? 21.628  21.520 14.220 1.00 59.53  ? 112 LEU B CB  1 
ATOM   3529 C  CG  . LEU B 2 112 ? 22.581  22.560 14.803 1.00 64.38  ? 112 LEU B CG  1 
ATOM   3530 C  CD1 . LEU B 2 112 ? 23.976  22.325 14.245 1.00 62.02  ? 112 LEU B CD1 1 
ATOM   3531 C  CD2 . LEU B 2 112 ? 22.093  23.958 14.458 1.00 62.05  ? 112 LEU B CD2 1 
ATOM   3532 N  N   . HIS B 2 113 ? 18.869  19.520 14.538 1.00 65.14  ? 113 HIS B N   1 
ATOM   3533 C  CA  . HIS B 2 113 ? 18.096  18.488 13.848 1.00 65.68  ? 113 HIS B CA  1 
ATOM   3534 C  C   . HIS B 2 113 ? 17.051  17.902 14.784 1.00 65.05  ? 113 HIS B C   1 
ATOM   3535 O  O   . HIS B 2 113 ? 17.133  16.738 15.167 1.00 58.38  ? 113 HIS B O   1 
ATOM   3536 C  CB  . HIS B 2 113 ? 19.026  17.374 13.358 1.00 58.92  ? 113 HIS B CB  1 
ATOM   3537 C  CG  . HIS B 2 113 ? 20.216  17.872 12.600 1.00 62.08  ? 113 HIS B CG  1 
ATOM   3538 N  ND1 . HIS B 2 113 ? 20.105  18.576 11.419 1.00 56.82  ? 113 HIS B ND1 1 
ATOM   3539 C  CD2 . HIS B 2 113 ? 21.542  17.786 12.864 1.00 58.13  ? 113 HIS B CD2 1 
ATOM   3540 C  CE1 . HIS B 2 113 ? 21.311  18.902 10.989 1.00 62.64  ? 113 HIS B CE1 1 
ATOM   3541 N  NE2 . HIS B 2 113 ? 22.201  18.434 11.847 1.00 59.27  ? 113 HIS B NE2 1 
ATOM   3542 N  N   . PRO B 2 114 ? 16.050  18.708 15.168 1.00 69.66  ? 114 PRO B N   1 
ATOM   3543 C  CA  . PRO B 2 114 ? 14.999  18.233 16.071 1.00 72.13  ? 114 PRO B CA  1 
ATOM   3544 C  C   . PRO B 2 114 ? 14.228  17.062 15.464 1.00 75.87  ? 114 PRO B C   1 
ATOM   3545 O  O   . PRO B 2 114 ? 13.747  16.181 16.181 1.00 74.56  ? 114 PRO B O   1 
ATOM   3546 C  CB  . PRO B 2 114 ? 14.116  19.468 16.255 1.00 75.35  ? 114 PRO B CB  1 
ATOM   3547 C  CG  . PRO B 2 114 ? 15.058  20.616 16.008 1.00 76.04  ? 114 PRO B CG  1 
ATOM   3548 C  CD  . PRO B 2 114 ? 15.836  20.123 14.820 1.00 72.75  ? 114 PRO B CD  1 
ATOM   3549 N  N   . GLN B 2 115 ? 14.123  17.057 14.138 1.00 74.49  ? 115 GLN B N   1 
ATOM   3550 C  CA  . GLN B 2 115 ? 13.401  16.004 13.434 1.00 80.32  ? 115 GLN B CA  1 
ATOM   3551 C  C   . GLN B 2 115 ? 14.170  14.682 13.419 1.00 82.16  ? 115 GLN B C   1 
ATOM   3552 O  O   . GLN B 2 115 ? 13.771  13.717 14.072 1.00 83.00  ? 115 GLN B O   1 
ATOM   3553 C  CB  . GLN B 2 115 ? 13.100  16.454 12.001 1.00 80.30  ? 115 GLN B CB  1 
ATOM   3554 C  CG  . GLN B 2 115 ? 12.418  17.817 11.920 1.00 85.51  ? 115 GLN B CG  1 
ATOM   3555 C  CD  . GLN B 2 115 ? 11.071  17.859 12.630 1.00 86.29  ? 115 GLN B CD  1 
ATOM   3556 O  OE1 . GLN B 2 115 ? 10.969  17.567 13.826 1.00 84.49  ? 115 GLN B OE1 1 
ATOM   3557 N  NE2 . GLN B 2 115 ? 10.029  18.230 11.894 1.00 86.80  ? 115 GLN B NE2 1 
ATOM   3558 N  N   . GLU B 2 116 ? 15.269  14.641 12.672 1.00 80.46  ? 116 GLU B N   1 
ATOM   3559 C  CA  . GLU B 2 116 ? 16.094  13.440 12.573 1.00 79.05  ? 116 GLU B CA  1 
ATOM   3560 C  C   . GLU B 2 116 ? 16.424  12.874 13.943 1.00 78.41  ? 116 GLU B C   1 
ATOM   3561 O  O   . GLU B 2 116 ? 16.053  13.450 14.965 1.00 78.24  ? 116 GLU B O   1 
ATOM   3562 C  CB  . GLU B 2 116 ? 17.394  13.761 11.848 1.00 74.02  ? 116 GLU B CB  1 
ATOM   3563 C  CG  . GLU B 2 116 ? 17.216  14.080 10.388 1.00 77.85  ? 116 GLU B CG  1 
ATOM   3564 C  CD  . GLU B 2 116 ? 18.393  14.842 9.838  1.00 80.41  ? 116 GLU B CD  1 
ATOM   3565 O  OE1 . GLU B 2 116 ? 19.536  14.501 10.213 1.00 78.41  ? 116 GLU B OE1 1 
ATOM   3566 O  OE2 . GLU B 2 116 ? 18.175  15.776 9.035  1.00 72.99  ? 116 GLU B OE2 1 
ATOM   3567 N  N   . SER B 2 117 ? 17.123  11.743 13.962 1.00 77.65  ? 117 SER B N   1 
ATOM   3568 C  CA  . SER B 2 117 ? 17.503  11.116 15.221 1.00 76.06  ? 117 SER B CA  1 
ATOM   3569 C  C   . SER B 2 117 ? 19.010  10.898 15.290 1.00 77.92  ? 117 SER B C   1 
ATOM   3570 O  O   . SER B 2 117 ? 19.680  10.788 14.258 1.00 78.48  ? 117 SER B O   1 
ATOM   3571 C  CB  . SER B 2 117 ? 16.780  9.785  15.398 1.00 74.77  ? 117 SER B CB  1 
ATOM   3572 O  OG  . SER B 2 117 ? 17.056  9.246  16.678 1.00 83.70  ? 117 SER B OG  1 
ATOM   3573 N  N   . LEU B 2 118 ? 19.536  10.833 16.511 1.00 76.85  ? 118 LEU B N   1 
ATOM   3574 C  CA  . LEU B 2 118 ? 20.967  10.653 16.723 1.00 77.51  ? 118 LEU B CA  1 
ATOM   3575 C  C   . LEU B 2 118 ? 21.541  9.517  15.902 1.00 77.30  ? 118 LEU B C   1 
ATOM   3576 O  O   . LEU B 2 118 ? 21.022  8.401  15.926 1.00 72.97  ? 118 LEU B O   1 
ATOM   3577 C  CB  . LEU B 2 118 ? 21.275  10.387 18.200 1.00 78.06  ? 118 LEU B CB  1 
ATOM   3578 C  CG  . LEU B 2 118 ? 20.867  11.440 19.231 1.00 84.55  ? 118 LEU B CG  1 
ATOM   3579 C  CD1 . LEU B 2 118 ? 19.362  11.376 19.454 1.00 83.49  ? 118 LEU B CD1 1 
ATOM   3580 C  CD2 . LEU B 2 118 ? 21.602  11.188 20.539 1.00 85.00  ? 118 LEU B CD2 1 
ATOM   3581 N  N   . PRO B 2 119 ? 22.613  9.793  15.144 1.00 79.01  ? 119 PRO B N   1 
ATOM   3582 C  CA  . PRO B 2 119 ? 23.230  8.741  14.333 1.00 82.45  ? 119 PRO B CA  1 
ATOM   3583 C  C   . PRO B 2 119 ? 23.792  7.715  15.310 1.00 84.35  ? 119 PRO B C   1 
ATOM   3584 O  O   . PRO B 2 119 ? 24.175  8.073  16.428 1.00 81.02  ? 119 PRO B O   1 
ATOM   3585 C  CB  . PRO B 2 119 ? 24.328  9.489  13.576 1.00 79.73  ? 119 PRO B CB  1 
ATOM   3586 C  CG  . PRO B 2 119 ? 23.754  10.876 13.440 1.00 77.42  ? 119 PRO B CG  1 
ATOM   3587 C  CD  . PRO B 2 119 ? 23.187  11.111 14.820 1.00 76.34  ? 119 PRO B CD  1 
ATOM   3588 N  N   . ASP B 2 120 ? 23.833  6.448  14.911 1.00 83.76  ? 120 ASP B N   1 
ATOM   3589 C  CA  . ASP B 2 120 ? 24.349  5.423  15.808 1.00 81.61  ? 120 ASP B CA  1 
ATOM   3590 C  C   . ASP B 2 120 ? 25.727  5.834  16.320 1.00 74.90  ? 120 ASP B C   1 
ATOM   3591 O  O   . ASP B 2 120 ? 26.618  6.148  15.529 1.00 70.24  ? 120 ASP B O   1 
ATOM   3592 C  CB  . ASP B 2 120 ? 24.419  4.067  15.092 1.00 83.60  ? 120 ASP B CB  1 
ATOM   3593 C  CG  . ASP B 2 120 ? 24.901  2.946  16.005 1.00 87.23  ? 120 ASP B CG  1 
ATOM   3594 O  OD1 . ASP B 2 120 ? 24.629  3.007  17.227 1.00 78.15  ? 120 ASP B OD1 1 
ATOM   3595 O  OD2 . ASP B 2 120 ? 25.539  1.999  15.494 1.00 87.50  ? 120 ASP B OD2 1 
ATOM   3596 N  N   . THR B 2 121 ? 25.888  5.846  17.644 1.00 65.75  ? 121 THR B N   1 
ATOM   3597 C  CA  . THR B 2 121 ? 27.156  6.226  18.259 1.00 65.21  ? 121 THR B CA  1 
ATOM   3598 C  C   . THR B 2 121 ? 28.247  5.254  17.855 1.00 60.49  ? 121 THR B C   1 
ATOM   3599 O  O   . THR B 2 121 ? 29.367  5.308  18.365 1.00 57.83  ? 121 THR B O   1 
ATOM   3600 C  CB  . THR B 2 121 ? 27.062  6.244  19.797 1.00 68.89  ? 121 THR B CB  1 
ATOM   3601 O  OG1 . THR B 2 121 ? 26.601  4.973  20.266 1.00 74.39  ? 121 THR B OG1 1 
ATOM   3602 C  CG2 . THR B 2 121 ? 26.106  7.324  20.256 1.00 72.96  ? 121 THR B CG2 1 
ATOM   3603 N  N   . ARG B 2 122 ? 27.899  4.366  16.932 1.00 65.78  ? 122 ARG B N   1 
ATOM   3604 C  CA  . ARG B 2 122 ? 28.811  3.355  16.424 1.00 63.25  ? 122 ARG B CA  1 
ATOM   3605 C  C   . ARG B 2 122 ? 28.984  3.559  14.928 1.00 62.83  ? 122 ARG B C   1 
ATOM   3606 O  O   . ARG B 2 122 ? 29.948  3.086  14.336 1.00 70.34  ? 122 ARG B O   1 
ATOM   3607 C  CB  . ARG B 2 122 ? 28.233  1.965  16.679 1.00 72.66  ? 122 ARG B CB  1 
ATOM   3608 C  CG  . ARG B 2 122 ? 27.938  1.660  18.134 1.00 72.84  ? 122 ARG B CG  1 
ATOM   3609 C  CD  . ARG B 2 122 ? 27.104  0.394  18.253 1.00 75.39  ? 122 ARG B CD  1 
ATOM   3610 N  NE  . ARG B 2 122 ? 27.404  -0.337 19.478 1.00 77.00  ? 122 ARG B NE  1 
ATOM   3611 C  CZ  . ARG B 2 122 ? 26.845  -1.494 19.811 1.00 80.95  ? 122 ARG B CZ  1 
ATOM   3612 N  NH1 . ARG B 2 122 ? 25.947  -2.050 19.008 1.00 81.27  ? 122 ARG B NH1 1 
ATOM   3613 N  NH2 . ARG B 2 122 ? 27.199  -2.107 20.936 1.00 82.94  ? 122 ARG B NH2 1 
ATOM   3614 N  N   . SER B 2 123 ? 28.041  4.269  14.320 1.00 61.69  ? 123 SER B N   1 
ATOM   3615 C  CA  . SER B 2 123 ? 28.091  4.521  12.886 1.00 71.30  ? 123 SER B CA  1 
ATOM   3616 C  C   . SER B 2 123 ? 29.334  5.290  12.493 1.00 73.59  ? 123 SER B C   1 
ATOM   3617 O  O   . SER B 2 123 ? 29.955  5.952  13.322 1.00 75.00  ? 123 SER B O   1 
ATOM   3618 C  CB  . SER B 2 123 ? 26.862  5.316  12.433 1.00 77.58  ? 123 SER B CB  1 
ATOM   3619 O  OG  . SER B 2 123 ? 26.867  6.624  12.979 1.00 76.06  ? 123 SER B OG  1 
ATOM   3620 N  N   . GLU B 2 124 ? 29.697  5.192  11.221 1.00 77.40  ? 124 GLU B N   1 
ATOM   3621 C  CA  . GLU B 2 124 ? 30.851  5.912  10.716 1.00 82.57  ? 124 GLU B CA  1 
ATOM   3622 C  C   . GLU B 2 124 ? 30.545  7.385  10.916 1.00 84.56  ? 124 GLU B C   1 
ATOM   3623 O  O   . GLU B 2 124 ? 31.263  8.090  11.625 1.00 84.57  ? 124 GLU B O   1 
ATOM   3624 C  CB  . GLU B 2 124 ? 31.053  5.631  9.224  1.00 82.11  ? 124 GLU B CB  1 
ATOM   3625 C  CG  . GLU B 2 124 ? 31.748  4.318  8.912  1.00 86.28  ? 124 GLU B CG  1 
ATOM   3626 C  CD  . GLU B 2 124 ? 33.210  4.320  9.326  1.00 90.13  ? 124 GLU B CD  1 
ATOM   3627 O  OE1 . GLU B 2 124 ? 33.486  4.403  10.543 1.00 88.33  ? 124 GLU B OE1 1 
ATOM   3628 O  OE2 . GLU B 2 124 ? 34.082  4.243  8.431  1.00 90.78  ? 124 GLU B OE2 1 
ATOM   3629 N  N   . ALA B 2 125 ? 29.457  7.827  10.291 1.00 87.35  ? 125 ALA B N   1 
ATOM   3630 C  CA  . ALA B 2 125 ? 29.004  9.211  10.359 1.00 85.45  ? 125 ALA B CA  1 
ATOM   3631 C  C   . ALA B 2 125 ? 29.163  9.818  11.748 1.00 83.25  ? 125 ALA B C   1 
ATOM   3632 O  O   . ALA B 2 125 ? 29.629  10.950 11.883 1.00 86.93  ? 125 ALA B O   1 
ATOM   3633 C  CB  . ALA B 2 125 ? 27.548  9.300  9.913  1.00 90.86  ? 125 ALA B CB  1 
ATOM   3634 N  N   . TYR B 2 126 ? 28.775  9.079  12.781 1.00 74.43  ? 126 TYR B N   1 
ATOM   3635 C  CA  . TYR B 2 126 ? 28.907  9.605  14.129 1.00 71.20  ? 126 TYR B CA  1 
ATOM   3636 C  C   . TYR B 2 126 ? 30.372  9.832  14.434 1.00 71.82  ? 126 TYR B C   1 
ATOM   3637 O  O   . TYR B 2 126 ? 30.832  10.970 14.477 1.00 80.18  ? 126 TYR B O   1 
ATOM   3638 C  CB  . TYR B 2 126 ? 28.343  8.643  15.160 1.00 65.27  ? 126 TYR B CB  1 
ATOM   3639 C  CG  . TYR B 2 126 ? 28.439  9.174  16.566 1.00 61.67  ? 126 TYR B CG  1 
ATOM   3640 C  CD1 . TYR B 2 126 ? 27.576  10.176 17.012 1.00 65.94  ? 126 TYR B CD1 1 
ATOM   3641 C  CD2 . TYR B 2 126 ? 29.398  8.688  17.447 1.00 64.83  ? 126 TYR B CD2 1 
ATOM   3642 C  CE1 . TYR B 2 126 ? 27.665  10.679 18.307 1.00 64.17  ? 126 TYR B CE1 1 
ATOM   3643 C  CE2 . TYR B 2 126 ? 29.501  9.185  18.746 1.00 69.31  ? 126 TYR B CE2 1 
ATOM   3644 C  CZ  . TYR B 2 126 ? 28.631  10.179 19.169 1.00 69.90  ? 126 TYR B CZ  1 
ATOM   3645 O  OH  . TYR B 2 126 ? 28.724  10.666 20.453 1.00 72.22  ? 126 TYR B OH  1 
ATOM   3646 N  N   . LEU B 2 127 ? 31.101  8.742  14.653 1.00 70.37  ? 127 LEU B N   1 
ATOM   3647 C  CA  . LEU B 2 127 ? 32.525  8.822  14.950 1.00 63.81  ? 127 LEU B CA  1 
ATOM   3648 C  C   . LEU B 2 127 ? 33.170  9.930  14.135 1.00 60.82  ? 127 LEU B C   1 
ATOM   3649 O  O   . LEU B 2 127 ? 34.088  10.600 14.600 1.00 61.81  ? 127 LEU B O   1 
ATOM   3650 C  CB  . LEU B 2 127 ? 33.214  7.493  14.636 1.00 59.82  ? 127 LEU B CB  1 
ATOM   3651 C  CG  . LEU B 2 127 ? 32.949  6.338  15.600 1.00 64.26  ? 127 LEU B CG  1 
ATOM   3652 C  CD1 . LEU B 2 127 ? 33.647  5.087  15.091 1.00 61.19  ? 127 LEU B CD1 1 
ATOM   3653 C  CD2 . LEU B 2 127 ? 33.444  6.704  16.996 1.00 65.54  ? 127 LEU B CD2 1 
ATOM   3654 N  N   . GLN B 2 128 ? 32.673  10.116 12.917 1.00 56.66  ? 128 GLN B N   1 
ATOM   3655 C  CA  . GLN B 2 128 ? 33.177  11.142 12.018 1.00 58.65  ? 128 GLN B CA  1 
ATOM   3656 C  C   . GLN B 2 128 ? 33.048  12.524 12.637 1.00 59.14  ? 128 GLN B C   1 
ATOM   3657 O  O   . GLN B 2 128 ? 34.039  13.234 12.806 1.00 59.74  ? 128 GLN B O   1 
ATOM   3658 C  CB  . GLN B 2 128 ? 32.406  11.118 10.702 1.00 57.81  ? 128 GLN B CB  1 
ATOM   3659 C  CG  . GLN B 2 128 ? 32.902  12.123 9.698  1.00 60.64  ? 128 GLN B CG  1 
ATOM   3660 C  CD  . GLN B 2 128 ? 34.368  11.931 9.394  1.00 68.01  ? 128 GLN B CD  1 
ATOM   3661 O  OE1 . GLN B 2 128 ? 35.221  12.110 10.265 1.00 68.40  ? 128 GLN B OE1 1 
ATOM   3662 N  NE2 . GLN B 2 128 ? 34.674  11.558 8.152  1.00 70.74  ? 128 GLN B NE2 1 
ATOM   3663 N  N   . GLN B 2 129 ? 31.823  12.907 12.970 1.00 57.88  ? 129 GLN B N   1 
ATOM   3664 C  CA  . GLN B 2 129 ? 31.607  14.211 13.560 1.00 65.79  ? 129 GLN B CA  1 
ATOM   3665 C  C   . GLN B 2 129 ? 32.357  14.364 14.879 1.00 66.88  ? 129 GLN B C   1 
ATOM   3666 O  O   . GLN B 2 129 ? 32.962  15.406 15.124 1.00 72.68  ? 129 GLN B O   1 
ATOM   3667 C  CB  . GLN B 2 129 ? 30.110  14.484 13.738 1.00 64.79  ? 129 GLN B CB  1 
ATOM   3668 C  CG  . GLN B 2 129 ? 29.332  13.440 14.504 1.00 70.57  ? 129 GLN B CG  1 
ATOM   3669 C  CD  . GLN B 2 129 ? 27.845  13.758 14.553 1.00 76.83  ? 129 GLN B CD  1 
ATOM   3670 O  OE1 . GLN B 2 129 ? 27.201  13.937 13.514 1.00 73.69  ? 129 GLN B OE1 1 
ATOM   3671 N  NE2 . GLN B 2 129 ? 27.293  13.830 15.759 1.00 73.03  ? 129 GLN B NE2 1 
ATOM   3672 N  N   . VAL B 2 130 ? 32.339  13.332 15.721 1.00 67.89  ? 130 VAL B N   1 
ATOM   3673 C  CA  . VAL B 2 130 ? 33.051  13.401 16.996 1.00 65.56  ? 130 VAL B CA  1 
ATOM   3674 C  C   . VAL B 2 130 ? 34.473  13.849 16.715 1.00 68.63  ? 130 VAL B C   1 
ATOM   3675 O  O   . VAL B 2 130 ? 35.108  14.499 17.542 1.00 71.38  ? 130 VAL B O   1 
ATOM   3676 C  CB  . VAL B 2 130 ? 33.106  12.034 17.712 1.00 62.79  ? 130 VAL B CB  1 
ATOM   3677 C  CG1 . VAL B 2 130 ? 34.035  12.118 18.918 1.00 54.80  ? 130 VAL B CG1 1 
ATOM   3678 C  CG2 . VAL B 2 130 ? 31.708  11.616 18.152 1.00 55.69  ? 130 VAL B CG2 1 
ATOM   3679 N  N   . GLN B 2 131 ? 34.966  13.491 15.535 1.00 71.95  ? 131 GLN B N   1 
ATOM   3680 C  CA  . GLN B 2 131 ? 36.308  13.870 15.121 1.00 70.78  ? 131 GLN B CA  1 
ATOM   3681 C  C   . GLN B 2 131 ? 36.319  15.319 14.672 1.00 66.39  ? 131 GLN B C   1 
ATOM   3682 O  O   . GLN B 2 131 ? 37.181  16.097 15.078 1.00 77.10  ? 131 GLN B O   1 
ATOM   3683 C  CB  . GLN B 2 131 ? 36.788  12.999 13.959 1.00 73.73  ? 131 GLN B CB  1 
ATOM   3684 C  CG  . GLN B 2 131 ? 37.155  11.576 14.332 1.00 82.56  ? 131 GLN B CG  1 
ATOM   3685 C  CD  . GLN B 2 131 ? 38.327  11.494 15.296 1.00 85.97  ? 131 GLN B CD  1 
ATOM   3686 O  OE1 . GLN B 2 131 ? 39.000  10.465 15.370 1.00 95.15  ? 131 GLN B OE1 1 
ATOM   3687 N  NE2 . GLN B 2 131 ? 38.570  12.568 16.048 1.00 86.42  ? 131 GLN B NE2 1 
ATOM   3688 N  N   . ASP B 2 132 ? 35.361  15.669 13.823 1.00 59.12  ? 132 ASP B N   1 
ATOM   3689 C  CA  . ASP B 2 132 ? 35.268  17.025 13.303 1.00 61.34  ? 132 ASP B CA  1 
ATOM   3690 C  C   . ASP B 2 132 ? 35.143  18.040 14.417 1.00 50.90  ? 132 ASP B C   1 
ATOM   3691 O  O   . ASP B 2 132 ? 35.627  19.158 14.292 1.00 50.60  ? 132 ASP B O   1 
ATOM   3692 C  CB  . ASP B 2 132 ? 34.087  17.159 12.337 1.00 63.04  ? 132 ASP B CB  1 
ATOM   3693 C  CG  . ASP B 2 132 ? 34.378  16.545 10.982 1.00 73.66  ? 132 ASP B CG  1 
ATOM   3694 O  OD1 . ASP B 2 132 ? 35.434  16.874 10.402 1.00 74.69  ? 132 ASP B OD1 1 
ATOM   3695 O  OD2 . ASP B 2 132 ? 33.553  15.743 10.494 1.00 75.34  ? 132 ASP B OD2 1 
ATOM   3696 N  N   . LEU B 2 133 ? 34.491  17.655 15.505 1.00 44.71  ? 133 LEU B N   1 
ATOM   3697 C  CA  . LEU B 2 133 ? 34.354  18.564 16.622 1.00 49.96  ? 133 LEU B CA  1 
ATOM   3698 C  C   . LEU B 2 133 ? 35.764  18.755 17.177 1.00 52.24  ? 133 LEU B C   1 
ATOM   3699 O  O   . LEU B 2 133 ? 36.246  19.883 17.268 1.00 50.26  ? 133 LEU B O   1 
ATOM   3700 C  CB  . LEU B 2 133 ? 33.414  17.979 17.681 1.00 52.60  ? 133 LEU B CB  1 
ATOM   3701 C  CG  . LEU B 2 133 ? 32.895  18.965 18.732 1.00 58.64  ? 133 LEU B CG  1 
ATOM   3702 C  CD1 . LEU B 2 133 ? 31.545  18.509 19.249 1.00 56.29  ? 133 LEU B CD1 1 
ATOM   3703 C  CD2 . LEU B 2 133 ? 33.901  19.099 19.864 1.00 65.52  ? 133 LEU B CD2 1 
ATOM   3704 N  N   . VAL B 2 134 ? 36.438  17.653 17.510 1.00 44.50  ? 134 VAL B N   1 
ATOM   3705 C  CA  . VAL B 2 134 ? 37.794  17.736 18.042 1.00 38.69  ? 134 VAL B CA  1 
ATOM   3706 C  C   . VAL B 2 134 ? 38.641  18.626 17.135 1.00 44.88  ? 134 VAL B C   1 
ATOM   3707 O  O   . VAL B 2 134 ? 39.330  19.525 17.610 1.00 46.64  ? 134 VAL B O   1 
ATOM   3708 C  CB  . VAL B 2 134 ? 38.473  16.348 18.129 1.00 43.21  ? 134 VAL B CB  1 
ATOM   3709 C  CG1 . VAL B 2 134 ? 39.884  16.500 18.677 1.00 45.21  ? 134 VAL B CG1 1 
ATOM   3710 C  CG2 . VAL B 2 134 ? 37.675  15.423 19.025 1.00 43.32  ? 134 VAL B CG2 1 
ATOM   3711 N  N   . ILE B 2 135 ? 38.586  18.366 15.832 1.00 41.27  ? 135 ILE B N   1 
ATOM   3712 C  CA  . ILE B 2 135 ? 39.343  19.141 14.856 1.00 38.34  ? 135 ILE B CA  1 
ATOM   3713 C  C   . ILE B 2 135 ? 39.060  20.645 14.964 1.00 49.28  ? 135 ILE B C   1 
ATOM   3714 O  O   . ILE B 2 135 ? 39.978  21.462 15.045 1.00 45.09  ? 135 ILE B O   1 
ATOM   3715 C  CB  . ILE B 2 135 ? 38.994  18.718 13.430 1.00 41.36  ? 135 ILE B CB  1 
ATOM   3716 C  CG1 . ILE B 2 135 ? 39.540  17.319 13.150 1.00 50.66  ? 135 ILE B CG1 1 
ATOM   3717 C  CG2 . ILE B 2 135 ? 39.554  19.728 12.437 1.00 38.43  ? 135 ILE B CG2 1 
ATOM   3718 C  CD1 . ILE B 2 135 ? 39.250  16.839 11.737 1.00 49.69  ? 135 ILE B CD1 1 
ATOM   3719 N  N   . LEU B 2 136 ? 37.779  20.995 14.932 1.00 41.05  ? 136 LEU B N   1 
ATOM   3720 C  CA  . LEU B 2 136 ? 37.349  22.378 15.024 1.00 47.78  ? 136 LEU B CA  1 
ATOM   3721 C  C   . LEU B 2 136 ? 37.904  23.014 16.296 1.00 44.56  ? 136 LEU B C   1 
ATOM   3722 O  O   . LEU B 2 136 ? 38.406  24.138 16.277 1.00 43.46  ? 136 LEU B O   1 
ATOM   3723 C  CB  . LEU B 2 136 ? 35.816  22.442 15.035 1.00 49.75  ? 136 LEU B CB  1 
ATOM   3724 C  CG  . LEU B 2 136 ? 35.197  23.432 14.051 1.00 55.49  ? 136 LEU B CG  1 
ATOM   3725 C  CD1 . LEU B 2 136 ? 35.735  23.146 12.654 1.00 50.24  ? 136 LEU B CD1 1 
ATOM   3726 C  CD2 . LEU B 2 136 ? 33.683  23.322 14.088 1.00 49.80  ? 136 LEU B CD2 1 
ATOM   3727 N  N   . GLU B 2 137 ? 37.801  22.288 17.401 1.00 39.85  ? 137 GLU B N   1 
ATOM   3728 C  CA  . GLU B 2 137 ? 38.294  22.789 18.664 1.00 41.59  ? 137 GLU B CA  1 
ATOM   3729 C  C   . GLU B 2 137 ? 39.740  23.247 18.493 1.00 41.72  ? 137 GLU B C   1 
ATOM   3730 O  O   . GLU B 2 137 ? 40.099  24.351 18.898 1.00 39.92  ? 137 GLU B O   1 
ATOM   3731 C  CB  . GLU B 2 137 ? 38.199  21.703 19.750 1.00 40.19  ? 137 GLU B CB  1 
ATOM   3732 C  CG  . GLU B 2 137 ? 38.666  22.157 21.135 1.00 34.31  ? 137 GLU B CG  1 
ATOM   3733 C  CD  . GLU B 2 137 ? 38.603  21.056 22.186 1.00 43.14  ? 137 GLU B CD  1 
ATOM   3734 O  OE1 . GLU B 2 137 ? 39.032  19.921 21.897 1.00 43.14  ? 137 GLU B OE1 1 
ATOM   3735 O  OE2 . GLU B 2 137 ? 38.139  21.333 23.312 1.00 45.15  ? 137 GLU B OE2 1 
ATOM   3736 N  N   . SER B 2 138 ? 40.560  22.418 17.860 1.00 38.78  ? 138 SER B N   1 
ATOM   3737 C  CA  . SER B 2 138 ? 41.971  22.760 17.686 1.00 48.27  ? 138 SER B CA  1 
ATOM   3738 C  C   . SER B 2 138 ? 42.183  24.005 16.850 1.00 39.74  ? 138 SER B C   1 
ATOM   3739 O  O   . SER B 2 138 ? 43.083  24.805 17.128 1.00 43.10  ? 138 SER B O   1 
ATOM   3740 C  CB  . SER B 2 138 ? 42.729  21.580 17.082 1.00 43.23  ? 138 SER B CB  1 
ATOM   3741 O  OG  . SER B 2 138 ? 42.543  20.437 17.898 1.00 58.35  ? 138 SER B OG  1 
ATOM   3742 N  N   . ILE B 2 139 ? 41.350  24.167 15.830 1.00 40.84  ? 139 ILE B N   1 
ATOM   3743 C  CA  . ILE B 2 139 ? 41.413  25.333 14.958 1.00 43.16  ? 139 ILE B CA  1 
ATOM   3744 C  C   . ILE B 2 139 ? 41.006  26.599 15.730 1.00 36.66  ? 139 ILE B C   1 
ATOM   3745 O  O   . ILE B 2 139 ? 41.576  27.669 15.535 1.00 44.92  ? 139 ILE B O   1 
ATOM   3746 C  CB  . ILE B 2 139 ? 40.495  25.138 13.741 1.00 42.05  ? 139 ILE B CB  1 
ATOM   3747 C  CG1 . ILE B 2 139 ? 41.063  24.023 12.857 1.00 52.26  ? 139 ILE B CG1 1 
ATOM   3748 C  CG2 . ILE B 2 139 ? 40.374  26.433 12.950 1.00 35.81  ? 139 ILE B CG2 1 
ATOM   3749 C  CD1 . ILE B 2 139 ? 40.128  23.566 11.745 1.00 44.13  ? 139 ILE B CD1 1 
ATOM   3750 N  N   . ILE B 2 140 ? 40.017  26.468 16.603 1.00 36.06  ? 140 ILE B N   1 
ATOM   3751 C  CA  . ILE B 2 140 ? 39.570  27.587 17.418 1.00 35.96  ? 140 ILE B CA  1 
ATOM   3752 C  C   . ILE B 2 140 ? 40.724  27.987 18.339 1.00 33.72  ? 140 ILE B C   1 
ATOM   3753 O  O   . ILE B 2 140 ? 41.089  29.153 18.402 1.00 33.21  ? 140 ILE B O   1 
ATOM   3754 C  CB  . ILE B 2 140 ? 38.352  27.197 18.254 1.00 31.79  ? 140 ILE B CB  1 
ATOM   3755 C  CG1 . ILE B 2 140 ? 37.137  27.044 17.337 1.00 31.73  ? 140 ILE B CG1 1 
ATOM   3756 C  CG2 . ILE B 2 140 ? 38.107  28.225 19.355 1.00 35.95  ? 140 ILE B CG2 1 
ATOM   3757 C  CD1 . ILE B 2 140 ? 35.966  26.334 17.993 1.00 29.89  ? 140 ILE B CD1 1 
ATOM   3758 N  N   . LEU B 2 141 ? 41.302  27.008 19.036 1.00 30.11  ? 141 LEU B N   1 
ATOM   3759 C  CA  . LEU B 2 141 ? 42.433  27.250 19.930 1.00 31.45  ? 141 LEU B CA  1 
ATOM   3760 C  C   . LEU B 2 141 ? 43.586  27.939 19.208 1.00 28.67  ? 141 LEU B C   1 
ATOM   3761 O  O   . LEU B 2 141 ? 44.191  28.876 19.728 1.00 28.41  ? 141 LEU B O   1 
ATOM   3762 C  CB  . LEU B 2 141 ? 42.939  25.927 20.520 1.00 29.80  ? 141 LEU B CB  1 
ATOM   3763 C  CG  . LEU B 2 141 ? 42.078  25.326 21.624 1.00 34.25  ? 141 LEU B CG  1 
ATOM   3764 C  CD1 . LEU B 2 141 ? 42.488  23.886 21.866 1.00 31.83  ? 141 LEU B CD1 1 
ATOM   3765 C  CD2 . LEU B 2 141 ? 42.216  26.166 22.894 1.00 35.61  ? 141 LEU B CD2 1 
ATOM   3766 N  N   . GLN B 2 142 ? 43.896  27.466 18.008 1.00 30.08  ? 142 GLN B N   1 
ATOM   3767 C  CA  . GLN B 2 142 ? 44.976  28.060 17.240 1.00 34.51  ? 142 GLN B CA  1 
ATOM   3768 C  C   . GLN B 2 142 ? 44.602  29.447 16.726 1.00 34.25  ? 142 GLN B C   1 
ATOM   3769 O  O   . GLN B 2 142 ? 45.434  30.356 16.692 1.00 32.28  ? 142 GLN B O   1 
ATOM   3770 C  CB  . GLN B 2 142 ? 45.345  27.141 16.076 1.00 36.33  ? 142 GLN B CB  1 
ATOM   3771 C  CG  . GLN B 2 142 ? 46.060  25.875 16.510 1.00 40.42  ? 142 GLN B CG  1 
ATOM   3772 C  CD  . GLN B 2 142 ? 46.198  24.874 15.379 1.00 46.01  ? 142 GLN B CD  1 
ATOM   3773 O  OE1 . GLN B 2 142 ? 46.704  25.196 14.296 1.00 45.83  ? 142 GLN B OE1 1 
ATOM   3774 N  NE2 . GLN B 2 142 ? 45.746  23.653 15.622 1.00 41.63  ? 142 GLN B NE2 1 
ATOM   3775 N  N   . THR B 2 143 ? 43.345  29.609 16.339 1.00 26.41  ? 143 THR B N   1 
ATOM   3776 C  CA  . THR B 2 143 ? 42.884  30.897 15.827 1.00 36.10  ? 143 THR B CA  1 
ATOM   3777 C  C   . THR B 2 143 ? 42.941  31.946 16.934 1.00 31.37  ? 143 THR B C   1 
ATOM   3778 O  O   . THR B 2 143 ? 43.342  33.084 16.696 1.00 35.73  ? 143 THR B O   1 
ATOM   3779 C  CB  . THR B 2 143 ? 41.437  30.809 15.288 1.00 36.77  ? 143 THR B CB  1 
ATOM   3780 O  OG1 . THR B 2 143 ? 41.385  29.869 14.212 1.00 42.34  ? 143 THR B OG1 1 
ATOM   3781 C  CG2 . THR B 2 143 ? 40.970  32.170 14.788 1.00 32.27  ? 143 THR B CG2 1 
ATOM   3782 N  N   . LEU B 2 144 ? 42.544  31.553 18.139 1.00 31.03  ? 144 LEU B N   1 
ATOM   3783 C  CA  . LEU B 2 144 ? 42.565  32.445 19.294 1.00 26.77  ? 144 LEU B CA  1 
ATOM   3784 C  C   . LEU B 2 144 ? 43.974  32.579 19.864 1.00 26.88  ? 144 LEU B C   1 
ATOM   3785 O  O   . LEU B 2 144 ? 44.173  33.217 20.899 1.00 34.27  ? 144 LEU B O   1 
ATOM   3786 C  CB  . LEU B 2 144 ? 41.644  31.914 20.395 1.00 29.63  ? 144 LEU B CB  1 
ATOM   3787 C  CG  . LEU B 2 144 ? 40.156  31.836 20.059 1.00 30.09  ? 144 LEU B CG  1 
ATOM   3788 C  CD1 . LEU B 2 144 ? 39.361  31.288 21.235 1.00 21.97  ? 144 LEU B CD1 1 
ATOM   3789 C  CD2 . LEU B 2 144 ? 39.659  33.236 19.704 1.00 26.81  ? 144 LEU B CD2 1 
ATOM   3790 N  N   . GLY B 2 145 ? 44.956  31.979 19.201 1.00 30.48  ? 145 GLY B N   1 
ATOM   3791 C  CA  . GLY B 2 145 ? 46.313  32.052 19.716 1.00 30.45  ? 145 GLY B CA  1 
ATOM   3792 C  C   . GLY B 2 145 ? 46.395  31.554 21.159 1.00 23.80  ? 145 GLY B C   1 
ATOM   3793 O  O   . GLY B 2 145 ? 47.263  31.965 21.929 1.00 29.79  ? 145 GLY B O   1 
ATOM   3794 N  N   . PHE B 2 146 ? 45.479  30.666 21.518 1.00 29.99  ? 146 PHE B N   1 
ATOM   3795 C  CA  . PHE B 2 146 ? 45.425  30.087 22.851 1.00 31.32  ? 146 PHE B CA  1 
ATOM   3796 C  C   . PHE B 2 146 ? 45.188  31.061 23.992 1.00 32.36  ? 146 PHE B C   1 
ATOM   3797 O  O   . PHE B 2 146 ? 45.604  30.812 25.128 1.00 28.72  ? 146 PHE B O   1 
ATOM   3798 C  CB  . PHE B 2 146 ? 46.694  29.276 23.107 1.00 29.04  ? 146 PHE B CB  1 
ATOM   3799 C  CG  . PHE B 2 146 ? 46.696  27.947 22.414 1.00 31.44  ? 146 PHE B CG  1 
ATOM   3800 C  CD1 . PHE B 2 146 ? 46.253  26.805 23.072 1.00 34.54  ? 146 PHE B CD1 1 
ATOM   3801 C  CD2 . PHE B 2 146 ? 47.125  27.836 21.093 1.00 30.78  ? 146 PHE B CD2 1 
ATOM   3802 C  CE1 . PHE B 2 146 ? 46.238  25.571 22.434 1.00 24.10  ? 146 PHE B CE1 1 
ATOM   3803 C  CE2 . PHE B 2 146 ? 47.115  26.612 20.442 1.00 20.88  ? 146 PHE B CE2 1 
ATOM   3804 C  CZ  . PHE B 2 146 ? 46.670  25.468 21.119 1.00 23.21  ? 146 PHE B CZ  1 
ATOM   3805 N  N   . GLU B 2 147 ? 44.509  32.166 23.699 1.00 33.20  ? 147 GLU B N   1 
ATOM   3806 C  CA  . GLU B 2 147 ? 44.196  33.143 24.731 1.00 36.62  ? 147 GLU B CA  1 
ATOM   3807 C  C   . GLU B 2 147 ? 42.809  32.709 25.216 1.00 33.56  ? 147 GLU B C   1 
ATOM   3808 O  O   . GLU B 2 147 ? 41.801  32.945 24.566 1.00 35.50  ? 147 GLU B O   1 
ATOM   3809 C  CB  . GLU B 2 147 ? 44.183  34.559 24.152 1.00 31.86  ? 147 GLU B CB  1 
ATOM   3810 C  CG  . GLU B 2 147 ? 44.171  35.640 25.208 1.00 36.03  ? 147 GLU B CG  1 
ATOM   3811 C  CD  . GLU B 2 147 ? 44.274  37.037 24.625 1.00 34.88  ? 147 GLU B CD  1 
ATOM   3812 O  OE1 . GLU B 2 147 ? 45.080  37.230 23.689 1.00 49.37  ? 147 GLU B OE1 1 
ATOM   3813 O  OE2 . GLU B 2 147 ? 43.568  37.940 25.120 1.00 40.93  ? 147 GLU B OE2 1 
ATOM   3814 N  N   . LEU B 2 148 ? 42.785  32.068 26.374 1.00 32.75  ? 148 LEU B N   1 
ATOM   3815 C  CA  . LEU B 2 148 ? 41.570  31.492 26.931 1.00 32.43  ? 148 LEU B CA  1 
ATOM   3816 C  C   . LEU B 2 148 ? 40.841  32.274 28.009 1.00 23.58  ? 148 LEU B C   1 
ATOM   3817 O  O   . LEU B 2 148 ? 39.640  32.139 28.147 1.00 35.32  ? 148 LEU B O   1 
ATOM   3818 C  CB  . LEU B 2 148 ? 41.911  30.104 27.486 1.00 28.36  ? 148 LEU B CB  1 
ATOM   3819 C  CG  . LEU B 2 148 ? 42.847  29.289 26.590 1.00 42.14  ? 148 LEU B CG  1 
ATOM   3820 C  CD1 . LEU B 2 148 ? 43.637  28.290 27.427 1.00 33.43  ? 148 LEU B CD1 1 
ATOM   3821 C  CD2 . LEU B 2 148 ? 42.046  28.602 25.505 1.00 29.55  ? 148 LEU B CD2 1 
ATOM   3822 N  N   . THR B 2 149 ? 41.566  33.064 28.787 1.00 23.50  ? 149 THR B N   1 
ATOM   3823 C  CA  . THR B 2 149 ? 40.958  33.829 29.873 1.00 30.24  ? 149 THR B CA  1 
ATOM   3824 C  C   . THR B 2 149 ? 40.188  35.048 29.358 1.00 29.79  ? 149 THR B C   1 
ATOM   3825 O  O   . THR B 2 149 ? 40.762  35.940 28.747 1.00 32.84  ? 149 THR B O   1 
ATOM   3826 C  CB  . THR B 2 149 ? 42.039  34.274 30.861 1.00 25.62  ? 149 THR B CB  1 
ATOM   3827 O  OG1 . THR B 2 149 ? 42.765  33.120 31.283 1.00 34.85  ? 149 THR B OG1 1 
ATOM   3828 C  CG2 . THR B 2 149 ? 41.428  34.957 32.068 1.00 31.81  ? 149 THR B CG2 1 
ATOM   3829 N  N   . ILE B 2 150 ? 38.886  35.082 29.613 1.00 34.22  ? 150 ILE B N   1 
ATOM   3830 C  CA  . ILE B 2 150 ? 38.047  36.179 29.131 1.00 28.90  ? 150 ILE B CA  1 
ATOM   3831 C  C   . ILE B 2 150 ? 37.414  36.983 30.256 1.00 31.85  ? 150 ILE B C   1 
ATOM   3832 O  O   . ILE B 2 150 ? 36.973  36.424 31.258 1.00 36.99  ? 150 ILE B O   1 
ATOM   3833 C  CB  . ILE B 2 150 ? 36.895  35.640 28.255 1.00 28.41  ? 150 ILE B CB  1 
ATOM   3834 C  CG1 . ILE B 2 150 ? 37.452  34.730 27.156 1.00 19.73  ? 150 ILE B CG1 1 
ATOM   3835 C  CG2 . ILE B 2 150 ? 36.101  36.808 27.654 1.00 24.93  ? 150 ILE B CG2 1 
ATOM   3836 C  CD1 . ILE B 2 150 ? 38.360  35.443 26.159 1.00 24.10  ? 150 ILE B CD1 1 
ATOM   3837 N  N   . ASP B 2 151 ? 37.369  38.300 30.088 1.00 30.06  ? 151 ASP B N   1 
ATOM   3838 C  CA  . ASP B 2 151 ? 36.739  39.150 31.086 1.00 33.20  ? 151 ASP B CA  1 
ATOM   3839 C  C   . ASP B 2 151 ? 35.392  39.545 30.490 1.00 32.67  ? 151 ASP B C   1 
ATOM   3840 O  O   . ASP B 2 151 ? 35.301  39.928 29.320 1.00 36.37  ? 151 ASP B O   1 
ATOM   3841 C  CB  . ASP B 2 151 ? 37.589  40.393 31.371 1.00 31.91  ? 151 ASP B CB  1 
ATOM   3842 C  CG  . ASP B 2 151 ? 37.102  41.175 32.596 1.00 47.86  ? 151 ASP B CG  1 
ATOM   3843 O  OD1 . ASP B 2 151 ? 36.670  40.542 33.588 1.00 38.72  ? 151 ASP B OD1 1 
ATOM   3844 O  OD2 . ASP B 2 151 ? 37.168  42.425 32.577 1.00 42.96  ? 151 ASP B OD2 1 
ATOM   3845 N  N   . HIS B 2 152 ? 34.341  39.426 31.284 1.00 32.54  ? 152 HIS B N   1 
ATOM   3846 C  CA  . HIS B 2 152 ? 33.013  39.766 30.812 1.00 30.64  ? 152 HIS B CA  1 
ATOM   3847 C  C   . HIS B 2 152 ? 32.450  40.976 31.545 1.00 41.67  ? 152 HIS B C   1 
ATOM   3848 O  O   . HIS B 2 152 ? 32.766  41.211 32.714 1.00 34.11  ? 152 HIS B O   1 
ATOM   3849 C  CB  . HIS B 2 152 ? 32.084  38.558 30.973 1.00 31.35  ? 152 HIS B CB  1 
ATOM   3850 C  CG  . HIS B 2 152 ? 32.458  37.407 30.095 1.00 31.62  ? 152 HIS B CG  1 
ATOM   3851 N  ND1 . HIS B 2 152 ? 32.539  37.522 28.725 1.00 35.58  ? 152 HIS B ND1 1 
ATOM   3852 C  CD2 . HIS B 2 152 ? 32.841  36.140 30.391 1.00 24.31  ? 152 HIS B CD2 1 
ATOM   3853 C  CE1 . HIS B 2 152 ? 32.959  36.380 28.213 1.00 34.02  ? 152 HIS B CE1 1 
ATOM   3854 N  NE2 . HIS B 2 152 ? 33.151  35.526 29.203 1.00 29.73  ? 152 HIS B NE2 1 
ATOM   3855 N  N   . PRO B 2 153 ? 31.616  41.769 30.856 1.00 39.07  ? 153 PRO B N   1 
ATOM   3856 C  CA  . PRO B 2 153 ? 30.981  42.976 31.405 1.00 37.26  ? 153 PRO B CA  1 
ATOM   3857 C  C   . PRO B 2 153 ? 30.292  42.670 32.728 1.00 32.31  ? 153 PRO B C   1 
ATOM   3858 O  O   . PRO B 2 153 ? 30.361  43.446 33.690 1.00 32.52  ? 153 PRO B O   1 
ATOM   3859 C  CB  . PRO B 2 153 ? 29.952  43.350 30.339 1.00 38.77  ? 153 PRO B CB  1 
ATOM   3860 C  CG  . PRO B 2 153 ? 30.522  42.819 29.097 1.00 38.85  ? 153 PRO B CG  1 
ATOM   3861 C  CD  . PRO B 2 153 ? 31.118  41.484 29.504 1.00 29.46  ? 153 PRO B CD  1 
ATOM   3862 N  N   . HIS B 2 154 ? 29.621  41.528 32.752 1.00 33.85  ? 154 HIS B N   1 
ATOM   3863 C  CA  . HIS B 2 154 ? 28.872  41.089 33.918 1.00 34.06  ? 154 HIS B CA  1 
ATOM   3864 C  C   . HIS B 2 154 ? 29.566  41.325 35.242 1.00 39.64  ? 154 HIS B C   1 
ATOM   3865 O  O   . HIS B 2 154 ? 28.939  41.756 36.210 1.00 39.68  ? 154 HIS B O   1 
ATOM   3866 C  CB  . HIS B 2 154 ? 28.529  39.621 33.761 1.00 26.94  ? 154 HIS B CB  1 
ATOM   3867 C  CG  . HIS B 2 154 ? 27.748  39.331 32.522 1.00 30.79  ? 154 HIS B CG  1 
ATOM   3868 N  ND1 . HIS B 2 154 ? 28.258  39.540 31.261 1.00 30.90  ? 154 HIS B ND1 1 
ATOM   3869 C  CD2 . HIS B 2 154 ? 26.497  38.842 32.347 1.00 34.44  ? 154 HIS B CD2 1 
ATOM   3870 C  CE1 . HIS B 2 154 ? 27.357  39.186 30.360 1.00 29.13  ? 154 HIS B CE1 1 
ATOM   3871 N  NE2 . HIS B 2 154 ? 26.279  38.757 30.993 1.00 23.86  ? 154 HIS B NE2 1 
ATOM   3872 N  N   . THR B 2 155 ? 30.865  41.061 35.273 1.00 37.95  ? 155 THR B N   1 
ATOM   3873 C  CA  . THR B 2 155 ? 31.643  41.232 36.487 1.00 43.72  ? 155 THR B CA  1 
ATOM   3874 C  C   . THR B 2 155 ? 31.677  42.675 36.981 1.00 41.00  ? 155 THR B C   1 
ATOM   3875 O  O   . THR B 2 155 ? 31.547  42.941 38.170 1.00 34.26  ? 155 THR B O   1 
ATOM   3876 C  CB  . THR B 2 155 ? 33.079  40.773 36.273 1.00 40.48  ? 155 THR B CB  1 
ATOM   3877 O  OG1 . THR B 2 155 ? 33.078  39.412 35.840 1.00 41.12  ? 155 THR B OG1 1 
ATOM   3878 C  CG2 . THR B 2 155 ? 33.856  40.891 37.564 1.00 46.02  ? 155 THR B CG2 1 
ATOM   3879 N  N   . HIS B 2 156 ? 31.864  43.607 36.065 1.00 35.87  ? 156 HIS B N   1 
ATOM   3880 C  CA  . HIS B 2 156 ? 31.915  45.011 36.435 1.00 37.63  ? 156 HIS B CA  1 
ATOM   3881 C  C   . HIS B 2 156 ? 30.519  45.574 36.683 1.00 32.97  ? 156 HIS B C   1 
ATOM   3882 O  O   . HIS B 2 156 ? 30.353  46.507 37.468 1.00 43.65  ? 156 HIS B O   1 
ATOM   3883 C  CB  . HIS B 2 156 ? 32.640  45.769 35.345 1.00 38.71  ? 156 HIS B CB  1 
ATOM   3884 C  CG  . HIS B 2 156 ? 33.966  45.174 35.013 1.00 42.69  ? 156 HIS B CG  1 
ATOM   3885 N  ND1 . HIS B 2 156 ? 35.113  45.475 35.715 1.00 41.34  ? 156 HIS B ND1 1 
ATOM   3886 C  CD2 . HIS B 2 156 ? 34.314  44.234 34.104 1.00 33.31  ? 156 HIS B CD2 1 
ATOM   3887 C  CE1 . HIS B 2 156 ? 36.112  44.747 35.249 1.00 41.27  ? 156 HIS B CE1 1 
ATOM   3888 N  NE2 . HIS B 2 156 ? 35.652  43.986 34.271 1.00 43.56  ? 156 HIS B NE2 1 
ATOM   3889 N  N   . VAL B 2 157 ? 29.516  44.989 36.038 1.00 31.42  ? 157 VAL B N   1 
ATOM   3890 C  CA  . VAL B 2 157 ? 28.132  45.428 36.226 1.00 34.71  ? 157 VAL B CA  1 
ATOM   3891 C  C   . VAL B 2 157 ? 27.660  45.211 37.677 1.00 35.56  ? 157 VAL B C   1 
ATOM   3892 O  O   . VAL B 2 157 ? 27.211  46.146 38.347 1.00 33.98  ? 157 VAL B O   1 
ATOM   3893 C  CB  . VAL B 2 157 ? 27.167  44.671 35.281 1.00 25.04  ? 157 VAL B CB  1 
ATOM   3894 C  CG1 . VAL B 2 157 ? 25.733  45.001 35.640 1.00 42.49  ? 157 VAL B CG1 1 
ATOM   3895 C  CG2 . VAL B 2 157 ? 27.438  45.069 33.812 1.00 32.86  ? 157 VAL B CG2 1 
ATOM   3896 N  N   . VAL B 2 158 ? 27.769  43.976 38.157 1.00 33.79  ? 158 VAL B N   1 
ATOM   3897 C  CA  . VAL B 2 158 ? 27.337  43.635 39.515 1.00 37.05  ? 158 VAL B CA  1 
ATOM   3898 C  C   . VAL B 2 158 ? 28.108  44.457 40.554 1.00 40.60  ? 158 VAL B C   1 
ATOM   3899 O  O   . VAL B 2 158 ? 27.524  45.032 41.467 1.00 43.06  ? 158 VAL B O   1 
ATOM   3900 C  CB  . VAL B 2 158 ? 27.501  42.106 39.761 1.00 39.53  ? 158 VAL B CB  1 
ATOM   3901 C  CG1 . VAL B 2 158 ? 26.891  41.694 41.100 1.00 37.08  ? 158 VAL B CG1 1 
ATOM   3902 C  CG2 . VAL B 2 158 ? 26.815  41.347 38.628 1.00 37.85  ? 158 VAL B CG2 1 
ATOM   3903 N  N   . LYS B 2 159 ? 29.418  44.547 40.386 1.00 39.19  ? 159 LYS B N   1 
ATOM   3904 C  CA  . LYS B 2 159 ? 30.254  45.322 41.293 1.00 34.54  ? 159 LYS B CA  1 
ATOM   3905 C  C   . LYS B 2 159 ? 29.768  46.785 41.356 1.00 43.46  ? 159 LYS B C   1 
ATOM   3906 O  O   . LYS B 2 159 ? 29.770  47.404 42.420 1.00 46.69  ? 159 LYS B O   1 
ATOM   3907 C  CB  . LYS B 2 159 ? 31.701  45.262 40.800 1.00 40.97  ? 159 LYS B CB  1 
ATOM   3908 C  CG  . LYS B 2 159 ? 32.765  45.721 41.776 1.00 50.83  ? 159 LYS B CG  1 
ATOM   3909 C  CD  . LYS B 2 159 ? 34.143  45.543 41.137 1.00 65.39  ? 159 LYS B CD  1 
ATOM   3910 C  CE  . LYS B 2 159 ? 34.330  44.121 40.568 1.00 71.75  ? 159 LYS B CE  1 
ATOM   3911 N  NZ  . LYS B 2 159 ? 35.563  43.959 39.731 1.00 66.18  ? 159 LYS B NZ  1 
ATOM   3912 N  N   . CYS B 2 160 ? 29.341  47.334 40.221 1.00 38.48  ? 160 CYS B N   1 
ATOM   3913 C  CA  . CYS B 2 160 ? 28.877  48.716 40.193 1.00 36.76  ? 160 CYS B CA  1 
ATOM   3914 C  C   . CYS B 2 160 ? 27.486  48.898 40.800 1.00 29.67  ? 160 CYS B C   1 
ATOM   3915 O  O   . CYS B 2 160 ? 27.247  49.840 41.555 1.00 38.63  ? 160 CYS B O   1 
ATOM   3916 C  CB  . CYS B 2 160 ? 28.868  49.249 38.755 1.00 48.50  ? 160 CYS B CB  1 
ATOM   3917 S  SG  . CYS B 2 160 ? 28.352  50.981 38.608 1.00 45.81  ? 160 CYS B SG  1 
ATOM   3918 N  N   . THR B 2 161 ? 26.571  48.001 40.464 1.00 33.39  ? 161 THR B N   1 
ATOM   3919 C  CA  . THR B 2 161 ? 25.217  48.103 40.968 1.00 40.88  ? 161 THR B CA  1 
ATOM   3920 C  C   . THR B 2 161 ? 25.199  47.936 42.487 1.00 48.60  ? 161 THR B C   1 
ATOM   3921 O  O   . THR B 2 161 ? 24.424  48.596 43.179 1.00 43.56  ? 161 THR B O   1 
ATOM   3922 C  CB  . THR B 2 161 ? 24.286  47.082 40.270 1.00 39.30  ? 161 THR B CB  1 
ATOM   3923 O  OG1 . THR B 2 161 ? 24.820  45.759 40.395 1.00 40.76  ? 161 THR B OG1 1 
ATOM   3924 C  CG2 . THR B 2 161 ? 24.151  47.437 38.776 1.00 36.86  ? 161 THR B CG2 1 
ATOM   3925 N  N   . GLN B 2 162 ? 26.075  47.075 43.002 1.00 46.80  ? 162 GLN B N   1 
ATOM   3926 C  CA  . GLN B 2 162 ? 26.163  46.865 44.441 1.00 49.65  ? 162 GLN B CA  1 
ATOM   3927 C  C   . GLN B 2 162 ? 26.724  48.158 45.043 1.00 43.30  ? 162 GLN B C   1 
ATOM   3928 O  O   . GLN B 2 162 ? 26.257  48.634 46.073 1.00 44.18  ? 162 GLN B O   1 
ATOM   3929 C  CB  . GLN B 2 162 ? 27.120  45.709 44.768 1.00 47.76  ? 162 GLN B CB  1 
ATOM   3930 C  CG  . GLN B 2 162 ? 26.871  44.399 44.027 1.00 52.49  ? 162 GLN B CG  1 
ATOM   3931 C  CD  . GLN B 2 162 ? 25.812  43.520 44.665 1.00 66.63  ? 162 GLN B CD  1 
ATOM   3932 O  OE1 . GLN B 2 162 ? 25.584  42.389 44.223 1.00 68.19  ? 162 GLN B OE1 1 
ATOM   3933 N  NE2 . GLN B 2 162 ? 25.160  44.029 45.708 1.00 74.07  ? 162 GLN B NE2 1 
ATOM   3934 N  N   . LEU B 2 163 ? 27.717  48.729 44.372 1.00 44.00  ? 163 LEU B N   1 
ATOM   3935 C  CA  . LEU B 2 163 ? 28.365  49.949 44.845 1.00 43.80  ? 163 LEU B CA  1 
ATOM   3936 C  C   . LEU B 2 163 ? 27.431  51.159 44.914 1.00 51.95  ? 163 LEU B C   1 
ATOM   3937 O  O   . LEU B 2 163 ? 27.552  51.976 45.822 1.00 58.71  ? 163 LEU B O   1 
ATOM   3938 C  CB  . LEU B 2 163 ? 29.575  50.277 43.961 1.00 40.94  ? 163 LEU B CB  1 
ATOM   3939 C  CG  . LEU B 2 163 ? 30.377  51.551 44.268 1.00 50.76  ? 163 LEU B CG  1 
ATOM   3940 C  CD1 . LEU B 2 163 ? 31.082  51.423 45.615 1.00 48.21  ? 163 LEU B CD1 1 
ATOM   3941 C  CD2 . LEU B 2 163 ? 31.398  51.794 43.154 1.00 53.83  ? 163 LEU B CD2 1 
ATOM   3942 N  N   . VAL B 2 164 ? 26.502  51.272 43.967 1.00 51.85  ? 164 VAL B N   1 
ATOM   3943 C  CA  . VAL B 2 164 ? 25.577  52.405 43.946 1.00 54.04  ? 164 VAL B CA  1 
ATOM   3944 C  C   . VAL B 2 164 ? 24.220  52.084 44.570 1.00 55.35  ? 164 VAL B C   1 
ATOM   3945 O  O   . VAL B 2 164 ? 23.309  52.913 44.558 1.00 56.96  ? 164 VAL B O   1 
ATOM   3946 C  CB  . VAL B 2 164 ? 25.346  52.897 42.510 1.00 50.35  ? 164 VAL B CB  1 
ATOM   3947 C  CG1 . VAL B 2 164 ? 26.661  53.342 41.892 1.00 51.54  ? 164 VAL B CG1 1 
ATOM   3948 C  CG2 . VAL B 2 164 ? 24.709  51.799 41.693 1.00 42.08  ? 164 VAL B CG2 1 
ATOM   3949 N  N   . ARG B 2 165 ? 24.096  50.877 45.112 1.00 53.40  ? 165 ARG B N   1 
ATOM   3950 C  CA  . ARG B 2 165 ? 22.868  50.425 45.741 1.00 53.28  ? 165 ARG B CA  1 
ATOM   3951 C  C   . ARG B 2 165 ? 21.691  50.466 44.777 1.00 57.76  ? 165 ARG B C   1 
ATOM   3952 O  O   . ARG B 2 165 ? 20.583  50.873 45.141 1.00 55.33  ? 165 ARG B O   1 
ATOM   3953 C  CB  . ARG B 2 165 ? 22.535  51.276 46.970 1.00 62.54  ? 165 ARG B CB  1 
ATOM   3954 C  CG  . ARG B 2 165 ? 23.601  51.312 48.049 1.00 61.68  ? 165 ARG B CG  1 
ATOM   3955 C  CD  . ARG B 2 165 ? 22.947  51.381 49.421 1.00 72.39  ? 165 ARG B CD  1 
ATOM   3956 N  NE  . ARG B 2 165 ? 22.611  50.047 49.921 1.00 71.53  ? 165 ARG B NE  1 
ATOM   3957 C  CZ  . ARG B 2 165 ? 21.445  49.716 50.464 1.00 69.48  ? 165 ARG B CZ  1 
ATOM   3958 N  NH1 . ARG B 2 165 ? 20.480  50.620 50.581 1.00 57.74  ? 165 ARG B NH1 1 
ATOM   3959 N  NH2 . ARG B 2 165 ? 21.246  48.478 50.901 1.00 71.66  ? 165 ARG B NH2 1 
ATOM   3960 N  N   . ALA B 2 166 ? 21.930  50.048 43.542 1.00 54.84  ? 166 ALA B N   1 
ATOM   3961 C  CA  . ALA B 2 166 ? 20.866  50.023 42.551 1.00 58.21  ? 166 ALA B CA  1 
ATOM   3962 C  C   . ALA B 2 166 ? 19.693  49.181 43.078 1.00 58.35  ? 166 ALA B C   1 
ATOM   3963 O  O   . ALA B 2 166 ? 19.851  48.386 44.003 1.00 54.00  ? 166 ALA B O   1 
ATOM   3964 C  CB  . ALA B 2 166 ? 21.392  49.433 41.242 1.00 50.45  ? 166 ALA B CB  1 
ATOM   3965 N  N   . SER B 2 167 ? 18.510  49.367 42.502 1.00 59.83  ? 167 SER B N   1 
ATOM   3966 C  CA  . SER B 2 167 ? 17.365  48.580 42.926 1.00 57.16  ? 167 SER B CA  1 
ATOM   3967 C  C   . SER B 2 167 ? 17.617  47.175 42.397 1.00 57.92  ? 167 SER B C   1 
ATOM   3968 O  O   . SER B 2 167 ? 18.388  46.995 41.452 1.00 61.12  ? 167 SER B O   1 
ATOM   3969 C  CB  . SER B 2 167 ? 16.064  49.137 42.335 1.00 56.07  ? 167 SER B CB  1 
ATOM   3970 O  OG  . SER B 2 167 ? 15.986  48.932 40.935 1.00 56.04  ? 167 SER B OG  1 
ATOM   3971 N  N   . LYS B 2 168 ? 16.989  46.178 43.006 1.00 47.69  ? 168 LYS B N   1 
ATOM   3972 C  CA  . LYS B 2 168 ? 17.173  44.816 42.544 1.00 56.15  ? 168 LYS B CA  1 
ATOM   3973 C  C   . LYS B 2 168 ? 16.841  44.745 41.063 1.00 48.27  ? 168 LYS B C   1 
ATOM   3974 O  O   . LYS B 2 168 ? 17.504  44.063 40.293 1.00 55.54  ? 168 LYS B O   1 
ATOM   3975 C  CB  . LYS B 2 168 ? 16.261  43.865 43.311 1.00 60.11  ? 168 LYS B CB  1 
ATOM   3976 C  CG  . LYS B 2 168 ? 16.525  43.825 44.799 1.00 69.34  ? 168 LYS B CG  1 
ATOM   3977 C  CD  . LYS B 2 168 ? 15.802  42.659 45.452 1.00 72.44  ? 168 LYS B CD  1 
ATOM   3978 C  CE  . LYS B 2 168 ? 16.297  41.317 44.906 1.00 79.55  ? 168 LYS B CE  1 
ATOM   3979 N  NZ  . LYS B 2 168 ? 15.912  41.074 43.483 1.00 69.58  ? 168 LYS B NZ  1 
ATOM   3980 N  N   . ASP B 2 169 ? 15.812  45.480 40.671 1.00 52.96  ? 169 ASP B N   1 
ATOM   3981 C  CA  . ASP B 2 169 ? 15.360  45.496 39.290 1.00 51.43  ? 169 ASP B CA  1 
ATOM   3982 C  C   . ASP B 2 169 ? 16.348  46.142 38.315 1.00 44.43  ? 169 ASP B C   1 
ATOM   3983 O  O   . ASP B 2 169 ? 16.507  45.685 37.182 1.00 37.05  ? 169 ASP B O   1 
ATOM   3984 C  CB  . ASP B 2 169 ? 14.010  46.211 39.205 1.00 55.44  ? 169 ASP B CB  1 
ATOM   3985 C  CG  . ASP B 2 169 ? 13.317  45.969 37.892 1.00 65.18  ? 169 ASP B CG  1 
ATOM   3986 O  OD1 . ASP B 2 169 ? 13.025  44.789 37.595 1.00 70.08  ? 169 ASP B OD1 1 
ATOM   3987 O  OD2 . ASP B 2 169 ? 13.067  46.952 37.160 1.00 71.42  ? 169 ASP B OD2 1 
ATOM   3988 N  N   . LEU B 2 170 ? 16.991  47.223 38.737 1.00 44.73  ? 170 LEU B N   1 
ATOM   3989 C  CA  . LEU B 2 170 ? 17.954  47.885 37.869 1.00 42.61  ? 170 LEU B CA  1 
ATOM   3990 C  C   . LEU B 2 170 ? 19.190  46.995 37.777 1.00 47.50  ? 170 LEU B C   1 
ATOM   3991 O  O   . LEU B 2 170 ? 19.855  46.925 36.742 1.00 37.50  ? 170 LEU B O   1 
ATOM   3992 C  CB  . LEU B 2 170 ? 18.348  49.236 38.440 1.00 38.40  ? 170 LEU B CB  1 
ATOM   3993 C  CG  . LEU B 2 170 ? 19.469  49.921 37.665 1.00 38.76  ? 170 LEU B CG  1 
ATOM   3994 C  CD1 . LEU B 2 170 ? 18.927  50.607 36.415 1.00 47.70  ? 170 LEU B CD1 1 
ATOM   3995 C  CD2 . LEU B 2 170 ? 20.116  50.923 38.560 1.00 44.69  ? 170 LEU B CD2 1 
ATOM   3996 N  N   . ALA B 2 171 ? 19.484  46.314 38.878 1.00 51.00  ? 171 ALA B N   1 
ATOM   3997 C  CA  . ALA B 2 171 ? 20.627  45.423 38.939 1.00 47.17  ? 171 ALA B CA  1 
ATOM   3998 C  C   . ALA B 2 171 ? 20.450  44.295 37.933 1.00 45.85  ? 171 ALA B C   1 
ATOM   3999 O  O   . ALA B 2 171 ? 21.374  43.944 37.209 1.00 47.56  ? 171 ALA B O   1 
ATOM   4000 C  CB  . ALA B 2 171 ? 20.767  44.859 40.347 1.00 50.61  ? 171 ALA B CB  1 
ATOM   4001 N  N   . GLN B 2 172 ? 19.247  43.739 37.892 1.00 40.71  ? 172 GLN B N   1 
ATOM   4002 C  CA  . GLN B 2 172 ? 18.930  42.646 36.994 1.00 40.25  ? 172 GLN B CA  1 
ATOM   4003 C  C   . GLN B 2 172 ? 18.879  43.095 35.530 1.00 38.16  ? 172 GLN B C   1 
ATOM   4004 O  O   . GLN B 2 172 ? 19.367  42.395 34.641 1.00 39.56  ? 172 GLN B O   1 
ATOM   4005 C  CB  . GLN B 2 172 ? 17.601  42.015 37.429 1.00 45.94  ? 172 GLN B CB  1 
ATOM   4006 C  CG  . GLN B 2 172 ? 17.089  40.860 36.578 1.00 58.62  ? 172 GLN B CG  1 
ATOM   4007 C  CD  . GLN B 2 172 ? 16.262  41.326 35.393 1.00 63.10  ? 172 GLN B CD  1 
ATOM   4008 O  OE1 . GLN B 2 172 ? 15.440  42.237 35.519 1.00 64.06  ? 172 GLN B OE1 1 
ATOM   4009 N  NE2 . GLN B 2 172 ? 16.460  40.693 34.237 1.00 60.64  ? 172 GLN B NE2 1 
ATOM   4010 N  N   . THR B 2 173 ? 18.302  44.262 35.281 1.00 38.25  ? 173 THR B N   1 
ATOM   4011 C  CA  . THR B 2 173 ? 18.202  44.780 33.921 1.00 39.82  ? 173 THR B CA  1 
ATOM   4012 C  C   . THR B 2 173 ? 19.586  45.017 33.344 1.00 32.87  ? 173 THR B C   1 
ATOM   4013 O  O   . THR B 2 173 ? 19.851  44.694 32.177 1.00 41.96  ? 173 THR B O   1 
ATOM   4014 C  CB  . THR B 2 173 ? 17.426  46.117 33.874 1.00 48.15  ? 173 THR B CB  1 
ATOM   4015 O  OG1 . THR B 2 173 ? 16.120  45.932 34.430 1.00 40.04  ? 173 THR B OG1 1 
ATOM   4016 C  CG2 . THR B 2 173 ? 17.296  46.609 32.420 1.00 42.04  ? 173 THR B CG2 1 
ATOM   4017 N  N   . SER B 2 174 ? 20.469  45.577 34.165 1.00 31.03  ? 174 SER B N   1 
ATOM   4018 C  CA  . SER B 2 174 ? 21.834  45.861 33.739 1.00 36.62  ? 174 SER B CA  1 
ATOM   4019 C  C   . SER B 2 174 ? 22.564  44.570 33.390 1.00 34.58  ? 174 SER B C   1 
ATOM   4020 O  O   . SER B 2 174 ? 23.229  44.471 32.357 1.00 33.63  ? 174 SER B O   1 
ATOM   4021 C  CB  . SER B 2 174 ? 22.585  46.603 34.845 1.00 41.08  ? 174 SER B CB  1 
ATOM   4022 O  OG  . SER B 2 174 ? 22.042  47.894 35.038 1.00 41.32  ? 174 SER B OG  1 
ATOM   4023 N  N   . TYR B 2 175 ? 22.439  43.582 34.263 1.00 33.39  ? 175 TYR B N   1 
ATOM   4024 C  CA  . TYR B 2 175 ? 23.072  42.288 34.039 1.00 35.33  ? 175 TYR B CA  1 
ATOM   4025 C  C   . TYR B 2 175 ? 22.522  41.669 32.756 1.00 26.40  ? 175 TYR B C   1 
ATOM   4026 O  O   . TYR B 2 175 ? 23.265  41.110 31.955 1.00 34.44  ? 175 TYR B O   1 
ATOM   4027 C  CB  . TYR B 2 175 ? 22.771  41.366 35.212 1.00 41.30  ? 175 TYR B CB  1 
ATOM   4028 C  CG  . TYR B 2 175 ? 23.413  40.004 35.109 1.00 46.34  ? 175 TYR B CG  1 
ATOM   4029 C  CD1 . TYR B 2 175 ? 24.689  39.766 35.629 1.00 42.49  ? 175 TYR B CD1 1 
ATOM   4030 C  CD2 . TYR B 2 175 ? 22.733  38.942 34.519 1.00 42.26  ? 175 TYR B CD2 1 
ATOM   4031 C  CE1 . TYR B 2 175 ? 25.266  38.489 35.571 1.00 36.02  ? 175 TYR B CE1 1 
ATOM   4032 C  CE2 . TYR B 2 175 ? 23.301  37.673 34.453 1.00 47.08  ? 175 TYR B CE2 1 
ATOM   4033 C  CZ  . TYR B 2 175 ? 24.564  37.454 34.982 1.00 41.57  ? 175 TYR B CZ  1 
ATOM   4034 O  OH  . TYR B 2 175 ? 25.108  36.193 34.920 1.00 45.88  ? 175 TYR B OH  1 
ATOM   4035 N  N   . PHE B 2 176 ? 21.209  41.774 32.577 1.00 32.67  ? 176 PHE B N   1 
ATOM   4036 C  CA  . PHE B 2 176 ? 20.531  41.229 31.401 1.00 41.08  ? 176 PHE B CA  1 
ATOM   4037 C  C   . PHE B 2 176 ? 21.028  41.892 30.112 1.00 37.47  ? 176 PHE B C   1 
ATOM   4038 O  O   . PHE B 2 176 ? 21.190  41.231 29.077 1.00 37.61  ? 176 PHE B O   1 
ATOM   4039 C  CB  . PHE B 2 176 ? 19.009  41.407 31.569 1.00 39.49  ? 176 PHE B CB  1 
ATOM   4040 C  CG  . PHE B 2 176 ? 18.197  41.010 30.357 1.00 44.05  ? 176 PHE B CG  1 
ATOM   4041 C  CD1 . PHE B 2 176 ? 18.527  39.888 29.606 1.00 44.47  ? 176 PHE B CD1 1 
ATOM   4042 C  CD2 . PHE B 2 176 ? 17.075  41.751 29.991 1.00 49.66  ? 176 PHE B CD2 1 
ATOM   4043 C  CE1 . PHE B 2 176 ? 17.749  39.509 28.506 1.00 45.94  ? 176 PHE B CE1 1 
ATOM   4044 C  CE2 . PHE B 2 176 ? 16.291  41.379 28.895 1.00 49.98  ? 176 PHE B CE2 1 
ATOM   4045 C  CZ  . PHE B 2 176 ? 16.632  40.256 28.154 1.00 48.04  ? 176 PHE B CZ  1 
ATOM   4046 N  N   . MET B 2 177 ? 21.280  43.198 30.177 1.00 42.71  ? 177 MET B N   1 
ATOM   4047 C  CA  . MET B 2 177 ? 21.769  43.911 29.009 1.00 36.53  ? 177 MET B CA  1 
ATOM   4048 C  C   . MET B 2 177 ? 23.198  43.534 28.686 1.00 36.01  ? 177 MET B C   1 
ATOM   4049 O  O   . MET B 2 177 ? 23.576  43.564 27.516 1.00 27.48  ? 177 MET B O   1 
ATOM   4050 C  CB  . MET B 2 177 ? 21.673  45.421 29.193 1.00 33.72  ? 177 MET B CB  1 
ATOM   4051 C  CG  . MET B 2 177 ? 20.232  45.946 29.245 1.00 38.31  ? 177 MET B CG  1 
ATOM   4052 S  SD  . MET B 2 177 ? 19.148  45.260 27.980 1.00 37.81  ? 177 MET B SD  1 
ATOM   4053 C  CE  . MET B 2 177 ? 19.962  45.794 26.536 1.00 21.87  ? 177 MET B CE  1 
ATOM   4054 N  N   . ALA B 2 178 ? 23.991  43.187 29.707 1.00 27.35  ? 178 ALA B N   1 
ATOM   4055 C  CA  . ALA B 2 178 ? 25.383  42.777 29.463 1.00 32.49  ? 178 ALA B CA  1 
ATOM   4056 C  C   . ALA B 2 178 ? 25.355  41.526 28.581 1.00 31.97  ? 178 ALA B C   1 
ATOM   4057 O  O   . ALA B 2 178 ? 26.110  41.415 27.618 1.00 36.08  ? 178 ALA B O   1 
ATOM   4058 C  CB  . ALA B 2 178 ? 26.101  42.484 30.776 1.00 34.77  ? 178 ALA B CB  1 
ATOM   4059 N  N   . THR B 2 179 ? 24.450  40.603 28.906 1.00 35.18  ? 179 THR B N   1 
ATOM   4060 C  CA  . THR B 2 179 ? 24.292  39.367 28.140 1.00 31.67  ? 179 THR B CA  1 
ATOM   4061 C  C   . THR B 2 179 ? 23.886  39.669 26.702 1.00 36.93  ? 179 THR B C   1 
ATOM   4062 O  O   . THR B 2 179 ? 24.447  39.105 25.756 1.00 30.37  ? 179 THR B O   1 
ATOM   4063 C  CB  . THR B 2 179 ? 23.219  38.473 28.755 1.00 33.04  ? 179 THR B CB  1 
ATOM   4064 O  OG1 . THR B 2 179 ? 23.559  38.201 30.118 1.00 39.48  ? 179 THR B OG1 1 
ATOM   4065 C  CG2 . THR B 2 179 ? 23.116  37.174 27.996 1.00 25.52  ? 179 THR B CG2 1 
ATOM   4066 N  N   . ASN B 2 180 ? 22.914  40.568 26.545 1.00 32.01  ? 180 ASN B N   1 
ATOM   4067 C  CA  . ASN B 2 180 ? 22.440  40.932 25.218 1.00 34.24  ? 180 ASN B CA  1 
ATOM   4068 C  C   . ASN B 2 180 ? 23.529  41.624 24.427 1.00 27.34  ? 180 ASN B C   1 
ATOM   4069 O  O   . ASN B 2 180 ? 23.570  41.527 23.200 1.00 35.30  ? 180 ASN B O   1 
ATOM   4070 C  CB  . ASN B 2 180 ? 21.206  41.822 25.316 1.00 37.81  ? 180 ASN B CB  1 
ATOM   4071 C  CG  . ASN B 2 180 ? 20.036  41.101 25.933 1.00 37.93  ? 180 ASN B CG  1 
ATOM   4072 O  OD1 . ASN B 2 180 ? 19.749  39.963 25.573 1.00 49.34  ? 180 ASN B OD1 1 
ATOM   4073 N  ND2 . ASN B 2 180 ? 19.354  41.753 26.864 1.00 43.45  ? 180 ASN B ND2 1 
ATOM   4074 N  N   . SER B 2 181 ? 24.425  42.311 25.129 1.00 28.97  ? 181 SER B N   1 
ATOM   4075 C  CA  . SER B 2 181 ? 25.514  42.980 24.443 1.00 30.05  ? 181 SER B CA  1 
ATOM   4076 C  C   . SER B 2 181 ? 26.404  41.917 23.785 1.00 30.02  ? 181 SER B C   1 
ATOM   4077 O  O   . SER B 2 181 ? 26.915  42.128 22.684 1.00 33.99  ? 181 SER B O   1 
ATOM   4078 C  CB  . SER B 2 181 ? 26.309  43.862 25.417 1.00 34.66  ? 181 SER B CB  1 
ATOM   4079 O  OG  . SER B 2 181 ? 27.213  43.115 26.212 1.00 36.58  ? 181 SER B OG  1 
ATOM   4080 N  N   . LEU B 2 182 ? 26.587  40.767 24.444 1.00 34.67  ? 182 LEU B N   1 
ATOM   4081 C  CA  . LEU B 2 182 ? 27.396  39.689 23.847 1.00 33.19  ? 182 LEU B CA  1 
ATOM   4082 C  C   . LEU B 2 182 ? 26.641  39.052 22.681 1.00 30.66  ? 182 LEU B C   1 
ATOM   4083 O  O   . LEU B 2 182 ? 27.204  38.791 21.615 1.00 29.92  ? 182 LEU B O   1 
ATOM   4084 C  CB  . LEU B 2 182 ? 27.728  38.613 24.887 1.00 32.91  ? 182 LEU B CB  1 
ATOM   4085 C  CG  . LEU B 2 182 ? 28.699  39.096 25.964 1.00 32.50  ? 182 LEU B CG  1 
ATOM   4086 C  CD1 . LEU B 2 182 ? 28.868  38.033 27.046 1.00 33.17  ? 182 LEU B CD1 1 
ATOM   4087 C  CD2 . LEU B 2 182 ? 30.026  39.458 25.299 1.00 27.50  ? 182 LEU B CD2 1 
ATOM   4088 N  N   . HIS B 2 183 ? 25.353  38.821 22.900 1.00 25.80  ? 183 HIS B N   1 
ATOM   4089 C  CA  . HIS B 2 183 ? 24.479  38.213 21.897 1.00 38.62  ? 183 HIS B CA  1 
ATOM   4090 C  C   . HIS B 2 183 ? 24.239  39.047 20.626 1.00 37.80  ? 183 HIS B C   1 
ATOM   4091 O  O   . HIS B 2 183 ? 24.423  38.568 19.504 1.00 33.76  ? 183 HIS B O   1 
ATOM   4092 C  CB  . HIS B 2 183 ? 23.106  37.926 22.520 1.00 42.07  ? 183 HIS B CB  1 
ATOM   4093 C  CG  . HIS B 2 183 ? 23.032  36.668 23.329 1.00 36.79  ? 183 HIS B CG  1 
ATOM   4094 N  ND1 . HIS B 2 183 ? 22.456  35.510 22.846 1.00 39.21  ? 183 HIS B ND1 1 
ATOM   4095 C  CD2 . HIS B 2 183 ? 23.361  36.415 24.619 1.00 40.75  ? 183 HIS B CD2 1 
ATOM   4096 C  CE1 . HIS B 2 183 ? 22.425  34.603 23.808 1.00 38.15  ? 183 HIS B CE1 1 
ATOM   4097 N  NE2 . HIS B 2 183 ? 22.968  35.128 24.892 1.00 31.60  ? 183 HIS B NE2 1 
ATOM   4098 N  N   . LEU B 2 184 ? 23.852  40.307 20.810 1.00 41.00  ? 184 LEU B N   1 
ATOM   4099 C  CA  . LEU B 2 184 ? 23.479  41.167 19.684 1.00 39.07  ? 184 LEU B CA  1 
ATOM   4100 C  C   . LEU B 2 184 ? 24.490  42.125 19.073 1.00 37.31  ? 184 LEU B C   1 
ATOM   4101 O  O   . LEU B 2 184 ? 24.355  42.517 17.907 1.00 36.50  ? 184 LEU B O   1 
ATOM   4102 C  CB  . LEU B 2 184 ? 22.232  41.948 20.085 1.00 35.75  ? 184 LEU B CB  1 
ATOM   4103 C  CG  . LEU B 2 184 ? 21.205  41.099 20.851 1.00 32.71  ? 184 LEU B CG  1 
ATOM   4104 C  CD1 . LEU B 2 184 ? 20.060  41.985 21.344 1.00 36.65  ? 184 LEU B CD1 1 
ATOM   4105 C  CD2 . LEU B 2 184 ? 20.683  39.999 19.947 1.00 36.40  ? 184 LEU B CD2 1 
ATOM   4106 N  N   . THR B 2 185 ? 25.493  42.517 19.846 1.00 35.31  ? 185 THR B N   1 
ATOM   4107 C  CA  . THR B 2 185 ? 26.492  43.455 19.353 1.00 33.35  ? 185 THR B CA  1 
ATOM   4108 C  C   . THR B 2 185 ? 27.862  42.807 19.313 1.00 39.49  ? 185 THR B C   1 
ATOM   4109 O  O   . THR B 2 185 ? 28.042  41.675 19.766 1.00 32.22  ? 185 THR B O   1 
ATOM   4110 C  CB  . THR B 2 185 ? 26.643  44.655 20.293 1.00 33.12  ? 185 THR B CB  1 
ATOM   4111 O  OG1 . THR B 2 185 ? 27.633  44.346 21.283 1.00 31.28  ? 185 THR B OG1 1 
ATOM   4112 C  CG2 . THR B 2 185 ? 25.320  44.956 21.009 1.00 30.84  ? 185 THR B CG2 1 
ATOM   4113 N  N   . THR B 2 186 ? 28.821  43.561 18.789 1.00 33.91  ? 186 THR B N   1 
ATOM   4114 C  CA  . THR B 2 186 ? 30.209  43.148 18.731 1.00 31.40  ? 186 THR B CA  1 
ATOM   4115 C  C   . THR B 2 186 ? 30.970  44.110 19.655 1.00 24.74  ? 186 THR B C   1 
ATOM   4116 O  O   . THR B 2 186 ? 32.138  44.432 19.426 1.00 28.60  ? 186 THR B O   1 
ATOM   4117 C  CB  . THR B 2 186 ? 30.802  43.229 17.283 1.00 31.26  ? 186 THR B CB  1 
ATOM   4118 O  OG1 . THR B 2 186 ? 30.661  44.554 16.768 1.00 30.56  ? 186 THR B OG1 1 
ATOM   4119 C  CG2 . THR B 2 186 ? 30.097  42.237 16.348 1.00 25.21  ? 186 THR B CG2 1 
ATOM   4120 N  N   . PHE B 2 187 ? 30.302  44.578 20.705 1.00 28.57  ? 187 PHE B N   1 
ATOM   4121 C  CA  . PHE B 2 187 ? 30.973  45.488 21.626 1.00 30.23  ? 187 PHE B CA  1 
ATOM   4122 C  C   . PHE B 2 187 ? 32.182  44.783 22.264 1.00 30.95  ? 187 PHE B C   1 
ATOM   4123 O  O   . PHE B 2 187 ? 33.184  45.432 22.571 1.00 29.46  ? 187 PHE B O   1 
ATOM   4124 C  CB  . PHE B 2 187 ? 30.013  46.003 22.716 1.00 31.97  ? 187 PHE B CB  1 
ATOM   4125 C  CG  . PHE B 2 187 ? 29.027  47.069 22.238 1.00 27.91  ? 187 PHE B CG  1 
ATOM   4126 C  CD1 . PHE B 2 187 ? 29.214  47.736 21.045 1.00 27.43  ? 187 PHE B CD1 1 
ATOM   4127 C  CD2 . PHE B 2 187 ? 27.942  47.426 23.025 1.00 31.57  ? 187 PHE B CD2 1 
ATOM   4128 C  CE1 . PHE B 2 187 ? 28.336  48.748 20.644 1.00 28.10  ? 187 PHE B CE1 1 
ATOM   4129 C  CE2 . PHE B 2 187 ? 27.057  48.436 22.635 1.00 36.91  ? 187 PHE B CE2 1 
ATOM   4130 C  CZ  . PHE B 2 187 ? 27.260  49.098 21.441 1.00 34.92  ? 187 PHE B CZ  1 
ATOM   4131 N  N   . SER B 2 188 ? 32.096  43.459 22.436 1.00 24.27  ? 188 SER B N   1 
ATOM   4132 C  CA  . SER B 2 188 ? 33.194  42.695 23.032 1.00 26.96  ? 188 SER B CA  1 
ATOM   4133 C  C   . SER B 2 188 ? 34.462  42.756 22.175 1.00 30.13  ? 188 SER B C   1 
ATOM   4134 O  O   . SER B 2 188 ? 35.553  42.440 22.651 1.00 26.45  ? 188 SER B O   1 
ATOM   4135 C  CB  . SER B 2 188 ? 32.779  41.236 23.235 1.00 30.55  ? 188 SER B CB  1 
ATOM   4136 O  OG  . SER B 2 188 ? 32.556  40.599 21.993 1.00 30.41  ? 188 SER B OG  1 
ATOM   4137 N  N   . LEU B 2 189 ? 34.313  43.169 20.914 1.00 27.63  ? 189 LEU B N   1 
ATOM   4138 C  CA  . LEU B 2 189 ? 35.444  43.285 20.006 1.00 21.65  ? 189 LEU B CA  1 
ATOM   4139 C  C   . LEU B 2 189 ? 35.892  44.743 19.848 1.00 32.67  ? 189 LEU B C   1 
ATOM   4140 O  O   . LEU B 2 189 ? 36.834  45.050 19.115 1.00 31.08  ? 189 LEU B O   1 
ATOM   4141 C  CB  . LEU B 2 189 ? 35.069  42.739 18.623 1.00 30.64  ? 189 LEU B CB  1 
ATOM   4142 C  CG  . LEU B 2 189 ? 34.763  41.250 18.490 1.00 33.51  ? 189 LEU B CG  1 
ATOM   4143 C  CD1 . LEU B 2 189 ? 34.337  40.915 17.046 1.00 30.12  ? 189 LEU B CD1 1 
ATOM   4144 C  CD2 . LEU B 2 189 ? 36.009  40.470 18.886 1.00 31.99  ? 189 LEU B CD2 1 
ATOM   4145 N  N   . GLN B 2 190 ? 35.226  45.649 20.540 1.00 33.97  ? 190 GLN B N   1 
ATOM   4146 C  CA  . GLN B 2 190 ? 35.564  47.051 20.390 1.00 30.69  ? 190 GLN B CA  1 
ATOM   4147 C  C   . GLN B 2 190 ? 35.892  47.761 21.687 1.00 30.68  ? 190 GLN B C   1 
ATOM   4148 O  O   . GLN B 2 190 ? 36.786  48.583 21.731 1.00 28.03  ? 190 GLN B O   1 
ATOM   4149 C  CB  . GLN B 2 190 ? 34.407  47.774 19.721 1.00 29.55  ? 190 GLN B CB  1 
ATOM   4150 C  CG  . GLN B 2 190 ? 33.910  47.125 18.437 1.00 30.78  ? 190 GLN B CG  1 
ATOM   4151 C  CD  . GLN B 2 190 ? 32.735  47.880 17.861 1.00 37.52  ? 190 GLN B CD  1 
ATOM   4152 O  OE1 . GLN B 2 190 ? 32.826  49.084 17.611 1.00 47.36  ? 190 GLN B OE1 1 
ATOM   4153 N  NE2 . GLN B 2 190 ? 31.622  47.188 17.658 1.00 40.85  ? 190 GLN B NE2 1 
ATOM   4154 N  N   . TYR B 2 191 ? 35.168  47.429 22.742 1.00 30.42  ? 191 TYR B N   1 
ATOM   4155 C  CA  . TYR B 2 191 ? 35.367  48.080 24.017 1.00 37.32  ? 191 TYR B CA  1 
ATOM   4156 C  C   . TYR B 2 191 ? 35.651  47.089 25.128 1.00 33.51  ? 191 TYR B C   1 
ATOM   4157 O  O   . TYR B 2 191 ? 35.169  45.967 25.110 1.00 33.69  ? 191 TYR B O   1 
ATOM   4158 C  CB  . TYR B 2 191 ? 34.122  48.910 24.334 1.00 43.04  ? 191 TYR B CB  1 
ATOM   4159 C  CG  . TYR B 2 191 ? 33.711  49.790 23.168 1.00 35.27  ? 191 TYR B CG  1 
ATOM   4160 C  CD1 . TYR B 2 191 ? 34.466  50.904 22.811 1.00 37.63  ? 191 TYR B CD1 1 
ATOM   4161 C  CD2 . TYR B 2 191 ? 32.592  49.479 22.396 1.00 38.03  ? 191 TYR B CD2 1 
ATOM   4162 C  CE1 . TYR B 2 191 ? 34.114  51.684 21.716 1.00 38.66  ? 191 TYR B CE1 1 
ATOM   4163 C  CE2 . TYR B 2 191 ? 32.235  50.249 21.303 1.00 33.03  ? 191 TYR B CE2 1 
ATOM   4164 C  CZ  . TYR B 2 191 ? 33.000  51.350 20.968 1.00 40.49  ? 191 TYR B CZ  1 
ATOM   4165 O  OH  . TYR B 2 191 ? 32.647  52.117 19.883 1.00 50.79  ? 191 TYR B OH  1 
ATOM   4166 N  N   . THR B 2 192 ? 36.465  47.512 26.084 1.00 34.19  ? 192 THR B N   1 
ATOM   4167 C  CA  . THR B 2 192 ? 36.826  46.665 27.188 1.00 30.13  ? 192 THR B CA  1 
ATOM   4168 C  C   . THR B 2 192 ? 35.592  46.386 28.036 1.00 35.10  ? 192 THR B C   1 
ATOM   4169 O  O   . THR B 2 192 ? 34.671  47.205 28.113 1.00 28.39  ? 192 THR B O   1 
ATOM   4170 C  CB  . THR B 2 192 ? 37.902  47.325 28.057 1.00 34.01  ? 192 THR B CB  1 
ATOM   4171 O  OG1 . THR B 2 192 ? 37.365  48.490 28.692 1.00 36.92  ? 192 THR B OG1 1 
ATOM   4172 C  CG2 . THR B 2 192 ? 39.097  47.724 27.205 1.00 30.80  ? 192 THR B CG2 1 
ATOM   4173 N  N   . PRO B 2 193 ? 35.562  45.217 28.682 1.00 33.51  ? 193 PRO B N   1 
ATOM   4174 C  CA  . PRO B 2 193 ? 34.447  44.809 29.532 1.00 28.49  ? 193 PRO B CA  1 
ATOM   4175 C  C   . PRO B 2 193 ? 33.948  45.880 30.505 1.00 32.43  ? 193 PRO B C   1 
ATOM   4176 O  O   . PRO B 2 193 ? 32.751  45.980 30.761 1.00 34.94  ? 193 PRO B O   1 
ATOM   4177 C  CB  . PRO B 2 193 ? 35.001  43.587 30.246 1.00 24.17  ? 193 PRO B CB  1 
ATOM   4178 C  CG  . PRO B 2 193 ? 35.882  42.973 29.188 1.00 34.57  ? 193 PRO B CG  1 
ATOM   4179 C  CD  . PRO B 2 193 ? 36.601  44.169 28.625 1.00 32.43  ? 193 PRO B CD  1 
ATOM   4180 N  N   . PRO B 2 194 ? 34.860  46.681 31.082 1.00 34.25  ? 194 PRO B N   1 
ATOM   4181 C  CA  . PRO B 2 194 ? 34.412  47.718 32.018 1.00 34.99  ? 194 PRO B CA  1 
ATOM   4182 C  C   . PRO B 2 194 ? 33.558  48.776 31.321 1.00 33.80  ? 194 PRO B C   1 
ATOM   4183 O  O   . PRO B 2 194 ? 32.538  49.243 31.852 1.00 29.84  ? 194 PRO B O   1 
ATOM   4184 C  CB  . PRO B 2 194 ? 35.724  48.284 32.548 1.00 39.53  ? 194 PRO B CB  1 
ATOM   4185 C  CG  . PRO B 2 194 ? 36.633  47.101 32.497 1.00 28.19  ? 194 PRO B CG  1 
ATOM   4186 C  CD  . PRO B 2 194 ? 36.320  46.528 31.146 1.00 30.33  ? 194 PRO B CD  1 
ATOM   4187 N  N   . VAL B 2 195 ? 33.978  49.151 30.123 1.00 34.87  ? 195 VAL B N   1 
ATOM   4188 C  CA  . VAL B 2 195 ? 33.245  50.149 29.363 1.00 35.17  ? 195 VAL B CA  1 
ATOM   4189 C  C   . VAL B 2 195 ? 31.883  49.592 28.970 1.00 31.48  ? 195 VAL B C   1 
ATOM   4190 O  O   . VAL B 2 195 ? 30.858  50.263 29.113 1.00 40.38  ? 195 VAL B O   1 
ATOM   4191 C  CB  . VAL B 2 195 ? 34.035  50.562 28.112 1.00 26.84  ? 195 VAL B CB  1 
ATOM   4192 C  CG1 . VAL B 2 195 ? 33.205  51.504 27.243 1.00 32.38  ? 195 VAL B CG1 1 
ATOM   4193 C  CG2 . VAL B 2 195 ? 35.334  51.212 28.532 1.00 27.24  ? 195 VAL B CG2 1 
ATOM   4194 N  N   . VAL B 2 196 ? 31.867  48.353 28.497 1.00 36.90  ? 196 VAL B N   1 
ATOM   4195 C  CA  . VAL B 2 196 ? 30.619  47.728 28.086 1.00 32.64  ? 196 VAL B CA  1 
ATOM   4196 C  C   . VAL B 2 196 ? 29.693  47.654 29.286 1.00 32.82  ? 196 VAL B C   1 
ATOM   4197 O  O   . VAL B 2 196 ? 28.482  47.826 29.142 1.00 33.11  ? 196 VAL B O   1 
ATOM   4198 C  CB  . VAL B 2 196 ? 30.867  46.293 27.479 1.00 33.17  ? 196 VAL B CB  1 
ATOM   4199 C  CG1 . VAL B 2 196 ? 29.545  45.615 27.109 1.00 25.42  ? 196 VAL B CG1 1 
ATOM   4200 C  CG2 . VAL B 2 196 ? 31.733  46.402 26.236 1.00 24.69  ? 196 VAL B CG2 1 
ATOM   4201 N  N   . ALA B 2 197 ? 30.261  47.414 30.472 1.00 32.16  ? 197 ALA B N   1 
ATOM   4202 C  CA  . ALA B 2 197 ? 29.457  47.325 31.686 1.00 29.54  ? 197 ALA B CA  1 
ATOM   4203 C  C   . ALA B 2 197 ? 28.752  48.653 31.945 1.00 29.88  ? 197 ALA B C   1 
ATOM   4204 O  O   . ALA B 2 197 ? 27.580  48.691 32.331 1.00 30.56  ? 197 ALA B O   1 
ATOM   4205 C  CB  . ALA B 2 197 ? 30.329  46.950 32.883 1.00 29.45  ? 197 ALA B CB  1 
ATOM   4206 N  N   . CYS B 2 198 ? 29.487  49.738 31.743 1.00 29.22  ? 198 CYS B N   1 
ATOM   4207 C  CA  . CYS B 2 198 ? 28.961  51.085 31.922 1.00 32.33  ? 198 CYS B CA  1 
ATOM   4208 C  C   . CYS B 2 198 ? 27.821  51.371 30.938 1.00 35.44  ? 198 CYS B C   1 
ATOM   4209 O  O   . CYS B 2 198 ? 26.824  51.997 31.302 1.00 39.18  ? 198 CYS B O   1 
ATOM   4210 C  CB  . CYS B 2 198 ? 30.076  52.104 31.715 1.00 30.35  ? 198 CYS B CB  1 
ATOM   4211 S  SG  . CYS B 2 198 ? 31.197  52.247 33.120 1.00 38.23  ? 198 CYS B SG  1 
ATOM   4212 N  N   . VAL B 2 199 ? 27.981  50.916 29.697 1.00 30.16  ? 199 VAL B N   1 
ATOM   4213 C  CA  . VAL B 2 199 ? 26.972  51.113 28.675 1.00 22.73  ? 199 VAL B CA  1 
ATOM   4214 C  C   . VAL B 2 199 ? 25.681  50.424 29.104 1.00 33.40  ? 199 VAL B C   1 
ATOM   4215 O  O   . VAL B 2 199 ? 24.598  51.012 29.028 1.00 33.40  ? 199 VAL B O   1 
ATOM   4216 C  CB  . VAL B 2 199 ? 27.437  50.555 27.299 1.00 25.96  ? 199 VAL B CB  1 
ATOM   4217 C  CG1 . VAL B 2 199 ? 26.313  50.686 26.262 1.00 27.04  ? 199 VAL B CG1 1 
ATOM   4218 C  CG2 . VAL B 2 199 ? 28.658  51.307 26.836 1.00 30.00  ? 199 VAL B CG2 1 
ATOM   4219 N  N   . CYS B 2 200 ? 25.809  49.186 29.572 1.00 27.26  ? 200 CYS B N   1 
ATOM   4220 C  CA  . CYS B 2 200 ? 24.669  48.403 30.027 1.00 34.18  ? 200 CYS B CA  1 
ATOM   4221 C  C   . CYS B 2 200 ? 23.969  49.015 31.238 1.00 31.20  ? 200 CYS B C   1 
ATOM   4222 O  O   . CYS B 2 200 ? 22.770  48.830 31.424 1.00 35.82  ? 200 CYS B O   1 
ATOM   4223 C  CB  . CYS B 2 200 ? 25.111  46.963 30.355 1.00 36.69  ? 200 CYS B CB  1 
ATOM   4224 S  SG  . CYS B 2 200 ? 25.795  46.088 28.930 1.00 39.32  ? 200 CYS B SG  1 
ATOM   4225 N  N   . ILE B 2 201 ? 24.708  49.719 32.082 1.00 31.49  ? 201 ILE B N   1 
ATOM   4226 C  CA  . ILE B 2 201 ? 24.075  50.349 33.242 1.00 38.13  ? 201 ILE B CA  1 
ATOM   4227 C  C   . ILE B 2 201 ? 23.398  51.658 32.799 1.00 33.76  ? 201 ILE B C   1 
ATOM   4228 O  O   . ILE B 2 201 ? 22.232  51.920 33.112 1.00 36.88  ? 201 ILE B O   1 
ATOM   4229 C  CB  . ILE B 2 201 ? 25.098  50.644 34.329 1.00 31.63  ? 201 ILE B CB  1 
ATOM   4230 C  CG1 . ILE B 2 201 ? 25.462  49.338 35.047 1.00 43.90  ? 201 ILE B CG1 1 
ATOM   4231 C  CG2 . ILE B 2 201 ? 24.542  51.667 35.302 1.00 38.66  ? 201 ILE B CG2 1 
ATOM   4232 C  CD1 . ILE B 2 201 ? 26.737  49.417 35.864 1.00 42.38  ? 201 ILE B CD1 1 
ATOM   4233 N  N   . HIS B 2 202 ? 24.151  52.464 32.067 1.00 36.70  ? 202 HIS B N   1 
ATOM   4234 C  CA  . HIS B 2 202 ? 23.668  53.731 31.543 1.00 42.92  ? 202 HIS B CA  1 
ATOM   4235 C  C   . HIS B 2 202 ? 22.339  53.481 30.844 1.00 46.17  ? 202 HIS B C   1 
ATOM   4236 O  O   . HIS B 2 202 ? 21.370  54.207 31.066 1.00 40.67  ? 202 HIS B O   1 
ATOM   4237 C  CB  . HIS B 2 202 ? 24.684  54.287 30.543 1.00 38.05  ? 202 HIS B CB  1 
ATOM   4238 C  CG  . HIS B 2 202 ? 24.372  55.666 30.059 1.00 44.67  ? 202 HIS B CG  1 
ATOM   4239 N  ND1 . HIS B 2 202 ? 24.261  56.743 30.910 1.00 32.44  ? 202 HIS B ND1 1 
ATOM   4240 C  CD2 . HIS B 2 202 ? 24.203  56.153 28.806 1.00 39.20  ? 202 HIS B CD2 1 
ATOM   4241 C  CE1 . HIS B 2 202 ? 24.041  57.837 30.203 1.00 43.96  ? 202 HIS B CE1 1 
ATOM   4242 N  NE2 . HIS B 2 202 ? 24.003  57.508 28.924 1.00 41.31  ? 202 HIS B NE2 1 
ATOM   4243 N  N   . LEU B 2 203 ? 22.296  52.445 30.004 1.00 41.79  ? 203 LEU B N   1 
ATOM   4244 C  CA  . LEU B 2 203 ? 21.077  52.122 29.293 1.00 34.32  ? 203 LEU B CA  1 
ATOM   4245 C  C   . LEU B 2 203 ? 19.982  51.734 30.272 1.00 42.78  ? 203 LEU B C   1 
ATOM   4246 O  O   . LEU B 2 203 ? 18.868  52.257 30.205 1.00 46.56  ? 203 LEU B O   1 
ATOM   4247 C  CB  . LEU B 2 203 ? 21.306  50.997 28.284 1.00 36.56  ? 203 LEU B CB  1 
ATOM   4248 C  CG  . LEU B 2 203 ? 20.073  50.671 27.439 1.00 32.14  ? 203 LEU B CG  1 
ATOM   4249 C  CD1 . LEU B 2 203 ? 19.463  51.967 26.917 1.00 41.22  ? 203 LEU B CD1 1 
ATOM   4250 C  CD2 . LEU B 2 203 ? 20.453  49.776 26.283 1.00 33.79  ? 203 LEU B CD2 1 
ATOM   4251 N  N   . ALA B 2 204 ? 20.290  50.821 31.186 1.00 39.18  ? 204 ALA B N   1 
ATOM   4252 C  CA  . ALA B 2 204 ? 19.300  50.408 32.173 1.00 42.27  ? 204 ALA B CA  1 
ATOM   4253 C  C   . ALA B 2 204 ? 18.787  51.623 32.959 1.00 39.55  ? 204 ALA B C   1 
ATOM   4254 O  O   . ALA B 2 204 ? 17.602  51.703 33.292 1.00 41.80  ? 204 ALA B O   1 
ATOM   4255 C  CB  . ALA B 2 204 ? 19.910  49.385 33.120 1.00 44.95  ? 204 ALA B CB  1 
ATOM   4256 N  N   . CYS B 2 205 ? 19.679  52.567 33.254 1.00 41.91  ? 205 CYS B N   1 
ATOM   4257 C  CA  . CYS B 2 205 ? 19.302  53.769 33.998 1.00 41.37  ? 205 CYS B CA  1 
ATOM   4258 C  C   . CYS B 2 205 ? 18.336  54.678 33.236 1.00 44.87  ? 205 CYS B C   1 
ATOM   4259 O  O   . CYS B 2 205 ? 17.512  55.365 33.838 1.00 40.71  ? 205 CYS B O   1 
ATOM   4260 C  CB  . CYS B 2 205 ? 20.544  54.567 34.397 1.00 43.25  ? 205 CYS B CB  1 
ATOM   4261 S  SG  . CYS B 2 205 ? 21.284  54.052 35.970 1.00 40.87  ? 205 CYS B SG  1 
ATOM   4262 N  N   . LYS B 2 206 ? 18.442  54.686 31.914 1.00 43.39  ? 206 LYS B N   1 
ATOM   4263 C  CA  . LYS B 2 206 ? 17.559  55.502 31.099 1.00 49.16  ? 206 LYS B CA  1 
ATOM   4264 C  C   . LYS B 2 206 ? 16.166  54.891 31.094 1.00 50.83  ? 206 LYS B C   1 
ATOM   4265 O  O   . LYS B 2 206 ? 15.171  55.599 31.241 1.00 55.86  ? 206 LYS B O   1 
ATOM   4266 C  CB  . LYS B 2 206 ? 18.100  55.619 29.665 1.00 45.99  ? 206 LYS B CB  1 
ATOM   4267 C  CG  . LYS B 2 206 ? 19.454  56.300 29.605 1.00 59.58  ? 206 LYS B CG  1 
ATOM   4268 C  CD  . LYS B 2 206 ? 19.485  57.447 28.613 1.00 60.89  ? 206 LYS B CD  1 
ATOM   4269 C  CE  . LYS B 2 206 ? 20.613  58.406 28.956 1.00 56.71  ? 206 LYS B CE  1 
ATOM   4270 N  NZ  . LYS B 2 206 ? 20.791  59.488 27.952 1.00 72.78  ? 206 LYS B NZ  1 
ATOM   4271 N  N   . TRP B 2 207 ? 16.089  53.575 30.943 1.00 46.61  ? 207 TRP B N   1 
ATOM   4272 C  CA  . TRP B 2 207 ? 14.790  52.922 30.933 1.00 49.14  ? 207 TRP B CA  1 
ATOM   4273 C  C   . TRP B 2 207 ? 14.051  53.054 32.266 1.00 53.26  ? 207 TRP B C   1 
ATOM   4274 O  O   . TRP B 2 207 ? 12.831  52.910 32.319 1.00 61.54  ? 207 TRP B O   1 
ATOM   4275 C  CB  . TRP B 2 207 ? 14.931  51.449 30.560 1.00 40.88  ? 207 TRP B CB  1 
ATOM   4276 C  CG  . TRP B 2 207 ? 15.275  51.230 29.115 1.00 47.23  ? 207 TRP B CG  1 
ATOM   4277 C  CD1 . TRP B 2 207 ? 14.906  52.009 28.055 1.00 47.81  ? 207 TRP B CD1 1 
ATOM   4278 C  CD2 . TRP B 2 207 ? 15.970  50.111 28.565 1.00 48.34  ? 207 TRP B CD2 1 
ATOM   4279 N  NE1 . TRP B 2 207 ? 15.321  51.438 26.873 1.00 48.42  ? 207 TRP B NE1 1 
ATOM   4280 C  CE2 . TRP B 2 207 ? 15.977  50.270 27.158 1.00 52.01  ? 207 TRP B CE2 1 
ATOM   4281 C  CE3 . TRP B 2 207 ? 16.585  48.982 29.122 1.00 50.20  ? 207 TRP B CE3 1 
ATOM   4282 C  CZ2 . TRP B 2 207 ? 16.575  49.343 26.303 1.00 49.10  ? 207 TRP B CZ2 1 
ATOM   4283 C  CZ3 . TRP B 2 207 ? 17.179  48.063 28.272 1.00 42.79  ? 207 TRP B CZ3 1 
ATOM   4284 C  CH2 . TRP B 2 207 ? 17.168  48.250 26.874 1.00 49.79  ? 207 TRP B CH2 1 
ATOM   4285 N  N   . SER B 2 208 ? 14.782  53.322 33.341 1.00 48.18  ? 208 SER B N   1 
ATOM   4286 C  CA  . SER B 2 208 ? 14.156  53.480 34.652 1.00 57.38  ? 208 SER B CA  1 
ATOM   4287 C  C   . SER B 2 208 ? 14.265  54.931 35.109 1.00 56.16  ? 208 SER B C   1 
ATOM   4288 O  O   . SER B 2 208 ? 14.081  55.241 36.291 1.00 58.80  ? 208 SER B O   1 
ATOM   4289 C  CB  . SER B 2 208 ? 14.813  52.549 35.686 1.00 54.63  ? 208 SER B CB  1 
ATOM   4290 O  OG  . SER B 2 208 ? 16.226  52.561 35.579 1.00 71.21  ? 208 SER B OG  1 
ATOM   4291 N  N   . ASN B 2 209 ? 14.554  55.812 34.155 1.00 53.22  ? 209 ASN B N   1 
ATOM   4292 C  CA  . ASN B 2 209 ? 14.711  57.238 34.427 1.00 49.29  ? 209 ASN B CA  1 
ATOM   4293 C  C   . ASN B 2 209 ? 15.381  57.479 35.779 1.00 50.73  ? 209 ASN B C   1 
ATOM   4294 O  O   . ASN B 2 209 ? 14.931  58.320 36.552 1.00 52.16  ? 209 ASN B O   1 
ATOM   4295 C  CB  . ASN B 2 209 ? 13.354  57.948 34.399 1.00 49.62  ? 209 ASN B CB  1 
ATOM   4296 C  CG  . ASN B 2 209 ? 13.485  59.464 34.397 1.00 58.22  ? 209 ASN B CG  1 
ATOM   4297 O  OD1 . ASN B 2 209 ? 12.566  60.173 34.801 1.00 60.44  ? 209 ASN B OD1 1 
ATOM   4298 N  ND2 . ASN B 2 209 ? 14.625  59.967 33.931 1.00 53.27  ? 209 ASN B ND2 1 
ATOM   4299 N  N   . TRP B 2 210 ? 16.442  56.724 36.067 1.00 54.38  ? 210 TRP B N   1 
ATOM   4300 C  CA  . TRP B 2 210 ? 17.181  56.888 37.315 1.00 50.11  ? 210 TRP B CA  1 
ATOM   4301 C  C   . TRP B 2 210 ? 18.478  57.607 37.001 1.00 47.94  ? 210 TRP B C   1 
ATOM   4302 O  O   . TRP B 2 210 ? 19.193  57.243 36.069 1.00 54.28  ? 210 TRP B O   1 
ATOM   4303 C  CB  . TRP B 2 210 ? 17.496  55.542 37.971 1.00 54.35  ? 210 TRP B CB  1 
ATOM   4304 C  CG  . TRP B 2 210 ? 18.210  55.717 39.281 1.00 58.01  ? 210 TRP B CG  1 
ATOM   4305 C  CD1 . TRP B 2 210 ? 17.879  56.593 40.275 1.00 72.74  ? 210 TRP B CD1 1 
ATOM   4306 C  CD2 . TRP B 2 210 ? 19.370  55.012 39.740 1.00 63.89  ? 210 TRP B CD2 1 
ATOM   4307 N  NE1 . TRP B 2 210 ? 18.760  56.481 41.323 1.00 72.95  ? 210 TRP B NE1 1 
ATOM   4308 C  CE2 . TRP B 2 210 ? 19.686  55.518 41.023 1.00 72.83  ? 210 TRP B CE2 1 
ATOM   4309 C  CE3 . TRP B 2 210 ? 20.174  54.003 39.197 1.00 70.02  ? 210 TRP B CE3 1 
ATOM   4310 C  CZ2 . TRP B 2 210 ? 20.777  55.045 41.773 1.00 74.89  ? 210 TRP B CZ2 1 
ATOM   4311 C  CZ3 . TRP B 2 210 ? 21.261  53.530 39.948 1.00 74.14  ? 210 TRP B CZ3 1 
ATOM   4312 C  CH2 . TRP B 2 210 ? 21.548  54.055 41.220 1.00 69.03  ? 210 TRP B CH2 1 
ATOM   4313 N  N   . GLU B 2 211 ? 18.782  58.627 37.788 1.00 49.33  ? 211 GLU B N   1 
ATOM   4314 C  CA  . GLU B 2 211 ? 19.976  59.420 37.564 1.00 55.24  ? 211 GLU B CA  1 
ATOM   4315 C  C   . GLU B 2 211 ? 20.931  59.296 38.749 1.00 59.55  ? 211 GLU B C   1 
ATOM   4316 O  O   . GLU B 2 211 ? 20.877  60.099 39.677 1.00 65.27  ? 211 GLU B O   1 
ATOM   4317 C  CB  . GLU B 2 211 ? 19.569  60.883 37.355 1.00 52.94  ? 211 GLU B CB  1 
ATOM   4318 C  CG  . GLU B 2 211 ? 20.583  61.714 36.614 1.00 67.35  ? 211 GLU B CG  1 
ATOM   4319 C  CD  . GLU B 2 211 ? 20.816  61.216 35.203 1.00 72.12  ? 211 GLU B CD  1 
ATOM   4320 O  OE1 . GLU B 2 211 ? 19.866  61.248 34.390 1.00 74.18  ? 211 GLU B OE1 1 
ATOM   4321 O  OE2 . GLU B 2 211 ? 21.950  60.788 34.909 1.00 65.80  ? 211 GLU B OE2 1 
ATOM   4322 N  N   . ILE B 2 212 ? 21.803  58.291 38.704 1.00 59.61  ? 212 ILE B N   1 
ATOM   4323 C  CA  . ILE B 2 212 ? 22.770  58.048 39.773 1.00 62.35  ? 212 ILE B CA  1 
ATOM   4324 C  C   . ILE B 2 212 ? 23.471  59.327 40.215 1.00 60.33  ? 212 ILE B C   1 
ATOM   4325 O  O   . ILE B 2 212 ? 24.158  59.979 39.428 1.00 54.17  ? 212 ILE B O   1 
ATOM   4326 C  CB  . ILE B 2 212 ? 23.850  57.033 39.342 1.00 62.47  ? 212 ILE B CB  1 
ATOM   4327 C  CG1 . ILE B 2 212 ? 23.185  55.732 38.890 1.00 47.39  ? 212 ILE B CG1 1 
ATOM   4328 C  CG2 . ILE B 2 212 ? 24.809  56.775 40.506 1.00 58.63  ? 212 ILE B CG2 1 
ATOM   4329 C  CD1 . ILE B 2 212 ? 24.130  54.738 38.264 1.00 46.79  ? 212 ILE B CD1 1 
ATOM   4330 N  N   . PRO B 2 213 ? 23.310  59.694 41.495 1.00 55.70  ? 213 PRO B N   1 
ATOM   4331 C  CA  . PRO B 2 213 ? 23.908  60.892 42.083 1.00 53.85  ? 213 PRO B CA  1 
ATOM   4332 C  C   . PRO B 2 213 ? 25.417  60.952 41.936 1.00 56.53  ? 213 PRO B C   1 
ATOM   4333 O  O   . PRO B 2 213 ? 26.098  59.933 42.012 1.00 62.95  ? 213 PRO B O   1 
ATOM   4334 C  CB  . PRO B 2 213 ? 23.482  60.802 43.544 1.00 54.86  ? 213 PRO B CB  1 
ATOM   4335 C  CG  . PRO B 2 213 ? 22.153  60.131 43.455 1.00 52.79  ? 213 PRO B CG  1 
ATOM   4336 C  CD  . PRO B 2 213 ? 22.444  59.018 42.476 1.00 60.48  ? 213 PRO B CD  1 
ATOM   4337 N  N   . VAL B 2 214 ? 25.928  62.158 41.722 1.00 58.78  ? 214 VAL B N   1 
ATOM   4338 C  CA  . VAL B 2 214 ? 27.358  62.371 41.585 1.00 63.48  ? 214 VAL B CA  1 
ATOM   4339 C  C   . VAL B 2 214 ? 27.942  62.387 42.982 1.00 71.57  ? 214 VAL B C   1 
ATOM   4340 O  O   . VAL B 2 214 ? 27.546  63.202 43.817 1.00 77.33  ? 214 VAL B O   1 
ATOM   4341 C  CB  . VAL B 2 214 ? 27.663  63.712 40.929 1.00 58.84  ? 214 VAL B CB  1 
ATOM   4342 C  CG1 . VAL B 2 214 ? 29.158  63.828 40.669 1.00 59.87  ? 214 VAL B CG1 1 
ATOM   4343 C  CG2 . VAL B 2 214 ? 26.869  63.844 39.646 1.00 68.25  ? 214 VAL B CG2 1 
ATOM   4344 N  N   . SER B 2 215 ? 28.880  61.483 43.236 1.00 77.72  ? 215 SER B N   1 
ATOM   4345 C  CA  . SER B 2 215 ? 29.496  61.395 44.547 1.00 81.61  ? 215 SER B CA  1 
ATOM   4346 C  C   . SER B 2 215 ? 30.003  62.752 45.005 1.00 82.54  ? 215 SER B C   1 
ATOM   4347 O  O   . SER B 2 215 ? 30.644  63.486 44.250 1.00 79.69  ? 215 SER B O   1 
ATOM   4348 C  CB  . SER B 2 215 ? 30.640  60.378 44.541 1.00 79.76  ? 215 SER B CB  1 
ATOM   4349 O  OG  . SER B 2 215 ? 30.149  59.060 44.357 1.00 75.96  ? 215 SER B OG  1 
ATOM   4350 N  N   . THR B 2 216 ? 29.675  63.068 46.252 1.00 85.68  ? 216 THR B N   1 
ATOM   4351 C  CA  . THR B 2 216 ? 30.052  64.310 46.911 1.00 88.11  ? 216 THR B CA  1 
ATOM   4352 C  C   . THR B 2 216 ? 31.235  65.039 46.279 1.00 88.54  ? 216 THR B C   1 
ATOM   4353 O  O   . THR B 2 216 ? 32.364  64.543 46.285 1.00 87.56  ? 216 THR B O   1 
ATOM   4354 C  CB  . THR B 2 216 ? 30.363  64.033 48.385 1.00 85.51  ? 216 THR B CB  1 
ATOM   4355 O  OG1 . THR B 2 216 ? 31.284  62.937 48.475 1.00 90.61  ? 216 THR B OG1 1 
ATOM   4356 C  CG2 . THR B 2 216 ? 29.087  63.668 49.133 1.00 80.64  ? 216 THR B CG2 1 
ATOM   4357 N  N   . ASP B 2 217 ? 30.953  66.219 45.733 1.00 87.88  ? 217 ASP B N   1 
ATOM   4358 C  CA  . ASP B 2 217 ? 31.958  67.062 45.093 1.00 86.76  ? 217 ASP B CA  1 
ATOM   4359 C  C   . ASP B 2 217 ? 33.040  66.262 44.360 1.00 85.64  ? 217 ASP B C   1 
ATOM   4360 O  O   . ASP B 2 217 ? 34.229  66.381 44.676 1.00 84.95  ? 217 ASP B O   1 
ATOM   4361 C  CB  . ASP B 2 217 ? 32.608  67.965 46.143 1.00 87.64  ? 217 ASP B CB  1 
ATOM   4362 C  CG  . ASP B 2 217 ? 33.489  69.035 45.528 1.00 100.78 ? 217 ASP B CG  1 
ATOM   4363 O  OD1 . ASP B 2 217 ? 34.122  69.791 46.297 1.00 99.61  ? 217 ASP B OD1 1 
ATOM   4364 O  OD2 . ASP B 2 217 ? 33.546  69.122 44.280 1.00 99.59  ? 217 ASP B OD2 1 
ATOM   4365 N  N   . GLY B 2 218 ? 32.636  65.455 43.378 1.00 79.53  ? 218 GLY B N   1 
ATOM   4366 C  CA  . GLY B 2 218 ? 33.616  64.666 42.655 1.00 74.05  ? 218 GLY B CA  1 
ATOM   4367 C  C   . GLY B 2 218 ? 33.202  63.953 41.376 1.00 71.17  ? 218 GLY B C   1 
ATOM   4368 O  O   . GLY B 2 218 ? 32.575  64.533 40.483 1.00 60.20  ? 218 GLY B O   1 
ATOM   4369 N  N   . LYS B 2 219 ? 33.573  62.676 41.307 1.00 65.91  ? 219 LYS B N   1 
ATOM   4370 C  CA  . LYS B 2 219 ? 33.316  61.816 40.157 1.00 64.74  ? 219 LYS B CA  1 
ATOM   4371 C  C   . LYS B 2 219 ? 31.878  61.337 39.941 1.00 57.06  ? 219 LYS B C   1 
ATOM   4372 O  O   . LYS B 2 219 ? 31.051  61.337 40.854 1.00 57.00  ? 219 LYS B O   1 
ATOM   4373 C  CB  . LYS B 2 219 ? 34.216  60.576 40.234 1.00 68.82  ? 219 LYS B CB  1 
ATOM   4374 C  CG  . LYS B 2 219 ? 35.709  60.848 40.382 1.00 74.97  ? 219 LYS B CG  1 
ATOM   4375 C  CD  . LYS B 2 219 ? 36.518  59.540 40.380 1.00 75.84  ? 219 LYS B CD  1 
ATOM   4376 C  CE  . LYS B 2 219 ? 36.142  58.628 41.546 1.00 67.86  ? 219 LYS B CE  1 
ATOM   4377 N  NZ  . LYS B 2 219 ? 36.836  57.310 41.493 1.00 66.47  ? 219 LYS B NZ  1 
ATOM   4378 N  N   . HIS B 2 220 ? 31.603  60.924 38.706 1.00 54.47  ? 220 HIS B N   1 
ATOM   4379 C  CA  . HIS B 2 220 ? 30.302  60.382 38.327 1.00 50.25  ? 220 HIS B CA  1 
ATOM   4380 C  C   . HIS B 2 220 ? 30.407  58.869 38.498 1.00 43.01  ? 220 HIS B C   1 
ATOM   4381 O  O   . HIS B 2 220 ? 31.506  58.314 38.418 1.00 45.67  ? 220 HIS B O   1 
ATOM   4382 C  CB  . HIS B 2 220 ? 29.997  60.718 36.874 1.00 57.83  ? 220 HIS B CB  1 
ATOM   4383 C  CG  . HIS B 2 220 ? 29.581  62.139 36.661 1.00 56.64  ? 220 HIS B CG  1 
ATOM   4384 N  ND1 . HIS B 2 220 ? 28.355  62.622 37.065 1.00 58.64  ? 220 HIS B ND1 1 
ATOM   4385 C  CD2 . HIS B 2 220 ? 30.232  63.184 36.099 1.00 54.16  ? 220 HIS B CD2 1 
ATOM   4386 C  CE1 . HIS B 2 220 ? 28.268  63.904 36.760 1.00 61.53  ? 220 HIS B CE1 1 
ATOM   4387 N  NE2 . HIS B 2 220 ? 29.394  64.269 36.174 1.00 63.88  ? 220 HIS B NE2 1 
ATOM   4388 N  N   . TRP B 2 221 ? 29.275  58.208 38.716 1.00 42.66  ? 221 TRP B N   1 
ATOM   4389 C  CA  . TRP B 2 221 ? 29.244  56.754 38.928 1.00 44.89  ? 221 TRP B CA  1 
ATOM   4390 C  C   . TRP B 2 221 ? 30.138  55.887 38.024 1.00 41.73  ? 221 TRP B C   1 
ATOM   4391 O  O   . TRP B 2 221 ? 30.762  54.943 38.495 1.00 45.89  ? 221 TRP B O   1 
ATOM   4392 C  CB  . TRP B 2 221 ? 27.805  56.232 38.826 1.00 39.87  ? 221 TRP B CB  1 
ATOM   4393 C  CG  . TRP B 2 221 ? 27.245  56.277 37.435 1.00 46.43  ? 221 TRP B CG  1 
ATOM   4394 C  CD1 . TRP B 2 221 ? 26.563  57.303 36.861 1.00 49.06  ? 221 TRP B CD1 1 
ATOM   4395 C  CD2 . TRP B 2 221 ? 27.351  55.254 36.436 1.00 44.28  ? 221 TRP B CD2 1 
ATOM   4396 N  NE1 . TRP B 2 221 ? 26.234  56.989 35.565 1.00 55.20  ? 221 TRP B NE1 1 
ATOM   4397 C  CE2 . TRP B 2 221 ? 26.708  55.738 35.276 1.00 52.07  ? 221 TRP B CE2 1 
ATOM   4398 C  CE3 . TRP B 2 221 ? 27.931  53.976 36.407 1.00 44.66  ? 221 TRP B CE3 1 
ATOM   4399 C  CZ2 . TRP B 2 221 ? 26.628  54.989 34.093 1.00 49.21  ? 221 TRP B CZ2 1 
ATOM   4400 C  CZ3 . TRP B 2 221 ? 27.853  53.230 35.232 1.00 42.13  ? 221 TRP B CZ3 1 
ATOM   4401 C  CH2 . TRP B 2 221 ? 27.204  53.743 34.090 1.00 50.53  ? 221 TRP B CH2 1 
ATOM   4402 N  N   . TRP B 2 222 ? 30.202  56.202 36.734 1.00 42.20  ? 222 TRP B N   1 
ATOM   4403 C  CA  . TRP B 2 222 ? 31.004  55.409 35.809 1.00 37.21  ? 222 TRP B CA  1 
ATOM   4404 C  C   . TRP B 2 222 ? 32.503  55.561 36.028 1.00 41.34  ? 222 TRP B C   1 
ATOM   4405 O  O   . TRP B 2 222 ? 33.284  54.746 35.548 1.00 39.81  ? 222 TRP B O   1 
ATOM   4406 C  CB  . TRP B 2 222 ? 30.659  55.773 34.366 1.00 37.70  ? 222 TRP B CB  1 
ATOM   4407 C  CG  . TRP B 2 222 ? 31.027  57.167 34.024 1.00 43.01  ? 222 TRP B CG  1 
ATOM   4408 C  CD1 . TRP B 2 222 ? 32.273  57.646 33.739 1.00 34.80  ? 222 TRP B CD1 1 
ATOM   4409 C  CD2 . TRP B 2 222 ? 30.142  58.279 33.959 1.00 37.88  ? 222 TRP B CD2 1 
ATOM   4410 N  NE1 . TRP B 2 222 ? 32.214  58.992 33.495 1.00 34.01  ? 222 TRP B NE1 1 
ATOM   4411 C  CE2 . TRP B 2 222 ? 30.916  59.408 33.622 1.00 39.25  ? 222 TRP B CE2 1 
ATOM   4412 C  CE3 . TRP B 2 222 ? 28.764  58.432 34.151 1.00 30.07  ? 222 TRP B CE3 1 
ATOM   4413 C  CZ2 . TRP B 2 222 ? 30.356  60.677 33.469 1.00 37.42  ? 222 TRP B CZ2 1 
ATOM   4414 C  CZ3 . TRP B 2 222 ? 28.211  59.692 33.998 1.00 33.26  ? 222 TRP B CZ3 1 
ATOM   4415 C  CH2 . TRP B 2 222 ? 29.006  60.793 33.659 1.00 25.74  ? 222 TRP B CH2 1 
ATOM   4416 N  N   . GLU B 2 223 ? 32.906  56.615 36.731 1.00 46.09  ? 223 GLU B N   1 
ATOM   4417 C  CA  . GLU B 2 223 ? 34.315  56.827 37.027 1.00 50.20  ? 223 GLU B CA  1 
ATOM   4418 C  C   . GLU B 2 223 ? 34.767  55.799 38.066 1.00 50.16  ? 223 GLU B C   1 
ATOM   4419 O  O   . GLU B 2 223 ? 35.957  55.665 38.341 1.00 53.02  ? 223 GLU B O   1 
ATOM   4420 C  CB  . GLU B 2 223 ? 34.549  58.245 37.553 1.00 52.89  ? 223 GLU B CB  1 
ATOM   4421 C  CG  . GLU B 2 223 ? 34.778  59.275 36.460 1.00 59.11  ? 223 GLU B CG  1 
ATOM   4422 C  CD  . GLU B 2 223 ? 34.920  60.686 37.001 1.00 54.09  ? 223 GLU B CD  1 
ATOM   4423 O  OE1 . GLU B 2 223 ? 33.896  61.293 37.378 1.00 46.65  ? 223 GLU B OE1 1 
ATOM   4424 O  OE2 . GLU B 2 223 ? 36.061  61.188 37.055 1.00 64.31  ? 223 GLU B OE2 1 
ATOM   4425 N  N   . TYR B 2 224 ? 33.804  55.082 38.640 1.00 45.97  ? 224 TYR B N   1 
ATOM   4426 C  CA  . TYR B 2 224 ? 34.094  54.046 39.623 1.00 49.41  ? 224 TYR B CA  1 
ATOM   4427 C  C   . TYR B 2 224 ? 34.126  52.692 38.927 1.00 46.82  ? 224 TYR B C   1 
ATOM   4428 O  O   . TYR B 2 224 ? 34.211  51.655 39.581 1.00 59.13  ? 224 TYR B O   1 
ATOM   4429 C  CB  . TYR B 2 224 ? 33.028  54.011 40.729 1.00 54.23  ? 224 TYR B CB  1 
ATOM   4430 C  CG  . TYR B 2 224 ? 33.078  55.191 41.671 1.00 67.96  ? 224 TYR B CG  1 
ATOM   4431 C  CD1 . TYR B 2 224 ? 32.514  56.422 41.320 1.00 67.46  ? 224 TYR B CD1 1 
ATOM   4432 C  CD2 . TYR B 2 224 ? 33.751  55.097 42.892 1.00 70.09  ? 224 TYR B CD2 1 
ATOM   4433 C  CE1 . TYR B 2 224 ? 32.625  57.532 42.159 1.00 60.01  ? 224 TYR B CE1 1 
ATOM   4434 C  CE2 . TYR B 2 224 ? 33.870  56.195 43.733 1.00 65.63  ? 224 TYR B CE2 1 
ATOM   4435 C  CZ  . TYR B 2 224 ? 33.309  57.407 43.362 1.00 69.09  ? 224 TYR B CZ  1 
ATOM   4436 O  OH  . TYR B 2 224 ? 33.467  58.494 44.183 1.00 59.66  ? 224 TYR B OH  1 
ATOM   4437 N  N   . VAL B 2 225 ? 34.030  52.697 37.601 1.00 49.93  ? 225 VAL B N   1 
ATOM   4438 C  CA  . VAL B 2 225 ? 34.048  51.448 36.840 1.00 48.72  ? 225 VAL B CA  1 
ATOM   4439 C  C   . VAL B 2 225 ? 35.168  51.456 35.811 1.00 43.78  ? 225 VAL B C   1 
ATOM   4440 O  O   . VAL B 2 225 ? 35.840  50.443 35.600 1.00 49.84  ? 225 VAL B O   1 
ATOM   4441 C  CB  . VAL B 2 225 ? 32.716  51.196 36.108 1.00 43.06  ? 225 VAL B CB  1 
ATOM   4442 C  CG1 . VAL B 2 225 ? 32.768  49.845 35.412 1.00 45.73  ? 225 VAL B CG1 1 
ATOM   4443 C  CG2 . VAL B 2 225 ? 31.559  51.240 37.084 1.00 36.23  ? 225 VAL B CG2 1 
ATOM   4444 N  N   . ASP B 2 226 ? 35.353  52.596 35.158 1.00 43.09  ? 226 ASP B N   1 
ATOM   4445 C  CA  . ASP B 2 226 ? 36.418  52.752 34.169 1.00 45.92  ? 226 ASP B CA  1 
ATOM   4446 C  C   . ASP B 2 226 ? 36.821  54.223 34.143 1.00 46.02  ? 226 ASP B C   1 
ATOM   4447 O  O   . ASP B 2 226 ? 35.969  55.109 34.220 1.00 47.94  ? 226 ASP B O   1 
ATOM   4448 C  CB  . ASP B 2 226 ? 35.952  52.285 32.792 1.00 39.60  ? 226 ASP B CB  1 
ATOM   4449 C  CG  . ASP B 2 226 ? 37.023  52.463 31.721 1.00 47.80  ? 226 ASP B CG  1 
ATOM   4450 O  OD1 . ASP B 2 226 ? 37.174  53.584 31.195 1.00 50.51  ? 226 ASP B OD1 1 
ATOM   4451 O  OD2 . ASP B 2 226 ? 37.723  51.482 31.407 1.00 49.45  ? 226 ASP B OD2 1 
ATOM   4452 N  N   . ALA B 2 227 ? 38.120  54.482 34.055 1.00 44.77  ? 227 ALA B N   1 
ATOM   4453 C  CA  . ALA B 2 227 ? 38.608  55.850 34.062 1.00 46.43  ? 227 ALA B CA  1 
ATOM   4454 C  C   . ALA B 2 227 ? 38.609  56.539 32.706 1.00 51.55  ? 227 ALA B C   1 
ATOM   4455 O  O   . ALA B 2 227 ? 38.765  57.752 32.643 1.00 50.36  ? 227 ALA B O   1 
ATOM   4456 C  CB  . ALA B 2 227 ? 40.007  55.905 34.676 1.00 52.76  ? 227 ALA B CB  1 
ATOM   4457 N  N   . THR B 2 228 ? 38.432  55.790 31.622 1.00 47.61  ? 228 THR B N   1 
ATOM   4458 C  CA  . THR B 2 228 ? 38.431  56.421 30.304 1.00 42.60  ? 228 THR B CA  1 
ATOM   4459 C  C   . THR B 2 228 ? 37.022  56.817 29.852 1.00 47.81  ? 228 THR B C   1 
ATOM   4460 O  O   . THR B 2 228 ? 36.852  57.740 29.055 1.00 48.81  ? 228 THR B O   1 
ATOM   4461 C  CB  . THR B 2 228 ? 39.064  55.501 29.234 1.00 46.97  ? 228 THR B CB  1 
ATOM   4462 O  OG1 . THR B 2 228 ? 38.211  54.367 28.999 1.00 47.75  ? 228 THR B OG1 1 
ATOM   4463 C  CG2 . THR B 2 228 ? 40.452  55.026 29.698 1.00 39.37  ? 228 THR B CG2 1 
ATOM   4464 N  N   . VAL B 2 229 ? 36.016  56.121 30.372 1.00 47.24  ? 229 VAL B N   1 
ATOM   4465 C  CA  . VAL B 2 229 ? 34.629  56.388 30.017 1.00 47.57  ? 229 VAL B CA  1 
ATOM   4466 C  C   . VAL B 2 229 ? 34.219  57.854 30.218 1.00 44.34  ? 229 VAL B C   1 
ATOM   4467 O  O   . VAL B 2 229 ? 34.552  58.483 31.216 1.00 43.79  ? 229 VAL B O   1 
ATOM   4468 C  CB  . VAL B 2 229 ? 33.656  55.475 30.834 1.00 41.92  ? 229 VAL B CB  1 
ATOM   4469 C  CG1 . VAL B 2 229 ? 32.220  55.899 30.608 1.00 48.24  ? 229 VAL B CG1 1 
ATOM   4470 C  CG2 . VAL B 2 229 ? 33.817  54.026 30.423 1.00 45.99  ? 229 VAL B CG2 1 
ATOM   4471 N  N   . THR B 2 230 ? 33.507  58.394 29.240 1.00 45.45  ? 230 THR B N   1 
ATOM   4472 C  CA  . THR B 2 230 ? 33.001  59.756 29.321 1.00 43.70  ? 230 THR B CA  1 
ATOM   4473 C  C   . THR B 2 230 ? 31.503  59.613 29.073 1.00 41.87  ? 230 THR B C   1 
ATOM   4474 O  O   . THR B 2 230 ? 31.065  58.623 28.489 1.00 44.48  ? 230 THR B O   1 
ATOM   4475 C  CB  . THR B 2 230 ? 33.588  60.667 28.216 1.00 40.99  ? 230 THR B CB  1 
ATOM   4476 O  OG1 . THR B 2 230 ? 33.204  60.167 26.927 1.00 33.84  ? 230 THR B OG1 1 
ATOM   4477 C  CG2 . THR B 2 230 ? 35.110  60.733 28.310 1.00 38.86  ? 230 THR B CG2 1 
ATOM   4478 N  N   . LEU B 2 231 ? 30.716  60.583 29.516 1.00 43.85  ? 231 LEU B N   1 
ATOM   4479 C  CA  . LEU B 2 231 ? 29.279  60.527 29.283 1.00 39.11  ? 231 LEU B CA  1 
ATOM   4480 C  C   . LEU B 2 231 ? 29.062  60.570 27.774 1.00 38.00  ? 231 LEU B C   1 
ATOM   4481 O  O   . LEU B 2 231 ? 28.146  59.957 27.240 1.00 36.80  ? 231 LEU B O   1 
ATOM   4482 C  CB  . LEU B 2 231 ? 28.588  61.726 29.927 1.00 33.81  ? 231 LEU B CB  1 
ATOM   4483 C  CG  . LEU B 2 231 ? 27.100  61.914 29.628 1.00 39.88  ? 231 LEU B CG  1 
ATOM   4484 C  CD1 . LEU B 2 231 ? 26.316  60.730 30.154 1.00 40.47  ? 231 LEU B CD1 1 
ATOM   4485 C  CD2 . LEU B 2 231 ? 26.608  63.207 30.282 1.00 45.87  ? 231 LEU B CD2 1 
ATOM   4486 N  N   . GLU B 2 232 ? 29.909  61.309 27.083 1.00 36.24  ? 232 GLU B N   1 
ATOM   4487 C  CA  . GLU B 2 232 ? 29.762  61.405 25.639 1.00 48.07  ? 232 GLU B CA  1 
ATOM   4488 C  C   . GLU B 2 232 ? 29.741  59.998 25.055 1.00 41.53  ? 232 GLU B C   1 
ATOM   4489 O  O   . GLU B 2 232 ? 28.861  59.656 24.257 1.00 33.00  ? 232 GLU B O   1 
ATOM   4490 C  CB  . GLU B 2 232 ? 30.918  62.209 25.019 1.00 48.87  ? 232 GLU B CB  1 
ATOM   4491 C  CG  . GLU B 2 232 ? 30.991  63.686 25.441 1.00 60.65  ? 232 GLU B CG  1 
ATOM   4492 C  CD  . GLU B 2 232 ? 31.342  63.900 26.923 1.00 72.86  ? 232 GLU B CD  1 
ATOM   4493 O  OE1 . GLU B 2 232 ? 32.405  63.415 27.378 1.00 67.69  ? 232 GLU B OE1 1 
ATOM   4494 O  OE2 . GLU B 2 232 ? 30.554  64.570 27.632 1.00 68.43  ? 232 GLU B OE2 1 
ATOM   4495 N  N   . LEU B 2 233 ? 30.704  59.180 25.476 1.00 38.22  ? 233 LEU B N   1 
ATOM   4496 C  CA  . LEU B 2 233 ? 30.812  57.814 24.979 1.00 35.68  ? 233 LEU B CA  1 
ATOM   4497 C  C   . LEU B 2 233 ? 29.614  56.973 25.360 1.00 29.81  ? 233 LEU B C   1 
ATOM   4498 O  O   . LEU B 2 233 ? 29.091  56.210 24.546 1.00 34.13  ? 233 LEU B O   1 
ATOM   4499 C  CB  . LEU B 2 233 ? 32.087  57.154 25.510 1.00 46.28  ? 233 LEU B CB  1 
ATOM   4500 C  CG  . LEU B 2 233 ? 32.402  55.741 25.015 1.00 43.10  ? 233 LEU B CG  1 
ATOM   4501 C  CD1 . LEU B 2 233 ? 32.626  55.759 23.506 1.00 41.57  ? 233 LEU B CD1 1 
ATOM   4502 C  CD2 . LEU B 2 233 ? 33.637  55.223 25.734 1.00 44.40  ? 233 LEU B CD2 1 
ATOM   4503 N  N   . LEU B 2 234 ? 29.170  57.107 26.601 1.00 34.09  ? 234 LEU B N   1 
ATOM   4504 C  CA  . LEU B 2 234 ? 28.033  56.331 27.039 1.00 35.06  ? 234 LEU B CA  1 
ATOM   4505 C  C   . LEU B 2 234 ? 26.785  56.622 26.207 1.00 38.03  ? 234 LEU B C   1 
ATOM   4506 O  O   . LEU B 2 234 ? 26.080  55.691 25.823 1.00 36.75  ? 234 LEU B O   1 
ATOM   4507 C  CB  . LEU B 2 234 ? 27.771  56.565 28.526 1.00 32.05  ? 234 LEU B CB  1 
ATOM   4508 C  CG  . LEU B 2 234 ? 28.892  56.086 29.462 1.00 43.79  ? 234 LEU B CG  1 
ATOM   4509 C  CD1 . LEU B 2 234 ? 28.383  56.124 30.902 1.00 28.64  ? 234 LEU B CD1 1 
ATOM   4510 C  CD2 . LEU B 2 234 ? 29.338  54.661 29.092 1.00 35.43  ? 234 LEU B CD2 1 
ATOM   4511 N  N   . ASP B 2 235 ? 26.505  57.897 25.920 1.00 41.17  ? 235 ASP B N   1 
ATOM   4512 C  CA  . ASP B 2 235 ? 25.330  58.234 25.103 1.00 40.36  ? 235 ASP B CA  1 
ATOM   4513 C  C   . ASP B 2 235 ? 25.440  57.616 23.698 1.00 32.23  ? 235 ASP B C   1 
ATOM   4514 O  O   . ASP B 2 235 ? 24.489  57.033 23.179 1.00 38.60  ? 235 ASP B O   1 
ATOM   4515 C  CB  . ASP B 2 235 ? 25.170  59.750 24.951 1.00 43.24  ? 235 ASP B CB  1 
ATOM   4516 C  CG  . ASP B 2 235 ? 24.650  60.421 26.206 1.00 39.42  ? 235 ASP B CG  1 
ATOM   4517 O  OD1 . ASP B 2 235 ? 23.792  59.834 26.895 1.00 43.08  ? 235 ASP B OD1 1 
ATOM   4518 O  OD2 . ASP B 2 235 ? 25.091  61.553 26.483 1.00 46.47  ? 235 ASP B OD2 1 
ATOM   4519 N  N   . GLU B 2 236 ? 26.609  57.758 23.086 1.00 30.84  ? 236 GLU B N   1 
ATOM   4520 C  CA  . GLU B 2 236 ? 26.841  57.210 21.753 1.00 35.04  ? 236 GLU B CA  1 
ATOM   4521 C  C   . GLU B 2 236 ? 26.613  55.694 21.684 1.00 40.78  ? 236 GLU B C   1 
ATOM   4522 O  O   . GLU B 2 236 ? 25.789  55.201 20.893 1.00 35.92  ? 236 GLU B O   1 
ATOM   4523 C  CB  . GLU B 2 236 ? 28.273  57.526 21.310 1.00 33.27  ? 236 GLU B CB  1 
ATOM   4524 C  CG  . GLU B 2 236 ? 28.683  56.766 20.061 1.00 46.31  ? 236 GLU B CG  1 
ATOM   4525 C  CD  . GLU B 2 236 ? 30.130  56.993 19.668 1.00 61.19  ? 236 GLU B CD  1 
ATOM   4526 O  OE1 . GLU B 2 236 ? 30.610  56.286 18.751 1.00 60.80  ? 236 GLU B OE1 1 
ATOM   4527 O  OE2 . GLU B 2 236 ? 30.781  57.881 20.266 1.00 62.93  ? 236 GLU B OE2 1 
ATOM   4528 N  N   . LEU B 2 237 ? 27.359  54.955 22.505 1.00 38.70  ? 237 LEU B N   1 
ATOM   4529 C  CA  . LEU B 2 237 ? 27.239  53.504 22.522 1.00 34.01  ? 237 LEU B CA  1 
ATOM   4530 C  C   . LEU B 2 237 ? 25.831  53.069 22.849 1.00 23.69  ? 237 LEU B C   1 
ATOM   4531 O  O   . LEU B 2 237 ? 25.338  52.094 22.295 1.00 31.24  ? 237 LEU B O   1 
ATOM   4532 C  CB  . LEU B 2 237 ? 28.229  52.896 23.512 1.00 35.22  ? 237 LEU B CB  1 
ATOM   4533 C  CG  . LEU B 2 237 ? 29.661  53.173 23.081 1.00 32.25  ? 237 LEU B CG  1 
ATOM   4534 C  CD1 . LEU B 2 237 ? 30.609  52.260 23.825 1.00 32.82  ? 237 LEU B CD1 1 
ATOM   4535 C  CD2 . LEU B 2 237 ? 29.762  52.954 21.564 1.00 25.23  ? 237 LEU B CD2 1 
ATOM   4536 N  N   . THR B 2 238 ? 25.183  53.790 23.752 1.00 26.95  ? 238 THR B N   1 
ATOM   4537 C  CA  . THR B 2 238 ? 23.809  53.483 24.107 1.00 30.41  ? 238 THR B CA  1 
ATOM   4538 C  C   . THR B 2 238 ? 22.901  53.704 22.882 1.00 36.33  ? 238 THR B C   1 
ATOM   4539 O  O   . THR B 2 238 ? 21.976  52.921 22.632 1.00 31.87  ? 238 THR B O   1 
ATOM   4540 C  CB  . THR B 2 238 ? 23.343  54.367 25.282 1.00 38.90  ? 238 THR B CB  1 
ATOM   4541 O  OG1 . THR B 2 238 ? 23.850  53.822 26.508 1.00 47.16  ? 238 THR B OG1 1 
ATOM   4542 C  CG2 . THR B 2 238 ? 21.827  54.440 25.352 1.00 38.98  ? 238 THR B CG2 1 
ATOM   4543 N  N   . HIS B 2 239 ? 23.166  54.768 22.122 1.00 34.46  ? 239 HIS B N   1 
ATOM   4544 C  CA  . HIS B 2 239 ? 22.378  55.062 20.920 1.00 33.02  ? 239 HIS B CA  1 
ATOM   4545 C  C   . HIS B 2 239 ? 22.573  53.884 19.965 1.00 36.27  ? 239 HIS B C   1 
ATOM   4546 O  O   . HIS B 2 239 ? 21.621  53.380 19.384 1.00 37.12  ? 239 HIS B O   1 
ATOM   4547 C  CB  . HIS B 2 239 ? 22.868  56.365 20.263 1.00 36.56  ? 239 HIS B CB  1 
ATOM   4548 C  CG  . HIS B 2 239 ? 22.144  56.736 19.001 1.00 33.91  ? 239 HIS B CG  1 
ATOM   4549 N  ND1 . HIS B 2 239 ? 20.772  56.841 18.928 1.00 33.78  ? 239 HIS B ND1 1 
ATOM   4550 C  CD2 . HIS B 2 239 ? 22.611  57.076 17.776 1.00 36.88  ? 239 HIS B CD2 1 
ATOM   4551 C  CE1 . HIS B 2 239 ? 20.424  57.230 17.715 1.00 32.87  ? 239 HIS B CE1 1 
ATOM   4552 N  NE2 . HIS B 2 239 ? 21.523  57.381 16.997 1.00 37.70  ? 239 HIS B NE2 1 
ATOM   4553 N  N   . GLU B 2 240 ? 23.821  53.448 19.836 1.00 37.88  ? 240 GLU B N   1 
ATOM   4554 C  CA  . GLU B 2 240 ? 24.192  52.329 18.964 1.00 42.01  ? 240 GLU B CA  1 
ATOM   4555 C  C   . GLU B 2 240 ? 23.534  50.989 19.361 1.00 40.04  ? 240 GLU B C   1 
ATOM   4556 O  O   . GLU B 2 240 ? 23.047  50.247 18.508 1.00 37.55  ? 240 GLU B O   1 
ATOM   4557 C  CB  . GLU B 2 240 ? 25.713  52.179 18.985 1.00 36.25  ? 240 GLU B CB  1 
ATOM   4558 C  CG  . GLU B 2 240 ? 26.304  51.433 17.810 1.00 55.70  ? 240 GLU B CG  1 
ATOM   4559 C  CD  . GLU B 2 240 ? 27.810  51.304 17.927 1.00 59.37  ? 240 GLU B CD  1 
ATOM   4560 O  OE1 . GLU B 2 240 ? 28.461  52.300 18.298 1.00 58.17  ? 240 GLU B OE1 1 
ATOM   4561 O  OE2 . GLU B 2 240 ? 28.342  50.211 17.644 1.00 71.76  ? 240 GLU B OE2 1 
ATOM   4562 N  N   . PHE B 2 241 ? 23.529  50.691 20.657 1.00 38.46  ? 241 PHE B N   1 
ATOM   4563 C  CA  . PHE B 2 241 ? 22.947  49.451 21.176 1.00 37.21  ? 241 PHE B CA  1 
ATOM   4564 C  C   . PHE B 2 241 ? 21.474  49.483 20.825 1.00 38.06  ? 241 PHE B C   1 
ATOM   4565 O  O   . PHE B 2 241 ? 20.908  48.464 20.429 1.00 41.01  ? 241 PHE B O   1 
ATOM   4566 C  CB  . PHE B 2 241 ? 23.144  49.367 22.704 1.00 29.24  ? 241 PHE B CB  1 
ATOM   4567 C  CG  . PHE B 2 241 ? 23.008  47.970 23.287 1.00 34.67  ? 241 PHE B CG  1 
ATOM   4568 C  CD1 . PHE B 2 241 ? 23.532  47.688 24.544 1.00 35.71  ? 241 PHE B CD1 1 
ATOM   4569 C  CD2 . PHE B 2 241 ? 22.338  46.959 22.612 1.00 35.26  ? 241 PHE B CD2 1 
ATOM   4570 C  CE1 . PHE B 2 241 ? 23.388  46.424 25.118 1.00 39.75  ? 241 PHE B CE1 1 
ATOM   4571 C  CE2 . PHE B 2 241 ? 22.183  45.693 23.173 1.00 32.00  ? 241 PHE B CE2 1 
ATOM   4572 C  CZ  . PHE B 2 241 ? 22.708  45.425 24.428 1.00 39.86  ? 241 PHE B CZ  1 
ATOM   4573 N  N   . LEU B 2 242 ? 20.851  50.656 20.955 1.00 43.25  ? 242 LEU B N   1 
ATOM   4574 C  CA  . LEU B 2 242 ? 19.433  50.781 20.623 1.00 35.58  ? 242 LEU B CA  1 
ATOM   4575 C  C   . LEU B 2 242 ? 19.176  50.594 19.120 1.00 28.31  ? 242 LEU B C   1 
ATOM   4576 O  O   . LEU B 2 242 ? 18.194  49.959 18.739 1.00 35.50  ? 242 LEU B O   1 
ATOM   4577 C  CB  . LEU B 2 242 ? 18.868  52.114 21.122 1.00 37.07  ? 242 LEU B CB  1 
ATOM   4578 C  CG  . LEU B 2 242 ? 18.774  52.218 22.654 1.00 45.19  ? 242 LEU B CG  1 
ATOM   4579 C  CD1 . LEU B 2 242 ? 18.374  53.626 23.054 1.00 43.18  ? 242 LEU B CD1 1 
ATOM   4580 C  CD2 . LEU B 2 242 ? 17.787  51.209 23.201 1.00 33.17  ? 242 LEU B CD2 1 
ATOM   4581 N  N   . GLN B 2 243 ? 20.050  51.116 18.263 1.00 31.65  ? 243 GLN B N   1 
ATOM   4582 C  CA  . GLN B 2 243 ? 19.861  50.916 16.829 1.00 36.96  ? 243 GLN B CA  1 
ATOM   4583 C  C   . GLN B 2 243 ? 19.907  49.418 16.509 1.00 41.80  ? 243 GLN B C   1 
ATOM   4584 O  O   . GLN B 2 243 ? 19.041  48.888 15.810 1.00 48.93  ? 243 GLN B O   1 
ATOM   4585 C  CB  . GLN B 2 243 ? 20.944  51.644 16.031 1.00 38.86  ? 243 GLN B CB  1 
ATOM   4586 C  CG  . GLN B 2 243 ? 20.741  53.149 15.964 1.00 43.19  ? 243 GLN B CG  1 
ATOM   4587 C  CD  . GLN B 2 243 ? 21.899  53.840 15.295 1.00 41.88  ? 243 GLN B CD  1 
ATOM   4588 O  OE1 . GLN B 2 243 ? 23.046  53.656 15.690 1.00 41.65  ? 243 GLN B OE1 1 
ATOM   4589 N  NE2 . GLN B 2 243 ? 21.609  54.645 14.274 1.00 46.84  ? 243 GLN B NE2 1 
ATOM   4590 N  N   . ILE B 2 244 ? 20.922  48.737 17.025 1.00 43.63  ? 244 ILE B N   1 
ATOM   4591 C  CA  . ILE B 2 244 ? 21.069  47.301 16.809 1.00 40.83  ? 244 ILE B CA  1 
ATOM   4592 C  C   . ILE B 2 244 ? 19.805  46.554 17.252 1.00 36.26  ? 244 ILE B C   1 
ATOM   4593 O  O   . ILE B 2 244 ? 19.338  45.650 16.559 1.00 39.87  ? 244 ILE B O   1 
ATOM   4594 C  CB  . ILE B 2 244 ? 22.336  46.761 17.553 1.00 39.84  ? 244 ILE B CB  1 
ATOM   4595 C  CG1 . ILE B 2 244 ? 23.590  47.345 16.892 1.00 31.58  ? 244 ILE B CG1 1 
ATOM   4596 C  CG2 . ILE B 2 244 ? 22.391  45.225 17.501 1.00 37.82  ? 244 ILE B CG2 1 
ATOM   4597 C  CD1 . ILE B 2 244 ? 24.881  47.177 17.682 1.00 40.80  ? 244 ILE B CD1 1 
ATOM   4598 N  N   . LEU B 2 245 ? 19.233  46.935 18.389 1.00 37.01  ? 245 LEU B N   1 
ATOM   4599 C  CA  . LEU B 2 245 ? 18.017  46.276 18.862 1.00 40.50  ? 245 LEU B CA  1 
ATOM   4600 C  C   . LEU B 2 245 ? 16.870  46.532 17.885 1.00 43.56  ? 245 LEU B C   1 
ATOM   4601 O  O   . LEU B 2 245 ? 16.022  45.670 17.662 1.00 44.06  ? 245 LEU B O   1 
ATOM   4602 C  CB  . LEU B 2 245 ? 17.611  46.792 20.242 1.00 40.93  ? 245 LEU B CB  1 
ATOM   4603 C  CG  . LEU B 2 245 ? 18.099  46.066 21.503 1.00 54.26  ? 245 LEU B CG  1 
ATOM   4604 C  CD1 . LEU B 2 245 ? 17.748  46.902 22.735 1.00 41.44  ? 245 LEU B CD1 1 
ATOM   4605 C  CD2 . LEU B 2 245 ? 17.452  44.687 21.600 1.00 45.98  ? 245 LEU B CD2 1 
ATOM   4606 N  N   . GLU B 2 246 ? 16.852  47.724 17.301 1.00 51.17  ? 246 GLU B N   1 
ATOM   4607 C  CA  . GLU B 2 246 ? 15.800  48.085 16.360 1.00 56.94  ? 246 GLU B CA  1 
ATOM   4608 C  C   . GLU B 2 246 ? 15.999  47.394 15.012 1.00 52.44  ? 246 GLU B C   1 
ATOM   4609 O  O   . GLU B 2 246 ? 15.155  47.502 14.124 1.00 62.17  ? 246 GLU B O   1 
ATOM   4610 C  CB  . GLU B 2 246 ? 15.758  49.608 16.172 1.00 56.44  ? 246 GLU B CB  1 
ATOM   4611 C  CG  . GLU B 2 246 ? 14.420  50.142 15.688 1.00 71.44  ? 246 GLU B CG  1 
ATOM   4612 C  CD  . GLU B 2 246 ? 13.297  49.908 16.691 1.00 74.57  ? 246 GLU B CD  1 
ATOM   4613 O  OE1 . GLU B 2 246 ? 12.150  50.307 16.400 1.00 73.35  ? 246 GLU B OE1 1 
ATOM   4614 O  OE2 . GLU B 2 246 ? 13.561  49.325 17.765 1.00 63.94  ? 246 GLU B OE2 1 
ATOM   4615 N  N   . LYS B 2 247 ? 17.110  46.681 14.856 1.00 49.65  ? 247 LYS B N   1 
ATOM   4616 C  CA  . LYS B 2 247 ? 17.372  45.989 13.601 1.00 49.34  ? 247 LYS B CA  1 
ATOM   4617 C  C   . LYS B 2 247 ? 17.225  44.470 13.667 1.00 45.46  ? 247 LYS B C   1 
ATOM   4618 O  O   . LYS B 2 247 ? 17.587  43.772 12.724 1.00 45.74  ? 247 LYS B O   1 
ATOM   4619 C  CB  . LYS B 2 247 ? 18.761  46.349 13.064 1.00 45.36  ? 247 LYS B CB  1 
ATOM   4620 C  CG  . LYS B 2 247 ? 18.862  47.786 12.588 1.00 55.96  ? 247 LYS B CG  1 
ATOM   4621 C  CD  . LYS B 2 247 ? 19.927  47.961 11.518 1.00 54.87  ? 247 LYS B CD  1 
ATOM   4622 C  CE  . LYS B 2 247 ? 21.303  47.554 12.011 1.00 61.28  ? 247 LYS B CE  1 
ATOM   4623 N  NZ  . LYS B 2 247 ? 22.321  47.602 10.921 1.00 58.97  ? 247 LYS B NZ  1 
ATOM   4624 N  N   . THR B 2 248 ? 16.696  43.959 14.774 1.00 41.76  ? 248 THR B N   1 
ATOM   4625 C  CA  . THR B 2 248 ? 16.512  42.526 14.892 1.00 43.32  ? 248 THR B CA  1 
ATOM   4626 C  C   . THR B 2 248 ? 15.220  42.142 14.163 1.00 52.10  ? 248 THR B C   1 
ATOM   4627 O  O   . THR B 2 248 ? 14.340  42.976 13.969 1.00 48.50  ? 248 THR B O   1 
ATOM   4628 C  CB  . THR B 2 248 ? 16.462  42.061 16.377 1.00 40.27  ? 248 THR B CB  1 
ATOM   4629 O  OG1 . THR B 2 248 ? 15.442  42.767 17.083 1.00 38.97  ? 248 THR B OG1 1 
ATOM   4630 C  CG2 . THR B 2 248 ? 17.794  42.300 17.056 1.00 44.30  ? 248 THR B CG2 1 
ATOM   4631 N  N   . PRO B 2 249 ? 15.096  40.867 13.752 1.00 55.52  ? 249 PRO B N   1 
ATOM   4632 C  CA  . PRO B 2 249 ? 13.933  40.336 13.034 1.00 55.42  ? 249 PRO B CA  1 
ATOM   4633 C  C   . PRO B 2 249 ? 12.555  40.882 13.402 1.00 49.62  ? 249 PRO B C   1 
ATOM   4634 O  O   . PRO B 2 249 ? 11.893  41.502 12.571 1.00 51.53  ? 249 PRO B O   1 
ATOM   4635 C  CB  . PRO B 2 249 ? 14.039  38.834 13.282 1.00 50.45  ? 249 PRO B CB  1 
ATOM   4636 C  CG  . PRO B 2 249 ? 15.511  38.622 13.277 1.00 52.89  ? 249 PRO B CG  1 
ATOM   4637 C  CD  . PRO B 2 249 ? 16.003  39.768 14.135 1.00 48.12  ? 249 PRO B CD  1 
ATOM   4638 N  N   . ASN B 2 250 ? 12.115  40.645 14.633 1.00 47.76  ? 250 ASN B N   1 
ATOM   4639 C  CA  . ASN B 2 250 ? 10.792  41.099 15.052 1.00 50.34  ? 250 ASN B CA  1 
ATOM   4640 C  C   . ASN B 2 250 ? 10.638  42.606 15.218 1.00 53.14  ? 250 ASN B C   1 
ATOM   4641 O  O   . ASN B 2 250 ? 9.658   43.070 15.789 1.00 52.54  ? 250 ASN B O   1 
ATOM   4642 C  CB  . ASN B 2 250 ? 10.368  40.388 16.340 1.00 50.04  ? 250 ASN B CB  1 
ATOM   4643 C  CG  . ASN B 2 250 ? 10.175  38.895 16.142 1.00 51.84  ? 250 ASN B CG  1 
ATOM   4644 O  OD1 . ASN B 2 250 ? 10.268  38.389 15.022 1.00 62.24  ? 250 ASN B OD1 1 
ATOM   4645 N  ND2 . ASN B 2 250 ? 9.903   38.182 17.228 1.00 58.31  ? 250 ASN B ND2 1 
ATOM   4646 N  N   . ARG B 2 251 ? 11.603  43.370 14.717 1.00 58.42  ? 251 ARG B N   1 
ATOM   4647 C  CA  . ARG B 2 251 ? 11.536  44.820 14.798 1.00 58.97  ? 251 ARG B CA  1 
ATOM   4648 C  C   . ARG B 2 251 ? 11.767  45.432 13.422 1.00 66.43  ? 251 ARG B C   1 
ATOM   4649 O  O   . ARG B 2 251 ? 12.504  46.400 13.267 1.00 70.28  ? 251 ARG B O   1 
ATOM   4650 C  CB  . ARG B 2 251 ? 12.556  45.341 15.810 1.00 63.17  ? 251 ARG B CB  1 
ATOM   4651 C  CG  . ARG B 2 251 ? 12.096  45.147 17.243 1.00 58.55  ? 251 ARG B CG  1 
ATOM   4652 C  CD  . ARG B 2 251 ? 13.075  45.701 18.261 1.00 71.96  ? 251 ARG B CD  1 
ATOM   4653 N  NE  . ARG B 2 251 ? 12.437  45.822 19.569 1.00 68.00  ? 251 ARG B NE  1 
ATOM   4654 C  CZ  . ARG B 2 251 ? 11.529  46.746 19.871 1.00 72.29  ? 251 ARG B CZ  1 
ATOM   4655 N  NH1 . ARG B 2 251 ? 11.154  47.642 18.965 1.00 61.15  ? 251 ARG B NH1 1 
ATOM   4656 N  NH2 . ARG B 2 251 ? 10.978  46.760 21.073 1.00 74.26  ? 251 ARG B NH2 1 
ATOM   4657 N  N   . LEU B 2 252 ? 11.121  44.844 12.422 1.00 68.51  ? 252 LEU B N   1 
ATOM   4658 C  CA  . LEU B 2 252 ? 11.222  45.311 11.047 1.00 70.75  ? 252 LEU B CA  1 
ATOM   4659 C  C   . LEU B 2 252 ? 10.026  44.785 10.261 1.00 72.64  ? 252 LEU B C   1 
ATOM   4660 O  O   . LEU B 2 252 ? 9.328   43.873 10.713 1.00 78.33  ? 252 LEU B O   1 
ATOM   4661 C  CB  . LEU B 2 252 ? 12.524  44.817 10.406 1.00 69.35  ? 252 LEU B CB  1 
ATOM   4662 C  CG  . LEU B 2 252 ? 13.846  45.380 10.936 1.00 63.96  ? 252 LEU B CG  1 
ATOM   4663 C  CD1 . LEU B 2 252 ? 15.005  44.720 10.218 1.00 62.22  ? 252 LEU B CD1 1 
ATOM   4664 C  CD2 . LEU B 2 252 ? 13.888  46.878 10.721 1.00 69.86  ? 252 LEU B CD2 1 
ATOM   4665 N  N   . CYS B 2 261 ? -0.788  30.929 27.745 1.00 97.16  ? 261 CYS B N   1 
ATOM   4666 C  CA  . CYS B 2 261 ? -1.198  31.314 29.092 1.00 101.57 ? 261 CYS B CA  1 
ATOM   4667 C  C   . CYS B 2 261 ? -1.579  32.795 29.159 1.00 104.13 ? 261 CYS B C   1 
ATOM   4668 O  O   . CYS B 2 261 ? -1.280  33.448 30.185 1.00 104.81 ? 261 CYS B O   1 
ATOM   4669 C  CB  . CYS B 2 261 ? -0.065  31.020 30.081 1.00 96.96  ? 261 CYS B CB  1 
ATOM   4670 S  SG  . CYS B 2 261 ? 1.537   31.730 29.617 1.00 103.13 ? 261 CYS B SG  1 
ATOM   4671 N  N   . MET C 3 1   ? 20.449  36.638 32.072 1.00 58.64  ? 1   MET C N   1 
ATOM   4672 C  CA  . MET C 3 1   ? 19.208  37.371 32.454 1.00 60.51  ? 1   MET C CA  1 
ATOM   4673 C  C   . MET C 3 1   ? 19.089  37.544 33.982 1.00 62.61  ? 1   MET C C   1 
ATOM   4674 O  O   . MET C 3 1   ? 18.516  38.527 34.452 1.00 57.90  ? 1   MET C O   1 
ATOM   4675 C  CB  . MET C 3 1   ? 17.982  36.635 31.889 1.00 63.94  ? 1   MET C CB  1 
ATOM   4676 C  CG  . MET C 3 1   ? 16.732  37.497 31.741 1.00 65.25  ? 1   MET C CG  1 
ATOM   4677 S  SD  . MET C 3 1   ? 15.294  36.632 31.026 1.00 59.07  ? 1   MET C SD  1 
ATOM   4678 C  CE  . MET C 3 1   ? 15.276  37.273 29.356 1.00 68.01  ? 1   MET C CE  1 
ATOM   4679 N  N   . GLU C 3 2   ? 19.646  36.599 34.745 1.00 64.05  ? 2   GLU C N   1 
ATOM   4680 C  CA  . GLU C 3 2   ? 19.621  36.635 36.218 1.00 59.70  ? 2   GLU C CA  1 
ATOM   4681 C  C   . GLU C 3 2   ? 21.044  36.893 36.750 1.00 60.80  ? 2   GLU C C   1 
ATOM   4682 O  O   . GLU C 3 2   ? 21.974  36.138 36.454 1.00 49.66  ? 2   GLU C O   1 
ATOM   4683 C  CB  . GLU C 3 2   ? 19.134  35.291 36.780 1.00 70.38  ? 2   GLU C CB  1 
ATOM   4684 C  CG  . GLU C 3 2   ? 17.828  34.748 36.196 1.00 85.26  ? 2   GLU C CG  1 
ATOM   4685 C  CD  . GLU C 3 2   ? 17.533  33.305 36.629 1.00 92.51  ? 2   GLU C CD  1 
ATOM   4686 O  OE1 . GLU C 3 2   ? 16.436  32.796 36.308 1.00 92.78  ? 2   GLU C OE1 1 
ATOM   4687 O  OE2 . GLU C 3 2   ? 18.396  32.676 37.283 1.00 89.82  ? 2   GLU C OE2 1 
ATOM   4688 N  N   . PRO C 3 3   ? 21.231  37.944 37.565 1.00 55.81  ? 3   PRO C N   1 
ATOM   4689 C  CA  . PRO C 3 3   ? 22.575  38.225 38.086 1.00 55.16  ? 3   PRO C CA  1 
ATOM   4690 C  C   . PRO C 3 3   ? 23.233  37.066 38.841 1.00 58.13  ? 3   PRO C C   1 
ATOM   4691 O  O   . PRO C 3 3   ? 22.579  36.367 39.611 1.00 54.25  ? 3   PRO C O   1 
ATOM   4692 C  CB  . PRO C 3 3   ? 22.348  39.444 38.981 1.00 61.37  ? 3   PRO C CB  1 
ATOM   4693 C  CG  . PRO C 3 3   ? 21.213  40.144 38.300 1.00 53.99  ? 3   PRO C CG  1 
ATOM   4694 C  CD  . PRO C 3 3   ? 20.284  38.992 37.979 1.00 47.21  ? 3   PRO C CD  1 
ATOM   4695 N  N   . VAL C 3 4   ? 24.526  36.864 38.598 1.00 53.64  ? 4   VAL C N   1 
ATOM   4696 C  CA  . VAL C 3 4   ? 25.296  35.819 39.272 1.00 51.76  ? 4   VAL C CA  1 
ATOM   4697 C  C   . VAL C 3 4   ? 26.411  36.542 40.016 1.00 48.36  ? 4   VAL C C   1 
ATOM   4698 O  O   . VAL C 3 4   ? 26.978  37.496 39.490 1.00 44.48  ? 4   VAL C O   1 
ATOM   4699 C  CB  . VAL C 3 4   ? 25.947  34.827 38.268 1.00 55.95  ? 4   VAL C CB  1 
ATOM   4700 C  CG1 . VAL C 3 4   ? 26.830  33.817 39.017 1.00 54.75  ? 4   VAL C CG1 1 
ATOM   4701 C  CG2 . VAL C 3 4   ? 24.879  34.098 37.490 1.00 40.93  ? 4   VAL C CG2 1 
ATOM   4702 N  N   . ASP C 3 5   ? 26.715  36.108 41.234 1.00 46.06  ? 5   ASP C N   1 
ATOM   4703 C  CA  . ASP C 3 5   ? 27.773  36.750 42.005 1.00 46.40  ? 5   ASP C CA  1 
ATOM   4704 C  C   . ASP C 3 5   ? 29.094  36.498 41.296 1.00 49.20  ? 5   ASP C C   1 
ATOM   4705 O  O   . ASP C 3 5   ? 29.544  35.359 41.174 1.00 53.03  ? 5   ASP C O   1 
ATOM   4706 C  CB  . ASP C 3 5   ? 27.808  36.192 43.427 1.00 60.47  ? 5   ASP C CB  1 
ATOM   4707 C  CG  . ASP C 3 5   ? 28.856  36.865 44.290 1.00 62.25  ? 5   ASP C CG  1 
ATOM   4708 O  OD1 . ASP C 3 5   ? 29.164  38.053 44.052 1.00 68.20  ? 5   ASP C OD1 1 
ATOM   4709 O  OD2 . ASP C 3 5   ? 29.360  36.208 45.219 1.00 70.14  ? 5   ASP C OD2 1 
ATOM   4710 N  N   . PRO C 3 6   ? 29.728  37.567 40.803 1.00 55.11  ? 6   PRO C N   1 
ATOM   4711 C  CA  . PRO C 3 6   ? 31.003  37.481 40.084 1.00 55.57  ? 6   PRO C CA  1 
ATOM   4712 C  C   . PRO C 3 6   ? 32.155  36.878 40.884 1.00 51.93  ? 6   PRO C C   1 
ATOM   4713 O  O   . PRO C 3 6   ? 32.969  36.143 40.342 1.00 47.63  ? 6   PRO C O   1 
ATOM   4714 C  CB  . PRO C 3 6   ? 31.280  38.934 39.697 1.00 56.92  ? 6   PRO C CB  1 
ATOM   4715 C  CG  . PRO C 3 6   ? 29.916  39.557 39.672 1.00 58.11  ? 6   PRO C CG  1 
ATOM   4716 C  CD  . PRO C 3 6   ? 29.278  38.964 40.891 1.00 52.55  ? 6   PRO C CD  1 
ATOM   4717 N  N   . ARG C 3 7   ? 32.210  37.189 42.172 1.00 48.16  ? 7   ARG C N   1 
ATOM   4718 C  CA  . ARG C 3 7   ? 33.280  36.703 43.032 1.00 50.77  ? 7   ARG C CA  1 
ATOM   4719 C  C   . ARG C 3 7   ? 33.373  35.174 43.168 1.00 51.23  ? 7   ARG C C   1 
ATOM   4720 O  O   . ARG C 3 7   ? 34.389  34.656 43.632 1.00 46.65  ? 7   ARG C O   1 
ATOM   4721 C  CB  . ARG C 3 7   ? 33.154  37.364 44.405 1.00 49.79  ? 7   ARG C CB  1 
ATOM   4722 C  CG  . ARG C 3 7   ? 33.130  38.896 44.339 1.00 50.08  ? 7   ARG C CG  1 
ATOM   4723 C  CD  . ARG C 3 7   ? 32.895  39.522 45.704 1.00 58.10  ? 7   ARG C CD  1 
ATOM   4724 N  NE  . ARG C 3 7   ? 31.608  39.127 46.271 1.00 69.81  ? 7   ARG C NE  1 
ATOM   4725 C  CZ  . ARG C 3 7   ? 31.150  39.540 47.449 1.00 71.65  ? 7   ARG C CZ  1 
ATOM   4726 N  NH1 . ARG C 3 7   ? 29.965  39.123 47.883 1.00 62.02  ? 7   ARG C NH1 1 
ATOM   4727 N  NH2 . ARG C 3 7   ? 31.875  40.368 48.192 1.00 71.88  ? 7   ARG C NH2 1 
ATOM   4728 N  N   . LEU C 3 8   ? 32.327  34.455 42.767 1.00 49.79  ? 8   LEU C N   1 
ATOM   4729 C  CA  . LEU C 3 8   ? 32.341  32.994 42.837 1.00 42.43  ? 8   LEU C CA  1 
ATOM   4730 C  C   . LEU C 3 8   ? 33.363  32.437 41.862 1.00 46.83  ? 8   LEU C C   1 
ATOM   4731 O  O   . LEU C 3 8   ? 33.454  32.900 40.724 1.00 36.10  ? 8   LEU C O   1 
ATOM   4732 C  CB  . LEU C 3 8   ? 30.980  32.408 42.456 1.00 47.73  ? 8   LEU C CB  1 
ATOM   4733 C  CG  . LEU C 3 8   ? 29.790  32.474 43.410 1.00 57.72  ? 8   LEU C CG  1 
ATOM   4734 C  CD1 . LEU C 3 8   ? 28.566  31.881 42.727 1.00 54.64  ? 8   LEU C CD1 1 
ATOM   4735 C  CD2 . LEU C 3 8   ? 30.113  31.702 44.680 1.00 60.88  ? 8   LEU C CD2 1 
ATOM   4736 N  N   . GLU C 3 9   ? 34.134  31.444 42.290 1.00 41.20  ? 9   GLU C N   1 
ATOM   4737 C  CA  . GLU C 3 9   ? 35.093  30.841 41.370 1.00 45.07  ? 9   GLU C CA  1 
ATOM   4738 C  C   . GLU C 3 9   ? 34.243  30.164 40.295 1.00 38.53  ? 9   GLU C C   1 
ATOM   4739 O  O   . GLU C 3 9   ? 33.160  29.665 40.579 1.00 40.56  ? 9   GLU C O   1 
ATOM   4740 C  CB  . GLU C 3 9   ? 35.987  29.832 42.101 1.00 38.39  ? 9   GLU C CB  1 
ATOM   4741 C  CG  . GLU C 3 9   ? 36.849  30.470 43.179 1.00 45.29  ? 9   GLU C CG  1 
ATOM   4742 C  CD  . GLU C 3 9   ? 37.771  31.574 42.654 1.00 59.73  ? 9   GLU C CD  1 
ATOM   4743 O  OE1 . GLU C 3 9   ? 38.337  32.302 43.497 1.00 53.29  ? 9   GLU C OE1 1 
ATOM   4744 O  OE2 . GLU C 3 9   ? 37.937  31.717 41.416 1.00 54.53  ? 9   GLU C OE2 1 
ATOM   4745 N  N   . PRO C 3 10  ? 34.733  30.121 39.052 1.00 39.67  ? 10  PRO C N   1 
ATOM   4746 C  CA  . PRO C 3 10  ? 34.005  29.515 37.929 1.00 35.76  ? 10  PRO C CA  1 
ATOM   4747 C  C   . PRO C 3 10  ? 33.268  28.206 38.182 1.00 36.31  ? 10  PRO C C   1 
ATOM   4748 O  O   . PRO C 3 10  ? 32.129  28.053 37.753 1.00 36.64  ? 10  PRO C O   1 
ATOM   4749 C  CB  . PRO C 3 10  ? 35.080  29.368 36.850 1.00 30.16  ? 10  PRO C CB  1 
ATOM   4750 C  CG  . PRO C 3 10  ? 35.996  30.509 37.139 1.00 35.95  ? 10  PRO C CG  1 
ATOM   4751 C  CD  . PRO C 3 10  ? 36.111  30.456 38.655 1.00 33.78  ? 10  PRO C CD  1 
ATOM   4752 N  N   . TRP C 3 11  ? 33.909  27.261 38.864 1.00 43.15  ? 11  TRP C N   1 
ATOM   4753 C  CA  . TRP C 3 11  ? 33.279  25.966 39.122 1.00 42.08  ? 11  TRP C CA  1 
ATOM   4754 C  C   . TRP C 3 11  ? 32.121  26.064 40.121 1.00 42.78  ? 11  TRP C C   1 
ATOM   4755 O  O   . TRP C 3 11  ? 31.268  25.183 40.170 1.00 45.65  ? 11  TRP C O   1 
ATOM   4756 C  CB  . TRP C 3 11  ? 34.336  24.930 39.568 1.00 37.24  ? 11  TRP C CB  1 
ATOM   4757 C  CG  . TRP C 3 11  ? 35.096  25.284 40.822 1.00 27.89  ? 11  TRP C CG  1 
ATOM   4758 C  CD1 . TRP C 3 11  ? 34.742  24.974 42.107 1.00 29.99  ? 11  TRP C CD1 1 
ATOM   4759 C  CD2 . TRP C 3 11  ? 36.298  26.066 40.916 1.00 32.86  ? 11  TRP C CD2 1 
ATOM   4760 N  NE1 . TRP C 3 11  ? 35.647  25.517 42.996 1.00 34.95  ? 11  TRP C NE1 1 
ATOM   4761 C  CE2 . TRP C 3 11  ? 36.611  26.192 42.295 1.00 29.41  ? 11  TRP C CE2 1 
ATOM   4762 C  CE3 . TRP C 3 11  ? 37.138  26.676 39.973 1.00 33.00  ? 11  TRP C CE3 1 
ATOM   4763 C  CZ2 . TRP C 3 11  ? 37.731  26.902 42.754 1.00 28.49  ? 11  TRP C CZ2 1 
ATOM   4764 C  CZ3 . TRP C 3 11  ? 38.259  27.388 40.431 1.00 33.66  ? 11  TRP C CZ3 1 
ATOM   4765 C  CH2 . TRP C 3 11  ? 38.543  27.492 41.817 1.00 24.51  ? 11  TRP C CH2 1 
ATOM   4766 N  N   . LYS C 3 12  ? 32.073  27.150 40.889 1.00 41.86  ? 12  LYS C N   1 
ATOM   4767 C  CA  . LYS C 3 12  ? 30.997  27.362 41.858 1.00 45.66  ? 12  LYS C CA  1 
ATOM   4768 C  C   . LYS C 3 12  ? 29.774  28.049 41.216 1.00 47.22  ? 12  LYS C C   1 
ATOM   4769 O  O   . LYS C 3 12  ? 28.777  28.293 41.889 1.00 45.37  ? 12  LYS C O   1 
ATOM   4770 C  CB  . LYS C 3 12  ? 31.482  28.229 43.029 1.00 38.37  ? 12  LYS C CB  1 
ATOM   4771 C  CG  . LYS C 3 12  ? 32.448  27.571 44.010 1.00 55.65  ? 12  LYS C CG  1 
ATOM   4772 C  CD  . LYS C 3 12  ? 31.722  26.706 45.036 1.00 50.01  ? 12  LYS C CD  1 
ATOM   4773 C  CE  . LYS C 3 12  ? 32.658  26.295 46.164 1.00 66.40  ? 12  LYS C CE  1 
ATOM   4774 N  NZ  . LYS C 3 12  ? 32.064  25.279 47.092 1.00 64.48  ? 12  LYS C NZ  1 
ATOM   4775 N  N   . HIS C 3 13  ? 29.847  28.366 39.927 1.00 52.06  ? 13  HIS C N   1 
ATOM   4776 C  CA  . HIS C 3 13  ? 28.731  29.033 39.246 1.00 44.13  ? 13  HIS C CA  1 
ATOM   4777 C  C   . HIS C 3 13  ? 27.555  28.114 38.933 1.00 48.75  ? 13  HIS C C   1 
ATOM   4778 O  O   . HIS C 3 13  ? 27.739  26.989 38.479 1.00 45.44  ? 13  HIS C O   1 
ATOM   4779 C  CB  . HIS C 3 13  ? 29.192  29.669 37.929 1.00 48.81  ? 13  HIS C CB  1 
ATOM   4780 C  CG  . HIS C 3 13  ? 29.870  30.989 38.094 1.00 44.14  ? 13  HIS C CG  1 
ATOM   4781 N  ND1 . HIS C 3 13  ? 29.743  32.004 37.172 1.00 40.57  ? 13  HIS C ND1 1 
ATOM   4782 C  CD2 . HIS C 3 13  ? 30.685  31.462 39.067 1.00 54.70  ? 13  HIS C CD2 1 
ATOM   4783 C  CE1 . HIS C 3 13  ? 30.448  33.047 37.571 1.00 43.01  ? 13  HIS C CE1 1 
ATOM   4784 N  NE2 . HIS C 3 13  ? 31.030  32.745 38.718 1.00 49.29  ? 13  HIS C NE2 1 
ATOM   4785 N  N   . PRO C 3 14  ? 26.320  28.605 39.138 1.00 45.33  ? 14  PRO C N   1 
ATOM   4786 C  CA  . PRO C 3 14  ? 25.100  27.835 38.880 1.00 34.32  ? 14  PRO C CA  1 
ATOM   4787 C  C   . PRO C 3 14  ? 24.905  27.557 37.403 1.00 46.31  ? 14  PRO C C   1 
ATOM   4788 O  O   . PRO C 3 14  ? 25.444  28.272 36.560 1.00 48.91  ? 14  PRO C O   1 
ATOM   4789 C  CB  . PRO C 3 14  ? 24.005  28.735 39.433 1.00 50.68  ? 14  PRO C CB  1 
ATOM   4790 C  CG  . PRO C 3 14  ? 24.559  30.118 39.183 1.00 51.22  ? 14  PRO C CG  1 
ATOM   4791 C  CD  . PRO C 3 14  ? 25.995  29.961 39.617 1.00 46.13  ? 14  PRO C CD  1 
ATOM   4792 N  N   . GLY C 3 15  ? 24.144  26.510 37.092 1.00 35.61  ? 15  GLY C N   1 
ATOM   4793 C  CA  . GLY C 3 15  ? 23.882  26.178 35.707 1.00 41.24  ? 15  GLY C CA  1 
ATOM   4794 C  C   . GLY C 3 15  ? 22.949  27.235 35.161 1.00 44.69  ? 15  GLY C C   1 
ATOM   4795 O  O   . GLY C 3 15  ? 22.273  27.915 35.926 1.00 40.88  ? 15  GLY C O   1 
ATOM   4796 N  N   . SER C 3 16  ? 22.902  27.369 33.843 1.00 46.26  ? 16  SER C N   1 
ATOM   4797 C  CA  . SER C 3 16  ? 22.060  28.369 33.199 1.00 46.30  ? 16  SER C CA  1 
ATOM   4798 C  C   . SER C 3 16  ? 20.685  27.838 32.807 1.00 55.32  ? 16  SER C C   1 
ATOM   4799 O  O   . SER C 3 16  ? 19.805  28.608 32.417 1.00 53.81  ? 16  SER C O   1 
ATOM   4800 C  CB  . SER C 3 16  ? 22.752  28.885 31.942 1.00 38.96  ? 16  SER C CB  1 
ATOM   4801 O  OG  . SER C 3 16  ? 22.725  27.894 30.920 1.00 40.72  ? 16  SER C OG  1 
ATOM   4802 N  N   . GLN C 3 17  ? 20.507  26.524 32.883 1.00 57.10  ? 17  GLN C N   1 
ATOM   4803 C  CA  . GLN C 3 17  ? 19.231  25.920 32.515 1.00 55.71  ? 17  GLN C CA  1 
ATOM   4804 C  C   . GLN C 3 17  ? 18.073  26.530 33.308 1.00 55.31  ? 17  GLN C C   1 
ATOM   4805 O  O   . GLN C 3 17  ? 18.127  26.637 34.539 1.00 56.54  ? 17  GLN C O   1 
ATOM   4806 C  CB  . GLN C 3 17  ? 19.281  24.408 32.744 1.00 57.42  ? 17  GLN C CB  1 
ATOM   4807 C  CG  . GLN C 3 17  ? 18.044  23.662 32.283 1.00 56.00  ? 17  GLN C CG  1 
ATOM   4808 C  CD  . GLN C 3 17  ? 18.221  22.159 32.343 1.00 54.06  ? 17  GLN C CD  1 
ATOM   4809 O  OE1 . GLN C 3 17  ? 18.385  21.582 33.417 1.00 53.67  ? 17  GLN C OE1 1 
ATOM   4810 N  NE2 . GLN C 3 17  ? 18.201  21.517 31.182 1.00 57.98  ? 17  GLN C NE2 1 
ATOM   4811 N  N   . PRO C 3 18  ? 17.016  26.963 32.602 1.00 57.08  ? 18  PRO C N   1 
ATOM   4812 C  CA  . PRO C 3 18  ? 15.840  27.564 33.239 1.00 56.51  ? 18  PRO C CA  1 
ATOM   4813 C  C   . PRO C 3 18  ? 15.093  26.570 34.135 1.00 62.25  ? 18  PRO C C   1 
ATOM   4814 O  O   . PRO C 3 18  ? 14.956  25.394 33.796 1.00 59.00  ? 18  PRO C O   1 
ATOM   4815 C  CB  . PRO C 3 18  ? 15.006  28.028 32.048 1.00 59.89  ? 18  PRO C CB  1 
ATOM   4816 C  CG  . PRO C 3 18  ? 15.394  27.073 30.959 1.00 60.65  ? 18  PRO C CG  1 
ATOM   4817 C  CD  . PRO C 3 18  ? 16.886  26.982 31.134 1.00 45.23  ? 18  PRO C CD  1 
ATOM   4818 N  N   . LYS C 3 19  ? 14.614  27.052 35.277 1.00 63.33  ? 19  LYS C N   1 
ATOM   4819 C  CA  . LYS C 3 19  ? 13.896  26.210 36.224 1.00 65.59  ? 19  LYS C CA  1 
ATOM   4820 C  C   . LYS C 3 19  ? 12.688  25.489 35.637 1.00 67.34  ? 19  LYS C C   1 
ATOM   4821 O  O   . LYS C 3 19  ? 12.293  24.444 36.147 1.00 63.87  ? 19  LYS C O   1 
ATOM   4822 C  CB  . LYS C 3 19  ? 13.456  27.039 37.430 1.00 73.93  ? 19  LYS C CB  1 
ATOM   4823 C  CG  . LYS C 3 19  ? 14.601  27.520 38.304 1.00 77.38  ? 19  LYS C CG  1 
ATOM   4824 C  CD  . LYS C 3 19  ? 15.317  26.349 38.964 1.00 89.57  ? 19  LYS C CD  1 
ATOM   4825 C  CE  . LYS C 3 19  ? 16.430  26.823 39.895 1.00 94.21  ? 19  LYS C CE  1 
ATOM   4826 N  NZ  . LYS C 3 19  ? 17.112  25.691 40.587 1.00 92.29  ? 19  LYS C NZ  1 
ATOM   4827 N  N   . THR C 3 20  ? 12.096  26.037 34.578 1.00 62.57  ? 20  THR C N   1 
ATOM   4828 C  CA  . THR C 3 20  ? 10.937  25.399 33.960 1.00 62.84  ? 20  THR C CA  1 
ATOM   4829 C  C   . THR C 3 20  ? 11.117  25.278 32.458 1.00 64.43  ? 20  THR C C   1 
ATOM   4830 O  O   . THR C 3 20  ? 11.914  25.992 31.860 1.00 64.67  ? 20  THR C O   1 
ATOM   4831 C  CB  . THR C 3 20  ? 9.651   26.188 34.208 1.00 63.63  ? 20  THR C CB  1 
ATOM   4832 O  OG1 . THR C 3 20  ? 9.682   27.392 33.435 1.00 72.54  ? 20  THR C OG1 1 
ATOM   4833 C  CG2 . THR C 3 20  ? 9.514   26.538 35.689 1.00 54.98  ? 20  THR C CG2 1 
ATOM   4834 N  N   . ALA C 3 21  ? 10.366  24.373 31.848 1.00 61.31  ? 21  ALA C N   1 
ATOM   4835 C  CA  . ALA C 3 21  ? 10.468  24.171 30.413 1.00 67.82  ? 21  ALA C CA  1 
ATOM   4836 C  C   . ALA C 3 21  ? 10.135  25.453 29.668 1.00 68.28  ? 21  ALA C C   1 
ATOM   4837 O  O   . ALA C 3 21  ? 9.527   26.373 30.217 1.00 67.28  ? 21  ALA C O   1 
ATOM   4838 C  CB  . ALA C 3 21  ? 9.535   23.061 29.977 1.00 54.47  ? 21  ALA C CB  1 
ATOM   4839 N  N   . CYS C 3 22  ? 10.550  25.511 28.412 1.00 67.98  ? 22  CYS C N   1 
ATOM   4840 C  CA  . CYS C 3 22  ? 10.275  26.672 27.589 1.00 69.71  ? 22  CYS C CA  1 
ATOM   4841 C  C   . CYS C 3 22  ? 9.023   26.393 26.771 1.00 76.07  ? 22  CYS C C   1 
ATOM   4842 O  O   . CYS C 3 22  ? 9.022   25.531 25.890 1.00 78.63  ? 22  CYS C O   1 
ATOM   4843 C  CB  . CYS C 3 22  ? 11.455  26.962 26.661 1.00 64.84  ? 22  CYS C CB  1 
ATOM   4844 S  SG  . CYS C 3 22  ? 12.888  27.673 27.494 1.00 61.35  ? 22  CYS C SG  1 
ATOM   4845 N  N   . THR C 3 23  ? 7.954   27.119 27.076 1.00 77.19  ? 23  THR C N   1 
ATOM   4846 C  CA  . THR C 3 23  ? 6.696   26.949 26.366 1.00 73.88  ? 23  THR C CA  1 
ATOM   4847 C  C   . THR C 3 23  ? 6.839   27.514 24.959 1.00 73.35  ? 23  THR C C   1 
ATOM   4848 O  O   . THR C 3 23  ? 7.889   28.038 24.593 1.00 75.47  ? 23  THR C O   1 
ATOM   4849 C  CB  . THR C 3 23  ? 5.560   27.689 27.079 1.00 76.04  ? 23  THR C CB  1 
ATOM   4850 O  OG1 . THR C 3 23  ? 5.630   29.085 26.764 1.00 79.25  ? 23  THR C OG1 1 
ATOM   4851 C  CG2 . THR C 3 23  ? 5.685   27.514 28.596 1.00 70.54  ? 23  THR C CG2 1 
ATOM   4852 N  N   . ASN C 3 24  ? 5.783   27.407 24.167 1.00 74.87  ? 24  ASN C N   1 
ATOM   4853 C  CA  . ASN C 3 24  ? 5.815   27.921 22.808 1.00 76.61  ? 24  ASN C CA  1 
ATOM   4854 C  C   . ASN C 3 24  ? 4.953   29.182 22.757 1.00 75.61  ? 24  ASN C C   1 
ATOM   4855 O  O   . ASN C 3 24  ? 4.703   29.750 21.691 1.00 75.95  ? 24  ASN C O   1 
ATOM   4856 C  CB  . ASN C 3 24  ? 5.279   26.861 21.839 1.00 79.47  ? 24  ASN C CB  1 
ATOM   4857 C  CG  . ASN C 3 24  ? 5.608   27.171 20.392 1.00 80.83  ? 24  ASN C CG  1 
ATOM   4858 O  OD1 . ASN C 3 24  ? 5.197   26.449 19.484 1.00 82.35  ? 24  ASN C OD1 1 
ATOM   4859 N  ND2 . ASN C 3 24  ? 6.357   28.245 20.169 1.00 86.44  ? 24  ASN C ND2 1 
ATOM   4860 N  N   . CYS C 3 25  ? 4.511   29.617 23.933 1.00 73.46  ? 25  CYS C N   1 
ATOM   4861 C  CA  . CYS C 3 25  ? 3.664   30.796 24.055 1.00 72.72  ? 25  CYS C CA  1 
ATOM   4862 C  C   . CYS C 3 25  ? 4.393   32.103 23.806 1.00 74.47  ? 25  CYS C C   1 
ATOM   4863 O  O   . CYS C 3 25  ? 5.591   32.216 24.059 1.00 78.95  ? 25  CYS C O   1 
ATOM   4864 C  CB  . CYS C 3 25  ? 3.032   30.851 25.442 1.00 64.50  ? 25  CYS C CB  1 
ATOM   4865 S  SG  . CYS C 3 25  ? 2.229   32.421 25.756 1.00 65.49  ? 25  CYS C SG  1 
ATOM   4866 N  N   . TYR C 3 26  ? 3.650   33.093 23.318 1.00 71.71  ? 26  TYR C N   1 
ATOM   4867 C  CA  . TYR C 3 26  ? 4.201   34.412 23.040 1.00 65.14  ? 26  TYR C CA  1 
ATOM   4868 C  C   . TYR C 3 26  ? 3.458   35.472 23.812 1.00 66.31  ? 26  TYR C C   1 
ATOM   4869 O  O   . TYR C 3 26  ? 2.374   35.884 23.431 1.00 81.86  ? 26  TYR C O   1 
ATOM   4870 C  CB  . TYR C 3 26  ? 4.105   34.736 21.554 1.00 62.65  ? 26  TYR C CB  1 
ATOM   4871 C  CG  . TYR C 3 26  ? 5.112   34.004 20.713 1.00 65.87  ? 26  TYR C CG  1 
ATOM   4872 C  CD1 . TYR C 3 26  ? 5.168   32.610 20.717 1.00 64.65  ? 26  TYR C CD1 1 
ATOM   4873 C  CD2 . TYR C 3 26  ? 6.037   34.705 19.938 1.00 66.56  ? 26  TYR C CD2 1 
ATOM   4874 C  CE1 . TYR C 3 26  ? 6.124   31.928 19.973 1.00 70.35  ? 26  TYR C CE1 1 
ATOM   4875 C  CE2 . TYR C 3 26  ? 6.999   34.035 19.191 1.00 69.45  ? 26  TYR C CE2 1 
ATOM   4876 C  CZ  . TYR C 3 26  ? 7.039   32.646 19.215 1.00 76.75  ? 26  TYR C CZ  1 
ATOM   4877 O  OH  . TYR C 3 26  ? 8.006   31.979 18.500 1.00 85.04  ? 26  TYR C OH  1 
ATOM   4878 N  N   . CYS C 3 27  ? 4.028   35.905 24.916 1.00 71.06  ? 27  CYS C N   1 
ATOM   4879 C  CA  . CYS C 3 27  ? 3.397   36.942 25.696 1.00 70.07  ? 27  CYS C CA  1 
ATOM   4880 C  C   . CYS C 3 27  ? 4.494   37.589 26.493 1.00 74.03  ? 27  CYS C C   1 
ATOM   4881 O  O   . CYS C 3 27  ? 5.487   36.951 26.833 1.00 75.51  ? 27  CYS C O   1 
ATOM   4882 C  CB  . CYS C 3 27  ? 2.304   36.369 26.607 1.00 68.28  ? 27  CYS C CB  1 
ATOM   4883 S  SG  . CYS C 3 27  ? 2.823   35.260 27.939 1.00 66.66  ? 27  CYS C SG  1 
ATOM   4884 N  N   . LYS C 3 28  ? 4.324   38.872 26.758 1.00 77.84  ? 28  LYS C N   1 
ATOM   4885 C  CA  . LYS C 3 28  ? 5.304   39.625 27.505 1.00 80.77  ? 28  LYS C CA  1 
ATOM   4886 C  C   . LYS C 3 28  ? 6.034   38.760 28.538 1.00 80.85  ? 28  LYS C C   1 
ATOM   4887 O  O   . LYS C 3 28  ? 7.226   38.953 28.774 1.00 88.95  ? 28  LYS C O   1 
ATOM   4888 C  CB  . LYS C 3 28  ? 4.614   40.804 28.179 1.00 79.37  ? 28  LYS C CB  1 
ATOM   4889 C  CG  . LYS C 3 28  ? 5.554   41.816 28.766 1.00 85.33  ? 28  LYS C CG  1 
ATOM   4890 C  CD  . LYS C 3 28  ? 4.755   42.908 29.419 1.00 96.25  ? 28  LYS C CD  1 
ATOM   4891 C  CE  . LYS C 3 28  ? 5.615   43.651 30.384 1.00 91.54  ? 28  LYS C CE  1 
ATOM   4892 N  NZ  . LYS C 3 28  ? 6.346   42.710 31.280 1.00 94.22  ? 28  LYS C NZ  1 
ATOM   4893 N  N   . LYS C 3 29  ? 5.335   37.796 29.134 1.00 75.00  ? 29  LYS C N   1 
ATOM   4894 C  CA  . LYS C 3 29  ? 5.960   36.941 30.136 1.00 73.60  ? 29  LYS C CA  1 
ATOM   4895 C  C   . LYS C 3 29  ? 6.695   35.730 29.580 1.00 69.62  ? 29  LYS C C   1 
ATOM   4896 O  O   . LYS C 3 29  ? 7.821   35.460 29.988 1.00 72.35  ? 29  LYS C O   1 
ATOM   4897 C  CB  . LYS C 3 29  ? 4.933   36.503 31.183 1.00 75.84  ? 29  LYS C CB  1 
ATOM   4898 C  CG  . LYS C 3 29  ? 4.531   37.639 32.129 1.00 82.69  ? 29  LYS C CG  1 
ATOM   4899 C  CD  . LYS C 3 29  ? 3.598   37.170 33.238 1.00 91.52  ? 29  LYS C CD  1 
ATOM   4900 C  CE  . LYS C 3 29  ? 3.240   38.314 34.186 1.00 90.94  ? 29  LYS C CE  1 
ATOM   4901 N  NZ  . LYS C 3 29  ? 2.265   37.895 35.239 1.00 88.61  ? 29  LYS C NZ  1 
ATOM   4902 N  N   . CYS C 3 30  ? 6.078   35.000 28.657 1.00 69.48  ? 30  CYS C N   1 
ATOM   4903 C  CA  . CYS C 3 30  ? 6.743   33.835 28.071 1.00 69.97  ? 30  CYS C CA  1 
ATOM   4904 C  C   . CYS C 3 30  ? 7.868   34.253 27.125 1.00 64.07  ? 30  CYS C C   1 
ATOM   4905 O  O   . CYS C 3 30  ? 8.755   33.464 26.805 1.00 66.48  ? 30  CYS C O   1 
ATOM   4906 C  CB  . CYS C 3 30  ? 5.738   32.960 27.325 1.00 63.50  ? 30  CYS C CB  1 
ATOM   4907 S  SG  . CYS C 3 30  ? 4.612   32.082 28.418 1.00 77.11  ? 30  CYS C SG  1 
ATOM   4908 N  N   . CYS C 3 31  ? 7.817   35.501 26.676 1.00 61.85  ? 31  CYS C N   1 
ATOM   4909 C  CA  . CYS C 3 31  ? 8.830   36.041 25.781 1.00 53.91  ? 31  CYS C CA  1 
ATOM   4910 C  C   . CYS C 3 31  ? 10.073  36.425 26.584 1.00 53.92  ? 31  CYS C C   1 
ATOM   4911 O  O   . CYS C 3 31  ? 11.118  36.737 26.016 1.00 56.94  ? 31  CYS C O   1 
ATOM   4912 C  CB  . CYS C 3 31  ? 8.279   37.267 25.048 1.00 53.97  ? 31  CYS C CB  1 
ATOM   4913 S  SG  . CYS C 3 31  ? 7.975   37.009 23.279 1.00 56.40  ? 31  CYS C SG  1 
ATOM   4914 N  N   . PHE C 3 32  ? 9.943   36.407 27.909 1.00 53.76  ? 32  PHE C N   1 
ATOM   4915 C  CA  . PHE C 3 32  ? 11.041  36.736 28.811 1.00 52.38  ? 32  PHE C CA  1 
ATOM   4916 C  C   . PHE C 3 32  ? 11.281  35.591 29.802 1.00 48.63  ? 32  PHE C C   1 
ATOM   4917 O  O   . PHE C 3 32  ? 11.792  35.807 30.901 1.00 50.78  ? 32  PHE C O   1 
ATOM   4918 C  CB  . PHE C 3 32  ? 10.736  38.019 29.595 1.00 46.90  ? 32  PHE C CB  1 
ATOM   4919 C  CG  . PHE C 3 32  ? 10.795  39.283 28.767 1.00 50.13  ? 32  PHE C CG  1 
ATOM   4920 C  CD1 . PHE C 3 32  ? 9.887   39.507 27.733 1.00 48.27  ? 32  PHE C CD1 1 
ATOM   4921 C  CD2 . PHE C 3 32  ? 11.730  40.269 29.059 1.00 43.58  ? 32  PHE C CD2 1 
ATOM   4922 C  CE1 . PHE C 3 32  ? 9.901   40.696 27.006 1.00 55.69  ? 32  PHE C CE1 1 
ATOM   4923 C  CE2 . PHE C 3 32  ? 11.756  41.464 28.338 1.00 58.54  ? 32  PHE C CE2 1 
ATOM   4924 C  CZ  . PHE C 3 32  ? 10.835  41.679 27.308 1.00 57.66  ? 32  PHE C CZ  1 
ATOM   4925 N  N   . HIS C 3 33  ? 10.904  34.377 29.420 1.00 51.33  ? 33  HIS C N   1 
ATOM   4926 C  CA  . HIS C 3 33  ? 11.097  33.223 30.295 1.00 50.17  ? 33  HIS C CA  1 
ATOM   4927 C  C   . HIS C 3 33  ? 12.589  33.030 30.596 1.00 50.83  ? 33  HIS C C   1 
ATOM   4928 O  O   . HIS C 3 33  ? 12.982  32.764 31.729 1.00 53.73  ? 33  HIS C O   1 
ATOM   4929 C  CB  . HIS C 3 33  ? 10.538  31.959 29.634 1.00 45.48  ? 33  HIS C CB  1 
ATOM   4930 C  CG  . HIS C 3 33  ? 10.730  30.713 30.447 1.00 54.31  ? 33  HIS C CG  1 
ATOM   4931 N  ND1 . HIS C 3 33  ? 11.482  29.661 29.988 1.00 50.33  ? 33  HIS C ND1 1 
ATOM   4932 C  CD2 . HIS C 3 33  ? 10.228  30.403 31.669 1.00 56.70  ? 33  HIS C CD2 1 
ATOM   4933 C  CE1 . HIS C 3 33  ? 11.418  28.735 30.922 1.00 44.93  ? 33  HIS C CE1 1 
ATOM   4934 N  NE2 . HIS C 3 33  ? 10.670  29.134 31.963 1.00 56.89  ? 33  HIS C NE2 1 
ATOM   4935 N  N   . CYS C 3 34  ? 13.417  33.173 29.570 1.00 52.60  ? 34  CYS C N   1 
ATOM   4936 C  CA  . CYS C 3 34  ? 14.858  33.004 29.726 1.00 54.69  ? 34  CYS C CA  1 
ATOM   4937 C  C   . CYS C 3 34  ? 15.541  33.686 28.552 1.00 54.96  ? 34  CYS C C   1 
ATOM   4938 O  O   . CYS C 3 34  ? 14.873  34.158 27.629 1.00 57.93  ? 34  CYS C O   1 
ATOM   4939 C  CB  . CYS C 3 34  ? 15.219  31.517 29.720 1.00 37.98  ? 34  CYS C CB  1 
ATOM   4940 S  SG  . CYS C 3 34  ? 14.934  30.734 28.122 1.00 43.99  ? 34  CYS C SG  1 
ATOM   4941 N  N   . GLN C 3 35  ? 16.867  33.723 28.576 1.00 48.38  ? 35  GLN C N   1 
ATOM   4942 C  CA  . GLN C 3 35  ? 17.604  34.356 27.496 1.00 47.61  ? 35  GLN C CA  1 
ATOM   4943 C  C   . GLN C 3 35  ? 17.206  33.803 26.135 1.00 41.39  ? 35  GLN C C   1 
ATOM   4944 O  O   . GLN C 3 35  ? 17.094  34.552 25.163 1.00 41.45  ? 35  GLN C O   1 
ATOM   4945 C  CB  . GLN C 3 35  ? 19.109  34.175 27.690 1.00 44.57  ? 35  GLN C CB  1 
ATOM   4946 C  CG  . GLN C 3 35  ? 19.958  34.905 26.656 1.00 40.68  ? 35  GLN C CG  1 
ATOM   4947 C  CD  . GLN C 3 35  ? 19.798  36.420 26.722 1.00 43.75  ? 35  GLN C CD  1 
ATOM   4948 O  OE1 . GLN C 3 35  ? 19.429  36.971 27.763 1.00 41.12  ? 35  GLN C OE1 1 
ATOM   4949 N  NE2 . GLN C 3 35  ? 20.102  37.101 25.617 1.00 29.33  ? 35  GLN C NE2 1 
ATOM   4950 N  N   . VAL C 3 36  ? 16.994  32.494 26.063 1.00 45.45  ? 36  VAL C N   1 
ATOM   4951 C  CA  . VAL C 3 36  ? 16.632  31.854 24.798 1.00 51.40  ? 36  VAL C CA  1 
ATOM   4952 C  C   . VAL C 3 36  ? 15.250  32.288 24.303 1.00 50.16  ? 36  VAL C C   1 
ATOM   4953 O  O   . VAL C 3 36  ? 15.072  32.632 23.133 1.00 49.65  ? 36  VAL C O   1 
ATOM   4954 C  CB  . VAL C 3 36  ? 16.672  30.327 24.935 1.00 55.45  ? 36  VAL C CB  1 
ATOM   4955 C  CG1 . VAL C 3 36  ? 16.570  29.685 23.568 1.00 43.03  ? 36  VAL C CG1 1 
ATOM   4956 C  CG2 . VAL C 3 36  ? 17.971  29.904 25.626 1.00 57.62  ? 36  VAL C CG2 1 
ATOM   4957 N  N   . CYS C 3 37  ? 14.272  32.268 25.197 1.00 40.43  ? 37  CYS C N   1 
ATOM   4958 C  CA  . CYS C 3 37  ? 12.932  32.692 24.835 1.00 51.85  ? 37  CYS C CA  1 
ATOM   4959 C  C   . CYS C 3 37  ? 12.934  34.176 24.423 1.00 53.12  ? 37  CYS C C   1 
ATOM   4960 O  O   . CYS C 3 37  ? 12.260  34.556 23.473 1.00 44.42  ? 37  CYS C O   1 
ATOM   4961 C  CB  . CYS C 3 37  ? 11.979  32.444 26.008 1.00 42.77  ? 37  CYS C CB  1 
ATOM   4962 S  SG  . CYS C 3 37  ? 11.672  30.678 26.303 1.00 52.45  ? 37  CYS C SG  1 
ATOM   4963 N  N   . PHE C 3 38  ? 13.710  35.003 25.123 1.00 52.38  ? 38  PHE C N   1 
ATOM   4964 C  CA  . PHE C 3 38  ? 13.791  36.431 24.808 1.00 49.35  ? 38  PHE C CA  1 
ATOM   4965 C  C   . PHE C 3 38  ? 14.404  36.675 23.432 1.00 42.39  ? 38  PHE C C   1 
ATOM   4966 O  O   . PHE C 3 38  ? 13.872  37.433 22.625 1.00 52.51  ? 38  PHE C O   1 
ATOM   4967 C  CB  . PHE C 3 38  ? 14.630  37.173 25.856 1.00 44.81  ? 38  PHE C CB  1 
ATOM   4968 C  CG  . PHE C 3 38  ? 14.922  38.601 25.491 1.00 43.26  ? 38  PHE C CG  1 
ATOM   4969 C  CD1 . PHE C 3 38  ? 13.930  39.573 25.576 1.00 45.53  ? 38  PHE C CD1 1 
ATOM   4970 C  CD2 . PHE C 3 38  ? 16.174  38.967 25.012 1.00 36.68  ? 38  PHE C CD2 1 
ATOM   4971 C  CE1 . PHE C 3 38  ? 14.187  40.885 25.184 1.00 41.32  ? 38  PHE C CE1 1 
ATOM   4972 C  CE2 . PHE C 3 38  ? 16.440  40.272 24.617 1.00 43.38  ? 38  PHE C CE2 1 
ATOM   4973 C  CZ  . PHE C 3 38  ? 15.445  41.233 24.701 1.00 44.91  ? 38  PHE C CZ  1 
ATOM   4974 N  N   . ILE C 3 39  ? 15.537  36.036 23.179 1.00 44.66  ? 39  ILE C N   1 
ATOM   4975 C  CA  . ILE C 3 39  ? 16.249  36.170 21.913 1.00 37.13  ? 39  ILE C CA  1 
ATOM   4976 C  C   . ILE C 3 39  ? 15.459  35.641 20.710 1.00 41.57  ? 39  ILE C C   1 
ATOM   4977 O  O   . ILE C 3 39  ? 15.479  36.232 19.635 1.00 44.04  ? 39  ILE C O   1 
ATOM   4978 C  CB  . ILE C 3 39  ? 17.613  35.436 22.002 1.00 35.37  ? 39  ILE C CB  1 
ATOM   4979 C  CG1 . ILE C 3 39  ? 18.554  36.216 22.928 1.00 33.92  ? 39  ILE C CG1 1 
ATOM   4980 C  CG2 . ILE C 3 39  ? 18.221  35.246 20.608 1.00 39.75  ? 39  ILE C CG2 1 
ATOM   4981 C  CD1 . ILE C 3 39  ? 18.870  37.619 22.445 1.00 37.28  ? 39  ILE C CD1 1 
ATOM   4982 N  N   . THR C 3 40  ? 14.765  34.524 20.899 1.00 45.58  ? 40  THR C N   1 
ATOM   4983 C  CA  . THR C 3 40  ? 14.001  33.906 19.817 1.00 54.87  ? 40  THR C CA  1 
ATOM   4984 C  C   . THR C 3 40  ? 12.569  34.420 19.636 1.00 48.24  ? 40  THR C C   1 
ATOM   4985 O  O   . THR C 3 40  ? 12.151  34.691 18.513 1.00 50.14  ? 40  THR C O   1 
ATOM   4986 C  CB  . THR C 3 40  ? 13.929  32.369 19.993 1.00 53.38  ? 40  THR C CB  1 
ATOM   4987 O  OG1 . THR C 3 40  ? 13.262  32.062 21.224 1.00 51.55  ? 40  THR C OG1 1 
ATOM   4988 C  CG2 . THR C 3 40  ? 15.322  31.765 20.008 1.00 51.59  ? 40  THR C CG2 1 
ATOM   4989 N  N   . LYS C 3 41  ? 11.823  34.542 20.734 1.00 52.88  ? 41  LYS C N   1 
ATOM   4990 C  CA  . LYS C 3 41  ? 10.432  35.005 20.672 1.00 51.11  ? 41  LYS C CA  1 
ATOM   4991 C  C   . LYS C 3 41  ? 10.328  36.514 20.500 1.00 49.81  ? 41  LYS C C   1 
ATOM   4992 O  O   . LYS C 3 41  ? 9.876   36.989 19.467 1.00 53.86  ? 41  LYS C O   1 
ATOM   4993 C  CB  . LYS C 3 41  ? 9.673   34.580 21.935 1.00 54.45  ? 41  LYS C CB  1 
ATOM   4994 C  CG  . LYS C 3 41  ? 9.457   33.078 22.080 1.00 53.17  ? 41  LYS C CG  1 
ATOM   4995 C  CD  . LYS C 3 41  ? 8.925   32.748 23.468 1.00 54.14  ? 41  LYS C CD  1 
ATOM   4996 C  CE  . LYS C 3 41  ? 8.724   31.253 23.648 1.00 55.87  ? 41  LYS C CE  1 
ATOM   4997 N  NZ  . LYS C 3 41  ? 8.386   30.892 25.063 1.00 52.58  ? 41  LYS C NZ  1 
ATOM   4998 N  N   . ALA C 3 42  ? 10.760  37.266 21.508 1.00 49.98  ? 42  ALA C N   1 
ATOM   4999 C  CA  . ALA C 3 42  ? 10.709  38.726 21.456 1.00 48.46  ? 42  ALA C CA  1 
ATOM   5000 C  C   . ALA C 3 42  ? 11.588  39.392 20.383 1.00 47.76  ? 42  ALA C C   1 
ATOM   5001 O  O   . ALA C 3 42  ? 11.208  40.436 19.856 1.00 55.24  ? 42  ALA C O   1 
ATOM   5002 C  CB  . ALA C 3 42  ? 11.039  39.309 22.836 1.00 43.11  ? 42  ALA C CB  1 
ATOM   5003 N  N   . LEU C 3 43  ? 12.747  38.816 20.054 1.00 43.18  ? 43  LEU C N   1 
ATOM   5004 C  CA  . LEU C 3 43  ? 13.622  39.428 19.039 1.00 48.95  ? 43  LEU C CA  1 
ATOM   5005 C  C   . LEU C 3 43  ? 13.589  38.703 17.701 1.00 40.03  ? 43  LEU C C   1 
ATOM   5006 O  O   . LEU C 3 43  ? 14.124  39.190 16.708 1.00 43.56  ? 43  LEU C O   1 
ATOM   5007 C  CB  . LEU C 3 43  ? 15.082  39.505 19.521 1.00 44.16  ? 43  LEU C CB  1 
ATOM   5008 C  CG  . LEU C 3 43  ? 15.505  40.371 20.717 1.00 36.58  ? 43  LEU C CG  1 
ATOM   5009 C  CD1 . LEU C 3 43  ? 16.991  40.702 20.566 1.00 29.33  ? 43  LEU C CD1 1 
ATOM   5010 C  CD2 . LEU C 3 43  ? 14.717  41.673 20.766 1.00 38.60  ? 43  LEU C CD2 1 
ATOM   5011 N  N   . GLY C 3 44  ? 12.985  37.521 17.691 1.00 47.09  ? 44  GLY C N   1 
ATOM   5012 C  CA  . GLY C 3 44  ? 12.870  36.750 16.465 1.00 48.22  ? 44  GLY C CA  1 
ATOM   5013 C  C   . GLY C 3 44  ? 14.158  36.273 15.827 1.00 51.61  ? 44  GLY C C   1 
ATOM   5014 O  O   . GLY C 3 44  ? 14.214  36.089 14.613 1.00 51.46  ? 44  GLY C O   1 
ATOM   5015 N  N   . ILE C 3 45  ? 15.195  36.087 16.637 1.00 47.59  ? 45  ILE C N   1 
ATOM   5016 C  CA  . ILE C 3 45  ? 16.479  35.594 16.146 1.00 49.93  ? 45  ILE C CA  1 
ATOM   5017 C  C   . ILE C 3 45  ? 16.437  34.071 16.259 1.00 43.74  ? 45  ILE C C   1 
ATOM   5018 O  O   . ILE C 3 45  ? 15.920  33.545 17.239 1.00 42.93  ? 45  ILE C O   1 
ATOM   5019 C  CB  . ILE C 3 45  ? 17.651  36.119 17.023 1.00 50.91  ? 45  ILE C CB  1 
ATOM   5020 C  CG1 . ILE C 3 45  ? 17.886  37.606 16.749 1.00 45.44  ? 45  ILE C CG1 1 
ATOM   5021 C  CG2 . ILE C 3 45  ? 18.914  35.300 16.772 1.00 36.28  ? 45  ILE C CG2 1 
ATOM   5022 C  CD1 . ILE C 3 45  ? 18.800  38.256 17.763 1.00 34.38  ? 45  ILE C CD1 1 
ATOM   5023 N  N   . SER C 3 46  ? 16.964  33.368 15.259 1.00 47.86  ? 46  SER C N   1 
ATOM   5024 C  CA  . SER C 3 46  ? 16.998  31.905 15.294 1.00 50.68  ? 46  SER C CA  1 
ATOM   5025 C  C   . SER C 3 46  ? 18.134  31.364 14.418 1.00 49.42  ? 46  SER C C   1 
ATOM   5026 O  O   . SER C 3 46  ? 18.409  31.895 13.339 1.00 47.76  ? 46  SER C O   1 
ATOM   5027 C  CB  . SER C 3 46  ? 15.674  31.320 14.807 1.00 55.28  ? 46  SER C CB  1 
ATOM   5028 O  OG  . SER C 3 46  ? 15.594  31.400 13.393 1.00 57.69  ? 46  SER C OG  1 
ATOM   5029 N  N   . TYR C 3 47  ? 18.769  30.292 14.882 1.00 49.92  ? 47  TYR C N   1 
ATOM   5030 C  CA  . TYR C 3 47  ? 19.882  29.664 14.165 1.00 55.09  ? 47  TYR C CA  1 
ATOM   5031 C  C   . TYR C 3 47  ? 19.481  28.686 13.058 1.00 58.73  ? 47  TYR C C   1 
ATOM   5032 O  O   . TYR C 3 47  ? 20.258  28.436 12.134 1.00 55.15  ? 47  TYR C O   1 
ATOM   5033 C  CB  . TYR C 3 47  ? 20.802  28.954 15.161 1.00 42.06  ? 47  TYR C CB  1 
ATOM   5034 C  CG  . TYR C 3 47  ? 20.097  28.020 16.129 1.00 39.29  ? 47  TYR C CG  1 
ATOM   5035 C  CD1 . TYR C 3 47  ? 19.740  26.721 15.761 1.00 40.95  ? 47  TYR C CD1 1 
ATOM   5036 C  CD2 . TYR C 3 47  ? 19.831  28.427 17.429 1.00 37.00  ? 47  TYR C CD2 1 
ATOM   5037 C  CE1 . TYR C 3 47  ? 19.139  25.849 16.684 1.00 26.91  ? 47  TYR C CE1 1 
ATOM   5038 C  CE2 . TYR C 3 47  ? 19.234  27.574 18.353 1.00 45.48  ? 47  TYR C CE2 1 
ATOM   5039 C  CZ  . TYR C 3 47  ? 18.893  26.289 17.975 1.00 39.29  ? 47  TYR C CZ  1 
ATOM   5040 O  OH  . TYR C 3 47  ? 18.312  25.458 18.899 1.00 34.37  ? 47  TYR C OH  1 
ATOM   5041 N  N   . GLY C 3 48  ? 18.274  28.135 13.158 1.00 63.54  ? 48  GLY C N   1 
ATOM   5042 C  CA  . GLY C 3 48  ? 17.795  27.197 12.157 1.00 74.48  ? 48  GLY C CA  1 
ATOM   5043 C  C   . GLY C 3 48  ? 17.253  27.878 10.912 1.00 81.43  ? 48  GLY C C   1 
ATOM   5044 O  O   . GLY C 3 48  ? 17.241  29.106 10.821 1.00 86.62  ? 48  GLY C O   1 
ATOM   5045 N  N   . ARG C 3 49  ? 16.792  27.080 9.953  1.00 88.31  ? 49  ARG C N   1 
ATOM   5046 C  CA  . ARG C 3 49  ? 16.260  27.608 8.698  1.00 87.99  ? 49  ARG C CA  1 
ATOM   5047 C  C   . ARG C 3 49  ? 14.728  27.672 8.697  1.00 93.58  ? 49  ARG C C   1 
ATOM   5048 O  O   . ARG C 3 49  ? 14.106  27.161 9.658  1.00 96.34  ? 49  ARG C O   1 
ATOM   5049 C  CB  . ARG C 3 49  ? 16.741  26.734 7.539  1.00 82.84  ? 49  ARG C CB  1 
ATOM   5050 C  CG  . ARG C 3 49  ? 16.632  27.365 6.161  1.00 82.15  ? 49  ARG C CG  1 
ATOM   5051 C  CD  . ARG C 3 49  ? 17.199  26.417 5.114  1.00 85.40  ? 49  ARG C CD  1 
ATOM   5052 N  NE  . ARG C 3 49  ? 17.652  27.107 3.910  1.00 88.22  ? 49  ARG C NE  1 
ATOM   5053 C  CZ  . ARG C 3 49  ? 18.400  26.540 2.968  1.00 89.80  ? 49  ARG C CZ  1 
ATOM   5054 N  NH1 . ARG C 3 49  ? 18.775  25.273 3.092  1.00 90.01  ? 49  ARG C NH1 1 
ATOM   5055 N  NH2 . ARG C 3 49  ? 18.786  27.239 1.907  1.00 80.80  ? 49  ARG C NH2 1 
HETATM 5056 ZN ZN  . ZN  D 4 .   ? 12.770  29.884 28.139 1.00 53.10  ? 87  ZN  C ZN  1 
HETATM 5057 ZN ZN  . ZN  E 4 .   ? 2.538   32.979 27.954 1.00 71.64  ? 88  ZN  C ZN  1 
HETATM 5058 O  O   . HOH F 5 .   ? 51.572  29.818 51.082 1.00 25.06  ? 352 HOH A O   1 
HETATM 5059 O  O   . HOH F 5 .   ? 57.276  23.258 32.804 1.00 22.03  ? 353 HOH A O   1 
HETATM 5060 O  O   . HOH F 5 .   ? 44.673  32.814 28.900 1.00 28.47  ? 354 HOH A O   1 
HETATM 5061 O  O   . HOH F 5 .   ? 70.150  28.117 32.044 1.00 27.50  ? 355 HOH A O   1 
HETATM 5062 O  O   . HOH F 5 .   ? 53.762  18.513 47.936 1.00 25.78  ? 356 HOH A O   1 
HETATM 5063 O  O   . HOH F 5 .   ? 51.320  25.739 54.752 1.00 24.92  ? 357 HOH A O   1 
HETATM 5064 O  O   . HOH F 5 .   ? 63.485  35.096 52.988 1.00 33.70  ? 358 HOH A O   1 
HETATM 5065 O  O   . HOH F 5 .   ? 52.470  19.537 45.444 1.00 27.93  ? 359 HOH A O   1 
HETATM 5066 O  O   . HOH F 5 .   ? 69.920  30.709 12.863 1.00 28.70  ? 360 HOH A O   1 
HETATM 5067 O  O   . HOH F 5 .   ? 61.684  14.580 41.508 1.00 36.87  ? 361 HOH A O   1 
HETATM 5068 O  O   . HOH F 5 .   ? 54.527  31.655 32.464 1.00 27.42  ? 362 HOH A O   1 
HETATM 5069 O  O   . HOH F 5 .   ? 71.806  30.494 20.417 1.00 33.49  ? 363 HOH A O   1 
HETATM 5070 O  O   . HOH F 5 .   ? 62.439  36.870 43.344 1.00 38.21  ? 364 HOH A O   1 
HETATM 5071 O  O   . HOH F 5 .   ? 64.892  10.257 57.209 1.00 54.88  ? 365 HOH A O   1 
HETATM 5072 O  O   . HOH F 5 .   ? 36.397  12.042 54.471 1.00 38.02  ? 366 HOH A O   1 
HETATM 5073 O  O   . HOH F 5 .   ? 63.847  21.790 14.088 1.00 40.74  ? 367 HOH A O   1 
HETATM 5074 O  O   . HOH F 5 .   ? 51.522  20.940 38.382 1.00 22.13  ? 368 HOH A O   1 
HETATM 5075 O  O   . HOH F 5 .   ? 67.362  36.884 53.684 1.00 27.25  ? 369 HOH A O   1 
HETATM 5076 O  O   . HOH F 5 .   ? 56.571  33.357 35.098 1.00 28.03  ? 370 HOH A O   1 
HETATM 5077 O  O   . HOH F 5 .   ? 68.805  28.370 11.272 1.00 49.13  ? 371 HOH A O   1 
HETATM 5078 O  O   . HOH F 5 .   ? 62.218  25.460 31.183 1.00 34.20  ? 372 HOH A O   1 
HETATM 5079 O  O   . HOH F 5 .   ? 72.066  21.650 28.048 1.00 43.89  ? 373 HOH A O   1 
HETATM 5080 O  O   . HOH F 5 .   ? 45.940  32.752 14.961 1.00 38.13  ? 374 HOH A O   1 
HETATM 5081 O  O   . HOH F 5 .   ? 54.664  15.644 42.866 1.00 36.80  ? 375 HOH A O   1 
HETATM 5082 O  O   . HOH F 5 .   ? 65.144  35.064 42.371 1.00 38.47  ? 376 HOH A O   1 
HETATM 5083 O  O   . HOH F 5 .   ? 39.535  26.473 48.232 1.00 40.59  ? 377 HOH A O   1 
HETATM 5084 O  O   . HOH F 5 .   ? 50.323  18.060 20.370 1.00 33.44  ? 378 HOH A O   1 
HETATM 5085 O  O   . HOH F 5 .   ? 59.586  35.067 17.134 1.00 44.69  ? 379 HOH A O   1 
HETATM 5086 O  O   . HOH F 5 .   ? 63.263  35.428 20.010 1.00 36.67  ? 380 HOH A O   1 
HETATM 5087 O  O   . HOH F 5 .   ? 67.496  13.061 42.972 1.00 40.89  ? 381 HOH A O   1 
HETATM 5088 O  O   . HOH F 5 .   ? 49.722  30.427 19.951 1.00 32.44  ? 382 HOH A O   1 
HETATM 5089 O  O   . HOH F 5 .   ? 54.506  24.215 33.181 1.00 25.59  ? 383 HOH A O   1 
HETATM 5090 O  O   . HOH F 5 .   ? 51.045  31.754 22.088 1.00 34.25  ? 384 HOH A O   1 
HETATM 5091 O  O   . HOH F 5 .   ? 64.278  23.666 30.579 1.00 34.32  ? 385 HOH A O   1 
HETATM 5092 O  O   . HOH F 5 .   ? 57.918  16.765 35.933 1.00 50.73  ? 386 HOH A O   1 
HETATM 5093 O  O   . HOH F 5 .   ? 40.150  11.997 42.414 1.00 50.24  ? 387 HOH A O   1 
HETATM 5094 O  O   . HOH F 5 .   ? 53.216  30.945 18.315 1.00 31.86  ? 388 HOH A O   1 
HETATM 5095 O  O   . HOH F 5 .   ? 60.583  33.689 34.917 1.00 29.70  ? 389 HOH A O   1 
HETATM 5096 O  O   . HOH F 5 .   ? 36.603  22.084 39.569 1.00 50.27  ? 390 HOH A O   1 
HETATM 5097 O  O   . HOH F 5 .   ? 46.491  21.314 35.236 1.00 44.31  ? 391 HOH A O   1 
HETATM 5098 O  O   . HOH F 5 .   ? 65.762  34.865 35.206 1.00 50.41  ? 392 HOH A O   1 
HETATM 5099 O  O   . HOH F 5 .   ? 45.985  21.425 52.525 1.00 37.30  ? 393 HOH A O   1 
HETATM 5100 O  O   . HOH F 5 .   ? 55.237  37.072 58.056 1.00 48.94  ? 394 HOH A O   1 
HETATM 5101 O  O   . HOH F 5 .   ? 74.382  22.434 57.618 1.00 35.48  ? 395 HOH A O   1 
HETATM 5102 O  O   . HOH F 5 .   ? 58.942  38.512 39.589 1.00 35.18  ? 396 HOH A O   1 
HETATM 5103 O  O   . HOH F 5 .   ? 39.729  17.634 36.182 1.00 39.23  ? 397 HOH A O   1 
HETATM 5104 O  O   . HOH F 5 .   ? 49.422  26.117 56.740 1.00 33.42  ? 398 HOH A O   1 
HETATM 5105 O  O   . HOH F 5 .   ? 55.283  12.653 51.526 1.00 40.33  ? 399 HOH A O   1 
HETATM 5106 O  O   . HOH F 5 .   ? 69.070  35.008 41.885 1.00 48.19  ? 400 HOH A O   1 
HETATM 5107 O  O   . HOH F 5 .   ? 79.158  25.379 46.574 1.00 42.50  ? 401 HOH A O   1 
HETATM 5108 O  O   . HOH F 5 .   ? 59.985  12.226 50.053 1.00 41.41  ? 402 HOH A O   1 
HETATM 5109 O  O   . HOH F 5 .   ? 38.491  32.861 46.020 1.00 51.13  ? 403 HOH A O   1 
HETATM 5110 O  O   . HOH F 5 .   ? 52.228  30.048 58.720 1.00 34.97  ? 404 HOH A O   1 
HETATM 5111 O  O   . HOH F 5 .   ? 65.612  31.670 27.211 1.00 36.22  ? 405 HOH A O   1 
HETATM 5112 O  O   . HOH F 5 .   ? 45.926  33.220 48.415 1.00 45.66  ? 406 HOH A O   1 
HETATM 5113 O  O   . HOH F 5 .   ? 61.722  35.386 27.976 1.00 42.45  ? 407 HOH A O   1 
HETATM 5114 O  O   . HOH F 5 .   ? 71.088  35.448 44.051 1.00 45.53  ? 408 HOH A O   1 
HETATM 5115 O  O   . HOH F 5 .   ? 59.945  19.926 35.347 1.00 38.91  ? 409 HOH A O   1 
HETATM 5116 O  O   . HOH F 5 .   ? 63.992  35.186 45.475 1.00 35.41  ? 410 HOH A O   1 
HETATM 5117 O  O   . HOH F 5 .   ? 63.542  13.948 43.846 1.00 52.02  ? 411 HOH A O   1 
HETATM 5118 O  O   . HOH F 5 .   ? 69.179  11.768 44.691 1.00 37.29  ? 412 HOH A O   1 
HETATM 5119 O  O   . HOH F 5 .   ? 55.985  39.042 39.146 1.00 41.14  ? 413 HOH A O   1 
HETATM 5120 O  O   . HOH F 5 .   ? 42.511  18.269 57.867 1.00 43.56  ? 414 HOH A O   1 
HETATM 5121 O  O   . HOH F 5 .   ? 50.703  35.816 29.464 1.00 39.31  ? 415 HOH A O   1 
HETATM 5122 O  O   . HOH F 5 .   ? 63.186  32.067 13.887 1.00 44.34  ? 416 HOH A O   1 
HETATM 5123 O  O   . HOH F 5 .   ? 44.937  19.749 36.661 1.00 37.13  ? 417 HOH A O   1 
HETATM 5124 O  O   . HOH F 5 .   ? 32.530  11.945 25.486 1.00 44.89  ? 418 HOH A O   1 
HETATM 5125 O  O   . HOH F 5 .   ? 50.557  33.525 49.243 1.00 36.44  ? 419 HOH A O   1 
HETATM 5126 O  O   . HOH F 5 .   ? 42.840  16.258 36.880 1.00 53.69  ? 420 HOH A O   1 
HETATM 5127 O  O   . HOH F 5 .   ? 70.180  18.966 36.595 1.00 33.07  ? 421 HOH A O   1 
HETATM 5128 O  O   . HOH F 5 .   ? 77.913  30.763 46.569 1.00 53.27  ? 422 HOH A O   1 
HETATM 5129 O  O   . HOH F 5 .   ? 62.211  39.204 58.774 1.00 46.43  ? 423 HOH A O   1 
HETATM 5130 O  O   . HOH F 5 .   ? 44.066  13.361 26.700 1.00 46.33  ? 424 HOH A O   1 
HETATM 5131 O  O   . HOH F 5 .   ? 61.962  14.546 50.156 1.00 54.97  ? 425 HOH A O   1 
HETATM 5132 O  O   . HOH F 5 .   ? 45.446  36.417 40.390 1.00 42.34  ? 426 HOH A O   1 
HETATM 5133 O  O   . HOH F 5 .   ? 54.456  24.891 61.670 1.00 54.26  ? 427 HOH A O   1 
HETATM 5134 O  O   . HOH F 5 .   ? 51.414  37.746 53.702 1.00 45.41  ? 428 HOH A O   1 
HETATM 5135 O  O   . HOH F 5 .   ? 58.227  16.081 30.788 1.00 44.56  ? 429 HOH A O   1 
HETATM 5136 O  O   . HOH F 5 .   ? 38.786  18.833 56.780 1.00 43.15  ? 430 HOH A O   1 
HETATM 5137 O  O   . HOH F 5 .   ? 42.237  21.010 62.842 1.00 53.15  ? 431 HOH A O   1 
HETATM 5138 O  O   . HOH F 5 .   ? 34.953  16.911 28.314 1.00 44.55  ? 432 HOH A O   1 
HETATM 5139 O  O   . HOH F 5 .   ? 54.136  30.755 11.639 1.00 42.30  ? 433 HOH A O   1 
HETATM 5140 O  O   . HOH F 5 .   ? 34.374  22.051 44.043 1.00 47.86  ? 434 HOH A O   1 
HETATM 5141 O  O   . HOH F 5 .   ? 52.852  20.317 27.050 1.00 47.50  ? 435 HOH A O   1 
HETATM 5142 O  O   . HOH F 5 .   ? 49.029  19.349 31.695 1.00 48.64  ? 436 HOH A O   1 
HETATM 5143 O  O   . HOH F 5 .   ? 61.223  5.324  59.580 1.00 54.57  ? 437 HOH A O   1 
HETATM 5144 O  O   . HOH F 5 .   ? 62.125  32.201 63.255 1.00 45.74  ? 438 HOH A O   1 
HETATM 5145 O  O   . HOH F 5 .   ? 46.596  15.452 14.060 1.00 60.05  ? 439 HOH A O   1 
HETATM 5146 O  O   . HOH F 5 .   ? 48.543  1.632  49.744 1.00 51.38  ? 440 HOH A O   1 
HETATM 5147 O  O   . HOH F 5 .   ? 51.755  32.459 52.438 1.00 42.08  ? 441 HOH A O   1 
HETATM 5148 O  O   . HOH F 5 .   ? 60.578  5.530  72.560 1.00 56.97  ? 442 HOH A O   1 
HETATM 5149 O  O   . HOH F 5 .   ? 52.379  33.753 28.526 1.00 48.24  ? 443 HOH A O   1 
HETATM 5150 O  O   . HOH F 5 .   ? 78.966  33.608 30.879 1.00 44.59  ? 444 HOH A O   1 
HETATM 5151 O  O   . HOH F 5 .   ? 72.358  38.874 59.592 1.00 51.38  ? 445 HOH A O   1 
HETATM 5152 O  O   . HOH F 5 .   ? 76.368  35.147 52.950 1.00 49.86  ? 446 HOH A O   1 
HETATM 5153 O  O   . HOH F 5 .   ? 58.104  35.846 27.018 1.00 36.70  ? 447 HOH A O   1 
HETATM 5154 O  O   . HOH F 5 .   ? 56.567  23.146 12.059 1.00 31.17  ? 448 HOH A O   1 
HETATM 5155 O  O   . HOH F 5 .   ? 50.403  27.571 52.925 1.00 35.66  ? 449 HOH A O   1 
HETATM 5156 O  O   . HOH F 5 .   ? 61.486  29.789 32.231 1.00 33.63  ? 450 HOH A O   1 
HETATM 5157 O  O   . HOH F 5 .   ? 60.326  24.058 31.045 1.00 37.25  ? 451 HOH A O   1 
HETATM 5158 O  O   . HOH F 5 .   ? 48.438  35.662 49.863 1.00 48.31  ? 452 HOH A O   1 
HETATM 5159 O  O   . HOH F 5 .   ? 76.929  19.794 49.446 1.00 41.08  ? 453 HOH A O   1 
HETATM 5160 O  O   . HOH F 5 .   ? 44.359  22.338 54.306 1.00 47.67  ? 454 HOH A O   1 
HETATM 5161 O  O   . HOH F 5 .   ? 43.078  34.755 38.673 1.00 38.78  ? 455 HOH A O   1 
HETATM 5162 O  O   . HOH F 5 .   ? 76.486  35.476 30.588 1.00 34.72  ? 456 HOH A O   1 
HETATM 5163 O  O   . HOH F 5 .   ? 51.435  32.010 25.516 1.00 38.45  ? 457 HOH A O   1 
HETATM 5164 O  O   . HOH F 5 .   ? 65.654  14.932 37.079 1.00 43.65  ? 458 HOH A O   1 
HETATM 5165 O  O   . HOH F 5 .   ? 70.550  27.116 9.770  1.00 37.97  ? 459 HOH A O   1 
HETATM 5166 O  O   . HOH F 5 .   ? 57.004  30.003 12.428 1.00 44.67  ? 460 HOH A O   1 
HETATM 5167 O  O   . HOH F 5 .   ? 47.886  28.818 53.500 1.00 40.40  ? 461 HOH A O   1 
HETATM 5168 O  O   . HOH F 5 .   ? 62.653  31.751 32.923 1.00 44.71  ? 462 HOH A O   1 
HETATM 5169 O  O   . HOH F 5 .   ? 67.210  10.390 55.713 1.00 51.92  ? 463 HOH A O   1 
HETATM 5170 O  O   . HOH F 5 .   ? 66.175  20.964 14.071 1.00 51.63  ? 464 HOH A O   1 
HETATM 5171 O  O   . HOH F 5 .   ? 55.289  15.517 36.410 1.00 45.42  ? 465 HOH A O   1 
HETATM 5172 O  O   . HOH F 5 .   ? 69.443  27.575 14.399 1.00 46.26  ? 466 HOH A O   1 
HETATM 5173 O  O   . HOH F 5 .   ? 39.587  18.569 59.412 1.00 43.64  ? 467 HOH A O   1 
HETATM 5174 O  O   . HOH F 5 .   ? 55.686  17.073 26.961 1.00 48.42  ? 468 HOH A O   1 
HETATM 5175 O  O   . HOH F 5 .   ? 51.047  34.915 56.836 1.00 38.61  ? 469 HOH A O   1 
HETATM 5176 O  O   . HOH F 5 .   ? 42.953  34.704 35.717 1.00 50.08  ? 470 HOH A O   1 
HETATM 5177 O  O   . HOH F 5 .   ? 86.458  12.681 30.887 1.00 42.22  ? 471 HOH A O   1 
HETATM 5178 O  O   . HOH F 5 .   ? 66.705  21.034 31.120 1.00 53.75  ? 472 HOH A O   1 
HETATM 5179 O  O   . HOH F 5 .   ? 51.601  32.453 12.878 1.00 47.17  ? 473 HOH A O   1 
HETATM 5180 O  O   . HOH F 5 .   ? 63.036  31.207 11.244 1.00 41.89  ? 474 HOH A O   1 
HETATM 5181 O  O   . HOH F 5 .   ? 74.114  17.642 37.721 1.00 44.16  ? 475 HOH A O   1 
HETATM 5182 O  O   . HOH F 5 .   ? 68.241  33.503 34.723 1.00 45.59  ? 476 HOH A O   1 
HETATM 5183 O  O   . HOH F 5 .   ? 51.934  18.747 30.744 1.00 55.34  ? 477 HOH A O   1 
HETATM 5184 O  O   . HOH F 5 .   ? 64.151  38.769 60.803 1.00 41.49  ? 478 HOH A O   1 
HETATM 5185 O  O   . HOH F 5 .   ? 68.954  37.939 51.950 1.00 47.63  ? 479 HOH A O   1 
HETATM 5186 O  O   . HOH F 5 .   ? 52.688  14.810 64.835 1.00 54.26  ? 480 HOH A O   1 
HETATM 5187 O  O   . HOH F 5 .   ? 52.632  17.928 36.711 1.00 47.24  ? 481 HOH A O   1 
HETATM 5188 O  O   . HOH F 5 .   ? 68.566  36.939 49.390 1.00 48.82  ? 482 HOH A O   1 
HETATM 5189 O  O   . HOH F 5 .   ? 74.203  19.554 50.829 1.00 49.16  ? 483 HOH A O   1 
HETATM 5190 O  O   . HOH F 5 .   ? 66.086  23.432 65.787 1.00 45.89  ? 484 HOH A O   1 
HETATM 5191 O  O   . HOH F 5 .   ? 62.919  12.109 31.986 1.00 52.20  ? 485 HOH A O   1 
HETATM 5192 O  O   . HOH F 5 .   ? 73.315  35.877 62.521 1.00 48.68  ? 486 HOH A O   1 
HETATM 5193 O  O   . HOH F 5 .   ? 72.620  30.430 13.770 1.00 40.26  ? 487 HOH A O   1 
HETATM 5194 O  O   . HOH F 5 .   ? 43.816  32.771 34.201 1.00 38.31  ? 488 HOH A O   1 
HETATM 5195 O  O   . HOH F 5 .   ? 49.463  16.811 32.559 1.00 40.82  ? 489 HOH A O   1 
HETATM 5196 O  O   . HOH F 5 .   ? 72.943  23.434 23.319 1.00 47.03  ? 490 HOH A O   1 
HETATM 5197 O  O   . HOH F 5 .   ? 57.750  35.406 33.616 1.00 46.06  ? 491 HOH A O   1 
HETATM 5198 O  O   . HOH F 5 .   ? 78.454  30.361 49.426 1.00 46.95  ? 492 HOH A O   1 
HETATM 5199 O  O   . HOH F 5 .   ? 71.129  27.641 29.916 1.00 55.87  ? 493 HOH A O   1 
HETATM 5200 O  O   . HOH F 5 .   ? 58.307  33.245 60.493 1.00 41.01  ? 494 HOH A O   1 
HETATM 5201 O  O   . HOH F 5 .   ? 57.695  1.339  44.475 1.00 46.38  ? 495 HOH A O   1 
HETATM 5202 O  O   . HOH F 5 .   ? 55.613  35.480 28.341 1.00 43.77  ? 496 HOH A O   1 
HETATM 5203 O  O   . HOH F 5 .   ? 58.532  29.144 10.533 1.00 54.79  ? 497 HOH A O   1 
HETATM 5204 O  O   . HOH F 5 .   ? 61.561  7.377  55.273 1.00 51.87  ? 498 HOH A O   1 
HETATM 5205 O  O   . HOH F 5 .   ? 63.939  36.058 60.814 1.00 50.59  ? 499 HOH A O   1 
HETATM 5206 O  O   . HOH F 5 .   ? 52.738  17.309 63.385 1.00 27.27  ? 500 HOH A O   1 
HETATM 5207 O  O   . HOH F 5 .   ? 72.378  27.899 12.970 1.00 32.39  ? 501 HOH A O   1 
HETATM 5208 O  O   . HOH F 5 .   ? 71.257  36.739 47.961 1.00 46.94  ? 502 HOH A O   1 
HETATM 5209 O  O   . HOH F 5 .   ? 50.302  35.810 58.981 1.00 42.87  ? 503 HOH A O   1 
HETATM 5210 O  O   . HOH F 5 .   ? 40.909  14.559 26.350 1.00 43.87  ? 504 HOH A O   1 
HETATM 5211 O  O   . HOH F 5 .   ? 68.924  36.220 35.527 1.00 47.59  ? 505 HOH A O   1 
HETATM 5212 O  O   . HOH F 5 .   ? 61.479  16.776 65.771 1.00 49.58  ? 506 HOH A O   1 
HETATM 5213 O  O   . HOH F 5 .   ? 57.142  21.078 32.352 1.00 41.25  ? 507 HOH A O   1 
HETATM 5214 O  O   . HOH F 5 .   ? 37.867  16.748 59.168 1.00 45.39  ? 508 HOH A O   1 
HETATM 5215 O  O   . HOH F 5 .   ? 71.454  37.320 52.181 1.00 52.37  ? 509 HOH A O   1 
HETATM 5216 O  O   . HOH F 5 .   ? 57.249  9.296  44.265 1.00 43.03  ? 510 HOH A O   1 
HETATM 5217 O  O   . HOH F 5 .   ? 51.377  29.756 11.057 1.00 50.21  ? 511 HOH A O   1 
HETATM 5218 O  O   . HOH F 5 .   ? 57.330  32.732 12.149 1.00 38.55  ? 512 HOH A O   1 
HETATM 5219 O  O   . HOH F 5 .   ? 75.004  22.846 55.035 1.00 49.04  ? 513 HOH A O   1 
HETATM 5220 O  O   . HOH F 5 .   ? 60.948  35.869 25.438 1.00 57.51  ? 514 HOH A O   1 
HETATM 5221 O  O   . HOH F 5 .   ? 61.327  2.956  51.193 1.00 50.26  ? 515 HOH A O   1 
HETATM 5222 O  O   . HOH F 5 .   ? 47.041  40.360 48.764 1.00 48.03  ? 516 HOH A O   1 
HETATM 5223 O  O   . HOH F 5 .   ? 52.130  38.173 29.733 1.00 57.26  ? 517 HOH A O   1 
HETATM 5224 O  O   . HOH F 5 .   ? 50.389  39.180 42.081 1.00 47.93  ? 518 HOH A O   1 
HETATM 5225 O  O   . HOH F 5 .   ? 40.729  11.221 25.304 1.00 42.71  ? 519 HOH A O   1 
HETATM 5226 O  O   . HOH F 5 .   ? 66.591  36.296 40.831 1.00 50.49  ? 520 HOH A O   1 
HETATM 5227 O  O   . HOH F 5 .   ? 55.099  23.660 64.364 1.00 35.89  ? 521 HOH A O   1 
HETATM 5228 O  O   . HOH F 5 .   ? 60.931  20.592 14.847 1.00 41.72  ? 522 HOH A O   1 
HETATM 5229 O  O   . HOH F 5 .   ? 54.002  19.088 64.499 1.00 58.12  ? 523 HOH A O   1 
HETATM 5230 O  O   . HOH F 5 .   ? 60.007  15.817 16.831 1.00 53.22  ? 524 HOH A O   1 
HETATM 5231 O  O   . HOH F 5 .   ? 69.750  31.560 31.973 1.00 45.41  ? 525 HOH A O   1 
HETATM 5232 O  O   . HOH F 5 .   ? 61.607  22.810 15.962 1.00 50.50  ? 526 HOH A O   1 
HETATM 5233 O  O   . HOH F 5 .   ? 36.815  16.088 51.937 1.00 54.22  ? 527 HOH A O   1 
HETATM 5234 O  O   . HOH F 5 .   ? 43.151  16.128 31.891 1.00 64.93  ? 528 HOH A O   1 
HETATM 5235 O  O   . HOH F 5 .   ? 58.567  5.864  67.812 1.00 53.78  ? 529 HOH A O   1 
HETATM 5236 O  O   . HOH F 5 .   ? 49.068  32.385 24.154 1.00 48.94  ? 530 HOH A O   1 
HETATM 5237 O  O   . HOH F 5 .   ? 54.899  13.957 38.437 1.00 57.23  ? 531 HOH A O   1 
HETATM 5238 O  O   . HOH F 5 .   ? 55.329  37.692 29.648 1.00 58.47  ? 532 HOH A O   1 
HETATM 5239 O  O   . HOH F 5 .   ? 50.172  18.414 63.203 1.00 39.67  ? 533 HOH A O   1 
HETATM 5240 O  O   . HOH F 5 .   ? 65.236  19.972 33.367 1.00 52.51  ? 535 HOH A O   1 
HETATM 5241 O  O   . HOH F 5 .   ? 71.992  30.065 59.771 1.00 51.11  ? 536 HOH A O   1 
HETATM 5242 O  O   . HOH F 5 .   ? 65.364  36.048 9.165  1.00 47.18  ? 537 HOH A O   1 
HETATM 5243 O  O   . HOH F 5 .   ? 59.099  11.603 30.727 1.00 63.93  ? 538 HOH A O   1 
HETATM 5244 O  O   . HOH F 5 .   ? 58.794  7.651  42.501 1.00 69.08  ? 539 HOH A O   1 
HETATM 5245 O  O   . HOH F 5 .   ? 44.465  12.679 39.616 1.00 46.34  ? 540 HOH A O   1 
HETATM 5246 O  O   . HOH F 5 .   ? 68.259  7.081  48.309 1.00 45.66  ? 541 HOH A O   1 
HETATM 5247 O  O   . HOH F 5 .   ? 50.275  20.426 28.433 1.00 54.15  ? 542 HOH A O   1 
HETATM 5248 O  O   . HOH F 5 .   ? 82.490  12.655 30.241 1.00 51.65  ? 543 HOH A O   1 
HETATM 5249 O  O   . HOH F 5 .   ? 61.618  6.339  52.747 1.00 53.13  ? 544 HOH A O   1 
HETATM 5250 O  O   . HOH F 5 .   ? 46.189  38.876 46.638 1.00 49.38  ? 545 HOH A O   1 
HETATM 5251 O  O   . HOH F 5 .   ? 38.325  10.162 53.837 1.00 55.84  ? 546 HOH A O   1 
HETATM 5252 O  O   . HOH F 5 .   ? 59.352  23.324 8.264  1.00 54.49  ? 547 HOH A O   1 
HETATM 5253 O  O   . HOH F 5 .   ? 50.125  33.457 59.585 1.00 51.92  ? 548 HOH A O   1 
HETATM 5254 O  O   . HOH F 5 .   ? 43.477  37.234 34.475 1.00 48.81  ? 549 HOH A O   1 
HETATM 5255 O  O   . HOH F 5 .   ? 60.962  36.653 15.441 1.00 49.47  ? 550 HOH A O   1 
HETATM 5256 O  O   . HOH F 5 .   ? 49.485  21.782 14.819 1.00 54.75  ? 551 HOH A O   1 
HETATM 5257 O  O   . HOH F 5 .   ? 57.098  37.689 31.960 1.00 65.87  ? 552 HOH A O   1 
HETATM 5258 O  O   . HOH F 5 .   ? 48.646  34.671 57.538 1.00 59.45  ? 553 HOH A O   1 
HETATM 5259 O  O   . HOH F 5 .   ? 75.367  26.445 61.151 1.00 53.40  ? 554 HOH A O   1 
HETATM 5260 O  O   . HOH F 5 .   ? 71.660  32.608 42.684 1.00 51.02  ? 555 HOH A O   1 
HETATM 5261 O  O   . HOH F 5 .   ? 46.837  27.232 5.282  1.00 63.44  ? 556 HOH A O   1 
HETATM 5262 O  O   . HOH G 5 .   ? 20.758  15.946 26.691 1.00 50.42  ? 267 HOH B O   1 
HETATM 5263 O  O   . HOH G 5 .   ? 36.351  42.433 25.322 1.00 27.99  ? 268 HOH B O   1 
HETATM 5264 O  O   . HOH G 5 .   ? 38.805  50.025 33.818 1.00 52.35  ? 269 HOH B O   1 
HETATM 5265 O  O   . HOH G 5 .   ? 37.845  40.967 22.117 1.00 37.90  ? 270 HOH B O   1 
HETATM 5266 O  O   . HOH G 5 .   ? 39.688  28.235 36.680 1.00 57.03  ? 271 HOH B O   1 
HETATM 5267 O  O   . HOH G 5 .   ? 45.323  35.983 21.452 1.00 30.76  ? 272 HOH B O   1 
HETATM 5268 O  O   . HOH G 5 .   ? 28.400  15.716 30.139 1.00 33.94  ? 273 HOH B O   1 
HETATM 5269 O  O   . HOH G 5 .   ? 32.041  49.428 41.120 1.00 50.18  ? 274 HOH B O   1 
HETATM 5270 O  O   . HOH G 5 .   ? 45.164  33.200 32.020 1.00 34.48  ? 275 HOH B O   1 
HETATM 5271 O  O   . HOH G 5 .   ? 40.690  38.356 32.770 1.00 57.40  ? 276 HOH B O   1 
HETATM 5272 O  O   . HOH G 5 .   ? 41.123  48.662 23.503 1.00 42.91  ? 277 HOH B O   1 
HETATM 5273 O  O   . HOH G 5 .   ? 25.448  31.017 35.460 1.00 34.05  ? 278 HOH B O   1 
HETATM 5274 O  O   . HOH G 5 .   ? 48.555  41.312 17.612 1.00 36.00  ? 279 HOH B O   1 
HETATM 5275 O  O   . HOH G 5 .   ? 38.851  39.480 27.714 1.00 33.39  ? 280 HOH B O   1 
HETATM 5276 O  O   . HOH G 5 .   ? 26.709  39.940 17.993 1.00 35.60  ? 281 HOH B O   1 
HETATM 5277 O  O   . HOH G 5 .   ? 29.234  59.850 41.291 1.00 48.87  ? 282 HOH B O   1 
HETATM 5278 O  O   . HOH G 5 .   ? 38.053  32.500 30.793 1.00 34.85  ? 283 HOH B O   1 
HETATM 5279 O  O   . HOH G 5 .   ? 18.497  52.444 41.144 1.00 46.54  ? 284 HOH B O   1 
HETATM 5280 O  O   . HOH G 5 .   ? 39.941  52.196 35.276 1.00 44.62  ? 285 HOH B O   1 
HETATM 5281 O  O   . HOH G 5 .   ? 27.767  32.298 35.183 1.00 44.32  ? 286 HOH B O   1 
HETATM 5282 O  O   . HOH G 5 .   ? 32.820  60.723 42.734 1.00 53.65  ? 287 HOH B O   1 
HETATM 5283 O  O   . HOH G 5 .   ? 40.832  19.703 20.190 1.00 51.35  ? 288 HOH B O   1 
HETATM 5284 O  O   . HOH G 5 .   ? 33.130  39.777 27.159 1.00 34.38  ? 289 HOH B O   1 
HETATM 5285 O  O   . HOH G 5 .   ? 42.744  30.534 37.222 1.00 52.71  ? 290 HOH B O   1 
HETATM 5286 O  O   . HOH G 5 .   ? 30.019  41.740 21.784 1.00 29.45  ? 291 HOH B O   1 
HETATM 5287 O  O   . HOH G 5 .   ? 15.788  51.993 39.712 1.00 49.42  ? 292 HOH B O   1 
HETATM 5288 O  O   . HOH G 5 .   ? 34.278  43.832 26.464 1.00 34.36  ? 293 HOH B O   1 
HETATM 5289 O  O   . HOH G 5 .   ? 36.355  40.060 26.520 1.00 37.95  ? 294 HOH B O   1 
HETATM 5290 O  O   . HOH G 5 .   ? 45.634  20.393 19.171 1.00 56.64  ? 295 HOH B O   1 
HETATM 5291 O  O   . HOH G 5 .   ? 41.040  34.799 22.730 1.00 29.18  ? 296 HOH B O   1 
HETATM 5292 O  O   . HOH G 5 .   ? 35.810  34.184 32.222 1.00 53.58  ? 297 HOH B O   1 
HETATM 5293 O  O   . HOH G 5 .   ? 21.591  36.081 20.022 1.00 52.53  ? 298 HOH B O   1 
HETATM 5294 O  O   . HOH G 5 .   ? 31.007  16.907 12.030 1.00 57.70  ? 299 HOH B O   1 
HETATM 5295 O  O   . HOH G 5 .   ? 33.351  20.494 28.101 1.00 43.68  ? 300 HOH B O   1 
HETATM 5296 O  O   . HOH G 5 .   ? 39.105  51.554 27.412 1.00 35.65  ? 301 HOH B O   1 
HETATM 5297 O  O   . HOH G 5 .   ? 43.397  42.061 22.974 1.00 35.98  ? 302 HOH B O   1 
HETATM 5298 O  O   . HOH G 5 .   ? 37.312  50.633 25.794 1.00 30.64  ? 303 HOH B O   1 
HETATM 5299 O  O   . HOH G 5 .   ? 30.451  47.623 13.531 1.00 55.03  ? 304 HOH B O   1 
HETATM 5300 O  O   . HOH G 5 .   ? 23.202  34.426 34.744 1.00 48.70  ? 305 HOH B O   1 
HETATM 5301 O  O   . HOH G 5 .   ? 29.602  42.645 24.549 1.00 32.50  ? 306 HOH B O   1 
HETATM 5302 O  O   . HOH G 5 .   ? 16.476  29.061 19.496 1.00 44.18  ? 307 HOH B O   1 
HETATM 5303 O  O   . HOH G 5 .   ? 31.912  37.595 34.740 1.00 33.25  ? 308 HOH B O   1 
HETATM 5304 O  O   . HOH G 5 .   ? 44.484  41.565 15.608 1.00 49.64  ? 309 HOH B O   1 
HETATM 5305 O  O   . HOH G 5 .   ? 35.952  64.847 28.452 1.00 46.71  ? 310 HOH B O   1 
HETATM 5306 O  O   . HOH G 5 .   ? 41.806  25.626 37.362 1.00 34.00  ? 311 HOH B O   1 
HETATM 5307 O  O   . HOH G 5 .   ? 20.661  43.687 14.958 1.00 44.36  ? 312 HOH B O   1 
HETATM 5308 O  O   . HOH G 5 .   ? 50.469  44.947 25.943 1.00 65.27  ? 313 HOH B O   1 
HETATM 5309 O  O   . HOH G 5 .   ? 30.844  47.053 44.769 1.00 57.63  ? 314 HOH B O   1 
HETATM 5310 O  O   . HOH G 5 .   ? 41.005  40.860 11.870 1.00 55.61  ? 315 HOH B O   1 
HETATM 5311 O  O   . HOH G 5 .   ? 27.354  21.163 14.559 1.00 40.15  ? 316 HOH B O   1 
HETATM 5312 O  O   . HOH G 5 .   ? 44.462  41.321 28.427 1.00 57.65  ? 317 HOH B O   1 
HETATM 5313 O  O   . HOH G 5 .   ? 42.993  32.154 39.129 1.00 50.47  ? 318 HOH B O   1 
HETATM 5314 O  O   . HOH G 5 .   ? 39.353  50.501 29.573 1.00 38.12  ? 319 HOH B O   1 
HETATM 5315 O  O   . HOH G 5 .   ? 32.307  48.194 38.532 1.00 38.99  ? 320 HOH B O   1 
HETATM 5316 O  O   . HOH G 5 .   ? 21.226  61.490 25.125 1.00 48.39  ? 321 HOH B O   1 
HETATM 5317 O  O   . HOH G 5 .   ? 18.510  55.557 14.036 1.00 57.65  ? 322 HOH B O   1 
HETATM 5318 O  O   . HOH G 5 .   ? 35.155  38.762 33.905 1.00 37.01  ? 323 HOH B O   1 
HETATM 5319 O  O   . HOH G 5 .   ? 38.807  43.786 31.422 1.00 43.91  ? 324 HOH B O   1 
HETATM 5320 O  O   . HOH G 5 .   ? 43.045  47.584 25.494 1.00 49.66  ? 325 HOH B O   1 
HETATM 5321 O  O   . HOH G 5 .   ? 19.580  41.483 13.773 1.00 50.81  ? 326 HOH B O   1 
HETATM 5322 O  O   . HOH G 5 .   ? 21.415  18.911 34.963 1.00 59.73  ? 327 HOH B O   1 
HETATM 5323 O  O   . HOH G 5 .   ? 35.576  57.874 33.600 1.00 32.02  ? 328 HOH B O   1 
HETATM 5324 O  O   . HOH G 5 .   ? 38.285  31.498 7.178  1.00 44.33  ? 329 HOH B O   1 
HETATM 5325 O  O   . HOH G 5 .   ? 26.207  24.343 36.020 1.00 52.80  ? 330 HOH B O   1 
HETATM 5326 O  O   . HOH G 5 .   ? 17.593  63.014 33.935 1.00 38.72  ? 331 HOH B O   1 
HETATM 5327 O  O   . HOH G 5 .   ? 27.923  9.032  25.992 1.00 51.97  ? 332 HOH B O   1 
HETATM 5328 O  O   . HOH G 5 .   ? 24.134  57.712 33.588 1.00 38.64  ? 333 HOH B O   1 
HETATM 5329 O  O   . HOH G 5 .   ? 22.961  44.488 14.105 1.00 54.09  ? 334 HOH B O   1 
HETATM 5330 O  O   . HOH G 5 .   ? 33.947  37.363 9.494  1.00 35.43  ? 335 HOH B O   1 
HETATM 5331 O  O   . HOH G 5 .   ? 36.908  32.622 34.652 1.00 41.41  ? 336 HOH B O   1 
HETATM 5332 O  O   . HOH G 5 .   ? 28.829  16.193 32.428 1.00 48.93  ? 337 HOH B O   1 
HETATM 5333 O  O   . HOH G 5 .   ? 19.715  37.920 13.629 1.00 42.73  ? 338 HOH B O   1 
HETATM 5334 O  O   . HOH G 5 .   ? 31.645  1.682  16.395 1.00 59.70  ? 339 HOH B O   1 
HETATM 5335 O  O   . HOH G 5 .   ? 22.506  57.555 35.896 1.00 42.60  ? 340 HOH B O   1 
HETATM 5336 O  O   . HOH G 5 .   ? 23.692  63.554 27.447 1.00 53.36  ? 341 HOH B O   1 
HETATM 5337 O  O   . HOH G 5 .   ? 23.948  43.562 38.765 1.00 34.65  ? 342 HOH B O   1 
HETATM 5338 O  O   . HOH G 5 .   ? 34.203  63.525 25.481 1.00 63.27  ? 343 HOH B O   1 
HETATM 5339 O  O   . HOH G 5 .   ? 25.744  31.666 12.496 1.00 31.66  ? 344 HOH B O   1 
HETATM 5340 O  O   . HOH G 5 .   ? 27.830  35.512 35.275 1.00 37.56  ? 345 HOH B O   1 
HETATM 5341 O  O   . HOH G 5 .   ? 31.590  20.817 15.716 1.00 40.04  ? 346 HOH B O   1 
HETATM 5342 O  O   . HOH G 5 .   ? 27.149  60.054 38.851 1.00 55.16  ? 347 HOH B O   1 
HETATM 5343 O  O   . HOH G 5 .   ? 29.812  45.286 14.182 1.00 54.45  ? 348 HOH B O   1 
HETATM 5344 O  O   . HOH G 5 .   ? 26.703  63.277 25.581 1.00 45.00  ? 349 HOH B O   1 
HETATM 5345 O  O   . HOH G 5 .   ? 31.740  42.305 26.368 1.00 32.46  ? 350 HOH B O   1 
HETATM 5346 O  O   . HOH G 5 .   ? 40.135  30.902 38.006 1.00 41.21  ? 351 HOH B O   1 
HETATM 5347 O  O   . HOH G 5 .   ? 23.391  42.350 41.069 1.00 43.37  ? 352 HOH B O   1 
HETATM 5348 O  O   . HOH G 5 .   ? 29.932  35.933 33.225 1.00 41.71  ? 353 HOH B O   1 
HETATM 5349 O  O   . HOH G 5 .   ? 35.590  19.755 11.429 1.00 40.95  ? 354 HOH B O   1 
HETATM 5350 O  O   . HOH G 5 .   ? 25.763  56.084 18.423 1.00 59.17  ? 355 HOH B O   1 
HETATM 5351 O  O   . HOH G 5 .   ? 47.112  41.718 15.432 1.00 44.26  ? 356 HOH B O   1 
HETATM 5352 O  O   . HOH G 5 .   ? 46.269  40.923 26.672 1.00 54.93  ? 357 HOH B O   1 
HETATM 5353 O  O   . HOH G 5 .   ? 17.335  60.388 40.198 1.00 41.96  ? 358 HOH B O   1 
HETATM 5354 O  O   . HOH G 5 .   ? 22.405  59.989 32.646 1.00 46.75  ? 359 HOH B O   1 
HETATM 5355 O  O   . HOH G 5 .   ? 38.683  36.564 33.395 1.00 39.85  ? 360 HOH B O   1 
HETATM 5356 O  O   . HOH G 5 .   ? 19.530  58.378 33.476 1.00 45.75  ? 361 HOH B O   1 
HETATM 5357 O  O   . HOH G 5 .   ? 22.846  31.802 35.196 1.00 44.26  ? 362 HOH B O   1 
HETATM 5358 O  O   . HOH G 5 .   ? 31.720  19.745 34.730 1.00 57.28  ? 363 HOH B O   1 
HETATM 5359 O  O   . HOH G 5 .   ? 40.598  43.769 27.692 1.00 49.06  ? 364 HOH B O   1 
HETATM 5360 O  O   . HOH G 5 .   ? 24.850  47.154 47.947 1.00 44.96  ? 365 HOH B O   1 
HETATM 5361 O  O   . HOH G 5 .   ? 28.203  46.341 17.727 1.00 49.97  ? 366 HOH B O   1 
HETATM 5362 O  O   . HOH G 5 .   ? 42.000  50.952 21.053 1.00 50.99  ? 367 HOH B O   1 
HETATM 5363 O  O   . HOH G 5 .   ? 48.746  33.793 21.319 1.00 50.72  ? 368 HOH B O   1 
HETATM 5364 O  O   . HOH G 5 .   ? 22.414  62.308 22.911 1.00 49.88  ? 369 HOH B O   1 
HETATM 5365 O  O   . HOH G 5 .   ? 23.976  19.664 35.800 1.00 53.80  ? 370 HOH B O   1 
HETATM 5366 O  O   . HOH G 5 .   ? 32.645  62.739 30.820 1.00 34.56  ? 371 HOH B O   1 
HETATM 5367 O  O   . HOH G 5 .   ? 27.034  45.388 15.741 1.00 47.77  ? 372 HOH B O   1 
HETATM 5368 O  O   . HOH G 5 .   ? 38.211  29.391 34.390 1.00 45.16  ? 373 HOH B O   1 
HETATM 5369 O  O   . HOH G 5 .   ? 36.161  67.270 47.174 1.00 70.61  ? 374 HOH B O   1 
HETATM 5370 O  O   . HOH G 5 .   ? 23.981  44.587 42.380 1.00 48.24  ? 375 HOH B O   1 
HETATM 5371 O  O   . HOH G 5 .   ? 25.789  39.611 43.204 1.00 50.94  ? 376 HOH B O   1 
HETATM 5372 O  O   . HOH G 5 .   ? 45.996  35.375 32.231 1.00 40.11  ? 377 HOH B O   1 
HETATM 5373 O  O   . HOH G 5 .   ? 35.205  47.761 36.963 1.00 51.52  ? 378 HOH B O   1 
HETATM 5374 O  O   . HOH G 5 .   ? 41.190  47.328 7.768  1.00 52.01  ? 379 HOH B O   1 
HETATM 5375 O  O   . HOH G 5 .   ? 25.208  43.170 15.730 1.00 51.17  ? 380 HOH B O   1 
HETATM 5376 O  O   . HOH G 5 .   ? 33.828  61.476 33.145 1.00 55.05  ? 381 HOH B O   1 
HETATM 5377 O  O   . HOH G 5 .   ? 51.860  40.358 21.216 1.00 62.76  ? 382 HOH B O   1 
HETATM 5378 O  O   . HOH G 5 .   ? 29.713  48.397 16.044 1.00 44.92  ? 383 HOH B O   1 
HETATM 5379 O  O   . HOH H 5 .   ? 34.050  30.537 45.103 1.00 25.44  ? 89  HOH C O   1 
HETATM 5380 O  O   . HOH H 5 .   ? 31.748  28.436 35.169 1.00 31.34  ? 90  HOH C O   1 
HETATM 5381 O  O   . HOH H 5 .   ? 17.901  35.052 13.474 1.00 53.21  ? 91  HOH C O   1 
HETATM 5382 O  O   . HOH H 5 .   ? 19.822  34.062 33.927 1.00 40.99  ? 92  HOH C O   1 
HETATM 5383 O  O   . HOH H 5 .   ? 20.249  37.102 41.305 1.00 54.90  ? 93  HOH C O   1 
HETATM 5384 O  O   . HOH H 5 .   ? 38.612  33.318 39.030 1.00 44.34  ? 94  HOH C O   1 
HETATM 5385 O  O   . HOH H 5 .   ? 40.856  31.093 41.493 1.00 41.04  ? 95  HOH C O   1 
HETATM 5386 O  O   . HOH H 5 .   ? 14.333  24.281 31.602 1.00 48.71  ? 106 HOH C O   1 
HETATM 5387 O  O   . HOH H 5 .   ? 15.894  33.798 33.605 1.00 44.96  ? 115 HOH C O   1 
HETATM 5388 O  O   . HOH H 5 .   ? 22.679  24.703 39.316 1.00 58.09  ? 117 HOH C O   1 
HETATM 5389 O  O   . HOH H 5 .   ? 29.179  41.036 44.240 1.00 57.39  ? 134 HOH C O   1 
HETATM 5390 O  O   . HOH H 5 .   ? 25.153  34.152 42.228 1.00 46.28  ? 141 HOH C O   1 
HETATM 5391 O  O   . HOH H 5 .   ? 7.695   29.599 33.789 1.00 60.65  ? 207 HOH C O   1 
HETATM 5392 O  O   . HOH H 5 .   ? 34.128  34.925 46.395 1.00 55.64  ? 227 HOH C O   1 
HETATM 5393 O  O   . HOH H 5 .   ? 18.251  33.826 31.401 1.00 43.88  ? 241 HOH C O   1 
HETATM 5394 O  O   . HOH H 5 .   ? 12.386  35.717 12.383 1.00 54.67  ? 266 HOH C O   1 
HETATM 5395 O  O   . HOH H 5 .   ? 18.428  30.947 35.120 1.00 56.74  ? 297 HOH C O   1 
HETATM 5396 O  O   . HOH H 5 .   ? 23.956  38.323 41.868 1.00 54.74  ? 306 HOH C O   1 
HETATM 5397 O  O   . HOH H 5 .   ? 15.338  21.466 31.452 1.00 58.90  ? 312 HOH C O   1 
HETATM 5398 O  O   . HOH H 5 .   ? 1.155   32.198 21.081 1.00 51.91  ? 534 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   LYS 3   3   ?   ?   ?   A . n 
A 1 4   GLN 4   4   ?   ?   ?   A . n 
A 1 5   TYR 5   5   ?   ?   ?   A . n 
A 1 6   ASP 6   6   ?   ?   ?   A . n 
A 1 7   SER 7   7   ?   ?   ?   A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  CYS 10  10  10  CYS CYS A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  PHE 12  12  12  PHE PHE A . n 
A 1 13  CYS 13  13  13  CYS CYS A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLN 27  27  27  GLN GLN A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  HIS 38  38  38  HIS HIS A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  MET 52  52  52  MET MET A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  HIS 75  75  75  HIS HIS A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  CYS 85  85  85  CYS CYS A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ALA 89  89  ?   ?   ?   A . n 
A 1 90  SER 90  90  ?   ?   ?   A . n 
A 1 91  PRO 91  91  ?   ?   ?   A . n 
A 1 92  TYR 92  92  ?   ?   ?   A . n 
A 1 93  ASN 93  93  ?   ?   ?   A . n 
A 1 94  ARG 94  94  ?   ?   ?   A . n 
A 1 95  CYS 95  95  ?   ?   ?   A . n 
A 1 96  LYS 96  96  ?   ?   ?   A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 ASP 104 104 104 ASP ASP A . n 
A 1 105 PHE 105 105 105 PHE PHE A . n 
A 1 106 CYS 106 106 106 CYS CYS A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 MET 130 130 130 MET MET A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 MET 132 132 132 MET MET A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 ASN 135 135 135 ASN ASN A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 TYR 138 138 138 TYR TYR A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 HIS 141 141 141 HIS HIS A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 ASN 143 143 143 ASN ASN A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 HIS 147 147 147 HIS HIS A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 MET 150 150 150 MET MET A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 PHE 168 168 168 PHE PHE A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 ALA 173 173 173 ALA ALA A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 SER 175 175 175 SER SER A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 LYS 178 178 178 LYS LYS A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ARG 184 184 184 ARG ARG A . n 
A 1 185 TYR 185 185 185 TYR TYR A . n 
A 1 186 TPO 186 186 186 TPO TPO A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 THR 191 191 191 THR THR A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 TRP 193 193 193 TRP TRP A . n 
A 1 194 TYR 194 194 194 TYR TYR A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
A 1 196 PRO 196 196 196 PRO PRO A . n 
A 1 197 PRO 197 197 197 PRO PRO A . n 
A 1 198 GLU 198 198 198 GLU GLU A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 ASP 205 205 205 ASP ASP A . n 
A 1 206 TYR 206 206 206 TYR TYR A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 PRO 208 208 208 PRO PRO A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 ASP 211 211 211 ASP ASP A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 TRP 213 213 213 TRP TRP A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 CYS 217 217 217 CYS CYS A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 MET 219 219 219 MET MET A . n 
A 1 220 ALA 220 220 220 ALA ALA A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 MET 222 222 222 MET MET A . n 
A 1 223 TRP 223 223 223 TRP TRP A . n 
A 1 224 THR 224 224 224 THR THR A . n 
A 1 225 ARG 225 225 225 ARG ARG A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 PRO 227 227 227 PRO PRO A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 MET 229 229 229 MET MET A . n 
A 1 230 GLN 230 230 230 GLN GLN A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 ASN 232 232 232 ASN ASN A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 GLN 235 235 235 GLN GLN A . n 
A 1 236 HIS 236 236 236 HIS HIS A . n 
A 1 237 GLN 237 237 237 GLN GLN A . n 
A 1 238 LEU 238 238 238 LEU LEU A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 SER 242 242 242 SER SER A . n 
A 1 243 GLN 243 243 243 GLN GLN A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 CYS 245 245 245 CYS CYS A . n 
A 1 246 GLY 246 246 246 GLY GLY A . n 
A 1 247 SER 247 247 247 SER SER A . n 
A 1 248 ILE 248 248 248 ILE ILE A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 GLU 251 251 251 GLU GLU A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 TRP 253 253 253 TRP TRP A . n 
A 1 254 PRO 254 254 254 PRO PRO A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 VAL 256 256 256 VAL VAL A . n 
A 1 257 ASP 257 257 257 ASP ASP A . n 
A 1 258 ASN 258 258 258 ASN ASN A . n 
A 1 259 TYR 259 259 259 TYR TYR A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 TYR 262 262 262 TYR TYR A . n 
A 1 263 GLU 263 263 263 GLU GLU A . n 
A 1 264 LYS 264 264 264 LYS LYS A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 GLU 266 266 266 GLU GLU A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 GLY 270 270 270 GLY GLY A . n 
A 1 271 GLN 271 271 271 GLN GLN A . n 
A 1 272 LYS 272 272 272 LYS LYS A . n 
A 1 273 ARG 273 273 273 ARG ARG A . n 
A 1 274 LYS 274 274 274 LYS LYS A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 LYS 276 276 276 LYS LYS A . n 
A 1 277 ASP 277 277 277 ASP ASP A . n 
A 1 278 ARG 278 278 278 ARG ARG A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 LYS 280 280 280 LYS LYS A . n 
A 1 281 ALA 281 281 281 ALA ALA A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 VAL 283 283 283 VAL VAL A . n 
A 1 284 ARG 284 284 284 ARG ARG A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 TYR 287 287 287 TYR TYR A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 ASP 290 290 290 ASP ASP A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 ILE 292 292 292 ILE ILE A . n 
A 1 293 ASP 293 293 293 ASP ASP A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 VAL 297 297 297 VAL VAL A . n 
A 1 298 LEU 298 298 298 LEU LEU A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 PRO 300 300 300 PRO PRO A . n 
A 1 301 ALA 301 301 301 ALA ALA A . n 
A 1 302 GLN 302 302 302 GLN GLN A . n 
A 1 303 ARG 303 303 303 ARG ARG A . n 
A 1 304 ILE 304 304 304 ILE ILE A . n 
A 1 305 ASP 305 305 305 ASP ASP A . n 
A 1 306 SER 306 306 306 SER SER A . n 
A 1 307 ASP 307 307 307 ASP ASP A . n 
A 1 308 ASP 308 308 308 ASP ASP A . n 
A 1 309 ALA 309 309 309 ALA ALA A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 ASN 311 311 311 ASN ASN A . n 
A 1 312 HIS 312 312 312 HIS HIS A . n 
A 1 313 ASP 313 313 313 ASP ASP A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 PHE 315 315 315 PHE PHE A . n 
A 1 316 TRP 316 316 316 TRP TRP A . n 
A 1 317 SER 317 317 317 SER SER A . n 
A 1 318 ASP 318 318 318 ASP ASP A . n 
A 1 319 PRO 319 319 319 PRO PRO A . n 
A 1 320 MET 320 320 320 MET MET A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 MET 327 327 327 MET MET A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 THR 330 330 330 THR THR A . n 
A 1 331 HIS 331 331 331 HIS HIS A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 THR 333 333 333 THR THR A . n 
A 1 334 SER 334 334 334 SER SER A . n 
A 1 335 MET 335 335 335 MET MET A . n 
A 1 336 PHE 336 336 336 PHE PHE A . n 
A 1 337 GLU 337 337 337 GLU GLU A . n 
A 1 338 TYR 338 338 338 TYR TYR A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 ALA 340 340 340 ALA ALA A . n 
A 1 341 PRO 341 341 341 PRO PRO A . n 
A 1 342 PRO 342 342 342 PRO PRO A . n 
A 1 343 ARG 343 343 343 ARG ARG A . n 
A 1 344 ARG 344 344 344 ARG ARG A . n 
A 1 345 LYS 345 345 ?   ?   ?   A . n 
A 1 346 HIS 346 346 ?   ?   ?   A . n 
A 1 347 HIS 347 347 ?   ?   ?   A . n 
A 1 348 HIS 348 348 ?   ?   ?   A . n 
A 1 349 HIS 349 349 ?   ?   ?   A . n 
A 1 350 HIS 350 350 ?   ?   ?   A . n 
A 1 351 HIS 351 351 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   GLU 2   2   ?   ?   ?   B . n 
B 2 3   GLY 3   3   ?   ?   ?   B . n 
B 2 4   GLU 4   4   ?   ?   ?   B . n 
B 2 5   ARG 5   5   ?   ?   ?   B . n 
B 2 6   LYS 6   6   ?   ?   ?   B . n 
B 2 7   ASN 7   7   7   ASN ASN B . n 
B 2 8   ASN 8   8   8   ASN ASN B . n 
B 2 9   ASN 9   9   9   ASN ASN B . n 
B 2 10  LYS 10  10  10  LYS LYS B . n 
B 2 11  ARG 11  11  11  ARG ARG B . n 
B 2 12  TRP 12  12  12  TRP TRP B . n 
B 2 13  TYR 13  13  13  TYR TYR B . n 
B 2 14  PHE 14  14  14  PHE PHE B . n 
B 2 15  THR 15  15  15  THR THR B . n 
B 2 16  ARG 16  16  16  ARG ARG B . n 
B 2 17  GLU 17  17  17  GLU GLU B . n 
B 2 18  GLN 18  18  18  GLN GLN B . n 
B 2 19  LEU 19  19  19  LEU LEU B . n 
B 2 20  GLU 20  20  20  GLU GLU B . n 
B 2 21  ASN 21  21  21  ASN ASN B . n 
B 2 22  SER 22  22  22  SER SER B . n 
B 2 23  PRO 23  23  23  PRO PRO B . n 
B 2 24  SER 24  24  24  SER SER B . n 
B 2 25  ARG 25  25  25  ARG ARG B . n 
B 2 26  ARG 26  26  26  ARG ARG B . n 
B 2 27  PHE 27  27  27  PHE PHE B . n 
B 2 28  GLY 28  28  28  GLY GLY B . n 
B 2 29  VAL 29  29  29  VAL VAL B . n 
B 2 30  ASP 30  30  30  ASP ASP B . n 
B 2 31  PRO 31  31  31  PRO PRO B . n 
B 2 32  ASP 32  32  32  ASP ASP B . n 
B 2 33  LYS 33  33  33  LYS LYS B . n 
B 2 34  GLU 34  34  34  GLU GLU B . n 
B 2 35  LEU 35  35  35  LEU LEU B . n 
B 2 36  SER 36  36  36  SER SER B . n 
B 2 37  TYR 37  37  37  TYR TYR B . n 
B 2 38  ARG 38  38  38  ARG ARG B . n 
B 2 39  GLN 39  39  39  GLN GLN B . n 
B 2 40  GLN 40  40  40  GLN GLN B . n 
B 2 41  ALA 41  41  41  ALA ALA B . n 
B 2 42  ALA 42  42  42  ALA ALA B . n 
B 2 43  ASN 43  43  43  ASN ASN B . n 
B 2 44  LEU 44  44  44  LEU LEU B . n 
B 2 45  LEU 45  45  45  LEU LEU B . n 
B 2 46  GLN 46  46  46  GLN GLN B . n 
B 2 47  ASP 47  47  47  ASP ASP B . n 
B 2 48  MET 48  48  48  MET MET B . n 
B 2 49  GLY 49  49  49  GLY GLY B . n 
B 2 50  GLN 50  50  50  GLN GLN B . n 
B 2 51  ARG 51  51  51  ARG ARG B . n 
B 2 52  LEU 52  52  52  LEU LEU B . n 
B 2 53  ASN 53  53  53  ASN ASN B . n 
B 2 54  VAL 54  54  54  VAL VAL B . n 
B 2 55  SER 55  55  55  SER SER B . n 
B 2 56  GLN 56  56  56  GLN GLN B . n 
B 2 57  LEU 57  57  57  LEU LEU B . n 
B 2 58  THR 58  58  58  THR THR B . n 
B 2 59  ILE 59  59  59  ILE ILE B . n 
B 2 60  ASN 60  60  60  ASN ASN B . n 
B 2 61  THR 61  61  61  THR THR B . n 
B 2 62  ALA 62  62  62  ALA ALA B . n 
B 2 63  ILE 63  63  63  ILE ILE B . n 
B 2 64  VAL 64  64  64  VAL VAL B . n 
B 2 65  TYR 65  65  65  TYR TYR B . n 
B 2 66  MET 66  66  66  MET MET B . n 
B 2 67  HIS 67  67  67  HIS HIS B . n 
B 2 68  ARG 68  68  68  ARG ARG B . n 
B 2 69  PHE 69  69  69  PHE PHE B . n 
B 2 70  TYR 70  70  70  TYR TYR B . n 
B 2 71  MET 71  71  71  MET MET B . n 
B 2 72  ILE 72  72  72  ILE ILE B . n 
B 2 73  GLN 73  73  73  GLN GLN B . n 
B 2 74  SER 74  74  74  SER SER B . n 
B 2 75  PHE 75  75  75  PHE PHE B . n 
B 2 76  THR 76  76  76  THR THR B . n 
B 2 77  GLN 77  77  77  GLN GLN B . n 
B 2 78  PHE 78  78  78  PHE PHE B . n 
B 2 79  PRO 79  79  79  PRO PRO B . n 
B 2 80  GLY 80  80  80  GLY GLY B . n 
B 2 81  ASN 81  81  81  ASN ASN B . n 
B 2 82  SER 82  82  82  SER SER B . n 
B 2 83  VAL 83  83  83  VAL VAL B . n 
B 2 84  ALA 84  84  84  ALA ALA B . n 
B 2 85  PRO 85  85  85  PRO PRO B . n 
B 2 86  ALA 86  86  86  ALA ALA B . n 
B 2 87  ALA 87  87  87  ALA ALA B . n 
B 2 88  LEU 88  88  88  LEU LEU B . n 
B 2 89  PHE 89  89  89  PHE PHE B . n 
B 2 90  LEU 90  90  90  LEU LEU B . n 
B 2 91  ALA 91  91  91  ALA ALA B . n 
B 2 92  ALA 92  92  92  ALA ALA B . n 
B 2 93  LYS 93  93  93  LYS LYS B . n 
B 2 94  VAL 94  94  94  VAL VAL B . n 
B 2 95  GLU 95  95  95  GLU GLU B . n 
B 2 96  GLU 96  96  96  GLU GLU B . n 
B 2 97  GLN 97  97  97  GLN GLN B . n 
B 2 98  PRO 98  98  98  PRO PRO B . n 
B 2 99  LYS 99  99  99  LYS LYS B . n 
B 2 100 LYS 100 100 100 LYS LYS B . n 
B 2 101 LEU 101 101 101 LEU LEU B . n 
B 2 102 GLU 102 102 102 GLU GLU B . n 
B 2 103 HIS 103 103 103 HIS HIS B . n 
B 2 104 VAL 104 104 104 VAL VAL B . n 
B 2 105 ILE 105 105 105 ILE ILE B . n 
B 2 106 LYS 106 106 106 LYS LYS B . n 
B 2 107 VAL 107 107 107 VAL VAL B . n 
B 2 108 ALA 108 108 108 ALA ALA B . n 
B 2 109 HIS 109 109 109 HIS HIS B . n 
B 2 110 THR 110 110 110 THR THR B . n 
B 2 111 CYS 111 111 111 CYS CYS B . n 
B 2 112 LEU 112 112 112 LEU LEU B . n 
B 2 113 HIS 113 113 113 HIS HIS B . n 
B 2 114 PRO 114 114 114 PRO PRO B . n 
B 2 115 GLN 115 115 115 GLN GLN B . n 
B 2 116 GLU 116 116 116 GLU GLU B . n 
B 2 117 SER 117 117 117 SER SER B . n 
B 2 118 LEU 118 118 118 LEU LEU B . n 
B 2 119 PRO 119 119 119 PRO PRO B . n 
B 2 120 ASP 120 120 120 ASP ASP B . n 
B 2 121 THR 121 121 121 THR THR B . n 
B 2 122 ARG 122 122 122 ARG ARG B . n 
B 2 123 SER 123 123 123 SER SER B . n 
B 2 124 GLU 124 124 124 GLU GLU B . n 
B 2 125 ALA 125 125 125 ALA ALA B . n 
B 2 126 TYR 126 126 126 TYR TYR B . n 
B 2 127 LEU 127 127 127 LEU LEU B . n 
B 2 128 GLN 128 128 128 GLN GLN B . n 
B 2 129 GLN 129 129 129 GLN GLN B . n 
B 2 130 VAL 130 130 130 VAL VAL B . n 
B 2 131 GLN 131 131 131 GLN GLN B . n 
B 2 132 ASP 132 132 132 ASP ASP B . n 
B 2 133 LEU 133 133 133 LEU LEU B . n 
B 2 134 VAL 134 134 134 VAL VAL B . n 
B 2 135 ILE 135 135 135 ILE ILE B . n 
B 2 136 LEU 136 136 136 LEU LEU B . n 
B 2 137 GLU 137 137 137 GLU GLU B . n 
B 2 138 SER 138 138 138 SER SER B . n 
B 2 139 ILE 139 139 139 ILE ILE B . n 
B 2 140 ILE 140 140 140 ILE ILE B . n 
B 2 141 LEU 141 141 141 LEU LEU B . n 
B 2 142 GLN 142 142 142 GLN GLN B . n 
B 2 143 THR 143 143 143 THR THR B . n 
B 2 144 LEU 144 144 144 LEU LEU B . n 
B 2 145 GLY 145 145 145 GLY GLY B . n 
B 2 146 PHE 146 146 146 PHE PHE B . n 
B 2 147 GLU 147 147 147 GLU GLU B . n 
B 2 148 LEU 148 148 148 LEU LEU B . n 
B 2 149 THR 149 149 149 THR THR B . n 
B 2 150 ILE 150 150 150 ILE ILE B . n 
B 2 151 ASP 151 151 151 ASP ASP B . n 
B 2 152 HIS 152 152 152 HIS HIS B . n 
B 2 153 PRO 153 153 153 PRO PRO B . n 
B 2 154 HIS 154 154 154 HIS HIS B . n 
B 2 155 THR 155 155 155 THR THR B . n 
B 2 156 HIS 156 156 156 HIS HIS B . n 
B 2 157 VAL 157 157 157 VAL VAL B . n 
B 2 158 VAL 158 158 158 VAL VAL B . n 
B 2 159 LYS 159 159 159 LYS LYS B . n 
B 2 160 CYS 160 160 160 CYS CYS B . n 
B 2 161 THR 161 161 161 THR THR B . n 
B 2 162 GLN 162 162 162 GLN GLN B . n 
B 2 163 LEU 163 163 163 LEU LEU B . n 
B 2 164 VAL 164 164 164 VAL VAL B . n 
B 2 165 ARG 165 165 165 ARG ARG B . n 
B 2 166 ALA 166 166 166 ALA ALA B . n 
B 2 167 SER 167 167 167 SER SER B . n 
B 2 168 LYS 168 168 168 LYS LYS B . n 
B 2 169 ASP 169 169 169 ASP ASP B . n 
B 2 170 LEU 170 170 170 LEU LEU B . n 
B 2 171 ALA 171 171 171 ALA ALA B . n 
B 2 172 GLN 172 172 172 GLN GLN B . n 
B 2 173 THR 173 173 173 THR THR B . n 
B 2 174 SER 174 174 174 SER SER B . n 
B 2 175 TYR 175 175 175 TYR TYR B . n 
B 2 176 PHE 176 176 176 PHE PHE B . n 
B 2 177 MET 177 177 177 MET MET B . n 
B 2 178 ALA 178 178 178 ALA ALA B . n 
B 2 179 THR 179 179 179 THR THR B . n 
B 2 180 ASN 180 180 180 ASN ASN B . n 
B 2 181 SER 181 181 181 SER SER B . n 
B 2 182 LEU 182 182 182 LEU LEU B . n 
B 2 183 HIS 183 183 183 HIS HIS B . n 
B 2 184 LEU 184 184 184 LEU LEU B . n 
B 2 185 THR 185 185 185 THR THR B . n 
B 2 186 THR 186 186 186 THR THR B . n 
B 2 187 PHE 187 187 187 PHE PHE B . n 
B 2 188 SER 188 188 188 SER SER B . n 
B 2 189 LEU 189 189 189 LEU LEU B . n 
B 2 190 GLN 190 190 190 GLN GLN B . n 
B 2 191 TYR 191 191 191 TYR TYR B . n 
B 2 192 THR 192 192 192 THR THR B . n 
B 2 193 PRO 193 193 193 PRO PRO B . n 
B 2 194 PRO 194 194 194 PRO PRO B . n 
B 2 195 VAL 195 195 195 VAL VAL B . n 
B 2 196 VAL 196 196 196 VAL VAL B . n 
B 2 197 ALA 197 197 197 ALA ALA B . n 
B 2 198 CYS 198 198 198 CYS CYS B . n 
B 2 199 VAL 199 199 199 VAL VAL B . n 
B 2 200 CYS 200 200 200 CYS CYS B . n 
B 2 201 ILE 201 201 201 ILE ILE B . n 
B 2 202 HIS 202 202 202 HIS HIS B . n 
B 2 203 LEU 203 203 203 LEU LEU B . n 
B 2 204 ALA 204 204 204 ALA ALA B . n 
B 2 205 CYS 205 205 205 CYS CYS B . n 
B 2 206 LYS 206 206 206 LYS LYS B . n 
B 2 207 TRP 207 207 207 TRP TRP B . n 
B 2 208 SER 208 208 208 SER SER B . n 
B 2 209 ASN 209 209 209 ASN ASN B . n 
B 2 210 TRP 210 210 210 TRP TRP B . n 
B 2 211 GLU 211 211 211 GLU GLU B . n 
B 2 212 ILE 212 212 212 ILE ILE B . n 
B 2 213 PRO 213 213 213 PRO PRO B . n 
B 2 214 VAL 214 214 214 VAL VAL B . n 
B 2 215 SER 215 215 215 SER SER B . n 
B 2 216 THR 216 216 216 THR THR B . n 
B 2 217 ASP 217 217 217 ASP ASP B . n 
B 2 218 GLY 218 218 218 GLY GLY B . n 
B 2 219 LYS 219 219 219 LYS LYS B . n 
B 2 220 HIS 220 220 220 HIS HIS B . n 
B 2 221 TRP 221 221 221 TRP TRP B . n 
B 2 222 TRP 222 222 222 TRP TRP B . n 
B 2 223 GLU 223 223 223 GLU GLU B . n 
B 2 224 TYR 224 224 224 TYR TYR B . n 
B 2 225 VAL 225 225 225 VAL VAL B . n 
B 2 226 ASP 226 226 226 ASP ASP B . n 
B 2 227 ALA 227 227 227 ALA ALA B . n 
B 2 228 THR 228 228 228 THR THR B . n 
B 2 229 VAL 229 229 229 VAL VAL B . n 
B 2 230 THR 230 230 230 THR THR B . n 
B 2 231 LEU 231 231 231 LEU LEU B . n 
B 2 232 GLU 232 232 232 GLU GLU B . n 
B 2 233 LEU 233 233 233 LEU LEU B . n 
B 2 234 LEU 234 234 234 LEU LEU B . n 
B 2 235 ASP 235 235 235 ASP ASP B . n 
B 2 236 GLU 236 236 236 GLU GLU B . n 
B 2 237 LEU 237 237 237 LEU LEU B . n 
B 2 238 THR 238 238 238 THR THR B . n 
B 2 239 HIS 239 239 239 HIS HIS B . n 
B 2 240 GLU 240 240 240 GLU GLU B . n 
B 2 241 PHE 241 241 241 PHE PHE B . n 
B 2 242 LEU 242 242 242 LEU LEU B . n 
B 2 243 GLN 243 243 243 GLN GLN B . n 
B 2 244 ILE 244 244 244 ILE ILE B . n 
B 2 245 LEU 245 245 245 LEU LEU B . n 
B 2 246 GLU 246 246 246 GLU GLU B . n 
B 2 247 LYS 247 247 247 LYS LYS B . n 
B 2 248 THR 248 248 248 THR THR B . n 
B 2 249 PRO 249 249 249 PRO PRO B . n 
B 2 250 ASN 250 250 250 ASN ASN B . n 
B 2 251 ARG 251 251 251 ARG ARG B . n 
B 2 252 LEU 252 252 252 LEU LEU B . n 
B 2 253 LYS 253 253 ?   ?   ?   B . n 
B 2 254 ARG 254 254 ?   ?   ?   B . n 
B 2 255 ILE 255 255 ?   ?   ?   B . n 
B 2 256 TRP 256 256 ?   ?   ?   B . n 
B 2 257 ASN 257 257 ?   ?   ?   B . n 
B 2 258 TRP 258 258 ?   ?   ?   B . n 
B 2 259 ARG 259 259 ?   ?   ?   B . n 
B 2 260 ALA 260 260 ?   ?   ?   B . n 
B 2 261 CYS 261 261 261 CYS CYS B . n 
B 2 262 GLU 262 262 ?   ?   ?   B . n 
B 2 263 ALA 263 263 ?   ?   ?   B . n 
B 2 264 ALA 264 264 ?   ?   ?   B . n 
B 2 265 LYS 265 265 ?   ?   ?   B . n 
B 2 266 LYS 266 266 ?   ?   ?   B . n 
C 3 1   MET 1   1   1   MET MET C . n 
C 3 2   GLU 2   2   2   GLU GLU C . n 
C 3 3   PRO 3   3   3   PRO PRO C . n 
C 3 4   VAL 4   4   4   VAL VAL C . n 
C 3 5   ASP 5   5   5   ASP ASP C . n 
C 3 6   PRO 6   6   6   PRO PRO C . n 
C 3 7   ARG 7   7   7   ARG ARG C . n 
C 3 8   LEU 8   8   8   LEU LEU C . n 
C 3 9   GLU 9   9   9   GLU GLU C . n 
C 3 10  PRO 10  10  10  PRO PRO C . n 
C 3 11  TRP 11  11  11  TRP TRP C . n 
C 3 12  LYS 12  12  12  LYS LYS C . n 
C 3 13  HIS 13  13  13  HIS HIS C . n 
C 3 14  PRO 14  14  14  PRO PRO C . n 
C 3 15  GLY 15  15  15  GLY GLY C . n 
C 3 16  SER 16  16  16  SER SER C . n 
C 3 17  GLN 17  17  17  GLN GLN C . n 
C 3 18  PRO 18  18  18  PRO PRO C . n 
C 3 19  LYS 19  19  19  LYS LYS C . n 
C 3 20  THR 20  20  20  THR THR C . n 
C 3 21  ALA 21  21  21  ALA ALA C . n 
C 3 22  CYS 22  22  22  CYS CYS C . n 
C 3 23  THR 23  23  23  THR THR C . n 
C 3 24  ASN 24  24  24  ASN ASN C . n 
C 3 25  CYS 25  25  25  CYS CYS C . n 
C 3 26  TYR 26  26  26  TYR TYR C . n 
C 3 27  CYS 27  27  27  CYS CYS C . n 
C 3 28  LYS 28  28  28  LYS LYS C . n 
C 3 29  LYS 29  29  29  LYS LYS C . n 
C 3 30  CYS 30  30  30  CYS CYS C . n 
C 3 31  CYS 31  31  31  CYS CYS C . n 
C 3 32  PHE 32  32  32  PHE PHE C . n 
C 3 33  HIS 33  33  33  HIS HIS C . n 
C 3 34  CYS 34  34  34  CYS CYS C . n 
C 3 35  GLN 35  35  35  GLN GLN C . n 
C 3 36  VAL 36  36  36  VAL VAL C . n 
C 3 37  CYS 37  37  37  CYS CYS C . n 
C 3 38  PHE 38  38  38  PHE PHE C . n 
C 3 39  ILE 39  39  39  ILE ILE C . n 
C 3 40  THR 40  40  40  THR THR C . n 
C 3 41  LYS 41  41  41  LYS LYS C . n 
C 3 42  ALA 42  42  42  ALA ALA C . n 
C 3 43  LEU 43  43  43  LEU LEU C . n 
C 3 44  GLY 44  44  44  GLY GLY C . n 
C 3 45  ILE 45  45  45  ILE ILE C . n 
C 3 46  SER 46  46  46  SER SER C . n 
C 3 47  TYR 47  47  47  TYR TYR C . n 
C 3 48  GLY 48  48  48  GLY GLY C . n 
C 3 49  ARG 49  49  49  ARG ARG C . n 
C 3 50  LYS 50  50  ?   ?   ?   C . n 
C 3 51  LYS 51  51  ?   ?   ?   C . n 
C 3 52  ARG 52  52  ?   ?   ?   C . n 
C 3 53  ARG 53  53  ?   ?   ?   C . n 
C 3 54  GLN 54  54  ?   ?   ?   C . n 
C 3 55  ARG 55  55  ?   ?   ?   C . n 
C 3 56  ARG 56  56  ?   ?   ?   C . n 
C 3 57  ARG 57  57  ?   ?   ?   C . n 
C 3 58  ALA 58  58  ?   ?   ?   C . n 
C 3 59  HIS 59  59  ?   ?   ?   C . n 
C 3 60  GLN 60  60  ?   ?   ?   C . n 
C 3 61  ASN 61  61  ?   ?   ?   C . n 
C 3 62  SER 62  62  ?   ?   ?   C . n 
C 3 63  GLN 63  63  ?   ?   ?   C . n 
C 3 64  THR 64  64  ?   ?   ?   C . n 
C 3 65  HIS 65  65  ?   ?   ?   C . n 
C 3 66  GLN 66  66  ?   ?   ?   C . n 
C 3 67  ALA 67  67  ?   ?   ?   C . n 
C 3 68  SER 68  68  ?   ?   ?   C . n 
C 3 69  LEU 69  69  ?   ?   ?   C . n 
C 3 70  SER 70  70  ?   ?   ?   C . n 
C 3 71  LYS 71  71  ?   ?   ?   C . n 
C 3 72  GLN 72  72  ?   ?   ?   C . n 
C 3 73  PRO 73  73  ?   ?   ?   C . n 
C 3 74  THR 74  74  ?   ?   ?   C . n 
C 3 75  SER 75  75  ?   ?   ?   C . n 
C 3 76  GLN 76  76  ?   ?   ?   C . n 
C 3 77  SER 77  77  ?   ?   ?   C . n 
C 3 78  ARG 78  78  ?   ?   ?   C . n 
C 3 79  GLY 79  79  ?   ?   ?   C . n 
C 3 80  ASP 80  80  ?   ?   ?   C . n 
C 3 81  PRO 81  81  ?   ?   ?   C . n 
C 3 82  THR 82  82  ?   ?   ?   C . n 
C 3 83  GLY 83  83  ?   ?   ?   C . n 
C 3 84  PRO 84  84  ?   ?   ?   C . n 
C 3 85  LYS 85  85  ?   ?   ?   C . n 
C 3 86  GLU 86  86  ?   ?   ?   C . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    TPO 
_pdbx_struct_mod_residue.label_seq_id     186 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     TPO 
_pdbx_struct_mod_residue.auth_seq_id      186 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   THR 
_pdbx_struct_mod_residue.details          PHOSPHOTHREONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5360  ? 
1 MORE         -72   ? 
1 'SSA (A^2)'  30370 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? C HIS 33 ? C HIS 33 ? 1_555 ZN ? D ZN . ? C ZN 87 ? 1_555 SG ? C CYS 37  ? C CYS 37  ? 1_555 114.7 ? 
2  ND1 ? C HIS 33 ? C HIS 33 ? 1_555 ZN ? D ZN . ? C ZN 87 ? 1_555 SG ? C CYS 22  ? C CYS 22  ? 1_555 99.4  ? 
3  SG  ? C CYS 37 ? C CYS 37 ? 1_555 ZN ? D ZN . ? C ZN 87 ? 1_555 SG ? C CYS 22  ? C CYS 22  ? 1_555 97.7  ? 
4  ND1 ? C HIS 33 ? C HIS 33 ? 1_555 ZN ? D ZN . ? C ZN 87 ? 1_555 SG ? C CYS 34  ? C CYS 34  ? 1_555 124.8 ? 
5  SG  ? C CYS 37 ? C CYS 37 ? 1_555 ZN ? D ZN . ? C ZN 87 ? 1_555 SG ? C CYS 34  ? C CYS 34  ? 1_555 108.3 ? 
6  SG  ? C CYS 22 ? C CYS 22 ? 1_555 ZN ? D ZN . ? C ZN 87 ? 1_555 SG ? C CYS 34  ? C CYS 34  ? 1_555 107.5 ? 
7  SG  ? C CYS 25 ? C CYS 25 ? 1_555 ZN ? E ZN . ? C ZN 88 ? 1_555 SG ? C CYS 27  ? C CYS 27  ? 1_555 104.6 ? 
8  SG  ? C CYS 25 ? C CYS 25 ? 1_555 ZN ? E ZN . ? C ZN 88 ? 1_555 SG ? C CYS 30  ? C CYS 30  ? 1_555 102.7 ? 
9  SG  ? C CYS 27 ? C CYS 27 ? 1_555 ZN ? E ZN . ? C ZN 88 ? 1_555 SG ? C CYS 30  ? C CYS 30  ? 1_555 106.0 ? 
10 SG  ? C CYS 25 ? C CYS 25 ? 1_555 ZN ? E ZN . ? C ZN 88 ? 1_555 SG ? B CYS 261 ? B CYS 261 ? 1_555 120.1 ? 
11 SG  ? C CYS 27 ? C CYS 27 ? 1_555 ZN ? E ZN . ? C ZN 88 ? 1_555 SG ? B CYS 261 ? B CYS 261 ? 1_555 126.5 ? 
12 SG  ? C CYS 30 ? C CYS 30 ? 1_555 ZN ? E ZN . ? C ZN 88 ? 1_555 SG ? B CYS 261 ? B CYS 261 ? 1_555 92.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-06-09 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum ? 1 
CNS      refinement        .       ? 2 
HKL-2000 'data reduction'  .       ? 3 
HKL-2000 'data scaling'    .       ? 4 
CNS      phasing           .       ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 30  ? ? -44.43  -76.37  
2  1 LYS A 56  ? ? -164.87 -68.05  
3  1 GLU A 57  ? ? -75.38  27.30   
4  1 VAL A 117 ? ? -55.27  -2.29   
5  1 ASP A 149 ? ? -153.07 39.78   
6  1 LYS A 151 ? ? 173.75  155.10  
7  1 ASP A 167 ? ? 56.36   81.19   
8  1 ASN A 179 ? ? -64.69  -109.01 
9  1 SER A 180 ? ? -74.60  -118.88 
10 1 VAL A 190 ? ? 77.38   136.99  
11 1 ASP A 205 ? ? -117.69 65.94   
12 1 LYS A 264 ? ? -56.67  17.82   
13 1 ARG A 284 ? ? 86.83   -70.75  
14 1 LEU A 296 ? ? -100.75 55.75   
15 1 SER A 334 ? ? 170.62  176.34  
16 1 ARG A 343 ? ? 177.34  -156.03 
17 1 GLN B 97  ? ? -156.00 53.36   
18 1 GLU B 116 ? ? -49.58  177.09  
19 1 THR B 121 ? ? -62.77  7.26    
20 1 TYR B 126 ? ? -63.06  -73.60  
21 1 LEU B 127 ? ? -37.38  -34.62  
22 1 ASN B 209 ? ? 36.52   44.55   
23 1 THR B 216 ? ? -19.92  114.17  
24 1 ASP B 217 ? ? 34.82   59.59   
25 1 LYS C 28  ? ? -31.67  -34.67  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A LYS 3   ? A LYS 3   
4  1 Y 1 A GLN 4   ? A GLN 4   
5  1 Y 1 A TYR 5   ? A TYR 5   
6  1 Y 1 A ASP 6   ? A ASP 6   
7  1 Y 1 A SER 7   ? A SER 7   
8  1 Y 1 A ALA 89  ? A ALA 89  
9  1 Y 1 A SER 90  ? A SER 90  
10 1 Y 1 A PRO 91  ? A PRO 91  
11 1 Y 1 A TYR 92  ? A TYR 92  
12 1 Y 1 A ASN 93  ? A ASN 93  
13 1 Y 1 A ARG 94  ? A ARG 94  
14 1 Y 1 A CYS 95  ? A CYS 95  
15 1 Y 1 A LYS 96  ? A LYS 96  
16 1 Y 1 A LYS 345 ? A LYS 345 
17 1 Y 1 A HIS 346 ? A HIS 346 
18 1 Y 1 A HIS 347 ? A HIS 347 
19 1 Y 1 A HIS 348 ? A HIS 348 
20 1 Y 1 A HIS 349 ? A HIS 349 
21 1 Y 1 A HIS 350 ? A HIS 350 
22 1 Y 1 A HIS 351 ? A HIS 351 
23 1 Y 1 B MET 1   ? B MET 1   
24 1 Y 1 B GLU 2   ? B GLU 2   
25 1 Y 1 B GLY 3   ? B GLY 3   
26 1 Y 1 B GLU 4   ? B GLU 4   
27 1 Y 1 B ARG 5   ? B ARG 5   
28 1 Y 1 B LYS 6   ? B LYS 6   
29 1 Y 1 B LYS 253 ? B LYS 253 
30 1 Y 1 B ARG 254 ? B ARG 254 
31 1 Y 1 B ILE 255 ? B ILE 255 
32 1 Y 1 B TRP 256 ? B TRP 256 
33 1 Y 1 B ASN 257 ? B ASN 257 
34 1 Y 1 B TRP 258 ? B TRP 258 
35 1 Y 1 B ARG 259 ? B ARG 259 
36 1 Y 1 B ALA 260 ? B ALA 260 
37 1 Y 1 B GLU 262 ? B GLU 262 
38 1 Y 1 B ALA 263 ? B ALA 263 
39 1 Y 1 B ALA 264 ? B ALA 264 
40 1 Y 1 B LYS 265 ? B LYS 265 
41 1 Y 1 B LYS 266 ? B LYS 266 
42 1 Y 1 C LYS 50  ? C LYS 50  
43 1 Y 1 C LYS 51  ? C LYS 51  
44 1 Y 1 C ARG 52  ? C ARG 52  
45 1 Y 1 C ARG 53  ? C ARG 53  
46 1 Y 1 C GLN 54  ? C GLN 54  
47 1 Y 1 C ARG 55  ? C ARG 55  
48 1 Y 1 C ARG 56  ? C ARG 56  
49 1 Y 1 C ARG 57  ? C ARG 57  
50 1 Y 1 C ALA 58  ? C ALA 58  
51 1 Y 1 C HIS 59  ? C HIS 59  
52 1 Y 1 C GLN 60  ? C GLN 60  
53 1 Y 1 C ASN 61  ? C ASN 61  
54 1 Y 1 C SER 62  ? C SER 62  
55 1 Y 1 C GLN 63  ? C GLN 63  
56 1 Y 1 C THR 64  ? C THR 64  
57 1 Y 1 C HIS 65  ? C HIS 65  
58 1 Y 1 C GLN 66  ? C GLN 66  
59 1 Y 1 C ALA 67  ? C ALA 67  
60 1 Y 1 C SER 68  ? C SER 68  
61 1 Y 1 C LEU 69  ? C LEU 69  
62 1 Y 1 C SER 70  ? C SER 70  
63 1 Y 1 C LYS 71  ? C LYS 71  
64 1 Y 1 C GLN 72  ? C GLN 72  
65 1 Y 1 C PRO 73  ? C PRO 73  
66 1 Y 1 C THR 74  ? C THR 74  
67 1 Y 1 C SER 75  ? C SER 75  
68 1 Y 1 C GLN 76  ? C GLN 76  
69 1 Y 1 C SER 77  ? C SER 77  
70 1 Y 1 C ARG 78  ? C ARG 78  
71 1 Y 1 C GLY 79  ? C GLY 79  
72 1 Y 1 C ASP 80  ? C ASP 80  
73 1 Y 1 C PRO 81  ? C PRO 81  
74 1 Y 1 C THR 82  ? C THR 82  
75 1 Y 1 C GLY 83  ? C GLY 83  
76 1 Y 1 C PRO 84  ? C PRO 84  
77 1 Y 1 C LYS 85  ? C LYS 85  
78 1 Y 1 C GLU 86  ? C GLU 86  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   87  1   ZN  ZN  C . 
E 4 ZN  1   88  2   ZN  ZN  C . 
F 5 HOH 1   352 1   HOH HOH A . 
F 5 HOH 2   353 2   HOH HOH A . 
F 5 HOH 3   354 3   HOH HOH A . 
F 5 HOH 4   355 4   HOH HOH A . 
F 5 HOH 5   356 5   HOH HOH A . 
F 5 HOH 6   357 6   HOH HOH A . 
F 5 HOH 7   358 7   HOH HOH A . 
F 5 HOH 8   359 9   HOH HOH A . 
F 5 HOH 9   360 10  HOH HOH A . 
F 5 HOH 10  361 12  HOH HOH A . 
F 5 HOH 11  362 13  HOH HOH A . 
F 5 HOH 12  363 14  HOH HOH A . 
F 5 HOH 13  364 15  HOH HOH A . 
F 5 HOH 14  365 16  HOH HOH A . 
F 5 HOH 15  366 17  HOH HOH A . 
F 5 HOH 16  367 18  HOH HOH A . 
F 5 HOH 17  368 20  HOH HOH A . 
F 5 HOH 18  369 22  HOH HOH A . 
F 5 HOH 19  370 23  HOH HOH A . 
F 5 HOH 20  371 24  HOH HOH A . 
F 5 HOH 21  372 27  HOH HOH A . 
F 5 HOH 22  373 28  HOH HOH A . 
F 5 HOH 23  374 29  HOH HOH A . 
F 5 HOH 24  375 30  HOH HOH A . 
F 5 HOH 25  376 32  HOH HOH A . 
F 5 HOH 26  377 34  HOH HOH A . 
F 5 HOH 27  378 35  HOH HOH A . 
F 5 HOH 28  379 38  HOH HOH A . 
F 5 HOH 29  380 39  HOH HOH A . 
F 5 HOH 30  381 40  HOH HOH A . 
F 5 HOH 31  382 42  HOH HOH A . 
F 5 HOH 32  383 44  HOH HOH A . 
F 5 HOH 33  384 47  HOH HOH A . 
F 5 HOH 34  385 49  HOH HOH A . 
F 5 HOH 35  386 54  HOH HOH A . 
F 5 HOH 36  387 55  HOH HOH A . 
F 5 HOH 37  388 56  HOH HOH A . 
F 5 HOH 38  389 58  HOH HOH A . 
F 5 HOH 39  390 59  HOH HOH A . 
F 5 HOH 40  391 62  HOH HOH A . 
F 5 HOH 41  392 63  HOH HOH A . 
F 5 HOH 42  393 64  HOH HOH A . 
F 5 HOH 43  394 65  HOH HOH A . 
F 5 HOH 44  395 66  HOH HOH A . 
F 5 HOH 45  396 67  HOH HOH A . 
F 5 HOH 46  397 69  HOH HOH A . 
F 5 HOH 47  398 72  HOH HOH A . 
F 5 HOH 48  399 73  HOH HOH A . 
F 5 HOH 49  400 83  HOH HOH A . 
F 5 HOH 50  401 86  HOH HOH A . 
F 5 HOH 51  402 87  HOH HOH A . 
F 5 HOH 52  403 89  HOH HOH A . 
F 5 HOH 53  404 90  HOH HOH A . 
F 5 HOH 54  405 92  HOH HOH A . 
F 5 HOH 55  406 93  HOH HOH A . 
F 5 HOH 56  407 95  HOH HOH A . 
F 5 HOH 57  408 97  HOH HOH A . 
F 5 HOH 58  409 98  HOH HOH A . 
F 5 HOH 59  410 101 HOH HOH A . 
F 5 HOH 60  411 102 HOH HOH A . 
F 5 HOH 61  412 103 HOH HOH A . 
F 5 HOH 62  413 104 HOH HOH A . 
F 5 HOH 63  414 105 HOH HOH A . 
F 5 HOH 64  415 109 HOH HOH A . 
F 5 HOH 65  416 110 HOH HOH A . 
F 5 HOH 66  417 111 HOH HOH A . 
F 5 HOH 67  418 113 HOH HOH A . 
F 5 HOH 68  419 114 HOH HOH A . 
F 5 HOH 69  420 118 HOH HOH A . 
F 5 HOH 70  421 119 HOH HOH A . 
F 5 HOH 71  422 120 HOH HOH A . 
F 5 HOH 72  423 122 HOH HOH A . 
F 5 HOH 73  424 124 HOH HOH A . 
F 5 HOH 74  425 125 HOH HOH A . 
F 5 HOH 75  426 126 HOH HOH A . 
F 5 HOH 76  427 128 HOH HOH A . 
F 5 HOH 77  428 130 HOH HOH A . 
F 5 HOH 78  429 132 HOH HOH A . 
F 5 HOH 79  430 133 HOH HOH A . 
F 5 HOH 80  431 137 HOH HOH A . 
F 5 HOH 81  432 138 HOH HOH A . 
F 5 HOH 82  433 139 HOH HOH A . 
F 5 HOH 83  434 142 HOH HOH A . 
F 5 HOH 84  435 145 HOH HOH A . 
F 5 HOH 85  436 146 HOH HOH A . 
F 5 HOH 86  437 147 HOH HOH A . 
F 5 HOH 87  438 148 HOH HOH A . 
F 5 HOH 88  439 149 HOH HOH A . 
F 5 HOH 89  440 150 HOH HOH A . 
F 5 HOH 90  441 153 HOH HOH A . 
F 5 HOH 91  442 154 HOH HOH A . 
F 5 HOH 92  443 155 HOH HOH A . 
F 5 HOH 93  444 157 HOH HOH A . 
F 5 HOH 94  445 159 HOH HOH A . 
F 5 HOH 95  446 162 HOH HOH A . 
F 5 HOH 96  447 164 HOH HOH A . 
F 5 HOH 97  448 165 HOH HOH A . 
F 5 HOH 98  449 166 HOH HOH A . 
F 5 HOH 99  450 167 HOH HOH A . 
F 5 HOH 100 451 168 HOH HOH A . 
F 5 HOH 101 452 169 HOH HOH A . 
F 5 HOH 102 453 171 HOH HOH A . 
F 5 HOH 103 454 172 HOH HOH A . 
F 5 HOH 104 455 173 HOH HOH A . 
F 5 HOH 105 456 174 HOH HOH A . 
F 5 HOH 106 457 175 HOH HOH A . 
F 5 HOH 107 458 176 HOH HOH A . 
F 5 HOH 108 459 177 HOH HOH A . 
F 5 HOH 109 460 180 HOH HOH A . 
F 5 HOH 110 461 182 HOH HOH A . 
F 5 HOH 111 462 183 HOH HOH A . 
F 5 HOH 112 463 184 HOH HOH A . 
F 5 HOH 113 464 185 HOH HOH A . 
F 5 HOH 114 465 186 HOH HOH A . 
F 5 HOH 115 466 187 HOH HOH A . 
F 5 HOH 116 467 188 HOH HOH A . 
F 5 HOH 117 468 191 HOH HOH A . 
F 5 HOH 118 469 192 HOH HOH A . 
F 5 HOH 119 470 194 HOH HOH A . 
F 5 HOH 120 471 195 HOH HOH A . 
F 5 HOH 121 472 196 HOH HOH A . 
F 5 HOH 122 473 201 HOH HOH A . 
F 5 HOH 123 474 202 HOH HOH A . 
F 5 HOH 124 475 203 HOH HOH A . 
F 5 HOH 125 476 204 HOH HOH A . 
F 5 HOH 126 477 208 HOH HOH A . 
F 5 HOH 127 478 210 HOH HOH A . 
F 5 HOH 128 479 211 HOH HOH A . 
F 5 HOH 129 480 213 HOH HOH A . 
F 5 HOH 130 481 214 HOH HOH A . 
F 5 HOH 131 482 215 HOH HOH A . 
F 5 HOH 132 483 216 HOH HOH A . 
F 5 HOH 133 484 217 HOH HOH A . 
F 5 HOH 134 485 218 HOH HOH A . 
F 5 HOH 135 486 220 HOH HOH A . 
F 5 HOH 136 487 222 HOH HOH A . 
F 5 HOH 137 488 224 HOH HOH A . 
F 5 HOH 138 489 225 HOH HOH A . 
F 5 HOH 139 490 228 HOH HOH A . 
F 5 HOH 140 491 229 HOH HOH A . 
F 5 HOH 141 492 230 HOH HOH A . 
F 5 HOH 142 493 231 HOH HOH A . 
F 5 HOH 143 494 232 HOH HOH A . 
F 5 HOH 144 495 233 HOH HOH A . 
F 5 HOH 145 496 235 HOH HOH A . 
F 5 HOH 146 497 237 HOH HOH A . 
F 5 HOH 147 498 238 HOH HOH A . 
F 5 HOH 148 499 243 HOH HOH A . 
F 5 HOH 149 500 244 HOH HOH A . 
F 5 HOH 150 501 245 HOH HOH A . 
F 5 HOH 151 502 246 HOH HOH A . 
F 5 HOH 152 503 247 HOH HOH A . 
F 5 HOH 153 504 250 HOH HOH A . 
F 5 HOH 154 505 252 HOH HOH A . 
F 5 HOH 155 506 254 HOH HOH A . 
F 5 HOH 156 507 255 HOH HOH A . 
F 5 HOH 157 508 256 HOH HOH A . 
F 5 HOH 158 509 257 HOH HOH A . 
F 5 HOH 159 510 258 HOH HOH A . 
F 5 HOH 160 511 261 HOH HOH A . 
F 5 HOH 161 512 262 HOH HOH A . 
F 5 HOH 162 513 268 HOH HOH A . 
F 5 HOH 163 514 270 HOH HOH A . 
F 5 HOH 164 515 272 HOH HOH A . 
F 5 HOH 165 516 273 HOH HOH A . 
F 5 HOH 166 517 275 HOH HOH A . 
F 5 HOH 167 518 278 HOH HOH A . 
F 5 HOH 168 519 279 HOH HOH A . 
F 5 HOH 169 520 280 HOH HOH A . 
F 5 HOH 170 521 281 HOH HOH A . 
F 5 HOH 171 522 282 HOH HOH A . 
F 5 HOH 172 523 283 HOH HOH A . 
F 5 HOH 173 524 286 HOH HOH A . 
F 5 HOH 174 525 288 HOH HOH A . 
F 5 HOH 175 526 289 HOH HOH A . 
F 5 HOH 176 527 291 HOH HOH A . 
F 5 HOH 177 528 293 HOH HOH A . 
F 5 HOH 178 529 294 HOH HOH A . 
F 5 HOH 179 530 296 HOH HOH A . 
F 5 HOH 180 531 298 HOH HOH A . 
F 5 HOH 181 532 300 HOH HOH A . 
F 5 HOH 182 533 302 HOH HOH A . 
F 5 HOH 183 535 305 HOH HOH A . 
F 5 HOH 184 536 308 HOH HOH A . 
F 5 HOH 185 537 309 HOH HOH A . 
F 5 HOH 186 538 311 HOH HOH A . 
F 5 HOH 187 539 313 HOH HOH A . 
F 5 HOH 188 540 316 HOH HOH A . 
F 5 HOH 189 541 318 HOH HOH A . 
F 5 HOH 190 542 319 HOH HOH A . 
F 5 HOH 191 543 320 HOH HOH A . 
F 5 HOH 192 544 321 HOH HOH A . 
F 5 HOH 193 545 323 HOH HOH A . 
F 5 HOH 194 546 324 HOH HOH A . 
F 5 HOH 195 547 325 HOH HOH A . 
F 5 HOH 196 548 328 HOH HOH A . 
F 5 HOH 197 549 329 HOH HOH A . 
F 5 HOH 198 550 330 HOH HOH A . 
F 5 HOH 199 551 331 HOH HOH A . 
F 5 HOH 200 552 333 HOH HOH A . 
F 5 HOH 201 553 335 HOH HOH A . 
F 5 HOH 202 554 336 HOH HOH A . 
F 5 HOH 203 555 340 HOH HOH A . 
F 5 HOH 204 556 341 HOH HOH A . 
G 5 HOH 1   267 267 HOH HOH B . 
G 5 HOH 2   268 11  HOH HOH B . 
G 5 HOH 3   269 269 HOH HOH B . 
G 5 HOH 4   270 21  HOH HOH B . 
G 5 HOH 5   271 271 HOH HOH B . 
G 5 HOH 6   272 25  HOH HOH B . 
G 5 HOH 7   273 26  HOH HOH B . 
G 5 HOH 8   274 274 HOH HOH B . 
G 5 HOH 9   275 31  HOH HOH B . 
G 5 HOH 10  276 276 HOH HOH B . 
G 5 HOH 11  277 277 HOH HOH B . 
G 5 HOH 12  278 33  HOH HOH B . 
G 5 HOH 13  279 36  HOH HOH B . 
G 5 HOH 14  280 37  HOH HOH B . 
G 5 HOH 15  281 43  HOH HOH B . 
G 5 HOH 16  282 45  HOH HOH B . 
G 5 HOH 17  283 46  HOH HOH B . 
G 5 HOH 18  284 284 HOH HOH B . 
G 5 HOH 19  285 285 HOH HOH B . 
G 5 HOH 20  286 48  HOH HOH B . 
G 5 HOH 21  287 287 HOH HOH B . 
G 5 HOH 22  288 50  HOH HOH B . 
G 5 HOH 23  289 51  HOH HOH B . 
G 5 HOH 24  290 290 HOH HOH B . 
G 5 HOH 25  291 53  HOH HOH B . 
G 5 HOH 26  292 292 HOH HOH B . 
G 5 HOH 27  293 57  HOH HOH B . 
G 5 HOH 28  294 60  HOH HOH B . 
G 5 HOH 29  295 295 HOH HOH B . 
G 5 HOH 30  296 61  HOH HOH B . 
G 5 HOH 31  297 68  HOH HOH B . 
G 5 HOH 32  298 70  HOH HOH B . 
G 5 HOH 33  299 299 HOH HOH B . 
G 5 HOH 34  300 71  HOH HOH B . 
G 5 HOH 35  301 301 HOH HOH B . 
G 5 HOH 36  302 74  HOH HOH B . 
G 5 HOH 37  303 75  HOH HOH B . 
G 5 HOH 38  304 304 HOH HOH B . 
G 5 HOH 39  305 76  HOH HOH B . 
G 5 HOH 40  306 78  HOH HOH B . 
G 5 HOH 41  307 307 HOH HOH B . 
G 5 HOH 42  308 79  HOH HOH B . 
G 5 HOH 43  309 81  HOH HOH B . 
G 5 HOH 44  310 310 HOH HOH B . 
G 5 HOH 45  311 84  HOH HOH B . 
G 5 HOH 46  312 85  HOH HOH B . 
G 5 HOH 47  313 88  HOH HOH B . 
G 5 HOH 48  314 314 HOH HOH B . 
G 5 HOH 49  315 315 HOH HOH B . 
G 5 HOH 50  316 91  HOH HOH B . 
G 5 HOH 51  317 317 HOH HOH B . 
G 5 HOH 52  318 94  HOH HOH B . 
G 5 HOH 53  319 96  HOH HOH B . 
G 5 HOH 54  320 99  HOH HOH B . 
G 5 HOH 55  321 100 HOH HOH B . 
G 5 HOH 56  322 322 HOH HOH B . 
G 5 HOH 57  323 107 HOH HOH B . 
G 5 HOH 58  324 108 HOH HOH B . 
G 5 HOH 59  325 112 HOH HOH B . 
G 5 HOH 60  326 326 HOH HOH B . 
G 5 HOH 61  327 327 HOH HOH B . 
G 5 HOH 62  328 116 HOH HOH B . 
G 5 HOH 63  329 121 HOH HOH B . 
G 5 HOH 64  330 123 HOH HOH B . 
G 5 HOH 65  331 127 HOH HOH B . 
G 5 HOH 66  332 332 HOH HOH B . 
G 5 HOH 67  333 129 HOH HOH B . 
G 5 HOH 68  334 334 HOH HOH B . 
G 5 HOH 69  335 131 HOH HOH B . 
G 5 HOH 70  336 135 HOH HOH B . 
G 5 HOH 71  337 337 HOH HOH B . 
G 5 HOH 72  338 338 HOH HOH B . 
G 5 HOH 73  339 339 HOH HOH B . 
G 5 HOH 74  340 136 HOH HOH B . 
G 5 HOH 75  341 140 HOH HOH B . 
G 5 HOH 76  342 143 HOH HOH B . 
G 5 HOH 77  343 144 HOH HOH B . 
G 5 HOH 78  344 151 HOH HOH B . 
G 5 HOH 79  345 152 HOH HOH B . 
G 5 HOH 80  346 156 HOH HOH B . 
G 5 HOH 81  347 158 HOH HOH B . 
G 5 HOH 82  348 160 HOH HOH B . 
G 5 HOH 83  349 161 HOH HOH B . 
G 5 HOH 84  350 163 HOH HOH B . 
G 5 HOH 85  351 170 HOH HOH B . 
G 5 HOH 86  352 178 HOH HOH B . 
G 5 HOH 87  353 179 HOH HOH B . 
G 5 HOH 88  354 181 HOH HOH B . 
G 5 HOH 89  355 189 HOH HOH B . 
G 5 HOH 90  356 190 HOH HOH B . 
G 5 HOH 91  357 193 HOH HOH B . 
G 5 HOH 92  358 197 HOH HOH B . 
G 5 HOH 93  359 198 HOH HOH B . 
G 5 HOH 94  360 199 HOH HOH B . 
G 5 HOH 95  361 200 HOH HOH B . 
G 5 HOH 96  362 205 HOH HOH B . 
G 5 HOH 97  363 206 HOH HOH B . 
G 5 HOH 98  364 209 HOH HOH B . 
G 5 HOH 99  365 212 HOH HOH B . 
G 5 HOH 100 366 219 HOH HOH B . 
G 5 HOH 101 367 221 HOH HOH B . 
G 5 HOH 102 368 223 HOH HOH B . 
G 5 HOH 103 369 226 HOH HOH B . 
G 5 HOH 104 370 234 HOH HOH B . 
G 5 HOH 105 371 236 HOH HOH B . 
G 5 HOH 106 372 239 HOH HOH B . 
G 5 HOH 107 373 240 HOH HOH B . 
G 5 HOH 108 374 242 HOH HOH B . 
G 5 HOH 109 375 248 HOH HOH B . 
G 5 HOH 110 376 249 HOH HOH B . 
G 5 HOH 111 377 251 HOH HOH B . 
G 5 HOH 112 378 253 HOH HOH B . 
G 5 HOH 113 379 259 HOH HOH B . 
G 5 HOH 114 380 260 HOH HOH B . 
G 5 HOH 115 381 263 HOH HOH B . 
G 5 HOH 116 382 264 HOH HOH B . 
G 5 HOH 117 383 265 HOH HOH B . 
H 5 HOH 1   89  8   HOH HOH C . 
H 5 HOH 2   90  19  HOH HOH C . 
H 5 HOH 3   91  41  HOH HOH C . 
H 5 HOH 4   92  52  HOH HOH C . 
H 5 HOH 5   93  77  HOH HOH C . 
H 5 HOH 6   94  80  HOH HOH C . 
H 5 HOH 7   95  82  HOH HOH C . 
H 5 HOH 8   106 106 HOH HOH C . 
H 5 HOH 9   115 115 HOH HOH C . 
H 5 HOH 10  117 117 HOH HOH C . 
H 5 HOH 11  134 134 HOH HOH C . 
H 5 HOH 12  141 141 HOH HOH C . 
H 5 HOH 13  207 207 HOH HOH C . 
H 5 HOH 14  227 227 HOH HOH C . 
H 5 HOH 15  241 241 HOH HOH C . 
H 5 HOH 16  266 266 HOH HOH C . 
H 5 HOH 17  297 297 HOH HOH C . 
H 5 HOH 18  306 306 HOH HOH C . 
H 5 HOH 19  312 312 HOH HOH C . 
H 5 HOH 20  534 303 HOH HOH C . 
#