data_3MXN
# 
_entry.id   3MXN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3MXN         
RCSB  RCSB059122   
WWPDB D_1000059122 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3MXN 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hoadley, K.A.'  1 
'Xu, D.'         2 
'Xue, Y.'        3 
'Satyshur, K.A.' 4 
'Wang, W.'       5 
'Keck, J.L.'     6 
# 
_citation.id                        primary 
_citation.title                     'Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            18 
_citation.page_first                1149 
_citation.page_last                 1158 
_citation.year                      2010 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20826341 
_citation.pdbx_database_id_DOI      10.1016/j.str.2010.06.009 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hoadley, K.A.'  1 
primary 'Xu, D.'         2 
primary 'Xue, Y.'        3 
primary 'Satyshur, K.A.' 4 
primary 'Wang, W.'       5 
primary 'Keck, J.L.'     6 
# 
_cell.entry_id           3MXN 
_cell.length_a           42.096 
_cell.length_b           42.223 
_cell.length_c           152.240 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3MXN 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RecQ-mediated genome instability protein 1' 17401.254 1   ? ? 'C-terminal OB domain (unp residues 473-625)' ? 
2 polymer     man 'RecQ-mediated genome instability protein 2' 16168.581 1   ? ? ?                                             ? 
3 non-polymer syn BENZAMIDINE                                  120.152   1   ? ? ?                                             ? 
4 water       nat water                                        18.015    251 ? ? ?                                             ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'BLM-associated protein of 75 kDa, BLAP75, FAAP75' 
2 'hRMI2, BLM-associated protein of 18 kDa, BLAP18'  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDE
ILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
;
;GSHMSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDE
ILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
;
A ? 
2 'polypeptide(L)' no no 
;GSHMAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDP
SGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
;
;GSHMAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDP
SGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   SER n 
1 6   SER n 
1 7   GLU n 
1 8   ASN n 
1 9   SER n 
1 10  ILE n 
1 11  ASN n 
1 12  LEU n 
1 13  SER n 
1 14  ILE n 
1 15  ALA n 
1 16  MET n 
1 17  ASP n 
1 18  LEU n 
1 19  TYR n 
1 20  SER n 
1 21  PRO n 
1 22  PRO n 
1 23  PHE n 
1 24  VAL n 
1 25  TYR n 
1 26  LEU n 
1 27  SER n 
1 28  VAL n 
1 29  LEU n 
1 30  MET n 
1 31  ALA n 
1 32  SER n 
1 33  LYS n 
1 34  PRO n 
1 35  LYS n 
1 36  GLU n 
1 37  VAL n 
1 38  THR n 
1 39  THR n 
1 40  VAL n 
1 41  LYS n 
1 42  VAL n 
1 43  LYS n 
1 44  ALA n 
1 45  PHE n 
1 46  ILE n 
1 47  VAL n 
1 48  THR n 
1 49  LEU n 
1 50  THR n 
1 51  GLY n 
1 52  ASN n 
1 53  LEU n 
1 54  SER n 
1 55  SER n 
1 56  SER n 
1 57  GLY n 
1 58  GLY n 
1 59  ILE n 
1 60  TRP n 
1 61  SER n 
1 62  ILE n 
1 63  THR n 
1 64  ALA n 
1 65  LYS n 
1 66  VAL n 
1 67  SER n 
1 68  ASP n 
1 69  GLY n 
1 70  THR n 
1 71  ALA n 
1 72  TYR n 
1 73  LEU n 
1 74  ASP n 
1 75  VAL n 
1 76  ASP n 
1 77  PHE n 
1 78  VAL n 
1 79  ASP n 
1 80  GLU n 
1 81  ILE n 
1 82  LEU n 
1 83  THR n 
1 84  SER n 
1 85  LEU n 
1 86  ILE n 
1 87  GLY n 
1 88  PHE n 
1 89  SER n 
1 90  VAL n 
1 91  PRO n 
1 92  GLU n 
1 93  MET n 
1 94  LYS n 
1 95  GLN n 
1 96  SER n 
1 97  LYS n 
1 98  LYS n 
1 99  ASP n 
1 100 PRO n 
1 101 LEU n 
1 102 GLN n 
1 103 TYR n 
1 104 GLN n 
1 105 LYS n 
1 106 PHE n 
1 107 LEU n 
1 108 GLU n 
1 109 GLY n 
1 110 LEU n 
1 111 GLN n 
1 112 LYS n 
1 113 CYS n 
1 114 GLN n 
1 115 ARG n 
1 116 ASP n 
1 117 LEU n 
1 118 ILE n 
1 119 ASP n 
1 120 LEU n 
1 121 CYS n 
1 122 CYS n 
1 123 LEU n 
1 124 MET n 
1 125 THR n 
1 126 ILE n 
1 127 SER n 
1 128 PHE n 
1 129 ASN n 
1 130 PRO n 
1 131 SER n 
1 132 LEU n 
1 133 SER n 
1 134 LYS n 
1 135 ALA n 
1 136 MET n 
1 137 VAL n 
1 138 LEU n 
1 139 ALA n 
1 140 LEU n 
1 141 GLN n 
1 142 ASP n 
1 143 VAL n 
1 144 ASN n 
1 145 MET n 
1 146 GLU n 
1 147 HIS n 
1 148 LEU n 
1 149 GLU n 
1 150 ASN n 
1 151 LEU n 
1 152 LYS n 
1 153 LYS n 
1 154 ARG n 
1 155 LEU n 
1 156 ASN n 
1 157 LYS n 
2 1   GLY n 
2 2   SER n 
2 3   HIS n 
2 4   MET n 
2 5   ALA n 
2 6   ALA n 
2 7   ALA n 
2 8   ALA n 
2 9   ASP n 
2 10  SER n 
2 11  PHE n 
2 12  SER n 
2 13  GLY n 
2 14  GLY n 
2 15  PRO n 
2 16  ALA n 
2 17  GLY n 
2 18  VAL n 
2 19  ARG n 
2 20  LEU n 
2 21  PRO n 
2 22  ARG n 
2 23  SER n 
2 24  PRO n 
2 25  PRO n 
2 26  LEU n 
2 27  LYS n 
2 28  VAL n 
2 29  LEU n 
2 30  ALA n 
2 31  GLU n 
2 32  GLN n 
2 33  LEU n 
2 34  ARG n 
2 35  ARG n 
2 36  ASP n 
2 37  ALA n 
2 38  GLU n 
2 39  GLY n 
2 40  GLY n 
2 41  PRO n 
2 42  GLY n 
2 43  ALA n 
2 44  TRP n 
2 45  ARG n 
2 46  LEU n 
2 47  SER n 
2 48  ARG n 
2 49  ALA n 
2 50  ALA n 
2 51  ALA n 
2 52  GLY n 
2 53  ARG n 
2 54  GLY n 
2 55  PRO n 
2 56  LEU n 
2 57  ASP n 
2 58  LEU n 
2 59  ALA n 
2 60  ALA n 
2 61  VAL n 
2 62  TRP n 
2 63  MET n 
2 64  GLN n 
2 65  GLY n 
2 66  ARG n 
2 67  VAL n 
2 68  VAL n 
2 69  MET n 
2 70  ALA n 
2 71  ASP n 
2 72  ARG n 
2 73  GLY n 
2 74  GLU n 
2 75  ALA n 
2 76  ARG n 
2 77  LEU n 
2 78  ARG n 
2 79  ASP n 
2 80  PRO n 
2 81  SER n 
2 82  GLY n 
2 83  ASP n 
2 84  PHE n 
2 85  SER n 
2 86  VAL n 
2 87  ARG n 
2 88  GLY n 
2 89  LEU n 
2 90  GLU n 
2 91  ARG n 
2 92  VAL n 
2 93  PRO n 
2 94  ARG n 
2 95  GLY n 
2 96  ARG n 
2 97  PRO n 
2 98  CYS n 
2 99  LEU n 
2 100 VAL n 
2 101 PRO n 
2 102 GLY n 
2 103 LYS n 
2 104 TYR n 
2 105 VAL n 
2 106 MET n 
2 107 VAL n 
2 108 MET n 
2 109 GLY n 
2 110 VAL n 
2 111 VAL n 
2 112 GLN n 
2 113 ALA n 
2 114 CYS n 
2 115 SER n 
2 116 PRO n 
2 117 GLU n 
2 118 PRO n 
2 119 CYS n 
2 120 LEU n 
2 121 GLN n 
2 122 ALA n 
2 123 VAL n 
2 124 LYS n 
2 125 MET n 
2 126 THR n 
2 127 ASP n 
2 128 LEU n 
2 129 SER n 
2 130 ASP n 
2 131 ASN n 
2 132 PRO n 
2 133 ILE n 
2 134 HIS n 
2 135 GLU n 
2 136 SER n 
2 137 MET n 
2 138 TRP n 
2 139 GLU n 
2 140 LEU n 
2 141 GLU n 
2 142 VAL n 
2 143 GLU n 
2 144 ASP n 
2 145 LEU n 
2 146 HIS n 
2 147 ARG n 
2 148 ASN n 
2 149 ILE n 
2 150 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'RMI1, C9orf76'  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? 'RMI2, C16orf75' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RMI1_HUMAN Q9H9A7 1 
;SSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTS
LIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
;
473 ? 
2 UNP RMI2_HUMAN Q96E14 2 
;MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGD
FSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
;
1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3MXN A 5 ? 157 ? Q9H9A7 473 ? 625 ? 473 625 
2 2 3MXN B 4 ? 150 ? Q96E14 1   ? 147 ? 1   147 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3MXN GLY A 1 ? UNP Q9H9A7 ? ? 'EXPRESSION TAG' 469 1 
1 3MXN SER A 2 ? UNP Q9H9A7 ? ? 'EXPRESSION TAG' 470 2 
1 3MXN HIS A 3 ? UNP Q9H9A7 ? ? 'EXPRESSION TAG' 471 3 
1 3MXN MET A 4 ? UNP Q9H9A7 ? ? 'EXPRESSION TAG' 472 4 
2 3MXN GLY B 1 ? UNP Q96E14 ? ? 'EXPRESSION TAG' -2  5 
2 3MXN SER B 2 ? UNP Q96E14 ? ? 'EXPRESSION TAG' -1  6 
2 3MXN HIS B 3 ? UNP Q96E14 ? ? 'EXPRESSION TAG' 0   7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BEN non-polymer         . BENZAMIDINE     ? 'C7 H8 N2'       120.152 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3MXN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.06 
_exptl_crystal.density_percent_sol   40.23 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.1 
_exptl_crystal_grow.pdbx_details    
;10 mM Hepes pH 7.1, 0.05 M NaSCN, 20% ethylene glycol, 2 mM DTT, 13% polyethylene glycol 3350, with benzamidine (1%) added to the drop, VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-07-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97933 1.0 
2 0.97856 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.97933, 0.97856' 
# 
_reflns.entry_id                     3MXN 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             29.8 
_reflns.d_resolution_high            1.55 
_reflns.number_obs                   39281 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.97 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.115 
_reflns.pdbx_netI_over_sigmaI        25.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.55 
_reflns_shell.d_res_low              1.58 
_reflns_shell.percent_possible_all   83 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.378 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        5.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3MXN 
_refine.ls_number_reflns_obs                     37250 
_refine.ls_number_reflns_all                     40496 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.8 
_refine.ls_d_res_high                            1.55 
_refine.ls_percent_reflns_obs                    96.97 
_refine.ls_R_factor_obs                          0.1972 
_refine.ls_R_factor_all                          0.1972 
_refine.ls_R_factor_R_work                       0.19548 
_refine.ls_R_factor_R_free                       0.23106 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1966 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.938 
_refine.B_iso_mean                               18.566 
_refine.aniso_B[1][1]                            -0.66 
_refine.aniso_B[2][2]                            0.09 
_refine.aniso_B[3][3]                            0.57 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.096 
_refine.overall_SU_ML                            0.057 
_refine.overall_SU_B                             3.411 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2182 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             251 
_refine_hist.number_atoms_total               2442 
_refine_hist.d_res_high                       1.55 
_refine_hist.d_res_low                        29.8 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.008  0.022  ? 2337 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.191  2.002  ? 3192 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 5.467  5.000  ? 316  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 32.838 24.149 ? 94   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 13.464 15.000 ? 436  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 17.879 15.000 ? 18   'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.078  0.200  ? 367  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.005  0.021  ? 1756 'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.611  1.500  ? 1473 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1.168  2.000  ? 2403 'X-RAY DIFFRACTION' ? 
r_scbond_it            1.877  3.000  ? 864  'X-RAY DIFFRACTION' ? 
r_scangle_it           3.181  4.500  ? 771  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.550 
_refine_ls_shell.d_res_low                        1.590 
_refine_ls_shell.number_reflns_R_work             2313 
_refine_ls_shell.R_factor_R_work                  0.314 
_refine_ls_shell.percent_reflns_obs               84.30 
_refine_ls_shell.R_factor_R_free                  0.366 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             130 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3MXN 
_struct.title                     'Crystal structure of the RMI core complex' 
_struct.pdbx_descriptor           . 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3MXN 
_struct_keywords.pdbx_keywords   REPLICATION 
_struct_keywords.text            'Bloom syndrome, helicase, RMI, topoisomerase, Replication protein A, REPLICATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 11  ? SER A 13  ? ASN A 479 SER A 481 5 ? 3  
HELX_P HELX_P2  2  ILE A 14  ? SER A 20  ? ILE A 482 SER A 488 1 ? 7  
HELX_P HELX_P3  3  TYR A 25  ? SER A 32  ? TYR A 493 SER A 500 1 ? 8  
HELX_P HELX_P4  4  SER A 55  ? ILE A 59  ? SER A 523 ILE A 527 5 ? 5  
HELX_P HELX_P5  5  VAL A 78  ? GLY A 87  ? VAL A 546 GLY A 555 1 ? 10 
HELX_P HELX_P6  6  SER A 89  ? LYS A 97  ? SER A 557 LYS A 565 1 ? 9  
HELX_P HELX_P7  7  ASP A 99  ? LEU A 120 ? ASP A 567 LEU A 588 1 ? 22 
HELX_P HELX_P8  8  ASN A 144 ? LEU A 155 ? ASN A 612 LEU A 623 1 ? 12 
HELX_P HELX_P9  9  LEU B 29  ? ASP B 36  ? LEU B 26  ASP B 33  1 ? 8  
HELX_P HELX_P10 10 GLY B 88  ? VAL B 92  ? GLY B 85  VAL B 89  5 ? 5  
HELX_P HELX_P11 11 PRO B 132 ? ARG B 147 ? PRO B 129 ARG B 144 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 21  A . ? PRO 489 A PRO 22  A ? PRO 490 A 1 7.47 
2 SER 115 B . ? SER 112 B PRO 116 B ? PRO 113 B 1 0.58 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 7 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 38  ? LEU A 49  ? THR A 506 LEU A 517 
A 2 THR A 63  ? SER A 67  ? THR A 531 SER A 535 
A 3 TYR A 72  ? PHE A 77  ? TYR A 540 PHE A 545 
A 4 LYS A 134 ? GLN A 141 ? LYS A 602 GLN A 609 
A 5 CYS A 121 ? ASN A 129 ? CYS A 589 ASN A 597 
A 6 THR A 38  ? LEU A 49  ? THR A 506 LEU A 517 
B 1 LEU B 26  ? LYS B 27  ? LEU B 23  LYS B 24  
B 2 ALA B 60  ? ASP B 71  ? ALA B 57  ASP B 68  
B 3 TYR B 104 ? ALA B 113 ? TYR B 101 ALA B 110 
B 4 CYS B 119 ? ASP B 127 ? CYS B 116 ASP B 124 
B 5 GLY B 82  ? ARG B 87  ? GLY B 79  ARG B 84  
B 6 GLU B 74  ? ASP B 79  ? GLU B 71  ASP B 76  
B 7 ALA B 60  ? ASP B 71  ? ALA B 57  ASP B 68  
C 1 ALA B 37  ? GLU B 38  ? ALA B 34  GLU B 35  
C 2 ARG B 45  ? LEU B 46  ? ARG B 42  LEU B 43  
C 3 LEU B 56  ? ASP B 57  ? LEU B 53  ASP B 54  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 48  ? N THR A 516 O LYS A 65  ? O LYS A 533 
A 2 3 N ALA A 64  ? N ALA A 532 O VAL A 75  ? O VAL A 543 
A 3 4 N ASP A 76  ? N ASP A 544 O VAL A 137 ? O VAL A 605 
A 4 5 O LYS A 134 ? O LYS A 602 N ASN A 129 ? N ASN A 597 
A 5 6 O PHE A 128 ? O PHE A 596 N THR A 38  ? N THR A 506 
B 1 2 N LEU B 26  ? N LEU B 23  O TRP B 62  ? O TRP B 59  
B 2 3 N MET B 63  ? N MET B 60  O VAL B 107 ? O VAL B 104 
B 3 4 N MET B 108 ? N MET B 105 O VAL B 123 ? O VAL B 120 
B 4 5 O ALA B 122 ? O ALA B 119 N ARG B 87  ? N ARG B 84  
B 5 6 O PHE B 84  ? O PHE B 81  N LEU B 77  ? N LEU B 74  
B 6 7 O ARG B 76  ? O ARG B 73  N VAL B 68  ? N VAL B 65  
C 1 2 N GLU B 38  ? N GLU B 35  O ARG B 45  ? O ARG B 42  
C 2 3 N LEU B 46  ? N LEU B 43  O LEU B 56  ? O LEU B 53  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE BEN A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 GLY A 87  ? GLY A 555 . ? 4_445 ? 
2 AC1 4 GLU A 92  ? GLU A 560 . ? 4_445 ? 
3 AC1 4 MET A 145 ? MET A 613 . ? 1_555 ? 
4 AC1 4 GLU A 149 ? GLU A 617 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3MXN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3MXN 
_atom_sites.fract_transf_matrix[1][1]   0.023755 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023684 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006569 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 7   ? -12.014 15.505  -6.823  1.00 30.30 ? 475 GLU A N   1 
ATOM   2    C CA  . GLU A 1 7   ? -13.080 14.936  -7.705  1.00 29.80 ? 475 GLU A CA  1 
ATOM   3    C C   . GLU A 1 7   ? -13.949 13.934  -6.944  1.00 28.57 ? 475 GLU A C   1 
ATOM   4    O O   . GLU A 1 7   ? -13.443 13.046  -6.246  1.00 29.19 ? 475 GLU A O   1 
ATOM   5    C CB  . GLU A 1 7   ? -12.476 14.297  -8.965  1.00 30.63 ? 475 GLU A CB  1 
ATOM   6    C CG  . GLU A 1 7   ? -13.501 13.752  -9.969  1.00 32.69 ? 475 GLU A CG  1 
ATOM   7    C CD  . GLU A 1 7   ? -14.342 14.838  -10.629 1.00 35.86 ? 475 GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 7   ? -13.756 15.789  -11.194 1.00 36.98 ? 475 GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 7   ? -15.592 14.731  -10.597 1.00 37.06 ? 475 GLU A OE2 1 
ATOM   10   N N   . ASN A 1 8   ? -15.261 14.084  -7.093  1.00 26.72 ? 476 ASN A N   1 
ATOM   11   C CA  . ASN A 1 8   ? -16.218 13.280  -6.342  1.00 24.65 ? 476 ASN A CA  1 
ATOM   12   C C   . ASN A 1 8   ? -17.008 12.281  -7.187  1.00 23.30 ? 476 ASN A C   1 
ATOM   13   O O   . ASN A 1 8   ? -18.034 11.767  -6.735  1.00 23.24 ? 476 ASN A O   1 
ATOM   14   C CB  . ASN A 1 8   ? -17.178 14.188  -5.560  1.00 24.98 ? 476 ASN A CB  1 
ATOM   15   C CG  . ASN A 1 8   ? -17.991 15.112  -6.459  1.00 25.70 ? 476 ASN A CG  1 
ATOM   16   O OD1 . ASN A 1 8   ? -17.945 15.021  -7.690  1.00 27.81 ? 476 ASN A OD1 1 
ATOM   17   N ND2 . ASN A 1 8   ? -18.743 16.017  -5.840  1.00 26.80 ? 476 ASN A ND2 1 
ATOM   18   N N   . SER A 1 9   ? -16.538 12.012  -8.403  1.00 22.42 ? 477 SER A N   1 
ATOM   19   C CA  . SER A 1 9   ? -17.202 11.043  -9.274  1.00 21.38 ? 477 SER A CA  1 
ATOM   20   C C   . SER A 1 9   ? -16.212 10.161  -10.025 1.00 20.87 ? 477 SER A C   1 
ATOM   21   O O   . SER A 1 9   ? -15.056 10.536  -10.227 1.00 20.60 ? 477 SER A O   1 
ATOM   22   C CB  . SER A 1 9   ? -18.142 11.740  -10.262 1.00 21.59 ? 477 SER A CB  1 
ATOM   23   O OG  . SER A 1 9   ? -17.419 12.350  -11.315 1.00 21.35 ? 477 SER A OG  1 
ATOM   24   N N   . ILE A 1 10  ? -16.676 8.982   -10.426 1.00 20.08 ? 478 ILE A N   1 
ATOM   25   C CA  . ILE A 1 10  ? -15.879 8.083   -11.258 1.00 19.69 ? 478 ILE A CA  1 
ATOM   26   C C   . ILE A 1 10  ? -16.759 7.474   -12.305 1.00 18.05 ? 478 ILE A C   1 
ATOM   27   O O   . ILE A 1 10  ? -17.934 7.213   -12.053 1.00 16.17 ? 478 ILE A O   1 
ATOM   28   C CB  . ILE A 1 10  ? -15.269 6.922   -10.483 1.00 20.55 ? 478 ILE A CB  1 
ATOM   29   C CG1 . ILE A 1 10  ? -16.084 6.651   -9.224  1.00 22.78 ? 478 ILE A CG1 1 
ATOM   30   C CG2 . ILE A 1 10  ? -13.789 7.178   -10.201 1.00 22.71 ? 478 ILE A CG2 1 
ATOM   31   C CD1 . ILE A 1 10  ? -16.306 5.209   -9.005  1.00 25.83 ? 478 ILE A CD1 1 
ATOM   32   N N   . ASN A 1 11  ? -16.179 7.246   -13.479 1.00 16.33 ? 479 ASN A N   1 
ATOM   33   C CA  . ASN A 1 11  ? -16.845 6.497   -14.516 1.00 16.14 ? 479 ASN A CA  1 
ATOM   34   C C   . ASN A 1 11  ? -16.834 5.050   -14.076 1.00 14.85 ? 479 ASN A C   1 
ATOM   35   O O   . ASN A 1 11  ? -15.790 4.395   -14.082 1.00 14.62 ? 479 ASN A O   1 
ATOM   36   C CB  . ASN A 1 11  ? -16.119 6.669   -15.852 1.00 16.42 ? 479 ASN A CB  1 
ATOM   37   C CG  . ASN A 1 11  ? -16.823 5.962   -17.000 1.00 17.75 ? 479 ASN A CG  1 
ATOM   38   O OD1 . ASN A 1 11  ? -17.801 5.236   -16.808 1.00 18.45 ? 479 ASN A OD1 1 
ATOM   39   N ND2 . ASN A 1 11  ? -16.314 6.167   -18.211 1.00 22.21 ? 479 ASN A ND2 1 
ATOM   40   N N   . LEU A 1 12  ? -17.993 4.556   -13.656 1.00 14.10 ? 480 LEU A N   1 
ATOM   41   C CA  . LEU A 1 12  ? -18.078 3.211   -13.121 1.00 13.30 ? 480 LEU A CA  1 
ATOM   42   C C   . LEU A 1 12  ? -17.689 2.186   -14.177 1.00 13.79 ? 480 LEU A C   1 
ATOM   43   O O   . LEU A 1 12  ? -17.209 1.109   -13.841 1.00 12.38 ? 480 LEU A O   1 
ATOM   44   C CB  . LEU A 1 12  ? -19.496 2.936   -12.576 1.00 13.07 ? 480 LEU A CB  1 
ATOM   45   C CG  . LEU A 1 12  ? -19.679 1.605   -11.831 1.00 12.62 ? 480 LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 12  ? -18.749 1.530   -10.618 1.00 12.45 ? 480 LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 12  ? -21.122 1.423   -11.422 1.00 12.72 ? 480 LEU A CD2 1 
ATOM   48   N N   . SER A 1 13  ? -17.872 2.533   -15.454 1.00 14.42 ? 481 SER A N   1 
ATOM   49   C CA  A SER A 1 13  ? -17.575 1.598   -16.537 0.50 15.46 ? 481 SER A CA  1 
ATOM   50   C CA  B SER A 1 13  ? -17.571 1.615   -16.550 0.50 15.39 ? 481 SER A CA  1 
ATOM   51   C C   . SER A 1 13  ? -16.082 1.343   -16.726 1.00 15.54 ? 481 SER A C   1 
ATOM   52   O O   . SER A 1 13  ? -15.694 0.492   -17.533 1.00 16.41 ? 481 SER A O   1 
ATOM   53   C CB  A SER A 1 13  ? -18.220 2.042   -17.853 0.50 15.47 ? 481 SER A CB  1 
ATOM   54   C CB  B SER A 1 13  ? -18.180 2.113   -17.861 0.50 15.37 ? 481 SER A CB  1 
ATOM   55   O OG  A SER A 1 13  ? -17.603 3.207   -18.364 0.50 16.55 ? 481 SER A OG  1 
ATOM   56   O OG  B SER A 1 13  ? -19.591 1.990   -17.837 0.50 16.05 ? 481 SER A OG  1 
ATOM   57   N N   . ILE A 1 14  ? -15.242 2.060   -15.984 1.00 15.31 ? 482 ILE A N   1 
ATOM   58   C CA  . ILE A 1 14  ? -13.799 1.785   -16.041 1.00 15.85 ? 482 ILE A CA  1 
ATOM   59   C C   . ILE A 1 14  ? -13.232 1.173   -14.753 1.00 14.70 ? 482 ILE A C   1 
ATOM   60   O O   . ILE A 1 14  ? -12.008 1.022   -14.619 1.00 14.69 ? 482 ILE A O   1 
ATOM   61   C CB  . ILE A 1 14  ? -12.944 3.021   -16.484 1.00 16.44 ? 482 ILE A CB  1 
ATOM   62   C CG1 . ILE A 1 14  ? -12.898 4.108   -15.403 1.00 18.09 ? 482 ILE A CG1 1 
ATOM   63   C CG2 . ILE A 1 14  ? -13.406 3.542   -17.845 1.00 19.02 ? 482 ILE A CG2 1 
ATOM   64   C CD1 . ILE A 1 14  ? -11.927 5.242   -15.720 1.00 20.45 ? 482 ILE A CD1 1 
ATOM   65   N N   . ALA A 1 15  ? -14.097 0.832   -13.794 1.00 12.87 ? 483 ALA A N   1 
ATOM   66   C CA  . ALA A 1 15  ? -13.597 0.324   -12.520 1.00 11.74 ? 483 ALA A CA  1 
ATOM   67   C C   . ALA A 1 15  ? -12.760 -0.948  -12.686 1.00 11.84 ? 483 ALA A C   1 
ATOM   68   O O   . ALA A 1 15  ? -11.640 -1.008  -12.188 1.00 11.60 ? 483 ALA A O   1 
ATOM   69   C CB  . ALA A 1 15  ? -14.740 0.133   -11.502 1.00 10.69 ? 483 ALA A CB  1 
ATOM   70   N N   . MET A 1 16  ? -13.276 -1.950  -13.390 1.00 11.60 ? 484 MET A N   1 
ATOM   71   C CA  . MET A 1 16  ? -12.463 -3.139  -13.656 1.00 11.99 ? 484 MET A CA  1 
ATOM   72   C C   . MET A 1 16  ? -11.249 -2.812  -14.502 1.00 12.27 ? 484 MET A C   1 
ATOM   73   O O   . MET A 1 16  ? -10.176 -3.401  -14.292 1.00 12.30 ? 484 MET A O   1 
ATOM   74   C CB  . MET A 1 16  ? -13.311 -4.247  -14.273 1.00 12.32 ? 484 MET A CB  1 
ATOM   75   C CG  . MET A 1 16  ? -14.215 -4.877  -13.252 1.00 12.86 ? 484 MET A CG  1 
ATOM   76   S SD  . MET A 1 16  ? -15.188 -6.264  -13.870 1.00 16.54 ? 484 MET A SD  1 
ATOM   77   C CE  . MET A 1 16  ? -16.475 -5.408  -14.778 1.00 18.22 ? 484 MET A CE  1 
ATOM   78   N N   . ASP A 1 17  ? -11.399 -1.875  -15.438 1.00 11.99 ? 485 ASP A N   1 
ATOM   79   C CA  . ASP A 1 17  ? -10.301 -1.492  -16.336 1.00 12.43 ? 485 ASP A CA  1 
ATOM   80   C C   . ASP A 1 17  ? -9.105  -0.939  -15.566 1.00 11.88 ? 485 ASP A C   1 
ATOM   81   O O   . ASP A 1 17  ? -7.954  -1.114  -15.991 1.00 12.16 ? 485 ASP A O   1 
ATOM   82   C CB  . ASP A 1 17  ? -10.772 -0.469  -17.376 1.00 13.74 ? 485 ASP A CB  1 
ATOM   83   C CG  . ASP A 1 17  ? -11.411 -1.109  -18.601 1.00 16.27 ? 485 ASP A CG  1 
ATOM   84   O OD1 . ASP A 1 17  ? -11.290 -2.341  -18.807 1.00 20.51 ? 485 ASP A OD1 1 
ATOM   85   O OD2 . ASP A 1 17  ? -12.022 -0.353  -19.378 1.00 21.51 ? 485 ASP A OD2 1 
ATOM   86   N N   . LEU A 1 18  ? -9.372  -0.262  -14.448 1.00 11.45 ? 486 LEU A N   1 
ATOM   87   C CA  . LEU A 1 18  ? -8.294  0.328   -13.642 1.00 10.87 ? 486 LEU A CA  1 
ATOM   88   C C   . LEU A 1 18  ? -7.837  -0.545  -12.489 1.00 10.81 ? 486 LEU A C   1 
ATOM   89   O O   . LEU A 1 18  ? -6.685  -0.451  -12.070 1.00 9.69  ? 486 LEU A O   1 
ATOM   90   C CB  . LEU A 1 18  ? -8.708  1.690   -13.083 1.00 12.13 ? 486 LEU A CB  1 
ATOM   91   C CG  . LEU A 1 18  ? -9.065  2.813   -14.060 1.00 14.12 ? 486 LEU A CG  1 
ATOM   92   C CD1 . LEU A 1 18  ? -9.470  4.021   -13.221 1.00 16.03 ? 486 LEU A CD1 1 
ATOM   93   C CD2 . LEU A 1 18  ? -7.914  3.162   -14.995 1.00 17.35 ? 486 LEU A CD2 1 
ATOM   94   N N   . TYR A 1 19  ? -8.725  -1.394  -11.971 1.00 10.15 ? 487 TYR A N   1 
ATOM   95   C CA  . TYR A 1 19  ? -8.478  -2.026  -10.670 1.00 10.09 ? 487 TYR A CA  1 
ATOM   96   C C   . TYR A 1 19  ? -8.621  -3.540  -10.599 1.00 10.19 ? 487 TYR A C   1 
ATOM   97   O O   . TYR A 1 19  ? -8.413  -4.118  -9.531  1.00 9.82  ? 487 TYR A O   1 
ATOM   98   C CB  . TYR A 1 19  ? -9.369  -1.378  -9.579  1.00 9.98  ? 487 TYR A CB  1 
ATOM   99   C CG  . TYR A 1 19  ? -9.227  0.127   -9.512  1.00 11.17 ? 487 TYR A CG  1 
ATOM   100  C CD1 . TYR A 1 19  ? -10.340 0.955   -9.673  1.00 12.56 ? 487 TYR A CD1 1 
ATOM   101  C CD2 . TYR A 1 19  ? -7.982  0.717   -9.303  1.00 12.54 ? 487 TYR A CD2 1 
ATOM   102  C CE1 . TYR A 1 19  ? -10.215 2.338   -9.625  1.00 14.86 ? 487 TYR A CE1 1 
ATOM   103  C CE2 . TYR A 1 19  ? -7.845  2.103   -9.262  1.00 14.75 ? 487 TYR A CE2 1 
ATOM   104  C CZ  . TYR A 1 19  ? -8.965  2.899   -9.420  1.00 15.60 ? 487 TYR A CZ  1 
ATOM   105  O OH  . TYR A 1 19  ? -8.832  4.267   -9.379  1.00 17.61 ? 487 TYR A OH  1 
ATOM   106  N N   . SER A 1 20  ? -8.966  -4.199  -11.708 1.00 10.00 ? 488 SER A N   1 
ATOM   107  C CA  A SER A 1 20  ? -9.132  -5.659  -11.735 0.50 10.45 ? 488 SER A CA  1 
ATOM   108  C CA  B SER A 1 20  ? -9.142  -5.643  -11.615 0.50 11.10 ? 488 SER A CA  1 
ATOM   109  C C   . SER A 1 20  ? -7.827  -6.404  -11.444 1.00 10.71 ? 488 SER A C   1 
ATOM   110  O O   . SER A 1 20  ? -6.810  -6.101  -12.071 1.00 10.57 ? 488 SER A O   1 
ATOM   111  C CB  A SER A 1 20  ? -9.646  -6.096  -13.108 0.50 9.97  ? 488 SER A CB  1 
ATOM   112  C CB  B SER A 1 20  ? -9.991  -6.217  -12.745 0.50 11.48 ? 488 SER A CB  1 
ATOM   113  O OG  A SER A 1 20  ? -9.711  -7.504  -13.196 0.50 9.65  ? 488 SER A OG  1 
ATOM   114  O OG  B SER A 1 20  ? -9.430  -5.952  -13.998 0.50 13.23 ? 488 SER A OG  1 
ATOM   115  N N   . PRO A 1 21  ? -7.845  -7.394  -10.537 1.00 10.70 ? 489 PRO A N   1 
ATOM   116  C CA  . PRO A 1 21  ? -6.625  -8.170  -10.346 1.00 10.70 ? 489 PRO A CA  1 
ATOM   117  C C   . PRO A 1 21  ? -6.390  -9.125  -11.514 1.00 9.99  ? 489 PRO A C   1 
ATOM   118  O O   . PRO A 1 21  ? -7.350  -9.584  -12.150 1.00 10.37 ? 489 PRO A O   1 
ATOM   119  C CB  . PRO A 1 21  ? -6.912  -8.965  -9.066  1.00 10.47 ? 489 PRO A CB  1 
ATOM   120  C CG  . PRO A 1 21  ? -8.383  -9.137  -9.067  1.00 12.72 ? 489 PRO A CG  1 
ATOM   121  C CD  . PRO A 1 21  ? -8.935  -7.852  -9.651  1.00 11.57 ? 489 PRO A CD  1 
ATOM   122  N N   . PRO A 1 22  ? -5.123  -9.478  -11.772 1.00 10.07 ? 490 PRO A N   1 
ATOM   123  C CA  . PRO A 1 22  ? -3.935  -9.181  -10.981 1.00 9.90  ? 490 PRO A CA  1 
ATOM   124  C C   . PRO A 1 22  ? -3.196  -7.909  -11.375 1.00 9.84  ? 490 PRO A C   1 
ATOM   125  O O   . PRO A 1 22  ? -2.337  -7.444  -10.626 1.00 10.14 ? 490 PRO A O   1 
ATOM   126  C CB  . PRO A 1 22  ? -3.044  -10.392 -11.248 1.00 10.02 ? 490 PRO A CB  1 
ATOM   127  C CG  . PRO A 1 22  ? -3.359  -10.778 -12.639 1.00 10.24 ? 490 PRO A CG  1 
ATOM   128  C CD  . PRO A 1 22  ? -4.848  -10.465 -12.830 1.00 9.86  ? 490 PRO A CD  1 
ATOM   129  N N   . PHE A 1 23  ? -3.524  -7.361  -12.542 1.00 9.13  ? 491 PHE A N   1 
ATOM   130  C CA  . PHE A 1 23  ? -2.886  -6.160  -13.062 1.00 9.07  ? 491 PHE A CA  1 
ATOM   131  C C   . PHE A 1 23  ? -3.728  -5.630  -14.214 1.00 9.00  ? 491 PHE A C   1 
ATOM   132  O O   . PHE A 1 23  ? -4.607  -6.326  -14.719 1.00 9.66  ? 491 PHE A O   1 
ATOM   133  C CB  . PHE A 1 23  ? -1.435  -6.433  -13.511 1.00 9.83  ? 491 PHE A CB  1 
ATOM   134  C CG  . PHE A 1 23  ? -1.287  -7.582  -14.479 1.00 11.51 ? 491 PHE A CG  1 
ATOM   135  C CD1 . PHE A 1 23  ? -1.651  -7.439  -15.818 1.00 13.91 ? 491 PHE A CD1 1 
ATOM   136  C CD2 . PHE A 1 23  ? -0.751  -8.788  -14.051 1.00 13.09 ? 491 PHE A CD2 1 
ATOM   137  C CE1 . PHE A 1 23  ? -1.507  -8.502  -16.707 1.00 16.39 ? 491 PHE A CE1 1 
ATOM   138  C CE2 . PHE A 1 23  ? -0.597  -9.853  -14.937 1.00 14.85 ? 491 PHE A CE2 1 
ATOM   139  C CZ  . PHE A 1 23  ? -0.980  -9.698  -16.261 1.00 14.67 ? 491 PHE A CZ  1 
ATOM   140  N N   . VAL A 1 24  ? -3.456  -4.396  -14.612 1.00 8.34  ? 492 VAL A N   1 
ATOM   141  C CA  . VAL A 1 24  ? -4.219  -3.720  -15.671 1.00 8.86  ? 492 VAL A CA  1 
ATOM   142  C C   . VAL A 1 24  ? -3.247  -3.135  -16.684 1.00 8.77  ? 492 VAL A C   1 
ATOM   143  O O   . VAL A 1 24  ? -2.043  -3.362  -16.569 1.00 9.15  ? 492 VAL A O   1 
ATOM   144  C CB  . VAL A 1 24  ? -5.146  -2.621  -15.099 1.00 8.64  ? 492 VAL A CB  1 
ATOM   145  C CG1 . VAL A 1 24  ? -6.209  -3.256  -14.184 1.00 9.25  ? 492 VAL A CG1 1 
ATOM   146  C CG2 . VAL A 1 24  ? -4.350  -1.578  -14.340 1.00 10.63 ? 492 VAL A CG2 1 
ATOM   147  N N   . TYR A 1 25  ? -3.755  -2.389  -17.664 1.00 9.26  ? 493 TYR A N   1 
ATOM   148  C CA  . TYR A 1 25  ? -2.917  -1.924  -18.763 1.00 9.36  ? 493 TYR A CA  1 
ATOM   149  C C   . TYR A 1 25  ? -2.750  -0.430  -18.834 1.00 9.97  ? 493 TYR A C   1 
ATOM   150  O O   . TYR A 1 25  ? -3.703  0.336   -18.670 1.00 10.03 ? 493 TYR A O   1 
ATOM   151  C CB  . TYR A 1 25  ? -3.388  -2.482  -20.116 1.00 9.19  ? 493 TYR A CB  1 
ATOM   152  C CG  . TYR A 1 25  ? -3.350  -3.984  -20.104 1.00 8.96  ? 493 TYR A CG  1 
ATOM   153  C CD1 . TYR A 1 25  ? -2.129  -4.670  -20.065 1.00 9.57  ? 493 TYR A CD1 1 
ATOM   154  C CD2 . TYR A 1 25  ? -4.530  -4.725  -20.024 1.00 9.42  ? 493 TYR A CD2 1 
ATOM   155  C CE1 . TYR A 1 25  ? -2.089  -6.051  -20.001 1.00 10.14 ? 493 TYR A CE1 1 
ATOM   156  C CE2 . TYR A 1 25  ? -4.498  -6.117  -19.956 1.00 10.28 ? 493 TYR A CE2 1 
ATOM   157  C CZ  . TYR A 1 25  ? -3.268  -6.767  -19.952 1.00 9.98  ? 493 TYR A CZ  1 
ATOM   158  O OH  . TYR A 1 25  ? -3.201  -8.130  -19.878 1.00 13.25 ? 493 TYR A OH  1 
ATOM   159  N N   . LEU A 1 26  ? -1.524  -0.025  -19.134 1.00 10.17 ? 494 LEU A N   1 
ATOM   160  C CA  . LEU A 1 26  ? -1.212  1.392   -19.275 1.00 11.18 ? 494 LEU A CA  1 
ATOM   161  C C   . LEU A 1 26  ? -1.983  2.067   -20.406 1.00 10.97 ? 494 LEU A C   1 
ATOM   162  O O   . LEU A 1 26  ? -2.454  3.192   -20.235 1.00 11.04 ? 494 LEU A O   1 
ATOM   163  C CB  . LEU A 1 26  ? 0.287   1.576   -19.471 1.00 10.62 ? 494 LEU A CB  1 
ATOM   164  C CG  . LEU A 1 26  ? 1.162   1.226   -18.256 1.00 11.27 ? 494 LEU A CG  1 
ATOM   165  C CD1 . LEU A 1 26  ? 2.632   1.305   -18.633 1.00 12.16 ? 494 LEU A CD1 1 
ATOM   166  C CD2 . LEU A 1 26  ? 0.868   2.148   -17.082 1.00 12.17 ? 494 LEU A CD2 1 
ATOM   167  N N   . SER A 1 27  ? -2.135  1.384   -21.545 1.00 10.77 ? 495 SER A N   1 
ATOM   168  C CA  . SER A 1 27  ? -2.879  1.956   -22.681 1.00 11.15 ? 495 SER A CA  1 
ATOM   169  C C   . SER A 1 27  ? -4.323  2.287   -22.277 1.00 11.12 ? 495 SER A C   1 
ATOM   170  O O   . SER A 1 27  ? -4.855  3.342   -22.649 1.00 11.85 ? 495 SER A O   1 
ATOM   171  C CB  . SER A 1 27  ? -2.850  1.000   -23.872 1.00 11.01 ? 495 SER A CB  1 
ATOM   172  O OG  . SER A 1 27  ? -3.470  -0.229  -23.523 1.00 12.23 ? 495 SER A OG  1 
ATOM   173  N N   . VAL A 1 28  ? -4.933  1.384   -21.515 1.00 10.69 ? 496 VAL A N   1 
ATOM   174  C CA  . VAL A 1 28  ? -6.318  1.513   -21.048 1.00 11.22 ? 496 VAL A CA  1 
ATOM   175  C C   . VAL A 1 28  ? -6.407  2.676   -20.049 1.00 11.85 ? 496 VAL A C   1 
ATOM   176  O O   . VAL A 1 28  ? -7.324  3.501   -20.124 1.00 12.59 ? 496 VAL A O   1 
ATOM   177  C CB  . VAL A 1 28  ? -6.813  0.177   -20.432 1.00 11.26 ? 496 VAL A CB  1 
ATOM   178  C CG1 . VAL A 1 28  ? -8.199  0.317   -19.766 1.00 11.86 ? 496 VAL A CG1 1 
ATOM   179  C CG2 . VAL A 1 28  ? -6.873  -0.901  -21.507 1.00 12.07 ? 496 VAL A CG2 1 
ATOM   180  N N   . LEU A 1 29  ? -5.437  2.758   -19.135 1.00 11.66 ? 497 LEU A N   1 
ATOM   181  C CA  . LEU A 1 29  ? -5.374  3.890   -18.203 1.00 12.01 ? 497 LEU A CA  1 
ATOM   182  C C   . LEU A 1 29  ? -5.317  5.209   -18.968 1.00 13.22 ? 497 LEU A C   1 
ATOM   183  O O   . LEU A 1 29  ? -6.108  6.115   -18.710 1.00 13.17 ? 497 LEU A O   1 
ATOM   184  C CB  . LEU A 1 29  ? -4.155  3.767   -17.265 1.00 12.37 ? 497 LEU A CB  1 
ATOM   185  C CG  . LEU A 1 29  ? -3.808  5.013   -16.436 1.00 11.98 ? 497 LEU A CG  1 
ATOM   186  C CD1 . LEU A 1 29  ? -4.929  5.367   -15.457 1.00 13.80 ? 497 LEU A CD1 1 
ATOM   187  C CD2 . LEU A 1 29  ? -2.484  4.836   -15.713 1.00 12.42 ? 497 LEU A CD2 1 
ATOM   188  N N   . MET A 1 30  ? -4.390  5.304   -19.913 1.00 13.45 ? 498 MET A N   1 
ATOM   189  C CA  . MET A 1 30  ? -4.195  6.546   -20.673 1.00 14.40 ? 498 MET A CA  1 
ATOM   190  C C   . MET A 1 30  ? -5.400  6.925   -21.530 1.00 14.88 ? 498 MET A C   1 
ATOM   191  O O   . MET A 1 30  ? -5.759  8.106   -21.620 1.00 14.69 ? 498 MET A O   1 
ATOM   192  C CB  . MET A 1 30  ? -2.898  6.491   -21.484 1.00 14.69 ? 498 MET A CB  1 
ATOM   193  C CG  . MET A 1 30  ? -1.636  6.376   -20.613 1.00 15.07 ? 498 MET A CG  1 
ATOM   194  S SD  . MET A 1 30  ? -1.572  7.514   -19.206 1.00 17.80 ? 498 MET A SD  1 
ATOM   195  C CE  . MET A 1 30  ? -0.137  6.881   -18.330 1.00 18.95 ? 498 MET A CE  1 
ATOM   196  N N   . ALA A 1 31  ? -6.021  5.923   -22.149 1.00 15.01 ? 499 ALA A N   1 
ATOM   197  C CA  . ALA A 1 31  ? -7.220  6.143   -22.957 1.00 15.75 ? 499 ALA A CA  1 
ATOM   198  C C   . ALA A 1 31  ? -8.385  6.683   -22.124 1.00 16.49 ? 499 ALA A C   1 
ATOM   199  O O   . ALA A 1 31  ? -9.265  7.375   -22.664 1.00 17.22 ? 499 ALA A O   1 
ATOM   200  C CB  . ALA A 1 31  ? -7.622  4.861   -23.674 1.00 15.79 ? 499 ALA A CB  1 
ATOM   201  N N   . SER A 1 32  ? -8.392  6.387   -20.820 1.00 16.39 ? 500 SER A N   1 
ATOM   202  C CA  . SER A 1 32  ? -9.462  6.859   -19.925 1.00 16.91 ? 500 SER A CA  1 
ATOM   203  C C   . SER A 1 32  ? -9.338  8.358   -19.609 1.00 17.24 ? 500 SER A C   1 
ATOM   204  O O   . SER A 1 32  ? -10.255 8.955   -19.032 1.00 17.71 ? 500 SER A O   1 
ATOM   205  C CB  . SER A 1 32  ? -9.522  6.028   -18.635 1.00 16.95 ? 500 SER A CB  1 
ATOM   206  O OG  . SER A 1 32  ? -8.504  6.415   -17.718 1.00 16.39 ? 500 SER A OG  1 
ATOM   207  N N   . LYS A 1 33  ? -8.209  8.951   -19.998 1.00 17.48 ? 501 LYS A N   1 
ATOM   208  C CA  . LYS A 1 33  ? -7.921  10.379  -19.780 1.00 17.83 ? 501 LYS A CA  1 
ATOM   209  C C   . LYS A 1 33  ? -8.154  10.813  -18.324 1.00 17.75 ? 501 LYS A C   1 
ATOM   210  O O   . LYS A 1 33  ? -9.027  11.646  -18.042 1.00 18.12 ? 501 LYS A O   1 
ATOM   211  C CB  . LYS A 1 33  ? -8.732  11.254  -20.753 1.00 18.69 ? 501 LYS A CB  1 
ATOM   212  C CG  . LYS A 1 33  ? -8.452  10.975  -22.231 1.00 20.72 ? 501 LYS A CG  1 
ATOM   213  C CD  . LYS A 1 33  ? -7.077  11.445  -22.667 1.00 24.79 ? 501 LYS A CD  1 
ATOM   214  C CE  . LYS A 1 33  ? -6.872  11.224  -24.164 1.00 26.71 ? 501 LYS A CE  1 
ATOM   215  N NZ  . LYS A 1 33  ? -5.509  11.652  -24.602 1.00 29.21 ? 501 LYS A NZ  1 
ATOM   216  N N   . PRO A 1 34  ? -7.376  10.243  -17.385 1.00 17.09 ? 502 PRO A N   1 
ATOM   217  C CA  . PRO A 1 34  ? -7.572  10.566  -15.969 1.00 17.03 ? 502 PRO A CA  1 
ATOM   218  C C   . PRO A 1 34  ? -7.408  12.063  -15.675 1.00 17.12 ? 502 PRO A C   1 
ATOM   219  O O   . PRO A 1 34  ? -6.610  12.750  -16.322 1.00 17.17 ? 502 PRO A O   1 
ATOM   220  C CB  . PRO A 1 34  ? -6.476  9.751   -15.261 1.00 16.89 ? 502 PRO A CB  1 
ATOM   221  C CG  . PRO A 1 34  ? -5.504  9.407   -16.321 1.00 16.95 ? 502 PRO A CG  1 
ATOM   222  C CD  . PRO A 1 34  ? -6.281  9.275   -17.582 1.00 17.44 ? 502 PRO A CD  1 
ATOM   223  N N   . LYS A 1 35  ? -8.181  12.549  -14.712 1.00 18.28 ? 503 LYS A N   1 
ATOM   224  C CA  . LYS A 1 35  ? -8.119  13.957  -14.328 1.00 19.13 ? 503 LYS A CA  1 
ATOM   225  C C   . LYS A 1 35  ? -7.457  14.154  -12.974 1.00 18.99 ? 503 LYS A C   1 
ATOM   226  O O   . LYS A 1 35  ? -7.015  15.260  -12.644 1.00 19.96 ? 503 LYS A O   1 
ATOM   227  C CB  . LYS A 1 35  ? -9.516  14.587  -14.350 1.00 19.61 ? 503 LYS A CB  1 
ATOM   228  C CG  . LYS A 1 35  ? -10.183 14.568  -15.722 1.00 22.61 ? 503 LYS A CG  1 
ATOM   229  C CD  . LYS A 1 35  ? -9.282  15.168  -16.793 1.00 27.89 ? 503 LYS A CD  1 
ATOM   230  C CE  . LYS A 1 35  ? -9.840  14.948  -18.189 1.00 30.11 ? 503 LYS A CE  1 
ATOM   231  N NZ  . LYS A 1 35  ? -8.790  15.147  -19.231 1.00 32.24 ? 503 LYS A NZ  1 
ATOM   232  N N   . GLU A 1 36  ? -7.386  13.076  -12.203 1.00 18.22 ? 504 GLU A N   1 
ATOM   233  C CA  . GLU A 1 36  ? -6.759  13.087  -10.885 1.00 17.74 ? 504 GLU A CA  1 
ATOM   234  C C   . GLU A 1 36  ? -5.673  12.021  -10.820 1.00 16.49 ? 504 GLU A C   1 
ATOM   235  O O   . GLU A 1 36  ? -5.606  11.135  -11.689 1.00 15.58 ? 504 GLU A O   1 
ATOM   236  C CB  . GLU A 1 36  ? -7.793  12.848  -9.787  1.00 18.78 ? 504 GLU A CB  1 
ATOM   237  C CG  . GLU A 1 36  ? -8.446  11.471  -9.793  1.00 22.44 ? 504 GLU A CG  1 
ATOM   238  C CD  . GLU A 1 36  ? -9.456  11.281  -8.668  1.00 27.11 ? 504 GLU A CD  1 
ATOM   239  O OE1 . GLU A 1 36  ? -10.121 10.224  -8.645  1.00 30.12 ? 504 GLU A OE1 1 
ATOM   240  O OE2 . GLU A 1 36  ? -9.596  12.183  -7.814  1.00 30.30 ? 504 GLU A OE2 1 
ATOM   241  N N   . VAL A 1 37  ? -4.826  12.117  -9.799  1.00 15.33 ? 505 VAL A N   1 
ATOM   242  C CA  . VAL A 1 37  ? -3.801  11.096  -9.570  1.00 14.34 ? 505 VAL A CA  1 
ATOM   243  C C   . VAL A 1 37  ? -4.481  9.739   -9.452  1.00 13.79 ? 505 VAL A C   1 
ATOM   244  O O   . VAL A 1 37  ? -5.419  9.573   -8.664  1.00 14.59 ? 505 VAL A O   1 
ATOM   245  C CB  . VAL A 1 37  ? -2.956  11.377  -8.310  1.00 14.28 ? 505 VAL A CB  1 
ATOM   246  C CG1 . VAL A 1 37  ? -2.010  10.211  -8.028  1.00 13.28 ? 505 VAL A CG1 1 
ATOM   247  C CG2 . VAL A 1 37  ? -2.159  12.653  -8.493  1.00 15.20 ? 505 VAL A CG2 1 
ATOM   248  N N   . THR A 1 38  ? -3.998  8.782   -10.250 1.00 12.81 ? 506 THR A N   1 
ATOM   249  C CA  . THR A 1 38  ? -4.593  7.456   -10.345 1.00 12.26 ? 506 THR A CA  1 
ATOM   250  C C   . THR A 1 38  ? -3.505  6.422   -10.124 1.00 11.59 ? 506 THR A C   1 
ATOM   251  O O   . THR A 1 38  ? -2.438  6.521   -10.740 1.00 11.92 ? 506 THR A O   1 
ATOM   252  C CB  . THR A 1 38  ? -5.232  7.267   -11.738 1.00 12.30 ? 506 THR A CB  1 
ATOM   253  O OG1 . THR A 1 38  ? -6.178  8.322   -11.952 1.00 12.97 ? 506 THR A OG1 1 
ATOM   254  C CG2 . THR A 1 38  ? -5.956  5.932   -11.852 1.00 12.89 ? 506 THR A CG2 1 
ATOM   255  N N   . THR A 1 39  ? -3.777  5.447   -9.257  1.00 11.76 ? 507 THR A N   1 
ATOM   256  C CA  . THR A 1 39  ? -2.796  4.410   -8.913  1.00 12.33 ? 507 THR A CA  1 
ATOM   257  C C   . THR A 1 39  ? -3.266  3.052   -9.424  1.00 12.04 ? 507 THR A C   1 
ATOM   258  O O   . THR A 1 39  ? -4.383  2.619   -9.116  1.00 12.36 ? 507 THR A O   1 
ATOM   259  C CB  . THR A 1 39  ? -2.552  4.369   -7.389  1.00 12.08 ? 507 THR A CB  1 
ATOM   260  O OG1 . THR A 1 39  ? -2.107  5.658   -6.954  1.00 14.49 ? 507 THR A OG1 1 
ATOM   261  C CG2 . THR A 1 39  ? -1.496  3.344   -7.023  1.00 12.67 ? 507 THR A CG2 1 
ATOM   262  N N   . VAL A 1 40  ? -2.419  2.395   -10.218 1.00 11.23 ? 508 VAL A N   1 
ATOM   263  C CA  . VAL A 1 40  ? -2.751  1.101   -10.824 1.00 10.94 ? 508 VAL A CA  1 
ATOM   264  C C   . VAL A 1 40  ? -1.588  0.125   -10.653 1.00 10.59 ? 508 VAL A C   1 
ATOM   265  O O   . VAL A 1 40  ? -0.453  0.538   -10.354 1.00 10.73 ? 508 VAL A O   1 
ATOM   266  C CB  . VAL A 1 40  ? -3.047  1.231   -12.345 1.00 10.74 ? 508 VAL A CB  1 
ATOM   267  C CG1 . VAL A 1 40  ? -4.340  2.043   -12.595 1.00 11.90 ? 508 VAL A CG1 1 
ATOM   268  C CG2 . VAL A 1 40  ? -1.853  1.831   -13.099 1.00 11.83 ? 508 VAL A CG2 1 
ATOM   269  N N   . LYS A 1 41  ? -1.862  -1.160  -10.860 1.00 10.09 ? 509 LYS A N   1 
ATOM   270  C CA  . LYS A 1 41  ? -0.826  -2.191  -10.803 1.00 10.20 ? 509 LYS A CA  1 
ATOM   271  C C   . LYS A 1 41  ? -0.677  -2.740  -12.204 1.00 9.55  ? 509 LYS A C   1 
ATOM   272  O O   . LYS A 1 41  ? -1.677  -3.100  -12.826 1.00 9.27  ? 509 LYS A O   1 
ATOM   273  C CB  . LYS A 1 41  ? -1.201  -3.313  -9.824  1.00 11.02 ? 509 LYS A CB  1 
ATOM   274  C CG  . LYS A 1 41  ? -0.017  -4.151  -9.390  1.00 14.85 ? 509 LYS A CG  1 
ATOM   275  C CD  . LYS A 1 41  ? -0.422  -5.352  -8.556  1.00 18.63 ? 509 LYS A CD  1 
ATOM   276  C CE  . LYS A 1 41  ? -0.539  -5.023  -7.092  1.00 19.77 ? 509 LYS A CE  1 
ATOM   277  N NZ  . LYS A 1 41  ? -0.722  -6.282  -6.299  1.00 18.02 ? 509 LYS A NZ  1 
ATOM   278  N N   . VAL A 1 42  ? 0.566   -2.797  -12.695 1.00 9.40  ? 510 VAL A N   1 
ATOM   279  C CA  . VAL A 1 42  ? 0.848   -3.302  -14.042 1.00 9.32  ? 510 VAL A CA  1 
ATOM   280  C C   . VAL A 1 42  ? 1.982   -4.329  -13.971 1.00 9.31  ? 510 VAL A C   1 
ATOM   281  O O   . VAL A 1 42  ? 2.821   -4.244  -13.079 1.00 10.04 ? 510 VAL A O   1 
ATOM   282  C CB  . VAL A 1 42  ? 1.221   -2.156  -15.023 1.00 9.21  ? 510 VAL A CB  1 
ATOM   283  C CG1 . VAL A 1 42  ? 0.075   -1.136  -15.106 1.00 10.50 ? 510 VAL A CG1 1 
ATOM   284  C CG2 . VAL A 1 42  ? 2.558   -1.481  -14.642 1.00 9.87  ? 510 VAL A CG2 1 
ATOM   285  N N   . LYS A 1 43  ? 2.004   -5.294  -14.892 1.00 9.57  ? 511 LYS A N   1 
ATOM   286  C CA  . LYS A 1 43  ? 3.193   -6.147  -15.039 1.00 9.48  ? 511 LYS A CA  1 
ATOM   287  C C   . LYS A 1 43  ? 4.089   -5.538  -16.101 1.00 9.68  ? 511 LYS A C   1 
ATOM   288  O O   . LYS A 1 43  ? 3.694   -5.372  -17.252 1.00 9.99  ? 511 LYS A O   1 
ATOM   289  C CB  . LYS A 1 43  ? 2.865   -7.603  -15.377 1.00 10.54 ? 511 LYS A CB  1 
ATOM   290  C CG  . LYS A 1 43  ? 4.144   -8.468  -15.275 1.00 10.79 ? 511 LYS A CG  1 
ATOM   291  C CD  . LYS A 1 43  ? 3.938   -9.935  -15.546 1.00 14.00 ? 511 LYS A CD  1 
ATOM   292  C CE  . LYS A 1 43  ? 5.221   -10.705 -15.261 1.00 15.86 ? 511 LYS A CE  1 
ATOM   293  N NZ  . LYS A 1 43  ? 5.171   -12.077 -15.822 1.00 15.03 ? 511 LYS A NZ  1 
ATOM   294  N N   . ALA A 1 44  ? 5.295   -5.167  -15.695 1.00 9.42  ? 512 ALA A N   1 
ATOM   295  C CA  . ALA A 1 44  ? 6.150   -4.367  -16.563 1.00 9.78  ? 512 ALA A CA  1 
ATOM   296  C C   . ALA A 1 44  ? 7.614   -4.714  -16.380 1.00 9.72  ? 512 ALA A C   1 
ATOM   297  O O   . ALA A 1 44  ? 8.004   -5.352  -15.400 1.00 10.12 ? 512 ALA A O   1 
ATOM   298  C CB  . ALA A 1 44  ? 5.917   -2.865  -16.314 1.00 10.02 ? 512 ALA A CB  1 
ATOM   299  N N   . PHE A 1 45  ? 8.394   -4.324  -17.376 1.00 9.27  ? 513 PHE A N   1 
ATOM   300  C CA  . PHE A 1 45  ? 9.850   -4.399  -17.336 1.00 8.93  ? 513 PHE A CA  1 
ATOM   301  C C   . PHE A 1 45  ? 10.403  -3.021  -17.702 1.00 8.93  ? 513 PHE A C   1 
ATOM   302  O O   . PHE A 1 45  ? 9.675   -2.143  -18.222 1.00 9.60  ? 513 PHE A O   1 
ATOM   303  C CB  . PHE A 1 45  ? 10.369  -5.493  -18.287 1.00 8.93  ? 513 PHE A CB  1 
ATOM   304  C CG  . PHE A 1 45  ? 10.212  -5.157  -19.752 1.00 9.22  ? 513 PHE A CG  1 
ATOM   305  C CD1 . PHE A 1 45  ? 8.988   -5.347  -20.400 1.00 9.90  ? 513 PHE A CD1 1 
ATOM   306  C CD2 . PHE A 1 45  ? 11.290  -4.648  -20.485 1.00 9.79  ? 513 PHE A CD2 1 
ATOM   307  C CE1 . PHE A 1 45  ? 8.849   -5.043  -21.749 1.00 10.59 ? 513 PHE A CE1 1 
ATOM   308  C CE2 . PHE A 1 45  ? 11.156  -4.328  -21.832 1.00 10.21 ? 513 PHE A CE2 1 
ATOM   309  C CZ  . PHE A 1 45  ? 9.937   -4.523  -22.471 1.00 11.60 ? 513 PHE A CZ  1 
ATOM   310  N N   . ILE A 1 46  ? 11.685  -2.812  -17.413 1.00 8.68  ? 514 ILE A N   1 
ATOM   311  C CA  . ILE A 1 46  ? 12.349  -1.560  -17.745 1.00 9.52  ? 514 ILE A CA  1 
ATOM   312  C C   . ILE A 1 46  ? 12.971  -1.668  -19.129 1.00 9.45  ? 514 ILE A C   1 
ATOM   313  O O   . ILE A 1 46  ? 13.851  -2.516  -19.363 1.00 10.41 ? 514 ILE A O   1 
ATOM   314  C CB  . ILE A 1 46  ? 13.440  -1.185  -16.711 1.00 9.21  ? 514 ILE A CB  1 
ATOM   315  C CG1 . ILE A 1 46  ? 12.781  -0.861  -15.366 1.00 9.77  ? 514 ILE A CG1 1 
ATOM   316  C CG2 . ILE A 1 46  ? 14.247  0.021   -17.226 1.00 10.78 ? 514 ILE A CG2 1 
ATOM   317  C CD1 . ILE A 1 46  ? 13.776  -0.784  -14.180 1.00 10.36 ? 514 ILE A CD1 1 
ATOM   318  N N   . VAL A 1 47  ? 12.520  -0.805  -20.029 1.00 9.43  ? 515 VAL A N   1 
ATOM   319  C CA  . VAL A 1 47  ? 13.073  -0.726  -21.382 1.00 10.72 ? 515 VAL A CA  1 
ATOM   320  C C   . VAL A 1 47  ? 14.462  -0.116  -21.348 1.00 11.31 ? 515 VAL A C   1 
ATOM   321  O O   . VAL A 1 47  ? 15.411  -0.666  -21.938 1.00 12.40 ? 515 VAL A O   1 
ATOM   322  C CB  . VAL A 1 47  ? 12.140  0.051   -22.325 1.00 10.15 ? 515 VAL A CB  1 
ATOM   323  C CG1 . VAL A 1 47  ? 12.755  0.162   -23.730 1.00 11.91 ? 515 VAL A CG1 1 
ATOM   324  C CG2 . VAL A 1 47  ? 10.779  -0.639  -22.388 1.00 11.21 ? 515 VAL A CG2 1 
ATOM   325  N N   . THR A 1 48  ? 14.584  1.005   -20.643 1.00 11.66 ? 516 THR A N   1 
ATOM   326  C CA  . THR A 1 48  ? 15.869  1.668   -20.481 1.00 12.77 ? 516 THR A CA  1 
ATOM   327  C C   . THR A 1 48  ? 15.801  2.606   -19.279 1.00 12.36 ? 516 THR A C   1 
ATOM   328  O O   . THR A 1 48  ? 14.732  3.123   -18.930 1.00 12.32 ? 516 THR A O   1 
ATOM   329  C CB  . THR A 1 48  ? 16.256  2.475   -21.748 1.00 13.22 ? 516 THR A CB  1 
ATOM   330  O OG1 . THR A 1 48  ? 17.603  2.957   -21.622 1.00 16.20 ? 516 THR A OG1 1 
ATOM   331  C CG2 . THR A 1 48  ? 15.304  3.644   -21.970 1.00 13.70 ? 516 THR A CG2 1 
ATOM   332  N N   . LEU A 1 49  ? 16.950  2.824   -18.651 1.00 12.53 ? 517 LEU A N   1 
ATOM   333  C CA  . LEU A 1 49  ? 17.096  3.936   -17.718 1.00 13.07 ? 517 LEU A CA  1 
ATOM   334  C C   . LEU A 1 49  ? 17.174  5.225   -18.526 1.00 13.42 ? 517 LEU A C   1 
ATOM   335  O O   . LEU A 1 49  ? 17.679  5.236   -19.664 1.00 14.37 ? 517 LEU A O   1 
ATOM   336  C CB  . LEU A 1 49  ? 18.342  3.746   -16.862 1.00 13.26 ? 517 LEU A CB  1 
ATOM   337  C CG  . LEU A 1 49  ? 18.414  2.437   -16.068 1.00 13.35 ? 517 LEU A CG  1 
ATOM   338  C CD1 . LEU A 1 49  ? 19.743  2.338   -15.333 1.00 15.15 ? 517 LEU A CD1 1 
ATOM   339  C CD2 . LEU A 1 49  ? 17.244  2.292   -15.093 1.00 14.33 ? 517 LEU A CD2 1 
ATOM   340  N N   . THR A 1 50  ? 16.658  6.308   -17.965 1.00 13.35 ? 518 THR A N   1 
ATOM   341  C CA  . THR A 1 50  ? 16.589  7.575   -18.689 1.00 14.01 ? 518 THR A CA  1 
ATOM   342  C C   . THR A 1 50  ? 17.321  8.683   -17.955 1.00 13.90 ? 518 THR A C   1 
ATOM   343  O O   . THR A 1 50  ? 17.414  9.811   -18.446 1.00 15.32 ? 518 THR A O   1 
ATOM   344  C CB  . THR A 1 50  ? 15.139  8.023   -18.934 1.00 13.89 ? 518 THR A CB  1 
ATOM   345  O OG1 . THR A 1 50  ? 14.446  8.096   -17.680 1.00 15.13 ? 518 THR A OG1 1 
ATOM   346  C CG2 . THR A 1 50  ? 14.407  7.034   -19.858 1.00 14.99 ? 518 THR A CG2 1 
ATOM   347  N N   . GLY A 1 51  ? 17.839  8.354   -16.782 1.00 14.34 ? 519 GLY A N   1 
ATOM   348  C CA  . GLY A 1 51  ? 18.619  9.305   -16.012 1.00 13.97 ? 519 GLY A CA  1 
ATOM   349  C C   . GLY A 1 51  ? 19.574  8.605   -15.081 1.00 13.96 ? 519 GLY A C   1 
ATOM   350  O O   . GLY A 1 51  ? 19.476  7.395   -14.870 1.00 15.27 ? 519 GLY A O   1 
ATOM   351  N N   . ASN A 1 52  ? 20.498  9.376   -14.519 1.00 13.35 ? 520 ASN A N   1 
ATOM   352  C CA  . ASN A 1 52  ? 21.438  8.843   -13.540 1.00 13.51 ? 520 ASN A CA  1 
ATOM   353  C C   . ASN A 1 52  ? 20.773  8.474   -12.220 1.00 12.93 ? 520 ASN A C   1 
ATOM   354  O O   . ASN A 1 52  ? 19.708  9.008   -11.857 1.00 13.52 ? 520 ASN A O   1 
ATOM   355  C CB  . ASN A 1 52  ? 22.543  9.859   -13.259 1.00 13.99 ? 520 ASN A CB  1 
ATOM   356  C CG  . ASN A 1 52  ? 23.590  9.917   -14.352 1.00 16.06 ? 520 ASN A CG  1 
ATOM   357  O OD1 . ASN A 1 52  ? 23.523  9.198   -15.358 1.00 17.49 ? 520 ASN A OD1 1 
ATOM   358  N ND2 . ASN A 1 52  ? 24.582  10.784  -14.157 1.00 18.66 ? 520 ASN A ND2 1 
ATOM   359  N N   . LEU A 1 53  ? 21.402  7.551   -11.501 1.00 12.78 ? 521 LEU A N   1 
ATOM   360  C CA  . LEU A 1 53  ? 21.030  7.318   -10.120 1.00 12.13 ? 521 LEU A CA  1 
ATOM   361  C C   . LEU A 1 53  ? 21.522  8.512   -9.317  1.00 12.37 ? 521 LEU A C   1 
ATOM   362  O O   . LEU A 1 53  ? 22.714  8.811   -9.318  1.00 13.02 ? 521 LEU A O   1 
ATOM   363  C CB  . LEU A 1 53  ? 21.669  6.037   -9.591  1.00 12.35 ? 521 LEU A CB  1 
ATOM   364  C CG  . LEU A 1 53  ? 21.461  5.786   -8.098  1.00 11.21 ? 521 LEU A CG  1 
ATOM   365  C CD1 . LEU A 1 53  ? 19.989  5.442   -7.787  1.00 13.45 ? 521 LEU A CD1 1 
ATOM   366  C CD2 . LEU A 1 53  ? 22.390  4.667   -7.644  1.00 12.41 ? 521 LEU A CD2 1 
ATOM   367  N N   . SER A 1 54  ? 20.603  9.200   -8.651  1.00 11.77 ? 522 SER A N   1 
ATOM   368  C CA  . SER A 1 54  ? 20.939  10.420  -7.916  1.00 12.30 ? 522 SER A CA  1 
ATOM   369  C C   . SER A 1 54  ? 20.801  10.220  -6.411  1.00 11.27 ? 522 SER A C   1 
ATOM   370  O O   . SER A 1 54  ? 19.973  9.431   -5.948  1.00 10.93 ? 522 SER A O   1 
ATOM   371  C CB  . SER A 1 54  ? 20.050  11.571  -8.380  1.00 12.85 ? 522 SER A CB  1 
ATOM   372  O OG  . SER A 1 54  ? 20.339  12.771  -7.669  1.00 15.41 ? 522 SER A OG  1 
ATOM   373  N N   . SER A 1 55  ? 21.629  10.940  -5.648  1.00 11.66 ? 523 SER A N   1 
ATOM   374  C CA  . SER A 1 55  ? 21.517  10.971  -4.185  1.00 11.97 ? 523 SER A CA  1 
ATOM   375  C C   . SER A 1 55  ? 21.080  12.365  -3.700  1.00 11.82 ? 523 SER A C   1 
ATOM   376  O O   . SER A 1 55  ? 21.143  12.665  -2.502  1.00 12.38 ? 523 SER A O   1 
ATOM   377  C CB  . SER A 1 55  ? 22.842  10.566  -3.533  1.00 12.11 ? 523 SER A CB  1 
ATOM   378  O OG  . SER A 1 55  ? 23.857  11.487  -3.908  1.00 13.14 ? 523 SER A OG  1 
ATOM   379  N N   . SER A 1 56  ? 20.641  13.194  -4.645  1.00 12.02 ? 524 SER A N   1 
ATOM   380  C CA  A SER A 1 56  ? 20.138  14.532  -4.339  0.50 12.55 ? 524 SER A CA  1 
ATOM   381  C CA  B SER A 1 56  ? 20.132  14.531  -4.341  0.50 12.60 ? 524 SER A CA  1 
ATOM   382  C C   . SER A 1 56  ? 18.980  14.469  -3.337  1.00 12.48 ? 524 SER A C   1 
ATOM   383  O O   . SER A 1 56  ? 18.107  13.600  -3.419  1.00 12.24 ? 524 SER A O   1 
ATOM   384  C CB  A SER A 1 56  ? 19.708  15.242  -5.621  0.50 12.79 ? 524 SER A CB  1 
ATOM   385  C CB  B SER A 1 56  ? 19.678  15.233  -5.618  0.50 12.85 ? 524 SER A CB  1 
ATOM   386  O OG  A SER A 1 56  ? 19.299  16.574  -5.370  0.50 13.34 ? 524 SER A OG  1 
ATOM   387  O OG  B SER A 1 56  ? 18.584  14.551  -6.212  0.50 13.72 ? 524 SER A OG  1 
ATOM   388  N N   . GLY A 1 57  ? 18.981  15.391  -2.389  1.00 12.71 ? 525 GLY A N   1 
ATOM   389  C CA  . GLY A 1 57  ? 17.958  15.372  -1.347  1.00 12.77 ? 525 GLY A CA  1 
ATOM   390  C C   . GLY A 1 57  ? 18.199  14.374  -0.232  1.00 12.13 ? 525 GLY A C   1 
ATOM   391  O O   . GLY A 1 57  ? 17.368  14.239  0.665   1.00 12.60 ? 525 GLY A O   1 
ATOM   392  N N   . GLY A 1 58  ? 19.331  13.665  -0.275  1.00 12.14 ? 526 GLY A N   1 
ATOM   393  C CA  . GLY A 1 58  ? 19.654  12.659  0.724   1.00 12.07 ? 526 GLY A CA  1 
ATOM   394  C C   . GLY A 1 58  ? 18.882  11.361  0.581   1.00 11.63 ? 526 GLY A C   1 
ATOM   395  O O   . GLY A 1 58  ? 18.795  10.570  1.526   1.00 12.21 ? 526 GLY A O   1 
ATOM   396  N N   . ILE A 1 59  ? 18.307  11.151  -0.607  1.00 10.87 ? 527 ILE A N   1 
ATOM   397  C CA  . ILE A 1 59  ? 17.572  9.932   -0.926  1.00 10.20 ? 527 ILE A CA  1 
ATOM   398  C C   . ILE A 1 59  ? 18.001  9.486   -2.307  1.00 9.54  ? 527 ILE A C   1 
ATOM   399  O O   . ILE A 1 59  ? 18.555  10.283  -3.066  1.00 9.30  ? 527 ILE A O   1 
ATOM   400  C CB  . ILE A 1 59  ? 16.018  10.129  -0.938  1.00 10.09 ? 527 ILE A CB  1 
ATOM   401  C CG1 . ILE A 1 59  ? 15.603  11.238  -1.919  1.00 10.97 ? 527 ILE A CG1 1 
ATOM   402  C CG2 . ILE A 1 59  ? 15.483  10.404  0.477   1.00 10.93 ? 527 ILE A CG2 1 
ATOM   403  C CD1 . ILE A 1 59  ? 14.173  11.083  -2.428  1.00 13.06 ? 527 ILE A CD1 1 
ATOM   404  N N   . TRP A 1 60  ? 17.751  8.217   -2.625  1.00 9.97  ? 528 TRP A N   1 
ATOM   405  C CA  . TRP A 1 60  ? 17.994  7.710   -3.981  1.00 9.44  ? 528 TRP A CA  1 
ATOM   406  C C   . TRP A 1 60  ? 16.845  8.037   -4.923  1.00 9.61  ? 528 TRP A C   1 
ATOM   407  O O   . TRP A 1 60  ? 15.682  7.955   -4.537  1.00 10.64 ? 528 TRP A O   1 
ATOM   408  C CB  . TRP A 1 60  ? 18.147  6.190   -3.973  1.00 9.45  ? 528 TRP A CB  1 
ATOM   409  C CG  . TRP A 1 60  ? 19.318  5.659   -3.222  1.00 10.12 ? 528 TRP A CG  1 
ATOM   410  C CD1 . TRP A 1 60  ? 19.284  4.812   -2.161  1.00 10.53 ? 528 TRP A CD1 1 
ATOM   411  C CD2 . TRP A 1 60  ? 20.706  5.897   -3.508  1.00 10.15 ? 528 TRP A CD2 1 
ATOM   412  N NE1 . TRP A 1 60  ? 20.565  4.530   -1.739  1.00 10.91 ? 528 TRP A NE1 1 
ATOM   413  C CE2 . TRP A 1 60  ? 21.456  5.173   -2.553  1.00 10.20 ? 528 TRP A CE2 1 
ATOM   414  C CE3 . TRP A 1 60  ? 21.387  6.664   -4.466  1.00 11.39 ? 528 TRP A CE3 1 
ATOM   415  C CZ2 . TRP A 1 60  ? 22.857  5.207   -2.522  1.00 11.44 ? 528 TRP A CZ2 1 
ATOM   416  C CZ3 . TRP A 1 60  ? 22.782  6.684   -4.443  1.00 11.41 ? 528 TRP A CZ3 1 
ATOM   417  C CH2 . TRP A 1 60  ? 23.499  5.954   -3.470  1.00 12.39 ? 528 TRP A CH2 1 
ATOM   418  N N   . SER A 1 61  ? 17.188  8.414   -6.150  1.00 9.86  ? 529 SER A N   1 
ATOM   419  C CA  . SER A 1 61  ? 16.182  8.530   -7.207  1.00 9.64  ? 529 SER A CA  1 
ATOM   420  C C   . SER A 1 61  ? 16.778  8.086   -8.531  1.00 9.86  ? 529 SER A C   1 
ATOM   421  O O   . SER A 1 61  ? 17.987  8.149   -8.724  1.00 10.74 ? 529 SER A O   1 
ATOM   422  C CB  . SER A 1 61  ? 15.630  9.961   -7.296  1.00 10.29 ? 529 SER A CB  1 
ATOM   423  O OG  . SER A 1 61  ? 16.643  10.889  -7.653  1.00 10.85 ? 529 SER A OG  1 
ATOM   424  N N   . ILE A 1 62  ? 15.919  7.613   -9.428  1.00 10.37 ? 530 ILE A N   1 
ATOM   425  C CA  . ILE A 1 62  ? 16.334  7.294   -10.784 1.00 10.93 ? 530 ILE A CA  1 
ATOM   426  C C   . ILE A 1 62  ? 15.096  7.331   -11.661 1.00 11.17 ? 530 ILE A C   1 
ATOM   427  O O   . ILE A 1 62  ? 13.995  7.048   -11.183 1.00 12.31 ? 530 ILE A O   1 
ATOM   428  C CB  . ILE A 1 62  ? 17.066  5.922   -10.871 1.00 11.20 ? 530 ILE A CB  1 
ATOM   429  C CG1 . ILE A 1 62  ? 17.887  5.831   -12.164 1.00 13.48 ? 530 ILE A CG1 1 
ATOM   430  C CG2 . ILE A 1 62  ? 16.083  4.737   -10.702 1.00 12.03 ? 530 ILE A CG2 1 
ATOM   431  C CD1 . ILE A 1 62  ? 18.892  4.665   -12.178 1.00 15.16 ? 530 ILE A CD1 1 
ATOM   432  N N   . THR A 1 63  ? 15.262  7.708   -12.923 1.00 10.80 ? 531 THR A N   1 
ATOM   433  C CA  . THR A 1 63  ? 14.143  7.648   -13.857 1.00 11.59 ? 531 THR A CA  1 
ATOM   434  C C   . THR A 1 63  ? 14.361  6.533   -14.878 1.00 11.05 ? 531 THR A C   1 
ATOM   435  O O   . THR A 1 63  ? 15.496  6.232   -15.262 1.00 11.44 ? 531 THR A O   1 
ATOM   436  C CB  . THR A 1 63  ? 13.895  8.995   -14.560 1.00 11.39 ? 531 THR A CB  1 
ATOM   437  O OG1 . THR A 1 63  ? 15.044  9.361   -15.332 1.00 13.18 ? 531 THR A OG1 1 
ATOM   438  C CG2 . THR A 1 63  ? 13.638  10.079  -13.531 1.00 13.05 ? 531 THR A CG2 1 
ATOM   439  N N   . ALA A 1 64  ? 13.264  5.911   -15.295 1.00 11.58 ? 532 ALA A N   1 
ATOM   440  C CA  . ALA A 1 64  ? 13.325  4.818   -16.253 1.00 11.94 ? 532 ALA A CA  1 
ATOM   441  C C   . ALA A 1 64  ? 12.090  4.823   -17.121 1.00 12.35 ? 532 ALA A C   1 
ATOM   442  O O   . ALA A 1 64  ? 11.047  5.336   -16.726 1.00 13.61 ? 532 ALA A O   1 
ATOM   443  C CB  . ALA A 1 64  ? 13.441  3.496   -15.540 1.00 12.33 ? 532 ALA A CB  1 
ATOM   444  N N   . LYS A 1 65  ? 12.217  4.239   -18.304 1.00 11.45 ? 533 LYS A N   1 
ATOM   445  C CA  . LYS A 1 65  ? 11.074  4.045   -19.170 1.00 11.17 ? 533 LYS A CA  1 
ATOM   446  C C   . LYS A 1 65  ? 10.664  2.591   -19.042 1.00 10.91 ? 533 LYS A C   1 
ATOM   447  O O   . LYS A 1 65  ? 11.465  1.699   -19.310 1.00 10.72 ? 533 LYS A O   1 
ATOM   448  C CB  . LYS A 1 65  ? 11.465  4.351   -20.610 1.00 12.07 ? 533 LYS A CB  1 
ATOM   449  C CG  . LYS A 1 65  ? 10.309  4.245   -21.600 1.00 14.11 ? 533 LYS A CG  1 
ATOM   450  C CD  . LYS A 1 65  ? 10.813  4.443   -23.041 1.00 16.24 ? 533 LYS A CD  1 
ATOM   451  C CE  . LYS A 1 65  ? 11.504  5.789   -23.229 1.00 19.31 ? 533 LYS A CE  1 
ATOM   452  N NZ  . LYS A 1 65  ? 10.600  6.944   -22.949 1.00 21.03 ? 533 LYS A NZ  1 
ATOM   453  N N   . VAL A 1 66  ? 9.431   2.351   -18.597 1.00 9.85  ? 534 VAL A N   1 
ATOM   454  C CA  . VAL A 1 66  ? 8.924   0.990   -18.471 1.00 9.85  ? 534 VAL A CA  1 
ATOM   455  C C   . VAL A 1 66  ? 7.919   0.694   -19.572 1.00 9.41  ? 534 VAL A C   1 
ATOM   456  O O   . VAL A 1 66  ? 7.401   1.609   -20.219 1.00 10.13 ? 534 VAL A O   1 
ATOM   457  C CB  . VAL A 1 66  ? 8.278   0.728   -17.078 1.00 9.12  ? 534 VAL A CB  1 
ATOM   458  C CG1 . VAL A 1 66  ? 9.270   1.021   -15.973 1.00 10.73 ? 534 VAL A CG1 1 
ATOM   459  C CG2 . VAL A 1 66  ? 7.007   1.557   -16.881 1.00 9.82  ? 534 VAL A CG2 1 
ATOM   460  N N   . SER A 1 67  ? 7.659   -0.588  -19.787 1.00 9.52  ? 535 SER A N   1 
ATOM   461  C CA  . SER A 1 67  ? 6.541   -0.986  -20.634 1.00 9.71  ? 535 SER A CA  1 
ATOM   462  C C   . SER A 1 67  ? 5.818   -2.173  -20.068 1.00 9.95  ? 535 SER A C   1 
ATOM   463  O O   . SER A 1 67  ? 6.432   -3.067  -19.468 1.00 9.87  ? 535 SER A O   1 
ATOM   464  C CB  . SER A 1 67  ? 6.995   -1.294  -22.056 1.00 9.67  ? 535 SER A CB  1 
ATOM   465  O OG  . SER A 1 67  ? 5.841   -1.556  -22.867 1.00 10.68 ? 535 SER A OG  1 
ATOM   466  N N   . ASP A 1 68  ? 4.500   -2.186  -20.263 1.00 9.26  ? 536 ASP A N   1 
ATOM   467  C CA  . ASP A 1 68  ? 3.666   -3.324  -19.872 1.00 9.20  ? 536 ASP A CA  1 
ATOM   468  C C   . ASP A 1 68  ? 3.182   -4.095  -21.103 1.00 9.25  ? 536 ASP A C   1 
ATOM   469  O O   . ASP A 1 68  ? 2.293   -4.957  -21.006 1.00 9.90  ? 536 ASP A O   1 
ATOM   470  C CB  . ASP A 1 68  ? 2.463   -2.849  -19.057 1.00 9.25  ? 536 ASP A CB  1 
ATOM   471  C CG  . ASP A 1 68  ? 1.471   -2.087  -19.890 1.00 10.50 ? 536 ASP A CG  1 
ATOM   472  O OD1 . ASP A 1 68  ? 1.835   -1.559  -20.962 1.00 11.47 ? 536 ASP A OD1 1 
ATOM   473  O OD2 . ASP A 1 68  ? 0.308   -2.023  -19.454 1.00 13.57 ? 536 ASP A OD2 1 
ATOM   474  N N   . GLY A 1 69  ? 3.775   -3.794  -22.258 1.00 9.01  ? 537 GLY A N   1 
ATOM   475  C CA  . GLY A 1 69  ? 3.336   -4.399  -23.520 1.00 9.94  ? 537 GLY A CA  1 
ATOM   476  C C   . GLY A 1 69  ? 2.290   -3.586  -24.267 1.00 10.30 ? 537 GLY A C   1 
ATOM   477  O O   . GLY A 1 69  ? 1.998   -3.888  -25.433 1.00 11.18 ? 537 GLY A O   1 
ATOM   478  N N   . THR A 1 70  ? 1.739   -2.549  -23.636 1.00 9.76  ? 538 THR A N   1 
ATOM   479  C CA  . THR A 1 70  ? 0.692   -1.731  -24.279 1.00 10.57 ? 538 THR A CA  1 
ATOM   480  C C   . THR A 1 70  ? 1.079   -0.265  -24.466 1.00 10.53 ? 538 THR A C   1 
ATOM   481  O O   . THR A 1 70  ? 0.471   0.445   -25.268 1.00 11.54 ? 538 THR A O   1 
ATOM   482  C CB  . THR A 1 70  ? -0.659  -1.781  -23.528 1.00 10.58 ? 538 THR A CB  1 
ATOM   483  O OG1 . THR A 1 70  ? -0.569  -1.045  -22.298 1.00 11.52 ? 538 THR A OG1 1 
ATOM   484  C CG2 . THR A 1 70  ? -1.099  -3.221  -23.265 1.00 11.57 ? 538 THR A CG2 1 
ATOM   485  N N   . ALA A 1 71  ? 2.064   0.196   -23.699 1.00 11.12 ? 539 ALA A N   1 
ATOM   486  C CA  . ALA A 1 71  ? 2.500   1.589   -23.762 1.00 11.85 ? 539 ALA A CA  1 
ATOM   487  C C   . ALA A 1 71  ? 3.872   1.700   -23.142 1.00 11.88 ? 539 ALA A C   1 
ATOM   488  O O   . ALA A 1 71  ? 4.329   0.755   -22.481 1.00 12.75 ? 539 ALA A O   1 
ATOM   489  C CB  . ALA A 1 71  ? 1.515   2.488   -23.013 1.00 12.35 ? 539 ALA A CB  1 
ATOM   490  N N   . TYR A 1 72  ? 4.540   2.832   -23.383 1.00 11.85 ? 540 TYR A N   1 
ATOM   491  C CA  . TYR A 1 72  ? 5.724   3.217   -22.622 1.00 11.95 ? 540 TYR A CA  1 
ATOM   492  C C   . TYR A 1 72  ? 5.320   4.218   -21.558 1.00 11.76 ? 540 TYR A C   1 
ATOM   493  O O   . TYR A 1 72  ? 4.378   5.004   -21.746 1.00 12.87 ? 540 TYR A O   1 
ATOM   494  C CB  . TYR A 1 72  ? 6.767   3.860   -23.529 1.00 11.37 ? 540 TYR A CB  1 
ATOM   495  C CG  . TYR A 1 72  ? 7.346   2.923   -24.552 1.00 13.10 ? 540 TYR A CG  1 
ATOM   496  C CD1 . TYR A 1 72  ? 8.220   1.899   -24.177 1.00 13.81 ? 540 TYR A CD1 1 
ATOM   497  C CD2 . TYR A 1 72  ? 7.019   3.054   -25.895 1.00 14.83 ? 540 TYR A CD2 1 
ATOM   498  C CE1 . TYR A 1 72  ? 8.754   1.029   -25.124 1.00 16.46 ? 540 TYR A CE1 1 
ATOM   499  C CE2 . TYR A 1 72  ? 7.547   2.189   -26.852 1.00 16.71 ? 540 TYR A CE2 1 
ATOM   500  C CZ  . TYR A 1 72  ? 8.416   1.184   -26.459 1.00 18.19 ? 540 TYR A CZ  1 
ATOM   501  O OH  . TYR A 1 72  ? 8.935   0.323   -27.408 1.00 21.32 ? 540 TYR A OH  1 
ATOM   502  N N   . LEU A 1 73  ? 6.036   4.201   -20.442 1.00 10.95 ? 541 LEU A N   1 
ATOM   503  C CA  . LEU A 1 73  ? 5.789   5.189   -19.397 1.00 11.08 ? 541 LEU A CA  1 
ATOM   504  C C   . LEU A 1 73  ? 7.091   5.516   -18.696 1.00 11.34 ? 541 LEU A C   1 
ATOM   505  O O   . LEU A 1 73  ? 7.794   4.626   -18.243 1.00 11.80 ? 541 LEU A O   1 
ATOM   506  C CB  . LEU A 1 73  ? 4.751   4.679   -18.388 1.00 10.71 ? 541 LEU A CB  1 
ATOM   507  C CG  . LEU A 1 73  ? 4.402   5.629   -17.233 1.00 11.93 ? 541 LEU A CG  1 
ATOM   508  C CD1 . LEU A 1 73  ? 3.689   6.860   -17.750 1.00 13.07 ? 541 LEU A CD1 1 
ATOM   509  C CD2 . LEU A 1 73  ? 3.533   4.921   -16.185 1.00 14.07 ? 541 LEU A CD2 1 
ATOM   510  N N   . ASP A 1 74  ? 7.397   6.806   -18.609 1.00 11.84 ? 542 ASP A N   1 
ATOM   511  C CA  . ASP A 1 74  ? 8.552   7.257   -17.851 1.00 12.91 ? 542 ASP A CA  1 
ATOM   512  C C   . ASP A 1 74  ? 8.165   7.351   -16.380 1.00 11.98 ? 542 ASP A C   1 
ATOM   513  O O   . ASP A 1 74  ? 7.127   7.933   -16.029 1.00 12.33 ? 542 ASP A O   1 
ATOM   514  C CB  . ASP A 1 74  ? 9.058   8.595   -18.402 1.00 14.09 ? 542 ASP A CB  1 
ATOM   515  C CG  . ASP A 1 74  ? 9.939   8.427   -19.652 1.00 17.20 ? 542 ASP A CG  1 
ATOM   516  O OD1 . ASP A 1 74  ? 10.119  7.294   -20.148 1.00 20.79 ? 542 ASP A OD1 1 
ATOM   517  O OD2 . ASP A 1 74  ? 10.475  9.439   -20.136 1.00 22.94 ? 542 ASP A OD2 1 
ATOM   518  N N   . VAL A 1 75  ? 8.987   6.746   -15.528 1.00 11.66 ? 543 VAL A N   1 
ATOM   519  C CA  . VAL A 1 75  ? 8.700   6.651   -14.099 1.00 12.24 ? 543 VAL A CA  1 
ATOM   520  C C   . VAL A 1 75  ? 9.890   7.022   -13.210 1.00 13.00 ? 543 VAL A C   1 
ATOM   521  O O   . VAL A 1 75  ? 11.063  6.949   -13.636 1.00 13.76 ? 543 VAL A O   1 
ATOM   522  C CB  . VAL A 1 75  ? 8.218   5.223   -13.678 1.00 12.11 ? 543 VAL A CB  1 
ATOM   523  C CG1 . VAL A 1 75  ? 6.971   4.779   -14.432 1.00 12.68 ? 543 VAL A CG1 1 
ATOM   524  C CG2 . VAL A 1 75  ? 9.338   4.187   -13.858 1.00 12.57 ? 543 VAL A CG2 1 
ATOM   525  N N   . ASP A 1 76  ? 9.554   7.438   -11.989 1.00 13.63 ? 544 ASP A N   1 
ATOM   526  C CA  A ASP A 1 76  ? 10.508  7.551   -10.895 0.50 14.34 ? 544 ASP A CA  1 
ATOM   527  C CA  B ASP A 1 76  ? 10.497  7.557   -10.870 0.50 14.15 ? 544 ASP A CA  1 
ATOM   528  C C   . ASP A 1 76  ? 10.300  6.344   -9.971  1.00 14.70 ? 544 ASP A C   1 
ATOM   529  O O   . ASP A 1 76  ? 9.240   5.738   -9.983  1.00 15.44 ? 544 ASP A O   1 
ATOM   530  C CB  A ASP A 1 76  ? 10.270  8.867   -10.153 0.50 15.02 ? 544 ASP A CB  1 
ATOM   531  C CB  B ASP A 1 76  ? 10.207  8.820   -10.052 0.50 14.56 ? 544 ASP A CB  1 
ATOM   532  C CG  A ASP A 1 76  ? 10.189  10.065  -11.099 0.50 16.25 ? 544 ASP A CG  1 
ATOM   533  C CG  B ASP A 1 76  ? 11.064  10.003  -10.462 0.50 15.32 ? 544 ASP A CG  1 
ATOM   534  O OD1 A ASP A 1 76  ? 9.148   10.755  -11.137 0.50 19.50 ? 544 ASP A OD1 1 
ATOM   535  O OD1 B ASP A 1 76  ? 12.233  10.075  -10.022 0.50 16.64 ? 544 ASP A OD1 1 
ATOM   536  O OD2 A ASP A 1 76  ? 11.169  10.312  -11.825 0.50 18.92 ? 544 ASP A OD2 1 
ATOM   537  O OD2 B ASP A 1 76  ? 10.558  10.874  -11.203 0.50 15.46 ? 544 ASP A OD2 1 
ATOM   538  N N   . PHE A 1 77  ? 11.323  5.965   -9.195  1.00 14.90 ? 545 PHE A N   1 
ATOM   539  C CA  . PHE A 1 77  ? 11.168  4.884   -8.203  1.00 15.59 ? 545 PHE A CA  1 
ATOM   540  C C   . PHE A 1 77  ? 11.289  5.446   -6.793  1.00 15.96 ? 545 PHE A C   1 
ATOM   541  O O   . PHE A 1 77  ? 12.181  6.262   -6.544  1.00 16.16 ? 545 PHE A O   1 
ATOM   542  C CB  . PHE A 1 77  ? 12.235  3.799   -8.401  1.00 15.72 ? 545 PHE A CB  1 
ATOM   543  C CG  . PHE A 1 77  ? 12.029  2.958   -9.617  1.00 14.70 ? 545 PHE A CG  1 
ATOM   544  C CD1 . PHE A 1 77  ? 11.395  1.725   -9.524  1.00 15.02 ? 545 PHE A CD1 1 
ATOM   545  C CD2 . PHE A 1 77  ? 12.460  3.405   -10.863 1.00 15.33 ? 545 PHE A CD2 1 
ATOM   546  C CE1 . PHE A 1 77  ? 11.188  0.946   -10.661 1.00 16.07 ? 545 PHE A CE1 1 
ATOM   547  C CE2 . PHE A 1 77  ? 12.266  2.635   -12.001 1.00 16.29 ? 545 PHE A CE2 1 
ATOM   548  C CZ  . PHE A 1 77  ? 11.634  1.407   -11.902 1.00 15.66 ? 545 PHE A CZ  1 
ATOM   549  N N   . VAL A 1 78  ? 10.414  5.033   -5.869  1.00 15.98 ? 546 VAL A N   1 
ATOM   550  C CA  . VAL A 1 78  ? 10.550  5.526   -4.482  1.00 16.47 ? 546 VAL A CA  1 
ATOM   551  C C   . VAL A 1 78  ? 11.890  5.123   -3.862  1.00 16.24 ? 546 VAL A C   1 
ATOM   552  O O   . VAL A 1 78  ? 12.445  4.060   -4.175  1.00 15.80 ? 546 VAL A O   1 
ATOM   553  C CB  . VAL A 1 78  ? 9.384   5.130   -3.524  1.00 16.90 ? 546 VAL A CB  1 
ATOM   554  C CG1 . VAL A 1 78  ? 8.089   5.855   -3.886  1.00 18.07 ? 546 VAL A CG1 1 
ATOM   555  C CG2 . VAL A 1 78  ? 9.207   3.610   -3.440  1.00 17.47 ? 546 VAL A CG2 1 
ATOM   556  N N   . ASP A 1 79  ? 12.398  5.995   -2.993  1.00 15.42 ? 547 ASP A N   1 
ATOM   557  C CA  . ASP A 1 79  ? 13.696  5.808   -2.325  1.00 14.85 ? 547 ASP A CA  1 
ATOM   558  C C   . ASP A 1 79  ? 13.806  4.456   -1.674  1.00 14.59 ? 547 ASP A C   1 
ATOM   559  O O   . ASP A 1 79  ? 14.844  3.809   -1.761  1.00 14.54 ? 547 ASP A O   1 
ATOM   560  C CB  . ASP A 1 79  ? 13.916  6.928   -1.310  1.00 15.27 ? 547 ASP A CB  1 
ATOM   561  C CG  . ASP A 1 79  ? 15.074  6.657   -0.335  1.00 15.48 ? 547 ASP A CG  1 
ATOM   562  O OD1 . ASP A 1 79  ? 14.795  6.653   0.868   1.00 18.40 ? 547 ASP A OD1 1 
ATOM   563  O OD2 . ASP A 1 79  ? 16.252  6.497   -0.753  1.00 15.79 ? 547 ASP A OD2 1 
ATOM   564  N N   . GLU A 1 80  ? 12.727  4.011   -1.041  1.00 14.02 ? 548 GLU A N   1 
ATOM   565  C CA  . GLU A 1 80  ? 12.729  2.727   -0.351  1.00 14.30 ? 548 GLU A CA  1 
ATOM   566  C C   . GLU A 1 80  ? 13.034  1.536   -1.272  1.00 13.75 ? 548 GLU A C   1 
ATOM   567  O O   . GLU A 1 80  ? 13.700  0.580   -0.849  1.00 14.37 ? 548 GLU A O   1 
ATOM   568  C CB  . GLU A 1 80  ? 11.405  2.517   0.389   1.00 14.98 ? 548 GLU A CB  1 
ATOM   569  C CG  . GLU A 1 80  ? 11.182  3.493   1.539   1.00 17.98 ? 548 GLU A CG  1 
ATOM   570  C CD  . GLU A 1 80  ? 10.388  4.751   1.159   1.00 20.97 ? 548 GLU A CD  1 
ATOM   571  O OE1 . GLU A 1 80  ? 10.417  5.206   -0.015  1.00 18.47 ? 548 GLU A OE1 1 
ATOM   572  O OE2 . GLU A 1 80  ? 9.720   5.296   2.068   1.00 24.43 ? 548 GLU A OE2 1 
ATOM   573  N N   . ILE A 1 81  ? 12.552  1.583   -2.517  1.00 11.82 ? 549 ILE A N   1 
ATOM   574  C CA  . ILE A 1 81  ? 12.833  0.511   -3.460  1.00 11.45 ? 549 ILE A CA  1 
ATOM   575  C C   . ILE A 1 81  ? 14.321  0.492   -3.771  1.00 10.88 ? 549 ILE A C   1 
ATOM   576  O O   . ILE A 1 81  ? 14.950  -0.560  -3.752  1.00 11.09 ? 549 ILE A O   1 
ATOM   577  C CB  . ILE A 1 81  ? 12.011  0.654   -4.758  1.00 11.59 ? 549 ILE A CB  1 
ATOM   578  C CG1 . ILE A 1 81  ? 10.538  0.351   -4.462  1.00 12.92 ? 549 ILE A CG1 1 
ATOM   579  C CG2 . ILE A 1 81  ? 12.558  -0.273  -5.866  1.00 12.36 ? 549 ILE A CG2 1 
ATOM   580  C CD1 . ILE A 1 81  ? 9.587   0.728   -5.598  1.00 13.27 ? 549 ILE A CD1 1 
ATOM   581  N N   . LEU A 1 82  ? 14.877  1.667   -4.036  1.00 10.60 ? 550 LEU A N   1 
ATOM   582  C CA  . LEU A 1 82  ? 16.283  1.735   -4.440  1.00 10.41 ? 550 LEU A CA  1 
ATOM   583  C C   . LEU A 1 82  ? 17.209  1.367   -3.270  1.00 10.55 ? 550 LEU A C   1 
ATOM   584  O O   . LEU A 1 82  ? 18.200  0.646   -3.458  1.00 10.98 ? 550 LEU A O   1 
ATOM   585  C CB  . LEU A 1 82  ? 16.610  3.079   -5.081  1.00 10.49 ? 550 LEU A CB  1 
ATOM   586  C CG  . LEU A 1 82  ? 15.844  3.376   -6.379  1.00 10.30 ? 550 LEU A CG  1 
ATOM   587  C CD1 . LEU A 1 82  ? 15.997  4.827   -6.754  1.00 11.03 ? 550 LEU A CD1 1 
ATOM   588  C CD2 . LEU A 1 82  ? 16.335  2.462   -7.499  1.00 11.92 ? 550 LEU A CD2 1 
ATOM   589  N N   . THR A 1 83  ? 16.859  1.811   -2.064  1.00 11.23 ? 551 THR A N   1 
ATOM   590  C CA  . THR A 1 83  ? 17.599  1.413   -0.859  1.00 10.95 ? 551 THR A CA  1 
ATOM   591  C C   . THR A 1 83  ? 17.606  -0.105  -0.672  1.00 11.85 ? 551 THR A C   1 
ATOM   592  O O   . THR A 1 83  ? 18.646  -0.690  -0.338  1.00 11.67 ? 551 THR A O   1 
ATOM   593  C CB  . THR A 1 83  ? 17.009  2.118   0.383   1.00 10.99 ? 551 THR A CB  1 
ATOM   594  O OG1 . THR A 1 83  ? 17.211  3.528   0.250   1.00 11.21 ? 551 THR A OG1 1 
ATOM   595  C CG2 . THR A 1 83  ? 17.667  1.634   1.672   1.00 10.79 ? 551 THR A CG2 1 
ATOM   596  N N   . SER A 1 84  ? 16.463  -0.747  -0.909  1.00 11.85 ? 552 SER A N   1 
ATOM   597  C CA  A SER A 1 84  ? 16.347  -2.194  -0.767  0.50 12.65 ? 552 SER A CA  1 
ATOM   598  C CA  B SER A 1 84  ? 16.363  -2.194  -0.759  0.50 12.74 ? 552 SER A CA  1 
ATOM   599  C C   . SER A 1 84  ? 17.215  -2.913  -1.799  1.00 12.49 ? 552 SER A C   1 
ATOM   600  O O   . SER A 1 84  ? 17.854  -3.920  -1.497  1.00 13.44 ? 552 SER A O   1 
ATOM   601  C CB  A SER A 1 84  ? 14.884  -2.630  -0.911  0.50 12.57 ? 552 SER A CB  1 
ATOM   602  C CB  B SER A 1 84  ? 14.907  -2.651  -0.860  0.50 12.68 ? 552 SER A CB  1 
ATOM   603  O OG  A SER A 1 84  ? 14.750  -4.036  -0.797  0.50 14.47 ? 552 SER A OG  1 
ATOM   604  O OG  B SER A 1 84  ? 14.153  -2.156  0.229   0.50 15.22 ? 552 SER A OG  1 
ATOM   605  N N   . LEU A 1 85  ? 17.248  -2.379  -3.019  1.00 11.71 ? 553 LEU A N   1 
ATOM   606  C CA  . LEU A 1 85  ? 18.003  -3.027  -4.086  1.00 11.51 ? 553 LEU A CA  1 
ATOM   607  C C   . LEU A 1 85  ? 19.508  -2.855  -3.931  1.00 11.08 ? 553 LEU A C   1 
ATOM   608  O O   . LEU A 1 85  ? 20.264  -3.808  -4.121  1.00 11.85 ? 553 LEU A O   1 
ATOM   609  C CB  . LEU A 1 85  ? 17.541  -2.527  -5.458  1.00 11.73 ? 553 LEU A CB  1 
ATOM   610  C CG  . LEU A 1 85  ? 16.101  -2.876  -5.854  1.00 12.27 ? 553 LEU A CG  1 
ATOM   611  C CD1 . LEU A 1 85  ? 15.822  -2.223  -7.179  1.00 14.40 ? 553 LEU A CD1 1 
ATOM   612  C CD2 . LEU A 1 85  ? 15.857  -4.380  -5.942  1.00 15.02 ? 553 LEU A CD2 1 
ATOM   613  N N   . ILE A 1 86  ? 19.936  -1.654  -3.538  1.00 10.70 ? 554 ILE A N   1 
ATOM   614  C CA  . ILE A 1 86  ? 21.366  -1.379  -3.318  1.00 10.37 ? 554 ILE A CA  1 
ATOM   615  C C   . ILE A 1 86  ? 21.872  -1.999  -2.005  1.00 11.27 ? 554 ILE A C   1 
ATOM   616  O O   . ILE A 1 86  ? 23.018  -2.471  -1.936  1.00 11.70 ? 554 ILE A O   1 
ATOM   617  C CB  . ILE A 1 86  ? 21.642  0.144   -3.352  1.00 10.35 ? 554 ILE A CB  1 
ATOM   618  C CG1 . ILE A 1 86  ? 21.242  0.737   -4.707  1.00 9.07  ? 554 ILE A CG1 1 
ATOM   619  C CG2 . ILE A 1 86  ? 23.107  0.469   -3.033  1.00 9.21  ? 554 ILE A CG2 1 
ATOM   620  C CD1 . ILE A 1 86  ? 21.087  2.259   -4.687  1.00 10.18 ? 554 ILE A CD1 1 
ATOM   621  N N   . GLY A 1 87  ? 21.033  -1.991  -0.976  1.00 11.28 ? 555 GLY A N   1 
ATOM   622  C CA  . GLY A 1 87  ? 21.438  -2.463  0.361   1.00 10.60 ? 555 GLY A CA  1 
ATOM   623  C C   . GLY A 1 87  ? 22.031  -1.360  1.222   1.00 11.06 ? 555 GLY A C   1 
ATOM   624  O O   . GLY A 1 87  ? 22.488  -1.618  2.334   1.00 12.32 ? 555 GLY A O   1 
ATOM   625  N N   . PHE A 1 88  ? 22.048  -0.138  0.695   1.00 10.31 ? 556 PHE A N   1 
ATOM   626  C CA  . PHE A 1 88  ? 22.521  1.056   1.410   1.00 10.45 ? 556 PHE A CA  1 
ATOM   627  C C   . PHE A 1 88  ? 21.570  2.198   1.131   1.00 10.72 ? 556 PHE A C   1 
ATOM   628  O O   . PHE A 1 88  ? 21.172  2.402   -0.012  1.00 11.47 ? 556 PHE A O   1 
ATOM   629  C CB  . PHE A 1 88  ? 23.900  1.523   0.893   1.00 10.61 ? 556 PHE A CB  1 
ATOM   630  C CG  . PHE A 1 88  ? 25.062  0.711   1.381   1.00 10.64 ? 556 PHE A CG  1 
ATOM   631  C CD1 . PHE A 1 88  ? 25.303  -0.560  0.874   1.00 11.50 ? 556 PHE A CD1 1 
ATOM   632  C CD2 . PHE A 1 88  ? 25.941  1.238   2.328   1.00 10.41 ? 556 PHE A CD2 1 
ATOM   633  C CE1 . PHE A 1 88  ? 26.388  -1.324  1.323   1.00 12.35 ? 556 PHE A CE1 1 
ATOM   634  C CE2 . PHE A 1 88  ? 27.037  0.488   2.776   1.00 10.44 ? 556 PHE A CE2 1 
ATOM   635  C CZ  . PHE A 1 88  ? 27.248  -0.801  2.271   1.00 11.84 ? 556 PHE A CZ  1 
ATOM   636  N N   . SER A 1 89  ? 21.215  2.951   2.167   1.00 10.76 ? 557 SER A N   1 
ATOM   637  C CA  . SER A 1 89  ? 20.546  4.235   1.964   1.00 10.78 ? 557 SER A CA  1 
ATOM   638  C C   . SER A 1 89  ? 21.607  5.257   1.604   1.00 10.86 ? 557 SER A C   1 
ATOM   639  O O   . SER A 1 89  ? 22.812  4.980   1.697   1.00 10.87 ? 557 SER A O   1 
ATOM   640  C CB  . SER A 1 89  ? 19.864  4.678   3.250   1.00 10.85 ? 557 SER A CB  1 
ATOM   641  O OG  . SER A 1 89  ? 20.847  4.985   4.229   1.00 12.32 ? 557 SER A OG  1 
ATOM   642  N N   . VAL A 1 90  ? 21.179  6.452   1.213   1.00 10.75 ? 558 VAL A N   1 
ATOM   643  C CA  . VAL A 1 90  ? 22.136  7.520   0.932   1.00 10.74 ? 558 VAL A CA  1 
ATOM   644  C C   . VAL A 1 90  ? 23.008  7.860   2.162   1.00 11.39 ? 558 VAL A C   1 
ATOM   645  O O   . VAL A 1 90  ? 24.233  7.882   2.039   1.00 11.34 ? 558 VAL A O   1 
ATOM   646  C CB  . VAL A 1 90  ? 21.458  8.757   0.291   1.00 11.20 ? 558 VAL A CB  1 
ATOM   647  C CG1 . VAL A 1 90  ? 22.371  9.945   0.314   1.00 11.31 ? 558 VAL A CG1 1 
ATOM   648  C CG2 . VAL A 1 90  ? 21.058  8.428   -1.138  1.00 10.26 ? 558 VAL A CG2 1 
ATOM   649  N N   . PRO A 1 91  ? 22.384  8.089   3.340   1.00 12.51 ? 559 PRO A N   1 
ATOM   650  C CA  . PRO A 1 91  ? 23.216  8.364   4.519   1.00 13.09 ? 559 PRO A CA  1 
ATOM   651  C C   . PRO A 1 91  ? 24.212  7.240   4.826   1.00 12.93 ? 559 PRO A C   1 
ATOM   652  O O   . PRO A 1 91  ? 25.354  7.520   5.211   1.00 13.62 ? 559 PRO A O   1 
ATOM   653  C CB  . PRO A 1 91  ? 22.184  8.529   5.651   1.00 12.93 ? 559 PRO A CB  1 
ATOM   654  C CG  . PRO A 1 91  ? 20.951  8.986   4.958   1.00 14.26 ? 559 PRO A CG  1 
ATOM   655  C CD  . PRO A 1 91  ? 20.944  8.225   3.650   1.00 12.69 ? 559 PRO A CD  1 
ATOM   656  N N   . GLU A 1 92  ? 23.797  5.985   4.628   1.00 12.63 ? 560 GLU A N   1 
ATOM   657  C CA  . GLU A 1 92  ? 24.680  4.846   4.853   1.00 12.41 ? 560 GLU A CA  1 
ATOM   658  C C   . GLU A 1 92  ? 25.840  4.816   3.862   1.00 12.36 ? 560 GLU A C   1 
ATOM   659  O O   . GLU A 1 92  ? 26.977  4.535   4.233   1.00 12.68 ? 560 GLU A O   1 
ATOM   660  C CB  . GLU A 1 92  ? 23.892  3.536   4.824   1.00 12.50 ? 560 GLU A CB  1 
ATOM   661  C CG  . GLU A 1 92  ? 22.908  3.407   5.982   1.00 12.83 ? 560 GLU A CG  1 
ATOM   662  C CD  . GLU A 1 92  ? 21.789  2.427   5.698   1.00 14.15 ? 560 GLU A CD  1 
ATOM   663  O OE1 . GLU A 1 92  ? 21.897  1.655   4.726   1.00 13.60 ? 560 GLU A OE1 1 
ATOM   664  O OE2 . GLU A 1 92  ? 20.779  2.436   6.445   1.00 16.72 ? 560 GLU A OE2 1 
ATOM   665  N N   . MET A 1 93  ? 25.550  5.126   2.603   1.00 12.32 ? 561 MET A N   1 
ATOM   666  C CA  . MET A 1 93  ? 26.572  5.214   1.576   1.00 12.36 ? 561 MET A CA  1 
ATOM   667  C C   . MET A 1 93  ? 27.589  6.305   1.930   1.00 12.86 ? 561 MET A C   1 
ATOM   668  O O   . MET A 1 93  ? 28.794  6.093   1.828   1.00 12.30 ? 561 MET A O   1 
ATOM   669  C CB  . MET A 1 93  ? 25.926  5.458   0.201   1.00 12.55 ? 561 MET A CB  1 
ATOM   670  C CG  . MET A 1 93  ? 26.928  5.662   -0.919  1.00 14.05 ? 561 MET A CG  1 
ATOM   671  S SD  . MET A 1 93  ? 27.553  7.347   -1.003  1.00 15.35 ? 561 MET A SD  1 
ATOM   672  C CE  . MET A 1 93  ? 26.120  8.278   -1.539  1.00 15.19 ? 561 MET A CE  1 
ATOM   673  N N   . LYS A 1 94  ? 27.095  7.454   2.390   1.00 13.43 ? 562 LYS A N   1 
ATOM   674  C CA  . LYS A 1 94  ? 27.988  8.560   2.700   1.00 14.10 ? 562 LYS A CA  1 
ATOM   675  C C   . LYS A 1 94  ? 28.889  8.215   3.880   1.00 14.37 ? 562 LYS A C   1 
ATOM   676  O O   . LYS A 1 94  ? 30.078  8.523   3.858   1.00 15.22 ? 562 LYS A O   1 
ATOM   677  C CB  . LYS A 1 94  ? 27.212  9.857   2.924   1.00 13.91 ? 562 LYS A CB  1 
ATOM   678  C CG  . LYS A 1 94  ? 26.482  10.334  1.671   1.00 15.97 ? 562 LYS A CG  1 
ATOM   679  C CD  . LYS A 1 94  ? 25.806  11.700  1.855   1.00 19.35 ? 562 LYS A CD  1 
ATOM   680  C CE  . LYS A 1 94  ? 26.770  12.862  1.641   1.00 21.88 ? 562 LYS A CE  1 
ATOM   681  N NZ  . LYS A 1 94  ? 27.251  12.987  0.230   1.00 23.74 ? 562 LYS A NZ  1 
ATOM   682  N N   . GLN A 1 95  ? 28.340  7.536   4.883   1.00 14.83 ? 563 GLN A N   1 
ATOM   683  C CA  . GLN A 1 95  ? 29.163  7.087   6.020   1.00 15.82 ? 563 GLN A CA  1 
ATOM   684  C C   . GLN A 1 95  ? 30.207  6.041   5.612   1.00 15.64 ? 563 GLN A C   1 
ATOM   685  O O   . GLN A 1 95  ? 31.311  5.988   6.171   1.00 16.61 ? 563 GLN A O   1 
ATOM   686  C CB  . GLN A 1 95  ? 28.281  6.551   7.150   1.00 16.89 ? 563 GLN A CB  1 
ATOM   687  C CG  . GLN A 1 95  ? 27.609  7.616   7.998   1.00 20.09 ? 563 GLN A CG  1 
ATOM   688  C CD  . GLN A 1 95  ? 28.578  8.408   8.877   1.00 23.72 ? 563 GLN A CD  1 
ATOM   689  O OE1 . GLN A 1 95  ? 29.722  7.998   9.101   1.00 27.53 ? 563 GLN A OE1 1 
ATOM   690  N NE2 . GLN A 1 95  ? 28.121  9.552   9.370   1.00 25.31 ? 563 GLN A NE2 1 
ATOM   691  N N   . SER A 1 96  ? 29.882  5.232   4.611   1.00 14.78 ? 564 SER A N   1 
ATOM   692  C CA  . SER A 1 96  ? 30.742  4.127   4.180   1.00 14.57 ? 564 SER A CA  1 
ATOM   693  C C   . SER A 1 96  ? 32.012  4.580   3.455   1.00 14.64 ? 564 SER A C   1 
ATOM   694  O O   . SER A 1 96  ? 33.003  3.840   3.396   1.00 14.21 ? 564 SER A O   1 
ATOM   695  C CB  . SER A 1 96  ? 29.950  3.173   3.264   1.00 14.78 ? 564 SER A CB  1 
ATOM   696  O OG  . SER A 1 96  ? 29.963  3.597   1.911   1.00 15.17 ? 564 SER A OG  1 
ATOM   697  N N   . LYS A 1 97  ? 31.984  5.787   2.894   1.00 14.29 ? 565 LYS A N   1 
ATOM   698  C CA  . LYS A 1 97  ? 33.014  6.193   1.944   1.00 13.90 ? 565 LYS A CA  1 
ATOM   699  C C   . LYS A 1 97  ? 34.431  6.241   2.540   1.00 13.33 ? 565 LYS A C   1 
ATOM   700  O O   . LYS A 1 97  ? 35.420  5.982   1.842   1.00 12.90 ? 565 LYS A O   1 
ATOM   701  C CB  . LYS A 1 97  ? 32.647  7.531   1.301   1.00 14.78 ? 565 LYS A CB  1 
ATOM   702  C CG  . LYS A 1 97  ? 33.329  7.759   -0.032  1.00 18.15 ? 565 LYS A CG  1 
ATOM   703  C CD  . LYS A 1 97  ? 32.537  8.726   -0.897  1.00 21.67 ? 565 LYS A CD  1 
ATOM   704  C CE  . LYS A 1 97  ? 32.471  10.119  -0.302  1.00 25.00 ? 565 LYS A CE  1 
ATOM   705  N NZ  . LYS A 1 97  ? 31.811  11.089  -1.218  1.00 27.17 ? 565 LYS A NZ  1 
ATOM   706  N N   . LYS A 1 98  ? 34.527  6.566   3.822   1.00 12.90 ? 566 LYS A N   1 
ATOM   707  C CA  . LYS A 1 98  ? 35.840  6.658   4.469   1.00 13.35 ? 566 LYS A CA  1 
ATOM   708  C C   . LYS A 1 98  ? 36.439  5.303   4.824   1.00 13.65 ? 566 LYS A C   1 
ATOM   709  O O   . LYS A 1 98  ? 37.614  5.220   5.186   1.00 13.93 ? 566 LYS A O   1 
ATOM   710  C CB  . LYS A 1 98  ? 35.788  7.558   5.709   1.00 13.24 ? 566 LYS A CB  1 
ATOM   711  C CG  . LYS A 1 98  ? 34.990  6.977   6.850   1.00 14.80 ? 566 LYS A CG  1 
ATOM   712  C CD  . LYS A 1 98  ? 34.935  7.942   8.018   1.00 18.87 ? 566 LYS A CD  1 
ATOM   713  C CE  . LYS A 1 98  ? 33.791  7.562   8.955   1.00 23.46 ? 566 LYS A CE  1 
ATOM   714  N NZ  . LYS A 1 98  ? 32.464  7.915   8.359   1.00 26.12 ? 566 LYS A NZ  1 
ATOM   715  N N   . ASP A 1 99  ? 35.640  4.243   4.732   1.00 14.32 ? 567 ASP A N   1 
ATOM   716  C CA  A ASP A 1 99  ? 36.095  2.905   5.054   0.50 15.12 ? 567 ASP A CA  1 
ATOM   717  C CA  B ASP A 1 99  ? 36.123  2.896   5.035   0.50 15.22 ? 567 ASP A CA  1 
ATOM   718  C C   . ASP A 1 99  ? 36.079  2.039   3.785   1.00 15.50 ? 567 ASP A C   1 
ATOM   719  O O   . ASP A 1 99  ? 35.010  1.612   3.348   1.00 15.29 ? 567 ASP A O   1 
ATOM   720  C CB  A ASP A 1 99  ? 35.205  2.306   6.154   0.50 15.58 ? 567 ASP A CB  1 
ATOM   721  C CB  B ASP A 1 99  ? 35.325  2.225   6.161   0.50 15.77 ? 567 ASP A CB  1 
ATOM   722  C CG  A ASP A 1 99  ? 35.330  3.047   7.486   0.50 16.66 ? 567 ASP A CG  1 
ATOM   723  C CG  B ASP A 1 99  ? 35.784  0.783   6.435   0.50 17.30 ? 567 ASP A CG  1 
ATOM   724  O OD1 A ASP A 1 99  ? 36.464  3.388   7.872   0.50 18.72 ? 567 ASP A OD1 1 
ATOM   725  O OD1 B ASP A 1 99  ? 36.760  0.310   5.805   0.50 18.48 ? 567 ASP A OD1 1 
ATOM   726  O OD2 A ASP A 1 99  ? 34.298  3.276   8.156   0.50 18.62 ? 567 ASP A OD2 1 
ATOM   727  O OD2 B ASP A 1 99  ? 35.172  0.115   7.295   0.50 19.92 ? 567 ASP A OD2 1 
ATOM   728  N N   . PRO A 1 100 ? 37.258  1.775   3.194   1.00 15.75 ? 568 PRO A N   1 
ATOM   729  C CA  . PRO A 1 100 ? 37.371  1.011   1.946   1.00 16.20 ? 568 PRO A CA  1 
ATOM   730  C C   . PRO A 1 100 ? 36.536  -0.262  1.888   1.00 16.14 ? 568 PRO A C   1 
ATOM   731  O O   . PRO A 1 100 ? 35.902  -0.525  0.862   1.00 16.17 ? 568 PRO A O   1 
ATOM   732  C CB  . PRO A 1 100 ? 38.851  0.652   1.899   1.00 16.60 ? 568 PRO A CB  1 
ATOM   733  C CG  . PRO A 1 100 ? 39.506  1.778   2.582   1.00 16.29 ? 568 PRO A CG  1 
ATOM   734  C CD  . PRO A 1 100 ? 38.581  2.252   3.649   1.00 16.08 ? 568 PRO A CD  1 
ATOM   735  N N   . LEU A 1 101 ? 36.549  -1.039  2.968   1.00 15.94 ? 569 LEU A N   1 
ATOM   736  C CA  . LEU A 1 101 ? 35.826  -2.314  3.001   1.00 16.11 ? 569 LEU A CA  1 
ATOM   737  C C   . LEU A 1 101 ? 34.315  -2.100  2.992   1.00 15.23 ? 569 LEU A C   1 
ATOM   738  O O   . LEU A 1 101 ? 33.580  -2.860  2.349   1.00 15.47 ? 569 LEU A O   1 
ATOM   739  C CB  . LEU A 1 101 ? 36.249  -3.163  4.205   1.00 16.78 ? 569 LEU A CB  1 
ATOM   740  C CG  . LEU A 1 101 ? 37.642  -3.802  4.174   1.00 19.20 ? 569 LEU A CG  1 
ATOM   741  C CD1 . LEU A 1 101 ? 37.872  -4.563  5.468   1.00 22.16 ? 569 LEU A CD1 1 
ATOM   742  C CD2 . LEU A 1 101 ? 37.823  -4.731  2.970   1.00 20.77 ? 569 LEU A CD2 1 
ATOM   743  N N   . GLN A 1 102 ? 33.854  -1.069  3.695   1.00 14.11 ? 570 GLN A N   1 
ATOM   744  C CA  . GLN A 1 102 ? 32.437  -0.706  3.665   1.00 13.88 ? 570 GLN A CA  1 
ATOM   745  C C   . GLN A 1 102 ? 32.009  -0.137  2.313   1.00 13.38 ? 570 GLN A C   1 
ATOM   746  O O   . GLN A 1 102 ? 30.947  -0.508  1.784   1.00 13.15 ? 570 GLN A O   1 
ATOM   747  C CB  . GLN A 1 102 ? 32.089  0.254   4.802   1.00 14.14 ? 570 GLN A CB  1 
ATOM   748  C CG  . GLN A 1 102 ? 32.082  -0.422  6.173   1.00 16.98 ? 570 GLN A CG  1 
ATOM   749  C CD  . GLN A 1 102 ? 31.008  -1.500  6.289   1.00 19.62 ? 570 GLN A CD  1 
ATOM   750  O OE1 . GLN A 1 102 ? 31.322  -2.690  6.351   1.00 21.66 ? 570 GLN A OE1 1 
ATOM   751  N NE2 . GLN A 1 102 ? 29.739  -1.090  6.290   1.00 20.86 ? 570 GLN A NE2 1 
ATOM   752  N N   . TYR A 1 103 ? 32.828  0.741   1.738   1.00 12.75 ? 571 TYR A N   1 
ATOM   753  C CA  . TYR A 1 103 ? 32.497  1.330   0.440   1.00 12.30 ? 571 TYR A CA  1 
ATOM   754  C C   . TYR A 1 103 ? 32.460  0.250   -0.634  1.00 12.07 ? 571 TYR A C   1 
ATOM   755  O O   . TYR A 1 103 ? 31.660  0.320   -1.561  1.00 12.23 ? 571 TYR A O   1 
ATOM   756  C CB  . TYR A 1 103 ? 33.476  2.439   0.042   1.00 12.80 ? 571 TYR A CB  1 
ATOM   757  C CG  . TYR A 1 103 ? 32.904  3.329   -1.040  1.00 12.75 ? 571 TYR A CG  1 
ATOM   758  C CD1 . TYR A 1 103 ? 31.762  4.102   -0.798  1.00 13.30 ? 571 TYR A CD1 1 
ATOM   759  C CD2 . TYR A 1 103 ? 33.482  3.375   -2.301  1.00 15.14 ? 571 TYR A CD2 1 
ATOM   760  C CE1 . TYR A 1 103 ? 31.221  4.922   -1.792  1.00 14.74 ? 571 TYR A CE1 1 
ATOM   761  C CE2 . TYR A 1 103 ? 32.942  4.185   -3.302  1.00 15.81 ? 571 TYR A CE2 1 
ATOM   762  C CZ  . TYR A 1 103 ? 31.820  4.949   -3.033  1.00 15.59 ? 571 TYR A CZ  1 
ATOM   763  O OH  . TYR A 1 103 ? 31.271  5.755   -4.010  1.00 18.62 ? 571 TYR A OH  1 
ATOM   764  N N   . GLN A 1 104 ? 33.307  -0.760  -0.490  1.00 12.11 ? 572 GLN A N   1 
ATOM   765  C CA  . GLN A 1 104 ? 33.307  -1.872  -1.421  1.00 12.46 ? 572 GLN A CA  1 
ATOM   766  C C   . GLN A 1 104 ? 31.964  -2.616  -1.397  1.00 11.69 ? 572 GLN A C   1 
ATOM   767  O O   . GLN A 1 104 ? 31.450  -3.011  -2.451  1.00 11.36 ? 572 GLN A O   1 
ATOM   768  C CB  . GLN A 1 104 ? 34.470  -2.815  -1.102  1.00 13.16 ? 572 GLN A CB  1 
ATOM   769  C CG  . GLN A 1 104 ? 34.556  -4.046  -2.010  1.00 16.21 ? 572 GLN A CG  1 
ATOM   770  C CD  . GLN A 1 104 ? 34.586  -3.716  -3.492  1.00 21.69 ? 572 GLN A CD  1 
ATOM   771  O OE1 . GLN A 1 104 ? 35.286  -2.805  -3.929  1.00 25.24 ? 572 GLN A OE1 1 
ATOM   772  N NE2 . GLN A 1 104 ? 33.825  -4.473  -4.278  1.00 24.01 ? 572 GLN A NE2 1 
ATOM   773  N N   . LYS A 1 105 ? 31.398  -2.789  -0.202  1.00 11.65 ? 573 LYS A N   1 
ATOM   774  C CA  . LYS A 1 105 ? 30.070  -3.395  -0.068  1.00 11.05 ? 573 LYS A CA  1 
ATOM   775  C C   . LYS A 1 105 ? 29.047  -2.544  -0.812  1.00 10.51 ? 573 LYS A C   1 
ATOM   776  O O   . LYS A 1 105 ? 28.142  -3.082  -1.457  1.00 10.66 ? 573 LYS A O   1 
ATOM   777  C CB  . LYS A 1 105 ? 29.649  -3.543  1.396   1.00 11.20 ? 573 LYS A CB  1 
ATOM   778  C CG  . LYS A 1 105 ? 30.451  -4.554  2.207   1.00 14.40 ? 573 LYS A CG  1 
ATOM   779  C CD  . LYS A 1 105 ? 29.942  -4.572  3.651   1.00 16.96 ? 573 LYS A CD  1 
ATOM   780  C CE  . LYS A 1 105 ? 30.712  -5.533  4.549   1.00 19.62 ? 573 LYS A CE  1 
ATOM   781  N NZ  . LYS A 1 105 ? 30.294  -5.351  5.990   1.00 21.89 ? 573 LYS A NZ  1 
ATOM   782  N N   . PHE A 1 106 ? 29.193  -1.217  -0.731  1.00 9.63  ? 574 PHE A N   1 
ATOM   783  C CA  . PHE A 1 106 ? 28.286  -0.328  -1.453  1.00 8.95  ? 574 PHE A CA  1 
ATOM   784  C C   . PHE A 1 106 ? 28.439  -0.501  -2.971  1.00 9.24  ? 574 PHE A C   1 
ATOM   785  O O   . PHE A 1 106 ? 27.441  -0.577  -3.698  1.00 10.15 ? 574 PHE A O   1 
ATOM   786  C CB  . PHE A 1 106 ? 28.486  1.137   -1.051  1.00 9.21  ? 574 PHE A CB  1 
ATOM   787  C CG  . PHE A 1 106 ? 27.876  2.094   -2.018  1.00 9.17  ? 574 PHE A CG  1 
ATOM   788  C CD1 . PHE A 1 106 ? 26.492  2.212   -2.118  1.00 10.34 ? 574 PHE A CD1 1 
ATOM   789  C CD2 . PHE A 1 106 ? 28.680  2.826   -2.869  1.00 9.90  ? 574 PHE A CD2 1 
ATOM   790  C CE1 . PHE A 1 106 ? 25.939  3.069   -3.052  1.00 10.20 ? 574 PHE A CE1 1 
ATOM   791  C CE2 . PHE A 1 106 ? 28.141  3.692   -3.788  1.00 11.63 ? 574 PHE A CE2 1 
ATOM   792  C CZ  . PHE A 1 106 ? 26.760  3.818   -3.875  1.00 11.11 ? 574 PHE A CZ  1 
ATOM   793  N N   . LEU A 1 107 ? 29.684  -0.551  -3.453  1.00 9.60  ? 575 LEU A N   1 
ATOM   794  C CA  . LEU A 1 107 ? 29.911  -0.719  -4.884  1.00 9.66  ? 575 LEU A CA  1 
ATOM   795  C C   . LEU A 1 107 ? 29.326  -2.033  -5.371  1.00 9.82  ? 575 LEU A C   1 
ATOM   796  O O   . LEU A 1 107 ? 28.796  -2.098  -6.478  1.00 9.29  ? 575 LEU A O   1 
ATOM   797  C CB  . LEU A 1 107 ? 31.402  -0.643  -5.229  1.00 9.98  ? 575 LEU A CB  1 
ATOM   798  C CG  . LEU A 1 107 ? 32.033  0.733   -5.003  1.00 10.66 ? 575 LEU A CG  1 
ATOM   799  C CD1 . LEU A 1 107 ? 33.511  0.659   -5.310  1.00 12.11 ? 575 LEU A CD1 1 
ATOM   800  C CD2 . LEU A 1 107 ? 31.359  1.852   -5.809  1.00 12.53 ? 575 LEU A CD2 1 
ATOM   801  N N   . GLU A 1 108 ? 29.416  -3.069  -4.544  1.00 10.31 ? 576 GLU A N   1 
ATOM   802  C CA  . GLU A 1 108 ? 28.796  -4.358  -4.882  1.00 9.91  ? 576 GLU A CA  1 
ATOM   803  C C   . GLU A 1 108 ? 27.274  -4.228  -4.947  1.00 10.14 ? 576 GLU A C   1 
ATOM   804  O O   . GLU A 1 108 ? 26.638  -4.795  -5.851  1.00 10.48 ? 576 GLU A O   1 
ATOM   805  C CB  . GLU A 1 108 ? 29.233  -5.440  -3.899  1.00 10.71 ? 576 GLU A CB  1 
ATOM   806  C CG  . GLU A 1 108 ? 30.668  -5.880  -4.160  1.00 13.49 ? 576 GLU A CG  1 
ATOM   807  C CD  . GLU A 1 108 ? 31.382  -6.460  -2.951  1.00 19.74 ? 576 GLU A CD  1 
ATOM   808  O OE1 . GLU A 1 108 ? 32.592  -6.752  -3.096  1.00 22.84 ? 576 GLU A OE1 1 
ATOM   809  O OE2 . GLU A 1 108 ? 30.768  -6.624  -1.871  1.00 21.69 ? 576 GLU A OE2 1 
ATOM   810  N N   . GLY A 1 109 ? 26.709  -3.449  -4.029  1.00 9.83  ? 577 GLY A N   1 
ATOM   811  C CA  . GLY A 1 109 ? 25.263  -3.196  -4.021  1.00 10.23 ? 577 GLY A CA  1 
ATOM   812  C C   . GLY A 1 109 ? 24.805  -2.408  -5.228  1.00 10.46 ? 577 GLY A C   1 
ATOM   813  O O   . GLY A 1 109 ? 23.708  -2.642  -5.765  1.00 10.63 ? 577 GLY A O   1 
ATOM   814  N N   . LEU A 1 110 ? 25.638  -1.465  -5.662  1.00 9.73  ? 578 LEU A N   1 
ATOM   815  C CA  A LEU A 1 110 ? 25.341  -0.670  -6.861  0.50 9.35  ? 578 LEU A CA  1 
ATOM   816  C CA  B LEU A 1 110 ? 25.341  -0.666  -6.836  0.50 9.50  ? 578 LEU A CA  1 
ATOM   817  C C   . LEU A 1 110 ? 25.197  -1.580  -8.057  1.00 9.84  ? 578 LEU A C   1 
ATOM   818  O O   . LEU A 1 110 ? 24.287  -1.420  -8.861  1.00 9.23  ? 578 LEU A O   1 
ATOM   819  C CB  A LEU A 1 110 ? 26.460  0.320   -7.164  0.50 9.87  ? 578 LEU A CB  1 
ATOM   820  C CB  B LEU A 1 110 ? 26.472  0.336   -7.034  0.50 10.08 ? 578 LEU A CB  1 
ATOM   821  C CG  A LEU A 1 110 ? 26.402  1.692   -6.525  0.50 8.91  ? 578 LEU A CG  1 
ATOM   822  C CG  B LEU A 1 110 ? 26.263  1.426   -8.064  0.50 9.85  ? 578 LEU A CG  1 
ATOM   823  C CD1 A LEU A 1 110 ? 27.480  2.575   -7.143  0.50 8.30  ? 578 LEU A CD1 1 
ATOM   824  C CD1 B LEU A 1 110 ? 25.121  2.318   -7.629  0.50 10.50 ? 578 LEU A CD1 1 
ATOM   825  C CD2 A LEU A 1 110 ? 25.015  2.310   -6.677  0.50 10.11 ? 578 LEU A CD2 1 
ATOM   826  C CD2 B LEU A 1 110 ? 27.555  2.213   -8.245  0.50 9.48  ? 578 LEU A CD2 1 
ATOM   827  N N   . GLN A 1 111 ? 26.119  -2.536  -8.173  1.00 9.24  ? 579 GLN A N   1 
ATOM   828  C CA  . GLN A 1 111 ? 26.128  -3.462  -9.305  1.00 9.90  ? 579 GLN A CA  1 
ATOM   829  C C   . GLN A 1 111 ? 24.949  -4.402  -9.224  1.00 10.13 ? 579 GLN A C   1 
ATOM   830  O O   . GLN A 1 111 ? 24.344  -4.731  -10.250 1.00 10.00 ? 579 GLN A O   1 
ATOM   831  C CB  . GLN A 1 111 ? 27.424  -4.255  -9.339  1.00 9.98  ? 579 GLN A CB  1 
ATOM   832  C CG  . GLN A 1 111 ? 28.631  -3.393  -9.621  1.00 10.16 ? 579 GLN A CG  1 
ATOM   833  C CD  . GLN A 1 111 ? 29.883  -4.165  -9.391  1.00 10.77 ? 579 GLN A CD  1 
ATOM   834  O OE1 . GLN A 1 111 ? 30.242  -5.035  -10.190 1.00 13.21 ? 579 GLN A OE1 1 
ATOM   835  N NE2 . GLN A 1 111 ? 30.546  -3.893  -8.282  1.00 11.07 ? 579 GLN A NE2 1 
ATOM   836  N N   . LYS A 1 112 ? 24.633  -4.830  -8.005  1.00 9.65  ? 580 LYS A N   1 
ATOM   837  C CA  . LYS A 1 112 ? 23.448  -5.658  -7.768  1.00 10.17 ? 580 LYS A CA  1 
ATOM   838  C C   . LYS A 1 112 ? 22.182  -4.927  -8.211  1.00 10.19 ? 580 LYS A C   1 
ATOM   839  O O   . LYS A 1 112 ? 21.342  -5.514  -8.904  1.00 10.39 ? 580 LYS A O   1 
ATOM   840  C CB  . LYS A 1 112 ? 23.356  -6.069  -6.300  1.00 10.84 ? 580 LYS A CB  1 
ATOM   841  C CG  . LYS A 1 112 ? 22.072  -6.797  -5.947  1.00 12.32 ? 580 LYS A CG  1 
ATOM   842  C CD  . LYS A 1 112 ? 21.926  -6.960  -4.430  1.00 14.88 ? 580 LYS A CD  1 
ATOM   843  C CE  . LYS A 1 112 ? 20.526  -7.412  -4.015  1.00 13.97 ? 580 LYS A CE  1 
ATOM   844  N NZ  . LYS A 1 112 ? 19.413  -6.529  -4.494  1.00 15.08 ? 580 LYS A NZ  1 
ATOM   845  N N   . CYS A 1 113 ? 22.068  -3.652  -7.831  1.00 9.37  ? 581 CYS A N   1 
ATOM   846  C CA  . CYS A 1 113 ? 20.930  -2.817  -8.226  1.00 9.66  ? 581 CYS A CA  1 
ATOM   847  C C   . CYS A 1 113 ? 20.849  -2.695  -9.753  1.00 9.52  ? 581 CYS A C   1 
ATOM   848  O O   . CYS A 1 113 ? 19.769  -2.843  -10.343 1.00 9.73  ? 581 CYS A O   1 
ATOM   849  C CB  . CYS A 1 113 ? 21.026  -1.447  -7.553  1.00 9.73  ? 581 CYS A CB  1 
ATOM   850  S SG  . CYS A 1 113 ? 19.628  -0.362  -7.960  1.00 11.05 ? 581 CYS A SG  1 
ATOM   851  N N   . GLN A 1 114 ? 21.988  -2.449  -10.394 1.00 9.55  ? 582 GLN A N   1 
ATOM   852  C CA  . GLN A 1 114 ? 22.041  -2.364  -11.841 1.00 9.56  ? 582 GLN A CA  1 
ATOM   853  C C   . GLN A 1 114 ? 21.477  -3.642  -12.472 1.00 10.33 ? 582 GLN A C   1 
ATOM   854  O O   . GLN A 1 114 ? 20.636  -3.557  -13.378 1.00 9.43  ? 582 GLN A O   1 
ATOM   855  C CB  . GLN A 1 114 ? 23.485  -2.141  -12.308 1.00 9.78  ? 582 GLN A CB  1 
ATOM   856  C CG  . GLN A 1 114 ? 23.567  -1.969  -13.807 1.00 8.96  ? 582 GLN A CG  1 
ATOM   857  C CD  . GLN A 1 114 ? 24.991  -2.000  -14.339 1.00 11.34 ? 582 GLN A CD  1 
ATOM   858  O OE1 . GLN A 1 114 ? 25.946  -2.092  -13.571 1.00 11.15 ? 582 GLN A OE1 1 
ATOM   859  N NE2 . GLN A 1 114 ? 25.133  -1.934  -15.661 1.00 12.45 ? 582 GLN A NE2 1 
ATOM   860  N N   . ARG A 1 115 ? 21.932  -4.800  -11.994 1.00 10.39 ? 583 ARG A N   1 
ATOM   861  C CA  . ARG A 1 115 ? 21.493  -6.091  -12.537 1.00 11.78 ? 583 ARG A CA  1 
ATOM   862  C C   . ARG A 1 115 ? 20.015  -6.318  -12.259 1.00 11.69 ? 583 ARG A C   1 
ATOM   863  O O   . ARG A 1 115 ? 19.288  -6.794  -13.136 1.00 11.95 ? 583 ARG A O   1 
ATOM   864  C CB  . ARG A 1 115 ? 22.307  -7.257  -11.974 1.00 12.59 ? 583 ARG A CB  1 
ATOM   865  C CG  . ARG A 1 115 ? 23.686  -7.389  -12.556 1.00 17.02 ? 583 ARG A CG  1 
ATOM   866  C CD  . ARG A 1 115 ? 24.336  -8.717  -12.140 1.00 19.41 ? 583 ARG A CD  1 
ATOM   867  N NE  . ARG A 1 115 ? 24.480  -8.834  -10.688 1.00 21.74 ? 583 ARG A NE  1 
ATOM   868  C CZ  . ARG A 1 115 ? 25.515  -8.357  -9.999  1.00 21.44 ? 583 ARG A CZ  1 
ATOM   869  N NH1 . ARG A 1 115 ? 26.500  -7.727  -10.631 1.00 23.25 ? 583 ARG A NH1 1 
ATOM   870  N NH2 . ARG A 1 115 ? 25.567  -8.509  -8.684  1.00 22.34 ? 583 ARG A NH2 1 
ATOM   871  N N   . ASP A 1 116 ? 19.583  -5.957  -11.053 1.00 11.34 ? 584 ASP A N   1 
ATOM   872  C CA  . ASP A 1 116 ? 18.188  -6.127  -10.642 1.00 11.97 ? 584 ASP A CA  1 
ATOM   873  C C   . ASP A 1 116 ? 17.259  -5.320  -11.536 1.00 11.42 ? 584 ASP A C   1 
ATOM   874  O O   . ASP A 1 116 ? 16.169  -5.788  -11.871 1.00 11.31 ? 584 ASP A O   1 
ATOM   875  C CB  . ASP A 1 116 ? 17.980  -5.684  -9.190  1.00 13.14 ? 584 ASP A CB  1 
ATOM   876  C CG  . ASP A 1 116 ? 18.555  -6.653  -8.174  1.00 15.32 ? 584 ASP A CG  1 
ATOM   877  O OD1 . ASP A 1 116 ? 18.792  -7.837  -8.512  1.00 20.63 ? 584 ASP A OD1 1 
ATOM   878  O OD2 . ASP A 1 116 ? 18.776  -6.199  -7.023  1.00 20.11 ? 584 ASP A OD2 1 
ATOM   879  N N   . LEU A 1 117 ? 17.670  -4.109  -11.896 1.00 10.37 ? 585 LEU A N   1 
ATOM   880  C CA  . LEU A 1 117 ? 16.845  -3.252  -12.772 1.00 10.75 ? 585 LEU A CA  1 
ATOM   881  C C   . LEU A 1 117 ? 16.843  -3.756  -14.234 1.00 11.24 ? 585 LEU A C   1 
ATOM   882  O O   . LEU A 1 117 ? 15.819  -3.704  -14.927 1.00 11.71 ? 585 LEU A O   1 
ATOM   883  C CB  . LEU A 1 117 ? 17.234  -1.772  -12.642 1.00 10.90 ? 585 LEU A CB  1 
ATOM   884  C CG  . LEU A 1 117 ? 16.998  -1.106  -11.266 1.00 10.80 ? 585 LEU A CG  1 
ATOM   885  C CD1 . LEU A 1 117 ? 17.437  0.359   -11.290 1.00 11.90 ? 585 LEU A CD1 1 
ATOM   886  C CD2 . LEU A 1 117 ? 15.550  -1.207  -10.811 1.00 11.31 ? 585 LEU A CD2 1 
ATOM   887  N N   . ILE A 1 118 ? 17.975  -4.270  -14.704 1.00 11.28 ? 586 ILE A N   1 
ATOM   888  C CA  . ILE A 1 118 ? 17.980  -4.941  -16.013 1.00 11.03 ? 586 ILE A CA  1 
ATOM   889  C C   . ILE A 1 118 ? 17.008  -6.143  -16.038 1.00 11.55 ? 586 ILE A C   1 
ATOM   890  O O   . ILE A 1 118 ? 16.295  -6.341  -17.031 1.00 11.77 ? 586 ILE A O   1 
ATOM   891  C CB  . ILE A 1 118 ? 19.413  -5.399  -16.424 1.00 10.67 ? 586 ILE A CB  1 
ATOM   892  C CG1 . ILE A 1 118 ? 20.311  -4.196  -16.716 1.00 10.91 ? 586 ILE A CG1 1 
ATOM   893  C CG2 . ILE A 1 118 ? 19.364  -6.359  -17.639 1.00 11.84 ? 586 ILE A CG2 1 
ATOM   894  C CD1 . ILE A 1 118 ? 21.798  -4.583  -16.828 1.00 13.59 ? 586 ILE A CD1 1 
ATOM   895  N N   . ASP A 1 119 ? 16.995  -6.941  -14.972 1.00 11.87 ? 587 ASP A N   1 
ATOM   896  C CA  . ASP A 1 119 ? 16.205  -8.182  -14.930 1.00 12.06 ? 587 ASP A CA  1 
ATOM   897  C C   . ASP A 1 119 ? 14.765  -8.017  -14.445 1.00 12.16 ? 587 ASP A C   1 
ATOM   898  O O   . ASP A 1 119 ? 13.982  -8.970  -14.491 1.00 13.44 ? 587 ASP A O   1 
ATOM   899  C CB  . ASP A 1 119 ? 16.938  -9.242  -14.094 1.00 12.57 ? 587 ASP A CB  1 
ATOM   900  C CG  . ASP A 1 119 ? 18.181  -9.758  -14.787 1.00 13.75 ? 587 ASP A CG  1 
ATOM   901  O OD1 . ASP A 1 119 ? 18.290  -9.622  -16.025 1.00 14.80 ? 587 ASP A OD1 1 
ATOM   902  O OD2 . ASP A 1 119 ? 19.061  -10.294 -14.087 1.00 15.83 ? 587 ASP A OD2 1 
ATOM   903  N N   . LEU A 1 120 ? 14.419  -6.811  -14.001 1.00 11.53 ? 588 LEU A N   1 
ATOM   904  C CA  . LEU A 1 120 ? 13.105  -6.551  -13.424 1.00 11.19 ? 588 LEU A CA  1 
ATOM   905  C C   . LEU A 1 120 ? 11.957  -6.887  -14.387 1.00 11.16 ? 588 LEU A C   1 
ATOM   906  O O   . LEU A 1 120 ? 11.921  -6.417  -15.523 1.00 11.24 ? 588 LEU A O   1 
ATOM   907  C CB  . LEU A 1 120 ? 13.029  -5.082  -12.985 1.00 11.14 ? 588 LEU A CB  1 
ATOM   908  C CG  . LEU A 1 120 ? 11.988  -4.727  -11.924 1.00 12.70 ? 588 LEU A CG  1 
ATOM   909  C CD1 . LEU A 1 120 ? 12.233  -5.519  -10.626 1.00 16.30 ? 588 LEU A CD1 1 
ATOM   910  C CD2 . LEU A 1 120 ? 12.023  -3.238  -11.659 1.00 13.56 ? 588 LEU A CD2 1 
ATOM   911  N N   . CYS A 1 121 ? 11.047  -7.734  -13.918 1.00 11.40 ? 589 CYS A N   1 
ATOM   912  C CA  . CYS A 1 121 ? 9.858   -8.082  -14.685 1.00 11.43 ? 589 CYS A CA  1 
ATOM   913  C C   . CYS A 1 121 ? 8.858   -8.548  -13.641 1.00 11.22 ? 589 CYS A C   1 
ATOM   914  O O   . CYS A 1 121 ? 8.898   -9.688  -13.194 1.00 11.93 ? 589 CYS A O   1 
ATOM   915  C CB  . CYS A 1 121 ? 10.164  -9.195  -15.687 1.00 11.60 ? 589 CYS A CB  1 
ATOM   916  S SG  . CYS A 1 121 ? 8.750   -9.599  -16.735 1.00 13.88 ? 589 CYS A SG  1 
ATOM   917  N N   . CYS A 1 122 ? 7.998   -7.632  -13.209 1.00 10.10 ? 590 CYS A N   1 
ATOM   918  C CA  . CYS A 1 122 ? 7.200   -7.879  -12.013 1.00 10.25 ? 590 CYS A CA  1 
ATOM   919  C C   . CYS A 1 122 ? 6.006   -6.950  -11.976 1.00 9.81  ? 590 CYS A C   1 
ATOM   920  O O   . CYS A 1 122 ? 5.801   -6.141  -12.890 1.00 9.29  ? 590 CYS A O   1 
ATOM   921  C CB  . CYS A 1 122 ? 8.067   -7.689  -10.756 1.00 10.72 ? 590 CYS A CB  1 
ATOM   922  S SG  . CYS A 1 122 ? 8.535   -5.986  -10.425 1.00 11.58 ? 590 CYS A SG  1 
ATOM   923  N N   . LEU A 1 123 ? 5.199   -7.073  -10.929 1.00 10.08 ? 591 LEU A N   1 
ATOM   924  C CA  . LEU A 1 123 ? 4.086   -6.157  -10.761 1.00 10.80 ? 591 LEU A CA  1 
ATOM   925  C C   . LEU A 1 123 ? 4.580   -4.882  -10.130 1.00 10.64 ? 591 LEU A C   1 
ATOM   926  O O   . LEU A 1 123 ? 5.246   -4.904  -9.088  1.00 11.15 ? 591 LEU A O   1 
ATOM   927  C CB  . LEU A 1 123 ? 2.976   -6.773  -9.909  1.00 11.24 ? 591 LEU A CB  1 
ATOM   928  C CG  . LEU A 1 123 ? 2.439   -8.124  -10.395 1.00 12.28 ? 591 LEU A CG  1 
ATOM   929  C CD1 . LEU A 1 123 ? 1.170   -8.470  -9.657  1.00 14.64 ? 591 LEU A CD1 1 
ATOM   930  C CD2 . LEU A 1 123 ? 2.159   -8.139  -11.896 1.00 14.01 ? 591 LEU A CD2 1 
ATOM   931  N N   . MET A 1 124 ? 4.243   -3.772  -10.776 1.00 9.61  ? 592 MET A N   1 
ATOM   932  C CA  . MET A 1 124 ? 4.640   -2.444  -10.301 1.00 9.65  ? 592 MET A CA  1 
ATOM   933  C C   . MET A 1 124 ? 3.387   -1.685  -9.929  1.00 9.23  ? 592 MET A C   1 
ATOM   934  O O   . MET A 1 124 ? 2.475   -1.586  -10.746 1.00 9.65  ? 592 MET A O   1 
ATOM   935  C CB  . MET A 1 124 ? 5.357   -1.674  -11.406 1.00 9.85  ? 592 MET A CB  1 
ATOM   936  C CG  . MET A 1 124 ? 6.625   -2.314  -11.891 1.00 11.98 ? 592 MET A CG  1 
ATOM   937  S SD  . MET A 1 124 ? 7.485   -1.219  -13.024 1.00 12.45 ? 592 MET A SD  1 
ATOM   938  C CE  . MET A 1 124 ? 8.749   -2.348  -13.608 1.00 16.00 ? 592 MET A CE  1 
ATOM   939  N N   . THR A 1 125 ? 3.342   -1.160  -8.700  1.00 8.48  ? 593 THR A N   1 
ATOM   940  C CA  . THR A 1 125 ? 2.261   -0.253  -8.317  1.00 9.64  ? 593 THR A CA  1 
ATOM   941  C C   . THR A 1 125 ? 2.710   1.155   -8.691  1.00 9.42  ? 593 THR A C   1 
ATOM   942  O O   . THR A 1 125 ? 3.770   1.605   -8.242  1.00 10.28 ? 593 THR A O   1 
ATOM   943  C CB  . THR A 1 125 ? 1.928   -0.373  -6.825  1.00 9.94  ? 593 THR A CB  1 
ATOM   944  O OG1 . THR A 1 125 ? 1.468   -1.707  -6.563  1.00 12.05 ? 593 THR A OG1 1 
ATOM   945  C CG2 . THR A 1 125 ? 0.812   0.619   -6.456  1.00 10.73 ? 593 THR A CG2 1 
ATOM   946  N N   . ILE A 1 126 ? 1.953   1.818   -9.562  1.00 9.36  ? 594 ILE A N   1 
ATOM   947  C CA  . ILE A 1 126 ? 2.374   3.099   -10.133 1.00 9.88  ? 594 ILE A CA  1 
ATOM   948  C C   . ILE A 1 126 ? 1.329   4.166   -9.866  1.00 10.08 ? 594 ILE A C   1 
ATOM   949  O O   . ILE A 1 126 ? 0.158   3.984   -10.186 1.00 10.80 ? 594 ILE A O   1 
ATOM   950  C CB  . ILE A 1 126 ? 2.642   2.989   -11.657 1.00 9.96  ? 594 ILE A CB  1 
ATOM   951  C CG1 . ILE A 1 126 ? 3.692   1.893   -11.922 1.00 11.76 ? 594 ILE A CG1 1 
ATOM   952  C CG2 . ILE A 1 126 ? 3.076   4.335   -12.228 1.00 12.11 ? 594 ILE A CG2 1 
ATOM   953  C CD1 . ILE A 1 126 ? 4.025   1.634   -13.394 1.00 13.90 ? 594 ILE A CD1 1 
ATOM   954  N N   . SER A 1 127 ? 1.770   5.277   -9.289  1.00 10.38 ? 595 SER A N   1 
ATOM   955  C CA  . SER A 1 127 ? 0.925   6.445   -9.115  1.00 11.10 ? 595 SER A CA  1 
ATOM   956  C C   . SER A 1 127 ? 1.140   7.355   -10.323 1.00 11.29 ? 595 SER A C   1 
ATOM   957  O O   . SER A 1 127 ? 2.244   7.827   -10.559 1.00 11.82 ? 595 SER A O   1 
ATOM   958  C CB  . SER A 1 127 ? 1.329   7.155   -7.823  1.00 11.08 ? 595 SER A CB  1 
ATOM   959  O OG  . SER A 1 127 ? 0.569   8.328   -7.624  1.00 13.13 ? 595 SER A OG  1 
ATOM   960  N N   . PHE A 1 128 ? 0.097   7.574   -11.116 1.00 11.29 ? 596 PHE A N   1 
ATOM   961  C CA  . PHE A 1 128 ? 0.201   8.443   -12.277 1.00 12.09 ? 596 PHE A CA  1 
ATOM   962  C C   . PHE A 1 128 ? -0.505  9.775   -12.030 1.00 12.60 ? 596 PHE A C   1 
ATOM   963  O O   . PHE A 1 128 ? -1.697  9.808   -11.731 1.00 12.66 ? 596 PHE A O   1 
ATOM   964  C CB  . PHE A 1 128 ? -0.365  7.757   -13.524 1.00 12.61 ? 596 PHE A CB  1 
ATOM   965  C CG  . PHE A 1 128 ? -0.394  8.652   -14.746 1.00 14.44 ? 596 PHE A CG  1 
ATOM   966  C CD1 . PHE A 1 128 ? 0.790   9.129   -15.307 1.00 16.18 ? 596 PHE A CD1 1 
ATOM   967  C CD2 . PHE A 1 128 ? -1.607  9.037   -15.310 1.00 16.52 ? 596 PHE A CD2 1 
ATOM   968  C CE1 . PHE A 1 128 ? 0.766   9.973   -16.423 1.00 18.79 ? 596 PHE A CE1 1 
ATOM   969  C CE2 . PHE A 1 128 ? -1.638  9.872   -16.431 1.00 17.04 ? 596 PHE A CE2 1 
ATOM   970  C CZ  . PHE A 1 128 ? -0.455  10.341  -16.982 1.00 18.19 ? 596 PHE A CZ  1 
ATOM   971  N N   . ASN A 1 129 ? 0.242   10.863  -12.167 1.00 13.94 ? 597 ASN A N   1 
ATOM   972  C CA  . ASN A 1 129 ? -0.298  12.200  -11.936 1.00 15.25 ? 597 ASN A CA  1 
ATOM   973  C C   . ASN A 1 129 ? -0.467  12.883  -13.288 1.00 16.11 ? 597 ASN A C   1 
ATOM   974  O O   . ASN A 1 129 ? 0.505   13.351  -13.881 1.00 16.43 ? 597 ASN A O   1 
ATOM   975  C CB  . ASN A 1 129 ? 0.646   12.990  -11.022 1.00 15.30 ? 597 ASN A CB  1 
ATOM   976  C CG  . ASN A 1 129 ? 0.101   14.357  -10.640 1.00 16.05 ? 597 ASN A CG  1 
ATOM   977  O OD1 . ASN A 1 129 ? -0.755  14.914  -11.323 1.00 18.46 ? 597 ASN A OD1 1 
ATOM   978  N ND2 . ASN A 1 129 ? 0.600   14.903  -9.529  1.00 17.83 ? 597 ASN A ND2 1 
ATOM   979  N N   . PRO A 1 130 ? -1.710  12.940  -13.795 1.00 16.76 ? 598 PRO A N   1 
ATOM   980  C CA  . PRO A 1 130 ? -1.887  13.444  -15.159 1.00 17.95 ? 598 PRO A CA  1 
ATOM   981  C C   . PRO A 1 130 ? -1.668  14.952  -15.263 1.00 19.12 ? 598 PRO A C   1 
ATOM   982  O O   . PRO A 1 130 ? -1.322  15.438  -16.337 1.00 20.02 ? 598 PRO A O   1 
ATOM   983  C CB  . PRO A 1 130 ? -3.339  13.080  -15.487 1.00 18.06 ? 598 PRO A CB  1 
ATOM   984  C CG  . PRO A 1 130 ? -4.011  12.942  -14.189 1.00 17.34 ? 598 PRO A CG  1 
ATOM   985  C CD  . PRO A 1 130 ? -2.978  12.491  -13.193 1.00 16.79 ? 598 PRO A CD  1 
ATOM   986  N N   . SER A 1 131 ? -1.844  15.671  -14.156 1.00 20.13 ? 599 SER A N   1 
ATOM   987  C CA  . SER A 1 131 ? -1.626  17.122  -14.153 1.00 21.35 ? 599 SER A CA  1 
ATOM   988  C C   . SER A 1 131 ? -0.151  17.479  -14.336 1.00 21.54 ? 599 SER A C   1 
ATOM   989  O O   . SER A 1 131 ? 0.169   18.482  -14.978 1.00 22.01 ? 599 SER A O   1 
ATOM   990  C CB  . SER A 1 131 ? -2.169  17.754  -12.873 1.00 21.13 ? 599 SER A CB  1 
ATOM   991  O OG  . SER A 1 131 ? -3.575  17.589  -12.785 1.00 23.67 ? 599 SER A OG  1 
ATOM   992  N N   . LEU A 1 132 ? 0.739   16.663  -13.773 1.00 21.66 ? 600 LEU A N   1 
ATOM   993  C CA  . LEU A 1 132 ? 2.182   16.934  -13.831 1.00 22.00 ? 600 LEU A CA  1 
ATOM   994  C C   . LEU A 1 132 ? 2.888   16.061  -14.858 1.00 22.12 ? 600 LEU A C   1 
ATOM   995  O O   . LEU A 1 132 ? 4.102   16.197  -15.063 1.00 22.29 ? 600 LEU A O   1 
ATOM   996  C CB  . LEU A 1 132 ? 2.836   16.735  -12.458 1.00 22.32 ? 600 LEU A CB  1 
ATOM   997  C CG  . LEU A 1 132 ? 2.613   17.783  -11.364 1.00 23.79 ? 600 LEU A CG  1 
ATOM   998  C CD1 . LEU A 1 132 ? 1.202   17.725  -10.825 1.00 27.09 ? 600 LEU A CD1 1 
ATOM   999  C CD2 . LEU A 1 132 ? 3.616   17.611  -10.234 1.00 26.39 ? 600 LEU A CD2 1 
ATOM   1000 N N   . SER A 1 133 ? 2.128   15.172  -15.500 1.00 21.64 ? 601 SER A N   1 
ATOM   1001 C CA  . SER A 1 133 ? 2.688   14.152  -16.403 1.00 21.89 ? 601 SER A CA  1 
ATOM   1002 C C   . SER A 1 133 ? 3.850   13.432  -15.727 1.00 20.98 ? 601 SER A C   1 
ATOM   1003 O O   . SER A 1 133 ? 4.931   13.307  -16.301 1.00 21.55 ? 601 SER A O   1 
ATOM   1004 C CB  . SER A 1 133 ? 3.137   14.773  -17.737 1.00 22.21 ? 601 SER A CB  1 
ATOM   1005 O OG  . SER A 1 133 ? 2.049   15.402  -18.399 1.00 24.98 ? 601 SER A OG  1 
ATOM   1006 N N   . LYS A 1 134 ? 3.627   12.995  -14.487 1.00 19.42 ? 602 LYS A N   1 
ATOM   1007 C CA  . LYS A 1 134 ? 4.642   12.278  -13.722 1.00 18.62 ? 602 LYS A CA  1 
ATOM   1008 C C   . LYS A 1 134 ? 4.078   10.969  -13.213 1.00 16.97 ? 602 LYS A C   1 
ATOM   1009 O O   . LYS A 1 134 ? 2.887   10.860  -12.938 1.00 17.16 ? 602 LYS A O   1 
ATOM   1010 C CB  . LYS A 1 134 ? 5.144   13.111  -12.543 1.00 19.09 ? 602 LYS A CB  1 
ATOM   1011 C CG  . LYS A 1 134 ? 5.681   14.473  -12.952 1.00 21.83 ? 602 LYS A CG  1 
ATOM   1012 C CD  . LYS A 1 134 ? 7.092   14.680  -12.486 1.00 25.46 ? 602 LYS A CD  1 
ATOM   1013 C CE  . LYS A 1 134 ? 8.056   13.939  -13.390 1.00 27.81 ? 602 LYS A CE  1 
ATOM   1014 N NZ  . LYS A 1 134 ? 9.352   13.778  -12.708 1.00 29.36 ? 602 LYS A NZ  1 
ATOM   1015 N N   . ALA A 1 135 ? 4.947   9.977   -13.085 1.00 14.78 ? 603 ALA A N   1 
ATOM   1016 C CA  . ALA A 1 135 ? 4.554   8.676   -12.551 1.00 13.76 ? 603 ALA A CA  1 
ATOM   1017 C C   . ALA A 1 135 ? 5.606   8.215   -11.572 1.00 12.43 ? 603 ALA A C   1 
ATOM   1018 O O   . ALA A 1 135 ? 6.803   8.402   -11.801 1.00 13.29 ? 603 ALA A O   1 
ATOM   1019 C CB  . ALA A 1 135 ? 4.392   7.663   -13.660 1.00 13.29 ? 603 ALA A CB  1 
ATOM   1020 N N   . MET A 1 136 ? 5.158   7.630   -10.468 1.00 11.30 ? 604 MET A N   1 
ATOM   1021 C CA  A MET A 1 136 ? 6.076   7.156   -9.439  0.50 11.47 ? 604 MET A CA  1 
ATOM   1022 C CA  B MET A 1 136 ? 6.060   7.168   -9.412  0.50 11.38 ? 604 MET A CA  1 
ATOM   1023 C C   . MET A 1 136 ? 5.769   5.706   -9.092  1.00 11.20 ? 604 MET A C   1 
ATOM   1024 O O   . MET A 1 136 ? 4.626   5.352   -8.813  1.00 10.96 ? 604 MET A O   1 
ATOM   1025 C CB  A MET A 1 136 ? 5.992   8.055   -8.199  0.50 11.99 ? 604 MET A CB  1 
ATOM   1026 C CB  B MET A 1 136 ? 5.868   8.039   -8.162  0.50 11.71 ? 604 MET A CB  1 
ATOM   1027 C CG  A MET A 1 136 ? 6.857   7.615   -7.026  0.50 13.50 ? 604 MET A CG  1 
ATOM   1028 C CG  B MET A 1 136 ? 6.635   7.605   -6.912  0.50 13.12 ? 604 MET A CG  1 
ATOM   1029 S SD  A MET A 1 136 ? 7.060   8.930   -5.812  0.50 16.27 ? 604 MET A SD  1 
ATOM   1030 S SD  B MET A 1 136 ? 8.407   7.912   -7.005  0.50 11.92 ? 604 MET A SD  1 
ATOM   1031 C CE  A MET A 1 136 ? 8.349   9.884   -6.600  0.50 11.12 ? 604 MET A CE  1 
ATOM   1032 C CE  B MET A 1 136 ? 8.636   8.949   -5.568  0.50 16.70 ? 604 MET A CE  1 
ATOM   1033 N N   . VAL A 1 137 ? 6.795   4.861   -9.137  1.00 10.35 ? 605 VAL A N   1 
ATOM   1034 C CA  . VAL A 1 137 ? 6.633   3.468   -8.754  1.00 10.83 ? 605 VAL A CA  1 
ATOM   1035 C C   . VAL A 1 137 ? 6.691   3.397   -7.240  1.00 11.03 ? 605 VAL A C   1 
ATOM   1036 O O   . VAL A 1 137 ? 7.720   3.735   -6.635  1.00 11.99 ? 605 VAL A O   1 
ATOM   1037 C CB  . VAL A 1 137 ? 7.720   2.544   -9.371  1.00 11.15 ? 605 VAL A CB  1 
ATOM   1038 C CG1 . VAL A 1 137 ? 7.591   1.133   -8.813  1.00 12.35 ? 605 VAL A CG1 1 
ATOM   1039 C CG2 . VAL A 1 137 ? 7.594   2.491   -10.892 1.00 12.05 ? 605 VAL A CG2 1 
ATOM   1040 N N   . LEU A 1 138 ? 5.581   2.961   -6.642  1.00 10.69 ? 606 LEU A N   1 
ATOM   1041 C CA  . LEU A 1 138 ? 5.410   2.898   -5.180  1.00 10.73 ? 606 LEU A CA  1 
ATOM   1042 C C   . LEU A 1 138 ? 5.803   1.561   -4.553  1.00 10.33 ? 606 LEU A C   1 
ATOM   1043 O O   . LEU A 1 138 ? 6.205   1.503   -3.388  1.00 11.67 ? 606 LEU A O   1 
ATOM   1044 C CB  . LEU A 1 138 ? 3.958   3.206   -4.805  1.00 10.14 ? 606 LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 138 ? 3.430   4.568   -5.257  1.00 12.38 ? 606 LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 138 ? 1.975   4.750   -4.843  1.00 12.84 ? 606 LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 138 ? 4.269   5.687   -4.681  1.00 14.36 ? 606 LEU A CD2 1 
ATOM   1048 N N   . ALA A 1 139 ? 5.655   0.489   -5.323  1.00 10.59 ? 607 ALA A N   1 
ATOM   1049 C CA  . ALA A 1 139 ? 5.925   -0.850  -4.840  1.00 10.20 ? 607 ALA A CA  1 
ATOM   1050 C C   . ALA A 1 139 ? 6.204   -1.793  -6.000  1.00 10.25 ? 607 ALA A C   1 
ATOM   1051 O O   . ALA A 1 139 ? 5.777   -1.550  -7.133  1.00 9.95  ? 607 ALA A O   1 
ATOM   1052 C CB  . ALA A 1 139 ? 4.758   -1.362  -3.994  1.00 11.21 ? 607 ALA A CB  1 
ATOM   1053 N N   . LEU A 1 140 ? 6.965   -2.845  -5.694  1.00 10.56 ? 608 LEU A N   1 
ATOM   1054 C CA  . LEU A 1 140 ? 7.226   -3.952  -6.609  1.00 10.95 ? 608 LEU A CA  1 
ATOM   1055 C C   . LEU A 1 140 ? 6.772   -5.246  -5.958  1.00 11.63 ? 608 LEU A C   1 
ATOM   1056 O O   . LEU A 1 140 ? 6.950   -5.436  -4.763  1.00 13.32 ? 608 LEU A O   1 
ATOM   1057 C CB  . LEU A 1 140 ? 8.724   -4.058  -6.899  1.00 10.86 ? 608 LEU A CB  1 
ATOM   1058 C CG  . LEU A 1 140 ? 9.411   -2.832  -7.477  1.00 9.75  ? 608 LEU A CG  1 
ATOM   1059 C CD1 . LEU A 1 140 ? 10.915  -3.102  -7.586  1.00 11.99 ? 608 LEU A CD1 1 
ATOM   1060 C CD2 . LEU A 1 140 ? 8.826   -2.441  -8.829  1.00 11.89 ? 608 LEU A CD2 1 
ATOM   1061 N N   . GLN A 1 141 ? 6.183   -6.141  -6.739  1.00 11.20 ? 609 GLN A N   1 
ATOM   1062 C CA  . GLN A 1 141 ? 5.773   -7.440  -6.228  1.00 12.10 ? 609 GLN A CA  1 
ATOM   1063 C C   . GLN A 1 141 ? 6.085   -8.535  -7.253  1.00 12.18 ? 609 GLN A C   1 
ATOM   1064 O O   . GLN A 1 141 ? 5.730   -8.410  -8.431  1.00 11.66 ? 609 GLN A O   1 
ATOM   1065 C CB  . GLN A 1 141 ? 4.273   -7.431  -5.913  1.00 12.01 ? 609 GLN A CB  1 
ATOM   1066 C CG  . GLN A 1 141 ? 3.767   -8.685  -5.195  1.00 15.50 ? 609 GLN A CG  1 
ATOM   1067 C CD  . GLN A 1 141 ? 2.250   -8.714  -5.046  1.00 18.80 ? 609 GLN A CD  1 
ATOM   1068 O OE1 . GLN A 1 141 ? 1.515   -8.206  -5.894  1.00 20.94 ? 609 GLN A OE1 1 
ATOM   1069 N NE2 . GLN A 1 141 ? 1.780   -9.342  -3.978  1.00 23.05 ? 609 GLN A NE2 1 
ATOM   1070 N N   . ASP A 1 142 ? 6.715   -9.615  -6.795  1.00 12.55 ? 610 ASP A N   1 
ATOM   1071 C CA  . ASP A 1 142 ? 6.924   -10.787 -7.642  1.00 13.94 ? 610 ASP A CA  1 
ATOM   1072 C C   . ASP A 1 142 ? 5.587   -11.425 -7.986  1.00 13.72 ? 610 ASP A C   1 
ATOM   1073 O O   . ASP A 1 142 ? 4.706   -11.528 -7.126  1.00 13.42 ? 610 ASP A O   1 
ATOM   1074 C CB  . ASP A 1 142 ? 7.763   -11.847 -6.906  1.00 14.94 ? 610 ASP A CB  1 
ATOM   1075 C CG  . ASP A 1 142 ? 9.226   -11.505 -6.824  1.00 19.99 ? 610 ASP A CG  1 
ATOM   1076 O OD1 . ASP A 1 142 ? 9.718   -10.654 -7.594  1.00 25.18 ? 610 ASP A OD1 1 
ATOM   1077 O OD2 . ASP A 1 142 ? 9.906   -12.114 -5.969  1.00 24.62 ? 610 ASP A OD2 1 
ATOM   1078 N N   . VAL A 1 143 ? 5.436   -11.870 -9.232  1.00 13.49 ? 611 VAL A N   1 
ATOM   1079 C CA  . VAL A 1 143 ? 4.244   -12.622 -9.597  1.00 13.76 ? 611 VAL A CA  1 
ATOM   1080 C C   . VAL A 1 143 ? 4.169   -13.942 -8.834  1.00 13.59 ? 611 VAL A C   1 
ATOM   1081 O O   . VAL A 1 143 ? 5.188   -14.606 -8.582  1.00 13.78 ? 611 VAL A O   1 
ATOM   1082 C CB  . VAL A 1 143 ? 4.101   -12.859 -11.131 1.00 13.92 ? 611 VAL A CB  1 
ATOM   1083 C CG1 . VAL A 1 143 ? 3.882   -11.529 -11.837 1.00 15.68 ? 611 VAL A CG1 1 
ATOM   1084 C CG2 . VAL A 1 143 ? 5.321   -13.567 -11.702 1.00 14.86 ? 611 VAL A CG2 1 
ATOM   1085 N N   . ASN A 1 144 ? 2.953   -14.294 -8.456  1.00 12.81 ? 612 ASN A N   1 
ATOM   1086 C CA  . ASN A 1 144 ? 2.703   -15.517 -7.702  1.00 13.09 ? 612 ASN A CA  1 
ATOM   1087 C C   . ASN A 1 144 ? 1.469   -16.288 -8.207  1.00 13.21 ? 612 ASN A C   1 
ATOM   1088 O O   . ASN A 1 144 ? 0.788   -15.848 -9.137  1.00 12.61 ? 612 ASN A O   1 
ATOM   1089 C CB  . ASN A 1 144 ? 2.621   -15.187 -6.204  1.00 12.91 ? 612 ASN A CB  1 
ATOM   1090 C CG  . ASN A 1 144 ? 1.418   -14.317 -5.851  1.00 13.20 ? 612 ASN A CG  1 
ATOM   1091 O OD1 . ASN A 1 144 ? 0.329   -14.517 -6.367  1.00 13.73 ? 612 ASN A OD1 1 
ATOM   1092 N ND2 . ASN A 1 144 ? 1.617   -13.366 -4.947  1.00 14.45 ? 612 ASN A ND2 1 
ATOM   1093 N N   . MET A 1 145 ? 1.190   -17.445 -7.610  1.00 13.94 ? 613 MET A N   1 
ATOM   1094 C CA  . MET A 1 145 ? 0.102   -18.299 -8.092  1.00 14.38 ? 613 MET A CA  1 
ATOM   1095 C C   . MET A 1 145 ? -1.292  -17.677 -7.926  1.00 13.88 ? 613 MET A C   1 
ATOM   1096 O O   . MET A 1 145 ? -2.188  -17.946 -8.725  1.00 14.04 ? 613 MET A O   1 
ATOM   1097 C CB  . MET A 1 145 ? 0.167   -19.699 -7.447  1.00 15.16 ? 613 MET A CB  1 
ATOM   1098 C CG  . MET A 1 145 ? -0.877  -20.702 -7.972  1.00 17.21 ? 613 MET A CG  1 
ATOM   1099 S SD  . MET A 1 145 ? -0.774  -21.127 -9.734  1.00 23.89 ? 613 MET A SD  1 
ATOM   1100 C CE  . MET A 1 145 ? 0.957   -21.473 -9.855  1.00 24.07 ? 613 MET A CE  1 
ATOM   1101 N N   . GLU A 1 146 ? -1.467  -16.838 -6.906  1.00 14.03 ? 614 GLU A N   1 
ATOM   1102 C CA  . GLU A 1 146 ? -2.715  -16.083 -6.779  1.00 13.85 ? 614 GLU A CA  1 
ATOM   1103 C C   . GLU A 1 146 ? -2.922  -15.190 -8.010  1.00 13.38 ? 614 GLU A C   1 
ATOM   1104 O O   . GLU A 1 146 ? -4.025  -15.122 -8.553  1.00 12.91 ? 614 GLU A O   1 
ATOM   1105 C CB  . GLU A 1 146 ? -2.747  -15.254 -5.495  1.00 14.28 ? 614 GLU A CB  1 
ATOM   1106 C CG  . GLU A 1 146 ? -4.033  -14.444 -5.319  1.00 18.07 ? 614 GLU A CG  1 
ATOM   1107 C CD  . GLU A 1 146 ? -4.069  -13.655 -4.015  1.00 23.21 ? 614 GLU A CD  1 
ATOM   1108 O OE1 . GLU A 1 146 ? -2.999  -13.427 -3.414  1.00 26.45 ? 614 GLU A OE1 1 
ATOM   1109 O OE2 . GLU A 1 146 ? -5.179  -13.261 -3.589  1.00 25.65 ? 614 GLU A OE2 1 
ATOM   1110 N N   . HIS A 1 147 ? -1.857  -14.536 -8.464  1.00 12.30 ? 615 HIS A N   1 
ATOM   1111 C CA  . HIS A 1 147 ? -1.962  -13.722 -9.689  1.00 12.13 ? 615 HIS A CA  1 
ATOM   1112 C C   . HIS A 1 147 ? -2.379  -14.552 -10.895 1.00 12.68 ? 615 HIS A C   1 
ATOM   1113 O O   . HIS A 1 147 ? -3.229  -14.135 -11.687 1.00 12.40 ? 615 HIS A O   1 
ATOM   1114 C CB  . HIS A 1 147 ? -0.658  -12.979 -9.975  1.00 11.64 ? 615 HIS A CB  1 
ATOM   1115 C CG  . HIS A 1 147 ? -0.226  -12.077 -8.865  1.00 11.36 ? 615 HIS A CG  1 
ATOM   1116 N ND1 . HIS A 1 147 ? 1.076   -12.023 -8.423  1.00 11.17 ? 615 HIS A ND1 1 
ATOM   1117 C CD2 . HIS A 1 147 ? -0.927  -11.223 -8.082  1.00 11.56 ? 615 HIS A CD2 1 
ATOM   1118 C CE1 . HIS A 1 147 ? 1.167   -11.150 -7.434  1.00 10.90 ? 615 HIS A CE1 1 
ATOM   1119 N NE2 . HIS A 1 147 ? -0.039  -10.659 -7.199  1.00 12.16 ? 615 HIS A NE2 1 
ATOM   1120 N N   . LEU A 1 148 ? -1.789  -15.739 -11.014 1.00 13.10 ? 616 LEU A N   1 
ATOM   1121 C CA  A LEU A 1 148 ? -2.116  -16.657 -12.102 0.50 13.74 ? 616 LEU A CA  1 
ATOM   1122 C CA  B LEU A 1 148 ? -2.113  -16.653 -12.102 0.50 13.65 ? 616 LEU A CA  1 
ATOM   1123 C C   . LEU A 1 148 ? -3.598  -17.019 -12.061 1.00 14.00 ? 616 LEU A C   1 
ATOM   1124 O O   . LEU A 1 148 ? -4.278  -16.980 -13.092 1.00 13.93 ? 616 LEU A O   1 
ATOM   1125 C CB  A LEU A 1 148 ? -1.237  -17.914 -12.040 0.50 14.10 ? 616 LEU A CB  1 
ATOM   1126 C CB  B LEU A 1 148 ? -1.218  -17.898 -12.040 0.50 13.88 ? 616 LEU A CB  1 
ATOM   1127 C CG  A LEU A 1 148 ? -1.474  -18.958 -13.142 0.50 14.30 ? 616 LEU A CG  1 
ATOM   1128 C CG  B LEU A 1 148 ? -1.222  -18.810 -13.275 0.50 13.77 ? 616 LEU A CG  1 
ATOM   1129 C CD1 A LEU A 1 148 ? -1.531  -18.304 -14.505 0.50 14.44 ? 616 LEU A CD1 1 
ATOM   1130 C CD1 B LEU A 1 148 ? 0.121   -19.498 -13.476 0.50 12.34 ? 616 LEU A CD1 1 
ATOM   1131 C CD2 A LEU A 1 148 ? -0.405  -20.034 -13.135 0.50 14.66 ? 616 LEU A CD2 1 
ATOM   1132 C CD2 B LEU A 1 148 ? -2.333  -19.831 -13.193 0.50 14.04 ? 616 LEU A CD2 1 
ATOM   1133 N N   . GLU A 1 149 ? -4.087  -17.360 -10.867 1.00 14.38 ? 617 GLU A N   1 
ATOM   1134 C CA  A GLU A 1 149 ? -5.486  -17.746 -10.697 0.50 14.83 ? 617 GLU A CA  1 
ATOM   1135 C CA  B GLU A 1 149 ? -5.486  -17.741 -10.689 0.50 14.97 ? 617 GLU A CA  1 
ATOM   1136 C C   . GLU A 1 149 ? -6.434  -16.580 -10.972 1.00 14.64 ? 617 GLU A C   1 
ATOM   1137 O O   . GLU A 1 149 ? -7.482  -16.775 -11.591 1.00 14.36 ? 617 GLU A O   1 
ATOM   1138 C CB  A GLU A 1 149 ? -5.724  -18.365 -9.315  0.50 15.13 ? 617 GLU A CB  1 
ATOM   1139 C CB  B GLU A 1 149 ? -5.719  -18.330 -9.294  0.50 15.36 ? 617 GLU A CB  1 
ATOM   1140 C CG  A GLU A 1 149 ? -5.068  -19.745 -9.128  0.50 17.23 ? 617 GLU A CG  1 
ATOM   1141 C CG  B GLU A 1 149 ? -5.079  -19.707 -9.107  0.50 18.14 ? 617 GLU A CG  1 
ATOM   1142 C CD  A GLU A 1 149 ? -5.480  -20.751 -10.195 0.50 18.25 ? 617 GLU A CD  1 
ATOM   1143 C CD  B GLU A 1 149 ? -5.650  -20.474 -7.934  0.50 20.43 ? 617 GLU A CD  1 
ATOM   1144 O OE1 A GLU A 1 149 ? -6.639  -20.693 -10.654 0.50 19.72 ? 617 GLU A OE1 1 
ATOM   1145 O OE1 B GLU A 1 149 ? -6.562  -19.951 -7.257  0.50 21.49 ? 617 GLU A OE1 1 
ATOM   1146 O OE2 A GLU A 1 149 ? -4.643  -21.603 -10.573 0.50 19.40 ? 617 GLU A OE2 1 
ATOM   1147 O OE2 B GLU A 1 149 ? -5.185  -21.607 -7.685  0.50 22.15 ? 617 GLU A OE2 1 
ATOM   1148 N N   . ASN A 1 150 ? -6.051  -15.374 -10.535 1.00 14.46 ? 618 ASN A N   1 
ATOM   1149 C CA  A ASN A 1 150 ? -6.783  -14.134 -10.855 0.50 14.22 ? 618 ASN A CA  1 
ATOM   1150 C CA  B ASN A 1 150 ? -6.861  -14.205 -10.844 0.50 14.37 ? 618 ASN A CA  1 
ATOM   1151 C C   . ASN A 1 150 ? -6.937  -13.939 -12.350 1.00 14.15 ? 618 ASN A C   1 
ATOM   1152 O O   . ASN A 1 150 ? -8.007  -13.570 -12.853 1.00 13.98 ? 618 ASN A O   1 
ATOM   1153 C CB  A ASN A 1 150 ? -6.027  -12.910 -10.343 0.50 14.33 ? 618 ASN A CB  1 
ATOM   1154 C CB  B ASN A 1 150 ? -6.410  -12.979 -10.043 0.50 14.60 ? 618 ASN A CB  1 
ATOM   1155 C CG  A ASN A 1 150 ? -6.013  -12.809 -8.848  0.50 13.97 ? 618 ASN A CG  1 
ATOM   1156 C CG  B ASN A 1 150 ? -7.104  -12.886 -8.689  0.50 14.92 ? 618 ASN A CG  1 
ATOM   1157 O OD1 A ASN A 1 150 ? -6.861  -13.383 -8.152  0.50 14.54 ? 618 ASN A OD1 1 
ATOM   1158 O OD1 B ASN A 1 150 ? -6.487  -12.552 -7.672  0.50 13.86 ? 618 ASN A OD1 1 
ATOM   1159 N ND2 A ASN A 1 150 ? -5.046  -12.068 -8.334  0.50 14.28 ? 618 ASN A ND2 1 
ATOM   1160 N ND2 B ASN A 1 150 ? -8.395  -13.193 -8.672  0.50 16.93 ? 618 ASN A ND2 1 
ATOM   1161 N N   . LEU A 1 151 ? -5.831  -14.155 -13.065 1.00 13.85 ? 619 LEU A N   1 
ATOM   1162 C CA  . LEU A 1 151 ? -5.808  -13.986 -14.508 1.00 14.31 ? 619 LEU A CA  1 
ATOM   1163 C C   . LEU A 1 151 ? -6.696  -15.022 -15.205 1.00 14.75 ? 619 LEU A C   1 
ATOM   1164 O O   . LEU A 1 151 ? -7.462  -14.678 -16.110 1.00 14.51 ? 619 LEU A O   1 
ATOM   1165 C CB  . LEU A 1 151 ? -4.367  -14.053 -15.034 1.00 14.19 ? 619 LEU A CB  1 
ATOM   1166 C CG  . LEU A 1 151 ? -4.167  -13.644 -16.494 1.00 14.18 ? 619 LEU A CG  1 
ATOM   1167 C CD1 . LEU A 1 151 ? -4.690  -12.240 -16.754 1.00 15.87 ? 619 LEU A CD1 1 
ATOM   1168 C CD2 . LEU A 1 151 ? -2.703  -13.718 -16.840 1.00 14.10 ? 619 LEU A CD2 1 
ATOM   1169 N N   . LYS A 1 152 ? -6.584  -16.280 -14.783 1.00 15.44 ? 620 LYS A N   1 
ATOM   1170 C CA  . LYS A 1 152 ? -7.434  -17.352 -15.315 1.00 16.36 ? 620 LYS A CA  1 
ATOM   1171 C C   . LYS A 1 152 ? -8.906  -17.032 -15.099 1.00 16.50 ? 620 LYS A C   1 
ATOM   1172 O O   . LYS A 1 152 ? -9.723  -17.215 -15.997 1.00 17.23 ? 620 LYS A O   1 
ATOM   1173 C CB  . LYS A 1 152 ? -7.124  -18.684 -14.627 1.00 16.81 ? 620 LYS A CB  1 
ATOM   1174 C CG  . LYS A 1 152 ? -5.801  -19.286 -15.019 1.00 18.76 ? 620 LYS A CG  1 
ATOM   1175 C CD  . LYS A 1 152 ? -5.454  -20.464 -14.120 1.00 21.69 ? 620 LYS A CD  1 
ATOM   1176 C CE  . LYS A 1 152 ? -6.048  -21.766 -14.614 1.00 25.43 ? 620 LYS A CE  1 
ATOM   1177 N NZ  . LYS A 1 152 ? -5.399  -22.916 -13.924 1.00 27.17 ? 620 LYS A NZ  1 
ATOM   1178 N N   . LYS A 1 153 ? -9.245  -16.555 -13.904 1.00 16.53 ? 621 LYS A N   1 
ATOM   1179 C CA  . LYS A 1 153 ? -10.633 -16.194 -13.587 1.00 16.98 ? 621 LYS A CA  1 
ATOM   1180 C C   . LYS A 1 153 ? -11.149 -15.092 -14.526 1.00 16.55 ? 621 LYS A C   1 
ATOM   1181 O O   . LYS A 1 153 ? -12.266 -15.176 -15.057 1.00 16.59 ? 621 LYS A O   1 
ATOM   1182 C CB  . LYS A 1 153 ? -10.743 -15.778 -12.118 1.00 17.43 ? 621 LYS A CB  1 
ATOM   1183 C CG  . LYS A 1 153 ? -12.156 -15.497 -11.623 1.00 20.69 ? 621 LYS A CG  1 
ATOM   1184 C CD  . LYS A 1 153 ? -12.145 -15.264 -10.108 1.00 24.25 ? 621 LYS A CD  1 
ATOM   1185 C CE  . LYS A 1 153 ? -13.411 -14.578 -9.621  1.00 26.91 ? 621 LYS A CE  1 
ATOM   1186 N NZ  . LYS A 1 153 ? -14.635 -15.361 -9.942  1.00 28.44 ? 621 LYS A NZ  1 
ATOM   1187 N N   . ARG A 1 154 ? -10.317 -14.078 -14.754 1.00 15.63 ? 622 ARG A N   1 
ATOM   1188 C CA  . ARG A 1 154 ? -10.657 -12.972 -15.650 1.00 15.87 ? 622 ARG A CA  1 
ATOM   1189 C C   . ARG A 1 154 ? -10.952 -13.422 -17.078 1.00 16.00 ? 622 ARG A C   1 
ATOM   1190 O O   . ARG A 1 154 ? -11.820 -12.849 -17.744 1.00 15.74 ? 622 ARG A O   1 
ATOM   1191 C CB  . ARG A 1 154 ? -9.519  -11.933 -15.645 1.00 15.47 ? 622 ARG A CB  1 
ATOM   1192 C CG  . ARG A 1 154 ? -9.813  -10.644 -16.374 1.00 17.03 ? 622 ARG A CG  1 
ATOM   1193 C CD  . ARG A 1 154 ? -9.046  -9.518  -15.718 1.00 14.69 ? 622 ARG A CD  1 
ATOM   1194 N NE  . ARG A 1 154 ? -7.727  -9.331  -16.307 1.00 12.55 ? 622 ARG A NE  1 
ATOM   1195 C CZ  . ARG A 1 154 ? -6.830  -8.482  -15.828 1.00 10.65 ? 622 ARG A CZ  1 
ATOM   1196 N NH1 . ARG A 1 154 ? -7.091  -7.767  -14.739 1.00 9.77  ? 622 ARG A NH1 1 
ATOM   1197 N NH2 . ARG A 1 154 ? -5.668  -8.355  -16.438 1.00 10.27 ? 622 ARG A NH2 1 
ATOM   1198 N N   . LEU A 1 155 ? -10.219 -14.436 -17.542 1.00 16.23 ? 623 LEU A N   1 
ATOM   1199 C CA  . LEU A 1 155 ? -10.388 -14.994 -18.881 1.00 17.90 ? 623 LEU A CA  1 
ATOM   1200 C C   . LEU A 1 155 ? -11.395 -16.144 -18.889 1.00 19.82 ? 623 LEU A C   1 
ATOM   1201 O O   . LEU A 1 155 ? -11.599 -16.777 -19.930 1.00 20.65 ? 623 LEU A O   1 
ATOM   1202 C CB  . LEU A 1 155 ? -9.040  -15.498 -19.404 1.00 17.22 ? 623 LEU A CB  1 
ATOM   1203 C CG  . LEU A 1 155 ? -7.969  -14.417 -19.589 1.00 15.61 ? 623 LEU A CG  1 
ATOM   1204 C CD1 . LEU A 1 155 ? -6.615  -15.066 -19.796 1.00 15.85 ? 623 LEU A CD1 1 
ATOM   1205 C CD2 . LEU A 1 155 ? -8.316  -13.493 -20.749 1.00 16.48 ? 623 LEU A CD2 1 
ATOM   1206 N N   . ASN A 1 156 ? -12.011 -16.388 -17.729 1.00 21.50 ? 624 ASN A N   1 
ATOM   1207 C CA  . ASN A 1 156 ? -12.910 -17.529 -17.479 1.00 23.74 ? 624 ASN A CA  1 
ATOM   1208 C C   . ASN A 1 156 ? -12.330 -18.900 -17.870 1.00 24.57 ? 624 ASN A C   1 
ATOM   1209 O O   . ASN A 1 156 ? -12.991 -19.710 -18.524 1.00 25.05 ? 624 ASN A O   1 
ATOM   1210 C CB  . ASN A 1 156 ? -14.286 -17.295 -18.120 1.00 23.62 ? 624 ASN A CB  1 
ATOM   1211 C CG  . ASN A 1 156 ? -15.364 -18.208 -17.544 1.00 25.69 ? 624 ASN A CG  1 
ATOM   1212 O OD1 . ASN A 1 156 ? -15.403 -18.472 -16.337 1.00 28.08 ? 624 ASN A OD1 1 
ATOM   1213 N ND2 . ASN A 1 156 ? -16.244 -18.699 -18.412 1.00 27.59 ? 624 ASN A ND2 1 
ATOM   1214 N N   . LYS A 1 157 ? -11.089 -19.145 -17.456 1.00 26.15 ? 625 LYS A N   1 
ATOM   1215 C CA  . LYS A 1 157 ? -10.390 -20.394 -17.764 1.00 27.56 ? 625 LYS A CA  1 
ATOM   1216 C C   . LYS A 1 157 ? -10.158 -21.211 -16.499 1.00 28.22 ? 625 LYS A C   1 
ATOM   1217 O O   . LYS A 1 157 ? -11.050 -21.325 -15.653 1.00 29.40 ? 625 LYS A O   1 
ATOM   1218 C CB  . LYS A 1 157 ? -9.061  -20.107 -18.476 1.00 27.87 ? 625 LYS A CB  1 
ATOM   1219 C CG  . LYS A 1 157 ? -9.235  -19.293 -19.750 1.00 29.26 ? 625 LYS A CG  1 
ATOM   1220 C CD  . LYS A 1 157 ? -7.933  -19.055 -20.477 1.00 31.15 ? 625 LYS A CD  1 
ATOM   1221 C CE  . LYS A 1 157 ? -7.771  -19.983 -21.663 1.00 32.08 ? 625 LYS A CE  1 
ATOM   1222 N NZ  . LYS A 1 157 ? -8.564  -19.502 -22.832 1.00 33.44 ? 625 LYS A NZ  1 
ATOM   1223 N N   . LEU B 2 20  ? 14.272  2.270   -28.676 1.00 38.37 ? 17  LEU B N   1 
ATOM   1224 C CA  . LEU B 2 20  ? 14.349  2.820   -30.065 1.00 38.12 ? 17  LEU B CA  1 
ATOM   1225 C C   . LEU B 2 20  ? 12.997  2.837   -30.797 1.00 37.78 ? 17  LEU B C   1 
ATOM   1226 O O   . LEU B 2 20  ? 12.620  3.870   -31.357 1.00 37.88 ? 17  LEU B O   1 
ATOM   1227 C CB  . LEU B 2 20  ? 15.420  2.095   -30.898 1.00 38.40 ? 17  LEU B CB  1 
ATOM   1228 C CG  . LEU B 2 20  ? 16.895  2.264   -30.508 1.00 38.85 ? 17  LEU B CG  1 
ATOM   1229 C CD1 . LEU B 2 20  ? 17.724  1.093   -31.031 1.00 38.84 ? 17  LEU B CD1 1 
ATOM   1230 C CD2 . LEU B 2 20  ? 17.468  3.594   -31.006 1.00 39.02 ? 17  LEU B CD2 1 
ATOM   1231 N N   . PRO B 2 21  ? 12.258  1.702   -30.797 1.00 37.17 ? 18  PRO B N   1 
ATOM   1232 C CA  . PRO B 2 21  ? 10.974  1.707   -31.510 1.00 36.42 ? 18  PRO B CA  1 
ATOM   1233 C C   . PRO B 2 21  ? 9.934   2.649   -30.892 1.00 35.75 ? 18  PRO B C   1 
ATOM   1234 O O   . PRO B 2 21  ? 9.868   2.787   -29.667 1.00 36.03 ? 18  PRO B O   1 
ATOM   1235 C CB  . PRO B 2 21  ? 10.512  0.245   -31.419 1.00 36.66 ? 18  PRO B CB  1 
ATOM   1236 C CG  . PRO B 2 21  ? 11.251  -0.326  -30.267 1.00 36.75 ? 18  PRO B CG  1 
ATOM   1237 C CD  . PRO B 2 21  ? 12.574  0.364   -30.258 1.00 37.25 ? 18  PRO B CD  1 
ATOM   1238 N N   . ARG B 2 22  ? 9.139   3.289   -31.747 1.00 34.68 ? 19  ARG B N   1 
ATOM   1239 C CA  . ARG B 2 22  ? 8.135   4.263   -31.318 1.00 33.43 ? 19  ARG B CA  1 
ATOM   1240 C C   . ARG B 2 22  ? 6.922   3.582   -30.681 1.00 31.86 ? 19  ARG B C   1 
ATOM   1241 O O   . ARG B 2 22  ? 6.398   4.051   -29.665 1.00 32.19 ? 19  ARG B O   1 
ATOM   1242 C CB  . ARG B 2 22  ? 7.708   5.140   -32.503 1.00 34.01 ? 19  ARG B CB  1 
ATOM   1243 C CG  . ARG B 2 22  ? 6.642   6.181   -32.182 1.00 35.31 ? 19  ARG B CG  1 
ATOM   1244 C CD  . ARG B 2 22  ? 6.412   7.116   -33.359 1.00 37.93 ? 19  ARG B CD  1 
ATOM   1245 N NE  . ARG B 2 22  ? 5.107   7.769   -33.279 1.00 39.29 ? 19  ARG B NE  1 
ATOM   1246 C CZ  . ARG B 2 22  ? 4.026   7.394   -33.962 1.00 40.29 ? 19  ARG B CZ  1 
ATOM   1247 N NH1 . ARG B 2 22  ? 4.077   6.364   -34.803 1.00 41.01 ? 19  ARG B NH1 1 
ATOM   1248 N NH2 . ARG B 2 22  ? 2.887   8.059   -33.808 1.00 41.30 ? 19  ARG B NH2 1 
ATOM   1249 N N   . SER B 2 23  ? 6.484   2.481   -31.287 1.00 29.44 ? 20  SER B N   1 
ATOM   1250 C CA  . SER B 2 23  ? 5.333   1.728   -30.800 1.00 27.11 ? 20  SER B CA  1 
ATOM   1251 C C   . SER B 2 23  ? 5.758   0.769   -29.686 1.00 24.61 ? 20  SER B C   1 
ATOM   1252 O O   . SER B 2 23  ? 6.905   0.323   -29.654 1.00 23.75 ? 20  SER B O   1 
ATOM   1253 C CB  . SER B 2 23  ? 4.667   0.966   -31.943 1.00 27.29 ? 20  SER B CB  1 
ATOM   1254 O OG  . SER B 2 23  ? 5.605   0.129   -32.590 1.00 28.84 ? 20  SER B OG  1 
ATOM   1255 N N   . PRO B 2 24  ? 4.831   0.451   -28.767 1.00 22.75 ? 21  PRO B N   1 
ATOM   1256 C CA  . PRO B 2 24  ? 5.179   -0.408  -27.636 1.00 20.89 ? 21  PRO B CA  1 
ATOM   1257 C C   . PRO B 2 24  ? 5.462   -1.860  -28.018 1.00 18.62 ? 21  PRO B C   1 
ATOM   1258 O O   . PRO B 2 24  ? 5.009   -2.320  -29.067 1.00 17.80 ? 21  PRO B O   1 
ATOM   1259 C CB  . PRO B 2 24  ? 3.932   -0.335  -26.749 1.00 21.02 ? 21  PRO B CB  1 
ATOM   1260 C CG  . PRO B 2 24  ? 2.836   0.019   -27.653 1.00 22.84 ? 21  PRO B CG  1 
ATOM   1261 C CD  . PRO B 2 24  ? 3.447   0.946   -28.657 1.00 22.64 ? 21  PRO B CD  1 
ATOM   1262 N N   . PRO B 2 25  ? 6.214   -2.581  -27.165 1.00 16.82 ? 22  PRO B N   1 
ATOM   1263 C CA  . PRO B 2 25  ? 6.533   -3.985  -27.421 1.00 15.59 ? 22  PRO B CA  1 
ATOM   1264 C C   . PRO B 2 25  ? 5.363   -4.891  -27.050 1.00 14.76 ? 22  PRO B C   1 
ATOM   1265 O O   . PRO B 2 25  ? 5.252   -5.363  -25.917 1.00 14.27 ? 22  PRO B O   1 
ATOM   1266 C CB  . PRO B 2 25  ? 7.737   -4.242  -26.521 1.00 15.74 ? 22  PRO B CB  1 
ATOM   1267 C CG  . PRO B 2 25  ? 7.562   -3.286  -25.385 1.00 15.81 ? 22  PRO B CG  1 
ATOM   1268 C CD  . PRO B 2 25  ? 6.904   -2.065  -25.966 1.00 17.10 ? 22  PRO B CD  1 
ATOM   1269 N N   . LEU B 2 26  ? 4.507   -5.130  -28.038 1.00 13.67 ? 23  LEU B N   1 
ATOM   1270 C CA  . LEU B 2 26  ? 3.310   -5.940  -27.887 1.00 13.33 ? 23  LEU B CA  1 
ATOM   1271 C C   . LEU B 2 26  ? 3.635   -7.374  -27.495 1.00 12.38 ? 23  LEU B C   1 
ATOM   1272 O O   . LEU B 2 26  ? 4.505   -7.985  -28.110 1.00 12.34 ? 23  LEU B O   1 
ATOM   1273 C CB  . LEU B 2 26  ? 2.592   -5.933  -29.237 1.00 14.00 ? 23  LEU B CB  1 
ATOM   1274 C CG  . LEU B 2 26  ? 1.257   -6.626  -29.357 1.00 16.74 ? 23  LEU B CG  1 
ATOM   1275 C CD1 . LEU B 2 26  ? 0.246   -5.830  -28.551 1.00 18.85 ? 23  LEU B CD1 1 
ATOM   1276 C CD2 . LEU B 2 26  ? 0.874   -6.715  -30.823 1.00 19.02 ? 23  LEU B CD2 1 
ATOM   1277 N N   . LYS B 2 27  ? 2.948   -7.915  -26.481 1.00 11.40 ? 24  LYS B N   1 
ATOM   1278 C CA  . LYS B 2 27  ? 3.112   -9.335  -26.121 1.00 10.86 ? 24  LYS B CA  1 
ATOM   1279 C C   . LYS B 2 27  ? 2.529   -10.193 -27.235 1.00 11.03 ? 24  LYS B C   1 
ATOM   1280 O O   . LYS B 2 27  ? 1.367   -10.003 -27.614 1.00 11.83 ? 24  LYS B O   1 
ATOM   1281 C CB  . LYS B 2 27  ? 2.409   -9.685  -24.804 1.00 10.50 ? 24  LYS B CB  1 
ATOM   1282 C CG  . LYS B 2 27  ? 2.917   -8.929  -23.595 1.00 8.92  ? 24  LYS B CG  1 
ATOM   1283 C CD  . LYS B 2 27  ? 2.170   -9.386  -22.352 1.00 9.61  ? 24  LYS B CD  1 
ATOM   1284 C CE  . LYS B 2 27  ? 2.584   -8.532  -21.148 1.00 10.32 ? 24  LYS B CE  1 
ATOM   1285 N NZ  . LYS B 2 27  ? 1.891   -8.986  -19.894 1.00 9.95  ? 24  LYS B NZ  1 
ATOM   1286 N N   . VAL B 2 28  ? 3.328   -11.109 -27.783 1.00 11.07 ? 25  VAL B N   1 
ATOM   1287 C CA  . VAL B 2 28  ? 2.844   -12.022 -28.814 1.00 11.63 ? 25  VAL B CA  1 
ATOM   1288 C C   . VAL B 2 28  ? 3.422   -13.417 -28.645 1.00 11.79 ? 25  VAL B C   1 
ATOM   1289 O O   . VAL B 2 28  ? 4.510   -13.582 -28.093 1.00 11.81 ? 25  VAL B O   1 
ATOM   1290 C CB  . VAL B 2 28  ? 3.150   -11.529 -30.266 1.00 11.70 ? 25  VAL B CB  1 
ATOM   1291 C CG1 . VAL B 2 28  ? 2.459   -10.216 -30.569 1.00 13.04 ? 25  VAL B CG1 1 
ATOM   1292 C CG2 . VAL B 2 28  ? 4.648   -11.439 -30.511 1.00 12.26 ? 25  VAL B CG2 1 
ATOM   1293 N N   . LEU B 2 29  ? 2.673   -14.412 -29.125 1.00 11.97 ? 26  LEU B N   1 
ATOM   1294 C CA  . LEU B 2 29  ? 3.169   -15.777 -29.280 1.00 12.65 ? 26  LEU B CA  1 
ATOM   1295 C C   . LEU B 2 29  ? 3.710   -15.971 -30.697 1.00 13.02 ? 26  LEU B C   1 
ATOM   1296 O O   . LEU B 2 29  ? 3.274   -15.297 -31.642 1.00 13.24 ? 26  LEU B O   1 
ATOM   1297 C CB  . LEU B 2 29  ? 2.050   -16.792 -29.020 1.00 12.81 ? 26  LEU B CB  1 
ATOM   1298 C CG  . LEU B 2 29  ? 1.611   -16.957 -27.564 1.00 13.60 ? 26  LEU B CG  1 
ATOM   1299 C CD1 . LEU B 2 29  ? 0.316   -17.742 -27.468 1.00 16.82 ? 26  LEU B CD1 1 
ATOM   1300 C CD2 . LEU B 2 29  ? 2.702   -17.598 -26.703 1.00 15.45 ? 26  LEU B CD2 1 
ATOM   1301 N N   . ALA B 2 30  ? 4.666   -16.884 -30.840 1.00 13.85 ? 27  ALA B N   1 
ATOM   1302 C CA  . ALA B 2 30  ? 5.243   -17.180 -32.154 1.00 13.98 ? 27  ALA B CA  1 
ATOM   1303 C C   . ALA B 2 30  ? 4.181   -17.444 -33.226 1.00 14.50 ? 27  ALA B C   1 
ATOM   1304 O O   . ALA B 2 30  ? 4.306   -16.930 -34.339 1.00 14.48 ? 27  ALA B O   1 
ATOM   1305 C CB  . ALA B 2 30  ? 6.225   -18.350 -32.070 1.00 14.35 ? 27  ALA B CB  1 
ATOM   1306 N N   . GLU B 2 31  ? 3.139   -18.211 -32.882 1.00 15.52 ? 28  GLU B N   1 
ATOM   1307 C CA  . GLU B 2 31  ? 2.057   -18.537 -33.839 1.00 16.65 ? 28  GLU B CA  1 
ATOM   1308 C C   . GLU B 2 31  ? 1.384   -17.296 -34.432 1.00 16.92 ? 28  GLU B C   1 
ATOM   1309 O O   . GLU B 2 31  ? 0.991   -17.291 -35.599 1.00 17.17 ? 28  GLU B O   1 
ATOM   1310 C CB  . GLU B 2 31  ? 0.996   -19.458 -33.204 1.00 16.83 ? 28  GLU B CB  1 
ATOM   1311 C CG  . GLU B 2 31  ? 0.187   -18.798 -32.057 1.00 18.95 ? 28  GLU B CG  1 
ATOM   1312 C CD  . GLU B 2 31  ? -0.874  -19.698 -31.453 1.00 22.90 ? 28  GLU B CD  1 
ATOM   1313 O OE1 . GLU B 2 31  ? -1.763  -19.169 -30.747 1.00 24.76 ? 28  GLU B OE1 1 
ATOM   1314 O OE2 . GLU B 2 31  ? -0.831  -20.926 -31.678 1.00 24.56 ? 28  GLU B OE2 1 
ATOM   1315 N N   . GLN B 2 32  ? 1.238   -16.242 -33.632 1.00 17.15 ? 29  GLN B N   1 
ATOM   1316 C CA  . GLN B 2 32  ? 0.642   -15.000 -34.124 1.00 17.55 ? 29  GLN B CA  1 
ATOM   1317 C C   . GLN B 2 32  ? 1.449   -14.362 -35.249 1.00 18.07 ? 29  GLN B C   1 
ATOM   1318 O O   . GLN B 2 32  ? 0.891   -13.921 -36.251 1.00 19.10 ? 29  GLN B O   1 
ATOM   1319 C CB  . GLN B 2 32  ? 0.458   -14.005 -32.980 1.00 17.23 ? 29  GLN B CB  1 
ATOM   1320 C CG  . GLN B 2 32  ? -0.635  -14.402 -32.014 1.00 16.96 ? 29  GLN B CG  1 
ATOM   1321 C CD  . GLN B 2 32  ? -0.733  -13.442 -30.851 1.00 16.31 ? 29  GLN B CD  1 
ATOM   1322 O OE1 . GLN B 2 32  ? 0.156   -13.392 -30.010 1.00 14.86 ? 29  GLN B OE1 1 
ATOM   1323 N NE2 . GLN B 2 32  ? -1.807  -12.661 -30.811 1.00 17.18 ? 29  GLN B NE2 1 
ATOM   1324 N N   . LEU B 2 33  ? 2.764   -14.304 -35.081 1.00 18.67 ? 30  LEU B N   1 
ATOM   1325 C CA  . LEU B 2 33  ? 3.616   -13.760 -36.125 1.00 19.36 ? 30  LEU B CA  1 
ATOM   1326 C C   . LEU B 2 33  ? 3.629   -14.708 -37.326 1.00 19.90 ? 30  LEU B C   1 
ATOM   1327 O O   . LEU B 2 33  ? 3.468   -14.274 -38.467 1.00 20.08 ? 30  LEU B O   1 
ATOM   1328 C CB  . LEU B 2 33  ? 5.039   -13.525 -35.606 1.00 19.46 ? 30  LEU B CB  1 
ATOM   1329 C CG  . LEU B 2 33  ? 5.201   -12.464 -34.506 1.00 20.46 ? 30  LEU B CG  1 
ATOM   1330 C CD1 . LEU B 2 33  ? 6.655   -12.316 -34.113 1.00 20.34 ? 30  LEU B CD1 1 
ATOM   1331 C CD2 . LEU B 2 33  ? 4.638   -11.136 -34.972 1.00 20.91 ? 30  LEU B CD2 1 
ATOM   1332 N N   . ARG B 2 34  ? 3.791   -16.000 -37.046 1.00 20.20 ? 31  ARG B N   1 
ATOM   1333 C CA  . ARG B 2 34  ? 3.924   -17.033 -38.076 1.00 21.12 ? 31  ARG B CA  1 
ATOM   1334 C C   . ARG B 2 34  ? 2.678   -17.123 -38.965 1.00 21.58 ? 31  ARG B C   1 
ATOM   1335 O O   . ARG B 2 34  ? 2.788   -17.309 -40.187 1.00 22.22 ? 31  ARG B O   1 
ATOM   1336 C CB  . ARG B 2 34  ? 4.223   -18.389 -37.411 1.00 20.94 ? 31  ARG B CB  1 
ATOM   1337 C CG  . ARG B 2 34  ? 4.651   -19.521 -38.355 1.00 21.00 ? 31  ARG B CG  1 
ATOM   1338 C CD  . ARG B 2 34  ? 4.897   -20.829 -37.587 1.00 20.23 ? 31  ARG B CD  1 
ATOM   1339 N NE  . ARG B 2 34  ? 3.668   -21.354 -36.990 1.00 19.14 ? 31  ARG B NE  1 
ATOM   1340 C CZ  . ARG B 2 34  ? 3.469   -21.563 -35.689 1.00 20.21 ? 31  ARG B CZ  1 
ATOM   1341 N NH1 . ARG B 2 34  ? 4.429   -21.307 -34.800 1.00 20.21 ? 31  ARG B NH1 1 
ATOM   1342 N NH2 . ARG B 2 34  ? 2.302   -22.034 -35.275 1.00 21.26 ? 31  ARG B NH2 1 
ATOM   1343 N N   . ARG B 2 35  ? 1.506   -16.961 -38.352 1.00 22.24 ? 32  ARG B N   1 
ATOM   1344 C CA  . ARG B 2 35  ? 0.226   -17.241 -39.012 1.00 23.06 ? 32  ARG B CA  1 
ATOM   1345 C C   . ARG B 2 35  ? -0.595  -16.003 -39.386 1.00 23.65 ? 32  ARG B C   1 
ATOM   1346 O O   . ARG B 2 35  ? -1.271  -16.000 -40.418 1.00 23.44 ? 32  ARG B O   1 
ATOM   1347 C CB  . ARG B 2 35  ? -0.599  -18.188 -38.128 1.00 23.37 ? 32  ARG B CB  1 
ATOM   1348 C CG  . ARG B 2 35  ? -1.965  -18.608 -38.675 1.00 24.21 ? 32  ARG B CG  1 
ATOM   1349 C CD  . ARG B 2 35  ? -2.821  -19.197 -37.564 1.00 25.72 ? 32  ARG B CD  1 
ATOM   1350 N NE  . ARG B 2 35  ? -3.123  -18.195 -36.540 1.00 27.17 ? 32  ARG B NE  1 
ATOM   1351 C CZ  . ARG B 2 35  ? -3.254  -18.454 -35.241 1.00 28.53 ? 32  ARG B CZ  1 
ATOM   1352 N NH1 . ARG B 2 35  ? -3.111  -19.694 -34.784 1.00 29.95 ? 32  ARG B NH1 1 
ATOM   1353 N NH2 . ARG B 2 35  ? -3.519  -17.466 -34.393 1.00 28.34 ? 32  ARG B NH2 1 
ATOM   1354 N N   . ASP B 2 36  ? -0.537  -14.959 -38.559 1.00 24.09 ? 33  ASP B N   1 
ATOM   1355 C CA  . ASP B 2 36  ? -1.447  -13.814 -38.693 1.00 25.06 ? 33  ASP B CA  1 
ATOM   1356 C C   . ASP B 2 36  ? -0.802  -12.518 -39.191 1.00 25.63 ? 33  ASP B C   1 
ATOM   1357 O O   . ASP B 2 36  ? -1.503  -11.545 -39.474 1.00 25.28 ? 33  ASP B O   1 
ATOM   1358 C CB  . ASP B 2 36  ? -2.167  -13.540 -37.362 1.00 25.28 ? 33  ASP B CB  1 
ATOM   1359 C CG  . ASP B 2 36  ? -2.866  -14.768 -36.800 1.00 26.27 ? 33  ASP B CG  1 
ATOM   1360 O OD1 . ASP B 2 36  ? -3.415  -15.579 -37.586 1.00 26.66 ? 33  ASP B OD1 1 
ATOM   1361 O OD2 . ASP B 2 36  ? -2.872  -14.919 -35.557 1.00 27.75 ? 33  ASP B OD2 1 
ATOM   1362 N N   . ALA B 2 37  ? 0.523   -12.492 -39.283 1.00 26.76 ? 34  ALA B N   1 
ATOM   1363 C CA  . ALA B 2 37  ? 1.224   -11.272 -39.670 1.00 28.12 ? 34  ALA B CA  1 
ATOM   1364 C C   . ALA B 2 37  ? 1.159   -11.024 -41.176 1.00 28.91 ? 34  ALA B C   1 
ATOM   1365 O O   . ALA B 2 37  ? 1.254   -11.958 -41.973 1.00 29.56 ? 34  ALA B O   1 
ATOM   1366 C CB  . ALA B 2 37  ? 2.660   -11.300 -39.190 1.00 28.26 ? 34  ALA B CB  1 
ATOM   1367 N N   . GLU B 2 38  ? 0.977   -9.757  -41.543 1.00 29.89 ? 35  GLU B N   1 
ATOM   1368 C CA  . GLU B 2 38  ? 0.891   -9.328  -42.939 1.00 30.94 ? 35  GLU B CA  1 
ATOM   1369 C C   . GLU B 2 38  ? 1.843   -8.161  -43.182 1.00 31.29 ? 35  GLU B C   1 
ATOM   1370 O O   . GLU B 2 38  ? 2.407   -7.602  -42.238 1.00 31.32 ? 35  GLU B O   1 
ATOM   1371 C CB  . GLU B 2 38  ? -0.540  -8.898  -43.283 1.00 31.03 ? 35  GLU B CB  1 
ATOM   1372 C CG  . GLU B 2 38  ? -1.576  -10.011 -43.212 1.00 32.42 ? 35  GLU B CG  1 
ATOM   1373 C CD  . GLU B 2 38  ? -3.006  -9.508  -43.347 1.00 33.58 ? 35  GLU B CD  1 
ATOM   1374 O OE1 . GLU B 2 38  ? -3.254  -8.301  -43.126 1.00 34.65 ? 35  GLU B OE1 1 
ATOM   1375 O OE2 . GLU B 2 38  ? -3.890  -10.332 -43.668 1.00 34.79 ? 35  GLU B OE2 1 
ATOM   1376 N N   . GLY B 2 39  ? 2.006   -7.788  -44.450 1.00 32.04 ? 36  GLY B N   1 
ATOM   1377 C CA  . GLY B 2 39  ? 2.893   -6.692  -44.823 1.00 32.68 ? 36  GLY B CA  1 
ATOM   1378 C C   . GLY B 2 39  ? 4.317   -7.174  -45.007 1.00 33.06 ? 36  GLY B C   1 
ATOM   1379 O O   . GLY B 2 39  ? 4.553   -8.226  -45.600 1.00 33.22 ? 36  GLY B O   1 
ATOM   1380 N N   . GLY B 2 40  ? 5.266   -6.401  -44.491 1.00 33.42 ? 37  GLY B N   1 
ATOM   1381 C CA  . GLY B 2 40  ? 6.685   -6.727  -44.605 1.00 33.99 ? 37  GLY B CA  1 
ATOM   1382 C C   . GLY B 2 40  ? 7.523   -5.752  -43.802 1.00 34.53 ? 37  GLY B C   1 
ATOM   1383 O O   . GLY B 2 40  ? 6.975   -4.986  -43.010 1.00 34.59 ? 37  GLY B O   1 
ATOM   1384 N N   . PRO B 2 41  ? 8.857   -5.773  -43.999 1.00 34.94 ? 38  PRO B N   1 
ATOM   1385 C CA  . PRO B 2 41  ? 9.786   -4.880  -43.298 1.00 35.18 ? 38  PRO B CA  1 
ATOM   1386 C C   . PRO B 2 41  ? 9.275   -3.439  -43.210 1.00 35.39 ? 38  PRO B C   1 
ATOM   1387 O O   . PRO B 2 41  ? 8.930   -2.837  -44.234 1.00 35.49 ? 38  PRO B O   1 
ATOM   1388 C CB  . PRO B 2 41  ? 11.046  -4.953  -44.161 1.00 35.24 ? 38  PRO B CB  1 
ATOM   1389 C CG  . PRO B 2 41  ? 11.019  -6.337  -44.717 1.00 35.28 ? 38  PRO B CG  1 
ATOM   1390 C CD  . PRO B 2 41  ? 9.566   -6.693  -44.911 1.00 34.95 ? 38  PRO B CD  1 
ATOM   1391 N N   . GLY B 2 42  ? 9.203   -2.914  -41.986 1.00 35.36 ? 39  GLY B N   1 
ATOM   1392 C CA  . GLY B 2 42  ? 8.755   -1.544  -41.737 1.00 35.35 ? 39  GLY B CA  1 
ATOM   1393 C C   . GLY B 2 42  ? 7.258   -1.303  -41.862 1.00 35.38 ? 39  GLY B C   1 
ATOM   1394 O O   . GLY B 2 42  ? 6.796   -0.170  -41.698 1.00 35.57 ? 39  GLY B O   1 
ATOM   1395 N N   . ALA B 2 43  ? 6.497   -2.359  -42.152 1.00 35.13 ? 40  ALA B N   1 
ATOM   1396 C CA  . ALA B 2 43  ? 5.045   -2.253  -42.315 1.00 34.66 ? 40  ALA B CA  1 
ATOM   1397 C C   . ALA B 2 43  ? 4.326   -3.556  -41.956 1.00 34.29 ? 40  ALA B C   1 
ATOM   1398 O O   . ALA B 2 43  ? 3.429   -4.000  -42.680 1.00 34.29 ? 40  ALA B O   1 
ATOM   1399 C CB  . ALA B 2 43  ? 4.693   -1.806  -43.748 1.00 34.85 ? 40  ALA B CB  1 
ATOM   1400 N N   . TRP B 2 44  ? 4.724   -4.161  -40.835 1.00 33.75 ? 41  TRP B N   1 
ATOM   1401 C CA  . TRP B 2 44  ? 4.087   -5.386  -40.344 1.00 33.08 ? 41  TRP B CA  1 
ATOM   1402 C C   . TRP B 2 44  ? 2.724   -5.101  -39.708 1.00 32.58 ? 41  TRP B C   1 
ATOM   1403 O O   . TRP B 2 44  ? 2.555   -4.116  -38.983 1.00 32.72 ? 41  TRP B O   1 
ATOM   1404 C CB  . TRP B 2 44  ? 4.983   -6.119  -39.343 1.00 32.98 ? 41  TRP B CB  1 
ATOM   1405 C CG  . TRP B 2 44  ? 6.321   -6.549  -39.885 1.00 32.94 ? 41  TRP B CG  1 
ATOM   1406 C CD1 . TRP B 2 44  ? 7.534   -5.976  -39.620 1.00 33.03 ? 41  TRP B CD1 1 
ATOM   1407 C CD2 . TRP B 2 44  ? 6.582   -7.645  -40.773 1.00 32.77 ? 41  TRP B CD2 1 
ATOM   1408 N NE1 . TRP B 2 44  ? 8.533   -6.644  -40.291 1.00 32.96 ? 41  TRP B NE1 1 
ATOM   1409 C CE2 . TRP B 2 44  ? 7.976   -7.672  -41.005 1.00 32.88 ? 41  TRP B CE2 1 
ATOM   1410 C CE3 . TRP B 2 44  ? 5.772   -8.602  -41.402 1.00 32.15 ? 41  TRP B CE3 1 
ATOM   1411 C CZ2 . TRP B 2 44  ? 8.581   -8.623  -41.836 1.00 32.92 ? 41  TRP B CZ2 1 
ATOM   1412 C CZ3 . TRP B 2 44  ? 6.376   -9.550  -42.225 1.00 32.63 ? 41  TRP B CZ3 1 
ATOM   1413 C CH2 . TRP B 2 44  ? 7.767   -9.550  -42.434 1.00 32.28 ? 41  TRP B CH2 1 
ATOM   1414 N N   . ARG B 2 45  ? 1.763   -5.971  -40.005 1.00 31.97 ? 42  ARG B N   1 
ATOM   1415 C CA  . ARG B 2 45  ? 0.400   -5.886  -39.488 1.00 31.45 ? 42  ARG B CA  1 
ATOM   1416 C C   . ARG B 2 45  ? 0.014   -7.234  -38.910 1.00 30.90 ? 42  ARG B C   1 
ATOM   1417 O O   . ARG B 2 45  ? 0.323   -8.269  -39.496 1.00 30.67 ? 42  ARG B O   1 
ATOM   1418 C CB  . ARG B 2 45  ? -0.588  -5.576  -40.617 1.00 31.49 ? 42  ARG B CB  1 
ATOM   1419 C CG  . ARG B 2 45  ? -0.526  -4.177  -41.177 1.00 31.70 ? 42  ARG B CG  1 
ATOM   1420 C CD  . ARG B 2 45  ? -1.698  -3.913  -42.123 1.00 32.16 ? 42  ARG B CD  1 
ATOM   1421 N NE  . ARG B 2 45  ? -1.703  -4.793  -43.293 1.00 31.80 ? 42  ARG B NE  1 
ATOM   1422 C CZ  . ARG B 2 45  ? -0.943  -4.618  -44.373 1.00 32.88 ? 42  ARG B CZ  1 
ATOM   1423 N NH1 . ARG B 2 45  ? -0.098  -3.595  -44.447 1.00 32.76 ? 42  ARG B NH1 1 
ATOM   1424 N NH2 . ARG B 2 45  ? -1.027  -5.473  -45.382 1.00 32.83 ? 42  ARG B NH2 1 
ATOM   1425 N N   . LEU B 2 46  ? -0.672  -7.225  -37.773 1.00 30.32 ? 43  LEU B N   1 
ATOM   1426 C CA  . LEU B 2 46  ? -1.281  -8.438  -37.252 1.00 29.91 ? 43  LEU B CA  1 
ATOM   1427 C C   . LEU B 2 46  ? -2.752  -8.430  -37.646 1.00 29.63 ? 43  LEU B C   1 
ATOM   1428 O O   . LEU B 2 46  ? -3.497  -7.522  -37.266 1.00 29.29 ? 43  LEU B O   1 
ATOM   1429 C CB  . LEU B 2 46  ? -1.116  -8.518  -35.729 1.00 29.87 ? 43  LEU B CB  1 
ATOM   1430 C CG  . LEU B 2 46  ? -1.378  -9.837  -34.998 1.00 30.56 ? 43  LEU B CG  1 
ATOM   1431 C CD1 . LEU B 2 46  ? -0.376  -10.913 -35.401 1.00 30.79 ? 43  LEU B CD1 1 
ATOM   1432 C CD2 . LEU B 2 46  ? -1.334  -9.604  -33.486 1.00 30.62 ? 43  LEU B CD2 1 
ATOM   1433 N N   . SER B 2 47  ? -3.160  -9.429  -38.430 1.00 29.52 ? 44  SER B N   1 
ATOM   1434 C CA  . SER B 2 47  ? -4.557  -9.559  -38.841 1.00 29.82 ? 44  SER B CA  1 
ATOM   1435 C C   . SER B 2 47  ? -5.413  -9.973  -37.654 1.00 30.07 ? 44  SER B C   1 
ATOM   1436 O O   . SER B 2 47  ? -5.037  -10.864 -36.888 1.00 30.04 ? 44  SER B O   1 
ATOM   1437 C CB  . SER B 2 47  ? -4.712  -10.576 -39.977 1.00 29.77 ? 44  SER B CB  1 
ATOM   1438 O OG  . SER B 2 47  ? -6.074  -10.703 -40.359 1.00 29.26 ? 44  SER B OG  1 
ATOM   1439 N N   . ARG B 2 48  ? -6.554  -9.307  -37.502 1.00 30.52 ? 45  ARG B N   1 
ATOM   1440 C CA  . ARG B 2 48  ? -7.499  -9.601  -36.430 1.00 31.26 ? 45  ARG B CA  1 
ATOM   1441 C C   . ARG B 2 48  ? -8.896  -9.762  -37.022 1.00 32.08 ? 45  ARG B C   1 
ATOM   1442 O O   . ARG B 2 48  ? -9.900  -9.642  -36.317 1.00 32.57 ? 45  ARG B O   1 
ATOM   1443 C CB  . ARG B 2 48  ? -7.487  -8.489  -35.373 1.00 31.03 ? 45  ARG B CB  1 
ATOM   1444 C CG  . ARG B 2 48  ? -6.161  -8.331  -34.632 1.00 30.00 ? 45  ARG B CG  1 
ATOM   1445 C CD  . ARG B 2 48  ? -6.292  -7.384  -33.448 1.00 28.81 ? 45  ARG B CD  1 
ATOM   1446 N NE  . ARG B 2 48  ? -6.655  -6.026  -33.853 1.00 27.47 ? 45  ARG B NE  1 
ATOM   1447 C CZ  . ARG B 2 48  ? -7.004  -5.059  -33.007 1.00 27.41 ? 45  ARG B CZ  1 
ATOM   1448 N NH1 . ARG B 2 48  ? -7.042  -5.290  -31.694 1.00 26.94 ? 45  ARG B NH1 1 
ATOM   1449 N NH2 . ARG B 2 48  ? -7.321  -3.860  -33.474 1.00 26.75 ? 45  ARG B NH2 1 
ATOM   1450 N N   . ALA B 2 49  ? -8.940  -10.045 -38.324 1.00 33.03 ? 46  ALA B N   1 
ATOM   1451 C CA  . ALA B 2 49  ? -10.190 -10.173 -39.076 1.00 33.88 ? 46  ALA B CA  1 
ATOM   1452 C C   . ALA B 2 49  ? -11.178 -11.141 -38.429 1.00 34.42 ? 46  ALA B C   1 
ATOM   1453 O O   . ALA B 2 49  ? -12.377 -10.847 -38.342 1.00 34.71 ? 46  ALA B O   1 
ATOM   1454 C CB  . ALA B 2 49  ? -9.898  -10.586 -40.514 1.00 33.93 ? 46  ALA B CB  1 
ATOM   1455 N N   . ALA B 2 50  ? -10.666 -12.284 -37.971 1.00 34.94 ? 47  ALA B N   1 
ATOM   1456 C CA  . ALA B 2 50  ? -11.476 -13.303 -37.301 1.00 35.17 ? 47  ALA B CA  1 
ATOM   1457 C C   . ALA B 2 50  ? -12.083 -12.790 -35.994 1.00 35.30 ? 47  ALA B C   1 
ATOM   1458 O O   . ALA B 2 50  ? -13.246 -13.069 -35.693 1.00 35.49 ? 47  ALA B O   1 
ATOM   1459 C CB  . ALA B 2 50  ? -10.648 -14.561 -37.047 1.00 35.26 ? 47  ALA B CB  1 
ATOM   1460 N N   . ALA B 2 51  ? -11.291 -12.034 -35.234 1.00 35.29 ? 48  ALA B N   1 
ATOM   1461 C CA  . ALA B 2 51  ? -11.720 -11.462 -33.953 1.00 34.97 ? 48  ALA B CA  1 
ATOM   1462 C C   . ALA B 2 51  ? -12.623 -10.234 -34.127 1.00 34.77 ? 48  ALA B C   1 
ATOM   1463 O O   . ALA B 2 51  ? -12.980 -9.567  -33.146 1.00 34.78 ? 48  ALA B O   1 
ATOM   1464 C CB  . ALA B 2 51  ? -10.506 -11.122 -33.093 1.00 35.12 ? 48  ALA B CB  1 
ATOM   1465 N N   . GLY B 2 52  ? -12.982 -9.945  -35.376 1.00 34.34 ? 49  GLY B N   1 
ATOM   1466 C CA  . GLY B 2 52  ? -13.864 -8.828  -35.709 1.00 34.05 ? 49  GLY B CA  1 
ATOM   1467 C C   . GLY B 2 52  ? -13.264 -7.447  -35.507 1.00 33.74 ? 49  GLY B C   1 
ATOM   1468 O O   . GLY B 2 52  ? -13.994 -6.473  -35.320 1.00 33.91 ? 49  GLY B O   1 
ATOM   1469 N N   . ARG B 2 53  ? -11.935 -7.359  -35.544 1.00 33.21 ? 50  ARG B N   1 
ATOM   1470 C CA  . ARG B 2 53  ? -11.241 -6.082  -35.375 1.00 32.60 ? 50  ARG B CA  1 
ATOM   1471 C C   . ARG B 2 53  ? -10.311 -5.778  -36.553 1.00 32.10 ? 50  ARG B C   1 
ATOM   1472 O O   . ARG B 2 53  ? -10.078 -6.633  -37.413 1.00 32.30 ? 50  ARG B O   1 
ATOM   1473 C CB  . ARG B 2 53  ? -10.485 -6.044  -34.038 1.00 32.73 ? 50  ARG B CB  1 
ATOM   1474 C CG  . ARG B 2 53  ? -11.405 -6.060  -32.817 1.00 32.86 ? 50  ARG B CG  1 
ATOM   1475 C CD  . ARG B 2 53  ? -10.657 -5.837  -31.509 1.00 33.87 ? 50  ARG B CD  1 
ATOM   1476 N NE  . ARG B 2 53  ? -11.532 -6.065  -30.358 1.00 34.51 ? 50  ARG B NE  1 
ATOM   1477 C CZ  . ARG B 2 53  ? -12.295 -5.136  -29.781 1.00 34.71 ? 50  ARG B CZ  1 
ATOM   1478 N NH1 . ARG B 2 53  ? -12.306 -3.887  -30.235 1.00 35.07 ? 50  ARG B NH1 1 
ATOM   1479 N NH2 . ARG B 2 53  ? -13.055 -5.461  -28.741 1.00 34.72 ? 50  ARG B NH2 1 
ATOM   1480 N N   . GLY B 2 54  ? -9.799  -4.549  -36.590 1.00 31.56 ? 51  GLY B N   1 
ATOM   1481 C CA  . GLY B 2 54  ? -8.893  -4.117  -37.649 1.00 30.50 ? 51  GLY B CA  1 
ATOM   1482 C C   . GLY B 2 54  ? -7.467  -4.585  -37.420 1.00 30.00 ? 51  GLY B C   1 
ATOM   1483 O O   . GLY B 2 54  ? -7.168  -5.189  -36.383 1.00 29.75 ? 51  GLY B O   1 
ATOM   1484 N N   . PRO B 2 55  ? -6.571  -4.308  -38.385 1.00 29.37 ? 52  PRO B N   1 
ATOM   1485 C CA  . PRO B 2 55  ? -5.179  -4.758  -38.291 1.00 28.85 ? 52  PRO B CA  1 
ATOM   1486 C C   . PRO B 2 55  ? -4.438  -4.083  -37.145 1.00 28.28 ? 52  PRO B C   1 
ATOM   1487 O O   . PRO B 2 55  ? -4.651  -2.897  -36.883 1.00 28.13 ? 52  PRO B O   1 
ATOM   1488 C CB  . PRO B 2 55  ? -4.569  -4.329  -39.635 1.00 28.93 ? 52  PRO B CB  1 
ATOM   1489 C CG  . PRO B 2 55  ? -5.725  -4.005  -40.519 1.00 29.08 ? 52  PRO B CG  1 
ATOM   1490 C CD  . PRO B 2 55  ? -6.816  -3.538  -39.618 1.00 29.22 ? 52  PRO B CD  1 
ATOM   1491 N N   . LEU B 2 56  ? -3.589  -4.850  -36.467 1.00 27.88 ? 53  LEU B N   1 
ATOM   1492 C CA  A LEU B 2 56  ? -2.773  -4.325  -35.381 0.50 27.65 ? 53  LEU B CA  1 
ATOM   1493 C CA  B LEU B 2 56  ? -2.777  -4.322  -35.380 0.50 27.78 ? 53  LEU B CA  1 
ATOM   1494 C C   . LEU B 2 56  ? -1.341  -4.154  -35.867 1.00 27.59 ? 53  LEU B C   1 
ATOM   1495 O O   . LEU B 2 56  ? -0.644  -5.137  -36.133 1.00 28.00 ? 53  LEU B O   1 
ATOM   1496 C CB  A LEU B 2 56  ? -2.832  -5.264  -34.173 0.50 27.54 ? 53  LEU B CB  1 
ATOM   1497 C CB  B LEU B 2 56  ? -2.835  -5.261  -34.172 0.50 27.74 ? 53  LEU B CB  1 
ATOM   1498 C CG  A LEU B 2 56  ? -2.226  -4.775  -32.859 0.50 27.24 ? 53  LEU B CG  1 
ATOM   1499 C CG  B LEU B 2 56  ? -3.249  -4.646  -32.836 0.50 28.05 ? 53  LEU B CG  1 
ATOM   1500 C CD1 A LEU B 2 56  ? -2.744  -3.386  -32.510 0.50 27.52 ? 53  LEU B CD1 1 
ATOM   1501 C CD1 B LEU B 2 56  ? -3.023  -5.652  -31.720 0.50 28.06 ? 53  LEU B CD1 1 
ATOM   1502 C CD2 A LEU B 2 56  ? -2.551  -5.772  -31.760 0.50 27.00 ? 53  LEU B CD2 1 
ATOM   1503 C CD2 B LEU B 2 56  ? -2.498  -3.348  -32.562 0.50 28.25 ? 53  LEU B CD2 1 
ATOM   1504 N N   . ASP B 2 57  ? -0.910  -2.904  -35.997 1.00 27.42 ? 54  ASP B N   1 
ATOM   1505 C CA  . ASP B 2 57  ? 0.431   -2.597  -36.476 1.00 26.73 ? 54  ASP B CA  1 
ATOM   1506 C C   . ASP B 2 57  ? 1.452   -3.022  -35.443 1.00 26.54 ? 54  ASP B C   1 
ATOM   1507 O O   . ASP B 2 57  ? 1.247   -2.836  -34.240 1.00 26.73 ? 54  ASP B O   1 
ATOM   1508 C CB  . ASP B 2 57  ? 0.569   -1.106  -36.766 1.00 26.71 ? 54  ASP B CB  1 
ATOM   1509 C CG  . ASP B 2 57  ? -0.410  -0.630  -37.818 1.00 26.91 ? 54  ASP B CG  1 
ATOM   1510 O OD1 . ASP B 2 57  ? -0.168  -0.883  -39.015 1.00 26.93 ? 54  ASP B OD1 1 
ATOM   1511 O OD2 . ASP B 2 57  ? -1.421  -0.011  -37.439 1.00 27.08 ? 54  ASP B OD2 1 
ATOM   1512 N N   . LEU B 2 58  ? 2.536   -3.628  -35.908 1.00 26.01 ? 55  LEU B N   1 
ATOM   1513 C CA  . LEU B 2 58  ? 3.575   -4.058  -34.987 1.00 25.63 ? 55  LEU B CA  1 
ATOM   1514 C C   . LEU B 2 58  ? 4.983   -3.901  -35.528 1.00 24.46 ? 55  LEU B C   1 
ATOM   1515 O O   . LEU B 2 58  ? 5.240   -4.096  -36.714 1.00 24.63 ? 55  LEU B O   1 
ATOM   1516 C CB  . LEU B 2 58  ? 3.314   -5.475  -34.444 1.00 26.18 ? 55  LEU B CB  1 
ATOM   1517 C CG  . LEU B 2 58  ? 3.548   -6.777  -35.207 1.00 27.20 ? 55  LEU B CG  1 
ATOM   1518 C CD1 . LEU B 2 58  ? 3.477   -7.895  -34.193 1.00 27.53 ? 55  LEU B CD1 1 
ATOM   1519 C CD2 . LEU B 2 58  ? 2.521   -7.000  -36.291 1.00 28.20 ? 55  LEU B CD2 1 
ATOM   1520 N N   . ALA B 2 59  ? 5.875   -3.505  -34.633 1.00 22.93 ? 56  ALA B N   1 
ATOM   1521 C CA  . ALA B 2 59  ? 7.276   -3.288  -34.942 1.00 21.48 ? 56  ALA B CA  1 
ATOM   1522 C C   . ALA B 2 59  ? 8.112   -3.949  -33.859 1.00 20.67 ? 56  ALA B C   1 
ATOM   1523 O O   . ALA B 2 59  ? 8.971   -4.779  -34.146 1.00 20.96 ? 56  ALA B O   1 
ATOM   1524 C CB  . ALA B 2 59  ? 7.576   -1.795  -35.024 1.00 21.72 ? 56  ALA B CB  1 
ATOM   1525 N N   . ALA B 2 60  ? 7.847   -3.571  -32.609 1.00 18.83 ? 57  ALA B N   1 
ATOM   1526 C CA  . ALA B 2 60  ? 8.496   -4.170  -31.458 1.00 17.09 ? 57  ALA B CA  1 
ATOM   1527 C C   . ALA B 2 60  ? 7.551   -5.144  -30.787 1.00 15.49 ? 57  ALA B C   1 
ATOM   1528 O O   . ALA B 2 60  ? 6.333   -4.933  -30.755 1.00 15.36 ? 57  ALA B O   1 
ATOM   1529 C CB  . ALA B 2 60  ? 8.910   -3.090  -30.468 1.00 17.18 ? 57  ALA B CB  1 
ATOM   1530 N N   . VAL B 2 61  ? 8.130   -6.206  -30.239 1.00 13.50 ? 58  VAL B N   1 
ATOM   1531 C CA  . VAL B 2 61  ? 7.367   -7.210  -29.514 1.00 12.89 ? 58  VAL B CA  1 
ATOM   1532 C C   . VAL B 2 61  ? 8.051   -7.628  -28.225 1.00 12.13 ? 58  VAL B C   1 
ATOM   1533 O O   . VAL B 2 61  ? 9.269   -7.456  -28.034 1.00 12.04 ? 58  VAL B O   1 
ATOM   1534 C CB  . VAL B 2 61  ? 7.096   -8.478  -30.356 1.00 12.69 ? 58  VAL B CB  1 
ATOM   1535 C CG1 . VAL B 2 61  ? 6.209   -8.155  -31.534 1.00 13.98 ? 58  VAL B CG1 1 
ATOM   1536 C CG2 . VAL B 2 61  ? 8.427   -9.141  -30.800 1.00 13.61 ? 58  VAL B CG2 1 
ATOM   1537 N N   . TRP B 2 62  ? 7.221   -8.164  -27.341 1.00 11.20 ? 59  TRP B N   1 
ATOM   1538 C CA  . TRP B 2 62  ? 7.630   -8.796  -26.100 1.00 10.61 ? 59  TRP B CA  1 
ATOM   1539 C C   . TRP B 2 62  ? 7.273   -10.264 -26.281 1.00 10.69 ? 59  TRP B C   1 
ATOM   1540 O O   . TRP B 2 62  ? 6.090   -10.623 -26.450 1.00 10.40 ? 59  TRP B O   1 
ATOM   1541 C CB  . TRP B 2 62  ? 6.828   -8.180  -24.952 1.00 11.26 ? 59  TRP B CB  1 
ATOM   1542 C CG  . TRP B 2 62  ? 6.975   -8.766  -23.564 1.00 10.58 ? 59  TRP B CG  1 
ATOM   1543 C CD1 . TRP B 2 62  ? 7.503   -9.988  -23.202 1.00 10.29 ? 59  TRP B CD1 1 
ATOM   1544 C CD2 . TRP B 2 62  ? 6.538   -8.151  -22.341 1.00 8.06  ? 59  TRP B CD2 1 
ATOM   1545 N NE1 . TRP B 2 62  ? 7.415   -10.161 -21.833 1.00 10.69 ? 59  TRP B NE1 1 
ATOM   1546 C CE2 . TRP B 2 62  ? 6.833   -9.046  -21.282 1.00 9.53  ? 59  TRP B CE2 1 
ATOM   1547 C CE3 . TRP B 2 62  ? 5.919   -6.933  -22.041 1.00 9.98  ? 59  TRP B CE3 1 
ATOM   1548 C CZ2 . TRP B 2 62  ? 6.525   -8.762  -19.948 1.00 9.89  ? 59  TRP B CZ2 1 
ATOM   1549 C CZ3 . TRP B 2 62  ? 5.616   -6.646  -20.694 1.00 10.30 ? 59  TRP B CZ3 1 
ATOM   1550 C CH2 . TRP B 2 62  ? 5.934   -7.548  -19.674 1.00 9.49  ? 59  TRP B CH2 1 
ATOM   1551 N N   . MET B 2 63  ? 8.294   -11.111 -26.323 1.00 10.78 ? 60  MET B N   1 
ATOM   1552 C CA  . MET B 2 63  ? 8.071   -12.550 -26.451 1.00 10.62 ? 60  MET B CA  1 
ATOM   1553 C C   . MET B 2 63  ? 8.791   -13.279 -25.333 1.00 11.26 ? 60  MET B C   1 
ATOM   1554 O O   . MET B 2 63  ? 9.671   -12.706 -24.687 1.00 10.81 ? 60  MET B O   1 
ATOM   1555 C CB  . MET B 2 63  ? 8.546   -13.035 -27.828 1.00 10.88 ? 60  MET B CB  1 
ATOM   1556 C CG  . MET B 2 63  ? 7.764   -12.422 -28.964 1.00 10.58 ? 60  MET B CG  1 
ATOM   1557 S SD  . MET B 2 63  ? 8.233   -13.076 -30.578 1.00 11.67 ? 60  MET B SD  1 
ATOM   1558 C CE  . MET B 2 63  ? 7.479   -14.693 -30.501 1.00 14.09 ? 60  MET B CE  1 
ATOM   1559 N N   . GLN B 2 64  ? 8.385   -14.522 -25.072 1.00 10.76 ? 61  GLN B N   1 
ATOM   1560 C CA  . GLN B 2 64  ? 8.984   -15.327 -24.005 1.00 11.86 ? 61  GLN B CA  1 
ATOM   1561 C C   . GLN B 2 64  ? 9.127   -16.760 -24.465 1.00 12.07 ? 61  GLN B C   1 
ATOM   1562 O O   . GLN B 2 64  ? 8.321   -17.240 -25.253 1.00 13.03 ? 61  GLN B O   1 
ATOM   1563 C CB  . GLN B 2 64  ? 8.140   -15.258 -22.731 1.00 11.53 ? 61  GLN B CB  1 
ATOM   1564 C CG  . GLN B 2 64  ? 8.025   -13.828 -22.197 1.00 10.77 ? 61  GLN B CG  1 
ATOM   1565 C CD  . GLN B 2 64  ? 7.463   -13.702 -20.787 1.00 9.62  ? 61  GLN B CD  1 
ATOM   1566 O OE1 . GLN B 2 64  ? 7.461   -12.597 -20.228 1.00 10.87 ? 61  GLN B OE1 1 
ATOM   1567 N NE2 . GLN B 2 64  ? 6.981   -14.797 -20.209 1.00 10.03 ? 61  GLN B NE2 1 
ATOM   1568 N N   . GLY B 2 65  ? 10.151  -17.438 -23.975 1.00 12.63 ? 62  GLY B N   1 
ATOM   1569 C CA  . GLY B 2 65  ? 10.306  -18.848 -24.298 1.00 12.93 ? 62  GLY B CA  1 
ATOM   1570 C C   . GLY B 2 65  ? 11.520  -19.477 -23.664 1.00 13.51 ? 62  GLY B C   1 
ATOM   1571 O O   . GLY B 2 65  ? 12.315  -18.813 -23.007 1.00 12.88 ? 62  GLY B O   1 
ATOM   1572 N N   . ARG B 2 66  ? 11.627  -20.784 -23.861 1.00 14.78 ? 63  ARG B N   1 
ATOM   1573 C CA  . ARG B 2 66  ? 12.793  -21.540 -23.444 1.00 15.91 ? 63  ARG B CA  1 
ATOM   1574 C C   . ARG B 2 66  ? 13.870  -21.430 -24.512 1.00 16.49 ? 63  ARG B C   1 
ATOM   1575 O O   . ARG B 2 66  ? 13.596  -21.557 -25.705 1.00 15.80 ? 63  ARG B O   1 
ATOM   1576 C CB  . ARG B 2 66  ? 12.429  -23.008 -23.237 1.00 16.54 ? 63  ARG B CB  1 
ATOM   1577 C CG  . ARG B 2 66  ? 11.514  -23.290 -22.064 1.00 17.57 ? 63  ARG B CG  1 
ATOM   1578 C CD  . ARG B 2 66  ? 12.302  -23.450 -20.782 1.00 21.84 ? 63  ARG B CD  1 
ATOM   1579 N NE  . ARG B 2 66  ? 11.430  -23.641 -19.627 1.00 24.06 ? 63  ARG B NE  1 
ATOM   1580 C CZ  . ARG B 2 66  ? 11.751  -24.369 -18.562 1.00 26.72 ? 63  ARG B CZ  1 
ATOM   1581 N NH1 . ARG B 2 66  ? 12.920  -24.998 -18.506 1.00 27.69 ? 63  ARG B NH1 1 
ATOM   1582 N NH2 . ARG B 2 66  ? 10.896  -24.484 -17.559 1.00 27.73 ? 63  ARG B NH2 1 
ATOM   1583 N N   . VAL B 2 67  ? 15.098  -21.180 -24.075 1.00 17.26 ? 64  VAL B N   1 
ATOM   1584 C CA  . VAL B 2 67  ? 16.242  -21.197 -24.975 1.00 18.37 ? 64  VAL B CA  1 
ATOM   1585 C C   . VAL B 2 67  ? 16.501  -22.643 -25.400 1.00 19.79 ? 64  VAL B C   1 
ATOM   1586 O O   . VAL B 2 67  ? 16.698  -23.520 -24.554 1.00 19.68 ? 64  VAL B O   1 
ATOM   1587 C CB  . VAL B 2 67  ? 17.498  -20.589 -24.312 1.00 18.36 ? 64  VAL B CB  1 
ATOM   1588 C CG1 . VAL B 2 67  ? 18.674  -20.587 -25.285 1.00 19.09 ? 64  VAL B CG1 1 
ATOM   1589 C CG2 . VAL B 2 67  ? 17.201  -19.164 -23.822 1.00 18.18 ? 64  VAL B CG2 1 
ATOM   1590 N N   . VAL B 2 68  ? 16.448  -22.884 -26.706 1.00 20.80 ? 65  VAL B N   1 
ATOM   1591 C CA  A VAL B 2 68  ? 16.749  -24.219 -27.213 0.50 21.78 ? 65  VAL B CA  1 
ATOM   1592 C CA  B VAL B 2 68  ? 16.724  -24.205 -27.287 0.50 21.61 ? 65  VAL B CA  1 
ATOM   1593 C C   . VAL B 2 68  ? 18.187  -24.274 -27.726 1.00 22.39 ? 65  VAL B C   1 
ATOM   1594 O O   . VAL B 2 68  ? 18.883  -25.271 -27.497 1.00 22.82 ? 65  VAL B O   1 
ATOM   1595 C CB  A VAL B 2 68  ? 15.688  -24.753 -28.229 0.50 21.70 ? 65  VAL B CB  1 
ATOM   1596 C CB  B VAL B 2 68  ? 15.808  -24.492 -28.503 0.50 21.44 ? 65  VAL B CB  1 
ATOM   1597 C CG1 A VAL B 2 68  ? 15.578  -23.870 -29.462 0.50 21.88 ? 65  VAL B CG1 1 
ATOM   1598 C CG1 B VAL B 2 68  ? 16.089  -25.879 -29.092 0.50 21.51 ? 65  VAL B CG1 1 
ATOM   1599 C CG2 A VAL B 2 68  ? 15.979  -26.209 -28.616 0.50 21.79 ? 65  VAL B CG2 1 
ATOM   1600 C CG2 B VAL B 2 68  ? 14.341  -24.370 -28.116 0.50 21.09 ? 65  VAL B CG2 1 
ATOM   1601 N N   . MET B 2 69  ? 18.638  -23.198 -28.366 1.00 23.66 ? 66  MET B N   1 
ATOM   1602 C CA  . MET B 2 69  ? 20.001  -23.098 -28.879 1.00 25.34 ? 66  MET B CA  1 
ATOM   1603 C C   . MET B 2 69  ? 20.536  -21.685 -28.754 1.00 25.75 ? 66  MET B C   1 
ATOM   1604 O O   . MET B 2 69  ? 19.791  -20.716 -28.907 1.00 25.68 ? 66  MET B O   1 
ATOM   1605 C CB  . MET B 2 69  ? 20.056  -23.527 -30.344 1.00 25.76 ? 66  MET B CB  1 
ATOM   1606 C CG  . MET B 2 69  ? 19.966  -25.025 -30.561 1.00 28.70 ? 66  MET B CG  1 
ATOM   1607 S SD  . MET B 2 69  ? 20.470  -25.498 -32.222 1.00 35.11 ? 66  MET B SD  1 
ATOM   1608 C CE  . MET B 2 69  ? 19.055  -24.945 -33.178 1.00 33.31 ? 66  MET B CE  1 
ATOM   1609 N N   . ALA B 2 70  ? 21.832  -21.574 -28.484 1.00 26.28 ? 67  ALA B N   1 
ATOM   1610 C CA  . ALA B 2 70  ? 22.498  -20.283 -28.434 1.00 27.24 ? 67  ALA B CA  1 
ATOM   1611 C C   . ALA B 2 70  ? 23.908  -20.405 -28.998 1.00 27.82 ? 67  ALA B C   1 
ATOM   1612 O O   . ALA B 2 70  ? 24.668  -21.292 -28.609 1.00 28.27 ? 67  ALA B O   1 
ATOM   1613 C CB  . ALA B 2 70  ? 22.527  -19.743 -27.008 1.00 27.30 ? 67  ALA B CB  1 
ATOM   1614 N N   . ASP B 2 71  ? 24.237  -19.512 -29.926 1.00 28.49 ? 68  ASP B N   1 
ATOM   1615 C CA  . ASP B 2 71  ? 25.533  -19.507 -30.594 1.00 29.20 ? 68  ASP B CA  1 
ATOM   1616 C C   . ASP B 2 71  ? 25.878  -18.059 -30.883 1.00 29.30 ? 68  ASP B C   1 
ATOM   1617 O O   . ASP B 2 71  ? 25.202  -17.413 -31.681 1.00 29.37 ? 68  ASP B O   1 
ATOM   1618 C CB  . ASP B 2 71  ? 25.455  -20.320 -31.895 1.00 29.37 ? 68  ASP B CB  1 
ATOM   1619 C CG  . ASP B 2 71  ? 26.818  -20.548 -32.545 1.00 30.73 ? 68  ASP B CG  1 
ATOM   1620 O OD1 . ASP B 2 71  ? 27.861  -20.233 -31.927 1.00 31.89 ? 68  ASP B OD1 1 
ATOM   1621 O OD2 . ASP B 2 71  ? 26.838  -21.057 -33.690 1.00 32.00 ? 68  ASP B OD2 1 
ATOM   1622 N N   . ARG B 2 72  ? 26.933  -17.565 -30.233 1.00 29.51 ? 69  ARG B N   1 
ATOM   1623 C CA  . ARG B 2 72  ? 27.271  -16.132 -30.194 1.00 29.80 ? 69  ARG B CA  1 
ATOM   1624 C C   . ARG B 2 72  ? 26.071  -15.278 -29.733 1.00 29.22 ? 69  ARG B C   1 
ATOM   1625 O O   . ARG B 2 72  ? 25.402  -15.620 -28.755 1.00 29.77 ? 69  ARG B O   1 
ATOM   1626 C CB  . ARG B 2 72  ? 27.885  -15.633 -31.524 1.00 30.14 ? 69  ARG B CB  1 
ATOM   1627 C CG  . ARG B 2 72  ? 26.902  -15.457 -32.693 1.00 32.00 ? 69  ARG B CG  1 
ATOM   1628 C CD  . ARG B 2 72  ? 26.990  -14.061 -33.300 1.00 35.29 ? 69  ARG B CD  1 
ATOM   1629 N NE  . ARG B 2 72  ? 25.665  -13.459 -33.464 1.00 36.70 ? 69  ARG B NE  1 
ATOM   1630 C CZ  . ARG B 2 72  ? 25.429  -12.148 -33.516 1.00 38.10 ? 69  ARG B CZ  1 
ATOM   1631 N NH1 . ARG B 2 72  ? 26.430  -11.279 -33.418 1.00 38.35 ? 69  ARG B NH1 1 
ATOM   1632 N NH2 . ARG B 2 72  ? 24.185  -11.700 -33.660 1.00 37.57 ? 69  ARG B NH2 1 
ATOM   1633 N N   . GLY B 2 73  ? 25.804  -14.182 -30.440 1.00 28.55 ? 70  GLY B N   1 
ATOM   1634 C CA  . GLY B 2 73  ? 24.666  -13.317 -30.160 1.00 27.18 ? 70  GLY B CA  1 
ATOM   1635 C C   . GLY B 2 73  ? 23.394  -13.714 -30.891 1.00 26.35 ? 70  GLY B C   1 
ATOM   1636 O O   . GLY B 2 73  ? 22.556  -12.864 -31.186 1.00 25.84 ? 70  GLY B O   1 
ATOM   1637 N N   . GLU B 2 74  ? 23.255  -15.005 -31.191 1.00 25.61 ? 71  GLU B N   1 
ATOM   1638 C CA  . GLU B 2 74  ? 22.038  -15.531 -31.811 1.00 25.17 ? 71  GLU B CA  1 
ATOM   1639 C C   . GLU B 2 74  ? 21.462  -16.651 -30.964 1.00 24.18 ? 71  GLU B C   1 
ATOM   1640 O O   . GLU B 2 74  ? 22.202  -17.433 -30.359 1.00 24.25 ? 71  GLU B O   1 
ATOM   1641 C CB  . GLU B 2 74  ? 22.300  -16.028 -33.237 1.00 25.49 ? 71  GLU B CB  1 
ATOM   1642 C CG  . GLU B 2 74  ? 22.750  -14.936 -34.208 1.00 27.51 ? 71  GLU B CG  1 
ATOM   1643 C CD  . GLU B 2 74  ? 22.868  -15.417 -35.644 1.00 29.91 ? 71  GLU B CD  1 
ATOM   1644 O OE1 . GLU B 2 74  ? 23.276  -14.607 -36.508 1.00 31.42 ? 71  GLU B OE1 1 
ATOM   1645 O OE2 . GLU B 2 74  ? 22.560  -16.598 -35.912 1.00 32.16 ? 71  GLU B OE2 1 
ATOM   1646 N N   . ALA B 2 75  ? 20.133  -16.723 -30.911 1.00 22.87 ? 72  ALA B N   1 
ATOM   1647 C CA  . ALA B 2 75  ? 19.473  -17.785 -30.174 1.00 21.70 ? 72  ALA B CA  1 
ATOM   1648 C C   . ALA B 2 75  ? 18.195  -18.245 -30.861 1.00 21.10 ? 72  ALA B C   1 
ATOM   1649 O O   . ALA B 2 75  ? 17.600  -17.500 -31.650 1.00 21.11 ? 72  ALA B O   1 
ATOM   1650 C CB  . ALA B 2 75  ? 19.176  -17.335 -28.745 1.00 21.79 ? 72  ALA B CB  1 
ATOM   1651 N N   . ARG B 2 76  ? 17.817  -19.490 -30.575 1.00 20.41 ? 73  ARG B N   1 
ATOM   1652 C CA  A ARG B 2 76  ? 16.519  -20.030 -30.967 0.50 20.18 ? 73  ARG B CA  1 
ATOM   1653 C CA  B ARG B 2 76  ? 16.522  -20.021 -30.963 0.50 20.25 ? 73  ARG B CA  1 
ATOM   1654 C C   . ARG B 2 76  ? 15.729  -20.272 -29.689 1.00 19.82 ? 73  ARG B C   1 
ATOM   1655 O O   . ARG B 2 76  ? 16.224  -20.919 -28.761 1.00 19.43 ? 73  ARG B O   1 
ATOM   1656 C CB  A ARG B 2 76  ? 16.677  -21.333 -31.766 0.50 20.46 ? 73  ARG B CB  1 
ATOM   1657 C CB  B ARG B 2 76  ? 16.691  -21.313 -31.762 0.50 20.54 ? 73  ARG B CB  1 
ATOM   1658 C CG  A ARG B 2 76  ? 15.356  -22.004 -32.163 0.50 21.45 ? 73  ARG B CG  1 
ATOM   1659 C CG  B ARG B 2 76  ? 15.458  -21.709 -32.545 0.50 21.93 ? 73  ARG B CG  1 
ATOM   1660 C CD  A ARG B 2 76  ? 15.589  -23.275 -32.983 0.50 23.32 ? 73  ARG B CD  1 
ATOM   1661 C CD  B ARG B 2 76  ? 15.840  -22.469 -33.801 0.50 23.62 ? 73  ARG B CD  1 
ATOM   1662 N NE  A ARG B 2 76  ? 15.958  -22.994 -34.371 0.50 24.55 ? 73  ARG B NE  1 
ATOM   1663 N NE  B ARG B 2 76  ? 14.707  -22.597 -34.707 0.50 24.55 ? 73  ARG B NE  1 
ATOM   1664 C CZ  A ARG B 2 76  ? 16.009  -21.776 -34.905 0.50 24.84 ? 73  ARG B CZ  1 
ATOM   1665 C CZ  B ARG B 2 76  ? 13.907  -23.657 -34.749 0.50 24.91 ? 73  ARG B CZ  1 
ATOM   1666 N NH1 A ARG B 2 76  ? 15.715  -20.713 -34.168 0.50 26.52 ? 73  ARG B NH1 1 
ATOM   1667 N NH1 B ARG B 2 76  ? 14.122  -24.683 -33.936 0.50 26.05 ? 73  ARG B NH1 1 
ATOM   1668 N NH2 A ARG B 2 76  ? 16.352  -21.621 -36.179 0.50 24.63 ? 73  ARG B NH2 1 
ATOM   1669 N NH2 B ARG B 2 76  ? 12.893  -23.691 -35.601 0.50 25.60 ? 73  ARG B NH2 1 
ATOM   1670 N N   . LEU B 2 77  ? 14.513  -19.728 -29.632 1.00 19.13 ? 74  LEU B N   1 
ATOM   1671 C CA  . LEU B 2 77  ? 13.664  -19.860 -28.452 1.00 18.69 ? 74  LEU B CA  1 
ATOM   1672 C C   . LEU B 2 77  ? 12.374  -20.576 -28.805 1.00 18.19 ? 74  LEU B C   1 
ATOM   1673 O O   . LEU B 2 77  ? 11.983  -20.608 -29.968 1.00 18.42 ? 74  LEU B O   1 
ATOM   1674 C CB  . LEU B 2 77  ? 13.347  -18.481 -27.845 1.00 18.41 ? 74  LEU B CB  1 
ATOM   1675 C CG  . LEU B 2 77  ? 14.327  -17.870 -26.831 1.00 19.02 ? 74  LEU B CG  1 
ATOM   1676 C CD1 . LEU B 2 77  ? 15.739  -17.730 -27.393 1.00 21.18 ? 74  LEU B CD1 1 
ATOM   1677 C CD2 . LEU B 2 77  ? 13.812  -16.523 -26.367 1.00 19.99 ? 74  LEU B CD2 1 
ATOM   1678 N N   . ARG B 2 78  ? 11.723  -21.141 -27.792 1.00 17.71 ? 75  ARG B N   1 
ATOM   1679 C CA  . ARG B 2 78  ? 10.506  -21.916 -27.979 1.00 17.80 ? 75  ARG B CA  1 
ATOM   1680 C C   . ARG B 2 78  ? 9.418   -21.486 -27.004 1.00 17.39 ? 75  ARG B C   1 
ATOM   1681 O O   . ARG B 2 78  ? 9.570   -21.635 -25.794 1.00 16.66 ? 75  ARG B O   1 
ATOM   1682 C CB  . ARG B 2 78  ? 10.816  -23.406 -27.784 1.00 18.39 ? 75  ARG B CB  1 
ATOM   1683 C CG  . ARG B 2 78  ? 9.649   -24.360 -27.978 1.00 20.18 ? 75  ARG B CG  1 
ATOM   1684 C CD  . ARG B 2 78  ? 10.164  -25.789 -28.174 1.00 23.27 ? 75  ARG B CD  1 
ATOM   1685 N NE  . ARG B 2 78  ? 10.977  -25.885 -29.388 1.00 24.52 ? 75  ARG B NE  1 
ATOM   1686 C CZ  . ARG B 2 78  ? 11.922  -26.795 -29.609 1.00 25.70 ? 75  ARG B CZ  1 
ATOM   1687 N NH1 . ARG B 2 78  ? 12.209  -27.716 -28.694 1.00 26.54 ? 75  ARG B NH1 1 
ATOM   1688 N NH2 . ARG B 2 78  ? 12.588  -26.776 -30.755 1.00 25.91 ? 75  ARG B NH2 1 
ATOM   1689 N N   . ASP B 2 79  ? 8.317   -20.954 -27.530 1.00 17.35 ? 76  ASP B N   1 
ATOM   1690 C CA  . ASP B 2 79  ? 7.132   -20.759 -26.689 1.00 17.75 ? 76  ASP B CA  1 
ATOM   1691 C C   . ASP B 2 79  ? 6.127   -21.892 -26.962 1.00 18.21 ? 76  ASP B C   1 
ATOM   1692 O O   . ASP B 2 79  ? 6.401   -22.763 -27.798 1.00 18.20 ? 76  ASP B O   1 
ATOM   1693 C CB  . ASP B 2 79  ? 6.568   -19.318 -26.776 1.00 17.52 ? 76  ASP B CB  1 
ATOM   1694 C CG  . ASP B 2 79  ? 5.848   -19.003 -28.083 1.00 16.09 ? 76  ASP B CG  1 
ATOM   1695 O OD1 . ASP B 2 79  ? 5.155   -19.880 -28.643 1.00 15.83 ? 76  ASP B OD1 1 
ATOM   1696 O OD2 . ASP B 2 79  ? 5.934   -17.836 -28.537 1.00 14.84 ? 76  ASP B OD2 1 
ATOM   1697 N N   . PRO B 2 80  ? 4.991   -21.934 -26.240 1.00 18.64 ? 77  PRO B N   1 
ATOM   1698 C CA  . PRO B 2 80  ? 4.088   -23.079 -26.439 1.00 18.95 ? 77  PRO B CA  1 
ATOM   1699 C C   . PRO B 2 80  ? 3.500   -23.220 -27.849 1.00 19.10 ? 77  PRO B C   1 
ATOM   1700 O O   . PRO B 2 80  ? 2.998   -24.294 -28.199 1.00 19.91 ? 77  PRO B O   1 
ATOM   1701 C CB  . PRO B 2 80  ? 2.976   -22.817 -25.430 1.00 18.92 ? 77  PRO B CB  1 
ATOM   1702 C CG  . PRO B 2 80  ? 3.653   -22.066 -24.339 1.00 18.85 ? 77  PRO B CG  1 
ATOM   1703 C CD  . PRO B 2 80  ? 4.605   -21.143 -25.054 1.00 18.72 ? 77  PRO B CD  1 
ATOM   1704 N N   . SER B 2 81  ? 3.585   -22.153 -28.638 1.00 18.39 ? 78  SER B N   1 
ATOM   1705 C CA  . SER B 2 81  ? 2.998   -22.094 -29.968 1.00 18.15 ? 78  SER B CA  1 
ATOM   1706 C C   . SER B 2 81  ? 4.015   -22.324 -31.090 1.00 17.85 ? 78  SER B C   1 
ATOM   1707 O O   . SER B 2 81  ? 3.632   -22.470 -32.255 1.00 18.44 ? 78  SER B O   1 
ATOM   1708 C CB  . SER B 2 81  ? 2.305   -20.741 -30.159 1.00 17.31 ? 78  SER B CB  1 
ATOM   1709 O OG  . SER B 2 81  ? 3.242   -19.699 -30.413 1.00 17.17 ? 78  SER B OG  1 
ATOM   1710 N N   . GLY B 2 82  ? 5.304   -22.334 -30.748 1.00 17.83 ? 79  GLY B N   1 
ATOM   1711 C CA  . GLY B 2 82  ? 6.353   -22.532 -31.750 1.00 18.16 ? 79  GLY B CA  1 
ATOM   1712 C C   . GLY B 2 82  ? 7.687   -21.879 -31.443 1.00 18.14 ? 79  GLY B C   1 
ATOM   1713 O O   . GLY B 2 82  ? 7.888   -21.296 -30.374 1.00 17.64 ? 79  GLY B O   1 
ATOM   1714 N N   . ASP B 2 83  ? 8.602   -21.973 -32.399 1.00 18.51 ? 80  ASP B N   1 
ATOM   1715 C CA  . ASP B 2 83  ? 9.955   -21.450 -32.225 1.00 18.71 ? 80  ASP B CA  1 
ATOM   1716 C C   . ASP B 2 83  ? 10.106  -20.067 -32.835 1.00 17.98 ? 80  ASP B C   1 
ATOM   1717 O O   . ASP B 2 83  ? 9.363   -19.681 -33.734 1.00 18.14 ? 80  ASP B O   1 
ATOM   1718 C CB  . ASP B 2 83  ? 10.984  -22.395 -32.857 1.00 19.34 ? 80  ASP B CB  1 
ATOM   1719 C CG  . ASP B 2 83  ? 11.078  -23.741 -32.142 1.00 21.85 ? 80  ASP B CG  1 
ATOM   1720 O OD1 . ASP B 2 83  ? 10.346  -23.974 -31.158 1.00 24.37 ? 80  ASP B OD1 1 
ATOM   1721 O OD2 . ASP B 2 83  ? 11.896  -24.578 -32.578 1.00 25.21 ? 80  ASP B OD2 1 
ATOM   1722 N N   . PHE B 2 84  ? 11.076  -19.314 -32.331 1.00 17.06 ? 81  PHE B N   1 
ATOM   1723 C CA  . PHE B 2 84  ? 11.437  -18.029 -32.923 1.00 16.61 ? 81  PHE B CA  1 
ATOM   1724 C C   . PHE B 2 84  ? 12.918  -17.771 -32.727 1.00 16.33 ? 81  PHE B C   1 
ATOM   1725 O O   . PHE B 2 84  ? 13.507  -18.291 -31.777 1.00 16.65 ? 81  PHE B O   1 
ATOM   1726 C CB  . PHE B 2 84  ? 10.570  -16.862 -32.401 1.00 16.79 ? 81  PHE B CB  1 
ATOM   1727 C CG  . PHE B 2 84  ? 10.610  -16.651 -30.897 1.00 16.69 ? 81  PHE B CG  1 
ATOM   1728 C CD1 . PHE B 2 84  ? 9.850   -17.441 -30.038 1.00 15.39 ? 81  PHE B CD1 1 
ATOM   1729 C CD2 . PHE B 2 84  ? 11.363  -15.610 -30.351 1.00 16.75 ? 81  PHE B CD2 1 
ATOM   1730 C CE1 . PHE B 2 84  ? 9.859   -17.218 -28.658 1.00 16.05 ? 81  PHE B CE1 1 
ATOM   1731 C CE2 . PHE B 2 84  ? 11.378  -15.378 -28.974 1.00 16.47 ? 81  PHE B CE2 1 
ATOM   1732 C CZ  . PHE B 2 84  ? 10.621  -16.182 -28.131 1.00 15.49 ? 81  PHE B CZ  1 
ATOM   1733 N N   . SER B 2 85  ? 13.509  -16.994 -33.635 1.00 16.35 ? 82  SER B N   1 
ATOM   1734 C CA  A SER B 2 85  ? 14.942  -16.686 -33.587 0.50 16.65 ? 82  SER B CA  1 
ATOM   1735 C CA  B SER B 2 85  ? 14.939  -16.700 -33.552 0.50 16.74 ? 82  SER B CA  1 
ATOM   1736 C C   . SER B 2 85  ? 15.197  -15.267 -33.105 1.00 16.82 ? 82  SER B C   1 
ATOM   1737 O O   . SER B 2 85  ? 14.387  -14.361 -33.341 1.00 16.53 ? 82  SER B O   1 
ATOM   1738 C CB  A SER B 2 85  ? 15.592  -16.887 -34.958 0.50 16.60 ? 82  SER B CB  1 
ATOM   1739 C CB  B SER B 2 85  ? 15.660  -17.011 -34.872 0.50 16.71 ? 82  SER B CB  1 
ATOM   1740 O OG  A SER B 2 85  ? 15.572  -18.249 -35.337 0.50 16.67 ? 82  SER B OG  1 
ATOM   1741 O OG  B SER B 2 85  ? 15.399  -16.030 -35.859 0.50 17.35 ? 82  SER B OG  1 
ATOM   1742 N N   . VAL B 2 86  ? 16.334  -15.080 -32.442 1.00 17.33 ? 83  VAL B N   1 
ATOM   1743 C CA  . VAL B 2 86  ? 16.725  -13.783 -31.918 1.00 17.99 ? 83  VAL B CA  1 
ATOM   1744 C C   . VAL B 2 86  ? 18.182  -13.554 -32.287 1.00 18.36 ? 83  VAL B C   1 
ATOM   1745 O O   . VAL B 2 86  ? 19.005  -14.448 -32.138 1.00 18.85 ? 83  VAL B O   1 
ATOM   1746 C CB  . VAL B 2 86  ? 16.549  -13.731 -30.385 1.00 17.76 ? 83  VAL B CB  1 
ATOM   1747 C CG1 . VAL B 2 86  ? 16.939  -12.370 -29.847 1.00 19.05 ? 83  VAL B CG1 1 
ATOM   1748 C CG2 . VAL B 2 86  ? 15.099  -14.068 -29.994 1.00 18.36 ? 83  VAL B CG2 1 
ATOM   1749 N N   . ARG B 2 87  ? 18.481  -12.358 -32.777 1.00 19.11 ? 84  ARG B N   1 
ATOM   1750 C CA  . ARG B 2 87  ? 19.851  -11.984 -33.135 1.00 19.86 ? 84  ARG B CA  1 
ATOM   1751 C C   . ARG B 2 87  ? 20.263  -10.683 -32.452 1.00 19.79 ? 84  ARG B C   1 
ATOM   1752 O O   . ARG B 2 87  ? 19.428  -9.985  -31.865 1.00 20.14 ? 84  ARG B O   1 
ATOM   1753 C CB  . ARG B 2 87  ? 19.983  -11.837 -34.652 1.00 20.53 ? 84  ARG B CB  1 
ATOM   1754 C CG  . ARG B 2 87  ? 19.556  -13.068 -35.430 1.00 23.13 ? 84  ARG B CG  1 
ATOM   1755 C CD  . ARG B 2 87  ? 19.919  -12.935 -36.880 1.00 27.84 ? 84  ARG B CD  1 
ATOM   1756 N NE  . ARG B 2 87  ? 19.457  -14.083 -37.653 1.00 31.59 ? 84  ARG B NE  1 
ATOM   1757 C CZ  . ARG B 2 87  ? 19.762  -14.301 -38.928 1.00 34.00 ? 84  ARG B CZ  1 
ATOM   1758 N NH1 . ARG B 2 87  ? 20.544  -13.451 -39.588 1.00 35.28 ? 84  ARG B NH1 1 
ATOM   1759 N NH2 . ARG B 2 87  ? 19.286  -15.374 -39.544 1.00 34.83 ? 84  ARG B NH2 1 
ATOM   1760 N N   . GLY B 2 88  ? 21.552  -10.367 -32.525 1.00 19.63 ? 85  GLY B N   1 
ATOM   1761 C CA  . GLY B 2 88  ? 22.083  -9.134  -31.951 1.00 19.08 ? 85  GLY B CA  1 
ATOM   1762 C C   . GLY B 2 88  ? 22.230  -9.152  -30.441 1.00 18.96 ? 85  GLY B C   1 
ATOM   1763 O O   . GLY B 2 88  ? 22.309  -8.091  -29.820 1.00 19.03 ? 85  GLY B O   1 
ATOM   1764 N N   . LEU B 2 89  ? 22.308  -10.342 -29.851 1.00 18.75 ? 86  LEU B N   1 
ATOM   1765 C CA  . LEU B 2 89  ? 22.329  -10.484 -28.390 1.00 19.48 ? 86  LEU B CA  1 
ATOM   1766 C C   . LEU B 2 89  ? 23.622  -10.013 -27.716 1.00 20.01 ? 86  LEU B C   1 
ATOM   1767 O O   . LEU B 2 89  ? 23.645  -9.788  -26.504 1.00 19.82 ? 86  LEU B O   1 
ATOM   1768 C CB  . LEU B 2 89  ? 21.989  -11.918 -27.981 1.00 19.19 ? 86  LEU B CB  1 
ATOM   1769 C CG  . LEU B 2 89  ? 20.526  -12.298 -28.229 1.00 19.23 ? 86  LEU B CG  1 
ATOM   1770 C CD1 . LEU B 2 89  ? 20.364  -13.795 -28.281 1.00 20.00 ? 86  LEU B CD1 1 
ATOM   1771 C CD2 . LEU B 2 89  ? 19.619  -11.703 -27.168 1.00 19.91 ? 86  LEU B CD2 1 
ATOM   1772 N N   . GLU B 2 90  ? 24.681  -9.841  -28.503 1.00 20.73 ? 87  GLU B N   1 
ATOM   1773 C CA  . GLU B 2 90  ? 25.922  -9.245  -28.002 1.00 21.78 ? 87  GLU B CA  1 
ATOM   1774 C C   . GLU B 2 90  ? 25.749  -7.777  -27.588 1.00 21.69 ? 87  GLU B C   1 
ATOM   1775 O O   . GLU B 2 90  ? 26.590  -7.230  -26.868 1.00 22.00 ? 87  GLU B O   1 
ATOM   1776 C CB  . GLU B 2 90  ? 27.043  -9.365  -29.048 1.00 21.82 ? 87  GLU B CB  1 
ATOM   1777 C CG  . GLU B 2 90  ? 26.965  -8.385  -30.242 1.00 24.16 ? 87  GLU B CG  1 
ATOM   1778 C CD  . GLU B 2 90  ? 25.878  -8.716  -31.269 1.00 26.08 ? 87  GLU B CD  1 
ATOM   1779 O OE1 . GLU B 2 90  ? 25.358  -9.856  -31.281 1.00 25.37 ? 87  GLU B OE1 1 
ATOM   1780 O OE2 . GLU B 2 90  ? 25.546  -7.816  -32.076 1.00 28.56 ? 87  GLU B OE2 1 
ATOM   1781 N N   . ARG B 2 91  ? 24.663  -7.154  -28.040 1.00 21.68 ? 88  ARG B N   1 
ATOM   1782 C CA  . ARG B 2 91  ? 24.433  -5.721  -27.838 1.00 22.01 ? 88  ARG B CA  1 
ATOM   1783 C C   . ARG B 2 91  ? 23.566  -5.384  -26.623 1.00 21.27 ? 88  ARG B C   1 
ATOM   1784 O O   . ARG B 2 91  ? 23.572  -4.241  -26.149 1.00 21.56 ? 88  ARG B O   1 
ATOM   1785 C CB  . ARG B 2 91  ? 23.816  -5.109  -29.097 1.00 22.70 ? 88  ARG B CB  1 
ATOM   1786 C CG  . ARG B 2 91  ? 24.829  -4.781  -30.172 1.00 25.19 ? 88  ARG B CG  1 
ATOM   1787 C CD  . ARG B 2 91  ? 24.185  -4.658  -31.538 1.00 29.72 ? 88  ARG B CD  1 
ATOM   1788 N NE  . ARG B 2 91  ? 24.771  -3.554  -32.298 1.00 33.63 ? 88  ARG B NE  1 
ATOM   1789 C CZ  . ARG B 2 91  ? 25.961  -3.585  -32.901 1.00 35.01 ? 88  ARG B CZ  1 
ATOM   1790 N NH1 . ARG B 2 91  ? 26.726  -4.673  -32.850 1.00 36.29 ? 88  ARG B NH1 1 
ATOM   1791 N NH2 . ARG B 2 91  ? 26.389  -2.516  -33.561 1.00 35.90 ? 88  ARG B NH2 1 
ATOM   1792 N N   . VAL B 2 92  ? 22.843  -6.374  -26.112 1.00 20.04 ? 89  VAL B N   1 
ATOM   1793 C CA  . VAL B 2 92  ? 21.830  -6.129  -25.075 1.00 19.02 ? 89  VAL B CA  1 
ATOM   1794 C C   . VAL B 2 92  ? 22.424  -6.018  -23.666 1.00 18.28 ? 89  VAL B C   1 
ATOM   1795 O O   . VAL B 2 92  ? 23.519  -6.523  -23.407 1.00 17.91 ? 89  VAL B O   1 
ATOM   1796 C CB  . VAL B 2 92  ? 20.675  -7.169  -25.124 1.00 18.73 ? 89  VAL B CB  1 
ATOM   1797 C CG1 . VAL B 2 92  ? 20.126  -7.267  -26.544 1.00 19.50 ? 89  VAL B CG1 1 
ATOM   1798 C CG2 . VAL B 2 92  ? 21.115  -8.535  -24.603 1.00 18.13 ? 89  VAL B CG2 1 
ATOM   1799 N N   . PRO B 2 93  ? 21.711  -5.328  -22.755 1.00 17.67 ? 90  PRO B N   1 
ATOM   1800 C CA  . PRO B 2 93  ? 22.162  -5.235  -21.360 1.00 17.41 ? 90  PRO B CA  1 
ATOM   1801 C C   . PRO B 2 93  ? 22.424  -6.595  -20.714 1.00 17.46 ? 90  PRO B C   1 
ATOM   1802 O O   . PRO B 2 93  ? 21.692  -7.565  -20.961 1.00 17.89 ? 90  PRO B O   1 
ATOM   1803 C CB  . PRO B 2 93  ? 20.997  -4.526  -20.664 1.00 16.82 ? 90  PRO B CB  1 
ATOM   1804 C CG  . PRO B 2 93  ? 20.380  -3.710  -21.738 1.00 17.34 ? 90  PRO B CG  1 
ATOM   1805 C CD  . PRO B 2 93  ? 20.505  -4.511  -22.994 1.00 17.86 ? 90  PRO B CD  1 
ATOM   1806 N N   . ARG B 2 94  ? 23.473  -6.654  -19.894 1.00 17.62 ? 91  ARG B N   1 
ATOM   1807 C CA  . ARG B 2 94  ? 23.915  -7.903  -19.284 1.00 17.63 ? 91  ARG B CA  1 
ATOM   1808 C C   . ARG B 2 94  ? 23.359  -8.116  -17.884 1.00 17.61 ? 91  ARG B C   1 
ATOM   1809 O O   . ARG B 2 94  ? 24.007  -7.784  -16.888 1.00 17.63 ? 91  ARG B O   1 
ATOM   1810 C CB  . ARG B 2 94  ? 25.442  -7.945  -19.219 1.00 18.13 ? 91  ARG B CB  1 
ATOM   1811 C CG  . ARG B 2 94  ? 26.106  -7.878  -20.551 1.00 20.14 ? 91  ARG B CG  1 
ATOM   1812 C CD  . ARG B 2 94  ? 27.568  -7.570  -20.351 1.00 21.25 ? 91  ARG B CD  1 
ATOM   1813 N NE  . ARG B 2 94  ? 28.261  -7.553  -21.629 1.00 22.57 ? 91  ARG B NE  1 
ATOM   1814 C CZ  . ARG B 2 94  ? 29.517  -7.157  -21.805 1.00 21.53 ? 91  ARG B CZ  1 
ATOM   1815 N NH1 . ARG B 2 94  ? 30.250  -6.730  -20.776 1.00 18.49 ? 91  ARG B NH1 1 
ATOM   1816 N NH2 . ARG B 2 94  ? 30.033  -7.190  -23.027 1.00 22.49 ? 91  ARG B NH2 1 
ATOM   1817 N N   . GLY B 2 95  ? 22.163  -8.684  -17.801 1.00 16.98 ? 92  GLY B N   1 
ATOM   1818 C CA  . GLY B 2 95  ? 21.640  -9.099  -16.506 1.00 17.77 ? 92  GLY B CA  1 
ATOM   1819 C C   . GLY B 2 95  ? 22.207  -10.460 -16.161 1.00 18.11 ? 92  GLY B C   1 
ATOM   1820 O O   . GLY B 2 95  ? 23.240  -10.864 -16.711 1.00 18.10 ? 92  GLY B O   1 
ATOM   1821 N N   . ARG B 2 96  ? 21.538  -11.177 -15.261 1.00 18.70 ? 93  ARG B N   1 
ATOM   1822 C CA  . ARG B 2 96  ? 21.916  -12.555 -14.949 1.00 20.16 ? 93  ARG B CA  1 
ATOM   1823 C C   . ARG B 2 96  ? 22.054  -13.320 -16.256 1.00 20.26 ? 93  ARG B C   1 
ATOM   1824 O O   . ARG B 2 96  ? 21.141  -13.308 -17.074 1.00 19.34 ? 93  ARG B O   1 
ATOM   1825 C CB  . ARG B 2 96  ? 20.870  -13.240 -14.074 1.00 20.76 ? 93  ARG B CB  1 
ATOM   1826 C CG  . ARG B 2 96  ? 20.742  -12.667 -12.680 1.00 23.90 ? 93  ARG B CG  1 
ATOM   1827 C CD  . ARG B 2 96  ? 20.023  -13.626 -11.733 1.00 28.55 ? 93  ARG B CD  1 
ATOM   1828 N NE  . ARG B 2 96  ? 18.906  -14.339 -12.354 1.00 32.20 ? 93  ARG B NE  1 
ATOM   1829 C CZ  . ARG B 2 96  ? 17.646  -13.909 -12.388 1.00 33.76 ? 93  ARG B CZ  1 
ATOM   1830 N NH1 . ARG B 2 96  ? 17.300  -12.744 -11.848 1.00 34.46 ? 93  ARG B NH1 1 
ATOM   1831 N NH2 . ARG B 2 96  ? 16.724  -14.653 -12.976 1.00 34.79 ? 93  ARG B NH2 1 
ATOM   1832 N N   . PRO B 2 97  ? 23.209  -13.974 -16.474 1.00 21.01 ? 94  PRO B N   1 
ATOM   1833 C CA  . PRO B 2 97  ? 23.414  -14.635 -17.761 1.00 21.61 ? 94  PRO B CA  1 
ATOM   1834 C C   . PRO B 2 97  ? 22.331  -15.680 -18.027 1.00 21.93 ? 94  PRO B C   1 
ATOM   1835 O O   . PRO B 2 97  ? 22.024  -16.493 -17.154 1.00 22.42 ? 94  PRO B O   1 
ATOM   1836 C CB  . PRO B 2 97  ? 24.802  -15.281 -17.613 1.00 21.66 ? 94  PRO B CB  1 
ATOM   1837 C CG  . PRO B 2 97  ? 25.066  -15.321 -16.141 1.00 22.25 ? 94  PRO B CG  1 
ATOM   1838 C CD  . PRO B 2 97  ? 24.371  -14.122 -15.579 1.00 21.27 ? 94  PRO B CD  1 
ATOM   1839 N N   . CYS B 2 98  ? 21.726  -15.628 -19.210 1.00 21.95 ? 95  CYS B N   1 
ATOM   1840 C CA  . CYS B 2 98  ? 20.627  -16.538 -19.525 1.00 22.71 ? 95  CYS B CA  1 
ATOM   1841 C C   . CYS B 2 98  ? 20.663  -17.159 -20.931 1.00 23.59 ? 95  CYS B C   1 
ATOM   1842 O O   . CYS B 2 98  ? 19.738  -17.892 -21.315 1.00 23.91 ? 95  CYS B O   1 
ATOM   1843 C CB  . CYS B 2 98  ? 19.271  -15.881 -19.221 1.00 22.46 ? 95  CYS B CB  1 
ATOM   1844 S SG  . CYS B 2 98  ? 18.924  -14.333 -20.076 1.00 20.69 ? 95  CYS B SG  1 
ATOM   1845 N N   . LEU B 2 99  ? 21.732  -16.885 -21.680 1.00 24.58 ? 96  LEU B N   1 
ATOM   1846 C CA  . LEU B 2 99  ? 21.956  -17.536 -22.980 1.00 25.44 ? 96  LEU B CA  1 
ATOM   1847 C C   . LEU B 2 99  ? 22.474  -18.961 -22.805 1.00 25.47 ? 96  LEU B C   1 
ATOM   1848 O O   . LEU B 2 99  ? 23.608  -19.288 -23.183 1.00 26.11 ? 96  LEU B O   1 
ATOM   1849 C CB  . LEU B 2 99  ? 22.900  -16.712 -23.863 1.00 25.76 ? 96  LEU B CB  1 
ATOM   1850 C CG  . LEU B 2 99  ? 22.297  -15.764 -24.902 1.00 26.81 ? 96  LEU B CG  1 
ATOM   1851 C CD1 . LEU B 2 99  ? 23.388  -15.284 -25.853 1.00 27.43 ? 96  LEU B CD1 1 
ATOM   1852 C CD2 . LEU B 2 99  ? 21.175  -16.443 -25.690 1.00 27.46 ? 96  LEU B CD2 1 
ATOM   1853 N N   . VAL B 2 100 ? 21.624  -19.793 -22.211 1.00 25.28 ? 97  VAL B N   1 
ATOM   1854 C CA  . VAL B 2 100 ? 21.914  -21.184 -21.892 1.00 24.90 ? 97  VAL B CA  1 
ATOM   1855 C C   . VAL B 2 100 ? 20.688  -22.011 -22.283 1.00 24.34 ? 97  VAL B C   1 
ATOM   1856 O O   . VAL B 2 100 ? 19.566  -21.662 -21.901 1.00 23.81 ? 97  VAL B O   1 
ATOM   1857 C CB  . VAL B 2 100 ? 22.156  -21.382 -20.369 1.00 25.13 ? 97  VAL B CB  1 
ATOM   1858 C CG1 . VAL B 2 100 ? 22.552  -22.823 -20.062 1.00 25.37 ? 97  VAL B CG1 1 
ATOM   1859 C CG2 . VAL B 2 100 ? 23.200  -20.404 -19.828 1.00 25.61 ? 97  VAL B CG2 1 
ATOM   1860 N N   . PRO B 2 101 ? 20.883  -23.108 -23.044 1.00 23.75 ? 98  PRO B N   1 
ATOM   1861 C CA  . PRO B 2 101 ? 19.763  -24.016 -23.301 1.00 23.29 ? 98  PRO B CA  1 
ATOM   1862 C C   . PRO B 2 101 ? 19.029  -24.422 -22.021 1.00 22.68 ? 98  PRO B C   1 
ATOM   1863 O O   . PRO B 2 101 ? 19.664  -24.805 -21.031 1.00 23.24 ? 98  PRO B O   1 
ATOM   1864 C CB  . PRO B 2 101 ? 20.446  -25.227 -23.943 1.00 23.54 ? 98  PRO B CB  1 
ATOM   1865 C CG  . PRO B 2 101 ? 21.600  -24.635 -24.660 1.00 23.71 ? 98  PRO B CG  1 
ATOM   1866 C CD  . PRO B 2 101 ? 22.095  -23.519 -23.783 1.00 23.96 ? 98  PRO B CD  1 
ATOM   1867 N N   . GLY B 2 102 ? 17.702  -24.302 -22.039 1.00 21.80 ? 99  GLY B N   1 
ATOM   1868 C CA  . GLY B 2 102 ? 16.868  -24.668 -20.901 1.00 20.52 ? 99  GLY B CA  1 
ATOM   1869 C C   . GLY B 2 102 ? 16.340  -23.498 -20.080 1.00 19.89 ? 99  GLY B C   1 
ATOM   1870 O O   . GLY B 2 102 ? 15.327  -23.635 -19.392 1.00 19.89 ? 99  GLY B O   1 
ATOM   1871 N N   . LYS B 2 103 ? 17.034  -22.362 -20.143 1.00 18.93 ? 100 LYS B N   1 
ATOM   1872 C CA  . LYS B 2 103 ? 16.615  -21.155 -19.426 1.00 18.49 ? 100 LYS B CA  1 
ATOM   1873 C C   . LYS B 2 103 ? 15.310  -20.639 -20.018 1.00 17.27 ? 100 LYS B C   1 
ATOM   1874 O O   . LYS B 2 103 ? 15.096  -20.744 -21.223 1.00 17.35 ? 100 LYS B O   1 
ATOM   1875 C CB  . LYS B 2 103 ? 17.685  -20.061 -19.524 1.00 18.90 ? 100 LYS B CB  1 
ATOM   1876 C CG  . LYS B 2 103 ? 18.966  -20.322 -18.730 1.00 21.13 ? 100 LYS B CG  1 
ATOM   1877 C CD  . LYS B 2 103 ? 18.827  -19.888 -17.279 1.00 24.02 ? 100 LYS B CD  1 
ATOM   1878 C CE  . LYS B 2 103 ? 20.141  -19.994 -16.532 1.00 25.56 ? 100 LYS B CE  1 
ATOM   1879 N NZ  . LYS B 2 103 ? 19.984  -19.579 -15.099 1.00 27.03 ? 100 LYS B NZ  1 
ATOM   1880 N N   . TYR B 2 104 ? 14.439  -20.093 -19.167 1.00 16.09 ? 101 TYR B N   1 
ATOM   1881 C CA  . TYR B 2 104 ? 13.219  -19.437 -19.636 1.00 15.46 ? 101 TYR B CA  1 
ATOM   1882 C C   . TYR B 2 104 ? 13.428  -17.934 -19.575 1.00 14.65 ? 101 TYR B C   1 
ATOM   1883 O O   . TYR B 2 104 ? 13.812  -17.409 -18.536 1.00 14.44 ? 101 TYR B O   1 
ATOM   1884 C CB  . TYR B 2 104 ? 12.011  -19.843 -18.796 1.00 15.06 ? 101 TYR B CB  1 
ATOM   1885 C CG  . TYR B 2 104 ? 10.710  -19.309 -19.348 1.00 14.54 ? 101 TYR B CG  1 
ATOM   1886 C CD1 . TYR B 2 104 ? 10.122  -19.895 -20.462 1.00 13.90 ? 101 TYR B CD1 1 
ATOM   1887 C CD2 . TYR B 2 104 ? 10.072  -18.218 -18.758 1.00 13.90 ? 101 TYR B CD2 1 
ATOM   1888 C CE1 . TYR B 2 104 ? 8.935   -19.408 -20.986 1.00 14.34 ? 101 TYR B CE1 1 
ATOM   1889 C CE2 . TYR B 2 104 ? 8.877   -17.721 -19.281 1.00 13.88 ? 101 TYR B CE2 1 
ATOM   1890 C CZ  . TYR B 2 104 ? 8.322   -18.324 -20.388 1.00 13.79 ? 101 TYR B CZ  1 
ATOM   1891 O OH  . TYR B 2 104 ? 7.142   -17.873 -20.915 1.00 12.39 ? 101 TYR B OH  1 
ATOM   1892 N N   . VAL B 2 105 ? 13.202  -17.242 -20.691 1.00 14.02 ? 102 VAL B N   1 
ATOM   1893 C CA  . VAL B 2 105 ? 13.595  -15.836 -20.785 1.00 14.17 ? 102 VAL B CA  1 
ATOM   1894 C C   . VAL B 2 105 ? 12.538  -14.983 -21.482 1.00 13.78 ? 102 VAL B C   1 
ATOM   1895 O O   . VAL B 2 105 ? 11.660  -15.524 -22.170 1.00 14.54 ? 102 VAL B O   1 
ATOM   1896 C CB  . VAL B 2 105 ? 14.951  -15.666 -21.543 1.00 14.44 ? 102 VAL B CB  1 
ATOM   1897 C CG1 . VAL B 2 105 ? 16.058  -16.521 -20.908 1.00 14.91 ? 102 VAL B CG1 1 
ATOM   1898 C CG2 . VAL B 2 105 ? 14.799  -16.017 -23.017 1.00 15.27 ? 102 VAL B CG2 1 
ATOM   1899 N N   . MET B 2 106 ? 12.610  -13.663 -21.273 1.00 13.43 ? 103 MET B N   1 
ATOM   1900 C CA  A MET B 2 106 ? 11.860  -12.706 -22.100 0.50 13.26 ? 103 MET B CA  1 
ATOM   1901 C CA  B MET B 2 106 ? 11.861  -12.715 -22.104 0.50 12.99 ? 103 MET B CA  1 
ATOM   1902 C C   . MET B 2 106 ? 12.783  -11.976 -23.067 1.00 13.11 ? 103 MET B C   1 
ATOM   1903 O O   . MET B 2 106 ? 13.970  -11.753 -22.776 1.00 12.46 ? 103 MET B O   1 
ATOM   1904 C CB  A MET B 2 106 ? 11.034  -11.705 -21.261 0.50 13.42 ? 103 MET B CB  1 
ATOM   1905 C CB  B MET B 2 106 ? 11.015  -11.727 -21.273 0.50 12.89 ? 103 MET B CB  1 
ATOM   1906 C CG  A MET B 2 106 ? 11.792  -10.481 -20.727 0.50 14.35 ? 103 MET B CG  1 
ATOM   1907 C CG  B MET B 2 106 ? 11.797  -10.740 -20.410 0.50 12.77 ? 103 MET B CG  1 
ATOM   1908 S SD  A MET B 2 106 ? 11.933  -9.081  -21.863 0.50 15.89 ? 103 MET B SD  1 
ATOM   1909 S SD  B MET B 2 106 ? 10.860  -9.225  -20.070 0.50 9.94  ? 103 MET B SD  1 
ATOM   1910 C CE  A MET B 2 106 ? 10.287  -8.393  -21.829 0.50 16.14 ? 103 MET B CE  1 
ATOM   1911 C CE  B MET B 2 106 ? 10.737  -8.508  -21.707 0.50 13.31 ? 103 MET B CE  1 
ATOM   1912 N N   . VAL B 2 107 ? 12.240  -11.619 -24.221 1.00 12.25 ? 104 VAL B N   1 
ATOM   1913 C CA  . VAL B 2 107 ? 12.963  -10.816 -25.177 1.00 13.21 ? 104 VAL B CA  1 
ATOM   1914 C C   . VAL B 2 107 ? 12.088  -9.645  -25.555 1.00 13.15 ? 104 VAL B C   1 
ATOM   1915 O O   . VAL B 2 107 ? 10.899  -9.817  -25.822 1.00 13.71 ? 104 VAL B O   1 
ATOM   1916 C CB  . VAL B 2 107 ? 13.332  -11.637 -26.443 1.00 13.07 ? 104 VAL B CB  1 
ATOM   1917 C CG1 . VAL B 2 107 ? 13.981  -10.744 -27.503 1.00 14.45 ? 104 VAL B CG1 1 
ATOM   1918 C CG2 . VAL B 2 107 ? 14.238  -12.802 -26.076 1.00 15.53 ? 104 VAL B CG2 1 
ATOM   1919 N N   . MET B 2 108 ? 12.647  -8.443  -25.532 1.00 12.70 ? 105 MET B N   1 
ATOM   1920 C CA  . MET B 2 108 ? 12.045  -7.353  -26.270 1.00 12.80 ? 105 MET B CA  1 
ATOM   1921 C C   . MET B 2 108 ? 12.820  -7.254  -27.566 1.00 13.37 ? 105 MET B C   1 
ATOM   1922 O O   . MET B 2 108 ? 14.038  -7.121  -27.544 1.00 13.48 ? 105 MET B O   1 
ATOM   1923 C CB  . MET B 2 108 ? 12.133  -6.046  -25.496 1.00 12.81 ? 105 MET B CB  1 
ATOM   1924 C CG  . MET B 2 108 ? 11.647  -4.855  -26.302 1.00 12.95 ? 105 MET B CG  1 
ATOM   1925 S SD  . MET B 2 108 ? 11.853  -3.298  -25.435 1.00 13.01 ? 105 MET B SD  1 
ATOM   1926 C CE  . MET B 2 108 ? 11.419  -2.141  -26.742 1.00 14.34 ? 105 MET B CE  1 
ATOM   1927 N N   . GLY B 2 109 ? 12.118  -7.335  -28.691 1.00 13.87 ? 106 GLY B N   1 
ATOM   1928 C CA  . GLY B 2 109 ? 12.792  -7.359  -29.992 1.00 14.44 ? 106 GLY B CA  1 
ATOM   1929 C C   . GLY B 2 109 ? 12.068  -6.601  -31.077 1.00 15.06 ? 106 GLY B C   1 
ATOM   1930 O O   . GLY B 2 109 ? 10.885  -6.304  -30.958 1.00 14.76 ? 106 GLY B O   1 
ATOM   1931 N N   . VAL B 2 110 ? 12.792  -6.274  -32.142 1.00 15.89 ? 107 VAL B N   1 
ATOM   1932 C CA  . VAL B 2 110 ? 12.191  -5.625  -33.301 1.00 17.10 ? 107 VAL B CA  1 
ATOM   1933 C C   . VAL B 2 110 ? 12.008  -6.705  -34.364 1.00 17.27 ? 107 VAL B C   1 
ATOM   1934 O O   . VAL B 2 110 ? 12.944  -7.454  -34.654 1.00 17.75 ? 107 VAL B O   1 
ATOM   1935 C CB  . VAL B 2 110 ? 13.066  -4.457  -33.829 1.00 17.60 ? 107 VAL B CB  1 
ATOM   1936 C CG1 . VAL B 2 110 ? 12.517  -3.905  -35.158 1.00 19.14 ? 107 VAL B CG1 1 
ATOM   1937 C CG2 . VAL B 2 110 ? 13.161  -3.344  -32.781 1.00 18.42 ? 107 VAL B CG2 1 
ATOM   1938 N N   . VAL B 2 111 ? 10.801  -6.798  -34.916 1.00 17.48 ? 108 VAL B N   1 
ATOM   1939 C CA  . VAL B 2 111 ? 10.470  -7.877  -35.846 1.00 18.14 ? 108 VAL B CA  1 
ATOM   1940 C C   . VAL B 2 111 ? 11.175  -7.692  -37.192 1.00 18.65 ? 108 VAL B C   1 
ATOM   1941 O O   . VAL B 2 111 ? 11.007  -6.664  -37.860 1.00 19.18 ? 108 VAL B O   1 
ATOM   1942 C CB  . VAL B 2 111 ? 8.950   -8.021  -36.036 1.00 18.15 ? 108 VAL B CB  1 
ATOM   1943 C CG1 . VAL B 2 111 ? 8.633   -9.076  -37.100 1.00 18.14 ? 108 VAL B CG1 1 
ATOM   1944 C CG2 . VAL B 2 111 ? 8.297   -8.390  -34.716 1.00 18.35 ? 108 VAL B CG2 1 
ATOM   1945 N N   . GLN B 2 112 ? 11.969  -8.694  -37.556 1.00 19.03 ? 109 GLN B N   1 
ATOM   1946 C CA  . GLN B 2 112 ? 12.710  -8.710  -38.821 1.00 20.19 ? 109 GLN B CA  1 
ATOM   1947 C C   . GLN B 2 112 ? 12.017  -9.600  -39.847 1.00 20.22 ? 109 GLN B C   1 
ATOM   1948 O O   . GLN B 2 112 ? 12.060  -9.321  -41.052 1.00 20.71 ? 109 GLN B O   1 
ATOM   1949 C CB  . GLN B 2 112 ? 14.140  -9.210  -38.595 1.00 20.55 ? 109 GLN B CB  1 
ATOM   1950 C CG  . GLN B 2 112 ? 14.976  -8.350  -37.651 1.00 23.03 ? 109 GLN B CG  1 
ATOM   1951 C CD  . GLN B 2 112 ? 15.101  -6.920  -38.125 1.00 26.74 ? 109 GLN B CD  1 
ATOM   1952 O OE1 . GLN B 2 112 ? 15.747  -6.644  -39.135 1.00 28.68 ? 109 GLN B OE1 1 
ATOM   1953 N NE2 . GLN B 2 112 ? 14.485  -5.998  -37.395 1.00 27.23 ? 109 GLN B NE2 1 
ATOM   1954 N N   . ALA B 2 113 ? 11.391  -10.668 -39.363 1.00 19.81 ? 110 ALA B N   1 
ATOM   1955 C CA  . ALA B 2 113 ? 10.681  -11.635 -40.207 1.00 19.74 ? 110 ALA B CA  1 
ATOM   1956 C C   . ALA B 2 113 ? 9.603   -12.335 -39.391 1.00 20.13 ? 110 ALA B C   1 
ATOM   1957 O O   . ALA B 2 113 ? 9.725   -12.459 -38.173 1.00 19.27 ? 110 ALA B O   1 
ATOM   1958 C CB  . ALA B 2 113 ? 11.656  -12.663 -40.760 1.00 19.94 ? 110 ALA B CB  1 
ATOM   1959 N N   . CYS B 2 114 ? 8.561   -12.814 -40.064 1.00 20.43 ? 111 CYS B N   1 
ATOM   1960 C CA  . CYS B 2 114 ? 7.452   -13.481 -39.380 1.00 21.10 ? 111 CYS B CA  1 
ATOM   1961 C C   . CYS B 2 114 ? 7.266   -14.940 -39.780 1.00 21.41 ? 111 CYS B C   1 
ATOM   1962 O O   . CYS B 2 114 ? 6.934   -15.785 -38.947 1.00 21.32 ? 111 CYS B O   1 
ATOM   1963 C CB  . CYS B 2 114 ? 6.154   -12.711 -39.612 1.00 21.14 ? 111 CYS B CB  1 
ATOM   1964 S SG  . CYS B 2 114 ? 6.111   -11.118 -38.788 1.00 22.01 ? 111 CYS B SG  1 
ATOM   1965 N N   . SER B 2 115 ? 7.487   -15.226 -41.060 1.00 21.88 ? 112 SER B N   1 
ATOM   1966 C CA  . SER B 2 115 ? 7.230   -16.544 -41.622 1.00 22.36 ? 112 SER B CA  1 
ATOM   1967 C C   . SER B 2 115 ? 8.423   -16.942 -42.482 1.00 21.99 ? 112 SER B C   1 
ATOM   1968 O O   . SER B 2 115 ? 9.007   -16.076 -43.139 1.00 22.99 ? 112 SER B O   1 
ATOM   1969 C CB  . SER B 2 115 ? 5.961   -16.489 -42.473 1.00 22.85 ? 112 SER B CB  1 
ATOM   1970 O OG  . SER B 2 115 ? 5.665   -17.749 -43.044 1.00 24.77 ? 112 SER B OG  1 
ATOM   1971 N N   . PRO B 2 116 ? 8.802   -18.241 -42.485 1.00 21.51 ? 113 PRO B N   1 
ATOM   1972 C CA  . PRO B 2 116 ? 8.238   -19.403 -41.782 1.00 21.17 ? 113 PRO B CA  1 
ATOM   1973 C C   . PRO B 2 116 ? 8.586   -19.481 -40.294 1.00 20.91 ? 113 PRO B C   1 
ATOM   1974 O O   . PRO B 2 116 ? 7.965   -20.249 -39.556 1.00 20.88 ? 113 PRO B O   1 
ATOM   1975 C CB  . PRO B 2 116 ? 8.864   -20.590 -42.517 1.00 21.22 ? 113 PRO B CB  1 
ATOM   1976 C CG  . PRO B 2 116 ? 10.152  -20.066 -43.033 1.00 21.01 ? 113 PRO B CG  1 
ATOM   1977 C CD  . PRO B 2 116 ? 9.859   -18.651 -43.432 1.00 21.53 ? 113 PRO B CD  1 
ATOM   1978 N N   . GLU B 2 117 ? 9.588   -18.712 -39.873 1.00 20.59 ? 114 GLU B N   1 
ATOM   1979 C CA  . GLU B 2 117 ? 9.949   -18.629 -38.467 1.00 20.60 ? 114 GLU B CA  1 
ATOM   1980 C C   . GLU B 2 117 ? 10.165  -17.167 -38.090 1.00 19.40 ? 114 GLU B C   1 
ATOM   1981 O O   . GLU B 2 117 ? 10.925  -16.459 -38.760 1.00 19.69 ? 114 GLU B O   1 
ATOM   1982 C CB  . GLU B 2 117 ? 11.198  -19.464 -38.150 1.00 21.32 ? 114 GLU B CB  1 
ATOM   1983 C CG  . GLU B 2 117 ? 11.444  -19.605 -36.650 1.00 23.60 ? 114 GLU B CG  1 
ATOM   1984 C CD  . GLU B 2 117 ? 12.722  -20.350 -36.303 1.00 26.46 ? 114 GLU B CD  1 
ATOM   1985 O OE1 . GLU B 2 117 ? 13.063  -21.343 -36.979 1.00 28.76 ? 114 GLU B OE1 1 
ATOM   1986 O OE2 . GLU B 2 117 ? 13.387  -19.944 -35.334 1.00 29.30 ? 114 GLU B OE2 1 
ATOM   1987 N N   . PRO B 2 118 ? 9.480   -16.699 -37.027 1.00 18.55 ? 115 PRO B N   1 
ATOM   1988 C CA  . PRO B 2 118 ? 9.677   -15.313 -36.617 1.00 17.89 ? 115 PRO B CA  1 
ATOM   1989 C C   . PRO B 2 118 ? 11.115  -15.054 -36.176 1.00 17.39 ? 115 PRO B C   1 
ATOM   1990 O O   . PRO B 2 118 ? 11.730  -15.906 -35.529 1.00 16.72 ? 115 PRO B O   1 
ATOM   1991 C CB  . PRO B 2 118 ? 8.709   -15.151 -35.441 1.00 17.95 ? 115 PRO B CB  1 
ATOM   1992 C CG  . PRO B 2 118 ? 7.674   -16.190 -35.666 1.00 17.95 ? 115 PRO B CG  1 
ATOM   1993 C CD  . PRO B 2 118 ? 8.437   -17.358 -36.228 1.00 18.59 ? 115 PRO B CD  1 
ATOM   1994 N N   . CYS B 2 119 ? 11.627  -13.889 -36.562 1.00 17.47 ? 116 CYS B N   1 
ATOM   1995 C CA  A CYS B 2 119 ? 12.998  -13.486 -36.255 0.50 17.92 ? 116 CYS B CA  1 
ATOM   1996 C CA  B CYS B 2 119 ? 12.986  -13.493 -36.233 0.50 17.58 ? 116 CYS B CA  1 
ATOM   1997 C C   . CYS B 2 119 ? 13.021  -12.069 -35.694 1.00 17.29 ? 116 CYS B C   1 
ATOM   1998 O O   . CYS B 2 119 ? 12.453  -11.147 -36.295 1.00 17.66 ? 116 CYS B O   1 
ATOM   1999 C CB  A CYS B 2 119 ? 13.871  -13.550 -37.509 0.50 17.93 ? 116 CYS B CB  1 
ATOM   2000 C CB  B CYS B 2 119 ? 13.887  -13.608 -37.457 0.50 17.54 ? 116 CYS B CB  1 
ATOM   2001 S SG  A CYS B 2 119 ? 13.965  -15.177 -38.284 0.50 20.77 ? 116 CYS B SG  1 
ATOM   2002 S SG  B CYS B 2 119 ? 15.579  -13.120 -37.125 0.50 18.35 ? 116 CYS B SG  1 
ATOM   2003 N N   . LEU B 2 120 ? 13.695  -11.900 -34.558 1.00 17.16 ? 117 LEU B N   1 
ATOM   2004 C CA  . LEU B 2 120 ? 13.776  -10.600 -33.905 1.00 16.76 ? 117 LEU B CA  1 
ATOM   2005 C C   . LEU B 2 120 ? 15.198  -10.079 -33.811 1.00 16.41 ? 117 LEU B C   1 
ATOM   2006 O O   . LEU B 2 120 ? 16.137  -10.846 -33.609 1.00 16.93 ? 117 LEU B O   1 
ATOM   2007 C CB  . LEU B 2 120 ? 13.226  -10.691 -32.477 1.00 16.30 ? 117 LEU B CB  1 
ATOM   2008 C CG  . LEU B 2 120 ? 11.895  -11.387 -32.211 1.00 16.41 ? 117 LEU B CG  1 
ATOM   2009 C CD1 . LEU B 2 120 ? 11.583  -11.350 -30.710 1.00 15.35 ? 117 LEU B CD1 1 
ATOM   2010 C CD2 . LEU B 2 120 ? 10.781  -10.751 -33.014 1.00 16.31 ? 117 LEU B CD2 1 
ATOM   2011 N N   . GLN B 2 121 ? 15.338  -8.764  -33.914 1.00 16.70 ? 118 GLN B N   1 
ATOM   2012 C CA  . GLN B 2 121 ? 16.564  -8.092  -33.510 1.00 17.41 ? 118 GLN B CA  1 
ATOM   2013 C C   . GLN B 2 121 ? 16.397  -7.666  -32.046 1.00 17.00 ? 118 GLN B C   1 
ATOM   2014 O O   . GLN B 2 121 ? 15.500  -6.885  -31.725 1.00 17.23 ? 118 GLN B O   1 
ATOM   2015 C CB  . GLN B 2 121 ? 16.855  -6.882  -34.403 1.00 17.85 ? 118 GLN B CB  1 
ATOM   2016 C CG  . GLN B 2 121 ? 18.293  -6.334  -34.281 1.00 21.10 ? 118 GLN B CG  1 
ATOM   2017 C CD  . GLN B 2 121 ? 19.351  -7.233  -34.941 1.00 25.14 ? 118 GLN B CD  1 
ATOM   2018 O OE1 . GLN B 2 121 ? 19.029  -8.147  -35.706 1.00 27.94 ? 118 GLN B OE1 1 
ATOM   2019 N NE2 . GLN B 2 121 ? 20.621  -6.963  -34.646 1.00 27.74 ? 118 GLN B NE2 1 
ATOM   2020 N N   . ALA B 2 122 ? 17.248  -8.189  -31.171 1.00 16.68 ? 119 ALA B N   1 
ATOM   2021 C CA  . ALA B 2 122 ? 17.069  -8.011  -29.728 1.00 16.97 ? 119 ALA B CA  1 
ATOM   2022 C C   . ALA B 2 122 ? 17.353  -6.603  -29.230 1.00 16.84 ? 119 ALA B C   1 
ATOM   2023 O O   . ALA B 2 122 ? 18.333  -5.965  -29.635 1.00 17.25 ? 119 ALA B O   1 
ATOM   2024 C CB  . ALA B 2 122 ? 17.906  -9.017  -28.963 1.00 17.26 ? 119 ALA B CB  1 
ATOM   2025 N N   . VAL B 2 123 ? 16.474  -6.134  -28.345 1.00 15.90 ? 120 VAL B N   1 
ATOM   2026 C CA  . VAL B 2 123 ? 16.674  -4.910  -27.574 1.00 16.15 ? 120 VAL B CA  1 
ATOM   2027 C C   . VAL B 2 123 ? 17.077  -5.333  -26.162 1.00 15.71 ? 120 VAL B C   1 
ATOM   2028 O O   . VAL B 2 123 ? 18.043  -4.794  -25.594 1.00 16.07 ? 120 VAL B O   1 
ATOM   2029 C CB  . VAL B 2 123 ? 15.397  -4.024  -27.567 1.00 16.04 ? 120 VAL B CB  1 
ATOM   2030 C CG1 . VAL B 2 123 ? 15.570  -2.790  -26.658 1.00 16.36 ? 120 VAL B CG1 1 
ATOM   2031 C CG2 . VAL B 2 123 ? 15.047  -3.601  -28.991 1.00 16.65 ? 120 VAL B CG2 1 
ATOM   2032 N N   . LYS B 2 124 ? 16.346  -6.297  -25.605 1.00 15.49 ? 121 LYS B N   1 
ATOM   2033 C CA  . LYS B 2 124 ? 16.690  -6.920  -24.321 1.00 14.71 ? 121 LYS B CA  1 
ATOM   2034 C C   . LYS B 2 124 ? 16.440  -8.420  -24.355 1.00 15.02 ? 121 LYS B C   1 
ATOM   2035 O O   . LYS B 2 124 ? 15.545  -8.894  -25.065 1.00 14.44 ? 121 LYS B O   1 
ATOM   2036 C CB  . LYS B 2 124 ? 15.840  -6.353  -23.175 1.00 14.84 ? 121 LYS B CB  1 
ATOM   2037 C CG  . LYS B 2 124 ? 16.068  -4.900  -22.817 1.00 15.23 ? 121 LYS B CG  1 
ATOM   2038 C CD  . LYS B 2 124 ? 15.277  -4.555  -21.558 1.00 12.79 ? 121 LYS B CD  1 
ATOM   2039 C CE  . LYS B 2 124 ? 15.951  -5.111  -20.295 1.00 13.10 ? 121 LYS B CE  1 
ATOM   2040 N NZ  . LYS B 2 124 ? 15.030  -5.008  -19.130 1.00 11.21 ? 121 LYS B NZ  1 
ATOM   2041 N N   . MET B 2 125 ? 17.232  -9.160  -23.591 1.00 14.46 ? 122 MET B N   1 
ATOM   2042 C CA  . MET B 2 125 ? 16.896  -10.531 -23.211 1.00 15.22 ? 122 MET B CA  1 
ATOM   2043 C C   . MET B 2 125 ? 17.242  -10.727 -21.752 1.00 15.75 ? 122 MET B C   1 
ATOM   2044 O O   . MET B 2 125 ? 18.398  -10.548 -21.348 1.00 16.15 ? 122 MET B O   1 
ATOM   2045 C CB  . MET B 2 125 ? 17.615  -11.583 -24.064 1.00 15.77 ? 122 MET B CB  1 
ATOM   2046 C CG  . MET B 2 125 ? 17.364  -13.003 -23.531 1.00 15.41 ? 122 MET B CG  1 
ATOM   2047 S SD  . MET B 2 125 ? 18.325  -14.336 -24.286 1.00 19.80 ? 122 MET B SD  1 
ATOM   2048 C CE  . MET B 2 125 ? 17.441  -14.520 -25.817 1.00 19.73 ? 122 MET B CE  1 
ATOM   2049 N N   . THR B 2 126 ? 16.245  -11.089 -20.953 1.00 15.26 ? 123 THR B N   1 
ATOM   2050 C CA  . THR B 2 126 ? 16.478  -11.246 -19.523 1.00 15.78 ? 123 THR B CA  1 
ATOM   2051 C C   . THR B 2 126 ? 15.861  -12.510 -18.944 1.00 15.90 ? 123 THR B C   1 
ATOM   2052 O O   . THR B 2 126 ? 14.885  -13.050 -19.472 1.00 14.70 ? 123 THR B O   1 
ATOM   2053 C CB  . THR B 2 126 ? 16.058  -9.977  -18.723 1.00 15.90 ? 123 THR B CB  1 
ATOM   2054 O OG1 . THR B 2 126 ? 14.652  -9.772  -18.844 1.00 17.52 ? 123 THR B OG1 1 
ATOM   2055 C CG2 . THR B 2 126 ? 16.803  -8.734  -19.221 1.00 16.23 ? 123 THR B CG2 1 
ATOM   2056 N N   . ASP B 2 127 ? 16.455  -12.984 -17.855 1.00 15.59 ? 124 ASP B N   1 
ATOM   2057 C CA  . ASP B 2 127 ? 16.123  -14.275 -17.270 1.00 16.61 ? 124 ASP B CA  1 
ATOM   2058 C C   . ASP B 2 127 ? 14.808  -14.238 -16.503 1.00 16.51 ? 124 ASP B C   1 
ATOM   2059 O O   . ASP B 2 127 ? 14.571  -13.328 -15.697 1.00 16.82 ? 124 ASP B O   1 
ATOM   2060 C CB  . ASP B 2 127 ? 17.258  -14.750 -16.351 1.00 17.15 ? 124 ASP B CB  1 
ATOM   2061 C CG  . ASP B 2 127 ? 17.272  -16.267 -16.152 1.00 18.64 ? 124 ASP B CG  1 
ATOM   2062 O OD1 . ASP B 2 127 ? 16.520  -16.994 -16.833 1.00 20.83 ? 124 ASP B OD1 1 
ATOM   2063 O OD2 . ASP B 2 127 ? 18.081  -16.751 -15.323 1.00 24.47 ? 124 ASP B OD2 1 
ATOM   2064 N N   . LEU B 2 128 ? 13.955  -15.222 -16.774 1.00 16.16 ? 125 LEU B N   1 
ATOM   2065 C CA  . LEU B 2 128 ? 12.722  -15.444 -16.022 1.00 16.38 ? 125 LEU B CA  1 
ATOM   2066 C C   . LEU B 2 128 ? 12.672  -16.860 -15.452 1.00 17.11 ? 125 LEU B C   1 
ATOM   2067 O O   . LEU B 2 128 ? 11.596  -17.387 -15.180 1.00 18.02 ? 125 LEU B O   1 
ATOM   2068 C CB  . LEU B 2 128 ? 11.499  -15.208 -16.919 1.00 15.77 ? 125 LEU B CB  1 
ATOM   2069 C CG  . LEU B 2 128 ? 11.301  -13.803 -17.484 1.00 16.16 ? 125 LEU B CG  1 
ATOM   2070 C CD1 . LEU B 2 128 ? 10.100  -13.812 -18.403 1.00 16.92 ? 125 LEU B CD1 1 
ATOM   2071 C CD2 . LEU B 2 128 ? 11.107  -12.782 -16.366 1.00 16.19 ? 125 LEU B CD2 1 
ATOM   2072 N N   . SER B 2 129 ? 13.841  -17.482 -15.280 1.00 17.67 ? 126 SER B N   1 
ATOM   2073 C CA  . SER B 2 129 ? 13.897  -18.887 -14.872 1.00 18.55 ? 126 SER B CA  1 
ATOM   2074 C C   . SER B 2 129 ? 13.645  -19.137 -13.387 1.00 19.12 ? 126 SER B C   1 
ATOM   2075 O O   . SER B 2 129 ? 13.145  -20.209 -13.027 1.00 19.42 ? 126 SER B O   1 
ATOM   2076 C CB  . SER B 2 129 ? 15.238  -19.526 -15.274 1.00 18.39 ? 126 SER B CB  1 
ATOM   2077 O OG  . SER B 2 129 ? 15.492  -19.394 -16.665 1.00 18.99 ? 126 SER B OG  1 
ATOM   2078 N N   . ASP B 2 130 ? 13.984  -18.155 -12.549 1.00 19.84 ? 127 ASP B N   1 
ATOM   2079 C CA  A ASP B 2 130 ? 13.897  -18.263 -11.084 0.50 20.39 ? 127 ASP B CA  1 
ATOM   2080 C CA  B ASP B 2 130 ? 13.907  -18.332 -11.096 0.50 20.30 ? 127 ASP B CA  1 
ATOM   2081 C C   . ASP B 2 130 ? 12.479  -18.493 -10.548 1.00 20.39 ? 127 ASP B C   1 
ATOM   2082 O O   . ASP B 2 130 ? 12.273  -19.236 -9.581  1.00 21.01 ? 127 ASP B O   1 
ATOM   2083 C CB  A ASP B 2 130 ? 14.522  -17.022 -10.410 0.50 20.84 ? 127 ASP B CB  1 
ATOM   2084 C CB  B ASP B 2 130 ? 14.662  -17.211 -10.365 0.50 20.70 ? 127 ASP B CB  1 
ATOM   2085 C CG  A ASP B 2 130 ? 13.793  -15.718 -10.749 0.50 21.82 ? 127 ASP B CG  1 
ATOM   2086 C CG  B ASP B 2 130 ? 16.172  -17.409 -10.392 0.50 21.38 ? 127 ASP B CG  1 
ATOM   2087 O OD1 A ASP B 2 130 ? 12.956  -15.697 -11.680 0.50 24.10 ? 127 ASP B OD1 1 
ATOM   2088 O OD1 B ASP B 2 130 ? 16.626  -18.494 -10.813 0.50 21.65 ? 127 ASP B OD1 1 
ATOM   2089 O OD2 A ASP B 2 130 ? 14.071  -14.694 -10.083 0.50 23.32 ? 127 ASP B OD2 1 
ATOM   2090 O OD2 B ASP B 2 130 ? 16.904  -16.479 -9.994  0.50 22.78 ? 127 ASP B OD2 1 
ATOM   2091 N N   . ASN B 2 131 ? 11.504  -17.839 -11.177 1.00 19.61 ? 128 ASN B N   1 
ATOM   2092 C CA  . ASN B 2 131 ? 10.109  -17.879 -10.732 1.00 18.69 ? 128 ASN B CA  1 
ATOM   2093 C C   . ASN B 2 131 ? 9.253   -18.672 -11.719 1.00 18.27 ? 128 ASN B C   1 
ATOM   2094 O O   . ASN B 2 131 ? 9.045   -18.225 -12.846 1.00 17.62 ? 128 ASN B O   1 
ATOM   2095 C CB  . ASN B 2 131 ? 9.581   -16.444 -10.575 1.00 18.98 ? 128 ASN B CB  1 
ATOM   2096 C CG  . ASN B 2 131 ? 8.181   -16.372 -9.958  1.00 18.42 ? 128 ASN B CG  1 
ATOM   2097 O OD1 . ASN B 2 131 ? 7.487   -17.378 -9.818  1.00 17.55 ? 128 ASN B OD1 1 
ATOM   2098 N ND2 . ASN B 2 131 ? 7.762   -15.154 -9.597  1.00 17.51 ? 128 ASN B ND2 1 
ATOM   2099 N N   . PRO B 2 132 ? 8.748   -19.852 -11.307 1.00 17.97 ? 129 PRO B N   1 
ATOM   2100 C CA  . PRO B 2 132 ? 8.042   -20.690 -12.280 1.00 17.65 ? 129 PRO B CA  1 
ATOM   2101 C C   . PRO B 2 132 ? 6.738   -20.072 -12.792 1.00 17.07 ? 129 PRO B C   1 
ATOM   2102 O O   . PRO B 2 132 ? 6.254   -20.456 -13.864 1.00 17.22 ? 129 PRO B O   1 
ATOM   2103 C CB  . PRO B 2 132 ? 7.761   -21.980 -11.506 1.00 18.50 ? 129 PRO B CB  1 
ATOM   2104 C CG  . PRO B 2 132 ? 7.821   -21.599 -10.068 1.00 18.55 ? 129 PRO B CG  1 
ATOM   2105 C CD  . PRO B 2 132 ? 8.792   -20.467 -9.964  1.00 18.51 ? 129 PRO B CD  1 
ATOM   2106 N N   . ILE B 2 133 ? 6.182   -19.125 -12.036 1.00 15.78 ? 130 ILE B N   1 
ATOM   2107 C CA  . ILE B 2 133 ? 4.909   -18.497 -12.403 1.00 15.08 ? 130 ILE B CA  1 
ATOM   2108 C C   . ILE B 2 133 ? 4.972   -17.809 -13.776 1.00 14.89 ? 130 ILE B C   1 
ATOM   2109 O O   . ILE B 2 133 ? 3.984   -17.841 -14.515 1.00 14.77 ? 130 ILE B O   1 
ATOM   2110 C CB  . ILE B 2 133 ? 4.412   -17.518 -11.291 1.00 15.57 ? 130 ILE B CB  1 
ATOM   2111 C CG1 . ILE B 2 133 ? 4.257   -18.243 -9.951  1.00 15.72 ? 130 ILE B CG1 1 
ATOM   2112 C CG2 . ILE B 2 133 ? 3.101   -16.833 -11.663 1.00 15.31 ? 130 ILE B CG2 1 
ATOM   2113 C CD1 . ILE B 2 133 ? 3.343   -19.448 -9.964  1.00 19.42 ? 130 ILE B CD1 1 
ATOM   2114 N N   . HIS B 2 134 ? 6.114   -17.217 -14.133 1.00 14.00 ? 131 HIS B N   1 
ATOM   2115 C CA  . HIS B 2 134 ? 6.228   -16.536 -15.441 1.00 13.65 ? 131 HIS B CA  1 
ATOM   2116 C C   . HIS B 2 134 ? 5.851   -17.462 -16.596 1.00 13.64 ? 131 HIS B C   1 
ATOM   2117 O O   . HIS B 2 134 ? 4.980   -17.131 -17.400 1.00 13.23 ? 131 HIS B O   1 
ATOM   2118 C CB  . HIS B 2 134 ? 7.633   -15.984 -15.701 1.00 13.28 ? 131 HIS B CB  1 
ATOM   2119 C CG  . HIS B 2 134 ? 8.065   -14.902 -14.763 1.00 14.73 ? 131 HIS B CG  1 
ATOM   2120 N ND1 . HIS B 2 134 ? 7.459   -13.664 -14.711 1.00 14.75 ? 131 HIS B ND1 1 
ATOM   2121 C CD2 . HIS B 2 134 ? 9.089   -14.857 -13.881 1.00 14.97 ? 131 HIS B CD2 1 
ATOM   2122 C CE1 . HIS B 2 134 ? 8.085   -12.908 -13.826 1.00 15.90 ? 131 HIS B CE1 1 
ATOM   2123 N NE2 . HIS B 2 134 ? 9.072   -13.612 -13.300 1.00 16.38 ? 131 HIS B NE2 1 
ATOM   2124 N N   . GLU B 2 135 ? 6.491   -18.629 -16.670 1.00 13.78 ? 132 GLU B N   1 
ATOM   2125 C CA  . GLU B 2 135 ? 6.233   -19.527 -17.792 1.00 14.56 ? 132 GLU B CA  1 
ATOM   2126 C C   . GLU B 2 135 ? 4.774   -19.970 -17.804 1.00 14.86 ? 132 GLU B C   1 
ATOM   2127 O O   . GLU B 2 135 ? 4.164   -20.069 -18.860 1.00 15.90 ? 132 GLU B O   1 
ATOM   2128 C CB  . GLU B 2 135 ? 7.186   -20.731 -17.788 1.00 14.81 ? 132 GLU B CB  1 
ATOM   2129 C CG  . GLU B 2 135 ? 7.040   -21.626 -19.025 1.00 17.11 ? 132 GLU B CG  1 
ATOM   2130 C CD  . GLU B 2 135 ? 8.122   -22.679 -19.123 1.00 19.93 ? 132 GLU B CD  1 
ATOM   2131 O OE1 . GLU B 2 135 ? 8.695   -23.041 -18.075 1.00 21.26 ? 132 GLU B OE1 1 
ATOM   2132 O OE2 . GLU B 2 135 ? 8.395   -23.142 -20.249 1.00 21.31 ? 132 GLU B OE2 1 
ATOM   2133 N N   . SER B 2 136 ? 4.227   -20.223 -16.618 1.00 15.42 ? 133 SER B N   1 
ATOM   2134 C CA  . SER B 2 136 ? 2.867   -20.744 -16.501 1.00 16.08 ? 133 SER B CA  1 
ATOM   2135 C C   . SER B 2 136 ? 1.803   -19.683 -16.785 1.00 15.29 ? 133 SER B C   1 
ATOM   2136 O O   . SER B 2 136 ? 0.650   -20.012 -17.079 1.00 15.91 ? 133 SER B O   1 
ATOM   2137 C CB  . SER B 2 136 ? 2.668   -21.358 -15.118 1.00 16.40 ? 133 SER B CB  1 
ATOM   2138 O OG  . SER B 2 136 ? 3.625   -22.388 -14.903 1.00 20.13 ? 133 SER B OG  1 
ATOM   2139 N N   . MET B 2 137 ? 2.208   -18.418 -16.722 1.00 14.37 ? 134 MET B N   1 
ATOM   2140 C CA  . MET B 2 137 ? 1.291   -17.293 -16.949 1.00 13.70 ? 134 MET B CA  1 
ATOM   2141 C C   . MET B 2 137 ? 1.332   -16.723 -18.362 1.00 12.81 ? 134 MET B C   1 
ATOM   2142 O O   . MET B 2 137 ? 0.429   -15.980 -18.744 1.00 12.87 ? 134 MET B O   1 
ATOM   2143 C CB  . MET B 2 137 ? 1.573   -16.157 -15.963 1.00 14.68 ? 134 MET B CB  1 
ATOM   2144 C CG  . MET B 2 137 ? 0.911   -16.345 -14.619 1.00 17.96 ? 134 MET B CG  1 
ATOM   2145 S SD  . MET B 2 137 ? 0.908   -14.912 -13.522 1.00 23.53 ? 134 MET B SD  1 
ATOM   2146 C CE  . MET B 2 137 ? 1.117   -13.581 -14.719 1.00 21.88 ? 134 MET B CE  1 
ATOM   2147 N N   . TRP B 2 138 ? 2.366   -17.054 -19.130 1.00 11.37 ? 135 TRP B N   1 
ATOM   2148 C CA  . TRP B 2 138 ? 2.641   -16.332 -20.366 1.00 11.16 ? 135 TRP B CA  1 
ATOM   2149 C C   . TRP B 2 138 ? 1.523   -16.404 -21.397 1.00 11.07 ? 135 TRP B C   1 
ATOM   2150 O O   . TRP B 2 138 ? 1.098   -15.364 -21.916 1.00 10.80 ? 135 TRP B O   1 
ATOM   2151 C CB  . TRP B 2 138 ? 3.991   -16.746 -20.970 1.00 10.47 ? 135 TRP B CB  1 
ATOM   2152 C CG  . TRP B 2 138 ? 4.336   -16.053 -22.262 1.00 10.29 ? 135 TRP B CG  1 
ATOM   2153 C CD1 . TRP B 2 138 ? 4.590   -16.655 -23.465 1.00 9.76  ? 135 TRP B CD1 1 
ATOM   2154 C CD2 . TRP B 2 138 ? 4.450   -14.643 -22.490 1.00 9.82  ? 135 TRP B CD2 1 
ATOM   2155 N NE1 . TRP B 2 138 ? 4.858   -15.715 -24.423 1.00 9.39  ? 135 TRP B NE1 1 
ATOM   2156 C CE2 . TRP B 2 138 ? 4.774   -14.467 -23.853 1.00 8.39  ? 135 TRP B CE2 1 
ATOM   2157 C CE3 . TRP B 2 138 ? 4.309   -13.508 -21.677 1.00 10.06 ? 135 TRP B CE3 1 
ATOM   2158 C CZ2 . TRP B 2 138 ? 4.977   -13.205 -24.419 1.00 8.71  ? 135 TRP B CZ2 1 
ATOM   2159 C CZ3 . TRP B 2 138 ? 4.515   -12.252 -22.238 1.00 10.37 ? 135 TRP B CZ3 1 
ATOM   2160 C CH2 . TRP B 2 138 ? 4.844   -12.112 -23.600 1.00 9.66  ? 135 TRP B CH2 1 
ATOM   2161 N N   . GLU B 2 139 ? 1.064   -17.618 -21.714 1.00 12.29 ? 136 GLU B N   1 
ATOM   2162 C CA  . GLU B 2 139 ? -0.017  -17.761 -22.697 1.00 13.26 ? 136 GLU B CA  1 
ATOM   2163 C C   . GLU B 2 139 ? -1.254  -16.966 -22.279 1.00 12.89 ? 136 GLU B C   1 
ATOM   2164 O O   . GLU B 2 139 ? -1.886  -16.311 -23.120 1.00 12.99 ? 136 GLU B O   1 
ATOM   2165 C CB  . GLU B 2 139 ? -0.396  -19.226 -22.918 1.00 14.01 ? 136 GLU B CB  1 
ATOM   2166 C CG  . GLU B 2 139 ? 0.517   -19.987 -23.830 1.00 17.83 ? 136 GLU B CG  1 
ATOM   2167 C CD  . GLU B 2 139 ? -0.070  -21.336 -24.204 1.00 21.64 ? 136 GLU B CD  1 
ATOM   2168 O OE1 . GLU B 2 139 ? -0.875  -21.397 -25.154 1.00 25.62 ? 136 GLU B OE1 1 
ATOM   2169 O OE2 . GLU B 2 139 ? 0.267   -22.335 -23.543 1.00 25.55 ? 136 GLU B OE2 1 
ATOM   2170 N N   . LEU B 2 140 ? -1.577  -17.021 -20.985 1.00 12.86 ? 137 LEU B N   1 
ATOM   2171 C CA  . LEU B 2 140 ? -2.696  -16.249 -20.433 1.00 12.87 ? 137 LEU B CA  1 
ATOM   2172 C C   . LEU B 2 140 ? -2.471  -14.744 -20.566 1.00 12.11 ? 137 LEU B C   1 
ATOM   2173 O O   . LEU B 2 140 ? -3.395  -14.009 -20.922 1.00 11.78 ? 137 LEU B O   1 
ATOM   2174 C CB  . LEU B 2 140 ? -2.947  -16.624 -18.977 1.00 13.67 ? 137 LEU B CB  1 
ATOM   2175 C CG  . LEU B 2 140 ? -3.402  -18.070 -18.773 1.00 15.50 ? 137 LEU B CG  1 
ATOM   2176 C CD1 . LEU B 2 140 ? -3.165  -18.489 -17.339 1.00 18.07 ? 137 LEU B CD1 1 
ATOM   2177 C CD2 . LEU B 2 140 ? -4.864  -18.252 -19.150 1.00 18.01 ? 137 LEU B CD2 1 
ATOM   2178 N N   . GLU B 2 141 ? -1.255  -14.289 -20.275 1.00 11.82 ? 138 GLU B N   1 
ATOM   2179 C CA  . GLU B 2 141 ? -0.902  -12.869 -20.448 1.00 11.08 ? 138 GLU B CA  1 
ATOM   2180 C C   . GLU B 2 141 ? -1.103  -12.391 -21.880 1.00 10.45 ? 138 GLU B C   1 
ATOM   2181 O O   . GLU B 2 141 ? -1.584  -11.278 -22.115 1.00 9.81  ? 138 GLU B O   1 
ATOM   2182 C CB  . GLU B 2 141 ? 0.555   -12.615 -20.073 1.00 10.94 ? 138 GLU B CB  1 
ATOM   2183 C CG  . GLU B 2 141 ? 0.839   -12.458 -18.620 1.00 12.43 ? 138 GLU B CG  1 
ATOM   2184 C CD  . GLU B 2 141 ? 2.324   -12.295 -18.374 1.00 13.47 ? 138 GLU B CD  1 
ATOM   2185 O OE1 . GLU B 2 141 ? 2.942   -11.312 -18.866 1.00 14.37 ? 138 GLU B OE1 1 
ATOM   2186 O OE2 . GLU B 2 141 ? 2.864   -13.159 -17.668 1.00 16.56 ? 138 GLU B OE2 1 
ATOM   2187 N N   . VAL B 2 142 ? -0.710  -13.212 -22.853 1.00 9.87  ? 139 VAL B N   1 
ATOM   2188 C CA  . VAL B 2 142 ? -0.847  -12.812 -24.255 1.00 10.40 ? 139 VAL B CA  1 
ATOM   2189 C C   . VAL B 2 142 ? -2.338  -12.695 -24.606 1.00 10.01 ? 139 VAL B C   1 
ATOM   2190 O O   . VAL B 2 142 ? -2.762  -11.708 -25.213 1.00 9.57  ? 139 VAL B O   1 
ATOM   2191 C CB  . VAL B 2 142 ? -0.107  -13.787 -25.222 1.00 10.58 ? 139 VAL B CB  1 
ATOM   2192 C CG1 . VAL B 2 142 ? -0.345  -13.385 -26.669 1.00 11.45 ? 139 VAL B CG1 1 
ATOM   2193 C CG2 . VAL B 2 142 ? 1.405   -13.810 -24.926 1.00 11.13 ? 139 VAL B CG2 1 
ATOM   2194 N N   . GLU B 2 143 ? -3.132  -13.689 -24.206 1.00 10.29 ? 140 GLU B N   1 
ATOM   2195 C CA  . GLU B 2 143 ? -4.574  -13.642 -24.454 1.00 11.37 ? 140 GLU B CA  1 
ATOM   2196 C C   . GLU B 2 143 ? -5.229  -12.425 -23.803 1.00 11.06 ? 140 GLU B C   1 
ATOM   2197 O O   . GLU B 2 143 ? -6.019  -11.734 -24.443 1.00 10.89 ? 140 GLU B O   1 
ATOM   2198 C CB  . GLU B 2 143 ? -5.253  -14.925 -23.979 1.00 11.86 ? 140 GLU B CB  1 
ATOM   2199 C CG  . GLU B 2 143 ? -6.743  -14.979 -24.292 1.00 14.50 ? 140 GLU B CG  1 
ATOM   2200 C CD  . GLU B 2 143 ? -7.434  -16.207 -23.733 1.00 18.43 ? 140 GLU B CD  1 
ATOM   2201 O OE1 . GLU B 2 143 ? -6.756  -17.194 -23.370 1.00 19.92 ? 140 GLU B OE1 1 
ATOM   2202 O OE2 . GLU B 2 143 ? -8.682  -16.173 -23.656 1.00 20.44 ? 140 GLU B OE2 1 
ATOM   2203 N N   . ASP B 2 144 ? -4.881  -12.165 -22.546 1.00 10.07 ? 141 ASP B N   1 
ATOM   2204 C CA  . ASP B 2 144 ? -5.514  -11.082 -21.804 1.00 10.05 ? 141 ASP B CA  1 
ATOM   2205 C C   . ASP B 2 144 ? -5.172  -9.726  -22.404 1.00 10.55 ? 141 ASP B C   1 
ATOM   2206 O O   . ASP B 2 144 ? -6.037  -8.856  -22.539 1.00 10.82 ? 141 ASP B O   1 
ATOM   2207 C CB  . ASP B 2 144 ? -5.108  -11.156 -20.327 1.00 10.41 ? 141 ASP B CB  1 
ATOM   2208 C CG  . ASP B 2 144 ? -5.926  -10.236 -19.442 1.00 9.66  ? 141 ASP B CG  1 
ATOM   2209 O OD1 . ASP B 2 144 ? -7.063  -10.584 -19.047 1.00 11.42 ? 141 ASP B OD1 1 
ATOM   2210 O OD2 . ASP B 2 144 ? -5.407  -9.150  -19.128 1.00 10.09 ? 141 ASP B OD2 1 
ATOM   2211 N N   . LEU B 2 145 ? -3.914  -9.533  -22.772 1.00 9.98  ? 142 LEU B N   1 
ATOM   2212 C CA  . LEU B 2 145 ? -3.512  -8.270  -23.371 1.00 10.24 ? 142 LEU B CA  1 
ATOM   2213 C C   . LEU B 2 145 ? -4.274  -8.041  -24.678 1.00 10.62 ? 142 LEU B C   1 
ATOM   2214 O O   . LEU B 2 145 ? -4.796  -6.952  -24.919 1.00 10.60 ? 142 LEU B O   1 
ATOM   2215 C CB  . LEU B 2 145 ? -1.990  -8.209  -23.574 1.00 10.13 ? 142 LEU B CB  1 
ATOM   2216 C CG  . LEU B 2 145 ? -1.415  -6.899  -24.114 1.00 11.48 ? 142 LEU B CG  1 
ATOM   2217 C CD1 . LEU B 2 145 ? 0.011   -6.670  -23.606 1.00 12.39 ? 142 LEU B CD1 1 
ATOM   2218 C CD2 . LEU B 2 145 ? -1.416  -6.924  -25.620 1.00 14.34 ? 142 LEU B CD2 1 
ATOM   2219 N N   . HIS B 2 146 ? -4.359  -9.076  -25.508 1.00 11.33 ? 143 HIS B N   1 
ATOM   2220 C CA  . HIS B 2 146 ? -4.988  -8.913  -26.816 1.00 12.42 ? 143 HIS B CA  1 
ATOM   2221 C C   . HIS B 2 146 ? -6.487  -8.657  -26.727 1.00 12.72 ? 143 HIS B C   1 
ATOM   2222 O O   . HIS B 2 146 ? -7.045  -8.016  -27.619 1.00 13.52 ? 143 HIS B O   1 
ATOM   2223 C CB  . HIS B 2 146 ? -4.628  -10.058 -27.757 1.00 12.76 ? 143 HIS B CB  1 
ATOM   2224 C CG  . HIS B 2 146 ? -3.257  -9.923  -28.324 1.00 14.16 ? 143 HIS B CG  1 
ATOM   2225 N ND1 . HIS B 2 146 ? -3.008  -9.293  -29.523 1.00 16.51 ? 143 HIS B ND1 1 
ATOM   2226 C CD2 . HIS B 2 146 ? -2.046  -10.259 -27.815 1.00 12.77 ? 143 HIS B CD2 1 
ATOM   2227 C CE1 . HIS B 2 146 ? -1.706  -9.277  -29.748 1.00 15.54 ? 143 HIS B CE1 1 
ATOM   2228 N NE2 . HIS B 2 146 ? -1.100  -9.863  -28.729 1.00 13.76 ? 143 HIS B NE2 1 
ATOM   2229 N N   . ARG B 2 147 ? -7.118  -9.136  -25.652 1.00 12.57 ? 144 ARG B N   1 
ATOM   2230 C CA  . ARG B 2 147 ? -8.542  -8.862  -25.355 1.00 14.41 ? 144 ARG B CA  1 
ATOM   2231 C C   . ARG B 2 147 ? -8.807  -7.401  -25.012 1.00 14.76 ? 144 ARG B C   1 
ATOM   2232 O O   . ARG B 2 147 ? -9.969  -6.959  -24.991 1.00 15.85 ? 144 ARG B O   1 
ATOM   2233 C CB  . ARG B 2 147 ? -9.006  -9.669  -24.136 1.00 15.24 ? 144 ARG B CB  1 
ATOM   2234 C CG  . ARG B 2 147 ? -9.368  -11.119 -24.340 1.00 19.21 ? 144 ARG B CG  1 
ATOM   2235 C CD  . ARG B 2 147 ? -10.027 -11.655 -23.052 1.00 22.49 ? 144 ARG B CD  1 
ATOM   2236 N NE  . ARG B 2 147 ? -11.435 -11.268 -22.924 1.00 26.70 ? 144 ARG B NE  1 
ATOM   2237 C CZ  . ARG B 2 147 ? -12.097 -11.113 -21.776 1.00 27.72 ? 144 ARG B CZ  1 
ATOM   2238 N NH1 . ARG B 2 147 ? -11.494 -11.281 -20.605 1.00 28.52 ? 144 ARG B NH1 1 
ATOM   2239 N NH2 . ARG B 2 147 ? -13.377 -10.769 -21.799 1.00 29.58 ? 144 ARG B NH2 1 
ATOM   2240 N N   . ASN B 2 148 ? -7.748  -6.660  -24.712 1.00 14.46 ? 145 ASN B N   1 
ATOM   2241 C CA  . ASN B 2 148 ? -7.881  -5.283  -24.232 1.00 14.77 ? 145 ASN B CA  1 
ATOM   2242 C C   . ASN B 2 148 ? -7.273  -4.211  -25.142 1.00 15.57 ? 145 ASN B C   1 
ATOM   2243 O O   . ASN B 2 148 ? -7.021  -3.082  -24.707 1.00 15.44 ? 145 ASN B O   1 
ATOM   2244 C CB  . ASN B 2 148 ? -7.333  -5.170  -22.806 1.00 14.68 ? 145 ASN B CB  1 
ATOM   2245 C CG  . ASN B 2 148 ? -8.178  -5.924  -21.816 1.00 15.09 ? 145 ASN B CG  1 
ATOM   2246 O OD1 . ASN B 2 148 ? -7.822  -7.024  -21.385 1.00 15.82 ? 145 ASN B OD1 1 
ATOM   2247 N ND2 . ASN B 2 148 ? -9.340  -5.361  -21.480 1.00 15.32 ? 145 ASN B ND2 1 
ATOM   2248 N N   . ILE B 2 149 ? -7.043  -4.566  -26.401 1.00 16.99 ? 146 ILE B N   1 
ATOM   2249 C CA  . ILE B 2 149 ? -6.619  -3.601  -27.417 1.00 18.46 ? 146 ILE B CA  1 
ATOM   2250 C C   . ILE B 2 149 ? -7.784  -3.341  -28.377 1.00 19.61 ? 146 ILE B C   1 
ATOM   2251 O O   . ILE B 2 149 ? -8.311  -4.279  -28.976 1.00 19.55 ? 146 ILE B O   1 
ATOM   2252 C CB  . ILE B 2 149 ? -5.422  -4.124  -28.246 1.00 19.04 ? 146 ILE B CB  1 
ATOM   2253 C CG1 . ILE B 2 149 ? -4.313  -4.654  -27.335 1.00 19.43 ? 146 ILE B CG1 1 
ATOM   2254 C CG2 . ILE B 2 149 ? -4.898  -3.043  -29.206 1.00 19.20 ? 146 ILE B CG2 1 
ATOM   2255 C CD1 . ILE B 2 149 ? -3.151  -5.241  -28.097 1.00 21.59 ? 146 ILE B CD1 1 
ATOM   2256 N N   . PRO B 2 150 ? -8.182  -2.065  -28.540 1.00 20.76 ? 147 PRO B N   1 
ATOM   2257 C CA  . PRO B 2 150 ? -9.316  -1.727  -29.416 1.00 21.42 ? 147 PRO B CA  1 
ATOM   2258 C C   . PRO B 2 150 ? -9.086  -2.107  -30.881 1.00 21.67 ? 147 PRO B C   1 
ATOM   2259 O O   . PRO B 2 150 ? -10.041 -2.267  -31.654 1.00 22.46 ? 147 PRO B O   1 
ATOM   2260 C CB  . PRO B 2 150 ? -9.435  -0.207  -29.275 1.00 21.60 ? 147 PRO B CB  1 
ATOM   2261 C CG  . PRO B 2 150 ? -8.136  0.246   -28.732 1.00 21.95 ? 147 PRO B CG  1 
ATOM   2262 C CD  . PRO B 2 150 ? -7.602  -0.871  -27.901 1.00 21.07 ? 147 PRO B CD  1 
ATOM   2263 O OXT . PRO B 2 150 ? -7.953  -2.270  -31.337 1.00 21.89 ? 147 PRO B OXT 1 
HETATM 2264 C C1  . BEN C 3 .   ? -2.957  -19.712 -4.290  1.00 28.05 ? 1   BEN A C1  1 
HETATM 2265 C C2  . BEN C 3 .   ? -2.883  -18.924 -3.136  1.00 28.51 ? 1   BEN A C2  1 
HETATM 2266 C C3  . BEN C 3 .   ? -3.854  -17.954 -2.888  1.00 28.40 ? 1   BEN A C3  1 
HETATM 2267 C C4  . BEN C 3 .   ? -4.899  -17.765 -3.792  1.00 28.42 ? 1   BEN A C4  1 
HETATM 2268 C C5  . BEN C 3 .   ? -4.975  -18.543 -4.945  1.00 28.02 ? 1   BEN A C5  1 
HETATM 2269 C C6  . BEN C 3 .   ? -4.007  -19.518 -5.192  1.00 28.32 ? 1   BEN A C6  1 
HETATM 2270 C C   . BEN C 3 .   ? -1.980  -20.689 -4.539  1.00 28.04 ? 1   BEN A C   1 
HETATM 2271 N N1  . BEN C 3 .   ? -0.722  -20.483 -4.192  1.00 27.29 ? 1   BEN A N1  1 
HETATM 2272 N N2  . BEN C 3 .   ? -2.277  -21.840 -5.128  1.00 28.58 ? 1   BEN A N2  1 
HETATM 2273 O O   . HOH D 4 .   ? -1.174  -15.631 -2.391  1.00 29.56 ? 3   HOH A O   1 
HETATM 2274 O O   . HOH D 4 .   ? 3.241   -3.964  -6.773  1.00 12.23 ? 4   HOH A O   1 
HETATM 2275 O O   . HOH D 4 .   ? 7.799   -11.217 -10.950 1.00 13.94 ? 5   HOH A O   1 
HETATM 2276 O O   . HOH D 4 .   ? -5.126  -1.393  -8.029  1.00 21.68 ? 6   HOH A O   1 
HETATM 2277 O O   . HOH D 4 .   ? -4.726  -5.845  -8.383  1.00 18.46 ? 7   HOH A O   1 
HETATM 2278 O O   . HOH D 4 .   ? 0.091   -4.979  -16.990 1.00 14.95 ? 8   HOH A O   1 
HETATM 2279 O O   . HOH D 4 .   ? 22.631  12.545  3.455   1.00 22.84 ? 9   HOH A O   1 
HETATM 2280 O O   . HOH D 4 .   ? 13.642  -4.620  -16.536 1.00 11.52 ? 10  HOH A O   1 
HETATM 2281 O O   . HOH D 4 .   ? -0.822  -9.458  -20.187 1.00 10.71 ? 12  HOH A O   1 
HETATM 2282 O O   . HOH D 4 .   ? -4.107  -10.099 -6.974  1.00 16.65 ? 13  HOH A O   1 
HETATM 2283 O O   . HOH D 4 .   ? 25.930  0.911   6.785   1.00 41.76 ? 14  HOH A O   1 
HETATM 2284 O O   . HOH D 4 .   ? -9.513  -11.421 -11.776 1.00 27.81 ? 15  HOH A O   1 
HETATM 2285 O O   . HOH D 4 .   ? 5.363   10.097  -16.763 1.00 33.76 ? 16  HOH A O   1 
HETATM 2286 O O   . HOH D 4 .   ? 17.611  6.910   5.556   1.00 32.29 ? 18  HOH A O   1 
HETATM 2287 O O   . HOH D 4 .   ? 6.136   -3.902  -1.108  1.00 36.71 ? 19  HOH A O   1 
HETATM 2288 O O   . HOH D 4 .   ? -6.545  5.332   -8.076  1.00 15.31 ? 20  HOH A O   1 
HETATM 2289 O O   . HOH D 4 .   ? 27.987  -1.698  -16.761 1.00 13.76 ? 22  HOH A O   1 
HETATM 2290 O O   . HOH D 4 .   ? -12.129 -8.514  -13.569 1.00 27.28 ? 24  HOH A O   1 
HETATM 2291 O O   . HOH D 4 .   ? -5.391  3.134   -26.535 1.00 36.90 ? 25  HOH A O   1 
HETATM 2292 O O   . HOH D 4 .   ? 2.490   9.132   -20.486 1.00 35.35 ? 26  HOH A O   1 
HETATM 2293 O O   . HOH D 4 .   ? -9.424  7.663   -15.539 1.00 18.98 ? 27  HOH A O   1 
HETATM 2294 O O   . HOH D 4 .   ? 14.060  -0.190  2.112   1.00 29.04 ? 28  HOH A O   1 
HETATM 2295 O O   . HOH D 4 .   ? 19.068  -11.664 -17.416 1.00 14.46 ? 30  HOH A O   1 
HETATM 2296 O O   . HOH D 4 .   ? -9.852  3.161   -21.423 1.00 25.17 ? 31  HOH A O   1 
HETATM 2297 O O   . HOH D 4 .   ? 13.186  7.987   -8.414  1.00 19.26 ? 32  HOH A O   1 
HETATM 2298 O O   . HOH D 4 .   ? 4.429   -12.297 -4.593  1.00 17.60 ? 33  HOH A O   1 
HETATM 2299 O O   . HOH D 4 .   ? 10.051  -7.755  -7.317  1.00 38.75 ? 35  HOH A O   1 
HETATM 2300 O O   . HOH D 4 .   ? -0.767  -11.862 -3.856  1.00 25.48 ? 36  HOH A O   1 
HETATM 2301 O O   . HOH D 4 .   ? -8.874  7.996   -12.742 1.00 20.90 ? 37  HOH A O   1 
HETATM 2302 O O   . HOH D 4 .   ? 3.456   -18.812 -6.386  1.00 27.14 ? 42  HOH A O   1 
HETATM 2303 O O   . HOH D 4 .   ? 27.413  -7.241  -7.083  1.00 22.09 ? 44  HOH A O   1 
HETATM 2304 O O   . HOH D 4 .   ? 26.815  -5.325  -0.689  1.00 19.51 ? 45  HOH A O   1 
HETATM 2305 O O   . HOH D 4 .   ? 16.431  11.454  -10.332 1.00 21.28 ? 46  HOH A O   1 
HETATM 2306 O O   . HOH D 4 .   ? 36.415  0.527   -1.692  1.00 26.20 ? 47  HOH A O   1 
HETATM 2307 O O   . HOH D 4 .   ? -1.598  5.997   -4.224  1.00 28.72 ? 48  HOH A O   1 
HETATM 2308 O O   . HOH D 4 .   ? 20.174  -1.072  -14.838 1.00 18.60 ? 50  HOH A O   1 
HETATM 2309 O O   . HOH D 4 .   ? 0.215   2.949   -26.422 1.00 34.83 ? 51  HOH A O   1 
HETATM 2310 O O   . HOH D 4 .   ? 1.034   -2.133  -3.817  1.00 28.85 ? 52  HOH A O   1 
HETATM 2311 O O   . HOH D 4 .   ? 21.693  -8.977  -9.111  1.00 30.76 ? 53  HOH A O   1 
HETATM 2312 O O   . HOH D 4 .   ? 11.630  -9.182  -11.386 1.00 22.52 ? 54  HOH A O   1 
HETATM 2313 O O   . HOH D 4 .   ? 29.391  -7.301  -10.364 1.00 28.59 ? 55  HOH A O   1 
HETATM 2314 O O   . HOH D 4 .   ? 19.458  1.534   -19.537 1.00 26.41 ? 56  HOH A O   1 
HETATM 2315 O O   . HOH D 4 .   ? 12.685  8.109   1.625   1.00 26.36 ? 58  HOH A O   1 
HETATM 2316 O O   . HOH D 4 .   ? -1.287  -0.666  -27.199 1.00 27.64 ? 60  HOH A O   1 
HETATM 2317 O O   . HOH D 4 .   ? 15.914  4.638   2.421   1.00 25.41 ? 61  HOH A O   1 
HETATM 2318 O O   . HOH D 4 .   ? -5.829  0.858   -16.637 1.00 20.85 ? 62  HOH A O   1 
HETATM 2319 O O   . HOH D 4 .   ? 15.140  -8.243  -10.835 1.00 18.21 ? 63  HOH A O   1 
HETATM 2320 O O   . HOH D 4 .   ? 15.112  15.719  0.730   1.00 15.32 ? 64  HOH A O   1 
HETATM 2321 O O   . HOH D 4 .   ? 7.359   10.430  -14.672 1.00 26.57 ? 65  HOH A O   1 
HETATM 2322 O O   . HOH D 4 .   ? 17.881  -1.544  -22.586 1.00 48.17 ? 66  HOH A O   1 
HETATM 2323 O O   . HOH D 4 .   ? -9.484  10.820  -12.836 1.00 25.47 ? 67  HOH A O   1 
HETATM 2324 O O   . HOH D 4 .   ? 16.950  -7.308  -3.148  1.00 27.71 ? 68  HOH A O   1 
HETATM 2325 O O   . HOH D 4 .   ? -4.330  7.498   -6.739  1.00 21.36 ? 70  HOH A O   1 
HETATM 2326 O O   . HOH D 4 .   ? 6.509   -15.383 -6.279  1.00 22.30 ? 71  HOH A O   1 
HETATM 2327 O O   . HOH D 4 .   ? -0.514  8.264   -5.179  1.00 24.37 ? 72  HOH A O   1 
HETATM 2328 O O   . HOH D 4 .   ? 17.551  10.198  -12.587 1.00 23.76 ? 73  HOH A O   1 
HETATM 2329 O O   . HOH D 4 .   ? 23.171  -5.228  -1.304  1.00 28.00 ? 74  HOH A O   1 
HETATM 2330 O O   . HOH D 4 .   ? -1.609  -9.408  -4.930  1.00 29.87 ? 75  HOH A O   1 
HETATM 2331 O O   . HOH D 4 .   ? -11.928 8.724   -16.042 1.00 38.12 ? 76  HOH A O   1 
HETATM 2332 O O   . HOH D 4 .   ? -5.660  -0.671  -25.056 1.00 18.64 ? 78  HOH A O   1 
HETATM 2333 O O   . HOH D 4 .   ? 17.837  11.712  -5.346  1.00 10.97 ? 79  HOH A O   1 
HETATM 2334 O O   . HOH D 4 .   ? 25.073  -6.594  -2.553  1.00 25.21 ? 80  HOH A O   1 
HETATM 2335 O O   . HOH D 4 .   ? -12.800 10.392  -8.237  1.00 34.19 ? 81  HOH A O   1 
HETATM 2336 O O   . HOH D 4 .   ? -11.434 5.101   -22.234 1.00 30.72 ? 87  HOH A O   1 
HETATM 2337 O O   . HOH D 4 .   ? 6.157   -14.186 -3.853  1.00 22.96 ? 88  HOH A O   1 
HETATM 2338 O O   . HOH D 4 .   ? -1.508  20.375  -16.217 1.00 29.82 ? 89  HOH A O   1 
HETATM 2339 O O   . HOH D 4 .   ? 34.043  -5.374  1.876   1.00 23.27 ? 90  HOH A O   1 
HETATM 2340 O O   . HOH D 4 .   ? 7.187   -0.221  -1.572  1.00 32.94 ? 93  HOH A O   1 
HETATM 2341 O O   . HOH D 4 .   ? 10.170  7.843   -0.082  1.00 29.18 ? 94  HOH A O   1 
HETATM 2342 O O   . HOH D 4 .   ? 16.765  11.950  -14.622 1.00 33.28 ? 96  HOH A O   1 
HETATM 2343 O O   . HOH D 4 .   ? 32.628  8.554   5.276   1.00 17.36 ? 97  HOH A O   1 
HETATM 2344 O O   . HOH D 4 .   ? 26.058  -5.162  2.077   1.00 26.29 ? 98  HOH A O   1 
HETATM 2345 O O   . HOH D 4 .   ? 33.364  -7.761  -5.743  1.00 28.95 ? 99  HOH A O   1 
HETATM 2346 O O   . HOH D 4 .   ? 20.606  12.034  -15.127 1.00 25.77 ? 100 HOH A O   1 
HETATM 2347 O O   . HOH D 4 .   ? -8.948  8.421   -25.290 1.00 29.74 ? 102 HOH A O   1 
HETATM 2348 O O   . HOH D 4 .   ? 5.865   3.515   -1.395  1.00 26.28 ? 103 HOH A O   1 
HETATM 2349 O O   . HOH D 4 .   ? 26.067  12.068  -2.358  1.00 31.11 ? 105 HOH A O   1 
HETATM 2350 O O   . HOH D 4 .   ? -0.868  17.133  -8.354  1.00 22.26 ? 107 HOH A O   1 
HETATM 2351 O O   . HOH D 4 .   ? 32.796  -5.280  -6.998  1.00 23.07 ? 108 HOH A O   1 
HETATM 2352 O O   . HOH D 4 .   ? 20.158  -5.695  -1.284  1.00 25.24 ? 110 HOH A O   1 
HETATM 2353 O O   . HOH D 4 .   ? -1.116  4.479   -24.720 1.00 32.16 ? 112 HOH A O   1 
HETATM 2354 O O   . HOH D 4 .   ? 21.837  8.066   -17.528 1.00 34.92 ? 114 HOH A O   1 
HETATM 2355 O O   . HOH D 4 .   ? -4.643  7.235   -25.080 1.00 28.84 ? 117 HOH A O   1 
HETATM 2356 O O   . HOH D 4 .   ? 23.605  16.300  -3.190  1.00 36.60 ? 120 HOH A O   1 
HETATM 2357 O O   . HOH D 4 .   ? -3.933  -0.056  -27.261 1.00 29.23 ? 121 HOH A O   1 
HETATM 2358 O O   . HOH D 4 .   ? -13.470 -10.509 -17.613 1.00 27.79 ? 124 HOH A O   1 
HETATM 2359 O O   . HOH D 4 .   ? 12.307  9.636   -17.894 1.00 35.75 ? 125 HOH A O   1 
HETATM 2360 O O   . HOH D 4 .   ? -6.540  11.043  -6.727  1.00 32.54 ? 126 HOH A O   1 
HETATM 2361 O O   . HOH D 4 .   ? 24.053  -0.068  5.183   1.00 33.89 ? 127 HOH A O   1 
HETATM 2362 O O   . HOH D 4 .   ? 29.450  10.950  0.229   1.00 28.79 ? 128 HOH A O   1 
HETATM 2363 O O   . HOH D 4 .   ? -20.227 14.497  -9.086  1.00 33.37 ? 130 HOH A O   1 
HETATM 2364 O O   . HOH D 4 .   ? 13.091  8.444   -5.414  1.00 14.04 ? 136 HOH A O   1 
HETATM 2365 O O   . HOH D 4 .   ? -14.600 -16.770 -14.194 1.00 33.58 ? 137 HOH A O   1 
HETATM 2366 O O   . HOH D 4 .   ? -3.250  11.719  -18.912 1.00 28.74 ? 139 HOH A O   1 
HETATM 2367 O O   . HOH D 4 .   ? 22.138  -0.750  -16.933 1.00 25.28 ? 140 HOH A O   1 
HETATM 2368 O O   . HOH D 4 .   ? -9.468  1.558   -23.854 1.00 33.27 ? 141 HOH A O   1 
HETATM 2369 O O   . HOH D 4 .   ? -2.577  9.950   -4.139  1.00 24.56 ? 143 HOH A O   1 
HETATM 2370 O O   . HOH D 4 .   ? -20.535 5.500   -14.771 1.00 16.38 ? 145 HOH A O   1 
HETATM 2371 O O   . HOH D 4 .   ? 18.408  6.943   1.111   1.00 15.22 ? 146 HOH A O   1 
HETATM 2372 O O   . HOH D 4 .   ? 3.403   4.647   -25.298 1.00 21.45 ? 147 HOH A O   1 
HETATM 2373 O O   . HOH D 4 .   ? -5.580  12.892  -18.871 1.00 28.16 ? 149 HOH A O   1 
HETATM 2374 O O   . HOH D 4 .   ? -13.360 7.659   -18.315 1.00 44.39 ? 150 HOH A O   1 
HETATM 2375 O O   . HOH D 4 .   ? 17.249  8.337   3.198   1.00 27.72 ? 151 HOH A O   1 
HETATM 2376 O O   . HOH D 4 .   ? -3.901  10.250  -21.411 1.00 36.61 ? 154 HOH A O   1 
HETATM 2377 O O   . HOH D 4 .   ? -4.814  -4.619  -10.759 1.00 9.89  ? 155 HOH A O   1 
HETATM 2378 O O   . HOH D 4 .   ? 19.763  5.802   6.478   1.00 23.38 ? 156 HOH A O   1 
HETATM 2379 O O   . HOH D 4 .   ? 23.687  -1.775  -18.778 1.00 40.51 ? 160 HOH A O   1 
HETATM 2380 O O   . HOH D 4 .   ? -4.732  -1.840  -10.727 1.00 9.62  ? 162 HOH A O   1 
HETATM 2381 O O   . HOH D 4 .   ? 1.698   -6.360  -18.837 1.00 13.33 ? 163 HOH A O   1 
HETATM 2382 O O   . HOH D 4 .   ? 21.287  17.234  -2.233  1.00 22.91 ? 164 HOH A O   1 
HETATM 2383 O O   . HOH D 4 .   ? -2.669  -7.834  -7.965  1.00 14.97 ? 165 HOH A O   1 
HETATM 2384 O O   . HOH D 4 .   ? 22.993  14.279  1.407   1.00 32.30 ? 167 HOH A O   1 
HETATM 2385 O O   . HOH D 4 .   ? 23.227  13.552  -1.104  1.00 26.14 ? 168 HOH A O   1 
HETATM 2386 O O   . HOH D 4 .   ? 11.214  -3.503  -3.205  1.00 47.46 ? 169 HOH A O   1 
HETATM 2387 O O   . HOH D 4 .   ? -3.857  4.641   -24.852 1.00 19.24 ? 170 HOH A O   1 
HETATM 2388 O O   . HOH D 4 .   ? 5.980   8.877   -20.163 1.00 22.59 ? 171 HOH A O   1 
HETATM 2389 O O   . HOH D 4 .   ? 30.122  -7.693  -7.515  1.00 40.82 ? 173 HOH A O   1 
HETATM 2390 O O   . HOH D 4 .   ? 13.082  -11.052 -12.915 1.00 37.48 ? 175 HOH A O   1 
HETATM 2391 O O   . HOH D 4 .   ? 3.157   13.869  -8.396  1.00 23.42 ? 177 HOH A O   1 
HETATM 2392 O O   . HOH D 4 .   ? 31.576  3.054   7.746   1.00 37.65 ? 178 HOH A O   1 
HETATM 2393 O O   . HOH D 4 .   ? 9.306   -6.343  -3.329  1.00 37.89 ? 179 HOH A O   1 
HETATM 2394 O O   . HOH D 4 .   ? 25.858  9.999   6.631   1.00 30.20 ? 180 HOH A O   1 
HETATM 2395 O O   . HOH D 4 .   ? 23.837  -3.979  3.061   1.00 31.43 ? 181 HOH A O   1 
HETATM 2396 O O   . HOH D 4 .   ? 32.527  -7.066  0.357   1.00 35.64 ? 182 HOH A O   1 
HETATM 2397 O O   . HOH D 4 .   ? 29.945  8.128   -3.727  1.00 42.27 ? 186 HOH A O   1 
HETATM 2398 O O   . HOH D 4 .   ? 31.986  5.547   -6.655  1.00 33.44 ? 187 HOH A O   1 
HETATM 2399 O O   . HOH D 4 .   ? 7.378   -9.736  -3.916  1.00 19.30 ? 188 HOH A O   1 
HETATM 2400 O O   . HOH D 4 .   ? 8.223   -2.701  -2.985  1.00 16.87 ? 189 HOH A O   1 
HETATM 2401 O O   . HOH D 4 .   ? -5.425  13.978  -7.630  1.00 23.08 ? 190 HOH A O   1 
HETATM 2402 O O   . HOH D 4 .   ? -5.024  1.015   -6.657  1.00 39.85 ? 192 HOH A O   1 
HETATM 2403 O O   . HOH D 4 .   ? 2.034   6.318   -21.276 1.00 28.16 ? 193 HOH A O   1 
HETATM 2404 O O   . HOH D 4 .   ? 8.082   7.041   -24.206 1.00 36.01 ? 194 HOH A O   1 
HETATM 2405 O O   . HOH D 4 .   ? 17.650  14.633  -8.756  1.00 40.45 ? 195 HOH A O   1 
HETATM 2406 O O   . HOH D 4 .   ? -0.049  -17.385 -4.120  1.00 25.90 ? 196 HOH A O   1 
HETATM 2407 O O   . HOH D 4 .   ? 19.427  -9.978  -11.394 1.00 30.54 ? 198 HOH A O   1 
HETATM 2408 O O   . HOH D 4 .   ? -7.820  7.957   -8.222  1.00 31.42 ? 199 HOH A O   1 
HETATM 2409 O O   . HOH D 4 .   ? 28.596  -7.342  -0.641  1.00 32.81 ? 203 HOH A O   1 
HETATM 2410 O O   . HOH D 4 .   ? 11.122  -1.660  -0.660  1.00 42.37 ? 204 HOH A O   1 
HETATM 2411 O O   . HOH D 4 .   ? -3.858  15.336  -11.351 1.00 33.09 ? 206 HOH A O   1 
HETATM 2412 O O   . HOH D 4 .   ? 37.002  -0.974  -3.658  1.00 38.92 ? 208 HOH A O   1 
HETATM 2413 O O   . HOH D 4 .   ? -13.672 8.842   -13.991 1.00 28.33 ? 209 HOH A O   1 
HETATM 2414 O O   . HOH D 4 .   ? -10.508 -11.592 -7.228  1.00 41.99 ? 211 HOH A O   1 
HETATM 2415 O O   . HOH D 4 .   ? -6.758  -2.383  -18.130 1.00 13.29 ? 214 HOH A O   1 
HETATM 2416 O O   . HOH D 4 .   ? -8.551  -5.685  -17.286 1.00 28.40 ? 215 HOH A O   1 
HETATM 2417 O O   . HOH D 4 .   ? -7.354  -2.956  -7.179  1.00 34.70 ? 217 HOH A O   1 
HETATM 2418 O O   . HOH D 4 .   ? -7.175  1.452   -24.822 1.00 29.80 ? 218 HOH A O   1 
HETATM 2419 O O   . HOH D 4 .   ? -13.235 6.306   -20.573 1.00 35.47 ? 219 HOH A O   1 
HETATM 2420 O O   . HOH D 4 .   ? -5.810  3.414   -5.787  1.00 39.13 ? 220 HOH A O   1 
HETATM 2421 O O   . HOH D 4 .   ? 17.693  -1.304  -16.512 1.00 26.45 ? 221 HOH A O   1 
HETATM 2422 O O   . HOH D 4 .   ? 18.295  -1.805  -19.358 1.00 37.67 ? 222 HOH A O   1 
HETATM 2423 O O   . HOH D 4 .   ? 27.296  3.009   6.688   1.00 34.49 ? 223 HOH A O   1 
HETATM 2424 O O   . HOH D 4 .   ? 24.254  11.696  5.529   1.00 21.18 ? 224 HOH A O   1 
HETATM 2425 O O   . HOH D 4 .   ? 9.985   10.382  -14.460 1.00 41.98 ? 225 HOH A O   1 
HETATM 2426 O O   . HOH D 4 .   ? 3.793   10.902  -18.550 1.00 45.10 ? 226 HOH A O   1 
HETATM 2427 O O   . HOH D 4 .   ? 13.929  11.791  -10.853 1.00 35.11 ? 227 HOH A O   1 
HETATM 2428 O O   . HOH D 4 .   ? 12.725  -10.830 -7.903  1.00 39.73 ? 229 HOH A O   1 
HETATM 2429 O O   . HOH D 4 .   ? -15.482 6.991   -6.193  1.00 39.67 ? 231 HOH A O   1 
HETATM 2430 O O   . HOH D 4 .   ? 29.545  1.714   6.594   1.00 34.82 ? 236 HOH A O   1 
HETATM 2431 O O   . HOH D 4 .   ? -11.736 12.164  -18.416 1.00 36.10 ? 237 HOH A O   1 
HETATM 2432 O O   . HOH D 4 .   ? 18.986  -9.469  -6.255  1.00 37.24 ? 239 HOH A O   1 
HETATM 2433 O O   . HOH D 4 .   ? 11.785  12.876  -12.397 1.00 41.19 ? 240 HOH A O   1 
HETATM 2434 O O   . HOH D 4 .   ? 14.423  -7.258  -8.020  1.00 34.53 ? 243 HOH A O   1 
HETATM 2435 O O   . HOH D 4 .   ? 14.316  2.139   3.103   1.00 36.99 ? 245 HOH A O   1 
HETATM 2436 O O   . HOH D 4 .   ? -13.135 -8.096  -16.625 1.00 38.00 ? 246 HOH A O   1 
HETATM 2437 O O   . HOH D 4 .   ? 20.923  -1.306  -19.290 1.00 41.21 ? 247 HOH A O   1 
HETATM 2438 O O   . HOH D 4 .   ? 16.355  -2.427  -18.281 1.00 50.10 ? 249 HOH A O   1 
HETATM 2439 O O   . HOH D 4 .   ? 37.501  3.073   -1.181  1.00 25.60 ? 250 HOH A O   1 
HETATM 2440 O O   . HOH D 4 .   ? 2.361   10.690  -8.852  1.00 30.73 ? 626 HOH A O   1 
HETATM 2441 O O   . HOH E 4 .   ? 9.937   -21.676 -15.716 1.00 28.59 ? 148 HOH B O   1 
HETATM 2442 O O   . HOH E 4 .   ? 9.110   -19.206 -15.231 1.00 17.38 ? 149 HOH B O   1 
HETATM 2443 O O   . HOH E 4 .   ? 5.149   -14.440 -17.969 1.00 15.18 ? 150 HOH B O   1 
HETATM 2444 O O   . HOH E 4 .   ? 13.644  -7.349  -19.704 1.00 14.54 ? 151 HOH B O   1 
HETATM 2445 O O   . HOH E 4 .   ? -4.425  -15.032 -32.060 1.00 34.83 ? 152 HOH B O   1 
HETATM 2446 O O   . HOH E 4 .   ? 1.198   -9.469  -46.827 1.00 37.16 ? 153 HOH B O   1 
HETATM 2447 O O   . HOH E 4 .   ? 22.239  -11.190 -22.097 1.00 40.56 ? 154 HOH B O   1 
HETATM 2448 O O   . HOH E 4 .   ? -0.401  -19.445 -19.490 1.00 15.94 ? 155 HOH B O   1 
HETATM 2449 O O   . HOH E 4 .   ? 6.208   -15.500 -26.987 1.00 11.33 ? 156 HOH B O   1 
HETATM 2450 O O   . HOH E 4 .   ? 20.465  -10.376 -19.531 1.00 19.36 ? 157 HOH B O   1 
HETATM 2451 O O   . HOH E 4 .   ? 8.082   -25.787 -30.796 1.00 36.72 ? 158 HOH B O   1 
HETATM 2452 O O   . HOH E 4 .   ? 6.348   -25.447 -28.779 1.00 30.53 ? 159 HOH B O   1 
HETATM 2453 O O   . HOH E 4 .   ? 19.011  -7.488  -21.777 1.00 16.72 ? 160 HOH B O   1 
HETATM 2454 O O   . HOH E 4 .   ? 4.226   0.098   -35.697 1.00 33.48 ? 161 HOH B O   1 
HETATM 2455 O O   . HOH E 4 .   ? 2.456   -20.115 -20.980 1.00 27.10 ? 162 HOH B O   1 
HETATM 2456 O O   . HOH E 4 .   ? 7.265   -20.980 -35.043 1.00 20.08 ? 163 HOH B O   1 
HETATM 2457 O O   . HOH E 4 .   ? 13.755  -10.734 -16.587 1.00 18.74 ? 164 HOH B O   1 
HETATM 2458 O O   . HOH E 4 .   ? 9.791   -12.979 -9.820  1.00 29.61 ? 165 HOH B O   1 
HETATM 2459 O O   . HOH E 4 .   ? 5.602   -19.830 -22.051 1.00 20.29 ? 166 HOH B O   1 
HETATM 2460 O O   . HOH E 4 .   ? 20.736  -6.017  -30.857 1.00 23.83 ? 167 HOH B O   1 
HETATM 2461 O O   . HOH E 4 .   ? 9.704   -4.214  -37.369 1.00 30.73 ? 168 HOH B O   1 
HETATM 2462 O O   . HOH E 4 .   ? 2.874   -14.485 -41.487 1.00 32.69 ? 169 HOH B O   1 
HETATM 2463 O O   . HOH E 4 .   ? 25.908  -9.470  -15.230 1.00 26.82 ? 170 HOH B O   1 
HETATM 2464 O O   . HOH E 4 .   ? 24.366  -11.286 -19.225 1.00 25.52 ? 171 HOH B O   1 
HETATM 2465 O O   . HOH E 4 .   ? -4.148  -20.815 -22.312 1.00 34.83 ? 172 HOH B O   1 
HETATM 2466 O O   . HOH E 4 .   ? 24.479  -15.454 -20.998 1.00 30.77 ? 173 HOH B O   1 
HETATM 2467 O O   . HOH E 4 .   ? 24.988  -4.260  -19.286 1.00 25.93 ? 174 HOH B O   1 
HETATM 2468 O O   . HOH E 4 .   ? -9.236  -6.477  -28.216 1.00 25.01 ? 175 HOH B O   1 
HETATM 2469 O O   . HOH E 4 .   ? 11.256  -12.570 -12.013 1.00 35.86 ? 176 HOH B O   1 
HETATM 2470 O O   . HOH E 4 .   ? 11.773  -17.138 -41.141 1.00 27.43 ? 177 HOH B O   1 
HETATM 2471 O O   . HOH E 4 .   ? 5.611   -11.389 -18.463 1.00 14.33 ? 178 HOH B O   1 
HETATM 2472 O O   . HOH E 4 .   ? -2.725  -17.143 -25.605 1.00 20.86 ? 179 HOH B O   1 
HETATM 2473 O O   . HOH E 4 .   ? -15.109 -11.738 -19.691 1.00 32.79 ? 180 HOH B O   1 
HETATM 2474 O O   . HOH E 4 .   ? -4.358  -18.423 -23.290 1.00 31.72 ? 181 HOH B O   1 
HETATM 2475 O O   . HOH E 4 .   ? -7.319  -12.624 -26.782 1.00 22.13 ? 182 HOH B O   1 
HETATM 2476 O O   . HOH E 4 .   ? -4.980  -9.644  -31.459 1.00 29.60 ? 183 HOH B O   1 
HETATM 2477 O O   . HOH E 4 .   ? 18.753  -25.138 -17.849 1.00 36.69 ? 184 HOH B O   1 
HETATM 2478 O O   . HOH E 4 .   ? 14.576  -22.625 -16.772 1.00 32.50 ? 185 HOH B O   1 
HETATM 2479 O O   . HOH E 4 .   ? 23.206  -24.285 -28.179 1.00 35.06 ? 186 HOH B O   1 
HETATM 2480 O O   . HOH E 4 .   ? 2.106   -1.549  -40.189 1.00 28.02 ? 187 HOH B O   1 
HETATM 2481 O O   . HOH E 4 .   ? 8.135   -12.849 -42.890 1.00 27.07 ? 188 HOH B O   1 
HETATM 2482 O O   . HOH E 4 .   ? 1.512   -22.463 -21.544 1.00 32.33 ? 189 HOH B O   1 
HETATM 2483 O O   . HOH E 4 .   ? 7.551   -23.526 -24.487 1.00 36.17 ? 190 HOH B O   1 
HETATM 2484 O O   . HOH E 4 .   ? -9.279  -8.982  -19.625 1.00 23.44 ? 191 HOH B O   1 
HETATM 2485 O O   . HOH E 4 .   ? 0.284   -1.331  -42.406 1.00 24.83 ? 192 HOH B O   1 
HETATM 2486 O O   . HOH E 4 .   ? -5.542  -7.505  -29.969 1.00 27.84 ? 193 HOH B O   1 
HETATM 2487 O O   . HOH E 4 .   ? -10.191 -1.679  -24.192 1.00 33.53 ? 194 HOH B O   1 
HETATM 2488 O O   . HOH E 4 .   ? -10.810 -2.768  -21.775 1.00 28.35 ? 195 HOH B O   1 
HETATM 2489 O O   . HOH E 4 .   ? -6.887  -1.767  -35.960 1.00 28.28 ? 196 HOH B O   1 
HETATM 2490 O O   . HOH E 4 .   ? -0.191  -23.078 -27.886 1.00 38.24 ? 197 HOH B O   1 
HETATM 2491 O O   . HOH E 4 .   ? 17.904  -21.809 -14.527 1.00 33.13 ? 198 HOH B O   1 
HETATM 2492 O O   . HOH E 4 .   ? 6.784   -22.375 -22.240 1.00 24.21 ? 199 HOH B O   1 
HETATM 2493 O O   . HOH E 4 .   ? 8.587   -21.643 -37.315 1.00 23.20 ? 200 HOH B O   1 
HETATM 2494 O O   . HOH E 4 .   ? 11.916  -15.268 -43.501 1.00 37.26 ? 201 HOH B O   1 
HETATM 2495 O O   . HOH E 4 .   ? 0.005   -24.889 -24.286 1.00 37.88 ? 202 HOH B O   1 
HETATM 2496 O O   . HOH E 4 .   ? -2.337  -21.451 -20.284 1.00 35.06 ? 203 HOH B O   1 
HETATM 2497 O O   . HOH E 4 .   ? 6.818   -18.767 -45.248 1.00 33.56 ? 204 HOH B O   1 
HETATM 2498 O O   . HOH E 4 .   ? -2.390  0.042   -34.960 1.00 39.12 ? 205 HOH B O   1 
HETATM 2499 O O   . HOH E 4 .   ? 28.736  -7.749  -25.393 1.00 27.25 ? 206 HOH B O   1 
HETATM 2500 O O   . HOH E 4 .   ? 12.630  -22.330 -14.944 1.00 37.06 ? 207 HOH B O   1 
HETATM 2501 O O   . HOH E 4 .   ? 4.979   -13.138 -43.235 1.00 39.61 ? 208 HOH B O   1 
HETATM 2502 O O   . HOH E 4 .   ? 24.777  -8.725  -24.311 1.00 23.84 ? 209 HOH B O   1 
HETATM 2503 O O   . HOH E 4 .   ? 21.955  -2.239  -25.069 1.00 38.93 ? 210 HOH B O   1 
HETATM 2504 O O   . HOH E 4 .   ? -5.498  -0.702  -31.846 1.00 30.17 ? 211 HOH B O   1 
HETATM 2505 O O   . HOH E 4 .   ? -11.643 -7.727  -27.498 1.00 22.52 ? 212 HOH B O   1 
HETATM 2506 O O   . HOH E 4 .   ? -7.495  -7.316  -39.236 1.00 35.54 ? 213 HOH B O   1 
HETATM 2507 O O   . HOH E 4 .   ? 6.275   -17.973 -7.174  1.00 32.83 ? 214 HOH B O   1 
HETATM 2508 O O   . HOH E 4 .   ? -3.314  -13.157 -33.611 1.00 32.36 ? 215 HOH B O   1 
HETATM 2509 O O   . HOH E 4 .   ? -8.062  -4.402  -18.899 1.00 27.66 ? 216 HOH B O   1 
HETATM 2510 O O   . HOH E 4 .   ? 14.829  -15.532 -13.429 1.00 39.26 ? 217 HOH B O   1 
HETATM 2511 O O   . HOH E 4 .   ? -8.548  -11.089 -28.532 1.00 27.56 ? 218 HOH B O   1 
HETATM 2512 O O   . HOH E 4 .   ? -3.573  -15.349 -27.386 1.00 30.20 ? 228 HOH B O   1 
HETATM 2513 O O   . HOH E 4 .   ? 25.815  -4.437  -23.339 1.00 36.50 ? 230 HOH B O   1 
HETATM 2514 O O   . HOH E 4 .   ? -3.012  -16.545 -29.768 1.00 38.84 ? 232 HOH B O   1 
HETATM 2515 O O   . HOH E 4 .   ? 11.660  -9.726  -43.869 1.00 32.16 ? 233 HOH B O   1 
HETATM 2516 O O   . HOH E 4 .   ? 4.194   -3.929  -32.004 1.00 30.84 ? 234 HOH B O   1 
HETATM 2517 O O   . HOH E 4 .   ? 8.513   1.290   -33.811 1.00 41.57 ? 235 HOH B O   1 
HETATM 2518 O O   . HOH E 4 .   ? 5.620   -2.164  -31.791 1.00 38.96 ? 238 HOH B O   1 
HETATM 2519 O O   . HOH E 4 .   ? 22.079  -26.083 -21.027 1.00 37.10 ? 241 HOH B O   1 
HETATM 2520 O O   . HOH E 4 .   ? 14.191  -18.021 -37.746 1.00 48.18 ? 242 HOH B O   1 
HETATM 2521 O O   . HOH E 4 .   ? 21.490  -20.930 -32.074 1.00 32.58 ? 244 HOH B O   1 
HETATM 2522 O O   . HOH E 4 .   ? -7.215  -10.554 -30.930 1.00 38.21 ? 248 HOH B O   1 
HETATM 2523 O O   . HOH E 4 .   ? -5.098  -0.235  -34.305 1.00 30.21 ? 251 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   469 ?   ?   ?   A . n 
A 1 2   SER 2   470 ?   ?   ?   A . n 
A 1 3   HIS 3   471 ?   ?   ?   A . n 
A 1 4   MET 4   472 ?   ?   ?   A . n 
A 1 5   SER 5   473 ?   ?   ?   A . n 
A 1 6   SER 6   474 ?   ?   ?   A . n 
A 1 7   GLU 7   475 475 GLU GLU A . n 
A 1 8   ASN 8   476 476 ASN ASN A . n 
A 1 9   SER 9   477 477 SER SER A . n 
A 1 10  ILE 10  478 478 ILE ILE A . n 
A 1 11  ASN 11  479 479 ASN ASN A . n 
A 1 12  LEU 12  480 480 LEU LEU A . n 
A 1 13  SER 13  481 481 SER SER A . n 
A 1 14  ILE 14  482 482 ILE ILE A . n 
A 1 15  ALA 15  483 483 ALA ALA A . n 
A 1 16  MET 16  484 484 MET MET A . n 
A 1 17  ASP 17  485 485 ASP ASP A . n 
A 1 18  LEU 18  486 486 LEU LEU A . n 
A 1 19  TYR 19  487 487 TYR TYR A . n 
A 1 20  SER 20  488 488 SER SER A . n 
A 1 21  PRO 21  489 489 PRO PRO A . n 
A 1 22  PRO 22  490 490 PRO PRO A . n 
A 1 23  PHE 23  491 491 PHE PHE A . n 
A 1 24  VAL 24  492 492 VAL VAL A . n 
A 1 25  TYR 25  493 493 TYR TYR A . n 
A 1 26  LEU 26  494 494 LEU LEU A . n 
A 1 27  SER 27  495 495 SER SER A . n 
A 1 28  VAL 28  496 496 VAL VAL A . n 
A 1 29  LEU 29  497 497 LEU LEU A . n 
A 1 30  MET 30  498 498 MET MET A . n 
A 1 31  ALA 31  499 499 ALA ALA A . n 
A 1 32  SER 32  500 500 SER SER A . n 
A 1 33  LYS 33  501 501 LYS LYS A . n 
A 1 34  PRO 34  502 502 PRO PRO A . n 
A 1 35  LYS 35  503 503 LYS LYS A . n 
A 1 36  GLU 36  504 504 GLU GLU A . n 
A 1 37  VAL 37  505 505 VAL VAL A . n 
A 1 38  THR 38  506 506 THR THR A . n 
A 1 39  THR 39  507 507 THR THR A . n 
A 1 40  VAL 40  508 508 VAL VAL A . n 
A 1 41  LYS 41  509 509 LYS LYS A . n 
A 1 42  VAL 42  510 510 VAL VAL A . n 
A 1 43  LYS 43  511 511 LYS LYS A . n 
A 1 44  ALA 44  512 512 ALA ALA A . n 
A 1 45  PHE 45  513 513 PHE PHE A . n 
A 1 46  ILE 46  514 514 ILE ILE A . n 
A 1 47  VAL 47  515 515 VAL VAL A . n 
A 1 48  THR 48  516 516 THR THR A . n 
A 1 49  LEU 49  517 517 LEU LEU A . n 
A 1 50  THR 50  518 518 THR THR A . n 
A 1 51  GLY 51  519 519 GLY GLY A . n 
A 1 52  ASN 52  520 520 ASN ASN A . n 
A 1 53  LEU 53  521 521 LEU LEU A . n 
A 1 54  SER 54  522 522 SER SER A . n 
A 1 55  SER 55  523 523 SER SER A . n 
A 1 56  SER 56  524 524 SER SER A . n 
A 1 57  GLY 57  525 525 GLY GLY A . n 
A 1 58  GLY 58  526 526 GLY GLY A . n 
A 1 59  ILE 59  527 527 ILE ILE A . n 
A 1 60  TRP 60  528 528 TRP TRP A . n 
A 1 61  SER 61  529 529 SER SER A . n 
A 1 62  ILE 62  530 530 ILE ILE A . n 
A 1 63  THR 63  531 531 THR THR A . n 
A 1 64  ALA 64  532 532 ALA ALA A . n 
A 1 65  LYS 65  533 533 LYS LYS A . n 
A 1 66  VAL 66  534 534 VAL VAL A . n 
A 1 67  SER 67  535 535 SER SER A . n 
A 1 68  ASP 68  536 536 ASP ASP A . n 
A 1 69  GLY 69  537 537 GLY GLY A . n 
A 1 70  THR 70  538 538 THR THR A . n 
A 1 71  ALA 71  539 539 ALA ALA A . n 
A 1 72  TYR 72  540 540 TYR TYR A . n 
A 1 73  LEU 73  541 541 LEU LEU A . n 
A 1 74  ASP 74  542 542 ASP ASP A . n 
A 1 75  VAL 75  543 543 VAL VAL A . n 
A 1 76  ASP 76  544 544 ASP ASP A . n 
A 1 77  PHE 77  545 545 PHE PHE A . n 
A 1 78  VAL 78  546 546 VAL VAL A . n 
A 1 79  ASP 79  547 547 ASP ASP A . n 
A 1 80  GLU 80  548 548 GLU GLU A . n 
A 1 81  ILE 81  549 549 ILE ILE A . n 
A 1 82  LEU 82  550 550 LEU LEU A . n 
A 1 83  THR 83  551 551 THR THR A . n 
A 1 84  SER 84  552 552 SER SER A . n 
A 1 85  LEU 85  553 553 LEU LEU A . n 
A 1 86  ILE 86  554 554 ILE ILE A . n 
A 1 87  GLY 87  555 555 GLY GLY A . n 
A 1 88  PHE 88  556 556 PHE PHE A . n 
A 1 89  SER 89  557 557 SER SER A . n 
A 1 90  VAL 90  558 558 VAL VAL A . n 
A 1 91  PRO 91  559 559 PRO PRO A . n 
A 1 92  GLU 92  560 560 GLU GLU A . n 
A 1 93  MET 93  561 561 MET MET A . n 
A 1 94  LYS 94  562 562 LYS LYS A . n 
A 1 95  GLN 95  563 563 GLN GLN A . n 
A 1 96  SER 96  564 564 SER SER A . n 
A 1 97  LYS 97  565 565 LYS LYS A . n 
A 1 98  LYS 98  566 566 LYS LYS A . n 
A 1 99  ASP 99  567 567 ASP ASP A . n 
A 1 100 PRO 100 568 568 PRO PRO A . n 
A 1 101 LEU 101 569 569 LEU LEU A . n 
A 1 102 GLN 102 570 570 GLN GLN A . n 
A 1 103 TYR 103 571 571 TYR TYR A . n 
A 1 104 GLN 104 572 572 GLN GLN A . n 
A 1 105 LYS 105 573 573 LYS LYS A . n 
A 1 106 PHE 106 574 574 PHE PHE A . n 
A 1 107 LEU 107 575 575 LEU LEU A . n 
A 1 108 GLU 108 576 576 GLU GLU A . n 
A 1 109 GLY 109 577 577 GLY GLY A . n 
A 1 110 LEU 110 578 578 LEU LEU A . n 
A 1 111 GLN 111 579 579 GLN GLN A . n 
A 1 112 LYS 112 580 580 LYS LYS A . n 
A 1 113 CYS 113 581 581 CYS CYS A . n 
A 1 114 GLN 114 582 582 GLN GLN A . n 
A 1 115 ARG 115 583 583 ARG ARG A . n 
A 1 116 ASP 116 584 584 ASP ASP A . n 
A 1 117 LEU 117 585 585 LEU LEU A . n 
A 1 118 ILE 118 586 586 ILE ILE A . n 
A 1 119 ASP 119 587 587 ASP ASP A . n 
A 1 120 LEU 120 588 588 LEU LEU A . n 
A 1 121 CYS 121 589 589 CYS CYS A . n 
A 1 122 CYS 122 590 590 CYS CYS A . n 
A 1 123 LEU 123 591 591 LEU LEU A . n 
A 1 124 MET 124 592 592 MET MET A . n 
A 1 125 THR 125 593 593 THR THR A . n 
A 1 126 ILE 126 594 594 ILE ILE A . n 
A 1 127 SER 127 595 595 SER SER A . n 
A 1 128 PHE 128 596 596 PHE PHE A . n 
A 1 129 ASN 129 597 597 ASN ASN A . n 
A 1 130 PRO 130 598 598 PRO PRO A . n 
A 1 131 SER 131 599 599 SER SER A . n 
A 1 132 LEU 132 600 600 LEU LEU A . n 
A 1 133 SER 133 601 601 SER SER A . n 
A 1 134 LYS 134 602 602 LYS LYS A . n 
A 1 135 ALA 135 603 603 ALA ALA A . n 
A 1 136 MET 136 604 604 MET MET A . n 
A 1 137 VAL 137 605 605 VAL VAL A . n 
A 1 138 LEU 138 606 606 LEU LEU A . n 
A 1 139 ALA 139 607 607 ALA ALA A . n 
A 1 140 LEU 140 608 608 LEU LEU A . n 
A 1 141 GLN 141 609 609 GLN GLN A . n 
A 1 142 ASP 142 610 610 ASP ASP A . n 
A 1 143 VAL 143 611 611 VAL VAL A . n 
A 1 144 ASN 144 612 612 ASN ASN A . n 
A 1 145 MET 145 613 613 MET MET A . n 
A 1 146 GLU 146 614 614 GLU GLU A . n 
A 1 147 HIS 147 615 615 HIS HIS A . n 
A 1 148 LEU 148 616 616 LEU LEU A . n 
A 1 149 GLU 149 617 617 GLU GLU A . n 
A 1 150 ASN 150 618 618 ASN ASN A . n 
A 1 151 LEU 151 619 619 LEU LEU A . n 
A 1 152 LYS 152 620 620 LYS LYS A . n 
A 1 153 LYS 153 621 621 LYS LYS A . n 
A 1 154 ARG 154 622 622 ARG ARG A . n 
A 1 155 LEU 155 623 623 LEU LEU A . n 
A 1 156 ASN 156 624 624 ASN ASN A . n 
A 1 157 LYS 157 625 625 LYS LYS A . n 
B 2 1   GLY 1   -2  ?   ?   ?   B . n 
B 2 2   SER 2   -1  ?   ?   ?   B . n 
B 2 3   HIS 3   0   ?   ?   ?   B . n 
B 2 4   MET 4   1   ?   ?   ?   B . n 
B 2 5   ALA 5   2   ?   ?   ?   B . n 
B 2 6   ALA 6   3   ?   ?   ?   B . n 
B 2 7   ALA 7   4   ?   ?   ?   B . n 
B 2 8   ALA 8   5   ?   ?   ?   B . n 
B 2 9   ASP 9   6   ?   ?   ?   B . n 
B 2 10  SER 10  7   ?   ?   ?   B . n 
B 2 11  PHE 11  8   ?   ?   ?   B . n 
B 2 12  SER 12  9   ?   ?   ?   B . n 
B 2 13  GLY 13  10  ?   ?   ?   B . n 
B 2 14  GLY 14  11  ?   ?   ?   B . n 
B 2 15  PRO 15  12  ?   ?   ?   B . n 
B 2 16  ALA 16  13  ?   ?   ?   B . n 
B 2 17  GLY 17  14  ?   ?   ?   B . n 
B 2 18  VAL 18  15  ?   ?   ?   B . n 
B 2 19  ARG 19  16  ?   ?   ?   B . n 
B 2 20  LEU 20  17  17  LEU LEU B . n 
B 2 21  PRO 21  18  18  PRO PRO B . n 
B 2 22  ARG 22  19  19  ARG ARG B . n 
B 2 23  SER 23  20  20  SER SER B . n 
B 2 24  PRO 24  21  21  PRO PRO B . n 
B 2 25  PRO 25  22  22  PRO PRO B . n 
B 2 26  LEU 26  23  23  LEU LEU B . n 
B 2 27  LYS 27  24  24  LYS LYS B . n 
B 2 28  VAL 28  25  25  VAL VAL B . n 
B 2 29  LEU 29  26  26  LEU LEU B . n 
B 2 30  ALA 30  27  27  ALA ALA B . n 
B 2 31  GLU 31  28  28  GLU GLU B . n 
B 2 32  GLN 32  29  29  GLN GLN B . n 
B 2 33  LEU 33  30  30  LEU LEU B . n 
B 2 34  ARG 34  31  31  ARG ARG B . n 
B 2 35  ARG 35  32  32  ARG ARG B . n 
B 2 36  ASP 36  33  33  ASP ASP B . n 
B 2 37  ALA 37  34  34  ALA ALA B . n 
B 2 38  GLU 38  35  35  GLU GLU B . n 
B 2 39  GLY 39  36  36  GLY GLY B . n 
B 2 40  GLY 40  37  37  GLY GLY B . n 
B 2 41  PRO 41  38  38  PRO PRO B . n 
B 2 42  GLY 42  39  39  GLY GLY B . n 
B 2 43  ALA 43  40  40  ALA ALA B . n 
B 2 44  TRP 44  41  41  TRP TRP B . n 
B 2 45  ARG 45  42  42  ARG ARG B . n 
B 2 46  LEU 46  43  43  LEU LEU B . n 
B 2 47  SER 47  44  44  SER SER B . n 
B 2 48  ARG 48  45  45  ARG ARG B . n 
B 2 49  ALA 49  46  46  ALA ALA B . n 
B 2 50  ALA 50  47  47  ALA ALA B . n 
B 2 51  ALA 51  48  48  ALA ALA B . n 
B 2 52  GLY 52  49  49  GLY GLY B . n 
B 2 53  ARG 53  50  50  ARG ARG B . n 
B 2 54  GLY 54  51  51  GLY GLY B . n 
B 2 55  PRO 55  52  52  PRO PRO B . n 
B 2 56  LEU 56  53  53  LEU LEU B . n 
B 2 57  ASP 57  54  54  ASP ASP B . n 
B 2 58  LEU 58  55  55  LEU LEU B . n 
B 2 59  ALA 59  56  56  ALA ALA B . n 
B 2 60  ALA 60  57  57  ALA ALA B . n 
B 2 61  VAL 61  58  58  VAL VAL B . n 
B 2 62  TRP 62  59  59  TRP TRP B . n 
B 2 63  MET 63  60  60  MET MET B . n 
B 2 64  GLN 64  61  61  GLN GLN B . n 
B 2 65  GLY 65  62  62  GLY GLY B . n 
B 2 66  ARG 66  63  63  ARG ARG B . n 
B 2 67  VAL 67  64  64  VAL VAL B . n 
B 2 68  VAL 68  65  65  VAL VAL B . n 
B 2 69  MET 69  66  66  MET MET B . n 
B 2 70  ALA 70  67  67  ALA ALA B . n 
B 2 71  ASP 71  68  68  ASP ASP B . n 
B 2 72  ARG 72  69  69  ARG ARG B . n 
B 2 73  GLY 73  70  70  GLY GLY B . n 
B 2 74  GLU 74  71  71  GLU GLU B . n 
B 2 75  ALA 75  72  72  ALA ALA B . n 
B 2 76  ARG 76  73  73  ARG ARG B . n 
B 2 77  LEU 77  74  74  LEU LEU B . n 
B 2 78  ARG 78  75  75  ARG ARG B . n 
B 2 79  ASP 79  76  76  ASP ASP B . n 
B 2 80  PRO 80  77  77  PRO PRO B . n 
B 2 81  SER 81  78  78  SER SER B . n 
B 2 82  GLY 82  79  79  GLY GLY B . n 
B 2 83  ASP 83  80  80  ASP ASP B . n 
B 2 84  PHE 84  81  81  PHE PHE B . n 
B 2 85  SER 85  82  82  SER SER B . n 
B 2 86  VAL 86  83  83  VAL VAL B . n 
B 2 87  ARG 87  84  84  ARG ARG B . n 
B 2 88  GLY 88  85  85  GLY GLY B . n 
B 2 89  LEU 89  86  86  LEU LEU B . n 
B 2 90  GLU 90  87  87  GLU GLU B . n 
B 2 91  ARG 91  88  88  ARG ARG B . n 
B 2 92  VAL 92  89  89  VAL VAL B . n 
B 2 93  PRO 93  90  90  PRO PRO B . n 
B 2 94  ARG 94  91  91  ARG ARG B . n 
B 2 95  GLY 95  92  92  GLY GLY B . n 
B 2 96  ARG 96  93  93  ARG ARG B . n 
B 2 97  PRO 97  94  94  PRO PRO B . n 
B 2 98  CYS 98  95  95  CYS CYS B . n 
B 2 99  LEU 99  96  96  LEU LEU B . n 
B 2 100 VAL 100 97  97  VAL VAL B . n 
B 2 101 PRO 101 98  98  PRO PRO B . n 
B 2 102 GLY 102 99  99  GLY GLY B . n 
B 2 103 LYS 103 100 100 LYS LYS B . n 
B 2 104 TYR 104 101 101 TYR TYR B . n 
B 2 105 VAL 105 102 102 VAL VAL B . n 
B 2 106 MET 106 103 103 MET MET B . n 
B 2 107 VAL 107 104 104 VAL VAL B . n 
B 2 108 MET 108 105 105 MET MET B . n 
B 2 109 GLY 109 106 106 GLY GLY B . n 
B 2 110 VAL 110 107 107 VAL VAL B . n 
B 2 111 VAL 111 108 108 VAL VAL B . n 
B 2 112 GLN 112 109 109 GLN GLN B . n 
B 2 113 ALA 113 110 110 ALA ALA B . n 
B 2 114 CYS 114 111 111 CYS CYS B . n 
B 2 115 SER 115 112 112 SER SER B . n 
B 2 116 PRO 116 113 113 PRO PRO B . n 
B 2 117 GLU 117 114 114 GLU GLU B . n 
B 2 118 PRO 118 115 115 PRO PRO B . n 
B 2 119 CYS 119 116 116 CYS CYS B . n 
B 2 120 LEU 120 117 117 LEU LEU B . n 
B 2 121 GLN 121 118 118 GLN GLN B . n 
B 2 122 ALA 122 119 119 ALA ALA B . n 
B 2 123 VAL 123 120 120 VAL VAL B . n 
B 2 124 LYS 124 121 121 LYS LYS B . n 
B 2 125 MET 125 122 122 MET MET B . n 
B 2 126 THR 126 123 123 THR THR B . n 
B 2 127 ASP 127 124 124 ASP ASP B . n 
B 2 128 LEU 128 125 125 LEU LEU B . n 
B 2 129 SER 129 126 126 SER SER B . n 
B 2 130 ASP 130 127 127 ASP ASP B . n 
B 2 131 ASN 131 128 128 ASN ASN B . n 
B 2 132 PRO 132 129 129 PRO PRO B . n 
B 2 133 ILE 133 130 130 ILE ILE B . n 
B 2 134 HIS 134 131 131 HIS HIS B . n 
B 2 135 GLU 135 132 132 GLU GLU B . n 
B 2 136 SER 136 133 133 SER SER B . n 
B 2 137 MET 137 134 134 MET MET B . n 
B 2 138 TRP 138 135 135 TRP TRP B . n 
B 2 139 GLU 139 136 136 GLU GLU B . n 
B 2 140 LEU 140 137 137 LEU LEU B . n 
B 2 141 GLU 141 138 138 GLU GLU B . n 
B 2 142 VAL 142 139 139 VAL VAL B . n 
B 2 143 GLU 143 140 140 GLU GLU B . n 
B 2 144 ASP 144 141 141 ASP ASP B . n 
B 2 145 LEU 145 142 142 LEU LEU B . n 
B 2 146 HIS 146 143 143 HIS HIS B . n 
B 2 147 ARG 147 144 144 ARG ARG B . n 
B 2 148 ASN 148 145 145 ASN ASN B . n 
B 2 149 ILE 149 146 146 ILE ILE B . n 
B 2 150 PRO 150 147 147 PRO PRO B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 BEN 1   1   1   BEN BEN A . 
D 4 HOH 1   3   3   HOH HOH A . 
D 4 HOH 2   4   4   HOH HOH A . 
D 4 HOH 3   5   5   HOH HOH A . 
D 4 HOH 4   6   6   HOH HOH A . 
D 4 HOH 5   7   7   HOH HOH A . 
D 4 HOH 6   8   8   HOH HOH A . 
D 4 HOH 7   9   9   HOH HOH A . 
D 4 HOH 8   10  10  HOH HOH A . 
D 4 HOH 9   12  12  HOH HOH A . 
D 4 HOH 10  13  13  HOH HOH A . 
D 4 HOH 11  14  14  HOH HOH A . 
D 4 HOH 12  15  15  HOH HOH A . 
D 4 HOH 13  16  16  HOH HOH A . 
D 4 HOH 14  18  18  HOH HOH A . 
D 4 HOH 15  19  19  HOH HOH A . 
D 4 HOH 16  20  20  HOH HOH A . 
D 4 HOH 17  22  22  HOH HOH A . 
D 4 HOH 18  24  24  HOH HOH A . 
D 4 HOH 19  25  25  HOH HOH A . 
D 4 HOH 20  26  26  HOH HOH A . 
D 4 HOH 21  27  27  HOH HOH A . 
D 4 HOH 22  28  28  HOH HOH A . 
D 4 HOH 23  30  30  HOH HOH A . 
D 4 HOH 24  31  31  HOH HOH A . 
D 4 HOH 25  32  32  HOH HOH A . 
D 4 HOH 26  33  33  HOH HOH A . 
D 4 HOH 27  35  35  HOH HOH A . 
D 4 HOH 28  36  36  HOH HOH A . 
D 4 HOH 29  37  37  HOH HOH A . 
D 4 HOH 30  42  42  HOH HOH A . 
D 4 HOH 31  44  44  HOH HOH A . 
D 4 HOH 32  45  45  HOH HOH A . 
D 4 HOH 33  46  46  HOH HOH A . 
D 4 HOH 34  47  47  HOH HOH A . 
D 4 HOH 35  48  48  HOH HOH A . 
D 4 HOH 36  50  50  HOH HOH A . 
D 4 HOH 37  51  51  HOH HOH A . 
D 4 HOH 38  52  52  HOH HOH A . 
D 4 HOH 39  53  53  HOH HOH A . 
D 4 HOH 40  54  54  HOH HOH A . 
D 4 HOH 41  55  55  HOH HOH A . 
D 4 HOH 42  56  56  HOH HOH A . 
D 4 HOH 43  58  58  HOH HOH A . 
D 4 HOH 44  60  60  HOH HOH A . 
D 4 HOH 45  61  61  HOH HOH A . 
D 4 HOH 46  62  62  HOH HOH A . 
D 4 HOH 47  63  63  HOH HOH A . 
D 4 HOH 48  64  64  HOH HOH A . 
D 4 HOH 49  65  65  HOH HOH A . 
D 4 HOH 50  66  66  HOH HOH A . 
D 4 HOH 51  67  67  HOH HOH A . 
D 4 HOH 52  68  68  HOH HOH A . 
D 4 HOH 53  70  70  HOH HOH A . 
D 4 HOH 54  71  71  HOH HOH A . 
D 4 HOH 55  72  72  HOH HOH A . 
D 4 HOH 56  73  73  HOH HOH A . 
D 4 HOH 57  74  74  HOH HOH A . 
D 4 HOH 58  75  75  HOH HOH A . 
D 4 HOH 59  76  76  HOH HOH A . 
D 4 HOH 60  78  78  HOH HOH A . 
D 4 HOH 61  79  79  HOH HOH A . 
D 4 HOH 62  80  80  HOH HOH A . 
D 4 HOH 63  81  81  HOH HOH A . 
D 4 HOH 64  87  87  HOH HOH A . 
D 4 HOH 65  88  88  HOH HOH A . 
D 4 HOH 66  89  89  HOH HOH A . 
D 4 HOH 67  90  90  HOH HOH A . 
D 4 HOH 68  93  93  HOH HOH A . 
D 4 HOH 69  94  94  HOH HOH A . 
D 4 HOH 70  96  96  HOH HOH A . 
D 4 HOH 71  97  97  HOH HOH A . 
D 4 HOH 72  98  98  HOH HOH A . 
D 4 HOH 73  99  99  HOH HOH A . 
D 4 HOH 74  100 100 HOH HOH A . 
D 4 HOH 75  102 102 HOH HOH A . 
D 4 HOH 76  103 103 HOH HOH A . 
D 4 HOH 77  105 105 HOH HOH A . 
D 4 HOH 78  107 107 HOH HOH A . 
D 4 HOH 79  108 108 HOH HOH A . 
D 4 HOH 80  110 110 HOH HOH A . 
D 4 HOH 81  112 112 HOH HOH A . 
D 4 HOH 82  114 114 HOH HOH A . 
D 4 HOH 83  117 117 HOH HOH A . 
D 4 HOH 84  120 120 HOH HOH A . 
D 4 HOH 85  121 121 HOH HOH A . 
D 4 HOH 86  124 124 HOH HOH A . 
D 4 HOH 87  125 125 HOH HOH A . 
D 4 HOH 88  126 126 HOH HOH A . 
D 4 HOH 89  127 127 HOH HOH A . 
D 4 HOH 90  128 128 HOH HOH A . 
D 4 HOH 91  130 130 HOH HOH A . 
D 4 HOH 92  136 136 HOH HOH A . 
D 4 HOH 93  137 137 HOH HOH A . 
D 4 HOH 94  139 139 HOH HOH A . 
D 4 HOH 95  140 140 HOH HOH A . 
D 4 HOH 96  141 141 HOH HOH A . 
D 4 HOH 97  143 143 HOH HOH A . 
D 4 HOH 98  145 145 HOH HOH A . 
D 4 HOH 99  146 146 HOH HOH A . 
D 4 HOH 100 147 147 HOH HOH A . 
D 4 HOH 101 149 149 HOH HOH A . 
D 4 HOH 102 150 150 HOH HOH A . 
D 4 HOH 103 151 151 HOH HOH A . 
D 4 HOH 104 154 154 HOH HOH A . 
D 4 HOH 105 155 155 HOH HOH A . 
D 4 HOH 106 156 156 HOH HOH A . 
D 4 HOH 107 160 160 HOH HOH A . 
D 4 HOH 108 162 162 HOH HOH A . 
D 4 HOH 109 163 163 HOH HOH A . 
D 4 HOH 110 164 164 HOH HOH A . 
D 4 HOH 111 165 165 HOH HOH A . 
D 4 HOH 112 167 167 HOH HOH A . 
D 4 HOH 113 168 168 HOH HOH A . 
D 4 HOH 114 169 169 HOH HOH A . 
D 4 HOH 115 170 170 HOH HOH A . 
D 4 HOH 116 171 171 HOH HOH A . 
D 4 HOH 117 173 173 HOH HOH A . 
D 4 HOH 118 175 175 HOH HOH A . 
D 4 HOH 119 177 177 HOH HOH A . 
D 4 HOH 120 178 178 HOH HOH A . 
D 4 HOH 121 179 179 HOH HOH A . 
D 4 HOH 122 180 180 HOH HOH A . 
D 4 HOH 123 181 181 HOH HOH A . 
D 4 HOH 124 182 182 HOH HOH A . 
D 4 HOH 125 186 186 HOH HOH A . 
D 4 HOH 126 187 187 HOH HOH A . 
D 4 HOH 127 188 188 HOH HOH A . 
D 4 HOH 128 189 189 HOH HOH A . 
D 4 HOH 129 190 190 HOH HOH A . 
D 4 HOH 130 192 192 HOH HOH A . 
D 4 HOH 131 193 193 HOH HOH A . 
D 4 HOH 132 194 194 HOH HOH A . 
D 4 HOH 133 195 195 HOH HOH A . 
D 4 HOH 134 196 196 HOH HOH A . 
D 4 HOH 135 198 198 HOH HOH A . 
D 4 HOH 136 199 199 HOH HOH A . 
D 4 HOH 137 203 203 HOH HOH A . 
D 4 HOH 138 204 204 HOH HOH A . 
D 4 HOH 139 206 206 HOH HOH A . 
D 4 HOH 140 208 208 HOH HOH A . 
D 4 HOH 141 209 209 HOH HOH A . 
D 4 HOH 142 211 211 HOH HOH A . 
D 4 HOH 143 214 214 HOH HOH A . 
D 4 HOH 144 215 215 HOH HOH A . 
D 4 HOH 145 217 217 HOH HOH A . 
D 4 HOH 146 218 218 HOH HOH A . 
D 4 HOH 147 219 219 HOH HOH A . 
D 4 HOH 148 220 220 HOH HOH A . 
D 4 HOH 149 221 221 HOH HOH A . 
D 4 HOH 150 222 222 HOH HOH A . 
D 4 HOH 151 223 223 HOH HOH A . 
D 4 HOH 152 224 224 HOH HOH A . 
D 4 HOH 153 225 225 HOH HOH A . 
D 4 HOH 154 226 226 HOH HOH A . 
D 4 HOH 155 227 227 HOH HOH A . 
D 4 HOH 156 229 229 HOH HOH A . 
D 4 HOH 157 231 231 HOH HOH A . 
D 4 HOH 158 236 236 HOH HOH A . 
D 4 HOH 159 237 237 HOH HOH A . 
D 4 HOH 160 239 239 HOH HOH A . 
D 4 HOH 161 240 240 HOH HOH A . 
D 4 HOH 162 243 243 HOH HOH A . 
D 4 HOH 163 245 245 HOH HOH A . 
D 4 HOH 164 246 246 HOH HOH A . 
D 4 HOH 165 247 247 HOH HOH A . 
D 4 HOH 166 249 249 HOH HOH A . 
D 4 HOH 167 250 250 HOH HOH A . 
D 4 HOH 168 626 1   HOH HOH A . 
E 4 HOH 1   148 148 HOH HOH B . 
E 4 HOH 2   149 2   HOH HOH B . 
E 4 HOH 3   150 11  HOH HOH B . 
E 4 HOH 4   151 17  HOH HOH B . 
E 4 HOH 5   152 152 HOH HOH B . 
E 4 HOH 6   153 153 HOH HOH B . 
E 4 HOH 7   154 21  HOH HOH B . 
E 4 HOH 8   155 23  HOH HOH B . 
E 4 HOH 9   156 29  HOH HOH B . 
E 4 HOH 10  157 157 HOH HOH B . 
E 4 HOH 11  158 158 HOH HOH B . 
E 4 HOH 12  159 159 HOH HOH B . 
E 4 HOH 13  160 34  HOH HOH B . 
E 4 HOH 14  161 161 HOH HOH B . 
E 4 HOH 15  162 38  HOH HOH B . 
E 4 HOH 16  163 39  HOH HOH B . 
E 4 HOH 17  164 40  HOH HOH B . 
E 4 HOH 18  165 41  HOH HOH B . 
E 4 HOH 19  166 166 HOH HOH B . 
E 4 HOH 20  167 43  HOH HOH B . 
E 4 HOH 21  168 49  HOH HOH B . 
E 4 HOH 22  169 57  HOH HOH B . 
E 4 HOH 23  170 59  HOH HOH B . 
E 4 HOH 24  171 69  HOH HOH B . 
E 4 HOH 25  172 172 HOH HOH B . 
E 4 HOH 26  173 77  HOH HOH B . 
E 4 HOH 27  174 174 HOH HOH B . 
E 4 HOH 28  175 82  HOH HOH B . 
E 4 HOH 29  176 176 HOH HOH B . 
E 4 HOH 30  177 83  HOH HOH B . 
E 4 HOH 31  178 84  HOH HOH B . 
E 4 HOH 32  179 85  HOH HOH B . 
E 4 HOH 33  180 86  HOH HOH B . 
E 4 HOH 34  181 91  HOH HOH B . 
E 4 HOH 35  182 92  HOH HOH B . 
E 4 HOH 36  183 183 HOH HOH B . 
E 4 HOH 37  184 184 HOH HOH B . 
E 4 HOH 38  185 185 HOH HOH B . 
E 4 HOH 39  186 95  HOH HOH B . 
E 4 HOH 40  187 101 HOH HOH B . 
E 4 HOH 41  188 104 HOH HOH B . 
E 4 HOH 42  189 106 HOH HOH B . 
E 4 HOH 43  190 109 HOH HOH B . 
E 4 HOH 44  191 191 HOH HOH B . 
E 4 HOH 45  192 111 HOH HOH B . 
E 4 HOH 46  193 113 HOH HOH B . 
E 4 HOH 47  194 115 HOH HOH B . 
E 4 HOH 48  195 116 HOH HOH B . 
E 4 HOH 49  196 118 HOH HOH B . 
E 4 HOH 50  197 197 HOH HOH B . 
E 4 HOH 51  198 119 HOH HOH B . 
E 4 HOH 52  199 122 HOH HOH B . 
E 4 HOH 53  200 200 HOH HOH B . 
E 4 HOH 54  201 201 HOH HOH B . 
E 4 HOH 55  202 202 HOH HOH B . 
E 4 HOH 56  203 123 HOH HOH B . 
E 4 HOH 57  204 129 HOH HOH B . 
E 4 HOH 58  205 205 HOH HOH B . 
E 4 HOH 59  206 131 HOH HOH B . 
E 4 HOH 60  207 207 HOH HOH B . 
E 4 HOH 61  208 132 HOH HOH B . 
E 4 HOH 62  209 133 HOH HOH B . 
E 4 HOH 63  210 210 HOH HOH B . 
E 4 HOH 64  211 134 HOH HOH B . 
E 4 HOH 65  212 212 HOH HOH B . 
E 4 HOH 66  213 213 HOH HOH B . 
E 4 HOH 67  214 135 HOH HOH B . 
E 4 HOH 68  215 138 HOH HOH B . 
E 4 HOH 69  216 216 HOH HOH B . 
E 4 HOH 70  217 142 HOH HOH B . 
E 4 HOH 71  218 144 HOH HOH B . 
E 4 HOH 72  228 228 HOH HOH B . 
E 4 HOH 73  230 230 HOH HOH B . 
E 4 HOH 74  232 232 HOH HOH B . 
E 4 HOH 75  233 233 HOH HOH B . 
E 4 HOH 76  234 234 HOH HOH B . 
E 4 HOH 77  235 235 HOH HOH B . 
E 4 HOH 78  238 238 HOH HOH B . 
E 4 HOH 79  241 241 HOH HOH B . 
E 4 HOH 80  242 242 HOH HOH B . 
E 4 HOH 81  244 244 HOH HOH B . 
E 4 HOH 82  248 248 HOH HOH B . 
E 4 HOH 83  251 251 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2820  ? 
1 MORE         -15   ? 
1 'SSA (A^2)'  14360 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-09-15 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 8.1832  0.4551   -10.1492 0.0022 0.0004 0.0004 0.0000  0.0005 0.0003  0.3878 0.1277 0.0790 0.1068  
0.1151  0.0383 -0.0012 -0.0056 -0.0059 0.0079  0.0028 0.0039  -0.0079 0.0010  -0.0017 
'X-RAY DIFFRACTION' 2 ? refined 8.2492  -12.8349 -28.4790 0.0090 0.0090 0.0068 -0.0024 0.0010 -0.0074 0.4841 0.3512 0.3724 -0.0230 
-0.0482 0.0740 -0.0126 0.0409  -0.0468 -0.0468 0.0270 -0.0109 0.0147  0.0239  -0.0144 
'X-RAY DIFFRACTION' 3 ? refined -3.1622 -19.4957 -4.2208  0.0167 0.0110 0.0198 -0.0003 0.0181 -0.0017 6.2915 9.7117 0.7103 -1.3068 
-1.3795 2.2487 -0.1458 0.1272  -0.1986 0.3812  0.0232 0.3984  0.1057  -0.0186 0.1226  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 476 ? ? A 625 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 20  ? ? B 148 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 1   ? ? A 232 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345   'data collection' .        ? 1 
ARP/wARP 'model building'  .        ? 2 
REFMAC   refinement        5.5.0072 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 215 ? ? O B HOH 216 ? ? 2.12 
2 1 NH2 B ARG 93  ? ? O B HOH 217 ? ? 2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA B 40 ? ? -151.67 44.79   
2 1 ALA B 56 ? ? -133.88 -55.30  
3 1 ARG B 69 ? ? 52.73   -133.85 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 469 ? A GLY 1  
2  1 Y 1 A SER 470 ? A SER 2  
3  1 Y 1 A HIS 471 ? A HIS 3  
4  1 Y 1 A MET 472 ? A MET 4  
5  1 Y 1 A SER 473 ? A SER 5  
6  1 Y 1 A SER 474 ? A SER 6  
7  1 Y 1 B GLY -2  ? B GLY 1  
8  1 Y 1 B SER -1  ? B SER 2  
9  1 Y 1 B HIS 0   ? B HIS 3  
10 1 Y 1 B MET 1   ? B MET 4  
11 1 Y 1 B ALA 2   ? B ALA 5  
12 1 Y 1 B ALA 3   ? B ALA 6  
13 1 Y 1 B ALA 4   ? B ALA 7  
14 1 Y 1 B ALA 5   ? B ALA 8  
15 1 Y 1 B ASP 6   ? B ASP 9  
16 1 Y 1 B SER 7   ? B SER 10 
17 1 Y 1 B PHE 8   ? B PHE 11 
18 1 Y 1 B SER 9   ? B SER 12 
19 1 Y 1 B GLY 10  ? B GLY 13 
20 1 Y 1 B GLY 11  ? B GLY 14 
21 1 Y 1 B PRO 12  ? B PRO 15 
22 1 Y 1 B ALA 13  ? B ALA 16 
23 1 Y 1 B GLY 14  ? B GLY 17 
24 1 Y 1 B VAL 15  ? B VAL 18 
25 1 Y 1 B ARG 16  ? B ARG 19 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 BENZAMIDINE BEN 
4 water       HOH 
#