data_3P8P
# 
_entry.id   3P8P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3P8P         
RCSB  RCSB062096   
WWPDB D_1000062096 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3I2E 'human DDAH-1'                                               unspecified 
PDB 3I4A 'human DDAH-1 complexed with N5-(1-iminopropyl)-L-ornithine' unspecified 
PDB 3P8E 'human DDAH-1 complexed with N5-(1-iminopentyl)-L-ornithine' unspecified 
# 
_pdbx_database_status.entry_id                        3P8P 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-10-14 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Monzingo, A.F.' 1 
'Lluis, M.'      2 
'Wang, Y.'       3 
'Fast, W.'       4 
'Robertus, J.D.' 5 
# 
_citation.id                        primary 
_citation.title                     
'Characterization of C-Alkyl Amidines as Bioavailable Covalent Reversible Inhibitors of Human DDAH-1.' 
_citation.journal_abbrev            Chemmedchem 
_citation.journal_volume            6 
_citation.page_first                81 
_citation.page_last                 88 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   DE 
_citation.journal_id_ISSN           1860-7179 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20979083 
_citation.pdbx_database_id_DOI      10.1002/cmdc.201000392 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lluis, M.'      1 
primary 'Wang, Y.'       2 
primary 'Monzingo, A.F.' 3 
primary 'Fast, W.'       4 
primary 'Robertus, J.D.' 5 
# 
_cell.length_a           47.226 
_cell.length_b           79.632 
_cell.length_c           73.608 
_cell.angle_alpha        90.000 
_cell.angle_beta         89.630 
_cell.angle_gamma        90.000 
_cell.entry_id           3P8P 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3P8P 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'N(G),N(G)-dimethylarginine dimethylaminohydrolase 1' 33607.430 2   3.5.3.18 C274S ? ? 
2 non-polymer syn 'N~5~-[(1E)-pentanimidoyl]-L-ornithine'               215.293   2   ?        ?     ? ? 
3 water       nat water                                                 18.015    130 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DDAH-1, Dimethylarginine dimethylaminohydrolase 1, DDAHI, Dimethylargininase-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMASMAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSK
LGLQVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGRE
FFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDD
IAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTSCSVLINKKVDS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMASMAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSK
LGLQVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGRE
FFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDD
IAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTSCSVLINKKVDS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  ALA n 
1 23  SER n 
1 24  MET n 
1 25  ALA n 
1 26  GLY n 
1 27  LEU n 
1 28  GLY n 
1 29  HIS n 
1 30  PRO n 
1 31  ALA n 
1 32  ALA n 
1 33  PHE n 
1 34  GLY n 
1 35  ARG n 
1 36  ALA n 
1 37  THR n 
1 38  HIS n 
1 39  ALA n 
1 40  VAL n 
1 41  VAL n 
1 42  ARG n 
1 43  ALA n 
1 44  LEU n 
1 45  PRO n 
1 46  GLU n 
1 47  SER n 
1 48  LEU n 
1 49  GLY n 
1 50  GLN n 
1 51  HIS n 
1 52  ALA n 
1 53  LEU n 
1 54  ARG n 
1 55  SER n 
1 56  ALA n 
1 57  LYS n 
1 58  GLY n 
1 59  GLU n 
1 60  GLU n 
1 61  VAL n 
1 62  ASP n 
1 63  VAL n 
1 64  ALA n 
1 65  ARG n 
1 66  ALA n 
1 67  GLU n 
1 68  ARG n 
1 69  GLN n 
1 70  HIS n 
1 71  GLN n 
1 72  LEU n 
1 73  TYR n 
1 74  VAL n 
1 75  GLY n 
1 76  VAL n 
1 77  LEU n 
1 78  GLY n 
1 79  SER n 
1 80  LYS n 
1 81  LEU n 
1 82  GLY n 
1 83  LEU n 
1 84  GLN n 
1 85  VAL n 
1 86  VAL n 
1 87  GLU n 
1 88  LEU n 
1 89  PRO n 
1 90  ALA n 
1 91  ASP n 
1 92  GLU n 
1 93  SER n 
1 94  LEU n 
1 95  PRO n 
1 96  ASP n 
1 97  CYS n 
1 98  VAL n 
1 99  PHE n 
1 100 VAL n 
1 101 GLU n 
1 102 ASP n 
1 103 VAL n 
1 104 ALA n 
1 105 VAL n 
1 106 VAL n 
1 107 CYS n 
1 108 GLU n 
1 109 GLU n 
1 110 THR n 
1 111 ALA n 
1 112 LEU n 
1 113 ILE n 
1 114 THR n 
1 115 ARG n 
1 116 PRO n 
1 117 GLY n 
1 118 ALA n 
1 119 PRO n 
1 120 SER n 
1 121 ARG n 
1 122 ARG n 
1 123 LYS n 
1 124 GLU n 
1 125 VAL n 
1 126 ASP n 
1 127 MET n 
1 128 MET n 
1 129 LYS n 
1 130 GLU n 
1 131 ALA n 
1 132 LEU n 
1 133 GLU n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 LEU n 
1 138 ASN n 
1 139 ILE n 
1 140 VAL n 
1 141 GLU n 
1 142 MET n 
1 143 LYS n 
1 144 ASP n 
1 145 GLU n 
1 146 ASN n 
1 147 ALA n 
1 148 THR n 
1 149 LEU n 
1 150 ASP n 
1 151 GLY n 
1 152 GLY n 
1 153 ASP n 
1 154 VAL n 
1 155 LEU n 
1 156 PHE n 
1 157 THR n 
1 158 GLY n 
1 159 ARG n 
1 160 GLU n 
1 161 PHE n 
1 162 PHE n 
1 163 VAL n 
1 164 GLY n 
1 165 LEU n 
1 166 SER n 
1 167 LYS n 
1 168 ARG n 
1 169 THR n 
1 170 ASN n 
1 171 GLN n 
1 172 ARG n 
1 173 GLY n 
1 174 ALA n 
1 175 GLU n 
1 176 ILE n 
1 177 LEU n 
1 178 ALA n 
1 179 ASP n 
1 180 THR n 
1 181 PHE n 
1 182 LYS n 
1 183 ASP n 
1 184 TYR n 
1 185 ALA n 
1 186 VAL n 
1 187 SER n 
1 188 THR n 
1 189 VAL n 
1 190 PRO n 
1 191 VAL n 
1 192 ALA n 
1 193 ASP n 
1 194 GLY n 
1 195 LEU n 
1 196 HIS n 
1 197 LEU n 
1 198 LYS n 
1 199 SER n 
1 200 PHE n 
1 201 CYS n 
1 202 SER n 
1 203 MET n 
1 204 ALA n 
1 205 GLY n 
1 206 PRO n 
1 207 ASN n 
1 208 LEU n 
1 209 ILE n 
1 210 ALA n 
1 211 ILE n 
1 212 GLY n 
1 213 SER n 
1 214 SER n 
1 215 GLU n 
1 216 SER n 
1 217 ALA n 
1 218 GLN n 
1 219 LYS n 
1 220 ALA n 
1 221 LEU n 
1 222 LYS n 
1 223 ILE n 
1 224 MET n 
1 225 GLN n 
1 226 GLN n 
1 227 MET n 
1 228 SER n 
1 229 ASP n 
1 230 HIS n 
1 231 ARG n 
1 232 TYR n 
1 233 ASP n 
1 234 LYS n 
1 235 LEU n 
1 236 THR n 
1 237 VAL n 
1 238 PRO n 
1 239 ASP n 
1 240 ASP n 
1 241 ILE n 
1 242 ALA n 
1 243 ALA n 
1 244 ASN n 
1 245 CYS n 
1 246 ILE n 
1 247 TYR n 
1 248 LEU n 
1 249 ASN n 
1 250 ILE n 
1 251 PRO n 
1 252 ASN n 
1 253 LYS n 
1 254 GLY n 
1 255 HIS n 
1 256 VAL n 
1 257 LEU n 
1 258 LEU n 
1 259 HIS n 
1 260 ARG n 
1 261 THR n 
1 262 PRO n 
1 263 GLU n 
1 264 GLU n 
1 265 TYR n 
1 266 PRO n 
1 267 GLU n 
1 268 SER n 
1 269 ALA n 
1 270 LYS n 
1 271 VAL n 
1 272 TYR n 
1 273 GLU n 
1 274 LYS n 
1 275 LEU n 
1 276 LYS n 
1 277 ASP n 
1 278 HIS n 
1 279 MET n 
1 280 LEU n 
1 281 ILE n 
1 282 PRO n 
1 283 VAL n 
1 284 SER n 
1 285 MET n 
1 286 SER n 
1 287 GLU n 
1 288 LEU n 
1 289 GLU n 
1 290 LYS n 
1 291 VAL n 
1 292 ASP n 
1 293 GLY n 
1 294 LEU n 
1 295 LEU n 
1 296 THR n 
1 297 SER n 
1 298 CYS n 
1 299 SER n 
1 300 VAL n 
1 301 LEU n 
1 302 ILE n 
1 303 ASN n 
1 304 LYS n 
1 305 LYS n 
1 306 VAL n 
1 307 ASP n 
1 308 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DDAH, DDAH1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28A-HDDAH-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DDAH1_HUMAN 
_struct_ref.pdbx_db_accession          O94760 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVEDV
AVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKD
YAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPE
EYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3P8P A 24 ? 308 ? O94760 1 ? 285 ? 1 285 
2 1 3P8P B 24 ? 308 ? O94760 1 ? 285 ? 1 285 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3P8P MET A 1   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -22 1  
1 3P8P GLY A 2   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -21 2  
1 3P8P SER A 3   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -20 3  
1 3P8P SER A 4   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -19 4  
1 3P8P HIS A 5   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -18 5  
1 3P8P HIS A 6   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -17 6  
1 3P8P HIS A 7   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -16 7  
1 3P8P HIS A 8   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -15 8  
1 3P8P HIS A 9   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -14 9  
1 3P8P HIS A 10  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -13 10 
1 3P8P SER A 11  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -12 11 
1 3P8P SER A 12  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -11 12 
1 3P8P GLY A 13  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -10 13 
1 3P8P LEU A 14  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -9  14 
1 3P8P VAL A 15  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -8  15 
1 3P8P PRO A 16  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -7  16 
1 3P8P ARG A 17  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -6  17 
1 3P8P GLY A 18  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -5  18 
1 3P8P SER A 19  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -4  19 
1 3P8P HIS A 20  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -3  20 
1 3P8P MET A 21  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -2  21 
1 3P8P ALA A 22  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -1  22 
1 3P8P SER A 23  ? UNP O94760 ?   ?   'EXPRESSION TAG'      0   23 
1 3P8P SER A 297 ? UNP O94760 CYS 274 'ENGINEERED MUTATION' 274 24 
2 3P8P MET B 1   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -22 25 
2 3P8P GLY B 2   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -21 26 
2 3P8P SER B 3   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -20 27 
2 3P8P SER B 4   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -19 28 
2 3P8P HIS B 5   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -18 29 
2 3P8P HIS B 6   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -17 30 
2 3P8P HIS B 7   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -16 31 
2 3P8P HIS B 8   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -15 32 
2 3P8P HIS B 9   ? UNP O94760 ?   ?   'EXPRESSION TAG'      -14 33 
2 3P8P HIS B 10  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -13 34 
2 3P8P SER B 11  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -12 35 
2 3P8P SER B 12  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -11 36 
2 3P8P GLY B 13  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -10 37 
2 3P8P LEU B 14  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -9  38 
2 3P8P VAL B 15  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -8  39 
2 3P8P PRO B 16  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -7  40 
2 3P8P ARG B 17  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -6  41 
2 3P8P GLY B 18  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -5  42 
2 3P8P SER B 19  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -4  43 
2 3P8P HIS B 20  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -3  44 
2 3P8P MET B 21  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -2  45 
2 3P8P ALA B 22  ? UNP O94760 ?   ?   'EXPRESSION TAG'      -1  46 
2 3P8P SER B 23  ? UNP O94760 ?   ?   'EXPRESSION TAG'      0   47 
2 3P8P SER B 297 ? UNP O94760 CYS 274 'ENGINEERED MUTATION' 274 48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                 ?                                'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                ?                                'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ?                                'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ?                                'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                ?                                'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                               ?                                'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ?                                'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                 ?                                'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                               ?                                'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                   ?                                'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ?                                'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                 ?                                'C6 H13 N O2'    131.173 
LN6 non-polymer         . 'N~5~-[(1E)-pentanimidoyl]-L-ornithine' 'N5-(1-iminopentyl)-L-ornithine' 'C10 H21 N3 O2'  215.293 
LYS 'L-peptide linking' y LYSINE                                  ?                                'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                              ?                                'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                           ?                                'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                 ?                                'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                  ?                                'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                               ?                                'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                                ?                                'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                  ?                                'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3P8P 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.06 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   40.27 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'23% polyethyleneglycol 6000, 0.1 M Tris-HCl, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-02-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'double crystal, Si (111) liquid nitrogen cooled' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
# 
_reflns.entry_id                     3P8P 
_reflns.d_resolution_high            2.500 
_reflns.d_resolution_low             20.000 
_reflns.number_obs                   18125 
_reflns.pdbx_Rmerge_I_obs            0.100 
_reflns.pdbx_netI_over_sigmaI        10.300 
_reflns.pdbx_chi_squared             2.332 
_reflns.pdbx_redundancy              3.100 
_reflns.percent_possible_obs         92.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.500 2.540  ? ? ? 0.477 2.49 ? 0.865 3.100 ? 921  95.300 ? 1  
2.540 2.590  ? ? ? 0.432 ?    ? 0.872 3.100 ? 913  94.300 ? 2  
2.590 2.640  ? ? ? 0.401 ?    ? 0.894 3.100 ? 918  92.200 ? 3  
2.640 2.690  ? ? ? 0.330 ?    ? 0.931 3.200 ? 916  95.400 ? 4  
2.690 2.750  ? ? ? 0.322 ?    ? 1.178 3.200 ? 941  93.600 ? 5  
2.750 2.810  ? ? ? 0.294 ?    ? 1.234 3.200 ? 890  91.200 ? 6  
2.810 2.890  ? ? ? 0.262 ?    ? 1.331 3.300 ? 895  94.400 ? 7  
2.890 2.960  ? ? ? 0.237 ?    ? 1.470 3.200 ? 915  90.800 ? 8  
2.960 3.050  ? ? ? 0.207 ?    ? 1.998 3.200 ? 920  93.900 ? 9  
3.050 3.150  ? ? ? 0.174 ?    ? 2.279 3.200 ? 902  90.700 ? 10 
3.150 3.260  ? ? ? 0.156 ?    ? 2.301 3.200 ? 900  91.800 ? 11 
3.260 3.390  ? ? ? 0.143 ?    ? 2.657 3.200 ? 894  89.600 ? 12 
3.390 3.540  ? ? ? 0.119 ?    ? 3.118 3.100 ? 882  91.300 ? 13 
3.540 3.730  ? ? ? 0.109 ?    ? 4.208 2.700 ? 833  85.100 ? 14 
3.730 3.960  ? ? ? 0.091 ?    ? 3.873 2.800 ? 854  85.800 ? 15 
3.960 4.260  ? ? ? 0.075 ?    ? 3.881 2.800 ? 846  86.800 ? 16 
4.260 4.690  ? ? ? 0.070 ?    ? 4.015 2.900 ? 874  88.600 ? 17 
4.690 5.350  ? ? ? 0.063 ?    ? 4.049 2.800 ? 906  90.800 ? 18 
5.350 6.700  ? ? ? 0.063 ?    ? 3.518 3.300 ? 1005 99.000 ? 19 
6.700 20.000 ? ? ? 0.045 ?    ? 3.489 3.200 ? 1000 98.800 ? 20 
# 
_refine.entry_id                                 3P8P 
_refine.ls_d_res_high                            2.5000 
_refine.ls_d_res_low                             20.0000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    85.6000 
_refine.ls_number_reflns_obs                     16211 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2275 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.3050 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.3000 
_refine.ls_number_reflns_R_free                  818 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               38.4638 
_refine.solvent_model_param_bsol                 32.9746 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -6.9940 
_refine.aniso_B[2][2]                            14.8100 
_refine.aniso_B[3][3]                            -7.8150 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -4.6420 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'pdb entry 3I2E' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7282 
_refine.B_iso_max                                70.060 
_refine.B_iso_min                                7.380 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4087 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             130 
_refine_hist.number_atoms_total               4247 
_refine_hist.d_res_high                       2.5000 
_refine_hist.d_res_low                        20.0000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d     ? 0.007 ?     ? 'X-RAY DIFFRACTION' ? 
c_angle_d    ? 1.433 ?     ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it  ? 1.431 1.500 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  ? 1.867 2.000 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it ? 2.437 2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it ? 2.742 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.5000 2.5500  16 . 886  . 0.2911 0.3968 . 45 . 931  . . 'X-RAY DIFFRACTION' 
2.5500 2.6100  16 . 919  . 0.3070 0.3656 . 52 . 971  . . 'X-RAY DIFFRACTION' 
2.6100 2.6800  16 . 919  . 0.3170 0.4553 . 60 . 979  . . 'X-RAY DIFFRACTION' 
2.6800 2.7500  16 . 939  . 0.3113 0.4348 . 50 . 989  . . 'X-RAY DIFFRACTION' 
2.7500 2.8300  16 . 933  . 0.3076 0.4360 . 44 . 977  . . 'X-RAY DIFFRACTION' 
2.8300 2.9200  16 . 927  . 0.2885 0.4331 . 52 . 979  . . 'X-RAY DIFFRACTION' 
2.9200 3.0300  16 . 944  . 0.2809 0.3785 . 63 . 1007 . . 'X-RAY DIFFRACTION' 
3.0300 3.1500  16 . 957  . 0.2855 0.3602 . 53 . 1010 . . 'X-RAY DIFFRACTION' 
3.1500 3.2900  16 . 1006 . 0.2697 0.3295 . 51 . 1057 . . 'X-RAY DIFFRACTION' 
3.2900 3.4600  16 . 966  . 0.2462 0.4168 . 49 . 1015 . . 'X-RAY DIFFRACTION' 
3.4600 3.6800  16 . 880  . 0.2959 0.3043 . 49 . 929  . . 'X-RAY DIFFRACTION' 
3.6800 3.9600  16 . 936  . 0.2157 0.2746 . 42 . 978  . . 'X-RAY DIFFRACTION' 
3.9600 4.3600  16 . 971  . 0.1954 0.3013 . 43 . 1014 . . 'X-RAY DIFFRACTION' 
4.3600 4.9800  16 . 975  . 0.1430 0.1823 . 59 . 1034 . . 'X-RAY DIFFRACTION' 
4.9800 6.2400  16 . 1089 . 0.1944 0.2907 . 52 . 1141 . . 'X-RAY DIFFRACTION' 
6.2400 20.0000 16 . 1146 . 0.1463 0.1650 . 54 . 1200 . . 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 ion.param         ion.top     'X-RAY DIFFRACTION' 
5 ipno.par          ipno.top    'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3P8P 
_struct.title                     
;Crystal Structure of Human Dimethylarginine Dimethylaminohydrolase-1 (DDAH-1) variant C274S bound with N5-(1-iminopentyl)-L-ornithine
;
_struct.pdbx_descriptor           'N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 (E.C.3.5.3.18)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3P8P 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            'DDAH, NITRIC OXIDE SYNTHASE REGULATOR, HYDROLASE-HYDROLASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 47  ? ALA A 52  ? SER A 24  ALA A 29  1 ? 6  
HELX_P HELX_P2  2  ASP A 62  ? GLY A 78  ? ASP A 39  GLY A 55  1 ? 17 
HELX_P HELX_P3  3  PHE A 99  ? ASP A 102 ? PHE A 76  ASP A 79  5 ? 4  
HELX_P HELX_P4  4  ALA A 118 ? LYS A 123 ? ALA A 95  LYS A 100 5 ? 6  
HELX_P HELX_P5  5  GLU A 124 ? LEU A 135 ? GLU A 101 LEU A 112 1 ? 12 
HELX_P HELX_P6  6  ASP A 150 ? GLY A 152 ? ASP A 127 GLY A 129 5 ? 3  
HELX_P HELX_P7  7  ASN A 170 ? PHE A 181 ? ASN A 147 PHE A 158 1 ? 12 
HELX_P HELX_P8  8  HIS A 196 ? SER A 199 ? HIS A 173 SER A 176 5 ? 4  
HELX_P HELX_P9  9  SER A 214 ? MET A 227 ? SER A 191 MET A 204 1 ? 14 
HELX_P HELX_P10 10 ASP A 240 ? ASN A 244 ? ASP A 217 ASN A 221 5 ? 5  
HELX_P HELX_P11 11 TYR A 265 ? LYS A 274 ? TYR A 242 LYS A 251 1 ? 10 
HELX_P HELX_P12 12 MET A 285 ? LYS A 290 ? MET A 262 LYS A 267 1 ? 6  
HELX_P HELX_P13 13 LEU A 295 ? SER A 299 ? LEU A 272 SER A 276 5 ? 5  
HELX_P HELX_P14 14 SER B 47  ? ALA B 52  ? SER B 24  ALA B 29  1 ? 6  
HELX_P HELX_P15 15 ASP B 62  ? SER B 79  ? ASP B 39  SER B 56  1 ? 18 
HELX_P HELX_P16 16 PHE B 99  ? ASP B 102 ? PHE B 76  ASP B 79  5 ? 4  
HELX_P HELX_P17 17 ALA B 118 ? LYS B 123 ? ALA B 95  LYS B 100 5 ? 6  
HELX_P HELX_P18 18 GLU B 124 ? GLU B 133 ? GLU B 101 GLU B 110 1 ? 10 
HELX_P HELX_P19 19 LYS B 134 ? GLN B 136 ? LYS B 111 GLN B 113 5 ? 3  
HELX_P HELX_P20 20 ASP B 150 ? GLY B 152 ? ASP B 127 GLY B 129 5 ? 3  
HELX_P HELX_P21 21 ASN B 170 ? PHE B 181 ? ASN B 147 PHE B 158 1 ? 12 
HELX_P HELX_P22 22 HIS B 196 ? SER B 199 ? HIS B 173 SER B 176 5 ? 4  
HELX_P HELX_P23 23 SER B 214 ? SER B 228 ? SER B 191 SER B 205 1 ? 15 
HELX_P HELX_P24 24 TYR B 265 ? LYS B 274 ? TYR B 242 LYS B 251 1 ? 10 
HELX_P HELX_P25 25 MET B 285 ? LYS B 290 ? MET B 262 LYS B 267 1 ? 6  
HELX_P HELX_P26 26 LEU B 295 ? SER B 299 ? LEU B 272 SER B 276 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
E ? 3 ? 
F ? 3 ? 
G ? 3 ? 
H ? 3 ? 
I ? 3 ? 
J ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? parallel      
J 1 2 ? anti-parallel 
J 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 84  ? LEU A 88  ? GLN A 61  LEU A 65  
A 2 HIS A 38  ? ARG A 42  ? HIS A 15  ARG A 19  
A 3 VAL A 300 ? ILE A 302 ? VAL A 277 ILE A 279 
B 1 ALA A 104 ? CYS A 107 ? ALA A 81  CYS A 84  
B 2 THR A 110 ? ILE A 113 ? THR A 87  ILE A 90  
B 3 ASN A 138 ? GLU A 141 ? ASN A 115 GLU A 118 
C 1 VAL A 154 ? PHE A 156 ? VAL A 131 PHE A 133 
C 2 GLU A 160 ? LEU A 165 ? GLU A 137 LEU A 142 
C 3 ALA A 185 ? PRO A 190 ? ALA A 162 PRO A 167 
D 1 CYS A 201 ? GLY A 205 ? CYS A 178 GLY A 182 
D 2 LEU A 208 ? GLY A 212 ? LEU A 185 GLY A 189 
D 3 ASP A 233 ? VAL A 237 ? ASP A 210 VAL A 214 
E 1 ILE A 246 ? ILE A 250 ? ILE A 223 ILE A 227 
E 2 GLY A 254 ? HIS A 259 ? GLY A 231 HIS A 236 
E 3 HIS A 278 ? PRO A 282 ? HIS A 255 PRO A 259 
F 1 GLN B 84  ? LEU B 88  ? GLN B 61  LEU B 65  
F 2 HIS B 38  ? ARG B 42  ? HIS B 15  ARG B 19  
F 3 VAL B 300 ? ILE B 302 ? VAL B 277 ILE B 279 
G 1 ALA B 104 ? CYS B 107 ? ALA B 81  CYS B 84  
G 2 THR B 110 ? ILE B 113 ? THR B 87  ILE B 90  
G 3 ASN B 138 ? GLU B 141 ? ASN B 115 GLU B 118 
H 1 VAL B 154 ? PHE B 156 ? VAL B 131 PHE B 133 
H 2 PHE B 161 ? LEU B 165 ? PHE B 138 LEU B 142 
H 3 VAL B 186 ? PRO B 190 ? VAL B 163 PRO B 167 
I 1 CYS B 201 ? GLY B 205 ? CYS B 178 GLY B 182 
I 2 LEU B 208 ? GLY B 212 ? LEU B 185 GLY B 189 
I 3 ASP B 233 ? VAL B 237 ? ASP B 210 VAL B 214 
J 1 ILE B 246 ? ILE B 250 ? ILE B 223 ILE B 227 
J 2 GLY B 254 ? HIS B 259 ? GLY B 231 HIS B 236 
J 3 HIS B 278 ? PRO B 282 ? HIS B 255 PRO B 259 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 86  ? O VAL A 63  N VAL A 41  ? N VAL A 18  
A 2 3 N HIS A 38  ? N HIS A 15  O ILE A 302 ? O ILE A 279 
B 1 2 N CYS A 107 ? N CYS A 84  O THR A 110 ? O THR A 87  
B 2 3 N ALA A 111 ? N ALA A 88  O ASN A 138 ? O ASN A 115 
C 1 2 N LEU A 155 ? N LEU A 132 O PHE A 162 ? O PHE A 139 
C 2 3 N PHE A 161 ? N PHE A 138 O ALA A 185 ? O ALA A 162 
D 1 2 N SER A 202 ? N SER A 179 O ALA A 210 ? O ALA A 187 
D 2 3 N ILE A 211 ? N ILE A 188 O VAL A 237 ? O VAL A 214 
E 1 2 N ILE A 250 ? N ILE A 227 O GLY A 254 ? O GLY A 231 
E 2 3 N HIS A 255 ? N HIS A 232 O MET A 279 ? O MET A 256 
F 1 2 O VAL B 86  ? O VAL B 63  N ALA B 39  ? N ALA B 16  
F 2 3 N HIS B 38  ? N HIS B 15  O ILE B 302 ? O ILE B 279 
G 1 2 N VAL B 105 ? N VAL B 82  O LEU B 112 ? O LEU B 89  
G 2 3 N ILE B 113 ? N ILE B 90  O VAL B 140 ? O VAL B 117 
H 1 2 N LEU B 155 ? N LEU B 132 O PHE B 162 ? O PHE B 139 
H 2 3 N VAL B 163 ? N VAL B 140 O SER B 187 ? O SER B 164 
I 1 2 N GLY B 205 ? N GLY B 182 O LEU B 208 ? O LEU B 185 
I 2 3 N ILE B 211 ? N ILE B 188 O LEU B 235 ? O LEU B 212 
J 1 2 N ILE B 250 ? N ILE B 227 O GLY B 254 ? O GLY B 231 
J 2 3 N HIS B 255 ? N HIS B 232 O MET B 279 ? O MET B 256 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE LN6 A 286' 
AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE LN6 B 286' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 LEU A 53  ? LEU A 30  . ? 1_555 ? 
2  AC1 14 ASP A 96  ? ASP A 73  . ? 1_555 ? 
3  AC1 14 PHE A 99  ? PHE A 76  . ? 1_555 ? 
4  AC1 14 ASP A 102 ? ASP A 79  . ? 1_555 ? 
5  AC1 14 ARG A 121 ? ARG A 98  . ? 1_555 ? 
6  AC1 14 ARG A 168 ? ARG A 145 . ? 1_555 ? 
7  AC1 14 HIS A 196 ? HIS A 173 . ? 1_555 ? 
8  AC1 14 LYS A 198 ? LYS A 175 . ? 1_555 ? 
9  AC1 14 ASN A 244 ? ASN A 221 . ? 1_555 ? 
10 AC1 14 VAL A 291 ? VAL A 268 . ? 1_555 ? 
11 AC1 14 ASP A 292 ? ASP A 269 . ? 1_555 ? 
12 AC1 14 THR A 296 ? THR A 273 . ? 1_555 ? 
13 AC1 14 SER A 297 ? SER A 274 . ? 1_555 ? 
14 AC1 14 HOH E .   ? HOH A 294 . ? 1_555 ? 
15 AC2 13 LEU B 53  ? LEU B 30  . ? 1_555 ? 
16 AC2 13 ASP B 96  ? ASP B 73  . ? 1_555 ? 
17 AC2 13 PHE B 99  ? PHE B 76  . ? 1_555 ? 
18 AC2 13 ASP B 102 ? ASP B 79  . ? 1_555 ? 
19 AC2 13 ARG B 121 ? ARG B 98  . ? 1_555 ? 
20 AC2 13 ARG B 168 ? ARG B 145 . ? 1_555 ? 
21 AC2 13 HIS B 196 ? HIS B 173 . ? 1_555 ? 
22 AC2 13 LYS B 198 ? LYS B 175 . ? 1_555 ? 
23 AC2 13 ASN B 244 ? ASN B 221 . ? 1_555 ? 
24 AC2 13 VAL B 291 ? VAL B 268 . ? 1_555 ? 
25 AC2 13 ASP B 292 ? ASP B 269 . ? 1_555 ? 
26 AC2 13 THR B 296 ? THR B 273 . ? 1_555 ? 
27 AC2 13 SER B 297 ? SER B 274 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3P8P 
_atom_sites.fract_transf_matrix[1][1]   0.021175 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   -0.000137 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012558 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013586 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 31  ? 12.482  5.944   -5.478  1.00 46.90 ? 8   ALA A N   1 
ATOM   2    C CA  . ALA A 1 31  ? 11.399  5.808   -4.460  1.00 47.75 ? 8   ALA A CA  1 
ATOM   3    C C   . ALA A 1 31  ? 10.452  4.640   -4.785  1.00 47.20 ? 8   ALA A C   1 
ATOM   4    O O   . ALA A 1 31  ? 9.410   4.826   -5.420  1.00 47.17 ? 8   ALA A O   1 
ATOM   5    C CB  . ALA A 1 31  ? 10.615  7.124   -4.360  1.00 47.27 ? 8   ALA A CB  1 
ATOM   6    N N   . ALA A 1 32  ? 10.829  3.442   -4.333  1.00 46.27 ? 9   ALA A N   1 
ATOM   7    C CA  . ALA A 1 32  ? 10.059  2.218   -4.562  1.00 44.56 ? 9   ALA A CA  1 
ATOM   8    C C   . ALA A 1 32  ? 9.191   1.805   -3.379  1.00 44.36 ? 9   ALA A C   1 
ATOM   9    O O   . ALA A 1 32  ? 9.093   2.520   -2.383  1.00 46.69 ? 9   ALA A O   1 
ATOM   10   C CB  . ALA A 1 32  ? 10.993  1.097   -4.903  1.00 46.02 ? 9   ALA A CB  1 
ATOM   11   N N   . PHE A 1 33  ? 8.559   0.641   -3.478  1.00 42.70 ? 10  PHE A N   1 
ATOM   12   C CA  . PHE A 1 33  ? 7.703   0.189   -2.385  1.00 41.59 ? 10  PHE A CA  1 
ATOM   13   C C   . PHE A 1 33  ? 8.474   0.063   -1.082  1.00 39.84 ? 10  PHE A C   1 
ATOM   14   O O   . PHE A 1 33  ? 9.549   -0.531  -1.041  1.00 40.50 ? 10  PHE A O   1 
ATOM   15   C CB  . PHE A 1 33  ? 7.053   -1.169  -2.676  1.00 39.68 ? 10  PHE A CB  1 
ATOM   16   C CG  . PHE A 1 33  ? 6.375   -1.758  -1.471  1.00 37.16 ? 10  PHE A CG  1 
ATOM   17   C CD1 . PHE A 1 33  ? 5.180   -1.220  -1.002  1.00 35.41 ? 10  PHE A CD1 1 
ATOM   18   C CD2 . PHE A 1 33  ? 6.991   -2.770  -0.735  1.00 35.35 ? 10  PHE A CD2 1 
ATOM   19   C CE1 . PHE A 1 33  ? 4.609   -1.677  0.188   1.00 35.62 ? 10  PHE A CE1 1 
ATOM   20   C CE2 . PHE A 1 33  ? 6.430   -3.230  0.452   1.00 33.64 ? 10  PHE A CE2 1 
ATOM   21   C CZ  . PHE A 1 33  ? 5.235   -2.682  0.916   1.00 33.19 ? 10  PHE A CZ  1 
ATOM   22   N N   . GLY A 1 34  ? 7.907   0.608   -0.016  1.00 39.28 ? 11  GLY A N   1 
ATOM   23   C CA  . GLY A 1 34  ? 8.557   0.530   1.280   1.00 37.92 ? 11  GLY A CA  1 
ATOM   24   C C   . GLY A 1 34  ? 9.513   1.671   1.560   1.00 36.88 ? 11  GLY A C   1 
ATOM   25   O O   . GLY A 1 34  ? 10.121  1.724   2.630   1.00 37.42 ? 11  GLY A O   1 
ATOM   26   N N   . ARG A 1 35  ? 9.663   2.580   0.601   1.00 35.75 ? 12  ARG A N   1 
ATOM   27   C CA  . ARG A 1 35  ? 10.554  3.715   0.789   1.00 33.82 ? 12  ARG A CA  1 
ATOM   28   C C   . ARG A 1 35  ? 9.875   4.721   1.693   1.00 30.98 ? 12  ARG A C   1 
ATOM   29   O O   . ARG A 1 35  ? 8.696   5.003   1.549   1.00 31.04 ? 12  ARG A O   1 
ATOM   30   C CB  . ARG A 1 35  ? 10.886  4.384   -0.554  1.00 36.72 ? 12  ARG A CB  1 
ATOM   31   C CG  . ARG A 1 35  ? 11.696  5.666   -0.419  1.00 38.42 ? 12  ARG A CG  1 
ATOM   32   C CD  . ARG A 1 35  ? 13.039  5.372   0.219   1.00 42.03 ? 12  ARG A CD  1 
ATOM   33   N NE  . ARG A 1 35  ? 13.760  4.389   -0.581  1.00 46.80 ? 12  ARG A NE  1 
ATOM   34   C CZ  . ARG A 1 35  ? 14.404  4.668   -1.708  1.00 48.54 ? 12  ARG A CZ  1 
ATOM   35   N NH1 . ARG A 1 35  ? 14.433  5.911   -2.175  1.00 49.62 ? 12  ARG A NH1 1 
ATOM   36   N NH2 . ARG A 1 35  ? 15.000  3.696   -2.379  1.00 49.94 ? 12  ARG A NH2 1 
ATOM   37   N N   . ALA A 1 36  ? 10.629  5.256   2.635   1.00 30.95 ? 13  ALA A N   1 
ATOM   38   C CA  . ALA A 1 36  ? 10.091  6.243   3.551   1.00 31.65 ? 13  ALA A CA  1 
ATOM   39   C C   . ALA A 1 36  ? 11.177  7.248   3.876   1.00 31.09 ? 13  ALA A C   1 
ATOM   40   O O   . ALA A 1 36  ? 12.360  7.006   3.633   1.00 31.47 ? 13  ALA A O   1 
ATOM   41   C CB  . ALA A 1 36  ? 9.604   5.564   4.845   1.00 32.99 ? 13  ALA A CB  1 
ATOM   42   N N   . THR A 1 37  ? 10.768  8.380   4.425   1.00 29.63 ? 14  THR A N   1 
ATOM   43   C CA  . THR A 1 37  ? 11.711  9.409   4.819   1.00 28.82 ? 14  THR A CA  1 
ATOM   44   C C   . THR A 1 37  ? 11.384  9.768   6.250   1.00 27.17 ? 14  THR A C   1 
ATOM   45   O O   . THR A 1 37  ? 12.237  10.216  7.007   1.00 26.73 ? 14  THR A O   1 
ATOM   46   C CB  . THR A 1 37  ? 11.610  10.688  3.922   1.00 28.86 ? 14  THR A CB  1 
ATOM   47   O OG1 . THR A 1 37  ? 10.237  11.054  3.737   1.00 26.64 ? 14  THR A OG1 1 
ATOM   48   C CG2 . THR A 1 37  ? 12.261  10.442  2.567   1.00 28.01 ? 14  THR A CG2 1 
ATOM   49   N N   . HIS A 1 38  ? 10.136  9.536   6.619   1.00 26.53 ? 15  HIS A N   1 
ATOM   50   C CA  . HIS A 1 38  ? 9.689   9.865   7.952   1.00 27.14 ? 15  HIS A CA  1 
ATOM   51   C C   . HIS A 1 38  ? 8.934   8.739   8.603   1.00 25.73 ? 15  HIS A C   1 
ATOM   52   O O   . HIS A 1 38  ? 8.398   7.851   7.947   1.00 28.09 ? 15  HIS A O   1 
ATOM   53   C CB  . HIS A 1 38  ? 8.786   11.093  7.918   1.00 30.00 ? 15  HIS A CB  1 
ATOM   54   C CG  . HIS A 1 38  ? 9.455   12.327  7.400   1.00 32.98 ? 15  HIS A CG  1 
ATOM   55   N ND1 . HIS A 1 38  ? 10.037  12.391  6.152   1.00 33.90 ? 15  HIS A ND1 1 
ATOM   56   C CD2 . HIS A 1 38  ? 9.617   13.552  7.957   1.00 33.06 ? 15  HIS A CD2 1 
ATOM   57   C CE1 . HIS A 1 38  ? 10.530  13.604  5.963   1.00 34.57 ? 15  HIS A CE1 1 
ATOM   58   N NE2 . HIS A 1 38  ? 10.288  14.327  7.042   1.00 33.10 ? 15  HIS A NE2 1 
ATOM   59   N N   . ALA A 1 39  ? 8.895   8.791   9.917   1.00 23.26 ? 16  ALA A N   1 
ATOM   60   C CA  . ALA A 1 39  ? 8.194   7.796   10.674  1.00 21.80 ? 16  ALA A CA  1 
ATOM   61   C C   . ALA A 1 39  ? 7.653   8.573   11.844  1.00 22.20 ? 16  ALA A C   1 
ATOM   62   O O   . ALA A 1 39  ? 8.353   9.420   12.385  1.00 21.82 ? 16  ALA A O   1 
ATOM   63   C CB  . ALA A 1 39  ? 9.164   6.713   11.149  1.00 19.31 ? 16  ALA A CB  1 
ATOM   64   N N   . VAL A 1 40  ? 6.400   8.321   12.207  1.00 22.68 ? 17  VAL A N   1 
ATOM   65   C CA  . VAL A 1 40  ? 5.790   8.983   13.356  1.00 21.23 ? 17  VAL A CA  1 
ATOM   66   C C   . VAL A 1 40  ? 5.734   7.970   14.486  1.00 21.23 ? 17  VAL A C   1 
ATOM   67   O O   . VAL A 1 40  ? 5.270   6.843   14.308  1.00 19.75 ? 17  VAL A O   1 
ATOM   68   C CB  . VAL A 1 40  ? 4.345   9.471   13.066  1.00 22.31 ? 17  VAL A CB  1 
ATOM   69   C CG1 . VAL A 1 40  ? 3.768   10.192  14.294  1.00 18.36 ? 17  VAL A CG1 1 
ATOM   70   C CG2 . VAL A 1 40  ? 4.346   10.399  11.858  1.00 19.14 ? 17  VAL A CG2 1 
ATOM   71   N N   . VAL A 1 41  ? 6.237   8.380   15.641  1.00 22.40 ? 18  VAL A N   1 
ATOM   72   C CA  . VAL A 1 41  ? 6.243   7.539   16.820  1.00 23.86 ? 18  VAL A CA  1 
ATOM   73   C C   . VAL A 1 41  ? 5.646   8.358   17.957  1.00 25.17 ? 18  VAL A C   1 
ATOM   74   O O   . VAL A 1 41  ? 5.370   9.549   17.807  1.00 24.99 ? 18  VAL A O   1 
ATOM   75   C CB  . VAL A 1 41  ? 7.681   7.100   17.197  1.00 25.32 ? 18  VAL A CB  1 
ATOM   76   C CG1 . VAL A 1 41  ? 8.295   6.308   16.058  1.00 23.22 ? 18  VAL A CG1 1 
ATOM   77   C CG2 . VAL A 1 41  ? 8.535   8.319   17.524  1.00 24.77 ? 18  VAL A CG2 1 
ATOM   78   N N   . ARG A 1 42  ? 5.434   7.718   19.095  1.00 25.31 ? 19  ARG A N   1 
ATOM   79   C CA  . ARG A 1 42  ? 4.867   8.410   20.232  1.00 24.11 ? 19  ARG A CA  1 
ATOM   80   C C   . ARG A 1 42  ? 5.320   7.708   21.490  1.00 25.04 ? 19  ARG A C   1 
ATOM   81   O O   . ARG A 1 42  ? 5.275   6.481   21.577  1.00 23.60 ? 19  ARG A O   1 
ATOM   82   C CB  . ARG A 1 42  ? 3.346   8.409   20.161  1.00 19.36 ? 19  ARG A CB  1 
ATOM   83   C CG  . ARG A 1 42  ? 2.723   9.125   21.344  1.00 23.42 ? 19  ARG A CG  1 
ATOM   84   C CD  . ARG A 1 42  ? 1.339   9.647   21.050  1.00 20.24 ? 19  ARG A CD  1 
ATOM   85   N NE  . ARG A 1 42  ? 0.945   10.625  22.053  1.00 24.68 ? 19  ARG A NE  1 
ATOM   86   C CZ  . ARG A 1 42  ? -0.209  11.283  22.046  1.00 26.42 ? 19  ARG A CZ  1 
ATOM   87   N NH1 . ARG A 1 42  ? -1.090  11.072  21.082  1.00 28.15 ? 19  ARG A NH1 1 
ATOM   88   N NH2 . ARG A 1 42  ? -0.489  12.146  23.011  1.00 27.79 ? 19  ARG A NH2 1 
ATOM   89   N N   . ALA A 1 43  ? 5.782   8.492   22.455  1.00 26.58 ? 20  ALA A N   1 
ATOM   90   C CA  . ALA A 1 43  ? 6.243   7.928   23.706  1.00 28.99 ? 20  ALA A CA  1 
ATOM   91   C C   . ALA A 1 43  ? 5.090   7.155   24.356  1.00 30.18 ? 20  ALA A C   1 
ATOM   92   O O   . ALA A 1 43  ? 3.922   7.574   24.289  1.00 28.91 ? 20  ALA A O   1 
ATOM   93   C CB  . ALA A 1 43  ? 6.738   9.039   24.627  1.00 27.13 ? 20  ALA A CB  1 
ATOM   94   N N   . LEU A 1 44  ? 5.417   6.014   24.952  1.00 30.25 ? 21  LEU A N   1 
ATOM   95   C CA  . LEU A 1 44  ? 4.408   5.210   25.621  1.00 32.90 ? 21  LEU A CA  1 
ATOM   96   C C   . LEU A 1 44  ? 4.215   5.795   27.020  1.00 33.56 ? 21  LEU A C   1 
ATOM   97   O O   . LEU A 1 44  ? 5.180   6.160   27.687  1.00 31.56 ? 21  LEU A O   1 
ATOM   98   C CB  . LEU A 1 44  ? 4.848   3.732   25.714  1.00 32.55 ? 21  LEU A CB  1 
ATOM   99   C CG  . LEU A 1 44  ? 6.076   3.393   26.573  1.00 33.94 ? 21  LEU A CG  1 
ATOM   100  C CD1 . LEU A 1 44  ? 5.660   2.497   27.721  1.00 33.07 ? 21  LEU A CD1 1 
ATOM   101  C CD2 . LEU A 1 44  ? 7.145   2.707   25.729  1.00 33.84 ? 21  LEU A CD2 1 
ATOM   102  N N   . PRO A 1 45  ? 2.959   5.921   27.465  1.00 36.65 ? 22  PRO A N   1 
ATOM   103  C CA  . PRO A 1 45  ? 2.693   6.467   28.795  1.00 40.18 ? 22  PRO A CA  1 
ATOM   104  C C   . PRO A 1 45  ? 2.927   5.441   29.897  1.00 42.50 ? 22  PRO A C   1 
ATOM   105  O O   . PRO A 1 45  ? 2.899   4.228   29.658  1.00 43.06 ? 22  PRO A O   1 
ATOM   106  C CB  . PRO A 1 45  ? 1.234   6.908   28.703  1.00 40.67 ? 22  PRO A CB  1 
ATOM   107  C CG  . PRO A 1 45  ? 0.659   5.915   27.774  1.00 40.10 ? 22  PRO A CG  1 
ATOM   108  C CD  . PRO A 1 45  ? 1.712   5.811   26.694  1.00 38.25 ? 22  PRO A CD  1 
ATOM   109  N N   . GLU A 1 46  ? 3.162   5.942   31.103  1.00 43.62 ? 23  GLU A N   1 
ATOM   110  C CA  . GLU A 1 46  ? 3.406   5.097   32.264  1.00 46.19 ? 23  GLU A CA  1 
ATOM   111  C C   . GLU A 1 46  ? 2.170   4.250   32.557  1.00 45.81 ? 23  GLU A C   1 
ATOM   112  O O   . GLU A 1 46  ? 2.274   3.103   33.001  1.00 45.89 ? 23  GLU A O   1 
ATOM   113  C CB  . GLU A 1 46  ? 3.733   5.987   33.461  1.00 49.18 ? 23  GLU A CB  1 
ATOM   114  C CG  . GLU A 1 46  ? 4.644   5.367   34.500  1.00 54.13 ? 23  GLU A CG  1 
ATOM   115  C CD  . GLU A 1 46  ? 5.407   6.430   35.281  1.00 56.67 ? 23  GLU A CD  1 
ATOM   116  O OE1 . GLU A 1 46  ? 6.117   7.231   34.631  1.00 56.46 ? 23  GLU A OE1 1 
ATOM   117  O OE2 . GLU A 1 46  ? 5.297   6.467   36.530  1.00 56.77 ? 23  GLU A OE2 1 
ATOM   118  N N   . SER A 1 47  ? 1.003   4.826   32.286  1.00 45.01 ? 24  SER A N   1 
ATOM   119  C CA  . SER A 1 47  ? -0.276  4.166   32.524  1.00 43.87 ? 24  SER A CA  1 
ATOM   120  C C   . SER A 1 47  ? -0.491  2.936   31.662  1.00 42.66 ? 24  SER A C   1 
ATOM   121  O O   . SER A 1 47  ? -1.385  2.138   31.932  1.00 41.04 ? 24  SER A O   1 
ATOM   122  C CB  . SER A 1 47  ? -1.422  5.137   32.275  1.00 44.46 ? 24  SER A CB  1 
ATOM   123  O OG  . SER A 1 47  ? -1.577  5.366   30.889  1.00 47.33 ? 24  SER A OG  1 
ATOM   124  N N   . LEU A 1 48  ? 0.312   2.786   30.615  1.00 42.28 ? 25  LEU A N   1 
ATOM   125  C CA  . LEU A 1 48  ? 0.171   1.631   29.739  1.00 42.32 ? 25  LEU A CA  1 
ATOM   126  C C   . LEU A 1 48  ? 0.379   0.362   30.560  1.00 41.24 ? 25  LEU A C   1 
ATOM   127  O O   . LEU A 1 48  ? -0.299  -0.646  30.351  1.00 40.18 ? 25  LEU A O   1 
ATOM   128  C CB  . LEU A 1 48  ? 1.187   1.700   28.588  1.00 43.44 ? 25  LEU A CB  1 
ATOM   129  C CG  . LEU A 1 48  ? 1.280   0.516   27.609  1.00 43.65 ? 25  LEU A CG  1 
ATOM   130  C CD1 . LEU A 1 48  ? 1.922   0.950   26.301  1.00 43.35 ? 25  LEU A CD1 1 
ATOM   131  C CD2 . LEU A 1 48  ? 2.077   -0.612  28.242  1.00 42.98 ? 25  LEU A CD2 1 
ATOM   132  N N   . GLY A 1 49  ? 1.310   0.435   31.505  1.00 39.29 ? 26  GLY A N   1 
ATOM   133  C CA  . GLY A 1 49  ? 1.610   -0.709  32.343  1.00 39.00 ? 26  GLY A CA  1 
ATOM   134  C C   . GLY A 1 49  ? 0.408   -1.447  32.891  1.00 37.56 ? 26  GLY A C   1 
ATOM   135  O O   . GLY A 1 49  ? 0.375   -2.672  32.867  1.00 37.74 ? 26  GLY A O   1 
ATOM   136  N N   . GLN A 1 50  ? -0.584  -0.708  33.369  1.00 37.27 ? 27  GLN A N   1 
ATOM   137  C CA  . GLN A 1 50  ? -1.775  -1.322  33.948  1.00 39.58 ? 27  GLN A CA  1 
ATOM   138  C C   . GLN A 1 50  ? -3.121  -1.003  33.295  1.00 40.03 ? 27  GLN A C   1 
ATOM   139  O O   . GLN A 1 50  ? -4.151  -1.559  33.694  1.00 39.40 ? 27  GLN A O   1 
ATOM   140  C CB  . GLN A 1 50  ? -1.896  -0.944  35.423  1.00 40.21 ? 27  GLN A CB  1 
ATOM   141  C CG  . GLN A 1 50  ? -0.886  -1.551  36.360  1.00 42.19 ? 27  GLN A CG  1 
ATOM   142  C CD  . GLN A 1 50  ? -1.381  -1.498  37.791  1.00 45.51 ? 27  GLN A CD  1 
ATOM   143  O OE1 . GLN A 1 50  ? -1.890  -0.469  38.247  1.00 46.95 ? 27  GLN A OE1 1 
ATOM   144  N NE2 . GLN A 1 50  ? -1.241  -2.607  38.508  1.00 46.21 ? 27  GLN A NE2 1 
ATOM   145  N N   . HIS A 1 51  ? -3.138  -0.124  32.304  1.00 40.75 ? 28  HIS A N   1 
ATOM   146  C CA  . HIS A 1 51  ? -4.417  0.235   31.702  1.00 43.07 ? 28  HIS A CA  1 
ATOM   147  C C   . HIS A 1 51  ? -4.502  0.024   30.205  1.00 41.55 ? 28  HIS A C   1 
ATOM   148  O O   . HIS A 1 51  ? -5.582  0.134   29.624  1.00 39.78 ? 28  HIS A O   1 
ATOM   149  C CB  . HIS A 1 51  ? -4.741  1.688   32.045  1.00 46.60 ? 28  HIS A CB  1 
ATOM   150  C CG  . HIS A 1 51  ? -4.622  1.991   33.508  1.00 51.82 ? 28  HIS A CG  1 
ATOM   151  N ND1 . HIS A 1 51  ? -5.573  1.602   34.429  1.00 53.71 ? 28  HIS A ND1 1 
ATOM   152  C CD2 . HIS A 1 51  ? -3.629  2.577   34.219  1.00 52.81 ? 28  HIS A CD2 1 
ATOM   153  C CE1 . HIS A 1 51  ? -5.170  1.935   35.643  1.00 54.49 ? 28  HIS A CE1 1 
ATOM   154  N NE2 . HIS A 1 51  ? -3.993  2.528   35.543  1.00 54.32 ? 28  HIS A NE2 1 
ATOM   155  N N   . ALA A 1 52  ? -3.369  -0.274  29.580  1.00 40.46 ? 29  ALA A N   1 
ATOM   156  C CA  . ALA A 1 52  ? -3.369  -0.499  28.150  1.00 39.55 ? 29  ALA A CA  1 
ATOM   157  C C   . ALA A 1 52  ? -4.254  -1.701  27.900  1.00 39.32 ? 29  ALA A C   1 
ATOM   158  O O   . ALA A 1 52  ? -4.154  -2.715  28.590  1.00 38.45 ? 29  ALA A O   1 
ATOM   159  C CB  . ALA A 1 52  ? -1.972  -0.767  27.652  1.00 39.69 ? 29  ALA A CB  1 
ATOM   160  N N   . LEU A 1 53  ? -5.137  -1.564  26.922  1.00 39.46 ? 30  LEU A N   1 
ATOM   161  C CA  . LEU A 1 53  ? -6.049  -2.625  26.556  1.00 39.86 ? 30  LEU A CA  1 
ATOM   162  C C   . LEU A 1 53  ? -5.205  -3.822  26.120  1.00 40.87 ? 30  LEU A C   1 
ATOM   163  O O   . LEU A 1 53  ? -4.201  -3.668  25.420  1.00 40.22 ? 30  LEU A O   1 
ATOM   164  C CB  . LEU A 1 53  ? -6.970  -2.143  25.419  1.00 38.59 ? 30  LEU A CB  1 
ATOM   165  C CG  . LEU A 1 53  ? -7.693  -0.792  25.630  1.00 37.74 ? 30  LEU A CG  1 
ATOM   166  C CD1 . LEU A 1 53  ? -8.642  -0.520  24.468  1.00 35.40 ? 30  LEU A CD1 1 
ATOM   167  C CD2 . LEU A 1 53  ? -8.473  -0.803  26.951  1.00 36.91 ? 30  LEU A CD2 1 
ATOM   168  N N   . ARG A 1 54  ? -5.594  -5.010  26.558  1.00 42.21 ? 31  ARG A N   1 
ATOM   169  C CA  . ARG A 1 54  ? -4.853  -6.214  26.206  1.00 45.41 ? 31  ARG A CA  1 
ATOM   170  C C   . ARG A 1 54  ? -5.821  -7.370  26.076  1.00 47.12 ? 31  ARG A C   1 
ATOM   171  O O   . ARG A 1 54  ? -6.661  -7.584  26.943  1.00 47.88 ? 31  ARG A O   1 
ATOM   172  C CB  . ARG A 1 54  ? -3.806  -6.518  27.278  1.00 44.47 ? 31  ARG A CB  1 
ATOM   173  C CG  . ARG A 1 54  ? -4.383  -6.732  28.651  1.00 43.62 ? 31  ARG A CG  1 
ATOM   174  C CD  . ARG A 1 54  ? -3.323  -6.531  29.701  1.00 44.69 ? 31  ARG A CD  1 
ATOM   175  N NE  . ARG A 1 54  ? -3.044  -5.118  29.924  1.00 43.73 ? 31  ARG A NE  1 
ATOM   176  C CZ  . ARG A 1 54  ? -1.965  -4.667  30.552  1.00 44.99 ? 31  ARG A CZ  1 
ATOM   177  N NH1 . ARG A 1 54  ? -1.060  -5.524  31.014  1.00 44.44 ? 31  ARG A NH1 1 
ATOM   178  N NH2 . ARG A 1 54  ? -1.792  -3.363  30.727  1.00 42.39 ? 31  ARG A NH2 1 
ATOM   179  N N   . SER A 1 55  ? -5.708  -8.114  24.985  1.00 50.21 ? 32  SER A N   1 
ATOM   180  C CA  . SER A 1 55  ? -6.605  -9.241  24.759  1.00 53.71 ? 32  SER A CA  1 
ATOM   181  C C   . SER A 1 55  ? -6.412  -10.345 25.792  1.00 55.55 ? 32  SER A C   1 
ATOM   182  O O   . SER A 1 55  ? -7.376  -10.785 26.414  1.00 56.52 ? 32  SER A O   1 
ATOM   183  C CB  . SER A 1 55  ? -6.415  -9.803  23.344  1.00 53.64 ? 32  SER A CB  1 
ATOM   184  O OG  . SER A 1 55  ? -5.088  -10.251 23.127  1.00 56.12 ? 32  SER A OG  1 
ATOM   185  N N   . ALA A 1 56  ? -5.171  -10.780 25.989  1.00 57.08 ? 33  ALA A N   1 
ATOM   186  C CA  . ALA A 1 56  ? -4.893  -11.842 26.948  1.00 58.25 ? 33  ALA A CA  1 
ATOM   187  C C   . ALA A 1 56  ? -4.295  -11.328 28.243  1.00 58.49 ? 33  ALA A C   1 
ATOM   188  O O   . ALA A 1 56  ? -3.554  -10.344 28.251  1.00 58.68 ? 33  ALA A O   1 
ATOM   189  C CB  . ALA A 1 56  ? -3.955  -12.874 26.328  1.00 58.61 ? 33  ALA A CB  1 
ATOM   190  N N   . LYS A 1 57  ? -4.629  -12.004 29.338  1.00 58.88 ? 34  LYS A N   1 
ATOM   191  C CA  . LYS A 1 57  ? -4.099  -11.652 30.647  1.00 59.39 ? 34  LYS A CA  1 
ATOM   192  C C   . LYS A 1 57  ? -2.787  -12.423 30.783  1.00 59.27 ? 34  LYS A C   1 
ATOM   193  O O   . LYS A 1 57  ? -2.784  -13.641 30.953  1.00 60.11 ? 34  LYS A O   1 
ATOM   194  C CB  . LYS A 1 57  ? -5.075  -12.060 31.744  1.00 59.39 ? 34  LYS A CB  1 
ATOM   195  N N   . GLY A 1 58  ? -1.674  -11.710 30.683  1.00 58.79 ? 35  GLY A N   1 
ATOM   196  C CA  . GLY A 1 58  ? -0.383  -12.358 30.783  1.00 58.49 ? 35  GLY A CA  1 
ATOM   197  C C   . GLY A 1 58  ? 0.350   -11.928 32.027  1.00 58.08 ? 35  GLY A C   1 
ATOM   198  O O   . GLY A 1 58  ? -0.272  -11.583 33.025  1.00 57.21 ? 35  GLY A O   1 
ATOM   199  N N   . GLU A 1 59  ? 1.675   -11.948 31.978  1.00 57.87 ? 36  GLU A N   1 
ATOM   200  C CA  . GLU A 1 59  ? 2.446   -11.543 33.135  1.00 58.24 ? 36  GLU A CA  1 
ATOM   201  C C   . GLU A 1 59  ? 2.506   -10.023 33.191  1.00 56.51 ? 36  GLU A C   1 
ATOM   202  O O   . GLU A 1 59  ? 2.213   -9.352  32.206  1.00 56.21 ? 36  GLU A O   1 
ATOM   203  C CB  . GLU A 1 59  ? 3.846   -12.149 33.071  1.00 60.75 ? 36  GLU A CB  1 
ATOM   204  C CG  . GLU A 1 59  ? 4.680   -11.719 31.886  1.00 64.88 ? 36  GLU A CG  1 
ATOM   205  C CD  . GLU A 1 59  ? 5.874   -12.630 31.684  1.00 68.03 ? 36  GLU A CD  1 
ATOM   206  O OE1 . GLU A 1 59  ? 6.801   -12.250 30.932  1.00 69.41 ? 36  GLU A OE1 1 
ATOM   207  O OE2 . GLU A 1 59  ? 5.875   -13.735 32.275  1.00 68.44 ? 36  GLU A OE2 1 
ATOM   208  N N   . GLU A 1 60  ? 2.868   -9.482  34.347  1.00 54.83 ? 37  GLU A N   1 
ATOM   209  C CA  . GLU A 1 60  ? 2.945   -8.039  34.505  1.00 53.51 ? 37  GLU A CA  1 
ATOM   210  C C   . GLU A 1 60  ? 3.870   -7.364  33.491  1.00 52.94 ? 37  GLU A C   1 
ATOM   211  O O   . GLU A 1 60  ? 4.941   -7.876  33.149  1.00 50.92 ? 37  GLU A O   1 
ATOM   212  C CB  . GLU A 1 60  ? 3.394   -7.671  35.924  1.00 53.83 ? 37  GLU A CB  1 
ATOM   213  C CG  . GLU A 1 60  ? 3.484   -6.161  36.152  1.00 52.22 ? 37  GLU A CG  1 
ATOM   214  C CD  . GLU A 1 60  ? 3.730   -5.794  37.596  1.00 50.23 ? 37  GLU A CD  1 
ATOM   215  O OE1 . GLU A 1 60  ? 4.801   -6.147  38.128  1.00 46.80 ? 37  GLU A OE1 1 
ATOM   216  O OE2 . GLU A 1 60  ? 2.843   -5.149  38.194  1.00 50.20 ? 37  GLU A OE2 1 
ATOM   217  N N   . VAL A 1 61  ? 3.434   -6.200  33.020  1.00 51.66 ? 38  VAL A N   1 
ATOM   218  C CA  . VAL A 1 61  ? 4.196   -5.431  32.056  1.00 49.80 ? 38  VAL A CA  1 
ATOM   219  C C   . VAL A 1 61  ? 5.257   -4.616  32.762  1.00 49.06 ? 38  VAL A C   1 
ATOM   220  O O   . VAL A 1 61  ? 4.948   -3.804  33.636  1.00 47.66 ? 38  VAL A O   1 
ATOM   221  C CB  . VAL A 1 61  ? 3.306   -4.454  31.295  1.00 49.84 ? 38  VAL A CB  1 
ATOM   222  C CG1 . VAL A 1 61  ? 4.154   -3.628  30.350  1.00 49.60 ? 38  VAL A CG1 1 
ATOM   223  C CG2 . VAL A 1 61  ? 2.234   -5.207  30.543  1.00 50.40 ? 38  VAL A CG2 1 
ATOM   224  N N   . ASP A 1 62  ? 6.510   -4.837  32.393  1.00 48.24 ? 39  ASP A N   1 
ATOM   225  C CA  . ASP A 1 62  ? 7.581   -4.070  32.991  1.00 48.01 ? 39  ASP A CA  1 
ATOM   226  C C   . ASP A 1 62  ? 7.731   -2.825  32.126  1.00 47.87 ? 39  ASP A C   1 
ATOM   227  O O   . ASP A 1 62  ? 8.440   -2.851  31.120  1.00 47.53 ? 39  ASP A O   1 
ATOM   228  C CB  . ASP A 1 62  ? 8.878   -4.855  32.985  1.00 48.83 ? 39  ASP A CB  1 
ATOM   229  C CG  . ASP A 1 62  ? 9.946   -4.190  33.814  1.00 50.56 ? 39  ASP A CG  1 
ATOM   230  O OD1 . ASP A 1 62  ? 10.116  -2.962  33.685  1.00 52.02 ? 39  ASP A OD1 1 
ATOM   231  O OD2 . ASP A 1 62  ? 10.616  -4.889  34.596  1.00 53.10 ? 39  ASP A OD2 1 
ATOM   232  N N   . VAL A 1 63  ? 7.055   -1.745  32.523  1.00 46.95 ? 40  VAL A N   1 
ATOM   233  C CA  . VAL A 1 63  ? 7.069   -0.490  31.775  1.00 45.62 ? 40  VAL A CA  1 
ATOM   234  C C   . VAL A 1 63  ? 8.466   -0.015  31.443  1.00 45.68 ? 40  VAL A C   1 
ATOM   235  O O   . VAL A 1 63  ? 8.692   0.594   30.396  1.00 46.39 ? 40  VAL A O   1 
ATOM   236  C CB  . VAL A 1 63  ? 6.354   0.638   32.538  1.00 45.04 ? 40  VAL A CB  1 
ATOM   237  C CG1 . VAL A 1 63  ? 6.379   1.908   31.723  1.00 44.44 ? 40  VAL A CG1 1 
ATOM   238  C CG2 . VAL A 1 63  ? 4.922   0.243   32.824  1.00 45.28 ? 40  VAL A CG2 1 
ATOM   239  N N   . ALA A 1 64  ? 9.406   -0.292  32.333  1.00 45.04 ? 41  ALA A N   1 
ATOM   240  C CA  . ALA A 1 64  ? 10.784  0.121   32.114  1.00 45.12 ? 41  ALA A CA  1 
ATOM   241  C C   . ALA A 1 64  ? 11.379  -0.556  30.877  1.00 44.51 ? 41  ALA A C   1 
ATOM   242  O O   . ALA A 1 64  ? 11.971  0.103   30.020  1.00 44.06 ? 41  ALA A O   1 
ATOM   243  C CB  . ALA A 1 64  ? 11.619  -0.200  33.348  1.00 45.11 ? 41  ALA A CB  1 
ATOM   244  N N   . ARG A 1 65  ? 11.215  -1.875  30.786  1.00 44.17 ? 42  ARG A N   1 
ATOM   245  C CA  . ARG A 1 65  ? 11.745  -2.628  29.655  1.00 42.24 ? 42  ARG A CA  1 
ATOM   246  C C   . ARG A 1 65  ? 11.076  -2.168  28.369  1.00 40.01 ? 42  ARG A C   1 
ATOM   247  O O   . ARG A 1 65  ? 11.689  -2.145  27.308  1.00 39.70 ? 42  ARG A O   1 
ATOM   248  C CB  . ARG A 1 65  ? 11.511  -4.131  29.839  1.00 42.23 ? 42  ARG A CB  1 
ATOM   249  C CG  . ARG A 1 65  ? 12.330  -4.958  28.868  1.00 43.99 ? 42  ARG A CG  1 
ATOM   250  C CD  . ARG A 1 65  ? 12.008  -6.433  28.884  1.00 45.47 ? 42  ARG A CD  1 
ATOM   251  N NE  . ARG A 1 65  ? 12.899  -7.135  27.964  1.00 48.72 ? 42  ARG A NE  1 
ATOM   252  C CZ  . ARG A 1 65  ? 12.695  -8.363  27.501  1.00 49.23 ? 42  ARG A CZ  1 
ATOM   253  N NH1 . ARG A 1 65  ? 11.613  -9.038  27.870  1.00 48.93 ? 42  ARG A NH1 1 
ATOM   254  N NH2 . ARG A 1 65  ? 13.575  -8.913  26.669  1.00 47.66 ? 42  ARG A NH2 1 
ATOM   255  N N   . ALA A 1 66  ? 9.808   -1.805  28.481  1.00 38.94 ? 43  ALA A N   1 
ATOM   256  C CA  . ALA A 1 66  ? 9.038   -1.340  27.343  1.00 37.60 ? 43  ALA A CA  1 
ATOM   257  C C   . ALA A 1 66  ? 9.670   -0.079  26.780  1.00 37.37 ? 43  ALA A C   1 
ATOM   258  O O   . ALA A 1 66  ? 9.694   0.123   25.572  1.00 38.20 ? 43  ALA A O   1 
ATOM   259  C CB  . ALA A 1 66  ? 7.615   -1.065  27.771  1.00 36.25 ? 43  ALA A CB  1 
ATOM   260  N N   . GLU A 1 67  ? 10.176  0.766   27.666  1.00 36.69 ? 44  GLU A N   1 
ATOM   261  C CA  . GLU A 1 67  ? 10.814  2.003   27.261  1.00 37.92 ? 44  GLU A CA  1 
ATOM   262  C C   . GLU A 1 67  ? 12.077  1.637   26.506  1.00 37.85 ? 44  GLU A C   1 
ATOM   263  O O   . GLU A 1 67  ? 12.320  2.105   25.399  1.00 38.05 ? 44  GLU A O   1 
ATOM   264  C CB  . GLU A 1 67  ? 11.188  2.819   28.491  1.00 41.05 ? 44  GLU A CB  1 
ATOM   265  C CG  . GLU A 1 67  ? 11.514  4.255   28.184  1.00 44.39 ? 44  GLU A CG  1 
ATOM   266  C CD  . GLU A 1 67  ? 10.276  5.034   27.816  1.00 47.77 ? 44  GLU A CD  1 
ATOM   267  O OE1 . GLU A 1 67  ? 9.322   5.026   28.631  1.00 50.17 ? 44  GLU A OE1 1 
ATOM   268  O OE2 . GLU A 1 67  ? 10.252  5.647   26.724  1.00 47.03 ? 44  GLU A OE2 1 
ATOM   269  N N   . ARG A 1 68  ? 12.885  0.793   27.135  1.00 37.79 ? 45  ARG A N   1 
ATOM   270  C CA  . ARG A 1 68  ? 14.132  0.314   26.552  1.00 37.03 ? 45  ARG A CA  1 
ATOM   271  C C   . ARG A 1 68  ? 13.878  -0.269  25.156  1.00 38.05 ? 45  ARG A C   1 
ATOM   272  O O   . ARG A 1 68  ? 14.605  0.028   24.198  1.00 38.00 ? 45  ARG A O   1 
ATOM   273  C CB  . ARG A 1 68  ? 14.732  -0.770  27.450  1.00 35.70 ? 45  ARG A CB  1 
ATOM   274  C CG  . ARG A 1 68  ? 16.090  -1.317  27.015  1.00 33.31 ? 45  ARG A CG  1 
ATOM   275  C CD  . ARG A 1 68  ? 17.231  -0.405  27.441  1.00 32.05 ? 45  ARG A CD  1 
ATOM   276  N NE  . ARG A 1 68  ? 17.613  0.586   26.438  1.00 30.07 ? 45  ARG A NE  1 
ATOM   277  C CZ  . ARG A 1 68  ? 17.292  1.874   26.476  1.00 33.26 ? 45  ARG A CZ  1 
ATOM   278  N NH1 . ARG A 1 68  ? 16.558  2.369   27.475  1.00 33.41 ? 45  ARG A NH1 1 
ATOM   279  N NH2 . ARG A 1 68  ? 17.745  2.684   25.521  1.00 35.17 ? 45  ARG A NH2 1 
ATOM   280  N N   . GLN A 1 69  ? 12.852  -1.109  25.047  1.00 36.23 ? 46  GLN A N   1 
ATOM   281  C CA  . GLN A 1 69  ? 12.540  -1.715  23.769  1.00 35.70 ? 46  GLN A CA  1 
ATOM   282  C C   . GLN A 1 69  ? 12.103  -0.636  22.799  1.00 34.45 ? 46  GLN A C   1 
ATOM   283  O O   . GLN A 1 69  ? 12.572  -0.576  21.670  1.00 34.67 ? 46  GLN A O   1 
ATOM   284  C CB  . GLN A 1 69  ? 11.424  -2.757  23.911  1.00 36.95 ? 46  GLN A CB  1 
ATOM   285  C CG  . GLN A 1 69  ? 11.749  -3.926  24.821  1.00 38.98 ? 46  GLN A CG  1 
ATOM   286  C CD  . GLN A 1 69  ? 10.898  -5.147  24.526  1.00 39.40 ? 46  GLN A CD  1 
ATOM   287  O OE1 . GLN A 1 69  ? 9.705   -5.035  24.246  1.00 39.90 ? 46  GLN A OE1 1 
ATOM   288  N NE2 . GLN A 1 69  ? 11.509  -6.324  24.598  1.00 40.73 ? 46  GLN A NE2 1 
ATOM   289  N N   . HIS A 1 70  ? 11.209  0.232   23.251  1.00 33.59 ? 47  HIS A N   1 
ATOM   290  C CA  . HIS A 1 70  ? 10.707  1.282   22.386  1.00 31.92 ? 47  HIS A CA  1 
ATOM   291  C C   . HIS A 1 70  ? 11.801  2.244   21.988  1.00 30.09 ? 47  HIS A C   1 
ATOM   292  O O   . HIS A 1 70  ? 11.808  2.733   20.859  1.00 31.37 ? 47  HIS A O   1 
ATOM   293  C CB  . HIS A 1 70  ? 9.548   2.020   23.056  1.00 31.51 ? 47  HIS A CB  1 
ATOM   294  C CG  . HIS A 1 70  ? 8.832   2.970   22.148  1.00 32.47 ? 47  HIS A CG  1 
ATOM   295  N ND1 . HIS A 1 70  ? 9.191   4.296   22.020  1.00 33.01 ? 47  HIS A ND1 1 
ATOM   296  C CD2 . HIS A 1 70  ? 7.779   2.786   21.317  1.00 33.53 ? 47  HIS A CD2 1 
ATOM   297  C CE1 . HIS A 1 70  ? 8.387   4.887   21.153  1.00 32.33 ? 47  HIS A CE1 1 
ATOM   298  N NE2 . HIS A 1 70  ? 7.521   3.993   20.711  1.00 30.96 ? 47  HIS A NE2 1 
ATOM   299  N N   . GLN A 1 71  ? 12.727  2.512   22.903  1.00 28.62 ? 48  GLN A N   1 
ATOM   300  C CA  . GLN A 1 71  ? 13.834  3.412   22.610  1.00 28.12 ? 48  GLN A CA  1 
ATOM   301  C C   . GLN A 1 71  ? 14.613  2.848   21.417  1.00 28.35 ? 48  GLN A C   1 
ATOM   302  O O   . GLN A 1 71  ? 14.809  3.528   20.413  1.00 28.87 ? 48  GLN A O   1 
ATOM   303  C CB  . GLN A 1 71  ? 14.760  3.536   23.825  1.00 28.41 ? 48  GLN A CB  1 
ATOM   304  C CG  . GLN A 1 71  ? 14.118  4.136   25.082  1.00 35.69 ? 48  GLN A CG  1 
ATOM   305  C CD  . GLN A 1 71  ? 14.661  5.530   25.476  1.00 36.20 ? 48  GLN A CD  1 
ATOM   306  O OE1 . GLN A 1 71  ? 14.289  6.082   26.523  1.00 33.28 ? 48  GLN A OE1 1 
ATOM   307  N NE2 . GLN A 1 71  ? 15.532  6.093   24.642  1.00 34.55 ? 48  GLN A NE2 1 
ATOM   308  N N   . LEU A 1 72  ? 15.037  1.590   21.523  1.00 27.89 ? 49  LEU A N   1 
ATOM   309  C CA  . LEU A 1 72  ? 15.794  0.931   20.458  1.00 27.24 ? 49  LEU A CA  1 
ATOM   310  C C   . LEU A 1 72  ? 15.021  0.941   19.141  1.00 27.13 ? 49  LEU A C   1 
ATOM   311  O O   . LEU A 1 72  ? 15.594  1.146   18.069  1.00 28.80 ? 49  LEU A O   1 
ATOM   312  C CB  . LEU A 1 72  ? 16.123  -0.519  20.855  1.00 23.36 ? 49  LEU A CB  1 
ATOM   313  C CG  . LEU A 1 72  ? 16.806  -0.742  22.207  1.00 23.38 ? 49  LEU A CG  1 
ATOM   314  C CD1 . LEU A 1 72  ? 17.080  -2.229  22.421  1.00 22.86 ? 49  LEU A CD1 1 
ATOM   315  C CD2 . LEU A 1 72  ? 18.097  0.036   22.266  1.00 23.16 ? 49  LEU A CD2 1 
ATOM   316  N N   . TYR A 1 73  ? 13.718  0.715   19.230  1.00 26.67 ? 50  TYR A N   1 
ATOM   317  C CA  . TYR A 1 73  ? 12.849  0.703   18.062  1.00 28.05 ? 50  TYR A CA  1 
ATOM   318  C C   . TYR A 1 73  ? 12.977  2.012   17.289  1.00 27.53 ? 50  TYR A C   1 
ATOM   319  O O   . TYR A 1 73  ? 13.199  2.007   16.078  1.00 29.94 ? 50  TYR A O   1 
ATOM   320  C CB  . TYR A 1 73  ? 11.403  0.494   18.509  1.00 30.16 ? 50  TYR A CB  1 
ATOM   321  C CG  . TYR A 1 73  ? 10.392  0.451   17.395  1.00 31.43 ? 50  TYR A CG  1 
ATOM   322  C CD1 . TYR A 1 73  ? 10.133  -0.735  16.699  1.00 30.44 ? 50  TYR A CD1 1 
ATOM   323  C CD2 . TYR A 1 73  ? 9.656   1.588   17.060  1.00 31.05 ? 50  TYR A CD2 1 
ATOM   324  C CE1 . TYR A 1 73  ? 9.156   -0.787  15.701  1.00 29.07 ? 50  TYR A CE1 1 
ATOM   325  C CE2 . TYR A 1 73  ? 8.680   1.548   16.064  1.00 31.23 ? 50  TYR A CE2 1 
ATOM   326  C CZ  . TYR A 1 73  ? 8.431   0.360   15.390  1.00 30.56 ? 50  TYR A CZ  1 
ATOM   327  O OH  . TYR A 1 73  ? 7.444   0.326   14.427  1.00 30.67 ? 50  TYR A OH  1 
ATOM   328  N N   . VAL A 1 74  ? 12.843  3.138   17.979  1.00 27.46 ? 51  VAL A N   1 
ATOM   329  C CA  . VAL A 1 74  ? 12.979  4.426   17.298  1.00 28.12 ? 51  VAL A CA  1 
ATOM   330  C C   . VAL A 1 74  ? 14.428  4.612   16.842  1.00 28.35 ? 51  VAL A C   1 
ATOM   331  O O   . VAL A 1 74  ? 14.684  5.189   15.780  1.00 30.38 ? 51  VAL A O   1 
ATOM   332  C CB  . VAL A 1 74  ? 12.565  5.618   18.220  1.00 27.47 ? 51  VAL A CB  1 
ATOM   333  C CG1 . VAL A 1 74  ? 12.944  6.954   17.571  1.00 24.30 ? 51  VAL A CG1 1 
ATOM   334  C CG2 . VAL A 1 74  ? 11.065  5.576   18.465  1.00 26.44 ? 51  VAL A CG2 1 
ATOM   335  N N   . GLY A 1 75  ? 15.366  4.115   17.648  1.00 27.91 ? 52  GLY A N   1 
ATOM   336  C CA  . GLY A 1 75  ? 16.778  4.218   17.316  1.00 25.73 ? 52  GLY A CA  1 
ATOM   337  C C   . GLY A 1 75  ? 17.059  3.601   15.967  1.00 24.53 ? 52  GLY A C   1 
ATOM   338  O O   . GLY A 1 75  ? 17.804  4.164   15.167  1.00 25.63 ? 52  GLY A O   1 
ATOM   339  N N   . VAL A 1 76  ? 16.460  2.440   15.712  1.00 22.41 ? 53  VAL A N   1 
ATOM   340  C CA  . VAL A 1 76  ? 16.633  1.757   14.432  1.00 19.46 ? 53  VAL A CA  1 
ATOM   341  C C   . VAL A 1 76  ? 16.048  2.592   13.298  1.00 19.90 ? 53  VAL A C   1 
ATOM   342  O O   . VAL A 1 76  ? 16.674  2.786   12.274  1.00 20.01 ? 53  VAL A O   1 
ATOM   343  C CB  . VAL A 1 76  ? 15.931  0.375   14.429  1.00 18.63 ? 53  VAL A CB  1 
ATOM   344  C CG1 . VAL A 1 76  ? 15.882  -0.188  13.012  1.00 15.82 ? 53  VAL A CG1 1 
ATOM   345  C CG2 . VAL A 1 76  ? 16.671  -0.588  15.342  1.00 15.43 ? 53  VAL A CG2 1 
ATOM   346  N N   . LEU A 1 77  ? 14.832  3.086   13.478  1.00 23.58 ? 54  LEU A N   1 
ATOM   347  C CA  . LEU A 1 77  ? 14.204  3.895   12.431  1.00 24.07 ? 54  LEU A CA  1 
ATOM   348  C C   . LEU A 1 77  ? 14.969  5.201   12.132  1.00 25.19 ? 54  LEU A C   1 
ATOM   349  O O   . LEU A 1 77  ? 15.227  5.524   10.963  1.00 25.90 ? 54  LEU A O   1 
ATOM   350  C CB  . LEU A 1 77  ? 12.734  4.206   12.803  1.00 18.75 ? 54  LEU A CB  1 
ATOM   351  C CG  . LEU A 1 77  ? 11.795  2.998   13.014  1.00 16.12 ? 54  LEU A CG  1 
ATOM   352  C CD1 . LEU A 1 77  ? 10.460  3.462   13.519  1.00 11.67 ? 54  LEU A CD1 1 
ATOM   353  C CD2 . LEU A 1 77  ? 11.613  2.224   11.723  1.00 12.76 ? 54  LEU A CD2 1 
ATOM   354  N N   . GLY A 1 78  ? 15.348  5.930   13.180  1.00 25.17 ? 55  GLY A N   1 
ATOM   355  C CA  . GLY A 1 78  ? 16.046  7.193   12.990  1.00 28.42 ? 55  GLY A CA  1 
ATOM   356  C C   . GLY A 1 78  ? 17.558  7.138   12.932  1.00 30.11 ? 55  GLY A C   1 
ATOM   357  O O   . GLY A 1 78  ? 18.153  7.267   11.860  1.00 30.01 ? 55  GLY A O   1 
ATOM   358  N N   . SER A 1 79  ? 18.184  6.954   14.089  1.00 33.00 ? 56  SER A N   1 
ATOM   359  C CA  . SER A 1 79  ? 19.642  6.889   14.169  1.00 35.88 ? 56  SER A CA  1 
ATOM   360  C C   . SER A 1 79  ? 20.254  5.907   13.170  1.00 36.91 ? 56  SER A C   1 
ATOM   361  O O   . SER A 1 79  ? 21.200  6.250   12.463  1.00 37.26 ? 56  SER A O   1 
ATOM   362  C CB  . SER A 1 79  ? 20.088  6.503   15.585  1.00 36.85 ? 56  SER A CB  1 
ATOM   363  O OG  . SER A 1 79  ? 19.572  7.398   16.556  1.00 37.74 ? 56  SER A OG  1 
ATOM   364  N N   . LYS A 1 80  ? 19.712  4.695   13.103  1.00 35.62 ? 57  LYS A N   1 
ATOM   365  C CA  . LYS A 1 80  ? 20.258  3.693   12.205  1.00 36.44 ? 57  LYS A CA  1 
ATOM   366  C C   . LYS A 1 80  ? 19.808  3.718   10.746  1.00 35.67 ? 57  LYS A C   1 
ATOM   367  O O   . LYS A 1 80  ? 20.603  3.405   9.858   1.00 36.40 ? 57  LYS A O   1 
ATOM   368  C CB  . LYS A 1 80  ? 20.028  2.293   12.772  1.00 38.01 ? 57  LYS A CB  1 
ATOM   369  C CG  . LYS A 1 80  ? 20.511  1.197   11.832  1.00 40.98 ? 57  LYS A CG  1 
ATOM   370  C CD  . LYS A 1 80  ? 20.764  -0.121  12.553  1.00 44.30 ? 57  LYS A CD  1 
ATOM   371  C CE  . LYS A 1 80  ? 21.530  -1.097  11.663  1.00 43.81 ? 57  LYS A CE  1 
ATOM   372  N NZ  . LYS A 1 80  ? 21.993  -2.291  12.419  1.00 45.12 ? 57  LYS A NZ  1 
ATOM   373  N N   . LEU A 1 81  ? 18.554  4.069   10.474  1.00 33.63 ? 58  LEU A N   1 
ATOM   374  C CA  . LEU A 1 81  ? 18.104  4.088   9.084   1.00 31.52 ? 58  LEU A CA  1 
ATOM   375  C C   . LEU A 1 81  ? 17.941  5.479   8.496   1.00 32.48 ? 58  LEU A C   1 
ATOM   376  O O   . LEU A 1 81  ? 17.468  5.621   7.375   1.00 34.06 ? 58  LEU A O   1 
ATOM   377  C CB  . LEU A 1 81  ? 16.801  3.300   8.923   1.00 27.23 ? 58  LEU A CB  1 
ATOM   378  C CG  . LEU A 1 81  ? 16.914  1.805   9.233   1.00 26.67 ? 58  LEU A CG  1 
ATOM   379  C CD1 . LEU A 1 81  ? 15.606  1.145   8.906   1.00 26.50 ? 58  LEU A CD1 1 
ATOM   380  C CD2 . LEU A 1 81  ? 18.049  1.156   8.434   1.00 25.54 ? 58  LEU A CD2 1 
ATOM   381  N N   . GLY A 1 82  ? 18.337  6.502   9.243   1.00 32.56 ? 59  GLY A N   1 
ATOM   382  C CA  . GLY A 1 82  ? 18.235  7.860   8.741   1.00 33.13 ? 59  GLY A CA  1 
ATOM   383  C C   . GLY A 1 82  ? 16.837  8.431   8.580   1.00 33.66 ? 59  GLY A C   1 
ATOM   384  O O   . GLY A 1 82  ? 16.676  9.594   8.205   1.00 34.53 ? 59  GLY A O   1 
ATOM   385  N N   . LEU A 1 83  ? 15.815  7.629   8.854   1.00 34.82 ? 60  LEU A N   1 
ATOM   386  C CA  . LEU A 1 83  ? 14.450  8.122   8.728   1.00 33.52 ? 60  LEU A CA  1 
ATOM   387  C C   . LEU A 1 83  ? 14.244  9.292   9.662   1.00 33.47 ? 60  LEU A C   1 
ATOM   388  O O   . LEU A 1 83  ? 14.615  9.238   10.839  1.00 33.83 ? 60  LEU A O   1 
ATOM   389  C CB  . LEU A 1 83  ? 13.427  7.028   9.064   1.00 32.76 ? 60  LEU A CB  1 
ATOM   390  C CG  . LEU A 1 83  ? 13.110  5.967   8.005   1.00 33.49 ? 60  LEU A CG  1 
ATOM   391  C CD1 . LEU A 1 83  ? 12.145  4.964   8.590   1.00 33.86 ? 60  LEU A CD1 1 
ATOM   392  C CD2 . LEU A 1 83  ? 12.504  6.612   6.762   1.00 32.58 ? 60  LEU A CD2 1 
ATOM   393  N N   . GLN A 1 84  ? 13.681  10.365  9.132   1.00 33.11 ? 61  GLN A N   1 
ATOM   394  C CA  . GLN A 1 84  ? 13.399  11.511  9.961   1.00 35.51 ? 61  GLN A CA  1 
ATOM   395  C C   . GLN A 1 84  ? 12.289  11.041  10.884  1.00 35.34 ? 61  GLN A C   1 
ATOM   396  O O   . GLN A 1 84  ? 11.202  10.672  10.431  1.00 34.75 ? 61  GLN A O   1 
ATOM   397  C CB  . GLN A 1 84  ? 12.926  12.692  9.112   1.00 39.09 ? 61  GLN A CB  1 
ATOM   398  C CG  . GLN A 1 84  ? 14.029  13.668  8.779   1.00 45.69 ? 61  GLN A CG  1 
ATOM   399  C CD  . GLN A 1 84  ? 14.675  14.256  10.027  1.00 49.19 ? 61  GLN A CD  1 
ATOM   400  O OE1 . GLN A 1 84  ? 15.248  13.531  10.849  1.00 50.62 ? 61  GLN A OE1 1 
ATOM   401  N NE2 . GLN A 1 84  ? 14.581  15.577  10.177  1.00 50.35 ? 61  GLN A NE2 1 
ATOM   402  N N   . VAL A 1 85  ? 12.559  11.034  12.180  1.00 34.99 ? 62  VAL A N   1 
ATOM   403  C CA  . VAL A 1 85  ? 11.548  10.578  13.108  1.00 36.70 ? 62  VAL A CA  1 
ATOM   404  C C   . VAL A 1 85  ? 10.864  11.697  13.869  1.00 37.15 ? 62  VAL A C   1 
ATOM   405  O O   . VAL A 1 85  ? 11.505  12.616  14.384  1.00 37.44 ? 62  VAL A O   1 
ATOM   406  C CB  . VAL A 1 85  ? 12.130  9.570   14.119  1.00 38.56 ? 62  VAL A CB  1 
ATOM   407  C CG1 . VAL A 1 85  ? 11.037  9.109   15.078  1.00 40.56 ? 62  VAL A CG1 1 
ATOM   408  C CG2 . VAL A 1 85  ? 12.713  8.368   13.383  1.00 39.29 ? 62  VAL A CG2 1 
ATOM   409  N N   . VAL A 1 86  ? 9.543   11.615  13.919  1.00 35.75 ? 63  VAL A N   1 
ATOM   410  C CA  . VAL A 1 86  ? 8.746   12.583  14.642  1.00 36.81 ? 63  VAL A CA  1 
ATOM   411  C C   . VAL A 1 86  ? 8.283   11.862  15.890  1.00 36.06 ? 63  VAL A C   1 
ATOM   412  O O   . VAL A 1 86  ? 7.515   10.915  15.812  1.00 33.88 ? 63  VAL A O   1 
ATOM   413  C CB  . VAL A 1 86  ? 7.548   13.045  13.820  1.00 37.80 ? 63  VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 86  ? 6.679   13.962  14.666  1.00 38.41 ? 63  VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 86  ? 8.037   13.781  12.564  1.00 36.21 ? 63  VAL A CG2 1 
ATOM   416  N N   . GLU A 1 87  ? 8.775   12.323  17.036  1.00 38.23 ? 64  GLU A N   1 
ATOM   417  C CA  . GLU A 1 87  ? 8.495   11.710  18.333  1.00 40.25 ? 64  GLU A CA  1 
ATOM   418  C C   . GLU A 1 87  ? 7.385   12.353  19.161  1.00 39.44 ? 64  GLU A C   1 
ATOM   419  O O   . GLU A 1 87  ? 7.665   13.089  20.103  1.00 41.99 ? 64  GLU A O   1 
ATOM   420  C CB  . GLU A 1 87  ? 9.808   11.683  19.136  1.00 43.28 ? 64  GLU A CB  1 
ATOM   421  C CG  . GLU A 1 87  ? 9.771   11.081  20.562  1.00 47.60 ? 64  GLU A CG  1 
ATOM   422  C CD  . GLU A 1 87  ? 9.532   9.578   20.587  1.00 48.43 ? 64  GLU A CD  1 
ATOM   423  O OE1 . GLU A 1 87  ? 8.361   9.168   20.454  1.00 52.41 ? 64  GLU A OE1 1 
ATOM   424  O OE2 . GLU A 1 87  ? 10.511  8.810   20.732  1.00 46.94 ? 64  GLU A OE2 1 
ATOM   425  N N   . LEU A 1 88  ? 6.130   12.064  18.830  1.00 37.79 ? 65  LEU A N   1 
ATOM   426  C CA  . LEU A 1 88  ? 4.999   12.615  19.581  1.00 37.83 ? 65  LEU A CA  1 
ATOM   427  C C   . LEU A 1 88  ? 5.121   12.341  21.081  1.00 36.53 ? 65  LEU A C   1 
ATOM   428  O O   . LEU A 1 88  ? 5.518   11.254  21.487  1.00 34.80 ? 65  LEU A O   1 
ATOM   429  C CB  . LEU A 1 88  ? 3.684   12.009  19.081  1.00 39.11 ? 65  LEU A CB  1 
ATOM   430  C CG  . LEU A 1 88  ? 3.262   12.260  17.629  1.00 39.38 ? 65  LEU A CG  1 
ATOM   431  C CD1 . LEU A 1 88  ? 2.015   11.453  17.321  1.00 39.39 ? 65  LEU A CD1 1 
ATOM   432  C CD2 . LEU A 1 88  ? 2.994   13.736  17.411  1.00 39.02 ? 65  LEU A CD2 1 
ATOM   433  N N   . PRO A 1 89  ? 4.793   13.335  21.924  1.00 37.30 ? 66  PRO A N   1 
ATOM   434  C CA  . PRO A 1 89  ? 4.885   13.130  23.371  1.00 37.66 ? 66  PRO A CA  1 
ATOM   435  C C   . PRO A 1 89  ? 3.805   12.180  23.885  1.00 38.91 ? 66  PRO A C   1 
ATOM   436  O O   . PRO A 1 89  ? 2.698   12.115  23.340  1.00 39.83 ? 66  PRO A O   1 
ATOM   437  C CB  . PRO A 1 89  ? 4.741   14.545  23.935  1.00 37.01 ? 66  PRO A CB  1 
ATOM   438  C CG  . PRO A 1 89  ? 3.901   15.242  22.921  1.00 36.80 ? 66  PRO A CG  1 
ATOM   439  C CD  . PRO A 1 89  ? 4.492   14.747  21.617  1.00 38.53 ? 66  PRO A CD  1 
ATOM   440  N N   . ALA A 1 90  ? 4.137   11.440  24.936  1.00 37.72 ? 67  ALA A N   1 
ATOM   441  C CA  . ALA A 1 90  ? 3.206   10.494  25.515  1.00 37.40 ? 67  ALA A CA  1 
ATOM   442  C C   . ALA A 1 90  ? 2.124   11.181  26.331  1.00 38.37 ? 67  ALA A C   1 
ATOM   443  O O   . ALA A 1 90  ? 2.346   12.219  26.959  1.00 38.49 ? 67  ALA A O   1 
ATOM   444  C CB  . ALA A 1 90  ? 3.949   9.505   26.391  1.00 35.88 ? 67  ALA A CB  1 
ATOM   445  N N   . ASP A 1 91  ? 0.940   10.596  26.307  1.00 39.13 ? 68  ASP A N   1 
ATOM   446  C CA  . ASP A 1 91  ? -0.153  11.129  27.083  1.00 41.29 ? 68  ASP A CA  1 
ATOM   447  C C   . ASP A 1 91  ? -0.596  10.013  28.012  1.00 41.04 ? 68  ASP A C   1 
ATOM   448  O O   . ASP A 1 91  ? -1.041  8.958   27.566  1.00 40.75 ? 68  ASP A O   1 
ATOM   449  C CB  . ASP A 1 91  ? -1.304  11.558  26.186  1.00 42.20 ? 68  ASP A CB  1 
ATOM   450  C CG  . ASP A 1 91  ? -2.480  12.082  26.975  1.00 43.20 ? 68  ASP A CG  1 
ATOM   451  O OD1 . ASP A 1 91  ? -3.544  12.299  26.368  1.00 43.71 ? 68  ASP A OD1 1 
ATOM   452  O OD2 . ASP A 1 91  ? -2.344  12.276  28.203  1.00 44.17 ? 68  ASP A OD2 1 
ATOM   453  N N   . GLU A 1 92  ? -0.450  10.253  29.308  1.00 42.19 ? 69  GLU A N   1 
ATOM   454  C CA  . GLU A 1 92  ? -0.812  9.272   30.322  1.00 41.95 ? 69  GLU A CA  1 
ATOM   455  C C   . GLU A 1 92  ? -2.249  8.794   30.203  1.00 40.69 ? 69  GLU A C   1 
ATOM   456  O O   . GLU A 1 92  ? -2.523  7.616   30.403  1.00 41.70 ? 69  GLU A O   1 
ATOM   457  C CB  . GLU A 1 92  ? -0.586  9.850   31.718  1.00 43.63 ? 69  GLU A CB  1 
ATOM   458  C CG  . GLU A 1 92  ? 0.878   10.056  32.089  1.00 45.00 ? 69  GLU A CG  1 
ATOM   459  C CD  . GLU A 1 92  ? 1.664   8.759   32.096  1.00 45.28 ? 69  GLU A CD  1 
ATOM   460  O OE1 . GLU A 1 92  ? 1.201   7.784   32.727  1.00 44.05 ? 69  GLU A OE1 1 
ATOM   461  O OE2 . GLU A 1 92  ? 2.749   8.718   31.479  1.00 45.87 ? 69  GLU A OE2 1 
ATOM   462  N N   . SER A 1 93  ? -3.166  9.698   29.874  1.00 38.79 ? 70  SER A N   1 
ATOM   463  C CA  . SER A 1 93  ? -4.569  9.326   29.754  1.00 37.24 ? 70  SER A CA  1 
ATOM   464  C C   . SER A 1 93  ? -4.853  8.415   28.557  1.00 38.02 ? 70  SER A C   1 
ATOM   465  O O   . SER A 1 93  ? -5.923  7.810   28.488  1.00 39.50 ? 70  SER A O   1 
ATOM   466  C CB  . SER A 1 93  ? -5.446  10.567  29.653  1.00 35.47 ? 70  SER A CB  1 
ATOM   467  O OG  . SER A 1 93  ? -5.388  11.122  28.356  1.00 31.19 ? 70  SER A OG  1 
ATOM   468  N N   . LEU A 1 94  ? -3.913  8.335   27.615  1.00 36.83 ? 71  LEU A N   1 
ATOM   469  C CA  . LEU A 1 94  ? -4.067  7.475   26.435  1.00 36.51 ? 71  LEU A CA  1 
ATOM   470  C C   . LEU A 1 94  ? -3.020  6.374   26.543  1.00 35.47 ? 71  LEU A C   1 
ATOM   471  O O   . LEU A 1 94  ? -2.025  6.366   25.828  1.00 34.85 ? 71  LEU A O   1 
ATOM   472  C CB  . LEU A 1 94  ? -3.841  8.265   25.138  1.00 35.22 ? 71  LEU A CB  1 
ATOM   473  C CG  . LEU A 1 94  ? -4.568  9.602   24.976  1.00 34.78 ? 71  LEU A CG  1 
ATOM   474  C CD1 . LEU A 1 94  ? -4.386  10.101  23.551  1.00 33.84 ? 71  LEU A CD1 1 
ATOM   475  C CD2 . LEU A 1 94  ? -6.040  9.442   25.302  1.00 31.38 ? 71  LEU A CD2 1 
ATOM   476  N N   . PRO A 1 95  ? -3.244  5.416   27.445  1.00 36.28 ? 72  PRO A N   1 
ATOM   477  C CA  . PRO A 1 95  ? -2.289  4.319   27.630  1.00 34.57 ? 72  PRO A CA  1 
ATOM   478  C C   . PRO A 1 95  ? -1.839  3.589   26.360  1.00 32.15 ? 72  PRO A C   1 
ATOM   479  O O   . PRO A 1 95  ? -0.847  2.875   26.391  1.00 32.08 ? 72  PRO A O   1 
ATOM   480  C CB  . PRO A 1 95  ? -2.999  3.411   28.640  1.00 34.52 ? 72  PRO A CB  1 
ATOM   481  C CG  . PRO A 1 95  ? -4.452  3.670   28.370  1.00 36.25 ? 72  PRO A CG  1 
ATOM   482  C CD  . PRO A 1 95  ? -4.491  5.164   28.190  1.00 35.91 ? 72  PRO A CD  1 
ATOM   483  N N   . ASP A 1 96  ? -2.548  3.783   25.252  1.00 30.99 ? 73  ASP A N   1 
ATOM   484  C CA  . ASP A 1 96  ? -2.184  3.139   23.987  1.00 31.64 ? 73  ASP A CA  1 
ATOM   485  C C   . ASP A 1 96  ? -1.620  4.085   22.909  1.00 30.84 ? 73  ASP A C   1 
ATOM   486  O O   . ASP A 1 96  ? -1.399  3.662   21.771  1.00 29.56 ? 73  ASP A O   1 
ATOM   487  C CB  . ASP A 1 96  ? -3.390  2.399   23.394  1.00 32.73 ? 73  ASP A CB  1 
ATOM   488  C CG  . ASP A 1 96  ? -3.854  1.232   24.255  1.00 34.17 ? 73  ASP A CG  1 
ATOM   489  O OD1 . ASP A 1 96  ? -4.908  1.384   24.917  1.00 33.80 ? 73  ASP A OD1 1 
ATOM   490  O OD2 . ASP A 1 96  ? -3.169  0.174   24.269  1.00 31.98 ? 73  ASP A OD2 1 
ATOM   491  N N   . CYS A 1 97  ? -1.386  5.348   23.266  1.00 30.03 ? 74  CYS A N   1 
ATOM   492  C CA  . CYS A 1 97  ? -0.864  6.344   22.323  1.00 29.23 ? 74  CYS A CA  1 
ATOM   493  C C   . CYS A 1 97  ? 0.391   5.899   21.563  1.00 26.84 ? 74  CYS A C   1 
ATOM   494  O O   . CYS A 1 97  ? 0.689   6.406   20.487  1.00 25.41 ? 74  CYS A O   1 
ATOM   495  C CB  . CYS A 1 97  ? -0.588  7.667   23.053  1.00 31.08 ? 74  CYS A CB  1 
ATOM   496  S SG  . CYS A 1 97  ? 0.423   7.568   24.561  1.00 38.28 ? 74  CYS A SG  1 
ATOM   497  N N   . VAL A 1 98  ? 1.101   4.930   22.132  1.00 26.69 ? 75  VAL A N   1 
ATOM   498  C CA  . VAL A 1 98  ? 2.320   4.382   21.555  1.00 23.04 ? 75  VAL A CA  1 
ATOM   499  C C   . VAL A 1 98  ? 2.110   3.549   20.279  1.00 23.10 ? 75  VAL A C   1 
ATOM   500  O O   . VAL A 1 98  ? 2.994   3.482   19.421  1.00 21.53 ? 75  VAL A O   1 
ATOM   501  C CB  . VAL A 1 98  ? 3.045   3.514   22.586  1.00 21.06 ? 75  VAL A CB  1 
ATOM   502  C CG1 . VAL A 1 98  ? 2.197   2.322   22.923  1.00 21.63 ? 75  VAL A CG1 1 
ATOM   503  C CG2 . VAL A 1 98  ? 4.399   3.092   22.054  1.00 20.55 ? 75  VAL A CG2 1 
ATOM   504  N N   . PHE A 1 99  ? 0.951   2.924   20.135  1.00 20.57 ? 76  PHE A N   1 
ATOM   505  C CA  . PHE A 1 99  ? 0.719   2.123   18.943  1.00 20.53 ? 76  PHE A CA  1 
ATOM   506  C C   . PHE A 1 99  ? 0.061   2.964   17.875  1.00 20.45 ? 76  PHE A C   1 
ATOM   507  O O   . PHE A 1 99  ? -1.017  2.660   17.381  1.00 21.25 ? 76  PHE A O   1 
ATOM   508  C CB  . PHE A 1 99  ? -0.121  0.913   19.308  1.00 21.90 ? 76  PHE A CB  1 
ATOM   509  C CG  . PHE A 1 99  ? 0.423   0.158   20.487  1.00 24.35 ? 76  PHE A CG  1 
ATOM   510  C CD1 . PHE A 1 99  ? -0.358  -0.059  21.616  1.00 24.35 ? 76  PHE A CD1 1 
ATOM   511  C CD2 . PHE A 1 99  ? 1.731   -0.318  20.474  1.00 26.34 ? 76  PHE A CD2 1 
ATOM   512  C CE1 . PHE A 1 99  ? 0.153   -0.742  22.720  1.00 25.80 ? 76  PHE A CE1 1 
ATOM   513  C CE2 . PHE A 1 99  ? 2.257   -1.005  21.573  1.00 28.04 ? 76  PHE A CE2 1 
ATOM   514  C CZ  . PHE A 1 99  ? 1.465   -1.217  22.699  1.00 26.69 ? 76  PHE A CZ  1 
ATOM   515  N N   . VAL A 1 100 ? 0.772   4.015   17.498  1.00 21.68 ? 77  VAL A N   1 
ATOM   516  C CA  . VAL A 1 100 ? 0.327   4.982   16.513  1.00 21.63 ? 77  VAL A CA  1 
ATOM   517  C C   . VAL A 1 100 ? -0.226  4.468   15.191  1.00 22.18 ? 77  VAL A C   1 
ATOM   518  O O   . VAL A 1 100 ? -1.108  5.087   14.612  1.00 20.53 ? 77  VAL A O   1 
ATOM   519  C CB  . VAL A 1 100 ? 1.455   5.997   16.251  1.00 23.94 ? 77  VAL A CB  1 
ATOM   520  C CG1 . VAL A 1 100 ? 1.682   6.823   17.515  1.00 23.03 ? 77  VAL A CG1 1 
ATOM   521  C CG2 . VAL A 1 100 ? 2.752   5.272   15.866  1.00 20.72 ? 77  VAL A CG2 1 
ATOM   522  N N   . GLU A 1 101 ? 0.265   3.338   14.705  1.00 24.45 ? 78  GLU A N   1 
ATOM   523  C CA  . GLU A 1 101 ? -0.240  2.817   13.437  1.00 24.98 ? 78  GLU A CA  1 
ATOM   524  C C   . GLU A 1 101 ? -1.753  2.586   13.397  1.00 24.76 ? 78  GLU A C   1 
ATOM   525  O O   . GLU A 1 101 ? -2.345  2.548   12.323  1.00 26.14 ? 78  GLU A O   1 
ATOM   526  C CB  . GLU A 1 101 ? 0.457   1.507   13.078  1.00 26.57 ? 78  GLU A CB  1 
ATOM   527  C CG  . GLU A 1 101 ? -0.485  0.488   12.477  1.00 29.52 ? 78  GLU A CG  1 
ATOM   528  C CD  . GLU A 1 101 ? 0.220   -0.727  11.961  1.00 32.63 ? 78  GLU A CD  1 
ATOM   529  O OE1 . GLU A 1 101 ? 0.782   -0.638  10.849  1.00 34.70 ? 78  GLU A OE1 1 
ATOM   530  O OE2 . GLU A 1 101 ? 0.222   -1.766  12.665  1.00 33.96 ? 78  GLU A OE2 1 
ATOM   531  N N   . ASP A 1 102 ? -2.388  2.403   14.546  1.00 23.17 ? 79  ASP A N   1 
ATOM   532  C CA  . ASP A 1 102 ? -3.829  2.170   14.533  1.00 21.81 ? 79  ASP A CA  1 
ATOM   533  C C   . ASP A 1 102 ? -4.681  3.407   14.268  1.00 21.95 ? 79  ASP A C   1 
ATOM   534  O O   . ASP A 1 102 ? -5.784  3.298   13.753  1.00 22.16 ? 79  ASP A O   1 
ATOM   535  C CB  . ASP A 1 102 ? -4.262  1.499   15.836  1.00 20.18 ? 79  ASP A CB  1 
ATOM   536  C CG  . ASP A 1 102 ? -3.911  0.018   15.867  1.00 20.04 ? 79  ASP A CG  1 
ATOM   537  O OD1 . ASP A 1 102 ? -4.266  -0.684  14.903  1.00 22.22 ? 79  ASP A OD1 1 
ATOM   538  O OD2 . ASP A 1 102 ? -3.290  -0.451  16.841  1.00 19.68 ? 79  ASP A OD2 1 
ATOM   539  N N   . VAL A 1 103 ? -4.145  4.582   14.585  1.00 24.63 ? 80  VAL A N   1 
ATOM   540  C CA  . VAL A 1 103 ? -4.847  5.854   14.418  1.00 26.90 ? 80  VAL A CA  1 
ATOM   541  C C   . VAL A 1 103 ? -4.733  6.498   13.041  1.00 29.72 ? 80  VAL A C   1 
ATOM   542  O O   . VAL A 1 103 ? -5.456  7.455   12.741  1.00 30.69 ? 80  VAL A O   1 
ATOM   543  C CB  . VAL A 1 103 ? -4.338  6.903   15.429  1.00 26.89 ? 80  VAL A CB  1 
ATOM   544  C CG1 . VAL A 1 103 ? -3.953  6.230   16.730  1.00 28.72 ? 80  VAL A CG1 1 
ATOM   545  C CG2 . VAL A 1 103 ? -3.156  7.658   14.848  1.00 27.21 ? 80  VAL A CG2 1 
ATOM   546  N N   . ALA A 1 104 ? -3.825  6.003   12.208  1.00 30.67 ? 81  ALA A N   1 
ATOM   547  C CA  . ALA A 1 104 ? -3.668  6.602   10.897  1.00 33.13 ? 81  ALA A CA  1 
ATOM   548  C C   . ALA A 1 104 ? -3.001  5.689   9.886   1.00 34.70 ? 81  ALA A C   1 
ATOM   549  O O   . ALA A 1 104 ? -2.188  4.842   10.229  1.00 36.89 ? 81  ALA A O   1 
ATOM   550  C CB  . ALA A 1 104 ? -2.886  7.896   11.019  1.00 32.19 ? 81  ALA A CB  1 
ATOM   551  N N   . VAL A 1 105 ? -3.356  5.887   8.627   1.00 36.03 ? 82  VAL A N   1 
ATOM   552  C CA  . VAL A 1 105 ? -2.820  5.108   7.529   1.00 36.78 ? 82  VAL A CA  1 
ATOM   553  C C   . VAL A 1 105 ? -2.413  6.110   6.448   1.00 38.23 ? 82  VAL A C   1 
ATOM   554  O O   . VAL A 1 105 ? -3.241  6.893   5.977   1.00 37.20 ? 82  VAL A O   1 
ATOM   555  C CB  . VAL A 1 105 ? -3.898  4.150   6.995   1.00 36.71 ? 82  VAL A CB  1 
ATOM   556  C CG1 . VAL A 1 105 ? -3.317  3.234   5.925   1.00 36.08 ? 82  VAL A CG1 1 
ATOM   557  C CG2 . VAL A 1 105 ? -4.476  3.348   8.147   1.00 36.31 ? 82  VAL A CG2 1 
ATOM   558  N N   . VAL A 1 106 ? -1.136  6.105   6.076   1.00 39.28 ? 83  VAL A N   1 
ATOM   559  C CA  . VAL A 1 106 ? -0.644  7.033   5.063   1.00 41.64 ? 83  VAL A CA  1 
ATOM   560  C C   . VAL A 1 106 ? -0.306  6.335   3.758   1.00 43.06 ? 83  VAL A C   1 
ATOM   561  O O   . VAL A 1 106 ? 0.492   5.403   3.721   1.00 43.78 ? 83  VAL A O   1 
ATOM   562  C CB  . VAL A 1 106 ? 0.604   7.807   5.553   1.00 41.05 ? 83  VAL A CB  1 
ATOM   563  C CG1 . VAL A 1 106 ? 1.584   6.863   6.211   1.00 42.43 ? 83  VAL A CG1 1 
ATOM   564  C CG2 . VAL A 1 106 ? 1.275   8.506   4.381   1.00 42.08 ? 83  VAL A CG2 1 
ATOM   565  N N   . CYS A 1 107 ? -0.924  6.796   2.681   1.00 44.08 ? 84  CYS A N   1 
ATOM   566  C CA  . CYS A 1 107 ? -0.690  6.212   1.377   1.00 45.63 ? 84  CYS A CA  1 
ATOM   567  C C   . CYS A 1 107 ? -0.184  7.299   0.447   1.00 45.93 ? 84  CYS A C   1 
ATOM   568  O O   . CYS A 1 107 ? -0.941  8.196   0.057   1.00 45.08 ? 84  CYS A O   1 
ATOM   569  C CB  . CYS A 1 107 ? -1.978  5.613   0.827   1.00 45.79 ? 84  CYS A CB  1 
ATOM   570  S SG  . CYS A 1 107 ? -1.714  4.740   -0.706  1.00 53.13 ? 84  CYS A SG  1 
ATOM   571  N N   . GLU A 1 108 ? 1.097   7.202   0.094   1.00 46.14 ? 85  GLU A N   1 
ATOM   572  C CA  . GLU A 1 108 ? 1.742   8.181   -0.769  1.00 46.08 ? 85  GLU A CA  1 
ATOM   573  C C   . GLU A 1 108 ? 1.709   9.545   -0.089  1.00 44.80 ? 85  GLU A C   1 
ATOM   574  O O   . GLU A 1 108 ? 2.401   9.763   0.906   1.00 44.22 ? 85  GLU A O   1 
ATOM   575  C CB  . GLU A 1 108 ? 1.053   8.241   -2.144  1.00 47.43 ? 85  GLU A CB  1 
ATOM   576  C CG  . GLU A 1 108 ? 1.541   7.178   -3.131  1.00 50.74 ? 85  GLU A CG  1 
ATOM   577  C CD  . GLU A 1 108 ? 0.826   7.232   -4.473  1.00 52.92 ? 85  GLU A CD  1 
ATOM   578  O OE1 . GLU A 1 108 ? -0.341  6.797   -4.555  1.00 55.07 ? 85  GLU A OE1 1 
ATOM   579  O OE2 . GLU A 1 108 ? 1.430   7.716   -5.452  1.00 53.54 ? 85  GLU A OE2 1 
ATOM   580  N N   . GLU A 1 109 ? 0.881   10.446  -0.603  1.00 42.74 ? 86  GLU A N   1 
ATOM   581  C CA  . GLU A 1 109 ? 0.780   11.787  -0.057  1.00 43.86 ? 86  GLU A CA  1 
ATOM   582  C C   . GLU A 1 109 ? -0.469  12.032  0.801   1.00 42.73 ? 86  GLU A C   1 
ATOM   583  O O   . GLU A 1 109 ? -0.587  13.063  1.461   1.00 41.10 ? 86  GLU A O   1 
ATOM   584  C CB  . GLU A 1 109 ? 0.832   12.787  -1.215  1.00 46.55 ? 86  GLU A CB  1 
ATOM   585  C CG  . GLU A 1 109 ? 2.186   12.834  -1.942  1.00 50.52 ? 86  GLU A CG  1 
ATOM   586  C CD  . GLU A 1 109 ? 2.698   11.452  -2.352  1.00 53.41 ? 86  GLU A CD  1 
ATOM   587  O OE1 . GLU A 1 109 ? 2.013   10.767  -3.141  1.00 55.68 ? 86  GLU A OE1 1 
ATOM   588  O OE2 . GLU A 1 109 ? 3.784   11.045  -1.884  1.00 53.99 ? 86  GLU A OE2 1 
ATOM   589  N N   . THR A 1 110 ? -1.383  11.068  0.814   1.00 42.26 ? 87  THR A N   1 
ATOM   590  C CA  . THR A 1 110 ? -2.630  11.202  1.561   1.00 41.27 ? 87  THR A CA  1 
ATOM   591  C C   . THR A 1 110 ? -2.660  10.447  2.887   1.00 40.14 ? 87  THR A C   1 
ATOM   592  O O   . THR A 1 110 ? -2.290  9.276   2.964   1.00 38.49 ? 87  THR A O   1 
ATOM   593  C CB  . THR A 1 110 ? -3.815  10.712  0.718   1.00 42.50 ? 87  THR A CB  1 
ATOM   594  O OG1 . THR A 1 110 ? -3.688  11.207  -0.621  1.00 42.80 ? 87  THR A OG1 1 
ATOM   595  C CG2 . THR A 1 110 ? -5.134  11.203  1.322   1.00 45.01 ? 87  THR A CG2 1 
ATOM   596  N N   . ALA A 1 111 ? -3.118  11.122  3.934   1.00 40.05 ? 88  ALA A N   1 
ATOM   597  C CA  . ALA A 1 111 ? -3.197  10.502  5.249   1.00 39.49 ? 88  ALA A CA  1 
ATOM   598  C C   . ALA A 1 111 ? -4.644  10.299  5.689   1.00 38.46 ? 88  ALA A C   1 
ATOM   599  O O   . ALA A 1 111 ? -5.471  11.188  5.561   1.00 39.02 ? 88  ALA A O   1 
ATOM   600  C CB  . ALA A 1 111 ? -2.457  11.353  6.276   1.00 38.79 ? 88  ALA A CB  1 
ATOM   601  N N   . LEU A 1 112 ? -4.942  9.113   6.199   1.00 38.83 ? 89  LEU A N   1 
ATOM   602  C CA  . LEU A 1 112 ? -6.277  8.808   6.674   1.00 37.50 ? 89  LEU A CA  1 
ATOM   603  C C   . LEU A 1 112 ? -6.235  8.608   8.174   1.00 37.20 ? 89  LEU A C   1 
ATOM   604  O O   . LEU A 1 112 ? -5.722  7.598   8.649   1.00 35.82 ? 89  LEU A O   1 
ATOM   605  C CB  . LEU A 1 112 ? -6.812  7.535   6.018   1.00 38.82 ? 89  LEU A CB  1 
ATOM   606  C CG  . LEU A 1 112 ? -8.082  6.960   6.665   1.00 40.11 ? 89  LEU A CG  1 
ATOM   607  C CD1 . LEU A 1 112 ? -9.210  7.988   6.585   1.00 41.17 ? 89  LEU A CD1 1 
ATOM   608  C CD2 . LEU A 1 112 ? -8.478  5.665   5.981   1.00 39.12 ? 89  LEU A CD2 1 
ATOM   609  N N   . ILE A 1 113 ? -6.752  9.580   8.920   1.00 37.05 ? 90  ILE A N   1 
ATOM   610  C CA  . ILE A 1 113 ? -6.790  9.460   10.370  1.00 35.79 ? 90  ILE A CA  1 
ATOM   611  C C   . ILE A 1 113 ? -7.971  8.524   10.621  1.00 35.31 ? 90  ILE A C   1 
ATOM   612  O O   . ILE A 1 113 ? -9.065  8.745   10.112  1.00 35.85 ? 90  ILE A O   1 
ATOM   613  C CB  . ILE A 1 113 ? -7.040  10.821  11.053  1.00 34.56 ? 90  ILE A CB  1 
ATOM   614  C CG1 . ILE A 1 113 ? -6.027  11.850  10.559  1.00 33.41 ? 90  ILE A CG1 1 
ATOM   615  C CG2 . ILE A 1 113 ? -6.879  10.677  12.552  1.00 32.78 ? 90  ILE A CG2 1 
ATOM   616  C CD1 . ILE A 1 113 ? -4.622  11.546  10.982  1.00 32.29 ? 90  ILE A CD1 1 
ATOM   617  N N   . THR A 1 114 ? -7.761  7.468   11.387  1.00 33.27 ? 91  THR A N   1 
ATOM   618  C CA  . THR A 1 114 ? -8.853  6.545   11.610  1.00 32.17 ? 91  THR A CA  1 
ATOM   619  C C   . THR A 1 114 ? -9.656  6.862   12.850  1.00 31.52 ? 91  THR A C   1 
ATOM   620  O O   . THR A 1 114 ? -9.385  7.817   13.574  1.00 32.68 ? 91  THR A O   1 
ATOM   621  C CB  . THR A 1 114 ? -8.355  5.084   11.734  1.00 30.60 ? 91  THR A CB  1 
ATOM   622  O OG1 . THR A 1 114 ? -7.590  4.943   12.933  1.00 31.10 ? 91  THR A OG1 1 
ATOM   623  C CG2 . THR A 1 114 ? -7.488  4.707   10.552  1.00 29.00 ? 91  THR A CG2 1 
ATOM   624  N N   . ARG A 1 115 ? -10.671 6.037   13.056  1.00 31.76 ? 92  ARG A N   1 
ATOM   625  C CA  . ARG A 1 115 ? -11.555 6.093   14.205  1.00 28.19 ? 92  ARG A CA  1 
ATOM   626  C C   . ARG A 1 115 ? -11.323 4.689   14.752  1.00 27.30 ? 92  ARG A C   1 
ATOM   627  O O   . ARG A 1 115 ? -11.914 3.719   14.277  1.00 27.21 ? 92  ARG A O   1 
ATOM   628  C CB  . ARG A 1 115 ? -12.999 6.279   13.742  1.00 26.54 ? 92  ARG A CB  1 
ATOM   629  C CG  . ARG A 1 115 ? -14.003 6.456   14.859  1.00 25.03 ? 92  ARG A CG  1 
ATOM   630  C CD  . ARG A 1 115 ? -15.335 6.985   14.323  1.00 22.66 ? 92  ARG A CD  1 
ATOM   631  N NE  . ARG A 1 115 ? -16.266 7.252   15.409  1.00 22.98 ? 92  ARG A NE  1 
ATOM   632  C CZ  . ARG A 1 115 ? -16.946 6.313   16.056  1.00 26.98 ? 92  ARG A CZ  1 
ATOM   633  N NH1 . ARG A 1 115 ? -16.807 5.032   15.716  1.00 28.83 ? 92  ARG A NH1 1 
ATOM   634  N NH2 . ARG A 1 115 ? -17.754 6.652   17.055  1.00 23.91 ? 92  ARG A NH2 1 
ATOM   635  N N   . PRO A 1 116 ? -10.420 4.562   15.736  1.00 27.56 ? 93  PRO A N   1 
ATOM   636  C CA  . PRO A 1 116 ? -10.060 3.289   16.376  1.00 26.82 ? 93  PRO A CA  1 
ATOM   637  C C   . PRO A 1 116 ? -11.239 2.408   16.783  1.00 30.14 ? 93  PRO A C   1 
ATOM   638  O O   . PRO A 1 116 ? -12.288 2.896   17.207  1.00 28.97 ? 93  PRO A O   1 
ATOM   639  C CB  . PRO A 1 116 ? -9.239  3.729   17.579  1.00 24.32 ? 93  PRO A CB  1 
ATOM   640  C CG  . PRO A 1 116 ? -8.642  5.023   17.137  1.00 24.40 ? 93  PRO A CG  1 
ATOM   641  C CD  . PRO A 1 116 ? -9.778  5.696   16.425  1.00 24.72 ? 93  PRO A CD  1 
ATOM   642  N N   . GLY A 1 117 ? -11.050 1.098   16.657  1.00 34.52 ? 94  GLY A N   1 
ATOM   643  C CA  . GLY A 1 117 ? -12.094 0.165   17.026  1.00 36.72 ? 94  GLY A CA  1 
ATOM   644  C C   . GLY A 1 117 ? -12.393 0.275   18.506  1.00 38.59 ? 94  GLY A C   1 
ATOM   645  O O   . GLY A 1 117 ? -13.511 -0.019  18.935  1.00 41.31 ? 94  GLY A O   1 
ATOM   646  N N   . ALA A 1 118 ? -11.389 0.688   19.280  1.00 38.41 ? 95  ALA A N   1 
ATOM   647  C CA  . ALA A 1 118 ? -11.510 0.855   20.726  1.00 39.90 ? 95  ALA A CA  1 
ATOM   648  C C   . ALA A 1 118 ? -11.869 2.308   21.058  1.00 43.12 ? 95  ALA A C   1 
ATOM   649  O O   . ALA A 1 118 ? -11.250 3.243   20.549  1.00 43.73 ? 95  ALA A O   1 
ATOM   650  C CB  . ALA A 1 118 ? -10.201 0.479   21.403  1.00 36.64 ? 95  ALA A CB  1 
ATOM   651  N N   . PRO A 1 119 ? -12.883 2.518   21.910  1.00 44.24 ? 96  PRO A N   1 
ATOM   652  C CA  . PRO A 1 119 ? -13.294 3.876   22.283  1.00 44.96 ? 96  PRO A CA  1 
ATOM   653  C C   . PRO A 1 119 ? -12.290 4.673   23.106  1.00 45.71 ? 96  PRO A C   1 
ATOM   654  O O   . PRO A 1 119 ? -12.075 5.859   22.851  1.00 45.89 ? 96  PRO A O   1 
ATOM   655  C CB  . PRO A 1 119 ? -14.593 3.640   23.039  1.00 45.71 ? 96  PRO A CB  1 
ATOM   656  C CG  . PRO A 1 119 ? -15.169 2.451   22.321  1.00 45.98 ? 96  PRO A CG  1 
ATOM   657  C CD  . PRO A 1 119 ? -13.957 1.553   22.203  1.00 45.25 ? 96  PRO A CD  1 
ATOM   658  N N   . SER A 1 120 ? -11.681 4.029   24.095  1.00 46.71 ? 97  SER A N   1 
ATOM   659  C CA  . SER A 1 120 ? -10.710 4.701   24.957  1.00 46.52 ? 97  SER A CA  1 
ATOM   660  C C   . SER A 1 120 ? -9.457  5.165   24.204  1.00 47.28 ? 97  SER A C   1 
ATOM   661  O O   . SER A 1 120 ? -8.571  5.802   24.781  1.00 47.64 ? 97  SER A O   1 
ATOM   662  C CB  . SER A 1 120 ? -10.306 3.780   26.117  1.00 45.84 ? 97  SER A CB  1 
ATOM   663  O OG  . SER A 1 120 ? -9.724  2.577   25.646  1.00 45.95 ? 97  SER A OG  1 
ATOM   664  N N   . ARG A 1 121 ? -9.388  4.851   22.915  1.00 46.69 ? 98  ARG A N   1 
ATOM   665  C CA  . ARG A 1 121 ? -8.243  5.237   22.103  1.00 46.09 ? 98  ARG A CA  1 
ATOM   666  C C   . ARG A 1 121 ? -8.560  6.357   21.105  1.00 47.27 ? 98  ARG A C   1 
ATOM   667  O O   . ARG A 1 121 ? -7.660  6.828   20.412  1.00 47.75 ? 98  ARG A O   1 
ATOM   668  C CB  . ARG A 1 121 ? -7.717  4.030   21.320  1.00 45.25 ? 98  ARG A CB  1 
ATOM   669  C CG  . ARG A 1 121 ? -7.258  2.850   22.155  1.00 43.18 ? 98  ARG A CG  1 
ATOM   670  C CD  . ARG A 1 121 ? -6.490  1.866   21.276  1.00 39.64 ? 98  ARG A CD  1 
ATOM   671  N NE  . ARG A 1 121 ? -5.334  2.512   20.658  1.00 37.74 ? 98  ARG A NE  1 
ATOM   672  C CZ  . ARG A 1 121 ? -4.582  1.974   19.700  1.00 36.51 ? 98  ARG A CZ  1 
ATOM   673  N NH1 . ARG A 1 121 ? -4.858  0.765   19.236  1.00 36.21 ? 98  ARG A NH1 1 
ATOM   674  N NH2 . ARG A 1 121 ? -3.551  2.646   19.206  1.00 33.68 ? 98  ARG A NH2 1 
ATOM   675  N N   . ARG A 1 122 ? -9.826  6.776   21.037  1.00 46.83 ? 99  ARG A N   1 
ATOM   676  C CA  . ARG A 1 122 ? -10.274 7.812   20.102  1.00 46.83 ? 99  ARG A CA  1 
ATOM   677  C C   . ARG A 1 122 ? -9.537  9.155   20.142  1.00 47.12 ? 99  ARG A C   1 
ATOM   678  O O   . ARG A 1 122 ? -9.335  9.784   19.102  1.00 47.17 ? 99  ARG A O   1 
ATOM   679  C CB  . ARG A 1 122 ? -11.771 8.069   20.290  1.00 46.91 ? 99  ARG A CB  1 
ATOM   680  C CG  . ARG A 1 122 ? -12.647 6.851   20.063  1.00 47.64 ? 99  ARG A CG  1 
ATOM   681  C CD  . ARG A 1 122 ? -12.730 6.514   18.594  1.00 47.93 ? 99  ARG A CD  1 
ATOM   682  N NE  . ARG A 1 122 ? -13.348 5.216   18.356  1.00 48.49 ? 99  ARG A NE  1 
ATOM   683  C CZ  . ARG A 1 122 ? -14.588 4.890   18.708  1.00 50.20 ? 99  ARG A CZ  1 
ATOM   684  N NH1 . ARG A 1 122 ? -15.370 5.773   19.324  1.00 47.77 ? 99  ARG A NH1 1 
ATOM   685  N NH2 . ARG A 1 122 ? -15.043 3.673   18.438  1.00 48.87 ? 99  ARG A NH2 1 
ATOM   686  N N   . LYS A 1 123 ? -9.136  9.601   21.326  1.00 47.81 ? 100 LYS A N   1 
ATOM   687  C CA  . LYS A 1 123 ? -8.449  10.887  21.446  1.00 49.53 ? 100 LYS A CA  1 
ATOM   688  C C   . LYS A 1 123 ? -6.988  10.906  20.976  1.00 48.84 ? 100 LYS A C   1 
ATOM   689  O O   . LYS A 1 123 ? -6.325  11.937  21.064  1.00 49.16 ? 100 LYS A O   1 
ATOM   690  C CB  . LYS A 1 123 ? -8.543  11.389  22.891  1.00 50.74 ? 100 LYS A CB  1 
ATOM   691  C CG  . LYS A 1 123 ? -9.966  11.744  23.319  1.00 53.06 ? 100 LYS A CG  1 
ATOM   692  C CD  . LYS A 1 123 ? -10.315 11.174  24.694  1.00 53.32 ? 100 LYS A CD  1 
ATOM   693  C CE  . LYS A 1 123 ? -11.729 11.572  25.116  1.00 53.32 ? 100 LYS A CE  1 
ATOM   694  N NZ  . LYS A 1 123 ? -11.921 13.054  25.101  1.00 52.44 ? 100 LYS A NZ  1 
ATOM   695  N N   . GLU A 1 124 ? -6.490  9.779   20.474  1.00 47.34 ? 101 GLU A N   1 
ATOM   696  C CA  . GLU A 1 124 ? -5.113  9.719   19.993  1.00 46.20 ? 101 GLU A CA  1 
ATOM   697  C C   . GLU A 1 124 ? -5.026  10.404  18.632  1.00 45.83 ? 101 GLU A C   1 
ATOM   698  O O   . GLU A 1 124 ? -3.939  10.727  18.154  1.00 44.49 ? 101 GLU A O   1 
ATOM   699  C CB  . GLU A 1 124 ? -4.643  8.268   19.860  1.00 46.48 ? 101 GLU A CB  1 
ATOM   700  C CG  . GLU A 1 124 ? -4.851  7.410   21.101  1.00 48.06 ? 101 GLU A CG  1 
ATOM   701  C CD  . GLU A 1 124 ? -4.123  6.079   21.007  1.00 48.73 ? 101 GLU A CD  1 
ATOM   702  O OE1 . GLU A 1 124 ? -3.748  5.687   19.879  1.00 46.61 ? 101 GLU A OE1 1 
ATOM   703  O OE2 . GLU A 1 124 ? -3.931  5.426   22.058  1.00 48.59 ? 101 GLU A OE2 1 
ATOM   704  N N   . VAL A 1 125 ? -6.191  10.612  18.022  1.00 45.06 ? 102 VAL A N   1 
ATOM   705  C CA  . VAL A 1 125 ? -6.317  11.258  16.713  1.00 44.79 ? 102 VAL A CA  1 
ATOM   706  C C   . VAL A 1 125 ? -5.857  12.723  16.731  1.00 44.23 ? 102 VAL A C   1 
ATOM   707  O O   . VAL A 1 125 ? -5.359  13.252  15.736  1.00 43.22 ? 102 VAL A O   1 
ATOM   708  C CB  . VAL A 1 125 ? -7.794  11.190  16.234  1.00 44.48 ? 102 VAL A CB  1 
ATOM   709  C CG1 . VAL A 1 125 ? -8.059  12.216  15.143  1.00 47.71 ? 102 VAL A CG1 1 
ATOM   710  C CG2 . VAL A 1 125 ? -8.097  9.803   15.715  1.00 44.13 ? 102 VAL A CG2 1 
ATOM   711  N N   . ASP A 1 126 ? -6.032  13.362  17.878  1.00 43.34 ? 103 ASP A N   1 
ATOM   712  C CA  . ASP A 1 126 ? -5.679  14.755  18.079  1.00 42.87 ? 103 ASP A CA  1 
ATOM   713  C C   . ASP A 1 126 ? -4.223  15.072  17.792  1.00 42.44 ? 103 ASP A C   1 
ATOM   714  O O   . ASP A 1 126 ? -3.920  15.835  16.875  1.00 42.27 ? 103 ASP A O   1 
ATOM   715  C CB  . ASP A 1 126 ? -6.029  15.136  19.514  1.00 43.43 ? 103 ASP A CB  1 
ATOM   716  C CG  . ASP A 1 126 ? -7.468  14.806  19.850  1.00 44.67 ? 103 ASP A CG  1 
ATOM   717  O OD1 . ASP A 1 126 ? -7.814  14.699  21.051  1.00 46.22 ? 103 ASP A OD1 1 
ATOM   718  O OD2 . ASP A 1 126 ? -8.259  14.657  18.891  1.00 43.91 ? 103 ASP A OD2 1 
ATOM   719  N N   . MET A 1 127 ? -3.321  14.488  18.571  1.00 41.77 ? 104 MET A N   1 
ATOM   720  C CA  . MET A 1 127 ? -1.903  14.747  18.384  1.00 42.58 ? 104 MET A CA  1 
ATOM   721  C C   . MET A 1 127 ? -1.375  14.173  17.075  1.00 42.55 ? 104 MET A C   1 
ATOM   722  O O   . MET A 1 127 ? -0.344  14.611  16.559  1.00 42.95 ? 104 MET A O   1 
ATOM   723  C CB  . MET A 1 127 ? -1.115  14.184  19.558  1.00 44.76 ? 104 MET A CB  1 
ATOM   724  C CG  . MET A 1 127 ? 0.308   14.664  19.605  1.00 47.11 ? 104 MET A CG  1 
ATOM   725  S SD  . MET A 1 127 ? 0.846   14.979  21.295  1.00 52.43 ? 104 MET A SD  1 
ATOM   726  C CE  . MET A 1 127 ? 0.330   16.701  21.503  1.00 48.29 ? 104 MET A CE  1 
ATOM   727  N N   . MET A 1 128 ? -2.092  13.194  16.535  1.00 41.42 ? 105 MET A N   1 
ATOM   728  C CA  . MET A 1 128 ? -1.701  12.566  15.284  1.00 39.32 ? 105 MET A CA  1 
ATOM   729  C C   . MET A 1 128 ? -2.103  13.413  14.083  1.00 38.09 ? 105 MET A C   1 
ATOM   730  O O   . MET A 1 128 ? -1.335  13.538  13.131  1.00 36.01 ? 105 MET A O   1 
ATOM   731  C CB  . MET A 1 128 ? -2.325  11.179  15.167  1.00 39.39 ? 105 MET A CB  1 
ATOM   732  C CG  . MET A 1 128 ? -1.956  10.454  13.883  1.00 40.88 ? 105 MET A CG  1 
ATOM   733  S SD  . MET A 1 128 ? -0.177  10.193  13.708  1.00 41.94 ? 105 MET A SD  1 
ATOM   734  C CE  . MET A 1 128 ? 0.112   8.782   14.847  1.00 40.11 ? 105 MET A CE  1 
ATOM   735  N N   . LYS A 1 129 ? -3.310  13.974  14.113  1.00 38.20 ? 106 LYS A N   1 
ATOM   736  C CA  . LYS A 1 129 ? -3.761  14.827  13.017  1.00 38.38 ? 106 LYS A CA  1 
ATOM   737  C C   . LYS A 1 129 ? -2.877  16.053  13.091  1.00 39.12 ? 106 LYS A C   1 
ATOM   738  O O   . LYS A 1 129 ? -2.517  16.628  12.077  1.00 40.49 ? 106 LYS A O   1 
ATOM   739  C CB  . LYS A 1 129 ? -5.226  15.223  13.189  1.00 36.63 ? 106 LYS A CB  1 
ATOM   740  N N   . GLU A 1 130 ? -2.512  16.432  14.310  1.00 39.97 ? 107 GLU A N   1 
ATOM   741  C CA  . GLU A 1 130 ? -1.654  17.587  14.533  1.00 41.87 ? 107 GLU A CA  1 
ATOM   742  C C   . GLU A 1 130 ? -0.300  17.391  13.858  1.00 43.94 ? 107 GLU A C   1 
ATOM   743  O O   . GLU A 1 130 ? 0.193   18.284  13.159  1.00 45.54 ? 107 GLU A O   1 
ATOM   744  C CB  . GLU A 1 130 ? -1.457  17.814  16.038  1.00 41.07 ? 107 GLU A CB  1 
ATOM   745  N N   . ALA A 1 131 ? 0.293   16.217  14.067  1.00 43.15 ? 108 ALA A N   1 
ATOM   746  C CA  . ALA A 1 131 ? 1.599   15.898  13.499  1.00 41.92 ? 108 ALA A CA  1 
ATOM   747  C C   . ALA A 1 131 ? 1.581   15.772  11.991  1.00 41.40 ? 108 ALA A C   1 
ATOM   748  O O   . ALA A 1 131 ? 2.442   16.321  11.313  1.00 42.00 ? 108 ALA A O   1 
ATOM   749  C CB  . ALA A 1 131 ? 2.135   14.614  14.108  1.00 42.58 ? 108 ALA A CB  1 
ATOM   750  N N   . LEU A 1 132 ? 0.615   15.037  11.457  1.00 40.94 ? 109 LEU A N   1 
ATOM   751  C CA  . LEU A 1 132 ? 0.544   14.870  10.016  1.00 40.91 ? 109 LEU A CA  1 
ATOM   752  C C   . LEU A 1 132 ? 0.268   16.211  9.347   1.00 42.17 ? 109 LEU A C   1 
ATOM   753  O O   . LEU A 1 132 ? 0.735   16.469  8.239   1.00 43.07 ? 109 LEU A O   1 
ATOM   754  C CB  . LEU A 1 132 ? -0.528  13.842  9.651   1.00 38.14 ? 109 LEU A CB  1 
ATOM   755  C CG  . LEU A 1 132 ? -0.280  12.465  10.264  1.00 35.78 ? 109 LEU A CG  1 
ATOM   756  C CD1 . LEU A 1 132 ? -1.336  11.485  9.789   1.00 32.28 ? 109 LEU A CD1 1 
ATOM   757  C CD2 . LEU A 1 132 ? 1.110   11.991  9.882   1.00 35.15 ? 109 LEU A CD2 1 
ATOM   758  N N   . GLU A 1 133 ? -0.483  17.070  10.026  1.00 44.43 ? 110 GLU A N   1 
ATOM   759  C CA  . GLU A 1 133 ? -0.773  18.390  9.487   1.00 46.20 ? 110 GLU A CA  1 
ATOM   760  C C   . GLU A 1 133 ? 0.548   19.134  9.313   1.00 46.31 ? 110 GLU A C   1 
ATOM   761  O O   . GLU A 1 133 ? 0.820   19.693  8.250   1.00 46.67 ? 110 GLU A O   1 
ATOM   762  C CB  . GLU A 1 133 ? -1.693  19.171  10.436  1.00 48.57 ? 110 GLU A CB  1 
ATOM   763  C CG  . GLU A 1 133 ? -3.173  18.804  10.326  1.00 50.42 ? 110 GLU A CG  1 
ATOM   764  C CD  . GLU A 1 133 ? -4.065  19.623  11.246  1.00 51.71 ? 110 GLU A CD  1 
ATOM   765  O OE1 . GLU A 1 133 ? -4.039  19.394  12.480  1.00 52.73 ? 110 GLU A OE1 1 
ATOM   766  O OE2 . GLU A 1 133 ? -4.791  20.501  10.729  1.00 52.17 ? 110 GLU A OE2 1 
ATOM   767  N N   . LYS A 1 134 ? 1.369   19.124  10.362  1.00 46.05 ? 111 LYS A N   1 
ATOM   768  C CA  . LYS A 1 134 ? 2.664   19.800  10.331  1.00 45.13 ? 111 LYS A CA  1 
ATOM   769  C C   . LYS A 1 134 ? 3.547   19.215  9.232   1.00 44.18 ? 111 LYS A C   1 
ATOM   770  O O   . LYS A 1 134 ? 4.492   19.856  8.777   1.00 44.26 ? 111 LYS A O   1 
ATOM   771  C CB  . LYS A 1 134 ? 3.370   19.678  11.704  1.00 43.83 ? 111 LYS A CB  1 
ATOM   772  N N   . LEU A 1 135 ? 3.234   17.997  8.803   1.00 42.63 ? 112 LEU A N   1 
ATOM   773  C CA  . LEU A 1 135 ? 4.021   17.348  7.772   1.00 41.60 ? 112 LEU A CA  1 
ATOM   774  C C   . LEU A 1 135 ? 3.467   17.573  6.382   1.00 41.80 ? 112 LEU A C   1 
ATOM   775  O O   . LEU A 1 135 ? 3.878   16.903  5.432   1.00 43.41 ? 112 LEU A O   1 
ATOM   776  C CB  . LEU A 1 135 ? 4.145   15.849  8.054   1.00 40.56 ? 112 LEU A CB  1 
ATOM   777  C CG  . LEU A 1 135 ? 5.185   15.471  9.118   1.00 40.08 ? 112 LEU A CG  1 
ATOM   778  C CD1 . LEU A 1 135 ? 5.127   13.983  9.398   1.00 37.96 ? 112 LEU A CD1 1 
ATOM   779  C CD2 . LEU A 1 135 ? 6.568   15.864  8.640   1.00 37.78 ? 112 LEU A CD2 1 
ATOM   780  N N   . GLN A 1 136 ? 2.530   18.513  6.268   1.00 41.50 ? 113 GLN A N   1 
ATOM   781  C CA  . GLN A 1 136 ? 1.931   18.871  4.982   1.00 40.52 ? 113 GLN A CA  1 
ATOM   782  C C   . GLN A 1 136 ? 1.260   17.693  4.244   1.00 39.34 ? 113 GLN A C   1 
ATOM   783  O O   . GLN A 1 136 ? 1.266   17.628  3.018   1.00 38.79 ? 113 GLN A O   1 
ATOM   784  C CB  . GLN A 1 136 ? 3.016   19.521  4.105   1.00 42.07 ? 113 GLN A CB  1 
ATOM   785  C CG  . GLN A 1 136 ? 2.586   19.951  2.702   1.00 48.87 ? 113 GLN A CG  1 
ATOM   786  C CD  . GLN A 1 136 ? 2.180   21.418  2.609   1.00 51.61 ? 113 GLN A CD  1 
ATOM   787  O OE1 . GLN A 1 136 ? 2.939   22.309  3.002   1.00 53.58 ? 113 GLN A OE1 1 
ATOM   788  N NE2 . GLN A 1 136 ? 0.987   21.675  2.076   1.00 49.85 ? 113 GLN A NE2 1 
ATOM   789  N N   . LEU A 1 137 ? 0.673   16.761  4.989   1.00 37.80 ? 114 LEU A N   1 
ATOM   790  C CA  . LEU A 1 137 ? -0.001  15.631  4.365   1.00 36.94 ? 114 LEU A CA  1 
ATOM   791  C C   . LEU A 1 137 ? -1.488  15.914  4.194   1.00 35.68 ? 114 LEU A C   1 
ATOM   792  O O   . LEU A 1 137 ? -2.100  16.537  5.052   1.00 33.61 ? 114 LEU A O   1 
ATOM   793  C CB  . LEU A 1 137 ? 0.188   14.366  5.201   1.00 36.86 ? 114 LEU A CB  1 
ATOM   794  C CG  . LEU A 1 137 ? 1.597   13.768  5.224   1.00 37.00 ? 114 LEU A CG  1 
ATOM   795  C CD1 . LEU A 1 137 ? 1.600   12.541  6.116   1.00 40.39 ? 114 LEU A CD1 1 
ATOM   796  C CD2 . LEU A 1 137 ? 2.028   13.384  3.828   1.00 37.36 ? 114 LEU A CD2 1 
ATOM   797  N N   . ASN A 1 138 ? -2.057  15.470  3.074   1.00 35.92 ? 115 ASN A N   1 
ATOM   798  C CA  . ASN A 1 138 ? -3.480  15.661  2.804   1.00 36.79 ? 115 ASN A CA  1 
ATOM   799  C C   . ASN A 1 138 ? -4.248  14.870  3.838   1.00 37.05 ? 115 ASN A C   1 
ATOM   800  O O   . ASN A 1 138 ? -4.209  13.640  3.837   1.00 36.07 ? 115 ASN A O   1 
ATOM   801  C CB  . ASN A 1 138 ? -3.848  15.135  1.420   1.00 38.59 ? 115 ASN A CB  1 
ATOM   802  C CG  . ASN A 1 138 ? -3.045  15.780  0.320   1.00 40.98 ? 115 ASN A CG  1 
ATOM   803  O OD1 . ASN A 1 138 ? -2.975  17.007  0.224   1.00 41.99 ? 115 ASN A OD1 1 
ATOM   804  N ND2 . ASN A 1 138 ? -2.434  14.957  -0.525  1.00 42.22 ? 115 ASN A ND2 1 
ATOM   805  N N   . ILE A 1 139 ? -4.954  15.569  4.713   1.00 38.41 ? 116 ILE A N   1 
ATOM   806  C CA  . ILE A 1 139 ? -5.694  14.887  5.756   1.00 40.10 ? 116 ILE A CA  1 
ATOM   807  C C   . ILE A 1 139 ? -7.128  14.592  5.394   1.00 40.76 ? 116 ILE A C   1 
ATOM   808  O O   . ILE A 1 139 ? -7.829  15.435  4.847   1.00 41.75 ? 116 ILE A O   1 
ATOM   809  C CB  . ILE A 1 139 ? -5.714  15.693  7.082   1.00 41.48 ? 116 ILE A CB  1 
ATOM   810  C CG1 . ILE A 1 139 ? -4.309  16.199  7.431   1.00 40.16 ? 116 ILE A CG1 1 
ATOM   811  C CG2 . ILE A 1 139 ? -6.241  14.804  8.215   1.00 40.71 ? 116 ILE A CG2 1 
ATOM   812  C CD1 . ILE A 1 139 ? -3.277  15.106  7.593   1.00 40.49 ? 116 ILE A CD1 1 
ATOM   813  N N   . VAL A 1 140 ? -7.545  13.377  5.721   1.00 42.51 ? 117 VAL A N   1 
ATOM   814  C CA  . VAL A 1 140 ? -8.901  12.907  5.505   1.00 43.94 ? 117 VAL A CA  1 
ATOM   815  C C   . VAL A 1 140 ? -9.292  12.201  6.803   1.00 46.67 ? 117 VAL A C   1 
ATOM   816  O O   . VAL A 1 140 ? -8.815  11.099  7.082   1.00 47.30 ? 117 VAL A O   1 
ATOM   817  C CB  . VAL A 1 140 ? -8.967  11.913  4.344   1.00 43.00 ? 117 VAL A CB  1 
ATOM   818  C CG1 . VAL A 1 140 ? -10.385 11.402  4.186   1.00 42.72 ? 117 VAL A CG1 1 
ATOM   819  C CG2 . VAL A 1 140 ? -8.504  12.582  3.067   1.00 42.64 ? 117 VAL A CG2 1 
ATOM   820  N N   . GLU A 1 141 ? -10.147 12.845  7.597   1.00 49.54 ? 118 GLU A N   1 
ATOM   821  C CA  . GLU A 1 141 ? -10.584 12.296  8.887   1.00 51.70 ? 118 GLU A CA  1 
ATOM   822  C C   . GLU A 1 141 ? -11.778 11.361  8.807   1.00 52.27 ? 118 GLU A C   1 
ATOM   823  O O   . GLU A 1 141 ? -12.744 11.631  8.103   1.00 53.26 ? 118 GLU A O   1 
ATOM   824  C CB  . GLU A 1 141 ? -10.930 13.429  9.867   1.00 52.61 ? 118 GLU A CB  1 
ATOM   825  C CG  . GLU A 1 141 ? -9.736  14.226  10.379  1.00 54.49 ? 118 GLU A CG  1 
ATOM   826  C CD  . GLU A 1 141 ? -10.132 15.382  11.300  1.00 55.18 ? 118 GLU A CD  1 
ATOM   827  O OE1 . GLU A 1 141 ? -10.876 16.280  10.844  1.00 53.63 ? 118 GLU A OE1 1 
ATOM   828  O OE2 . GLU A 1 141 ? -9.692  15.395  12.474  1.00 53.91 ? 118 GLU A OE2 1 
ATOM   829  N N   . MET A 1 142 ? -11.706 10.260  9.546   1.00 53.32 ? 119 MET A N   1 
ATOM   830  C CA  . MET A 1 142 ? -12.797 9.292   9.593   1.00 53.70 ? 119 MET A CA  1 
ATOM   831  C C   . MET A 1 142 ? -13.723 9.783   10.709  1.00 54.41 ? 119 MET A C   1 
ATOM   832  O O   . MET A 1 142 ? -13.388 9.695   11.890  1.00 52.35 ? 119 MET A O   1 
ATOM   833  C CB  . MET A 1 142 ? -12.251 7.898   9.916   1.00 52.72 ? 119 MET A CB  1 
ATOM   834  C CG  . MET A 1 142 ? -13.260 6.781   9.744   1.00 51.16 ? 119 MET A CG  1 
ATOM   835  S SD  . MET A 1 142 ? -12.552 5.151   10.038  1.00 50.54 ? 119 MET A SD  1 
ATOM   836  C CE  . MET A 1 142 ? -11.824 4.806   8.472   1.00 49.39 ? 119 MET A CE  1 
ATOM   837  N N   . LYS A 1 143 ? -14.883 10.306  10.326  1.00 55.96 ? 120 LYS A N   1 
ATOM   838  C CA  . LYS A 1 143 ? -15.827 10.854  11.292  1.00 57.06 ? 120 LYS A CA  1 
ATOM   839  C C   . LYS A 1 143 ? -17.036 9.965   11.572  1.00 57.67 ? 120 LYS A C   1 
ATOM   840  O O   . LYS A 1 143 ? -17.487 9.881   12.712  1.00 58.31 ? 120 LYS A O   1 
ATOM   841  C CB  . LYS A 1 143 ? -16.303 12.231  10.812  1.00 57.63 ? 120 LYS A CB  1 
ATOM   842  C CG  . LYS A 1 143 ? -15.193 13.106  10.236  1.00 58.04 ? 120 LYS A CG  1 
ATOM   843  C CD  . LYS A 1 143 ? -14.223 13.576  11.298  1.00 58.50 ? 120 LYS A CD  1 
ATOM   844  C CE  . LYS A 1 143 ? -14.648 14.921  11.874  1.00 59.45 ? 120 LYS A CE  1 
ATOM   845  N NZ  . LYS A 1 143 ? -14.535 16.015  10.867  1.00 58.76 ? 120 LYS A NZ  1 
ATOM   846  N N   . ASP A 1 144 ? -17.557 9.309   10.536  1.00 58.41 ? 121 ASP A N   1 
ATOM   847  C CA  . ASP A 1 144 ? -18.728 8.433   10.657  1.00 58.68 ? 121 ASP A CA  1 
ATOM   848  C C   . ASP A 1 144 ? -18.841 7.723   12.017  1.00 59.33 ? 121 ASP A C   1 
ATOM   849  O O   . ASP A 1 144 ? -17.977 6.919   12.383  1.00 60.10 ? 121 ASP A O   1 
ATOM   850  C CB  . ASP A 1 144 ? -18.715 7.399   9.527   1.00 58.69 ? 121 ASP A CB  1 
ATOM   851  C CG  . ASP A 1 144 ? -19.983 6.558   9.486   1.00 60.57 ? 121 ASP A CG  1 
ATOM   852  O OD1 . ASP A 1 144 ? -20.313 5.920   10.509  1.00 61.00 ? 121 ASP A OD1 1 
ATOM   853  O OD2 . ASP A 1 144 ? -20.650 6.527   8.428   1.00 60.89 ? 121 ASP A OD2 1 
ATOM   854  N N   . GLU A 1 145 ? -19.920 8.018   12.749  1.00 58.74 ? 122 GLU A N   1 
ATOM   855  C CA  . GLU A 1 145 ? -20.172 7.442   14.078  1.00 57.13 ? 122 GLU A CA  1 
ATOM   856  C C   . GLU A 1 145 ? -20.407 5.928   14.082  1.00 54.91 ? 122 GLU A C   1 
ATOM   857  O O   . GLU A 1 145 ? -20.530 5.322   15.147  1.00 55.58 ? 122 GLU A O   1 
ATOM   858  C CB  . GLU A 1 145 ? -21.368 8.157   14.745  1.00 57.48 ? 122 GLU A CB  1 
ATOM   859  N N   . ASN A 1 146 ? -20.461 5.323   12.901  1.00 51.02 ? 123 ASN A N   1 
ATOM   860  C CA  . ASN A 1 146 ? -20.685 3.886   12.793  1.00 48.73 ? 123 ASN A CA  1 
ATOM   861  C C   . ASN A 1 146 ? -19.540 3.196   12.052  1.00 46.07 ? 123 ASN A C   1 
ATOM   862  O O   . ASN A 1 146 ? -19.683 2.057   11.608  1.00 44.40 ? 123 ASN A O   1 
ATOM   863  C CB  . ASN A 1 146 ? -21.997 3.608   12.041  1.00 49.94 ? 123 ASN A CB  1 
ATOM   864  C CG  . ASN A 1 146 ? -23.119 4.548   12.444  1.00 50.29 ? 123 ASN A CG  1 
ATOM   865  O OD1 . ASN A 1 146 ? -23.531 4.588   13.609  1.00 52.35 ? 123 ASN A OD1 1 
ATOM   866  N ND2 . ASN A 1 146 ? -23.623 5.313   11.479  1.00 46.95 ? 123 ASN A ND2 1 
ATOM   867  N N   . ALA A 1 147 ? -18.407 3.880   11.918  1.00 43.46 ? 124 ALA A N   1 
ATOM   868  C CA  . ALA A 1 147 ? -17.267 3.311   11.204  1.00 40.79 ? 124 ALA A CA  1 
ATOM   869  C C   . ALA A 1 147 ? -16.009 3.171   12.043  1.00 39.16 ? 124 ALA A C   1 
ATOM   870  O O   . ALA A 1 147 ? -15.421 4.152   12.473  1.00 36.81 ? 124 ALA A O   1 
ATOM   871  C CB  . ALA A 1 147 ? -16.964 4.143   9.969   1.00 41.19 ? 124 ALA A CB  1 
ATOM   872  N N   . THR A 1 148 ? -15.585 1.938   12.265  1.00 39.46 ? 125 THR A N   1 
ATOM   873  C CA  . THR A 1 148 ? -14.382 1.703   13.042  1.00 40.65 ? 125 THR A CA  1 
ATOM   874  C C   . THR A 1 148 ? -13.326 1.069   12.154  1.00 39.79 ? 125 THR A C   1 
ATOM   875  O O   . THR A 1 148 ? -13.640 0.213   11.320  1.00 39.82 ? 125 THR A O   1 
ATOM   876  C CB  . THR A 1 148 ? -14.645 0.753   14.211  1.00 42.53 ? 125 THR A CB  1 
ATOM   877  O OG1 . THR A 1 148 ? -15.093 -0.510  13.699  1.00 45.72 ? 125 THR A OG1 1 
ATOM   878  C CG2 . THR A 1 148 ? -15.697 1.335   15.146  1.00 42.16 ? 125 THR A CG2 1 
ATOM   879  N N   . LEU A 1 149 ? -12.081 1.506   12.332  1.00 36.94 ? 126 LEU A N   1 
ATOM   880  C CA  . LEU A 1 149 ? -10.951 0.979   11.572  1.00 33.44 ? 126 LEU A CA  1 
ATOM   881  C C   . LEU A 1 149 ? -9.629  1.176   12.296  1.00 32.19 ? 126 LEU A C   1 
ATOM   882  O O   . LEU A 1 149 ? -9.216  2.308   12.564  1.00 31.62 ? 126 LEU A O   1 
ATOM   883  C CB  . LEU A 1 149 ? -10.854 1.631   10.187  1.00 30.86 ? 126 LEU A CB  1 
ATOM   884  C CG  . LEU A 1 149 ? -9.733  1.110   9.263   1.00 31.91 ? 126 LEU A CG  1 
ATOM   885  C CD1 . LEU A 1 149 ? -9.952  1.628   7.856   1.00 31.39 ? 126 LEU A CD1 1 
ATOM   886  C CD2 . LEU A 1 149 ? -8.369  1.546   9.746   1.00 29.73 ? 126 LEU A CD2 1 
ATOM   887  N N   . ASP A 1 150 ? -8.979  0.065   12.622  1.00 30.22 ? 127 ASP A N   1 
ATOM   888  C CA  . ASP A 1 150 ? -7.677  0.114   13.264  1.00 29.91 ? 127 ASP A CA  1 
ATOM   889  C C   . ASP A 1 150 ? -6.713  -0.113  12.125  1.00 28.83 ? 127 ASP A C   1 
ATOM   890  O O   . ASP A 1 150 ? -6.933  -1.003  11.301  1.00 29.20 ? 127 ASP A O   1 
ATOM   891  C CB  . ASP A 1 150 ? -7.534  -0.981  14.328  1.00 28.55 ? 127 ASP A CB  1 
ATOM   892  C CG  . ASP A 1 150 ? -8.039  -0.535  15.699  1.00 29.15 ? 127 ASP A CG  1 
ATOM   893  O OD1 . ASP A 1 150 ? -8.771  0.475   15.754  1.00 32.50 ? 127 ASP A OD1 1 
ATOM   894  O OD2 . ASP A 1 150 ? -7.718  -1.186  16.715  1.00 24.97 ? 127 ASP A OD2 1 
ATOM   895  N N   . GLY A 1 151 ? -5.679  0.723   12.060  1.00 28.17 ? 128 GLY A N   1 
ATOM   896  C CA  . GLY A 1 151 ? -4.684  0.624   11.005  1.00 26.97 ? 128 GLY A CA  1 
ATOM   897  C C   . GLY A 1 151 ? -4.039  -0.740  10.973  1.00 27.00 ? 128 GLY A C   1 
ATOM   898  O O   . GLY A 1 151 ? -3.654  -1.219  9.910   1.00 26.57 ? 128 GLY A O   1 
ATOM   899  N N   . GLY A 1 152 ? -3.931  -1.357  12.151  1.00 27.46 ? 129 GLY A N   1 
ATOM   900  C CA  . GLY A 1 152 ? -3.350  -2.687  12.284  1.00 27.72 ? 129 GLY A CA  1 
ATOM   901  C C   . GLY A 1 152 ? -4.030  -3.719  11.398  1.00 29.04 ? 129 GLY A C   1 
ATOM   902  O O   . GLY A 1 152 ? -3.419  -4.726  11.025  1.00 32.06 ? 129 GLY A O   1 
ATOM   903  N N   . ASP A 1 153 ? -5.296  -3.485  11.062  1.00 25.60 ? 130 ASP A N   1 
ATOM   904  C CA  . ASP A 1 153 ? -6.017  -4.396  10.189  1.00 24.50 ? 130 ASP A CA  1 
ATOM   905  C C   . ASP A 1 153 ? -5.728  -4.070  8.716   1.00 24.65 ? 130 ASP A C   1 
ATOM   906  O O   . ASP A 1 153 ? -6.294  -4.689  7.828   1.00 26.43 ? 130 ASP A O   1 
ATOM   907  C CB  . ASP A 1 153 ? -7.533  -4.298  10.424  1.00 22.14 ? 130 ASP A CB  1 
ATOM   908  C CG  . ASP A 1 153 ? -7.974  -4.933  11.733  1.00 23.02 ? 130 ASP A CG  1 
ATOM   909  O OD1 . ASP A 1 153 ? -7.595  -6.097  11.987  1.00 23.17 ? 130 ASP A OD1 1 
ATOM   910  O OD2 . ASP A 1 153 ? -8.708  -4.276  12.503  1.00 18.95 ? 130 ASP A OD2 1 
ATOM   911  N N   . VAL A 1 154 ? -4.845  -3.119  8.439   1.00 23.69 ? 131 VAL A N   1 
ATOM   912  C CA  . VAL A 1 154 ? -4.613  -2.777  7.047   1.00 23.53 ? 131 VAL A CA  1 
ATOM   913  C C   . VAL A 1 154 ? -3.255  -3.104  6.435   1.00 26.51 ? 131 VAL A C   1 
ATOM   914  O O   . VAL A 1 154 ? -2.225  -2.573  6.846   1.00 27.05 ? 131 VAL A O   1 
ATOM   915  C CB  . VAL A 1 154 ? -4.916  -1.298  6.811   1.00 23.51 ? 131 VAL A CB  1 
ATOM   916  C CG1 . VAL A 1 154 ? -4.686  -0.943  5.346   1.00 21.07 ? 131 VAL A CG1 1 
ATOM   917  C CG2 . VAL A 1 154 ? -6.357  -1.006  7.222   1.00 21.15 ? 131 VAL A CG2 1 
ATOM   918  N N   . LEU A 1 155 ? -3.286  -3.962  5.413   1.00 28.45 ? 132 LEU A N   1 
ATOM   919  C CA  . LEU A 1 155 ? -2.094  -4.405  4.702   1.00 29.35 ? 132 LEU A CA  1 
ATOM   920  C C   . LEU A 1 155 ? -1.934  -3.737  3.327   1.00 30.39 ? 132 LEU A C   1 
ATOM   921  O O   . LEU A 1 155 ? -2.568  -4.136  2.350   1.00 32.35 ? 132 LEU A O   1 
ATOM   922  C CB  . LEU A 1 155 ? -2.145  -5.925  4.526   1.00 27.92 ? 132 LEU A CB  1 
ATOM   923  C CG  . LEU A 1 155 ? -0.862  -6.568  4.005   1.00 27.91 ? 132 LEU A CG  1 
ATOM   924  C CD1 . LEU A 1 155 ? 0.232   -6.420  5.049   1.00 28.26 ? 132 LEU A CD1 1 
ATOM   925  C CD2 . LEU A 1 155 ? -1.106  -8.034  3.705   1.00 27.56 ? 132 LEU A CD2 1 
ATOM   926  N N   . PHE A 1 156 ? -1.084  -2.721  3.257   1.00 30.66 ? 133 PHE A N   1 
ATOM   927  C CA  . PHE A 1 156 ? -0.839  -2.033  2.000   1.00 31.16 ? 133 PHE A CA  1 
ATOM   928  C C   . PHE A 1 156 ? 0.305   -2.700  1.258   1.00 31.04 ? 133 PHE A C   1 
ATOM   929  O O   . PHE A 1 156 ? 1.465   -2.372  1.467   1.00 30.86 ? 133 PHE A O   1 
ATOM   930  C CB  . PHE A 1 156 ? -0.500  -0.568  2.248   1.00 31.45 ? 133 PHE A CB  1 
ATOM   931  C CG  . PHE A 1 156 ? -0.204  0.186   1.001   1.00 30.99 ? 133 PHE A CG  1 
ATOM   932  C CD1 . PHE A 1 156 ? -1.050  0.086   -0.094  1.00 32.46 ? 133 PHE A CD1 1 
ATOM   933  C CD2 . PHE A 1 156 ? 0.938   0.966   0.898   1.00 32.86 ? 133 PHE A CD2 1 
ATOM   934  C CE1 . PHE A 1 156 ? -0.758  0.752   -1.283  1.00 33.76 ? 133 PHE A CE1 1 
ATOM   935  C CE2 . PHE A 1 156 ? 1.239   1.637   -0.286  1.00 33.38 ? 133 PHE A CE2 1 
ATOM   936  C CZ  . PHE A 1 156 ? 0.390   1.527   -1.377  1.00 32.86 ? 133 PHE A CZ  1 
ATOM   937  N N   . THR A 1 157 ? -0.041  -3.627  0.377   1.00 33.26 ? 134 THR A N   1 
ATOM   938  C CA  . THR A 1 157 ? 0.942   -4.384  -0.386  1.00 34.63 ? 134 THR A CA  1 
ATOM   939  C C   . THR A 1 157 ? 1.755   -3.521  -1.343  1.00 35.49 ? 134 THR A C   1 
ATOM   940  O O   . THR A 1 157 ? 2.755   -3.985  -1.904  1.00 35.56 ? 134 THR A O   1 
ATOM   941  C CB  . THR A 1 157 ? 0.267   -5.525  -1.199  1.00 35.01 ? 134 THR A CB  1 
ATOM   942  O OG1 . THR A 1 157 ? -0.375  -4.986  -2.358  1.00 36.33 ? 134 THR A OG1 1 
ATOM   943  C CG2 . THR A 1 157 ? -0.778  -6.227  -0.359  1.00 33.77 ? 134 THR A CG2 1 
ATOM   944  N N   . GLY A 1 158 ? 1.326   -2.275  -1.529  1.00 34.93 ? 135 GLY A N   1 
ATOM   945  C CA  . GLY A 1 158 ? 2.039   -1.383  -2.429  1.00 36.05 ? 135 GLY A CA  1 
ATOM   946  C C   . GLY A 1 158 ? 1.466   -1.453  -3.828  1.00 36.92 ? 135 GLY A C   1 
ATOM   947  O O   . GLY A 1 158 ? 1.983   -0.848  -4.765  1.00 37.48 ? 135 GLY A O   1 
ATOM   948  N N   . ARG A 1 159 ? 0.383   -2.214  -3.951  1.00 37.32 ? 136 ARG A N   1 
ATOM   949  C CA  . ARG A 1 159 ? -0.324  -2.418  -5.207  1.00 36.01 ? 136 ARG A CA  1 
ATOM   950  C C   . ARG A 1 159 ? -1.830  -2.406  -4.910  1.00 31.86 ? 136 ARG A C   1 
ATOM   951  O O   . ARG A 1 159 ? -2.652  -2.156  -5.783  1.00 31.51 ? 136 ARG A O   1 
ATOM   952  C CB  . ARG A 1 159 ? 0.089   -3.764  -5.832  1.00 40.53 ? 136 ARG A CB  1 
ATOM   953  C CG  . ARG A 1 159 ? 1.348   -3.723  -6.731  1.00 48.13 ? 136 ARG A CG  1 
ATOM   954  C CD  . ARG A 1 159 ? 1.964   -5.125  -6.980  1.00 52.19 ? 136 ARG A CD  1 
ATOM   955  N NE  . ARG A 1 159 ? 0.990   -6.209  -6.836  1.00 57.62 ? 136 ARG A NE  1 
ATOM   956  C CZ  . ARG A 1 159 ? 0.032   -6.498  -7.718  1.00 61.64 ? 136 ARG A CZ  1 
ATOM   957  N NH1 . ARG A 1 159 ? -0.087  -5.791  -8.834  1.00 63.47 ? 136 ARG A NH1 1 
ATOM   958  N NH2 . ARG A 1 159 ? -0.830  -7.481  -7.471  1.00 61.00 ? 136 ARG A NH2 1 
ATOM   959  N N   . GLU A 1 160 ? -2.182  -2.674  -3.663  1.00 28.56 ? 137 GLU A N   1 
ATOM   960  C CA  . GLU A 1 160 ? -3.577  -2.690  -3.248  1.00 26.15 ? 137 GLU A CA  1 
ATOM   961  C C   . GLU A 1 160 ? -3.626  -2.708  -1.729  1.00 23.42 ? 137 GLU A C   1 
ATOM   962  O O   . GLU A 1 160 ? -2.592  -2.733  -1.057  1.00 22.21 ? 137 GLU A O   1 
ATOM   963  C CB  . GLU A 1 160 ? -4.287  -3.932  -3.806  1.00 28.79 ? 137 GLU A CB  1 
ATOM   964  C CG  . GLU A 1 160 ? -3.740  -5.240  -3.243  1.00 34.99 ? 137 GLU A CG  1 
ATOM   965  C CD  . GLU A 1 160 ? -4.055  -6.459  -4.100  1.00 35.82 ? 137 GLU A CD  1 
ATOM   966  O OE1 . GLU A 1 160 ? -5.244  -6.830  -4.228  1.00 36.43 ? 137 GLU A OE1 1 
ATOM   967  O OE2 . GLU A 1 160 ? -3.099  -7.049  -4.641  1.00 33.52 ? 137 GLU A OE2 1 
ATOM   968  N N   . PHE A 1 161 ? -4.833  -2.686  -1.188  1.00 22.30 ? 138 PHE A N   1 
ATOM   969  C CA  . PHE A 1 161 ? -5.005  -2.721  0.255   1.00 21.70 ? 138 PHE A CA  1 
ATOM   970  C C   . PHE A 1 161 ? -5.767  -3.968  0.669   1.00 22.09 ? 138 PHE A C   1 
ATOM   971  O O   . PHE A 1 161 ? -6.559  -4.515  -0.099  1.00 20.49 ? 138 PHE A O   1 
ATOM   972  C CB  . PHE A 1 161 ? -5.819  -1.527  0.748   1.00 21.80 ? 138 PHE A CB  1 
ATOM   973  C CG  . PHE A 1 161 ? -5.055  -0.254  0.859   1.00 22.25 ? 138 PHE A CG  1 
ATOM   974  C CD1 . PHE A 1 161 ? -5.191  0.738   -0.108  1.00 22.53 ? 138 PHE A CD1 1 
ATOM   975  C CD2 . PHE A 1 161 ? -4.241  -0.015  1.966   1.00 22.91 ? 138 PHE A CD2 1 
ATOM   976  C CE1 . PHE A 1 161 ? -4.531  1.957   0.026   1.00 23.07 ? 138 PHE A CE1 1 
ATOM   977  C CE2 . PHE A 1 161 ? -3.574  1.197   2.117   1.00 21.53 ? 138 PHE A CE2 1 
ATOM   978  C CZ  . PHE A 1 161 ? -3.719  2.189   1.146   1.00 24.66 ? 138 PHE A CZ  1 
ATOM   979  N N   . PHE A 1 162 ? -5.521  -4.406  1.894   1.00 22.91 ? 139 PHE A N   1 
ATOM   980  C CA  . PHE A 1 162 ? -6.242  -5.526  2.459   1.00 24.96 ? 139 PHE A CA  1 
ATOM   981  C C   . PHE A 1 162 ? -6.684  -5.128  3.858   1.00 25.56 ? 139 PHE A C   1 
ATOM   982  O O   . PHE A 1 162 ? -5.888  -5.056  4.788   1.00 29.32 ? 139 PHE A O   1 
ATOM   983  C CB  . PHE A 1 162 ? -5.371  -6.769  2.500   1.00 27.17 ? 139 PHE A CB  1 
ATOM   984  C CG  . PHE A 1 162 ? -5.196  -7.388  1.178   1.00 29.26 ? 139 PHE A CG  1 
ATOM   985  C CD1 . PHE A 1 162 ? -3.977  -7.308  0.515   1.00 30.65 ? 139 PHE A CD1 1 
ATOM   986  C CD2 . PHE A 1 162 ? -6.278  -7.984  0.547   1.00 28.18 ? 139 PHE A CD2 1 
ATOM   987  C CE1 . PHE A 1 162 ? -3.837  -7.806  -0.760  1.00 30.57 ? 139 PHE A CE1 1 
ATOM   988  C CE2 . PHE A 1 162 ? -6.155  -8.488  -0.725  1.00 31.88 ? 139 PHE A CE2 1 
ATOM   989  C CZ  . PHE A 1 162 ? -4.926  -8.398  -1.387  1.00 33.87 ? 139 PHE A CZ  1 
ATOM   990  N N   . VAL A 1 163 ? -7.960  -4.837  4.005   1.00 24.28 ? 140 VAL A N   1 
ATOM   991  C CA  . VAL A 1 163 ? -8.471  -4.443  5.302   1.00 21.98 ? 140 VAL A CA  1 
ATOM   992  C C   . VAL A 1 163 ? -9.107  -5.650  5.954   1.00 22.73 ? 140 VAL A C   1 
ATOM   993  O O   . VAL A 1 163 ? -9.970  -6.311  5.379   1.00 24.71 ? 140 VAL A O   1 
ATOM   994  C CB  . VAL A 1 163 ? -9.500  -3.317  5.154   1.00 18.95 ? 140 VAL A CB  1 
ATOM   995  C CG1 . VAL A 1 163 ? -9.972  -2.844  6.520   1.00 15.07 ? 140 VAL A CG1 1 
ATOM   996  C CG2 . VAL A 1 163 ? -8.864  -2.171  4.383   1.00 20.19 ? 140 VAL A CG2 1 
ATOM   997  N N   . GLY A 1 164 ? -8.651  -5.965  7.147   1.00 22.49 ? 141 GLY A N   1 
ATOM   998  C CA  . GLY A 1 164 ? -9.225  -7.088  7.833   1.00 24.40 ? 141 GLY A CA  1 
ATOM   999  C C   . GLY A 1 164 ? -10.492 -6.612  8.505   1.00 25.28 ? 141 GLY A C   1 
ATOM   1000 O O   . GLY A 1 164 ? -10.495 -5.561  9.138   1.00 28.48 ? 141 GLY A O   1 
ATOM   1001 N N   . LEU A 1 165 ? -11.581 -7.348  8.332   1.00 25.91 ? 142 LEU A N   1 
ATOM   1002 C CA  . LEU A 1 165 ? -12.822 -6.988  9.000   1.00 26.86 ? 142 LEU A CA  1 
ATOM   1003 C C   . LEU A 1 165 ? -12.723 -7.734  10.324  1.00 27.91 ? 142 LEU A C   1 
ATOM   1004 O O   . LEU A 1 165 ? -12.699 -8.970  10.356  1.00 30.07 ? 142 LEU A O   1 
ATOM   1005 C CB  . LEU A 1 165 ? -14.034 -7.428  8.168   1.00 25.03 ? 142 LEU A CB  1 
ATOM   1006 C CG  . LEU A 1 165 ? -14.248 -6.531  6.933   1.00 24.86 ? 142 LEU A CG  1 
ATOM   1007 C CD1 . LEU A 1 165 ? -15.447 -6.992  6.147   1.00 22.57 ? 142 LEU A CD1 1 
ATOM   1008 C CD2 . LEU A 1 165 ? -14.432 -5.088  7.361   1.00 22.02 ? 142 LEU A CD2 1 
ATOM   1009 N N   . SER A 1 166 ? -12.611 -6.989  11.417  1.00 27.97 ? 143 SER A N   1 
ATOM   1010 C CA  . SER A 1 166 ? -12.456 -7.625  12.725  1.00 28.43 ? 143 SER A CA  1 
ATOM   1011 C C   . SER A 1 166 ? -13.250 -6.953  13.843  1.00 28.81 ? 143 SER A C   1 
ATOM   1012 O O   . SER A 1 166 ? -14.197 -6.206  13.591  1.00 28.25 ? 143 SER A O   1 
ATOM   1013 C CB  . SER A 1 166 ? -10.981 -7.634  13.102  1.00 25.09 ? 143 SER A CB  1 
ATOM   1014 O OG  . SER A 1 166 ? -10.517 -6.300  13.195  1.00 23.83 ? 143 SER A OG  1 
ATOM   1015 N N   . LYS A 1 167 ? -12.852 -7.234  15.081  1.00 29.99 ? 144 LYS A N   1 
ATOM   1016 C CA  . LYS A 1 167 ? -13.512 -6.656  16.246  1.00 33.21 ? 144 LYS A CA  1 
ATOM   1017 C C   . LYS A 1 167 ? -13.230 -5.159  16.266  1.00 34.12 ? 144 LYS A C   1 
ATOM   1018 O O   . LYS A 1 167 ? -13.906 -4.394  16.945  1.00 35.20 ? 144 LYS A O   1 
ATOM   1019 C CB  . LYS A 1 167 ? -12.993 -7.315  17.529  1.00 32.00 ? 144 LYS A CB  1 
ATOM   1020 N N   . ARG A 1 168 ? -12.230 -4.748  15.496  1.00 35.34 ? 145 ARG A N   1 
ATOM   1021 C CA  . ARG A 1 168 ? -11.848 -3.350  15.430  1.00 35.30 ? 145 ARG A CA  1 
ATOM   1022 C C   . ARG A 1 168 ? -12.262 -2.658  14.136  1.00 33.76 ? 145 ARG A C   1 
ATOM   1023 O O   . ARG A 1 168 ? -12.438 -1.448  14.113  1.00 34.23 ? 145 ARG A O   1 
ATOM   1024 C CB  . ARG A 1 168 ? -10.329 -3.221  15.597  1.00 36.37 ? 145 ARG A CB  1 
ATOM   1025 C CG  . ARG A 1 168 ? -9.789  -3.749  16.916  1.00 37.56 ? 145 ARG A CG  1 
ATOM   1026 C CD  . ARG A 1 168 ? -10.469 -3.065  18.090  1.00 37.36 ? 145 ARG A CD  1 
ATOM   1027 N NE  . ARG A 1 168 ? -9.858  -3.390  19.379  1.00 39.69 ? 145 ARG A NE  1 
ATOM   1028 C CZ  . ARG A 1 168 ? -8.761  -2.820  19.879  1.00 39.26 ? 145 ARG A CZ  1 
ATOM   1029 N NH1 . ARG A 1 168 ? -8.115  -1.872  19.208  1.00 39.87 ? 145 ARG A NH1 1 
ATOM   1030 N NH2 . ARG A 1 168 ? -8.319  -3.193  21.070  1.00 38.52 ? 145 ARG A NH2 1 
ATOM   1031 N N   . THR A 1 169 ? -12.430 -3.418  13.063  1.00 32.55 ? 146 THR A N   1 
ATOM   1032 C CA  . THR A 1 169 ? -12.763 -2.808  11.777  1.00 32.11 ? 146 THR A CA  1 
ATOM   1033 C C   . THR A 1 169 ? -13.991 -3.366  11.089  1.00 34.11 ? 146 THR A C   1 
ATOM   1034 O O   . THR A 1 169 ? -14.160 -4.579  10.972  1.00 34.33 ? 146 THR A O   1 
ATOM   1035 C CB  . THR A 1 169 ? -11.575 -2.933  10.804  1.00 29.19 ? 146 THR A CB  1 
ATOM   1036 O OG1 . THR A 1 169 ? -10.391 -2.480  11.463  1.00 24.49 ? 146 THR A OG1 1 
ATOM   1037 C CG2 . THR A 1 169 ? -11.809 -2.106  9.542   1.00 24.95 ? 146 THR A CG2 1 
ATOM   1038 N N   . ASN A 1 170 ? -14.840 -2.468  10.608  1.00 35.97 ? 147 ASN A N   1 
ATOM   1039 C CA  . ASN A 1 170 ? -16.047 -2.898  9.940   1.00 37.97 ? 147 ASN A CA  1 
ATOM   1040 C C   . ASN A 1 170 ? -16.140 -2.440  8.504   1.00 39.94 ? 147 ASN A C   1 
ATOM   1041 O O   . ASN A 1 170 ? -15.212 -1.849  7.958   1.00 39.15 ? 147 ASN A O   1 
ATOM   1042 C CB  . ASN A 1 170 ? -17.291 -2.427  10.709  1.00 37.10 ? 147 ASN A CB  1 
ATOM   1043 C CG  . ASN A 1 170 ? -17.315 -0.921  10.952  1.00 34.55 ? 147 ASN A CG  1 
ATOM   1044 O OD1 . ASN A 1 170 ? -16.852 -0.129  10.129  1.00 34.35 ? 147 ASN A OD1 1 
ATOM   1045 N ND2 . ASN A 1 170 ? -17.885 -0.523  12.083  1.00 30.62 ? 147 ASN A ND2 1 
ATOM   1046 N N   . GLN A 1 171 ? -17.285 -2.735  7.907   1.00 43.61 ? 148 GLN A N   1 
ATOM   1047 C CA  . GLN A 1 171 ? -17.581 -2.370  6.537   1.00 47.85 ? 148 GLN A CA  1 
ATOM   1048 C C   . GLN A 1 171 ? -17.243 -0.904  6.307   1.00 48.98 ? 148 GLN A C   1 
ATOM   1049 O O   . GLN A 1 171 ? -16.285 -0.579  5.609   1.00 49.21 ? 148 GLN A O   1 
ATOM   1050 C CB  . GLN A 1 171 ? -19.068 -2.589  6.257   1.00 50.80 ? 148 GLN A CB  1 
ATOM   1051 C CG  . GLN A 1 171 ? -19.340 -3.186  4.911   1.00 53.98 ? 148 GLN A CG  1 
ATOM   1052 C CD  . GLN A 1 171 ? -18.718 -4.551  4.793   1.00 57.43 ? 148 GLN A CD  1 
ATOM   1053 O OE1 . GLN A 1 171 ? -19.203 -5.525  5.376   1.00 58.16 ? 148 GLN A OE1 1 
ATOM   1054 N NE2 . GLN A 1 171 ? -17.619 -4.632  4.054   1.00 58.78 ? 148 GLN A NE2 1 
ATOM   1055 N N   . ARG A 1 172 ? -18.037 -0.022  6.906   1.00 50.32 ? 149 ARG A N   1 
ATOM   1056 C CA  . ARG A 1 172 ? -17.829 1.412   6.750   1.00 51.85 ? 149 ARG A CA  1 
ATOM   1057 C C   . ARG A 1 172 ? -16.364 1.798   6.815   1.00 50.63 ? 149 ARG A C   1 
ATOM   1058 O O   . ARG A 1 172 ? -15.910 2.662   6.064   1.00 50.01 ? 149 ARG A O   1 
ATOM   1059 C CB  . ARG A 1 172 ? -18.620 2.191   7.806   1.00 53.94 ? 149 ARG A CB  1 
ATOM   1060 C CG  . ARG A 1 172 ? -20.101 2.294   7.494   1.00 57.87 ? 149 ARG A CG  1 
ATOM   1061 C CD  . ARG A 1 172 ? -20.319 2.872   6.095   1.00 60.50 ? 149 ARG A CD  1 
ATOM   1062 N NE  . ARG A 1 172 ? -19.922 4.275   5.989   1.00 62.32 ? 149 ARG A NE  1 
ATOM   1063 C CZ  . ARG A 1 172 ? -19.667 4.894   4.837   1.00 64.06 ? 149 ARG A CZ  1 
ATOM   1064 N NH1 . ARG A 1 172 ? -19.321 6.177   4.829   1.00 64.75 ? 149 ARG A NH1 1 
ATOM   1065 N NH2 . ARG A 1 172 ? -19.735 4.229   3.691   1.00 63.01 ? 149 ARG A NH2 1 
ATOM   1066 N N   . GLY A 1 173 ? -15.628 1.153   7.713   1.00 48.60 ? 150 GLY A N   1 
ATOM   1067 C CA  . GLY A 1 173 ? -14.218 1.455   7.841   1.00 47.46 ? 150 GLY A CA  1 
ATOM   1068 C C   . GLY A 1 173 ? -13.537 1.276   6.503   1.00 46.62 ? 150 GLY A C   1 
ATOM   1069 O O   . GLY A 1 173 ? -13.050 2.235   5.904   1.00 47.72 ? 150 GLY A O   1 
ATOM   1070 N N   . ALA A 1 174 ? -13.517 0.038   6.025   1.00 45.31 ? 151 ALA A N   1 
ATOM   1071 C CA  . ALA A 1 174 ? -12.896 -0.271  4.752   1.00 43.79 ? 151 ALA A CA  1 
ATOM   1072 C C   . ALA A 1 174 ? -13.527 0.570   3.646   1.00 43.69 ? 151 ALA A C   1 
ATOM   1073 O O   . ALA A 1 174 ? -12.835 1.066   2.754   1.00 43.45 ? 151 ALA A O   1 
ATOM   1074 C CB  . ALA A 1 174 ? -13.059 -1.749  4.447   1.00 43.02 ? 151 ALA A CB  1 
ATOM   1075 N N   . GLU A 1 175 ? -14.845 0.732   3.714   1.00 43.21 ? 152 GLU A N   1 
ATOM   1076 C CA  . GLU A 1 175 ? -15.572 1.505   2.713   1.00 42.54 ? 152 GLU A CA  1 
ATOM   1077 C C   . GLU A 1 175 ? -15.071 2.942   2.618   1.00 41.15 ? 152 GLU A C   1 
ATOM   1078 O O   . GLU A 1 175 ? -14.911 3.481   1.526   1.00 40.55 ? 152 GLU A O   1 
ATOM   1079 C CB  . GLU A 1 175 ? -17.074 1.507   3.026   1.00 44.67 ? 152 GLU A CB  1 
ATOM   1080 C CG  . GLU A 1 175 ? -17.840 0.285   2.529   1.00 45.28 ? 152 GLU A CG  1 
ATOM   1081 C CD  . GLU A 1 175 ? -19.322 0.322   2.912   1.00 46.66 ? 152 GLU A CD  1 
ATOM   1082 O OE1 . GLU A 1 175 ? -19.900 1.432   2.954   1.00 45.60 ? 152 GLU A OE1 1 
ATOM   1083 O OE2 . GLU A 1 175 ? -19.910 -0.759  3.154   1.00 46.53 ? 152 GLU A OE2 1 
ATOM   1084 N N   . ILE A 1 176 ? -14.825 3.572   3.759   1.00 39.82 ? 153 ILE A N   1 
ATOM   1085 C CA  . ILE A 1 176 ? -14.346 4.938   3.725   1.00 38.46 ? 153 ILE A CA  1 
ATOM   1086 C C   . ILE A 1 176 ? -12.903 4.952   3.255   1.00 38.64 ? 153 ILE A C   1 
ATOM   1087 O O   . ILE A 1 176 ? -12.503 5.818   2.483   1.00 38.27 ? 153 ILE A O   1 
ATOM   1088 C CB  . ILE A 1 176 ? -14.440 5.591   5.088   1.00 37.28 ? 153 ILE A CB  1 
ATOM   1089 C CG1 . ILE A 1 176 ? -15.904 5.679   5.505   1.00 38.86 ? 153 ILE A CG1 1 
ATOM   1090 C CG2 . ILE A 1 176 ? -13.835 6.977   5.036   1.00 37.93 ? 153 ILE A CG2 1 
ATOM   1091 C CD1 . ILE A 1 176 ? -16.116 6.349   6.845   1.00 41.06 ? 153 ILE A CD1 1 
ATOM   1092 N N   . LEU A 1 177 ? -12.127 3.978   3.711   1.00 38.81 ? 154 LEU A N   1 
ATOM   1093 C CA  . LEU A 1 177 ? -10.727 3.900   3.318   1.00 41.00 ? 154 LEU A CA  1 
ATOM   1094 C C   . LEU A 1 177 ? -10.593 3.659   1.814   1.00 41.98 ? 154 LEU A C   1 
ATOM   1095 O O   . LEU A 1 177 ? -9.717  4.229   1.164   1.00 42.70 ? 154 LEU A O   1 
ATOM   1096 C CB  . LEU A 1 177 ? -10.012 2.792   4.114   1.00 38.71 ? 154 LEU A CB  1 
ATOM   1097 C CG  . LEU A 1 177 ? -8.500  2.605   3.892   1.00 36.65 ? 154 LEU A CG  1 
ATOM   1098 C CD1 . LEU A 1 177 ? -7.868  1.919   5.112   1.00 34.45 ? 154 LEU A CD1 1 
ATOM   1099 C CD2 . LEU A 1 177 ? -8.247  1.803   2.613   1.00 32.54 ? 154 LEU A CD2 1 
ATOM   1100 N N   . ALA A 1 178 ? -11.466 2.818   1.266   1.00 43.70 ? 155 ALA A N   1 
ATOM   1101 C CA  . ALA A 1 178 ? -11.447 2.507   -0.163  1.00 44.89 ? 155 ALA A CA  1 
ATOM   1102 C C   . ALA A 1 178 ? -11.714 3.774   -0.950  1.00 46.27 ? 155 ALA A C   1 
ATOM   1103 O O   . ALA A 1 178 ? -11.167 3.985   -2.038  1.00 46.39 ? 155 ALA A O   1 
ATOM   1104 C CB  . ALA A 1 178 ? -12.508 1.470   -0.485  1.00 44.37 ? 155 ALA A CB  1 
ATOM   1105 N N   . ASP A 1 179 ? -12.569 4.614   -0.382  1.00 47.54 ? 156 ASP A N   1 
ATOM   1106 C CA  . ASP A 1 179 ? -12.943 5.872   -0.998  1.00 49.04 ? 156 ASP A CA  1 
ATOM   1107 C C   . ASP A 1 179 ? -11.792 6.884   -0.934  1.00 48.10 ? 156 ASP A C   1 
ATOM   1108 O O   . ASP A 1 179 ? -11.591 7.678   -1.860  1.00 48.42 ? 156 ASP A O   1 
ATOM   1109 C CB  . ASP A 1 179 ? -14.185 6.424   -0.290  1.00 50.54 ? 156 ASP A CB  1 
ATOM   1110 C CG  . ASP A 1 179 ? -14.686 7.709   -0.913  1.00 52.35 ? 156 ASP A CG  1 
ATOM   1111 O OD1 . ASP A 1 179 ? -13.992 8.746   -0.785  1.00 51.76 ? 156 ASP A OD1 1 
ATOM   1112 O OD2 . ASP A 1 179 ? -15.772 7.675   -1.536  1.00 53.18 ? 156 ASP A OD2 1 
ATOM   1113 N N   . THR A 1 180 ? -11.028 6.832   0.153   1.00 46.32 ? 157 THR A N   1 
ATOM   1114 C CA  . THR A 1 180 ? -9.912  7.747   0.358   1.00 44.31 ? 157 THR A CA  1 
ATOM   1115 C C   . THR A 1 180 ? -8.752  7.446   -0.575  1.00 44.95 ? 157 THR A C   1 
ATOM   1116 O O   . THR A 1 180 ? -8.016  8.348   -0.984  1.00 45.42 ? 157 THR A O   1 
ATOM   1117 C CB  . THR A 1 180 ? -9.387  7.664   1.796   1.00 42.39 ? 157 THR A CB  1 
ATOM   1118 O OG1 . THR A 1 180 ? -10.487 7.652   2.710   1.00 39.45 ? 157 THR A OG1 1 
ATOM   1119 C CG2 . THR A 1 180 ? -8.499  8.855   2.099   1.00 42.30 ? 157 THR A CG2 1 
ATOM   1120 N N   . PHE A 1 181 ? -8.593  6.172   -0.910  1.00 44.37 ? 158 PHE A N   1 
ATOM   1121 C CA  . PHE A 1 181 ? -7.509  5.754   -1.779  1.00 44.00 ? 158 PHE A CA  1 
ATOM   1122 C C   . PHE A 1 181 ? -8.022  5.109   -3.068  1.00 45.65 ? 158 PHE A C   1 
ATOM   1123 O O   . PHE A 1 181 ? -7.802  3.925   -3.332  1.00 44.13 ? 158 PHE A O   1 
ATOM   1124 C CB  . PHE A 1 181 ? -6.604  4.804   -1.007  1.00 42.41 ? 158 PHE A CB  1 
ATOM   1125 C CG  . PHE A 1 181 ? -6.070  5.392   0.274   1.00 40.31 ? 158 PHE A CG  1 
ATOM   1126 C CD1 . PHE A 1 181 ? -6.263  4.741   1.489   1.00 38.67 ? 158 PHE A CD1 1 
ATOM   1127 C CD2 . PHE A 1 181 ? -5.367  6.594   0.265   1.00 39.17 ? 158 PHE A CD2 1 
ATOM   1128 C CE1 . PHE A 1 181 ? -5.763  5.276   2.672   1.00 36.18 ? 158 PHE A CE1 1 
ATOM   1129 C CE2 . PHE A 1 181 ? -4.864  7.136   1.441   1.00 36.06 ? 158 PHE A CE2 1 
ATOM   1130 C CZ  . PHE A 1 181 ? -5.062  6.476   2.645   1.00 36.55 ? 158 PHE A CZ  1 
ATOM   1131 N N   . LYS A 1 182 ? -8.702  5.922   -3.871  1.00 46.41 ? 159 LYS A N   1 
ATOM   1132 C CA  . LYS A 1 182 ? -9.274  5.488   -5.137  1.00 46.31 ? 159 LYS A CA  1 
ATOM   1133 C C   . LYS A 1 182 ? -8.211  5.108   -6.154  1.00 45.84 ? 159 LYS A C   1 
ATOM   1134 O O   . LYS A 1 182 ? -8.525  4.700   -7.270  1.00 45.15 ? 159 LYS A O   1 
ATOM   1135 C CB  . LYS A 1 182 ? -10.175 6.589   -5.695  1.00 48.07 ? 159 LYS A CB  1 
ATOM   1136 C CG  . LYS A 1 182 ? -10.090 7.902   -4.925  1.00 50.89 ? 159 LYS A CG  1 
ATOM   1137 C CD  . LYS A 1 182 ? -8.701  8.511   -5.028  1.00 52.63 ? 159 LYS A CD  1 
ATOM   1138 C CE  . LYS A 1 182 ? -8.603  9.817   -4.264  1.00 54.21 ? 159 LYS A CE  1 
ATOM   1139 N NZ  . LYS A 1 182 ? -7.289  10.482  -4.510  1.00 54.13 ? 159 LYS A NZ  1 
ATOM   1140 N N   . ASP A 1 183 ? -6.948  5.251   -5.774  1.00 45.95 ? 160 ASP A N   1 
ATOM   1141 C CA  . ASP A 1 183 ? -5.854  4.875   -6.667  1.00 46.51 ? 160 ASP A CA  1 
ATOM   1142 C C   . ASP A 1 183 ? -5.595  3.385   -6.530  1.00 45.45 ? 160 ASP A C   1 
ATOM   1143 O O   . ASP A 1 183 ? -5.021  2.760   -7.430  1.00 45.84 ? 160 ASP A O   1 
ATOM   1144 C CB  . ASP A 1 183 ? -4.564  5.615   -6.314  1.00 47.02 ? 160 ASP A CB  1 
ATOM   1145 C CG  . ASP A 1 183 ? -4.601  7.063   -6.713  1.00 50.23 ? 160 ASP A CG  1 
ATOM   1146 O OD1 . ASP A 1 183 ? -4.860  7.332   -7.907  1.00 51.48 ? 160 ASP A OD1 1 
ATOM   1147 O OD2 . ASP A 1 183 ? -4.369  7.931   -5.840  1.00 52.25 ? 160 ASP A OD2 1 
ATOM   1148 N N   . TYR A 1 184 ? -6.025  2.821   -5.401  1.00 42.55 ? 161 TYR A N   1 
ATOM   1149 C CA  . TYR A 1 184 ? -5.794  1.413   -5.137  1.00 41.59 ? 161 TYR A CA  1 
ATOM   1150 C C   . TYR A 1 184 ? -7.017  0.566   -4.802  1.00 41.45 ? 161 TYR A C   1 
ATOM   1151 O O   . TYR A 1 184 ? -7.979  1.024   -4.178  1.00 41.05 ? 161 TYR A O   1 
ATOM   1152 C CB  . TYR A 1 184 ? -4.755  1.255   -4.021  1.00 39.95 ? 161 TYR A CB  1 
ATOM   1153 C CG  . TYR A 1 184 ? -3.418  1.883   -4.333  1.00 39.80 ? 161 TYR A CG  1 
ATOM   1154 C CD1 . TYR A 1 184 ? -3.203  3.252   -4.139  1.00 41.30 ? 161 TYR A CD1 1 
ATOM   1155 C CD2 . TYR A 1 184 ? -2.374  1.120   -4.847  1.00 37.52 ? 161 TYR A CD2 1 
ATOM   1156 C CE1 . TYR A 1 184 ? -1.977  3.842   -4.451  1.00 42.10 ? 161 TYR A CE1 1 
ATOM   1157 C CE2 . TYR A 1 184 ? -1.148  1.694   -5.164  1.00 39.08 ? 161 TYR A CE2 1 
ATOM   1158 C CZ  . TYR A 1 184 ? -0.951  3.054   -4.964  1.00 41.66 ? 161 TYR A CZ  1 
ATOM   1159 O OH  . TYR A 1 184 ? 0.267   3.623   -5.265  1.00 41.10 ? 161 TYR A OH  1 
ATOM   1160 N N   . ALA A 1 185 ? -6.950  -0.690  -5.224  1.00 39.35 ? 162 ALA A N   1 
ATOM   1161 C CA  . ALA A 1 185 ? -8.012  -1.636  -4.981  1.00 38.29 ? 162 ALA A CA  1 
ATOM   1162 C C   . ALA A 1 185 ? -7.983  -2.025  -3.509  1.00 37.63 ? 162 ALA A C   1 
ATOM   1163 O O   . ALA A 1 185 ? -6.915  -2.261  -2.943  1.00 37.25 ? 162 ALA A O   1 
ATOM   1164 C CB  . ALA A 1 185 ? -7.813  -2.864  -5.857  1.00 38.40 ? 162 ALA A CB  1 
ATOM   1165 N N   . VAL A 1 186 ? -9.162  -2.079  -2.896  1.00 37.13 ? 163 VAL A N   1 
ATOM   1166 C CA  . VAL A 1 186 ? -9.295  -2.444  -1.491  1.00 36.91 ? 163 VAL A CA  1 
ATOM   1167 C C   . VAL A 1 186 ? -10.231 -3.625  -1.306  1.00 36.40 ? 163 VAL A C   1 
ATOM   1168 O O   . VAL A 1 186 ? -11.411 -3.553  -1.632  1.00 36.03 ? 163 VAL A O   1 
ATOM   1169 C CB  . VAL A 1 186 ? -9.857  -1.286  -0.651  1.00 37.55 ? 163 VAL A CB  1 
ATOM   1170 C CG1 . VAL A 1 186 ? -10.025 -1.737  0.789   1.00 36.41 ? 163 VAL A CG1 1 
ATOM   1171 C CG2 . VAL A 1 186 ? -8.937  -0.078  -0.742  1.00 37.03 ? 163 VAL A CG2 1 
ATOM   1172 N N   . SER A 1 187 ? -9.694  -4.712  -0.782  1.00 37.81 ? 164 SER A N   1 
ATOM   1173 C CA  . SER A 1 187 ? -10.481 -5.902  -0.524  1.00 40.29 ? 164 SER A CA  1 
ATOM   1174 C C   . SER A 1 187 ? -10.441 -6.186  0.974   1.00 41.99 ? 164 SER A C   1 
ATOM   1175 O O   . SER A 1 187 ? -9.442  -5.908  1.640   1.00 42.81 ? 164 SER A O   1 
ATOM   1176 C CB  . SER A 1 187 ? -9.929  -7.089  -1.312  1.00 40.59 ? 164 SER A CB  1 
ATOM   1177 O OG  . SER A 1 187 ? -10.156 -6.915  -2.703  1.00 42.13 ? 164 SER A OG  1 
ATOM   1178 N N   . THR A 1 188 ? -11.529 -6.736  1.502   1.00 42.59 ? 165 THR A N   1 
ATOM   1179 C CA  . THR A 1 188 ? -11.610 -7.037  2.917   1.00 43.61 ? 165 THR A CA  1 
ATOM   1180 C C   . THR A 1 188 ? -11.514 -8.535  3.189   1.00 45.06 ? 165 THR A C   1 
ATOM   1181 O O   . THR A 1 188 ? -12.059 -9.343  2.442   1.00 46.32 ? 165 THR A O   1 
ATOM   1182 C CB  . THR A 1 188 ? -12.924 -6.506  3.482   1.00 44.60 ? 165 THR A CB  1 
ATOM   1183 O OG1 . THR A 1 188 ? -14.019 -7.122  2.792   1.00 44.16 ? 165 THR A OG1 1 
ATOM   1184 C CG2 . THR A 1 188 ? -13.004 -4.996  3.293   1.00 43.06 ? 165 THR A CG2 1 
ATOM   1185 N N   . VAL A 1 189 ? -10.809 -8.901  4.256   1.00 47.26 ? 166 VAL A N   1 
ATOM   1186 C CA  . VAL A 1 189 ? -10.650 -10.305 4.630   1.00 48.39 ? 166 VAL A CA  1 
ATOM   1187 C C   . VAL A 1 189 ? -11.006 -10.520 6.092   1.00 48.74 ? 166 VAL A C   1 
ATOM   1188 O O   . VAL A 1 189 ? -10.515 -9.818  6.972   1.00 48.31 ? 166 VAL A O   1 
ATOM   1189 C CB  . VAL A 1 189 ? -9.208  -10.808 4.400   1.00 49.01 ? 166 VAL A CB  1 
ATOM   1190 C CG1 . VAL A 1 189 ? -8.208  -9.847  5.010   1.00 49.74 ? 166 VAL A CG1 1 
ATOM   1191 C CG2 . VAL A 1 189 ? -9.048  -12.189 5.017   1.00 49.98 ? 166 VAL A CG2 1 
ATOM   1192 N N   . PRO A 1 190 ? -11.863 -11.509 6.370   1.00 49.59 ? 167 PRO A N   1 
ATOM   1193 C CA  . PRO A 1 190 ? -12.293 -11.817 7.737   1.00 49.69 ? 167 PRO A CA  1 
ATOM   1194 C C   . PRO A 1 190 ? -11.179 -12.180 8.710   1.00 49.12 ? 167 PRO A C   1 
ATOM   1195 O O   . PRO A 1 190 ? -10.436 -13.144 8.493   1.00 49.50 ? 167 PRO A O   1 
ATOM   1196 C CB  . PRO A 1 190 ? -13.277 -12.968 7.537   1.00 51.29 ? 167 PRO A CB  1 
ATOM   1197 C CG  . PRO A 1 190 ? -13.841 -12.686 6.172   1.00 51.49 ? 167 PRO A CG  1 
ATOM   1198 C CD  . PRO A 1 190 ? -12.599 -12.328 5.395   1.00 49.68 ? 167 PRO A CD  1 
ATOM   1199 N N   . VAL A 1 191 ? -11.078 -11.387 9.775   1.00 48.42 ? 168 VAL A N   1 
ATOM   1200 C CA  . VAL A 1 191 ? -10.102 -11.589 10.843  1.00 47.68 ? 168 VAL A CA  1 
ATOM   1201 C C   . VAL A 1 191 ? -10.909 -11.894 12.106  1.00 49.49 ? 168 VAL A C   1 
ATOM   1202 O O   . VAL A 1 191 ? -11.658 -11.046 12.607  1.00 49.73 ? 168 VAL A O   1 
ATOM   1203 C CB  . VAL A 1 191 ? -9.229  -10.329 11.062  1.00 45.03 ? 168 VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 191 ? -8.318  -10.518 12.263  1.00 40.49 ? 168 VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 191 ? -8.397  -10.066 9.817   1.00 44.29 ? 168 VAL A CG2 1 
ATOM   1206 N N   . ALA A 1 192 ? -10.759 -13.118 12.603  1.00 51.54 ? 169 ALA A N   1 
ATOM   1207 C CA  . ALA A 1 192 ? -11.490 -13.576 13.782  1.00 53.88 ? 169 ALA A CA  1 
ATOM   1208 C C   . ALA A 1 192 ? -10.822 -13.219 15.109  1.00 54.68 ? 169 ALA A C   1 
ATOM   1209 O O   . ALA A 1 192 ? -9.687  -12.737 15.139  1.00 55.74 ? 169 ALA A O   1 
ATOM   1210 C CB  . ALA A 1 192 ? -11.706 -15.091 13.700  1.00 53.92 ? 169 ALA A CB  1 
ATOM   1211 N N   . ASP A 1 193 ? -11.551 -13.457 16.198  1.00 54.17 ? 170 ASP A N   1 
ATOM   1212 C CA  . ASP A 1 193 ? -11.076 -13.190 17.551  1.00 52.76 ? 170 ASP A CA  1 
ATOM   1213 C C   . ASP A 1 193 ? -10.675 -11.740 17.753  1.00 52.14 ? 170 ASP A C   1 
ATOM   1214 O O   . ASP A 1 193 ? -11.209 -10.830 17.110  1.00 52.29 ? 170 ASP A O   1 
ATOM   1215 C CB  . ASP A 1 193 ? -9.895  -14.104 17.885  1.00 52.38 ? 170 ASP A CB  1 
ATOM   1216 N N   . GLY A 1 194 ? -9.728  -11.535 18.660  1.00 51.62 ? 171 GLY A N   1 
ATOM   1217 C CA  . GLY A 1 194 ? -9.253  -10.194 18.942  1.00 50.86 ? 171 GLY A CA  1 
ATOM   1218 C C   . GLY A 1 194 ? -7.985  -9.896  18.177  1.00 48.85 ? 171 GLY A C   1 
ATOM   1219 O O   . GLY A 1 194 ? -7.135  -9.137  18.631  1.00 49.34 ? 171 GLY A O   1 
ATOM   1220 N N   . LEU A 1 195 ? -7.855  -10.508 17.008  1.00 47.01 ? 172 LEU A N   1 
ATOM   1221 C CA  . LEU A 1 195 ? -6.684  -10.301 16.179  1.00 45.28 ? 172 LEU A CA  1 
ATOM   1222 C C   . LEU A 1 195 ? -6.945  -9.201  15.195  1.00 43.51 ? 172 LEU A C   1 
ATOM   1223 O O   . LEU A 1 195 ? -8.083  -8.764  15.011  1.00 44.65 ? 172 LEU A O   1 
ATOM   1224 C CB  . LEU A 1 195 ? -6.345  -11.552 15.383  1.00 44.95 ? 172 LEU A CB  1 
ATOM   1225 C CG  . LEU A 1 195 ? -5.944  -12.781 16.178  1.00 47.63 ? 172 LEU A CG  1 
ATOM   1226 C CD1 . LEU A 1 195 ? -5.655  -13.907 15.212  1.00 48.79 ? 172 LEU A CD1 1 
ATOM   1227 C CD2 . LEU A 1 195 ? -4.727  -12.474 17.026  1.00 48.60 ? 172 LEU A CD2 1 
ATOM   1228 N N   . HIS A 1 196 ? -5.868  -8.757  14.568  1.00 39.65 ? 173 HIS A N   1 
ATOM   1229 C CA  . HIS A 1 196 ? -5.950  -7.752  13.541  1.00 36.71 ? 173 HIS A CA  1 
ATOM   1230 C C   . HIS A 1 196 ? -5.365  -8.469  12.362  1.00 34.94 ? 173 HIS A C   1 
ATOM   1231 O O   . HIS A 1 196 ? -4.687  -9.473  12.532  1.00 34.96 ? 173 HIS A O   1 
ATOM   1232 C CB  . HIS A 1 196 ? -5.100  -6.535  13.883  1.00 35.95 ? 173 HIS A CB  1 
ATOM   1233 C CG  . HIS A 1 196 ? -5.714  -5.648  14.916  1.00 33.63 ? 173 HIS A CG  1 
ATOM   1234 N ND1 . HIS A 1 196 ? -5.863  -6.030  16.231  1.00 34.98 ? 173 HIS A ND1 1 
ATOM   1235 C CD2 . HIS A 1 196 ? -6.246  -4.408  14.822  1.00 32.62 ? 173 HIS A CD2 1 
ATOM   1236 C CE1 . HIS A 1 196 ? -6.462  -5.062  16.903  1.00 34.65 ? 173 HIS A CE1 1 
ATOM   1237 N NE2 . HIS A 1 196 ? -6.706  -4.067  16.072  1.00 32.34 ? 173 HIS A NE2 1 
ATOM   1238 N N   . LEU A 1 197 ? -5.635  -7.978  11.166  1.00 32.85 ? 174 LEU A N   1 
ATOM   1239 C CA  . LEU A 1 197 ? -5.082  -8.605  9.978   1.00 30.63 ? 174 LEU A CA  1 
ATOM   1240 C C   . LEU A 1 197 ? -3.563  -8.799  10.113  1.00 30.07 ? 174 LEU A C   1 
ATOM   1241 O O   . LEU A 1 197 ? -3.056  -9.888  9.846   1.00 29.04 ? 174 LEU A O   1 
ATOM   1242 C CB  . LEU A 1 197 ? -5.394  -7.746  8.755   1.00 28.70 ? 174 LEU A CB  1 
ATOM   1243 C CG  . LEU A 1 197 ? -4.783  -8.123  7.408   1.00 28.61 ? 174 LEU A CG  1 
ATOM   1244 C CD1 . LEU A 1 197 ? -5.000  -9.603  7.083   1.00 25.60 ? 174 LEU A CD1 1 
ATOM   1245 C CD2 . LEU A 1 197 ? -5.439  -7.234  6.348   1.00 28.54 ? 174 LEU A CD2 1 
ATOM   1246 N N   . LYS A 1 198 ? -2.847  -7.757  10.546  1.00 27.63 ? 175 LYS A N   1 
ATOM   1247 C CA  . LYS A 1 198 ? -1.397  -7.844  10.680  1.00 27.53 ? 175 LYS A CA  1 
ATOM   1248 C C   . LYS A 1 198 ? -0.870  -8.591  11.908  1.00 27.18 ? 175 LYS A C   1 
ATOM   1249 O O   . LYS A 1 198 ? 0.325   -8.576  12.192  1.00 26.49 ? 175 LYS A O   1 
ATOM   1250 C CB  . LYS A 1 198 ? -0.766  -6.451  10.579  1.00 26.92 ? 175 LYS A CB  1 
ATOM   1251 C CG  . LYS A 1 198 ? -0.696  -5.953  9.131   1.00 30.56 ? 175 LYS A CG  1 
ATOM   1252 C CD  . LYS A 1 198 ? 0.137   -4.678  8.931   1.00 30.84 ? 175 LYS A CD  1 
ATOM   1253 C CE  . LYS A 1 198 ? -0.533  -3.447  9.547   1.00 33.39 ? 175 LYS A CE  1 
ATOM   1254 N NZ  . LYS A 1 198 ? -0.149  -2.164  8.852   1.00 29.83 ? 175 LYS A NZ  1 
ATOM   1255 N N   . SER A 1 199 ? -1.761  -9.254  12.634  1.00 27.26 ? 176 SER A N   1 
ATOM   1256 C CA  . SER A 1 199 ? -1.332  -10.040 13.784  1.00 27.14 ? 176 SER A CA  1 
ATOM   1257 C C   . SER A 1 199 ? -0.675  -11.299 13.217  1.00 25.98 ? 176 SER A C   1 
ATOM   1258 O O   . SER A 1 199 ? -0.037  -12.061 13.939  1.00 26.13 ? 176 SER A O   1 
ATOM   1259 C CB  . SER A 1 199 ? -2.523  -10.435 14.661  1.00 26.65 ? 176 SER A CB  1 
ATOM   1260 O OG  . SER A 1 199 ? -3.027  -9.323  15.368  1.00 30.62 ? 176 SER A OG  1 
ATOM   1261 N N   . PHE A 1 200 ? -0.842  -11.518 11.917  1.00 24.07 ? 177 PHE A N   1 
ATOM   1262 C CA  . PHE A 1 200 ? -0.236  -12.682 11.297  1.00 25.30 ? 177 PHE A CA  1 
ATOM   1263 C C   . PHE A 1 200 ? 0.401   -12.442 9.933   1.00 24.40 ? 177 PHE A C   1 
ATOM   1264 O O   . PHE A 1 200 ? 0.819   -13.384 9.267   1.00 26.12 ? 177 PHE A O   1 
ATOM   1265 C CB  . PHE A 1 200 ? -1.236  -13.855 11.247  1.00 25.19 ? 177 PHE A CB  1 
ATOM   1266 C CG  . PHE A 1 200 ? -2.586  -13.507 10.683  1.00 26.36 ? 177 PHE A CG  1 
ATOM   1267 C CD1 . PHE A 1 200 ? -2.796  -13.478 9.300   1.00 25.03 ? 177 PHE A CD1 1 
ATOM   1268 C CD2 . PHE A 1 200 ? -3.664  -13.232 11.542  1.00 25.69 ? 177 PHE A CD2 1 
ATOM   1269 C CE1 . PHE A 1 200 ? -4.057  -13.184 8.775   1.00 25.07 ? 177 PHE A CE1 1 
ATOM   1270 C CE2 . PHE A 1 200 ? -4.931  -12.936 11.031  1.00 25.41 ? 177 PHE A CE2 1 
ATOM   1271 C CZ  . PHE A 1 200 ? -5.130  -12.913 9.639   1.00 27.48 ? 177 PHE A CZ  1 
ATOM   1272 N N   . CYS A 1 201 ? 0.492   -11.182 9.522   1.00 23.37 ? 178 CYS A N   1 
ATOM   1273 C CA  . CYS A 1 201 ? 1.129   -10.869 8.253   1.00 23.56 ? 178 CYS A CA  1 
ATOM   1274 C C   . CYS A 1 201 ? 1.603   -9.419  8.151   1.00 25.17 ? 178 CYS A C   1 
ATOM   1275 O O   . CYS A 1 201 ? 1.321   -8.581  9.024   1.00 23.72 ? 178 CYS A O   1 
ATOM   1276 C CB  . CYS A 1 201 ? 0.200   -11.173 7.079   1.00 23.05 ? 178 CYS A CB  1 
ATOM   1277 S SG  . CYS A 1 201 ? -1.219  -10.084 6.950   1.00 22.33 ? 178 CYS A SG  1 
ATOM   1278 N N   . SER A 1 202 ? 2.338   -9.153  7.074   1.00 22.51 ? 179 SER A N   1 
ATOM   1279 C CA  . SER A 1 202 ? 2.865   -7.839  6.783   1.00 23.48 ? 179 SER A CA  1 
ATOM   1280 C C   . SER A 1 202 ? 3.818   -7.953  5.602   1.00 23.17 ? 179 SER A C   1 
ATOM   1281 O O   . SER A 1 202 ? 4.226   -9.046  5.214   1.00 21.62 ? 179 SER A O   1 
ATOM   1282 C CB  . SER A 1 202 ? 3.574   -7.248  8.013   1.00 25.33 ? 179 SER A CB  1 
ATOM   1283 O OG  . SER A 1 202 ? 4.473   -8.169  8.603   1.00 28.39 ? 179 SER A OG  1 
ATOM   1284 N N   . MET A 1 203 ? 4.167   -6.821  5.014   1.00 22.74 ? 180 MET A N   1 
ATOM   1285 C CA  . MET A 1 203 ? 5.044   -6.859  3.870   1.00 21.76 ? 180 MET A CA  1 
ATOM   1286 C C   . MET A 1 203 ? 6.485   -7.026  4.297   1.00 23.49 ? 180 MET A C   1 
ATOM   1287 O O   . MET A 1 203 ? 6.999   -6.250  5.106   1.00 22.67 ? 180 MET A O   1 
ATOM   1288 C CB  . MET A 1 203 ? 4.877   -5.597  3.027   1.00 19.99 ? 180 MET A CB  1 
ATOM   1289 C CG  . MET A 1 203 ? 3.481   -5.432  2.479   1.00 18.04 ? 180 MET A CG  1 
ATOM   1290 S SD  . MET A 1 203 ? 2.893   -6.872  1.575   1.00 20.97 ? 180 MET A SD  1 
ATOM   1291 C CE  . MET A 1 203 ? 4.061   -6.839  0.159   1.00 16.98 ? 180 MET A CE  1 
ATOM   1292 N N   . ALA A 1 204 ? 7.119   -8.065  3.762   1.00 23.51 ? 181 ALA A N   1 
ATOM   1293 C CA  . ALA A 1 204 ? 8.509   -8.354  4.055   1.00 24.19 ? 181 ALA A CA  1 
ATOM   1294 C C   . ALA A 1 204 ? 9.310   -7.918  2.838   1.00 25.32 ? 181 ALA A C   1 
ATOM   1295 O O   . ALA A 1 204 ? 10.518  -8.127  2.769   1.00 25.25 ? 181 ALA A O   1 
ATOM   1296 C CB  . ALA A 1 204 ? 8.692   -9.825  4.295   1.00 23.56 ? 181 ALA A CB  1 
ATOM   1297 N N   . GLY A 1 205 ? 8.620   -7.311  1.875   1.00 26.28 ? 182 GLY A N   1 
ATOM   1298 C CA  . GLY A 1 205 ? 9.286   -6.853  0.669   1.00 25.68 ? 182 GLY A CA  1 
ATOM   1299 C C   . GLY A 1 205 ? 8.400   -6.720  -0.554  1.00 25.56 ? 182 GLY A C   1 
ATOM   1300 O O   . GLY A 1 205 ? 7.186   -6.945  -0.505  1.00 24.85 ? 182 GLY A O   1 
ATOM   1301 N N   . PRO A 1 206 ? 8.994   -6.339  -1.685  1.00 27.58 ? 183 PRO A N   1 
ATOM   1302 C CA  . PRO A 1 206 ? 8.213   -6.184  -2.911  1.00 28.25 ? 183 PRO A CA  1 
ATOM   1303 C C   . PRO A 1 206 ? 7.635   -7.521  -3.351  1.00 30.04 ? 183 PRO A C   1 
ATOM   1304 O O   . PRO A 1 206 ? 8.378   -8.440  -3.699  1.00 31.90 ? 183 PRO A O   1 
ATOM   1305 C CB  . PRO A 1 206 ? 9.235   -5.623  -3.896  1.00 26.56 ? 183 PRO A CB  1 
ATOM   1306 C CG  . PRO A 1 206 ? 10.523  -6.216  -3.421  1.00 27.76 ? 183 PRO A CG  1 
ATOM   1307 C CD  . PRO A 1 206 ? 10.421  -6.065  -1.926  1.00 28.32 ? 183 PRO A CD  1 
ATOM   1308 N N   . ASN A 1 207 ? 6.309   -7.627  -3.309  1.00 30.11 ? 184 ASN A N   1 
ATOM   1309 C CA  . ASN A 1 207 ? 5.613   -8.841  -3.711  1.00 29.33 ? 184 ASN A CA  1 
ATOM   1310 C C   . ASN A 1 207 ? 5.850   -9.947  -2.693  1.00 29.96 ? 184 ASN A C   1 
ATOM   1311 O O   . ASN A 1 207 ? 5.581   -11.124 -2.958  1.00 29.74 ? 184 ASN A O   1 
ATOM   1312 C CB  . ASN A 1 207 ? 6.104   -9.301  -5.091  1.00 28.47 ? 184 ASN A CB  1 
ATOM   1313 C CG  . ASN A 1 207 ? 5.002   -9.915  -5.921  1.00 27.28 ? 184 ASN A CG  1 
ATOM   1314 O OD1 . ASN A 1 207 ? 5.177   -10.972 -6.515  1.00 28.13 ? 184 ASN A OD1 1 
ATOM   1315 N ND2 . ASN A 1 207 ? 3.859   -9.248  -5.972  1.00 26.94 ? 184 ASN A ND2 1 
ATOM   1316 N N   . LEU A 1 208 ? 6.346   -9.562  -1.523  1.00 27.73 ? 185 LEU A N   1 
ATOM   1317 C CA  . LEU A 1 208 ? 6.626   -10.523 -0.480  1.00 27.22 ? 185 LEU A CA  1 
ATOM   1318 C C   . LEU A 1 208 ? 5.773   -10.275 0.764   1.00 28.03 ? 185 LEU A C   1 
ATOM   1319 O O   . LEU A 1 208 ? 5.993   -9.322  1.518   1.00 26.92 ? 185 LEU A O   1 
ATOM   1320 C CB  . LEU A 1 208 ? 8.113   -10.473 -0.140  1.00 26.74 ? 185 LEU A CB  1 
ATOM   1321 C CG  . LEU A 1 208 ? 8.638   -11.666 0.668   1.00 29.78 ? 185 LEU A CG  1 
ATOM   1322 C CD1 . LEU A 1 208 ? 8.203   -12.978 0.005   1.00 27.30 ? 185 LEU A CD1 1 
ATOM   1323 C CD2 . LEU A 1 208 ? 10.152  -11.589 0.775   1.00 25.91 ? 185 LEU A CD2 1 
ATOM   1324 N N   . ILE A 1 209 ? 4.788   -11.144 0.974   1.00 28.59 ? 186 ILE A N   1 
ATOM   1325 C CA  . ILE A 1 209 ? 3.887   -11.019 2.119   1.00 27.33 ? 186 ILE A CA  1 
ATOM   1326 C C   . ILE A 1 209 ? 4.244   -11.973 3.247   1.00 27.12 ? 186 ILE A C   1 
ATOM   1327 O O   . ILE A 1 209 ? 4.085   -13.183 3.105   1.00 28.57 ? 186 ILE A O   1 
ATOM   1328 C CB  . ILE A 1 209 ? 2.440   -11.305 1.718   1.00 25.68 ? 186 ILE A CB  1 
ATOM   1329 C CG1 . ILE A 1 209 ? 2.005   -10.311 0.641   1.00 26.32 ? 186 ILE A CG1 1 
ATOM   1330 C CG2 . ILE A 1 209 ? 1.545   -11.219 2.944   1.00 25.20 ? 186 ILE A CG2 1 
ATOM   1331 C CD1 . ILE A 1 209 ? 0.596   -10.520 0.117   1.00 24.04 ? 186 ILE A CD1 1 
ATOM   1332 N N   . ALA A 1 210 ? 4.723   -11.436 4.365   1.00 26.56 ? 187 ALA A N   1 
ATOM   1333 C CA  . ALA A 1 210 ? 5.081   -12.285 5.501   1.00 25.92 ? 187 ALA A CA  1 
ATOM   1334 C C   . ALA A 1 210 ? 3.788   -12.842 6.067   1.00 26.06 ? 187 ALA A C   1 
ATOM   1335 O O   . ALA A 1 210 ? 2.871   -12.086 6.385   1.00 26.52 ? 187 ALA A O   1 
ATOM   1336 C CB  . ALA A 1 210 ? 5.819   -11.480 6.555   1.00 25.80 ? 187 ALA A CB  1 
ATOM   1337 N N   . ILE A 1 211 ? 3.720   -14.161 6.201   1.00 27.23 ? 188 ILE A N   1 
ATOM   1338 C CA  . ILE A 1 211 ? 2.507   -14.806 6.687   1.00 28.39 ? 188 ILE A CA  1 
ATOM   1339 C C   . ILE A 1 211 ? 2.768   -15.938 7.686   1.00 30.21 ? 188 ILE A C   1 
ATOM   1340 O O   . ILE A 1 211 ? 3.770   -16.661 7.589   1.00 29.08 ? 188 ILE A O   1 
ATOM   1341 C CB  . ILE A 1 211 ? 1.708   -15.349 5.479   1.00 28.73 ? 188 ILE A CB  1 
ATOM   1342 C CG1 . ILE A 1 211 ? 0.384   -15.971 5.933   1.00 29.30 ? 188 ILE A CG1 1 
ATOM   1343 C CG2 . ILE A 1 211 ? 2.571   -16.342 4.715   1.00 29.29 ? 188 ILE A CG2 1 
ATOM   1344 C CD1 . ILE A 1 211 ? -0.647  -14.969 6.418   1.00 28.98 ? 188 ILE A CD1 1 
ATOM   1345 N N   . GLY A 1 212 ? 1.855   -16.080 8.645   1.00 31.58 ? 189 GLY A N   1 
ATOM   1346 C CA  . GLY A 1 212 ? 1.980   -17.112 9.661   1.00 34.11 ? 189 GLY A CA  1 
ATOM   1347 C C   . GLY A 1 212 ? 1.506   -18.488 9.226   1.00 36.24 ? 189 GLY A C   1 
ATOM   1348 O O   . GLY A 1 212 ? 0.689   -18.622 8.319   1.00 35.43 ? 189 GLY A O   1 
ATOM   1349 N N   . SER A 1 213 ? 2.013   -19.518 9.892   1.00 39.13 ? 190 SER A N   1 
ATOM   1350 C CA  . SER A 1 213 ? 1.652   -20.891 9.565   1.00 41.22 ? 190 SER A CA  1 
ATOM   1351 C C   . SER A 1 213 ? 0.229   -21.291 9.951   1.00 44.10 ? 190 SER A C   1 
ATOM   1352 O O   . SER A 1 213 ? -0.368  -22.137 9.292   1.00 44.18 ? 190 SER A O   1 
ATOM   1353 C CB  . SER A 1 213 ? 2.636   -21.845 10.220  1.00 40.19 ? 190 SER A CB  1 
ATOM   1354 O OG  . SER A 1 213 ? 3.943   -21.566 9.775   1.00 41.15 ? 190 SER A OG  1 
ATOM   1355 N N   . SER A 1 214 ? -0.316  -20.694 11.010  1.00 46.67 ? 191 SER A N   1 
ATOM   1356 C CA  . SER A 1 214 ? -1.672  -21.032 11.442  1.00 49.59 ? 191 SER A CA  1 
ATOM   1357 C C   . SER A 1 214 ? -2.601  -21.322 10.270  1.00 50.51 ? 191 SER A C   1 
ATOM   1358 O O   . SER A 1 214 ? -2.463  -20.744 9.187   1.00 49.40 ? 191 SER A O   1 
ATOM   1359 C CB  . SER A 1 214 ? -2.289  -19.901 12.284  1.00 51.15 ? 191 SER A CB  1 
ATOM   1360 O OG  . SER A 1 214 ? -1.866  -19.947 13.639  1.00 52.66 ? 191 SER A OG  1 
ATOM   1361 N N   . GLU A 1 215 ? -3.546  -22.229 10.496  1.00 52.32 ? 192 GLU A N   1 
ATOM   1362 C CA  . GLU A 1 215 ? -4.516  -22.572 9.469   1.00 54.13 ? 192 GLU A CA  1 
ATOM   1363 C C   . GLU A 1 215 ? -5.357  -21.317 9.280   1.00 54.31 ? 192 GLU A C   1 
ATOM   1364 O O   . GLU A 1 215 ? -5.753  -20.993 8.164   1.00 56.71 ? 192 GLU A O   1 
ATOM   1365 C CB  . GLU A 1 215 ? -5.391  -23.753 9.920   1.00 53.98 ? 192 GLU A CB  1 
ATOM   1366 N N   . SER A 1 216 ? -5.613  -20.606 10.376  1.00 53.76 ? 193 SER A N   1 
ATOM   1367 C CA  . SER A 1 216 ? -6.386  -19.368 10.324  1.00 53.55 ? 193 SER A CA  1 
ATOM   1368 C C   . SER A 1 216 ? -5.617  -18.327 9.510   1.00 53.56 ? 193 SER A C   1 
ATOM   1369 O O   . SER A 1 216 ? -6.197  -17.567 8.731   1.00 53.50 ? 193 SER A O   1 
ATOM   1370 C CB  . SER A 1 216 ? -6.618  -18.843 11.735  1.00 53.64 ? 193 SER A CB  1 
ATOM   1371 O OG  . SER A 1 216 ? -5.390  -18.763 12.435  1.00 56.71 ? 193 SER A OG  1 
ATOM   1372 N N   . ALA A 1 217 ? -4.303  -18.302 9.706   1.00 53.15 ? 194 ALA A N   1 
ATOM   1373 C CA  . ALA A 1 217 ? -3.433  -17.380 8.994   1.00 50.99 ? 194 ALA A CA  1 
ATOM   1374 C C   . ALA A 1 217 ? -3.493  -17.714 7.517   1.00 50.15 ? 194 ALA A C   1 
ATOM   1375 O O   . ALA A 1 217 ? -3.872  -16.877 6.701   1.00 50.21 ? 194 ALA A O   1 
ATOM   1376 C CB  . ALA A 1 217 ? -2.008  -17.519 9.493   1.00 50.56 ? 194 ALA A CB  1 
ATOM   1377 N N   . GLN A 1 218 ? -3.125  -18.947 7.184   1.00 48.97 ? 195 GLN A N   1 
ATOM   1378 C CA  . GLN A 1 218 ? -3.123  -19.401 5.800   1.00 47.96 ? 195 GLN A CA  1 
ATOM   1379 C C   . GLN A 1 218 ? -4.469  -19.225 5.111   1.00 45.76 ? 195 GLN A C   1 
ATOM   1380 O O   . GLN A 1 218 ? -4.521  -18.984 3.909   1.00 43.57 ? 195 GLN A O   1 
ATOM   1381 C CB  . GLN A 1 218 ? -2.701  -20.870 5.712   1.00 49.58 ? 195 GLN A CB  1 
ATOM   1382 C CG  . GLN A 1 218 ? -1.245  -21.166 6.109   1.00 52.73 ? 195 GLN A CG  1 
ATOM   1383 C CD  . GLN A 1 218 ? -0.219  -20.294 5.388   1.00 52.52 ? 195 GLN A CD  1 
ATOM   1384 O OE1 . GLN A 1 218 ? 0.016   -19.155 5.775   1.00 53.10 ? 195 GLN A OE1 1 
ATOM   1385 N NE2 . GLN A 1 218 ? 0.392   -20.832 4.336   1.00 53.13 ? 195 GLN A NE2 1 
ATOM   1386 N N   . LYS A 1 219 ? -5.556  -19.350 5.865   1.00 45.53 ? 196 LYS A N   1 
ATOM   1387 C CA  . LYS A 1 219 ? -6.888  -19.187 5.290   1.00 45.89 ? 196 LYS A CA  1 
ATOM   1388 C C   . LYS A 1 219 ? -7.066  -17.720 4.924   1.00 46.91 ? 196 LYS A C   1 
ATOM   1389 O O   . LYS A 1 219 ? -7.448  -17.385 3.803   1.00 48.85 ? 196 LYS A O   1 
ATOM   1390 C CB  . LYS A 1 219 ? -7.966  -19.618 6.288   1.00 44.55 ? 196 LYS A CB  1 
ATOM   1391 N N   . ALA A 1 220 ? -6.780  -16.843 5.877   1.00 47.04 ? 197 ALA A N   1 
ATOM   1392 C CA  . ALA A 1 220 ? -6.898  -15.421 5.635   1.00 45.11 ? 197 ALA A CA  1 
ATOM   1393 C C   . ALA A 1 220 ? -6.122  -15.093 4.368   1.00 45.49 ? 197 ALA A C   1 
ATOM   1394 O O   . ALA A 1 220 ? -6.632  -14.412 3.482   1.00 45.78 ? 197 ALA A O   1 
ATOM   1395 C CB  . ALA A 1 220 ? -6.345  -14.643 6.819   1.00 43.94 ? 197 ALA A CB  1 
ATOM   1396 N N   . LEU A 1 221 ? -4.898  -15.599 4.267   1.00 46.27 ? 198 LEU A N   1 
ATOM   1397 C CA  . LEU A 1 221 ? -4.079  -15.321 3.098   1.00 47.63 ? 198 LEU A CA  1 
ATOM   1398 C C   . LEU A 1 221 ? -4.769  -15.756 1.825   1.00 49.59 ? 198 LEU A C   1 
ATOM   1399 O O   . LEU A 1 221 ? -5.004  -14.940 0.937   1.00 50.40 ? 198 LEU A O   1 
ATOM   1400 C CB  . LEU A 1 221 ? -2.713  -16.003 3.201   1.00 48.39 ? 198 LEU A CB  1 
ATOM   1401 C CG  . LEU A 1 221 ? -1.874  -16.031 1.913   1.00 48.99 ? 198 LEU A CG  1 
ATOM   1402 C CD1 . LEU A 1 221 ? -1.890  -14.689 1.208   1.00 49.91 ? 198 LEU A CD1 1 
ATOM   1403 C CD2 . LEU A 1 221 ? -0.461  -16.409 2.259   1.00 50.58 ? 198 LEU A CD2 1 
ATOM   1404 N N   . LYS A 1 222 ? -5.096  -17.038 1.727   1.00 51.49 ? 199 LYS A N   1 
ATOM   1405 C CA  . LYS A 1 222 ? -5.766  -17.542 0.532   1.00 53.17 ? 199 LYS A CA  1 
ATOM   1406 C C   . LYS A 1 222 ? -6.945  -16.635 0.134   1.00 53.15 ? 199 LYS A C   1 
ATOM   1407 O O   . LYS A 1 222 ? -7.096  -16.276 -1.039  1.00 53.71 ? 199 LYS A O   1 
ATOM   1408 C CB  . LYS A 1 222 ? -6.241  -18.988 0.749   1.00 53.16 ? 199 LYS A CB  1 
ATOM   1409 C CG  . LYS A 1 222 ? -5.115  -20.023 0.790   1.00 54.95 ? 199 LYS A CG  1 
ATOM   1410 C CD  . LYS A 1 222 ? -5.663  -21.443 0.947   1.00 57.45 ? 199 LYS A CD  1 
ATOM   1411 C CE  . LYS A 1 222 ? -4.554  -22.493 1.052   1.00 58.29 ? 199 LYS A CE  1 
ATOM   1412 N NZ  . LYS A 1 222 ? -5.080  -23.901 1.113   1.00 57.72 ? 199 LYS A NZ  1 
ATOM   1413 N N   . ILE A 1 223 ? -7.771  -16.252 1.102   1.00 51.65 ? 200 ILE A N   1 
ATOM   1414 C CA  . ILE A 1 223 ? -8.897  -15.383 0.797   1.00 50.57 ? 200 ILE A CA  1 
ATOM   1415 C C   . ILE A 1 223 ? -8.372  -14.148 0.072   1.00 50.15 ? 200 ILE A C   1 
ATOM   1416 O O   . ILE A 1 223 ? -8.981  -13.666 -0.874  1.00 49.72 ? 200 ILE A O   1 
ATOM   1417 C CB  . ILE A 1 223 ? -9.622  -14.930 2.079   1.00 51.44 ? 200 ILE A CB  1 
ATOM   1418 C CG1 . ILE A 1 223 ? -10.146 -16.148 2.847   1.00 50.34 ? 200 ILE A CG1 1 
ATOM   1419 C CG2 . ILE A 1 223 ? -10.761 -13.980 1.717   1.00 51.21 ? 200 ILE A CG2 1 
ATOM   1420 C CD1 . ILE A 1 223 ? -10.651 -15.834 4.251   1.00 49.15 ? 200 ILE A CD1 1 
ATOM   1421 N N   . MET A 1 224 ? -7.226  -13.651 0.517   1.00 49.90 ? 201 MET A N   1 
ATOM   1422 C CA  . MET A 1 224 ? -6.630  -12.469 -0.078  1.00 50.48 ? 201 MET A CA  1 
ATOM   1423 C C   . MET A 1 224 ? -6.282  -12.603 -1.560  1.00 52.38 ? 201 MET A C   1 
ATOM   1424 O O   . MET A 1 224 ? -6.892  -11.929 -2.388  1.00 55.56 ? 201 MET A O   1 
ATOM   1425 C CB  . MET A 1 224 ? -5.385  -12.047 0.714   1.00 49.11 ? 201 MET A CB  1 
ATOM   1426 C CG  . MET A 1 224 ? -5.689  -11.297 2.004   1.00 47.78 ? 201 MET A CG  1 
ATOM   1427 S SD  . MET A 1 224 ? -4.234  -10.822 2.979   1.00 45.79 ? 201 MET A SD  1 
ATOM   1428 C CE  . MET A 1 224 ? -4.448  -11.846 4.391   1.00 44.68 ? 201 MET A CE  1 
ATOM   1429 N N   . GLN A 1 225 ? -5.321  -13.461 -1.901  1.00 52.46 ? 202 GLN A N   1 
ATOM   1430 C CA  . GLN A 1 225 ? -4.902  -13.623 -3.298  1.00 53.00 ? 202 GLN A CA  1 
ATOM   1431 C C   . GLN A 1 225 ? -5.993  -13.978 -4.298  1.00 51.85 ? 202 GLN A C   1 
ATOM   1432 O O   . GLN A 1 225 ? -5.856  -13.706 -5.485  1.00 51.60 ? 202 GLN A O   1 
ATOM   1433 C CB  . GLN A 1 225 ? -3.767  -14.646 -3.416  1.00 54.47 ? 202 GLN A CB  1 
ATOM   1434 C CG  . GLN A 1 225 ? -2.396  -14.075 -3.095  1.00 56.90 ? 202 GLN A CG  1 
ATOM   1435 C CD  . GLN A 1 225 ? -1.255  -14.935 -3.610  1.00 59.07 ? 202 GLN A CD  1 
ATOM   1436 O OE1 . GLN A 1 225 ? -1.282  -15.408 -4.751  1.00 59.67 ? 202 GLN A OE1 1 
ATOM   1437 N NE2 . GLN A 1 225 ? -0.234  -15.127 -2.777  1.00 58.82 ? 202 GLN A NE2 1 
ATOM   1438 N N   . GLN A 1 226 ? -7.063  -14.601 -3.828  1.00 52.00 ? 203 GLN A N   1 
ATOM   1439 C CA  . GLN A 1 226 ? -8.164  -14.965 -4.708  1.00 52.55 ? 203 GLN A CA  1 
ATOM   1440 C C   . GLN A 1 226 ? -8.692  -13.699 -5.381  1.00 51.46 ? 203 GLN A C   1 
ATOM   1441 O O   . GLN A 1 226 ? -8.931  -13.673 -6.589  1.00 50.91 ? 203 GLN A O   1 
ATOM   1442 C CB  . GLN A 1 226 ? -9.284  -15.626 -3.891  1.00 54.63 ? 203 GLN A CB  1 
ATOM   1443 C CG  . GLN A 1 226 ? -10.601 -15.861 -4.639  1.00 58.05 ? 203 GLN A CG  1 
ATOM   1444 C CD  . GLN A 1 226 ? -11.806 -15.272 -3.900  1.00 60.91 ? 203 GLN A CD  1 
ATOM   1445 O OE1 . GLN A 1 226 ? -11.970 -15.473 -2.695  1.00 60.49 ? 203 GLN A OE1 1 
ATOM   1446 N NE2 . GLN A 1 226 ? -12.655 -14.546 -4.627  1.00 61.17 ? 203 GLN A NE2 1 
ATOM   1447 N N   . MET A 1 227 ? -8.849  -12.650 -4.580  1.00 48.54 ? 204 MET A N   1 
ATOM   1448 C CA  . MET A 1 227 ? -9.369  -11.376 -5.041  1.00 46.94 ? 204 MET A CA  1 
ATOM   1449 C C   . MET A 1 227 ? -8.321  -10.448 -5.624  1.00 45.05 ? 204 MET A C   1 
ATOM   1450 O O   . MET A 1 227 ? -8.558  -9.252  -5.750  1.00 41.37 ? 204 MET A O   1 
ATOM   1451 C CB  . MET A 1 227 ? -10.044 -10.656 -3.888  1.00 47.48 ? 204 MET A CB  1 
ATOM   1452 C CG  . MET A 1 227 ? -10.999 -11.506 -3.110  1.00 48.39 ? 204 MET A CG  1 
ATOM   1453 S SD  . MET A 1 227 ? -11.453 -10.614 -1.635  1.00 48.90 ? 204 MET A SD  1 
ATOM   1454 C CE  . MET A 1 227 ? -9.968  -10.833 -0.635  1.00 49.18 ? 204 MET A CE  1 
ATOM   1455 N N   . SER A 1 228 ? -7.160  -10.982 -5.965  1.00 45.09 ? 205 SER A N   1 
ATOM   1456 C CA  . SER A 1 228 ? -6.111  -10.149 -6.537  1.00 45.92 ? 205 SER A CA  1 
ATOM   1457 C C   . SER A 1 228 ? -5.807  -10.542 -7.976  1.00 46.73 ? 205 SER A C   1 
ATOM   1458 O O   . SER A 1 228 ? -6.172  -11.631 -8.419  1.00 47.72 ? 205 SER A O   1 
ATOM   1459 C CB  . SER A 1 228 ? -4.842  -10.247 -5.698  1.00 44.76 ? 205 SER A CB  1 
ATOM   1460 O OG  . SER A 1 228 ? -3.794  -9.500  -6.284  1.00 43.92 ? 205 SER A OG  1 
ATOM   1461 N N   . ASP A 1 229 ? -5.142  -9.648  -8.701  1.00 48.26 ? 206 ASP A N   1 
ATOM   1462 C CA  . ASP A 1 229 ? -4.787  -9.894  -10.097 1.00 49.51 ? 206 ASP A CA  1 
ATOM   1463 C C   . ASP A 1 229 ? -3.360  -10.411 -10.223 1.00 49.58 ? 206 ASP A C   1 
ATOM   1464 O O   . ASP A 1 229 ? -3.011  -11.081 -11.201 1.00 51.62 ? 206 ASP A O   1 
ATOM   1465 C CB  . ASP A 1 229 ? -4.946  -8.615  -10.938 1.00 49.66 ? 206 ASP A CB  1 
ATOM   1466 C CG  . ASP A 1 229 ? -6.404  -8.175  -11.080 1.00 50.08 ? 206 ASP A CG  1 
ATOM   1467 O OD1 . ASP A 1 229 ? -7.244  -9.009  -11.481 1.00 49.57 ? 206 ASP A OD1 1 
ATOM   1468 O OD2 . ASP A 1 229 ? -6.708  -6.991  -10.804 1.00 49.81 ? 206 ASP A OD2 1 
ATOM   1469 N N   . HIS A 1 230 ? -2.530  -10.093 -9.237  1.00 48.05 ? 207 HIS A N   1 
ATOM   1470 C CA  . HIS A 1 230 ? -1.154  -10.552 -9.262  1.00 46.46 ? 207 HIS A CA  1 
ATOM   1471 C C   . HIS A 1 230 ? -0.922  -11.508 -8.111  1.00 45.69 ? 207 HIS A C   1 
ATOM   1472 O O   . HIS A 1 230 ? -1.595  -11.444 -7.081  1.00 45.40 ? 207 HIS A O   1 
ATOM   1473 C CB  . HIS A 1 230 ? -0.198  -9.385  -9.176  1.00 47.18 ? 207 HIS A CB  1 
ATOM   1474 N N   . ARG A 1 231 ? 0.025   -12.412 -8.303  1.00 44.68 ? 208 ARG A N   1 
ATOM   1475 C CA  . ARG A 1 231 ? 0.346   -13.386 -7.282  1.00 44.09 ? 208 ARG A CA  1 
ATOM   1476 C C   . ARG A 1 231 ? 1.489   -12.832 -6.453  1.00 42.51 ? 208 ARG A C   1 
ATOM   1477 O O   . ARG A 1 231 ? 2.489   -12.375 -7.005  1.00 43.13 ? 208 ARG A O   1 
ATOM   1478 C CB  . ARG A 1 231 ? 0.748   -14.728 -7.934  1.00 43.77 ? 208 ARG A CB  1 
ATOM   1479 N N   . TYR A 1 232 ? 1.326   -12.835 -5.134  1.00 41.27 ? 209 TYR A N   1 
ATOM   1480 C CA  . TYR A 1 232 ? 2.386   -12.372 -4.255  1.00 38.34 ? 209 TYR A CA  1 
ATOM   1481 C C   . TYR A 1 232 ? 3.169   -13.586 -3.793  1.00 37.29 ? 209 TYR A C   1 
ATOM   1482 O O   . TYR A 1 232 ? 2.599   -14.657 -3.572  1.00 34.68 ? 209 TYR A O   1 
ATOM   1483 C CB  . TYR A 1 232 ? 1.825   -11.668 -3.030  1.00 36.98 ? 209 TYR A CB  1 
ATOM   1484 C CG  . TYR A 1 232 ? 1.184   -10.346 -3.312  1.00 38.21 ? 209 TYR A CG  1 
ATOM   1485 C CD1 . TYR A 1 232 ? -0.195  -10.194 -3.221  1.00 39.75 ? 209 TYR A CD1 1 
ATOM   1486 C CD2 . TYR A 1 232 ? 1.956   -9.227  -3.616  1.00 38.07 ? 209 TYR A CD2 1 
ATOM   1487 C CE1 . TYR A 1 232 ? -0.795  -8.955  -3.415  1.00 39.62 ? 209 TYR A CE1 1 
ATOM   1488 C CE2 . TYR A 1 232 ? 1.369   -7.981  -3.814  1.00 37.91 ? 209 TYR A CE2 1 
ATOM   1489 C CZ  . TYR A 1 232 ? -0.007  -7.854  -3.707  1.00 39.62 ? 209 TYR A CZ  1 
ATOM   1490 O OH  . TYR A 1 232 ? -0.604  -6.630  -3.866  1.00 39.81 ? 209 TYR A OH  1 
ATOM   1491 N N   . ASP A 1 233 ? 4.481   -13.422 -3.675  1.00 38.30 ? 210 ASP A N   1 
ATOM   1492 C CA  . ASP A 1 233 ? 5.326   -14.504 -3.197  1.00 38.87 ? 210 ASP A CA  1 
ATOM   1493 C C   . ASP A 1 233 ? 5.097   -14.481 -1.685  1.00 38.98 ? 210 ASP A C   1 
ATOM   1494 O O   . ASP A 1 233 ? 4.918   -13.412 -1.098  1.00 38.85 ? 210 ASP A O   1 
ATOM   1495 C CB  . ASP A 1 233 ? 6.811   -14.239 -3.510  1.00 38.76 ? 210 ASP A CB  1 
ATOM   1496 C CG  . ASP A 1 233 ? 7.082   -14.006 -4.998  1.00 40.97 ? 210 ASP A CG  1 
ATOM   1497 O OD1 . ASP A 1 233 ? 6.972   -12.852 -5.463  1.00 43.54 ? 210 ASP A OD1 1 
ATOM   1498 O OD2 . ASP A 1 233 ? 7.408   -14.975 -5.713  1.00 41.45 ? 210 ASP A OD2 1 
ATOM   1499 N N   . LYS A 1 234 ? 5.099   -15.642 -1.045  1.00 38.85 ? 211 LYS A N   1 
ATOM   1500 C CA  . LYS A 1 234 ? 4.863   -15.660 0.391   1.00 38.04 ? 211 LYS A CA  1 
ATOM   1501 C C   . LYS A 1 234 ? 5.995   -16.216 1.242   1.00 37.49 ? 211 LYS A C   1 
ATOM   1502 O O   . LYS A 1 234 ? 6.570   -17.260 0.931   1.00 36.98 ? 211 LYS A O   1 
ATOM   1503 C CB  . LYS A 1 234 ? 3.591   -16.446 0.706   1.00 38.42 ? 211 LYS A CB  1 
ATOM   1504 C CG  . LYS A 1 234 ? 3.728   -17.953 0.541   1.00 37.91 ? 211 LYS A CG  1 
ATOM   1505 C CD  . LYS A 1 234 ? 2.440   -18.629 0.936   1.00 38.12 ? 211 LYS A CD  1 
ATOM   1506 C CE  . LYS A 1 234 ? 2.532   -20.127 0.790   1.00 38.79 ? 211 LYS A CE  1 
ATOM   1507 N NZ  . LYS A 1 234 ? 1.227   -20.759 1.122   1.00 39.22 ? 211 LYS A NZ  1 
ATOM   1508 N N   . LEU A 1 235 ? 6.302   -15.501 2.324   1.00 37.64 ? 212 LEU A N   1 
ATOM   1509 C CA  . LEU A 1 235 ? 7.322   -15.925 3.281   1.00 36.16 ? 212 LEU A CA  1 
ATOM   1510 C C   . LEU A 1 235 ? 6.554   -16.450 4.491   1.00 35.70 ? 212 LEU A C   1 
ATOM   1511 O O   . LEU A 1 235 ? 6.045   -15.674 5.299   1.00 36.03 ? 212 LEU A O   1 
ATOM   1512 C CB  . LEU A 1 235 ? 8.221   -14.753 3.694   1.00 34.55 ? 212 LEU A CB  1 
ATOM   1513 C CG  . LEU A 1 235 ? 9.355   -15.077 4.682   1.00 32.84 ? 212 LEU A CG  1 
ATOM   1514 C CD1 . LEU A 1 235 ? 10.285  -16.116 4.089   1.00 31.64 ? 212 LEU A CD1 1 
ATOM   1515 C CD2 . LEU A 1 235 ? 10.128  -13.817 5.005   1.00 33.35 ? 212 LEU A CD2 1 
ATOM   1516 N N   . THR A 1 236 ? 6.449   -17.771 4.601   1.00 36.39 ? 213 THR A N   1 
ATOM   1517 C CA  . THR A 1 236 ? 5.720   -18.375 5.710   1.00 35.40 ? 213 THR A CA  1 
ATOM   1518 C C   . THR A 1 236 ? 6.577   -18.539 6.961   1.00 35.77 ? 213 THR A C   1 
ATOM   1519 O O   . THR A 1 236 ? 7.721   -18.989 6.885   1.00 35.81 ? 213 THR A O   1 
ATOM   1520 C CB  . THR A 1 236 ? 5.142   -19.746 5.315   1.00 33.64 ? 213 THR A CB  1 
ATOM   1521 O OG1 . THR A 1 236 ? 4.117   -19.561 4.324   1.00 32.63 ? 213 THR A OG1 1 
ATOM   1522 C CG2 . THR A 1 236 ? 4.552   -20.454 6.539   1.00 31.69 ? 213 THR A CG2 1 
ATOM   1523 N N   . VAL A 1 237 ? 6.022   -18.150 8.108   1.00 34.82 ? 214 VAL A N   1 
ATOM   1524 C CA  . VAL A 1 237 ? 6.739   -18.281 9.364   1.00 34.45 ? 214 VAL A CA  1 
ATOM   1525 C C   . VAL A 1 237 ? 5.923   -19.073 10.368  1.00 34.12 ? 214 VAL A C   1 
ATOM   1526 O O   . VAL A 1 237 ? 4.716   -18.894 10.492  1.00 33.30 ? 214 VAL A O   1 
ATOM   1527 C CB  . VAL A 1 237 ? 7.113   -16.904 9.970   1.00 34.83 ? 214 VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 237 ? 8.073   -16.196 9.048   1.00 34.24 ? 214 VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 237 ? 5.864   -16.068 10.206  1.00 34.01 ? 214 VAL A CG2 1 
ATOM   1530 N N   . PRO A 1 238 ? 6.588   -19.979 11.093  1.00 35.61 ? 215 PRO A N   1 
ATOM   1531 C CA  . PRO A 1 238 ? 5.948   -20.828 12.101  1.00 35.50 ? 215 PRO A CA  1 
ATOM   1532 C C   . PRO A 1 238 ? 5.140   -20.066 13.136  1.00 34.75 ? 215 PRO A C   1 
ATOM   1533 O O   . PRO A 1 238 ? 4.021   -20.450 13.475  1.00 35.62 ? 215 PRO A O   1 
ATOM   1534 C CB  . PRO A 1 238 ? 7.128   -21.590 12.716  1.00 36.40 ? 215 PRO A CB  1 
ATOM   1535 C CG  . PRO A 1 238 ? 8.332   -20.706 12.419  1.00 36.27 ? 215 PRO A CG  1 
ATOM   1536 C CD  . PRO A 1 238 ? 8.037   -20.246 11.024  1.00 35.49 ? 215 PRO A CD  1 
ATOM   1537 N N   . ASP A 1 239 ? 5.716   -18.982 13.638  1.00 35.34 ? 216 ASP A N   1 
ATOM   1538 C CA  . ASP A 1 239 ? 5.055   -18.167 14.647  1.00 34.24 ? 216 ASP A CA  1 
ATOM   1539 C C   . ASP A 1 239 ? 4.279   -17.082 13.920  1.00 33.47 ? 216 ASP A C   1 
ATOM   1540 O O   . ASP A 1 239 ? 4.859   -16.244 13.225  1.00 32.03 ? 216 ASP A O   1 
ATOM   1541 C CB  . ASP A 1 239 ? 6.097   -17.565 15.600  1.00 33.96 ? 216 ASP A CB  1 
ATOM   1542 C CG  . ASP A 1 239 ? 7.050   -18.614 16.171  1.00 33.63 ? 216 ASP A CG  1 
ATOM   1543 O OD1 . ASP A 1 239 ? 8.212   -18.672 15.718  1.00 35.54 ? 216 ASP A OD1 1 
ATOM   1544 O OD2 . ASP A 1 239 ? 6.641   -19.388 17.064  1.00 33.04 ? 216 ASP A OD2 1 
ATOM   1545 N N   . ASP A 1 240 ? 2.960   -17.118 14.077  1.00 33.40 ? 217 ASP A N   1 
ATOM   1546 C CA  . ASP A 1 240 ? 2.085   -16.170 13.406  1.00 33.80 ? 217 ASP A CA  1 
ATOM   1547 C C   . ASP A 1 240 ? 2.348   -14.695 13.697  1.00 31.88 ? 217 ASP A C   1 
ATOM   1548 O O   . ASP A 1 240 ? 2.296   -13.869 12.798  1.00 32.62 ? 217 ASP A O   1 
ATOM   1549 C CB  . ASP A 1 240 ? 0.627   -16.527 13.699  1.00 34.13 ? 217 ASP A CB  1 
ATOM   1550 C CG  . ASP A 1 240 ? 0.234   -17.856 13.084  1.00 39.00 ? 217 ASP A CG  1 
ATOM   1551 O OD1 . ASP A 1 240 ? 0.603   -18.918 13.645  1.00 41.09 ? 217 ASP A OD1 1 
ATOM   1552 O OD2 . ASP A 1 240 ? -0.419  -17.841 12.021  1.00 37.27 ? 217 ASP A OD2 1 
ATOM   1553 N N   . ILE A 1 241 ? 2.651   -14.363 14.939  1.00 29.68 ? 218 ILE A N   1 
ATOM   1554 C CA  . ILE A 1 241 ? 2.899   -12.974 15.285  1.00 30.21 ? 218 ILE A CA  1 
ATOM   1555 C C   . ILE A 1 241 ? 4.256   -12.475 14.784  1.00 29.79 ? 218 ILE A C   1 
ATOM   1556 O O   . ILE A 1 241 ? 4.463   -11.281 14.583  1.00 27.91 ? 218 ILE A O   1 
ATOM   1557 C CB  . ILE A 1 241 ? 2.711   -12.783 16.807  1.00 30.19 ? 218 ILE A CB  1 
ATOM   1558 C CG1 . ILE A 1 241 ? 1.200   -12.735 17.083  1.00 30.50 ? 218 ILE A CG1 1 
ATOM   1559 C CG2 . ILE A 1 241 ? 3.445   -11.550 17.306  1.00 31.04 ? 218 ILE A CG2 1 
ATOM   1560 C CD1 . ILE A 1 241 ? 0.803   -12.370 18.480  1.00 33.44 ? 218 ILE A CD1 1 
ATOM   1561 N N   . ALA A 1 242 ? 5.177   -13.401 14.559  1.00 30.84 ? 219 ALA A N   1 
ATOM   1562 C CA  . ALA A 1 242 ? 6.477   -13.024 14.039  1.00 30.13 ? 219 ALA A CA  1 
ATOM   1563 C C   . ALA A 1 242 ? 6.286   -12.568 12.590  1.00 29.55 ? 219 ALA A C   1 
ATOM   1564 O O   . ALA A 1 242 ? 7.106   -11.833 12.056  1.00 31.51 ? 219 ALA A O   1 
ATOM   1565 C CB  . ALA A 1 242 ? 7.433   -14.196 14.103  1.00 30.11 ? 219 ALA A CB  1 
ATOM   1566 N N   . ALA A 1 243 ? 5.203   -12.998 11.953  1.00 26.35 ? 220 ALA A N   1 
ATOM   1567 C CA  . ALA A 1 243 ? 4.941   -12.579 10.581  1.00 24.31 ? 220 ALA A CA  1 
ATOM   1568 C C   . ALA A 1 243 ? 4.801   -11.052 10.545  1.00 23.89 ? 220 ALA A C   1 
ATOM   1569 O O   . ALA A 1 243 ? 4.834   -10.437 9.483   1.00 24.41 ? 220 ALA A O   1 
ATOM   1570 C CB  . ALA A 1 243 ? 3.671   -13.228 10.063  1.00 20.37 ? 220 ALA A CB  1 
ATOM   1571 N N   . ASN A 1 244 ? 4.629   -10.437 11.706  1.00 22.32 ? 221 ASN A N   1 
ATOM   1572 C CA  . ASN A 1 244 ? 4.502   -9.001  11.734  1.00 22.00 ? 221 ASN A CA  1 
ATOM   1573 C C   . ASN A 1 244 ? 5.891   -8.413  11.777  1.00 22.94 ? 221 ASN A C   1 
ATOM   1574 O O   . ASN A 1 244 ? 6.611   -8.606  12.748  1.00 23.59 ? 221 ASN A O   1 
ATOM   1575 C CB  . ASN A 1 244 ? 3.730   -8.537  12.963  1.00 20.27 ? 221 ASN A CB  1 
ATOM   1576 C CG  . ASN A 1 244 ? 3.710   -7.027  13.083  1.00 23.36 ? 221 ASN A CG  1 
ATOM   1577 O OD1 . ASN A 1 244 ? 4.763   -6.396  13.170  1.00 20.60 ? 221 ASN A OD1 1 
ATOM   1578 N ND2 . ASN A 1 244 ? 2.513   -6.435  13.075  1.00 22.17 ? 221 ASN A ND2 1 
ATOM   1579 N N   . CYS A 1 245 ? 6.258   -7.685  10.730  1.00 22.92 ? 222 CYS A N   1 
ATOM   1580 C CA  . CYS A 1 245 ? 7.566   -7.055  10.663  1.00 24.14 ? 222 CYS A CA  1 
ATOM   1581 C C   . CYS A 1 245 ? 7.541   -5.800  9.790   1.00 24.63 ? 222 CYS A C   1 
ATOM   1582 O O   . CYS A 1 245 ? 6.509   -5.423  9.242   1.00 26.18 ? 222 CYS A O   1 
ATOM   1583 C CB  . CYS A 1 245 ? 8.578   -8.024  10.090  1.00 22.55 ? 222 CYS A CB  1 
ATOM   1584 S SG  . CYS A 1 245 ? 8.331   -8.258  8.360   1.00 29.25 ? 222 CYS A SG  1 
ATOM   1585 N N   . ILE A 1 246 ? 8.701   -5.169  9.652   1.00 24.83 ? 223 ILE A N   1 
ATOM   1586 C CA  . ILE A 1 246 ? 8.829   -3.955  8.860   1.00 23.01 ? 223 ILE A CA  1 
ATOM   1587 C C   . ILE A 1 246 ? 9.845   -4.085  7.741   1.00 22.94 ? 223 ILE A C   1 
ATOM   1588 O O   . ILE A 1 246 ? 11.005  -4.434  7.971   1.00 21.03 ? 223 ILE A O   1 
ATOM   1589 C CB  . ILE A 1 246 ? 9.268   -2.746  9.722   1.00 23.24 ? 223 ILE A CB  1 
ATOM   1590 C CG1 . ILE A 1 246 ? 8.124   -2.284  10.616  1.00 23.48 ? 223 ILE A CG1 1 
ATOM   1591 C CG2 . ILE A 1 246 ? 9.722   -1.593  8.820   1.00 26.30 ? 223 ILE A CG2 1 
ATOM   1592 C CD1 . ILE A 1 246 ? 8.504   -1.096  11.478  1.00 25.26 ? 223 ILE A CD1 1 
ATOM   1593 N N   . TYR A 1 247 ? 9.393   -3.800  6.526   1.00 22.31 ? 224 TYR A N   1 
ATOM   1594 C CA  . TYR A 1 247 ? 10.261  -3.823  5.373   1.00 22.35 ? 224 TYR A CA  1 
ATOM   1595 C C   . TYR A 1 247 ? 10.468  -2.355  5.070   1.00 22.72 ? 224 TYR A C   1 
ATOM   1596 O O   . TYR A 1 247 ? 9.624   -1.518  5.391   1.00 23.44 ? 224 TYR A O   1 
ATOM   1597 C CB  . TYR A 1 247 ? 9.597   -4.526  4.185   1.00 25.14 ? 224 TYR A CB  1 
ATOM   1598 C CG  . TYR A 1 247 ? 10.240  -4.191  2.855   1.00 27.56 ? 224 TYR A CG  1 
ATOM   1599 C CD1 . TYR A 1 247 ? 11.468  -4.730  2.490   1.00 27.25 ? 224 TYR A CD1 1 
ATOM   1600 C CD2 . TYR A 1 247 ? 9.638   -3.280  1.986   1.00 28.51 ? 224 TYR A CD2 1 
ATOM   1601 C CE1 . TYR A 1 247 ? 12.081  -4.363  1.284   1.00 28.96 ? 224 TYR A CE1 1 
ATOM   1602 C CE2 . TYR A 1 247 ? 10.237  -2.913  0.794   1.00 27.27 ? 224 TYR A CE2 1 
ATOM   1603 C CZ  . TYR A 1 247 ? 11.453  -3.451  0.446   1.00 28.40 ? 224 TYR A CZ  1 
ATOM   1604 O OH  . TYR A 1 247 ? 12.033  -3.061  -0.741  1.00 30.34 ? 224 TYR A OH  1 
ATOM   1605 N N   . LEU A 1 248 ? 11.602  -2.039  4.471   1.00 22.85 ? 225 LEU A N   1 
ATOM   1606 C CA  . LEU A 1 248 ? 11.919  -0.666  4.135   1.00 23.05 ? 225 LEU A CA  1 
ATOM   1607 C C   . LEU A 1 248 ? 12.924  -0.736  3.041   1.00 24.84 ? 225 LEU A C   1 
ATOM   1608 O O   . LEU A 1 248 ? 13.773  -1.637  3.020   1.00 22.48 ? 225 LEU A O   1 
ATOM   1609 C CB  . LEU A 1 248 ? 12.550  0.074   5.315   1.00 22.38 ? 225 LEU A CB  1 
ATOM   1610 C CG  . LEU A 1 248 ? 11.655  0.418   6.501   1.00 25.34 ? 225 LEU A CG  1 
ATOM   1611 C CD1 . LEU A 1 248 ? 12.489  0.857   7.687   1.00 22.36 ? 225 LEU A CD1 1 
ATOM   1612 C CD2 . LEU A 1 248 ? 10.698  1.520   6.082   1.00 28.30 ? 225 LEU A CD2 1 
ATOM   1613 N N   . ASN A 1 249 ? 12.808  0.208   2.118   1.00 27.15 ? 226 ASN A N   1 
ATOM   1614 C CA  . ASN A 1 249 ? 13.733  0.303   1.013   1.00 28.95 ? 226 ASN A CA  1 
ATOM   1615 C C   . ASN A 1 249 ? 14.524  1.553   1.326   1.00 30.99 ? 226 ASN A C   1 
ATOM   1616 O O   . ASN A 1 249 ? 14.226  2.630   0.824   1.00 33.49 ? 226 ASN A O   1 
ATOM   1617 C CB  . ASN A 1 249 ? 12.991  0.467   -0.302  1.00 28.97 ? 226 ASN A CB  1 
ATOM   1618 C CG  . ASN A 1 249 ? 13.929  0.550   -1.483  1.00 29.47 ? 226 ASN A CG  1 
ATOM   1619 O OD1 . ASN A 1 249 ? 14.914  1.284   -1.450  1.00 28.40 ? 226 ASN A OD1 1 
ATOM   1620 N ND2 . ASN A 1 249 ? 13.625  -0.196  -2.539  1.00 29.09 ? 226 ASN A ND2 1 
ATOM   1621 N N   . ILE A 1 250 ? 15.511  1.409   2.197   1.00 33.27 ? 227 ILE A N   1 
ATOM   1622 C CA  . ILE A 1 250 ? 16.350  2.525   2.595   1.00 34.35 ? 227 ILE A CA  1 
ATOM   1623 C C   . ILE A 1 250 ? 17.500  2.642   1.612   1.00 35.39 ? 227 ILE A C   1 
ATOM   1624 O O   . ILE A 1 250 ? 18.101  1.645   1.235   1.00 35.13 ? 227 ILE A O   1 
ATOM   1625 C CB  . ILE A 1 250 ? 16.886  2.315   4.045   1.00 33.90 ? 227 ILE A CB  1 
ATOM   1626 C CG1 . ILE A 1 250 ? 15.715  2.338   5.029   1.00 32.13 ? 227 ILE A CG1 1 
ATOM   1627 C CG2 . ILE A 1 250 ? 17.882  3.399   4.428   1.00 34.24 ? 227 ILE A CG2 1 
ATOM   1628 C CD1 . ILE A 1 250 ? 14.877  3.588   4.928   1.00 31.03 ? 227 ILE A CD1 1 
ATOM   1629 N N   . PRO A 1 251 ? 17.788  3.868   1.147   1.00 38.61 ? 228 PRO A N   1 
ATOM   1630 C CA  . PRO A 1 251 ? 18.883  4.101   0.197   1.00 40.36 ? 228 PRO A CA  1 
ATOM   1631 C C   . PRO A 1 251 ? 20.265  3.787   0.762   1.00 42.42 ? 228 PRO A C   1 
ATOM   1632 O O   . PRO A 1 251 ? 20.543  4.042   1.934   1.00 42.96 ? 228 PRO A O   1 
ATOM   1633 C CB  . PRO A 1 251 ? 18.720  5.582   -0.166  1.00 40.75 ? 228 PRO A CB  1 
ATOM   1634 C CG  . PRO A 1 251 ? 17.981  6.166   1.025   1.00 38.04 ? 228 PRO A CG  1 
ATOM   1635 C CD  . PRO A 1 251 ? 16.980  5.090   1.323   1.00 38.67 ? 228 PRO A CD  1 
ATOM   1636 N N   . ASN A 1 252 ? 21.128  3.235   -0.087  1.00 45.48 ? 229 ASN A N   1 
ATOM   1637 C CA  . ASN A 1 252 ? 22.488  2.873   0.302   1.00 47.91 ? 229 ASN A CA  1 
ATOM   1638 C C   . ASN A 1 252 ? 22.430  1.592   1.103   1.00 49.03 ? 229 ASN A C   1 
ATOM   1639 O O   . ASN A 1 252 ? 23.456  1.038   1.504   1.00 49.15 ? 229 ASN A O   1 
ATOM   1640 C CB  . ASN A 1 252 ? 23.133  3.974   1.152   1.00 50.21 ? 229 ASN A CB  1 
ATOM   1641 C CG  . ASN A 1 252 ? 23.279  5.278   0.401   1.00 51.76 ? 229 ASN A CG  1 
ATOM   1642 O OD1 . ASN A 1 252 ? 23.866  5.321   -0.686  1.00 51.68 ? 229 ASN A OD1 1 
ATOM   1643 N ND2 . ASN A 1 252 ? 22.752  6.352   0.976   1.00 51.23 ? 229 ASN A ND2 1 
ATOM   1644 N N   . LYS A 1 253 ? 21.211  1.134   1.343   1.00 49.18 ? 230 LYS A N   1 
ATOM   1645 C CA  . LYS A 1 253 ? 21.003  -0.086  2.089   1.00 49.63 ? 230 LYS A CA  1 
ATOM   1646 C C   . LYS A 1 253 ? 20.278  -1.073  1.184   1.00 48.63 ? 230 LYS A C   1 
ATOM   1647 O O   . LYS A 1 253 ? 20.757  -2.183  0.956   1.00 49.60 ? 230 LYS A O   1 
ATOM   1648 C CB  . LYS A 1 253 ? 20.183  0.202   3.341   1.00 50.41 ? 230 LYS A CB  1 
ATOM   1649 N N   . GLY A 1 254 ? 19.138  -0.650  0.645   1.00 46.85 ? 231 GLY A N   1 
ATOM   1650 C CA  . GLY A 1 254 ? 18.357  -1.518  -0.220  1.00 44.69 ? 231 GLY A CA  1 
ATOM   1651 C C   . GLY A 1 254 ? 17.151  -2.008  0.551   1.00 43.23 ? 231 GLY A C   1 
ATOM   1652 O O   . GLY A 1 254 ? 16.417  -1.205  1.122   1.00 41.95 ? 231 GLY A O   1 
ATOM   1653 N N   . HIS A 1 255 ? 16.948  -3.322  0.572   1.00 42.80 ? 232 HIS A N   1 
ATOM   1654 C CA  . HIS A 1 255 ? 15.835  -3.927  1.305   1.00 41.94 ? 232 HIS A CA  1 
ATOM   1655 C C   . HIS A 1 255 ? 16.180  -4.042  2.771   1.00 39.57 ? 232 HIS A C   1 
ATOM   1656 O O   . HIS A 1 255 ? 17.209  -4.606  3.129   1.00 38.82 ? 232 HIS A O   1 
ATOM   1657 C CB  . HIS A 1 255 ? 15.541  -5.328  0.792   1.00 45.76 ? 232 HIS A CB  1 
ATOM   1658 C CG  . HIS A 1 255 ? 14.848  -5.354  -0.528  1.00 49.28 ? 232 HIS A CG  1 
ATOM   1659 N ND1 . HIS A 1 255 ? 15.187  -4.509  -1.560  1.00 50.57 ? 232 HIS A ND1 1 
ATOM   1660 C CD2 . HIS A 1 255 ? 13.859  -6.150  -0.999  1.00 50.67 ? 232 HIS A CD2 1 
ATOM   1661 C CE1 . HIS A 1 255 ? 14.438  -4.782  -2.612  1.00 52.74 ? 232 HIS A CE1 1 
ATOM   1662 N NE2 . HIS A 1 255 ? 13.625  -5.775  -2.298  1.00 53.16 ? 232 HIS A NE2 1 
ATOM   1663 N N   . VAL A 1 256 ? 15.310  -3.517  3.621   1.00 37.73 ? 233 VAL A N   1 
ATOM   1664 C CA  . VAL A 1 256 ? 15.531  -3.579  5.052   1.00 34.33 ? 233 VAL A CA  1 
ATOM   1665 C C   . VAL A 1 256 ? 14.330  -4.262  5.681   1.00 33.97 ? 233 VAL A C   1 
ATOM   1666 O O   . VAL A 1 256 ? 13.190  -4.031  5.284   1.00 32.93 ? 233 VAL A O   1 
ATOM   1667 C CB  . VAL A 1 256 ? 15.702  -2.168  5.654   1.00 33.38 ? 233 VAL A CB  1 
ATOM   1668 C CG1 . VAL A 1 256 ? 16.027  -2.260  7.124   1.00 30.22 ? 233 VAL A CG1 1 
ATOM   1669 C CG2 . VAL A 1 256 ? 16.799  -1.428  4.930   1.00 32.36 ? 233 VAL A CG2 1 
ATOM   1670 N N   . LEU A 1 257 ? 14.595  -5.121  6.653   1.00 33.95 ? 234 LEU A N   1 
ATOM   1671 C CA  . LEU A 1 257 ? 13.532  -5.825  7.334   1.00 33.53 ? 234 LEU A CA  1 
ATOM   1672 C C   . LEU A 1 257 ? 13.885  -5.911  8.810   1.00 33.79 ? 234 LEU A C   1 
ATOM   1673 O O   . LEU A 1 257 ? 14.935  -6.457  9.170   1.00 35.72 ? 234 LEU A O   1 
ATOM   1674 C CB  . LEU A 1 257 ? 13.375  -7.234  6.755   1.00 34.56 ? 234 LEU A CB  1 
ATOM   1675 C CG  . LEU A 1 257 ? 12.014  -7.926  6.922   1.00 35.15 ? 234 LEU A CG  1 
ATOM   1676 C CD1 . LEU A 1 257 ? 12.061  -9.283  6.248   1.00 36.75 ? 234 LEU A CD1 1 
ATOM   1677 C CD2 . LEU A 1 257 ? 11.667  -8.082  8.378   1.00 35.02 ? 234 LEU A CD2 1 
ATOM   1678 N N   . LEU A 1 258 ? 13.027  -5.335  9.653   1.00 30.25 ? 235 LEU A N   1 
ATOM   1679 C CA  . LEU A 1 258 ? 13.205  -5.379  11.096  1.00 27.37 ? 235 LEU A CA  1 
ATOM   1680 C C   . LEU A 1 258 ? 12.278  -6.508  11.493  1.00 28.52 ? 235 LEU A C   1 
ATOM   1681 O O   . LEU A 1 258 ? 11.072  -6.434  11.246  1.00 28.49 ? 235 LEU A O   1 
ATOM   1682 C CB  . LEU A 1 258 ? 12.727  -4.090  11.768  1.00 25.26 ? 235 LEU A CB  1 
ATOM   1683 C CG  . LEU A 1 258 ? 13.503  -2.778  11.625  1.00 23.91 ? 235 LEU A CG  1 
ATOM   1684 C CD1 . LEU A 1 258 ? 13.680  -2.397  10.167  1.00 22.62 ? 235 LEU A CD1 1 
ATOM   1685 C CD2 . LEU A 1 258 ? 12.742  -1.697  12.347  1.00 21.92 ? 235 LEU A CD2 1 
ATOM   1686 N N   . HIS A 1 259 ? 12.831  -7.561  12.081  1.00 27.31 ? 236 HIS A N   1 
ATOM   1687 C CA  . HIS A 1 259 ? 12.016  -8.686  12.491  1.00 26.73 ? 236 HIS A CA  1 
ATOM   1688 C C   . HIS A 1 259 ? 12.195  -8.976  13.972  1.00 25.33 ? 236 HIS A C   1 
ATOM   1689 O O   . HIS A 1 259 ? 13.032  -8.371  14.629  1.00 24.76 ? 236 HIS A O   1 
ATOM   1690 C CB  . HIS A 1 259 ? 12.401  -9.907  11.680  1.00 27.14 ? 236 HIS A CB  1 
ATOM   1691 C CG  . HIS A 1 259 ? 13.856  -10.234 11.760  1.00 28.06 ? 236 HIS A CG  1 
ATOM   1692 N ND1 . HIS A 1 259 ? 14.814  -9.518  11.080  1.00 29.89 ? 236 HIS A ND1 1 
ATOM   1693 C CD2 . HIS A 1 259 ? 14.521  -11.169 12.478  1.00 25.90 ? 236 HIS A CD2 1 
ATOM   1694 C CE1 . HIS A 1 259 ? 16.009  -9.996  11.376  1.00 28.05 ? 236 HIS A CE1 1 
ATOM   1695 N NE2 . HIS A 1 259 ? 15.858  -10.997 12.221  1.00 27.68 ? 236 HIS A NE2 1 
ATOM   1696 N N   . ARG A 1 260 ? 11.397  -9.894  14.501  1.00 25.30 ? 237 ARG A N   1 
ATOM   1697 C CA  . ARG A 1 260 ? 11.511  -10.257 15.906  1.00 28.27 ? 237 ARG A CA  1 
ATOM   1698 C C   . ARG A 1 260 ? 12.819  -11.022 16.101  1.00 29.10 ? 237 ARG A C   1 
ATOM   1699 O O   . ARG A 1 260 ? 13.181  -11.850 15.266  1.00 30.92 ? 237 ARG A O   1 
ATOM   1700 C CB  . ARG A 1 260 ? 10.314  -11.110 16.340  1.00 27.89 ? 237 ARG A CB  1 
ATOM   1701 C CG  . ARG A 1 260 ? 8.987   -10.378 16.237  1.00 27.41 ? 237 ARG A CG  1 
ATOM   1702 C CD  . ARG A 1 260 ? 9.077   -9.016  16.898  1.00 25.31 ? 237 ARG A CD  1 
ATOM   1703 N NE  . ARG A 1 260 ? 9.278   -9.158  18.329  1.00 22.09 ? 237 ARG A NE  1 
ATOM   1704 C CZ  . ARG A 1 260 ? 8.304   -9.414  19.192  1.00 23.96 ? 237 ARG A CZ  1 
ATOM   1705 N NH1 . ARG A 1 260 ? 7.056   -9.550  18.761  1.00 22.20 ? 237 ARG A NH1 1 
ATOM   1706 N NH2 . ARG A 1 260 ? 8.578   -9.534  20.486  1.00 23.95 ? 237 ARG A NH2 1 
ATOM   1707 N N   . THR A 1 261 ? 13.517  -10.737 17.200  1.00 29.51 ? 238 THR A N   1 
ATOM   1708 C CA  . THR A 1 261 ? 14.814  -11.350 17.504  1.00 29.16 ? 238 THR A CA  1 
ATOM   1709 C C   . THR A 1 261 ? 14.819  -12.864 17.625  1.00 30.21 ? 238 THR A C   1 
ATOM   1710 O O   . THR A 1 261 ? 13.797  -13.472 17.933  1.00 31.10 ? 238 THR A O   1 
ATOM   1711 C CB  . THR A 1 261 ? 15.387  -10.806 18.807  1.00 27.92 ? 238 THR A CB  1 
ATOM   1712 O OG1 . THR A 1 261 ? 14.693  -11.411 19.903  1.00 25.33 ? 238 THR A OG1 1 
ATOM   1713 C CG2 . THR A 1 261 ? 15.247  -9.277  18.858  1.00 24.75 ? 238 THR A CG2 1 
ATOM   1714 N N   . PRO A 1 262 ? 15.988  -13.495 17.389  1.00 32.55 ? 239 PRO A N   1 
ATOM   1715 C CA  . PRO A 1 262 ? 16.088  -14.960 17.486  1.00 31.55 ? 239 PRO A CA  1 
ATOM   1716 C C   . PRO A 1 262 ? 15.652  -15.426 18.862  1.00 31.28 ? 239 PRO A C   1 
ATOM   1717 O O   . PRO A 1 262 ? 15.027  -16.468 19.002  1.00 31.48 ? 239 PRO A O   1 
ATOM   1718 C CB  . PRO A 1 262 ? 17.567  -15.224 17.225  1.00 32.91 ? 239 PRO A CB  1 
ATOM   1719 C CG  . PRO A 1 262 ? 17.960  -14.079 16.293  1.00 32.82 ? 239 PRO A CG  1 
ATOM   1720 C CD  . PRO A 1 262 ? 17.273  -12.904 16.958  1.00 31.40 ? 239 PRO A CD  1 
ATOM   1721 N N   . GLU A 1 263 ? 15.970  -14.626 19.871  1.00 31.08 ? 240 GLU A N   1 
ATOM   1722 C CA  . GLU A 1 263 ? 15.617  -14.944 21.240  1.00 34.86 ? 240 GLU A CA  1 
ATOM   1723 C C   . GLU A 1 263 ? 14.101  -15.070 21.433  1.00 36.80 ? 240 GLU A C   1 
ATOM   1724 O O   . GLU A 1 263 ? 13.626  -16.022 22.056  1.00 37.61 ? 240 GLU A O   1 
ATOM   1725 C CB  . GLU A 1 263 ? 16.174  -13.876 22.196  1.00 35.54 ? 240 GLU A CB  1 
ATOM   1726 C CG  . GLU A 1 263 ? 17.701  -13.693 22.151  1.00 39.14 ? 240 GLU A CG  1 
ATOM   1727 C CD  . GLU A 1 263 ? 18.211  -13.145 20.809  1.00 42.26 ? 240 GLU A CD  1 
ATOM   1728 O OE1 . GLU A 1 263 ? 17.686  -12.103 20.350  1.00 42.03 ? 240 GLU A OE1 1 
ATOM   1729 O OE2 . GLU A 1 263 ? 19.142  -13.748 20.220  1.00 40.15 ? 240 GLU A OE2 1 
ATOM   1730 N N   . GLU A 1 264 ? 13.342  -14.123 20.891  1.00 36.47 ? 241 GLU A N   1 
ATOM   1731 C CA  . GLU A 1 264 ? 11.886  -14.140 21.031  1.00 37.03 ? 241 GLU A CA  1 
ATOM   1732 C C   . GLU A 1 264 ? 11.173  -15.186 20.162  1.00 36.31 ? 241 GLU A C   1 
ATOM   1733 O O   . GLU A 1 264 ? 10.180  -15.777 20.583  1.00 38.41 ? 241 GLU A O   1 
ATOM   1734 C CB  . GLU A 1 264 ? 11.316  -12.756 20.711  1.00 37.35 ? 241 GLU A CB  1 
ATOM   1735 C CG  . GLU A 1 264 ? 11.897  -11.604 21.525  1.00 36.28 ? 241 GLU A CG  1 
ATOM   1736 C CD  . GLU A 1 264 ? 11.390  -10.264 21.030  1.00 35.86 ? 241 GLU A CD  1 
ATOM   1737 O OE1 . GLU A 1 264 ? 11.613  -9.963  19.842  1.00 37.40 ? 241 GLU A OE1 1 
ATOM   1738 O OE2 . GLU A 1 264 ? 10.767  -9.517  21.810  1.00 35.63 ? 241 GLU A OE2 1 
ATOM   1739 N N   . TYR A 1 265 ? 11.666  -15.394 18.946  1.00 36.27 ? 242 TYR A N   1 
ATOM   1740 C CA  . TYR A 1 265 ? 11.078  -16.362 18.017  1.00 35.39 ? 242 TYR A CA  1 
ATOM   1741 C C   . TYR A 1 265 ? 12.162  -16.934 17.125  1.00 34.41 ? 242 TYR A C   1 
ATOM   1742 O O   . TYR A 1 265 ? 12.296  -16.554 15.968  1.00 33.86 ? 242 TYR A O   1 
ATOM   1743 C CB  . TYR A 1 265 ? 10.004  -15.700 17.155  1.00 36.72 ? 242 TYR A CB  1 
ATOM   1744 C CG  . TYR A 1 265 ? 8.775   -15.310 17.936  1.00 39.02 ? 242 TYR A CG  1 
ATOM   1745 C CD1 . TYR A 1 265 ? 8.543   -13.990 18.297  1.00 39.53 ? 242 TYR A CD1 1 
ATOM   1746 C CD2 . TYR A 1 265 ? 7.857   -16.273 18.339  1.00 40.76 ? 242 TYR A CD2 1 
ATOM   1747 C CE1 . TYR A 1 265 ? 7.417   -13.634 19.046  1.00 41.88 ? 242 TYR A CE1 1 
ATOM   1748 C CE2 . TYR A 1 265 ? 6.729   -15.936 19.085  1.00 42.09 ? 242 TYR A CE2 1 
ATOM   1749 C CZ  . TYR A 1 265 ? 6.512   -14.615 19.436  1.00 42.69 ? 242 TYR A CZ  1 
ATOM   1750 O OH  . TYR A 1 265 ? 5.382   -14.282 20.155  1.00 41.43 ? 242 TYR A OH  1 
ATOM   1751 N N   . PRO A 1 266 ? 12.951  -17.865 17.662  1.00 34.19 ? 243 PRO A N   1 
ATOM   1752 C CA  . PRO A 1 266 ? 14.035  -18.490 16.911  1.00 34.08 ? 243 PRO A CA  1 
ATOM   1753 C C   . PRO A 1 266 ? 13.614  -19.202 15.634  1.00 34.57 ? 243 PRO A C   1 
ATOM   1754 O O   . PRO A 1 266 ? 14.270  -19.052 14.602  1.00 34.95 ? 243 PRO A O   1 
ATOM   1755 C CB  . PRO A 1 266 ? 14.665  -19.436 17.934  1.00 32.52 ? 243 PRO A CB  1 
ATOM   1756 C CG  . PRO A 1 266 ? 13.521  -19.807 18.794  1.00 32.76 ? 243 PRO A CG  1 
ATOM   1757 C CD  . PRO A 1 266 ? 12.816  -18.482 18.993  1.00 33.55 ? 243 PRO A CD  1 
ATOM   1758 N N   . GLU A 1 267 ? 12.530  -19.970 15.685  1.00 34.56 ? 244 GLU A N   1 
ATOM   1759 C CA  . GLU A 1 267 ? 12.098  -20.693 14.490  1.00 35.93 ? 244 GLU A CA  1 
ATOM   1760 C C   . GLU A 1 267 ? 11.603  -19.767 13.378  1.00 36.06 ? 244 GLU A C   1 
ATOM   1761 O O   . GLU A 1 267 ? 11.662  -20.122 12.202  1.00 37.55 ? 244 GLU A O   1 
ATOM   1762 C CB  . GLU A 1 267 ? 11.020  -21.718 14.833  1.00 36.79 ? 244 GLU A CB  1 
ATOM   1763 C CG  . GLU A 1 267 ? 11.401  -22.687 15.955  1.00 40.62 ? 244 GLU A CG  1 
ATOM   1764 C CD  . GLU A 1 267 ? 12.901  -22.990 16.035  1.00 41.67 ? 244 GLU A CD  1 
ATOM   1765 O OE1 . GLU A 1 267 ? 13.499  -23.425 15.027  1.00 41.92 ? 244 GLU A OE1 1 
ATOM   1766 O OE2 . GLU A 1 267 ? 13.478  -22.793 17.126  1.00 41.76 ? 244 GLU A OE2 1 
ATOM   1767 N N   . SER A 1 268 ? 11.117  -18.585 13.758  1.00 35.01 ? 245 SER A N   1 
ATOM   1768 C CA  . SER A 1 268 ? 10.642  -17.586 12.805  1.00 31.12 ? 245 SER A CA  1 
ATOM   1769 C C   . SER A 1 268 ? 11.820  -16.734 12.348  1.00 30.40 ? 245 SER A C   1 
ATOM   1770 O O   . SER A 1 268 ? 11.945  -16.420 11.170  1.00 30.04 ? 245 SER A O   1 
ATOM   1771 C CB  . SER A 1 268 ? 9.587   -16.693 13.456  1.00 32.03 ? 245 SER A CB  1 
ATOM   1772 O OG  . SER A 1 268 ? 8.334   -17.352 13.561  1.00 28.15 ? 245 SER A OG  1 
ATOM   1773 N N   . ALA A 1 269 ? 12.687  -16.375 13.289  1.00 31.11 ? 246 ALA A N   1 
ATOM   1774 C CA  . ALA A 1 269 ? 13.877  -15.574 13.002  1.00 31.35 ? 246 ALA A CA  1 
ATOM   1775 C C   . ALA A 1 269 ? 14.802  -16.298 12.031  1.00 32.00 ? 246 ALA A C   1 
ATOM   1776 O O   . ALA A 1 269 ? 15.434  -15.678 11.178  1.00 32.49 ? 246 ALA A O   1 
ATOM   1777 C CB  . ALA A 1 269 ? 14.620  -15.260 14.306  1.00 28.62 ? 246 ALA A CB  1 
ATOM   1778 N N   . LYS A 1 270 ? 14.892  -17.616 12.185  1.00 34.20 ? 247 LYS A N   1 
ATOM   1779 C CA  . LYS A 1 270 ? 15.719  -18.458 11.316  1.00 35.40 ? 247 LYS A CA  1 
ATOM   1780 C C   . LYS A 1 270 ? 15.204  -18.411 9.883   1.00 35.11 ? 247 LYS A C   1 
ATOM   1781 O O   . LYS A 1 270 ? 15.968  -18.579 8.932   1.00 35.72 ? 247 LYS A O   1 
ATOM   1782 C CB  . LYS A 1 270 ? 15.682  -19.910 11.784  1.00 36.17 ? 247 LYS A CB  1 
ATOM   1783 C CG  . LYS A 1 270 ? 16.306  -20.179 13.136  1.00 35.83 ? 247 LYS A CG  1 
ATOM   1784 C CD  . LYS A 1 270 ? 16.010  -21.610 13.499  1.00 36.84 ? 247 LYS A CD  1 
ATOM   1785 C CE  . LYS A 1 270 ? 16.583  -21.997 14.830  1.00 37.25 ? 247 LYS A CE  1 
ATOM   1786 N NZ  . LYS A 1 270 ? 16.083  -23.343 15.172  1.00 37.03 ? 247 LYS A NZ  1 
ATOM   1787 N N   . VAL A 1 271 ? 13.899  -18.211 9.734   1.00 34.37 ? 248 VAL A N   1 
ATOM   1788 C CA  . VAL A 1 271 ? 13.300  -18.122 8.413   1.00 35.60 ? 248 VAL A CA  1 
ATOM   1789 C C   . VAL A 1 271 ? 13.713  -16.809 7.767   1.00 37.08 ? 248 VAL A C   1 
ATOM   1790 O O   . VAL A 1 271 ? 14.099  -16.793 6.602   1.00 37.34 ? 248 VAL A O   1 
ATOM   1791 C CB  . VAL A 1 271 ? 11.754  -18.205 8.480   1.00 35.77 ? 248 VAL A CB  1 
ATOM   1792 C CG1 . VAL A 1 271 ? 11.126  -17.476 7.300   1.00 34.22 ? 248 VAL A CG1 1 
ATOM   1793 C CG2 . VAL A 1 271 ? 11.317  -19.665 8.465   1.00 35.42 ? 248 VAL A CG2 1 
ATOM   1794 N N   . TYR A 1 272 ? 13.635  -15.713 8.526   1.00 39.14 ? 249 TYR A N   1 
ATOM   1795 C CA  . TYR A 1 272 ? 14.015  -14.392 8.011   1.00 41.78 ? 249 TYR A CA  1 
ATOM   1796 C C   . TYR A 1 272 ? 15.487  -14.371 7.664   1.00 43.73 ? 249 TYR A C   1 
ATOM   1797 O O   . TYR A 1 272 ? 15.913  -13.641 6.779   1.00 43.20 ? 249 TYR A O   1 
ATOM   1798 C CB  . TYR A 1 272 ? 13.755  -13.280 9.042   1.00 40.78 ? 249 TYR A CB  1 
ATOM   1799 C CG  . TYR A 1 272 ? 12.316  -12.823 9.143   1.00 38.77 ? 249 TYR A CG  1 
ATOM   1800 C CD1 . TYR A 1 272 ? 11.490  -13.263 10.174  1.00 39.03 ? 249 TYR A CD1 1 
ATOM   1801 C CD2 . TYR A 1 272 ? 11.780  -11.954 8.199   1.00 37.88 ? 249 TYR A CD2 1 
ATOM   1802 C CE1 . TYR A 1 272 ? 10.159  -12.847 10.262  1.00 38.75 ? 249 TYR A CE1 1 
ATOM   1803 C CE2 . TYR A 1 272 ? 10.457  -11.530 8.274   1.00 37.92 ? 249 TYR A CE2 1 
ATOM   1804 C CZ  . TYR A 1 272 ? 9.651   -11.976 9.306   1.00 38.62 ? 249 TYR A CZ  1 
ATOM   1805 O OH  . TYR A 1 272 ? 8.351   -11.527 9.392   1.00 37.03 ? 249 TYR A OH  1 
ATOM   1806 N N   . GLU A 1 273 ? 16.250  -15.189 8.378   1.00 46.85 ? 250 GLU A N   1 
ATOM   1807 C CA  . GLU A 1 273 ? 17.688  -15.281 8.203   1.00 50.87 ? 250 GLU A CA  1 
ATOM   1808 C C   . GLU A 1 273 ? 18.132  -15.719 6.805   1.00 52.73 ? 250 GLU A C   1 
ATOM   1809 O O   . GLU A 1 273 ? 19.215  -15.353 6.347   1.00 52.93 ? 250 GLU A O   1 
ATOM   1810 C CB  . GLU A 1 273 ? 18.254  -16.237 9.258   1.00 51.61 ? 250 GLU A CB  1 
ATOM   1811 C CG  . GLU A 1 273 ? 19.691  -15.958 9.615   1.00 53.21 ? 250 GLU A CG  1 
ATOM   1812 C CD  . GLU A 1 273 ? 20.029  -14.496 9.444   1.00 54.16 ? 250 GLU A CD  1 
ATOM   1813 O OE1 . GLU A 1 273 ? 20.504  -14.117 8.354   1.00 53.29 ? 250 GLU A OE1 1 
ATOM   1814 O OE2 . GLU A 1 273 ? 19.794  -13.720 10.390  1.00 55.77 ? 250 GLU A OE2 1 
ATOM   1815 N N   . LYS A 1 274 ? 17.289  -16.487 6.125   1.00 54.81 ? 251 LYS A N   1 
ATOM   1816 C CA  . LYS A 1 274 ? 17.615  -16.989 4.796   1.00 57.15 ? 251 LYS A CA  1 
ATOM   1817 C C   . LYS A 1 274 ? 17.548  -15.949 3.674   1.00 58.31 ? 251 LYS A C   1 
ATOM   1818 O O   . LYS A 1 274 ? 18.054  -16.189 2.577   1.00 58.97 ? 251 LYS A O   1 
ATOM   1819 C CB  . LYS A 1 274 ? 16.728  -18.203 4.483   1.00 56.95 ? 251 LYS A CB  1 
ATOM   1820 C CG  . LYS A 1 274 ? 17.118  -19.433 5.318   1.00 59.10 ? 251 LYS A CG  1 
ATOM   1821 C CD  . LYS A 1 274 ? 15.950  -20.367 5.657   1.00 59.24 ? 251 LYS A CD  1 
ATOM   1822 C CE  . LYS A 1 274 ? 15.497  -21.180 4.465   1.00 59.49 ? 251 LYS A CE  1 
ATOM   1823 N NZ  . LYS A 1 274 ? 14.990  -20.314 3.373   1.00 59.55 ? 251 LYS A NZ  1 
ATOM   1824 N N   . LEU A 1 275 ? 16.940  -14.797 3.951   1.00 58.94 ? 252 LEU A N   1 
ATOM   1825 C CA  . LEU A 1 275 ? 16.838  -13.715 2.965   1.00 59.45 ? 252 LEU A CA  1 
ATOM   1826 C C   . LEU A 1 275 ? 18.159  -12.957 2.965   1.00 59.93 ? 252 LEU A C   1 
ATOM   1827 O O   . LEU A 1 275 ? 18.421  -12.180 3.877   1.00 59.73 ? 252 LEU A O   1 
ATOM   1828 C CB  . LEU A 1 275 ? 15.719  -12.734 3.339   1.00 59.42 ? 252 LEU A CB  1 
ATOM   1829 C CG  . LEU A 1 275 ? 14.256  -13.181 3.438   1.00 59.09 ? 252 LEU A CG  1 
ATOM   1830 C CD1 . LEU A 1 275 ? 13.430  -12.084 4.094   1.00 59.39 ? 252 LEU A CD1 1 
ATOM   1831 C CD2 . LEU A 1 275 ? 13.714  -13.498 2.063   1.00 59.18 ? 252 LEU A CD2 1 
ATOM   1832 N N   . LYS A 1 276 ? 18.991  -13.175 1.952   1.00 61.40 ? 253 LYS A N   1 
ATOM   1833 C CA  . LYS A 1 276 ? 20.282  -12.493 1.890   1.00 62.46 ? 253 LYS A CA  1 
ATOM   1834 C C   . LYS A 1 276 ? 20.266  -11.139 1.190   1.00 62.41 ? 253 LYS A C   1 
ATOM   1835 O O   . LYS A 1 276 ? 21.260  -10.408 1.229   1.00 63.21 ? 253 LYS A O   1 
ATOM   1836 C CB  . LYS A 1 276 ? 21.339  -13.403 1.245   1.00 62.71 ? 253 LYS A CB  1 
ATOM   1837 C CG  . LYS A 1 276 ? 21.999  -14.354 2.238   1.00 64.14 ? 253 LYS A CG  1 
ATOM   1838 C CD  . LYS A 1 276 ? 22.729  -13.576 3.335   1.00 64.46 ? 253 LYS A CD  1 
ATOM   1839 C CE  . LYS A 1 276 ? 22.952  -14.420 4.588   1.00 65.28 ? 253 LYS A CE  1 
ATOM   1840 N NZ  . LYS A 1 276 ? 23.765  -15.645 4.342   1.00 65.58 ? 253 LYS A NZ  1 
ATOM   1841 N N   . ASP A 1 277 ? 19.145  -10.797 0.559   1.00 62.35 ? 254 ASP A N   1 
ATOM   1842 C CA  . ASP A 1 277 ? 19.030  -9.512  -0.130  1.00 61.86 ? 254 ASP A CA  1 
ATOM   1843 C C   . ASP A 1 277 ? 18.453  -8.443  0.790   1.00 60.11 ? 254 ASP A C   1 
ATOM   1844 O O   . ASP A 1 277 ? 18.296  -7.286  0.401   1.00 59.15 ? 254 ASP A O   1 
ATOM   1845 C CB  . ASP A 1 277 ? 18.159  -9.640  -1.387  1.00 63.51 ? 254 ASP A CB  1 
ATOM   1846 C CG  . ASP A 1 277 ? 18.935  -10.160 -2.590  1.00 64.55 ? 254 ASP A CG  1 
ATOM   1847 O OD1 . ASP A 1 277 ? 20.033  -9.628  -2.863  1.00 64.56 ? 254 ASP A OD1 1 
ATOM   1848 O OD2 . ASP A 1 277 ? 18.446  -11.088 -3.270  1.00 64.97 ? 254 ASP A OD2 1 
ATOM   1849 N N   . HIS A 1 278 ? 18.148  -8.842  2.017   1.00 59.14 ? 255 HIS A N   1 
ATOM   1850 C CA  . HIS A 1 278 ? 17.590  -7.928  3.005   1.00 57.81 ? 255 HIS A CA  1 
ATOM   1851 C C   . HIS A 1 278 ? 18.497  -7.740  4.214   1.00 56.35 ? 255 HIS A C   1 
ATOM   1852 O O   . HIS A 1 278 ? 18.928  -8.713  4.845   1.00 56.15 ? 255 HIS A O   1 
ATOM   1853 C CB  . HIS A 1 278 ? 16.247  -8.443  3.521   1.00 58.38 ? 255 HIS A CB  1 
ATOM   1854 C CG  . HIS A 1 278 ? 15.209  -8.602  2.463   1.00 58.29 ? 255 HIS A CG  1 
ATOM   1855 N ND1 . HIS A 1 278 ? 15.412  -9.361  1.333   1.00 58.72 ? 255 HIS A ND1 1 
ATOM   1856 C CD2 . HIS A 1 278 ? 13.947  -8.126  2.378   1.00 58.61 ? 255 HIS A CD2 1 
ATOM   1857 C CE1 . HIS A 1 278 ? 14.316  -9.347  0.596   1.00 59.83 ? 255 HIS A CE1 1 
ATOM   1858 N NE2 . HIS A 1 278 ? 13.412  -8.604  1.208   1.00 59.94 ? 255 HIS A NE2 1 
ATOM   1859 N N   . MET A 1 279 ? 18.780  -6.485  4.537   1.00 52.97 ? 256 MET A N   1 
ATOM   1860 C CA  . MET A 1 279 ? 19.578  -6.191  5.706   1.00 50.33 ? 256 MET A CA  1 
ATOM   1861 C C   . MET A 1 279 ? 18.643  -6.543  6.870   1.00 48.73 ? 256 MET A C   1 
ATOM   1862 O O   . MET A 1 279 ? 17.640  -5.866  7.104   1.00 46.83 ? 256 MET A O   1 
ATOM   1863 C CB  . MET A 1 279 ? 19.934  -4.713  5.731   1.00 50.57 ? 256 MET A CB  1 
ATOM   1864 C CG  . MET A 1 279 ? 20.670  -4.284  6.971   1.00 52.49 ? 256 MET A CG  1 
ATOM   1865 S SD  . MET A 1 279 ? 20.797  -2.500  7.017   1.00 54.50 ? 256 MET A SD  1 
ATOM   1866 C CE  . MET A 1 279 ? 22.207  -2.237  5.879   1.00 54.51 ? 256 MET A CE  1 
ATOM   1867 N N   . LEU A 1 280 ? 18.968  -7.619  7.580   1.00 46.88 ? 257 LEU A N   1 
ATOM   1868 C CA  . LEU A 1 280 ? 18.147  -8.086  8.692   1.00 44.85 ? 257 LEU A CA  1 
ATOM   1869 C C   . LEU A 1 280 ? 18.498  -7.449  10.036  1.00 42.40 ? 257 LEU A C   1 
ATOM   1870 O O   . LEU A 1 280 ? 19.601  -7.629  10.556  1.00 41.73 ? 257 LEU A O   1 
ATOM   1871 C CB  . LEU A 1 280 ? 18.242  -9.615  8.792   1.00 45.82 ? 257 LEU A CB  1 
ATOM   1872 C CG  . LEU A 1 280 ? 17.873  -10.378 7.509   1.00 47.01 ? 257 LEU A CG  1 
ATOM   1873 C CD1 . LEU A 1 280 ? 18.148  -11.867 7.675   1.00 46.62 ? 257 LEU A CD1 1 
ATOM   1874 C CD2 . LEU A 1 280 ? 16.408  -10.133 7.170   1.00 45.60 ? 257 LEU A CD2 1 
ATOM   1875 N N   . ILE A 1 281 ? 17.540  -6.713  10.593  1.00 38.85 ? 258 ILE A N   1 
ATOM   1876 C CA  . ILE A 1 281 ? 17.720  -6.046  11.872  1.00 36.93 ? 258 ILE A CA  1 
ATOM   1877 C C   . ILE A 1 281 ? 16.750  -6.602  12.914  1.00 35.97 ? 258 ILE A C   1 
ATOM   1878 O O   . ILE A 1 281 ? 15.567  -6.268  12.893  1.00 36.04 ? 258 ILE A O   1 
ATOM   1879 C CB  . ILE A 1 281 ? 17.462  -4.546  11.738  1.00 36.46 ? 258 ILE A CB  1 
ATOM   1880 C CG1 . ILE A 1 281 ? 18.321  -3.966  10.614  1.00 35.78 ? 258 ILE A CG1 1 
ATOM   1881 C CG2 . ILE A 1 281 ? 17.753  -3.864  13.054  1.00 35.75 ? 258 ILE A CG2 1 
ATOM   1882 C CD1 . ILE A 1 281 ? 18.140  -2.479  10.403  1.00 33.57 ? 258 ILE A CD1 1 
ATOM   1883 N N   . PRO A 1 282 ? 17.238  -7.446  13.844  1.00 34.56 ? 259 PRO A N   1 
ATOM   1884 C CA  . PRO A 1 282 ? 16.374  -8.027  14.878  1.00 32.84 ? 259 PRO A CA  1 
ATOM   1885 C C   . PRO A 1 282 ? 15.876  -6.935  15.799  1.00 31.40 ? 259 PRO A C   1 
ATOM   1886 O O   . PRO A 1 282 ? 16.625  -6.017  16.121  1.00 32.90 ? 259 PRO A O   1 
ATOM   1887 C CB  . PRO A 1 282 ? 17.299  -8.998  15.610  1.00 33.55 ? 259 PRO A CB  1 
ATOM   1888 C CG  . PRO A 1 282 ? 18.409  -9.259  14.626  1.00 33.05 ? 259 PRO A CG  1 
ATOM   1889 C CD  . PRO A 1 282 ? 18.622  -7.908  14.023  1.00 34.08 ? 259 PRO A CD  1 
ATOM   1890 N N   . VAL A 1 283 ? 14.620  -7.032  16.223  1.00 29.35 ? 260 VAL A N   1 
ATOM   1891 C CA  . VAL A 1 283 ? 14.041  -6.028  17.110  1.00 26.02 ? 260 VAL A CA  1 
ATOM   1892 C C   . VAL A 1 283 ? 13.044  -6.657  18.087  1.00 25.98 ? 260 VAL A C   1 
ATOM   1893 O O   . VAL A 1 283 ? 12.004  -7.182  17.684  1.00 23.46 ? 260 VAL A O   1 
ATOM   1894 C CB  . VAL A 1 283 ? 13.352  -4.911  16.288  1.00 24.55 ? 260 VAL A CB  1 
ATOM   1895 C CG1 . VAL A 1 283 ? 12.657  -3.919  17.207  1.00 21.03 ? 260 VAL A CG1 1 
ATOM   1896 C CG2 . VAL A 1 283 ? 14.378  -4.197  15.443  1.00 21.70 ? 260 VAL A CG2 1 
ATOM   1897 N N   . SER A 1 284 ? 13.379  -6.592  19.375  1.00 26.64 ? 261 SER A N   1 
ATOM   1898 C CA  . SER A 1 284 ? 12.547  -7.168  20.425  1.00 28.96 ? 261 SER A CA  1 
ATOM   1899 C C   . SER A 1 284 ? 11.295  -6.354  20.687  1.00 29.29 ? 261 SER A C   1 
ATOM   1900 O O   . SER A 1 284 ? 11.316  -5.130  20.602  1.00 31.95 ? 261 SER A O   1 
ATOM   1901 C CB  . SER A 1 284 ? 13.347  -7.288  21.722  1.00 31.45 ? 261 SER A CB  1 
ATOM   1902 O OG  . SER A 1 284 ? 13.505  -6.025  22.341  1.00 32.01 ? 261 SER A OG  1 
ATOM   1903 N N   . MET A 1 285 ? 10.203  -7.032  21.020  1.00 28.29 ? 262 MET A N   1 
ATOM   1904 C CA  . MET A 1 285 ? 8.938   -6.351  21.284  1.00 28.14 ? 262 MET A CA  1 
ATOM   1905 C C   . MET A 1 285 ? 8.134   -7.121  22.304  1.00 28.51 ? 262 MET A C   1 
ATOM   1906 O O   . MET A 1 285 ? 6.917   -6.977  22.367  1.00 29.62 ? 262 MET A O   1 
ATOM   1907 C CB  . MET A 1 285 ? 8.102   -6.238  20.002  1.00 26.88 ? 262 MET A CB  1 
ATOM   1908 C CG  . MET A 1 285 ? 8.151   -4.908  19.261  1.00 27.53 ? 262 MET A CG  1 
ATOM   1909 S SD  . MET A 1 285 ? 7.329   -3.507  20.089  1.00 27.58 ? 262 MET A SD  1 
ATOM   1910 C CE  . MET A 1 285 ? 8.601   -2.259  19.903  1.00 23.22 ? 262 MET A CE  1 
ATOM   1911 N N   . SER A 1 286 ? 8.807   -7.931  23.108  1.00 28.67 ? 263 SER A N   1 
ATOM   1912 C CA  . SER A 1 286 ? 8.108   -8.742  24.098  1.00 28.55 ? 263 SER A CA  1 
ATOM   1913 C C   . SER A 1 286 ? 7.238   -7.955  25.071  1.00 26.71 ? 263 SER A C   1 
ATOM   1914 O O   . SER A 1 286 ? 6.072   -8.290  25.269  1.00 26.60 ? 263 SER A O   1 
ATOM   1915 C CB  . SER A 1 286 ? 9.110   -9.613  24.865  1.00 28.76 ? 263 SER A CB  1 
ATOM   1916 O OG  . SER A 1 286 ? 10.196  -8.846  25.356  1.00 31.25 ? 263 SER A OG  1 
ATOM   1917 N N   . GLU A 1 287 ? 7.781   -6.899  25.663  1.00 25.53 ? 264 GLU A N   1 
ATOM   1918 C CA  . GLU A 1 287 ? 7.000   -6.134  26.619  1.00 26.17 ? 264 GLU A CA  1 
ATOM   1919 C C   . GLU A 1 287 ? 5.739   -5.534  26.017  1.00 25.82 ? 264 GLU A C   1 
ATOM   1920 O O   . GLU A 1 287 ? 4.655   -5.693  26.566  1.00 27.22 ? 264 GLU A O   1 
ATOM   1921 C CB  . GLU A 1 287 ? 7.845   -5.030  27.255  1.00 26.64 ? 264 GLU A CB  1 
ATOM   1922 C CG  . GLU A 1 287 ? 8.981   -5.530  28.114  1.00 30.25 ? 264 GLU A CG  1 
ATOM   1923 C CD  . GLU A 1 287 ? 8.518   -6.428  29.252  1.00 33.38 ? 264 GLU A CD  1 
ATOM   1924 O OE1 . GLU A 1 287 ? 7.529   -6.076  29.936  1.00 34.82 ? 264 GLU A OE1 1 
ATOM   1925 O OE2 . GLU A 1 287 ? 9.153   -7.482  29.473  1.00 33.04 ? 264 GLU A OE2 1 
ATOM   1926 N N   . LEU A 1 288 ? 5.858   -4.849  24.889  1.00 25.99 ? 265 LEU A N   1 
ATOM   1927 C CA  . LEU A 1 288 ? 4.674   -4.250  24.293  1.00 26.19 ? 265 LEU A CA  1 
ATOM   1928 C C   . LEU A 1 288 ? 3.746   -5.286  23.705  1.00 26.84 ? 265 LEU A C   1 
ATOM   1929 O O   . LEU A 1 288 ? 2.551   -5.033  23.539  1.00 25.44 ? 265 LEU A O   1 
ATOM   1930 C CB  . LEU A 1 288 ? 5.056   -3.218  23.228  1.00 27.11 ? 265 LEU A CB  1 
ATOM   1931 C CG  . LEU A 1 288 ? 5.646   -1.903  23.759  1.00 26.92 ? 265 LEU A CG  1 
ATOM   1932 C CD1 . LEU A 1 288 ? 5.525   -0.817  22.691  1.00 28.52 ? 265 LEU A CD1 1 
ATOM   1933 C CD2 . LEU A 1 288 ? 4.899   -1.466  24.998  1.00 25.16 ? 265 LEU A CD2 1 
ATOM   1934 N N   . GLU A 1 289 ? 4.293   -6.456  23.386  1.00 28.46 ? 266 GLU A N   1 
ATOM   1935 C CA  . GLU A 1 289 ? 3.478   -7.519  22.827  1.00 29.11 ? 266 GLU A CA  1 
ATOM   1936 C C   . GLU A 1 289 ? 2.536   -8.014  23.908  1.00 30.18 ? 266 GLU A C   1 
ATOM   1937 O O   . GLU A 1 289 ? 1.480   -8.576  23.616  1.00 30.67 ? 266 GLU A O   1 
ATOM   1938 C CB  . GLU A 1 289 ? 4.335   -8.678  22.325  1.00 29.64 ? 266 GLU A CB  1 
ATOM   1939 C CG  . GLU A 1 289 ? 3.515   -9.689  21.532  1.00 33.60 ? 266 GLU A CG  1 
ATOM   1940 C CD  . GLU A 1 289 ? 4.318   -10.873 21.001  1.00 35.42 ? 266 GLU A CD  1 
ATOM   1941 O OE1 . GLU A 1 289 ? 5.450   -10.670 20.496  1.00 39.09 ? 266 GLU A OE1 1 
ATOM   1942 O OE2 . GLU A 1 289 ? 3.797   -12.006 21.071  1.00 33.20 ? 266 GLU A OE2 1 
ATOM   1943 N N   . LYS A 1 290 ? 2.916   -7.804  25.163  1.00 30.74 ? 267 LYS A N   1 
ATOM   1944 C CA  . LYS A 1 290 ? 2.069   -8.225  26.260  1.00 32.02 ? 267 LYS A CA  1 
ATOM   1945 C C   . LYS A 1 290 ? 0.731   -7.504  26.149  1.00 32.71 ? 267 LYS A C   1 
ATOM   1946 O O   . LYS A 1 290 ? -0.286  -7.994  26.640  1.00 36.55 ? 267 LYS A O   1 
ATOM   1947 C CB  . LYS A 1 290 ? 2.737   -7.941  27.612  1.00 32.69 ? 267 LYS A CB  1 
ATOM   1948 C CG  . LYS A 1 290 ? 4.030   -8.726  27.842  1.00 32.34 ? 267 LYS A CG  1 
ATOM   1949 C CD  . LYS A 1 290 ? 4.553   -8.533  29.260  1.00 33.96 ? 267 LYS A CD  1 
ATOM   1950 C CE  . LYS A 1 290 ? 5.959   -9.127  29.431  1.00 34.26 ? 267 LYS A CE  1 
ATOM   1951 N NZ  . LYS A 1 290 ? 6.563   -8.843  30.780  1.00 32.98 ? 267 LYS A NZ  1 
ATOM   1952 N N   . VAL A 1 291 ? 0.726   -6.342  25.504  1.00 31.68 ? 268 VAL A N   1 
ATOM   1953 C CA  . VAL A 1 291 ? -0.515  -5.600  25.317  1.00 30.18 ? 268 VAL A CA  1 
ATOM   1954 C C   . VAL A 1 291 ? -0.819  -5.449  23.840  1.00 31.07 ? 268 VAL A C   1 
ATOM   1955 O O   . VAL A 1 291 ? -1.048  -4.350  23.334  1.00 29.52 ? 268 VAL A O   1 
ATOM   1956 C CB  . VAL A 1 291 ? -0.473  -4.224  25.989  1.00 30.85 ? 268 VAL A CB  1 
ATOM   1957 C CG1 . VAL A 1 291 ? -0.421  -4.417  27.499  1.00 31.00 ? 268 VAL A CG1 1 
ATOM   1958 C CG2 . VAL A 1 291 ? 0.719   -3.416  25.496  1.00 27.97 ? 268 VAL A CG2 1 
ATOM   1959 N N   . ASP A 1 292 ? -0.788  -6.597  23.163  1.00 33.03 ? 269 ASP A N   1 
ATOM   1960 C CA  . ASP A 1 292 ? -1.070  -6.742  21.733  1.00 33.23 ? 269 ASP A CA  1 
ATOM   1961 C C   . ASP A 1 292 ? -0.371  -5.766  20.788  1.00 32.25 ? 269 ASP A C   1 
ATOM   1962 O O   . ASP A 1 292 ? -0.904  -5.453  19.730  1.00 34.29 ? 269 ASP A O   1 
ATOM   1963 C CB  . ASP A 1 292 ? -2.586  -6.659  21.506  1.00 33.60 ? 269 ASP A CB  1 
ATOM   1964 C CG  . ASP A 1 292 ? -3.384  -7.346  22.610  1.00 36.76 ? 269 ASP A CG  1 
ATOM   1965 O OD1 . ASP A 1 292 ? -3.044  -8.504  22.950  1.00 35.44 ? 269 ASP A OD1 1 
ATOM   1966 O OD2 . ASP A 1 292 ? -4.349  -6.729  23.132  1.00 36.83 ? 269 ASP A OD2 1 
ATOM   1967 N N   . GLY A 1 293 ? 0.817   -5.295  21.145  1.00 31.23 ? 270 GLY A N   1 
ATOM   1968 C CA  . GLY A 1 293 ? 1.508   -4.349  20.282  1.00 28.45 ? 270 GLY A CA  1 
ATOM   1969 C C   . GLY A 1 293 ? 2.664   -4.961  19.519  1.00 25.01 ? 270 GLY A C   1 
ATOM   1970 O O   . GLY A 1 293 ? 3.614   -5.446  20.132  1.00 26.80 ? 270 GLY A O   1 
ATOM   1971 N N   . LEU A 1 294 ? 2.603   -4.938  18.190  1.00 21.73 ? 271 LEU A N   1 
ATOM   1972 C CA  . LEU A 1 294 ? 3.672   -5.523  17.393  1.00 20.48 ? 271 LEU A CA  1 
ATOM   1973 C C   . LEU A 1 294 ? 4.552   -4.459  16.779  1.00 20.17 ? 271 LEU A C   1 
ATOM   1974 O O   . LEU A 1 294 ? 4.363   -3.272  17.013  1.00 24.22 ? 271 LEU A O   1 
ATOM   1975 C CB  . LEU A 1 294 ? 3.097   -6.425  16.298  1.00 18.92 ? 271 LEU A CB  1 
ATOM   1976 C CG  . LEU A 1 294 ? 2.017   -7.416  16.750  1.00 16.91 ? 271 LEU A CG  1 
ATOM   1977 C CD1 . LEU A 1 294 ? 1.681   -8.386  15.642  1.00 15.13 ? 271 LEU A CD1 1 
ATOM   1978 C CD2 . LEU A 1 294 ? 2.501   -8.155  17.956  1.00 18.00 ? 271 LEU A CD2 1 
ATOM   1979 N N   . LEU A 1 295 ? 5.521   -4.891  15.989  1.00 21.73 ? 272 LEU A N   1 
ATOM   1980 C CA  . LEU A 1 295 ? 6.441   -3.972  15.347  1.00 21.78 ? 272 LEU A CA  1 
ATOM   1981 C C   . LEU A 1 295 ? 5.759   -2.854  14.564  1.00 21.60 ? 272 LEU A C   1 
ATOM   1982 O O   . LEU A 1 295 ? 5.951   -1.678  14.880  1.00 20.92 ? 272 LEU A O   1 
ATOM   1983 C CB  . LEU A 1 295 ? 7.374   -4.739  14.422  1.00 23.07 ? 272 LEU A CB  1 
ATOM   1984 C CG  . LEU A 1 295 ? 8.381   -5.698  15.055  1.00 27.58 ? 272 LEU A CG  1 
ATOM   1985 C CD1 . LEU A 1 295 ? 9.135   -6.426  13.922  1.00 26.81 ? 272 LEU A CD1 1 
ATOM   1986 C CD2 . LEU A 1 295 ? 9.357   -4.931  15.971  1.00 25.43 ? 272 LEU A CD2 1 
ATOM   1987 N N   . THR A 1 296 ? 4.972   -3.223  13.553  1.00 20.41 ? 273 THR A N   1 
ATOM   1988 C CA  . THR A 1 296 ? 4.273   -2.257  12.697  1.00 21.73 ? 273 THR A CA  1 
ATOM   1989 C C   . THR A 1 296 ? 3.442   -1.238  13.492  1.00 23.65 ? 273 THR A C   1 
ATOM   1990 O O   . THR A 1 296 ? 3.363   -0.047  13.146  1.00 20.39 ? 273 THR A O   1 
ATOM   1991 C CB  . THR A 1 296 ? 3.309   -2.971  11.684  1.00 22.92 ? 273 THR A CB  1 
ATOM   1992 O OG1 . THR A 1 296 ? 2.313   -3.713  12.396  1.00 24.13 ? 273 THR A OG1 1 
ATOM   1993 C CG2 . THR A 1 296 ? 4.075   -3.909  10.766  1.00 24.21 ? 273 THR A CG2 1 
ATOM   1994 N N   . SER A 1 297 ? 2.832   -1.736  14.562  1.00 23.11 ? 274 SER A N   1 
ATOM   1995 C CA  . SER A 1 297 ? 1.982   -0.952  15.425  1.00 21.31 ? 274 SER A CA  1 
ATOM   1996 C C   . SER A 1 297 ? 2.623   0.318   15.933  1.00 21.57 ? 274 SER A C   1 
ATOM   1997 O O   . SER A 1 297 ? 1.953   1.340   16.069  1.00 21.66 ? 274 SER A O   1 
ATOM   1998 C CB  . SER A 1 297 ? 1.570   -1.806  16.616  1.00 21.63 ? 274 SER A CB  1 
ATOM   1999 O OG  . SER A 1 297 ? 1.109   -3.071  16.183  1.00 23.62 ? 274 SER A OG  1 
ATOM   2000 N N   . CYS A 1 298 ? 3.925   0.262   16.194  1.00 20.26 ? 275 CYS A N   1 
ATOM   2001 C CA  . CYS A 1 298 ? 4.620   1.409   16.774  1.00 17.87 ? 275 CYS A CA  1 
ATOM   2002 C C   . CYS A 1 298 ? 5.029   2.574   15.921  1.00 16.48 ? 275 CYS A C   1 
ATOM   2003 O O   . CYS A 1 298 ? 5.714   3.471   16.399  1.00 14.73 ? 275 CYS A O   1 
ATOM   2004 C CB  . CYS A 1 298 ? 5.842   0.936   17.546  1.00 19.27 ? 275 CYS A CB  1 
ATOM   2005 S SG  . CYS A 1 298 ? 5.419   -0.010  18.992  1.00 26.06 ? 275 CYS A SG  1 
ATOM   2006 N N   . SER A 1 299 ? 4.628   2.590   14.664  1.00 16.74 ? 276 SER A N   1 
ATOM   2007 C CA  . SER A 1 299 ? 5.020   3.716   13.846  1.00 16.47 ? 276 SER A CA  1 
ATOM   2008 C C   . SER A 1 299 ? 4.255   3.824   12.545  1.00 16.90 ? 276 SER A C   1 
ATOM   2009 O O   . SER A 1 299 ? 3.733   2.838   12.030  1.00 16.67 ? 276 SER A O   1 
ATOM   2010 C CB  . SER A 1 299 ? 6.512   3.630   13.549  1.00 14.56 ? 276 SER A CB  1 
ATOM   2011 O OG  . SER A 1 299 ? 6.764   2.566   12.664  1.00 16.10 ? 276 SER A OG  1 
ATOM   2012 N N   . VAL A 1 300 ? 4.192   5.049   12.037  1.00 17.60 ? 277 VAL A N   1 
ATOM   2013 C CA  . VAL A 1 300 ? 3.541   5.351   10.774  1.00 20.37 ? 277 VAL A CA  1 
ATOM   2014 C C   . VAL A 1 300 ? 4.685   5.790   9.848   1.00 22.23 ? 277 VAL A C   1 
ATOM   2015 O O   . VAL A 1 300 ? 5.457   6.681   10.171  1.00 23.74 ? 277 VAL A O   1 
ATOM   2016 C CB  . VAL A 1 300 ? 2.511   6.482   10.954  1.00 20.24 ? 277 VAL A CB  1 
ATOM   2017 C CG1 . VAL A 1 300 ? 1.754   6.717   9.658   1.00 20.50 ? 277 VAL A CG1 1 
ATOM   2018 C CG2 . VAL A 1 300 ? 1.534   6.110   12.080  1.00 23.13 ? 277 VAL A CG2 1 
ATOM   2019 N N   . LEU A 1 301 ? 4.817   5.136   8.709   1.00 24.56 ? 278 LEU A N   1 
ATOM   2020 C CA  . LEU A 1 301 ? 5.890   5.462   7.784   1.00 26.32 ? 278 LEU A CA  1 
ATOM   2021 C C   . LEU A 1 301 ? 5.397   6.325   6.646   1.00 26.52 ? 278 LEU A C   1 
ATOM   2022 O O   . LEU A 1 301 ? 4.567   5.909   5.843   1.00 26.31 ? 278 LEU A O   1 
ATOM   2023 C CB  . LEU A 1 301 ? 6.502   4.180   7.230   1.00 26.49 ? 278 LEU A CB  1 
ATOM   2024 C CG  . LEU A 1 301 ? 6.971   3.284   8.371   1.00 29.13 ? 278 LEU A CG  1 
ATOM   2025 C CD1 . LEU A 1 301 ? 7.359   1.913   7.827   1.00 29.46 ? 278 LEU A CD1 1 
ATOM   2026 C CD2 . LEU A 1 301 ? 8.132   3.950   9.093   1.00 27.85 ? 278 LEU A CD2 1 
ATOM   2027 N N   . ILE A 1 302 ? 5.922   7.534   6.583   1.00 25.87 ? 279 ILE A N   1 
ATOM   2028 C CA  . ILE A 1 302 ? 5.528   8.450   5.552   1.00 27.96 ? 279 ILE A CA  1 
ATOM   2029 C C   . ILE A 1 302 ? 6.653   8.582   4.548   1.00 30.81 ? 279 ILE A C   1 
ATOM   2030 O O   . ILE A 1 302 ? 7.840   8.530   4.906   1.00 30.42 ? 279 ILE A O   1 
ATOM   2031 C CB  . ILE A 1 302 ? 5.233   9.847   6.132   1.00 29.00 ? 279 ILE A CB  1 
ATOM   2032 C CG1 . ILE A 1 302 ? 4.048   9.778   7.095   1.00 29.33 ? 279 ILE A CG1 1 
ATOM   2033 C CG2 . ILE A 1 302 ? 4.950   10.837  5.004   1.00 30.35 ? 279 ILE A CG2 1 
ATOM   2034 C CD1 . ILE A 1 302 ? 4.427   9.431   8.498   1.00 27.71 ? 279 ILE A CD1 1 
ATOM   2035 N N   . ASN A 1 303 ? 6.278   8.725   3.282   1.00 31.04 ? 280 ASN A N   1 
ATOM   2036 C CA  . ASN A 1 303 ? 7.271   8.933   2.255   1.00 32.62 ? 280 ASN A CA  1 
ATOM   2037 C C   . ASN A 1 303 ? 7.009   10.294  1.634   1.00 33.92 ? 280 ASN A C   1 
ATOM   2038 O O   . ASN A 1 303 ? 6.159   10.446  0.768   1.00 35.39 ? 280 ASN A O   1 
ATOM   2039 C CB  . ASN A 1 303 ? 7.232   7.850   1.182   1.00 30.98 ? 280 ASN A CB  1 
ATOM   2040 C CG  . ASN A 1 303 ? 8.260   8.090   0.094   1.00 29.09 ? 280 ASN A CG  1 
ATOM   2041 O OD1 . ASN A 1 303 ? 9.437   8.294   0.379   1.00 24.68 ? 280 ASN A OD1 1 
ATOM   2042 N ND2 . ASN A 1 303 ? 7.819   8.070   -1.160  1.00 28.08 ? 280 ASN A ND2 1 
ATOM   2043 N N   . LYS A 1 304 ? 7.730   11.287  2.137   1.00 38.30 ? 281 LYS A N   1 
ATOM   2044 C CA  . LYS A 1 304 ? 7.654   12.661  1.666   1.00 40.60 ? 281 LYS A CA  1 
ATOM   2045 C C   . LYS A 1 304 ? 8.857   12.746  0.734   1.00 41.87 ? 281 LYS A C   1 
ATOM   2046 O O   . LYS A 1 304 ? 9.997   12.602  1.170   1.00 42.42 ? 281 LYS A O   1 
ATOM   2047 C CB  . LYS A 1 304 ? 7.816   13.602  2.853   1.00 42.36 ? 281 LYS A CB  1 
ATOM   2048 C CG  . LYS A 1 304 ? 7.396   15.028  2.602   1.00 46.57 ? 281 LYS A CG  1 
ATOM   2049 C CD  . LYS A 1 304 ? 7.329   15.790  3.917   1.00 47.84 ? 281 LYS A CD  1 
ATOM   2050 C CE  . LYS A 1 304 ? 6.797   17.188  3.694   1.00 50.64 ? 281 LYS A CE  1 
ATOM   2051 N NZ  . LYS A 1 304 ? 5.490   17.145  2.981   1.00 52.93 ? 281 LYS A NZ  1 
ATOM   2052 N N   . LYS A 1 305 ? 8.609   12.944  -0.551  1.00 43.32 ? 282 LYS A N   1 
ATOM   2053 C CA  . LYS A 1 305 ? 9.697   12.994  -1.519  1.00 44.68 ? 282 LYS A CA  1 
ATOM   2054 C C   . LYS A 1 305 ? 10.159  14.420  -1.841  1.00 45.29 ? 282 LYS A C   1 
ATOM   2055 O O   . LYS A 1 305 ? 11.348  14.727  -1.594  1.00 45.91 ? 282 LYS A O   1 
ATOM   2056 C CB  . LYS A 1 305 ? 9.272   12.260  -2.794  1.00 44.61 ? 282 LYS A CB  1 
ATOM   2057 N N   . ALA B 1 31  ? 37.183  -7.521  64.111  1.00 44.38 ? 8   ALA B N   1 
ATOM   2058 C CA  . ALA B 1 31  ? 35.948  -7.369  63.288  1.00 44.10 ? 8   ALA B CA  1 
ATOM   2059 C C   . ALA B 1 31  ? 34.917  -6.453  63.940  1.00 43.54 ? 8   ALA B C   1 
ATOM   2060 O O   . ALA B 1 31  ? 34.520  -6.660  65.091  1.00 43.25 ? 8   ALA B O   1 
ATOM   2061 C CB  . ALA B 1 31  ? 35.317  -8.744  63.023  1.00 44.24 ? 8   ALA B CB  1 
ATOM   2062 N N   . ALA B 1 32  ? 34.500  -5.439  63.186  1.00 41.62 ? 9   ALA B N   1 
ATOM   2063 C CA  . ALA B 1 32  ? 33.494  -4.478  63.618  1.00 40.67 ? 9   ALA B CA  1 
ATOM   2064 C C   . ALA B 1 32  ? 32.738  -3.949  62.389  1.00 40.94 ? 9   ALA B C   1 
ATOM   2065 O O   . ALA B 1 32  ? 32.502  -4.696  61.431  1.00 39.42 ? 9   ALA B O   1 
ATOM   2066 C CB  . ALA B 1 32  ? 34.141  -3.332  64.380  1.00 42.90 ? 9   ALA B CB  1 
ATOM   2067 N N   . PHE B 1 33  ? 32.359  -2.673  62.392  1.00 39.24 ? 10  PHE B N   1 
ATOM   2068 C CA  . PHE B 1 33  ? 31.617  -2.155  61.244  1.00 38.90 ? 10  PHE B CA  1 
ATOM   2069 C C   . PHE B 1 33  ? 32.391  -2.133  59.934  1.00 37.48 ? 10  PHE B C   1 
ATOM   2070 O O   . PHE B 1 33  ? 33.479  -1.556  59.839  1.00 36.50 ? 10  PHE B O   1 
ATOM   2071 C CB  . PHE B 1 33  ? 31.062  -0.748  61.482  1.00 35.85 ? 10  PHE B CB  1 
ATOM   2072 C CG  . PHE B 1 33  ? 30.302  -0.218  60.296  1.00 34.64 ? 10  PHE B CG  1 
ATOM   2073 C CD1 . PHE B 1 33  ? 29.083  -0.783  59.930  1.00 33.17 ? 10  PHE B CD1 1 
ATOM   2074 C CD2 . PHE B 1 33  ? 30.841  0.783   59.490  1.00 33.88 ? 10  PHE B CD2 1 
ATOM   2075 C CE1 . PHE B 1 33  ? 28.415  -0.368  58.782  1.00 31.15 ? 10  PHE B CE1 1 
ATOM   2076 C CE2 . PHE B 1 33  ? 30.177  1.202   58.339  1.00 31.94 ? 10  PHE B CE2 1 
ATOM   2077 C CZ  . PHE B 1 33  ? 28.962  0.624   57.985  1.00 31.70 ? 10  PHE B CZ  1 
ATOM   2078 N N   . GLY B 1 34  ? 31.790  -2.750  58.918  1.00 36.69 ? 11  GLY B N   1 
ATOM   2079 C CA  . GLY B 1 34  ? 32.398  -2.806  57.605  1.00 34.16 ? 11  GLY B CA  1 
ATOM   2080 C C   . GLY B 1 34  ? 33.239  -4.052  57.414  1.00 32.36 ? 11  GLY B C   1 
ATOM   2081 O O   . GLY B 1 34  ? 33.861  -4.226  56.369  1.00 31.82 ? 11  GLY B O   1 
ATOM   2082 N N   . ARG B 1 35  ? 33.279  -4.923  58.417  1.00 31.19 ? 12  ARG B N   1 
ATOM   2083 C CA  . ARG B 1 35  ? 34.065  -6.139  58.271  1.00 29.83 ? 12  ARG B CA  1 
ATOM   2084 C C   . ARG B 1 35  ? 33.368  -7.072  57.311  1.00 28.64 ? 12  ARG B C   1 
ATOM   2085 O O   . ARG B 1 35  ? 32.190  -7.378  57.481  1.00 30.80 ? 12  ARG B O   1 
ATOM   2086 C CB  . ARG B 1 35  ? 34.274  -6.844  59.614  1.00 29.21 ? 12  ARG B CB  1 
ATOM   2087 C CG  . ARG B 1 35  ? 35.036  -8.166  59.514  1.00 27.96 ? 12  ARG B CG  1 
ATOM   2088 C CD  . ARG B 1 35  ? 36.252  -8.062  58.583  1.00 30.15 ? 12  ARG B CD  1 
ATOM   2089 N NE  . ARG B 1 35  ? 37.221  -7.063  59.032  1.00 30.76 ? 12  ARG B NE  1 
ATOM   2090 C CZ  . ARG B 1 35  ? 38.073  -7.249  60.037  1.00 30.08 ? 12  ARG B CZ  1 
ATOM   2091 N NH1 . ARG B 1 35  ? 38.080  -8.405  60.693  1.00 27.72 ? 12  ARG B NH1 1 
ATOM   2092 N NH2 . ARG B 1 35  ? 38.907  -6.278  60.389  1.00 27.25 ? 12  ARG B NH2 1 
ATOM   2093 N N   . ALA B 1 36  ? 34.099  -7.501  56.288  1.00 27.24 ? 13  ALA B N   1 
ATOM   2094 C CA  . ALA B 1 36  ? 33.557  -8.418  55.298  1.00 28.95 ? 13  ALA B CA  1 
ATOM   2095 C C   . ALA B 1 36  ? 34.587  -9.494  54.938  1.00 28.20 ? 13  ALA B C   1 
ATOM   2096 O O   . ALA B 1 36  ? 35.787  -9.252  54.986  1.00 29.29 ? 13  ALA B O   1 
ATOM   2097 C CB  . ALA B 1 36  ? 33.133  -7.642  54.033  1.00 27.49 ? 13  ALA B CB  1 
ATOM   2098 N N   . THR B 1 37  ? 34.117  -10.686 54.593  1.00 27.18 ? 14  THR B N   1 
ATOM   2099 C CA  . THR B 1 37  ? 35.026  -11.747 54.199  1.00 26.61 ? 14  THR B CA  1 
ATOM   2100 C C   . THR B 1 37  ? 34.769  -12.138 52.752  1.00 26.47 ? 14  THR B C   1 
ATOM   2101 O O   . THR B 1 37  ? 35.707  -12.391 52.003  1.00 28.74 ? 14  THR B O   1 
ATOM   2102 C CB  . THR B 1 37  ? 34.888  -12.986 55.100  1.00 27.51 ? 14  THR B CB  1 
ATOM   2103 O OG1 . THR B 1 37  ? 33.533  -13.452 55.085  1.00 26.38 ? 14  THR B OG1 1 
ATOM   2104 C CG2 . THR B 1 37  ? 35.309  -12.645 56.523  1.00 25.79 ? 14  THR B CG2 1 
ATOM   2105 N N   . HIS B 1 38  ? 33.501  -12.172 52.352  1.00 24.02 ? 15  HIS B N   1 
ATOM   2106 C CA  . HIS B 1 38  ? 33.157  -12.525 50.980  1.00 22.73 ? 15  HIS B CA  1 
ATOM   2107 C C   . HIS B 1 38  ? 32.425  -11.431 50.239  1.00 21.87 ? 15  HIS B C   1 
ATOM   2108 O O   . HIS B 1 38  ? 31.763  -10.584 50.822  1.00 20.60 ? 15  HIS B O   1 
ATOM   2109 C CB  . HIS B 1 38  ? 32.283  -13.762 50.946  1.00 21.87 ? 15  HIS B CB  1 
ATOM   2110 C CG  . HIS B 1 38  ? 32.916  -14.951 51.575  1.00 26.01 ? 15  HIS B CG  1 
ATOM   2111 N ND1 . HIS B 1 38  ? 33.531  -14.896 52.805  1.00 29.23 ? 15  HIS B ND1 1 
ATOM   2112 C CD2 . HIS B 1 38  ? 33.008  -16.236 51.160  1.00 26.75 ? 15  HIS B CD2 1 
ATOM   2113 C CE1 . HIS B 1 38  ? 33.975  -16.100 53.121  1.00 31.99 ? 15  HIS B CE1 1 
ATOM   2114 N NE2 . HIS B 1 38  ? 33.671  -16.930 52.139  1.00 27.60 ? 15  HIS B NE2 1 
ATOM   2115 N N   . ALA B 1 39  ? 32.537  -11.475 48.928  1.00 23.74 ? 16  ALA B N   1 
ATOM   2116 C CA  . ALA B 1 39  ? 31.869  -10.506 48.095  1.00 26.02 ? 16  ALA B CA  1 
ATOM   2117 C C   . ALA B 1 39  ? 31.203  -11.291 46.987  1.00 27.55 ? 16  ALA B C   1 
ATOM   2118 O O   . ALA B 1 39  ? 31.854  -12.076 46.300  1.00 29.43 ? 16  ALA B O   1 
ATOM   2119 C CB  . ALA B 1 39  ? 32.873  -9.520  47.524  1.00 25.58 ? 16  ALA B CB  1 
ATOM   2120 N N   . VAL B 1 40  ? 29.901  -11.107 46.833  1.00 28.93 ? 17  VAL B N   1 
ATOM   2121 C CA  . VAL B 1 40  ? 29.177  -11.799 45.779  1.00 31.69 ? 17  VAL B CA  1 
ATOM   2122 C C   . VAL B 1 40  ? 28.990  -10.810 44.634  1.00 33.01 ? 17  VAL B C   1 
ATOM   2123 O O   . VAL B 1 40  ? 28.581  -9.679  44.864  1.00 33.50 ? 17  VAL B O   1 
ATOM   2124 C CB  . VAL B 1 40  ? 27.778  -12.284 46.266  1.00 32.22 ? 17  VAL B CB  1 
ATOM   2125 C CG1 . VAL B 1 40  ? 27.062  -13.030 45.147  1.00 31.63 ? 17  VAL B CG1 1 
ATOM   2126 C CG2 . VAL B 1 40  ? 27.922  -13.183 47.485  1.00 29.91 ? 17  VAL B CG2 1 
ATOM   2127 N N   . VAL B 1 41  ? 29.317  -11.233 43.416  1.00 34.35 ? 18  VAL B N   1 
ATOM   2128 C CA  . VAL B 1 41  ? 29.161  -10.402 42.226  1.00 36.78 ? 18  VAL B CA  1 
ATOM   2129 C C   . VAL B 1 41  ? 28.645  -11.281 41.089  1.00 39.40 ? 18  VAL B C   1 
ATOM   2130 O O   . VAL B 1 41  ? 28.557  -12.506 41.229  1.00 41.09 ? 18  VAL B O   1 
ATOM   2131 C CB  . VAL B 1 41  ? 30.506  -9.755  41.772  1.00 37.16 ? 18  VAL B CB  1 
ATOM   2132 C CG1 . VAL B 1 41  ? 30.778  -8.479  42.548  1.00 37.08 ? 18  VAL B CG1 1 
ATOM   2133 C CG2 . VAL B 1 41  ? 31.643  -10.725 41.974  1.00 35.57 ? 18  VAL B CG2 1 
ATOM   2134 N N   . ARG B 1 42  ? 28.294  -10.654 39.968  1.00 40.26 ? 19  ARG B N   1 
ATOM   2135 C CA  . ARG B 1 42  ? 27.807  -11.388 38.809  1.00 38.53 ? 19  ARG B CA  1 
ATOM   2136 C C   . ARG B 1 42  ? 28.332  -10.733 37.543  1.00 38.26 ? 19  ARG B C   1 
ATOM   2137 O O   . ARG B 1 42  ? 28.273  -9.512  37.394  1.00 38.06 ? 19  ARG B O   1 
ATOM   2138 C CB  . ARG B 1 42  ? 26.274  -11.426 38.781  1.00 38.62 ? 19  ARG B CB  1 
ATOM   2139 C CG  . ARG B 1 42  ? 25.716  -12.356 37.701  1.00 37.13 ? 19  ARG B CG  1 
ATOM   2140 C CD  . ARG B 1 42  ? 24.232  -12.631 37.881  1.00 38.08 ? 19  ARG B CD  1 
ATOM   2141 N NE  . ARG B 1 42  ? 23.810  -13.843 37.174  1.00 39.64 ? 19  ARG B NE  1 
ATOM   2142 C CZ  . ARG B 1 42  ? 22.611  -14.406 37.305  1.00 39.90 ? 19  ARG B CZ  1 
ATOM   2143 N NH1 . ARG B 1 42  ? 21.709  -13.867 38.114  1.00 41.91 ? 19  ARG B NH1 1 
ATOM   2144 N NH2 . ARG B 1 42  ? 22.318  -15.519 36.645  1.00 39.87 ? 19  ARG B NH2 1 
ATOM   2145 N N   . ALA B 1 43  ? 28.852  -11.561 36.642  1.00 38.70 ? 20  ALA B N   1 
ATOM   2146 C CA  . ALA B 1 43  ? 29.412  -11.103 35.375  1.00 38.92 ? 20  ALA B CA  1 
ATOM   2147 C C   . ALA B 1 43  ? 28.360  -10.360 34.566  1.00 40.12 ? 20  ALA B C   1 
ATOM   2148 O O   . ALA B 1 43  ? 27.203  -10.783 34.503  1.00 41.28 ? 20  ALA B O   1 
ATOM   2149 C CB  . ALA B 1 43  ? 29.934  -12.291 34.583  1.00 36.40 ? 20  ALA B CB  1 
ATOM   2150 N N   . LEU B 1 44  ? 28.755  -9.248  33.954  1.00 39.36 ? 21  LEU B N   1 
ATOM   2151 C CA  . LEU B 1 44  ? 27.814  -8.480  33.151  1.00 39.94 ? 21  LEU B CA  1 
ATOM   2152 C C   . LEU B 1 44  ? 27.604  -9.158  31.799  1.00 39.20 ? 21  LEU B C   1 
ATOM   2153 O O   . LEU B 1 44  ? 28.561  -9.525  31.120  1.00 39.63 ? 21  LEU B O   1 
ATOM   2154 C CB  . LEU B 1 44  ? 28.308  -7.037  32.960  1.00 38.07 ? 21  LEU B CB  1 
ATOM   2155 C CG  . LEU B 1 44  ? 29.599  -6.745  32.193  1.00 39.29 ? 21  LEU B CG  1 
ATOM   2156 C CD1 . LEU B 1 44  ? 29.410  -6.889  30.681  1.00 37.43 ? 21  LEU B CD1 1 
ATOM   2157 C CD2 . LEU B 1 44  ? 30.008  -5.329  32.522  1.00 39.58 ? 21  LEU B CD2 1 
ATOM   2158 N N   . PRO B 1 45  ? 26.338  -9.363  31.412  1.00 38.91 ? 22  PRO B N   1 
ATOM   2159 C CA  . PRO B 1 45  ? 26.025  -9.998  30.135  1.00 40.22 ? 22  PRO B CA  1 
ATOM   2160 C C   . PRO B 1 45  ? 26.194  -9.028  28.969  1.00 42.32 ? 22  PRO B C   1 
ATOM   2161 O O   . PRO B 1 45  ? 26.150  -7.809  29.140  1.00 43.10 ? 22  PRO B O   1 
ATOM   2162 C CB  . PRO B 1 45  ? 24.582  -10.447 30.325  1.00 39.85 ? 22  PRO B CB  1 
ATOM   2163 C CG  . PRO B 1 45  ? 24.023  -9.400  31.226  1.00 38.58 ? 22  PRO B CG  1 
ATOM   2164 C CD  . PRO B 1 45  ? 25.122  -9.185  32.225  1.00 38.77 ? 22  PRO B CD  1 
ATOM   2165 N N   . GLU B 1 46  ? 26.395  -9.576  27.781  1.00 45.07 ? 23  GLU B N   1 
ATOM   2166 C CA  . GLU B 1 46  ? 26.581  -8.758  26.593  1.00 46.68 ? 23  GLU B CA  1 
ATOM   2167 C C   . GLU B 1 46  ? 25.367  -7.883  26.302  1.00 45.77 ? 23  GLU B C   1 
ATOM   2168 O O   . GLU B 1 46  ? 25.507  -6.768  25.797  1.00 45.21 ? 23  GLU B O   1 
ATOM   2169 C CB  . GLU B 1 46  ? 26.863  -9.656  25.391  1.00 48.61 ? 23  GLU B CB  1 
ATOM   2170 C CG  . GLU B 1 46  ? 27.177  -8.899  24.106  1.00 52.70 ? 23  GLU B CG  1 
ATOM   2171 C CD  . GLU B 1 46  ? 28.482  -8.127  24.183  1.00 55.50 ? 23  GLU B CD  1 
ATOM   2172 O OE1 . GLU B 1 46  ? 28.869  -7.526  23.159  1.00 53.50 ? 23  GLU B OE1 1 
ATOM   2173 O OE2 . GLU B 1 46  ? 29.118  -8.121  25.265  1.00 58.15 ? 23  GLU B OE2 1 
ATOM   2174 N N   . SER B 1 47  ? 24.183  -8.396  26.630  1.00 44.55 ? 24  SER B N   1 
ATOM   2175 C CA  . SER B 1 47  ? 22.928  -7.684  26.385  1.00 44.72 ? 24  SER B CA  1 
ATOM   2176 C C   . SER B 1 47  ? 22.769  -6.404  27.199  1.00 43.19 ? 24  SER B C   1 
ATOM   2177 O O   . SER B 1 47  ? 21.994  -5.526  26.839  1.00 41.64 ? 24  SER B O   1 
ATOM   2178 C CB  . SER B 1 47  ? 21.735  -8.604  26.656  1.00 45.74 ? 24  SER B CB  1 
ATOM   2179 O OG  . SER B 1 47  ? 21.579  -8.857  28.039  1.00 48.56 ? 24  SER B OG  1 
ATOM   2180 N N   . LEU B 1 48  ? 23.489  -6.308  28.308  1.00 42.79 ? 25  LEU B N   1 
ATOM   2181 C CA  . LEU B 1 48  ? 23.418  -5.116  29.137  1.00 41.64 ? 25  LEU B CA  1 
ATOM   2182 C C   . LEU B 1 48  ? 23.655  -3.916  28.250  1.00 40.98 ? 25  LEU B C   1 
ATOM   2183 O O   . LEU B 1 48  ? 22.974  -2.904  28.356  1.00 39.46 ? 25  LEU B O   1 
ATOM   2184 C CB  . LEU B 1 48  ? 24.485  -5.162  30.235  1.00 40.31 ? 25  LEU B CB  1 
ATOM   2185 C CG  . LEU B 1 48  ? 24.884  -3.832  30.883  1.00 38.62 ? 25  LEU B CG  1 
ATOM   2186 C CD1 . LEU B 1 48  ? 25.212  -4.043  32.341  1.00 38.36 ? 25  LEU B CD1 1 
ATOM   2187 C CD2 . LEU B 1 48  ? 26.071  -3.238  30.153  1.00 37.21 ? 25  LEU B CD2 1 
ATOM   2188 N N   . GLY B 1 49  ? 24.631  -4.052  27.364  1.00 42.51 ? 26  GLY B N   1 
ATOM   2189 C CA  . GLY B 1 49  ? 24.964  -2.971  26.462  1.00 45.47 ? 26  GLY B CA  1 
ATOM   2190 C C   . GLY B 1 49  ? 23.765  -2.291  25.832  1.00 47.01 ? 26  GLY B C   1 
ATOM   2191 O O   . GLY B 1 49  ? 23.678  -1.064  25.841  1.00 47.97 ? 26  GLY B O   1 
ATOM   2192 N N   . GLN B 1 50  ? 22.833  -3.084  25.304  1.00 48.56 ? 27  GLN B N   1 
ATOM   2193 C CA  . GLN B 1 50  ? 21.641  -2.552  24.634  1.00 48.33 ? 27  GLN B CA  1 
ATOM   2194 C C   . GLN B 1 50  ? 20.313  -2.681  25.386  1.00 46.05 ? 27  GLN B C   1 
ATOM   2195 O O   . GLN B 1 50  ? 19.379  -1.916  25.127  1.00 44.43 ? 27  GLN B O   1 
ATOM   2196 C CB  . GLN B 1 50  ? 21.480  -3.221  23.256  1.00 50.74 ? 27  GLN B CB  1 
ATOM   2197 C CG  . GLN B 1 50  ? 22.619  -2.959  22.273  1.00 54.31 ? 27  GLN B CG  1 
ATOM   2198 C CD  . GLN B 1 50  ? 22.573  -1.561  21.672  1.00 56.25 ? 27  GLN B CD  1 
ATOM   2199 O OE1 . GLN B 1 50  ? 21.798  -1.289  20.747  1.00 57.97 ? 27  GLN B OE1 1 
ATOM   2200 N NE2 . GLN B 1 50  ? 23.399  -0.663  22.202  1.00 56.83 ? 27  GLN B NE2 1 
ATOM   2201 N N   . HIS B 1 51  ? 20.223  -3.629  26.314  1.00 44.25 ? 28  HIS B N   1 
ATOM   2202 C CA  . HIS B 1 51  ? 18.967  -3.845  27.022  1.00 43.30 ? 28  HIS B CA  1 
ATOM   2203 C C   . HIS B 1 51  ? 18.943  -3.525  28.500  1.00 41.12 ? 28  HIS B C   1 
ATOM   2204 O O   . HIS B 1 51  ? 17.892  -3.616  29.133  1.00 40.19 ? 28  HIS B O   1 
ATOM   2205 C CB  . HIS B 1 51  ? 18.514  -5.283  26.809  1.00 44.89 ? 28  HIS B CB  1 
ATOM   2206 C CG  . HIS B 1 51  ? 18.590  -5.722  25.382  1.00 47.49 ? 28  HIS B CG  1 
ATOM   2207 N ND1 . HIS B 1 51  ? 17.849  -5.128  24.384  1.00 47.88 ? 28  HIS B ND1 1 
ATOM   2208 C CD2 . HIS B 1 51  ? 19.350  -6.665  24.778  1.00 48.76 ? 28  HIS B CD2 1 
ATOM   2209 C CE1 . HIS B 1 51  ? 18.151  -5.686  23.225  1.00 48.98 ? 28  HIS B CE1 1 
ATOM   2210 N NE2 . HIS B 1 51  ? 19.059  -6.621  23.436  1.00 49.85 ? 28  HIS B NE2 1 
ATOM   2211 N N   . ALA B 1 52  ? 20.092  -3.167  29.057  1.00 39.35 ? 29  ALA B N   1 
ATOM   2212 C CA  . ALA B 1 52  ? 20.136  -2.820  30.467  1.00 38.40 ? 29  ALA B CA  1 
ATOM   2213 C C   . ALA B 1 52  ? 19.239  -1.610  30.642  1.00 38.16 ? 29  ALA B C   1 
ATOM   2214 O O   . ALA B 1 52  ? 19.351  -0.634  29.898  1.00 40.59 ? 29  ALA B O   1 
ATOM   2215 C CB  . ALA B 1 52  ? 21.552  -2.473  30.892  1.00 37.31 ? 29  ALA B CB  1 
ATOM   2216 N N   . LEU B 1 53  ? 18.338  -1.671  31.612  1.00 35.27 ? 30  LEU B N   1 
ATOM   2217 C CA  . LEU B 1 53  ? 17.448  -0.553  31.856  1.00 33.09 ? 30  LEU B CA  1 
ATOM   2218 C C   . LEU B 1 53  ? 18.252  0.640   32.383  1.00 32.28 ? 30  LEU B C   1 
ATOM   2219 O O   . LEU B 1 53  ? 19.090  0.490   33.271  1.00 32.00 ? 30  LEU B O   1 
ATOM   2220 C CB  . LEU B 1 53  ? 16.369  -0.964  32.861  1.00 31.09 ? 30  LEU B CB  1 
ATOM   2221 C CG  . LEU B 1 53  ? 15.472  -2.127  32.418  1.00 31.09 ? 30  LEU B CG  1 
ATOM   2222 C CD1 . LEU B 1 53  ? 14.845  -2.794  33.624  1.00 28.42 ? 30  LEU B CD1 1 
ATOM   2223 C CD2 . LEU B 1 53  ? 14.409  -1.615  31.457  1.00 29.49 ? 30  LEU B CD2 1 
ATOM   2224 N N   . ARG B 1 54  ? 18.019  1.813   31.803  1.00 31.33 ? 31  ARG B N   1 
ATOM   2225 C CA  . ARG B 1 54  ? 18.694  3.030   32.228  1.00 30.65 ? 31  ARG B CA  1 
ATOM   2226 C C   . ARG B 1 54  ? 17.587  4.053   32.384  1.00 32.11 ? 31  ARG B C   1 
ATOM   2227 O O   . ARG B 1 54  ? 16.648  4.073   31.594  1.00 32.34 ? 31  ARG B O   1 
ATOM   2228 C CB  . ARG B 1 54  ? 19.743  3.466   31.193  1.00 29.75 ? 31  ARG B CB  1 
ATOM   2229 C CG  . ARG B 1 54  ? 19.220  3.762   29.800  1.00 28.45 ? 31  ARG B CG  1 
ATOM   2230 C CD  . ARG B 1 54  ? 20.250  3.383   28.737  1.00 30.34 ? 31  ARG B CD  1 
ATOM   2231 N NE  . ARG B 1 54  ? 20.407  1.932   28.619  1.00 31.23 ? 31  ARG B NE  1 
ATOM   2232 C CZ  . ARG B 1 54  ? 21.236  1.319   27.773  1.00 31.68 ? 31  ARG B CZ  1 
ATOM   2233 N NH1 . ARG B 1 54  ? 22.011  2.025   26.948  1.00 29.53 ? 31  ARG B NH1 1 
ATOM   2234 N NH2 . ARG B 1 54  ? 21.282  -0.008  27.747  1.00 24.88 ? 31  ARG B NH2 1 
ATOM   2235 N N   . SER B 1 55  ? 17.680  4.883   33.417  1.00 35.00 ? 32  SER B N   1 
ATOM   2236 C CA  . SER B 1 55  ? 16.648  5.889   33.698  1.00 37.33 ? 32  SER B CA  1 
ATOM   2237 C C   . SER B 1 55  ? 16.601  7.110   32.764  1.00 38.75 ? 32  SER B C   1 
ATOM   2238 O O   . SER B 1 55  ? 15.616  7.851   32.760  1.00 37.18 ? 32  SER B O   1 
ATOM   2239 C CB  . SER B 1 55  ? 16.772  6.363   35.152  1.00 37.09 ? 32  SER B CB  1 
ATOM   2240 O OG  . SER B 1 55  ? 18.063  6.892   35.415  1.00 38.66 ? 32  SER B OG  1 
ATOM   2241 N N   . ALA B 1 56  ? 17.650  7.311   31.971  1.00 41.55 ? 33  ALA B N   1 
ATOM   2242 C CA  . ALA B 1 56  ? 17.704  8.445   31.057  1.00 44.40 ? 33  ALA B CA  1 
ATOM   2243 C C   . ALA B 1 56  ? 18.452  8.113   29.768  1.00 46.49 ? 33  ALA B C   1 
ATOM   2244 O O   . ALA B 1 56  ? 19.248  7.172   29.726  1.00 47.24 ? 33  ALA B O   1 
ATOM   2245 C CB  . ALA B 1 56  ? 18.357  9.629   31.750  1.00 44.40 ? 33  ALA B CB  1 
ATOM   2246 N N   . LYS B 1 57  ? 18.186  8.903   28.727  1.00 48.87 ? 34  LYS B N   1 
ATOM   2247 C CA  . LYS B 1 57  ? 18.789  8.738   27.401  1.00 50.76 ? 34  LYS B CA  1 
ATOM   2248 C C   . LYS B 1 57  ? 20.271  9.137   27.341  1.00 50.97 ? 34  LYS B C   1 
ATOM   2249 O O   . LYS B 1 57  ? 20.641  10.116  26.691  1.00 49.79 ? 34  LYS B O   1 
ATOM   2250 C CB  . LYS B 1 57  ? 17.984  9.540   26.378  1.00 50.92 ? 34  LYS B CB  1 
ATOM   2251 N N   . GLY B 1 58  ? 21.111  8.345   28.001  1.00 52.33 ? 35  GLY B N   1 
ATOM   2252 C CA  . GLY B 1 58  ? 22.538  8.616   28.052  1.00 52.17 ? 35  GLY B CA  1 
ATOM   2253 C C   . GLY B 1 58  ? 23.327  8.337   26.795  1.00 51.95 ? 35  GLY B C   1 
ATOM   2254 O O   . GLY B 1 58  ? 22.822  8.477   25.688  1.00 52.25 ? 35  GLY B O   1 
ATOM   2255 N N   . GLU B 1 59  ? 24.579  7.936   26.968  1.00 52.85 ? 36  GLU B N   1 
ATOM   2256 C CA  . GLU B 1 59  ? 25.431  7.660   25.826  1.00 54.15 ? 36  GLU B CA  1 
ATOM   2257 C C   . GLU B 1 59  ? 25.471  6.196   25.436  1.00 54.59 ? 36  GLU B C   1 
ATOM   2258 O O   . GLU B 1 59  ? 24.668  5.386   25.893  1.00 54.45 ? 36  GLU B O   1 
ATOM   2259 C CB  . GLU B 1 59  ? 26.855  8.123   26.106  1.00 55.66 ? 36  GLU B CB  1 
ATOM   2260 C CG  . GLU B 1 59  ? 26.996  9.584   26.436  1.00 56.55 ? 36  GLU B CG  1 
ATOM   2261 C CD  . GLU B 1 59  ? 28.417  10.071  26.224  1.00 59.03 ? 36  GLU B CD  1 
ATOM   2262 O OE1 . GLU B 1 59  ? 29.351  9.467   26.794  1.00 60.46 ? 36  GLU B OE1 1 
ATOM   2263 O OE2 . GLU B 1 59  ? 28.603  11.058  25.483  1.00 59.69 ? 36  GLU B OE2 1 
ATOM   2264 N N   . GLU B 1 60  ? 26.425  5.876   24.570  1.00 55.67 ? 37  GLU B N   1 
ATOM   2265 C CA  . GLU B 1 60  ? 26.629  4.519   24.098  1.00 56.36 ? 37  GLU B CA  1 
ATOM   2266 C C   . GLU B 1 60  ? 27.490  3.795   25.112  1.00 56.21 ? 37  GLU B C   1 
ATOM   2267 O O   . GLU B 1 60  ? 28.586  4.244   25.437  1.00 56.29 ? 37  GLU B O   1 
ATOM   2268 C CB  . GLU B 1 60  ? 27.335  4.530   22.740  1.00 58.01 ? 37  GLU B CB  1 
ATOM   2269 C CG  . GLU B 1 60  ? 27.820  3.159   22.264  1.00 59.25 ? 37  GLU B CG  1 
ATOM   2270 C CD  . GLU B 1 60  ? 28.342  3.182   20.835  1.00 59.63 ? 37  GLU B CD  1 
ATOM   2271 O OE1 . GLU B 1 60  ? 29.239  3.998   20.538  1.00 58.87 ? 37  GLU B OE1 1 
ATOM   2272 O OE2 . GLU B 1 60  ? 27.856  2.381   20.009  1.00 59.77 ? 37  GLU B OE2 1 
ATOM   2273 N N   . VAL B 1 61  ? 26.985  2.670   25.603  1.00 56.28 ? 38  VAL B N   1 
ATOM   2274 C CA  . VAL B 1 61  ? 27.687  1.866   26.593  1.00 56.47 ? 38  VAL B CA  1 
ATOM   2275 C C   . VAL B 1 61  ? 28.738  0.932   25.993  1.00 56.41 ? 38  VAL B C   1 
ATOM   2276 O O   . VAL B 1 61  ? 28.405  -0.131  25.475  1.00 56.56 ? 38  VAL B O   1 
ATOM   2277 C CB  . VAL B 1 61  ? 26.684  1.019   27.398  1.00 56.47 ? 38  VAL B CB  1 
ATOM   2278 C CG1 . VAL B 1 61  ? 27.418  0.103   28.350  1.00 55.31 ? 38  VAL B CG1 1 
ATOM   2279 C CG2 . VAL B 1 61  ? 25.733  1.932   28.146  1.00 56.28 ? 38  VAL B CG2 1 
ATOM   2280 N N   . ASP B 1 62  ? 30.005  1.335   26.061  1.00 56.17 ? 39  ASP B N   1 
ATOM   2281 C CA  . ASP B 1 62  ? 31.095  0.511   25.548  1.00 55.24 ? 39  ASP B CA  1 
ATOM   2282 C C   . ASP B 1 62  ? 31.159  -0.733  26.426  1.00 53.59 ? 39  ASP B C   1 
ATOM   2283 O O   . ASP B 1 62  ? 31.801  -0.710  27.472  1.00 52.63 ? 39  ASP B O   1 
ATOM   2284 C CB  . ASP B 1 62  ? 32.430  1.259   25.653  1.00 57.50 ? 39  ASP B CB  1 
ATOM   2285 C CG  . ASP B 1 62  ? 33.627  0.393   25.244  1.00 60.28 ? 39  ASP B CG  1 
ATOM   2286 O OD1 . ASP B 1 62  ? 33.565  -0.838  25.449  1.00 60.68 ? 39  ASP B OD1 1 
ATOM   2287 O OD2 . ASP B 1 62  ? 34.637  0.938   24.731  1.00 60.93 ? 39  ASP B OD2 1 
ATOM   2288 N N   . VAL B 1 63  ? 30.508  -1.816  26.008  1.00 51.18 ? 40  VAL B N   1 
ATOM   2289 C CA  . VAL B 1 63  ? 30.505  -3.040  26.801  1.00 48.14 ? 40  VAL B CA  1 
ATOM   2290 C C   . VAL B 1 63  ? 31.904  -3.534  27.140  1.00 46.46 ? 40  VAL B C   1 
ATOM   2291 O O   . VAL B 1 63  ? 32.090  -4.225  28.131  1.00 47.07 ? 40  VAL B O   1 
ATOM   2292 C CB  . VAL B 1 63  ? 29.750  -4.161  26.091  1.00 47.76 ? 40  VAL B CB  1 
ATOM   2293 C CG1 . VAL B 1 63  ? 29.757  -5.418  26.948  1.00 48.61 ? 40  VAL B CG1 1 
ATOM   2294 C CG2 . VAL B 1 63  ? 28.332  -3.724  25.819  1.00 47.70 ? 40  VAL B CG2 1 
ATOM   2295 N N   . ALA B 1 64  ? 32.885  -3.172  26.323  1.00 45.23 ? 41  ALA B N   1 
ATOM   2296 C CA  . ALA B 1 64  ? 34.266  -3.591  26.548  1.00 43.86 ? 41  ALA B CA  1 
ATOM   2297 C C   . ALA B 1 64  ? 34.890  -2.863  27.732  1.00 44.32 ? 41  ALA B C   1 
ATOM   2298 O O   . ALA B 1 64  ? 35.586  -3.476  28.549  1.00 43.01 ? 41  ALA B O   1 
ATOM   2299 C CB  . ALA B 1 64  ? 35.094  -3.340  25.302  1.00 43.61 ? 41  ALA B CB  1 
ATOM   2300 N N   . ARG B 1 65  ? 34.655  -1.548  27.796  1.00 44.43 ? 42  ARG B N   1 
ATOM   2301 C CA  . ARG B 1 65  ? 35.166  -0.706  28.877  1.00 44.06 ? 42  ARG B CA  1 
ATOM   2302 C C   . ARG B 1 65  ? 34.406  -1.023  30.167  1.00 44.90 ? 42  ARG B C   1 
ATOM   2303 O O   . ARG B 1 65  ? 35.017  -1.176  31.227  1.00 45.19 ? 42  ARG B O   1 
ATOM   2304 C CB  . ARG B 1 65  ? 35.005  0.765   28.523  1.00 43.02 ? 42  ARG B CB  1 
ATOM   2305 N N   . ALA B 1 66  ? 33.079  -1.122  30.068  1.00 43.95 ? 43  ALA B N   1 
ATOM   2306 C CA  . ALA B 1 66  ? 32.236  -1.449  31.221  1.00 44.07 ? 43  ALA B CA  1 
ATOM   2307 C C   . ALA B 1 66  ? 32.684  -2.806  31.749  1.00 43.70 ? 43  ALA B C   1 
ATOM   2308 O O   . ALA B 1 66  ? 32.605  -3.076  32.953  1.00 43.85 ? 43  ALA B O   1 
ATOM   2309 C CB  . ALA B 1 66  ? 30.769  -1.503  30.815  1.00 43.26 ? 43  ALA B CB  1 
ATOM   2310 N N   . GLU B 1 67  ? 33.147  -3.647  30.824  1.00 41.94 ? 44  GLU B N   1 
ATOM   2311 C CA  . GLU B 1 67  ? 33.659  -4.976  31.129  1.00 40.38 ? 44  GLU B CA  1 
ATOM   2312 C C   . GLU B 1 67  ? 34.992  -4.772  31.829  1.00 37.90 ? 44  GLU B C   1 
ATOM   2313 O O   . GLU B 1 67  ? 35.190  -5.210  32.955  1.00 38.39 ? 44  GLU B O   1 
ATOM   2314 C CB  . GLU B 1 67  ? 33.862  -5.757  29.827  1.00 43.08 ? 44  GLU B CB  1 
ATOM   2315 C CG  . GLU B 1 67  ? 34.703  -7.007  29.956  1.00 45.47 ? 44  GLU B CG  1 
ATOM   2316 C CD  . GLU B 1 67  ? 34.092  -8.015  30.901  1.00 47.29 ? 44  GLU B CD  1 
ATOM   2317 O OE1 . GLU B 1 67  ? 32.980  -8.510  30.609  1.00 48.87 ? 44  GLU B OE1 1 
ATOM   2318 O OE2 . GLU B 1 67  ? 34.725  -8.309  31.936  1.00 47.89 ? 44  GLU B OE2 1 
ATOM   2319 N N   . ARG B 1 68  ? 35.900  -4.081  31.154  1.00 37.60 ? 45  ARG B N   1 
ATOM   2320 C CA  . ARG B 1 68  ? 37.219  -3.800  31.699  1.00 37.75 ? 45  ARG B CA  1 
ATOM   2321 C C   . ARG B 1 68  ? 37.120  -3.211  33.103  1.00 36.65 ? 45  ARG B C   1 
ATOM   2322 O O   . ARG B 1 68  ? 37.968  -3.486  33.950  1.00 37.37 ? 45  ARG B O   1 
ATOM   2323 C CB  . ARG B 1 68  ? 37.975  -2.818  30.794  1.00 39.41 ? 45  ARG B CB  1 
ATOM   2324 C CG  . ARG B 1 68  ? 39.463  -2.692  31.121  1.00 39.99 ? 45  ARG B CG  1 
ATOM   2325 C CD  . ARG B 1 68  ? 40.202  -3.965  30.738  1.00 38.74 ? 45  ARG B CD  1 
ATOM   2326 N NE  . ARG B 1 68  ? 41.489  -4.094  31.410  1.00 40.07 ? 45  ARG B NE  1 
ATOM   2327 C CZ  . ARG B 1 68  ? 41.640  -4.336  32.710  1.00 41.94 ? 45  ARG B CZ  1 
ATOM   2328 N NH1 . ARG B 1 68  ? 40.582  -4.480  33.498  1.00 43.11 ? 45  ARG B NH1 1 
ATOM   2329 N NH2 . ARG B 1 68  ? 42.853  -4.428  33.230  1.00 41.42 ? 45  ARG B NH2 1 
ATOM   2330 N N   . GLN B 1 69  ? 36.083  -2.413  33.346  1.00 34.93 ? 46  GLN B N   1 
ATOM   2331 C CA  . GLN B 1 69  ? 35.884  -1.776  34.650  1.00 34.90 ? 46  GLN B CA  1 
ATOM   2332 C C   . GLN B 1 69  ? 35.341  -2.699  35.740  1.00 35.27 ? 46  GLN B C   1 
ATOM   2333 O O   . GLN B 1 69  ? 35.724  -2.577  36.900  1.00 35.36 ? 46  GLN B O   1 
ATOM   2334 C CB  . GLN B 1 69  ? 34.940  -0.580  34.536  1.00 32.94 ? 46  GLN B CB  1 
ATOM   2335 C CG  . GLN B 1 69  ? 35.424  0.549   33.669  1.00 32.42 ? 46  GLN B CG  1 
ATOM   2336 C CD  . GLN B 1 69  ? 34.478  1.732   33.700  1.00 33.64 ? 46  GLN B CD  1 
ATOM   2337 O OE1 . GLN B 1 69  ? 33.256  1.571   33.779  1.00 33.73 ? 46  GLN B OE1 1 
ATOM   2338 N NE2 . GLN B 1 69  ? 35.036  2.930   33.629  1.00 33.89 ? 46  GLN B NE2 1 
ATOM   2339 N N   . HIS B 1 70  ? 34.429  -3.596  35.382  1.00 35.14 ? 47  HIS B N   1 
ATOM   2340 C CA  . HIS B 1 70  ? 33.874  -4.508  36.375  1.00 35.35 ? 47  HIS B CA  1 
ATOM   2341 C C   . HIS B 1 70  ? 34.975  -5.444  36.835  1.00 34.74 ? 47  HIS B C   1 
ATOM   2342 O O   . HIS B 1 70  ? 35.001  -5.869  37.986  1.00 33.79 ? 47  HIS B O   1 
ATOM   2343 C CB  . HIS B 1 70  ? 32.708  -5.314  35.793  1.00 36.35 ? 47  HIS B CB  1 
ATOM   2344 C CG  . HIS B 1 70  ? 32.053  -6.237  36.779  1.00 38.61 ? 47  HIS B CG  1 
ATOM   2345 N ND1 . HIS B 1 70  ? 32.599  -7.450  37.145  1.00 39.53 ? 47  HIS B ND1 1 
ATOM   2346 C CD2 . HIS B 1 70  ? 30.887  -6.131  37.461  1.00 38.82 ? 47  HIS B CD2 1 
ATOM   2347 C CE1 . HIS B 1 70  ? 31.796  -8.051  38.006  1.00 38.87 ? 47  HIS B CE1 1 
ATOM   2348 N NE2 . HIS B 1 70  ? 30.750  -7.272  38.216  1.00 39.57 ? 47  HIS B NE2 1 
ATOM   2349 N N   . GLN B 1 71  ? 35.892  -5.758  35.926  1.00 33.91 ? 48  GLN B N   1 
ATOM   2350 C CA  . GLN B 1 71  ? 36.994  -6.633  36.265  1.00 31.46 ? 48  GLN B CA  1 
ATOM   2351 C C   . GLN B 1 71  ? 37.908  -5.952  37.268  1.00 29.38 ? 48  GLN B C   1 
ATOM   2352 O O   . GLN B 1 71  ? 38.457  -6.611  38.145  1.00 31.28 ? 48  GLN B O   1 
ATOM   2353 C CB  . GLN B 1 71  ? 37.766  -7.019  35.011  1.00 33.35 ? 48  GLN B CB  1 
ATOM   2354 C CG  . GLN B 1 71  ? 36.967  -7.907  34.097  1.00 36.72 ? 48  GLN B CG  1 
ATOM   2355 C CD  . GLN B 1 71  ? 37.789  -8.423  32.952  1.00 38.03 ? 48  GLN B CD  1 
ATOM   2356 O OE1 . GLN B 1 71  ? 38.422  -7.648  32.239  1.00 40.43 ? 48  GLN B OE1 1 
ATOM   2357 N NE2 . GLN B 1 71  ? 37.791  -9.741  32.766  1.00 37.75 ? 48  GLN B NE2 1 
ATOM   2358 N N   . LEU B 1 72  ? 38.071  -4.638  37.152  1.00 26.94 ? 49  LEU B N   1 
ATOM   2359 C CA  . LEU B 1 72  ? 38.918  -3.915  38.095  1.00 27.11 ? 49  LEU B CA  1 
ATOM   2360 C C   . LEU B 1 72  ? 38.245  -3.897  39.476  1.00 26.32 ? 49  LEU B C   1 
ATOM   2361 O O   . LEU B 1 72  ? 38.906  -4.053  40.502  1.00 26.72 ? 49  LEU B O   1 
ATOM   2362 C CB  . LEU B 1 72  ? 39.189  -2.489  37.588  1.00 27.44 ? 49  LEU B CB  1 
ATOM   2363 C CG  . LEU B 1 72  ? 40.143  -2.386  36.387  1.00 27.50 ? 49  LEU B CG  1 
ATOM   2364 C CD1 . LEU B 1 72  ? 40.128  -0.983  35.815  1.00 25.01 ? 49  LEU B CD1 1 
ATOM   2365 C CD2 . LEU B 1 72  ? 41.553  -2.779  36.811  1.00 26.95 ? 49  LEU B CD2 1 
ATOM   2366 N N   . TYR B 1 73  ? 36.923  -3.725  39.490  1.00 26.80 ? 50  TYR B N   1 
ATOM   2367 C CA  . TYR B 1 73  ? 36.132  -3.713  40.725  1.00 25.33 ? 50  TYR B CA  1 
ATOM   2368 C C   . TYR B 1 73  ? 36.396  -5.032  41.458  1.00 24.52 ? 50  TYR B C   1 
ATOM   2369 O O   . TYR B 1 73  ? 36.914  -5.041  42.573  1.00 25.17 ? 50  TYR B O   1 
ATOM   2370 C CB  . TYR B 1 73  ? 34.646  -3.577  40.357  1.00 25.60 ? 50  TYR B CB  1 
ATOM   2371 C CG  . TYR B 1 73  ? 33.631  -3.457  41.490  1.00 22.68 ? 50  TYR B CG  1 
ATOM   2372 C CD1 . TYR B 1 73  ? 33.298  -2.212  42.032  1.00 21.48 ? 50  TYR B CD1 1 
ATOM   2373 C CD2 . TYR B 1 73  ? 32.902  -4.576  41.917  1.00 19.09 ? 50  TYR B CD2 1 
ATOM   2374 C CE1 . TYR B 1 73  ? 32.243  -2.084  42.957  1.00 21.33 ? 50  TYR B CE1 1 
ATOM   2375 C CE2 . TYR B 1 73  ? 31.858  -4.460  42.836  1.00 17.91 ? 50  TYR B CE2 1 
ATOM   2376 C CZ  . TYR B 1 73  ? 31.524  -3.217  43.349  1.00 19.81 ? 50  TYR B CZ  1 
ATOM   2377 O OH  . TYR B 1 73  ? 30.447  -3.099  44.208  1.00 20.42 ? 50  TYR B OH  1 
ATOM   2378 N N   . VAL B 1 74  ? 36.061  -6.146  40.816  1.00 23.92 ? 51  VAL B N   1 
ATOM   2379 C CA  . VAL B 1 74  ? 36.284  -7.458  41.409  1.00 25.98 ? 51  VAL B CA  1 
ATOM   2380 C C   . VAL B 1 74  ? 37.734  -7.613  41.820  1.00 27.29 ? 51  VAL B C   1 
ATOM   2381 O O   . VAL B 1 74  ? 38.044  -8.241  42.839  1.00 29.25 ? 51  VAL B O   1 
ATOM   2382 C CB  . VAL B 1 74  ? 35.959  -8.592  40.427  1.00 25.77 ? 51  VAL B CB  1 
ATOM   2383 C CG1 . VAL B 1 74  ? 36.330  -9.926  41.050  1.00 22.10 ? 51  VAL B CG1 1 
ATOM   2384 C CG2 . VAL B 1 74  ? 34.489  -8.558  40.073  1.00 23.51 ? 51  VAL B CG2 1 
ATOM   2385 N N   . GLY B 1 75  ? 38.619  -7.040  41.010  1.00 28.80 ? 52  GLY B N   1 
ATOM   2386 C CA  . GLY B 1 75  ? 40.039  -7.101  41.297  1.00 29.06 ? 52  GLY B CA  1 
ATOM   2387 C C   . GLY B 1 75  ? 40.332  -6.493  42.651  1.00 28.78 ? 52  GLY B C   1 
ATOM   2388 O O   . GLY B 1 75  ? 40.952  -7.136  43.504  1.00 30.27 ? 52  GLY B O   1 
ATOM   2389 N N   . VAL B 1 76  ? 39.866  -5.261  42.853  1.00 28.09 ? 53  VAL B N   1 
ATOM   2390 C CA  . VAL B 1 76  ? 40.082  -4.548  44.114  1.00 26.93 ? 53  VAL B CA  1 
ATOM   2391 C C   . VAL B 1 76  ? 39.498  -5.286  45.310  1.00 26.52 ? 53  VAL B C   1 
ATOM   2392 O O   . VAL B 1 76  ? 40.070  -5.270  46.397  1.00 24.65 ? 53  VAL B O   1 
ATOM   2393 C CB  . VAL B 1 76  ? 39.465  -3.126  44.061  1.00 26.60 ? 53  VAL B CB  1 
ATOM   2394 C CG1 . VAL B 1 76  ? 39.434  -2.500  45.456  1.00 24.38 ? 53  VAL B CG1 1 
ATOM   2395 C CG2 . VAL B 1 76  ? 40.279  -2.251  43.110  1.00 23.19 ? 53  VAL B CG2 1 
ATOM   2396 N N   . LEU B 1 77  ? 38.363  -5.938  45.095  1.00 27.77 ? 54  LEU B N   1 
ATOM   2397 C CA  . LEU B 1 77  ? 37.684  -6.658  46.155  1.00 29.82 ? 54  LEU B CA  1 
ATOM   2398 C C   . LEU B 1 77  ? 38.328  -7.954  46.593  1.00 30.98 ? 54  LEU B C   1 
ATOM   2399 O O   . LEU B 1 77  ? 38.580  -8.159  47.774  1.00 31.33 ? 54  LEU B O   1 
ATOM   2400 C CB  . LEU B 1 77  ? 36.250  -6.970  45.749  1.00 29.40 ? 54  LEU B CB  1 
ATOM   2401 C CG  . LEU B 1 77  ? 35.345  -5.794  45.431  1.00 30.04 ? 54  LEU B CG  1 
ATOM   2402 C CD1 . LEU B 1 77  ? 33.961  -6.325  45.150  1.00 30.23 ? 54  LEU B CD1 1 
ATOM   2403 C CD2 . LEU B 1 77  ? 35.318  -4.827  46.593  1.00 30.36 ? 54  LEU B CD2 1 
ATOM   2404 N N   . GLY B 1 78  ? 38.574  -8.846  45.649  1.00 32.10 ? 55  GLY B N   1 
ATOM   2405 C CA  . GLY B 1 78  ? 39.134  -10.122 46.034  1.00 35.89 ? 55  GLY B CA  1 
ATOM   2406 C C   . GLY B 1 78  ? 40.641  -10.212 46.031  1.00 38.23 ? 55  GLY B C   1 
ATOM   2407 O O   . GLY B 1 78  ? 41.253  -10.761 46.951  1.00 39.42 ? 55  GLY B O   1 
ATOM   2408 N N   . SER B 1 79  ? 41.247  -9.656  45.001  1.00 37.94 ? 56  SER B N   1 
ATOM   2409 C CA  . SER B 1 79  ? 42.679  -9.728  44.871  1.00 40.42 ? 56  SER B CA  1 
ATOM   2410 C C   . SER B 1 79  ? 43.448  -8.665  45.649  1.00 41.86 ? 56  SER B C   1 
ATOM   2411 O O   . SER B 1 79  ? 44.420  -8.980  46.342  1.00 42.76 ? 56  SER B O   1 
ATOM   2412 C CB  . SER B 1 79  ? 42.996  -9.682  43.393  1.00 41.19 ? 56  SER B CB  1 
ATOM   2413 O OG  . SER B 1 79  ? 42.035  -10.491 42.721  1.00 44.00 ? 56  SER B OG  1 
ATOM   2414 N N   . LYS B 1 80  ? 43.006  -7.416  45.545  1.00 42.66 ? 57  LYS B N   1 
ATOM   2415 C CA  . LYS B 1 80  ? 43.653  -6.308  46.240  1.00 42.25 ? 57  LYS B CA  1 
ATOM   2416 C C   . LYS B 1 80  ? 43.338  -6.312  47.726  1.00 41.73 ? 57  LYS B C   1 
ATOM   2417 O O   . LYS B 1 80  ? 44.231  -6.124  48.545  1.00 42.43 ? 57  LYS B O   1 
ATOM   2418 C CB  . LYS B 1 80  ? 43.223  -4.971  45.622  1.00 42.86 ? 57  LYS B CB  1 
ATOM   2419 N N   . LEU B 1 81  ? 42.071  -6.534  48.067  1.00 41.96 ? 58  LEU B N   1 
ATOM   2420 C CA  . LEU B 1 81  ? 41.627  -6.544  49.463  1.00 41.92 ? 58  LEU B CA  1 
ATOM   2421 C C   . LEU B 1 81  ? 41.596  -7.910  50.132  1.00 41.51 ? 58  LEU B C   1 
ATOM   2422 O O   . LEU B 1 81  ? 41.536  -8.003  51.358  1.00 41.65 ? 58  LEU B O   1 
ATOM   2423 C CB  . LEU B 1 81  ? 40.244  -5.905  49.590  1.00 41.16 ? 58  LEU B CB  1 
ATOM   2424 C CG  . LEU B 1 81  ? 40.198  -4.407  49.317  1.00 43.25 ? 58  LEU B CG  1 
ATOM   2425 C CD1 . LEU B 1 81  ? 38.809  -3.881  49.636  1.00 42.86 ? 58  LEU B CD1 1 
ATOM   2426 C CD2 . LEU B 1 81  ? 41.251  -3.697  50.167  1.00 42.31 ? 58  LEU B CD2 1 
ATOM   2427 N N   . GLY B 1 82  ? 41.606  -8.967  49.334  1.00 42.05 ? 59  GLY B N   1 
ATOM   2428 C CA  . GLY B 1 82  ? 41.606  -10.297 49.909  1.00 42.91 ? 59  GLY B CA  1 
ATOM   2429 C C   . GLY B 1 82  ? 40.268  -10.921 50.243  1.00 42.54 ? 59  GLY B C   1 
ATOM   2430 O O   . GLY B 1 82  ? 40.228  -11.986 50.854  1.00 44.50 ? 59  GLY B O   1 
ATOM   2431 N N   . LEU B 1 83  ? 39.169  -10.280 49.873  1.00 42.24 ? 60  LEU B N   1 
ATOM   2432 C CA  . LEU B 1 83  ? 37.874  -10.877 50.161  1.00 42.83 ? 60  LEU B CA  1 
ATOM   2433 C C   . LEU B 1 83  ? 37.740  -12.144 49.335  1.00 43.74 ? 60  LEU B C   1 
ATOM   2434 O O   . LEU B 1 83  ? 38.398  -12.307 48.305  1.00 44.02 ? 60  LEU B O   1 
ATOM   2435 C CB  . LEU B 1 83  ? 36.723  -9.946  49.773  1.00 41.60 ? 60  LEU B CB  1 
ATOM   2436 C CG  . LEU B 1 83  ? 36.397  -8.728  50.630  1.00 41.77 ? 60  LEU B CG  1 
ATOM   2437 C CD1 . LEU B 1 83  ? 35.140  -8.057  50.082  1.00 40.96 ? 60  LEU B CD1 1 
ATOM   2438 C CD2 . LEU B 1 83  ? 36.184  -9.150  52.067  1.00 41.10 ? 60  LEU B CD2 1 
ATOM   2439 N N   . GLN B 1 84  ? 36.900  -13.055 49.796  1.00 44.60 ? 61  GLN B N   1 
ATOM   2440 C CA  . GLN B 1 84  ? 36.659  -14.252 49.026  1.00 45.63 ? 61  GLN B CA  1 
ATOM   2441 C C   . GLN B 1 84  ? 35.569  -13.809 48.062  1.00 45.58 ? 61  GLN B C   1 
ATOM   2442 O O   . GLN B 1 84  ? 34.477  -13.414 48.480  1.00 45.05 ? 61  GLN B O   1 
ATOM   2443 C CB  . GLN B 1 84  ? 36.193  -15.392 49.927  1.00 46.56 ? 61  GLN B CB  1 
ATOM   2444 C CG  . GLN B 1 84  ? 37.318  -15.956 50.765  1.00 50.01 ? 61  GLN B CG  1 
ATOM   2445 C CD  . GLN B 1 84  ? 38.555  -16.252 49.928  1.00 52.46 ? 61  GLN B CD  1 
ATOM   2446 O OE1 . GLN B 1 84  ? 39.182  -15.343 49.376  1.00 53.10 ? 61  GLN B OE1 1 
ATOM   2447 N NE2 . GLN B 1 84  ? 38.908  -17.530 49.824  1.00 54.34 ? 61  GLN B NE2 1 
ATOM   2448 N N   . VAL B 1 85  ? 35.885  -13.841 46.773  1.00 45.00 ? 62  VAL B N   1 
ATOM   2449 C CA  . VAL B 1 85  ? 34.947  -13.402 45.752  1.00 45.16 ? 62  VAL B CA  1 
ATOM   2450 C C   . VAL B 1 85  ? 34.213  -14.512 45.011  1.00 45.32 ? 62  VAL B C   1 
ATOM   2451 O O   . VAL B 1 85  ? 34.832  -15.393 44.423  1.00 45.89 ? 62  VAL B O   1 
ATOM   2452 C CB  . VAL B 1 85  ? 35.659  -12.505 44.722  1.00 44.32 ? 62  VAL B CB  1 
ATOM   2453 C CG1 . VAL B 1 85  ? 34.728  -12.212 43.551  1.00 45.45 ? 62  VAL B CG1 1 
ATOM   2454 C CG2 . VAL B 1 85  ? 36.093  -11.207 45.385  1.00 43.49 ? 62  VAL B CG2 1 
ATOM   2455 N N   . VAL B 1 86  ? 32.884  -14.453 45.041  1.00 45.72 ? 63  VAL B N   1 
ATOM   2456 C CA  . VAL B 1 86  ? 32.047  -15.438 44.361  1.00 46.16 ? 63  VAL B CA  1 
ATOM   2457 C C   . VAL B 1 86  ? 31.525  -14.880 43.032  1.00 46.50 ? 63  VAL B C   1 
ATOM   2458 O O   . VAL B 1 86  ? 30.666  -13.999 42.999  1.00 46.85 ? 63  VAL B O   1 
ATOM   2459 C CB  . VAL B 1 86  ? 30.861  -15.862 45.250  1.00 45.57 ? 63  VAL B CB  1 
ATOM   2460 C CG1 . VAL B 1 86  ? 29.987  -16.860 44.512  1.00 44.69 ? 63  VAL B CG1 1 
ATOM   2461 C CG2 . VAL B 1 86  ? 31.381  -16.471 46.541  1.00 44.14 ? 63  VAL B CG2 1 
ATOM   2462 N N   . GLU B 1 87  ? 32.058  -15.415 41.941  1.00 47.51 ? 64  GLU B N   1 
ATOM   2463 C CA  . GLU B 1 87  ? 31.711  -14.993 40.589  1.00 49.12 ? 64  GLU B CA  1 
ATOM   2464 C C   . GLU B 1 87  ? 30.497  -15.682 39.972  1.00 47.87 ? 64  GLU B C   1 
ATOM   2465 O O   . GLU B 1 87  ? 30.638  -16.699 39.286  1.00 47.77 ? 64  GLU B O   1 
ATOM   2466 C CB  . GLU B 1 87  ? 32.916  -15.210 39.668  1.00 52.03 ? 64  GLU B CB  1 
ATOM   2467 C CG  . GLU B 1 87  ? 34.052  -14.215 39.857  1.00 56.16 ? 64  GLU B CG  1 
ATOM   2468 C CD  . GLU B 1 87  ? 33.702  -12.836 39.321  1.00 58.67 ? 64  GLU B CD  1 
ATOM   2469 O OE1 . GLU B 1 87  ? 32.710  -12.250 39.804  1.00 59.04 ? 64  GLU B OE1 1 
ATOM   2470 O OE2 . GLU B 1 87  ? 34.413  -12.341 38.417  1.00 58.83 ? 64  GLU B OE2 1 
ATOM   2471 N N   . LEU B 1 88  ? 29.310  -15.130 40.195  1.00 45.50 ? 65  LEU B N   1 
ATOM   2472 C CA  . LEU B 1 88  ? 28.123  -15.722 39.608  1.00 44.20 ? 65  LEU B CA  1 
ATOM   2473 C C   . LEU B 1 88  ? 28.205  -15.543 38.101  1.00 44.07 ? 65  LEU B C   1 
ATOM   2474 O O   . LEU B 1 88  ? 28.806  -14.595 37.616  1.00 42.30 ? 65  LEU B O   1 
ATOM   2475 C CB  . LEU B 1 88  ? 26.856  -15.053 40.136  1.00 43.11 ? 65  LEU B CB  1 
ATOM   2476 C CG  . LEU B 1 88  ? 26.521  -15.324 41.594  1.00 42.55 ? 65  LEU B CG  1 
ATOM   2477 C CD1 . LEU B 1 88  ? 25.060  -14.997 41.837  1.00 41.63 ? 65  LEU B CD1 1 
ATOM   2478 C CD2 . LEU B 1 88  ? 26.782  -16.781 41.905  1.00 43.54 ? 65  LEU B CD2 1 
ATOM   2479 N N   . PRO B 1 89  ? 27.618  -16.470 37.341  1.00 44.89 ? 66  PRO B N   1 
ATOM   2480 C CA  . PRO B 1 89  ? 27.640  -16.388 35.880  1.00 45.73 ? 66  PRO B CA  1 
ATOM   2481 C C   . PRO B 1 89  ? 26.598  -15.448 35.289  1.00 46.74 ? 66  PRO B C   1 
ATOM   2482 O O   . PRO B 1 89  ? 25.437  -15.454 35.699  1.00 46.29 ? 66  PRO B O   1 
ATOM   2483 C CB  . PRO B 1 89  ? 27.418  -17.833 35.460  1.00 45.23 ? 66  PRO B CB  1 
ATOM   2484 C CG  . PRO B 1 89  ? 26.530  -18.349 36.536  1.00 45.79 ? 66  PRO B CG  1 
ATOM   2485 C CD  . PRO B 1 89  ? 27.183  -17.807 37.779  1.00 46.11 ? 66  PRO B CD  1 
ATOM   2486 N N   . ALA B 1 90  ? 27.026  -14.643 34.319  1.00 49.07 ? 67  ALA B N   1 
ATOM   2487 C CA  . ALA B 1 90  ? 26.144  -13.695 33.646  1.00 50.54 ? 67  ALA B CA  1 
ATOM   2488 C C   . ALA B 1 90  ? 25.020  -14.448 32.945  1.00 52.13 ? 67  ALA B C   1 
ATOM   2489 O O   . ALA B 1 90  ? 25.085  -15.667 32.753  1.00 50.86 ? 67  ALA B O   1 
ATOM   2490 C CB  . ALA B 1 90  ? 26.932  -12.870 32.635  1.00 50.68 ? 67  ALA B CB  1 
ATOM   2491 N N   . ASP B 1 91  ? 23.989  -13.709 32.558  1.00 53.52 ? 68  ASP B N   1 
ATOM   2492 C CA  . ASP B 1 91  ? 22.835  -14.290 31.888  1.00 54.81 ? 68  ASP B CA  1 
ATOM   2493 C C   . ASP B 1 91  ? 22.262  -13.256 30.930  1.00 55.53 ? 68  ASP B C   1 
ATOM   2494 O O   . ASP B 1 91  ? 21.789  -12.205 31.368  1.00 57.14 ? 68  ASP B O   1 
ATOM   2495 C CB  . ASP B 1 91  ? 21.790  -14.673 32.934  1.00 55.37 ? 68  ASP B CB  1 
ATOM   2496 C CG  . ASP B 1 91  ? 20.539  -15.276 32.325  1.00 56.21 ? 68  ASP B CG  1 
ATOM   2497 O OD1 . ASP B 1 91  ? 19.594  -15.579 33.092  1.00 55.55 ? 68  ASP B OD1 1 
ATOM   2498 O OD2 . ASP B 1 91  ? 20.498  -15.445 31.086  1.00 57.39 ? 68  ASP B OD2 1 
ATOM   2499 N N   . GLU B 1 92  ? 22.297  -13.546 29.631  1.00 55.41 ? 69  GLU B N   1 
ATOM   2500 C CA  . GLU B 1 92  ? 21.784  -12.607 28.631  1.00 55.11 ? 69  GLU B CA  1 
ATOM   2501 C C   . GLU B 1 92  ? 20.329  -12.193 28.836  1.00 54.36 ? 69  GLU B C   1 
ATOM   2502 O O   . GLU B 1 92  ? 19.975  -11.029 28.656  1.00 55.03 ? 69  GLU B O   1 
ATOM   2503 C CB  . GLU B 1 92  ? 21.978  -13.182 27.236  1.00 55.83 ? 69  GLU B CB  1 
ATOM   2504 C CG  . GLU B 1 92  ? 23.437  -13.341 26.884  1.00 57.27 ? 69  GLU B CG  1 
ATOM   2505 C CD  . GLU B 1 92  ? 24.249  -12.135 27.306  1.00 58.90 ? 69  GLU B CD  1 
ATOM   2506 O OE1 . GLU B 1 92  ? 23.764  -11.003 27.112  1.00 61.16 ? 69  GLU B OE1 1 
ATOM   2507 O OE2 . GLU B 1 92  ? 25.369  -12.312 27.825  1.00 59.44 ? 69  GLU B OE2 1 
ATOM   2508 N N   . SER B 1 93  ? 19.485  -13.145 29.206  1.00 52.60 ? 70  SER B N   1 
ATOM   2509 C CA  . SER B 1 93  ? 18.086  -12.849 29.467  1.00 51.23 ? 70  SER B CA  1 
ATOM   2510 C C   . SER B 1 93  ? 17.978  -11.742 30.517  1.00 50.05 ? 70  SER B C   1 
ATOM   2511 O O   . SER B 1 93  ? 16.993  -11.006 30.543  1.00 50.48 ? 70  SER B O   1 
ATOM   2512 C CB  . SER B 1 93  ? 17.373  -14.099 29.982  1.00 52.37 ? 70  SER B CB  1 
ATOM   2513 O OG  . SER B 1 93  ? 16.099  -13.772 30.509  1.00 52.02 ? 70  SER B OG  1 
ATOM   2514 N N   . LEU B 1 94  ? 18.993  -11.639 31.379  1.00 47.98 ? 71  LEU B N   1 
ATOM   2515 C CA  . LEU B 1 94  ? 19.046  -10.627 32.445  1.00 45.17 ? 71  LEU B CA  1 
ATOM   2516 C C   . LEU B 1 94  ? 20.190  -9.630  32.202  1.00 43.21 ? 71  LEU B C   1 
ATOM   2517 O O   . LEU B 1 94  ? 21.298  -9.806  32.725  1.00 43.32 ? 71  LEU B O   1 
ATOM   2518 C CB  . LEU B 1 94  ? 19.267  -11.297 33.808  1.00 44.00 ? 71  LEU B CB  1 
ATOM   2519 C CG  . LEU B 1 94  ? 18.287  -12.357 34.306  1.00 44.20 ? 71  LEU B CG  1 
ATOM   2520 C CD1 . LEU B 1 94  ? 18.742  -12.857 35.672  1.00 44.06 ? 71  LEU B CD1 1 
ATOM   2521 C CD2 . LEU B 1 94  ? 16.888  -11.779 34.387  1.00 42.66 ? 71  LEU B CD2 1 
ATOM   2522 N N   . PRO B 1 95  ? 19.941  -8.568  31.412  1.00 40.31 ? 72  PRO B N   1 
ATOM   2523 C CA  . PRO B 1 95  ? 21.015  -7.605  31.162  1.00 36.62 ? 72  PRO B CA  1 
ATOM   2524 C C   . PRO B 1 95  ? 21.503  -6.935  32.438  1.00 34.29 ? 72  PRO B C   1 
ATOM   2525 O O   . PRO B 1 95  ? 22.650  -6.501  32.513  1.00 34.72 ? 72  PRO B O   1 
ATOM   2526 C CB  . PRO B 1 95  ? 20.374  -6.614  30.194  1.00 38.15 ? 72  PRO B CB  1 
ATOM   2527 C CG  . PRO B 1 95  ? 19.364  -7.439  29.473  1.00 38.07 ? 72  PRO B CG  1 
ATOM   2528 C CD  . PRO B 1 95  ? 18.753  -8.231  30.609  1.00 40.82 ? 72  PRO B CD  1 
ATOM   2529 N N   . ASP B 1 96  ? 20.642  -6.856  33.447  1.00 31.08 ? 73  ASP B N   1 
ATOM   2530 C CA  . ASP B 1 96  ? 21.035  -6.219  34.696  1.00 28.68 ? 73  ASP B CA  1 
ATOM   2531 C C   . ASP B 1 96  ? 21.527  -7.149  35.796  1.00 27.75 ? 73  ASP B C   1 
ATOM   2532 O O   . ASP B 1 96  ? 21.722  -6.713  36.925  1.00 27.70 ? 73  ASP B O   1 
ATOM   2533 C CB  . ASP B 1 96  ? 19.896  -5.346  35.230  1.00 28.03 ? 73  ASP B CB  1 
ATOM   2534 C CG  . ASP B 1 96  ? 19.636  -4.133  34.349  1.00 30.58 ? 73  ASP B CG  1 
ATOM   2535 O OD1 . ASP B 1 96  ? 18.953  -4.288  33.312  1.00 30.68 ? 73  ASP B OD1 1 
ATOM   2536 O OD2 . ASP B 1 96  ? 20.131  -3.029  34.680  1.00 27.73 ? 73  ASP B OD2 1 
ATOM   2537 N N   . CYS B 1 97  ? 21.748  -8.417  35.469  1.00 27.32 ? 74  CYS B N   1 
ATOM   2538 C CA  . CYS B 1 97  ? 22.221  -9.384  36.459  1.00 28.44 ? 74  CYS B CA  1 
ATOM   2539 C C   . CYS B 1 97  ? 23.510  -8.933  37.188  1.00 29.81 ? 74  CYS B C   1 
ATOM   2540 O O   . CYS B 1 97  ? 23.769  -9.316  38.341  1.00 31.07 ? 74  CYS B O   1 
ATOM   2541 C CB  . CYS B 1 97  ? 22.429  -10.759 35.798  1.00 23.98 ? 74  CYS B CB  1 
ATOM   2542 S SG  . CYS B 1 97  ? 23.602  -10.835 34.396  1.00 27.52 ? 74  CYS B SG  1 
ATOM   2543 N N   . VAL B 1 98  ? 24.302  -8.098  36.528  1.00 29.19 ? 75  VAL B N   1 
ATOM   2544 C CA  . VAL B 1 98  ? 25.547  -7.613  37.117  1.00 29.13 ? 75  VAL B CA  1 
ATOM   2545 C C   . VAL B 1 98  ? 25.364  -6.847  38.429  1.00 29.18 ? 75  VAL B C   1 
ATOM   2546 O O   . VAL B 1 98  ? 26.273  -6.816  39.275  1.00 30.54 ? 75  VAL B O   1 
ATOM   2547 C CB  . VAL B 1 98  ? 26.281  -6.710  36.131  1.00 26.57 ? 75  VAL B CB  1 
ATOM   2548 C CG1 . VAL B 1 98  ? 25.383  -5.581  35.731  1.00 26.17 ? 75  VAL B CG1 1 
ATOM   2549 C CG2 . VAL B 1 98  ? 27.555  -6.197  36.749  1.00 27.49 ? 75  VAL B CG2 1 
ATOM   2550 N N   . PHE B 1 99  ? 24.182  -6.250  38.594  1.00 27.82 ? 76  PHE B N   1 
ATOM   2551 C CA  . PHE B 1 99  ? 23.841  -5.446  39.771  1.00 24.24 ? 76  PHE B CA  1 
ATOM   2552 C C   . PHE B 1 99  ? 23.182  -6.225  40.884  1.00 22.15 ? 76  PHE B C   1 
ATOM   2553 O O   . PHE B 1 99  ? 22.017  -6.022  41.216  1.00 23.19 ? 76  PHE B O   1 
ATOM   2554 C CB  . PHE B 1 99  ? 22.954  -4.286  39.334  1.00 24.08 ? 76  PHE B CB  1 
ATOM   2555 C CG  . PHE B 1 99  ? 23.578  -3.449  38.271  1.00 24.83 ? 76  PHE B CG  1 
ATOM   2556 C CD1 . PHE B 1 99  ? 22.909  -3.187  37.090  1.00 25.67 ? 76  PHE B CD1 1 
ATOM   2557 C CD2 . PHE B 1 99  ? 24.876  -2.968  38.430  1.00 25.74 ? 76  PHE B CD2 1 
ATOM   2558 C CE1 . PHE B 1 99  ? 23.525  -2.464  36.080  1.00 25.41 ? 76  PHE B CE1 1 
ATOM   2559 C CE2 . PHE B 1 99  ? 25.493  -2.246  37.430  1.00 24.43 ? 76  PHE B CE2 1 
ATOM   2560 C CZ  . PHE B 1 99  ? 24.820  -1.994  36.252  1.00 23.74 ? 76  PHE B CZ  1 
ATOM   2561 N N   . VAL B 1 100 ? 23.973  -7.082  41.499  1.00 20.73 ? 77  VAL B N   1 
ATOM   2562 C CA  . VAL B 1 100 ? 23.500  -7.943  42.551  1.00 19.84 ? 77  VAL B CA  1 
ATOM   2563 C C   . VAL B 1 100 ? 22.988  -7.276  43.806  1.00 21.49 ? 77  VAL B C   1 
ATOM   2564 O O   . VAL B 1 100 ? 22.158  -7.842  44.506  1.00 22.58 ? 77  VAL B O   1 
ATOM   2565 C CB  . VAL B 1 100 ? 24.589  -8.963  42.910  1.00 18.11 ? 77  VAL B CB  1 
ATOM   2566 C CG1 . VAL B 1 100 ? 24.751  -9.948  41.768  1.00 16.68 ? 77  VAL B CG1 1 
ATOM   2567 C CG2 . VAL B 1 100 ? 25.901  -8.259  43.178  1.00 17.42 ? 77  VAL B CG2 1 
ATOM   2568 N N   . GLU B 1 101 ? 23.454  -6.072  44.101  1.00 24.27 ? 78  GLU B N   1 
ATOM   2569 C CA  . GLU B 1 101 ? 23.001  -5.409  45.313  1.00 23.40 ? 78  GLU B CA  1 
ATOM   2570 C C   . GLU B 1 101 ? 21.499  -5.278  45.428  1.00 25.15 ? 78  GLU B C   1 
ATOM   2571 O O   . GLU B 1 101 ? 20.974  -5.221  46.535  1.00 24.91 ? 78  GLU B O   1 
ATOM   2572 C CB  . GLU B 1 101 ? 23.605  -4.018  45.442  1.00 25.00 ? 78  GLU B CB  1 
ATOM   2573 C CG  . GLU B 1 101 ? 22.732  -3.071  46.277  1.00 29.48 ? 78  GLU B CG  1 
ATOM   2574 C CD  . GLU B 1 101 ? 23.468  -1.832  46.748  1.00 35.22 ? 78  GLU B CD  1 
ATOM   2575 O OE1 . GLU B 1 101 ? 24.399  -1.983  47.582  1.00 35.14 ? 78  GLU B OE1 1 
ATOM   2576 O OE2 . GLU B 1 101 ? 23.114  -0.715  46.285  1.00 35.62 ? 78  GLU B OE2 1 
ATOM   2577 N N   . ASP B 1 102 ? 20.802  -5.217  44.298  1.00 26.83 ? 79  ASP B N   1 
ATOM   2578 C CA  . ASP B 1 102 ? 19.352  -5.047  44.337  1.00 27.93 ? 79  ASP B CA  1 
ATOM   2579 C C   . ASP B 1 102 ? 18.543  -6.288  44.696  1.00 29.07 ? 79  ASP B C   1 
ATOM   2580 O O   . ASP B 1 102 ? 17.507  -6.188  45.366  1.00 27.19 ? 79  ASP B O   1 
ATOM   2581 C CB  . ASP B 1 102 ? 18.842  -4.466  43.010  1.00 26.91 ? 79  ASP B CB  1 
ATOM   2582 C CG  . ASP B 1 102 ? 19.302  -3.038  42.793  1.00 29.61 ? 79  ASP B CG  1 
ATOM   2583 O OD1 . ASP B 1 102 ? 19.268  -2.266  43.781  1.00 30.06 ? 79  ASP B OD1 1 
ATOM   2584 O OD2 . ASP B 1 102 ? 19.694  -2.686  41.652  1.00 27.93 ? 79  ASP B OD2 1 
ATOM   2585 N N   . VAL B 1 103 ? 19.026  -7.453  44.279  1.00 30.05 ? 80  VAL B N   1 
ATOM   2586 C CA  . VAL B 1 103 ? 18.312  -8.695  44.537  1.00 32.39 ? 80  VAL B CA  1 
ATOM   2587 C C   . VAL B 1 103 ? 18.554  -9.320  45.902  1.00 32.74 ? 80  VAL B C   1 
ATOM   2588 O O   . VAL B 1 103 ? 18.035  -10.405 46.172  1.00 33.37 ? 80  VAL B O   1 
ATOM   2589 C CB  . VAL B 1 103 ? 18.661  -9.763  43.481  1.00 34.23 ? 80  VAL B CB  1 
ATOM   2590 C CG1 . VAL B 1 103 ? 18.846  -9.097  42.116  1.00 36.01 ? 80  VAL B CG1 1 
ATOM   2591 C CG2 . VAL B 1 103 ? 19.918  -10.544 43.898  1.00 33.46 ? 80  VAL B CG2 1 
ATOM   2592 N N   . ALA B 1 104 ? 19.322  -8.660  46.765  1.00 32.58 ? 81  ALA B N   1 
ATOM   2593 C CA  . ALA B 1 104 ? 19.612  -9.265  48.062  1.00 33.11 ? 81  ALA B CA  1 
ATOM   2594 C C   . ALA B 1 104 ? 20.301  -8.361  49.060  1.00 32.75 ? 81  ALA B C   1 
ATOM   2595 O O   . ALA B 1 104 ? 21.191  -7.599  48.712  1.00 32.80 ? 81  ALA B O   1 
ATOM   2596 C CB  . ALA B 1 104 ? 20.463  -10.531 47.861  1.00 34.38 ? 81  ALA B CB  1 
ATOM   2597 N N   . VAL B 1 105 ? 19.895  -8.488  50.317  1.00 33.48 ? 82  VAL B N   1 
ATOM   2598 C CA  . VAL B 1 105 ? 20.456  -7.704  51.408  1.00 33.14 ? 82  VAL B CA  1 
ATOM   2599 C C   . VAL B 1 105 ? 20.960  -8.651  52.496  1.00 34.32 ? 82  VAL B C   1 
ATOM   2600 O O   . VAL B 1 105 ? 20.246  -9.559  52.924  1.00 33.15 ? 82  VAL B O   1 
ATOM   2601 C CB  . VAL B 1 105 ? 19.403  -6.767  52.002  1.00 32.95 ? 82  VAL B CB  1 
ATOM   2602 C CG1 . VAL B 1 105 ? 20.028  -5.918  53.096  1.00 30.65 ? 82  VAL B CG1 1 
ATOM   2603 C CG2 . VAL B 1 105 ? 18.803  -5.905  50.894  1.00 31.54 ? 82  VAL B CG2 1 
ATOM   2604 N N   . VAL B 1 106 ? 22.192  -8.430  52.945  1.00 34.81 ? 83  VAL B N   1 
ATOM   2605 C CA  . VAL B 1 106 ? 22.796  -9.291  53.950  1.00 35.19 ? 83  VAL B CA  1 
ATOM   2606 C C   . VAL B 1 106 ? 23.310  -8.583  55.186  1.00 36.05 ? 83  VAL B C   1 
ATOM   2607 O O   . VAL B 1 106 ? 24.233  -7.770  55.135  1.00 36.18 ? 83  VAL B O   1 
ATOM   2608 C CB  . VAL B 1 106 ? 23.963  -10.105 53.356  1.00 34.30 ? 83  VAL B CB  1 
ATOM   2609 C CG1 . VAL B 1 106 ? 24.702  -10.834 54.471  1.00 34.97 ? 83  VAL B CG1 1 
ATOM   2610 C CG2 . VAL B 1 106 ? 23.432  -11.091 52.341  1.00 29.75 ? 83  VAL B CG2 1 
ATOM   2611 N N   . CYS B 1 107 ? 22.706  -8.923  56.310  1.00 36.70 ? 84  CYS B N   1 
ATOM   2612 C CA  . CYS B 1 107 ? 23.102  -8.347  57.568  1.00 36.85 ? 84  CYS B CA  1 
ATOM   2613 C C   . CYS B 1 107 ? 23.458  -9.540  58.414  1.00 36.47 ? 84  CYS B C   1 
ATOM   2614 O O   . CYS B 1 107 ? 22.619  -10.397 58.644  1.00 34.17 ? 84  CYS B O   1 
ATOM   2615 C CB  . CYS B 1 107 ? 21.945  -7.580  58.185  1.00 36.53 ? 84  CYS B CB  1 
ATOM   2616 S SG  . CYS B 1 107 ? 22.458  -6.598  59.566  1.00 39.89 ? 84  CYS B SG  1 
ATOM   2617 N N   . GLU B 1 108 ? 24.711  -9.604  58.847  1.00 38.91 ? 85  GLU B N   1 
ATOM   2618 C CA  . GLU B 1 108 ? 25.180  -10.718 59.654  1.00 43.46 ? 85  GLU B CA  1 
ATOM   2619 C C   . GLU B 1 108 ? 25.060  -12.040 58.890  1.00 43.64 ? 85  GLU B C   1 
ATOM   2620 O O   . GLU B 1 108 ? 25.583  -12.145 57.785  1.00 43.20 ? 85  GLU B O   1 
ATOM   2621 C CB  . GLU B 1 108 ? 24.413  -10.748 60.983  1.00 46.15 ? 85  GLU B CB  1 
ATOM   2622 C CG  . GLU B 1 108 ? 24.868  -9.630  61.932  1.00 49.99 ? 85  GLU B CG  1 
ATOM   2623 C CD  . GLU B 1 108 ? 24.088  -9.577  63.233  1.00 52.75 ? 85  GLU B CD  1 
ATOM   2624 O OE1 . GLU B 1 108 ? 23.006  -8.947  63.253  1.00 53.26 ? 85  GLU B OE1 1 
ATOM   2625 O OE2 . GLU B 1 108 ? 24.558  -10.171 64.234  1.00 54.71 ? 85  GLU B OE2 1 
ATOM   2626 N N   . GLU B 1 109 ? 24.400  -13.044 59.463  1.00 45.62 ? 86  GLU B N   1 
ATOM   2627 C CA  . GLU B 1 109 ? 24.252  -14.326 58.771  1.00 48.82 ? 86  GLU B CA  1 
ATOM   2628 C C   . GLU B 1 109 ? 22.818  -14.516 58.328  1.00 49.49 ? 86  GLU B C   1 
ATOM   2629 O O   . GLU B 1 109 ? 22.352  -15.644 58.179  1.00 50.60 ? 86  GLU B O   1 
ATOM   2630 C CB  . GLU B 1 109 ? 24.636  -15.513 59.660  1.00 51.39 ? 86  GLU B CB  1 
ATOM   2631 C CG  . GLU B 1 109 ? 26.003  -15.427 60.308  1.00 54.60 ? 86  GLU B CG  1 
ATOM   2632 C CD  . GLU B 1 109 ? 26.029  -14.415 61.429  1.00 56.12 ? 86  GLU B CD  1 
ATOM   2633 O OE1 . GLU B 1 109 ? 25.108  -14.462 62.274  1.00 58.32 ? 86  GLU B OE1 1 
ATOM   2634 O OE2 . GLU B 1 109 ? 26.960  -13.580 61.468  1.00 56.70 ? 86  GLU B OE2 1 
ATOM   2635 N N   . THR B 1 110 ? 22.120  -13.405 58.134  1.00 49.02 ? 87  THR B N   1 
ATOM   2636 C CA  . THR B 1 110 ? 20.736  -13.435 57.700  1.00 48.07 ? 87  THR B CA  1 
ATOM   2637 C C   . THR B 1 110 ? 20.624  -12.615 56.417  1.00 47.76 ? 87  THR B C   1 
ATOM   2638 O O   . THR B 1 110 ? 20.781  -11.391 56.423  1.00 48.50 ? 87  THR B O   1 
ATOM   2639 C CB  . THR B 1 110 ? 19.798  -12.860 58.791  1.00 48.84 ? 87  THR B CB  1 
ATOM   2640 O OG1 . THR B 1 110 ? 20.169  -11.509 59.086  1.00 49.76 ? 87  THR B OG1 1 
ATOM   2641 C CG2 . THR B 1 110 ? 19.902  -13.684 60.071  1.00 50.01 ? 87  THR B CG2 1 
ATOM   2642 N N   . ALA B 1 111 ? 20.377  -13.300 55.308  1.00 45.85 ? 88  ALA B N   1 
ATOM   2643 C CA  . ALA B 1 111 ? 20.256  -12.628 54.028  1.00 43.13 ? 88  ALA B CA  1 
ATOM   2644 C C   . ALA B 1 111 ? 18.803  -12.566 53.568  1.00 41.99 ? 88  ALA B C   1 
ATOM   2645 O O   . ALA B 1 111 ? 18.028  -13.501 53.762  1.00 41.62 ? 88  ALA B O   1 
ATOM   2646 C CB  . ALA B 1 111 ? 21.100  -13.340 52.989  1.00 42.51 ? 88  ALA B CB  1 
ATOM   2647 N N   . LEU B 1 112 ? 18.443  -11.446 52.960  1.00 40.15 ? 89  LEU B N   1 
ATOM   2648 C CA  . LEU B 1 112 ? 17.101  -11.248 52.453  1.00 39.24 ? 89  LEU B CA  1 
ATOM   2649 C C   . LEU B 1 112 ? 17.111  -11.283 50.939  1.00 40.33 ? 89  LEU B C   1 
ATOM   2650 O O   . LEU B 1 112 ? 17.833  -10.511 50.306  1.00 42.35 ? 89  LEU B O   1 
ATOM   2651 C CB  . LEU B 1 112 ? 16.562  -9.894  52.887  1.00 36.61 ? 89  LEU B CB  1 
ATOM   2652 C CG  . LEU B 1 112 ? 15.324  -9.458  52.113  1.00 35.81 ? 89  LEU B CG  1 
ATOM   2653 C CD1 . LEU B 1 112 ? 14.184  -10.423 52.414  1.00 34.53 ? 89  LEU B CD1 1 
ATOM   2654 C CD2 . LEU B 1 112 ? 14.953  -8.029  52.486  1.00 34.37 ? 89  LEU B CD2 1 
ATOM   2655 N N   . ILE B 1 113 ? 16.320  -12.175 50.354  1.00 39.79 ? 90  ILE B N   1 
ATOM   2656 C CA  . ILE B 1 113 ? 16.232  -12.247 48.904  1.00 38.37 ? 90  ILE B CA  1 
ATOM   2657 C C   . ILE B 1 113 ? 15.064  -11.351 48.523  1.00 37.39 ? 90  ILE B C   1 
ATOM   2658 O O   . ILE B 1 113 ? 13.907  -11.710 48.715  1.00 36.10 ? 90  ILE B O   1 
ATOM   2659 C CB  . ILE B 1 113 ? 15.955  -13.666 48.422  1.00 38.35 ? 90  ILE B CB  1 
ATOM   2660 C CG1 . ILE B 1 113 ? 17.098  -14.592 48.840  1.00 39.37 ? 90  ILE B CG1 1 
ATOM   2661 C CG2 . ILE B 1 113 ? 15.808  -13.661 46.930  1.00 36.91 ? 90  ILE B CG2 1 
ATOM   2662 C CD1 . ILE B 1 113 ? 18.461  -14.161 48.325  1.00 40.90 ? 90  ILE B CD1 1 
ATOM   2663 N N   . THR B 1 114 ? 15.384  -10.182 47.988  1.00 37.40 ? 91  THR B N   1 
ATOM   2664 C CA  . THR B 1 114 ? 14.376  -9.198  47.616  1.00 38.52 ? 91  THR B CA  1 
ATOM   2665 C C   . THR B 1 114 ? 13.504  -9.598  46.436  1.00 38.98 ? 91  THR B C   1 
ATOM   2666 O O   . THR B 1 114 ? 13.688  -10.642 45.815  1.00 38.65 ? 91  THR B O   1 
ATOM   2667 C CB  . THR B 1 114 ? 15.028  -7.810  47.251  1.00 38.53 ? 91  THR B CB  1 
ATOM   2668 O OG1 . THR B 1 114 ? 15.457  -7.824  45.883  1.00 37.32 ? 91  THR B OG1 1 
ATOM   2669 C CG2 . THR B 1 114 ? 16.238  -7.513  48.134  1.00 36.12 ? 91  THR B CG2 1 
ATOM   2670 N N   . ARG B 1 115 ? 12.539  -8.730  46.152  1.00 40.86 ? 92  ARG B N   1 
ATOM   2671 C CA  . ARG B 1 115 ? 11.642  -8.870  45.017  1.00 38.27 ? 92  ARG B CA  1 
ATOM   2672 C C   . ARG B 1 115 ? 11.830  -7.543  44.288  1.00 37.72 ? 92  ARG B C   1 
ATOM   2673 O O   . ARG B 1 115 ? 11.155  -6.559  44.581  1.00 38.02 ? 92  ARG B O   1 
ATOM   2674 C CB  . ARG B 1 115 ? 10.189  -9.027  45.469  1.00 38.27 ? 92  ARG B CB  1 
ATOM   2675 C CG  . ARG B 1 115 ? 9.205   -9.180  44.319  1.00 35.22 ? 92  ARG B CG  1 
ATOM   2676 C CD  . ARG B 1 115 ? 7.960   -9.923  44.769  1.00 35.49 ? 92  ARG B CD  1 
ATOM   2677 N NE  . ARG B 1 115 ? 7.063   -10.214 43.656  1.00 36.49 ? 92  ARG B NE  1 
ATOM   2678 C CZ  . ARG B 1 115 ? 6.203   -9.346  43.132  1.00 36.47 ? 92  ARG B CZ  1 
ATOM   2679 N NH1 . ARG B 1 115 ? 6.105   -8.115  43.615  1.00 35.68 ? 92  ARG B NH1 1 
ATOM   2680 N NH2 . ARG B 1 115 ? 5.436   -9.712  42.118  1.00 38.66 ? 92  ARG B NH2 1 
ATOM   2681 N N   . PRO B 1 116 ? 12.786  -7.499  43.346  1.00 37.26 ? 93  PRO B N   1 
ATOM   2682 C CA  . PRO B 1 116 ? 13.108  -6.316  42.551  1.00 37.50 ? 93  PRO B CA  1 
ATOM   2683 C C   . PRO B 1 116 ? 11.896  -5.582  41.985  1.00 38.45 ? 93  PRO B C   1 
ATOM   2684 O O   . PRO B 1 116 ? 11.010  -6.188  41.382  1.00 39.18 ? 93  PRO B O   1 
ATOM   2685 C CB  . PRO B 1 116 ? 13.999  -6.884  41.454  1.00 36.56 ? 93  PRO B CB  1 
ATOM   2686 C CG  . PRO B 1 116 ? 14.725  -7.940  42.154  1.00 35.92 ? 93  PRO B CG  1 
ATOM   2687 C CD  . PRO B 1 116 ? 13.636  -8.630  42.937  1.00 36.49 ? 93  PRO B CD  1 
ATOM   2688 N N   . GLY B 1 117 ? 11.866  -4.271  42.181  1.00 38.85 ? 94  GLY B N   1 
ATOM   2689 C CA  . GLY B 1 117 ? 10.769  -3.483  41.663  1.00 40.36 ? 94  GLY B CA  1 
ATOM   2690 C C   . GLY B 1 117 ? 10.613  -3.719  40.170  1.00 40.67 ? 94  GLY B C   1 
ATOM   2691 O O   . GLY B 1 117 ? 9.491   -3.735  39.655  1.00 41.47 ? 94  GLY B O   1 
ATOM   2692 N N   . ALA B 1 118 ? 11.735  -3.895  39.474  1.00 39.47 ? 95  ALA B N   1 
ATOM   2693 C CA  . ALA B 1 118 ? 11.712  -4.143  38.034  1.00 38.17 ? 95  ALA B CA  1 
ATOM   2694 C C   . ALA B 1 118 ? 11.289  -5.595  37.799  1.00 38.92 ? 95  ALA B C   1 
ATOM   2695 O O   . ALA B 1 118 ? 12.027  -6.525  38.129  1.00 39.77 ? 95  ALA B O   1 
ATOM   2696 C CB  . ALA B 1 118 ? 13.088  -3.894  37.448  1.00 38.51 ? 95  ALA B CB  1 
ATOM   2697 N N   . PRO B 1 119 ? 10.093  -5.811  37.234  1.00 37.73 ? 96  PRO B N   1 
ATOM   2698 C CA  . PRO B 1 119 ? 9.636   -7.183  36.992  1.00 37.64 ? 96  PRO B CA  1 
ATOM   2699 C C   . PRO B 1 119 ? 10.641  -7.991  36.184  1.00 36.47 ? 96  PRO B C   1 
ATOM   2700 O O   . PRO B 1 119 ? 11.020  -9.095  36.554  1.00 36.52 ? 96  PRO B O   1 
ATOM   2701 C CB  . PRO B 1 119 ? 8.326   -6.982  36.235  1.00 38.62 ? 96  PRO B CB  1 
ATOM   2702 C CG  . PRO B 1 119 ? 7.829   -5.662  36.756  1.00 38.21 ? 96  PRO B CG  1 
ATOM   2703 C CD  . PRO B 1 119 ? 9.083   -4.832  36.796  1.00 36.99 ? 96  PRO B CD  1 
ATOM   2704 N N   . SER B 1 120 ? 11.077  -7.413  35.077  1.00 36.72 ? 97  SER B N   1 
ATOM   2705 C CA  . SER B 1 120 ? 12.023  -8.058  34.180  1.00 37.68 ? 97  SER B CA  1 
ATOM   2706 C C   . SER B 1 120 ? 13.336  -8.472  34.827  1.00 38.82 ? 97  SER B C   1 
ATOM   2707 O O   . SER B 1 120 ? 14.145  -9.163  34.203  1.00 38.16 ? 97  SER B O   1 
ATOM   2708 C CB  . SER B 1 120 ? 12.304  -7.140  32.983  1.00 38.15 ? 97  SER B CB  1 
ATOM   2709 O OG  . SER B 1 120 ? 12.632  -5.826  33.406  1.00 35.93 ? 97  SER B OG  1 
ATOM   2710 N N   . ARG B 1 121 ? 13.550  -8.051  36.072  1.00 40.94 ? 98  ARG B N   1 
ATOM   2711 C CA  . ARG B 1 121 ? 14.777  -8.376  36.800  1.00 41.74 ? 98  ARG B CA  1 
ATOM   2712 C C   . ARG B 1 121 ? 14.551  -9.461  37.851  1.00 42.87 ? 98  ARG B C   1 
ATOM   2713 O O   . ARG B 1 121 ? 15.482  -10.170 38.245  1.00 42.26 ? 98  ARG B O   1 
ATOM   2714 C CB  . ARG B 1 121 ? 15.336  -7.127  37.506  1.00 42.53 ? 98  ARG B CB  1 
ATOM   2715 C CG  . ARG B 1 121 ? 15.828  -6.005  36.595  1.00 43.20 ? 98  ARG B CG  1 
ATOM   2716 C CD  . ARG B 1 121 ? 16.776  -5.093  37.357  1.00 42.25 ? 98  ARG B CD  1 
ATOM   2717 N NE  . ARG B 1 121 ? 17.958  -5.827  37.797  1.00 42.35 ? 98  ARG B NE  1 
ATOM   2718 C CZ  . ARG B 1 121 ? 18.880  -5.356  38.634  1.00 43.13 ? 98  ARG B CZ  1 
ATOM   2719 N NH1 . ARG B 1 121 ? 18.775  -4.135  39.139  1.00 43.02 ? 98  ARG B NH1 1 
ATOM   2720 N NH2 . ARG B 1 121 ? 19.909  -6.116  38.982  1.00 42.05 ? 98  ARG B NH2 1 
ATOM   2721 N N   . ARG B 1 122 ? 13.307  -9.585  38.292  1.00 43.01 ? 99  ARG B N   1 
ATOM   2722 C CA  . ARG B 1 122 ? 12.942  -10.533 39.326  1.00 44.87 ? 99  ARG B CA  1 
ATOM   2723 C C   . ARG B 1 122 ? 13.498  -11.945 39.213  1.00 45.95 ? 99  ARG B C   1 
ATOM   2724 O O   . ARG B 1 122 ? 13.499  -12.688 40.194  1.00 45.77 ? 99  ARG B O   1 
ATOM   2725 C CB  . ARG B 1 122 ? 11.424  -10.554 39.461  1.00 44.63 ? 99  ARG B CB  1 
ATOM   2726 C CG  . ARG B 1 122 ? 10.907  -9.213  39.915  1.00 44.93 ? 99  ARG B CG  1 
ATOM   2727 C CD  . ARG B 1 122 ? 9.414   -9.119  39.879  1.00 46.85 ? 99  ARG B CD  1 
ATOM   2728 N NE  . ARG B 1 122 ? 8.986   -7.756  40.177  1.00 49.21 ? 99  ARG B NE  1 
ATOM   2729 C CZ  . ARG B 1 122 ? 7.736   -7.325  40.063  1.00 50.81 ? 99  ARG B CZ  1 
ATOM   2730 N NH1 . ARG B 1 122 ? 6.783   -8.154  39.657  1.00 52.52 ? 99  ARG B NH1 1 
ATOM   2731 N NH2 . ARG B 1 122 ? 7.436   -6.066  40.349  1.00 52.51 ? 99  ARG B NH2 1 
ATOM   2732 N N   . LYS B 1 123 ? 13.990  -12.318 38.038  1.00 47.70 ? 100 LYS B N   1 
ATOM   2733 C CA  . LYS B 1 123 ? 14.549  -13.651 37.866  1.00 49.69 ? 100 LYS B CA  1 
ATOM   2734 C C   . LYS B 1 123 ? 16.062  -13.621 38.022  1.00 51.15 ? 100 LYS B C   1 
ATOM   2735 O O   . LYS B 1 123 ? 16.764  -14.511 37.547  1.00 52.20 ? 100 LYS B O   1 
ATOM   2736 C CB  . LYS B 1 123 ? 14.169  -14.213 36.506  1.00 49.84 ? 100 LYS B CB  1 
ATOM   2737 N N   . GLU B 1 124 ? 16.562  -12.580 38.677  1.00 52.11 ? 101 GLU B N   1 
ATOM   2738 C CA  . GLU B 1 124 ? 17.991  -12.443 38.920  1.00 53.59 ? 101 GLU B CA  1 
ATOM   2739 C C   . GLU B 1 124 ? 18.301  -13.197 40.200  1.00 54.31 ? 101 GLU B C   1 
ATOM   2740 O O   . GLU B 1 124 ? 19.414  -13.686 40.416  1.00 54.51 ? 101 GLU B O   1 
ATOM   2741 C CB  . GLU B 1 124 ? 18.361  -10.976 39.107  1.00 53.33 ? 101 GLU B CB  1 
ATOM   2742 C CG  . GLU B 1 124 ? 18.796  -10.283 37.849  1.00 55.08 ? 101 GLU B CG  1 
ATOM   2743 C CD  . GLU B 1 124 ? 19.137  -8.830  38.094  1.00 55.63 ? 101 GLU B CD  1 
ATOM   2744 O OE1 . GLU B 1 124 ? 19.742  -8.537  39.145  1.00 55.00 ? 101 GLU B OE1 1 
ATOM   2745 O OE2 . GLU B 1 124 ? 18.813  -7.986  37.233  1.00 56.11 ? 101 GLU B OE2 1 
ATOM   2746 N N   . VAL B 1 125 ? 17.283  -13.281 41.044  1.00 53.84 ? 102 VAL B N   1 
ATOM   2747 C CA  . VAL B 1 125 ? 17.378  -13.946 42.327  1.00 54.46 ? 102 VAL B CA  1 
ATOM   2748 C C   . VAL B 1 125 ? 17.875  -15.389 42.276  1.00 54.58 ? 102 VAL B C   1 
ATOM   2749 O O   . VAL B 1 125 ? 18.693  -15.801 43.093  1.00 54.38 ? 102 VAL B O   1 
ATOM   2750 C CB  . VAL B 1 125 ? 16.025  -13.917 43.013  1.00 53.99 ? 102 VAL B CB  1 
ATOM   2751 C CG1 . VAL B 1 125 ? 16.043  -14.819 44.220  1.00 55.58 ? 102 VAL B CG1 1 
ATOM   2752 C CG2 . VAL B 1 125 ? 15.689  -12.495 43.400  1.00 53.52 ? 102 VAL B CG2 1 
ATOM   2753 N N   . ASP B 1 126 ? 17.367  -16.155 41.321  1.00 55.53 ? 103 ASP B N   1 
ATOM   2754 C CA  . ASP B 1 126 ? 17.751  -17.550 41.178  1.00 55.55 ? 103 ASP B CA  1 
ATOM   2755 C C   . ASP B 1 126 ? 19.196  -17.834 41.532  1.00 54.14 ? 103 ASP B C   1 
ATOM   2756 O O   . ASP B 1 126 ? 19.472  -18.465 42.551  1.00 54.22 ? 103 ASP B O   1 
ATOM   2757 C CB  . ASP B 1 126 ? 17.467  -18.022 39.757  1.00 57.81 ? 103 ASP B CB  1 
ATOM   2758 C CG  . ASP B 1 126 ? 15.991  -18.248 39.515  1.00 60.94 ? 103 ASP B CG  1 
ATOM   2759 O OD1 . ASP B 1 126 ? 15.614  -18.510 38.351  1.00 62.53 ? 103 ASP B OD1 1 
ATOM   2760 O OD2 . ASP B 1 126 ? 15.208  -18.167 40.494  1.00 60.26 ? 103 ASP B OD2 1 
ATOM   2761 N N   . MET B 1 127 ? 20.116  -17.369 40.696  1.00 52.52 ? 104 MET B N   1 
ATOM   2762 C CA  . MET B 1 127 ? 21.529  -17.601 40.943  1.00 52.22 ? 104 MET B CA  1 
ATOM   2763 C C   . MET B 1 127 ? 21.943  -17.096 42.322  1.00 50.06 ? 104 MET B C   1 
ATOM   2764 O O   . MET B 1 127 ? 22.727  -17.729 43.026  1.00 49.54 ? 104 MET B O   1 
ATOM   2765 C CB  . MET B 1 127 ? 22.370  -16.920 39.864  1.00 53.21 ? 104 MET B CB  1 
ATOM   2766 C CG  . MET B 1 127 ? 23.319  -17.863 39.141  1.00 55.67 ? 104 MET B CG  1 
ATOM   2767 S SD  . MET B 1 127 ? 24.435  -18.751 40.261  1.00 61.45 ? 104 MET B SD  1 
ATOM   2768 C CE  . MET B 1 127 ? 24.094  -20.501 39.843  1.00 58.63 ? 104 MET B CE  1 
ATOM   2769 N N   . MET B 1 128 ? 21.398  -15.956 42.713  1.00 48.87 ? 105 MET B N   1 
ATOM   2770 C CA  . MET B 1 128 ? 21.730  -15.378 44.003  1.00 46.24 ? 105 MET B CA  1 
ATOM   2771 C C   . MET B 1 128 ? 21.385  -16.318 45.150  1.00 45.26 ? 105 MET B C   1 
ATOM   2772 O O   . MET B 1 128 ? 22.238  -16.618 45.977  1.00 44.01 ? 105 MET B O   1 
ATOM   2773 C CB  . MET B 1 128 ? 21.001  -14.045 44.190  1.00 45.48 ? 105 MET B CB  1 
ATOM   2774 C CG  . MET B 1 128 ? 21.485  -13.245 45.389  1.00 44.42 ? 105 MET B CG  1 
ATOM   2775 S SD  . MET B 1 128 ? 23.259  -12.883 45.283  1.00 44.32 ? 105 MET B SD  1 
ATOM   2776 C CE  . MET B 1 128 ? 23.243  -11.336 44.401  1.00 44.62 ? 105 MET B CE  1 
ATOM   2777 N N   . LYS B 1 129 ? 20.139  -16.780 45.200  1.00 44.25 ? 106 LYS B N   1 
ATOM   2778 C CA  . LYS B 1 129 ? 19.704  -17.674 46.266  1.00 44.64 ? 106 LYS B CA  1 
ATOM   2779 C C   . LYS B 1 129 ? 20.576  -18.932 46.327  1.00 45.59 ? 106 LYS B C   1 
ATOM   2780 O O   . LYS B 1 129 ? 21.071  -19.310 47.386  1.00 44.91 ? 106 LYS B O   1 
ATOM   2781 C CB  . LYS B 1 129 ? 18.234  -18.049 46.070  1.00 42.60 ? 106 LYS B CB  1 
ATOM   2782 N N   . GLU B 1 130 ? 20.772  -19.572 45.183  1.00 47.45 ? 107 GLU B N   1 
ATOM   2783 C CA  . GLU B 1 130 ? 21.584  -20.777 45.119  1.00 49.33 ? 107 GLU B CA  1 
ATOM   2784 C C   . GLU B 1 130 ? 22.946  -20.527 45.735  1.00 49.55 ? 107 GLU B C   1 
ATOM   2785 O O   . GLU B 1 130 ? 23.494  -21.391 46.407  1.00 49.70 ? 107 GLU B O   1 
ATOM   2786 C CB  . GLU B 1 130 ? 21.774  -21.219 43.669  1.00 51.64 ? 107 GLU B CB  1 
ATOM   2787 C CG  . GLU B 1 130 ? 20.483  -21.412 42.897  1.00 54.98 ? 107 GLU B CG  1 
ATOM   2788 C CD  . GLU B 1 130 ? 20.727  -21.662 41.423  1.00 57.07 ? 107 GLU B CD  1 
ATOM   2789 O OE1 . GLU B 1 130 ? 21.299  -20.773 40.755  1.00 57.74 ? 107 GLU B OE1 1 
ATOM   2790 O OE2 . GLU B 1 130 ? 20.351  -22.749 40.935  1.00 57.91 ? 107 GLU B OE2 1 
ATOM   2791 N N   . ALA B 1 131 ? 23.488  -19.338 45.509  1.00 49.86 ? 108 ALA B N   1 
ATOM   2792 C CA  . ALA B 1 131 ? 24.803  -18.997 46.032  1.00 50.92 ? 108 ALA B CA  1 
ATOM   2793 C C   . ALA B 1 131 ? 24.831  -18.607 47.516  1.00 52.25 ? 108 ALA B C   1 
ATOM   2794 O O   . ALA B 1 131 ? 25.819  -18.859 48.212  1.00 53.01 ? 108 ALA B O   1 
ATOM   2795 C CB  . ALA B 1 131 ? 25.420  -17.888 45.182  1.00 49.66 ? 108 ALA B CB  1 
ATOM   2796 N N   . LEU B 1 132 ? 23.757  -18.000 48.009  1.00 53.40 ? 109 LEU B N   1 
ATOM   2797 C CA  . LEU B 1 132 ? 23.716  -17.586 49.408  1.00 54.84 ? 109 LEU B CA  1 
ATOM   2798 C C   . LEU B 1 132 ? 23.496  -18.731 50.382  1.00 55.99 ? 109 LEU B C   1 
ATOM   2799 O O   . LEU B 1 132 ? 24.216  -18.859 51.371  1.00 55.96 ? 109 LEU B O   1 
ATOM   2800 C CB  . LEU B 1 132 ? 22.636  -16.527 49.618  1.00 54.34 ? 109 LEU B CB  1 
ATOM   2801 C CG  . LEU B 1 132 ? 23.072  -15.119 49.246  1.00 54.47 ? 109 LEU B CG  1 
ATOM   2802 C CD1 . LEU B 1 132 ? 21.935  -14.124 49.460  1.00 54.76 ? 109 LEU B CD1 1 
ATOM   2803 C CD2 . LEU B 1 132 ? 24.275  -14.765 50.100  1.00 55.67 ? 109 LEU B CD2 1 
ATOM   2804 N N   . GLU B 1 133 ? 22.488  -19.551 50.109  1.00 57.13 ? 110 GLU B N   1 
ATOM   2805 C CA  . GLU B 1 133 ? 22.182  -20.686 50.968  1.00 58.77 ? 110 GLU B CA  1 
ATOM   2806 C C   . GLU B 1 133 ? 23.431  -21.550 50.925  1.00 58.68 ? 110 GLU B C   1 
ATOM   2807 O O   . GLU B 1 133 ? 23.712  -22.330 51.836  1.00 58.08 ? 110 GLU B O   1 
ATOM   2808 C CB  . GLU B 1 133 ? 20.976  -21.445 50.408  1.00 60.85 ? 110 GLU B CB  1 
ATOM   2809 C CG  . GLU B 1 133 ? 19.944  -20.515 49.768  1.00 63.33 ? 110 GLU B CG  1 
ATOM   2810 C CD  . GLU B 1 133 ? 18.755  -21.242 49.173  1.00 63.71 ? 110 GLU B CD  1 
ATOM   2811 O OE1 . GLU B 1 133 ? 18.957  -22.275 48.499  1.00 63.72 ? 110 GLU B OE1 1 
ATOM   2812 O OE2 . GLU B 1 133 ? 17.617  -20.765 49.368  1.00 64.70 ? 110 GLU B OE2 1 
ATOM   2813 N N   . LYS B 1 134 ? 24.189  -21.362 49.853  1.00 58.22 ? 111 LYS B N   1 
ATOM   2814 C CA  . LYS B 1 134 ? 25.421  -22.088 49.616  1.00 58.56 ? 111 LYS B CA  1 
ATOM   2815 C C   . LYS B 1 134 ? 26.543  -21.610 50.515  1.00 59.37 ? 111 LYS B C   1 
ATOM   2816 O O   . LYS B 1 134 ? 27.658  -22.117 50.428  1.00 60.06 ? 111 LYS B O   1 
ATOM   2817 C CB  . LYS B 1 134 ? 25.827  -21.920 48.186  1.00 57.46 ? 111 LYS B CB  1 
ATOM   2818 N N   . LEU B 1 135 ? 26.252  -20.640 51.377  1.00 59.92 ? 112 LEU B N   1 
ATOM   2819 C CA  . LEU B 1 135 ? 27.268  -20.100 52.273  1.00 60.04 ? 112 LEU B CA  1 
ATOM   2820 C C   . LEU B 1 135 ? 26.841  -19.961 53.736  1.00 60.37 ? 112 LEU B C   1 
ATOM   2821 O O   . LEU B 1 135 ? 27.327  -19.081 54.449  1.00 61.53 ? 112 LEU B O   1 
ATOM   2822 C CB  . LEU B 1 135 ? 27.766  -18.748 51.742  1.00 60.66 ? 112 LEU B CB  1 
ATOM   2823 C CG  . LEU B 1 135 ? 28.526  -18.781 50.406  1.00 62.18 ? 112 LEU B CG  1 
ATOM   2824 C CD1 . LEU B 1 135 ? 28.929  -17.374 49.987  1.00 61.99 ? 112 LEU B CD1 1 
ATOM   2825 C CD2 . LEU B 1 135 ? 29.761  -19.657 50.544  1.00 63.46 ? 112 LEU B CD2 1 
ATOM   2826 N N   . GLN B 1 136 ? 25.938  -20.832 54.181  1.00 59.55 ? 113 GLN B N   1 
ATOM   2827 C CA  . GLN B 1 136 ? 25.469  -20.835 55.571  1.00 58.08 ? 113 GLN B CA  1 
ATOM   2828 C C   . GLN B 1 136 ? 24.707  -19.582 55.996  1.00 56.42 ? 113 GLN B C   1 
ATOM   2829 O O   . GLN B 1 136 ? 24.880  -19.083 57.112  1.00 55.81 ? 113 GLN B O   1 
ATOM   2830 C CB  . GLN B 1 136 ? 26.653  -21.061 56.515  1.00 58.02 ? 113 GLN B CB  1 
ATOM   2831 N N   . LEU B 1 137 ? 23.852  -19.085 55.110  1.00 54.47 ? 114 LEU B N   1 
ATOM   2832 C CA  . LEU B 1 137 ? 23.072  -17.895 55.404  1.00 52.13 ? 114 LEU B CA  1 
ATOM   2833 C C   . LEU B 1 137 ? 21.633  -18.282 55.686  1.00 51.14 ? 114 LEU B C   1 
ATOM   2834 O O   . LEU B 1 137 ? 21.119  -19.235 55.106  1.00 50.80 ? 114 LEU B O   1 
ATOM   2835 C CB  . LEU B 1 137 ? 23.129  -16.936 54.227  1.00 51.97 ? 114 LEU B CB  1 
ATOM   2836 N N   . ASN B 1 138 ? 20.992  -17.550 56.588  1.00 49.85 ? 115 ASN B N   1 
ATOM   2837 C CA  . ASN B 1 138 ? 19.599  -17.805 56.920  1.00 49.78 ? 115 ASN B CA  1 
ATOM   2838 C C   . ASN B 1 138 ? 18.814  -17.013 55.884  1.00 49.69 ? 115 ASN B C   1 
ATOM   2839 O O   . ASN B 1 138 ? 18.702  -15.793 55.982  1.00 50.38 ? 115 ASN B O   1 
ATOM   2840 C CB  . ASN B 1 138 ? 19.294  -17.298 58.327  1.00 51.78 ? 115 ASN B CB  1 
ATOM   2841 C CG  . ASN B 1 138 ? 20.262  -17.848 59.367  1.00 54.24 ? 115 ASN B CG  1 
ATOM   2842 O OD1 . ASN B 1 138 ? 20.325  -17.362 60.497  1.00 55.34 ? 115 ASN B OD1 1 
ATOM   2843 N ND2 . ASN B 1 138 ? 21.018  -18.870 58.988  1.00 55.45 ? 115 ASN B ND2 1 
ATOM   2844 N N   . ILE B 1 139 ? 18.288  -17.708 54.883  1.00 49.02 ? 116 ILE B N   1 
ATOM   2845 C CA  . ILE B 1 139 ? 17.548  -17.059 53.811  1.00 48.68 ? 116 ILE B CA  1 
ATOM   2846 C C   . ILE B 1 139 ? 16.080  -16.770 54.088  1.00 49.10 ? 116 ILE B C   1 
ATOM   2847 O O   . ILE B 1 139 ? 15.362  -17.567 54.687  1.00 50.55 ? 116 ILE B O   1 
ATOM   2848 C CB  . ILE B 1 139 ? 17.612  -17.878 52.516  1.00 47.53 ? 116 ILE B CB  1 
ATOM   2849 C CG1 . ILE B 1 139 ? 19.056  -18.278 52.220  1.00 46.19 ? 116 ILE B CG1 1 
ATOM   2850 C CG2 . ILE B 1 139 ? 17.038  -17.069 51.373  1.00 47.44 ? 116 ILE B CG2 1 
ATOM   2851 C CD1 . ILE B 1 139 ? 20.027  -17.127 52.210  1.00 45.94 ? 116 ILE B CD1 1 
ATOM   2852 N N   . VAL B 1 140 ? 15.647  -15.609 53.627  1.00 49.12 ? 117 VAL B N   1 
ATOM   2853 C CA  . VAL B 1 140 ? 14.275  -15.177 53.777  1.00 49.06 ? 117 VAL B CA  1 
ATOM   2854 C C   . VAL B 1 140 ? 13.917  -14.568 52.439  1.00 49.48 ? 117 VAL B C   1 
ATOM   2855 O O   . VAL B 1 140 ? 14.388  -13.486 52.101  1.00 48.17 ? 117 VAL B O   1 
ATOM   2856 C CB  . VAL B 1 140 ? 14.149  -14.106 54.862  1.00 49.88 ? 117 VAL B CB  1 
ATOM   2857 C CG1 . VAL B 1 140 ? 12.706  -13.642 54.971  1.00 49.02 ? 117 VAL B CG1 1 
ATOM   2858 C CG2 . VAL B 1 140 ? 14.649  -14.657 56.182  1.00 49.52 ? 117 VAL B CG2 1 
ATOM   2859 N N   . GLU B 1 141 ? 13.102  -15.270 51.665  1.00 50.14 ? 118 GLU B N   1 
ATOM   2860 C CA  . GLU B 1 141 ? 12.714  -14.769 50.354  1.00 51.29 ? 118 GLU B CA  1 
ATOM   2861 C C   . GLU B 1 141 ? 11.476  -13.874 50.363  1.00 51.38 ? 118 GLU B C   1 
ATOM   2862 O O   . GLU B 1 141 ? 10.491  -14.145 51.054  1.00 51.25 ? 118 GLU B O   1 
ATOM   2863 C CB  . GLU B 1 141 ? 12.508  -15.937 49.381  1.00 50.40 ? 118 GLU B CB  1 
ATOM   2864 C CG  . GLU B 1 141 ? 13.767  -16.360 48.645  1.00 51.20 ? 118 GLU B CG  1 
ATOM   2865 C CD  . GLU B 1 141 ? 13.569  -17.627 47.835  1.00 52.61 ? 118 GLU B CD  1 
ATOM   2866 O OE1 . GLU B 1 141 ? 13.326  -18.687 48.447  1.00 51.86 ? 118 GLU B OE1 1 
ATOM   2867 O OE2 . GLU B 1 141 ? 13.653  -17.566 46.589  1.00 53.08 ? 118 GLU B OE2 1 
ATOM   2868 N N   . MET B 1 142 ? 11.549  -12.791 49.596  1.00 51.08 ? 119 MET B N   1 
ATOM   2869 C CA  . MET B 1 142 ? 10.442  -11.854 49.472  1.00 50.98 ? 119 MET B CA  1 
ATOM   2870 C C   . MET B 1 142 ? 9.577   -12.417 48.348  1.00 51.95 ? 119 MET B C   1 
ATOM   2871 O O   . MET B 1 142 ? 9.869   -12.224 47.167  1.00 51.80 ? 119 MET B O   1 
ATOM   2872 C CB  . MET B 1 142 ? 10.973  -10.457 49.104  1.00 48.45 ? 119 MET B CB  1 
ATOM   2873 C CG  . MET B 1 142 ? 9.923   -9.357  49.115  1.00 46.52 ? 119 MET B CG  1 
ATOM   2874 S SD  . MET B 1 142 ? 10.609  -7.721  48.825  1.00 42.97 ? 119 MET B SD  1 
ATOM   2875 C CE  . MET B 1 142 ? 11.119  -7.292  50.490  1.00 38.36 ? 119 MET B CE  1 
ATOM   2876 N N   . LYS B 1 143 ? 8.524   -13.137 48.719  1.00 54.17 ? 120 LYS B N   1 
ATOM   2877 C CA  . LYS B 1 143 ? 7.639   -13.746 47.731  1.00 55.32 ? 120 LYS B CA  1 
ATOM   2878 C C   . LYS B 1 143 ? 6.427   -12.866 47.466  1.00 55.52 ? 120 LYS B C   1 
ATOM   2879 O O   . LYS B 1 143 ? 6.004   -12.714 46.318  1.00 55.04 ? 120 LYS B O   1 
ATOM   2880 C CB  . LYS B 1 143 ? 7.170   -15.131 48.204  1.00 57.72 ? 120 LYS B CB  1 
ATOM   2881 C CG  . LYS B 1 143 ? 8.283   -16.092 48.651  1.00 59.40 ? 120 LYS B CG  1 
ATOM   2882 C CD  . LYS B 1 143 ? 9.436   -16.185 47.644  1.00 61.84 ? 120 LYS B CD  1 
ATOM   2883 C CE  . LYS B 1 143 ? 9.012   -16.721 46.280  1.00 62.39 ? 120 LYS B CE  1 
ATOM   2884 N NZ  . LYS B 1 143 ? 10.133  -16.612 45.292  1.00 62.51 ? 120 LYS B NZ  1 
ATOM   2885 N N   . ASP B 1 144 ? 5.877   -12.301 48.541  1.00 55.51 ? 121 ASP B N   1 
ATOM   2886 C CA  . ASP B 1 144 ? 4.716   -11.424 48.476  1.00 55.01 ? 121 ASP B CA  1 
ATOM   2887 C C   . ASP B 1 144 ? 4.666   -10.675 47.146  1.00 55.46 ? 121 ASP B C   1 
ATOM   2888 O O   . ASP B 1 144 ? 5.350   -9.670  46.968  1.00 56.62 ? 121 ASP B O   1 
ATOM   2889 C CB  . ASP B 1 144 ? 4.768   -10.426 49.631  1.00 54.90 ? 121 ASP B CB  1 
ATOM   2890 C CG  . ASP B 1 144 ? 3.566   -9.508  49.665  1.00 54.25 ? 121 ASP B CG  1 
ATOM   2891 O OD1 . ASP B 1 144 ? 3.258   -8.889  48.627  1.00 53.23 ? 121 ASP B OD1 1 
ATOM   2892 O OD2 . ASP B 1 144 ? 2.931   -9.396  50.734  1.00 55.15 ? 121 ASP B OD2 1 
ATOM   2893 N N   . GLU B 1 145 ? 3.846   -11.167 46.221  1.00 55.56 ? 122 GLU B N   1 
ATOM   2894 C CA  . GLU B 1 145 ? 3.715   -10.570 44.897  1.00 54.85 ? 122 GLU B CA  1 
ATOM   2895 C C   . GLU B 1 145 ? 3.347   -9.087  44.913  1.00 54.30 ? 122 GLU B C   1 
ATOM   2896 O O   . GLU B 1 145 ? 3.223   -8.470  43.858  1.00 54.56 ? 122 GLU B O   1 
ATOM   2897 C CB  . GLU B 1 145 ? 2.693   -11.355 44.074  1.00 55.05 ? 122 GLU B CB  1 
ATOM   2898 N N   . ASN B 1 146 ? 3.176   -8.518  46.104  1.00 53.20 ? 123 ASN B N   1 
ATOM   2899 C CA  . ASN B 1 146 ? 2.829   -7.101  46.240  1.00 51.79 ? 123 ASN B CA  1 
ATOM   2900 C C   . ASN B 1 146 ? 3.904   -6.270  46.955  1.00 50.05 ? 123 ASN B C   1 
ATOM   2901 O O   . ASN B 1 146 ? 3.701   -5.090  47.249  1.00 49.49 ? 123 ASN B O   1 
ATOM   2902 C CB  . ASN B 1 146 ? 1.487   -6.954  46.972  1.00 52.58 ? 123 ASN B CB  1 
ATOM   2903 C CG  . ASN B 1 146 ? 0.293   -7.134  46.046  1.00 53.74 ? 123 ASN B CG  1 
ATOM   2904 O OD1 . ASN B 1 146 ? -0.088  -6.213  45.312  1.00 52.25 ? 123 ASN B OD1 1 
ATOM   2905 N ND2 . ASN B 1 146 ? -0.296  -8.328  46.065  1.00 53.57 ? 123 ASN B ND2 1 
ATOM   2906 N N   . ALA B 1 147 ? 5.048   -6.888  47.231  1.00 47.36 ? 124 ALA B N   1 
ATOM   2907 C CA  . ALA B 1 147 ? 6.140   -6.193  47.897  1.00 44.76 ? 124 ALA B CA  1 
ATOM   2908 C C   . ALA B 1 147 ? 7.335   -6.089  46.960  1.00 43.45 ? 124 ALA B C   1 
ATOM   2909 O O   . ALA B 1 147 ? 7.841   -7.093  46.480  1.00 44.27 ? 124 ALA B O   1 
ATOM   2910 C CB  . ALA B 1 147 ? 6.541   -6.932  49.174  1.00 42.51 ? 124 ALA B CB  1 
ATOM   2911 N N   . THR B 1 148 ? 7.780   -4.870  46.694  1.00 42.01 ? 125 THR B N   1 
ATOM   2912 C CA  . THR B 1 148 ? 8.931   -4.665  45.832  1.00 40.81 ? 125 THR B CA  1 
ATOM   2913 C C   . THR B 1 148 ? 10.036  -3.995  46.643  1.00 38.47 ? 125 THR B C   1 
ATOM   2914 O O   . THR B 1 148 ? 9.764   -3.378  47.672  1.00 36.85 ? 125 THR B O   1 
ATOM   2915 C CB  . THR B 1 148 ? 8.571   -3.784  44.620  1.00 42.89 ? 125 THR B CB  1 
ATOM   2916 O OG1 . THR B 1 148 ? 8.063   -2.527  45.077  1.00 43.40 ? 125 THR B OG1 1 
ATOM   2917 C CG2 . THR B 1 148 ? 7.516   -4.465  43.768  1.00 43.82 ? 125 THR B CG2 1 
ATOM   2918 N N   . LEU B 1 149 ? 11.278  -4.138  46.192  1.00 36.99 ? 126 LEU B N   1 
ATOM   2919 C CA  . LEU B 1 149 ? 12.422  -3.546  46.880  1.00 36.32 ? 126 LEU B CA  1 
ATOM   2920 C C   . LEU B 1 149 ? 13.734  -3.909  46.212  1.00 34.57 ? 126 LEU B C   1 
ATOM   2921 O O   . LEU B 1 149 ? 13.968  -5.068  45.869  1.00 33.49 ? 126 LEU B O   1 
ATOM   2922 C CB  . LEU B 1 149 ? 12.473  -3.994  48.348  1.00 38.37 ? 126 LEU B CB  1 
ATOM   2923 C CG  . LEU B 1 149 ? 13.641  -3.456  49.190  1.00 40.60 ? 126 LEU B CG  1 
ATOM   2924 C CD1 . LEU B 1 149 ? 13.290  -3.553  50.665  1.00 42.61 ? 126 LEU B CD1 1 
ATOM   2925 C CD2 . LEU B 1 149 ? 14.915  -4.228  48.893  1.00 40.06 ? 126 LEU B CD2 1 
ATOM   2926 N N   . ASP B 1 150 ? 14.590  -2.904  46.057  1.00 31.84 ? 127 ASP B N   1 
ATOM   2927 C CA  . ASP B 1 150 ? 15.900  -3.076  45.443  1.00 29.53 ? 127 ASP B CA  1 
ATOM   2928 C C   . ASP B 1 150 ? 17.009  -2.738  46.427  1.00 28.15 ? 127 ASP B C   1 
ATOM   2929 O O   . ASP B 1 150 ? 17.048  -1.632  46.969  1.00 29.51 ? 127 ASP B O   1 
ATOM   2930 C CB  . ASP B 1 150 ? 16.020  -2.185  44.207  1.00 27.46 ? 127 ASP B CB  1 
ATOM   2931 C CG  . ASP B 1 150 ? 15.099  -2.623  43.101  1.00 27.83 ? 127 ASP B CG  1 
ATOM   2932 O OD1 . ASP B 1 150 ? 14.167  -3.392  43.394  1.00 29.40 ? 127 ASP B OD1 1 
ATOM   2933 O OD2 . ASP B 1 150 ? 15.291  -2.205  41.946  1.00 27.43 ? 127 ASP B OD2 1 
ATOM   2934 N N   . GLY B 1 151 ? 17.901  -3.699  46.651  1.00 24.47 ? 128 GLY B N   1 
ATOM   2935 C CA  . GLY B 1 151 ? 19.007  -3.505  47.565  1.00 22.67 ? 128 GLY B CA  1 
ATOM   2936 C C   . GLY B 1 151 ? 19.583  -2.101  47.628  1.00 23.59 ? 128 GLY B C   1 
ATOM   2937 O O   . GLY B 1 151 ? 19.952  -1.647  48.708  1.00 25.15 ? 128 GLY B O   1 
ATOM   2938 N N   . GLY B 1 152 ? 19.678  -1.421  46.485  1.00 23.74 ? 129 GLY B N   1 
ATOM   2939 C CA  . GLY B 1 152 ? 20.210  -0.067  46.457  1.00 22.42 ? 129 GLY B CA  1 
ATOM   2940 C C   . GLY B 1 152 ? 19.472  0.891   47.385  1.00 24.53 ? 129 GLY B C   1 
ATOM   2941 O O   . GLY B 1 152 ? 20.086  1.726   48.057  1.00 24.70 ? 129 GLY B O   1 
ATOM   2942 N N   . ASP B 1 153 ? 18.150  0.777   47.435  1.00 23.68 ? 130 ASP B N   1 
ATOM   2943 C CA  . ASP B 1 153 ? 17.353  1.649   48.295  1.00 24.28 ? 130 ASP B CA  1 
ATOM   2944 C C   . ASP B 1 153 ? 17.582  1.380   49.784  1.00 24.25 ? 130 ASP B C   1 
ATOM   2945 O O   . ASP B 1 153 ? 16.990  2.034   50.632  1.00 22.06 ? 130 ASP B O   1 
ATOM   2946 C CB  . ASP B 1 153 ? 15.852  1.491   47.995  1.00 23.11 ? 130 ASP B CB  1 
ATOM   2947 C CG  . ASP B 1 153 ? 15.431  2.141   46.677  1.00 23.54 ? 130 ASP B CG  1 
ATOM   2948 O OD1 . ASP B 1 153 ? 15.683  3.366   46.504  1.00 19.84 ? 130 ASP B OD1 1 
ATOM   2949 O OD2 . ASP B 1 153 ? 14.834  1.428   45.831  1.00 21.32 ? 130 ASP B OD2 1 
ATOM   2950 N N   . VAL B 1 154 ? 18.455  0.433   50.108  1.00 25.73 ? 131 VAL B N   1 
ATOM   2951 C CA  . VAL B 1 154 ? 18.676  0.095   51.514  1.00 25.80 ? 131 VAL B CA  1 
ATOM   2952 C C   . VAL B 1 154 ? 20.039  0.468   52.078  1.00 26.18 ? 131 VAL B C   1 
ATOM   2953 O O   . VAL B 1 154 ? 21.069  -0.037  51.642  1.00 28.08 ? 131 VAL B O   1 
ATOM   2954 C CB  . VAL B 1 154 ? 18.404  -1.409  51.745  1.00 23.18 ? 131 VAL B CB  1 
ATOM   2955 C CG1 . VAL B 1 154 ? 18.723  -1.789  53.179  1.00 24.42 ? 131 VAL B CG1 1 
ATOM   2956 C CG2 . VAL B 1 154 ? 16.934  -1.710  51.441  1.00 22.74 ? 131 VAL B CG2 1 
ATOM   2957 N N   . LEU B 1 155 ? 20.029  1.360   53.063  1.00 26.31 ? 132 LEU B N   1 
ATOM   2958 C CA  . LEU B 1 155 ? 21.264  1.809   53.683  1.00 25.50 ? 132 LEU B CA  1 
ATOM   2959 C C   . LEU B 1 155 ? 21.418  1.159   55.026  1.00 25.98 ? 132 LEU B C   1 
ATOM   2960 O O   . LEU B 1 155 ? 20.552  1.287   55.893  1.00 29.60 ? 132 LEU B O   1 
ATOM   2961 C CB  . LEU B 1 155 ? 21.269  3.327   53.877  1.00 23.03 ? 132 LEU B CB  1 
ATOM   2962 C CG  . LEU B 1 155 ? 22.585  3.871   54.452  1.00 23.21 ? 132 LEU B CG  1 
ATOM   2963 C CD1 . LEU B 1 155 ? 23.665  3.791   53.382  1.00 19.09 ? 132 LEU B CD1 1 
ATOM   2964 C CD2 . LEU B 1 155 ? 22.418  5.315   54.912  1.00 20.82 ? 132 LEU B CD2 1 
ATOM   2965 N N   . PHE B 1 156 ? 22.514  0.445   55.206  1.00 26.75 ? 133 PHE B N   1 
ATOM   2966 C CA  . PHE B 1 156 ? 22.758  -0.185  56.487  1.00 26.15 ? 133 PHE B CA  1 
ATOM   2967 C C   . PHE B 1 156 ? 23.962  0.507   57.081  1.00 24.63 ? 133 PHE B C   1 
ATOM   2968 O O   . PHE B 1 156 ? 25.074  0.378   56.574  1.00 27.16 ? 133 PHE B O   1 
ATOM   2969 C CB  . PHE B 1 156 ? 23.043  -1.668  56.327  1.00 24.96 ? 133 PHE B CB  1 
ATOM   2970 C CG  . PHE B 1 156 ? 23.298  -2.352  57.618  1.00 22.81 ? 133 PHE B CG  1 
ATOM   2971 C CD1 . PHE B 1 156 ? 22.277  -2.494  58.543  1.00 22.24 ? 133 PHE B CD1 1 
ATOM   2972 C CD2 . PHE B 1 156 ? 24.562  -2.828  57.921  1.00 23.25 ? 133 PHE B CD2 1 
ATOM   2973 C CE1 . PHE B 1 156 ? 22.506  -3.101  59.755  1.00 24.39 ? 133 PHE B CE1 1 
ATOM   2974 C CE2 . PHE B 1 156 ? 24.818  -3.438  59.126  1.00 25.46 ? 133 PHE B CE2 1 
ATOM   2975 C CZ  . PHE B 1 156 ? 23.787  -3.578  60.055  1.00 28.75 ? 133 PHE B CZ  1 
ATOM   2976 N N   . THR B 1 157 ? 23.736  1.236   58.160  1.00 24.50 ? 134 THR B N   1 
ATOM   2977 C CA  . THR B 1 157 ? 24.794  1.998   58.803  1.00 25.34 ? 134 THR B CA  1 
ATOM   2978 C C   . THR B 1 157 ? 25.535  1.280   59.916  1.00 27.96 ? 134 THR B C   1 
ATOM   2979 O O   . THR B 1 157 ? 26.391  1.874   60.566  1.00 29.55 ? 134 THR B O   1 
ATOM   2980 C CB  . THR B 1 157 ? 24.226  3.291   59.366  1.00 23.21 ? 134 THR B CB  1 
ATOM   2981 O OG1 . THR B 1 157 ? 23.274  2.972   60.387  1.00 23.85 ? 134 THR B OG1 1 
ATOM   2982 C CG2 . THR B 1 157 ? 23.524  4.080   58.269  1.00 22.37 ? 134 THR B CG2 1 
ATOM   2983 N N   . GLY B 1 158 ? 25.223  0.005   60.132  1.00 30.30 ? 135 GLY B N   1 
ATOM   2984 C CA  . GLY B 1 158 ? 25.884  -0.739  61.191  1.00 31.17 ? 135 GLY B CA  1 
ATOM   2985 C C   . GLY B 1 158 ? 25.131  -0.642  62.515  1.00 34.95 ? 135 GLY B C   1 
ATOM   2986 O O   . GLY B 1 158 ? 25.472  -1.324  63.492  1.00 35.79 ? 135 GLY B O   1 
ATOM   2987 N N   . ARG B 1 159 ? 24.099  0.203   62.551  1.00 36.33 ? 136 ARG B N   1 
ATOM   2988 C CA  . ARG B 1 159 ? 23.294  0.391   63.756  1.00 37.27 ? 136 ARG B CA  1 
ATOM   2989 C C   . ARG B 1 159 ? 21.799  0.341   63.439  1.00 36.58 ? 136 ARG B C   1 
ATOM   2990 O O   . ARG B 1 159 ? 20.972  0.190   64.340  1.00 36.77 ? 136 ARG B O   1 
ATOM   2991 C CB  . ARG B 1 159 ? 23.619  1.736   64.409  1.00 39.67 ? 136 ARG B CB  1 
ATOM   2992 C CG  . ARG B 1 159 ? 25.088  2.107   64.378  1.00 43.24 ? 136 ARG B CG  1 
ATOM   2993 C CD  . ARG B 1 159 ? 25.327  3.445   65.049  1.00 45.04 ? 136 ARG B CD  1 
ATOM   2994 N NE  . ARG B 1 159 ? 24.274  4.405   64.729  1.00 46.94 ? 136 ARG B NE  1 
ATOM   2995 C CZ  . ARG B 1 159 ? 24.258  5.663   65.157  1.00 48.11 ? 136 ARG B CZ  1 
ATOM   2996 N NH1 . ARG B 1 159 ? 25.247  6.113   65.916  1.00 49.33 ? 136 ARG B NH1 1 
ATOM   2997 N NH2 . ARG B 1 159 ? 23.244  6.464   64.849  1.00 48.15 ? 136 ARG B NH2 1 
ATOM   2998 N N   . GLU B 1 160 ? 21.453  0.478   62.162  1.00 35.79 ? 137 GLU B N   1 
ATOM   2999 C CA  . GLU B 1 160 ? 20.058  0.442   61.743  1.00 35.61 ? 137 GLU B CA  1 
ATOM   3000 C C   . GLU B 1 160 ? 19.972  0.524   60.236  1.00 34.51 ? 137 GLU B C   1 
ATOM   3001 O O   . GLU B 1 160 ? 20.986  0.632   59.562  1.00 33.76 ? 137 GLU B O   1 
ATOM   3002 C CB  . GLU B 1 160 ? 19.280  1.609   62.357  1.00 38.66 ? 137 GLU B CB  1 
ATOM   3003 C CG  . GLU B 1 160 ? 19.735  2.977   61.873  1.00 42.59 ? 137 GLU B CG  1 
ATOM   3004 C CD  . GLU B 1 160 ? 19.142  4.115   62.681  1.00 44.53 ? 137 GLU B CD  1 
ATOM   3005 O OE1 . GLU B 1 160 ? 17.899  4.244   62.703  1.00 47.12 ? 137 GLU B OE1 1 
ATOM   3006 O OE2 . GLU B 1 160 ? 19.920  4.879   63.295  1.00 45.13 ? 137 GLU B OE2 1 
ATOM   3007 N N   . PHE B 1 161 ? 18.752  0.471   59.716  1.00 34.62 ? 138 PHE B N   1 
ATOM   3008 C CA  . PHE B 1 161 ? 18.523  0.549   58.280  1.00 34.82 ? 138 PHE B CA  1 
ATOM   3009 C C   . PHE B 1 161 ? 17.731  1.778   57.912  1.00 35.79 ? 138 PHE B C   1 
ATOM   3010 O O   . PHE B 1 161 ? 16.946  2.300   58.698  1.00 37.94 ? 138 PHE B O   1 
ATOM   3011 C CB  . PHE B 1 161 ? 17.715  -0.641  57.764  1.00 33.52 ? 138 PHE B CB  1 
ATOM   3012 C CG  . PHE B 1 161 ? 18.384  -1.955  57.937  1.00 32.51 ? 138 PHE B CG  1 
ATOM   3013 C CD1 . PHE B 1 161 ? 18.427  -2.566  59.177  1.00 31.03 ? 138 PHE B CD1 1 
ATOM   3014 C CD2 . PHE B 1 161 ? 18.961  -2.598  56.850  1.00 33.20 ? 138 PHE B CD2 1 
ATOM   3015 C CE1 . PHE B 1 161 ? 19.032  -3.801  59.332  1.00 31.89 ? 138 PHE B CE1 1 
ATOM   3016 C CE2 . PHE B 1 161 ? 19.572  -3.838  56.996  1.00 31.53 ? 138 PHE B CE2 1 
ATOM   3017 C CZ  . PHE B 1 161 ? 19.607  -4.440  58.240  1.00 30.83 ? 138 PHE B CZ  1 
ATOM   3018 N N   . PHE B 1 162 ? 17.937  2.222   56.688  1.00 35.59 ? 139 PHE B N   1 
ATOM   3019 C CA  . PHE B 1 162 ? 17.210  3.345   56.150  1.00 35.83 ? 139 PHE B CA  1 
ATOM   3020 C C   . PHE B 1 162 ? 16.807  2.805   54.804  1.00 33.75 ? 139 PHE B C   1 
ATOM   3021 O O   . PHE B 1 162 ? 17.671  2.426   54.017  1.00 34.79 ? 139 PHE B O   1 
ATOM   3022 C CB  . PHE B 1 162 ? 18.124  4.556   55.991  1.00 39.09 ? 139 PHE B CB  1 
ATOM   3023 C CG  . PHE B 1 162 ? 18.364  5.295   57.265  1.00 41.72 ? 139 PHE B CG  1 
ATOM   3024 C CD1 . PHE B 1 162 ? 19.656  5.551   57.702  1.00 44.47 ? 139 PHE B CD1 1 
ATOM   3025 C CD2 . PHE B 1 162 ? 17.294  5.758   58.021  1.00 43.00 ? 139 PHE B CD2 1 
ATOM   3026 C CE1 . PHE B 1 162 ? 19.879  6.263   58.878  1.00 45.89 ? 139 PHE B CE1 1 
ATOM   3027 C CE2 . PHE B 1 162 ? 17.503  6.471   59.196  1.00 43.84 ? 139 PHE B CE2 1 
ATOM   3028 C CZ  . PHE B 1 162 ? 18.794  6.725   59.626  1.00 45.41 ? 139 PHE B CZ  1 
ATOM   3029 N N   . VAL B 1 163 ? 15.506  2.716   54.552  1.00 31.86 ? 140 VAL B N   1 
ATOM   3030 C CA  . VAL B 1 163 ? 15.032  2.197   53.271  1.00 30.57 ? 140 VAL B CA  1 
ATOM   3031 C C   . VAL B 1 163 ? 14.345  3.285   52.454  1.00 31.52 ? 140 VAL B C   1 
ATOM   3032 O O   . VAL B 1 163 ? 13.504  4.022   52.957  1.00 31.31 ? 140 VAL B O   1 
ATOM   3033 C CB  . VAL B 1 163 ? 14.058  0.990   53.457  1.00 27.38 ? 140 VAL B CB  1 
ATOM   3034 C CG1 . VAL B 1 163 ? 13.683  0.420   52.121  1.00 23.26 ? 140 VAL B CG1 1 
ATOM   3035 C CG2 . VAL B 1 163 ? 14.711  -0.089  54.301  1.00 24.63 ? 140 VAL B CG2 1 
ATOM   3036 N N   . GLY B 1 164 ? 14.727  3.387   51.189  1.00 32.46 ? 141 GLY B N   1 
ATOM   3037 C CA  . GLY B 1 164 ? 14.138  4.383   50.328  1.00 34.63 ? 141 GLY B CA  1 
ATOM   3038 C C   . GLY B 1 164 ? 12.892  3.904   49.604  1.00 36.43 ? 141 GLY B C   1 
ATOM   3039 O O   . GLY B 1 164 ? 12.922  2.920   48.858  1.00 36.11 ? 141 GLY B O   1 
ATOM   3040 N N   . LEU B 1 165 ? 11.785  4.602   49.843  1.00 37.33 ? 142 LEU B N   1 
ATOM   3041 C CA  . LEU B 1 165 ? 10.521  4.291   49.185  1.00 37.91 ? 142 LEU B CA  1 
ATOM   3042 C C   . LEU B 1 165 ? 10.550  5.078   47.875  1.00 37.43 ? 142 LEU B C   1 
ATOM   3043 O O   . LEU B 1 165 ? 10.137  6.233   47.807  1.00 39.65 ? 142 LEU B O   1 
ATOM   3044 C CB  . LEU B 1 165 ? 9.336   4.712   50.072  1.00 37.77 ? 142 LEU B CB  1 
ATOM   3045 C CG  . LEU B 1 165 ? 9.241   3.930   51.394  1.00 37.11 ? 142 LEU B CG  1 
ATOM   3046 C CD1 . LEU B 1 165 ? 8.152   4.485   52.292  1.00 37.79 ? 142 LEU B CD1 1 
ATOM   3047 C CD2 . LEU B 1 165 ? 8.975   2.469   51.080  1.00 37.73 ? 142 LEU B CD2 1 
ATOM   3048 N N   . SER B 1 166 ? 11.076  4.439   46.841  1.00 36.72 ? 143 SER B N   1 
ATOM   3049 C CA  . SER B 1 166 ? 11.216  5.054   45.533  1.00 35.31 ? 143 SER B CA  1 
ATOM   3050 C C   . SER B 1 166 ? 10.250  4.420   44.551  1.00 34.52 ? 143 SER B C   1 
ATOM   3051 O O   . SER B 1 166 ? 9.285   3.775   44.947  1.00 33.45 ? 143 SER B O   1 
ATOM   3052 C CB  . SER B 1 166 ? 12.638  4.841   45.035  1.00 34.56 ? 143 SER B CB  1 
ATOM   3053 O OG  . SER B 1 166 ? 12.923  3.449   44.987  1.00 33.44 ? 143 SER B OG  1 
ATOM   3054 N N   . LYS B 1 167 ? 10.520  4.611   43.264  1.00 34.05 ? 144 LYS B N   1 
ATOM   3055 C CA  . LYS B 1 167 ? 9.690   4.023   42.225  1.00 34.26 ? 144 LYS B CA  1 
ATOM   3056 C C   . LYS B 1 167 ? 9.968   2.506   42.173  1.00 35.14 ? 144 LYS B C   1 
ATOM   3057 O O   . LYS B 1 167 ? 9.207   1.744   41.583  1.00 35.75 ? 144 LYS B O   1 
ATOM   3058 C CB  . LYS B 1 167 ? 10.003  4.675   40.874  1.00 32.95 ? 144 LYS B CB  1 
ATOM   3059 N N   . ARG B 1 168 ? 11.058  2.077   42.806  1.00 35.00 ? 145 ARG B N   1 
ATOM   3060 C CA  . ARG B 1 168 ? 11.437  0.672   42.825  1.00 33.32 ? 145 ARG B CA  1 
ATOM   3061 C C   . ARG B 1 168 ? 11.078  -0.030  44.138  1.00 33.53 ? 145 ARG B C   1 
ATOM   3062 O O   . ARG B 1 168 ? 10.866  -1.239  44.156  1.00 33.44 ? 145 ARG B O   1 
ATOM   3063 C CB  . ARG B 1 168 ? 12.939  0.532   42.568  1.00 31.69 ? 145 ARG B CB  1 
ATOM   3064 C CG  . ARG B 1 168 ? 13.374  0.713   41.119  1.00 29.87 ? 145 ARG B CG  1 
ATOM   3065 C CD  . ARG B 1 168 ? 12.992  -0.485  40.227  1.00 29.02 ? 145 ARG B CD  1 
ATOM   3066 N NE  . ARG B 1 168 ? 13.594  -0.365  38.899  1.00 28.47 ? 145 ARG B NE  1 
ATOM   3067 C CZ  . ARG B 1 168 ? 14.861  -0.671  38.605  1.00 29.29 ? 145 ARG B CZ  1 
ATOM   3068 N NH1 . ARG B 1 168 ? 15.678  -1.139  39.538  1.00 31.29 ? 145 ARG B NH1 1 
ATOM   3069 N NH2 . ARG B 1 168 ? 15.335  -0.466  37.385  1.00 25.54 ? 145 ARG B NH2 1 
ATOM   3070 N N   . THR B 1 169 ? 11.018  0.715   45.235  1.00 33.70 ? 146 THR B N   1 
ATOM   3071 C CA  . THR B 1 169 ? 10.682  0.112   46.527  1.00 35.47 ? 146 THR B CA  1 
ATOM   3072 C C   . THR B 1 169 ? 9.361   0.636   47.069  1.00 35.72 ? 146 THR B C   1 
ATOM   3073 O O   . THR B 1 169 ? 8.984   1.770   46.795  1.00 36.91 ? 146 THR B O   1 
ATOM   3074 C CB  . THR B 1 169 ? 11.768  0.386   47.580  1.00 34.86 ? 146 THR B CB  1 
ATOM   3075 O OG1 . THR B 1 169 ? 13.016  -0.113  47.099  1.00 39.39 ? 146 THR B OG1 1 
ATOM   3076 C CG2 . THR B 1 169 ? 11.435  -0.301  48.893  1.00 33.30 ? 146 THR B CG2 1 
ATOM   3077 N N   . ASN B 1 170 ? 8.659   -0.197  47.832  1.00 34.91 ? 147 ASN B N   1 
ATOM   3078 C CA  . ASN B 1 170 ? 7.390   0.208   48.407  1.00 32.65 ? 147 ASN B CA  1 
ATOM   3079 C C   . ASN B 1 170 ? 7.324   -0.084  49.874  1.00 34.17 ? 147 ASN B C   1 
ATOM   3080 O O   . ASN B 1 170 ? 8.191   -0.756  50.438  1.00 32.58 ? 147 ASN B O   1 
ATOM   3081 C CB  . ASN B 1 170 ? 6.205   -0.482  47.719  1.00 31.21 ? 147 ASN B CB  1 
ATOM   3082 C CG  . ASN B 1 170 ? 6.298   -2.008  47.734  1.00 29.46 ? 147 ASN B CG  1 
ATOM   3083 O OD1 . ASN B 1 170 ? 6.859   -2.623  48.648  1.00 28.12 ? 147 ASN B OD1 1 
ATOM   3084 N ND2 . ASN B 1 170 ? 5.718   -2.621  46.721  1.00 27.28 ? 147 ASN B ND2 1 
ATOM   3085 N N   . GLN B 1 171 ? 6.270   0.442   50.479  1.00 37.99 ? 148 GLN B N   1 
ATOM   3086 C CA  . GLN B 1 171 ? 6.008   0.275   51.895  1.00 41.74 ? 148 GLN B CA  1 
ATOM   3087 C C   . GLN B 1 171 ? 6.141   -1.204  52.277  1.00 42.57 ? 148 GLN B C   1 
ATOM   3088 O O   . GLN B 1 171 ? 6.793   -1.536  53.268  1.00 41.65 ? 148 GLN B O   1 
ATOM   3089 C CB  . GLN B 1 171 ? 4.597   0.793   52.199  1.00 45.34 ? 148 GLN B CB  1 
ATOM   3090 C CG  . GLN B 1 171 ? 4.195   0.761   53.660  1.00 50.09 ? 148 GLN B CG  1 
ATOM   3091 C CD  . GLN B 1 171 ? 5.114   1.590   54.527  1.00 52.89 ? 148 GLN B CD  1 
ATOM   3092 O OE1 . GLN B 1 171 ? 5.398   2.750   54.219  1.00 55.04 ? 148 GLN B OE1 1 
ATOM   3093 N NE2 . GLN B 1 171 ? 5.581   1.003   55.624  1.00 53.60 ? 148 GLN B NE2 1 
ATOM   3094 N N   . ARG B 1 172 ? 5.540   -2.085  51.475  1.00 42.59 ? 149 ARG B N   1 
ATOM   3095 C CA  . ARG B 1 172 ? 5.582   -3.526  51.732  1.00 42.80 ? 149 ARG B CA  1 
ATOM   3096 C C   . ARG B 1 172 ? 6.979   -4.109  51.805  1.00 41.97 ? 149 ARG B C   1 
ATOM   3097 O O   . ARG B 1 172 ? 7.341   -4.729  52.804  1.00 40.20 ? 149 ARG B O   1 
ATOM   3098 C CB  . ARG B 1 172 ? 4.803   -4.297  50.666  1.00 44.23 ? 149 ARG B CB  1 
ATOM   3099 C CG  . ARG B 1 172 ? 3.345   -4.514  50.996  1.00 48.26 ? 149 ARG B CG  1 
ATOM   3100 C CD  . ARG B 1 172 ? 3.172   -5.199  52.351  1.00 50.10 ? 149 ARG B CD  1 
ATOM   3101 N NE  . ARG B 1 172 ? 3.712   -6.555  52.394  1.00 50.69 ? 149 ARG B NE  1 
ATOM   3102 C CZ  . ARG B 1 172 ? 3.729   -7.305  53.492  1.00 51.80 ? 149 ARG B CZ  1 
ATOM   3103 N NH1 . ARG B 1 172 ? 4.233   -8.532  53.457  1.00 50.75 ? 149 ARG B NH1 1 
ATOM   3104 N NH2 . ARG B 1 172 ? 3.246   -6.821  54.632  1.00 52.27 ? 149 ARG B NH2 1 
ATOM   3105 N N   . GLY B 1 173 ? 7.741   -3.928  50.727  1.00 40.49 ? 150 GLY B N   1 
ATOM   3106 C CA  . GLY B 1 173 ? 9.092   -4.446  50.669  1.00 39.55 ? 150 GLY B CA  1 
ATOM   3107 C C   . GLY B 1 173 ? 9.900   -3.976  51.855  1.00 39.53 ? 150 GLY B C   1 
ATOM   3108 O O   . GLY B 1 173 ? 10.674  -4.731  52.439  1.00 38.49 ? 150 GLY B O   1 
ATOM   3109 N N   . ALA B 1 174 ? 9.733   -2.712  52.219  1.00 40.00 ? 151 ALA B N   1 
ATOM   3110 C CA  . ALA B 1 174 ? 10.470  -2.198  53.354  1.00 40.71 ? 151 ALA B CA  1 
ATOM   3111 C C   . ALA B 1 174 ? 9.972   -2.947  54.583  1.00 40.97 ? 151 ALA B C   1 
ATOM   3112 O O   . ALA B 1 174 ? 10.764  -3.396  55.412  1.00 40.83 ? 151 ALA B O   1 
ATOM   3113 C CB  . ALA B 1 174 ? 10.240  -0.699  53.505  1.00 39.73 ? 151 ALA B CB  1 
ATOM   3114 N N   . GLU B 1 175 ? 8.650   -3.093  54.676  1.00 41.85 ? 152 GLU B N   1 
ATOM   3115 C CA  . GLU B 1 175 ? 8.008   -3.778  55.797  1.00 41.27 ? 152 GLU B CA  1 
ATOM   3116 C C   . GLU B 1 175 ? 8.565   -5.177  56.002  1.00 40.06 ? 152 GLU B C   1 
ATOM   3117 O O   . GLU B 1 175 ? 8.858   -5.582  57.126  1.00 38.66 ? 152 GLU B O   1 
ATOM   3118 C CB  . GLU B 1 175 ? 6.491   -3.866  55.575  1.00 43.87 ? 152 GLU B CB  1 
ATOM   3119 C CG  . GLU B 1 175 ? 5.741   -2.536  55.643  1.00 43.91 ? 152 GLU B CG  1 
ATOM   3120 C CD  . GLU B 1 175 ? 4.267   -2.681  55.282  1.00 44.75 ? 152 GLU B CD  1 
ATOM   3121 O OE1 . GLU B 1 175 ? 3.977   -3.305  54.242  1.00 43.69 ? 152 GLU B OE1 1 
ATOM   3122 O OE2 . GLU B 1 175 ? 3.405   -2.173  56.032  1.00 42.94 ? 152 GLU B OE2 1 
ATOM   3123 N N   . ILE B 1 176 ? 8.710   -5.914  54.908  1.00 39.63 ? 153 ILE B N   1 
ATOM   3124 C CA  . ILE B 1 176 ? 9.233   -7.270  54.966  1.00 40.45 ? 153 ILE B CA  1 
ATOM   3125 C C   . ILE B 1 176 ? 10.735  -7.293  55.287  1.00 42.47 ? 153 ILE B C   1 
ATOM   3126 O O   . ILE B 1 176 ? 11.255  -8.292  55.799  1.00 44.01 ? 153 ILE B O   1 
ATOM   3127 C CB  . ILE B 1 176 ? 8.947   -8.009  53.642  1.00 38.42 ? 153 ILE B CB  1 
ATOM   3128 C CG1 . ILE B 1 176 ? 7.436   -8.096  53.432  1.00 34.70 ? 153 ILE B CG1 1 
ATOM   3129 C CG2 . ILE B 1 176 ? 9.547   -9.397  53.668  1.00 37.54 ? 153 ILE B CG2 1 
ATOM   3130 C CD1 . ILE B 1 176 ? 7.049   -8.716  52.132  1.00 35.60 ? 153 ILE B CD1 1 
ATOM   3131 N N   . LEU B 1 177 ? 11.426  -6.192  54.996  1.00 42.59 ? 154 LEU B N   1 
ATOM   3132 C CA  . LEU B 1 177 ? 12.853  -6.089  55.280  1.00 43.13 ? 154 LEU B CA  1 
ATOM   3133 C C   . LEU B 1 177 ? 13.057  -5.870  56.767  1.00 43.73 ? 154 LEU B C   1 
ATOM   3134 O O   . LEU B 1 177 ? 13.880  -6.536  57.394  1.00 44.44 ? 154 LEU B O   1 
ATOM   3135 C CB  . LEU B 1 177 ? 13.484  -4.936  54.493  1.00 43.77 ? 154 LEU B CB  1 
ATOM   3136 C CG  . LEU B 1 177 ? 14.931  -4.591  54.862  1.00 43.44 ? 154 LEU B CG  1 
ATOM   3137 C CD1 . LEU B 1 177 ? 15.681  -4.085  53.637  1.00 44.46 ? 154 LEU B CD1 1 
ATOM   3138 C CD2 . LEU B 1 177 ? 14.941  -3.552  55.977  1.00 42.53 ? 154 LEU B CD2 1 
ATOM   3139 N N   . ALA B 1 178 ? 12.311  -4.924  57.328  1.00 44.88 ? 155 ALA B N   1 
ATOM   3140 C CA  . ALA B 1 178 ? 12.390  -4.633  58.758  1.00 45.59 ? 155 ALA B CA  1 
ATOM   3141 C C   . ALA B 1 178 ? 11.933  -5.898  59.476  1.00 45.74 ? 155 ALA B C   1 
ATOM   3142 O O   . ALA B 1 178 ? 12.398  -6.243  60.567  1.00 44.72 ? 155 ALA B O   1 
ATOM   3143 C CB  . ALA B 1 178 ? 11.461  -3.475  59.094  1.00 45.43 ? 155 ALA B CB  1 
ATOM   3144 N N   . ASP B 1 179 ? 11.008  -6.579  58.816  1.00 46.77 ? 156 ASP B N   1 
ATOM   3145 C CA  . ASP B 1 179 ? 10.416  -7.815  59.283  1.00 48.45 ? 156 ASP B CA  1 
ATOM   3146 C C   . ASP B 1 179 ? 11.457  -8.918  59.459  1.00 47.66 ? 156 ASP B C   1 
ATOM   3147 O O   . ASP B 1 179 ? 11.354  -9.748  60.362  1.00 48.64 ? 156 ASP B O   1 
ATOM   3148 C CB  . ASP B 1 179 ? 9.375   -8.269  58.260  1.00 51.15 ? 156 ASP B CB  1 
ATOM   3149 C CG  . ASP B 1 179 ? 8.449   -9.333  58.794  1.00 52.51 ? 156 ASP B CG  1 
ATOM   3150 O OD1 . ASP B 1 179 ? 8.944   -10.342 59.349  1.00 52.78 ? 156 ASP B OD1 1 
ATOM   3151 O OD2 . ASP B 1 179 ? 7.220   -9.155  58.643  1.00 54.06 ? 156 ASP B OD2 1 
ATOM   3152 N N   . THR B 1 180 ? 12.460  -8.921  58.595  1.00 46.27 ? 157 THR B N   1 
ATOM   3153 C CA  . THR B 1 180 ? 13.478  -9.951  58.645  1.00 45.40 ? 157 THR B CA  1 
ATOM   3154 C C   . THR B 1 180 ? 14.677  -9.632  59.526  1.00 45.45 ? 157 THR B C   1 
ATOM   3155 O O   . THR B 1 180 ? 15.289  -10.522 60.115  1.00 43.66 ? 157 THR B O   1 
ATOM   3156 C CB  . THR B 1 180 ? 13.952  -10.263 57.244  1.00 44.25 ? 157 THR B CB  1 
ATOM   3157 O OG1 . THR B 1 180 ? 12.913  -9.941  56.314  1.00 40.92 ? 157 THR B OG1 1 
ATOM   3158 C CG2 . THR B 1 180 ? 14.264  -11.731 57.128  1.00 44.80 ? 157 THR B CG2 1 
ATOM   3159 N N   . PHE B 1 181 ? 15.023  -8.361  59.615  1.00 47.88 ? 158 PHE B N   1 
ATOM   3160 C CA  . PHE B 1 181 ? 16.144  -7.983  60.450  1.00 50.40 ? 158 PHE B CA  1 
ATOM   3161 C C   . PHE B 1 181 ? 15.602  -7.386  61.729  1.00 51.49 ? 158 PHE B C   1 
ATOM   3162 O O   . PHE B 1 181 ? 15.940  -6.272  62.101  1.00 51.70 ? 158 PHE B O   1 
ATOM   3163 C CB  . PHE B 1 181 ? 17.038  -6.985  59.726  1.00 51.06 ? 158 PHE B CB  1 
ATOM   3164 C CG  . PHE B 1 181 ? 17.631  -7.521  58.453  1.00 51.88 ? 158 PHE B CG  1 
ATOM   3165 C CD1 . PHE B 1 181 ? 17.137  -7.121  57.216  1.00 50.36 ? 158 PHE B CD1 1 
ATOM   3166 C CD2 . PHE B 1 181 ? 18.685  -8.430  58.491  1.00 51.92 ? 158 PHE B CD2 1 
ATOM   3167 C CE1 . PHE B 1 181 ? 17.680  -7.611  56.039  1.00 49.12 ? 158 PHE B CE1 1 
ATOM   3168 C CE2 . PHE B 1 181 ? 19.233  -8.927  57.314  1.00 51.06 ? 158 PHE B CE2 1 
ATOM   3169 C CZ  . PHE B 1 181 ? 18.730  -8.515  56.088  1.00 50.70 ? 158 PHE B CZ  1 
ATOM   3170 N N   . LYS B 1 182 ? 14.744  -8.150  62.394  1.00 54.20 ? 159 LYS B N   1 
ATOM   3171 C CA  . LYS B 1 182 ? 14.129  -7.730  63.648  1.00 55.13 ? 159 LYS B CA  1 
ATOM   3172 C C   . LYS B 1 182 ? 15.165  -7.133  64.594  1.00 53.97 ? 159 LYS B C   1 
ATOM   3173 O O   . LYS B 1 182 ? 14.888  -6.158  65.294  1.00 54.01 ? 159 LYS B O   1 
ATOM   3174 C CB  . LYS B 1 182 ? 13.438  -8.929  64.313  1.00 56.46 ? 159 LYS B CB  1 
ATOM   3175 C CG  . LYS B 1 182 ? 12.279  -9.485  63.502  1.00 58.09 ? 159 LYS B CG  1 
ATOM   3176 C CD  . LYS B 1 182 ? 11.527  -10.578 64.240  1.00 58.80 ? 159 LYS B CD  1 
ATOM   3177 C CE  . LYS B 1 182 ? 10.251  -10.955 63.498  1.00 58.78 ? 159 LYS B CE  1 
ATOM   3178 N NZ  . LYS B 1 182 ? 9.306   -9.806  63.361  1.00 58.40 ? 159 LYS B NZ  1 
ATOM   3179 N N   . ASP B 1 183 ? 16.360  -7.724  64.596  1.00 52.80 ? 160 ASP B N   1 
ATOM   3180 C CA  . ASP B 1 183 ? 17.466  -7.279  65.442  1.00 51.09 ? 160 ASP B CA  1 
ATOM   3181 C C   . ASP B 1 183 ? 17.864  -5.816  65.231  1.00 49.42 ? 160 ASP B C   1 
ATOM   3182 O O   . ASP B 1 183 ? 18.701  -5.287  65.962  1.00 49.10 ? 160 ASP B O   1 
ATOM   3183 C CB  . ASP B 1 183 ? 18.688  -8.175  65.215  1.00 51.04 ? 160 ASP B CB  1 
ATOM   3184 C CG  . ASP B 1 183 ? 18.439  -9.608  65.619  1.00 51.09 ? 160 ASP B CG  1 
ATOM   3185 O OD1 . ASP B 1 183 ? 19.331  -10.452 65.425  1.00 50.32 ? 160 ASP B OD1 1 
ATOM   3186 O OD2 . ASP B 1 183 ? 17.341  -9.890  66.136  1.00 52.21 ? 160 ASP B OD2 1 
ATOM   3187 N N   . TYR B 1 184 ? 17.280  -5.165  64.229  1.00 47.86 ? 161 TYR B N   1 
ATOM   3188 C CA  . TYR B 1 184 ? 17.586  -3.764  63.960  1.00 45.26 ? 161 TYR B CA  1 
ATOM   3189 C C   . TYR B 1 184 ? 16.337  -2.949  63.687  1.00 43.71 ? 161 TYR B C   1 
ATOM   3190 O O   . TYR B 1 184 ? 15.300  -3.479  63.294  1.00 42.85 ? 161 TYR B O   1 
ATOM   3191 C CB  . TYR B 1 184 ? 18.536  -3.624  62.766  1.00 44.62 ? 161 TYR B CB  1 
ATOM   3192 C CG  . TYR B 1 184 ? 19.970  -4.007  63.059  1.00 46.35 ? 161 TYR B CG  1 
ATOM   3193 C CD1 . TYR B 1 184 ? 20.383  -5.343  63.019  1.00 47.02 ? 161 TYR B CD1 1 
ATOM   3194 C CD2 . TYR B 1 184 ? 20.915  -3.038  63.398  1.00 46.45 ? 161 TYR B CD2 1 
ATOM   3195 C CE1 . TYR B 1 184 ? 21.698  -5.706  63.308  1.00 45.76 ? 161 TYR B CE1 1 
ATOM   3196 C CE2 . TYR B 1 184 ? 22.235  -3.388  63.689  1.00 46.29 ? 161 TYR B CE2 1 
ATOM   3197 C CZ  . TYR B 1 184 ? 22.620  -4.725  63.641  1.00 47.10 ? 161 TYR B CZ  1 
ATOM   3198 O OH  . TYR B 1 184 ? 23.926  -5.080  63.913  1.00 46.23 ? 161 TYR B OH  1 
ATOM   3199 N N   . ALA B 1 185 ? 16.442  -1.650  63.918  1.00 43.53 ? 162 ALA B N   1 
ATOM   3200 C CA  . ALA B 1 185 ? 15.335  -0.751  63.670  1.00 43.58 ? 162 ALA B CA  1 
ATOM   3201 C C   . ALA B 1 185 ? 15.373  -0.485  62.175  1.00 45.08 ? 162 ALA B C   1 
ATOM   3202 O O   . ALA B 1 185 ? 16.437  -0.543  61.563  1.00 46.25 ? 162 ALA B O   1 
ATOM   3203 C CB  . ALA B 1 185 ? 15.528  0.529   64.442  1.00 42.82 ? 162 ALA B CB  1 
ATOM   3204 N N   . VAL B 1 186 ? 14.225  -0.194  61.579  1.00 46.09 ? 163 VAL B N   1 
ATOM   3205 C CA  . VAL B 1 186 ? 14.180  0.051   60.148  1.00 46.61 ? 163 VAL B CA  1 
ATOM   3206 C C   . VAL B 1 186 ? 13.323  1.260   59.817  1.00 47.78 ? 163 VAL B C   1 
ATOM   3207 O O   . VAL B 1 186 ? 12.112  1.257   60.033  1.00 48.66 ? 163 VAL B O   1 
ATOM   3208 C CB  . VAL B 1 186 ? 13.634  -1.186  59.405  1.00 46.66 ? 163 VAL B CB  1 
ATOM   3209 C CG1 . VAL B 1 186 ? 13.581  -0.927  57.915  1.00 45.61 ? 163 VAL B CG1 1 
ATOM   3210 C CG2 . VAL B 1 186 ? 14.510  -2.388  59.697  1.00 46.06 ? 163 VAL B CG2 1 
ATOM   3211 N N   . SER B 1 187 ? 13.961  2.294   59.283  1.00 48.56 ? 164 SER B N   1 
ATOM   3212 C CA  . SER B 1 187 ? 13.255  3.515   58.929  1.00 49.91 ? 164 SER B CA  1 
ATOM   3213 C C   . SER B 1 187 ? 13.086  3.643   57.414  1.00 50.91 ? 164 SER B C   1 
ATOM   3214 O O   . SER B 1 187 ? 13.724  2.924   56.640  1.00 51.19 ? 164 SER B O   1 
ATOM   3215 C CB  . SER B 1 187 ? 14.008  4.730   59.479  1.00 49.02 ? 164 SER B CB  1 
ATOM   3216 O OG  . SER B 1 187 ? 14.120  4.660   60.890  1.00 48.47 ? 164 SER B OG  1 
ATOM   3217 N N   . THR B 1 188 ? 12.210  4.557   57.006  1.00 50.93 ? 165 THR B N   1 
ATOM   3218 C CA  . THR B 1 188 ? 11.938  4.799   55.598  1.00 51.90 ? 165 THR B CA  1 
ATOM   3219 C C   . THR B 1 188 ? 12.232  6.247   55.254  1.00 52.58 ? 165 THR B C   1 
ATOM   3220 O O   . THR B 1 188 ? 12.292  7.096   56.140  1.00 52.14 ? 165 THR B O   1 
ATOM   3221 C CB  . THR B 1 188 ? 10.462  4.483   55.244  1.00 52.41 ? 165 THR B CB  1 
ATOM   3222 O OG1 . THR B 1 188 ? 9.649   4.554   56.425  1.00 52.48 ? 165 THR B OG1 1 
ATOM   3223 C CG2 . THR B 1 188 ? 10.347  3.100   54.639  1.00 52.38 ? 165 THR B CG2 1 
ATOM   3224 N N   . VAL B 1 189 ? 12.423  6.521   53.966  1.00 54.11 ? 166 VAL B N   1 
ATOM   3225 C CA  . VAL B 1 189 ? 12.716  7.873   53.495  1.00 56.10 ? 166 VAL B CA  1 
ATOM   3226 C C   . VAL B 1 189 ? 12.356  8.036   52.012  1.00 56.93 ? 166 VAL B C   1 
ATOM   3227 O O   . VAL B 1 189 ? 12.898  7.344   51.150  1.00 57.31 ? 166 VAL B O   1 
ATOM   3228 C CB  . VAL B 1 189 ? 14.216  8.223   53.723  1.00 55.74 ? 166 VAL B CB  1 
ATOM   3229 C CG1 . VAL B 1 189 ? 15.098  7.231   53.009  1.00 56.78 ? 166 VAL B CG1 1 
ATOM   3230 C CG2 . VAL B 1 189 ? 14.508  9.636   53.252  1.00 56.94 ? 166 VAL B CG2 1 
ATOM   3231 N N   . PRO B 1 190 ? 11.423  8.957   51.700  1.00 57.56 ? 167 PRO B N   1 
ATOM   3232 C CA  . PRO B 1 190 ? 10.983  9.214   50.325  1.00 57.57 ? 167 PRO B CA  1 
ATOM   3233 C C   . PRO B 1 190 ? 12.136  9.474   49.369  1.00 57.25 ? 167 PRO B C   1 
ATOM   3234 O O   . PRO B 1 190 ? 13.001  10.297  49.653  1.00 57.68 ? 167 PRO B O   1 
ATOM   3235 C CB  . PRO B 1 190 ? 10.078  10.435  50.478  1.00 57.75 ? 167 PRO B CB  1 
ATOM   3236 C CG  . PRO B 1 190 ? 9.492   10.241  51.830  1.00 57.61 ? 167 PRO B CG  1 
ATOM   3237 C CD  . PRO B 1 190 ? 10.700  9.830   52.642  1.00 57.66 ? 167 PRO B CD  1 
ATOM   3238 N N   . VAL B 1 191 ? 12.133  8.776   48.234  1.00 57.67 ? 168 VAL B N   1 
ATOM   3239 C CA  . VAL B 1 191 ? 13.180  8.925   47.224  1.00 57.27 ? 168 VAL B CA  1 
ATOM   3240 C C   . VAL B 1 191 ? 12.624  9.452   45.905  1.00 58.04 ? 168 VAL B C   1 
ATOM   3241 O O   . VAL B 1 191 ? 11.736  8.845   45.289  1.00 57.38 ? 168 VAL B O   1 
ATOM   3242 C CB  . VAL B 1 191 ? 13.904  7.590   46.977  1.00 56.83 ? 168 VAL B CB  1 
ATOM   3243 C CG1 . VAL B 1 191 ? 14.955  7.758   45.898  1.00 55.54 ? 168 VAL B CG1 1 
ATOM   3244 C CG2 . VAL B 1 191 ? 14.549  7.113   48.270  1.00 55.85 ? 168 VAL B CG2 1 
ATOM   3245 N N   . ALA B 1 192 ? 13.180  10.586  45.482  1.00 59.05 ? 169 ALA B N   1 
ATOM   3246 C CA  . ALA B 1 192 ? 12.778  11.289  44.265  1.00 58.75 ? 169 ALA B CA  1 
ATOM   3247 C C   . ALA B 1 192 ? 13.053  10.573  42.948  1.00 58.33 ? 169 ALA B C   1 
ATOM   3248 O O   . ALA B 1 192 ? 13.807  9.602   42.894  1.00 57.49 ? 169 ALA B O   1 
ATOM   3249 C CB  . ALA B 1 192 ? 13.426  12.675  44.239  1.00 59.11 ? 169 ALA B CB  1 
ATOM   3250 N N   . ASP B 1 193 ? 12.414  11.086  41.895  1.00 57.86 ? 170 ASP B N   1 
ATOM   3251 C CA  . ASP B 1 193 ? 12.528  10.579  40.532  1.00 55.61 ? 170 ASP B CA  1 
ATOM   3252 C C   . ASP B 1 193 ? 12.523  9.062   40.450  1.00 54.95 ? 170 ASP B C   1 
ATOM   3253 O O   . ASP B 1 193 ? 11.715  8.382   41.091  1.00 55.08 ? 170 ASP B O   1 
ATOM   3254 C CB  . ASP B 1 193 ? 13.798  11.128  39.888  1.00 55.76 ? 170 ASP B CB  1 
ATOM   3255 N N   . GLY B 1 194 ? 13.432  8.551   39.624  1.00 53.98 ? 171 GLY B N   1 
ATOM   3256 C CA  . GLY B 1 194 ? 13.603  7.123   39.453  1.00 50.66 ? 171 GLY B CA  1 
ATOM   3257 C C   . GLY B 1 194 ? 14.933  6.803   40.102  1.00 48.69 ? 171 GLY B C   1 
ATOM   3258 O O   . GLY B 1 194 ? 15.679  5.936   39.651  1.00 49.44 ? 171 GLY B O   1 
ATOM   3259 N N   . LEU B 1 195 ? 15.227  7.544   41.164  1.00 46.68 ? 172 LEU B N   1 
ATOM   3260 C CA  . LEU B 1 195 ? 16.454  7.386   41.927  1.00 44.91 ? 172 LEU B CA  1 
ATOM   3261 C C   . LEU B 1 195 ? 16.242  6.393   43.063  1.00 43.29 ? 172 LEU B C   1 
ATOM   3262 O O   . LEU B 1 195 ? 15.107  6.070   43.430  1.00 42.25 ? 172 LEU B O   1 
ATOM   3263 C CB  . LEU B 1 195 ? 16.884  8.718   42.545  1.00 45.31 ? 172 LEU B CB  1 
ATOM   3264 C CG  . LEU B 1 195 ? 17.174  9.938   41.672  1.00 46.28 ? 172 LEU B CG  1 
ATOM   3265 C CD1 . LEU B 1 195 ? 17.549  11.091  42.589  1.00 46.03 ? 172 LEU B CD1 1 
ATOM   3266 C CD2 . LEU B 1 195 ? 18.305  9.647   40.695  1.00 46.17 ? 172 LEU B CD2 1 
ATOM   3267 N N   . HIS B 1 196 ? 17.356  5.916   43.608  1.00 40.37 ? 173 HIS B N   1 
ATOM   3268 C CA  . HIS B 1 196 ? 17.349  4.989   44.729  1.00 37.51 ? 173 HIS B CA  1 
ATOM   3269 C C   . HIS B 1 196 ? 17.936  5.744   45.917  1.00 35.56 ? 173 HIS B C   1 
ATOM   3270 O O   . HIS B 1 196 ? 18.529  6.812   45.757  1.00 33.86 ? 173 HIS B O   1 
ATOM   3271 C CB  . HIS B 1 196 ? 18.206  3.751   44.427  1.00 37.76 ? 173 HIS B CB  1 
ATOM   3272 C CG  . HIS B 1 196 ? 17.544  2.760   43.518  1.00 39.71 ? 173 HIS B CG  1 
ATOM   3273 N ND1 . HIS B 1 196 ? 17.249  3.035   42.200  1.00 39.09 ? 173 HIS B ND1 1 
ATOM   3274 C CD2 . HIS B 1 196 ? 17.114  1.495   43.745  1.00 38.80 ? 173 HIS B CD2 1 
ATOM   3275 C CE1 . HIS B 1 196 ? 16.667  1.981   41.655  1.00 41.39 ? 173 HIS B CE1 1 
ATOM   3276 N NE2 . HIS B 1 196 ? 16.573  1.033   42.572  1.00 39.81 ? 173 HIS B NE2 1 
ATOM   3277 N N   . LEU B 1 197 ? 17.763  5.207   47.115  1.00 32.59 ? 174 LEU B N   1 
ATOM   3278 C CA  . LEU B 1 197 ? 18.315  5.885   48.261  1.00 28.40 ? 174 LEU B CA  1 
ATOM   3279 C C   . LEU B 1 197 ? 19.816  6.076   48.050  1.00 26.03 ? 174 LEU B C   1 
ATOM   3280 O O   . LEU B 1 197 ? 20.295  7.204   48.002  1.00 24.18 ? 174 LEU B O   1 
ATOM   3281 C CB  . LEU B 1 197 ? 18.059  5.082   49.528  1.00 27.62 ? 174 LEU B CB  1 
ATOM   3282 C CG  . LEU B 1 197 ? 18.830  5.574   50.749  1.00 25.46 ? 174 LEU B CG  1 
ATOM   3283 C CD1 . LEU B 1 197 ? 18.560  7.054   50.957  1.00 24.34 ? 174 LEU B CD1 1 
ATOM   3284 C CD2 . LEU B 1 197 ? 18.425  4.759   51.969  1.00 27.20 ? 174 LEU B CD2 1 
ATOM   3285 N N   . LYS B 1 198 ? 20.556  4.979   47.907  1.00 24.50 ? 175 LYS B N   1 
ATOM   3286 C CA  . LYS B 1 198 ? 22.002  5.084   47.731  1.00 23.89 ? 175 LYS B CA  1 
ATOM   3287 C C   . LYS B 1 198 ? 22.439  5.725   46.413  1.00 23.09 ? 175 LYS B C   1 
ATOM   3288 O O   . LYS B 1 198 ? 23.580  5.582   45.976  1.00 24.05 ? 175 LYS B O   1 
ATOM   3289 C CB  . LYS B 1 198 ? 22.665  3.716   47.916  1.00 22.62 ? 175 LYS B CB  1 
ATOM   3290 C CG  . LYS B 1 198 ? 22.628  3.266   49.362  1.00 23.40 ? 175 LYS B CG  1 
ATOM   3291 C CD  . LYS B 1 198 ? 23.498  2.046   49.610  1.00 23.65 ? 175 LYS B CD  1 
ATOM   3292 C CE  . LYS B 1 198 ? 22.994  0.825   48.841  1.00 22.68 ? 175 LYS B CE  1 
ATOM   3293 N NZ  . LYS B 1 198 ? 23.492  -0.449  49.430  1.00 20.13 ? 175 LYS B NZ  1 
ATOM   3294 N N   . SER B 1 199 ? 21.524  6.439   45.780  1.00 22.82 ? 176 SER B N   1 
ATOM   3295 C CA  . SER B 1 199 ? 21.853  7.122   44.545  1.00 24.04 ? 176 SER B CA  1 
ATOM   3296 C C   . SER B 1 199 ? 22.629  8.369   44.933  1.00 24.08 ? 176 SER B C   1 
ATOM   3297 O O   . SER B 1 199 ? 23.498  8.834   44.192  1.00 25.12 ? 176 SER B O   1 
ATOM   3298 C CB  . SER B 1 199 ? 20.589  7.511   43.802  1.00 22.50 ? 176 SER B CB  1 
ATOM   3299 O OG  . SER B 1 199 ? 19.904  6.346   43.412  1.00 25.18 ? 176 SER B OG  1 
ATOM   3300 N N   . PHE B 1 200 ? 22.310  8.902   46.104  1.00 20.71 ? 177 PHE B N   1 
ATOM   3301 C CA  . PHE B 1 200 ? 22.996  10.076  46.590  1.00 21.08 ? 177 PHE B CA  1 
ATOM   3302 C C   . PHE B 1 200 ? 23.675  9.855   47.953  1.00 22.95 ? 177 PHE B C   1 
ATOM   3303 O O   . PHE B 1 200 ? 24.064  10.823  48.605  1.00 27.19 ? 177 PHE B O   1 
ATOM   3304 C CB  . PHE B 1 200 ? 22.016  11.249  46.655  1.00 20.30 ? 177 PHE B CB  1 
ATOM   3305 C CG  . PHE B 1 200 ? 20.765  10.947  47.433  1.00 23.06 ? 177 PHE B CG  1 
ATOM   3306 C CD1 . PHE B 1 200 ? 20.794  10.852  48.817  1.00 22.29 ? 177 PHE B CD1 1 
ATOM   3307 C CD2 . PHE B 1 200 ? 19.566  10.690  46.774  1.00 24.49 ? 177 PHE B CD2 1 
ATOM   3308 C CE1 . PHE B 1 200 ? 19.647  10.497  49.534  1.00 25.16 ? 177 PHE B CE1 1 
ATOM   3309 C CE2 . PHE B 1 200 ? 18.419  10.333  47.482  1.00 24.51 ? 177 PHE B CE2 1 
ATOM   3310 C CZ  . PHE B 1 200 ? 18.460  10.236  48.862  1.00 23.37 ? 177 PHE B CZ  1 
ATOM   3311 N N   . CYS B 1 201 ? 23.828  8.607   48.401  1.00 20.28 ? 178 CYS B N   1 
ATOM   3312 C CA  . CYS B 1 201 ? 24.487  8.377   49.690  1.00 22.75 ? 178 CYS B CA  1 
ATOM   3313 C C   . CYS B 1 201 ? 24.899  6.932   49.909  1.00 21.62 ? 178 CYS B C   1 
ATOM   3314 O O   . CYS B 1 201 ? 24.509  6.050   49.165  1.00 24.51 ? 178 CYS B O   1 
ATOM   3315 C CB  . CYS B 1 201 ? 23.578  8.789   50.854  1.00 24.92 ? 178 CYS B CB  1 
ATOM   3316 S SG  . CYS B 1 201 ? 22.319  7.529   51.270  1.00 30.49 ? 178 CYS B SG  1 
ATOM   3317 N N   . SER B 1 202 ? 25.690  6.698   50.944  1.00 19.94 ? 179 SER B N   1 
ATOM   3318 C CA  . SER B 1 202 ? 26.141  5.358   51.273  1.00 20.78 ? 179 SER B CA  1 
ATOM   3319 C C   . SER B 1 202 ? 27.030  5.533   52.486  1.00 21.76 ? 179 SER B C   1 
ATOM   3320 O O   . SER B 1 202 ? 27.347  6.669   52.855  1.00 20.88 ? 179 SER B O   1 
ATOM   3321 C CB  . SER B 1 202 ? 26.931  4.734   50.101  1.00 22.07 ? 179 SER B CB  1 
ATOM   3322 O OG  . SER B 1 202 ? 28.265  5.225   50.000  1.00 17.20 ? 179 SER B OG  1 
ATOM   3323 N N   . MET B 1 203 ? 27.417  4.425   53.114  1.00 21.66 ? 180 MET B N   1 
ATOM   3324 C CA  . MET B 1 203 ? 28.274  4.485   54.286  1.00 22.76 ? 180 MET B CA  1 
ATOM   3325 C C   . MET B 1 203 ? 29.727  4.687   53.889  1.00 26.38 ? 180 MET B C   1 
ATOM   3326 O O   . MET B 1 203 ? 30.238  3.991   53.012  1.00 27.77 ? 180 MET B O   1 
ATOM   3327 C CB  . MET B 1 203 ? 28.140  3.213   55.107  1.00 23.50 ? 180 MET B CB  1 
ATOM   3328 C CG  . MET B 1 203 ? 26.778  3.075   55.765  1.00 25.61 ? 180 MET B CG  1 
ATOM   3329 S SD  . MET B 1 203 ? 26.258  4.614   56.520  1.00 25.81 ? 180 MET B SD  1 
ATOM   3330 C CE  . MET B 1 203 ? 27.296  4.633   58.014  1.00 22.33 ? 180 MET B CE  1 
ATOM   3331 N N   . ALA B 1 204 ? 30.386  5.639   54.550  1.00 27.00 ? 181 ALA B N   1 
ATOM   3332 C CA  . ALA B 1 204 ? 31.783  5.966   54.277  1.00 27.79 ? 181 ALA B CA  1 
ATOM   3333 C C   . ALA B 1 204 ? 32.737  5.531   55.389  1.00 28.36 ? 181 ALA B C   1 
ATOM   3334 O O   . ALA B 1 204 ? 33.956  5.601   55.231  1.00 29.89 ? 181 ALA B O   1 
ATOM   3335 C CB  . ALA B 1 204 ? 31.918  7.459   54.048  1.00 26.13 ? 181 ALA B CB  1 
ATOM   3336 N N   . GLY B 1 205 ? 32.176  5.092   56.508  1.00 28.15 ? 182 GLY B N   1 
ATOM   3337 C CA  . GLY B 1 205 ? 32.978  4.663   57.635  1.00 28.16 ? 182 GLY B CA  1 
ATOM   3338 C C   . GLY B 1 205 ? 32.109  4.588   58.877  1.00 29.92 ? 182 GLY B C   1 
ATOM   3339 O O   . GLY B 1 205 ? 30.951  5.017   58.856  1.00 30.12 ? 182 GLY B O   1 
ATOM   3340 N N   . PRO B 1 206 ? 32.635  4.051   59.982  1.00 29.84 ? 183 PRO B N   1 
ATOM   3341 C CA  . PRO B 1 206 ? 31.838  3.954   61.203  1.00 29.74 ? 183 PRO B CA  1 
ATOM   3342 C C   . PRO B 1 206 ? 31.103  5.262   61.486  1.00 29.76 ? 183 PRO B C   1 
ATOM   3343 O O   . PRO B 1 206 ? 31.690  6.342   61.455  1.00 29.45 ? 183 PRO B O   1 
ATOM   3344 C CB  . PRO B 1 206 ? 32.885  3.648   62.268  1.00 30.37 ? 183 PRO B CB  1 
ATOM   3345 C CG  . PRO B 1 206 ? 33.921  2.907   61.512  1.00 31.61 ? 183 PRO B CG  1 
ATOM   3346 C CD  . PRO B 1 206 ? 34.037  3.701   60.246  1.00 30.67 ? 183 PRO B CD  1 
ATOM   3347 N N   . ASN B 1 207 ? 29.809  5.158   61.740  1.00 29.68 ? 184 ASN B N   1 
ATOM   3348 C CA  . ASN B 1 207 ? 29.001  6.325   62.053  1.00 28.61 ? 184 ASN B CA  1 
ATOM   3349 C C   . ASN B 1 207 ? 29.177  7.448   61.036  1.00 27.75 ? 184 ASN B C   1 
ATOM   3350 O O   . ASN B 1 207 ? 28.877  8.609   61.321  1.00 28.81 ? 184 ASN B O   1 
ATOM   3351 C CB  . ASN B 1 207 ? 29.377  6.847   63.441  1.00 28.55 ? 184 ASN B CB  1 
ATOM   3352 C CG  . ASN B 1 207 ? 28.294  7.715   64.047  1.00 28.98 ? 184 ASN B CG  1 
ATOM   3353 O OD1 . ASN B 1 207 ? 28.576  8.666   64.777  1.00 31.74 ? 184 ASN B OD1 1 
ATOM   3354 N ND2 . ASN B 1 207 ? 27.044  7.383   63.759  1.00 27.13 ? 184 ASN B ND2 1 
ATOM   3355 N N   . LEU B 1 208 ? 29.652  7.118   59.844  1.00 25.51 ? 185 LEU B N   1 
ATOM   3356 C CA  . LEU B 1 208 ? 29.861  8.153   58.846  1.00 22.76 ? 185 LEU B CA  1 
ATOM   3357 C C   . LEU B 1 208 ? 29.094  7.920   57.549  1.00 23.36 ? 185 LEU B C   1 
ATOM   3358 O O   . LEU B 1 208 ? 29.350  6.958   56.825  1.00 24.34 ? 185 LEU B O   1 
ATOM   3359 C CB  . LEU B 1 208 ? 31.354  8.292   58.563  1.00 21.03 ? 185 LEU B CB  1 
ATOM   3360 C CG  . LEU B 1 208 ? 31.773  9.374   57.573  1.00 21.41 ? 185 LEU B CG  1 
ATOM   3361 C CD1 . LEU B 1 208 ? 31.150  10.704  57.945  1.00 19.15 ? 185 LEU B CD1 1 
ATOM   3362 C CD2 . LEU B 1 208 ? 33.280  9.473   57.569  1.00 20.54 ? 185 LEU B CD2 1 
ATOM   3363 N N   . ILE B 1 209 ? 28.149  8.814   57.268  1.00 21.06 ? 186 ILE B N   1 
ATOM   3364 C CA  . ILE B 1 209 ? 27.330  8.729   56.066  1.00 19.26 ? 186 ILE B CA  1 
ATOM   3365 C C   . ILE B 1 209 ? 27.810  9.678   54.974  1.00 20.50 ? 186 ILE B C   1 
ATOM   3366 O O   . ILE B 1 209 ? 27.861  10.904  55.176  1.00 16.47 ? 186 ILE B O   1 
ATOM   3367 C CB  . ILE B 1 209 ? 25.866  9.104   56.341  1.00 18.26 ? 186 ILE B CB  1 
ATOM   3368 C CG1 . ILE B 1 209 ? 25.304  8.282   57.499  1.00 21.02 ? 186 ILE B CG1 1 
ATOM   3369 C CG2 . ILE B 1 209 ? 25.046  8.855   55.104  1.00 17.81 ? 186 ILE B CG2 1 
ATOM   3370 C CD1 . ILE B 1 209 ? 23.992  8.820   58.032  1.00 17.12 ? 186 ILE B CD1 1 
ATOM   3371 N N   . ALA B 1 210 ? 28.158  9.115   53.818  1.00 20.27 ? 187 ALA B N   1 
ATOM   3372 C CA  . ALA B 1 210 ? 28.579  9.946   52.695  1.00 20.45 ? 187 ALA B CA  1 
ATOM   3373 C C   . ALA B 1 210 ? 27.278  10.528  52.129  1.00 19.69 ? 187 ALA B C   1 
ATOM   3374 O O   . ALA B 1 210 ? 26.357  9.783   51.811  1.00 18.95 ? 187 ALA B O   1 
ATOM   3375 C CB  . ALA B 1 210 ? 29.309  9.099   51.642  1.00 19.31 ? 187 ALA B CB  1 
ATOM   3376 N N   . ILE B 1 211 ? 27.190  11.849  52.015  1.00 19.17 ? 188 ILE B N   1 
ATOM   3377 C CA  . ILE B 1 211 ? 25.962  12.440  51.511  1.00 21.42 ? 188 ILE B CA  1 
ATOM   3378 C C   . ILE B 1 211 ? 26.185  13.380  50.338  1.00 22.43 ? 188 ILE B C   1 
ATOM   3379 O O   . ILE B 1 211 ? 27.259  13.952  50.193  1.00 26.62 ? 188 ILE B O   1 
ATOM   3380 C CB  . ILE B 1 211 ? 25.210  13.214  52.634  1.00 20.84 ? 188 ILE B CB  1 
ATOM   3381 C CG1 . ILE B 1 211 ? 23.790  13.558  52.173  1.00 23.06 ? 188 ILE B CG1 1 
ATOM   3382 C CG2 . ILE B 1 211 ? 25.939  14.505  52.980  1.00 21.37 ? 188 ILE B CG2 1 
ATOM   3383 C CD1 . ILE B 1 211 ? 22.836  12.399  52.170  1.00 14.46 ? 188 ILE B CD1 1 
ATOM   3384 N N   . GLY B 1 212 ? 25.169  13.512  49.492  1.00 21.94 ? 189 GLY B N   1 
ATOM   3385 C CA  . GLY B 1 212 ? 25.262  14.415  48.363  1.00 22.81 ? 189 GLY B CA  1 
ATOM   3386 C C   . GLY B 1 212 ? 24.930  15.796  48.898  1.00 24.23 ? 189 GLY B C   1 
ATOM   3387 O O   . GLY B 1 212 ? 24.405  15.930  50.006  1.00 24.93 ? 189 GLY B O   1 
ATOM   3388 N N   . SER B 1 213 ? 25.216  16.834  48.135  1.00 24.73 ? 190 SER B N   1 
ATOM   3389 C CA  . SER B 1 213 ? 24.931  18.168  48.624  1.00 26.87 ? 190 SER B CA  1 
ATOM   3390 C C   . SER B 1 213 ? 23.714  18.797  47.980  1.00 28.33 ? 190 SER B C   1 
ATOM   3391 O O   . SER B 1 213 ? 23.475  19.987  48.165  1.00 30.58 ? 190 SER B O   1 
ATOM   3392 C CB  . SER B 1 213 ? 26.141  19.067  48.413  1.00 24.80 ? 190 SER B CB  1 
ATOM   3393 O OG  . SER B 1 213 ? 26.434  19.177  47.045  1.00 23.69 ? 190 SER B OG  1 
ATOM   3394 N N   . SER B 1 214 ? 22.947  18.002  47.234  1.00 29.86 ? 191 SER B N   1 
ATOM   3395 C CA  . SER B 1 214 ? 21.741  18.496  46.561  1.00 31.57 ? 191 SER B CA  1 
ATOM   3396 C C   . SER B 1 214 ? 20.652  18.813  47.575  1.00 32.00 ? 191 SER B C   1 
ATOM   3397 O O   . SER B 1 214 ? 20.732  18.402  48.736  1.00 32.17 ? 191 SER B O   1 
ATOM   3398 C CB  . SER B 1 214 ? 21.202  17.451  45.566  1.00 34.19 ? 191 SER B CB  1 
ATOM   3399 O OG  . SER B 1 214 ? 20.396  16.459  46.204  1.00 35.02 ? 191 SER B OG  1 
ATOM   3400 N N   . GLU B 1 215 ? 19.628  19.538  47.138  1.00 33.26 ? 192 GLU B N   1 
ATOM   3401 C CA  . GLU B 1 215 ? 18.528  19.885  48.032  1.00 34.83 ? 192 GLU B CA  1 
ATOM   3402 C C   . GLU B 1 215 ? 17.794  18.608  48.466  1.00 34.22 ? 192 GLU B C   1 
ATOM   3403 O O   . GLU B 1 215 ? 17.324  18.505  49.597  1.00 34.41 ? 192 GLU B O   1 
ATOM   3404 C CB  . GLU B 1 215 ? 17.564  20.852  47.334  1.00 33.94 ? 192 GLU B CB  1 
ATOM   3405 N N   . SER B 1 216 ? 17.711  17.637  47.563  1.00 34.60 ? 193 SER B N   1 
ATOM   3406 C CA  . SER B 1 216 ? 17.039  16.368  47.854  1.00 36.15 ? 193 SER B CA  1 
ATOM   3407 C C   . SER B 1 216 ? 17.865  15.490  48.813  1.00 36.66 ? 193 SER B C   1 
ATOM   3408 O O   . SER B 1 216 ? 17.335  14.928  49.785  1.00 35.11 ? 193 SER B O   1 
ATOM   3409 C CB  . SER B 1 216 ? 16.777  15.598  46.555  1.00 36.04 ? 193 SER B CB  1 
ATOM   3410 O OG  . SER B 1 216 ? 15.839  14.562  46.771  1.00 38.02 ? 193 SER B OG  1 
ATOM   3411 N N   . ALA B 1 217 ? 19.163  15.369  48.537  1.00 36.28 ? 194 ALA B N   1 
ATOM   3412 C CA  . ALA B 1 217 ? 20.035  14.577  49.392  1.00 34.47 ? 194 ALA B CA  1 
ATOM   3413 C C   . ALA B 1 217 ? 19.950  15.128  50.816  1.00 34.09 ? 194 ALA B C   1 
ATOM   3414 O O   . ALA B 1 217 ? 19.624  14.396  51.747  1.00 32.32 ? 194 ALA B O   1 
ATOM   3415 C CB  . ALA B 1 217 ? 21.469  14.635  48.875  1.00 34.53 ? 194 ALA B CB  1 
ATOM   3416 N N   . GLN B 1 218 ? 20.230  16.422  50.973  1.00 34.72 ? 195 GLN B N   1 
ATOM   3417 C CA  . GLN B 1 218 ? 20.177  17.080  52.279  1.00 35.65 ? 195 GLN B CA  1 
ATOM   3418 C C   . GLN B 1 218 ? 18.871  16.779  53.003  1.00 35.39 ? 195 GLN B C   1 
ATOM   3419 O O   . GLN B 1 218 ? 18.874  16.420  54.182  1.00 36.23 ? 195 GLN B O   1 
ATOM   3420 C CB  . GLN B 1 218 ? 20.311  18.597  52.129  1.00 38.04 ? 195 GLN B CB  1 
ATOM   3421 C CG  . GLN B 1 218 ? 21.674  19.089  51.653  1.00 41.10 ? 195 GLN B CG  1 
ATOM   3422 C CD  . GLN B 1 218 ? 22.813  18.678  52.573  1.00 43.46 ? 195 GLN B CD  1 
ATOM   3423 O OE1 . GLN B 1 218 ? 23.400  17.605  52.412  1.00 46.93 ? 195 GLN B OE1 1 
ATOM   3424 N NE2 . GLN B 1 218 ? 23.125  19.525  53.550  1.00 41.32 ? 195 GLN B NE2 1 
ATOM   3425 N N   . LYS B 1 219 ? 17.755  16.952  52.302  1.00 33.98 ? 196 LYS B N   1 
ATOM   3426 C CA  . LYS B 1 219 ? 16.447  16.680  52.880  1.00 33.80 ? 196 LYS B CA  1 
ATOM   3427 C C   . LYS B 1 219 ? 16.398  15.223  53.340  1.00 34.24 ? 196 LYS B C   1 
ATOM   3428 O O   . LYS B 1 219 ? 16.208  14.937  54.522  1.00 35.58 ? 196 LYS B O   1 
ATOM   3429 C CB  . LYS B 1 219 ? 15.348  16.944  51.850  1.00 33.60 ? 196 LYS B CB  1 
ATOM   3430 N N   . ALA B 1 220 ? 16.567  14.299  52.403  1.00 33.54 ? 197 ALA B N   1 
ATOM   3431 C CA  . ALA B 1 220 ? 16.536  12.888  52.739  1.00 31.83 ? 197 ALA B CA  1 
ATOM   3432 C C   . ALA B 1 220 ? 17.431  12.608  53.941  1.00 32.49 ? 197 ALA B C   1 
ATOM   3433 O O   . ALA B 1 220 ? 17.203  11.647  54.674  1.00 34.06 ? 197 ALA B O   1 
ATOM   3434 C CB  . ALA B 1 220 ? 16.979  12.063  51.552  1.00 30.62 ? 197 ALA B CB  1 
ATOM   3435 N N   . LEU B 1 221 ? 18.436  13.455  54.155  1.00 32.68 ? 198 LEU B N   1 
ATOM   3436 C CA  . LEU B 1 221 ? 19.365  13.268  55.273  1.00 33.06 ? 198 LEU B CA  1 
ATOM   3437 C C   . LEU B 1 221 ? 18.879  13.832  56.598  1.00 33.70 ? 198 LEU B C   1 
ATOM   3438 O O   . LEU B 1 221 ? 19.132  13.247  57.656  1.00 34.65 ? 198 LEU B O   1 
ATOM   3439 C CB  . LEU B 1 221 ? 20.730  13.877  54.960  1.00 32.49 ? 198 LEU B CB  1 
ATOM   3440 C CG  . LEU B 1 221 ? 21.677  13.832  56.157  1.00 32.29 ? 198 LEU B CG  1 
ATOM   3441 C CD1 . LEU B 1 221 ? 21.890  12.394  56.584  1.00 31.57 ? 198 LEU B CD1 1 
ATOM   3442 C CD2 . LEU B 1 221 ? 22.990  14.472  55.791  1.00 35.09 ? 198 LEU B CD2 1 
ATOM   3443 N N   . LYS B 1 222 ? 18.217  14.981  56.547  1.00 34.67 ? 199 LYS B N   1 
ATOM   3444 C CA  . LYS B 1 222 ? 17.689  15.592  57.760  1.00 35.48 ? 199 LYS B CA  1 
ATOM   3445 C C   . LYS B 1 222 ? 16.713  14.577  58.334  1.00 35.04 ? 199 LYS B C   1 
ATOM   3446 O O   . LYS B 1 222 ? 16.705  14.306  59.531  1.00 33.93 ? 199 LYS B O   1 
ATOM   3447 C CB  . LYS B 1 222 ? 16.968  16.907  57.431  1.00 35.44 ? 199 LYS B CB  1 
ATOM   3448 N N   . ILE B 1 223 ? 15.900  14.006  57.454  1.00 35.43 ? 200 ILE B N   1 
ATOM   3449 C CA  . ILE B 1 223 ? 14.922  13.010  57.853  1.00 36.03 ? 200 ILE B CA  1 
ATOM   3450 C C   . ILE B 1 223 ? 15.585  11.860  58.612  1.00 38.37 ? 200 ILE B C   1 
ATOM   3451 O O   . ILE B 1 223 ? 15.055  11.389  59.607  1.00 38.12 ? 200 ILE B O   1 
ATOM   3452 C CB  . ILE B 1 223 ? 14.166  12.465  56.608  1.00 34.52 ? 200 ILE B CB  1 
ATOM   3453 C CG1 . ILE B 1 223 ? 13.115  13.487  56.166  1.00 30.16 ? 200 ILE B CG1 1 
ATOM   3454 C CG2 . ILE B 1 223 ? 13.543  11.104  56.912  1.00 31.51 ? 200 ILE B CG2 1 
ATOM   3455 C CD1 . ILE B 1 223 ? 12.425  13.146  54.893  1.00 27.76 ? 200 ILE B CD1 1 
ATOM   3456 N N   . MET B 1 224 ? 16.751  11.423  58.150  1.00 40.57 ? 201 MET B N   1 
ATOM   3457 C CA  . MET B 1 224 ? 17.453  10.323  58.799  1.00 43.89 ? 201 MET B CA  1 
ATOM   3458 C C   . MET B 1 224 ? 18.002  10.676  60.167  1.00 46.69 ? 201 MET B C   1 
ATOM   3459 O O   . MET B 1 224 ? 17.720  9.990   61.147  1.00 47.29 ? 201 MET B O   1 
ATOM   3460 C CB  . MET B 1 224 ? 18.598  9.830   57.920  1.00 44.40 ? 201 MET B CB  1 
ATOM   3461 C CG  . MET B 1 224 ? 18.152  9.113   56.673  1.00 43.19 ? 201 MET B CG  1 
ATOM   3462 S SD  . MET B 1 224 ? 19.561  8.559   55.731  1.00 44.99 ? 201 MET B SD  1 
ATOM   3463 C CE  . MET B 1 224 ? 19.848  9.944   54.695  1.00 42.30 ? 201 MET B CE  1 
ATOM   3464 N N   . GLN B 1 225 ? 18.806  11.732  60.228  1.00 50.46 ? 202 GLN B N   1 
ATOM   3465 C CA  . GLN B 1 225 ? 19.398  12.176  61.487  1.00 53.99 ? 202 GLN B CA  1 
ATOM   3466 C C   . GLN B 1 225 ? 18.300  12.308  62.526  1.00 55.42 ? 202 GLN B C   1 
ATOM   3467 O O   . GLN B 1 225 ? 18.450  11.919  63.687  1.00 55.18 ? 202 GLN B O   1 
ATOM   3468 C CB  . GLN B 1 225 ? 20.081  13.530  61.292  1.00 54.41 ? 202 GLN B CB  1 
ATOM   3469 C CG  . GLN B 1 225 ? 21.269  13.482  60.360  1.00 56.87 ? 202 GLN B CG  1 
ATOM   3470 C CD  . GLN B 1 225 ? 22.388  12.607  60.898  1.00 59.09 ? 202 GLN B CD  1 
ATOM   3471 O OE1 . GLN B 1 225 ? 22.182  11.430  61.221  1.00 59.77 ? 202 GLN B OE1 1 
ATOM   3472 N NE2 . GLN B 1 225 ? 23.583  13.178  60.997  1.00 59.06 ? 202 GLN B NE2 1 
ATOM   3473 N N   . GLN B 1 226 ? 17.193  12.869  62.067  1.00 57.67 ? 203 GLN B N   1 
ATOM   3474 C CA  . GLN B 1 226 ? 16.007  13.105  62.865  1.00 60.31 ? 203 GLN B CA  1 
ATOM   3475 C C   . GLN B 1 226 ? 15.512  11.832  63.558  1.00 60.98 ? 203 GLN B C   1 
ATOM   3476 O O   . GLN B 1 226 ? 15.369  11.785  64.786  1.00 61.45 ? 203 GLN B O   1 
ATOM   3477 C CB  . GLN B 1 226 ? 14.924  13.676  61.936  1.00 62.44 ? 203 GLN B CB  1 
ATOM   3478 C CG  . GLN B 1 226 ? 13.491  13.593  62.438  1.00 66.41 ? 203 GLN B CG  1 
ATOM   3479 C CD  . GLN B 1 226 ? 12.504  13.292  61.313  1.00 68.68 ? 203 GLN B CD  1 
ATOM   3480 O OE1 . GLN B 1 226 ? 12.407  14.035  60.333  1.00 69.01 ? 203 GLN B OE1 1 
ATOM   3481 N NE2 . GLN B 1 226 ? 11.770  12.192  61.452  1.00 69.36 ? 203 GLN B NE2 1 
ATOM   3482 N N   . MET B 1 227 ? 15.273  10.797  62.759  1.00 60.09 ? 204 MET B N   1 
ATOM   3483 C CA  . MET B 1 227 ? 14.754  9.532   63.256  1.00 59.02 ? 204 MET B CA  1 
ATOM   3484 C C   . MET B 1 227 ? 15.746  8.587   63.914  1.00 57.49 ? 204 MET B C   1 
ATOM   3485 O O   . MET B 1 227 ? 15.354  7.732   64.697  1.00 58.28 ? 204 MET B O   1 
ATOM   3486 C CB  . MET B 1 227 ? 14.053  8.801   62.123  1.00 60.60 ? 204 MET B CB  1 
ATOM   3487 C CG  . MET B 1 227 ? 13.032  9.645   61.408  1.00 61.69 ? 204 MET B CG  1 
ATOM   3488 S SD  . MET B 1 227 ? 12.231  8.698   60.122  1.00 64.93 ? 204 MET B SD  1 
ATOM   3489 C CE  . MET B 1 227 ? 13.646  8.311   59.074  1.00 64.46 ? 204 MET B CE  1 
ATOM   3490 N N   . SER B 1 228 ? 17.023  8.704   63.587  1.00 56.13 ? 205 SER B N   1 
ATOM   3491 C CA  . SER B 1 228 ? 17.989  7.825   64.213  1.00 54.97 ? 205 SER B CA  1 
ATOM   3492 C C   . SER B 1 228 ? 18.026  8.165   65.689  1.00 55.48 ? 205 SER B C   1 
ATOM   3493 O O   . SER B 1 228 ? 17.864  9.321   66.072  1.00 55.23 ? 205 SER B O   1 
ATOM   3494 C CB  . SER B 1 228 ? 19.376  8.016   63.611  1.00 52.93 ? 205 SER B CB  1 
ATOM   3495 O OG  . SER B 1 228 ? 20.324  7.227   64.306  1.00 51.24 ? 205 SER B OG  1 
ATOM   3496 N N   . ASP B 1 229 ? 18.223  7.157   66.524  1.00 57.30 ? 206 ASP B N   1 
ATOM   3497 C CA  . ASP B 1 229 ? 18.283  7.395   67.953  1.00 58.71 ? 206 ASP B CA  1 
ATOM   3498 C C   . ASP B 1 229 ? 19.593  8.111   68.278  1.00 58.34 ? 206 ASP B C   1 
ATOM   3499 O O   . ASP B 1 229 ? 19.936  8.311   69.439  1.00 57.21 ? 206 ASP B O   1 
ATOM   3500 C CB  . ASP B 1 229 ? 18.170  6.069   68.723  1.00 60.84 ? 206 ASP B CB  1 
ATOM   3501 C CG  . ASP B 1 229 ? 16.825  5.367   68.498  1.00 63.36 ? 206 ASP B CG  1 
ATOM   3502 O OD1 . ASP B 1 229 ? 15.786  6.068   68.437  1.00 63.64 ? 206 ASP B OD1 1 
ATOM   3503 O OD2 . ASP B 1 229 ? 16.803  4.116   68.394  1.00 63.62 ? 206 ASP B OD2 1 
ATOM   3504 N N   . HIS B 1 230 ? 20.315  8.511   67.236  1.00 58.39 ? 207 HIS B N   1 
ATOM   3505 C CA  . HIS B 1 230 ? 21.583  9.207   67.410  1.00 58.46 ? 207 HIS B CA  1 
ATOM   3506 C C   . HIS B 1 230 ? 21.971  10.026  66.173  1.00 56.20 ? 207 HIS B C   1 
ATOM   3507 O O   . HIS B 1 230 ? 21.438  9.813   65.085  1.00 57.10 ? 207 HIS B O   1 
ATOM   3508 C CB  . HIS B 1 230 ? 22.683  8.197   67.751  1.00 60.84 ? 207 HIS B CB  1 
ATOM   3509 C CG  . HIS B 1 230 ? 24.056  8.789   67.780  1.00 65.92 ? 207 HIS B CG  1 
ATOM   3510 N ND1 . HIS B 1 230 ? 24.315  10.037  68.305  1.00 68.15 ? 207 HIS B ND1 1 
ATOM   3511 C CD2 . HIS B 1 230 ? 25.245  8.314   67.340  1.00 67.62 ? 207 HIS B CD2 1 
ATOM   3512 C CE1 . HIS B 1 230 ? 25.603  10.307  68.184  1.00 69.13 ? 207 HIS B CE1 1 
ATOM   3513 N NE2 . HIS B 1 230 ? 26.190  9.277   67.600  1.00 70.06 ? 207 HIS B NE2 1 
ATOM   3514 N N   . ARG B 1 231 ? 22.897  10.966  66.346  1.00 52.68 ? 208 ARG B N   1 
ATOM   3515 C CA  . ARG B 1 231 ? 23.353  11.807  65.240  1.00 49.35 ? 208 ARG B CA  1 
ATOM   3516 C C   . ARG B 1 231 ? 24.592  11.239  64.539  1.00 46.32 ? 208 ARG B C   1 
ATOM   3517 O O   . ARG B 1 231 ? 25.655  11.082  65.142  1.00 44.76 ? 208 ARG B O   1 
ATOM   3518 C CB  . ARG B 1 231 ? 23.641  13.231  65.744  1.00 49.37 ? 208 ARG B CB  1 
ATOM   3519 N N   . TYR B 1 232 ? 24.440  10.933  63.256  1.00 43.24 ? 209 TYR B N   1 
ATOM   3520 C CA  . TYR B 1 232 ? 25.531  10.397  62.461  1.00 40.88 ? 209 TYR B CA  1 
ATOM   3521 C C   . TYR B 1 232 ? 26.473  11.503  62.029  1.00 38.83 ? 209 TYR B C   1 
ATOM   3522 O O   . TYR B 1 232 ? 26.071  12.648  61.875  1.00 37.71 ? 209 TYR B O   1 
ATOM   3523 C CB  . TYR B 1 232 ? 24.997  9.706   61.200  1.00 42.20 ? 209 TYR B CB  1 
ATOM   3524 C CG  . TYR B 1 232 ? 24.435  8.320   61.420  1.00 42.89 ? 209 TYR B CG  1 
ATOM   3525 C CD1 . TYR B 1 232 ? 23.124  8.134   61.851  1.00 42.60 ? 209 TYR B CD1 1 
ATOM   3526 C CD2 . TYR B 1 232 ? 25.233  7.189   61.225  1.00 42.27 ? 209 TYR B CD2 1 
ATOM   3527 C CE1 . TYR B 1 232 ? 22.620  6.852   62.086  1.00 42.82 ? 209 TYR B CE1 1 
ATOM   3528 C CE2 . TYR B 1 232 ? 24.743  5.908   61.458  1.00 41.83 ? 209 TYR B CE2 1 
ATOM   3529 C CZ  . TYR B 1 232 ? 23.437  5.746   61.892  1.00 43.14 ? 209 TYR B CZ  1 
ATOM   3530 O OH  . TYR B 1 232 ? 22.959  4.481   62.165  1.00 43.44 ? 209 TYR B OH  1 
ATOM   3531 N N   . ASP B 1 233 ? 27.737  11.156  61.839  1.00 37.98 ? 210 ASP B N   1 
ATOM   3532 C CA  . ASP B 1 233 ? 28.710  12.126  61.373  1.00 36.28 ? 210 ASP B CA  1 
ATOM   3533 C C   . ASP B 1 233 ? 28.547  12.075  59.873  1.00 35.82 ? 210 ASP B C   1 
ATOM   3534 O O   . ASP B 1 233 ? 28.154  11.042  59.339  1.00 35.02 ? 210 ASP B O   1 
ATOM   3535 C CB  . ASP B 1 233 ? 30.117  11.711  61.790  1.00 34.99 ? 210 ASP B CB  1 
ATOM   3536 C CG  . ASP B 1 233 ? 30.296  11.728  63.298  1.00 34.03 ? 210 ASP B CG  1 
ATOM   3537 O OD1 . ASP B 1 233 ? 30.089  10.682  63.944  1.00 33.72 ? 210 ASP B OD1 1 
ATOM   3538 O OD2 . ASP B 1 233 ? 30.622  12.800  63.842  1.00 34.26 ? 210 ASP B OD2 1 
ATOM   3539 N N   . LYS B 1 234 ? 28.813  13.175  59.181  1.00 36.72 ? 211 LYS B N   1 
ATOM   3540 C CA  . LYS B 1 234 ? 28.641  13.165  57.729  1.00 38.60 ? 211 LYS B CA  1 
ATOM   3541 C C   . LYS B 1 234 ? 29.833  13.638  56.912  1.00 38.44 ? 211 LYS B C   1 
ATOM   3542 O O   . LYS B 1 234 ? 30.666  14.404  57.383  1.00 40.70 ? 211 LYS B O   1 
ATOM   3543 C CB  . LYS B 1 234 ? 27.410  13.996  57.321  1.00 40.04 ? 211 LYS B CB  1 
ATOM   3544 C CG  . LYS B 1 234 ? 27.568  15.510  57.489  1.00 42.82 ? 211 LYS B CG  1 
ATOM   3545 C CD  . LYS B 1 234 ? 26.382  16.286  56.925  1.00 42.16 ? 211 LYS B CD  1 
ATOM   3546 C CE  . LYS B 1 234 ? 26.537  17.774  57.194  1.00 43.17 ? 211 LYS B CE  1 
ATOM   3547 N NZ  . LYS B 1 234 ? 25.432  18.595  56.613  1.00 44.48 ? 211 LYS B NZ  1 
ATOM   3548 N N   . LEU B 1 235 ? 29.903  13.145  55.678  1.00 37.57 ? 212 LEU B N   1 
ATOM   3549 C CA  . LEU B 1 235 ? 30.938  13.516  54.717  1.00 34.40 ? 212 LEU B CA  1 
ATOM   3550 C C   . LEU B 1 235 ? 30.156  13.967  53.477  1.00 32.01 ? 212 LEU B C   1 
ATOM   3551 O O   . LEU B 1 235 ? 29.507  13.152  52.800  1.00 32.20 ? 212 LEU B O   1 
ATOM   3552 C CB  . LEU B 1 235 ? 31.835  12.322  54.376  1.00 35.22 ? 212 LEU B CB  1 
ATOM   3553 C CG  . LEU B 1 235 ? 33.058  12.651  53.508  1.00 36.59 ? 212 LEU B CG  1 
ATOM   3554 C CD1 . LEU B 1 235 ? 34.072  13.469  54.294  1.00 35.11 ? 212 LEU B CD1 1 
ATOM   3555 C CD2 . LEU B 1 235 ? 33.700  11.361  53.051  1.00 37.89 ? 212 LEU B CD2 1 
ATOM   3556 N N   . THR B 1 236 ? 30.204  15.269  53.208  1.00 28.11 ? 213 THR B N   1 
ATOM   3557 C CA  . THR B 1 236 ? 29.490  15.871  52.094  1.00 27.43 ? 213 THR B CA  1 
ATOM   3558 C C   . THR B 1 236 ? 30.296  15.948  50.789  1.00 27.97 ? 213 THR B C   1 
ATOM   3559 O O   . THR B 1 236 ? 31.462  16.346  50.782  1.00 28.04 ? 213 THR B O   1 
ATOM   3560 C CB  . THR B 1 236 ? 28.995  17.279  52.504  1.00 26.55 ? 213 THR B CB  1 
ATOM   3561 O OG1 . THR B 1 236 ? 28.131  17.160  53.650  1.00 23.91 ? 213 THR B OG1 1 
ATOM   3562 C CG2 . THR B 1 236 ? 28.249  17.956  51.345  1.00 22.16 ? 213 THR B CG2 1 
ATOM   3563 N N   . VAL B 1 237 ? 29.667  15.544  49.688  1.00 28.09 ? 214 VAL B N   1 
ATOM   3564 C CA  . VAL B 1 237 ? 30.313  15.577  48.377  1.00 29.16 ? 214 VAL B CA  1 
ATOM   3565 C C   . VAL B 1 237 ? 29.518  16.508  47.480  1.00 30.50 ? 214 VAL B C   1 
ATOM   3566 O O   . VAL B 1 237 ? 28.311  16.662  47.648  1.00 32.03 ? 214 VAL B O   1 
ATOM   3567 C CB  . VAL B 1 237 ? 30.364  14.168  47.708  1.00 28.49 ? 214 VAL B CB  1 
ATOM   3568 C CG1 . VAL B 1 237 ? 31.217  13.234  48.529  1.00 27.93 ? 214 VAL B CG1 1 
ATOM   3569 C CG2 . VAL B 1 237 ? 28.962  13.606  47.571  1.00 27.78 ? 214 VAL B CG2 1 
ATOM   3570 N N   . PRO B 1 238 ? 30.184  17.149  46.511  1.00 32.78 ? 215 PRO B N   1 
ATOM   3571 C CA  . PRO B 1 238 ? 29.458  18.060  45.620  1.00 33.01 ? 215 PRO B CA  1 
ATOM   3572 C C   . PRO B 1 238 ? 28.572  17.386  44.557  1.00 35.38 ? 215 PRO B C   1 
ATOM   3573 O O   . PRO B 1 238 ? 27.726  18.042  43.946  1.00 37.20 ? 215 PRO B O   1 
ATOM   3574 C CB  . PRO B 1 238 ? 30.577  18.896  45.013  1.00 32.64 ? 215 PRO B CB  1 
ATOM   3575 C CG  . PRO B 1 238 ? 31.741  17.941  44.989  1.00 32.61 ? 215 PRO B CG  1 
ATOM   3576 C CD  . PRO B 1 238 ? 31.644  17.260  46.322  1.00 31.62 ? 215 PRO B CD  1 
ATOM   3577 N N   . ASP B 1 239 ? 28.765  16.087  44.331  1.00 36.19 ? 216 ASP B N   1 
ATOM   3578 C CA  . ASP B 1 239 ? 27.969  15.353  43.337  1.00 36.42 ? 216 ASP B CA  1 
ATOM   3579 C C   . ASP B 1 239 ? 27.165  14.268  44.016  1.00 35.95 ? 216 ASP B C   1 
ATOM   3580 O O   . ASP B 1 239 ? 27.740  13.283  44.489  1.00 35.98 ? 216 ASP B O   1 
ATOM   3581 C CB  . ASP B 1 239 ? 28.849  14.659  42.288  1.00 37.83 ? 216 ASP B CB  1 
ATOM   3582 C CG  . ASP B 1 239 ? 29.729  15.621  41.509  1.00 40.16 ? 216 ASP B CG  1 
ATOM   3583 O OD1 . ASP B 1 239 ? 30.826  15.959  42.007  1.00 41.00 ? 216 ASP B OD1 1 
ATOM   3584 O OD2 . ASP B 1 239 ? 29.326  16.029  40.393  1.00 41.13 ? 216 ASP B OD2 1 
ATOM   3585 N N   . ASP B 1 240 ? 25.847  14.439  44.049  1.00 33.84 ? 217 ASP B N   1 
ATOM   3586 C CA  . ASP B 1 240 ? 24.962  13.456  44.665  1.00 32.92 ? 217 ASP B CA  1 
ATOM   3587 C C   . ASP B 1 240 ? 25.350  12.011  44.358  1.00 31.89 ? 217 ASP B C   1 
ATOM   3588 O O   . ASP B 1 240 ? 25.335  11.155  45.240  1.00 32.82 ? 217 ASP B O   1 
ATOM   3589 C CB  . ASP B 1 240 ? 23.528  13.693  44.207  1.00 34.07 ? 217 ASP B CB  1 
ATOM   3590 C CG  . ASP B 1 240 ? 22.760  14.582  45.157  1.00 37.82 ? 217 ASP B CG  1 
ATOM   3591 O OD1 . ASP B 1 240 ? 23.412  15.341  45.913  1.00 38.96 ? 217 ASP B OD1 1 
ATOM   3592 O OD2 . ASP B 1 240 ? 21.507  14.527  45.139  1.00 38.20 ? 217 ASP B OD2 1 
ATOM   3593 N N   . ILE B 1 241 ? 25.710  11.744  43.110  1.00 28.73 ? 218 ILE B N   1 
ATOM   3594 C CA  . ILE B 1 241 ? 26.075  10.397  42.699  1.00 26.63 ? 218 ILE B CA  1 
ATOM   3595 C C   . ILE B 1 241 ? 27.403  9.906   43.228  1.00 26.27 ? 218 ILE B C   1 
ATOM   3596 O O   . ILE B 1 241 ? 27.599  8.696   43.414  1.00 26.66 ? 218 ILE B O   1 
ATOM   3597 C CB  . ILE B 1 241 ? 26.037  10.284  41.157  1.00 24.52 ? 218 ILE B CB  1 
ATOM   3598 C CG1 . ILE B 1 241 ? 24.610  9.967   40.736  1.00 23.58 ? 218 ILE B CG1 1 
ATOM   3599 C CG2 . ILE B 1 241 ? 27.002  9.230   40.643  1.00 24.63 ? 218 ILE B CG2 1 
ATOM   3600 C CD1 . ILE B 1 241 ? 24.407  10.022  39.280  1.00 28.29 ? 218 ILE B CD1 1 
ATOM   3601 N N   . ALA B 1 242 ? 28.320  10.829  43.478  1.00 25.34 ? 219 ALA B N   1 
ATOM   3602 C CA  . ALA B 1 242 ? 29.623  10.421  43.977  1.00 24.39 ? 219 ALA B CA  1 
ATOM   3603 C C   . ALA B 1 242 ? 29.509  9.931   45.424  1.00 22.86 ? 219 ALA B C   1 
ATOM   3604 O O   . ALA B 1 242 ? 30.282  9.080   45.852  1.00 26.14 ? 219 ALA B O   1 
ATOM   3605 C CB  . ALA B 1 242 ? 30.613  11.567  43.861  1.00 24.01 ? 219 ALA B CB  1 
ATOM   3606 N N   . ALA B 1 243 ? 28.526  10.434  46.167  1.00 20.31 ? 220 ALA B N   1 
ATOM   3607 C CA  . ALA B 1 243 ? 28.333  10.018  47.560  1.00 18.69 ? 220 ALA B CA  1 
ATOM   3608 C C   . ALA B 1 243 ? 28.129  8.504   47.714  1.00 18.31 ? 220 ALA B C   1 
ATOM   3609 O O   . ALA B 1 243 ? 28.057  7.993   48.831  1.00 18.40 ? 220 ALA B O   1 
ATOM   3610 C CB  . ALA B 1 243 ? 27.153  10.746  48.164  1.00 15.36 ? 220 ALA B CB  1 
ATOM   3611 N N   . ASN B 1 244 ? 28.009  7.801   46.595  1.00 16.58 ? 221 ASN B N   1 
ATOM   3612 C CA  . ASN B 1 244 ? 27.823  6.358   46.618  1.00 15.40 ? 221 ASN B CA  1 
ATOM   3613 C C   . ASN B 1 244 ? 29.233  5.800   46.533  1.00 15.17 ? 221 ASN B C   1 
ATOM   3614 O O   . ASN B 1 244 ? 29.957  6.036   45.561  1.00 14.15 ? 221 ASN B O   1 
ATOM   3615 C CB  . ASN B 1 244 ? 26.959  5.898   45.413  1.00 14.74 ? 221 ASN B CB  1 
ATOM   3616 C CG  . ASN B 1 244 ? 26.633  4.392   45.448  1.00 19.00 ? 221 ASN B CG  1 
ATOM   3617 O OD1 . ASN B 1 244 ? 27.453  3.556   45.042  1.00 18.05 ? 221 ASN B OD1 1 
ATOM   3618 N ND2 . ASN B 1 244 ? 25.433  4.043   45.949  1.00 14.80 ? 221 ASN B ND2 1 
ATOM   3619 N N   . CYS B 1 245 ? 29.639  5.092   47.576  1.00 14.06 ? 222 CYS B N   1 
ATOM   3620 C CA  . CYS B 1 245 ? 30.961  4.510   47.604  1.00 14.15 ? 222 CYS B CA  1 
ATOM   3621 C C   . CYS B 1 245 ? 30.852  3.231   48.399  1.00 14.30 ? 222 CYS B C   1 
ATOM   3622 O O   . CYS B 1 245 ? 29.771  2.695   48.550  1.00 15.22 ? 222 CYS B O   1 
ATOM   3623 C CB  . CYS B 1 245 ? 31.941  5.458   48.278  1.00 17.33 ? 222 CYS B CB  1 
ATOM   3624 S SG  . CYS B 1 245 ? 31.584  5.696   50.008  1.00 27.60 ? 222 CYS B SG  1 
ATOM   3625 N N   . ILE B 1 246 ? 31.970  2.743   48.907  1.00 13.04 ? 223 ILE B N   1 
ATOM   3626 C CA  . ILE B 1 246 ? 31.956  1.531   49.685  1.00 11.25 ? 223 ILE B CA  1 
ATOM   3627 C C   . ILE B 1 246 ? 33.033  1.536   50.733  1.00 14.97 ? 223 ILE B C   1 
ATOM   3628 O O   . ILE B 1 246 ? 34.211  1.714   50.437  1.00 16.35 ? 223 ILE B O   1 
ATOM   3629 C CB  . ILE B 1 246 ? 32.144  0.279   48.800  1.00 12.49 ? 223 ILE B CB  1 
ATOM   3630 C CG1 . ILE B 1 246 ? 30.797  -0.189  48.252  1.00 15.77 ? 223 ILE B CG1 1 
ATOM   3631 C CG2 . ILE B 1 246 ? 32.746  -0.840  49.592  1.00 7.38  ? 223 ILE B CG2 1 
ATOM   3632 C CD1 . ILE B 1 246 ? 30.922  -1.340  47.248  1.00 21.57 ? 223 ILE B CD1 1 
ATOM   3633 N N   . TYR B 1 247 ? 32.618  1.337   51.970  1.00 17.06 ? 224 TYR B N   1 
ATOM   3634 C CA  . TYR B 1 247 ? 33.552  1.269   53.067  1.00 18.89 ? 224 TYR B CA  1 
ATOM   3635 C C   . TYR B 1 247 ? 33.685  -0.181  53.488  1.00 22.29 ? 224 TYR B C   1 
ATOM   3636 O O   . TYR B 1 247 ? 32.722  -0.949  53.437  1.00 21.63 ? 224 TYR B O   1 
ATOM   3637 C CB  . TYR B 1 247 ? 33.046  2.061   54.264  1.00 21.32 ? 224 TYR B CB  1 
ATOM   3638 C CG  . TYR B 1 247 ? 33.835  1.774   55.519  1.00 23.22 ? 224 TYR B CG  1 
ATOM   3639 C CD1 . TYR B 1 247 ? 34.957  2.528   55.845  1.00 23.35 ? 224 TYR B CD1 1 
ATOM   3640 C CD2 . TYR B 1 247 ? 33.478  0.723   56.366  1.00 22.61 ? 224 TYR B CD2 1 
ATOM   3641 C CE1 . TYR B 1 247 ? 35.700  2.247   56.984  1.00 24.69 ? 224 TYR B CE1 1 
ATOM   3642 C CE2 . TYR B 1 247 ? 34.219  0.430   57.504  1.00 23.47 ? 224 TYR B CE2 1 
ATOM   3643 C CZ  . TYR B 1 247 ? 35.329  1.196   57.812  1.00 24.94 ? 224 TYR B CZ  1 
ATOM   3644 O OH  . TYR B 1 247 ? 36.072  0.925   58.950  1.00 26.80 ? 224 TYR B OH  1 
ATOM   3645 N N   . LEU B 1 248 ? 34.886  -0.541  53.913  1.00 24.45 ? 225 LEU B N   1 
ATOM   3646 C CA  . LEU B 1 248 ? 35.166  -1.879  54.403  1.00 27.99 ? 225 LEU B CA  1 
ATOM   3647 C C   . LEU B 1 248 ? 36.226  -1.752  55.445  1.00 30.53 ? 225 LEU B C   1 
ATOM   3648 O O   . LEU B 1 248 ? 37.103  -0.891  55.354  1.00 32.63 ? 225 LEU B O   1 
ATOM   3649 C CB  . LEU B 1 248 ? 35.728  -2.806  53.335  1.00 27.43 ? 225 LEU B CB  1 
ATOM   3650 C CG  . LEU B 1 248 ? 34.866  -3.302  52.195  1.00 29.97 ? 225 LEU B CG  1 
ATOM   3651 C CD1 . LEU B 1 248 ? 35.043  -2.387  51.003  1.00 30.73 ? 225 LEU B CD1 1 
ATOM   3652 C CD2 . LEU B 1 248 ? 35.302  -4.707  51.835  1.00 30.24 ? 225 LEU B CD2 1 
ATOM   3653 N N   . ASN B 1 249 ? 36.136  -2.607  56.447  1.00 33.12 ? 226 ASN B N   1 
ATOM   3654 C CA  . ASN B 1 249 ? 37.140  -2.629  57.476  1.00 34.34 ? 226 ASN B CA  1 
ATOM   3655 C C   . ASN B 1 249 ? 37.922  -3.898  57.169  1.00 34.07 ? 226 ASN B C   1 
ATOM   3656 O O   . ASN B 1 249 ? 37.504  -4.998  57.524  1.00 33.66 ? 226 ASN B O   1 
ATOM   3657 C CB  . ASN B 1 249 ? 36.511  -2.699  58.859  1.00 34.06 ? 226 ASN B CB  1 
ATOM   3658 C CG  . ASN B 1 249 ? 37.553  -2.822  59.949  1.00 35.51 ? 226 ASN B CG  1 
ATOM   3659 O OD1 . ASN B 1 249 ? 38.083  -3.905  60.196  1.00 34.48 ? 226 ASN B OD1 1 
ATOM   3660 N ND2 . ASN B 1 249 ? 37.873  -1.701  60.592  1.00 36.01 ? 226 ASN B ND2 1 
ATOM   3661 N N   . ILE B 1 250 ? 39.036  -3.726  56.465  1.00 34.39 ? 227 ILE B N   1 
ATOM   3662 C CA  . ILE B 1 250 ? 39.894  -4.829  56.080  1.00 35.15 ? 227 ILE B CA  1 
ATOM   3663 C C   . ILE B 1 250 ? 41.004  -5.049  57.109  1.00 36.58 ? 227 ILE B C   1 
ATOM   3664 O O   . ILE B 1 250 ? 41.687  -4.109  57.526  1.00 33.55 ? 227 ILE B O   1 
ATOM   3665 C CB  . ILE B 1 250 ? 40.496  -4.559  54.699  1.00 35.25 ? 227 ILE B CB  1 
ATOM   3666 N N   . PRO B 1 251 ? 41.182  -6.302  57.552  1.00 37.51 ? 228 PRO B N   1 
ATOM   3667 C CA  . PRO B 1 251 ? 42.226  -6.607  58.533  1.00 38.45 ? 228 PRO B CA  1 
ATOM   3668 C C   . PRO B 1 251 ? 43.641  -6.308  58.037  1.00 38.36 ? 228 PRO B C   1 
ATOM   3669 O O   . PRO B 1 251 ? 43.957  -6.490  56.857  1.00 39.62 ? 228 PRO B O   1 
ATOM   3670 C CB  . PRO B 1 251 ? 42.001  -8.095  58.835  1.00 37.90 ? 228 PRO B CB  1 
ATOM   3671 C CG  . PRO B 1 251 ? 41.287  -8.613  57.614  1.00 36.69 ? 228 PRO B CG  1 
ATOM   3672 C CD  . PRO B 1 251 ? 40.352  -7.489  57.277  1.00 38.20 ? 228 PRO B CD  1 
ATOM   3673 N N   . ASN B 1 252 ? 44.480  -5.847  58.958  1.00 40.58 ? 229 ASN B N   1 
ATOM   3674 C CA  . ASN B 1 252 ? 45.870  -5.505  58.673  1.00 43.26 ? 229 ASN B CA  1 
ATOM   3675 C C   . ASN B 1 252 ? 45.943  -4.207  57.880  1.00 43.45 ? 229 ASN B C   1 
ATOM   3676 O O   . ASN B 1 252 ? 47.028  -3.724  57.550  1.00 44.48 ? 229 ASN B O   1 
ATOM   3677 C CB  . ASN B 1 252 ? 46.549  -6.639  57.900  1.00 43.80 ? 229 ASN B CB  1 
ATOM   3678 N N   . LYS B 1 253 ? 44.774  -3.646  57.592  1.00 43.77 ? 230 LYS B N   1 
ATOM   3679 C CA  . LYS B 1 253 ? 44.672  -2.404  56.836  1.00 43.71 ? 230 LYS B CA  1 
ATOM   3680 C C   . LYS B 1 253 ? 43.917  -1.316  57.599  1.00 43.33 ? 230 LYS B C   1 
ATOM   3681 O O   . LYS B 1 253 ? 44.456  -0.243  57.845  1.00 43.30 ? 230 LYS B O   1 
ATOM   3682 C CB  . LYS B 1 253 ? 43.986  -2.673  55.503  1.00 44.48 ? 230 LYS B CB  1 
ATOM   3683 N N   . GLY B 1 254 ? 42.669  -1.604  57.969  1.00 41.82 ? 231 GLY B N   1 
ATOM   3684 C CA  . GLY B 1 254 ? 41.854  -0.640  58.685  1.00 39.68 ? 231 GLY B CA  1 
ATOM   3685 C C   . GLY B 1 254 ? 40.801  -0.033  57.773  1.00 39.54 ? 231 GLY B C   1 
ATOM   3686 O O   . GLY B 1 254 ? 40.097  -0.757  57.066  1.00 37.90 ? 231 GLY B O   1 
ATOM   3687 N N   . HIS B 1 255 ? 40.702  1.297   57.783  1.00 39.12 ? 232 HIS B N   1 
ATOM   3688 C CA  . HIS B 1 255 ? 39.740  2.033   56.955  1.00 38.42 ? 232 HIS B CA  1 
ATOM   3689 C C   . HIS B 1 255 ? 40.051  1.966   55.459  1.00 36.92 ? 232 HIS B C   1 
ATOM   3690 O O   . HIS B 1 255 ? 41.085  2.466   55.013  1.00 36.81 ? 232 HIS B O   1 
ATOM   3691 C CB  . HIS B 1 255 ? 39.708  3.510   57.355  1.00 40.87 ? 232 HIS B CB  1 
ATOM   3692 C CG  . HIS B 1 255 ? 39.167  3.765   58.727  1.00 42.08 ? 232 HIS B CG  1 
ATOM   3693 N ND1 . HIS B 1 255 ? 37.845  3.558   59.058  1.00 41.70 ? 232 HIS B ND1 1 
ATOM   3694 C CD2 . HIS B 1 255 ? 39.761  4.259   59.839  1.00 43.41 ? 232 HIS B CD2 1 
ATOM   3695 C CE1 . HIS B 1 255 ? 37.647  3.918   60.313  1.00 42.87 ? 232 HIS B CE1 1 
ATOM   3696 N NE2 . HIS B 1 255 ? 38.794  4.348   60.811  1.00 42.80 ? 232 HIS B NE2 1 
ATOM   3697 N N   . VAL B 1 256 ? 39.136  1.376   54.692  1.00 34.42 ? 233 VAL B N   1 
ATOM   3698 C CA  . VAL B 1 256 ? 39.299  1.255   53.248  1.00 30.93 ? 233 VAL B CA  1 
ATOM   3699 C C   . VAL B 1 256 ? 38.049  1.753   52.526  1.00 30.37 ? 233 VAL B C   1 
ATOM   3700 O O   . VAL B 1 256 ? 36.941  1.280   52.790  1.00 30.25 ? 233 VAL B O   1 
ATOM   3701 C CB  . VAL B 1 256 ? 39.544  -0.192  52.841  1.00 29.10 ? 233 VAL B CB  1 
ATOM   3702 C CG1 . VAL B 1 256 ? 39.867  -0.263  51.379  1.00 28.67 ? 233 VAL B CG1 1 
ATOM   3703 C CG2 . VAL B 1 256 ? 40.673  -0.774  53.666  1.00 30.75 ? 233 VAL B CG2 1 
ATOM   3704 N N   . LEU B 1 257 ? 38.234  2.713   51.622  1.00 28.02 ? 234 LEU B N   1 
ATOM   3705 C CA  . LEU B 1 257 ? 37.128  3.278   50.861  1.00 25.91 ? 234 LEU B CA  1 
ATOM   3706 C C   . LEU B 1 257 ? 37.390  3.317   49.350  1.00 24.15 ? 234 LEU B C   1 
ATOM   3707 O O   . LEU B 1 257 ? 38.390  3.854   48.894  1.00 23.72 ? 234 LEU B O   1 
ATOM   3708 C CB  . LEU B 1 257 ? 36.829  4.695   51.342  1.00 26.44 ? 234 LEU B CB  1 
ATOM   3709 C CG  . LEU B 1 257 ? 35.500  5.238   50.815  1.00 28.37 ? 234 LEU B CG  1 
ATOM   3710 C CD1 . LEU B 1 257 ? 34.354  4.566   51.569  1.00 29.19 ? 234 LEU B CD1 1 
ATOM   3711 C CD2 . LEU B 1 257 ? 35.427  6.729   51.010  1.00 28.61 ? 234 LEU B CD2 1 
ATOM   3712 N N   . LEU B 1 258 ? 36.473  2.752   48.577  1.00 23.03 ? 235 LEU B N   1 
ATOM   3713 C CA  . LEU B 1 258 ? 36.581  2.738   47.127  1.00 20.94 ? 235 LEU B CA  1 
ATOM   3714 C C   . LEU B 1 258 ? 35.655  3.852   46.662  1.00 20.75 ? 235 LEU B C   1 
ATOM   3715 O O   . LEU B 1 258 ? 34.460  3.829   46.955  1.00 22.35 ? 235 LEU B O   1 
ATOM   3716 C CB  . LEU B 1 258 ? 36.141  1.364   46.592  1.00 19.24 ? 235 LEU B CB  1 
ATOM   3717 C CG  . LEU B 1 258 ? 37.098  0.198   46.934  1.00 20.92 ? 235 LEU B CG  1 
ATOM   3718 C CD1 . LEU B 1 258 ? 37.430  0.190   48.414  1.00 15.17 ? 235 LEU B CD1 1 
ATOM   3719 C CD2 . LEU B 1 258 ? 36.481  -1.143  46.552  1.00 23.74 ? 235 LEU B CD2 1 
ATOM   3720 N N   . HIS B 1 259 ? 36.202  4.848   45.975  1.00 20.18 ? 236 HIS B N   1 
ATOM   3721 C CA  . HIS B 1 259 ? 35.382  5.965   45.530  1.00 21.69 ? 236 HIS B CA  1 
ATOM   3722 C C   . HIS B 1 259 ? 35.558  6.250   44.054  1.00 21.33 ? 236 HIS B C   1 
ATOM   3723 O O   . HIS B 1 259 ? 36.515  5.790   43.455  1.00 22.63 ? 236 HIS B O   1 
ATOM   3724 C CB  . HIS B 1 259 ? 35.737  7.213   46.331  1.00 23.55 ? 236 HIS B CB  1 
ATOM   3725 C CG  . HIS B 1 259 ? 37.185  7.560   46.266  1.00 26.73 ? 236 HIS B CG  1 
ATOM   3726 N ND1 . HIS B 1 259 ? 38.123  6.981   47.092  1.00 30.57 ? 236 HIS B ND1 1 
ATOM   3727 C CD2 . HIS B 1 259 ? 37.875  8.343   45.402  1.00 27.40 ? 236 HIS B CD2 1 
ATOM   3728 C CE1 . HIS B 1 259 ? 39.330  7.388   46.737  1.00 30.29 ? 236 HIS B CE1 1 
ATOM   3729 N NE2 . HIS B 1 259 ? 39.206  8.213   45.714  1.00 27.42 ? 236 HIS B NE2 1 
ATOM   3730 N N   . ARG B 1 260 ? 34.639  7.016   43.471  1.00 22.51 ? 237 ARG B N   1 
ATOM   3731 C CA  . ARG B 1 260 ? 34.721  7.351   42.047  1.00 27.05 ? 237 ARG B CA  1 
ATOM   3732 C C   . ARG B 1 260 ? 36.006  8.126   41.729  1.00 29.36 ? 237 ARG B C   1 
ATOM   3733 O O   . ARG B 1 260 ? 36.419  9.010   42.484  1.00 31.69 ? 237 ARG B O   1 
ATOM   3734 C CB  . ARG B 1 260 ? 33.504  8.175   41.616  1.00 24.93 ? 237 ARG B CB  1 
ATOM   3735 C CG  . ARG B 1 260 ? 32.159  7.577   42.017  1.00 28.95 ? 237 ARG B CG  1 
ATOM   3736 C CD  . ARG B 1 260 ? 31.964  6.170   41.465  1.00 27.37 ? 237 ARG B CD  1 
ATOM   3737 N NE  . ARG B 1 260 ? 32.136  6.154   40.019  1.00 29.16 ? 237 ARG B NE  1 
ATOM   3738 C CZ  . ARG B 1 260 ? 31.220  6.568   39.146  1.00 30.09 ? 237 ARG B CZ  1 
ATOM   3739 N NH1 . ARG B 1 260 ? 30.055  7.024   39.580  1.00 29.84 ? 237 ARG B NH1 1 
ATOM   3740 N NH2 . ARG B 1 260 ? 31.478  6.547   37.842  1.00 25.04 ? 237 ARG B NH2 1 
ATOM   3741 N N   . THR B 1 261 ? 36.630  7.795   40.607  1.00 31.23 ? 238 THR B N   1 
ATOM   3742 C CA  . THR B 1 261 ? 37.873  8.444   40.194  1.00 33.73 ? 238 THR B CA  1 
ATOM   3743 C C   . THR B 1 261 ? 37.764  9.969   40.054  1.00 36.92 ? 238 THR B C   1 
ATOM   3744 O O   . THR B 1 261 ? 36.666  10.534  39.959  1.00 35.39 ? 238 THR B O   1 
ATOM   3745 C CB  . THR B 1 261 ? 38.341  7.892   38.844  1.00 31.93 ? 238 THR B CB  1 
ATOM   3746 O OG1 . THR B 1 261 ? 37.446  8.335   37.819  1.00 32.72 ? 238 THR B OG1 1 
ATOM   3747 C CG2 . THR B 1 261 ? 38.345  6.376   38.858  1.00 29.44 ? 238 THR B CG2 1 
ATOM   3748 N N   . PRO B 1 262 ? 38.911  10.661  40.070  1.00 39.65 ? 239 PRO B N   1 
ATOM   3749 C CA  . PRO B 1 262 ? 38.885  12.121  39.926  1.00 41.35 ? 239 PRO B CA  1 
ATOM   3750 C C   . PRO B 1 262 ? 38.553  12.455  38.474  1.00 43.83 ? 239 PRO B C   1 
ATOM   3751 O O   . PRO B 1 262 ? 38.254  13.595  38.145  1.00 43.42 ? 239 PRO B O   1 
ATOM   3752 C CB  . PRO B 1 262 ? 40.306  12.537  40.295  1.00 40.10 ? 239 PRO B CB  1 
ATOM   3753 C CG  . PRO B 1 262 ? 40.737  11.465  41.246  1.00 40.63 ? 239 PRO B CG  1 
ATOM   3754 C CD  . PRO B 1 262 ? 40.215  10.210  40.582  1.00 39.73 ? 239 PRO B CD  1 
ATOM   3755 N N   . GLU B 1 263 ? 38.615  11.445  37.607  1.00 46.64 ? 240 GLU B N   1 
ATOM   3756 C CA  . GLU B 1 263 ? 38.306  11.628  36.192  1.00 50.73 ? 240 GLU B CA  1 
ATOM   3757 C C   . GLU B 1 263 ? 36.805  11.470  35.961  1.00 51.47 ? 240 GLU B C   1 
ATOM   3758 O O   . GLU B 1 263 ? 36.337  11.438  34.822  1.00 52.60 ? 240 GLU B O   1 
ATOM   3759 C CB  . GLU B 1 263 ? 39.061  10.605  35.333  1.00 52.83 ? 240 GLU B CB  1 
ATOM   3760 C CG  . GLU B 1 263 ? 38.828  10.766  33.822  1.00 56.68 ? 240 GLU B CG  1 
ATOM   3761 C CD  . GLU B 1 263 ? 39.396  9.617   32.983  1.00 59.75 ? 240 GLU B CD  1 
ATOM   3762 O OE1 . GLU B 1 263 ? 39.220  9.651   31.745  1.00 60.92 ? 240 GLU B OE1 1 
ATOM   3763 O OE2 . GLU B 1 263 ? 40.012  8.681   33.548  1.00 59.92 ? 240 GLU B OE2 1 
ATOM   3764 N N   . GLU B 1 264 ? 36.053  11.361  37.050  1.00 52.74 ? 241 GLU B N   1 
ATOM   3765 C CA  . GLU B 1 264 ? 34.603  11.206  36.974  1.00 53.32 ? 241 GLU B CA  1 
ATOM   3766 C C   . GLU B 1 264 ? 33.939  12.280  37.819  1.00 53.13 ? 241 GLU B C   1 
ATOM   3767 O O   . GLU B 1 264 ? 32.950  12.885  37.407  1.00 53.30 ? 241 GLU B O   1 
ATOM   3768 C CB  . GLU B 1 264 ? 34.179  9.823   37.486  1.00 54.07 ? 241 GLU B CB  1 
ATOM   3769 C CG  . GLU B 1 264 ? 34.698  8.645   36.668  1.00 54.74 ? 241 GLU B CG  1 
ATOM   3770 C CD  . GLU B 1 264 ? 34.307  7.306   37.268  1.00 55.21 ? 241 GLU B CD  1 
ATOM   3771 O OE1 . GLU B 1 264 ? 34.653  7.057   38.443  1.00 54.38 ? 241 GLU B OE1 1 
ATOM   3772 O OE2 . GLU B 1 264 ? 33.657  6.504   36.566  1.00 53.85 ? 241 GLU B OE2 1 
ATOM   3773 N N   . TYR B 1 265 ? 34.495  12.496  39.008  1.00 52.84 ? 242 TYR B N   1 
ATOM   3774 C CA  . TYR B 1 265 ? 33.992  13.487  39.954  1.00 51.70 ? 242 TYR B CA  1 
ATOM   3775 C C   . TYR B 1 265 ? 35.174  14.018  40.767  1.00 49.29 ? 242 TYR B C   1 
ATOM   3776 O O   . TYR B 1 265 ? 35.239  13.830  41.982  1.00 49.49 ? 242 TYR B O   1 
ATOM   3777 C CB  . TYR B 1 265 ? 32.960  12.843  40.888  1.00 52.82 ? 242 TYR B CB  1 
ATOM   3778 C CG  . TYR B 1 265 ? 31.749  12.275  40.178  1.00 53.17 ? 242 TYR B CG  1 
ATOM   3779 C CD1 . TYR B 1 265 ? 31.589  10.901  40.007  1.00 53.80 ? 242 TYR B CD1 1 
ATOM   3780 C CD2 . TYR B 1 265 ? 30.759  13.116  39.681  1.00 53.93 ? 242 TYR B CD2 1 
ATOM   3781 C CE1 . TYR B 1 265 ? 30.465  10.385  39.363  1.00 53.14 ? 242 TYR B CE1 1 
ATOM   3782 C CE2 . TYR B 1 265 ? 29.639  12.614  39.035  1.00 53.72 ? 242 TYR B CE2 1 
ATOM   3783 C CZ  . TYR B 1 265 ? 29.497  11.253  38.880  1.00 53.90 ? 242 TYR B CZ  1 
ATOM   3784 O OH  . TYR B 1 265 ? 28.381  10.777  38.241  1.00 53.99 ? 242 TYR B OH  1 
ATOM   3785 N N   . PRO B 1 266 ? 36.110  14.714  40.100  1.00 47.02 ? 243 PRO B N   1 
ATOM   3786 C CA  . PRO B 1 266 ? 37.314  15.289  40.711  1.00 44.04 ? 243 PRO B CA  1 
ATOM   3787 C C   . PRO B 1 266 ? 37.041  16.164  41.917  1.00 41.68 ? 243 PRO B C   1 
ATOM   3788 O O   . PRO B 1 266 ? 37.889  16.295  42.788  1.00 41.01 ? 243 PRO B O   1 
ATOM   3789 C CB  . PRO B 1 266 ? 37.942  16.072  39.565  1.00 44.17 ? 243 PRO B CB  1 
ATOM   3790 C CG  . PRO B 1 266 ? 36.745  16.552  38.823  1.00 45.70 ? 243 PRO B CG  1 
ATOM   3791 C CD  . PRO B 1 266 ? 35.872  15.314  38.775  1.00 46.53 ? 243 PRO B CD  1 
ATOM   3792 N N   . GLU B 1 267 ? 35.862  16.767  41.969  1.00 40.93 ? 244 GLU B N   1 
ATOM   3793 C CA  . GLU B 1 267 ? 35.514  17.624  43.101  1.00 41.75 ? 244 GLU B CA  1 
ATOM   3794 C C   . GLU B 1 267 ? 35.038  16.783  44.279  1.00 40.84 ? 244 GLU B C   1 
ATOM   3795 O O   . GLU B 1 267 ? 35.301  17.090  45.450  1.00 40.25 ? 244 GLU B O   1 
ATOM   3796 C CB  . GLU B 1 267 ? 34.432  18.630  42.701  1.00 41.24 ? 244 GLU B CB  1 
ATOM   3797 C CG  . GLU B 1 267 ? 34.828  19.513  41.520  1.00 43.79 ? 244 GLU B CG  1 
ATOM   3798 C CD  . GLU B 1 267 ? 36.280  19.985  41.582  1.00 43.99 ? 244 GLU B CD  1 
ATOM   3799 O OE1 . GLU B 1 267 ? 36.693  20.527  42.626  1.00 43.16 ? 244 GLU B OE1 1 
ATOM   3800 O OE2 . GLU B 1 267 ? 37.006  19.817  40.577  1.00 44.97 ? 244 GLU B OE2 1 
ATOM   3801 N N   . SER B 1 268 ? 34.328  15.713  43.963  1.00 39.48 ? 245 SER B N   1 
ATOM   3802 C CA  . SER B 1 268 ? 33.853  14.830  44.999  1.00 37.80 ? 245 SER B CA  1 
ATOM   3803 C C   . SER B 1 268 ? 35.035  13.971  45.399  1.00 37.31 ? 245 SER B C   1 
ATOM   3804 O O   . SER B 1 268 ? 35.143  13.558  46.540  1.00 35.65 ? 245 SER B O   1 
ATOM   3805 C CB  . SER B 1 268 ? 32.711  13.982  44.465  1.00 36.24 ? 245 SER B CB  1 
ATOM   3806 O OG  . SER B 1 268 ? 31.659  14.826  44.046  1.00 31.64 ? 245 SER B OG  1 
ATOM   3807 N N   . ALA B 1 269 ? 35.939  13.743  44.451  1.00 39.49 ? 246 ALA B N   1 
ATOM   3808 C CA  . ALA B 1 269 ? 37.129  12.935  44.689  1.00 43.06 ? 246 ALA B CA  1 
ATOM   3809 C C   . ALA B 1 269 ? 38.081  13.640  45.646  1.00 45.46 ? 246 ALA B C   1 
ATOM   3810 O O   . ALA B 1 269 ? 38.722  13.004  46.480  1.00 46.68 ? 246 ALA B O   1 
ATOM   3811 C CB  . ALA B 1 269 ? 37.834  12.647  43.373  1.00 41.06 ? 246 ALA B CB  1 
ATOM   3812 N N   . LYS B 1 270 ? 38.193  14.955  45.514  1.00 48.58 ? 247 LYS B N   1 
ATOM   3813 C CA  . LYS B 1 270 ? 39.058  15.718  46.405  1.00 51.48 ? 247 LYS B CA  1 
ATOM   3814 C C   . LYS B 1 270 ? 38.532  15.593  47.839  1.00 52.77 ? 247 LYS B C   1 
ATOM   3815 O O   . LYS B 1 270 ? 39.304  15.519  48.798  1.00 53.27 ? 247 LYS B O   1 
ATOM   3816 C CB  . LYS B 1 270 ? 39.087  17.189  45.983  1.00 51.93 ? 247 LYS B CB  1 
ATOM   3817 C CG  . LYS B 1 270 ? 39.812  17.442  44.675  1.00 52.62 ? 247 LYS B CG  1 
ATOM   3818 C CD  . LYS B 1 270 ? 39.715  18.902  44.273  1.00 53.69 ? 247 LYS B CD  1 
ATOM   3819 C CE  . LYS B 1 270 ? 40.400  19.159  42.941  1.00 52.93 ? 247 LYS B CE  1 
ATOM   3820 N NZ  . LYS B 1 270 ? 40.249  20.577  42.515  1.00 53.63 ? 247 LYS B NZ  1 
ATOM   3821 N N   . VAL B 1 271 ? 37.210  15.563  47.974  1.00 53.71 ? 248 VAL B N   1 
ATOM   3822 C CA  . VAL B 1 271 ? 36.579  15.434  49.277  1.00 53.87 ? 248 VAL B CA  1 
ATOM   3823 C C   . VAL B 1 271 ? 37.011  14.139  49.959  1.00 54.96 ? 248 VAL B C   1 
ATOM   3824 O O   . VAL B 1 271 ? 37.123  14.088  51.185  1.00 55.91 ? 248 VAL B O   1 
ATOM   3825 C CB  . VAL B 1 271 ? 35.042  15.443  49.154  1.00 53.84 ? 248 VAL B CB  1 
ATOM   3826 C CG1 . VAL B 1 271 ? 34.412  15.216  50.520  1.00 51.63 ? 248 VAL B CG1 1 
ATOM   3827 C CG2 . VAL B 1 271 ? 34.574  16.764  48.555  1.00 52.95 ? 248 VAL B CG2 1 
ATOM   3828 N N   . TYR B 1 272 ? 37.251  13.093  49.169  1.00 55.30 ? 249 TYR B N   1 
ATOM   3829 C CA  . TYR B 1 272 ? 37.674  11.802  49.722  1.00 55.78 ? 249 TYR B CA  1 
ATOM   3830 C C   . TYR B 1 272 ? 39.168  11.781  50.023  1.00 55.66 ? 249 TYR B C   1 
ATOM   3831 O O   . TYR B 1 272 ? 39.603  11.177  51.004  1.00 54.66 ? 249 TYR B O   1 
ATOM   3832 C CB  . TYR B 1 272 ? 37.346  10.652  48.763  1.00 55.20 ? 249 TYR B CB  1 
ATOM   3833 C CG  . TYR B 1 272 ? 35.870  10.330  48.613  1.00 55.31 ? 249 TYR B CG  1 
ATOM   3834 C CD1 . TYR B 1 272 ? 35.113  10.884  47.583  1.00 56.30 ? 249 TYR B CD1 1 
ATOM   3835 C CD2 . TYR B 1 272 ? 35.243  9.443   49.477  1.00 53.75 ? 249 TYR B CD2 1 
ATOM   3836 C CE1 . TYR B 1 272 ? 33.765  10.557  47.413  1.00 54.35 ? 249 TYR B CE1 1 
ATOM   3837 C CE2 . TYR B 1 272 ? 33.901  9.109   49.318  1.00 54.43 ? 249 TYR B CE2 1 
ATOM   3838 C CZ  . TYR B 1 272 ? 33.169  9.668   48.284  1.00 54.52 ? 249 TYR B CZ  1 
ATOM   3839 O OH  . TYR B 1 272 ? 31.847  9.329   48.116  1.00 53.54 ? 249 TYR B OH  1 
ATOM   3840 N N   . GLU B 1 273 ? 39.949  12.431  49.166  1.00 55.93 ? 250 GLU B N   1 
ATOM   3841 C CA  . GLU B 1 273 ? 41.393  12.502  49.350  1.00 57.10 ? 250 GLU B CA  1 
ATOM   3842 C C   . GLU B 1 273 ? 41.706  13.093  50.730  1.00 56.51 ? 250 GLU B C   1 
ATOM   3843 O O   . GLU B 1 273 ? 42.742  12.793  51.328  1.00 55.08 ? 250 GLU B O   1 
ATOM   3844 C CB  . GLU B 1 273 ? 42.024  13.369  48.250  1.00 59.72 ? 250 GLU B CB  1 
ATOM   3845 C CG  . GLU B 1 273 ? 42.042  12.746  46.848  1.00 63.22 ? 250 GLU B CG  1 
ATOM   3846 C CD  . GLU B 1 273 ? 43.141  11.697  46.673  1.00 66.24 ? 250 GLU B CD  1 
ATOM   3847 O OE1 . GLU B 1 273 ? 44.329  12.051  46.830  1.00 67.96 ? 250 GLU B OE1 1 
ATOM   3848 O OE2 . GLU B 1 273 ? 42.824  10.521  46.373  1.00 67.09 ? 250 GLU B OE2 1 
ATOM   3849 N N   . LYS B 1 274 ? 40.791  13.918  51.236  1.00 55.87 ? 251 LYS B N   1 
ATOM   3850 C CA  . LYS B 1 274 ? 40.973  14.562  52.529  1.00 55.63 ? 251 LYS B CA  1 
ATOM   3851 C C   . LYS B 1 274 ? 40.733  13.665  53.728  1.00 55.79 ? 251 LYS B C   1 
ATOM   3852 O O   . LYS B 1 274 ? 40.972  14.071  54.859  1.00 57.79 ? 251 LYS B O   1 
ATOM   3853 C CB  . LYS B 1 274 ? 40.088  15.806  52.639  1.00 54.68 ? 251 LYS B CB  1 
ATOM   3854 C CG  . LYS B 1 274 ? 40.406  16.878  51.609  1.00 54.05 ? 251 LYS B CG  1 
ATOM   3855 C CD  . LYS B 1 274 ? 40.088  18.267  52.137  1.00 54.10 ? 251 LYS B CD  1 
ATOM   3856 C CE  . LYS B 1 274 ? 41.019  18.640  53.294  1.00 54.41 ? 251 LYS B CE  1 
ATOM   3857 N NZ  . LYS B 1 274 ? 40.727  19.986  53.859  1.00 52.29 ? 251 LYS B NZ  1 
ATOM   3858 N N   . LEU B 1 275 ? 40.246  12.454  53.500  1.00 56.83 ? 252 LEU B N   1 
ATOM   3859 C CA  . LEU B 1 275 ? 40.027  11.524  54.606  1.00 57.42 ? 252 LEU B CA  1 
ATOM   3860 C C   . LEU B 1 275 ? 41.400  10.935  54.893  1.00 57.37 ? 252 LEU B C   1 
ATOM   3861 O O   . LEU B 1 275 ? 41.931  10.149  54.114  1.00 58.25 ? 252 LEU B O   1 
ATOM   3862 C CB  . LEU B 1 275 ? 39.034  10.438  54.197  1.00 58.12 ? 252 LEU B CB  1 
ATOM   3863 C CG  . LEU B 1 275 ? 37.614  10.966  53.985  1.00 57.80 ? 252 LEU B CG  1 
ATOM   3864 C CD1 . LEU B 1 275 ? 36.857  10.063  53.032  1.00 57.21 ? 252 LEU B CD1 1 
ATOM   3865 C CD2 . LEU B 1 275 ? 36.908  11.068  55.329  1.00 58.39 ? 252 LEU B CD2 1 
ATOM   3866 N N   . LYS B 1 276 ? 41.966  11.318  56.026  1.00 57.30 ? 253 LYS B N   1 
ATOM   3867 C CA  . LYS B 1 276 ? 43.308  10.904  56.387  1.00 57.78 ? 253 LYS B CA  1 
ATOM   3868 C C   . LYS B 1 276 ? 43.552  9.523   57.010  1.00 57.93 ? 253 LYS B C   1 
ATOM   3869 O O   . LYS B 1 276 ? 44.617  8.936   56.794  1.00 57.33 ? 253 LYS B O   1 
ATOM   3870 C CB  . LYS B 1 276 ? 43.916  12.022  57.237  1.00 59.39 ? 253 LYS B CB  1 
ATOM   3871 C CG  . LYS B 1 276 ? 43.873  13.373  56.500  1.00 59.95 ? 253 LYS B CG  1 
ATOM   3872 C CD  . LYS B 1 276 ? 44.393  14.547  57.320  1.00 62.30 ? 253 LYS B CD  1 
ATOM   3873 C CE  . LYS B 1 276 ? 43.415  14.977  58.402  1.00 62.09 ? 253 LYS B CE  1 
ATOM   3874 N NZ  . LYS B 1 276 ? 43.949  16.142  59.161  1.00 62.70 ? 253 LYS B NZ  1 
ATOM   3875 N N   . ASP B 1 277 ? 42.590  8.990   57.760  1.00 57.74 ? 254 ASP B N   1 
ATOM   3876 C CA  . ASP B 1 277 ? 42.764  7.667   58.370  1.00 57.23 ? 254 ASP B CA  1 
ATOM   3877 C C   . ASP B 1 277 ? 42.219  6.553   57.459  1.00 56.79 ? 254 ASP B C   1 
ATOM   3878 O O   . ASP B 1 277 ? 42.168  5.377   57.842  1.00 57.03 ? 254 ASP B O   1 
ATOM   3879 C CB  . ASP B 1 277 ? 42.072  7.622   59.733  1.00 57.31 ? 254 ASP B CB  1 
ATOM   3880 N N   . HIS B 1 278 ? 41.830  6.937   56.245  1.00 54.24 ? 255 HIS B N   1 
ATOM   3881 C CA  . HIS B 1 278 ? 41.272  6.012   55.259  1.00 51.87 ? 255 HIS B CA  1 
ATOM   3882 C C   . HIS B 1 278 ? 42.215  5.615   54.133  1.00 51.57 ? 255 HIS B C   1 
ATOM   3883 O O   . HIS B 1 278 ? 43.030  6.417   53.663  1.00 52.17 ? 255 HIS B O   1 
ATOM   3884 C CB  . HIS B 1 278 ? 40.042  6.623   54.581  1.00 47.99 ? 255 HIS B CB  1 
ATOM   3885 C CG  . HIS B 1 278 ? 38.754  6.368   55.291  1.00 44.41 ? 255 HIS B CG  1 
ATOM   3886 N ND1 . HIS B 1 278 ? 38.433  6.965   56.489  1.00 42.84 ? 255 HIS B ND1 1 
ATOM   3887 C CD2 . HIS B 1 278 ? 37.683  5.618   54.945  1.00 43.54 ? 255 HIS B CD2 1 
ATOM   3888 C CE1 . HIS B 1 278 ? 37.216  6.600   56.848  1.00 41.89 ? 255 HIS B CE1 1 
ATOM   3889 N NE2 . HIS B 1 278 ? 36.739  5.783   55.927  1.00 42.27 ? 255 HIS B NE2 1 
ATOM   3890 N N   . MET B 1 279 ? 42.084  4.370   53.689  1.00 49.30 ? 256 MET B N   1 
ATOM   3891 C CA  . MET B 1 279 ? 42.861  3.914   52.554  1.00 46.97 ? 256 MET B CA  1 
ATOM   3892 C C   . MET B 1 279 ? 41.981  4.296   51.358  1.00 44.70 ? 256 MET B C   1 
ATOM   3893 O O   . MET B 1 279 ? 40.808  3.938   51.301  1.00 42.73 ? 256 MET B O   1 
ATOM   3894 C CB  . MET B 1 279 ? 43.066  2.402   52.580  1.00 47.44 ? 256 MET B CB  1 
ATOM   3895 C CG  . MET B 1 279 ? 43.772  1.917   51.333  1.00 48.97 ? 256 MET B CG  1 
ATOM   3896 S SD  . MET B 1 279 ? 44.216  0.194   51.359  1.00 51.93 ? 256 MET B SD  1 
ATOM   3897 C CE  . MET B 1 279 ? 45.727  0.255   52.355  1.00 51.25 ? 256 MET B CE  1 
ATOM   3898 N N   . LEU B 1 280 ? 42.528  5.039   50.411  1.00 42.20 ? 257 LEU B N   1 
ATOM   3899 C CA  . LEU B 1 280 ? 41.722  5.438   49.280  1.00 40.31 ? 257 LEU B CA  1 
ATOM   3900 C C   . LEU B 1 280 ? 41.989  4.583   48.059  1.00 38.55 ? 257 LEU B C   1 
ATOM   3901 O O   . LEU B 1 280 ? 43.120  4.179   47.798  1.00 39.60 ? 257 LEU B O   1 
ATOM   3902 C CB  . LEU B 1 280 ? 41.947  6.922   48.970  1.00 40.58 ? 257 LEU B CB  1 
ATOM   3903 C CG  . LEU B 1 280 ? 41.539  7.864   50.115  1.00 40.04 ? 257 LEU B CG  1 
ATOM   3904 C CD1 . LEU B 1 280 ? 41.999  9.265   49.805  1.00 40.54 ? 257 LEU B CD1 1 
ATOM   3905 C CD2 . LEU B 1 280 ? 40.028  7.827   50.318  1.00 39.98 ? 257 LEU B CD2 1 
ATOM   3906 N N   . ILE B 1 281 ? 40.925  4.295   47.322  1.00 35.79 ? 258 ILE B N   1 
ATOM   3907 C CA  . ILE B 1 281 ? 41.029  3.500   46.122  1.00 33.26 ? 258 ILE B CA  1 
ATOM   3908 C C   . ILE B 1 281 ? 40.069  4.012   45.059  1.00 32.70 ? 258 ILE B C   1 
ATOM   3909 O O   . ILE B 1 281 ? 38.889  3.668   45.035  1.00 31.31 ? 258 ILE B O   1 
ATOM   3910 C CB  . ILE B 1 281 ? 40.745  2.023   46.417  1.00 31.86 ? 258 ILE B CB  1 
ATOM   3911 C CG1 . ILE B 1 281 ? 41.776  1.498   47.417  1.00 31.69 ? 258 ILE B CG1 1 
ATOM   3912 C CG2 . ILE B 1 281 ? 40.792  1.220   45.135  1.00 32.93 ? 258 ILE B CG2 1 
ATOM   3913 C CD1 . ILE B 1 281 ? 41.678  0.021   47.692  1.00 28.92 ? 258 ILE B CD1 1 
ATOM   3914 N N   . PRO B 1 282 ? 40.571  4.869   44.165  1.00 33.30 ? 259 PRO B N   1 
ATOM   3915 C CA  . PRO B 1 282 ? 39.688  5.385   43.120  1.00 33.34 ? 259 PRO B CA  1 
ATOM   3916 C C   . PRO B 1 282 ? 39.246  4.196   42.288  1.00 32.96 ? 259 PRO B C   1 
ATOM   3917 O O   . PRO B 1 282 ? 40.040  3.307   41.987  1.00 33.60 ? 259 PRO B O   1 
ATOM   3918 C CB  . PRO B 1 282 ? 40.581  6.364   42.357  1.00 32.37 ? 259 PRO B CB  1 
ATOM   3919 C CG  . PRO B 1 282 ? 41.951  5.783   42.539  1.00 34.53 ? 259 PRO B CG  1 
ATOM   3920 C CD  . PRO B 1 282 ? 41.951  5.348   43.987  1.00 32.68 ? 259 PRO B CD  1 
ATOM   3921 N N   . VAL B 1 283 ? 37.967  4.168   41.951  1.00 32.40 ? 260 VAL B N   1 
ATOM   3922 C CA  . VAL B 1 283 ? 37.417  3.073   41.176  1.00 30.77 ? 260 VAL B CA  1 
ATOM   3923 C C   . VAL B 1 283 ? 36.454  3.640   40.142  1.00 31.66 ? 260 VAL B C   1 
ATOM   3924 O O   . VAL B 1 283 ? 35.476  4.300   40.484  1.00 31.21 ? 260 VAL B O   1 
ATOM   3925 C CB  . VAL B 1 283 ? 36.691  2.077   42.101  1.00 28.14 ? 260 VAL B CB  1 
ATOM   3926 C CG1 . VAL B 1 283 ? 36.206  0.875   41.318  1.00 26.90 ? 260 VAL B CG1 1 
ATOM   3927 C CG2 . VAL B 1 283 ? 37.623  1.646   43.199  1.00 27.58 ? 260 VAL B CG2 1 
ATOM   3928 N N   . SER B 1 284 ? 36.754  3.386   38.875  1.00 33.38 ? 261 SER B N   1 
ATOM   3929 C CA  . SER B 1 284 ? 35.940  3.871   37.778  1.00 35.58 ? 261 SER B CA  1 
ATOM   3930 C C   . SER B 1 284 ? 34.681  3.023   37.608  1.00 37.09 ? 261 SER B C   1 
ATOM   3931 O O   . SER B 1 284 ? 34.717  1.793   37.718  1.00 37.76 ? 261 SER B O   1 
ATOM   3932 C CB  . SER B 1 284 ? 36.766  3.851   36.483  1.00 35.79 ? 261 SER B CB  1 
ATOM   3933 O OG  . SER B 1 284 ? 36.138  4.598   35.453  1.00 38.27 ? 261 SER B OG  1 
ATOM   3934 N N   . MET B 1 285 ? 33.564  3.690   37.348  1.00 37.92 ? 262 MET B N   1 
ATOM   3935 C CA  . MET B 1 285 ? 32.295  3.009   37.128  1.00 39.20 ? 262 MET B CA  1 
ATOM   3936 C C   . MET B 1 285 ? 31.679  3.518   35.834  1.00 39.60 ? 262 MET B C   1 
ATOM   3937 O O   . MET B 1 285 ? 31.102  2.738   35.074  1.00 42.14 ? 262 MET B O   1 
ATOM   3938 C CB  . MET B 1 285 ? 31.322  3.259   38.285  1.00 39.31 ? 262 MET B CB  1 
ATOM   3939 C CG  . MET B 1 285 ? 31.301  2.162   39.329  1.00 42.89 ? 262 MET B CG  1 
ATOM   3940 S SD  . MET B 1 285 ? 30.998  0.521   38.630  1.00 46.70 ? 262 MET B SD  1 
ATOM   3941 C CE  . MET B 1 285 ? 32.661  -0.047  38.436  1.00 43.39 ? 262 MET B CE  1 
ATOM   3942 N N   . SER B 1 286 ? 31.825  4.827   35.605  1.00 38.27 ? 263 SER B N   1 
ATOM   3943 C CA  . SER B 1 286 ? 31.310  5.550   34.434  1.00 36.37 ? 263 SER B CA  1 
ATOM   3944 C C   . SER B 1 286 ? 30.438  4.790   33.431  1.00 36.24 ? 263 SER B C   1 
ATOM   3945 O O   . SER B 1 286 ? 29.278  5.156   33.223  1.00 36.09 ? 263 SER B O   1 
ATOM   3946 C CB  . SER B 1 286 ? 32.460  6.238   33.686  1.00 34.13 ? 263 SER B CB  1 
ATOM   3947 O OG  . SER B 1 286 ? 33.499  5.339   33.351  1.00 33.94 ? 263 SER B OG  1 
ATOM   3948 N N   . GLU B 1 287 ? 30.981  3.752   32.797  1.00 35.22 ? 264 GLU B N   1 
ATOM   3949 C CA  . GLU B 1 287 ? 30.195  2.989   31.833  1.00 35.51 ? 264 GLU B CA  1 
ATOM   3950 C C   . GLU B 1 287 ? 28.915  2.403   32.434  1.00 34.13 ? 264 GLU B C   1 
ATOM   3951 O O   . GLU B 1 287 ? 27.829  2.598   31.886  1.00 34.40 ? 264 GLU B O   1 
ATOM   3952 C CB  . GLU B 1 287 ? 31.028  1.869   31.196  1.00 36.83 ? 264 GLU B CB  1 
ATOM   3953 C CG  . GLU B 1 287 ? 31.816  2.285   29.953  1.00 38.76 ? 264 GLU B CG  1 
ATOM   3954 C CD  . GLU B 1 287 ? 30.947  2.957   28.899  1.00 41.55 ? 264 GLU B CD  1 
ATOM   3955 O OE1 . GLU B 1 287 ? 29.798  2.507   28.687  1.00 40.89 ? 264 GLU B OE1 1 
ATOM   3956 O OE2 . GLU B 1 287 ? 31.419  3.933   28.274  1.00 43.52 ? 264 GLU B OE2 1 
ATOM   3957 N N   . LEU B 1 288 ? 29.032  1.700   33.554  1.00 31.13 ? 265 LEU B N   1 
ATOM   3958 C CA  . LEU B 1 288 ? 27.856  1.115   34.171  1.00 32.66 ? 265 LEU B CA  1 
ATOM   3959 C C   . LEU B 1 288 ? 26.952  2.176   34.797  1.00 32.80 ? 265 LEU B C   1 
ATOM   3960 O O   . LEU B 1 288 ? 25.788  1.921   35.103  1.00 31.98 ? 265 LEU B O   1 
ATOM   3961 C CB  . LEU B 1 288 ? 28.280  0.070   35.200  1.00 33.05 ? 265 LEU B CB  1 
ATOM   3962 C CG  . LEU B 1 288 ? 29.046  -1.093  34.549  1.00 34.55 ? 265 LEU B CG  1 
ATOM   3963 C CD1 . LEU B 1 288 ? 29.366  -2.172  35.580  1.00 34.98 ? 265 LEU B CD1 1 
ATOM   3964 C CD2 . LEU B 1 288 ? 28.205  -1.678  33.420  1.00 34.86 ? 265 LEU B CD2 1 
ATOM   3965 N N   . GLU B 1 289 ? 27.498  3.374   34.966  1.00 33.38 ? 266 GLU B N   1 
ATOM   3966 C CA  . GLU B 1 289 ? 26.751  4.491   35.521  1.00 32.14 ? 266 GLU B CA  1 
ATOM   3967 C C   . GLU B 1 289 ? 25.713  4.934   34.493  1.00 31.62 ? 266 GLU B C   1 
ATOM   3968 O O   . GLU B 1 289 ? 24.678  5.504   34.846  1.00 30.10 ? 266 GLU B O   1 
ATOM   3969 C CB  . GLU B 1 289 ? 27.700  5.644   35.846  1.00 30.72 ? 266 GLU B CB  1 
ATOM   3970 C CG  . GLU B 1 289 ? 27.017  6.857   36.437  1.00 34.32 ? 266 GLU B CG  1 
ATOM   3971 C CD  . GLU B 1 289 ? 27.992  7.928   36.931  1.00 35.16 ? 266 GLU B CD  1 
ATOM   3972 O OE1 . GLU B 1 289 ? 28.749  7.656   37.883  1.00 35.27 ? 266 GLU B OE1 1 
ATOM   3973 O OE2 . GLU B 1 289 ? 28.002  9.045   36.371  1.00 36.45 ? 266 GLU B OE2 1 
ATOM   3974 N N   . LYS B 1 290 ? 25.988  4.642   33.223  1.00 31.27 ? 267 LYS B N   1 
ATOM   3975 C CA  . LYS B 1 290 ? 25.094  5.013   32.128  1.00 32.28 ? 267 LYS B CA  1 
ATOM   3976 C C   . LYS B 1 290 ? 23.771  4.273   32.258  1.00 33.31 ? 267 LYS B C   1 
ATOM   3977 O O   . LYS B 1 290 ? 22.739  4.710   31.739  1.00 32.46 ? 267 LYS B O   1 
ATOM   3978 C CB  . LYS B 1 290 ? 25.747  4.700   30.771  1.00 32.52 ? 267 LYS B CB  1 
ATOM   3979 C CG  . LYS B 1 290 ? 26.986  5.555   30.442  1.00 33.32 ? 267 LYS B CG  1 
ATOM   3980 C CD  . LYS B 1 290 ? 27.670  5.136   29.129  1.00 32.33 ? 267 LYS B CD  1 
ATOM   3981 C CE  . LYS B 1 290 ? 28.858  6.038   28.805  1.00 32.08 ? 267 LYS B CE  1 
ATOM   3982 N NZ  . LYS B 1 290 ? 29.528  5.723   27.503  1.00 31.81 ? 267 LYS B NZ  1 
ATOM   3983 N N   . VAL B 1 291 ? 23.810  3.143   32.956  1.00 33.16 ? 268 VAL B N   1 
ATOM   3984 C CA  . VAL B 1 291 ? 22.611  2.351   33.173  1.00 31.45 ? 268 VAL B CA  1 
ATOM   3985 C C   . VAL B 1 291 ? 22.261  2.319   34.664  1.00 31.84 ? 268 VAL B C   1 
ATOM   3986 O O   . VAL B 1 291 ? 21.657  1.370   35.174  1.00 31.76 ? 268 VAL B O   1 
ATOM   3987 C CB  . VAL B 1 291 ? 22.773  0.911   32.592  1.00 30.60 ? 268 VAL B CB  1 
ATOM   3988 C CG1 . VAL B 1 291 ? 22.883  0.987   31.068  1.00 27.73 ? 268 VAL B CG1 1 
ATOM   3989 C CG2 . VAL B 1 291 ? 23.983  0.221   33.191  1.00 29.70 ? 268 VAL B CG2 1 
ATOM   3990 N N   . ASP B 1 292 ? 22.649  3.393   35.346  1.00 31.97 ? 269 ASP B N   1 
ATOM   3991 C CA  . ASP B 1 292 ? 22.395  3.583   36.767  1.00 31.66 ? 269 ASP B CA  1 
ATOM   3992 C C   . ASP B 1 292 ? 23.104  2.624   37.703  1.00 30.93 ? 269 ASP B C   1 
ATOM   3993 O O   . ASP B 1 292 ? 22.638  2.381   38.818  1.00 31.00 ? 269 ASP B O   1 
ATOM   3994 C CB  . ASP B 1 292 ? 20.897  3.533   37.030  1.00 30.49 ? 269 ASP B CB  1 
ATOM   3995 C CG  . ASP B 1 292 ? 20.168  4.627   36.320  1.00 28.99 ? 269 ASP B CG  1 
ATOM   3996 O OD1 . ASP B 1 292 ? 20.736  5.729   36.254  1.00 28.60 ? 269 ASP B OD1 1 
ATOM   3997 O OD2 . ASP B 1 292 ? 19.040  4.395   35.843  1.00 28.48 ? 269 ASP B OD2 1 
ATOM   3998 N N   . GLY B 1 293 ? 24.236  2.097   37.248  1.00 30.33 ? 270 GLY B N   1 
ATOM   3999 C CA  . GLY B 1 293 ? 25.007  1.169   38.055  1.00 28.94 ? 270 GLY B CA  1 
ATOM   4000 C C   . GLY B 1 293 ? 26.174  1.847   38.750  1.00 28.51 ? 270 GLY B C   1 
ATOM   4001 O O   . GLY B 1 293 ? 27.120  2.313   38.108  1.00 28.63 ? 270 GLY B O   1 
ATOM   4002 N N   . LEU B 1 294 ? 26.103  1.902   40.073  1.00 27.49 ? 271 LEU B N   1 
ATOM   4003 C CA  . LEU B 1 294 ? 27.145  2.520   40.865  1.00 25.77 ? 271 LEU B CA  1 
ATOM   4004 C C   . LEU B 1 294 ? 28.037  1.473   41.509  1.00 26.73 ? 271 LEU B C   1 
ATOM   4005 O O   . LEU B 1 294 ? 28.059  0.310   41.095  1.00 27.72 ? 271 LEU B O   1 
ATOM   4006 C CB  . LEU B 1 294 ? 26.528  3.404   41.945  1.00 22.70 ? 271 LEU B CB  1 
ATOM   4007 C CG  . LEU B 1 294 ? 25.547  4.428   41.412  1.00 18.40 ? 271 LEU B CG  1 
ATOM   4008 C CD1 . LEU B 1 294 ? 25.091  5.290   42.545  1.00 18.20 ? 271 LEU B CD1 1 
ATOM   4009 C CD2 . LEU B 1 294 ? 26.200  5.258   40.309  1.00 18.38 ? 271 LEU B CD2 1 
ATOM   4010 N N   . LEU B 1 295 ? 28.763  1.907   42.532  1.00 27.18 ? 272 LEU B N   1 
ATOM   4011 C CA  . LEU B 1 295 ? 29.699  1.065   43.255  1.00 28.31 ? 272 LEU B CA  1 
ATOM   4012 C C   . LEU B 1 295 ? 29.049  0.015   44.121  1.00 26.96 ? 272 LEU B C   1 
ATOM   4013 O O   . LEU B 1 295 ? 29.395  -1.158  44.024  1.00 28.23 ? 272 LEU B O   1 
ATOM   4014 C CB  . LEU B 1 295 ? 30.626  1.938   44.104  1.00 29.30 ? 272 LEU B CB  1 
ATOM   4015 C CG  . LEU B 1 295 ? 31.799  2.527   43.322  1.00 31.75 ? 272 LEU B CG  1 
ATOM   4016 C CD1 . LEU B 1 295 ? 32.446  3.689   44.073  1.00 33.54 ? 272 LEU B CD1 1 
ATOM   4017 C CD2 . LEU B 1 295 ? 32.802  1.415   43.073  1.00 31.73 ? 272 LEU B CD2 1 
ATOM   4018 N N   . THR B 1 296 ? 28.117  0.423   44.973  1.00 25.22 ? 273 THR B N   1 
ATOM   4019 C CA  . THR B 1 296 ? 27.446  -0.538  45.849  1.00 25.75 ? 273 THR B CA  1 
ATOM   4020 C C   . THR B 1 296 ? 26.667  -1.567  45.030  1.00 26.32 ? 273 THR B C   1 
ATOM   4021 O O   . THR B 1 296 ? 26.582  -2.731  45.399  1.00 26.36 ? 273 THR B O   1 
ATOM   4022 C CB  . THR B 1 296 ? 26.459  0.153   46.804  1.00 23.14 ? 273 THR B CB  1 
ATOM   4023 O OG1 . THR B 1 296 ? 25.587  0.995   46.050  1.00 25.93 ? 273 THR B OG1 1 
ATOM   4024 C CG2 . THR B 1 296 ? 27.192  0.974   47.840  1.00 22.97 ? 273 THR B CG2 1 
ATOM   4025 N N   . SER B 1 297 ? 26.126  -1.119  43.904  1.00 26.06 ? 274 SER B N   1 
ATOM   4026 C CA  . SER B 1 297 ? 25.325  -1.947  43.015  1.00 26.96 ? 274 SER B CA  1 
ATOM   4027 C C   . SER B 1 297 ? 25.912  -3.266  42.535  1.00 28.00 ? 274 SER B C   1 
ATOM   4028 O O   . SER B 1 297 ? 25.188  -4.251  42.418  1.00 29.89 ? 274 SER B O   1 
ATOM   4029 C CB  . SER B 1 297 ? 24.927  -1.133  41.789  1.00 27.42 ? 274 SER B CB  1 
ATOM   4030 O OG  . SER B 1 297 ? 24.426  0.138   42.160  1.00 28.24 ? 274 SER B OG  1 
ATOM   4031 N N   . CYS B 1 298 ? 27.210  -3.307  42.262  1.00 26.91 ? 275 CYS B N   1 
ATOM   4032 C CA  . CYS B 1 298 ? 27.796  -4.531  41.731  1.00 27.18 ? 275 CYS B CA  1 
ATOM   4033 C C   . CYS B 1 298 ? 28.238  -5.630  42.685  1.00 28.17 ? 275 CYS B C   1 
ATOM   4034 O O   . CYS B 1 298 ? 28.701  -6.691  42.240  1.00 30.62 ? 275 CYS B O   1 
ATOM   4035 C CB  . CYS B 1 298 ? 28.955  -4.170  40.810  1.00 27.64 ? 275 CYS B CB  1 
ATOM   4036 S SG  . CYS B 1 298 ? 28.454  -3.029  39.525  1.00 33.19 ? 275 CYS B SG  1 
ATOM   4037 N N   . SER B 1 299 ? 28.103  -5.407  43.985  1.00 26.15 ? 276 SER B N   1 
ATOM   4038 C CA  . SER B 1 299 ? 28.502  -6.435  44.926  1.00 24.01 ? 276 SER B CA  1 
ATOM   4039 C C   . SER B 1 299 ? 27.609  -6.486  46.133  1.00 24.78 ? 276 SER B C   1 
ATOM   4040 O O   . SER B 1 299 ? 26.908  -5.534  46.434  1.00 26.21 ? 276 SER B O   1 
ATOM   4041 C CB  . SER B 1 299 ? 29.934  -6.207  45.398  1.00 23.52 ? 276 SER B CB  1 
ATOM   4042 O OG  . SER B 1 299 ? 30.047  -5.020  46.163  1.00 25.16 ? 276 SER B OG  1 
ATOM   4043 N N   . VAL B 1 300 ? 27.637  -7.618  46.816  1.00 24.95 ? 277 VAL B N   1 
ATOM   4044 C CA  . VAL B 1 300 ? 26.884  -7.796  48.037  1.00 25.04 ? 277 VAL B CA  1 
ATOM   4045 C C   . VAL B 1 300 ? 27.963  -8.319  48.970  1.00 27.65 ? 277 VAL B C   1 
ATOM   4046 O O   . VAL B 1 300 ? 28.553  -9.378  48.738  1.00 26.46 ? 277 VAL B O   1 
ATOM   4047 C CB  . VAL B 1 300 ? 25.760  -8.838  47.908  1.00 25.40 ? 277 VAL B CB  1 
ATOM   4048 C CG1 . VAL B 1 300 ? 24.896  -8.813  49.173  1.00 23.57 ? 277 VAL B CG1 1 
ATOM   4049 C CG2 . VAL B 1 300 ? 24.911  -8.553  46.681  1.00 23.21 ? 277 VAL B CG2 1 
ATOM   4050 N N   . LEU B 1 301 ? 28.241  -7.548  50.008  1.00 29.49 ? 278 LEU B N   1 
ATOM   4051 C CA  . LEU B 1 301 ? 29.280  -7.893  50.959  1.00 30.11 ? 278 LEU B CA  1 
ATOM   4052 C C   . LEU B 1 301 ? 28.779  -8.745  52.100  1.00 31.14 ? 278 LEU B C   1 
ATOM   4053 O O   . LEU B 1 301 ? 27.767  -8.435  52.722  1.00 33.64 ? 278 LEU B O   1 
ATOM   4054 C CB  . LEU B 1 301 ? 29.888  -6.610  51.495  1.00 28.27 ? 278 LEU B CB  1 
ATOM   4055 C CG  . LEU B 1 301 ? 30.212  -5.718  50.300  1.00 28.49 ? 278 LEU B CG  1 
ATOM   4056 C CD1 . LEU B 1 301 ? 30.423  -4.267  50.734  1.00 28.35 ? 278 LEU B CD1 1 
ATOM   4057 C CD2 . LEU B 1 301 ? 31.424  -6.287  49.601  1.00 25.67 ? 278 LEU B CD2 1 
ATOM   4058 N N   . ILE B 1 302 ? 29.495  -9.825  52.374  1.00 29.72 ? 279 ILE B N   1 
ATOM   4059 C CA  . ILE B 1 302 ? 29.114  -10.708 53.456  1.00 30.57 ? 279 ILE B CA  1 
ATOM   4060 C C   . ILE B 1 302 ? 30.275  -10.868 54.429  1.00 31.17 ? 279 ILE B C   1 
ATOM   4061 O O   . ILE B 1 302 ? 31.437  -10.918 54.033  1.00 30.48 ? 279 ILE B O   1 
ATOM   4062 C CB  . ILE B 1 302 ? 28.720  -12.128 52.931  1.00 32.02 ? 279 ILE B CB  1 
ATOM   4063 C CG1 . ILE B 1 302 ? 27.424  -12.063 52.113  1.00 30.70 ? 279 ILE B CG1 1 
ATOM   4064 C CG2 . ILE B 1 302 ? 28.570  -13.105 54.104  1.00 29.33 ? 279 ILE B CG2 1 
ATOM   4065 C CD1 . ILE B 1 302 ? 27.577  -11.417 50.772  1.00 30.94 ? 279 ILE B CD1 1 
ATOM   4066 N N   . ASN B 1 303 ? 29.962  -10.935 55.712  1.00 31.81 ? 280 ASN B N   1 
ATOM   4067 C CA  . ASN B 1 303 ? 30.998  -11.148 56.700  1.00 33.14 ? 280 ASN B CA  1 
ATOM   4068 C C   . ASN B 1 303 ? 30.678  -12.526 57.229  1.00 33.47 ? 280 ASN B C   1 
ATOM   4069 O O   . ASN B 1 303 ? 29.569  -12.774 57.688  1.00 33.51 ? 280 ASN B O   1 
ATOM   4070 C CB  . ASN B 1 303 ? 30.918  -10.106 57.810  1.00 34.11 ? 280 ASN B CB  1 
ATOM   4071 C CG  . ASN B 1 303 ? 32.042  -10.238 58.809  1.00 34.35 ? 280 ASN B CG  1 
ATOM   4072 O OD1 . ASN B 1 303 ? 33.167  -10.585 58.449  1.00 33.94 ? 280 ASN B OD1 1 
ATOM   4073 N ND2 . ASN B 1 303 ? 31.751  -9.944  60.072  1.00 35.69 ? 280 ASN B ND2 1 
ATOM   4074 N N   . LYS B 1 304 ? 31.628  -13.441 57.119  1.00 35.86 ? 281 LYS B N   1 
ATOM   4075 C CA  . LYS B 1 304 ? 31.395  -14.793 57.592  1.00 38.57 ? 281 LYS B CA  1 
ATOM   4076 C C   . LYS B 1 304 ? 32.463  -15.203 58.596  1.00 39.72 ? 281 LYS B C   1 
ATOM   4077 O O   . LYS B 1 304 ? 33.586  -15.553 58.228  1.00 38.00 ? 281 LYS B O   1 
ATOM   4078 C CB  . LYS B 1 304 ? 31.365  -15.770 56.419  1.00 39.34 ? 281 LYS B CB  1 
ATOM   4079 C CG  . LYS B 1 304 ? 30.620  -17.029 56.755  1.00 41.28 ? 281 LYS B CG  1 
ATOM   4080 C CD  . LYS B 1 304 ? 30.976  -18.188 55.851  1.00 42.17 ? 281 LYS B CD  1 
ATOM   4081 C CE  . LYS B 1 304 ? 30.483  -19.496 56.478  1.00 44.57 ? 281 LYS B CE  1 
ATOM   4082 N NZ  . LYS B 1 304 ? 30.950  -19.652 57.902  1.00 41.40 ? 281 LYS B NZ  1 
ATOM   4083 N N   . LYS B 1 305 ? 32.088  -15.146 59.870  1.00 42.98 ? 282 LYS B N   1 
ATOM   4084 C CA  . LYS B 1 305 ? 32.963  -15.485 60.991  1.00 45.38 ? 282 LYS B CA  1 
ATOM   4085 C C   . LYS B 1 305 ? 33.435  -16.945 60.995  1.00 46.51 ? 282 LYS B C   1 
ATOM   4086 O O   . LYS B 1 305 ? 34.621  -17.179 61.330  1.00 47.59 ? 282 LYS B O   1 
ATOM   4087 C CB  . LYS B 1 305 ? 32.254  -15.154 62.307  1.00 44.42 ? 282 LYS B CB  1 
HETATM 4088 C C   . LN6 C 2 .   ? -5.029  -2.170  21.625  1.00 27.82 ? 286 LN6 A C   1 
HETATM 4089 N N   . LN6 C 2 .   ? -3.351  -2.342  23.393  1.00 24.71 ? 286 LN6 A N   1 
HETATM 4090 C CA  . LN6 C 2 .   ? -3.589  -1.846  22.030  1.00 27.38 ? 286 LN6 A CA  1 
HETATM 4091 C CB  . LN6 C 2 .   ? -2.606  -2.513  21.065  1.00 26.42 ? 286 LN6 A CB  1 
HETATM 4092 C CD  . LN6 C 2 .   ? -1.501  -2.358  18.797  1.00 23.86 ? 286 LN6 A CD  1 
HETATM 4093 N NE  . LN6 C 2 .   ? -1.753  -3.724  18.314  1.00 21.46 ? 286 LN6 A NE  1 
HETATM 4094 C CG  . LN6 C 2 .   ? -2.641  -1.853  19.685  1.00 24.86 ? 286 LN6 A CG  1 
HETATM 4095 C CZ  . LN6 C 2 .   ? -2.715  -3.978  17.431  1.00 20.23 ? 286 LN6 A CZ  1 
HETATM 4096 O OA1 . LN6 C 2 .   ? -5.461  -1.651  20.573  1.00 28.47 ? 286 LN6 A OA1 1 
HETATM 4097 O OA2 . LN6 C 2 .   ? -5.671  -2.927  22.384  1.00 29.16 ? 286 LN6 A OA2 1 
HETATM 4098 C CH1 . LN6 C 2 .   ? -2.947  -5.412  16.951  1.00 21.69 ? 286 LN6 A CH1 1 
HETATM 4099 N NH2 . LN6 C 2 .   ? -3.445  -2.986  16.928  1.00 16.05 ? 286 LN6 A NH2 1 
HETATM 4100 C CI1 . LN6 C 2 .   ? -1.529  -5.088  14.891  1.00 20.97 ? 286 LN6 A CI1 1 
HETATM 4101 C CK1 . LN6 C 2 .   ? -0.349  -5.620  14.074  1.00 21.39 ? 286 LN6 A CK1 1 
HETATM 4102 C CT1 . LN6 C 2 .   ? -1.749  -5.928  16.151  1.00 22.70 ? 286 LN6 A CT1 1 
HETATM 4103 C C   . LN6 D 2 .   ? 18.584  -1.092  37.058  1.00 36.59 ? 286 LN6 B C   1 
HETATM 4104 N N   . LN6 D 2 .   ? 20.347  -0.505  35.455  1.00 36.58 ? 286 LN6 B N   1 
HETATM 4105 C CA  . LN6 D 2 .   ? 20.072  -1.203  36.719  1.00 37.04 ? 286 LN6 B CA  1 
HETATM 4106 C CB  . LN6 D 2 .   ? 20.922  -0.606  37.844  1.00 35.17 ? 286 LN6 B CB  1 
HETATM 4107 C CD  . LN6 D 2 .   ? 21.700  -0.920  40.220  1.00 29.18 ? 286 LN6 B CD  1 
HETATM 4108 N NE  . LN6 D 2 .   ? 21.663  0.526   40.484  1.00 27.61 ? 286 LN6 B NE  1 
HETATM 4109 C CG  . LN6 D 2 .   ? 20.653  -1.311  39.174  1.00 32.09 ? 286 LN6 B CG  1 
HETATM 4110 C CZ  . LN6 D 2 .   ? 20.640  1.094   41.116  1.00 25.89 ? 286 LN6 B CZ  1 
HETATM 4111 O OA1 . LN6 D 2 .   ? 18.053  -2.095  37.582  1.00 36.21 ? 286 LN6 B OA1 1 
HETATM 4112 O OA2 . LN6 D 2 .   ? 18.008  -0.019  36.775  1.00 36.12 ? 286 LN6 B OA2 1 
HETATM 4113 C CH1 . LN6 D 2 .   ? 20.652  2.603   41.363  1.00 27.40 ? 286 LN6 B CH1 1 
HETATM 4114 N NH2 . LN6 D 2 .   ? 19.630  0.358   41.572  1.00 17.88 ? 286 LN6 B NH2 1 
HETATM 4115 C CI1 . LN6 D 2 .   ? 21.881  2.240   43.536  1.00 33.28 ? 286 LN6 B CI1 1 
HETATM 4116 C CK1 . LN6 D 2 .   ? 23.070  2.665   44.400  1.00 32.39 ? 286 LN6 B CK1 1 
HETATM 4117 C CT1 . LN6 D 2 .   ? 21.864  2.999   42.208  1.00 30.48 ? 286 LN6 B CT1 1 
HETATM 4118 O O   . HOH E 3 .   ? 4.770   -5.635  -4.018  1.00 23.94 ? 287 HOH A O   1 
HETATM 4119 O O   . HOH E 3 .   ? -12.713 9.587   2.389   1.00 21.21 ? 288 HOH A O   1 
HETATM 4120 O O   . HOH E 3 .   ? -0.944  -8.875  29.118  1.00 34.10 ? 289 HOH A O   1 
HETATM 4121 O O   . HOH E 3 .   ? 1.796   -20.894 12.803  1.00 43.14 ? 290 HOH A O   1 
HETATM 4122 O O   . HOH E 3 .   ? 4.938   0.188   10.935  1.00 15.73 ? 291 HOH A O   1 
HETATM 4123 O O   . HOH E 3 .   ? 17.915  10.169  11.600  1.00 39.94 ? 292 HOH A O   1 
HETATM 4124 O O   . HOH E 3 .   ? 4.047   5.468   3.130   1.00 37.35 ? 293 HOH A O   1 
HETATM 4125 O O   . HOH E 3 .   ? -0.872  -2.195  14.952  1.00 25.06 ? 294 HOH A O   1 
HETATM 4126 O O   . HOH E 3 .   ? -16.013 9.948   7.563   1.00 21.05 ? 295 HOH A O   1 
HETATM 4127 O O   . HOH E 3 .   ? 13.827  2.315   30.927  1.00 26.17 ? 296 HOH A O   1 
HETATM 4128 O O   . HOH E 3 .   ? 3.673   24.207  0.908   1.00 28.52 ? 297 HOH A O   1 
HETATM 4129 O O   . HOH E 3 .   ? 8.797   -11.140 -3.980  1.00 39.32 ? 298 HOH A O   1 
HETATM 4130 O O   . HOH E 3 .   ? 6.187   -4.664  6.810   1.00 34.07 ? 299 HOH A O   1 
HETATM 4131 O O   . HOH E 3 .   ? -2.947  -9.597  18.187  1.00 28.44 ? 300 HOH A O   1 
HETATM 4132 O O   . HOH E 3 .   ? 10.194  -19.802 16.717  1.00 27.28 ? 301 HOH A O   1 
HETATM 4133 O O   . HOH E 3 .   ? -0.304  16.686  0.609   1.00 26.63 ? 302 HOH A O   1 
HETATM 4134 O O   . HOH E 3 .   ? 3.753   11.696  2.046   1.00 39.44 ? 303 HOH A O   1 
HETATM 4135 O O   . HOH E 3 .   ? 8.424   5.546   24.779  1.00 23.07 ? 304 HOH A O   1 
HETATM 4136 O O   . HOH E 3 .   ? 0.343   2.890   3.490   1.00 28.23 ? 305 HOH A O   1 
HETATM 4137 O O   . HOH E 3 .   ? 20.278  -17.773 7.566   1.00 24.07 ? 306 HOH A O   1 
HETATM 4138 O O   . HOH E 3 .   ? 5.992   4.085   18.601  1.00 20.19 ? 307 HOH A O   1 
HETATM 4139 O O   . HOH E 3 .   ? 7.170   -11.185 23.223  1.00 45.25 ? 308 HOH A O   1 
HETATM 4140 O O   . HOH E 3 .   ? -0.464  13.822  29.353  1.00 20.84 ? 309 HOH A O   1 
HETATM 4141 O O   . HOH E 3 .   ? 12.486  10.872  19.572  1.00 36.62 ? 310 HOH A O   1 
HETATM 4142 O O   . HOH E 3 .   ? -1.959  -20.286 16.120  1.00 36.57 ? 311 HOH A O   1 
HETATM 4143 O O   . HOH E 3 .   ? 6.634   -2.019  7.077   1.00 24.47 ? 312 HOH A O   1 
HETATM 4144 O O   . HOH E 3 .   ? 21.345  -17.722 4.053   1.00 43.01 ? 313 HOH A O   1 
HETATM 4145 O O   . HOH E 3 .   ? -1.718  0.130   6.212   1.00 25.58 ? 314 HOH A O   1 
HETATM 4146 O O   . HOH E 3 .   ? 8.006   -19.755 4.060   1.00 45.79 ? 315 HOH A O   1 
HETATM 4147 O O   . HOH E 3 .   ? -8.350  -16.249 9.228   1.00 34.73 ? 316 HOH A O   1 
HETATM 4148 O O   . HOH E 3 .   ? 21.135  -14.418 19.010  1.00 33.75 ? 317 HOH A O   1 
HETATM 4149 O O   . HOH E 3 .   ? 8.799   -10.064 12.921  1.00 33.42 ? 318 HOH A O   1 
HETATM 4150 O O   . HOH E 3 .   ? -7.619  -5.093  -2.530  1.00 24.06 ? 319 HOH A O   1 
HETATM 4151 O O   . HOH E 3 .   ? -4.035  -10.238 -3.122  1.00 44.19 ? 320 HOH A O   1 
HETATM 4152 O O   . HOH E 3 .   ? -6.580  5.337   26.393  1.00 37.76 ? 321 HOH A O   1 
HETATM 4153 O O   . HOH E 3 .   ? -5.915  17.963  4.574   1.00 50.53 ? 322 HOH A O   1 
HETATM 4154 O O   . HOH E 3 .   ? 8.752   -10.877 29.912  1.00 42.47 ? 323 HOH A O   1 
HETATM 4155 O O   . HOH E 3 .   ? -12.034 14.841  6.927   1.00 24.98 ? 324 HOH A O   1 
HETATM 4156 O O   . HOH E 3 .   ? -16.530 -6.278  2.506   1.00 42.29 ? 325 HOH A O   1 
HETATM 4157 O O   . HOH E 3 .   ? 9.952   7.982   25.413  1.00 21.42 ? 326 HOH A O   1 
HETATM 4158 O O   . HOH E 3 .   ? 13.078  15.724  12.458  1.00 32.66 ? 327 HOH A O   1 
HETATM 4159 O O   . HOH E 3 .   ? -3.529  -9.186  32.063  1.00 56.23 ? 328 HOH A O   1 
HETATM 4160 O O   . HOH E 3 .   ? 3.684   -19.185 17.908  1.00 27.62 ? 329 HOH A O   1 
HETATM 4161 O O   . HOH E 3 .   ? 17.265  -16.061 13.171  1.00 35.52 ? 330 HOH A O   1 
HETATM 4162 O O   . HOH E 3 .   ? -8.837  -8.161  21.364  1.00 25.40 ? 331 HOH A O   1 
HETATM 4163 O O   . HOH E 3 .   ? -2.623  -22.610 18.159  1.00 36.30 ? 332 HOH A O   1 
HETATM 4164 O O   . HOH E 3 .   ? 13.107  7.251   21.900  1.00 19.83 ? 333 HOH A O   1 
HETATM 4165 O O   . HOH E 3 .   ? -4.829  -13.803 -8.436  1.00 27.02 ? 334 HOH A O   1 
HETATM 4166 O O   . HOH E 3 .   ? 8.460   -9.833  27.411  1.00 23.47 ? 335 HOH A O   1 
HETATM 4167 O O   . HOH E 3 .   ? -0.218  -5.172  37.153  1.00 52.82 ? 336 HOH A O   1 
HETATM 4168 O O   . HOH E 3 .   ? 20.820  -6.491  12.317  1.00 37.42 ? 337 HOH A O   1 
HETATM 4169 O O   . HOH E 3 .   ? 1.748   1.865   10.630  1.00 10.76 ? 338 HOH A O   1 
HETATM 4170 O O   . HOH E 3 .   ? -9.309  -6.724  16.098  1.00 36.47 ? 339 HOH A O   1 
HETATM 4171 O O   . HOH E 3 .   ? -14.448 -10.931 3.599   1.00 23.30 ? 340 HOH A O   1 
HETATM 4172 O O   . HOH E 3 .   ? 8.793   3.210   31.714  1.00 28.34 ? 341 HOH A O   1 
HETATM 4173 O O   . HOH E 3 .   ? -6.555  2.597   26.332  1.00 43.08 ? 342 HOH A O   1 
HETATM 4174 O O   . HOH E 3 .   ? 5.350   7.478   -2.273  1.00 27.27 ? 343 HOH A O   1 
HETATM 4175 O O   . HOH E 3 .   ? 1.518   20.207  0.091   1.00 50.17 ? 344 HOH A O   1 
HETATM 4176 O O   . HOH E 3 .   ? 19.101  -5.904  -2.138  1.00 29.68 ? 345 HOH A O   1 
HETATM 4177 O O   . HOH E 3 .   ? 6.060   19.320  6.204   1.00 53.75 ? 346 HOH A O   1 
HETATM 4178 O O   . HOH E 3 .   ? -4.081  -15.927 13.066  1.00 35.40 ? 347 HOH A O   1 
HETATM 4179 O O   . HOH E 3 .   ? 21.855  -9.056  -1.298  1.00 54.09 ? 348 HOH A O   1 
HETATM 4180 O O   . HOH E 3 .   ? 3.019   -2.315  35.044  1.00 34.63 ? 349 HOH A O   1 
HETATM 4181 O O   . HOH E 3 .   ? 8.749   9.568   27.449  1.00 38.97 ? 350 HOH A O   1 
HETATM 4182 O O   . HOH F 3 .   ? 19.986  -15.983 38.060  1.00 45.34 ? 287 HOH B O   1 
HETATM 4183 O O   . HOH F 3 .   ? 28.393  3.342   62.239  1.00 17.38 ? 288 HOH B O   1 
HETATM 4184 O O   . HOH F 3 .   ? 38.868  -5.550  64.370  1.00 16.54 ? 289 HOH B O   1 
HETATM 4185 O O   . HOH F 3 .   ? 7.940   3.057   58.518  1.00 26.09 ? 290 HOH B O   1 
HETATM 4186 O O   . HOH F 3 .   ? 32.510  7.757   45.801  1.00 11.96 ? 291 HOH B O   1 
HETATM 4187 O O   . HOH F 3 .   ? 37.511  -10.278 63.817  1.00 19.65 ? 292 HOH B O   1 
HETATM 4188 O O   . HOH F 3 .   ? 38.589  6.887   35.945  1.00 34.81 ? 293 HOH B O   1 
HETATM 4189 O O   . HOH F 3 .   ? 30.971  11.803  35.471  1.00 29.54 ? 294 HOH B O   1 
HETATM 4190 O O   . HOH F 3 .   ? 40.906  10.056  37.598  1.00 32.86 ? 295 HOH B O   1 
HETATM 4191 O O   . HOH F 3 .   ? 18.617  -20.955 53.601  1.00 25.89 ? 296 HOH B O   1 
HETATM 4192 O O   . HOH F 3 .   ? 20.264  -20.619 38.441  1.00 30.14 ? 297 HOH B O   1 
HETATM 4193 O O   . HOH F 3 .   ? 29.686  -16.110 59.719  1.00 31.53 ? 298 HOH B O   1 
HETATM 4194 O O   . HOH F 3 .   ? 22.895  4.915   27.359  1.00 28.42 ? 299 HOH B O   1 
HETATM 4195 O O   . HOH F 3 .   ? 32.825  15.726  38.094  1.00 28.46 ? 300 HOH B O   1 
HETATM 4196 O O   . HOH F 3 .   ? 28.650  -2.159  63.713  1.00 23.64 ? 301 HOH B O   1 
HETATM 4197 O O   . HOH F 3 .   ? 34.810  -11.742 60.017  1.00 21.05 ? 302 HOH B O   1 
HETATM 4198 O O   . HOH F 3 .   ? 20.773  -21.427 56.981  1.00 24.65 ? 303 HOH B O   1 
HETATM 4199 O O   . HOH F 3 .   ? 39.905  -6.623  30.486  1.00 39.72 ? 304 HOH B O   1 
HETATM 4200 O O   . HOH F 3 .   ? 5.934   -8.875  37.471  1.00 39.70 ? 305 HOH B O   1 
HETATM 4201 O O   . HOH F 3 .   ? 22.465  5.955   38.688  1.00 35.55 ? 306 HOH B O   1 
HETATM 4202 O O   . HOH F 3 .   ? 17.977  -8.225  34.255  1.00 28.46 ? 307 HOH B O   1 
HETATM 4203 O O   . HOH F 3 .   ? 29.132  6.015   42.961  1.00 25.07 ? 308 HOH B O   1 
HETATM 4204 O O   . HOH F 3 .   ? 29.135  -3.611  59.298  1.00 17.95 ? 309 HOH B O   1 
HETATM 4205 O O   . HOH F 3 .   ? 15.119  -8.369  66.996  1.00 44.48 ? 310 HOH B O   1 
HETATM 4206 O O   . HOH F 3 .   ? 28.372  -22.989 48.273  1.00 26.18 ? 311 HOH B O   1 
HETATM 4207 O O   . HOH F 3 .   ? 35.753  -2.860  62.432  1.00 25.93 ? 312 HOH B O   1 
HETATM 4208 O O   . HOH F 3 .   ? 24.127  -0.277  52.926  1.00 34.48 ? 313 HOH B O   1 
HETATM 4209 O O   . HOH F 3 .   ? 14.371  -19.444 52.830  1.00 29.50 ? 314 HOH B O   1 
HETATM 4210 O O   . HOH F 3 .   ? 28.820  -7.372  55.690  1.00 22.53 ? 315 HOH B O   1 
HETATM 4211 O O   . HOH F 3 .   ? 21.016  4.329   66.007  1.00 24.48 ? 316 HOH B O   1 
HETATM 4212 O O   . HOH F 3 .   ? 10.523  8.918   56.020  1.00 43.30 ? 317 HOH B O   1 
HETATM 4213 O O   . HOH F 3 .   ? 34.979  0.157   61.172  1.00 15.20 ? 318 HOH B O   1 
HETATM 4214 O O   . HOH F 3 .   ? 16.080  -10.422 55.518  1.00 44.40 ? 319 HOH B O   1 
HETATM 4215 O O   . HOH F 3 .   ? 17.356  15.953  61.129  1.00 16.76 ? 320 HOH B O   1 
HETATM 4216 O O   . HOH F 3 .   ? 11.933  -13.300 45.415  1.00 21.75 ? 321 HOH B O   1 
HETATM 4217 O O   . HOH F 3 .   ? 8.739   8.938   48.251  1.00 42.66 ? 322 HOH B O   1 
HETATM 4218 O O   . HOH F 3 .   ? 29.482  -26.130 48.244  1.00 21.51 ? 323 HOH B O   1 
HETATM 4219 O O   . HOH F 3 .   ? 14.505  14.368  49.436  1.00 21.25 ? 324 HOH B O   1 
HETATM 4220 O O   . HOH F 3 .   ? 24.973  8.525   37.147  1.00 38.07 ? 325 HOH B O   1 
HETATM 4221 O O   . HOH F 3 .   ? 21.347  17.579  55.497  1.00 27.91 ? 326 HOH B O   1 
HETATM 4222 O O   . HOH F 3 .   ? 39.344  17.355  55.496  1.00 36.78 ? 327 HOH B O   1 
HETATM 4223 O O   . HOH F 3 .   ? 13.193  12.400  50.961  1.00 36.11 ? 328 HOH B O   1 
HETATM 4224 O O   . HOH F 3 .   ? 21.642  5.678   29.484  1.00 37.60 ? 329 HOH B O   1 
HETATM 4225 O O   . HOH F 3 .   ? 17.935  -19.408 36.608  1.00 25.23 ? 330 HOH B O   1 
HETATM 4226 O O   . HOH F 3 .   ? 14.355  3.890   39.238  1.00 42.64 ? 331 HOH B O   1 
HETATM 4227 O O   . HOH F 3 .   ? 22.624  -4.956  49.042  1.00 17.48 ? 332 HOH B O   1 
HETATM 4228 O O   . HOH F 3 .   ? 23.679  -5.459  23.784  1.00 46.41 ? 333 HOH B O   1 
HETATM 4229 O O   . HOH F 3 .   ? 24.806  8.406   64.580  1.00 30.29 ? 334 HOH B O   1 
HETATM 4230 O O   . HOH F 3 .   ? 26.553  -23.429 46.214  1.00 12.05 ? 335 HOH B O   1 
HETATM 4231 O O   . HOH F 3 .   ? 39.836  -13.446 46.157  1.00 17.20 ? 336 HOH B O   1 
HETATM 4232 O O   . HOH F 3 .   ? 32.988  17.190  40.714  1.00 26.65 ? 337 HOH B O   1 
HETATM 4233 O O   . HOH F 3 .   ? 25.068  -4.754  48.098  1.00 14.33 ? 338 HOH B O   1 
HETATM 4234 O O   . HOH F 3 .   ? 12.102  -8.235  53.265  1.00 47.08 ? 339 HOH B O   1 
HETATM 4235 O O   . HOH F 3 .   ? 21.771  -10.326 40.358  1.00 40.81 ? 340 HOH B O   1 
HETATM 4236 O O   . HOH F 3 .   ? 46.182  -0.954  55.015  1.00 41.37 ? 341 HOH B O   1 
HETATM 4237 O O   . HOH F 3 .   ? 9.784   4.654   59.690  1.00 23.86 ? 342 HOH B O   1 
HETATM 4238 O O   . HOH F 3 .   ? 44.264  -7.380  52.618  1.00 47.35 ? 343 HOH B O   1 
HETATM 4239 O O   . HOH F 3 .   ? 18.747  -2.578  67.524  1.00 32.64 ? 344 HOH B O   1 
HETATM 4240 O O   . HOH F 3 .   ? 26.932  1.754   52.198  1.00 23.23 ? 345 HOH B O   1 
HETATM 4241 O O   . HOH F 3 .   ? 35.981  -18.347 49.811  1.00 30.90 ? 346 HOH B O   1 
HETATM 4242 O O   . HOH F 3 .   ? 6.871   -5.368  58.588  1.00 24.74 ? 347 HOH B O   1 
HETATM 4243 O O   . HOH F 3 .   ? 20.639  5.883   26.892  1.00 25.77 ? 348 HOH B O   1 
HETATM 4244 O O   . HOH F 3 .   ? 37.248  -11.395 59.212  1.00 26.37 ? 349 HOH B O   1 
HETATM 4245 O O   . HOH F 3 .   ? 26.938  -9.846  56.422  1.00 43.68 ? 350 HOH B O   1 
HETATM 4246 O O   . HOH F 3 .   ? 33.971  -19.498 62.248  1.00 25.44 ? 351 HOH B O   1 
HETATM 4247 O O   . HOH F 3 .   ? 44.963  -2.857  53.012  1.00 33.09 ? 352 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -22 ?   ?   ?   A . n 
A 1 2   GLY 2   -21 ?   ?   ?   A . n 
A 1 3   SER 3   -20 ?   ?   ?   A . n 
A 1 4   SER 4   -19 ?   ?   ?   A . n 
A 1 5   HIS 5   -18 ?   ?   ?   A . n 
A 1 6   HIS 6   -17 ?   ?   ?   A . n 
A 1 7   HIS 7   -16 ?   ?   ?   A . n 
A 1 8   HIS 8   -15 ?   ?   ?   A . n 
A 1 9   HIS 9   -14 ?   ?   ?   A . n 
A 1 10  HIS 10  -13 ?   ?   ?   A . n 
A 1 11  SER 11  -12 ?   ?   ?   A . n 
A 1 12  SER 12  -11 ?   ?   ?   A . n 
A 1 13  GLY 13  -10 ?   ?   ?   A . n 
A 1 14  LEU 14  -9  ?   ?   ?   A . n 
A 1 15  VAL 15  -8  ?   ?   ?   A . n 
A 1 16  PRO 16  -7  ?   ?   ?   A . n 
A 1 17  ARG 17  -6  ?   ?   ?   A . n 
A 1 18  GLY 18  -5  ?   ?   ?   A . n 
A 1 19  SER 19  -4  ?   ?   ?   A . n 
A 1 20  HIS 20  -3  ?   ?   ?   A . n 
A 1 21  MET 21  -2  ?   ?   ?   A . n 
A 1 22  ALA 22  -1  ?   ?   ?   A . n 
A 1 23  SER 23  0   ?   ?   ?   A . n 
A 1 24  MET 24  1   ?   ?   ?   A . n 
A 1 25  ALA 25  2   ?   ?   ?   A . n 
A 1 26  GLY 26  3   ?   ?   ?   A . n 
A 1 27  LEU 27  4   ?   ?   ?   A . n 
A 1 28  GLY 28  5   ?   ?   ?   A . n 
A 1 29  HIS 29  6   ?   ?   ?   A . n 
A 1 30  PRO 30  7   ?   ?   ?   A . n 
A 1 31  ALA 31  8   8   ALA ALA A . n 
A 1 32  ALA 32  9   9   ALA ALA A . n 
A 1 33  PHE 33  10  10  PHE PHE A . n 
A 1 34  GLY 34  11  11  GLY GLY A . n 
A 1 35  ARG 35  12  12  ARG ARG A . n 
A 1 36  ALA 36  13  13  ALA ALA A . n 
A 1 37  THR 37  14  14  THR THR A . n 
A 1 38  HIS 38  15  15  HIS HIS A . n 
A 1 39  ALA 39  16  16  ALA ALA A . n 
A 1 40  VAL 40  17  17  VAL VAL A . n 
A 1 41  VAL 41  18  18  VAL VAL A . n 
A 1 42  ARG 42  19  19  ARG ARG A . n 
A 1 43  ALA 43  20  20  ALA ALA A . n 
A 1 44  LEU 44  21  21  LEU LEU A . n 
A 1 45  PRO 45  22  22  PRO PRO A . n 
A 1 46  GLU 46  23  23  GLU GLU A . n 
A 1 47  SER 47  24  24  SER SER A . n 
A 1 48  LEU 48  25  25  LEU LEU A . n 
A 1 49  GLY 49  26  26  GLY GLY A . n 
A 1 50  GLN 50  27  27  GLN GLN A . n 
A 1 51  HIS 51  28  28  HIS HIS A . n 
A 1 52  ALA 52  29  29  ALA ALA A . n 
A 1 53  LEU 53  30  30  LEU LEU A . n 
A 1 54  ARG 54  31  31  ARG ARG A . n 
A 1 55  SER 55  32  32  SER SER A . n 
A 1 56  ALA 56  33  33  ALA ALA A . n 
A 1 57  LYS 57  34  34  LYS LYS A . n 
A 1 58  GLY 58  35  35  GLY GLY A . n 
A 1 59  GLU 59  36  36  GLU GLU A . n 
A 1 60  GLU 60  37  37  GLU GLU A . n 
A 1 61  VAL 61  38  38  VAL VAL A . n 
A 1 62  ASP 62  39  39  ASP ASP A . n 
A 1 63  VAL 63  40  40  VAL VAL A . n 
A 1 64  ALA 64  41  41  ALA ALA A . n 
A 1 65  ARG 65  42  42  ARG ARG A . n 
A 1 66  ALA 66  43  43  ALA ALA A . n 
A 1 67  GLU 67  44  44  GLU GLU A . n 
A 1 68  ARG 68  45  45  ARG ARG A . n 
A 1 69  GLN 69  46  46  GLN GLN A . n 
A 1 70  HIS 70  47  47  HIS HIS A . n 
A 1 71  GLN 71  48  48  GLN GLN A . n 
A 1 72  LEU 72  49  49  LEU LEU A . n 
A 1 73  TYR 73  50  50  TYR TYR A . n 
A 1 74  VAL 74  51  51  VAL VAL A . n 
A 1 75  GLY 75  52  52  GLY GLY A . n 
A 1 76  VAL 76  53  53  VAL VAL A . n 
A 1 77  LEU 77  54  54  LEU LEU A . n 
A 1 78  GLY 78  55  55  GLY GLY A . n 
A 1 79  SER 79  56  56  SER SER A . n 
A 1 80  LYS 80  57  57  LYS LYS A . n 
A 1 81  LEU 81  58  58  LEU LEU A . n 
A 1 82  GLY 82  59  59  GLY GLY A . n 
A 1 83  LEU 83  60  60  LEU LEU A . n 
A 1 84  GLN 84  61  61  GLN GLN A . n 
A 1 85  VAL 85  62  62  VAL VAL A . n 
A 1 86  VAL 86  63  63  VAL VAL A . n 
A 1 87  GLU 87  64  64  GLU GLU A . n 
A 1 88  LEU 88  65  65  LEU LEU A . n 
A 1 89  PRO 89  66  66  PRO PRO A . n 
A 1 90  ALA 90  67  67  ALA ALA A . n 
A 1 91  ASP 91  68  68  ASP ASP A . n 
A 1 92  GLU 92  69  69  GLU GLU A . n 
A 1 93  SER 93  70  70  SER SER A . n 
A 1 94  LEU 94  71  71  LEU LEU A . n 
A 1 95  PRO 95  72  72  PRO PRO A . n 
A 1 96  ASP 96  73  73  ASP ASP A . n 
A 1 97  CYS 97  74  74  CYS CYS A . n 
A 1 98  VAL 98  75  75  VAL VAL A . n 
A 1 99  PHE 99  76  76  PHE PHE A . n 
A 1 100 VAL 100 77  77  VAL VAL A . n 
A 1 101 GLU 101 78  78  GLU GLU A . n 
A 1 102 ASP 102 79  79  ASP ASP A . n 
A 1 103 VAL 103 80  80  VAL VAL A . n 
A 1 104 ALA 104 81  81  ALA ALA A . n 
A 1 105 VAL 105 82  82  VAL VAL A . n 
A 1 106 VAL 106 83  83  VAL VAL A . n 
A 1 107 CYS 107 84  84  CYS CYS A . n 
A 1 108 GLU 108 85  85  GLU GLU A . n 
A 1 109 GLU 109 86  86  GLU GLU A . n 
A 1 110 THR 110 87  87  THR THR A . n 
A 1 111 ALA 111 88  88  ALA ALA A . n 
A 1 112 LEU 112 89  89  LEU LEU A . n 
A 1 113 ILE 113 90  90  ILE ILE A . n 
A 1 114 THR 114 91  91  THR THR A . n 
A 1 115 ARG 115 92  92  ARG ARG A . n 
A 1 116 PRO 116 93  93  PRO PRO A . n 
A 1 117 GLY 117 94  94  GLY GLY A . n 
A 1 118 ALA 118 95  95  ALA ALA A . n 
A 1 119 PRO 119 96  96  PRO PRO A . n 
A 1 120 SER 120 97  97  SER SER A . n 
A 1 121 ARG 121 98  98  ARG ARG A . n 
A 1 122 ARG 122 99  99  ARG ARG A . n 
A 1 123 LYS 123 100 100 LYS LYS A . n 
A 1 124 GLU 124 101 101 GLU GLU A . n 
A 1 125 VAL 125 102 102 VAL VAL A . n 
A 1 126 ASP 126 103 103 ASP ASP A . n 
A 1 127 MET 127 104 104 MET MET A . n 
A 1 128 MET 128 105 105 MET MET A . n 
A 1 129 LYS 129 106 106 LYS LYS A . n 
A 1 130 GLU 130 107 107 GLU GLU A . n 
A 1 131 ALA 131 108 108 ALA ALA A . n 
A 1 132 LEU 132 109 109 LEU LEU A . n 
A 1 133 GLU 133 110 110 GLU GLU A . n 
A 1 134 LYS 134 111 111 LYS LYS A . n 
A 1 135 LEU 135 112 112 LEU LEU A . n 
A 1 136 GLN 136 113 113 GLN GLN A . n 
A 1 137 LEU 137 114 114 LEU LEU A . n 
A 1 138 ASN 138 115 115 ASN ASN A . n 
A 1 139 ILE 139 116 116 ILE ILE A . n 
A 1 140 VAL 140 117 117 VAL VAL A . n 
A 1 141 GLU 141 118 118 GLU GLU A . n 
A 1 142 MET 142 119 119 MET MET A . n 
A 1 143 LYS 143 120 120 LYS LYS A . n 
A 1 144 ASP 144 121 121 ASP ASP A . n 
A 1 145 GLU 145 122 122 GLU GLU A . n 
A 1 146 ASN 146 123 123 ASN ASN A . n 
A 1 147 ALA 147 124 124 ALA ALA A . n 
A 1 148 THR 148 125 125 THR THR A . n 
A 1 149 LEU 149 126 126 LEU LEU A . n 
A 1 150 ASP 150 127 127 ASP ASP A . n 
A 1 151 GLY 151 128 128 GLY GLY A . n 
A 1 152 GLY 152 129 129 GLY GLY A . n 
A 1 153 ASP 153 130 130 ASP ASP A . n 
A 1 154 VAL 154 131 131 VAL VAL A . n 
A 1 155 LEU 155 132 132 LEU LEU A . n 
A 1 156 PHE 156 133 133 PHE PHE A . n 
A 1 157 THR 157 134 134 THR THR A . n 
A 1 158 GLY 158 135 135 GLY GLY A . n 
A 1 159 ARG 159 136 136 ARG ARG A . n 
A 1 160 GLU 160 137 137 GLU GLU A . n 
A 1 161 PHE 161 138 138 PHE PHE A . n 
A 1 162 PHE 162 139 139 PHE PHE A . n 
A 1 163 VAL 163 140 140 VAL VAL A . n 
A 1 164 GLY 164 141 141 GLY GLY A . n 
A 1 165 LEU 165 142 142 LEU LEU A . n 
A 1 166 SER 166 143 143 SER SER A . n 
A 1 167 LYS 167 144 144 LYS LYS A . n 
A 1 168 ARG 168 145 145 ARG ARG A . n 
A 1 169 THR 169 146 146 THR THR A . n 
A 1 170 ASN 170 147 147 ASN ASN A . n 
A 1 171 GLN 171 148 148 GLN GLN A . n 
A 1 172 ARG 172 149 149 ARG ARG A . n 
A 1 173 GLY 173 150 150 GLY GLY A . n 
A 1 174 ALA 174 151 151 ALA ALA A . n 
A 1 175 GLU 175 152 152 GLU GLU A . n 
A 1 176 ILE 176 153 153 ILE ILE A . n 
A 1 177 LEU 177 154 154 LEU LEU A . n 
A 1 178 ALA 178 155 155 ALA ALA A . n 
A 1 179 ASP 179 156 156 ASP ASP A . n 
A 1 180 THR 180 157 157 THR THR A . n 
A 1 181 PHE 181 158 158 PHE PHE A . n 
A 1 182 LYS 182 159 159 LYS LYS A . n 
A 1 183 ASP 183 160 160 ASP ASP A . n 
A 1 184 TYR 184 161 161 TYR TYR A . n 
A 1 185 ALA 185 162 162 ALA ALA A . n 
A 1 186 VAL 186 163 163 VAL VAL A . n 
A 1 187 SER 187 164 164 SER SER A . n 
A 1 188 THR 188 165 165 THR THR A . n 
A 1 189 VAL 189 166 166 VAL VAL A . n 
A 1 190 PRO 190 167 167 PRO PRO A . n 
A 1 191 VAL 191 168 168 VAL VAL A . n 
A 1 192 ALA 192 169 169 ALA ALA A . n 
A 1 193 ASP 193 170 170 ASP ASP A . n 
A 1 194 GLY 194 171 171 GLY GLY A . n 
A 1 195 LEU 195 172 172 LEU LEU A . n 
A 1 196 HIS 196 173 173 HIS HIS A . n 
A 1 197 LEU 197 174 174 LEU LEU A . n 
A 1 198 LYS 198 175 175 LYS LYS A . n 
A 1 199 SER 199 176 176 SER SER A . n 
A 1 200 PHE 200 177 177 PHE PHE A . n 
A 1 201 CYS 201 178 178 CYS CYS A . n 
A 1 202 SER 202 179 179 SER SER A . n 
A 1 203 MET 203 180 180 MET MET A . n 
A 1 204 ALA 204 181 181 ALA ALA A . n 
A 1 205 GLY 205 182 182 GLY GLY A . n 
A 1 206 PRO 206 183 183 PRO PRO A . n 
A 1 207 ASN 207 184 184 ASN ASN A . n 
A 1 208 LEU 208 185 185 LEU LEU A . n 
A 1 209 ILE 209 186 186 ILE ILE A . n 
A 1 210 ALA 210 187 187 ALA ALA A . n 
A 1 211 ILE 211 188 188 ILE ILE A . n 
A 1 212 GLY 212 189 189 GLY GLY A . n 
A 1 213 SER 213 190 190 SER SER A . n 
A 1 214 SER 214 191 191 SER SER A . n 
A 1 215 GLU 215 192 192 GLU GLU A . n 
A 1 216 SER 216 193 193 SER SER A . n 
A 1 217 ALA 217 194 194 ALA ALA A . n 
A 1 218 GLN 218 195 195 GLN GLN A . n 
A 1 219 LYS 219 196 196 LYS LYS A . n 
A 1 220 ALA 220 197 197 ALA ALA A . n 
A 1 221 LEU 221 198 198 LEU LEU A . n 
A 1 222 LYS 222 199 199 LYS LYS A . n 
A 1 223 ILE 223 200 200 ILE ILE A . n 
A 1 224 MET 224 201 201 MET MET A . n 
A 1 225 GLN 225 202 202 GLN GLN A . n 
A 1 226 GLN 226 203 203 GLN GLN A . n 
A 1 227 MET 227 204 204 MET MET A . n 
A 1 228 SER 228 205 205 SER SER A . n 
A 1 229 ASP 229 206 206 ASP ASP A . n 
A 1 230 HIS 230 207 207 HIS HIS A . n 
A 1 231 ARG 231 208 208 ARG ARG A . n 
A 1 232 TYR 232 209 209 TYR TYR A . n 
A 1 233 ASP 233 210 210 ASP ASP A . n 
A 1 234 LYS 234 211 211 LYS LYS A . n 
A 1 235 LEU 235 212 212 LEU LEU A . n 
A 1 236 THR 236 213 213 THR THR A . n 
A 1 237 VAL 237 214 214 VAL VAL A . n 
A 1 238 PRO 238 215 215 PRO PRO A . n 
A 1 239 ASP 239 216 216 ASP ASP A . n 
A 1 240 ASP 240 217 217 ASP ASP A . n 
A 1 241 ILE 241 218 218 ILE ILE A . n 
A 1 242 ALA 242 219 219 ALA ALA A . n 
A 1 243 ALA 243 220 220 ALA ALA A . n 
A 1 244 ASN 244 221 221 ASN ASN A . n 
A 1 245 CYS 245 222 222 CYS CYS A . n 
A 1 246 ILE 246 223 223 ILE ILE A . n 
A 1 247 TYR 247 224 224 TYR TYR A . n 
A 1 248 LEU 248 225 225 LEU LEU A . n 
A 1 249 ASN 249 226 226 ASN ASN A . n 
A 1 250 ILE 250 227 227 ILE ILE A . n 
A 1 251 PRO 251 228 228 PRO PRO A . n 
A 1 252 ASN 252 229 229 ASN ASN A . n 
A 1 253 LYS 253 230 230 LYS LYS A . n 
A 1 254 GLY 254 231 231 GLY GLY A . n 
A 1 255 HIS 255 232 232 HIS HIS A . n 
A 1 256 VAL 256 233 233 VAL VAL A . n 
A 1 257 LEU 257 234 234 LEU LEU A . n 
A 1 258 LEU 258 235 235 LEU LEU A . n 
A 1 259 HIS 259 236 236 HIS HIS A . n 
A 1 260 ARG 260 237 237 ARG ARG A . n 
A 1 261 THR 261 238 238 THR THR A . n 
A 1 262 PRO 262 239 239 PRO PRO A . n 
A 1 263 GLU 263 240 240 GLU GLU A . n 
A 1 264 GLU 264 241 241 GLU GLU A . n 
A 1 265 TYR 265 242 242 TYR TYR A . n 
A 1 266 PRO 266 243 243 PRO PRO A . n 
A 1 267 GLU 267 244 244 GLU GLU A . n 
A 1 268 SER 268 245 245 SER SER A . n 
A 1 269 ALA 269 246 246 ALA ALA A . n 
A 1 270 LYS 270 247 247 LYS LYS A . n 
A 1 271 VAL 271 248 248 VAL VAL A . n 
A 1 272 TYR 272 249 249 TYR TYR A . n 
A 1 273 GLU 273 250 250 GLU GLU A . n 
A 1 274 LYS 274 251 251 LYS LYS A . n 
A 1 275 LEU 275 252 252 LEU LEU A . n 
A 1 276 LYS 276 253 253 LYS LYS A . n 
A 1 277 ASP 277 254 254 ASP ASP A . n 
A 1 278 HIS 278 255 255 HIS HIS A . n 
A 1 279 MET 279 256 256 MET MET A . n 
A 1 280 LEU 280 257 257 LEU LEU A . n 
A 1 281 ILE 281 258 258 ILE ILE A . n 
A 1 282 PRO 282 259 259 PRO PRO A . n 
A 1 283 VAL 283 260 260 VAL VAL A . n 
A 1 284 SER 284 261 261 SER SER A . n 
A 1 285 MET 285 262 262 MET MET A . n 
A 1 286 SER 286 263 263 SER SER A . n 
A 1 287 GLU 287 264 264 GLU GLU A . n 
A 1 288 LEU 288 265 265 LEU LEU A . n 
A 1 289 GLU 289 266 266 GLU GLU A . n 
A 1 290 LYS 290 267 267 LYS LYS A . n 
A 1 291 VAL 291 268 268 VAL VAL A . n 
A 1 292 ASP 292 269 269 ASP ASP A . n 
A 1 293 GLY 293 270 270 GLY GLY A . n 
A 1 294 LEU 294 271 271 LEU LEU A . n 
A 1 295 LEU 295 272 272 LEU LEU A . n 
A 1 296 THR 296 273 273 THR THR A . n 
A 1 297 SER 297 274 274 SER SER A . n 
A 1 298 CYS 298 275 275 CYS CYS A . n 
A 1 299 SER 299 276 276 SER SER A . n 
A 1 300 VAL 300 277 277 VAL VAL A . n 
A 1 301 LEU 301 278 278 LEU LEU A . n 
A 1 302 ILE 302 279 279 ILE ILE A . n 
A 1 303 ASN 303 280 280 ASN ASN A . n 
A 1 304 LYS 304 281 281 LYS LYS A . n 
A 1 305 LYS 305 282 282 LYS LYS A . n 
A 1 306 VAL 306 283 ?   ?   ?   A . n 
A 1 307 ASP 307 284 ?   ?   ?   A . n 
A 1 308 SER 308 285 ?   ?   ?   A . n 
B 1 1   MET 1   -22 ?   ?   ?   B . n 
B 1 2   GLY 2   -21 ?   ?   ?   B . n 
B 1 3   SER 3   -20 ?   ?   ?   B . n 
B 1 4   SER 4   -19 ?   ?   ?   B . n 
B 1 5   HIS 5   -18 ?   ?   ?   B . n 
B 1 6   HIS 6   -17 ?   ?   ?   B . n 
B 1 7   HIS 7   -16 ?   ?   ?   B . n 
B 1 8   HIS 8   -15 ?   ?   ?   B . n 
B 1 9   HIS 9   -14 ?   ?   ?   B . n 
B 1 10  HIS 10  -13 ?   ?   ?   B . n 
B 1 11  SER 11  -12 ?   ?   ?   B . n 
B 1 12  SER 12  -11 ?   ?   ?   B . n 
B 1 13  GLY 13  -10 ?   ?   ?   B . n 
B 1 14  LEU 14  -9  ?   ?   ?   B . n 
B 1 15  VAL 15  -8  ?   ?   ?   B . n 
B 1 16  PRO 16  -7  ?   ?   ?   B . n 
B 1 17  ARG 17  -6  ?   ?   ?   B . n 
B 1 18  GLY 18  -5  ?   ?   ?   B . n 
B 1 19  SER 19  -4  ?   ?   ?   B . n 
B 1 20  HIS 20  -3  ?   ?   ?   B . n 
B 1 21  MET 21  -2  ?   ?   ?   B . n 
B 1 22  ALA 22  -1  ?   ?   ?   B . n 
B 1 23  SER 23  0   ?   ?   ?   B . n 
B 1 24  MET 24  1   ?   ?   ?   B . n 
B 1 25  ALA 25  2   ?   ?   ?   B . n 
B 1 26  GLY 26  3   ?   ?   ?   B . n 
B 1 27  LEU 27  4   ?   ?   ?   B . n 
B 1 28  GLY 28  5   ?   ?   ?   B . n 
B 1 29  HIS 29  6   ?   ?   ?   B . n 
B 1 30  PRO 30  7   ?   ?   ?   B . n 
B 1 31  ALA 31  8   8   ALA ALA B . n 
B 1 32  ALA 32  9   9   ALA ALA B . n 
B 1 33  PHE 33  10  10  PHE PHE B . n 
B 1 34  GLY 34  11  11  GLY GLY B . n 
B 1 35  ARG 35  12  12  ARG ARG B . n 
B 1 36  ALA 36  13  13  ALA ALA B . n 
B 1 37  THR 37  14  14  THR THR B . n 
B 1 38  HIS 38  15  15  HIS HIS B . n 
B 1 39  ALA 39  16  16  ALA ALA B . n 
B 1 40  VAL 40  17  17  VAL VAL B . n 
B 1 41  VAL 41  18  18  VAL VAL B . n 
B 1 42  ARG 42  19  19  ARG ARG B . n 
B 1 43  ALA 43  20  20  ALA ALA B . n 
B 1 44  LEU 44  21  21  LEU LEU B . n 
B 1 45  PRO 45  22  22  PRO PRO B . n 
B 1 46  GLU 46  23  23  GLU GLU B . n 
B 1 47  SER 47  24  24  SER SER B . n 
B 1 48  LEU 48  25  25  LEU LEU B . n 
B 1 49  GLY 49  26  26  GLY GLY B . n 
B 1 50  GLN 50  27  27  GLN GLN B . n 
B 1 51  HIS 51  28  28  HIS HIS B . n 
B 1 52  ALA 52  29  29  ALA ALA B . n 
B 1 53  LEU 53  30  30  LEU LEU B . n 
B 1 54  ARG 54  31  31  ARG ARG B . n 
B 1 55  SER 55  32  32  SER SER B . n 
B 1 56  ALA 56  33  33  ALA ALA B . n 
B 1 57  LYS 57  34  34  LYS LYS B . n 
B 1 58  GLY 58  35  35  GLY GLY B . n 
B 1 59  GLU 59  36  36  GLU GLU B . n 
B 1 60  GLU 60  37  37  GLU GLU B . n 
B 1 61  VAL 61  38  38  VAL VAL B . n 
B 1 62  ASP 62  39  39  ASP ASP B . n 
B 1 63  VAL 63  40  40  VAL VAL B . n 
B 1 64  ALA 64  41  41  ALA ALA B . n 
B 1 65  ARG 65  42  42  ARG ARG B . n 
B 1 66  ALA 66  43  43  ALA ALA B . n 
B 1 67  GLU 67  44  44  GLU GLU B . n 
B 1 68  ARG 68  45  45  ARG ARG B . n 
B 1 69  GLN 69  46  46  GLN GLN B . n 
B 1 70  HIS 70  47  47  HIS HIS B . n 
B 1 71  GLN 71  48  48  GLN GLN B . n 
B 1 72  LEU 72  49  49  LEU LEU B . n 
B 1 73  TYR 73  50  50  TYR TYR B . n 
B 1 74  VAL 74  51  51  VAL VAL B . n 
B 1 75  GLY 75  52  52  GLY GLY B . n 
B 1 76  VAL 76  53  53  VAL VAL B . n 
B 1 77  LEU 77  54  54  LEU LEU B . n 
B 1 78  GLY 78  55  55  GLY GLY B . n 
B 1 79  SER 79  56  56  SER SER B . n 
B 1 80  LYS 80  57  57  LYS LYS B . n 
B 1 81  LEU 81  58  58  LEU LEU B . n 
B 1 82  GLY 82  59  59  GLY GLY B . n 
B 1 83  LEU 83  60  60  LEU LEU B . n 
B 1 84  GLN 84  61  61  GLN GLN B . n 
B 1 85  VAL 85  62  62  VAL VAL B . n 
B 1 86  VAL 86  63  63  VAL VAL B . n 
B 1 87  GLU 87  64  64  GLU GLU B . n 
B 1 88  LEU 88  65  65  LEU LEU B . n 
B 1 89  PRO 89  66  66  PRO PRO B . n 
B 1 90  ALA 90  67  67  ALA ALA B . n 
B 1 91  ASP 91  68  68  ASP ASP B . n 
B 1 92  GLU 92  69  69  GLU GLU B . n 
B 1 93  SER 93  70  70  SER SER B . n 
B 1 94  LEU 94  71  71  LEU LEU B . n 
B 1 95  PRO 95  72  72  PRO PRO B . n 
B 1 96  ASP 96  73  73  ASP ASP B . n 
B 1 97  CYS 97  74  74  CYS CYS B . n 
B 1 98  VAL 98  75  75  VAL VAL B . n 
B 1 99  PHE 99  76  76  PHE PHE B . n 
B 1 100 VAL 100 77  77  VAL VAL B . n 
B 1 101 GLU 101 78  78  GLU GLU B . n 
B 1 102 ASP 102 79  79  ASP ASP B . n 
B 1 103 VAL 103 80  80  VAL VAL B . n 
B 1 104 ALA 104 81  81  ALA ALA B . n 
B 1 105 VAL 105 82  82  VAL VAL B . n 
B 1 106 VAL 106 83  83  VAL VAL B . n 
B 1 107 CYS 107 84  84  CYS CYS B . n 
B 1 108 GLU 108 85  85  GLU GLU B . n 
B 1 109 GLU 109 86  86  GLU GLU B . n 
B 1 110 THR 110 87  87  THR THR B . n 
B 1 111 ALA 111 88  88  ALA ALA B . n 
B 1 112 LEU 112 89  89  LEU LEU B . n 
B 1 113 ILE 113 90  90  ILE ILE B . n 
B 1 114 THR 114 91  91  THR THR B . n 
B 1 115 ARG 115 92  92  ARG ARG B . n 
B 1 116 PRO 116 93  93  PRO PRO B . n 
B 1 117 GLY 117 94  94  GLY GLY B . n 
B 1 118 ALA 118 95  95  ALA ALA B . n 
B 1 119 PRO 119 96  96  PRO PRO B . n 
B 1 120 SER 120 97  97  SER SER B . n 
B 1 121 ARG 121 98  98  ARG ARG B . n 
B 1 122 ARG 122 99  99  ARG ARG B . n 
B 1 123 LYS 123 100 100 LYS LYS B . n 
B 1 124 GLU 124 101 101 GLU GLU B . n 
B 1 125 VAL 125 102 102 VAL VAL B . n 
B 1 126 ASP 126 103 103 ASP ASP B . n 
B 1 127 MET 127 104 104 MET MET B . n 
B 1 128 MET 128 105 105 MET MET B . n 
B 1 129 LYS 129 106 106 LYS LYS B . n 
B 1 130 GLU 130 107 107 GLU GLU B . n 
B 1 131 ALA 131 108 108 ALA ALA B . n 
B 1 132 LEU 132 109 109 LEU LEU B . n 
B 1 133 GLU 133 110 110 GLU GLU B . n 
B 1 134 LYS 134 111 111 LYS LYS B . n 
B 1 135 LEU 135 112 112 LEU LEU B . n 
B 1 136 GLN 136 113 113 GLN GLN B . n 
B 1 137 LEU 137 114 114 LEU LEU B . n 
B 1 138 ASN 138 115 115 ASN ASN B . n 
B 1 139 ILE 139 116 116 ILE ILE B . n 
B 1 140 VAL 140 117 117 VAL VAL B . n 
B 1 141 GLU 141 118 118 GLU GLU B . n 
B 1 142 MET 142 119 119 MET MET B . n 
B 1 143 LYS 143 120 120 LYS LYS B . n 
B 1 144 ASP 144 121 121 ASP ASP B . n 
B 1 145 GLU 145 122 122 GLU GLU B . n 
B 1 146 ASN 146 123 123 ASN ASN B . n 
B 1 147 ALA 147 124 124 ALA ALA B . n 
B 1 148 THR 148 125 125 THR THR B . n 
B 1 149 LEU 149 126 126 LEU LEU B . n 
B 1 150 ASP 150 127 127 ASP ASP B . n 
B 1 151 GLY 151 128 128 GLY GLY B . n 
B 1 152 GLY 152 129 129 GLY GLY B . n 
B 1 153 ASP 153 130 130 ASP ASP B . n 
B 1 154 VAL 154 131 131 VAL VAL B . n 
B 1 155 LEU 155 132 132 LEU LEU B . n 
B 1 156 PHE 156 133 133 PHE PHE B . n 
B 1 157 THR 157 134 134 THR THR B . n 
B 1 158 GLY 158 135 135 GLY GLY B . n 
B 1 159 ARG 159 136 136 ARG ARG B . n 
B 1 160 GLU 160 137 137 GLU GLU B . n 
B 1 161 PHE 161 138 138 PHE PHE B . n 
B 1 162 PHE 162 139 139 PHE PHE B . n 
B 1 163 VAL 163 140 140 VAL VAL B . n 
B 1 164 GLY 164 141 141 GLY GLY B . n 
B 1 165 LEU 165 142 142 LEU LEU B . n 
B 1 166 SER 166 143 143 SER SER B . n 
B 1 167 LYS 167 144 144 LYS LYS B . n 
B 1 168 ARG 168 145 145 ARG ARG B . n 
B 1 169 THR 169 146 146 THR THR B . n 
B 1 170 ASN 170 147 147 ASN ASN B . n 
B 1 171 GLN 171 148 148 GLN GLN B . n 
B 1 172 ARG 172 149 149 ARG ARG B . n 
B 1 173 GLY 173 150 150 GLY GLY B . n 
B 1 174 ALA 174 151 151 ALA ALA B . n 
B 1 175 GLU 175 152 152 GLU GLU B . n 
B 1 176 ILE 176 153 153 ILE ILE B . n 
B 1 177 LEU 177 154 154 LEU LEU B . n 
B 1 178 ALA 178 155 155 ALA ALA B . n 
B 1 179 ASP 179 156 156 ASP ASP B . n 
B 1 180 THR 180 157 157 THR THR B . n 
B 1 181 PHE 181 158 158 PHE PHE B . n 
B 1 182 LYS 182 159 159 LYS LYS B . n 
B 1 183 ASP 183 160 160 ASP ASP B . n 
B 1 184 TYR 184 161 161 TYR TYR B . n 
B 1 185 ALA 185 162 162 ALA ALA B . n 
B 1 186 VAL 186 163 163 VAL VAL B . n 
B 1 187 SER 187 164 164 SER SER B . n 
B 1 188 THR 188 165 165 THR THR B . n 
B 1 189 VAL 189 166 166 VAL VAL B . n 
B 1 190 PRO 190 167 167 PRO PRO B . n 
B 1 191 VAL 191 168 168 VAL VAL B . n 
B 1 192 ALA 192 169 169 ALA ALA B . n 
B 1 193 ASP 193 170 170 ASP ASP B . n 
B 1 194 GLY 194 171 171 GLY GLY B . n 
B 1 195 LEU 195 172 172 LEU LEU B . n 
B 1 196 HIS 196 173 173 HIS HIS B . n 
B 1 197 LEU 197 174 174 LEU LEU B . n 
B 1 198 LYS 198 175 175 LYS LYS B . n 
B 1 199 SER 199 176 176 SER SER B . n 
B 1 200 PHE 200 177 177 PHE PHE B . n 
B 1 201 CYS 201 178 178 CYS CYS B . n 
B 1 202 SER 202 179 179 SER SER B . n 
B 1 203 MET 203 180 180 MET MET B . n 
B 1 204 ALA 204 181 181 ALA ALA B . n 
B 1 205 GLY 205 182 182 GLY GLY B . n 
B 1 206 PRO 206 183 183 PRO PRO B . n 
B 1 207 ASN 207 184 184 ASN ASN B . n 
B 1 208 LEU 208 185 185 LEU LEU B . n 
B 1 209 ILE 209 186 186 ILE ILE B . n 
B 1 210 ALA 210 187 187 ALA ALA B . n 
B 1 211 ILE 211 188 188 ILE ILE B . n 
B 1 212 GLY 212 189 189 GLY GLY B . n 
B 1 213 SER 213 190 190 SER SER B . n 
B 1 214 SER 214 191 191 SER SER B . n 
B 1 215 GLU 215 192 192 GLU GLU B . n 
B 1 216 SER 216 193 193 SER SER B . n 
B 1 217 ALA 217 194 194 ALA ALA B . n 
B 1 218 GLN 218 195 195 GLN GLN B . n 
B 1 219 LYS 219 196 196 LYS LYS B . n 
B 1 220 ALA 220 197 197 ALA ALA B . n 
B 1 221 LEU 221 198 198 LEU LEU B . n 
B 1 222 LYS 222 199 199 LYS LYS B . n 
B 1 223 ILE 223 200 200 ILE ILE B . n 
B 1 224 MET 224 201 201 MET MET B . n 
B 1 225 GLN 225 202 202 GLN GLN B . n 
B 1 226 GLN 226 203 203 GLN GLN B . n 
B 1 227 MET 227 204 204 MET MET B . n 
B 1 228 SER 228 205 205 SER SER B . n 
B 1 229 ASP 229 206 206 ASP ASP B . n 
B 1 230 HIS 230 207 207 HIS HIS B . n 
B 1 231 ARG 231 208 208 ARG ARG B . n 
B 1 232 TYR 232 209 209 TYR TYR B . n 
B 1 233 ASP 233 210 210 ASP ASP B . n 
B 1 234 LYS 234 211 211 LYS LYS B . n 
B 1 235 LEU 235 212 212 LEU LEU B . n 
B 1 236 THR 236 213 213 THR THR B . n 
B 1 237 VAL 237 214 214 VAL VAL B . n 
B 1 238 PRO 238 215 215 PRO PRO B . n 
B 1 239 ASP 239 216 216 ASP ASP B . n 
B 1 240 ASP 240 217 217 ASP ASP B . n 
B 1 241 ILE 241 218 218 ILE ILE B . n 
B 1 242 ALA 242 219 219 ALA ALA B . n 
B 1 243 ALA 243 220 220 ALA ALA B . n 
B 1 244 ASN 244 221 221 ASN ASN B . n 
B 1 245 CYS 245 222 222 CYS CYS B . n 
B 1 246 ILE 246 223 223 ILE ILE B . n 
B 1 247 TYR 247 224 224 TYR TYR B . n 
B 1 248 LEU 248 225 225 LEU LEU B . n 
B 1 249 ASN 249 226 226 ASN ASN B . n 
B 1 250 ILE 250 227 227 ILE ILE B . n 
B 1 251 PRO 251 228 228 PRO PRO B . n 
B 1 252 ASN 252 229 229 ASN ASN B . n 
B 1 253 LYS 253 230 230 LYS LYS B . n 
B 1 254 GLY 254 231 231 GLY GLY B . n 
B 1 255 HIS 255 232 232 HIS HIS B . n 
B 1 256 VAL 256 233 233 VAL VAL B . n 
B 1 257 LEU 257 234 234 LEU LEU B . n 
B 1 258 LEU 258 235 235 LEU LEU B . n 
B 1 259 HIS 259 236 236 HIS HIS B . n 
B 1 260 ARG 260 237 237 ARG ARG B . n 
B 1 261 THR 261 238 238 THR THR B . n 
B 1 262 PRO 262 239 239 PRO PRO B . n 
B 1 263 GLU 263 240 240 GLU GLU B . n 
B 1 264 GLU 264 241 241 GLU GLU B . n 
B 1 265 TYR 265 242 242 TYR TYR B . n 
B 1 266 PRO 266 243 243 PRO PRO B . n 
B 1 267 GLU 267 244 244 GLU GLU B . n 
B 1 268 SER 268 245 245 SER SER B . n 
B 1 269 ALA 269 246 246 ALA ALA B . n 
B 1 270 LYS 270 247 247 LYS LYS B . n 
B 1 271 VAL 271 248 248 VAL VAL B . n 
B 1 272 TYR 272 249 249 TYR TYR B . n 
B 1 273 GLU 273 250 250 GLU GLU B . n 
B 1 274 LYS 274 251 251 LYS LYS B . n 
B 1 275 LEU 275 252 252 LEU LEU B . n 
B 1 276 LYS 276 253 253 LYS LYS B . n 
B 1 277 ASP 277 254 254 ASP ASP B . n 
B 1 278 HIS 278 255 255 HIS HIS B . n 
B 1 279 MET 279 256 256 MET MET B . n 
B 1 280 LEU 280 257 257 LEU LEU B . n 
B 1 281 ILE 281 258 258 ILE ILE B . n 
B 1 282 PRO 282 259 259 PRO PRO B . n 
B 1 283 VAL 283 260 260 VAL VAL B . n 
B 1 284 SER 284 261 261 SER SER B . n 
B 1 285 MET 285 262 262 MET MET B . n 
B 1 286 SER 286 263 263 SER SER B . n 
B 1 287 GLU 287 264 264 GLU GLU B . n 
B 1 288 LEU 288 265 265 LEU LEU B . n 
B 1 289 GLU 289 266 266 GLU GLU B . n 
B 1 290 LYS 290 267 267 LYS LYS B . n 
B 1 291 VAL 291 268 268 VAL VAL B . n 
B 1 292 ASP 292 269 269 ASP ASP B . n 
B 1 293 GLY 293 270 270 GLY GLY B . n 
B 1 294 LEU 294 271 271 LEU LEU B . n 
B 1 295 LEU 295 272 272 LEU LEU B . n 
B 1 296 THR 296 273 273 THR THR B . n 
B 1 297 SER 297 274 274 SER SER B . n 
B 1 298 CYS 298 275 275 CYS CYS B . n 
B 1 299 SER 299 276 276 SER SER B . n 
B 1 300 VAL 300 277 277 VAL VAL B . n 
B 1 301 LEU 301 278 278 LEU LEU B . n 
B 1 302 ILE 302 279 279 ILE ILE B . n 
B 1 303 ASN 303 280 280 ASN ASN B . n 
B 1 304 LYS 304 281 281 LYS LYS B . n 
B 1 305 LYS 305 282 282 LYS LYS B . n 
B 1 306 VAL 306 283 ?   ?   ?   B . n 
B 1 307 ASP 307 284 ?   ?   ?   B . n 
B 1 308 SER 308 285 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 LN6 1  286 1   LN6 LN6 A . 
D 2 LN6 1  286 1   LN6 LN6 B . 
E 3 HOH 1  287 4   HOH HOH A . 
E 3 HOH 2  288 5   HOH HOH A . 
E 3 HOH 3  289 7   HOH HOH A . 
E 3 HOH 4  290 9   HOH HOH A . 
E 3 HOH 5  291 11  HOH HOH A . 
E 3 HOH 6  292 12  HOH HOH A . 
E 3 HOH 7  293 13  HOH HOH A . 
E 3 HOH 8  294 23  HOH HOH A . 
E 3 HOH 9  295 27  HOH HOH A . 
E 3 HOH 10 296 28  HOH HOH A . 
E 3 HOH 11 297 30  HOH HOH A . 
E 3 HOH 12 298 31  HOH HOH A . 
E 3 HOH 13 299 33  HOH HOH A . 
E 3 HOH 14 300 36  HOH HOH A . 
E 3 HOH 15 301 38  HOH HOH A . 
E 3 HOH 16 302 42  HOH HOH A . 
E 3 HOH 17 303 44  HOH HOH A . 
E 3 HOH 18 304 45  HOH HOH A . 
E 3 HOH 19 305 47  HOH HOH A . 
E 3 HOH 20 306 49  HOH HOH A . 
E 3 HOH 21 307 51  HOH HOH A . 
E 3 HOH 22 308 53  HOH HOH A . 
E 3 HOH 23 309 59  HOH HOH A . 
E 3 HOH 24 310 60  HOH HOH A . 
E 3 HOH 25 311 62  HOH HOH A . 
E 3 HOH 26 312 64  HOH HOH A . 
E 3 HOH 27 313 65  HOH HOH A . 
E 3 HOH 28 314 66  HOH HOH A . 
E 3 HOH 29 315 68  HOH HOH A . 
E 3 HOH 30 316 72  HOH HOH A . 
E 3 HOH 31 317 73  HOH HOH A . 
E 3 HOH 32 318 76  HOH HOH A . 
E 3 HOH 33 319 78  HOH HOH A . 
E 3 HOH 34 320 83  HOH HOH A . 
E 3 HOH 35 321 84  HOH HOH A . 
E 3 HOH 36 322 86  HOH HOH A . 
E 3 HOH 37 323 93  HOH HOH A . 
E 3 HOH 38 324 96  HOH HOH A . 
E 3 HOH 39 325 102 HOH HOH A . 
E 3 HOH 40 326 103 HOH HOH A . 
E 3 HOH 41 327 110 HOH HOH A . 
E 3 HOH 42 328 111 HOH HOH A . 
E 3 HOH 43 329 116 HOH HOH A . 
E 3 HOH 44 330 118 HOH HOH A . 
E 3 HOH 45 331 119 HOH HOH A . 
E 3 HOH 46 332 121 HOH HOH A . 
E 3 HOH 47 333 124 HOH HOH A . 
E 3 HOH 48 334 125 HOH HOH A . 
E 3 HOH 49 335 126 HOH HOH A . 
E 3 HOH 50 336 127 HOH HOH A . 
E 3 HOH 51 337 128 HOH HOH A . 
E 3 HOH 52 338 129 HOH HOH A . 
E 3 HOH 53 339 130 HOH HOH A . 
E 3 HOH 54 340 132 HOH HOH A . 
E 3 HOH 55 341 133 HOH HOH A . 
E 3 HOH 56 342 134 HOH HOH A . 
E 3 HOH 57 343 136 HOH HOH A . 
E 3 HOH 58 344 137 HOH HOH A . 
E 3 HOH 59 345 139 HOH HOH A . 
E 3 HOH 60 346 146 HOH HOH A . 
E 3 HOH 61 347 147 HOH HOH A . 
E 3 HOH 62 348 148 HOH HOH A . 
E 3 HOH 63 349 150 HOH HOH A . 
E 3 HOH 64 350 151 HOH HOH A . 
F 3 HOH 1  287 1   HOH HOH B . 
F 3 HOH 2  288 2   HOH HOH B . 
F 3 HOH 3  289 3   HOH HOH B . 
F 3 HOH 4  290 6   HOH HOH B . 
F 3 HOH 5  291 8   HOH HOH B . 
F 3 HOH 6  292 10  HOH HOH B . 
F 3 HOH 7  293 14  HOH HOH B . 
F 3 HOH 8  294 15  HOH HOH B . 
F 3 HOH 9  295 16  HOH HOH B . 
F 3 HOH 10 296 17  HOH HOH B . 
F 3 HOH 11 297 18  HOH HOH B . 
F 3 HOH 12 298 20  HOH HOH B . 
F 3 HOH 13 299 22  HOH HOH B . 
F 3 HOH 14 300 25  HOH HOH B . 
F 3 HOH 15 301 26  HOH HOH B . 
F 3 HOH 16 302 29  HOH HOH B . 
F 3 HOH 17 303 32  HOH HOH B . 
F 3 HOH 18 304 34  HOH HOH B . 
F 3 HOH 19 305 35  HOH HOH B . 
F 3 HOH 20 306 39  HOH HOH B . 
F 3 HOH 21 307 41  HOH HOH B . 
F 3 HOH 22 308 48  HOH HOH B . 
F 3 HOH 23 309 50  HOH HOH B . 
F 3 HOH 24 310 54  HOH HOH B . 
F 3 HOH 25 311 55  HOH HOH B . 
F 3 HOH 26 312 56  HOH HOH B . 
F 3 HOH 27 313 58  HOH HOH B . 
F 3 HOH 28 314 61  HOH HOH B . 
F 3 HOH 29 315 63  HOH HOH B . 
F 3 HOH 30 316 67  HOH HOH B . 
F 3 HOH 31 317 70  HOH HOH B . 
F 3 HOH 32 318 71  HOH HOH B . 
F 3 HOH 33 319 74  HOH HOH B . 
F 3 HOH 34 320 75  HOH HOH B . 
F 3 HOH 35 321 77  HOH HOH B . 
F 3 HOH 36 322 79  HOH HOH B . 
F 3 HOH 37 323 80  HOH HOH B . 
F 3 HOH 38 324 81  HOH HOH B . 
F 3 HOH 39 325 82  HOH HOH B . 
F 3 HOH 40 326 85  HOH HOH B . 
F 3 HOH 41 327 88  HOH HOH B . 
F 3 HOH 42 328 89  HOH HOH B . 
F 3 HOH 43 329 90  HOH HOH B . 
F 3 HOH 44 330 91  HOH HOH B . 
F 3 HOH 45 331 94  HOH HOH B . 
F 3 HOH 46 332 95  HOH HOH B . 
F 3 HOH 47 333 97  HOH HOH B . 
F 3 HOH 48 334 98  HOH HOH B . 
F 3 HOH 49 335 100 HOH HOH B . 
F 3 HOH 50 336 101 HOH HOH B . 
F 3 HOH 51 337 104 HOH HOH B . 
F 3 HOH 52 338 105 HOH HOH B . 
F 3 HOH 53 339 106 HOH HOH B . 
F 3 HOH 54 340 108 HOH HOH B . 
F 3 HOH 55 341 109 HOH HOH B . 
F 3 HOH 56 342 112 HOH HOH B . 
F 3 HOH 57 343 113 HOH HOH B . 
F 3 HOH 58 344 114 HOH HOH B . 
F 3 HOH 59 345 115 HOH HOH B . 
F 3 HOH 60 346 131 HOH HOH B . 
F 3 HOH 61 347 138 HOH HOH B . 
F 3 HOH 62 348 141 HOH HOH B . 
F 3 HOH 63 349 142 HOH HOH B . 
F 3 HOH 64 350 144 HOH HOH B . 
F 3 HOH 65 351 149 HOH HOH B . 
F 3 HOH 66 352 152 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-11-10 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_software.classification'       
2 3 'Structure model' '_software.contact_author'       
3 3 'Structure model' '_software.contact_author_email' 
4 3 'Structure model' '_software.date'                 
5 3 'Structure model' '_software.language'             
6 3 'Structure model' '_software.location'             
7 3 'Structure model' '_software.name'                 
8 3 'Structure model' '_software.type'                 
9 3 'Structure model' '_software.version'              
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .       ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                  ?          ? 
2 SCALEPACK   .       ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                  ?          ? 
3 CNS         .       ?               package 'Axel T. Brunger'    axel.brunger@yale.edu    refinement        
http://cns-online.org/                    Fortran_77 ? 
4 PDB_EXTRACT 3.10    'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++        ? 
5 ADSC        Quantum ?               ?       ?                    ?                        'data collection' ? ?          ? 
6 HKL-2000    .       ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
7 PHASER      .       ?               ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 71  ? ? -113.41 73.80   
2  1 PRO A 72  ? ? -49.99  -14.82  
3  1 PHE A 76  ? ? -91.97  59.92   
4  1 GLU A 85  ? ? 61.66   -108.13 
5  1 ASP A 121 ? ? -31.86  117.45  
6  1 GLN A 148 ? ? -48.22  -70.21  
7  1 PHE A 158 ? ? -118.88 64.98   
8  1 ASP A 170 ? ? 57.34   -151.04 
9  1 SER A 179 ? ? 171.59  165.72  
10 1 SER A 191 ? ? -36.06  147.37  
11 1 ASN A 229 ? ? 76.94   -3.83   
12 1 MET A 262 ? ? -149.13 22.96   
13 1 VAL A 268 ? ? -118.43 51.59   
14 1 ASP A 269 ? ? 48.13   29.83   
15 1 ALA B 9   ? ? -150.84 -144.05 
16 1 ASP B 39  ? ? -66.24  94.76   
17 1 ALA B 81  ? ? -170.59 141.24  
18 1 GLU B 85  ? ? 61.23   -126.32 
19 1 SER B 97  ? ? -57.13  -8.56   
20 1 ARG B 99  ? ? -45.23  -16.47  
21 1 ASP B 103 ? ? -34.57  -70.34  
22 1 ASP B 121 ? ? -29.62  99.62   
23 1 GLU B 122 ? ? -55.47  -0.68   
24 1 LEU B 126 ? ? 177.08  135.34  
25 1 ASP B 130 ? ? -68.06  0.70    
26 1 SER B 143 ? ? -109.87 -161.84 
27 1 PHE B 158 ? ? -103.20 54.70   
28 1 ASP B 160 ? ? -57.40  -7.01   
29 1 ASP B 170 ? ? 41.70   -136.16 
30 1 LYS B 175 ? ? -67.20  18.68   
31 1 SER B 179 ? ? 178.97  170.22  
32 1 ALA B 220 ? ? -57.44  -6.99   
33 1 CYS B 222 ? ? -148.12 -159.70 
34 1 ASN B 229 ? ? 73.34   -0.48   
35 1 LYS B 230 ? ? -122.79 -58.37  
36 1 SER B 263 ? ? 5.08    -61.60  
37 1 LEU B 271 ? ? -102.64 -161.72 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 34  ? CG  ? A LYS 57  CG  
2   1 Y 1 A LYS 34  ? CD  ? A LYS 57  CD  
3   1 Y 1 A LYS 34  ? CE  ? A LYS 57  CE  
4   1 Y 1 A LYS 34  ? NZ  ? A LYS 57  NZ  
5   1 Y 1 A LYS 106 ? CG  ? A LYS 129 CG  
6   1 Y 1 A LYS 106 ? CD  ? A LYS 129 CD  
7   1 Y 1 A LYS 106 ? CE  ? A LYS 129 CE  
8   1 Y 1 A LYS 106 ? NZ  ? A LYS 129 NZ  
9   1 Y 1 A GLU 107 ? CG  ? A GLU 130 CG  
10  1 Y 1 A GLU 107 ? CD  ? A GLU 130 CD  
11  1 Y 1 A GLU 107 ? OE1 ? A GLU 130 OE1 
12  1 Y 1 A GLU 107 ? OE2 ? A GLU 130 OE2 
13  1 Y 1 A LYS 111 ? CG  ? A LYS 134 CG  
14  1 Y 1 A LYS 111 ? CD  ? A LYS 134 CD  
15  1 Y 1 A LYS 111 ? CE  ? A LYS 134 CE  
16  1 Y 1 A LYS 111 ? NZ  ? A LYS 134 NZ  
17  1 Y 1 A GLU 122 ? CG  ? A GLU 145 CG  
18  1 Y 1 A GLU 122 ? CD  ? A GLU 145 CD  
19  1 Y 1 A GLU 122 ? OE1 ? A GLU 145 OE1 
20  1 Y 1 A GLU 122 ? OE2 ? A GLU 145 OE2 
21  1 Y 1 A LYS 144 ? CG  ? A LYS 167 CG  
22  1 Y 1 A LYS 144 ? CD  ? A LYS 167 CD  
23  1 Y 1 A LYS 144 ? CE  ? A LYS 167 CE  
24  1 Y 1 A LYS 144 ? NZ  ? A LYS 167 NZ  
25  1 Y 1 A ASP 170 ? CG  ? A ASP 193 CG  
26  1 Y 1 A ASP 170 ? OD1 ? A ASP 193 OD1 
27  1 Y 1 A ASP 170 ? OD2 ? A ASP 193 OD2 
28  1 Y 1 A GLU 192 ? CG  ? A GLU 215 CG  
29  1 Y 1 A GLU 192 ? CD  ? A GLU 215 CD  
30  1 Y 1 A GLU 192 ? OE1 ? A GLU 215 OE1 
31  1 Y 1 A GLU 192 ? OE2 ? A GLU 215 OE2 
32  1 Y 1 A LYS 196 ? CG  ? A LYS 219 CG  
33  1 Y 1 A LYS 196 ? CD  ? A LYS 219 CD  
34  1 Y 1 A LYS 196 ? CE  ? A LYS 219 CE  
35  1 Y 1 A LYS 196 ? NZ  ? A LYS 219 NZ  
36  1 Y 1 A HIS 207 ? CG  ? A HIS 230 CG  
37  1 Y 1 A HIS 207 ? ND1 ? A HIS 230 ND1 
38  1 Y 1 A HIS 207 ? CD2 ? A HIS 230 CD2 
39  1 Y 1 A HIS 207 ? CE1 ? A HIS 230 CE1 
40  1 Y 1 A HIS 207 ? NE2 ? A HIS 230 NE2 
41  1 Y 1 A ARG 208 ? CG  ? A ARG 231 CG  
42  1 Y 1 A ARG 208 ? CD  ? A ARG 231 CD  
43  1 Y 1 A ARG 208 ? NE  ? A ARG 231 NE  
44  1 Y 1 A ARG 208 ? CZ  ? A ARG 231 CZ  
45  1 Y 1 A ARG 208 ? NH1 ? A ARG 231 NH1 
46  1 Y 1 A ARG 208 ? NH2 ? A ARG 231 NH2 
47  1 Y 1 A LYS 230 ? CG  ? A LYS 253 CG  
48  1 Y 1 A LYS 230 ? CD  ? A LYS 253 CD  
49  1 Y 1 A LYS 230 ? CE  ? A LYS 253 CE  
50  1 Y 1 A LYS 230 ? NZ  ? A LYS 253 NZ  
51  1 Y 1 A LYS 282 ? CG  ? A LYS 305 CG  
52  1 Y 1 A LYS 282 ? CD  ? A LYS 305 CD  
53  1 Y 1 A LYS 282 ? CE  ? A LYS 305 CE  
54  1 Y 1 A LYS 282 ? NZ  ? A LYS 305 NZ  
55  1 Y 1 B LYS 34  ? CG  ? B LYS 57  CG  
56  1 Y 1 B LYS 34  ? CD  ? B LYS 57  CD  
57  1 Y 1 B LYS 34  ? CE  ? B LYS 57  CE  
58  1 Y 1 B LYS 34  ? NZ  ? B LYS 57  NZ  
59  1 Y 1 B ARG 42  ? CG  ? B ARG 65  CG  
60  1 Y 1 B ARG 42  ? CD  ? B ARG 65  CD  
61  1 Y 1 B ARG 42  ? NE  ? B ARG 65  NE  
62  1 Y 1 B ARG 42  ? CZ  ? B ARG 65  CZ  
63  1 Y 1 B ARG 42  ? NH1 ? B ARG 65  NH1 
64  1 Y 1 B ARG 42  ? NH2 ? B ARG 65  NH2 
65  1 Y 1 B LYS 57  ? CG  ? B LYS 80  CG  
66  1 Y 1 B LYS 57  ? CD  ? B LYS 80  CD  
67  1 Y 1 B LYS 57  ? CE  ? B LYS 80  CE  
68  1 Y 1 B LYS 57  ? NZ  ? B LYS 80  NZ  
69  1 Y 1 B LYS 100 ? CG  ? B LYS 123 CG  
70  1 Y 1 B LYS 100 ? CD  ? B LYS 123 CD  
71  1 Y 1 B LYS 100 ? CE  ? B LYS 123 CE  
72  1 Y 1 B LYS 100 ? NZ  ? B LYS 123 NZ  
73  1 Y 1 B LYS 106 ? CG  ? B LYS 129 CG  
74  1 Y 1 B LYS 106 ? CD  ? B LYS 129 CD  
75  1 Y 1 B LYS 106 ? CE  ? B LYS 129 CE  
76  1 Y 1 B LYS 106 ? NZ  ? B LYS 129 NZ  
77  1 Y 1 B LYS 111 ? CG  ? B LYS 134 CG  
78  1 Y 1 B LYS 111 ? CD  ? B LYS 134 CD  
79  1 Y 1 B LYS 111 ? CE  ? B LYS 134 CE  
80  1 Y 1 B LYS 111 ? NZ  ? B LYS 134 NZ  
81  1 Y 1 B GLN 113 ? CG  ? B GLN 136 CG  
82  1 Y 1 B GLN 113 ? CD  ? B GLN 136 CD  
83  1 Y 1 B GLN 113 ? OE1 ? B GLN 136 OE1 
84  1 Y 1 B GLN 113 ? NE2 ? B GLN 136 NE2 
85  1 Y 1 B LEU 114 ? CG  ? B LEU 137 CG  
86  1 Y 1 B LEU 114 ? CD1 ? B LEU 137 CD1 
87  1 Y 1 B LEU 114 ? CD2 ? B LEU 137 CD2 
88  1 Y 1 B GLU 122 ? CG  ? B GLU 145 CG  
89  1 Y 1 B GLU 122 ? CD  ? B GLU 145 CD  
90  1 Y 1 B GLU 122 ? OE1 ? B GLU 145 OE1 
91  1 Y 1 B GLU 122 ? OE2 ? B GLU 145 OE2 
92  1 Y 1 B LYS 144 ? CG  ? B LYS 167 CG  
93  1 Y 1 B LYS 144 ? CD  ? B LYS 167 CD  
94  1 Y 1 B LYS 144 ? CE  ? B LYS 167 CE  
95  1 Y 1 B LYS 144 ? NZ  ? B LYS 167 NZ  
96  1 Y 1 B ASP 170 ? CG  ? B ASP 193 CG  
97  1 Y 1 B ASP 170 ? OD1 ? B ASP 193 OD1 
98  1 Y 1 B ASP 170 ? OD2 ? B ASP 193 OD2 
99  1 Y 1 B GLU 192 ? CG  ? B GLU 215 CG  
100 1 Y 1 B GLU 192 ? CD  ? B GLU 215 CD  
101 1 Y 1 B GLU 192 ? OE1 ? B GLU 215 OE1 
102 1 Y 1 B GLU 192 ? OE2 ? B GLU 215 OE2 
103 1 Y 1 B LYS 196 ? CG  ? B LYS 219 CG  
104 1 Y 1 B LYS 196 ? CD  ? B LYS 219 CD  
105 1 Y 1 B LYS 196 ? CE  ? B LYS 219 CE  
106 1 Y 1 B LYS 196 ? NZ  ? B LYS 219 NZ  
107 1 Y 1 B LYS 199 ? CG  ? B LYS 222 CG  
108 1 Y 1 B LYS 199 ? CD  ? B LYS 222 CD  
109 1 Y 1 B LYS 199 ? CE  ? B LYS 222 CE  
110 1 Y 1 B LYS 199 ? NZ  ? B LYS 222 NZ  
111 1 Y 1 B ARG 208 ? CG  ? B ARG 231 CG  
112 1 Y 1 B ARG 208 ? CD  ? B ARG 231 CD  
113 1 Y 1 B ARG 208 ? NE  ? B ARG 231 NE  
114 1 Y 1 B ARG 208 ? CZ  ? B ARG 231 CZ  
115 1 Y 1 B ARG 208 ? NH1 ? B ARG 231 NH1 
116 1 Y 1 B ARG 208 ? NH2 ? B ARG 231 NH2 
117 1 Y 1 B ILE 227 ? CG1 ? B ILE 250 CG1 
118 1 Y 1 B ILE 227 ? CG2 ? B ILE 250 CG2 
119 1 Y 1 B ILE 227 ? CD1 ? B ILE 250 CD1 
120 1 Y 1 B ASN 229 ? CG  ? B ASN 252 CG  
121 1 Y 1 B ASN 229 ? OD1 ? B ASN 252 OD1 
122 1 Y 1 B ASN 229 ? ND2 ? B ASN 252 ND2 
123 1 Y 1 B LYS 230 ? CG  ? B LYS 253 CG  
124 1 Y 1 B LYS 230 ? CD  ? B LYS 253 CD  
125 1 Y 1 B LYS 230 ? CE  ? B LYS 253 CE  
126 1 Y 1 B LYS 230 ? NZ  ? B LYS 253 NZ  
127 1 Y 1 B ASP 254 ? CG  ? B ASP 277 CG  
128 1 Y 1 B ASP 254 ? OD1 ? B ASP 277 OD1 
129 1 Y 1 B ASP 254 ? OD2 ? B ASP 277 OD2 
130 1 Y 1 B LYS 282 ? CG  ? B LYS 305 CG  
131 1 Y 1 B LYS 282 ? CD  ? B LYS 305 CD  
132 1 Y 1 B LYS 282 ? CE  ? B LYS 305 CE  
133 1 Y 1 B LYS 282 ? NZ  ? B LYS 305 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -22 ? A MET 1   
2  1 Y 1 A GLY -21 ? A GLY 2   
3  1 Y 1 A SER -20 ? A SER 3   
4  1 Y 1 A SER -19 ? A SER 4   
5  1 Y 1 A HIS -18 ? A HIS 5   
6  1 Y 1 A HIS -17 ? A HIS 6   
7  1 Y 1 A HIS -16 ? A HIS 7   
8  1 Y 1 A HIS -15 ? A HIS 8   
9  1 Y 1 A HIS -14 ? A HIS 9   
10 1 Y 1 A HIS -13 ? A HIS 10  
11 1 Y 1 A SER -12 ? A SER 11  
12 1 Y 1 A SER -11 ? A SER 12  
13 1 Y 1 A GLY -10 ? A GLY 13  
14 1 Y 1 A LEU -9  ? A LEU 14  
15 1 Y 1 A VAL -8  ? A VAL 15  
16 1 Y 1 A PRO -7  ? A PRO 16  
17 1 Y 1 A ARG -6  ? A ARG 17  
18 1 Y 1 A GLY -5  ? A GLY 18  
19 1 Y 1 A SER -4  ? A SER 19  
20 1 Y 1 A HIS -3  ? A HIS 20  
21 1 Y 1 A MET -2  ? A MET 21  
22 1 Y 1 A ALA -1  ? A ALA 22  
23 1 Y 1 A SER 0   ? A SER 23  
24 1 Y 1 A MET 1   ? A MET 24  
25 1 Y 1 A ALA 2   ? A ALA 25  
26 1 Y 1 A GLY 3   ? A GLY 26  
27 1 Y 1 A LEU 4   ? A LEU 27  
28 1 Y 1 A GLY 5   ? A GLY 28  
29 1 Y 1 A HIS 6   ? A HIS 29  
30 1 Y 1 A PRO 7   ? A PRO 30  
31 1 Y 1 A VAL 283 ? A VAL 306 
32 1 Y 1 A ASP 284 ? A ASP 307 
33 1 Y 1 A SER 285 ? A SER 308 
34 1 Y 1 B MET -22 ? B MET 1   
35 1 Y 1 B GLY -21 ? B GLY 2   
36 1 Y 1 B SER -20 ? B SER 3   
37 1 Y 1 B SER -19 ? B SER 4   
38 1 Y 1 B HIS -18 ? B HIS 5   
39 1 Y 1 B HIS -17 ? B HIS 6   
40 1 Y 1 B HIS -16 ? B HIS 7   
41 1 Y 1 B HIS -15 ? B HIS 8   
42 1 Y 1 B HIS -14 ? B HIS 9   
43 1 Y 1 B HIS -13 ? B HIS 10  
44 1 Y 1 B SER -12 ? B SER 11  
45 1 Y 1 B SER -11 ? B SER 12  
46 1 Y 1 B GLY -10 ? B GLY 13  
47 1 Y 1 B LEU -9  ? B LEU 14  
48 1 Y 1 B VAL -8  ? B VAL 15  
49 1 Y 1 B PRO -7  ? B PRO 16  
50 1 Y 1 B ARG -6  ? B ARG 17  
51 1 Y 1 B GLY -5  ? B GLY 18  
52 1 Y 1 B SER -4  ? B SER 19  
53 1 Y 1 B HIS -3  ? B HIS 20  
54 1 Y 1 B MET -2  ? B MET 21  
55 1 Y 1 B ALA -1  ? B ALA 22  
56 1 Y 1 B SER 0   ? B SER 23  
57 1 Y 1 B MET 1   ? B MET 24  
58 1 Y 1 B ALA 2   ? B ALA 25  
59 1 Y 1 B GLY 3   ? B GLY 26  
60 1 Y 1 B LEU 4   ? B LEU 27  
61 1 Y 1 B GLY 5   ? B GLY 28  
62 1 Y 1 B HIS 6   ? B HIS 29  
63 1 Y 1 B PRO 7   ? B PRO 30  
64 1 Y 1 B VAL 283 ? B VAL 306 
65 1 Y 1 B ASP 284 ? B ASP 307 
66 1 Y 1 B SER 285 ? B SER 308 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'N~5~-[(1E)-pentanimidoyl]-L-ornithine' LN6 
3 water                                   HOH 
#