data_3PE4
# 
_entry.id   3PE4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3PE4         
RCSB  RCSB062266   
WWPDB D_1000062266 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3PE3 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3PE4 
_pdbx_database_status.recvd_initial_deposition_date   2010-10-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lazarus, M.B.' 1 
'Nam, Y.'       2 
'Jiang, J.'     3 
'Sliz, P.'      4 
'Walker, S.'    5 
# 
_citation.id                        primary 
_citation.title                     'Structure of human O-GlcNAc transferase and its complex with a peptide substrate.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            469 
_citation.page_first                564 
_citation.page_last                 567 
_citation.year                      2011 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21240259 
_citation.pdbx_database_id_DOI      10.1038/nature09638 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lazarus, M.B.' 1 
primary 'Nam, Y.'       2 
primary 'Jiang, J.'     3 
primary 'Sliz, P.'      4 
primary 'Walker, S.'    5 
# 
_cell.entry_id           3PE4 
_cell.length_a           98.6 
_cell.length_b           136.7 
_cell.length_c           153.5 
_cell.angle_alpha        90.0 
_cell.angle_beta         102.9 
_cell.angle_gamma        90.0 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3PE4 
_symmetry.space_group_name_H-M             'I 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit' 80974.508 2   2.4.1.- ? 
'hOGT4.5, UNP residues 323-1041' ? 
2 polymer     syn 'Casein kinase II subunit alpha'                                                   1398.562  2   ?       ? 
'UNP residues 340-352'           ? 
3 non-polymer syn "URIDINE-5'-DIPHOSPHATE"                                                           404.161   2   ?       ? ? ? 
4 non-polymer syn 'SULFATE ION'                                                                      96.063    3   ?       ? ? ? 
5 water       nat water                                                                              18.015    854 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'O-GlcNAc transferase subunit p110, O-linked N-acetylglucosamine transferase 110 kDa subunit' 
2 'CK II alpha'                                                                                 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPGSCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAY
SNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCD
WTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRV
GYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVN
MNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKK
AVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQIT
INGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRF
PAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAAS
QLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
PVE
;
;GPGSCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAY
SNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCD
WTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRV
GYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVN
MNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKK
AVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQIT
INGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRF
PAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAAS
QLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
PVE
;
A,C ? 
2 'polypeptide(L)' no no YPGGSTPVSSANMM YPGGSTPVSSANMM B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   SER n 
1 5   CYS n 
1 6   PRO n 
1 7   THR n 
1 8   HIS n 
1 9   ALA n 
1 10  ASP n 
1 11  SER n 
1 12  LEU n 
1 13  ASN n 
1 14  ASN n 
1 15  LEU n 
1 16  ALA n 
1 17  ASN n 
1 18  ILE n 
1 19  LYS n 
1 20  ARG n 
1 21  GLU n 
1 22  GLN n 
1 23  GLY n 
1 24  ASN n 
1 25  ILE n 
1 26  GLU n 
1 27  GLU n 
1 28  ALA n 
1 29  VAL n 
1 30  ARG n 
1 31  LEU n 
1 32  TYR n 
1 33  ARG n 
1 34  LYS n 
1 35  ALA n 
1 36  LEU n 
1 37  GLU n 
1 38  VAL n 
1 39  PHE n 
1 40  PRO n 
1 41  GLU n 
1 42  PHE n 
1 43  ALA n 
1 44  ALA n 
1 45  ALA n 
1 46  HIS n 
1 47  SER n 
1 48  ASN n 
1 49  LEU n 
1 50  ALA n 
1 51  SER n 
1 52  VAL n 
1 53  LEU n 
1 54  GLN n 
1 55  GLN n 
1 56  GLN n 
1 57  GLY n 
1 58  LYS n 
1 59  LEU n 
1 60  GLN n 
1 61  GLU n 
1 62  ALA n 
1 63  LEU n 
1 64  MET n 
1 65  HIS n 
1 66  TYR n 
1 67  LYS n 
1 68  GLU n 
1 69  ALA n 
1 70  ILE n 
1 71  ARG n 
1 72  ILE n 
1 73  SER n 
1 74  PRO n 
1 75  THR n 
1 76  PHE n 
1 77  ALA n 
1 78  ASP n 
1 79  ALA n 
1 80  TYR n 
1 81  SER n 
1 82  ASN n 
1 83  MET n 
1 84  GLY n 
1 85  ASN n 
1 86  THR n 
1 87  LEU n 
1 88  LYS n 
1 89  GLU n 
1 90  MET n 
1 91  GLN n 
1 92  ASP n 
1 93  VAL n 
1 94  GLN n 
1 95  GLY n 
1 96  ALA n 
1 97  LEU n 
1 98  GLN n 
1 99  CYS n 
1 100 TYR n 
1 101 THR n 
1 102 ARG n 
1 103 ALA n 
1 104 ILE n 
1 105 GLN n 
1 106 ILE n 
1 107 ASN n 
1 108 PRO n 
1 109 ALA n 
1 110 PHE n 
1 111 ALA n 
1 112 ASP n 
1 113 ALA n 
1 114 HIS n 
1 115 SER n 
1 116 ASN n 
1 117 LEU n 
1 118 ALA n 
1 119 SER n 
1 120 ILE n 
1 121 HIS n 
1 122 LYS n 
1 123 ASP n 
1 124 SER n 
1 125 GLY n 
1 126 ASN n 
1 127 ILE n 
1 128 PRO n 
1 129 GLU n 
1 130 ALA n 
1 131 ILE n 
1 132 ALA n 
1 133 SER n 
1 134 TYR n 
1 135 ARG n 
1 136 THR n 
1 137 ALA n 
1 138 LEU n 
1 139 LYS n 
1 140 LEU n 
1 141 LYS n 
1 142 PRO n 
1 143 ASP n 
1 144 PHE n 
1 145 PRO n 
1 146 ASP n 
1 147 ALA n 
1 148 TYR n 
1 149 CYS n 
1 150 ASN n 
1 151 LEU n 
1 152 ALA n 
1 153 HIS n 
1 154 CYS n 
1 155 LEU n 
1 156 GLN n 
1 157 ILE n 
1 158 VAL n 
1 159 CYS n 
1 160 ASP n 
1 161 TRP n 
1 162 THR n 
1 163 ASP n 
1 164 TYR n 
1 165 ASP n 
1 166 GLU n 
1 167 ARG n 
1 168 MET n 
1 169 LYS n 
1 170 LYS n 
1 171 LEU n 
1 172 VAL n 
1 173 SER n 
1 174 ILE n 
1 175 VAL n 
1 176 ALA n 
1 177 ASP n 
1 178 GLN n 
1 179 LEU n 
1 180 GLU n 
1 181 LYS n 
1 182 ASN n 
1 183 ARG n 
1 184 LEU n 
1 185 PRO n 
1 186 SER n 
1 187 VAL n 
1 188 HIS n 
1 189 PRO n 
1 190 HIS n 
1 191 HIS n 
1 192 SER n 
1 193 MET n 
1 194 LEU n 
1 195 TYR n 
1 196 PRO n 
1 197 LEU n 
1 198 SER n 
1 199 HIS n 
1 200 GLY n 
1 201 PHE n 
1 202 ARG n 
1 203 LYS n 
1 204 ALA n 
1 205 ILE n 
1 206 ALA n 
1 207 GLU n 
1 208 ARG n 
1 209 HIS n 
1 210 GLY n 
1 211 ASN n 
1 212 LEU n 
1 213 CYS n 
1 214 LEU n 
1 215 ASP n 
1 216 LYS n 
1 217 ILE n 
1 218 ASN n 
1 219 VAL n 
1 220 LEU n 
1 221 HIS n 
1 222 LYS n 
1 223 PRO n 
1 224 PRO n 
1 225 TYR n 
1 226 GLU n 
1 227 HIS n 
1 228 PRO n 
1 229 LYS n 
1 230 ASP n 
1 231 LEU n 
1 232 LYS n 
1 233 LEU n 
1 234 SER n 
1 235 ASP n 
1 236 GLY n 
1 237 ARG n 
1 238 LEU n 
1 239 ARG n 
1 240 VAL n 
1 241 GLY n 
1 242 TYR n 
1 243 VAL n 
1 244 SER n 
1 245 SER n 
1 246 ASP n 
1 247 PHE n 
1 248 GLY n 
1 249 ASN n 
1 250 HIS n 
1 251 PRO n 
1 252 THR n 
1 253 SER n 
1 254 HIS n 
1 255 LEU n 
1 256 MET n 
1 257 GLN n 
1 258 SER n 
1 259 ILE n 
1 260 PRO n 
1 261 GLY n 
1 262 MET n 
1 263 HIS n 
1 264 ASN n 
1 265 PRO n 
1 266 ASP n 
1 267 LYS n 
1 268 PHE n 
1 269 GLU n 
1 270 VAL n 
1 271 PHE n 
1 272 CYS n 
1 273 TYR n 
1 274 ALA n 
1 275 LEU n 
1 276 SER n 
1 277 PRO n 
1 278 ASP n 
1 279 ASP n 
1 280 GLY n 
1 281 THR n 
1 282 ASN n 
1 283 PHE n 
1 284 ARG n 
1 285 VAL n 
1 286 LYS n 
1 287 VAL n 
1 288 MET n 
1 289 ALA n 
1 290 GLU n 
1 291 ALA n 
1 292 ASN n 
1 293 HIS n 
1 294 PHE n 
1 295 ILE n 
1 296 ASP n 
1 297 LEU n 
1 298 SER n 
1 299 GLN n 
1 300 ILE n 
1 301 PRO n 
1 302 CYS n 
1 303 ASN n 
1 304 GLY n 
1 305 LYS n 
1 306 ALA n 
1 307 ALA n 
1 308 ASP n 
1 309 ARG n 
1 310 ILE n 
1 311 HIS n 
1 312 GLN n 
1 313 ASP n 
1 314 GLY n 
1 315 ILE n 
1 316 HIS n 
1 317 ILE n 
1 318 LEU n 
1 319 VAL n 
1 320 ASN n 
1 321 MET n 
1 322 ASN n 
1 323 GLY n 
1 324 TYR n 
1 325 THR n 
1 326 LYS n 
1 327 GLY n 
1 328 ALA n 
1 329 ARG n 
1 330 ASN n 
1 331 GLU n 
1 332 LEU n 
1 333 PHE n 
1 334 ALA n 
1 335 LEU n 
1 336 ARG n 
1 337 PRO n 
1 338 ALA n 
1 339 PRO n 
1 340 ILE n 
1 341 GLN n 
1 342 ALA n 
1 343 MET n 
1 344 TRP n 
1 345 LEU n 
1 346 GLY n 
1 347 TYR n 
1 348 PRO n 
1 349 GLY n 
1 350 THR n 
1 351 SER n 
1 352 GLY n 
1 353 ALA n 
1 354 LEU n 
1 355 PHE n 
1 356 MET n 
1 357 ASP n 
1 358 TYR n 
1 359 ILE n 
1 360 ILE n 
1 361 THR n 
1 362 ASP n 
1 363 GLN n 
1 364 GLU n 
1 365 THR n 
1 366 SER n 
1 367 PRO n 
1 368 ALA n 
1 369 GLU n 
1 370 VAL n 
1 371 ALA n 
1 372 GLU n 
1 373 GLN n 
1 374 TYR n 
1 375 SER n 
1 376 GLU n 
1 377 LYS n 
1 378 LEU n 
1 379 ALA n 
1 380 TYR n 
1 381 MET n 
1 382 PRO n 
1 383 HIS n 
1 384 THR n 
1 385 PHE n 
1 386 PHE n 
1 387 ILE n 
1 388 GLY n 
1 389 ASP n 
1 390 HIS n 
1 391 ALA n 
1 392 ASN n 
1 393 MET n 
1 394 PHE n 
1 395 PRO n 
1 396 HIS n 
1 397 LEU n 
1 398 LYS n 
1 399 LYS n 
1 400 LYS n 
1 401 ALA n 
1 402 VAL n 
1 403 ILE n 
1 404 ASP n 
1 405 PHE n 
1 406 LYS n 
1 407 SER n 
1 408 ASN n 
1 409 GLY n 
1 410 HIS n 
1 411 ILE n 
1 412 TYR n 
1 413 ASP n 
1 414 ASN n 
1 415 ARG n 
1 416 ILE n 
1 417 VAL n 
1 418 LEU n 
1 419 ASN n 
1 420 GLY n 
1 421 ILE n 
1 422 ASP n 
1 423 LEU n 
1 424 LYS n 
1 425 ALA n 
1 426 PHE n 
1 427 LEU n 
1 428 ASP n 
1 429 SER n 
1 430 LEU n 
1 431 PRO n 
1 432 ASP n 
1 433 VAL n 
1 434 LYS n 
1 435 ILE n 
1 436 VAL n 
1 437 LYS n 
1 438 MET n 
1 439 LYS n 
1 440 CYS n 
1 441 PRO n 
1 442 ASP n 
1 443 GLY n 
1 444 GLY n 
1 445 ASP n 
1 446 ASN n 
1 447 ALA n 
1 448 ASP n 
1 449 SER n 
1 450 SER n 
1 451 ASN n 
1 452 THR n 
1 453 ALA n 
1 454 LEU n 
1 455 ASN n 
1 456 MET n 
1 457 PRO n 
1 458 VAL n 
1 459 ILE n 
1 460 PRO n 
1 461 MET n 
1 462 ASN n 
1 463 THR n 
1 464 ILE n 
1 465 ALA n 
1 466 GLU n 
1 467 ALA n 
1 468 VAL n 
1 469 ILE n 
1 470 GLU n 
1 471 MET n 
1 472 ILE n 
1 473 ASN n 
1 474 ARG n 
1 475 GLY n 
1 476 GLN n 
1 477 ILE n 
1 478 GLN n 
1 479 ILE n 
1 480 THR n 
1 481 ILE n 
1 482 ASN n 
1 483 GLY n 
1 484 PHE n 
1 485 SER n 
1 486 ILE n 
1 487 SER n 
1 488 ASN n 
1 489 GLY n 
1 490 LEU n 
1 491 ALA n 
1 492 THR n 
1 493 THR n 
1 494 GLN n 
1 495 ILE n 
1 496 ASN n 
1 497 ASN n 
1 498 LYS n 
1 499 ALA n 
1 500 ALA n 
1 501 THR n 
1 502 GLY n 
1 503 GLU n 
1 504 GLU n 
1 505 VAL n 
1 506 PRO n 
1 507 ARG n 
1 508 THR n 
1 509 ILE n 
1 510 ILE n 
1 511 VAL n 
1 512 THR n 
1 513 THR n 
1 514 ARG n 
1 515 SER n 
1 516 GLN n 
1 517 TYR n 
1 518 GLY n 
1 519 LEU n 
1 520 PRO n 
1 521 GLU n 
1 522 ASP n 
1 523 ALA n 
1 524 ILE n 
1 525 VAL n 
1 526 TYR n 
1 527 CYS n 
1 528 ASN n 
1 529 PHE n 
1 530 ASN n 
1 531 GLN n 
1 532 LEU n 
1 533 TYR n 
1 534 LYS n 
1 535 ILE n 
1 536 ASP n 
1 537 PRO n 
1 538 SER n 
1 539 THR n 
1 540 LEU n 
1 541 GLN n 
1 542 MET n 
1 543 TRP n 
1 544 ALA n 
1 545 ASN n 
1 546 ILE n 
1 547 LEU n 
1 548 LYS n 
1 549 ARG n 
1 550 VAL n 
1 551 PRO n 
1 552 ASN n 
1 553 SER n 
1 554 VAL n 
1 555 LEU n 
1 556 TRP n 
1 557 LEU n 
1 558 LEU n 
1 559 ARG n 
1 560 PHE n 
1 561 PRO n 
1 562 ALA n 
1 563 VAL n 
1 564 GLY n 
1 565 GLU n 
1 566 PRO n 
1 567 ASN n 
1 568 ILE n 
1 569 GLN n 
1 570 GLN n 
1 571 TYR n 
1 572 ALA n 
1 573 GLN n 
1 574 ASN n 
1 575 MET n 
1 576 GLY n 
1 577 LEU n 
1 578 PRO n 
1 579 GLN n 
1 580 ASN n 
1 581 ARG n 
1 582 ILE n 
1 583 ILE n 
1 584 PHE n 
1 585 SER n 
1 586 PRO n 
1 587 VAL n 
1 588 ALA n 
1 589 PRO n 
1 590 LYS n 
1 591 GLU n 
1 592 GLU n 
1 593 HIS n 
1 594 VAL n 
1 595 ARG n 
1 596 ARG n 
1 597 GLY n 
1 598 GLN n 
1 599 LEU n 
1 600 ALA n 
1 601 ASP n 
1 602 VAL n 
1 603 CYS n 
1 604 LEU n 
1 605 ASP n 
1 606 THR n 
1 607 PRO n 
1 608 LEU n 
1 609 CYS n 
1 610 ASN n 
1 611 GLY n 
1 612 HIS n 
1 613 THR n 
1 614 THR n 
1 615 GLY n 
1 616 MET n 
1 617 ASP n 
1 618 VAL n 
1 619 LEU n 
1 620 TRP n 
1 621 ALA n 
1 622 GLY n 
1 623 THR n 
1 624 PRO n 
1 625 MET n 
1 626 VAL n 
1 627 THR n 
1 628 MET n 
1 629 PRO n 
1 630 GLY n 
1 631 GLU n 
1 632 THR n 
1 633 LEU n 
1 634 ALA n 
1 635 SER n 
1 636 ARG n 
1 637 VAL n 
1 638 ALA n 
1 639 ALA n 
1 640 SER n 
1 641 GLN n 
1 642 LEU n 
1 643 THR n 
1 644 CYS n 
1 645 LEU n 
1 646 GLY n 
1 647 CYS n 
1 648 LEU n 
1 649 GLU n 
1 650 LEU n 
1 651 ILE n 
1 652 ALA n 
1 653 LYS n 
1 654 ASN n 
1 655 ARG n 
1 656 GLN n 
1 657 GLU n 
1 658 TYR n 
1 659 GLU n 
1 660 ASP n 
1 661 ILE n 
1 662 ALA n 
1 663 VAL n 
1 664 LYS n 
1 665 LEU n 
1 666 GLY n 
1 667 THR n 
1 668 ASP n 
1 669 LEU n 
1 670 GLU n 
1 671 TYR n 
1 672 LEU n 
1 673 LYS n 
1 674 LYS n 
1 675 VAL n 
1 676 ARG n 
1 677 GLY n 
1 678 LYS n 
1 679 VAL n 
1 680 TRP n 
1 681 LYS n 
1 682 GLN n 
1 683 ARG n 
1 684 ILE n 
1 685 SER n 
1 686 SER n 
1 687 PRO n 
1 688 LEU n 
1 689 PHE n 
1 690 ASN n 
1 691 THR n 
1 692 LYS n 
1 693 GLN n 
1 694 TYR n 
1 695 THR n 
1 696 MET n 
1 697 GLU n 
1 698 LEU n 
1 699 GLU n 
1 700 ARG n 
1 701 LEU n 
1 702 TYR n 
1 703 LEU n 
1 704 GLN n 
1 705 MET n 
1 706 TRP n 
1 707 GLU n 
1 708 HIS n 
1 709 TYR n 
1 710 ALA n 
1 711 ALA n 
1 712 GLY n 
1 713 ASN n 
1 714 LYS n 
1 715 PRO n 
1 716 ASP n 
1 717 HIS n 
1 718 MET n 
1 719 ILE n 
1 720 LYS n 
1 721 PRO n 
1 722 VAL n 
1 723 GLU n 
2 1   TYR n 
2 2   PRO n 
2 3   GLY n 
2 4   GLY n 
2 5   SER n 
2 6   THR n 
2 7   PRO n 
2 8   VAL n 
2 9   SER n 
2 10  SER n 
2 11  ALA n 
2 12  ASN n 
2 13  MET n 
2 14  MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 OGT 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                'This is a synthetically made peptide of a sequence that occurs naturally in humans' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP OGT1_HUMAN  O15294 1 
;CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG
NTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDY
DERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVS
SDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGY
TKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVID
FKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGF
SISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVG
EPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTC
LGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVE
;
323 ? 
2 UNP CSK21_HUMAN P68400 2 PGGSTPVSSANMM 340 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3PE4 A 5 ? 723 ? O15294 323 ? 1041 ? 313 1031 
2 2 3PE4 B 2 ? 14  ? P68400 340 ? 352  ? 14  26   
3 1 3PE4 C 5 ? 723 ? O15294 323 ? 1041 ? 313 1031 
4 2 3PE4 D 2 ? 14  ? P68400 340 ? 352  ? 14  26   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3PE4 GLY A 1 ? UNP O15294 ? ? 'EXPRESSION TAG' 309 1  
1 3PE4 PRO A 2 ? UNP O15294 ? ? 'EXPRESSION TAG' 310 2  
1 3PE4 GLY A 3 ? UNP O15294 ? ? 'EXPRESSION TAG' 311 3  
1 3PE4 SER A 4 ? UNP O15294 ? ? 'EXPRESSION TAG' 312 4  
2 3PE4 TYR B 1 ? UNP P68400 ? ? 'EXPRESSION TAG' 13  5  
3 3PE4 GLY C 1 ? UNP O15294 ? ? 'EXPRESSION TAG' 309 6  
3 3PE4 PRO C 2 ? UNP O15294 ? ? 'EXPRESSION TAG' 310 7  
3 3PE4 GLY C 3 ? UNP O15294 ? ? 'EXPRESSION TAG' 311 8  
3 3PE4 SER C 4 ? UNP O15294 ? ? 'EXPRESSION TAG' 312 9  
4 3PE4 TYR D 1 ? UNP P68400 ? ? 'EXPRESSION TAG' 13  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                 ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE               ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                 ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                  ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                    ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                  ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                   ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE               ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                  ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                   ? 'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'            ? 'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                 ? 'C9 H11 N O3'      181.189 
UDP 'RNA linking'       . "URIDINE-5'-DIPHOSPHATE" ? 'C9 H14 N2 O12 P2' 404.161 
VAL 'L-peptide linking' y VALINE                   ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          3PE4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.06 
_exptl_crystal.density_percent_sol   59.81 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-11-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     3PE4 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   141571 
_reflns.number_all                   143873 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.098 
_reflns.pdbx_netI_over_sigmaI        8.4 
_reflns.B_iso_Wilson_estimate        21.792 
_reflns.pdbx_redundancy              3.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.06 
_reflns_shell.percent_possible_all   94.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.180 
_reflns_shell.meanI_over_sigI_obs    4.7 
_reflns_shell.pdbx_redundancy        2.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3PE4 
_refine.ls_number_reflns_obs                     141555 
_refine.ls_number_reflns_all                     143886 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    98.38 
_refine.ls_R_factor_obs                          0.2254 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2240 
_refine.ls_R_factor_R_free                       0.2518 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_number_reflns_R_free                  7099 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -2.2691 
_refine.aniso_B[2][2]                            -1.5422 
_refine.aniso_B[3][3]                            3.8112 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            3.1097 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.408 
_refine.solvent_model_param_bsol                 40.408 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.27 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11015 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         65 
_refine_hist.number_atoms_solvent             854 
_refine_hist.number_atoms_total               11934 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 11453 'X-RAY DIFFRACTION' ? 
f_angle_d          1.050  ? ? 15573 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.312 ? ? 4299  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.071  ? ? 1722  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 2020  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 5385 ?     ? POSITIONAL 1 1 'X-RAY DIFFRACTION' ? ? ? 
2 C 5385 0.024 ? POSITIONAL 1 2 'X-RAY DIFFRACTION' ? ? ? 
1 B 95   ?     ? POSITIONAL 2 3 'X-RAY DIFFRACTION' ? ? ? 
2 D 95   0.017 ? POSITIONAL 2 4 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 1.9500 1.9722  3993 0.2186 87.00  0.2779 . . 204 . . . . 'X-RAY DIFFRACTION' 
. 1.9722 1.9954  4211 0.2059 93.00  0.2456 . . 224 . . . . 'X-RAY DIFFRACTION' 
. 1.9954 2.0197  4369 0.1934 96.00  0.2321 . . 244 . . . . 'X-RAY DIFFRACTION' 
. 2.0197 2.0453  4510 0.1917 99.00  0.2590 . . 239 . . . . 'X-RAY DIFFRACTION' 
. 2.0453 2.0722  4484 0.1889 100.00 0.2282 . . 217 . . . . 'X-RAY DIFFRACTION' 
. 2.0722 2.1005  4559 0.1987 99.00  0.2485 . . 210 . . . . 'X-RAY DIFFRACTION' 
. 2.1005 2.1305  4555 0.2021 99.00  0.2518 . . 244 . . . . 'X-RAY DIFFRACTION' 
. 2.1305 2.1623  4515 0.2004 99.00  0.2237 . . 232 . . . . 'X-RAY DIFFRACTION' 
. 2.1623 2.1961  4500 0.2009 100.00 0.2538 . . 242 . . . . 'X-RAY DIFFRACTION' 
. 2.1961 2.2321  4501 0.2083 99.00  0.2459 . . 243 . . . . 'X-RAY DIFFRACTION' 
. 2.2321 2.2706  4502 0.2122 99.00  0.2754 . . 258 . . . . 'X-RAY DIFFRACTION' 
. 2.2706 2.3119  4531 0.2135 99.00  0.2549 . . 238 . . . . 'X-RAY DIFFRACTION' 
. 2.3119 2.3563  4553 0.2154 99.00  0.2504 . . 220 . . . . 'X-RAY DIFFRACTION' 
. 2.3563 2.4044  4493 0.2178 100.00 0.2796 . . 255 . . . . 'X-RAY DIFFRACTION' 
. 2.4044 2.4566  4494 0.2105 99.00  0.2504 . . 271 . . . . 'X-RAY DIFFRACTION' 
. 2.4566 2.5138  4518 0.2132 99.00  0.2502 . . 236 . . . . 'X-RAY DIFFRACTION' 
. 2.5138 2.5766  4527 0.2182 99.00  0.2516 . . 248 . . . . 'X-RAY DIFFRACTION' 
. 2.5766 2.6462  4541 0.2150 100.00 0.2501 . . 220 . . . . 'X-RAY DIFFRACTION' 
. 2.6462 2.7240  4572 0.2211 99.00  0.2581 . . 205 . . . . 'X-RAY DIFFRACTION' 
. 2.7240 2.8119  4551 0.2279 99.00  0.2622 . . 219 . . . . 'X-RAY DIFFRACTION' 
. 2.8119 2.9123  4503 0.2311 99.00  0.2486 . . 243 . . . . 'X-RAY DIFFRACTION' 
. 2.9123 3.0288  4543 0.2320 100.00 0.2591 . . 259 . . . . 'X-RAY DIFFRACTION' 
. 3.0288 3.1665  4509 0.2264 99.00  0.2391 . . 236 . . . . 'X-RAY DIFFRACTION' 
. 3.1665 3.3333  4524 0.2266 99.00  0.2493 . . 248 . . . . 'X-RAY DIFFRACTION' 
. 3.3333 3.5418  4540 0.2180 99.00  0.2531 . . 248 . . . . 'X-RAY DIFFRACTION' 
. 3.5418 3.8147  4514 0.2086 99.00  0.2054 . . 254 . . . . 'X-RAY DIFFRACTION' 
. 3.8147 4.1977  4534 0.2034 99.00  0.2288 . . 228 . . . . 'X-RAY DIFFRACTION' 
. 4.1977 4.8030  4480 0.2096 97.00  0.2298 . . 245 . . . . 'X-RAY DIFFRACTION' 
. 4.8030 6.0431  4291 0.2421 94.00  0.2677 . . 226 . . . . 'X-RAY DIFFRACTION' 
. 6.0431 29.9848 4539 0.2927 98.00  0.2797 . . 243 . . . . 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
1 ? 2 
2 ? 2 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain A and (resseq 315:619 or resseq 621:633 or resseq 635:714 or resseq 719:746 or resseq 762:1028 or resseq 1212:1212 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain C and (resseq 336:619 or resseq 621:633 or resseq 635:714 or resseq 719:746 or resseq 762:1028 or resseq 1212:1212 )' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'chain B and (resseq 13:26 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'chain D and (resseq 13:26 )' 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  3PE4 
_struct.title                     'Structure of human O-GlcNAc transferase and its complex with a peptide substrate' 
_struct.pdbx_descriptor           
'UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (E.C.2.4.1.-)/Casein Kinase II peptide complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3PE4 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'GT-B, glycosyltransferase, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 7   ? GLY A 23  ? THR A 315 GLY A 331  1 ? 17 
HELX_P HELX_P2  2  ASN A 24  ? PHE A 39  ? ASN A 332 PHE A 347  1 ? 16 
HELX_P HELX_P3  3  PHE A 42  ? GLN A 56  ? PHE A 350 GLN A 364  1 ? 15 
HELX_P HELX_P4  4  LYS A 58  ? SER A 73  ? LYS A 366 SER A 381  1 ? 16 
HELX_P HELX_P5  5  PHE A 76  ? MET A 90  ? PHE A 384 MET A 398  1 ? 15 
HELX_P HELX_P6  6  ASP A 92  ? ASN A 107 ? ASP A 400 ASN A 415  1 ? 16 
HELX_P HELX_P7  7  PHE A 110 ? SER A 124 ? PHE A 418 SER A 432  1 ? 15 
HELX_P HELX_P8  8  ASN A 126 ? LYS A 141 ? ASN A 434 LYS A 449  1 ? 16 
HELX_P HELX_P9  9  PHE A 144 ? VAL A 158 ? PHE A 452 VAL A 466  1 ? 15 
HELX_P HELX_P10 10 ASP A 163 ? LYS A 181 ? ASP A 471 LYS A 489  1 ? 19 
HELX_P HELX_P11 11 HIS A 188 ? TYR A 195 ? HIS A 496 TYR A 503  5 ? 8  
HELX_P HELX_P12 12 SER A 198 ? VAL A 219 ? SER A 506 VAL A 527  1 ? 22 
HELX_P HELX_P13 13 HIS A 250 ? GLN A 257 ? HIS A 558 GLN A 565  1 ? 8  
HELX_P HELX_P14 14 SER A 258 ? HIS A 263 ? SER A 566 HIS A 571  1 ? 6  
HELX_P HELX_P15 15 THR A 281 ? ALA A 291 ? THR A 589 ALA A 599  1 ? 11 
HELX_P HELX_P16 16 SER A 298 ? ILE A 300 ? SER A 606 ILE A 608  5 ? 3  
HELX_P HELX_P17 17 CYS A 302 ? ASP A 313 ? CYS A 610 ASP A 621  1 ? 12 
HELX_P HELX_P18 18 ASN A 330 ? LEU A 335 ? ASN A 638 LEU A 643  1 ? 6  
HELX_P HELX_P19 19 PRO A 367 ? TYR A 374 ? PRO A 675 TYR A 682  5 ? 8  
HELX_P HELX_P20 20 ASP A 389 ? PHE A 394 ? ASP A 697 PHE A 702  1 ? 6  
HELX_P HELX_P21 21 PRO A 395 ? LYS A 398 ? PRO A 703 LYS A 706  5 ? 4  
HELX_P HELX_P22 22 ASP A 422 ? SER A 429 ? ASP A 730 SER A 737  1 ? 8  
HELX_P HELX_P23 23 ASN A 462 ? GLY A 475 ? ASN A 770 GLY A 783  1 ? 14 
HELX_P HELX_P24 24 ALA A 491 ? ASN A 496 ? ALA A 799 ASN A 804  1 ? 6  
HELX_P HELX_P25 25 ASN A 496 ? THR A 501 ? ASN A 804 THR A 809  1 ? 6  
HELX_P HELX_P26 26 SER A 515 ? GLY A 518 ? SER A 823 GLY A 826  5 ? 4  
HELX_P HELX_P27 27 GLN A 531 ? ILE A 535 ? GLN A 839 ILE A 843  5 ? 5  
HELX_P HELX_P28 28 ASP A 536 ? VAL A 550 ? ASP A 844 VAL A 858  1 ? 15 
HELX_P HELX_P29 29 PRO A 561 ? VAL A 563 ? PRO A 869 VAL A 871  5 ? 3  
HELX_P HELX_P30 30 GLY A 564 ? MET A 575 ? GLY A 872 MET A 883  1 ? 12 
HELX_P HELX_P31 31 PRO A 578 ? ASN A 580 ? PRO A 886 ASN A 888  5 ? 3  
HELX_P HELX_P32 32 PRO A 589 ? GLY A 597 ? PRO A 897 GLY A 905  1 ? 9  
HELX_P HELX_P33 33 GLN A 598 ? ALA A 600 ? GLN A 906 ALA A 908  5 ? 3  
HELX_P HELX_P34 34 HIS A 612 ? ALA A 621 ? HIS A 920 ALA A 929  1 ? 10 
HELX_P HELX_P35 35 THR A 632 ? SER A 635 ? THR A 940 SER A 943  5 ? 4  
HELX_P HELX_P36 36 ARG A 636 ? GLY A 646 ? ARG A 944 GLY A 954  1 ? 11 
HELX_P HELX_P37 37 CYS A 647 ? ILE A 651 ? CYS A 955 ILE A 959  5 ? 5  
HELX_P HELX_P38 38 ASN A 654 ? ASP A 668 ? ASN A 962 ASP A 976  1 ? 15 
HELX_P HELX_P39 39 ASP A 668 ? SER A 686 ? ASP A 976 SER A 994  1 ? 19 
HELX_P HELX_P40 40 ASN A 690 ? ALA A 711 ? ASN A 998 ALA A 1019 1 ? 22 
HELX_P HELX_P41 41 ALA C 28  ? PHE C 39  ? ALA C 336 PHE C 347  1 ? 12 
HELX_P HELX_P42 42 PHE C 42  ? GLY C 57  ? PHE C 350 GLY C 365  1 ? 16 
HELX_P HELX_P43 43 LYS C 58  ? SER C 73  ? LYS C 366 SER C 381  1 ? 16 
HELX_P HELX_P44 44 PHE C 76  ? MET C 90  ? PHE C 384 MET C 398  1 ? 15 
HELX_P HELX_P45 45 ASP C 92  ? ASN C 107 ? ASP C 400 ASN C 415  1 ? 16 
HELX_P HELX_P46 46 PHE C 110 ? SER C 124 ? PHE C 418 SER C 432  1 ? 15 
HELX_P HELX_P47 47 ASN C 126 ? LYS C 141 ? ASN C 434 LYS C 449  1 ? 16 
HELX_P HELX_P48 48 PHE C 144 ? VAL C 158 ? PHE C 452 VAL C 466  1 ? 15 
HELX_P HELX_P49 49 ASP C 163 ? LYS C 181 ? ASP C 471 LYS C 489  1 ? 19 
HELX_P HELX_P50 50 HIS C 188 ? TYR C 195 ? HIS C 496 TYR C 503  5 ? 8  
HELX_P HELX_P51 51 SER C 198 ? VAL C 219 ? SER C 506 VAL C 527  1 ? 22 
HELX_P HELX_P52 52 HIS C 250 ? GLN C 257 ? HIS C 558 GLN C 565  1 ? 8  
HELX_P HELX_P53 53 SER C 258 ? HIS C 263 ? SER C 566 HIS C 571  1 ? 6  
HELX_P HELX_P54 54 THR C 281 ? ALA C 291 ? THR C 589 ALA C 599  1 ? 11 
HELX_P HELX_P55 55 SER C 298 ? ILE C 300 ? SER C 606 ILE C 608  5 ? 3  
HELX_P HELX_P56 56 CYS C 302 ? ASP C 313 ? CYS C 610 ASP C 621  1 ? 12 
HELX_P HELX_P57 57 ASN C 330 ? LEU C 335 ? ASN C 638 LEU C 643  1 ? 6  
HELX_P HELX_P58 58 PRO C 367 ? TYR C 374 ? PRO C 675 TYR C 682  5 ? 8  
HELX_P HELX_P59 59 ASP C 389 ? PHE C 394 ? ASP C 697 PHE C 702  1 ? 6  
HELX_P HELX_P60 60 PRO C 395 ? LYS C 398 ? PRO C 703 LYS C 706  5 ? 4  
HELX_P HELX_P61 61 ASP C 422 ? SER C 429 ? ASP C 730 SER C 737  1 ? 8  
HELX_P HELX_P62 62 ASN C 462 ? GLY C 475 ? ASN C 770 GLY C 783  1 ? 14 
HELX_P HELX_P63 63 ALA C 491 ? ASN C 496 ? ALA C 799 ASN C 804  1 ? 6  
HELX_P HELX_P64 64 ASN C 496 ? THR C 501 ? ASN C 804 THR C 809  1 ? 6  
HELX_P HELX_P65 65 SER C 515 ? TYR C 517 ? SER C 823 TYR C 825  5 ? 3  
HELX_P HELX_P66 66 GLN C 531 ? ILE C 535 ? GLN C 839 ILE C 843  5 ? 5  
HELX_P HELX_P67 67 ASP C 536 ? VAL C 550 ? ASP C 844 VAL C 858  1 ? 15 
HELX_P HELX_P68 68 PRO C 561 ? VAL C 563 ? PRO C 869 VAL C 871  5 ? 3  
HELX_P HELX_P69 69 GLY C 564 ? MET C 575 ? GLY C 872 MET C 883  1 ? 12 
HELX_P HELX_P70 70 PRO C 578 ? ASN C 580 ? PRO C 886 ASN C 888  5 ? 3  
HELX_P HELX_P71 71 PRO C 589 ? GLY C 597 ? PRO C 897 GLY C 905  1 ? 9  
HELX_P HELX_P72 72 GLN C 598 ? ALA C 600 ? GLN C 906 ALA C 908  5 ? 3  
HELX_P HELX_P73 73 HIS C 612 ? ALA C 621 ? HIS C 920 ALA C 929  1 ? 10 
HELX_P HELX_P74 74 THR C 632 ? SER C 635 ? THR C 940 SER C 943  5 ? 4  
HELX_P HELX_P75 75 ARG C 636 ? GLY C 646 ? ARG C 944 GLY C 954  1 ? 11 
HELX_P HELX_P76 76 CYS C 647 ? ILE C 651 ? CYS C 955 ILE C 959  5 ? 5  
HELX_P HELX_P77 77 ASN C 654 ? ASP C 668 ? ASN C 962 ASP C 976  1 ? 15 
HELX_P HELX_P78 78 ASP C 668 ? SER C 686 ? ASP C 976 SER C 994  1 ? 19 
HELX_P HELX_P79 79 ASN C 690 ? ALA C 711 ? ASN C 998 ALA C 1019 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 560 A . ? PHE 868 A PRO 561 A ? PRO 869 A 1 4.96 
2 PHE 560 C . ? PHE 868 C PRO 561 C ? PRO 869 C 1 6.28 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 5 ? 
D ? 7 ? 
E ? 7 ? 
F ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? parallel      
E 6 7 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 293 ? ASP A 296 ? HIS A 601 ASP A 604 
A 2 PHE A 268 ? ALA A 274 ? PHE A 576 ALA A 582 
A 3 LEU A 238 ? SER A 244 ? LEU A 546 SER A 552 
A 4 ILE A 317 ? ASN A 320 ? ILE A 625 ASN A 628 
A 5 ILE A 340 ? MET A 343 ? ILE A 648 MET A 651 
A 6 TYR A 358 ? THR A 361 ? TYR A 666 THR A 669 
A 7 LYS A 377 ? TYR A 380 ? LYS A 685 TYR A 688 
B 1 LYS A 434 ? VAL A 436 ? LYS A 742 VAL A 744 
B 2 MET A 456 ? PRO A 460 ? MET A 764 PRO A 768 
B 3 ALA A 401 ? ASP A 404 ? ALA A 709 ASP A 712 
B 4 ILE A 416 ? ASN A 419 ? ILE A 724 ASN A 727 
B 5 ILE A 509 ? THR A 513 ? ILE A 817 THR A 821 
B 6 PHE A 484 ? ASN A 488 ? PHE A 792 ASN A 796 
B 7 GLN A 478 ? ILE A 481 ? GLN A 786 ILE A 789 
C 1 ILE A 582 ? PRO A 586 ? ILE A 890 PRO A 894 
C 2 SER A 553 ? ARG A 559 ? SER A 861 ARG A 867 
C 3 ILE A 524 ? CYS A 527 ? ILE A 832 CYS A 835 
C 4 VAL A 602 ? LEU A 604 ? VAL A 910 LEU A 912 
C 5 MET A 625 ? VAL A 626 ? MET A 933 VAL A 934 
D 1 HIS C 293 ? ASP C 296 ? HIS C 601 ASP C 604 
D 2 PHE C 268 ? ALA C 274 ? PHE C 576 ALA C 582 
D 3 LEU C 238 ? SER C 244 ? LEU C 546 SER C 552 
D 4 ILE C 317 ? ASN C 320 ? ILE C 625 ASN C 628 
D 5 ILE C 340 ? TRP C 344 ? ILE C 648 TRP C 652 
D 6 TYR C 358 ? THR C 361 ? TYR C 666 THR C 669 
D 7 LYS C 377 ? TYR C 380 ? LYS C 685 TYR C 688 
E 1 LYS C 434 ? VAL C 436 ? LYS C 742 VAL C 744 
E 2 MET C 456 ? PRO C 460 ? MET C 764 PRO C 768 
E 3 ALA C 401 ? ASP C 404 ? ALA C 709 ASP C 712 
E 4 ILE C 416 ? ASN C 419 ? ILE C 724 ASN C 727 
E 5 ILE C 509 ? THR C 513 ? ILE C 817 THR C 821 
E 6 PHE C 484 ? ASN C 488 ? PHE C 792 ASN C 796 
E 7 GLN C 478 ? ILE C 481 ? GLN C 786 ILE C 789 
F 1 ILE C 582 ? PRO C 586 ? ILE C 890 PRO C 894 
F 2 SER C 553 ? ARG C 559 ? SER C 861 ARG C 867 
F 3 ILE C 524 ? CYS C 527 ? ILE C 832 CYS C 835 
F 4 VAL C 602 ? LEU C 604 ? VAL C 910 LEU C 912 
F 5 MET C 625 ? VAL C 626 ? MET C 933 VAL C 934 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 295 ? O ILE A 603 N CYS A 272 ? N CYS A 580 
A 2 3 O TYR A 273 ? O TYR A 581 N TYR A 242 ? N TYR A 550 
A 3 4 N GLY A 241 ? N GLY A 549 O VAL A 319 ? O VAL A 627 
A 4 5 N ASN A 320 ? N ASN A 628 O ALA A 342 ? O ALA A 650 
A 5 6 N MET A 343 ? N MET A 651 O TYR A 358 ? O TYR A 666 
A 6 7 N THR A 361 ? N THR A 669 O ALA A 379 ? O ALA A 687 
B 1 2 N LYS A 434 ? N LYS A 742 O VAL A 458 ? O VAL A 766 
B 2 3 O ILE A 459 ? O ILE A 767 N VAL A 402 ? N VAL A 710 
B 3 4 N ALA A 401 ? N ALA A 709 O LEU A 418 ? O LEU A 726 
B 4 5 N VAL A 417 ? N VAL A 725 O THR A 512 ? O THR A 820 
B 5 6 O ILE A 509 ? O ILE A 817 N SER A 487 ? N SER A 795 
B 6 7 O ILE A 486 ? O ILE A 794 N ILE A 479 ? N ILE A 787 
C 1 2 O ILE A 583 ? O ILE A 891 N LEU A 555 ? N LEU A 863 
C 2 3 O TRP A 556 ? O TRP A 864 N TYR A 526 ? N TYR A 834 
C 3 4 N CYS A 527 ? N CYS A 835 O LEU A 604 ? O LEU A 912 
C 4 5 N CYS A 603 ? N CYS A 911 O VAL A 626 ? O VAL A 934 
D 1 2 O ILE C 295 ? O ILE C 603 N CYS C 272 ? N CYS C 580 
D 2 3 O TYR C 273 ? O TYR C 581 N TYR C 242 ? N TYR C 550 
D 3 4 N GLY C 241 ? N GLY C 549 O VAL C 319 ? O VAL C 627 
D 4 5 N ASN C 320 ? N ASN C 628 O ALA C 342 ? O ALA C 650 
D 5 6 N MET C 343 ? N MET C 651 O TYR C 358 ? O TYR C 666 
D 6 7 N THR C 361 ? N THR C 669 O ALA C 379 ? O ALA C 687 
E 1 2 N LYS C 434 ? N LYS C 742 O VAL C 458 ? O VAL C 766 
E 2 3 O ILE C 459 ? O ILE C 767 N VAL C 402 ? N VAL C 710 
E 3 4 N ALA C 401 ? N ALA C 709 O LEU C 418 ? O LEU C 726 
E 4 5 N VAL C 417 ? N VAL C 725 O THR C 512 ? O THR C 820 
E 5 6 O ILE C 509 ? O ILE C 817 N SER C 487 ? N SER C 795 
E 6 7 O ILE C 486 ? O ILE C 794 N ILE C 479 ? N ILE C 787 
F 1 2 O ILE C 583 ? O ILE C 891 N LEU C 555 ? N LEU C 863 
F 2 3 O TRP C 556 ? O TRP C 864 N TYR C 526 ? N TYR C 834 
F 3 4 N CYS C 527 ? N CYS C 835 O LEU C 604 ? O LEU C 912 
F 4 5 N CYS C 603 ? N CYS C 911 O VAL C 626 ? O VAL C 934 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE UDP A 1212' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 5'    
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 1'    
AC4 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE UDP C 1212' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 D 3'    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 21 HOH J .   ? HOH A 4    . ? 1_555 ? 
2  AC1 21 PRO A 251 ? PRO A 559  . ? 1_555 ? 
3  AC1 21 GLN A 531 ? GLN A 839  . ? 1_555 ? 
4  AC1 21 LYS A 534 ? LYS A 842  . ? 1_555 ? 
5  AC1 21 LEU A 558 ? LEU A 866  . ? 1_555 ? 
6  AC1 21 VAL A 587 ? VAL A 895  . ? 1_555 ? 
7  AC1 21 ALA A 588 ? ALA A 896  . ? 1_555 ? 
8  AC1 21 LYS A 590 ? LYS A 898  . ? 1_555 ? 
9  AC1 21 HIS A 593 ? HIS A 901  . ? 1_555 ? 
10 AC1 21 ARG A 596 ? ARG A 904  . ? 1_555 ? 
11 AC1 21 HIS A 612 ? HIS A 920  . ? 1_555 ? 
12 AC1 21 THR A 613 ? THR A 921  . ? 1_555 ? 
13 AC1 21 THR A 614 ? THR A 922  . ? 1_555 ? 
14 AC1 21 ASP A 617 ? ASP A 925  . ? 1_555 ? 
15 AC1 21 HOH J .   ? HOH A 1064 . ? 1_555 ? 
16 AC1 21 HOH J .   ? HOH A 1087 . ? 1_555 ? 
17 AC1 21 THR B 6   ? THR B 18   . ? 1_555 ? 
18 AC1 21 VAL B 8   ? VAL B 20   . ? 1_555 ? 
19 AC1 21 SER B 9   ? SER B 21   . ? 1_555 ? 
20 AC1 21 HOH K .   ? HOH B 27   . ? 1_555 ? 
21 AC1 21 HOH K .   ? HOH B 57   . ? 1_555 ? 
22 AC2 5  GLY A 57  ? GLY A 365  . ? 1_555 ? 
23 AC2 5  LYS A 58  ? LYS A 366  . ? 1_555 ? 
24 AC2 5  LEU A 59  ? LEU A 367  . ? 1_555 ? 
25 AC2 5  GLN A 60  ? GLN A 368  . ? 1_555 ? 
26 AC2 5  HOH J .   ? HOH A 1070 . ? 1_555 ? 
27 AC3 4  GLY A 327 ? GLY A 635  . ? 1_555 ? 
28 AC3 4  HOH J .   ? HOH A 1103 . ? 1_555 ? 
29 AC3 4  ASN B 12  ? ASN B 24   . ? 1_555 ? 
30 AC3 4  MET B 13  ? MET B 25   . ? 1_555 ? 
31 AC4 22 HOH L .   ? HOH C 9    . ? 1_555 ? 
32 AC4 22 PRO C 251 ? PRO C 559  . ? 1_555 ? 
33 AC4 22 GLN C 531 ? GLN C 839  . ? 1_555 ? 
34 AC4 22 LYS C 534 ? LYS C 842  . ? 1_555 ? 
35 AC4 22 LEU C 558 ? LEU C 866  . ? 1_555 ? 
36 AC4 22 VAL C 587 ? VAL C 895  . ? 1_555 ? 
37 AC4 22 ALA C 588 ? ALA C 896  . ? 1_555 ? 
38 AC4 22 LYS C 590 ? LYS C 898  . ? 1_555 ? 
39 AC4 22 HIS C 593 ? HIS C 901  . ? 1_555 ? 
40 AC4 22 ARG C 596 ? ARG C 904  . ? 1_555 ? 
41 AC4 22 HIS C 612 ? HIS C 920  . ? 1_555 ? 
42 AC4 22 THR C 613 ? THR C 921  . ? 1_555 ? 
43 AC4 22 THR C 614 ? THR C 922  . ? 1_555 ? 
44 AC4 22 ASP C 617 ? ASP C 925  . ? 1_555 ? 
45 AC4 22 HOH L .   ? HOH C 1060 . ? 1_555 ? 
46 AC4 22 HOH L .   ? HOH C 1086 . ? 1_555 ? 
47 AC4 22 HOH L .   ? HOH C 1254 . ? 1_555 ? 
48 AC4 22 THR D 6   ? THR D 18   . ? 1_555 ? 
49 AC4 22 VAL D 8   ? VAL D 20   . ? 1_555 ? 
50 AC4 22 SER D 9   ? SER D 21   . ? 1_555 ? 
51 AC4 22 HOH M .   ? HOH D 32   . ? 1_555 ? 
52 AC4 22 HOH M .   ? HOH D 98   . ? 1_555 ? 
53 AC5 4  GLY C 327 ? GLY C 635  . ? 1_555 ? 
54 AC5 4  HOH L .   ? HOH C 1182 . ? 1_555 ? 
55 AC5 4  ASN D 12  ? ASN D 24   . ? 1_555 ? 
56 AC5 4  MET D 13  ? MET D 25   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3PE4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3PE4 
_atom_sites.fract_transf_matrix[1][1]   0.010144 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002324 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007317 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006682 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . THR A 1 7   ? -3.860  43.426  -42.811 1.00 64.52  ? 315  THR A N     1 
ATOM   2     C CA    . THR A 1 7   ? -5.168  43.837  -43.311 1.00 67.77  ? 315  THR A CA    1 
ATOM   3     C C     . THR A 1 7   ? -6.061  42.626  -43.577 1.00 54.89  ? 315  THR A C     1 
ATOM   4     O O     . THR A 1 7   ? -7.242  42.626  -43.225 1.00 47.59  ? 315  THR A O     1 
ATOM   5     C CB    . THR A 1 7   ? -5.047  44.705  -44.583 1.00 75.73  ? 315  THR A CB    1 
ATOM   6     O OG1   . THR A 1 7   ? -6.354  45.079  -45.038 1.00 76.20  ? 315  THR A OG1   1 
ATOM   7     C CG2   . THR A 1 7   ? -4.318  43.950  -45.688 1.00 78.06  ? 315  THR A CG2   1 
ATOM   8     N N     . HIS A 1 8   ? -5.497  41.597  -44.201 1.00 51.23  ? 316  HIS A N     1 
ATOM   9     C CA    . HIS A 1 8   ? -6.204  40.329  -44.344 1.00 50.66  ? 316  HIS A CA    1 
ATOM   10    C C     . HIS A 1 8   ? -6.263  39.651  -42.980 1.00 35.73  ? 316  HIS A C     1 
ATOM   11    O O     . HIS A 1 8   ? -7.290  39.094  -42.589 1.00 25.72  ? 316  HIS A O     1 
ATOM   12    C CB    . HIS A 1 8   ? -5.511  39.419  -45.360 1.00 48.28  ? 316  HIS A CB    1 
ATOM   13    C CG    . HIS A 1 8   ? -6.171  38.084  -45.519 1.00 49.60  ? 316  HIS A CG    1 
ATOM   14    N ND1   . HIS A 1 8   ? -7.518  37.890  -45.298 1.00 54.84  ? 316  HIS A ND1   1 
ATOM   15    C CD2   . HIS A 1 8   ? -5.669  36.876  -45.869 1.00 50.49  ? 316  HIS A CD2   1 
ATOM   16    C CE1   . HIS A 1 8   ? -7.817  36.619  -45.504 1.00 51.65  ? 316  HIS A CE1   1 
ATOM   17    N NE2   . HIS A 1 8   ? -6.713  35.982  -45.852 1.00 52.81  ? 316  HIS A NE2   1 
ATOM   18    N N     . ALA A 1 9   ? -5.153  39.706  -42.255 1.00 24.74  ? 317  ALA A N     1 
ATOM   19    C CA    . ALA A 1 9   ? -5.136  39.226  -40.883 1.00 25.91  ? 317  ALA A CA    1 
ATOM   20    C C     . ALA A 1 9   ? -6.166  39.994  -40.063 1.00 26.79  ? 317  ALA A C     1 
ATOM   21    O O     . ALA A 1 9   ? -6.795  39.436  -39.167 1.00 33.56  ? 317  ALA A O     1 
ATOM   22    C CB    . ALA A 1 9   ? -3.755  39.383  -40.283 1.00 37.37  ? 317  ALA A CB    1 
ATOM   23    N N     . ASP A 1 10  ? -6.332  41.276  -40.380 1.00 29.45  ? 318  ASP A N     1 
ATOM   24    C CA    . ASP A 1 10  ? -7.325  42.116  -39.715 1.00 34.09  ? 318  ASP A CA    1 
ATOM   25    C C     . ASP A 1 10  ? -8.748  41.625  -39.961 1.00 31.37  ? 318  ASP A C     1 
ATOM   26    O O     . ASP A 1 10  ? -9.547  41.519  -39.027 1.00 38.73  ? 318  ASP A O     1 
ATOM   27    C CB    . ASP A 1 10  ? -7.194  43.574  -40.173 1.00 36.73  ? 318  ASP A CB    1 
ATOM   28    C CG    . ASP A 1 10  ? -6.184  44.349  -39.358 1.00 49.40  ? 318  ASP A CG    1 
ATOM   29    O OD1   . ASP A 1 10  ? -6.072  44.075  -38.145 1.00 64.05  ? 318  ASP A OD1   1 
ATOM   30    O OD2   . ASP A 1 10  ? -5.500  45.227  -39.926 1.00 52.03  ? 318  ASP A OD2   1 
ATOM   31    N N     A SER A 1 11  ? -9.065  41.328  -41.218 0.50 32.33  ? 319  SER A N     1 
ATOM   32    N N     B SER A 1 11  ? -9.062  41.329  -41.219 0.50 32.31  ? 319  SER A N     1 
ATOM   33    C CA    A SER A 1 11  ? -10.403 40.857  -41.567 0.50 34.44  ? 319  SER A CA    1 
ATOM   34    C CA    B SER A 1 11  ? -10.395 40.853  -41.577 0.50 34.48  ? 319  SER A CA    1 
ATOM   35    C C     A SER A 1 11  ? -10.667 39.474  -40.980 0.50 35.77  ? 319  SER A C     1 
ATOM   36    C C     B SER A 1 11  ? -10.663 39.478  -40.977 0.50 35.77  ? 319  SER A C     1 
ATOM   37    O O     A SER A 1 11  ? -11.795 39.155  -40.600 0.50 37.12  ? 319  SER A O     1 
ATOM   38    O O     B SER A 1 11  ? -11.790 39.168  -40.586 0.50 37.25  ? 319  SER A O     1 
ATOM   39    C CB    A SER A 1 11  ? -10.609 40.847  -43.087 0.50 33.87  ? 319  SER A CB    1 
ATOM   40    C CB    B SER A 1 11  ? -10.566 40.812  -43.099 0.50 33.98  ? 319  SER A CB    1 
ATOM   41    O OG    A SER A 1 11  ? -9.713  39.956  -43.726 0.50 37.00  ? 319  SER A OG    1 
ATOM   42    O OG    B SER A 1 11  ? -10.436 42.108  -43.659 0.50 28.10  ? 319  SER A OG    1 
ATOM   43    N N     . LEU A 1 12  ? -9.623  38.655  -40.904 1.00 29.31  ? 320  LEU A N     1 
ATOM   44    C CA    . LEU A 1 12  ? -9.748  37.335  -40.300 1.00 30.03  ? 320  LEU A CA    1 
ATOM   45    C C     . LEU A 1 12  ? -10.089 37.470  -38.816 1.00 31.38  ? 320  LEU A C     1 
ATOM   46    O O     . LEU A 1 12  ? -10.973 36.775  -38.318 1.00 24.70  ? 320  LEU A O     1 
ATOM   47    C CB    . LEU A 1 12  ? -8.477  36.507  -40.513 1.00 32.94  ? 320  LEU A CB    1 
ATOM   48    C CG    . LEU A 1 12  ? -8.289  35.981  -41.941 1.00 40.22  ? 320  LEU A CG    1 
ATOM   49    C CD1   . LEU A 1 12  ? -6.893  35.408  -42.159 1.00 34.03  ? 320  LEU A CD1   1 
ATOM   50    C CD2   . LEU A 1 12  ? -9.357  34.946  -42.274 1.00 44.95  ? 320  LEU A CD2   1 
ATOM   51    N N     . ASN A 1 13  ? -9.401  38.372  -38.118 1.00 32.39  ? 321  ASN A N     1 
ATOM   52    C CA    . ASN A 1 13  ? -9.673  38.610  -36.696 1.00 27.98  ? 321  ASN A CA    1 
ATOM   53    C C     . ASN A 1 13  ? -11.099 39.129  -36.519 1.00 37.93  ? 321  ASN A C     1 
ATOM   54    O O     . ASN A 1 13  ? -11.808 38.729  -35.594 1.00 36.57  ? 321  ASN A O     1 
ATOM   55    C CB    . ASN A 1 13  ? -8.642  39.583  -36.099 1.00 35.09  ? 321  ASN A CB    1 
ATOM   56    C CG    . ASN A 1 13  ? -8.883  39.877  -34.618 1.00 29.88  ? 321  ASN A CG    1 
ATOM   57    O OD1   . ASN A 1 13  ? -8.718  39.004  -33.764 1.00 30.40  ? 321  ASN A OD1   1 
ATOM   58    N ND2   . ASN A 1 13  ? -9.239  41.123  -34.307 1.00 31.57  ? 321  ASN A ND2   1 
ATOM   59    N N     . ASN A 1 14  ? -11.524 40.004  -37.426 1.00 32.83  ? 322  ASN A N     1 
ATOM   60    C CA    . ASN A 1 14  ? -12.904 40.484  -37.419 1.00 39.93  ? 322  ASN A CA    1 
ATOM   61    C C     . ASN A 1 14  ? -13.918 39.348  -37.552 1.00 31.67  ? 322  ASN A C     1 
ATOM   62    O O     . ASN A 1 14  ? -14.887 39.278  -36.797 1.00 38.33  ? 322  ASN A O     1 
ATOM   63    C CB    . ASN A 1 14  ? -13.139 41.499  -38.535 1.00 41.46  ? 322  ASN A CB    1 
ATOM   64    C CG    . ASN A 1 14  ? -14.573 41.986  -38.572 1.00 48.26  ? 322  ASN A CG    1 
ATOM   65    O OD1   . ASN A 1 14  ? -15.163 42.283  -37.531 1.00 43.64  ? 322  ASN A OD1   1 
ATOM   66    N ND2   . ASN A 1 14  ? -15.153 42.045  -39.770 1.00 44.39  ? 322  ASN A ND2   1 
ATOM   67    N N     . LEU A 1 15  ? -13.690 38.462  -38.517 1.00 29.87  ? 323  LEU A N     1 
ATOM   68    C CA    . LEU A 1 15  ? -14.578 37.321  -38.737 1.00 41.34  ? 323  LEU A CA    1 
ATOM   69    C C     . LEU A 1 15  ? -14.640 36.428  -37.506 1.00 44.78  ? 323  LEU A C     1 
ATOM   70    O O     . LEU A 1 15  ? -15.717 35.996  -37.095 1.00 26.76  ? 323  LEU A O     1 
ATOM   71    C CB    . LEU A 1 15  ? -14.129 36.508  -39.952 1.00 47.53  ? 323  LEU A CB    1 
ATOM   72    C CG    . LEU A 1 15  ? -14.251 37.191  -41.316 1.00 51.77  ? 323  LEU A CG    1 
ATOM   73    C CD1   . LEU A 1 15  ? -13.687 36.293  -42.402 1.00 49.00  ? 323  LEU A CD1   1 
ATOM   74    C CD2   . LEU A 1 15  ? -15.700 37.558  -41.612 1.00 49.08  ? 323  LEU A CD2   1 
ATOM   75    N N     . ALA A 1 16  ? -13.476 36.152  -36.926 1.00 33.77  ? 324  ALA A N     1 
ATOM   76    C CA    . ALA A 1 16  ? -13.397 35.389  -35.693 1.00 32.70  ? 324  ALA A CA    1 
ATOM   77    C C     . ALA A 1 16  ? -14.306 35.993  -34.613 1.00 30.76  ? 324  ALA A C     1 
ATOM   78    O O     . ALA A 1 16  ? -15.110 35.288  -34.003 1.00 39.41  ? 324  ALA A O     1 
ATOM   79    C CB    . ALA A 1 16  ? -11.939 35.317  -35.211 1.00 24.32  ? 324  ALA A CB    1 
ATOM   80    N N     . ASN A 1 17  ? -14.158 37.294  -34.378 1.00 29.14  ? 325  ASN A N     1 
ATOM   81    C CA    . ASN A 1 17  ? -14.991 38.024  -33.420 1.00 34.07  ? 325  ASN A CA    1 
ATOM   82    C C     . ASN A 1 17  ? -16.480 37.805  -33.677 1.00 38.38  ? 325  ASN A C     1 
ATOM   83    O O     . ASN A 1 17  ? -17.255 37.574  -32.749 1.00 35.14  ? 325  ASN A O     1 
ATOM   84    C CB    . ASN A 1 17  ? -14.690 39.528  -33.477 1.00 29.44  ? 325  ASN A CB    1 
ATOM   85    C CG    . ASN A 1 17  ? -13.317 39.877  -32.933 1.00 39.89  ? 325  ASN A CG    1 
ATOM   86    O OD1   . ASN A 1 17  ? -12.762 39.156  -32.104 1.00 34.80  ? 325  ASN A OD1   1 
ATOM   87    N ND2   . ASN A 1 17  ? -12.763 40.997  -33.397 1.00 40.73  ? 325  ASN A ND2   1 
ATOM   88    N N     . ILE A 1 18  ? -16.875 37.888  -34.943 1.00 35.55  ? 326  ILE A N     1 
ATOM   89    C CA    . ILE A 1 18  ? -18.272 37.689  -35.325 1.00 46.81  ? 326  ILE A CA    1 
ATOM   90    C C     . ILE A 1 18  ? -18.770 36.291  -34.947 1.00 49.46  ? 326  ILE A C     1 
ATOM   91    O O     . ILE A 1 18  ? -19.756 36.146  -34.217 1.00 42.14  ? 326  ILE A O     1 
ATOM   92    C CB    . ILE A 1 18  ? -18.470 37.924  -36.832 1.00 40.67  ? 326  ILE A CB    1 
ATOM   93    C CG1   . ILE A 1 18  ? -18.168 39.384  -37.174 1.00 32.47  ? 326  ILE A CG1   1 
ATOM   94    C CG2   . ILE A 1 18  ? -19.889 37.551  -37.247 1.00 46.99  ? 326  ILE A CG2   1 
ATOM   95    C CD1   . ILE A 1 18  ? -18.013 39.649  -38.659 1.00 32.59  ? 326  ILE A CD1   1 
ATOM   96    N N     . LYS A 1 19  ? -18.083 35.267  -35.442 1.00 50.82  ? 327  LYS A N     1 
ATOM   97    C CA    . LYS A 1 19  ? -18.442 33.888  -35.132 1.00 60.06  ? 327  LYS A CA    1 
ATOM   98    C C     . LYS A 1 19  ? -18.433 33.647  -33.625 1.00 58.97  ? 327  LYS A C     1 
ATOM   99    O O     . LYS A 1 19  ? -19.210 32.842  -33.108 1.00 57.61  ? 327  LYS A O     1 
ATOM   100   C CB    . LYS A 1 19  ? -17.498 32.911  -35.838 1.00 65.60  ? 327  LYS A CB    1 
ATOM   101   C CG    . LYS A 1 19  ? -18.119 32.208  -37.035 1.00 71.23  ? 327  LYS A CG    1 
ATOM   102   C CD    . LYS A 1 19  ? -18.795 33.195  -37.971 1.00 75.64  ? 327  LYS A CD    1 
ATOM   103   C CE    . LYS A 1 19  ? -19.470 32.476  -39.125 1.00 82.00  ? 327  LYS A CE    1 
ATOM   104   N NZ    . LYS A 1 19  ? -20.448 31.460  -38.646 1.00 87.02  ? 327  LYS A NZ    1 
ATOM   105   N N     . ARG A 1 20  ? -17.552 34.355  -32.924 1.00 52.22  ? 328  ARG A N     1 
ATOM   106   C CA    . ARG A 1 20  ? -17.496 34.273  -31.471 1.00 49.24  ? 328  ARG A CA    1 
ATOM   107   C C     . ARG A 1 20  ? -18.798 34.789  -30.863 1.00 40.97  ? 328  ARG A C     1 
ATOM   108   O O     . ARG A 1 20  ? -19.432 34.107  -30.057 1.00 39.60  ? 328  ARG A O     1 
ATOM   109   C CB    . ARG A 1 20  ? -16.310 35.075  -30.930 1.00 46.39  ? 328  ARG A CB    1 
ATOM   110   C CG    . ARG A 1 20  ? -16.223 35.073  -29.416 1.00 47.97  ? 328  ARG A CG    1 
ATOM   111   C CD    . ARG A 1 20  ? -15.084 35.938  -28.909 1.00 59.16  ? 328  ARG A CD    1 
ATOM   112   N NE    . ARG A 1 20  ? -14.883 35.758  -27.473 1.00 76.25  ? 328  ARG A NE    1 
ATOM   113   C CZ    . ARG A 1 20  ? -13.911 36.331  -26.771 1.00 89.14  ? 328  ARG A CZ    1 
ATOM   114   N NH1   . ARG A 1 20  ? -13.036 37.129  -27.370 1.00 96.60  ? 328  ARG A NH1   1 
ATOM   115   N NH2   . ARG A 1 20  ? -13.811 36.103  -25.469 1.00 88.84  ? 328  ARG A NH2   1 
ATOM   116   N N     . GLU A 1 21  ? -19.188 35.996  -31.256 1.00 38.21  ? 329  GLU A N     1 
ATOM   117   C CA    . GLU A 1 21  ? -20.417 36.602  -30.757 1.00 53.49  ? 329  GLU A CA    1 
ATOM   118   C C     . GLU A 1 21  ? -21.630 35.732  -31.076 1.00 64.33  ? 329  GLU A C     1 
ATOM   119   O O     . GLU A 1 21  ? -22.565 35.643  -30.280 1.00 65.25  ? 329  GLU A O     1 
ATOM   120   C CB    . GLU A 1 21  ? -20.599 38.008  -31.333 1.00 63.05  ? 329  GLU A CB    1 
ATOM   121   C CG    . GLU A 1 21  ? -19.482 38.971  -30.966 1.00 70.44  ? 329  GLU A CG    1 
ATOM   122   C CD    . GLU A 1 21  ? -19.332 39.145  -29.465 1.00 74.69  ? 329  GLU A CD    1 
ATOM   123   O OE1   . GLU A 1 21  ? -20.269 39.673  -28.828 1.00 70.21  ? 329  GLU A OE1   1 
ATOM   124   O OE2   . GLU A 1 21  ? -18.279 38.747  -28.921 1.00 74.67  ? 329  GLU A OE2   1 
ATOM   125   N N     . GLN A 1 22  ? -21.607 35.093  -32.243 1.00 64.05  ? 330  GLN A N     1 
ATOM   126   C CA    . GLN A 1 22  ? -22.661 34.163  -32.636 1.00 57.64  ? 330  GLN A CA    1 
ATOM   127   C C     . GLN A 1 22  ? -22.765 33.010  -31.639 1.00 69.94  ? 330  GLN A C     1 
ATOM   128   O O     . GLN A 1 22  ? -23.822 32.393  -31.495 1.00 76.55  ? 330  GLN A O     1 
ATOM   129   C CB    . GLN A 1 22  ? -22.400 33.610  -34.040 1.00 51.43  ? 330  GLN A CB    1 
ATOM   130   C CG    . GLN A 1 22  ? -22.626 34.600  -35.171 1.00 50.08  ? 330  GLN A CG    1 
ATOM   131   C CD    . GLN A 1 22  ? -22.267 34.012  -36.524 1.00 72.73  ? 330  GLN A CD    1 
ATOM   132   O OE1   . GLN A 1 22  ? -21.891 32.843  -36.624 1.00 77.83  ? 330  GLN A OE1   1 
ATOM   133   N NE2   . GLN A 1 22  ? -22.378 34.820  -37.573 1.00 78.30  ? 330  GLN A NE2   1 
ATOM   134   N N     . GLY A 1 23  ? -21.663 32.727  -30.952 1.00 62.41  ? 331  GLY A N     1 
ATOM   135   C CA    . GLY A 1 23  ? -21.622 31.643  -29.990 1.00 66.76  ? 331  GLY A CA    1 
ATOM   136   C C     . GLY A 1 23  ? -20.839 30.459  -30.520 1.00 66.71  ? 331  GLY A C     1 
ATOM   137   O O     . GLY A 1 23  ? -20.578 29.499  -29.792 1.00 66.27  ? 331  GLY A O     1 
ATOM   138   N N     . ASN A 1 24  ? -20.470 30.529  -31.796 1.00 58.00  ? 332  ASN A N     1 
ATOM   139   C CA    . ASN A 1 24  ? -19.681 29.480  -32.428 1.00 58.52  ? 332  ASN A CA    1 
ATOM   140   C C     . ASN A 1 24  ? -18.200 29.640  -32.095 1.00 61.05  ? 332  ASN A C     1 
ATOM   141   O O     . ASN A 1 24  ? -17.446 30.278  -32.831 1.00 53.34  ? 332  ASN A O     1 
ATOM   142   C CB    . ASN A 1 24  ? -19.901 29.485  -33.942 1.00 63.71  ? 332  ASN A CB    1 
ATOM   143   C CG    . ASN A 1 24  ? -19.307 28.266  -34.625 1.00 69.02  ? 332  ASN A CG    1 
ATOM   144   O OD1   . ASN A 1 24  ? -18.716 27.397  -33.977 1.00 60.67  ? 332  ASN A OD1   1 
ATOM   145   N ND2   . ASN A 1 24  ? -19.473 28.189  -35.943 1.00 72.04  ? 332  ASN A ND2   1 
ATOM   146   N N     . ILE A 1 25  ? -17.790 29.055  -30.976 1.00 57.95  ? 333  ILE A N     1 
ATOM   147   C CA    . ILE A 1 25  ? -16.446 29.262  -30.460 1.00 41.73  ? 333  ILE A CA    1 
ATOM   148   C C     . ILE A 1 25  ? -15.383 28.501  -31.249 1.00 44.78  ? 333  ILE A C     1 
ATOM   149   O O     . ILE A 1 25  ? -14.266 28.987  -31.413 1.00 42.84  ? 333  ILE A O     1 
ATOM   150   C CB    . ILE A 1 25  ? -16.355 28.892  -28.968 1.00 46.57  ? 333  ILE A CB    1 
ATOM   151   C CG1   . ILE A 1 25  ? -17.404 29.668  -28.168 1.00 47.32  ? 333  ILE A CG1   1 
ATOM   152   C CG2   . ILE A 1 25  ? -14.967 29.182  -28.431 1.00 50.53  ? 333  ILE A CG2   1 
ATOM   153   C CD1   . ILE A 1 25  ? -17.365 31.166  -28.405 1.00 58.46  ? 333  ILE A CD1   1 
ATOM   154   N N     . GLU A 1 26  ? -15.725 27.312  -31.738 1.00 35.08  ? 334  GLU A N     1 
ATOM   155   C CA    . GLU A 1 26  ? -14.769 26.528  -32.521 1.00 48.03  ? 334  GLU A CA    1 
ATOM   156   C C     . GLU A 1 26  ? -14.373 27.211  -33.839 1.00 40.90  ? 334  GLU A C     1 
ATOM   157   O O     . GLU A 1 26  ? -13.195 27.245  -34.203 1.00 34.84  ? 334  GLU A O     1 
ATOM   158   C CB    . GLU A 1 26  ? -15.294 25.111  -32.765 1.00 55.40  ? 334  GLU A CB    1 
ATOM   159   C CG    . GLU A 1 26  ? -15.326 24.260  -31.507 1.00 69.17  ? 334  GLU A CG    1 
ATOM   160   C CD    . GLU A 1 26  ? -13.997 24.268  -30.766 1.00 83.48  ? 334  GLU A CD    1 
ATOM   161   O OE1   . GLU A 1 26  ? -12.940 24.319  -31.431 1.00 83.26  ? 334  GLU A OE1   1 
ATOM   162   O OE2   . GLU A 1 26  ? -14.009 24.231  -29.517 1.00 86.21  ? 334  GLU A OE2   1 
ATOM   163   N N     . GLU A 1 27  ? -15.356 27.755  -34.549 1.00 43.35  ? 335  GLU A N     1 
ATOM   164   C CA    . GLU A 1 27  ? -15.080 28.518  -35.768 1.00 52.53  ? 335  GLU A CA    1 
ATOM   165   C C     . GLU A 1 27  ? -14.267 29.778  -35.477 1.00 49.17  ? 335  GLU A C     1 
ATOM   166   O O     . GLU A 1 27  ? -13.339 30.119  -36.220 1.00 40.32  ? 335  GLU A O     1 
ATOM   167   C CB    . GLU A 1 27  ? -16.380 28.886  -36.489 1.00 55.95  ? 335  GLU A CB    1 
ATOM   168   C CG    . GLU A 1 27  ? -16.777 27.912  -37.585 1.00 72.52  ? 335  GLU A CG    1 
ATOM   169   C CD    . GLU A 1 27  ? -15.800 27.910  -38.746 1.00 88.88  ? 335  GLU A CD    1 
ATOM   170   O OE1   . GLU A 1 27  ? -15.018 28.876  -38.870 1.00 94.53  ? 335  GLU A OE1   1 
ATOM   171   O OE2   . GLU A 1 27  ? -15.814 26.942  -39.535 1.00 95.73  ? 335  GLU A OE2   1 
ATOM   172   N N     . ALA A 1 28  ? -14.632 30.474  -34.403 1.00 45.08  ? 336  ALA A N     1 
ATOM   173   C CA    . ALA A 1 28  ? -13.884 31.640  -33.947 1.00 51.41  ? 336  ALA A CA    1 
ATOM   174   C C     . ALA A 1 28  ? -12.406 31.300  -33.750 1.00 48.92  ? 336  ALA A C     1 
ATOM   175   O O     . ALA A 1 28  ? -11.528 32.010  -34.239 1.00 30.55  ? 336  ALA A O     1 
ATOM   176   C CB    . ALA A 1 28  ? -14.483 32.183  -32.656 1.00 46.63  ? 336  ALA A CB    1 
ATOM   177   N N     . VAL A 1 29  ? -12.139 30.213  -33.030 1.00 48.50  ? 337  VAL A N     1 
ATOM   178   C CA    . VAL A 1 29  ? -10.770 29.762  -32.798 1.00 42.75  ? 337  VAL A CA    1 
ATOM   179   C C     . VAL A 1 29  ? -10.064 29.462  -34.117 1.00 41.27  ? 337  VAL A C     1 
ATOM   180   O O     . VAL A 1 29  ? -8.921  29.873  -34.331 1.00 39.45  ? 337  VAL A O     1 
ATOM   181   C CB    . VAL A 1 29  ? -10.727 28.503  -31.904 1.00 45.93  ? 337  VAL A CB    1 
ATOM   182   C CG1   . VAL A 1 29  ? -9.329  27.908  -31.884 1.00 37.06  ? 337  VAL A CG1   1 
ATOM   183   C CG2   . VAL A 1 29  ? -11.191 28.831  -30.493 1.00 39.56  ? 337  VAL A CG2   1 
ATOM   184   N N     . ARG A 1 30  ? -10.748 28.743  -35.001 1.00 42.01  ? 338  ARG A N     1 
ATOM   185   C CA    . ARG A 1 30  ? -10.182 28.424  -36.305 1.00 41.57  ? 338  ARG A CA    1 
ATOM   186   C C     . ARG A 1 30  ? -9.797  29.703  -37.032 1.00 35.86  ? 338  ARG A C     1 
ATOM   187   O O     . ARG A 1 30  ? -8.767  29.750  -37.707 1.00 32.46  ? 338  ARG A O     1 
ATOM   188   C CB    . ARG A 1 30  ? -11.166 27.615  -37.152 1.00 45.07  ? 338  ARG A CB    1 
ATOM   189   C CG    . ARG A 1 30  ? -10.573 27.103  -38.457 1.00 58.24  ? 338  ARG A CG    1 
ATOM   190   C CD    . ARG A 1 30  ? -11.615 26.398  -39.315 1.00 68.57  ? 338  ARG A CD    1 
ATOM   191   N NE    . ARG A 1 30  ? -12.651 27.315  -39.777 1.00 73.44  ? 338  ARG A NE    1 
ATOM   192   C CZ    . ARG A 1 30  ? -12.600 27.982  -40.926 1.00 75.63  ? 338  ARG A CZ    1 
ATOM   193   N NH1   . ARG A 1 30  ? -11.563 27.834  -41.738 1.00 66.78  ? 338  ARG A NH1   1 
ATOM   194   N NH2   . ARG A 1 30  ? -13.591 28.796  -41.262 1.00 75.37  ? 338  ARG A NH2   1 
ATOM   195   N N     . LEU A 1 31  ? -10.616 30.741  -36.878 1.00 26.84  ? 339  LEU A N     1 
ATOM   196   C CA    . LEU A 1 31  ? -10.405 31.993  -37.611 1.00 42.08  ? 339  LEU A CA    1 
ATOM   197   C C     . LEU A 1 31  ? -9.294  32.848  -36.997 1.00 40.99  ? 339  LEU A C     1 
ATOM   198   O O     . LEU A 1 31  ? -8.504  33.473  -37.714 1.00 34.19  ? 339  LEU A O     1 
ATOM   199   C CB    . LEU A 1 31  ? -11.714 32.784  -37.730 1.00 45.79  ? 339  LEU A CB    1 
ATOM   200   C CG    . LEU A 1 31  ? -12.794 32.140  -38.613 1.00 50.82  ? 339  LEU A CG    1 
ATOM   201   C CD1   . LEU A 1 31  ? -14.148 32.826  -38.444 1.00 43.16  ? 339  LEU A CD1   1 
ATOM   202   C CD2   . LEU A 1 31  ? -12.371 32.122  -40.078 1.00 50.86  ? 339  LEU A CD2   1 
ATOM   203   N N     . TYR A 1 32  ? -9.227  32.876  -35.668 1.00 32.30  ? 340  TYR A N     1 
ATOM   204   C CA    . TYR A 1 32  ? -8.133  33.570  -35.007 1.00 25.90  ? 340  TYR A CA    1 
ATOM   205   C C     . TYR A 1 32  ? -6.809  32.935  -35.421 1.00 30.54  ? 340  TYR A C     1 
ATOM   206   O O     . TYR A 1 32  ? -5.837  33.633  -35.697 1.00 29.81  ? 340  TYR A O     1 
ATOM   207   C CB    . TYR A 1 32  ? -8.274  33.509  -33.490 1.00 25.48  ? 340  TYR A CB    1 
ATOM   208   C CG    . TYR A 1 32  ? -9.359  34.388  -32.919 1.00 39.10  ? 340  TYR A CG    1 
ATOM   209   C CD1   . TYR A 1 32  ? -9.360  35.758  -33.143 1.00 36.98  ? 340  TYR A CD1   1 
ATOM   210   C CD2   . TYR A 1 32  ? -10.368 33.851  -32.126 1.00 39.52  ? 340  TYR A CD2   1 
ATOM   211   C CE1   . TYR A 1 32  ? -10.347 36.568  -32.612 1.00 41.52  ? 340  TYR A CE1   1 
ATOM   212   C CE2   . TYR A 1 32  ? -11.357 34.652  -31.591 1.00 50.36  ? 340  TYR A CE2   1 
ATOM   213   C CZ    . TYR A 1 32  ? -11.342 36.011  -31.836 1.00 48.22  ? 340  TYR A CZ    1 
ATOM   214   O OH    . TYR A 1 32  ? -12.324 36.810  -31.300 1.00 43.87  ? 340  TYR A OH    1 
ATOM   215   N N     . ARG A 1 33  ? -6.776  31.605  -35.455 1.00 24.47  ? 341  ARG A N     1 
ATOM   216   C CA    . ARG A 1 33  ? -5.562  30.891  -35.836 1.00 27.70  ? 341  ARG A CA    1 
ATOM   217   C C     . ARG A 1 33  ? -5.159  31.210  -37.274 1.00 28.32  ? 341  ARG A C     1 
ATOM   218   O O     . ARG A 1 33  ? -3.976  31.361  -37.575 1.00 32.73  ? 341  ARG A O     1 
ATOM   219   C CB    . ARG A 1 33  ? -5.739  29.384  -35.669 1.00 34.59  ? 341  ARG A CB    1 
ATOM   220   C CG    . ARG A 1 33  ? -5.977  28.937  -34.233 1.00 35.13  ? 341  ARG A CG    1 
ATOM   221   C CD    . ARG A 1 33  ? -5.902  27.425  -34.131 1.00 40.14  ? 341  ARG A CD    1 
ATOM   222   N NE    . ARG A 1 33  ? -6.363  26.939  -32.834 1.00 40.84  ? 341  ARG A NE    1 
ATOM   223   C CZ    . ARG A 1 33  ? -5.632  26.958  -31.727 1.00 36.94  ? 341  ARG A CZ    1 
ATOM   224   N NH1   . ARG A 1 33  ? -4.398  27.444  -31.751 1.00 31.46  ? 341  ARG A NH1   1 
ATOM   225   N NH2   . ARG A 1 33  ? -6.135  26.491  -30.592 1.00 38.31  ? 341  ARG A NH2   1 
ATOM   226   N N     . LYS A 1 34  ? -6.146  31.298  -38.159 1.00 25.82  ? 342  LYS A N     1 
ATOM   227   C CA    . LYS A 1 34  ? -5.890  31.696  -39.542 1.00 40.56  ? 342  LYS A CA    1 
ATOM   228   C C     . LYS A 1 34  ? -5.271  33.096  -39.599 1.00 32.15  ? 342  LYS A C     1 
ATOM   229   O O     . LYS A 1 34  ? -4.374  33.353  -40.400 1.00 30.48  ? 342  LYS A O     1 
ATOM   230   C CB    . LYS A 1 34  ? -7.178  31.649  -40.365 1.00 50.37  ? 342  LYS A CB    1 
ATOM   231   C CG    . LYS A 1 34  ? -6.965  31.815  -41.861 1.00 63.38  ? 342  LYS A CG    1 
ATOM   232   C CD    . LYS A 1 34  ? -6.148  30.669  -42.433 1.00 72.48  ? 342  LYS A CD    1 
ATOM   233   C CE    . LYS A 1 34  ? -5.996  30.800  -43.940 1.00 85.53  ? 342  LYS A CE    1 
ATOM   234   N NZ    . LYS A 1 34  ? -5.238  29.660  -44.526 1.00 92.14  ? 342  LYS A NZ    1 
ATOM   235   N N     . ALA A 1 35  ? -5.748  33.991  -38.736 1.00 32.62  ? 343  ALA A N     1 
ATOM   236   C CA    . ALA A 1 35  ? -5.199  35.347  -38.647 1.00 29.31  ? 343  ALA A CA    1 
ATOM   237   C C     . ALA A 1 35  ? -3.728  35.307  -38.247 1.00 28.83  ? 343  ALA A C     1 
ATOM   238   O O     . ALA A 1 35  ? -2.896  36.029  -38.797 1.00 22.48  ? 343  ALA A O     1 
ATOM   239   C CB    . ALA A 1 35  ? -5.990  36.178  -37.651 1.00 23.74  ? 343  ALA A CB    1 
ATOM   240   N N     . LEU A 1 36  ? -3.415  34.455  -37.277 1.00 35.40  ? 344  LEU A N     1 
ATOM   241   C CA    . LEU A 1 36  ? -2.041  34.298  -36.817 1.00 35.38  ? 344  LEU A CA    1 
ATOM   242   C C     . LEU A 1 36  ? -1.176  33.678  -37.909 1.00 26.69  ? 344  LEU A C     1 
ATOM   243   O O     . LEU A 1 36  ? -0.012  34.052  -38.084 1.00 29.67  ? 344  LEU A O     1 
ATOM   244   C CB    . LEU A 1 36  ? -1.998  33.432  -35.559 1.00 33.81  ? 344  LEU A CB    1 
ATOM   245   C CG    . LEU A 1 36  ? -2.729  34.006  -34.347 1.00 33.01  ? 344  LEU A CG    1 
ATOM   246   C CD1   . LEU A 1 36  ? -2.702  33.016  -33.196 1.00 32.71  ? 344  LEU A CD1   1 
ATOM   247   C CD2   . LEU A 1 36  ? -2.105  35.334  -33.943 1.00 28.66  ? 344  LEU A CD2   1 
ATOM   248   N N     . GLU A 1 37  ? -1.750  32.726  -38.634 1.00 23.07  ? 345  GLU A N     1 
ATOM   249   C CA    . GLU A 1 37  ? -1.045  32.074  -39.732 1.00 36.24  ? 345  GLU A CA    1 
ATOM   250   C C     . GLU A 1 37  ? -0.622  33.104  -40.779 1.00 44.38  ? 345  GLU A C     1 
ATOM   251   O O     . GLU A 1 37  ? 0.493   33.057  -41.298 1.00 45.64  ? 345  GLU A O     1 
ATOM   252   C CB    . GLU A 1 37  ? -1.928  31.001  -40.374 1.00 36.75  ? 345  GLU A CB    1 
ATOM   253   C CG    . GLU A 1 37  ? -1.226  30.179  -41.440 1.00 40.22  ? 345  GLU A CG    1 
ATOM   254   C CD    . GLU A 1 37  ? -2.137  29.154  -42.082 1.00 54.91  ? 345  GLU A CD    1 
ATOM   255   O OE1   . GLU A 1 37  ? -1.963  28.880  -43.288 1.00 64.77  ? 345  GLU A OE1   1 
ATOM   256   O OE2   . GLU A 1 37  ? -3.021  28.619  -41.384 1.00 52.17  ? 345  GLU A OE2   1 
ATOM   257   N N     . VAL A 1 38  ? -1.524  34.035  -41.073 1.00 35.84  ? 346  VAL A N     1 
ATOM   258   C CA    . VAL A 1 38  ? -1.274  35.096  -42.047 1.00 37.72  ? 346  VAL A CA    1 
ATOM   259   C C     . VAL A 1 38  ? -0.306  36.150  -41.514 1.00 36.69  ? 346  VAL A C     1 
ATOM   260   O O     . VAL A 1 38  ? 0.574   36.619  -42.232 1.00 39.19  ? 346  VAL A O     1 
ATOM   261   C CB    . VAL A 1 38  ? -2.588  35.795  -42.443 1.00 52.49  ? 346  VAL A CB    1 
ATOM   262   C CG1   . VAL A 1 38  ? -2.301  37.120  -43.140 1.00 56.58  ? 346  VAL A CG1   1 
ATOM   263   C CG2   . VAL A 1 38  ? -3.433  34.878  -43.319 1.00 54.62  ? 346  VAL A CG2   1 
ATOM   264   N N     . PHE A 1 39  ? -0.472  36.512  -40.246 1.00 31.99  ? 347  PHE A N     1 
ATOM   265   C CA    . PHE A 1 39  ? 0.313   37.573  -39.629 1.00 32.06  ? 347  PHE A CA    1 
ATOM   266   C C     . PHE A 1 39  ? 0.605   37.218  -38.166 1.00 32.98  ? 347  PHE A C     1 
ATOM   267   O O     . PHE A 1 39  ? -0.150  37.573  -37.271 1.00 28.21  ? 347  PHE A O     1 
ATOM   268   C CB    . PHE A 1 39  ? -0.450  38.896  -39.744 1.00 46.92  ? 347  PHE A CB    1 
ATOM   269   C CG    . PHE A 1 39  ? 0.224   40.060  -39.079 1.00 53.43  ? 347  PHE A CG    1 
ATOM   270   C CD1   . PHE A 1 39  ? 1.585   40.259  -39.206 1.00 56.20  ? 347  PHE A CD1   1 
ATOM   271   C CD2   . PHE A 1 39  ? -0.518  40.976  -38.350 1.00 57.51  ? 347  PHE A CD2   1 
ATOM   272   C CE1   . PHE A 1 39  ? 2.199   41.339  -38.599 1.00 57.79  ? 347  PHE A CE1   1 
ATOM   273   C CE2   . PHE A 1 39  ? 0.086   42.058  -37.744 1.00 56.57  ? 347  PHE A CE2   1 
ATOM   274   C CZ    . PHE A 1 39  ? 1.448   42.240  -37.867 1.00 53.97  ? 347  PHE A CZ    1 
ATOM   275   N N     . PRO A 1 40  ? 1.711   36.498  -37.927 1.00 44.83  ? 348  PRO A N     1 
ATOM   276   C CA    . PRO A 1 40  ? 2.066   35.910  -36.624 1.00 44.93  ? 348  PRO A CA    1 
ATOM   277   C C     . PRO A 1 40  ? 2.236   36.895  -35.460 1.00 42.32  ? 348  PRO A C     1 
ATOM   278   O O     . PRO A 1 40  ? 1.993   36.512  -34.313 1.00 36.55  ? 348  PRO A O     1 
ATOM   279   C CB    . PRO A 1 40  ? 3.398   35.207  -36.914 1.00 50.94  ? 348  PRO A CB    1 
ATOM   280   C CG    . PRO A 1 40  ? 3.351   34.910  -38.378 1.00 47.19  ? 348  PRO A CG    1 
ATOM   281   C CD    . PRO A 1 40  ? 2.638   36.078  -38.992 1.00 47.46  ? 348  PRO A CD    1 
ATOM   282   N N     . GLU A 1 41  ? 2.652   38.126  -35.741 1.00 41.81  ? 349  GLU A N     1 
ATOM   283   C CA    . GLU A 1 41  ? 2.867   39.117  -34.687 1.00 42.84  ? 349  GLU A CA    1 
ATOM   284   C C     . GLU A 1 41  ? 1.649   40.027  -34.494 1.00 34.73  ? 349  GLU A C     1 
ATOM   285   O O     . GLU A 1 41  ? 1.772   41.250  -34.461 1.00 34.82  ? 349  GLU A O     1 
ATOM   286   C CB    . GLU A 1 41  ? 4.109   39.956  -34.994 1.00 41.83  ? 349  GLU A CB    1 
ATOM   287   C CG    . GLU A 1 41  ? 5.383   39.143  -35.173 1.00 32.73  ? 349  GLU A CG    1 
ATOM   288   C CD    . GLU A 1 41  ? 5.879   38.543  -33.876 1.00 44.58  ? 349  GLU A CD    1 
ATOM   289   O OE1   . GLU A 1 41  ? 6.270   39.314  -32.976 1.00 47.58  ? 349  GLU A OE1   1 
ATOM   290   O OE2   . GLU A 1 41  ? 5.879   37.303  -33.751 1.00 53.16  ? 349  GLU A OE2   1 
ATOM   291   N N     . PHE A 1 42  ? 0.474   39.422  -34.364 1.00 36.89  ? 350  PHE A N     1 
ATOM   292   C CA    . PHE A 1 42  ? -0.775  40.170  -34.252 1.00 32.28  ? 350  PHE A CA    1 
ATOM   293   C C     . PHE A 1 42  ? -1.246  40.158  -32.796 1.00 38.24  ? 350  PHE A C     1 
ATOM   294   O O     . PHE A 1 42  ? -1.929  39.230  -32.372 1.00 27.06  ? 350  PHE A O     1 
ATOM   295   C CB    . PHE A 1 42  ? -1.832  39.541  -35.163 1.00 40.14  ? 350  PHE A CB    1 
ATOM   296   C CG    . PHE A 1 42  ? -3.057  40.395  -35.377 1.00 36.27  ? 350  PHE A CG    1 
ATOM   297   C CD1   . PHE A 1 42  ? -3.250  41.564  -34.659 1.00 40.95  ? 350  PHE A CD1   1 
ATOM   298   C CD2   . PHE A 1 42  ? -4.020  40.016  -36.301 1.00 32.70  ? 350  PHE A CD2   1 
ATOM   299   C CE1   . PHE A 1 42  ? -4.377  42.340  -34.859 1.00 38.43  ? 350  PHE A CE1   1 
ATOM   300   C CE2   . PHE A 1 42  ? -5.152  40.790  -36.508 1.00 28.07  ? 350  PHE A CE2   1 
ATOM   301   C CZ    . PHE A 1 42  ? -5.330  41.952  -35.787 1.00 31.10  ? 350  PHE A CZ    1 
ATOM   302   N N     . ALA A 1 43  ? -0.869  41.187  -32.041 1.00 21.40  ? 351  ALA A N     1 
ATOM   303   C CA    . ALA A 1 43  ? -1.165  41.258  -30.611 1.00 26.77  ? 351  ALA A CA    1 
ATOM   304   C C     . ALA A 1 43  ? -2.645  41.066  -30.280 1.00 29.35  ? 351  ALA A C     1 
ATOM   305   O O     . ALA A 1 43  ? -2.982  40.365  -29.331 1.00 29.55  ? 351  ALA A O     1 
ATOM   306   C CB    . ALA A 1 43  ? -0.657  42.572  -30.029 1.00 29.42  ? 351  ALA A CB    1 
ATOM   307   N N     . ALA A 1 44  ? -3.525  41.688  -31.058 1.00 28.91  ? 352  ALA A N     1 
ATOM   308   C CA    . ALA A 1 44  ? -4.961  41.625  -30.779 1.00 31.27  ? 352  ALA A CA    1 
ATOM   309   C C     . ALA A 1 44  ? -5.545  40.235  -31.038 1.00 31.61  ? 352  ALA A C     1 
ATOM   310   O O     . ALA A 1 44  ? -6.428  39.779  -30.307 1.00 29.68  ? 352  ALA A O     1 
ATOM   311   C CB    . ALA A 1 44  ? -5.711  42.682  -31.586 1.00 45.56  ? 352  ALA A CB    1 
ATOM   312   N N     . ALA A 1 45  ? -5.054  39.560  -32.074 1.00 29.44  ? 353  ALA A N     1 
ATOM   313   C CA    . ALA A 1 45  ? -5.536  38.215  -32.376 1.00 35.18  ? 353  ALA A CA    1 
ATOM   314   C C     . ALA A 1 45  ? -5.145  37.276  -31.241 1.00 33.05  ? 353  ALA A C     1 
ATOM   315   O O     . ALA A 1 45  ? -5.932  36.428  -30.814 1.00 25.64  ? 353  ALA A O     1 
ATOM   316   C CB    . ALA A 1 45  ? -4.976  37.716  -33.700 1.00 31.36  ? 353  ALA A CB    1 
ATOM   317   N N     . HIS A 1 46  ? -3.923  37.440  -30.748 1.00 26.16  ? 354  HIS A N     1 
ATOM   318   C CA    . HIS A 1 46  ? -3.447  36.627  -29.643 1.00 22.05  ? 354  HIS A CA    1 
ATOM   319   C C     . HIS A 1 46  ? -4.265  36.893  -28.385 1.00 29.73  ? 354  HIS A C     1 
ATOM   320   O O     . HIS A 1 46  ? -4.704  35.963  -27.717 1.00 24.73  ? 354  HIS A O     1 
ATOM   321   C CB    . HIS A 1 46  ? -1.961  36.873  -29.382 1.00 26.67  ? 354  HIS A CB    1 
ATOM   322   C CG    . HIS A 1 46  ? -1.051  36.064  -30.257 1.00 24.64  ? 354  HIS A CG    1 
ATOM   323   N ND1   . HIS A 1 46  ? -1.005  34.686  -30.211 1.00 19.49  ? 354  HIS A ND1   1 
ATOM   324   C CD2   . HIS A 1 46  ? -0.145  36.439  -31.192 1.00 23.60  ? 354  HIS A CD2   1 
ATOM   325   C CE1   . HIS A 1 46  ? -0.108  34.248  -31.078 1.00 24.20  ? 354  HIS A CE1   1 
ATOM   326   N NE2   . HIS A 1 46  ? 0.426   35.291  -31.688 1.00 26.10  ? 354  HIS A NE2   1 
ATOM   327   N N     . SER A 1 47  ? -4.473  38.166  -28.068 1.00 21.32  ? 355  SER A N     1 
ATOM   328   C CA    . SER A 1 47  ? -5.219  38.521  -26.869 1.00 25.24  ? 355  SER A CA    1 
ATOM   329   C C     . SER A 1 47  ? -6.674  38.052  -26.957 1.00 30.51  ? 355  SER A C     1 
ATOM   330   O O     . SER A 1 47  ? -7.265  37.657  -25.951 1.00 27.09  ? 355  SER A O     1 
ATOM   331   C CB    . SER A 1 47  ? -5.130  40.028  -26.603 1.00 27.94  ? 355  SER A CB    1 
ATOM   332   O OG    . SER A 1 47  ? -5.936  40.393  -25.495 1.00 53.52  ? 355  SER A OG    1 
ATOM   333   N N     . ASN A 1 48  ? -7.245  38.076  -28.160 1.00 28.49  ? 356  ASN A N     1 
ATOM   334   C CA    . ASN A 1 48  ? -8.608  37.594  -28.370 1.00 27.95  ? 356  ASN A CA    1 
ATOM   335   C C     . ASN A 1 48  ? -8.716  36.080  -28.249 1.00 29.69  ? 356  ASN A C     1 
ATOM   336   O O     . ASN A 1 48  ? -9.617  35.558  -27.599 1.00 28.60  ? 356  ASN A O     1 
ATOM   337   C CB    . ASN A 1 48  ? -9.135  38.016  -29.746 1.00 42.15  ? 356  ASN A CB    1 
ATOM   338   C CG    . ASN A 1 48  ? -9.585  39.461  -29.784 1.00 40.78  ? 356  ASN A CG    1 
ATOM   339   O OD1   . ASN A 1 48  ? -9.953  40.033  -28.761 1.00 33.43  ? 356  ASN A OD1   1 
ATOM   340   N ND2   . ASN A 1 48  ? -9.568  40.055  -30.974 1.00 40.29  ? 356  ASN A ND2   1 
ATOM   341   N N     . LEU A 1 49  ? -7.808  35.373  -28.908 1.00 21.74  ? 357  LEU A N     1 
ATOM   342   C CA    . LEU A 1 49  ? -7.792  33.918  -28.832 1.00 31.06  ? 357  LEU A CA    1 
ATOM   343   C C     . LEU A 1 49  ? -7.556  33.476  -27.388 1.00 25.58  ? 357  LEU A C     1 
ATOM   344   O O     . LEU A 1 49  ? -8.140  32.496  -26.924 1.00 23.87  ? 357  LEU A O     1 
ATOM   345   C CB    . LEU A 1 49  ? -6.717  33.344  -29.760 1.00 28.59  ? 357  LEU A CB    1 
ATOM   346   C CG    . LEU A 1 49  ? -6.544  31.825  -29.809 1.00 30.91  ? 357  LEU A CG    1 
ATOM   347   C CD1   . LEU A 1 49  ? -7.869  31.124  -30.098 1.00 28.47  ? 357  LEU A CD1   1 
ATOM   348   C CD2   . LEU A 1 49  ? -5.505  31.457  -30.853 1.00 37.57  ? 357  LEU A CD2   1 
ATOM   349   N N     . ALA A 1 50  ? -6.710  34.209  -26.670 1.00 24.36  ? 358  ALA A N     1 
ATOM   350   C CA    . ALA A 1 50  ? -6.444  33.888  -25.263 1.00 25.72  ? 358  ALA A CA    1 
ATOM   351   C C     . ALA A 1 50  ? -7.703  33.992  -24.404 1.00 27.07  ? 358  ALA A C     1 
ATOM   352   O O     . ALA A 1 50  ? -8.006  33.096  -23.603 1.00 20.05  ? 358  ALA A O     1 
ATOM   353   C CB    . ALA A 1 50  ? -5.344  34.782  -24.701 1.00 21.50  ? 358  ALA A CB    1 
ATOM   354   N N     . SER A 1 51  ? -8.428  35.091  -24.566 1.00 27.95  ? 359  SER A N     1 
ATOM   355   C CA    . SER A 1 51  ? -9.670  35.306  -23.833 1.00 33.39  ? 359  SER A CA    1 
ATOM   356   C C     . SER A 1 51  ? -10.656 34.162  -24.097 1.00 34.74  ? 359  SER A C     1 
ATOM   357   O O     . SER A 1 51  ? -11.262 33.618  -23.169 1.00 27.17  ? 359  SER A O     1 
ATOM   358   C CB    . SER A 1 51  ? -10.282 36.654  -24.229 1.00 44.52  ? 359  SER A CB    1 
ATOM   359   O OG    . SER A 1 51  ? -11.565 36.828  -23.655 1.00 49.13  ? 359  SER A OG    1 
ATOM   360   N N     . VAL A 1 52  ? -10.794 33.794  -25.368 1.00 25.92  ? 360  VAL A N     1 
ATOM   361   C CA    . VAL A 1 52  ? -11.699 32.731  -25.793 1.00 27.57  ? 360  VAL A CA    1 
ATOM   362   C C     . VAL A 1 52  ? -11.316 31.395  -25.174 1.00 34.12  ? 360  VAL A C     1 
ATOM   363   O O     . VAL A 1 52  ? -12.156 30.684  -24.619 1.00 29.39  ? 360  VAL A O     1 
ATOM   364   C CB    . VAL A 1 52  ? -11.694 32.580  -27.329 1.00 44.65  ? 360  VAL A CB    1 
ATOM   365   C CG1   . VAL A 1 52  ? -12.293 31.249  -27.739 1.00 49.60  ? 360  VAL A CG1   1 
ATOM   366   C CG2   . VAL A 1 52  ? -12.434 33.737  -27.982 1.00 49.09  ? 360  VAL A CG2   1 
ATOM   367   N N     . LEU A 1 53  ? -10.039 31.052  -25.273 1.00 21.24  ? 361  LEU A N     1 
ATOM   368   C CA    . LEU A 1 53  ? -9.541  29.823  -24.674 1.00 24.74  ? 361  LEU A CA    1 
ATOM   369   C C     . LEU A 1 53  ? -9.794  29.845  -23.167 1.00 22.73  ? 361  LEU A C     1 
ATOM   370   O O     . LEU A 1 53  ? -10.237 28.849  -22.591 1.00 27.68  ? 361  LEU A O     1 
ATOM   371   C CB    . LEU A 1 53  ? -8.046  29.633  -24.988 1.00 28.17  ? 361  LEU A CB    1 
ATOM   372   C CG    . LEU A 1 53  ? -7.671  29.333  -26.449 1.00 35.26  ? 361  LEU A CG    1 
ATOM   373   C CD1   . LEU A 1 53  ? -6.162  29.472  -26.707 1.00 19.48  ? 361  LEU A CD1   1 
ATOM   374   C CD2   . LEU A 1 53  ? -8.167  27.950  -26.875 1.00 28.78  ? 361  LEU A CD2   1 
ATOM   375   N N     . GLN A 1 54  ? -9.537  30.989  -22.537 1.00 19.28  ? 362  GLN A N     1 
ATOM   376   C CA    . GLN A 1 54  ? -9.758  31.134  -21.101 1.00 21.68  ? 362  GLN A CA    1 
ATOM   377   C C     . GLN A 1 54  ? -11.209 30.848  -20.734 1.00 26.73  ? 362  GLN A C     1 
ATOM   378   O O     . GLN A 1 54  ? -11.479 30.228  -19.708 1.00 24.66  ? 362  GLN A O     1 
ATOM   379   C CB    . GLN A 1 54  ? -9.383  32.536  -20.602 1.00 22.97  ? 362  GLN A CB    1 
ATOM   380   C CG    . GLN A 1 54  ? -9.508  32.656  -19.079 1.00 27.93  ? 362  GLN A CG    1 
ATOM   381   C CD    . GLN A 1 54  ? -9.403  34.083  -18.563 1.00 51.65  ? 362  GLN A CD    1 
ATOM   382   O OE1   . GLN A 1 54  ? -8.773  34.948  -19.184 1.00 47.19  ? 362  GLN A OE1   1 
ATOM   383   N NE2   . GLN A 1 54  ? -10.023 34.335  -17.413 1.00 51.54  ? 362  GLN A NE2   1 
ATOM   384   N N     . GLN A 1 55  ? -12.140 31.308  -21.567 1.00 36.60  ? 363  GLN A N     1 
ATOM   385   C CA    . GLN A 1 55  ? -13.559 31.092  -21.298 1.00 40.07  ? 363  GLN A CA    1 
ATOM   386   C C     . GLN A 1 55  ? -13.949 29.638  -21.524 1.00 37.50  ? 363  GLN A C     1 
ATOM   387   O O     . GLN A 1 55  ? -14.901 29.148  -20.928 1.00 31.52  ? 363  GLN A O     1 
ATOM   388   C CB    . GLN A 1 55  ? -14.435 32.020  -22.144 1.00 44.70  ? 363  GLN A CB    1 
ATOM   389   C CG    . GLN A 1 55  ? -14.316 33.485  -21.764 1.00 57.03  ? 363  GLN A CG    1 
ATOM   390   C CD    . GLN A 1 55  ? -15.308 34.366  -22.498 1.00 70.90  ? 363  GLN A CD    1 
ATOM   391   O OE1   . GLN A 1 55  ? -15.105 35.573  -22.627 1.00 75.99  ? 363  GLN A OE1   1 
ATOM   392   N NE2   . GLN A 1 55  ? -16.393 33.766  -22.977 1.00 73.30  ? 363  GLN A NE2   1 
ATOM   393   N N     . GLN A 1 56  ? -13.209 28.950  -22.384 1.00 31.39  ? 364  GLN A N     1 
ATOM   394   C CA    . GLN A 1 56  ? -13.460 27.535  -22.633 1.00 34.56  ? 364  GLN A CA    1 
ATOM   395   C C     . GLN A 1 56  ? -12.861 26.673  -21.530 1.00 32.26  ? 364  GLN A C     1 
ATOM   396   O O     . GLN A 1 56  ? -13.055 25.456  -21.504 1.00 37.17  ? 364  GLN A O     1 
ATOM   397   C CB    . GLN A 1 56  ? -12.889 27.111  -23.988 1.00 35.56  ? 364  GLN A CB    1 
ATOM   398   C CG    . GLN A 1 56  ? -13.633 27.664  -25.190 1.00 49.40  ? 364  GLN A CG    1 
ATOM   399   C CD    . GLN A 1 56  ? -13.149 27.063  -26.495 1.00 50.74  ? 364  GLN A CD    1 
ATOM   400   O OE1   . GLN A 1 56  ? -11.948 27.000  -26.752 1.00 41.31  ? 364  GLN A OE1   1 
ATOM   401   N NE2   . GLN A 1 56  ? -14.084 26.607  -27.323 1.00 56.35  ? 364  GLN A NE2   1 
ATOM   402   N N     . GLY A 1 57  ? -12.121 27.306  -20.624 1.00 24.05  ? 365  GLY A N     1 
ATOM   403   C CA    . GLY A 1 57  ? -11.456 26.594  -19.549 1.00 26.54  ? 365  GLY A CA    1 
ATOM   404   C C     . GLY A 1 57  ? -10.125 26.001  -19.987 1.00 27.55  ? 365  GLY A C     1 
ATOM   405   O O     . GLY A 1 57  ? -9.548  25.161  -19.294 1.00 30.61  ? 365  GLY A O     1 
ATOM   406   N N     . LYS A 1 58  ? -9.642  26.438  -21.144 1.00 24.56  ? 366  LYS A N     1 
ATOM   407   C CA    . LYS A 1 58  ? -8.350  26.004  -21.663 1.00 19.63  ? 366  LYS A CA    1 
ATOM   408   C C     . LYS A 1 58  ? -7.268  26.991  -21.235 1.00 28.06  ? 366  LYS A C     1 
ATOM   409   O O     . LYS A 1 58  ? -6.759  27.771  -22.035 1.00 22.18  ? 366  LYS A O     1 
ATOM   410   C CB    . LYS A 1 58  ? -8.404  25.862  -23.189 1.00 25.21  ? 366  LYS A CB    1 
ATOM   411   C CG    . LYS A 1 58  ? -9.422  24.822  -23.653 1.00 29.69  ? 366  LYS A CG    1 
ATOM   412   C CD    . LYS A 1 58  ? -9.492  24.710  -25.166 1.00 30.20  ? 366  LYS A CD    1 
ATOM   413   C CE    . LYS A 1 58  ? -10.578 23.727  -25.583 1.00 41.37  ? 366  LYS A CE    1 
ATOM   414   N NZ    . LYS A 1 58  ? -10.591 23.494  -27.051 1.00 46.26  ? 366  LYS A NZ    1 
ATOM   415   N N     . LEU A 1 59  ? -6.917  26.933  -19.955 1.00 20.52  ? 367  LEU A N     1 
ATOM   416   C CA    . LEU A 1 59  ? -6.088  27.954  -19.331 1.00 21.87  ? 367  LEU A CA    1 
ATOM   417   C C     . LEU A 1 59  ? -4.628  27.905  -19.764 1.00 23.08  ? 367  LEU A C     1 
ATOM   418   O O     . LEU A 1 59  ? -4.035  28.937  -20.053 1.00 18.43  ? 367  LEU A O     1 
ATOM   419   C CB    . LEU A 1 59  ? -6.183  27.838  -17.815 1.00 19.49  ? 367  LEU A CB    1 
ATOM   420   C CG    . LEU A 1 59  ? -7.612  27.758  -17.269 1.00 16.96  ? 367  LEU A CG    1 
ATOM   421   C CD1   . LEU A 1 59  ? -7.584  27.662  -15.748 1.00 23.22  ? 367  LEU A CD1   1 
ATOM   422   C CD2   . LEU A 1 59  ? -8.438  28.948  -17.724 1.00 16.97  ? 367  LEU A CD2   1 
ATOM   423   N N     . GLN A 1 60  ? -4.040  26.713  -19.784 1.00 18.54  ? 368  GLN A N     1 
ATOM   424   C CA    . GLN A 1 60  ? -2.658  26.580  -20.238 1.00 22.55  ? 368  GLN A CA    1 
ATOM   425   C C     . GLN A 1 60  ? -2.486  27.094  -21.661 1.00 19.17  ? 368  GLN A C     1 
ATOM   426   O O     . GLN A 1 60  ? -1.479  27.731  -21.991 1.00 18.63  ? 368  GLN A O     1 
ATOM   427   C CB    . GLN A 1 60  ? -2.198  25.126  -20.163 1.00 15.33  ? 368  GLN A CB    1 
ATOM   428   C CG    . GLN A 1 60  ? -1.911  24.648  -18.764 1.00 19.58  ? 368  GLN A CG    1 
ATOM   429   C CD    . GLN A 1 60  ? -1.550  23.178  -18.741 1.00 35.55  ? 368  GLN A CD    1 
ATOM   430   O OE1   . GLN A 1 60  ? -0.478  22.800  -18.284 1.00 46.28  ? 368  GLN A OE1   1 
ATOM   431   N NE2   . GLN A 1 60  ? -2.450  22.341  -19.243 1.00 35.60  ? 368  GLN A NE2   1 
ATOM   432   N N     . GLU A 1 61  ? -3.467  26.808  -22.504 1.00 21.80  ? 369  GLU A N     1 
ATOM   433   C CA    . GLU A 1 61  ? -3.412  27.247  -23.890 1.00 22.81  ? 369  GLU A CA    1 
ATOM   434   C C     . GLU A 1 61  ? -3.571  28.762  -23.991 1.00 21.40  ? 369  GLU A C     1 
ATOM   435   O O     . GLU A 1 61  ? -2.866  29.417  -24.757 1.00 22.79  ? 369  GLU A O     1 
ATOM   436   C CB    . GLU A 1 61  ? -4.476  26.531  -24.730 1.00 21.08  ? 369  GLU A CB    1 
ATOM   437   C CG    . GLU A 1 61  ? -4.102  26.470  -26.187 1.00 23.36  ? 369  GLU A CG    1 
ATOM   438   C CD    . GLU A 1 61  ? -5.042  25.625  -27.008 1.00 33.62  ? 369  GLU A CD    1 
ATOM   439   O OE1   . GLU A 1 61  ? -5.893  24.914  -26.425 1.00 24.99  ? 369  GLU A OE1   1 
ATOM   440   O OE2   . GLU A 1 61  ? -4.915  25.678  -28.246 1.00 27.71  ? 369  GLU A OE2   1 
ATOM   441   N N     . ALA A 1 62  ? -4.498  29.314  -23.213 1.00 18.59  ? 370  ALA A N     1 
ATOM   442   C CA    . ALA A 1 62  ? -4.709  30.763  -23.170 1.00 18.64  ? 370  ALA A CA    1 
ATOM   443   C C     . ALA A 1 62  ? -3.417  31.486  -22.764 1.00 17.77  ? 370  ALA A C     1 
ATOM   444   O O     . ALA A 1 62  ? -3.054  32.517  -23.326 1.00 19.46  ? 370  ALA A O     1 
ATOM   445   C CB    . ALA A 1 62  ? -5.844  31.099  -22.205 1.00 26.13  ? 370  ALA A CB    1 
ATOM   446   N N     . LEU A 1 63  ? -2.720  30.922  -21.788 1.00 16.14  ? 371  LEU A N     1 
ATOM   447   C CA    . LEU A 1 63  ? -1.447  31.471  -21.320 1.00 18.53  ? 371  LEU A CA    1 
ATOM   448   C C     . LEU A 1 63  ? -0.414  31.678  -22.433 1.00 25.46  ? 371  LEU A C     1 
ATOM   449   O O     . LEU A 1 63  ? 0.290   32.695  -22.454 1.00 17.49  ? 371  LEU A O     1 
ATOM   450   C CB    . LEU A 1 63  ? -0.861  30.551  -20.255 1.00 19.57  ? 371  LEU A CB    1 
ATOM   451   C CG    . LEU A 1 63  ? -0.370  31.198  -18.971 1.00 31.26  ? 371  LEU A CG    1 
ATOM   452   C CD1   . LEU A 1 63  ? -1.513  31.963  -18.291 1.00 29.14  ? 371  LEU A CD1   1 
ATOM   453   C CD2   . LEU A 1 63  ? 0.219   30.129  -18.059 1.00 12.65  ? 371  LEU A CD2   1 
ATOM   454   N N     . MET A 1 64  ? -0.303  30.704  -23.337 1.00 18.18  ? 372  MET A N     1 
ATOM   455   C CA    . MET A 1 64  ? 0.611   30.818  -24.477 1.00 14.87  ? 372  MET A CA    1 
ATOM   456   C C     . MET A 1 64  ? 0.370   32.101  -25.248 1.00 22.12  ? 372  MET A C     1 
ATOM   457   O O     . MET A 1 64  ? 1.312   32.780  -25.660 1.00 23.73  ? 372  MET A O     1 
ATOM   458   C CB    . MET A 1 64  ? 0.423   29.653  -25.450 1.00 21.42  ? 372  MET A CB    1 
ATOM   459   C CG    . MET A 1 64  ? 1.130   28.375  -25.067 1.00 24.11  ? 372  MET A CG    1 
ATOM   460   S SD    . MET A 1 64  ? 0.909   27.093  -26.324 1.00 28.95  ? 372  MET A SD    1 
ATOM   461   C CE    . MET A 1 64  ? 1.592   27.897  -27.774 1.00 72.02  ? 372  MET A CE    1 
ATOM   462   N N     . HIS A 1 65  ? -0.902  32.411  -25.470 1.00 23.07  ? 373  HIS A N     1 
ATOM   463   C CA    . HIS A 1 65  ? -1.266  33.558  -26.288 1.00 18.72  ? 373  HIS A CA    1 
ATOM   464   C C     . HIS A 1 65  ? -1.156  34.857  -25.513 1.00 21.21  ? 373  HIS A C     1 
ATOM   465   O O     . HIS A 1 65  ? -0.772  35.878  -26.065 1.00 17.29  ? 373  HIS A O     1 
ATOM   466   C CB    . HIS A 1 65  ? -2.649  33.346  -26.902 1.00 20.81  ? 373  HIS A CB    1 
ATOM   467   C CG    . HIS A 1 65  ? -2.685  32.201  -27.867 1.00 27.83  ? 373  HIS A CG    1 
ATOM   468   N ND1   . HIS A 1 65  ? -2.254  32.317  -29.171 1.00 25.88  ? 373  HIS A ND1   1 
ATOM   469   C CD2   . HIS A 1 65  ? -3.047  30.906  -27.704 1.00 24.22  ? 373  HIS A CD2   1 
ATOM   470   C CE1   . HIS A 1 65  ? -2.374  31.151  -29.778 1.00 27.01  ? 373  HIS A CE1   1 
ATOM   471   N NE2   . HIS A 1 65  ? -2.852  30.277  -28.910 1.00 24.71  ? 373  HIS A NE2   1 
ATOM   472   N N     . TYR A 1 66  ? -1.460  34.823  -24.219 1.00 14.48  ? 374  TYR A N     1 
ATOM   473   C CA    . TYR A 1 66  ? -1.233  36.012  -23.415 1.00 13.95  ? 374  TYR A CA    1 
ATOM   474   C C     . TYR A 1 66  ? 0.255   36.351  -23.439 1.00 17.32  ? 374  TYR A C     1 
ATOM   475   O O     . TYR A 1 66  ? 0.636   37.519  -23.508 1.00 16.78  ? 374  TYR A O     1 
ATOM   476   C CB    . TYR A 1 66  ? -1.716  35.801  -21.978 1.00 15.66  ? 374  TYR A CB    1 
ATOM   477   C CG    . TYR A 1 66  ? -3.207  35.959  -21.815 1.00 20.11  ? 374  TYR A CG    1 
ATOM   478   C CD1   . TYR A 1 66  ? -3.862  37.081  -22.301 1.00 28.31  ? 374  TYR A CD1   1 
ATOM   479   C CD2   . TYR A 1 66  ? -3.964  34.978  -21.189 1.00 13.32  ? 374  TYR A CD2   1 
ATOM   480   C CE1   . TYR A 1 66  ? -5.225  37.229  -22.155 1.00 23.60  ? 374  TYR A CE1   1 
ATOM   481   C CE2   . TYR A 1 66  ? -5.322  35.117  -21.044 1.00 21.85  ? 374  TYR A CE2   1 
ATOM   482   C CZ    . TYR A 1 66  ? -5.947  36.241  -21.527 1.00 25.35  ? 374  TYR A CZ    1 
ATOM   483   O OH    . TYR A 1 66  ? -7.307  36.367  -21.379 1.00 21.07  ? 374  TYR A OH    1 
ATOM   484   N N     . LYS A 1 67  ? 1.101   35.324  -23.386 1.00 10.23  ? 375  LYS A N     1 
ATOM   485   C CA    . LYS A 1 67  ? 2.544   35.558  -23.435 1.00 16.91  ? 375  LYS A CA    1 
ATOM   486   C C     . LYS A 1 67  ? 3.004   36.219  -24.743 1.00 21.03  ? 375  LYS A C     1 
ATOM   487   O O     . LYS A 1 67  ? 3.877   37.093  -24.734 1.00 12.08  ? 375  LYS A O     1 
ATOM   488   C CB    . LYS A 1 67  ? 3.321   34.265  -23.141 1.00 16.45  ? 375  LYS A CB    1 
ATOM   489   C CG    . LYS A 1 67  ? 3.259   33.886  -21.663 1.00 17.59  ? 375  LYS A CG    1 
ATOM   490   C CD    . LYS A 1 67  ? 3.915   32.535  -21.363 1.00 16.60  ? 375  LYS A CD    1 
ATOM   491   C CE    . LYS A 1 67  ? 3.549   32.091  -19.947 1.00 17.85  ? 375  LYS A CE    1 
ATOM   492   N NZ    . LYS A 1 67  ? 4.090   30.741  -19.599 1.00 23.48  ? 375  LYS A NZ    1 
ATOM   493   N N     . GLU A 1 68  ? 2.412   35.806  -25.859 1.00 16.99  ? 376  GLU A N     1 
ATOM   494   C CA    . GLU A 1 68  ? 2.682   36.452  -27.139 1.00 15.17  ? 376  GLU A CA    1 
ATOM   495   C C     . GLU A 1 68  ? 2.297   37.922  -27.127 1.00 31.05  ? 376  GLU A C     1 
ATOM   496   O O     . GLU A 1 68  ? 3.098   38.787  -27.508 1.00 27.89  ? 376  GLU A O     1 
ATOM   497   C CB    . GLU A 1 68  ? 1.952   35.724  -28.271 1.00 30.01  ? 376  GLU A CB    1 
ATOM   498   C CG    . GLU A 1 68  ? 2.545   34.371  -28.566 1.00 35.89  ? 376  GLU A CG    1 
ATOM   499   C CD    . GLU A 1 68  ? 4.047   34.453  -28.721 1.00 43.83  ? 376  GLU A CD    1 
ATOM   500   O OE1   . GLU A 1 68  ? 4.494   35.061  -29.718 1.00 32.18  ? 376  GLU A OE1   1 
ATOM   501   O OE2   . GLU A 1 68  ? 4.776   33.940  -27.835 1.00 34.13  ? 376  GLU A OE2   1 
ATOM   502   N N     . ALA A 1 69  ? 1.074   38.203  -26.683 1.00 19.30  ? 377  ALA A N     1 
ATOM   503   C CA    . ALA A 1 69  ? 0.557   39.564  -26.709 1.00 18.36  ? 377  ALA A CA    1 
ATOM   504   C C     . ALA A 1 69  ? 1.467   40.518  -25.949 1.00 28.72  ? 377  ALA A C     1 
ATOM   505   O O     . ALA A 1 69  ? 1.842   41.579  -26.462 1.00 20.76  ? 377  ALA A O     1 
ATOM   506   C CB    . ALA A 1 69  ? -0.880  39.610  -26.149 1.00 17.45  ? 377  ALA A CB    1 
ATOM   507   N N     . ILE A 1 70  ? 1.835   40.139  -24.728 1.00 28.69  ? 378  ILE A N     1 
ATOM   508   C CA    . ILE A 1 70  ? 2.655   41.020  -23.905 1.00 24.48  ? 378  ILE A CA    1 
ATOM   509   C C     . ILE A 1 70  ? 4.049   41.244  -24.477 1.00 25.45  ? 378  ILE A C     1 
ATOM   510   O O     . ILE A 1 70  ? 4.627   42.312  -24.285 1.00 28.42  ? 378  ILE A O     1 
ATOM   511   C CB    . ILE A 1 70  ? 2.761   40.553  -22.436 1.00 25.19  ? 378  ILE A CB    1 
ATOM   512   C CG1   . ILE A 1 70  ? 3.350   39.143  -22.345 1.00 17.96  ? 378  ILE A CG1   1 
ATOM   513   C CG2   . ILE A 1 70  ? 1.404   40.636  -21.754 1.00 22.78  ? 378  ILE A CG2   1 
ATOM   514   C CD1   . ILE A 1 70  ? 3.756   38.750  -20.894 1.00 22.77  ? 378  ILE A CD1   1 
ATOM   515   N N     . ARG A 1 71  ? 4.596   40.252  -25.179 1.00 27.44  ? 379  ARG A N     1 
ATOM   516   C CA    . ARG A 1 71  ? 5.878   40.458  -25.836 1.00 30.46  ? 379  ARG A CA    1 
ATOM   517   C C     . ARG A 1 71  ? 5.726   41.535  -26.914 1.00 33.36  ? 379  ARG A C     1 
ATOM   518   O O     . ARG A 1 71  ? 6.397   42.570  -26.884 1.00 32.99  ? 379  ARG A O     1 
ATOM   519   C CB    . ARG A 1 71  ? 6.415   39.162  -26.460 1.00 20.33  ? 379  ARG A CB    1 
ATOM   520   C CG    . ARG A 1 71  ? 7.773   39.343  -27.137 1.00 22.54  ? 379  ARG A CG    1 
ATOM   521   C CD    . ARG A 1 71  ? 8.337   38.034  -27.716 1.00 26.39  ? 379  ARG A CD    1 
ATOM   522   N NE    . ARG A 1 71  ? 7.413   37.324  -28.601 1.00 23.08  ? 379  ARG A NE    1 
ATOM   523   C CZ    . ARG A 1 71  ? 7.104   37.707  -29.837 1.00 27.78  ? 379  ARG A CZ    1 
ATOM   524   N NH1   . ARG A 1 71  ? 7.625   38.816  -30.342 1.00 34.67  ? 379  ARG A NH1   1 
ATOM   525   N NH2   . ARG A 1 71  ? 6.257   36.989  -30.560 1.00 30.33  ? 379  ARG A NH2   1 
ATOM   526   N N     . ILE A 1 72  ? 4.822   41.274  -27.850 1.00 30.16  ? 380  ILE A N     1 
ATOM   527   C CA    . ILE A 1 72  ? 4.606   42.129  -29.010 1.00 24.32  ? 380  ILE A CA    1 
ATOM   528   C C     . ILE A 1 72  ? 4.308   43.571  -28.588 1.00 35.00  ? 380  ILE A C     1 
ATOM   529   O O     . ILE A 1 72  ? 4.953   44.502  -29.060 1.00 37.19  ? 380  ILE A O     1 
ATOM   530   C CB    . ILE A 1 72  ? 3.459   41.564  -29.884 1.00 27.51  ? 380  ILE A CB    1 
ATOM   531   C CG1   . ILE A 1 72  ? 3.800   40.144  -30.344 1.00 17.82  ? 380  ILE A CG1   1 
ATOM   532   C CG2   . ILE A 1 72  ? 3.181   42.457  -31.083 1.00 26.06  ? 380  ILE A CG2   1 
ATOM   533   C CD1   . ILE A 1 72  ? 2.601   39.353  -30.846 1.00 27.12  ? 380  ILE A CD1   1 
ATOM   534   N N     . SER A 1 73  ? 3.344   43.744  -27.688 1.00 32.26  ? 381  SER A N     1 
ATOM   535   C CA    A SER A 1 73  ? 2.956   45.072  -27.220 0.50 28.01  ? 381  SER A CA    1 
ATOM   536   C CA    B SER A 1 73  ? 2.950   45.071  -27.219 0.50 28.03  ? 381  SER A CA    1 
ATOM   537   C C     . SER A 1 73  ? 3.298   45.240  -25.743 1.00 35.33  ? 381  SER A C     1 
ATOM   538   O O     . SER A 1 73  ? 2.487   44.939  -24.881 1.00 31.38  ? 381  SER A O     1 
ATOM   539   C CB    A SER A 1 73  ? 1.457   45.292  -27.437 0.50 26.90  ? 381  SER A CB    1 
ATOM   540   C CB    B SER A 1 73  ? 1.442   45.276  -27.408 0.50 26.75  ? 381  SER A CB    1 
ATOM   541   O OG    A SER A 1 73  ? 1.076   46.613  -27.098 0.50 21.06  ? 381  SER A OG    1 
ATOM   542   O OG    B SER A 1 73  ? 1.007   44.815  -28.676 0.50 28.96  ? 381  SER A OG    1 
ATOM   543   N N     . PRO A 1 74  ? 4.511   45.735  -25.449 1.00 32.21  ? 382  PRO A N     1 
ATOM   544   C CA    . PRO A 1 74  ? 4.990   45.861  -24.067 1.00 26.36  ? 382  PRO A CA    1 
ATOM   545   C C     . PRO A 1 74  ? 4.249   46.907  -23.237 1.00 31.13  ? 382  PRO A C     1 
ATOM   546   O O     . PRO A 1 74  ? 4.454   46.966  -22.023 1.00 31.18  ? 382  PRO A O     1 
ATOM   547   C CB    . PRO A 1 74  ? 6.456   46.288  -24.238 1.00 26.26  ? 382  PRO A CB    1 
ATOM   548   C CG    . PRO A 1 74  ? 6.789   46.026  -25.681 1.00 38.08  ? 382  PRO A CG    1 
ATOM   549   C CD    . PRO A 1 74  ? 5.508   46.211  -26.419 1.00 39.59  ? 382  PRO A CD    1 
ATOM   550   N N     . THR A 1 75  ? 3.421   47.727  -23.874 1.00 35.02  ? 383  THR A N     1 
ATOM   551   C CA    . THR A 1 75  ? 2.622   48.711  -23.146 1.00 37.75  ? 383  THR A CA    1 
ATOM   552   C C     . THR A 1 75  ? 1.172   48.229  -23.035 1.00 42.02  ? 383  THR A C     1 
ATOM   553   O O     . THR A 1 75  ? 0.276   48.986  -22.658 1.00 50.21  ? 383  THR A O     1 
ATOM   554   C CB    . THR A 1 75  ? 2.668   50.107  -23.826 1.00 33.39  ? 383  THR A CB    1 
ATOM   555   O OG1   . THR A 1 75  ? 2.052   50.036  -25.119 1.00 26.94  ? 383  THR A OG1   1 
ATOM   556   C CG2   . THR A 1 75  ? 4.111   50.612  -23.973 1.00 18.08  ? 383  THR A CG2   1 
ATOM   557   N N     . PHE A 1 76  ? 0.965   46.958  -23.368 1.00 33.26  ? 384  PHE A N     1 
ATOM   558   C CA    . PHE A 1 76  ? -0.351  46.319  -23.361 1.00 38.33  ? 384  PHE A CA    1 
ATOM   559   C C     . PHE A 1 76  ? -0.751  45.927  -21.939 1.00 24.49  ? 384  PHE A C     1 
ATOM   560   O O     . PHE A 1 76  ? -0.705  44.742  -21.582 1.00 26.26  ? 384  PHE A O     1 
ATOM   561   C CB    . PHE A 1 76  ? -0.296  45.049  -24.224 1.00 39.82  ? 384  PHE A CB    1 
ATOM   562   C CG    . PHE A 1 76  ? -1.620  44.630  -24.804 1.00 35.45  ? 384  PHE A CG    1 
ATOM   563   C CD1   . PHE A 1 76  ? -1.675  43.615  -25.749 1.00 34.79  ? 384  PHE A CD1   1 
ATOM   564   C CD2   . PHE A 1 76  ? -2.801  45.248  -24.423 1.00 38.89  ? 384  PHE A CD2   1 
ATOM   565   C CE1   . PHE A 1 76  ? -2.880  43.218  -26.301 1.00 37.82  ? 384  PHE A CE1   1 
ATOM   566   C CE2   . PHE A 1 76  ? -4.017  44.854  -24.968 1.00 32.20  ? 384  PHE A CE2   1 
ATOM   567   C CZ    . PHE A 1 76  ? -4.056  43.839  -25.906 1.00 41.79  ? 384  PHE A CZ    1 
ATOM   568   N N     . ALA A 1 77  ? -1.152  46.904  -21.129 1.00 22.95  ? 385  ALA A N     1 
ATOM   569   C CA    . ALA A 1 77  ? -1.514  46.613  -19.743 1.00 20.79  ? 385  ALA A CA    1 
ATOM   570   C C     . ALA A 1 77  ? -2.680  45.626  -19.656 1.00 22.44  ? 385  ALA A C     1 
ATOM   571   O O     . ALA A 1 77  ? -2.729  44.771  -18.767 1.00 16.44  ? 385  ALA A O     1 
ATOM   572   C CB    . ALA A 1 77  ? -1.823  47.899  -18.987 1.00 30.36  ? 385  ALA A CB    1 
ATOM   573   N N     . ASP A 1 78  ? -3.606  45.741  -20.600 1.00 13.49  ? 386  ASP A N     1 
ATOM   574   C CA    . ASP A 1 78  ? -4.814  44.928  -20.607 1.00 21.70  ? 386  ASP A CA    1 
ATOM   575   C C     . ASP A 1 78  ? -4.454  43.460  -20.667 1.00 24.64  ? 386  ASP A C     1 
ATOM   576   O O     . ASP A 1 78  ? -5.102  42.623  -20.043 1.00 20.02  ? 386  ASP A O     1 
ATOM   577   C CB    . ASP A 1 78  ? -5.687  45.299  -21.805 1.00 27.92  ? 386  ASP A CB    1 
ATOM   578   C CG    . ASP A 1 78  ? -6.977  45.969  -21.397 1.00 49.27  ? 386  ASP A CG    1 
ATOM   579   O OD1   . ASP A 1 78  ? -7.214  47.123  -21.821 1.00 55.44  ? 386  ASP A OD1   1 
ATOM   580   O OD2   . ASP A 1 78  ? -7.759  45.333  -20.658 1.00 59.82  ? 386  ASP A OD2   1 
ATOM   581   N N     . ALA A 1 79  ? -3.410  43.145  -21.419 1.00 17.91  ? 387  ALA A N     1 
ATOM   582   C CA    . ALA A 1 79  ? -3.011  41.754  -21.592 1.00 19.39  ? 387  ALA A CA    1 
ATOM   583   C C     . ALA A 1 79  ? -2.386  41.211  -20.310 1.00 17.04  ? 387  ALA A C     1 
ATOM   584   O O     . ALA A 1 79  ? -2.634  40.069  -19.927 1.00 16.99  ? 387  ALA A O     1 
ATOM   585   C CB    . ALA A 1 79  ? -2.054  41.604  -22.776 1.00 23.49  ? 387  ALA A CB    1 
ATOM   586   N N     . TYR A 1 80  ? -1.572  42.027  -19.648 1.00 16.54  ? 388  TYR A N     1 
ATOM   587   C CA    . TYR A 1 80  ? -1.028  41.642  -18.347 1.00 19.94  ? 388  TYR A CA    1 
ATOM   588   C C     . TYR A 1 80  ? -2.142  41.337  -17.352 1.00 18.49  ? 388  TYR A C     1 
ATOM   589   O O     . TYR A 1 80  ? -2.110  40.303  -16.679 1.00 13.47  ? 388  TYR A O     1 
ATOM   590   C CB    . TYR A 1 80  ? -0.096  42.722  -17.786 1.00 12.03  ? 388  TYR A CB    1 
ATOM   591   C CG    . TYR A 1 80  ? 1.328   42.566  -18.284 1.00 15.67  ? 388  TYR A CG    1 
ATOM   592   C CD1   . TYR A 1 80  ? 2.196   41.673  -17.668 1.00 19.28  ? 388  TYR A CD1   1 
ATOM   593   C CD2   . TYR A 1 80  ? 1.798   43.298  -19.373 1.00 12.36  ? 388  TYR A CD2   1 
ATOM   594   C CE1   . TYR A 1 80  ? 3.497   41.502  -18.122 1.00 22.51  ? 388  TYR A CE1   1 
ATOM   595   C CE2   . TYR A 1 80  ? 3.103   43.137  -19.836 1.00 17.62  ? 388  TYR A CE2   1 
ATOM   596   C CZ    . TYR A 1 80  ? 3.950   42.243  -19.204 1.00 18.82  ? 388  TYR A CZ    1 
ATOM   597   O OH    . TYR A 1 80  ? 5.246   42.068  -19.660 1.00 19.74  ? 388  TYR A OH    1 
ATOM   598   N N     . SER A 1 81  ? -3.121  42.239  -17.280 1.00 18.48  ? 389  SER A N     1 
ATOM   599   C CA    . SER A 1 81  ? -4.247  42.124  -16.364 1.00 11.77  ? 389  SER A CA    1 
ATOM   600   C C     . SER A 1 81  ? -5.048  40.863  -16.661 1.00 14.71  ? 389  SER A C     1 
ATOM   601   O O     . SER A 1 81  ? -5.353  40.078  -15.765 1.00 18.16  ? 389  SER A O     1 
ATOM   602   C CB    . SER A 1 81  ? -5.168  43.340  -16.514 1.00 20.22  ? 389  SER A CB    1 
ATOM   603   O OG    . SER A 1 81  ? -6.269  43.230  -15.629 1.00 19.94  ? 389  SER A OG    1 
ATOM   604   N N     . ASN A 1 82  ? -5.404  40.689  -17.926 1.00 19.79  ? 390  ASN A N     1 
ATOM   605   C CA    . ASN A 1 82  ? -6.119  39.501  -18.347 1.00 14.02  ? 390  ASN A CA    1 
ATOM   606   C C     . ASN A 1 82  ? -5.311  38.235  -18.116 1.00 21.78  ? 390  ASN A C     1 
ATOM   607   O O     . ASN A 1 82  ? -5.851  37.244  -17.668 1.00 13.68  ? 390  ASN A O     1 
ATOM   608   C CB    . ASN A 1 82  ? -6.579  39.627  -19.802 1.00 16.24  ? 390  ASN A CB    1 
ATOM   609   C CG    . ASN A 1 82  ? -7.829  40.482  -19.932 1.00 26.53  ? 390  ASN A CG    1 
ATOM   610   O OD1   . ASN A 1 82  ? -8.721  40.402  -19.096 1.00 27.29  ? 390  ASN A OD1   1 
ATOM   611   N ND2   . ASN A 1 82  ? -7.893  41.303  -20.969 1.00 22.41  ? 390  ASN A ND2   1 
ATOM   612   N N     . MET A 1 83  ? -4.012  38.262  -18.404 1.00 13.42  ? 391  MET A N     1 
ATOM   613   C CA    . MET A 1 83  ? -3.192  37.095  -18.111 1.00 8.42   ? 391  MET A CA    1 
ATOM   614   C C     . MET A 1 83  ? -3.213  36.827  -16.609 1.00 18.04  ? 391  MET A C     1 
ATOM   615   O O     . MET A 1 83  ? -3.245  35.685  -16.164 1.00 15.44  ? 391  MET A O     1 
ATOM   616   C CB    . MET A 1 83  ? -1.763  37.327  -18.583 1.00 13.05  ? 391  MET A CB    1 
ATOM   617   C CG    . MET A 1 83  ? -0.803  36.196  -18.286 1.00 21.12  ? 391  MET A CG    1 
ATOM   618   S SD    . MET A 1 83  ? 0.832   36.479  -19.038 1.00 19.76  ? 391  MET A SD    1 
ATOM   619   C CE    . MET A 1 83  ? 1.834   35.453  -18.021 1.00 10.65  ? 391  MET A CE    1 
ATOM   620   N N     . GLY A 1 84  ? -3.201  37.893  -15.822 1.00 10.93  ? 392  GLY A N     1 
ATOM   621   C CA    . GLY A 1 84  ? -3.312  37.740  -14.385 1.00 18.81  ? 392  GLY A CA    1 
ATOM   622   C C     . GLY A 1 84  ? -4.561  36.966  -13.974 1.00 18.65  ? 392  GLY A C     1 
ATOM   623   O O     . GLY A 1 84  ? -4.479  36.072  -13.143 1.00 14.72  ? 392  GLY A O     1 
ATOM   624   N N     . ASN A 1 85  ? -5.713  37.316  -14.546 1.00 14.30  ? 393  ASN A N     1 
ATOM   625   C CA    . ASN A 1 85  ? -6.955  36.591  -14.295 1.00 12.50  ? 393  ASN A CA    1 
ATOM   626   C C     . ASN A 1 85  ? -6.829  35.103  -14.588 1.00 12.38  ? 393  ASN A C     1 
ATOM   627   O O     . ASN A 1 85  ? -7.369  34.262  -13.867 1.00 13.01  ? 393  ASN A O     1 
ATOM   628   C CB    . ASN A 1 85  ? -8.082  37.161  -15.145 1.00 14.77  ? 393  ASN A CB    1 
ATOM   629   C CG    . ASN A 1 85  ? -8.540  38.510  -14.661 1.00 15.62  ? 393  ASN A CG    1 
ATOM   630   O OD1   . ASN A 1 85  ? -8.201  38.925  -13.559 1.00 22.53  ? 393  ASN A OD1   1 
ATOM   631   N ND2   . ASN A 1 85  ? -9.293  39.207  -15.484 1.00 14.90  ? 393  ASN A ND2   1 
ATOM   632   N N     . THR A 1 86  ? -6.130  34.773  -15.662 1.00 16.67  ? 394  THR A N     1 
ATOM   633   C CA    . THR A 1 86  ? -5.954  33.368  -16.014 1.00 13.22  ? 394  THR A CA    1 
ATOM   634   C C     . THR A 1 86  ? -5.066  32.630  -14.991 1.00 10.58  ? 394  THR A C     1 
ATOM   635   O O     . THR A 1 86  ? -5.379  31.511  -14.560 1.00 14.13  ? 394  THR A O     1 
ATOM   636   C CB    . THR A 1 86  ? -5.416  33.225  -17.452 1.00 18.53  ? 394  THR A CB    1 
ATOM   637   O OG1   . THR A 1 86  ? -6.431  33.654  -18.373 1.00 15.94  ? 394  THR A OG1   1 
ATOM   638   C CG2   . THR A 1 86  ? -5.070  31.766  -17.749 1.00 18.34  ? 394  THR A CG2   1 
ATOM   639   N N     . LEU A 1 87  ? -3.967  33.252  -14.580 1.00 11.28  ? 395  LEU A N     1 
ATOM   640   C CA    . LEU A 1 87  ? -3.119  32.641  -13.548 1.00 9.89   ? 395  LEU A CA    1 
ATOM   641   C C     . LEU A 1 87  ? -3.872  32.470  -12.236 1.00 13.21  ? 395  LEU A C     1 
ATOM   642   O O     . LEU A 1 87  ? -3.686  31.482  -11.524 1.00 15.23  ? 395  LEU A O     1 
ATOM   643   C CB    . LEU A 1 87  ? -1.862  33.458  -13.306 1.00 8.61   ? 395  LEU A CB    1 
ATOM   644   C CG    . LEU A 1 87  ? -0.907  33.512  -14.504 1.00 20.13  ? 395  LEU A CG    1 
ATOM   645   C CD1   . LEU A 1 87  ? 0.325   34.365  -14.182 1.00 13.54  ? 395  LEU A CD1   1 
ATOM   646   C CD2   . LEU A 1 87  ? -0.513  32.109  -14.936 1.00 14.10  ? 395  LEU A CD2   1 
ATOM   647   N N     . LYS A 1 88  ? -4.698  33.447  -11.898 1.00 11.48  ? 396  LYS A N     1 
ATOM   648   C CA    . LYS A 1 88  ? -5.517  33.335  -10.692 1.00 16.15  ? 396  LYS A CA    1 
ATOM   649   C C     . LYS A 1 88  ? -6.395  32.085  -10.774 1.00 20.28  ? 396  LYS A C     1 
ATOM   650   O O     . LYS A 1 88  ? -6.531  31.340  -9.800  1.00 15.02  ? 396  LYS A O     1 
ATOM   651   C CB    . LYS A 1 88  ? -6.369  34.590  -10.503 1.00 14.27  ? 396  LYS A CB    1 
ATOM   652   C CG    . LYS A 1 88  ? -7.128  34.661  -9.165  1.00 24.47  ? 396  LYS A CG    1 
ATOM   653   C CD    . LYS A 1 88  ? -8.053  35.879  -9.136  1.00 23.85  ? 396  LYS A CD    1 
ATOM   654   C CE    . LYS A 1 88  ? -9.008  35.853  -7.948  1.00 35.54  ? 396  LYS A CE    1 
ATOM   655   N NZ    . LYS A 1 88  ? -8.290  35.855  -6.650  1.00 43.45  ? 396  LYS A NZ    1 
ATOM   656   N N     . GLU A 1 89  ? -6.974  31.847  -11.946 1.00 16.16  ? 397  GLU A N     1 
ATOM   657   C CA    . GLU A 1 89  ? -7.858  30.704  -12.125 1.00 23.81  ? 397  GLU A CA    1 
ATOM   658   C C     . GLU A 1 89  ? -7.064  29.402  -12.071 1.00 28.30  ? 397  GLU A C     1 
ATOM   659   O O     . GLU A 1 89  ? -7.583  28.366  -11.665 1.00 20.31  ? 397  GLU A O     1 
ATOM   660   C CB    . GLU A 1 89  ? -8.652  30.821  -13.425 1.00 26.19  ? 397  GLU A CB    1 
ATOM   661   C CG    . GLU A 1 89  ? -9.683  29.726  -13.605 1.00 39.53  ? 397  GLU A CG    1 
ATOM   662   C CD    . GLU A 1 89  ? -10.653 30.009  -14.730 1.00 37.25  ? 397  GLU A CD    1 
ATOM   663   O OE1   . GLU A 1 89  ? -10.669 31.154  -15.237 1.00 38.45  ? 397  GLU A OE1   1 
ATOM   664   O OE2   . GLU A 1 89  ? -11.401 29.079  -15.100 1.00 35.88  ? 397  GLU A OE2   1 
ATOM   665   N N     . MET A 1 90  ? -5.794  29.469  -12.463 1.00 16.10  ? 398  MET A N     1 
ATOM   666   C CA    . MET A 1 90  ? -4.905  28.313  -12.409 1.00 22.19  ? 398  MET A CA    1 
ATOM   667   C C     . MET A 1 90  ? -4.325  28.104  -11.016 1.00 19.26  ? 398  MET A C     1 
ATOM   668   O O     . MET A 1 90  ? -3.533  27.185  -10.793 1.00 24.76  ? 398  MET A O     1 
ATOM   669   C CB    . MET A 1 90  ? -3.769  28.478  -13.418 1.00 24.51  ? 398  MET A CB    1 
ATOM   670   C CG    . MET A 1 90  ? -4.240  28.550  -14.855 1.00 19.78  ? 398  MET A CG    1 
ATOM   671   S SD    . MET A 1 90  ? -2.876  28.922  -15.959 1.00 19.21  ? 398  MET A SD    1 
ATOM   672   C CE    . MET A 1 90  ? -1.949  27.389  -15.884 1.00 22.09  ? 398  MET A CE    1 
ATOM   673   N N     . GLN A 1 91  ? -4.720  28.962  -10.082 1.00 18.31  ? 399  GLN A N     1 
ATOM   674   C CA    . GLN A 1 91  ? -4.257  28.889  -8.697  1.00 20.61  ? 399  GLN A CA    1 
ATOM   675   C C     . GLN A 1 91  ? -2.793  29.280  -8.565  1.00 29.20  ? 399  GLN A C     1 
ATOM   676   O O     . GLN A 1 91  ? -2.133  28.894  -7.596  1.00 22.34  ? 399  GLN A O     1 
ATOM   677   C CB    . GLN A 1 91  ? -4.464  27.485  -8.100  1.00 26.22  ? 399  GLN A CB    1 
ATOM   678   C CG    . GLN A 1 91  ? -5.832  26.874  -8.339  1.00 41.77  ? 399  GLN A CG    1 
ATOM   679   C CD    . GLN A 1 91  ? -6.845  27.266  -7.288  1.00 59.58  ? 399  GLN A CD    1 
ATOM   680   O OE1   . GLN A 1 91  ? -6.648  28.232  -6.550  1.00 68.22  ? 399  GLN A OE1   1 
ATOM   681   N NE2   . GLN A 1 91  ? -7.937  26.512  -7.206  1.00 65.28  ? 399  GLN A NE2   1 
ATOM   682   N N     . ASP A 1 92  ? -2.277  30.024  -9.544  1.00 23.62  ? 400  ASP A N     1 
ATOM   683   C CA    . ASP A 1 92  ? -0.949  30.612  -9.426  1.00 22.23  ? 400  ASP A CA    1 
ATOM   684   C C     . ASP A 1 92  ? -1.122  32.018  -8.852  1.00 26.98  ? 400  ASP A C     1 
ATOM   685   O O     . ASP A 1 92  ? -1.251  32.984  -9.598  1.00 21.45  ? 400  ASP A O     1 
ATOM   686   C CB    . ASP A 1 92  ? -0.266  30.660  -10.792 1.00 16.00  ? 400  ASP A CB    1 
ATOM   687   C CG    . ASP A 1 92  ? 1.140   31.257  -10.738 1.00 24.46  ? 400  ASP A CG    1 
ATOM   688   O OD1   . ASP A 1 92  ? 1.636   31.579  -9.632  1.00 23.08  ? 400  ASP A OD1   1 
ATOM   689   O OD2   . ASP A 1 92  ? 1.757   31.407  -11.817 1.00 16.52  ? 400  ASP A OD2   1 
ATOM   690   N N     . VAL A 1 93  ? -1.147  32.121  -7.523  1.00 19.15  ? 401  VAL A N     1 
ATOM   691   C CA    . VAL A 1 93  ? -1.449  33.380  -6.840  1.00 22.90  ? 401  VAL A CA    1 
ATOM   692   C C     . VAL A 1 93  ? -0.351  34.442  -6.957  1.00 16.33  ? 401  VAL A C     1 
ATOM   693   O O     . VAL A 1 93  ? -0.641  35.619  -7.177  1.00 18.43  ? 401  VAL A O     1 
ATOM   694   C CB    . VAL A 1 93  ? -1.806  33.164  -5.342  1.00 26.10  ? 401  VAL A CB    1 
ATOM   695   C CG1   . VAL A 1 93  ? -1.565  34.441  -4.564  1.00 43.88  ? 401  VAL A CG1   1 
ATOM   696   C CG2   . VAL A 1 93  ? -3.271  32.723  -5.187  1.00 21.02  ? 401  VAL A CG2   1 
ATOM   697   N N     . GLN A 1 94  ? 0.899   34.021  -6.816  1.00 18.76  ? 402  GLN A N     1 
ATOM   698   C CA    . GLN A 1 94  ? 2.040   34.911  -6.978  1.00 26.10  ? 402  GLN A CA    1 
ATOM   699   C C     . GLN A 1 94  ? 2.159   35.390  -8.411  1.00 14.66  ? 402  GLN A C     1 
ATOM   700   O O     . GLN A 1 94  ? 2.428   36.567  -8.663  1.00 14.98  ? 402  GLN A O     1 
ATOM   701   C CB    . GLN A 1 94  ? 3.343   34.209  -6.600  1.00 22.06  ? 402  GLN A CB    1 
ATOM   702   C CG    . GLN A 1 94  ? 3.600   34.116  -5.111  1.00 29.69  ? 402  GLN A CG    1 
ATOM   703   C CD    . GLN A 1 94  ? 5.040   33.736  -4.800  1.00 44.09  ? 402  GLN A CD    1 
ATOM   704   O OE1   . GLN A 1 94  ? 5.852   33.520  -5.704  1.00 53.21  ? 402  GLN A OE1   1 
ATOM   705   N NE2   . GLN A 1 94  ? 5.361   33.652  -3.518  1.00 53.16  ? 402  GLN A NE2   1 
ATOM   706   N N     . GLY A 1 95  ? 1.986   34.467  -9.345  1.00 11.61  ? 403  GLY A N     1 
ATOM   707   C CA    . GLY A 1 95  ? 2.069   34.825  -10.745 1.00 17.87  ? 403  GLY A CA    1 
ATOM   708   C C     . GLY A 1 95  ? 1.062   35.906  -11.083 1.00 11.51  ? 403  GLY A C     1 
ATOM   709   O O     . GLY A 1 95  ? 1.397   36.868  -11.774 1.00 15.39  ? 403  GLY A O     1 
ATOM   710   N N     . ALA A 1 96  ? -0.175  35.738  -10.610 1.00 11.94  ? 404  ALA A N     1 
ATOM   711   C CA    . ALA A 1 96  ? -1.259  36.657  -10.957 1.00 17.26  ? 404  ALA A CA    1 
ATOM   712   C C     . ALA A 1 96  ? -0.931  38.010  -10.399 1.00 13.18  ? 404  ALA A C     1 
ATOM   713   O O     . ALA A 1 96  ? -1.110  39.022  -11.053 1.00 13.35  ? 404  ALA A O     1 
ATOM   714   C CB    . ALA A 1 96  ? -2.621  36.174  -10.394 1.00 13.00  ? 404  ALA A CB    1 
ATOM   715   N N     . LEU A 1 97  ? -0.462  38.031  -9.162  1.00 9.70   ? 405  LEU A N     1 
ATOM   716   C CA    . LEU A 1 97  ? -0.118  39.293  -8.535  1.00 14.86  ? 405  LEU A CA    1 
ATOM   717   C C     . LEU A 1 97  ? 0.986   39.987  -9.314  1.00 19.55  ? 405  LEU A C     1 
ATOM   718   O O     . LEU A 1 97  ? 0.955   41.205  -9.506  1.00 20.30  ? 405  LEU A O     1 
ATOM   719   C CB    . LEU A 1 97  ? 0.321   39.092  -7.094  1.00 21.86  ? 405  LEU A CB    1 
ATOM   720   C CG    . LEU A 1 97  ? 0.296   40.386  -6.288  1.00 23.07  ? 405  LEU A CG    1 
ATOM   721   C CD1   . LEU A 1 97  ? -0.292  40.124  -4.920  1.00 30.01  ? 405  LEU A CD1   1 
ATOM   722   C CD2   . LEU A 1 97  ? 1.690   41.008  -6.189  1.00 33.89  ? 405  LEU A CD2   1 
ATOM   723   N N     . GLN A 1 98  ? 1.979   39.218  -9.741  1.00 20.78  ? 406  GLN A N     1 
ATOM   724   C CA    . GLN A 1 98  ? 3.054   39.782  -10.546 1.00 14.35  ? 406  GLN A CA    1 
ATOM   725   C C     . GLN A 1 98  ? 2.448   40.457  -11.780 1.00 15.55  ? 406  GLN A C     1 
ATOM   726   O O     . GLN A 1 98  ? 2.834   41.557  -12.138 1.00 14.24  ? 406  GLN A O     1 
ATOM   727   C CB    . GLN A 1 98  ? 4.046   38.687  -10.946 1.00 22.91  ? 406  GLN A CB    1 
ATOM   728   C CG    . GLN A 1 98  ? 5.295   39.183  -11.637 1.00 40.46  ? 406  GLN A CG    1 
ATOM   729   C CD    . GLN A 1 98  ? 6.272   39.884  -10.695 1.00 40.85  ? 406  GLN A CD    1 
ATOM   730   O OE1   . GLN A 1 98  ? 7.336   40.350  -11.132 1.00 19.14  ? 406  GLN A OE1   1 
ATOM   731   N NE2   . GLN A 1 98  ? 5.919   39.964  -9.396  1.00 15.77  ? 406  GLN A NE2   1 
ATOM   732   N N     . CYS A 1 99  ? 1.470   39.809  -12.405 1.00 6.20   ? 407  CYS A N     1 
ATOM   733   C CA    . CYS A 1 99  ? 0.881   40.362  -13.627 1.00 5.59   ? 407  CYS A CA    1 
ATOM   734   C C     . CYS A 1 99  ? 0.085   41.630  -13.382 1.00 9.06   ? 407  CYS A C     1 
ATOM   735   O O     . CYS A 1 99  ? 0.122   42.561  -14.190 1.00 12.55  ? 407  CYS A O     1 
ATOM   736   C CB    . CYS A 1 99  ? -0.001  39.325  -14.344 1.00 18.27  ? 407  CYS A CB    1 
ATOM   737   S SG    . CYS A 1 99  ? 0.916   37.937  -15.151 1.00 16.35  ? 407  CYS A SG    1 
ATOM   738   N N     . TYR A 1 100 ? -0.689  41.657  -12.295 1.00 13.93  ? 408  TYR A N     1 
ATOM   739   C CA    . TYR A 1 100 ? -1.478  42.849  -11.979 1.00 10.84  ? 408  TYR A CA    1 
ATOM   740   C C     . TYR A 1 100 ? -0.533  43.994  -11.631 1.00 10.02  ? 408  TYR A C     1 
ATOM   741   O O     . TYR A 1 100 ? -0.766  45.128  -11.975 1.00 9.34   ? 408  TYR A O     1 
ATOM   742   C CB    . TYR A 1 100 ? -2.418  42.593  -10.793 1.00 12.55  ? 408  TYR A CB    1 
ATOM   743   C CG    . TYR A 1 100 ? -3.476  41.541  -11.035 1.00 10.07  ? 408  TYR A CG    1 
ATOM   744   C CD1   . TYR A 1 100 ? -4.127  41.432  -12.271 1.00 16.32  ? 408  TYR A CD1   1 
ATOM   745   C CD2   . TYR A 1 100 ? -3.842  40.655  -10.020 1.00 8.18   ? 408  TYR A CD2   1 
ATOM   746   C CE1   . TYR A 1 100 ? -5.094  40.456  -12.485 1.00 11.12  ? 408  TYR A CE1   1 
ATOM   747   C CE2   . TYR A 1 100 ? -4.804  39.691  -10.227 1.00 14.60  ? 408  TYR A CE2   1 
ATOM   748   C CZ    . TYR A 1 100 ? -5.437  39.604  -11.454 1.00 15.34  ? 408  TYR A CZ    1 
ATOM   749   O OH    . TYR A 1 100 ? -6.392  38.633  -11.636 1.00 19.79  ? 408  TYR A OH    1 
ATOM   750   N N     . THR A 1 101 ? 0.552   43.665  -10.949 1.00 12.94  ? 409  THR A N     1 
ATOM   751   C CA    . THR A 1 101 ? 1.529   44.649  -10.549 1.00 13.44  ? 409  THR A CA    1 
ATOM   752   C C     . THR A 1 101 ? 2.172   45.278  -11.778 1.00 13.27  ? 409  THR A C     1 
ATOM   753   O O     . THR A 1 101 ? 2.351   46.488  -11.846 1.00 14.47  ? 409  THR A O     1 
ATOM   754   C CB    . THR A 1 101 ? 2.597   44.002  -9.635  1.00 12.48  ? 409  THR A CB    1 
ATOM   755   O OG1   . THR A 1 101 ? 1.963   43.519  -8.453  1.00 14.43  ? 409  THR A OG1   1 
ATOM   756   C CG2   . THR A 1 101 ? 3.677   45.016  -9.237  1.00 17.79  ? 409  THR A CG2   1 
ATOM   757   N N     . ARG A 1 102 ? 2.503   44.456  -12.762 1.00 12.02  ? 410  ARG A N     1 
ATOM   758   C CA    . ARG A 1 102 ? 3.068   44.977  -13.998 1.00 17.36  ? 410  ARG A CA    1 
ATOM   759   C C     . ARG A 1 102 ? 2.050   45.859  -14.718 1.00 13.25  ? 410  ARG A C     1 
ATOM   760   O O     . ARG A 1 102 ? 2.403   46.910  -15.233 1.00 12.80  ? 410  ARG A O     1 
ATOM   761   C CB    . ARG A 1 102 ? 3.537   43.837  -14.918 1.00 14.78  ? 410  ARG A CB    1 
ATOM   762   C CG    . ARG A 1 102 ? 4.833   43.140  -14.483 1.00 14.27  ? 410  ARG A CG    1 
ATOM   763   C CD    . ARG A 1 102 ? 6.032   44.081  -14.508 1.00 16.18  ? 410  ARG A CD    1 
ATOM   764   N NE    . ARG A 1 102 ? 6.354   44.544  -15.863 1.00 18.87  ? 410  ARG A NE    1 
ATOM   765   C CZ    . ARG A 1 102 ? 6.310   45.809  -16.279 1.00 16.92  ? 410  ARG A CZ    1 
ATOM   766   N NH1   . ARG A 1 102 ? 5.973   46.788  -15.455 1.00 20.72  ? 410  ARG A NH1   1 
ATOM   767   N NH2   . ARG A 1 102 ? 6.613   46.097  -17.538 1.00 17.53  ? 410  ARG A NH2   1 
ATOM   768   N N     . ALA A 1 103 ? 0.792   45.420  -14.758 1.00 12.48  ? 411  ALA A N     1 
ATOM   769   C CA    . ALA A 1 103 ? -0.272  46.177  -15.418 1.00 13.23  ? 411  ALA A CA    1 
ATOM   770   C C     . ALA A 1 103 ? -0.424  47.595  -14.861 1.00 20.02  ? 411  ALA A C     1 
ATOM   771   O O     . ALA A 1 103 ? -0.615  48.549  -15.611 1.00 20.32  ? 411  ALA A O     1 
ATOM   772   C CB    . ALA A 1 103 ? -1.608  45.418  -15.322 1.00 9.39   ? 411  ALA A CB    1 
ATOM   773   N N     . ILE A 1 104 ? -0.344  47.722  -13.542 1.00 17.17  ? 412  ILE A N     1 
ATOM   774   C CA    . ILE A 1 104 ? -0.493  49.011  -12.876 1.00 14.80  ? 412  ILE A CA    1 
ATOM   775   C C     . ILE A 1 104 ? 0.763   49.867  -13.076 1.00 18.53  ? 412  ILE A C     1 
ATOM   776   O O     . ILE A 1 104 ? 0.684   51.097  -13.148 1.00 19.34  ? 412  ILE A O     1 
ATOM   777   C CB    . ILE A 1 104 ? -0.797  48.808  -11.370 1.00 14.94  ? 412  ILE A CB    1 
ATOM   778   C CG1   . ILE A 1 104 ? -2.222  48.251  -11.173 1.00 9.28   ? 412  ILE A CG1   1 
ATOM   779   C CG2   . ILE A 1 104 ? -0.627  50.105  -10.610 1.00 30.26  ? 412  ILE A CG2   1 
ATOM   780   C CD1   . ILE A 1 104 ? -2.375  47.416  -9.885  1.00 13.76  ? 412  ILE A CD1   1 
ATOM   781   N N     . GLN A 1 105 ? 1.914   49.216  -13.210 1.00 11.66  ? 413  GLN A N     1 
ATOM   782   C CA    . GLN A 1 105 ? 3.171   49.928  -13.473 1.00 15.45  ? 413  GLN A CA    1 
ATOM   783   C C     . GLN A 1 105 ? 3.163   50.514  -14.876 1.00 22.67  ? 413  GLN A C     1 
ATOM   784   O O     . GLN A 1 105 ? 3.602   51.647  -15.098 1.00 19.62  ? 413  GLN A O     1 
ATOM   785   C CB    . GLN A 1 105 ? 4.380   49.000  -13.301 1.00 19.60  ? 413  GLN A CB    1 
ATOM   786   C CG    . GLN A 1 105 ? 4.682   48.583  -11.874 1.00 18.39  ? 413  GLN A CG    1 
ATOM   787   C CD    . GLN A 1 105 ? 5.962   47.746  -11.758 1.00 29.54  ? 413  GLN A CD    1 
ATOM   788   O OE1   . GLN A 1 105 ? 6.315   46.992  -12.671 1.00 19.73  ? 413  GLN A OE1   1 
ATOM   789   N NE2   . GLN A 1 105 ? 6.658   47.877  -10.629 1.00 17.44  ? 413  GLN A NE2   1 
ATOM   790   N N     . ILE A 1 106 ? 2.642   49.738  -15.820 1.00 15.13  ? 414  ILE A N     1 
ATOM   791   C CA    . ILE A 1 106 ? 2.552   50.165  -17.209 1.00 20.26  ? 414  ILE A CA    1 
ATOM   792   C C     . ILE A 1 106 ? 1.511   51.273  -17.374 1.00 23.35  ? 414  ILE A C     1 
ATOM   793   O O     . ILE A 1 106 ? 1.731   52.230  -18.106 1.00 20.91  ? 414  ILE A O     1 
ATOM   794   C CB    . ILE A 1 106 ? 2.211   48.971  -18.127 1.00 24.27  ? 414  ILE A CB    1 
ATOM   795   C CG1   . ILE A 1 106 ? 3.405   48.000  -18.189 1.00 14.05  ? 414  ILE A CG1   1 
ATOM   796   C CG2   . ILE A 1 106 ? 1.807   49.461  -19.521 1.00 25.98  ? 414  ILE A CG2   1 
ATOM   797   C CD1   . ILE A 1 106 ? 3.081   46.653  -18.765 1.00 14.39  ? 414  ILE A CD1   1 
ATOM   798   N N     . ASN A 1 107 ? 0.379   51.134  -16.691 1.00 15.80  ? 415  ASN A N     1 
ATOM   799   C CA    . ASN A 1 107 ? -0.679  52.140  -16.731 1.00 25.29  ? 415  ASN A CA    1 
ATOM   800   C C     . ASN A 1 107 ? -1.287  52.345  -15.347 1.00 25.69  ? 415  ASN A C     1 
ATOM   801   O O     . ASN A 1 107 ? -2.165  51.588  -14.948 1.00 16.41  ? 415  ASN A O     1 
ATOM   802   C CB    . ASN A 1 107 ? -1.765  51.714  -17.714 1.00 26.37  ? 415  ASN A CB    1 
ATOM   803   C CG    . ASN A 1 107 ? -2.861  52.738  -17.851 1.00 28.48  ? 415  ASN A CG    1 
ATOM   804   O OD1   . ASN A 1 107 ? -2.808  53.810  -17.246 1.00 23.72  ? 415  ASN A OD1   1 
ATOM   805   N ND2   . ASN A 1 107 ? -3.862  52.422  -18.667 1.00 35.20  ? 415  ASN A ND2   1 
ATOM   806   N N     . PRO A 1 108 ? -0.804  53.359  -14.609 1.00 23.54  ? 416  PRO A N     1 
ATOM   807   C CA    . PRO A 1 108 ? -1.219  53.632  -13.225 1.00 30.11  ? 416  PRO A CA    1 
ATOM   808   C C     . PRO A 1 108 ? -2.683  54.058  -13.139 1.00 26.46  ? 416  PRO A C     1 
ATOM   809   O O     . PRO A 1 108 ? -3.261  54.074  -12.047 1.00 30.54  ? 416  PRO A O     1 
ATOM   810   C CB    . PRO A 1 108 ? -0.295  54.784  -12.800 1.00 30.84  ? 416  PRO A CB    1 
ATOM   811   C CG    . PRO A 1 108 ? 0.867   54.713  -13.750 1.00 26.73  ? 416  PRO A CG    1 
ATOM   812   C CD    . PRO A 1 108 ? 0.275   54.259  -15.046 1.00 19.84  ? 416  PRO A CD    1 
ATOM   813   N N     . ALA A 1 109 ? -3.273  54.355  -14.293 1.00 20.41  ? 417  ALA A N     1 
ATOM   814   C CA    . ALA A 1 109 ? -4.657  54.818  -14.384 1.00 19.82  ? 417  ALA A CA    1 
ATOM   815   C C     . ALA A 1 109 ? -5.601  53.674  -14.690 1.00 18.49  ? 417  ALA A C     1 
ATOM   816   O O     . ALA A 1 109 ? -6.767  53.892  -15.028 1.00 21.40  ? 417  ALA A O     1 
ATOM   817   C CB    . ALA A 1 109 ? -4.776  55.881  -15.468 1.00 21.99  ? 417  ALA A CB    1 
ATOM   818   N N     . PHE A 1 110 ? -5.091  52.449  -14.593 1.00 17.31  ? 418  PHE A N     1 
ATOM   819   C CA    . PHE A 1 110 ? -5.819  51.280  -15.069 1.00 17.96  ? 418  PHE A CA    1 
ATOM   820   C C     . PHE A 1 110 ? -6.664  50.744  -13.924 1.00 15.03  ? 418  PHE A C     1 
ATOM   821   O O     . PHE A 1 110 ? -6.175  49.959  -13.109 1.00 17.46  ? 418  PHE A O     1 
ATOM   822   C CB    . PHE A 1 110 ? -4.823  50.217  -15.557 1.00 22.43  ? 418  PHE A CB    1 
ATOM   823   C CG    . PHE A 1 110 ? -5.452  49.046  -16.291 1.00 26.16  ? 418  PHE A CG    1 
ATOM   824   C CD1   . PHE A 1 110 ? -6.768  49.081  -16.710 1.00 22.85  ? 418  PHE A CD1   1 
ATOM   825   C CD2   . PHE A 1 110 ? -4.702  47.908  -16.556 1.00 26.35  ? 418  PHE A CD2   1 
ATOM   826   C CE1   . PHE A 1 110 ? -7.325  48.007  -17.383 1.00 31.65  ? 418  PHE A CE1   1 
ATOM   827   C CE2   . PHE A 1 110 ? -5.254  46.835  -17.226 1.00 21.14  ? 418  PHE A CE2   1 
ATOM   828   C CZ    . PHE A 1 110 ? -6.573  46.886  -17.639 1.00 23.84  ? 418  PHE A CZ    1 
ATOM   829   N N     . ALA A 1 111 ? -7.927  51.178  -13.884 1.00 15.85  ? 419  ALA A N     1 
ATOM   830   C CA    . ALA A 1 111 ? -8.855  50.897  -12.782 1.00 22.25  ? 419  ALA A CA    1 
ATOM   831   C C     . ALA A 1 111 ? -9.052  49.398  -12.552 1.00 23.78  ? 419  ALA A C     1 
ATOM   832   O O     . ALA A 1 111 ? -8.963  48.912  -11.414 1.00 19.11  ? 419  ALA A O     1 
ATOM   833   C CB    . ALA A 1 111 ? -10.216 51.592  -13.052 1.00 22.59  ? 419  ALA A CB    1 
ATOM   834   N N     . ASP A 1 112 ? -9.296  48.663  -13.633 1.00 17.60  ? 420  ASP A N     1 
ATOM   835   C CA    . ASP A 1 112 ? -9.481  47.208  -13.543 1.00 21.18  ? 420  ASP A CA    1 
ATOM   836   C C     . ASP A 1 112 ? -8.331  46.467  -12.847 1.00 12.74  ? 420  ASP A C     1 
ATOM   837   O O     . ASP A 1 112 ? -8.562  45.558  -12.037 1.00 10.40  ? 420  ASP A O     1 
ATOM   838   C CB    . ASP A 1 112 ? -9.722  46.593  -14.923 1.00 27.73  ? 420  ASP A CB    1 
ATOM   839   C CG    . ASP A 1 112 ? -11.052 46.999  -15.521 1.00 40.28  ? 420  ASP A CG    1 
ATOM   840   O OD1   . ASP A 1 112 ? -11.839 47.677  -14.827 1.00 34.60  ? 420  ASP A OD1   1 
ATOM   841   O OD2   . ASP A 1 112 ? -11.310 46.627  -16.684 1.00 40.91  ? 420  ASP A OD2   1 
ATOM   842   N N     . ALA A 1 113 ? -7.097  46.843  -13.160 1.00 11.28  ? 421  ALA A N     1 
ATOM   843   C CA    . ALA A 1 113 ? -5.953  46.128  -12.614 1.00 16.36  ? 421  ALA A CA    1 
ATOM   844   C C     . ALA A 1 113 ? -5.836  46.321  -11.109 1.00 20.78  ? 421  ALA A C     1 
ATOM   845   O O     . ALA A 1 113 ? -5.396  45.411  -10.392 1.00 12.94  ? 421  ALA A O     1 
ATOM   846   C CB    . ALA A 1 113 ? -4.660  46.529  -13.329 1.00 11.82  ? 421  ALA A CB    1 
ATOM   847   N N     . HIS A 1 114 ? -6.208  47.503  -10.630 1.00 18.30  ? 422  HIS A N     1 
ATOM   848   C CA    . HIS A 1 114 ? -6.195  47.769  -9.192  1.00 23.50  ? 422  HIS A CA    1 
ATOM   849   C C     . HIS A 1 114 ? -7.237  46.913  -8.478  1.00 15.59  ? 422  HIS A C     1 
ATOM   850   O O     . HIS A 1 114 ? -7.006  46.402  -7.384  1.00 15.65  ? 422  HIS A O     1 
ATOM   851   C CB    . HIS A 1 114 ? -6.462  49.249  -8.908  1.00 20.45  ? 422  HIS A CB    1 
ATOM   852   C CG    . HIS A 1 114 ? -5.299  50.143  -9.206  1.00 18.83  ? 422  HIS A CG    1 
ATOM   853   N ND1   . HIS A 1 114 ? -4.228  50.272  -8.351  1.00 17.68  ? 422  HIS A ND1   1 
ATOM   854   C CD2   . HIS A 1 114 ? -5.032  50.941  -10.266 1.00 15.30  ? 422  HIS A CD2   1 
ATOM   855   C CE1   . HIS A 1 114 ? -3.360  51.128  -8.861  1.00 11.52  ? 422  HIS A CE1   1 
ATOM   856   N NE2   . HIS A 1 114 ? -3.822  51.544  -10.023 1.00 15.37  ? 422  HIS A NE2   1 
ATOM   857   N N     . SER A 1 115 ? -8.390  46.785  -9.109  1.00 9.12   ? 423  SER A N     1 
ATOM   858   C CA    . SER A 1 115 ? -9.502  45.987  -8.595  1.00 11.00  ? 423  SER A CA    1 
ATOM   859   C C     . SER A 1 115 ? -9.124  44.504  -8.553  1.00 12.73  ? 423  SER A C     1 
ATOM   860   O O     . SER A 1 115 ? -9.417  43.795  -7.590  1.00 12.53  ? 423  SER A O     1 
ATOM   861   C CB    . SER A 1 115 ? -10.731 46.211  -9.509  1.00 14.10  ? 423  SER A CB    1 
ATOM   862   O OG    . SER A 1 115 ? -11.904 45.630  -8.973  1.00 16.85  ? 423  SER A OG    1 
ATOM   863   N N     . ASN A 1 116 ? -8.470  44.035  -9.607  1.00 9.08   ? 424  ASN A N     1 
ATOM   864   C CA    . ASN A 1 116 ? -7.983  42.665  -9.651  1.00 10.24  ? 424  ASN A CA    1 
ATOM   865   C C     . ASN A 1 116 ? -6.917  42.442  -8.586  1.00 10.37  ? 424  ASN A C     1 
ATOM   866   O O     . ASN A 1 116 ? -6.914  41.414  -7.904  1.00 10.36  ? 424  ASN A O     1 
ATOM   867   C CB    . ASN A 1 116 ? -7.428  42.331  -11.046 1.00 16.78  ? 424  ASN A CB    1 
ATOM   868   C CG    . ASN A 1 116 ? -8.509  42.309  -12.109 1.00 25.82  ? 424  ASN A CG    1 
ATOM   869   O OD1   . ASN A 1 116 ? -9.671  42.024  -11.818 1.00 23.66  ? 424  ASN A OD1   1 
ATOM   870   N ND2   . ASN A 1 116 ? -8.137  42.614  -13.341 1.00 15.40  ? 424  ASN A ND2   1 
ATOM   871   N N     . LEU A 1 117 ? -6.033  43.415  -8.411  1.00 9.37   ? 425  LEU A N     1 
ATOM   872   C CA    . LEU A 1 117 ? -5.024  43.299  -7.348  1.00 15.16  ? 425  LEU A CA    1 
ATOM   873   C C     . LEU A 1 117 ? -5.683  43.301  -5.986  1.00 18.80  ? 425  LEU A C     1 
ATOM   874   O O     . LEU A 1 117 ? -5.279  42.559  -5.090  1.00 10.20  ? 425  LEU A O     1 
ATOM   875   C CB    . LEU A 1 117 ? -4.020  44.430  -7.405  1.00 12.00  ? 425  LEU A CB    1 
ATOM   876   C CG    . LEU A 1 117 ? -2.878  44.384  -6.381  1.00 19.99  ? 425  LEU A CG    1 
ATOM   877   C CD1   . LEU A 1 117 ? -2.115  43.079  -6.488  1.00 17.25  ? 425  LEU A CD1   1 
ATOM   878   C CD2   . LEU A 1 117 ? -1.957  45.562  -6.635  1.00 18.41  ? 425  LEU A CD2   1 
ATOM   879   N N     . ALA A 1 118 ? -6.681  44.162  -5.824  1.00 7.67   ? 426  ALA A N     1 
ATOM   880   C CA    . ALA A 1 118 ? -7.462  44.191  -4.585  1.00 14.87  ? 426  ALA A CA    1 
ATOM   881   C C     . ALA A 1 118 ? -8.058  42.818  -4.316  1.00 21.18  ? 426  ALA A C     1 
ATOM   882   O O     . ALA A 1 118 ? -8.050  42.337  -3.179  1.00 14.49  ? 426  ALA A O     1 
ATOM   883   C CB    . ALA A 1 118 ? -8.573  45.225  -4.679  1.00 10.17  ? 426  ALA A CB    1 
ATOM   884   N N     . SER A 1 119 ? -8.585  42.186  -5.361  1.00 13.68  ? 427  SER A N     1 
ATOM   885   C CA    . SER A 1 119 ? -9.158  40.847  -5.199  1.00 15.21  ? 427  SER A CA    1 
ATOM   886   C C     . SER A 1 119 ? -8.156  39.783  -4.685  1.00 15.40  ? 427  SER A C     1 
ATOM   887   O O     . SER A 1 119 ? -8.542  38.887  -3.920  1.00 18.67  ? 427  SER A O     1 
ATOM   888   C CB    . SER A 1 119 ? -9.830  40.383  -6.490  1.00 27.47  ? 427  SER A CB    1 
ATOM   889   O OG    . SER A 1 119 ? -10.743 41.366  -6.946  1.00 42.81  ? 427  SER A OG    1 
ATOM   890   N N     . ILE A 1 120 ? -6.888  39.887  -5.088  1.00 15.62  ? 428  ILE A N     1 
ATOM   891   C CA    . ILE A 1 120 ? -5.836  38.988  -4.593  1.00 12.88  ? 428  ILE A CA    1 
ATOM   892   C C     . ILE A 1 120 ? -5.604  39.236  -3.118  1.00 10.87  ? 428  ILE A C     1 
ATOM   893   O O     . ILE A 1 120 ? -5.438  38.294  -2.320  1.00 15.04  ? 428  ILE A O     1 
ATOM   894   C CB    . ILE A 1 120 ? -4.462  39.177  -5.320  1.00 9.24   ? 428  ILE A CB    1 
ATOM   895   C CG1   . ILE A 1 120 ? -4.586  38.884  -6.802  1.00 19.79  ? 428  ILE A CG1   1 
ATOM   896   C CG2   . ILE A 1 120 ? -3.427  38.215  -4.724  1.00 17.38  ? 428  ILE A CG2   1 
ATOM   897   C CD1   . ILE A 1 120 ? -4.966  37.443  -7.106  1.00 32.23  ? 428  ILE A CD1   1 
ATOM   898   N N     . HIS A 1 121 ? -5.574  40.507  -2.739  1.00 15.74  ? 429  HIS A N     1 
ATOM   899   C CA    . HIS A 1 121 ? -5.386  40.844  -1.330  1.00 17.89  ? 429  HIS A CA    1 
ATOM   900   C C     . HIS A 1 121 ? -6.576  40.293  -0.537  1.00 20.12  ? 429  HIS A C     1 
ATOM   901   O O     . HIS A 1 121 ? -6.408  39.612  0.489   1.00 19.58  ? 429  HIS A O     1 
ATOM   902   C CB    . HIS A 1 121 ? -5.208  42.363  -1.133  1.00 12.46  ? 429  HIS A CB    1 
ATOM   903   C CG    . HIS A 1 121 ? -3.915  42.903  -1.683  1.00 15.19  ? 429  HIS A CG    1 
ATOM   904   N ND1   . HIS A 1 121 ? -2.698  42.295  -1.458  1.00 29.67  ? 429  HIS A ND1   1 
ATOM   905   C CD2   . HIS A 1 121 ? -3.651  43.991  -2.448  1.00 28.68  ? 429  HIS A CD2   1 
ATOM   906   C CE1   . HIS A 1 121 ? -1.742  42.983  -2.059  1.00 28.89  ? 429  HIS A CE1   1 
ATOM   907   N NE2   . HIS A 1 121 ? -2.292  44.017  -2.669  1.00 15.70  ? 429  HIS A NE2   1 
ATOM   908   N N     . LYS A 1 122 ? -7.778  40.552  -1.042  1.00 14.87  ? 430  LYS A N     1 
ATOM   909   C CA    . LYS A 1 122 ? -9.000  40.051  -0.399  1.00 12.82  ? 430  LYS A CA    1 
ATOM   910   C C     . LYS A 1 122 ? -8.942  38.540  -0.212  1.00 17.29  ? 430  LYS A C     1 
ATOM   911   O O     . LYS A 1 122 ? -9.106  38.025  0.903   1.00 20.22  ? 430  LYS A O     1 
ATOM   912   C CB    . LYS A 1 122 ? -10.243 40.438  -1.217  1.00 13.04  ? 430  LYS A CB    1 
ATOM   913   C CG    . LYS A 1 122 ? -11.582 40.093  -0.534  1.00 26.12  ? 430  LYS A CG    1 
ATOM   914   C CD    . LYS A 1 122 ? -12.764 40.641  -1.326  1.00 24.75  ? 430  LYS A CD    1 
ATOM   915   C CE    . LYS A 1 122 ? -14.065 40.616  -0.521  1.00 20.53  ? 430  LYS A CE    1 
ATOM   916   N NZ    . LYS A 1 122 ? -14.605 39.244  -0.223  1.00 11.01  ? 430  LYS A NZ    1 
ATOM   917   N N     . ASP A 1 123 ? -8.708  37.828  -1.302  1.00 15.89  ? 431  ASP A N     1 
ATOM   918   C CA    . ASP A 1 123 ? -8.772  36.370  -1.285  1.00 15.72  ? 431  ASP A CA    1 
ATOM   919   C C     . ASP A 1 123 ? -7.674  35.798  -0.413  1.00 31.92  ? 431  ASP A C     1 
ATOM   920   O O     . ASP A 1 123 ? -7.765  34.665  0.061   1.00 39.35  ? 431  ASP A O     1 
ATOM   921   C CB    . ASP A 1 123 ? -8.697  35.796  -2.706  1.00 21.78  ? 431  ASP A CB    1 
ATOM   922   C CG    . ASP A 1 123 ? -9.976  36.019  -3.490  1.00 47.01  ? 431  ASP A CG    1 
ATOM   923   O OD1   . ASP A 1 123 ? -11.049 36.134  -2.860  1.00 43.34  ? 431  ASP A OD1   1 
ATOM   924   O OD2   . ASP A 1 123 ? -9.910  36.076  -4.736  1.00 62.00  ? 431  ASP A OD2   1 
ATOM   925   N N     . SER A 1 124 ? -6.644  36.600  -0.185  1.00 30.28  ? 432  SER A N     1 
ATOM   926   C CA    . SER A 1 124 ? -5.546  36.208  0.682   1.00 35.60  ? 432  SER A CA    1 
ATOM   927   C C     . SER A 1 124 ? -5.787  36.631  2.132   1.00 39.53  ? 432  SER A C     1 
ATOM   928   O O     . SER A 1 124 ? -4.925  36.438  2.988   1.00 35.60  ? 432  SER A O     1 
ATOM   929   C CB    . SER A 1 124 ? -4.240  36.810  0.165   1.00 37.37  ? 432  SER A CB    1 
ATOM   930   O OG    . SER A 1 124 ? -3.939  36.291  -1.118  1.00 29.64  ? 432  SER A OG    1 
ATOM   931   N N     . GLY A 1 125 ? -6.953  37.216  2.401   1.00 25.61  ? 433  GLY A N     1 
ATOM   932   C CA    . GLY A 1 125 ? -7.312  37.624  3.752   1.00 35.93  ? 433  GLY A CA    1 
ATOM   933   C C     . GLY A 1 125 ? -6.844  39.008  4.188   1.00 39.68  ? 433  GLY A C     1 
ATOM   934   O O     . GLY A 1 125 ? -7.238  39.489  5.250   1.00 50.50  ? 433  GLY A O     1 
ATOM   935   N N     . ASN A 1 126 ? -6.009  39.650  3.372   1.00 23.19  ? 434  ASN A N     1 
ATOM   936   C CA    . ASN A 1 126 ? -5.460  40.969  3.686   1.00 24.36  ? 434  ASN A CA    1 
ATOM   937   C C     . ASN A 1 126 ? -6.433  42.088  3.335   1.00 30.01  ? 434  ASN A C     1 
ATOM   938   O O     . ASN A 1 126 ? -6.247  42.809  2.355   1.00 13.54  ? 434  ASN A O     1 
ATOM   939   C CB    . ASN A 1 126 ? -4.154  41.174  2.921   1.00 30.78  ? 434  ASN A CB    1 
ATOM   940   C CG    . ASN A 1 126 ? -3.427  42.425  3.337   1.00 19.30  ? 434  ASN A CG    1 
ATOM   941   O OD1   . ASN A 1 126 ? -4.013  43.334  3.931   1.00 23.96  ? 434  ASN A OD1   1 
ATOM   942   N ND2   . ASN A 1 126 ? -2.141  42.494  3.007   1.00 22.62  ? 434  ASN A ND2   1 
ATOM   943   N N     . ILE A 1 127 ? -7.465  42.240  4.152   1.00 32.44  ? 435  ILE A N     1 
ATOM   944   C CA    . ILE A 1 127 ? -8.577  43.102  3.796   1.00 11.95  ? 435  ILE A CA    1 
ATOM   945   C C     . ILE A 1 127 ? -8.261  44.590  3.673   1.00 10.21  ? 435  ILE A C     1 
ATOM   946   O O     . ILE A 1 127 ? -8.792  45.247  2.786   1.00 19.53  ? 435  ILE A O     1 
ATOM   947   C CB    . ILE A 1 127 ? -9.776  42.928  4.764   1.00 13.93  ? 435  ILE A CB    1 
ATOM   948   C CG1   . ILE A 1 127 ? -10.201 41.465  4.853   1.00 11.38  ? 435  ILE A CG1   1 
ATOM   949   C CG2   . ILE A 1 127 ? -10.941 43.821  4.342   1.00 21.99  ? 435  ILE A CG2   1 
ATOM   950   C CD1   . ILE A 1 127 ? -10.573 40.820  3.553   1.00 19.58  ? 435  ILE A CD1   1 
ATOM   951   N N     . PRO A 1 128 ? -7.438  45.143  4.592   1.00 21.00  ? 436  PRO A N     1 
ATOM   952   C CA    . PRO A 1 128 ? -7.090  46.568  4.494   1.00 24.80  ? 436  PRO A CA    1 
ATOM   953   C C     . PRO A 1 128 ? -6.354  46.940  3.208   1.00 5.72   ? 436  PRO A C     1 
ATOM   954   O O     . PRO A 1 128 ? -6.615  48.001  2.694   1.00 12.79  ? 436  PRO A O     1 
ATOM   955   C CB    . PRO A 1 128 ? -6.192  46.798  5.716   1.00 24.92  ? 436  PRO A CB    1 
ATOM   956   C CG    . PRO A 1 128 ? -6.659  45.774  6.697   1.00 25.98  ? 436  PRO A CG    1 
ATOM   957   C CD    . PRO A 1 128 ? -6.954  44.553  5.854   1.00 23.23  ? 436  PRO A CD    1 
ATOM   958   N N     . GLU A 1 129 ? -5.446  46.101  2.721   1.00 20.19  ? 437  GLU A N     1 
ATOM   959   C CA    . GLU A 1 129 ? -4.812  46.367  1.439   1.00 18.53  ? 437  GLU A CA    1 
ATOM   960   C C     . GLU A 1 129 ? -5.821  46.156  0.317   1.00 16.93  ? 437  GLU A C     1 
ATOM   961   O O     . GLU A 1 129 ? -5.787  46.858  -0.693  1.00 18.22  ? 437  GLU A O     1 
ATOM   962   C CB    . GLU A 1 129 ? -3.581  45.478  1.223   1.00 24.49  ? 437  GLU A CB    1 
ATOM   963   C CG    . GLU A 1 129 ? -2.402  45.805  2.148   1.00 47.59  ? 437  GLU A CG    1 
ATOM   964   C CD    . GLU A 1 129 ? -1.614  47.049  1.745   1.00 42.28  ? 437  GLU A CD    1 
ATOM   965   O OE1   . GLU A 1 129 ? -0.435  47.156  2.156   1.00 28.98  ? 437  GLU A OE1   1 
ATOM   966   O OE2   . GLU A 1 129 ? -2.162  47.921  1.030   1.00 41.81  ? 437  GLU A OE2   1 
ATOM   967   N N     . ALA A 1 130 ? -6.732  45.204  0.502   1.00 19.47  ? 438  ALA A N     1 
ATOM   968   C CA    . ALA A 1 130 ? -7.827  45.014  -0.449  1.00 14.23  ? 438  ALA A CA    1 
ATOM   969   C C     . ALA A 1 130 ? -8.695  46.259  -0.508  1.00 27.39  ? 438  ALA A C     1 
ATOM   970   O O     . ALA A 1 130 ? -8.994  46.771  -1.577  1.00 12.48  ? 438  ALA A O     1 
ATOM   971   C CB    . ALA A 1 130 ? -8.651  43.812  -0.064  1.00 11.90  ? 438  ALA A CB    1 
ATOM   972   N N     . ILE A 1 131 ? -9.092  46.752  0.657   1.00 18.30  ? 439  ILE A N     1 
ATOM   973   C CA    . ILE A 1 131 ? -9.835  47.994  0.729   1.00 28.24  ? 439  ILE A CA    1 
ATOM   974   C C     . ILE A 1 131 ? -9.082  49.155  0.073   1.00 22.00  ? 439  ILE A C     1 
ATOM   975   O O     . ILE A 1 131 ? -9.689  49.949  -0.610  1.00 14.34  ? 439  ILE A O     1 
ATOM   976   C CB    . ILE A 1 131 ? -10.229 48.330  2.183   1.00 22.42  ? 439  ILE A CB    1 
ATOM   977   C CG1   . ILE A 1 131 ? -11.306 47.358  2.665   1.00 12.51  ? 439  ILE A CG1   1 
ATOM   978   C CG2   . ILE A 1 131 ? -10.728 49.768  2.304   1.00 17.96  ? 439  ILE A CG2   1 
ATOM   979   C CD1   . ILE A 1 131 ? -11.417 47.309  4.217   1.00 7.86   ? 439  ILE A CD1   1 
ATOM   980   N N     . ALA A 1 132 ? -7.761  49.218  0.234   1.00 15.75  ? 440  ALA A N     1 
ATOM   981   C CA    . ALA A 1 132 ? -6.987  50.320  -0.340  1.00 14.76  ? 440  ALA A CA    1 
ATOM   982   C C     . ALA A 1 132 ? -6.988  50.326  -1.865  1.00 10.87  ? 440  ALA A C     1 
ATOM   983   O O     . ALA A 1 132 ? -7.188  51.369  -2.508  1.00 11.97  ? 440  ALA A O     1 
ATOM   984   C CB    . ALA A 1 132 ? -5.562  50.298  0.193   1.00 21.98  ? 440  ALA A CB    1 
ATOM   985   N N     . SER A 1 133 ? -6.750  49.156  -2.440  1.00 10.50  ? 441  SER A N     1 
ATOM   986   C CA    . SER A 1 133 ? -6.726  48.999  -3.887  1.00 19.27  ? 441  SER A CA    1 
ATOM   987   C C     . SER A 1 133 ? -8.103  49.206  -4.552  1.00 13.57  ? 441  SER A C     1 
ATOM   988   O O     . SER A 1 133 ? -8.168  49.796  -5.617  1.00 14.34  ? 441  SER A O     1 
ATOM   989   C CB    . SER A 1 133 ? -6.124  47.643  -4.260  1.00 10.93  ? 441  SER A CB    1 
ATOM   990   O OG    . SER A 1 133 ? -4.715  47.634  -4.021  1.00 22.28  ? 441  SER A OG    1 
ATOM   991   N N     . TYR A 1 134 ? -9.193  48.726  -3.940  1.00 9.12   ? 442  TYR A N     1 
ATOM   992   C CA    . TYR A 1 134 ? -10.543 49.007  -4.467  1.00 15.93  ? 442  TYR A CA    1 
ATOM   993   C C     . TYR A 1 134 ? -10.870 50.489  -4.488  1.00 14.72  ? 442  TYR A C     1 
ATOM   994   O O     . TYR A 1 134 ? -11.447 50.988  -5.455  1.00 16.33  ? 442  TYR A O     1 
ATOM   995   C CB    . TYR A 1 134 ? -11.635 48.296  -3.659  1.00 22.22  ? 442  TYR A CB    1 
ATOM   996   C CG    . TYR A 1 134 ? -11.770 46.838  -3.980  1.00 13.63  ? 442  TYR A CG    1 
ATOM   997   C CD1   . TYR A 1 134 ? -11.861 46.402  -5.288  1.00 12.57  ? 442  TYR A CD1   1 
ATOM   998   C CD2   . TYR A 1 134 ? -11.762 45.890  -2.960  1.00 14.18  ? 442  TYR A CD2   1 
ATOM   999   C CE1   . TYR A 1 134 ? -11.974 45.046  -5.582  1.00 15.07  ? 442  TYR A CE1   1 
ATOM   1000  C CE2   . TYR A 1 134 ? -11.865 44.558  -3.230  1.00 13.32  ? 442  TYR A CE2   1 
ATOM   1001  C CZ    . TYR A 1 134 ? -11.965 44.130  -4.539  1.00 12.08  ? 442  TYR A CZ    1 
ATOM   1002  O OH    . TYR A 1 134 ? -12.048 42.784  -4.793  1.00 15.32  ? 442  TYR A OH    1 
ATOM   1003  N N     . ARG A 1 135 ? -10.509 51.197  -3.421  1.00 12.64  ? 443  ARG A N     1 
ATOM   1004  C CA    . ARG A 1 135 ? -10.735 52.651  -3.366  1.00 7.47   ? 443  ARG A CA    1 
ATOM   1005  C C     . ARG A 1 135 ? -9.946  53.353  -4.466  1.00 12.52  ? 443  ARG A C     1 
ATOM   1006  O O     . ARG A 1 135 ? -10.446 54.278  -5.108  1.00 18.78  ? 443  ARG A O     1 
ATOM   1007  C CB    . ARG A 1 135 ? -10.327 53.201  -1.990  1.00 18.56  ? 443  ARG A CB    1 
ATOM   1008  C CG    . ARG A 1 135 ? -11.323 52.937  -0.869  1.00 29.56  ? 443  ARG A CG    1 
ATOM   1009  C CD    . ARG A 1 135 ? -10.787 53.503  0.440   1.00 36.61  ? 443  ARG A CD    1 
ATOM   1010  N NE    . ARG A 1 135 ? -11.435 52.950  1.623   1.00 39.69  ? 443  ARG A NE    1 
ATOM   1011  C CZ    . ARG A 1 135 ? -12.691 53.202  1.950   1.00 29.63  ? 443  ARG A CZ    1 
ATOM   1012  N NH1   . ARG A 1 135 ? -13.414 53.994  1.169   1.00 55.15  ? 443  ARG A NH1   1 
ATOM   1013  N NH2   . ARG A 1 135 ? -13.221 52.681  3.045   1.00 31.79  ? 443  ARG A NH2   1 
ATOM   1014  N N     . THR A 1 136 ? -8.710  52.915  -4.700  1.00 30.09  ? 444  THR A N     1 
ATOM   1015  C CA    . THR A 1 136 ? -7.936  53.469  -5.810  1.00 22.53  ? 444  THR A CA    1 
ATOM   1016  C C     . THR A 1 136 ? -8.683  53.208  -7.136  1.00 16.05  ? 444  THR A C     1 
ATOM   1017  O O     . THR A 1 136 ? -8.849  54.107  -7.938  1.00 16.73  ? 444  THR A O     1 
ATOM   1018  C CB    . THR A 1 136 ? -6.494  52.906  -5.868  1.00 18.66  ? 444  THR A CB    1 
ATOM   1019  O OG1   . THR A 1 136 ? -5.747  53.341  -4.721  1.00 10.19  ? 444  THR A OG1   1 
ATOM   1020  C CG2   . THR A 1 136 ? -5.773  53.373  -7.127  1.00 18.48  ? 444  THR A CG2   1 
ATOM   1021  N N     . ALA A 1 137 ? -9.155  51.982  -7.344  1.00 15.37  ? 445  ALA A N     1 
ATOM   1022  C CA    . ALA A 1 137 ? -9.917  51.655  -8.557  1.00 15.37  ? 445  ALA A CA    1 
ATOM   1023  C C     . ALA A 1 137 ? -11.081 52.609  -8.754  1.00 17.40  ? 445  ALA A C     1 
ATOM   1024  O O     . ALA A 1 137 ? -11.319 53.094  -9.854  1.00 19.69  ? 445  ALA A O     1 
ATOM   1025  C CB    . ALA A 1 137 ? -10.445 50.218  -8.506  1.00 13.34  ? 445  ALA A CB    1 
ATOM   1026  N N     . LEU A 1 138 ? -11.822 52.825  -7.673  1.00 17.31  ? 446  LEU A N     1 
ATOM   1027  C CA    . LEU A 1 138 ? -13.001 53.664  -7.669  1.00 17.76  ? 446  LEU A CA    1 
ATOM   1028  C C     . LEU A 1 138 ? -12.640 55.157  -7.773  1.00 24.55  ? 446  LEU A C     1 
ATOM   1029  O O     . LEU A 1 138 ? -13.445 55.964  -8.226  1.00 20.19  ? 446  LEU A O     1 
ATOM   1030  C CB    . LEU A 1 138 ? -13.832 53.372  -6.412  1.00 12.83  ? 446  LEU A CB    1 
ATOM   1031  C CG    . LEU A 1 138 ? -14.554 52.011  -6.412  1.00 16.23  ? 446  LEU A CG    1 
ATOM   1032  C CD1   . LEU A 1 138 ? -14.953 51.582  -5.004  1.00 18.66  ? 446  LEU A CD1   1 
ATOM   1033  C CD2   . LEU A 1 138 ? -15.778 52.049  -7.347  1.00 20.01  ? 446  LEU A CD2   1 
ATOM   1034  N N     . LYS A 1 139 ? -11.429 55.513  -7.355  1.00 24.30  ? 447  LYS A N     1 
ATOM   1035  C CA    . LYS A 1 139 ? -10.913 56.866  -7.564  1.00 24.86  ? 447  LYS A CA    1 
ATOM   1036  C C     . LYS A 1 139 ? -10.765 57.080  -9.073  1.00 22.33  ? 447  LYS A C     1 
ATOM   1037  O O     . LYS A 1 139 ? -11.263 58.058  -9.633  1.00 23.46  ? 447  LYS A O     1 
ATOM   1038  C CB    . LYS A 1 139 ? -9.563  57.046  -6.843  1.00 19.27  ? 447  LYS A CB    1 
ATOM   1039  C CG    . LYS A 1 139 ? -9.113  58.501  -6.747  1.00 44.50  ? 447  LYS A CG    1 
ATOM   1040  C CD    . LYS A 1 139 ? -7.934  58.671  -5.805  1.00 50.28  ? 447  LYS A CD    1 
ATOM   1041  C CE    . LYS A 1 139 ? -7.547  60.141  -5.679  1.00 66.38  ? 447  LYS A CE    1 
ATOM   1042  N NZ    . LYS A 1 139 ? -6.403  60.354  -4.746  1.00 68.74  ? 447  LYS A NZ    1 
ATOM   1043  N N     . LEU A 1 140 ? -10.093 56.129  -9.719  1.00 23.67  ? 448  LEU A N     1 
ATOM   1044  C CA    . LEU A 1 140 ? -9.890  56.106  -11.170 1.00 23.46  ? 448  LEU A CA    1 
ATOM   1045  C C     . LEU A 1 140 ? -11.169 55.985  -11.988 1.00 26.67  ? 448  LEU A C     1 
ATOM   1046  O O     . LEU A 1 140 ? -11.307 56.619  -13.033 1.00 22.06  ? 448  LEU A O     1 
ATOM   1047  C CB    . LEU A 1 140 ? -8.967  54.937  -11.533 1.00 12.93  ? 448  LEU A CB    1 
ATOM   1048  C CG    . LEU A 1 140 ? -7.512  55.143  -11.119 1.00 21.18  ? 448  LEU A CG    1 
ATOM   1049  C CD1   . LEU A 1 140 ? -6.694  53.847  -11.185 1.00 17.47  ? 448  LEU A CD1   1 
ATOM   1050  C CD2   . LEU A 1 140 ? -6.913  56.209  -12.006 1.00 14.84  ? 448  LEU A CD2   1 
ATOM   1051  N N     . LYS A 1 141 ? -12.094 55.146  -11.529 1.00 19.48  ? 449  LYS A N     1 
ATOM   1052  C CA    . LYS A 1 141 ? -13.323 54.883  -12.266 1.00 27.66  ? 449  LYS A CA    1 
ATOM   1053  C C     . LYS A 1 141 ? -14.511 54.797  -11.306 1.00 24.85  ? 449  LYS A C     1 
ATOM   1054  O O     . LYS A 1 141 ? -14.846 53.707  -10.820 1.00 20.38  ? 449  LYS A O     1 
ATOM   1055  C CB    . LYS A 1 141 ? -13.196 53.584  -13.068 1.00 26.76  ? 449  LYS A CB    1 
ATOM   1056  C CG    . LYS A 1 141 ? -14.371 53.333  -14.008 1.00 29.90  ? 449  LYS A CG    1 
ATOM   1057  C CD    . LYS A 1 141 ? -13.977 52.411  -15.149 1.00 26.88  ? 449  LYS A CD    1 
ATOM   1058  C CE    . LYS A 1 141 ? -14.054 50.950  -14.767 1.00 20.49  ? 449  LYS A CE    1 
ATOM   1059  N NZ    . LYS A 1 141 ? -13.253 50.097  -15.718 1.00 16.10  ? 449  LYS A NZ    1 
ATOM   1060  N N     . PRO A 1 142 ? -15.137 55.953  -11.022 1.00 25.28  ? 450  PRO A N     1 
ATOM   1061  C CA    . PRO A 1 142 ? -16.234 56.108  -10.062 1.00 20.05  ? 450  PRO A CA    1 
ATOM   1062  C C     . PRO A 1 142 ? -17.374 55.126  -10.312 1.00 20.94  ? 450  PRO A C     1 
ATOM   1063  O O     . PRO A 1 142 ? -17.965 54.622  -9.363  1.00 18.31  ? 450  PRO A O     1 
ATOM   1064  C CB    . PRO A 1 142 ? -16.725 57.536  -10.327 1.00 31.19  ? 450  PRO A CB    1 
ATOM   1065  C CG    . PRO A 1 142 ? -15.513 58.254  -10.813 1.00 37.48  ? 450  PRO A CG    1 
ATOM   1066  C CD    . PRO A 1 142 ? -14.751 57.243  -11.628 1.00 38.02  ? 450  PRO A CD    1 
ATOM   1067  N N     . ASP A 1 143 ? -17.676 54.884  -11.582 1.00 20.46  ? 451  ASP A N     1 
ATOM   1068  C CA    . ASP A 1 143 ? -18.708 53.940  -11.978 1.00 16.60  ? 451  ASP A CA    1 
ATOM   1069  C C     . ASP A 1 143 ? -18.087 52.569  -12.265 1.00 15.01  ? 451  ASP A C     1 
ATOM   1070  O O     . ASP A 1 143 ? -17.648 52.287  -13.380 1.00 15.14  ? 451  ASP A O     1 
ATOM   1071  C CB    . ASP A 1 143 ? -19.452 54.469  -13.209 1.00 22.86  ? 451  ASP A CB    1 
ATOM   1072  C CG    . ASP A 1 143 ? -20.817 53.860  -13.371 1.00 26.78  ? 451  ASP A CG    1 
ATOM   1073  O OD1   . ASP A 1 143 ? -20.988 52.657  -13.065 1.00 32.30  ? 451  ASP A OD1   1 
ATOM   1074  O OD2   . ASP A 1 143 ? -21.732 54.589  -13.805 1.00 50.09  ? 451  ASP A OD2   1 
ATOM   1075  N N     . PHE A 1 144 ? -18.042 51.725  -11.241 1.00 16.87  ? 452  PHE A N     1 
ATOM   1076  C CA    . PHE A 1 144 ? -17.327 50.454  -11.332 1.00 17.81  ? 452  PHE A CA    1 
ATOM   1077  C C     . PHE A 1 144 ? -17.979 49.426  -10.406 1.00 21.70  ? 452  PHE A C     1 
ATOM   1078  O O     . PHE A 1 144 ? -17.510 49.195  -9.300  1.00 17.67  ? 452  PHE A O     1 
ATOM   1079  C CB    . PHE A 1 144 ? -15.863 50.676  -10.943 1.00 16.69  ? 452  PHE A CB    1 
ATOM   1080  C CG    . PHE A 1 144 ? -14.935 49.562  -11.347 1.00 14.67  ? 452  PHE A CG    1 
ATOM   1081  C CD1   . PHE A 1 144 ? -15.419 48.374  -11.860 1.00 19.27  ? 452  PHE A CD1   1 
ATOM   1082  C CD2   . PHE A 1 144 ? -13.577 49.724  -11.227 1.00 13.14  ? 452  PHE A CD2   1 
ATOM   1083  C CE1   . PHE A 1 144 ? -14.556 47.360  -12.232 1.00 15.32  ? 452  PHE A CE1   1 
ATOM   1084  C CE2   . PHE A 1 144 ? -12.700 48.715  -11.599 1.00 25.11  ? 452  PHE A CE2   1 
ATOM   1085  C CZ    . PHE A 1 144 ? -13.195 47.529  -12.103 1.00 24.19  ? 452  PHE A CZ    1 
ATOM   1086  N N     . PRO A 1 145 ? -19.072 48.806  -10.867 1.00 18.22  ? 453  PRO A N     1 
ATOM   1087  C CA    . PRO A 1 145 ? -19.860 47.913  -10.029 1.00 25.74  ? 453  PRO A CA    1 
ATOM   1088  C C     . PRO A 1 145 ? -19.035 46.816  -9.350  1.00 21.48  ? 453  PRO A C     1 
ATOM   1089  O O     . PRO A 1 145 ? -19.217 46.617  -8.152  1.00 20.11  ? 453  PRO A O     1 
ATOM   1090  C CB    . PRO A 1 145 ? -20.852 47.312  -11.017 1.00 25.98  ? 453  PRO A CB    1 
ATOM   1091  C CG    . PRO A 1 145 ? -21.067 48.399  -12.000 1.00 22.83  ? 453  PRO A CG    1 
ATOM   1092  C CD    . PRO A 1 145 ? -19.702 49.012  -12.182 1.00 21.20  ? 453  PRO A CD    1 
ATOM   1093  N N     . ASP A 1 146 ? -18.168 46.119  -10.079 1.00 23.57  ? 454  ASP A N     1 
ATOM   1094  C CA    . ASP A 1 146 ? -17.405 45.036  -9.454  1.00 26.89  ? 454  ASP A CA    1 
ATOM   1095  C C     . ASP A 1 146 ? -16.635 45.525  -8.251  1.00 17.56  ? 454  ASP A C     1 
ATOM   1096  O O     . ASP A 1 146 ? -16.677 44.911  -7.187  1.00 23.77  ? 454  ASP A O     1 
ATOM   1097  C CB    . ASP A 1 146 ? -16.436 44.384  -10.425 1.00 29.25  ? 454  ASP A CB    1 
ATOM   1098  C CG    . ASP A 1 146 ? -17.135 43.544  -11.453 1.00 28.81  ? 454  ASP A CG    1 
ATOM   1099  O OD1   . ASP A 1 146 ? -18.356 43.320  -11.308 1.00 31.72  ? 454  ASP A OD1   1 
ATOM   1100  O OD2   . ASP A 1 146 ? -16.459 43.101  -12.394 1.00 31.52  ? 454  ASP A OD2   1 
ATOM   1101  N N     . ALA A 1 147 ? -15.925 46.629  -8.426  1.00 11.58  ? 455  ALA A N     1 
ATOM   1102  C CA    . ALA A 1 147 ? -15.087 47.145  -7.367  1.00 11.82  ? 455  ALA A CA    1 
ATOM   1103  C C     . ALA A 1 147 ? -15.945 47.681  -6.212  1.00 15.24  ? 455  ALA A C     1 
ATOM   1104  O O     . ALA A 1 147 ? -15.640 47.442  -5.053  1.00 12.55  ? 455  ALA A O     1 
ATOM   1105  C CB    . ALA A 1 147 ? -14.173 48.225  -7.895  1.00 15.53  ? 455  ALA A CB    1 
ATOM   1106  N N     . TYR A 1 148 ? -17.016 48.400  -6.521  1.00 14.25  ? 456  TYR A N     1 
ATOM   1107  C CA    . TYR A 1 148 ? -17.847 48.935  -5.440  1.00 18.07  ? 456  TYR A CA    1 
ATOM   1108  C C     . TYR A 1 148 ? -18.406 47.810  -4.574  1.00 18.81  ? 456  TYR A C     1 
ATOM   1109  O O     . TYR A 1 148 ? -18.368 47.871  -3.340  1.00 15.83  ? 456  TYR A O     1 
ATOM   1110  C CB    . TYR A 1 148 ? -18.996 49.789  -5.976  1.00 14.12  ? 456  TYR A CB    1 
ATOM   1111  C CG    . TYR A 1 148 ? -19.747 50.489  -4.869  1.00 15.17  ? 456  TYR A CG    1 
ATOM   1112  C CD1   . TYR A 1 148 ? -19.338 51.733  -4.402  1.00 22.39  ? 456  TYR A CD1   1 
ATOM   1113  C CD2   . TYR A 1 148 ? -20.839 49.892  -4.265  1.00 17.43  ? 456  TYR A CD2   1 
ATOM   1114  C CE1   . TYR A 1 148 ? -20.024 52.367  -3.369  1.00 20.62  ? 456  TYR A CE1   1 
ATOM   1115  C CE2   . TYR A 1 148 ? -21.523 50.517  -3.245  1.00 21.53  ? 456  TYR A CE2   1 
ATOM   1116  C CZ    . TYR A 1 148 ? -21.113 51.753  -2.805  1.00 19.81  ? 456  TYR A CZ    1 
ATOM   1117  O OH    . TYR A 1 148 ? -21.797 52.362  -1.777  1.00 20.92  ? 456  TYR A OH    1 
ATOM   1118  N N     . CYS A 1 149 ? -18.949 46.786  -5.226  1.00 14.34  ? 457  CYS A N     1 
ATOM   1119  C CA    . CYS A 1 149 ? -19.580 45.680  -4.503  1.00 16.82  ? 457  CYS A CA    1 
ATOM   1120  C C     . CYS A 1 149 ? -18.568 44.812  -3.760  1.00 16.66  ? 457  CYS A C     1 
ATOM   1121  O O     . CYS A 1 149 ? -18.851 44.322  -2.657  1.00 14.16  ? 457  CYS A O     1 
ATOM   1122  C CB    . CYS A 1 149 ? -20.423 44.825  -5.450  1.00 17.87  ? 457  CYS A CB    1 
ATOM   1123  S SG    . CYS A 1 149 ? -21.866 45.708  -6.096  1.00 21.72  ? 457  CYS A SG    1 
ATOM   1124  N N     . ASN A 1 150 ? -17.397 44.610  -4.355  1.00 16.69  ? 458  ASN A N     1 
ATOM   1125  C CA    . ASN A 1 150 ? -16.352 43.856  -3.675  1.00 9.51   ? 458  ASN A CA    1 
ATOM   1126  C C     . ASN A 1 150 ? -15.816 44.628  -2.491  1.00 12.54  ? 458  ASN A C     1 
ATOM   1127  O O     . ASN A 1 150 ? -15.538 44.057  -1.427  1.00 12.91  ? 458  ASN A O     1 
ATOM   1128  C CB    . ASN A 1 150 ? -15.239 43.417  -4.647  1.00 9.57   ? 458  ASN A CB    1 
ATOM   1129  C CG    . ASN A 1 150 ? -15.632 42.194  -5.468  1.00 22.86  ? 458  ASN A CG    1 
ATOM   1130  O OD1   . ASN A 1 150 ? -16.381 41.342  -5.000  1.00 26.47  ? 458  ASN A OD1   1 
ATOM   1131  N ND2   . ASN A 1 150 ? -15.142 42.113  -6.701  1.00 16.37  ? 458  ASN A ND2   1 
ATOM   1132  N N     . LEU A 1 151 ? -15.695 45.937  -2.658  1.00 15.73  ? 459  LEU A N     1 
ATOM   1133  C CA    . LEU A 1 151 ? -15.326 46.811  -1.544  1.00 12.36  ? 459  LEU A CA    1 
ATOM   1134  C C     . LEU A 1 151 ? -16.391 46.751  -0.438  1.00 20.08  ? 459  LEU A C     1 
ATOM   1135  O O     . LEU A 1 151 ? -16.075 46.644  0.749   1.00 14.19  ? 459  LEU A O     1 
ATOM   1136  C CB    . LEU A 1 151 ? -15.110 48.259  -2.036  1.00 10.13  ? 459  LEU A CB    1 
ATOM   1137  C CG    . LEU A 1 151 ? -15.051 49.333  -0.945  1.00 14.70  ? 459  LEU A CG    1 
ATOM   1138  C CD1   . LEU A 1 151 ? -13.927 49.072  0.061   1.00 6.13   ? 459  LEU A CD1   1 
ATOM   1139  C CD2   . LEU A 1 151 ? -14.930 50.719  -1.564  1.00 18.78  ? 459  LEU A CD2   1 
ATOM   1140  N N     . ALA A 1 152 ? -17.660 46.799  -0.825  1.00 5.91   ? 460  ALA A N     1 
ATOM   1141  C CA    . ALA A 1 152 ? -18.737 46.699  0.151   1.00 10.93  ? 460  ALA A CA    1 
ATOM   1142  C C     . ALA A 1 152 ? -18.612 45.415  0.986   1.00 13.81  ? 460  ALA A C     1 
ATOM   1143  O O     . ALA A 1 152 ? -18.805 45.427  2.207   1.00 14.36  ? 460  ALA A O     1 
ATOM   1144  C CB    . ALA A 1 152 ? -20.092 46.747  -0.548  1.00 11.82  ? 460  ALA A CB    1 
ATOM   1145  N N     . HIS A 1 153 ? -18.282 44.308  0.333   1.00 13.18  ? 461  HIS A N     1 
ATOM   1146  C CA    . HIS A 1 153 ? -18.119 43.063  1.066   1.00 11.05  ? 461  HIS A CA    1 
ATOM   1147  C C     . HIS A 1 153 ? -16.924 43.125  2.027   1.00 16.06  ? 461  HIS A C     1 
ATOM   1148  O O     . HIS A 1 153 ? -17.021 42.659  3.159   1.00 10.52  ? 461  HIS A O     1 
ATOM   1149  C CB    . HIS A 1 153 ? -18.022 41.848  0.137   1.00 12.55  ? 461  HIS A CB    1 
ATOM   1150  C CG    . HIS A 1 153 ? -18.165 40.547  0.857   1.00 18.54  ? 461  HIS A CG    1 
ATOM   1151  N ND1   . HIS A 1 153 ? -17.181 39.581  0.861   1.00 18.75  ? 461  HIS A ND1   1 
ATOM   1152  C CD2   . HIS A 1 153 ? -19.164 40.072  1.639   1.00 18.37  ? 461  HIS A CD2   1 
ATOM   1153  C CE1   . HIS A 1 153 ? -17.575 38.560  1.603   1.00 21.44  ? 461  HIS A CE1   1 
ATOM   1154  N NE2   . HIS A 1 153 ? -18.776 38.833  2.086   1.00 10.18  ? 461  HIS A NE2   1 
ATOM   1155  N N     . CYS A 1 154 ? -15.808 43.707  1.594   1.00 11.24  ? 462  CYS A N     1 
ATOM   1156  C CA    . CYS A 1 154 ? -14.675 43.907  2.506   1.00 10.71  ? 462  CYS A CA    1 
ATOM   1157  C C     . CYS A 1 154 ? -15.075 44.730  3.733   1.00 12.08  ? 462  CYS A C     1 
ATOM   1158  O O     . CYS A 1 154 ? -14.663 44.437  4.870   1.00 11.38  ? 462  CYS A O     1 
ATOM   1159  C CB    . CYS A 1 154 ? -13.507 44.618  1.799   1.00 12.28  ? 462  CYS A CB    1 
ATOM   1160  S SG    . CYS A 1 154 ? -12.692 43.696  0.455   1.00 17.57  ? 462  CYS A SG    1 
ATOM   1161  N N     . LEU A 1 155 ? -15.838 45.794  3.507   1.00 11.66  ? 463  LEU A N     1 
ATOM   1162  C CA    . LEU A 1 155 ? -16.271 46.630  4.619   1.00 10.96  ? 463  LEU A CA    1 
ATOM   1163  C C     . LEU A 1 155 ? -17.155 45.830  5.553   1.00 9.19   ? 463  LEU A C     1 
ATOM   1164  O O     . LEU A 1 155 ? -17.090 46.001  6.762   1.00 14.28  ? 463  LEU A O     1 
ATOM   1165  C CB    . LEU A 1 155 ? -17.009 47.872  4.124   1.00 11.19  ? 463  LEU A CB    1 
ATOM   1166  C CG    . LEU A 1 155 ? -16.128 48.754  3.240   1.00 7.91   ? 463  LEU A CG    1 
ATOM   1167  C CD1   . LEU A 1 155 ? -16.951 49.905  2.662   1.00 8.74   ? 463  LEU A CD1   1 
ATOM   1168  C CD2   . LEU A 1 155 ? -14.921 49.281  4.003   1.00 15.65  ? 463  LEU A CD2   1 
ATOM   1169  N N     . GLN A 1 156 ? -17.956 44.930  4.984   1.00 12.87  ? 464  GLN A N     1 
ATOM   1170  C CA    . GLN A 1 156 ? -18.819 44.059  5.786   1.00 14.43  ? 464  GLN A CA    1 
ATOM   1171  C C     . GLN A 1 156 ? -18.001 43.127  6.679   1.00 10.03  ? 464  GLN A C     1 
ATOM   1172  O O     . GLN A 1 156 ? -18.289 42.963  7.867   1.00 12.02  ? 464  GLN A O     1 
ATOM   1173  C CB    . GLN A 1 156 ? -19.766 43.250  4.890   1.00 15.65  ? 464  GLN A CB    1 
ATOM   1174  C CG    . GLN A 1 156 ? -20.858 42.490  5.652   1.00 16.96  ? 464  GLN A CG    1 
ATOM   1175  C CD    . GLN A 1 156 ? -22.055 43.362  5.996   1.00 12.85  ? 464  GLN A CD    1 
ATOM   1176  O OE1   . GLN A 1 156 ? -22.257 44.427  5.406   1.00 14.36  ? 464  GLN A OE1   1 
ATOM   1177  N NE2   . GLN A 1 156 ? -22.861 42.909  6.956   1.00 14.73  ? 464  GLN A NE2   1 
ATOM   1178  N N     . ILE A 1 157 ? -16.970 42.530  6.096   1.00 8.91   ? 465  ILE A N     1 
ATOM   1179  C CA    . ILE A 1 157 ? -16.111 41.573  6.800   1.00 10.34  ? 465  ILE A CA    1 
ATOM   1180  C C     . ILE A 1 157 ? -15.464 42.190  8.038   1.00 11.95  ? 465  ILE A C     1 
ATOM   1181  O O     . ILE A 1 157 ? -15.291 41.515  9.051   1.00 13.84  ? 465  ILE A O     1 
ATOM   1182  C CB    . ILE A 1 157 ? -14.998 41.041  5.858   1.00 12.87  ? 465  ILE A CB    1 
ATOM   1183  C CG1   . ILE A 1 157 ? -15.590 40.093  4.815   1.00 11.76  ? 465  ILE A CG1   1 
ATOM   1184  C CG2   . ILE A 1 157 ? -13.870 40.378  6.649   1.00 5.98   ? 465  ILE A CG2   1 
ATOM   1185  C CD1   . ILE A 1 157 ? -14.695 39.855  3.568   1.00 13.31  ? 465  ILE A CD1   1 
ATOM   1186  N N     . VAL A 1 158 ? -15.099 43.466  7.963   1.00 8.63   ? 466  VAL A N     1 
ATOM   1187  C CA    . VAL A 1 158 ? -14.408 44.095  9.094   1.00 13.62  ? 466  VAL A CA    1 
ATOM   1188  C C     . VAL A 1 158 ? -15.299 45.011  9.930   1.00 15.55  ? 466  VAL A C     1 
ATOM   1189  O O     . VAL A 1 158 ? -14.812 45.726  10.811  1.00 14.13  ? 466  VAL A O     1 
ATOM   1190  C CB    . VAL A 1 158 ? -13.133 44.842  8.650   1.00 15.15  ? 466  VAL A CB    1 
ATOM   1191  C CG1   . VAL A 1 158 ? -12.232 43.890  7.871   1.00 9.19   ? 466  VAL A CG1   1 
ATOM   1192  C CG2   . VAL A 1 158 ? -13.494 46.074  7.817   1.00 10.55  ? 466  VAL A CG2   1 
ATOM   1193  N N     . CYS A 1 159 ? -16.600 44.971  9.655   1.00 8.12   ? 467  CYS A N     1 
ATOM   1194  C CA    . CYS A 1 159 ? -17.569 45.789  10.372  1.00 13.26  ? 467  CYS A CA    1 
ATOM   1195  C C     . CYS A 1 159 ? -17.250 47.279  10.289  1.00 16.03  ? 467  CYS A C     1 
ATOM   1196  O O     . CYS A 1 159 ? -17.342 47.992  11.279  1.00 7.97   ? 467  CYS A O     1 
ATOM   1197  C CB    . CYS A 1 159 ? -17.702 45.336  11.833  1.00 14.78  ? 467  CYS A CB    1 
ATOM   1198  S SG    . CYS A 1 159 ? -18.330 43.634  12.036  1.00 15.15  ? 467  CYS A SG    1 
ATOM   1199  N N     . ASP A 1 160 ? -16.867 47.733  9.097   1.00 11.71  ? 468  ASP A N     1 
ATOM   1200  C CA    . ASP A 1 160 ? -16.738 49.163  8.822   1.00 11.04  ? 468  ASP A CA    1 
ATOM   1201  C C     . ASP A 1 160 ? -18.085 49.601  8.302   1.00 16.88  ? 468  ASP A C     1 
ATOM   1202  O O     . ASP A 1 160 ? -18.475 49.201  7.208   1.00 12.54  ? 468  ASP A O     1 
ATOM   1203  C CB    . ASP A 1 160 ? -15.659 49.408  7.754   1.00 5.31   ? 468  ASP A CB    1 
ATOM   1204  C CG    . ASP A 1 160 ? -15.472 50.898  7.426   1.00 12.59  ? 468  ASP A CG    1 
ATOM   1205  O OD1   . ASP A 1 160 ? -16.460 51.661  7.455   1.00 21.80  ? 468  ASP A OD1   1 
ATOM   1206  O OD2   . ASP A 1 160 ? -14.332 51.285  7.137   1.00 24.13  ? 468  ASP A OD2   1 
ATOM   1207  N N     . TRP A 1 161 ? -18.809 50.395  9.091   1.00 8.16   ? 469  TRP A N     1 
ATOM   1208  C CA    . TRP A 1 161 ? -20.150 50.814  8.718   1.00 9.98   ? 469  TRP A CA    1 
ATOM   1209  C C     . TRP A 1 161 ? -20.227 52.312  8.380   1.00 15.75  ? 469  TRP A C     1 
ATOM   1210  O O     . TRP A 1 161 ? -21.264 52.937  8.565   1.00 14.89  ? 469  TRP A O     1 
ATOM   1211  C CB    . TRP A 1 161 ? -21.145 50.466  9.839   1.00 9.65   ? 469  TRP A CB    1 
ATOM   1212  C CG    . TRP A 1 161 ? -21.148 48.972  10.168  1.00 9.76   ? 469  TRP A CG    1 
ATOM   1213  C CD1   . TRP A 1 161 ? -20.972 47.936  9.290   1.00 11.24  ? 469  TRP A CD1   1 
ATOM   1214  C CD2   . TRP A 1 161 ? -21.318 48.384  11.456  1.00 8.93   ? 469  TRP A CD2   1 
ATOM   1215  N NE1   . TRP A 1 161 ? -21.029 46.725  9.960   1.00 10.59  ? 469  TRP A NE1   1 
ATOM   1216  C CE2   . TRP A 1 161 ? -21.242 46.976  11.291  1.00 13.22  ? 469  TRP A CE2   1 
ATOM   1217  C CE3   . TRP A 1 161 ? -21.540 48.905  12.738  1.00 12.45  ? 469  TRP A CE3   1 
ATOM   1218  C CZ2   . TRP A 1 161 ? -21.373 46.092  12.358  1.00 12.44  ? 469  TRP A CZ2   1 
ATOM   1219  C CZ3   . TRP A 1 161 ? -21.664 48.013  13.805  1.00 13.32  ? 469  TRP A CZ3   1 
ATOM   1220  C CH2   . TRP A 1 161 ? -21.586 46.630  13.605  1.00 11.42  ? 469  TRP A CH2   1 
ATOM   1221  N N     . THR A 1 162 ? -19.134 52.883  7.886   1.00 19.80  ? 470  THR A N     1 
ATOM   1222  C CA    . THR A 1 162 ? -19.161 54.274  7.415   1.00 16.91  ? 470  THR A CA    1 
ATOM   1223  C C     . THR A 1 162 ? -20.189 54.434  6.290   1.00 19.26  ? 470  THR A C     1 
ATOM   1224  O O     . THR A 1 162 ? -20.170 53.685  5.305   1.00 13.75  ? 470  THR A O     1 
ATOM   1225  C CB    . THR A 1 162 ? -17.793 54.726  6.892   1.00 21.04  ? 470  THR A CB    1 
ATOM   1226  O OG1   . THR A 1 162 ? -16.784 54.465  7.876   1.00 19.70  ? 470  THR A OG1   1 
ATOM   1227  C CG2   . THR A 1 162 ? -17.800 56.229  6.553   1.00 19.78  ? 470  THR A CG2   1 
ATOM   1228  N N     . ASP A 1 163 ? -21.106 55.387  6.459   1.00 15.92  ? 471  ASP A N     1 
ATOM   1229  C CA    . ASP A 1 163 ? -22.096 55.708  5.431   1.00 20.70  ? 471  ASP A CA    1 
ATOM   1230  C C     . ASP A 1 163 ? -22.857 54.462  4.992   1.00 24.80  ? 471  ASP A C     1 
ATOM   1231  O O     . ASP A 1 163 ? -23.104 54.277  3.799   1.00 18.17  ? 471  ASP A O     1 
ATOM   1232  C CB    . ASP A 1 163 ? -21.425 56.359  4.213   1.00 22.21  ? 471  ASP A CB    1 
ATOM   1233  C CG    . ASP A 1 163 ? -20.745 57.674  4.549   1.00 41.54  ? 471  ASP A CG    1 
ATOM   1234  O OD1   . ASP A 1 163 ? -21.138 58.310  5.547   1.00 48.39  ? 471  ASP A OD1   1 
ATOM   1235  O OD2   . ASP A 1 163 ? -19.817 58.073  3.812   1.00 58.62  ? 471  ASP A OD2   1 
ATOM   1236  N N     . TYR A 1 164 ? -23.241 53.637  5.967   1.00 22.41  ? 472  TYR A N     1 
ATOM   1237  C CA    . TYR A 1 164 ? -23.828 52.304  5.733   1.00 16.30  ? 472  TYR A CA    1 
ATOM   1238  C C     . TYR A 1 164 ? -25.135 52.318  4.932   1.00 17.57  ? 472  TYR A C     1 
ATOM   1239  O O     . TYR A 1 164 ? -25.270 51.594  3.948   1.00 16.10  ? 472  TYR A O     1 
ATOM   1240  C CB    . TYR A 1 164 ? -24.021 51.572  7.072   1.00 18.27  ? 472  TYR A CB    1 
ATOM   1241  C CG    . TYR A 1 164 ? -24.669 50.200  6.961   1.00 21.07  ? 472  TYR A CG    1 
ATOM   1242  C CD1   . TYR A 1 164 ? -23.912 49.063  6.725   1.00 20.94  ? 472  TYR A CD1   1 
ATOM   1243  C CD2   . TYR A 1 164 ? -26.044 50.052  7.097   1.00 23.69  ? 472  TYR A CD2   1 
ATOM   1244  C CE1   . TYR A 1 164 ? -24.510 47.807  6.621   1.00 12.17  ? 472  TYR A CE1   1 
ATOM   1245  C CE2   . TYR A 1 164 ? -26.641 48.817  6.988   1.00 21.70  ? 472  TYR A CE2   1 
ATOM   1246  C CZ    . TYR A 1 164 ? -25.864 47.698  6.760   1.00 14.68  ? 472  TYR A CZ    1 
ATOM   1247  O OH    . TYR A 1 164 ? -26.478 46.471  6.655   1.00 21.22  ? 472  TYR A OH    1 
ATOM   1248  N N     . ASP A 1 165 ? -26.079 53.161  5.350   1.00 14.02  ? 473  ASP A N     1 
ATOM   1249  C CA    . ASP A 1 165 ? -27.379 53.278  4.699   1.00 17.54  ? 473  ASP A CA    1 
ATOM   1250  C C     . ASP A 1 165 ? -27.284 53.652  3.222   1.00 13.78  ? 473  ASP A C     1 
ATOM   1251  O O     . ASP A 1 165 ? -27.976 53.074  2.387   1.00 21.06  ? 473  ASP A O     1 
ATOM   1252  C CB    . ASP A 1 165 ? -28.260 54.304  5.437   1.00 26.28  ? 473  ASP A CB    1 
ATOM   1253  C CG    . ASP A 1 165 ? -28.594 53.876  6.851   1.00 38.78  ? 473  ASP A CG    1 
ATOM   1254  O OD1   . ASP A 1 165 ? -28.680 52.651  7.104   1.00 28.93  ? 473  ASP A OD1   1 
ATOM   1255  O OD2   . ASP A 1 165 ? -28.774 54.766  7.708   1.00 54.04  ? 473  ASP A OD2   1 
ATOM   1256  N N     . GLU A 1 166 ? -26.439 54.632  2.902   1.00 18.99  ? 474  GLU A N     1 
ATOM   1257  C CA    . GLU A 1 166 ? -26.228 55.034  1.514   1.00 17.73  ? 474  GLU A CA    1 
ATOM   1258  C C     . GLU A 1 166 ? -25.492 53.930  0.762   1.00 10.58  ? 474  GLU A C     1 
ATOM   1259  O O     . GLU A 1 166 ? -25.711 53.721  -0.427  1.00 18.60  ? 474  GLU A O     1 
ATOM   1260  C CB    . GLU A 1 166 ? -25.415 56.325  1.442   1.00 20.42  ? 474  GLU A CB    1 
ATOM   1261  C CG    . GLU A 1 166 ? -25.386 56.959  0.053   1.00 33.57  ? 474  GLU A CG    1 
ATOM   1262  C CD    . GLU A 1 166 ? -24.265 57.970  -0.118  1.00 51.19  ? 474  GLU A CD    1 
ATOM   1263  O OE1   . GLU A 1 166 ? -23.104 57.625  0.190   1.00 44.30  ? 474  GLU A OE1   1 
ATOM   1264  O OE2   . GLU A 1 166 ? -24.543 59.107  -0.567  1.00 59.00  ? 474  GLU A OE2   1 
ATOM   1265  N N     . ARG A 1 167 ? -24.595 53.236  1.459   1.00 19.27  ? 475  ARG A N     1 
ATOM   1266  C CA    . ARG A 1 167 ? -23.890 52.105  0.853   1.00 16.27  ? 475  ARG A CA    1 
ATOM   1267  C C     . ARG A 1 167 ? -24.919 51.058  0.440   1.00 19.91  ? 475  ARG A C     1 
ATOM   1268  O O     . ARG A 1 167 ? -24.879 50.537  -0.679  1.00 11.97  ? 475  ARG A O     1 
ATOM   1269  C CB    . ARG A 1 167 ? -22.904 51.482  1.842   1.00 9.62   ? 475  ARG A CB    1 
ATOM   1270  C CG    . ARG A 1 167 ? -21.971 50.425  1.217   1.00 16.37  ? 475  ARG A CG    1 
ATOM   1271  C CD    . ARG A 1 167 ? -21.249 49.616  2.300   1.00 23.46  ? 475  ARG A CD    1 
ATOM   1272  N NE    . ARG A 1 167 ? -20.480 50.465  3.213   1.00 15.04  ? 475  ARG A NE    1 
ATOM   1273  C CZ    . ARG A 1 167 ? -20.067 50.081  4.423   1.00 15.48  ? 475  ARG A CZ    1 
ATOM   1274  N NH1   . ARG A 1 167 ? -20.351 48.866  4.890   1.00 14.81  ? 475  ARG A NH1   1 
ATOM   1275  N NH2   . ARG A 1 167 ? -19.366 50.915  5.169   1.00 27.79  ? 475  ARG A NH2   1 
ATOM   1276  N N     . MET A 1 168 ? -25.840 50.752  1.355   1.00 15.59  ? 476  MET A N     1 
ATOM   1277  C CA    . MET A 1 168 ? -26.838 49.722  1.103   1.00 15.93  ? 476  MET A CA    1 
ATOM   1278  C C     . MET A 1 168 ? -27.752 50.162  -0.039  1.00 20.23  ? 476  MET A C     1 
ATOM   1279  O O     . MET A 1 168 ? -28.152 49.348  -0.869  1.00 20.39  ? 476  MET A O     1 
ATOM   1280  C CB    . MET A 1 168 ? -27.666 49.417  2.346   1.00 20.27  ? 476  MET A CB    1 
ATOM   1281  C CG    . MET A 1 168 ? -26.918 48.733  3.475   1.00 19.46  ? 476  MET A CG    1 
ATOM   1282  S SD    . MET A 1 168 ? -26.117 47.177  3.000   1.00 18.74  ? 476  MET A SD    1 
ATOM   1283  C CE    . MET A 1 168 ? -24.428 47.735  2.827   1.00 16.11  ? 476  MET A CE    1 
ATOM   1284  N N     . LYS A 1 169 ? -28.089 51.447  -0.079  1.00 9.68   ? 477  LYS A N     1 
ATOM   1285  C CA    . LYS A 1 169 ? -28.936 51.961  -1.170  1.00 18.04  ? 477  LYS A CA    1 
ATOM   1286  C C     . LYS A 1 169 ? -28.239 51.861  -2.530  1.00 15.92  ? 477  LYS A C     1 
ATOM   1287  O O     . LYS A 1 169 ? -28.850 51.477  -3.531  1.00 19.34  ? 477  LYS A O     1 
ATOM   1288  C CB    . LYS A 1 169 ? -29.382 53.408  -0.907  1.00 19.08  ? 477  LYS A CB    1 
ATOM   1289  C CG    . LYS A 1 169 ? -30.493 53.531  0.135   1.00 28.87  ? 477  LYS A CG    1 
ATOM   1290  C CD    . LYS A 1 169 ? -30.995 54.973  0.278   1.00 33.48  ? 477  LYS A CD    1 
ATOM   1291  C CE    . LYS A 1 169 ? -32.271 55.011  1.108   1.00 49.57  ? 477  LYS A CE    1 
ATOM   1292  N NZ    . LYS A 1 169 ? -32.754 56.395  1.380   1.00 57.90  ? 477  LYS A NZ    1 
ATOM   1293  N N     . LYS A 1 170 ? -26.960 52.216  -2.564  1.00 16.17  ? 478  LYS A N     1 
ATOM   1294  C CA    . LYS A 1 170 ? -26.187 52.111  -3.803  1.00 20.25  ? 478  LYS A CA    1 
ATOM   1295  C C     . LYS A 1 170 ? -26.045 50.666  -4.289  1.00 15.38  ? 478  LYS A C     1 
ATOM   1296  O O     . LYS A 1 170 ? -26.111 50.416  -5.491  1.00 15.79  ? 478  LYS A O     1 
ATOM   1297  C CB    . LYS A 1 170 ? -24.813 52.780  -3.681  1.00 19.52  ? 478  LYS A CB    1 
ATOM   1298  C CG    . LYS A 1 170 ? -24.071 52.807  -5.011  1.00 26.71  ? 478  LYS A CG    1 
ATOM   1299  C CD    . LYS A 1 170 ? -22.823 53.648  -4.954  1.00 37.05  ? 478  LYS A CD    1 
ATOM   1300  C CE    . LYS A 1 170 ? -22.244 53.839  -6.345  1.00 45.75  ? 478  LYS A CE    1 
ATOM   1301  N NZ    . LYS A 1 170 ? -21.051 54.738  -6.344  1.00 40.62  ? 478  LYS A NZ    1 
ATOM   1302  N N     . LEU A 1 171 ? -25.872 49.721  -3.365  1.00 17.77  ? 479  LEU A N     1 
ATOM   1303  C CA    . LEU A 1 171 ? -25.761 48.311  -3.732  1.00 18.87  ? 479  LEU A CA    1 
ATOM   1304  C C     . LEU A 1 171 ? -27.021 47.833  -4.440  1.00 22.85  ? 479  LEU A C     1 
ATOM   1305  O O     . LEU A 1 171 ? -26.967 47.128  -5.457  1.00 10.89  ? 479  LEU A O     1 
ATOM   1306  C CB    . LEU A 1 171 ? -25.536 47.437  -2.495  1.00 21.94  ? 479  LEU A CB    1 
ATOM   1307  C CG    . LEU A 1 171 ? -24.158 47.401  -1.828  1.00 26.01  ? 479  LEU A CG    1 
ATOM   1308  C CD1   . LEU A 1 171 ? -24.195 46.501  -0.562  1.00 20.60  ? 479  LEU A CD1   1 
ATOM   1309  C CD2   . LEU A 1 171 ? -23.109 46.920  -2.803  1.00 17.44  ? 479  LEU A CD2   1 
ATOM   1310  N N     . VAL A 1 172 ? -28.155 48.203  -3.863  1.00 19.96  ? 480  VAL A N     1 
ATOM   1311  C CA    . VAL A 1 172 ? -29.456 47.866  -4.408  1.00 23.64  ? 480  VAL A CA    1 
ATOM   1312  C C     . VAL A 1 172 ? -29.626 48.482  -5.793  1.00 17.60  ? 480  VAL A C     1 
ATOM   1313  O O     . VAL A 1 172 ? -30.122 47.837  -6.714  1.00 21.17  ? 480  VAL A O     1 
ATOM   1314  C CB    . VAL A 1 172 ? -30.589 48.352  -3.464  1.00 20.75  ? 480  VAL A CB    1 
ATOM   1315  C CG1   . VAL A 1 172 ? -31.959 48.131  -4.100  1.00 30.79  ? 480  VAL A CG1   1 
ATOM   1316  C CG2   . VAL A 1 172 ? -30.497 47.632  -2.113  1.00 14.64  ? 480  VAL A CG2   1 
ATOM   1317  N N     . SER A 1 173 ? -29.205 49.734  -5.932  1.00 19.26  ? 481  SER A N     1 
ATOM   1318  C CA    A SER A 1 173 ? -29.343 50.447  -7.193  0.50 17.30  ? 481  SER A CA    1 
ATOM   1319  C CA    B SER A 1 173 ? -29.341 50.449  -7.193  0.50 17.29  ? 481  SER A CA    1 
ATOM   1320  C C     . SER A 1 173 ? -28.470 49.824  -8.272  1.00 19.56  ? 481  SER A C     1 
ATOM   1321  O O     . SER A 1 173 ? -28.888 49.699  -9.433  1.00 15.93  ? 481  SER A O     1 
ATOM   1322  C CB    A SER A 1 173 ? -28.993 51.922  -7.019  0.50 16.40  ? 481  SER A CB    1 
ATOM   1323  C CB    B SER A 1 173 ? -28.989 51.925  -7.014  0.50 16.39  ? 481  SER A CB    1 
ATOM   1324  O OG    A SER A 1 173 ? -29.156 52.616  -8.242  0.50 21.94  ? 481  SER A OG    1 
ATOM   1325  O OG    B SER A 1 173 ? -29.945 52.570  -6.192  0.50 24.36  ? 481  SER A OG    1 
ATOM   1326  N N     . ILE A 1 174 ? -27.264 49.424  -7.884  1.00 19.49  ? 482  ILE A N     1 
ATOM   1327  C CA    . ILE A 1 174 ? -26.345 48.768  -8.796  1.00 20.75  ? 482  ILE A CA    1 
ATOM   1328  C C     . ILE A 1 174 ? -26.921 47.438  -9.312  1.00 24.99  ? 482  ILE A C     1 
ATOM   1329  O O     . ILE A 1 174 ? -26.883 47.160  -10.510 1.00 24.95  ? 482  ILE A O     1 
ATOM   1330  C CB    . ILE A 1 174 ? -24.976 48.516  -8.117  1.00 25.37  ? 482  ILE A CB    1 
ATOM   1331  C CG1   . ILE A 1 174 ? -24.210 49.834  -7.964  1.00 25.32  ? 482  ILE A CG1   1 
ATOM   1332  C CG2   . ILE A 1 174 ? -24.177 47.481  -8.897  1.00 24.74  ? 482  ILE A CG2   1 
ATOM   1333  C CD1   . ILE A 1 174 ? -23.079 49.797  -6.940  1.00 22.58  ? 482  ILE A CD1   1 
ATOM   1334  N N     . VAL A 1 175 ? -27.443 46.618  -8.405  1.00 24.10  ? 483  VAL A N     1 
ATOM   1335  C CA    . VAL A 1 175 ? -28.080 45.351  -8.786  1.00 31.51  ? 483  VAL A CA    1 
ATOM   1336  C C     . VAL A 1 175 ? -29.318 45.566  -9.679  1.00 25.02  ? 483  VAL A C     1 
ATOM   1337  O O     . VAL A 1 175 ? -29.514 44.870  -10.676 1.00 23.02  ? 483  VAL A O     1 
ATOM   1338  C CB    . VAL A 1 175 ? -28.468 44.514  -7.537  1.00 26.33  ? 483  VAL A CB    1 
ATOM   1339  C CG1   . VAL A 1 175 ? -29.408 43.352  -7.913  1.00 10.71  ? 483  VAL A CG1   1 
ATOM   1340  C CG2   . VAL A 1 175 ? -27.221 44.010  -6.833  1.00 20.82  ? 483  VAL A CG2   1 
ATOM   1341  N N     . ALA A 1 176 ? -30.152 46.532  -9.319  1.00 18.49  ? 484  ALA A N     1 
ATOM   1342  C CA    . ALA A 1 176 ? -31.315 46.857  -10.147 1.00 24.87  ? 484  ALA A CA    1 
ATOM   1343  C C     . ALA A 1 176 ? -30.925 47.163  -11.600 1.00 33.58  ? 484  ALA A C     1 
ATOM   1344  O O     . ALA A 1 176 ? -31.572 46.684  -12.535 1.00 22.84  ? 484  ALA A O     1 
ATOM   1345  C CB    . ALA A 1 176 ? -32.079 48.022  -9.548  1.00 21.70  ? 484  ALA A CB    1 
ATOM   1346  N N     . ASP A 1 177 ? -29.872 47.966  -11.766 1.00 26.85  ? 485  ASP A N     1 
ATOM   1347  C CA    . ASP A 1 177 ? -29.379 48.387  -13.080 1.00 28.42  ? 485  ASP A CA    1 
ATOM   1348  C C     . ASP A 1 177 ? -28.762 47.229  -13.847 1.00 25.93  ? 485  ASP A C     1 
ATOM   1349  O O     . ASP A 1 177 ? -28.941 47.101  -15.059 1.00 36.38  ? 485  ASP A O     1 
ATOM   1350  C CB    . ASP A 1 177 ? -28.338 49.500  -12.922 1.00 28.31  ? 485  ASP A CB    1 
ATOM   1351  C CG    . ASP A 1 177 ? -27.826 50.010  -14.249 1.00 44.34  ? 485  ASP A CG    1 
ATOM   1352  O OD1   . ASP A 1 177 ? -28.665 50.391  -15.091 1.00 55.88  ? 485  ASP A OD1   1 
ATOM   1353  O OD2   . ASP A 1 177 ? -26.592 50.028  -14.453 1.00 39.66  ? 485  ASP A OD2   1 
ATOM   1354  N N     . GLN A 1 178 ? -28.033 46.374  -13.145 1.00 19.43  ? 486  GLN A N     1 
ATOM   1355  C CA    . GLN A 1 178 ? -27.402 45.240  -13.811 1.00 21.34  ? 486  GLN A CA    1 
ATOM   1356  C C     . GLN A 1 178 ? -28.425 44.192  -14.269 1.00 20.60  ? 486  GLN A C     1 
ATOM   1357  O O     . GLN A 1 178 ? -28.332 43.661  -15.378 1.00 30.07  ? 486  GLN A O     1 
ATOM   1358  C CB    . GLN A 1 178 ? -26.328 44.623  -12.920 1.00 20.15  ? 486  GLN A CB    1 
ATOM   1359  C CG    . GLN A 1 178 ? -25.042 45.442  -12.880 1.00 30.05  ? 486  GLN A CG    1 
ATOM   1360  C CD    . GLN A 1 178 ? -24.051 44.908  -11.877 1.00 31.60  ? 486  GLN A CD    1 
ATOM   1361  O OE1   . GLN A 1 178 ? -24.436 44.345  -10.849 1.00 23.66  ? 486  GLN A OE1   1 
ATOM   1362  N NE2   . GLN A 1 178 ? -22.768 45.070  -12.173 1.00 25.16  ? 486  GLN A NE2   1 
ATOM   1363  N N     . LEU A 1 179 ? -29.402 43.899  -13.422 1.00 24.62  ? 487  LEU A N     1 
ATOM   1364  C CA    . LEU A 1 179 ? -30.458 42.970  -13.804 1.00 28.66  ? 487  LEU A CA    1 
ATOM   1365  C C     . LEU A 1 179 ? -31.234 43.499  -15.008 1.00 35.95  ? 487  LEU A C     1 
ATOM   1366  O O     . LEU A 1 179 ? -31.556 42.754  -15.934 1.00 34.12  ? 487  LEU A O     1 
ATOM   1367  C CB    . LEU A 1 179 ? -31.407 42.716  -12.630 1.00 27.04  ? 487  LEU A CB    1 
ATOM   1368  C CG    . LEU A 1 179 ? -30.872 41.858  -11.477 1.00 27.55  ? 487  LEU A CG    1 
ATOM   1369  C CD1   . LEU A 1 179 ? -31.868 41.832  -10.330 1.00 14.70  ? 487  LEU A CD1   1 
ATOM   1370  C CD2   . LEU A 1 179 ? -30.540 40.436  -11.935 1.00 24.89  ? 487  LEU A CD2   1 
ATOM   1371  N N     . GLU A 1 180 ? -31.529 44.794  -14.983 1.00 33.40  ? 488  GLU A N     1 
ATOM   1372  C CA    . GLU A 1 180 ? -32.241 45.449  -16.070 1.00 38.80  ? 488  GLU A CA    1 
ATOM   1373  C C     . GLU A 1 180 ? -31.447 45.434  -17.377 1.00 46.56  ? 488  GLU A C     1 
ATOM   1374  O O     . GLU A 1 180 ? -32.011 45.229  -18.451 1.00 51.21  ? 488  GLU A O     1 
ATOM   1375  C CB    . GLU A 1 180 ? -32.581 46.884  -15.671 1.00 28.41  ? 488  GLU A CB    1 
ATOM   1376  C CG    . GLU A 1 180 ? -32.973 47.785  -16.831 1.00 52.31  ? 488  GLU A CG    1 
ATOM   1377  C CD    . GLU A 1 180 ? -33.164 49.228  -16.399 1.00 54.96  ? 488  GLU A CD    1 
ATOM   1378  O OE1   . GLU A 1 180 ? -33.547 49.452  -15.231 1.00 63.35  ? 488  GLU A OE1   1 
ATOM   1379  O OE2   . GLU A 1 180 ? -32.923 50.138  -17.220 1.00 50.57  ? 488  GLU A OE2   1 
ATOM   1380  N N     . LYS A 1 181 ? -30.138 45.645  -17.286 1.00 39.56  ? 489  LYS A N     1 
ATOM   1381  C CA    . LYS A 1 181 ? -29.296 45.687  -18.477 1.00 33.00  ? 489  LYS A CA    1 
ATOM   1382  C C     . LYS A 1 181 ? -28.699 44.319  -18.796 1.00 43.42  ? 489  LYS A C     1 
ATOM   1383  O O     . LYS A 1 181 ? -27.801 44.199  -19.632 1.00 50.75  ? 489  LYS A O     1 
ATOM   1384  C CB    . LYS A 1 181 ? -28.199 46.741  -18.321 1.00 32.37  ? 489  LYS A CB    1 
ATOM   1385  C CG    . LYS A 1 181 ? -28.736 48.153  -18.204 1.00 39.34  ? 489  LYS A CG    1 
ATOM   1386  C CD    . LYS A 1 181 ? -27.629 49.162  -17.979 1.00 48.71  ? 489  LYS A CD    1 
ATOM   1387  C CE    . LYS A 1 181 ? -28.189 50.572  -17.933 1.00 57.82  ? 489  LYS A CE    1 
ATOM   1388  N NZ    . LYS A 1 181 ? -27.165 51.560  -17.498 1.00 66.20  ? 489  LYS A NZ    1 
ATOM   1389  N N     . ASN A 1 182 ? -29.202 43.293  -18.117 1.00 46.01  ? 490  ASN A N     1 
ATOM   1390  C CA    . ASN A 1 182 ? -28.823 41.910  -18.395 1.00 46.73  ? 490  ASN A CA    1 
ATOM   1391  C C     . ASN A 1 182 ? -27.322 41.637  -18.316 1.00 53.91  ? 490  ASN A C     1 
ATOM   1392  O O     . ASN A 1 182 ? -26.765 40.935  -19.163 1.00 60.89  ? 490  ASN A O     1 
ATOM   1393  C CB    . ASN A 1 182 ? -29.364 41.478  -19.760 1.00 58.54  ? 490  ASN A CB    1 
ATOM   1394  C CG    . ASN A 1 182 ? -29.454 39.971  -19.901 1.00 68.28  ? 490  ASN A CG    1 
ATOM   1395  O OD1   . ASN A 1 182 ? -30.313 39.331  -19.295 1.00 73.05  ? 490  ASN A OD1   1 
ATOM   1396  N ND2   . ASN A 1 182 ? -28.570 39.398  -20.710 1.00 68.35  ? 490  ASN A ND2   1 
ATOM   1397  N N     . ARG A 1 183 ? -26.670 42.195  -17.301 1.00 41.43  ? 491  ARG A N     1 
ATOM   1398  C CA    . ARG A 1 183 ? -25.267 41.895  -17.040 1.00 37.85  ? 491  ARG A CA    1 
ATOM   1399  C C     . ARG A 1 183 ? -25.154 41.175  -15.698 1.00 28.36  ? 491  ARG A C     1 
ATOM   1400  O O     . ARG A 1 183 ? -25.955 41.411  -14.801 1.00 32.48  ? 491  ARG A O     1 
ATOM   1401  C CB    . ARG A 1 183 ? -24.431 43.176  -17.039 1.00 47.99  ? 491  ARG A CB    1 
ATOM   1402  C CG    . ARG A 1 183 ? -24.503 43.972  -18.342 1.00 56.32  ? 491  ARG A CG    1 
ATOM   1403  C CD    . ARG A 1 183 ? -23.216 44.745  -18.574 1.00 64.25  ? 491  ARG A CD    1 
ATOM   1404  N NE    . ARG A 1 183 ? -22.070 43.843  -18.672 1.00 73.40  ? 491  ARG A NE    1 
ATOM   1405  C CZ    . ARG A 1 183 ? -20.810 44.205  -18.456 1.00 81.80  ? 491  ARG A CZ    1 
ATOM   1406  N NH1   . ARG A 1 183 ? -20.524 45.458  -18.123 1.00 86.74  ? 491  ARG A NH1   1 
ATOM   1407  N NH2   . ARG A 1 183 ? -19.835 43.312  -18.567 1.00 81.81  ? 491  ARG A NH2   1 
ATOM   1408  N N     . LEU A 1 184 ? -24.171 40.295  -15.562 1.00 31.97  ? 492  LEU A N     1 
ATOM   1409  C CA    . LEU A 1 184 ? -24.028 39.518  -14.334 1.00 34.05  ? 492  LEU A CA    1 
ATOM   1410  C C     . LEU A 1 184 ? -23.890 40.447  -13.127 1.00 31.13  ? 492  LEU A C     1 
ATOM   1411  O O     . LEU A 1 184 ? -22.984 41.276  -13.078 1.00 28.45  ? 492  LEU A O     1 
ATOM   1412  C CB    . LEU A 1 184 ? -22.827 38.575  -14.427 1.00 33.73  ? 492  LEU A CB    1 
ATOM   1413  C CG    . LEU A 1 184 ? -22.677 37.590  -13.270 1.00 23.88  ? 492  LEU A CG    1 
ATOM   1414  C CD1   . LEU A 1 184 ? -23.745 36.518  -13.355 1.00 24.44  ? 492  LEU A CD1   1 
ATOM   1415  C CD2   . LEU A 1 184 ? -21.285 36.962  -13.273 1.00 38.74  ? 492  LEU A CD2   1 
ATOM   1416  N N     . PRO A 1 185 ? -24.806 40.326  -12.155 1.00 28.27  ? 493  PRO A N     1 
ATOM   1417  C CA    . PRO A 1 185 ? -24.741 41.235  -11.003 1.00 24.86  ? 493  PRO A CA    1 
ATOM   1418  C C     . PRO A 1 185 ? -23.408 41.146  -10.268 1.00 17.02  ? 493  PRO A C     1 
ATOM   1419  O O     . PRO A 1 185 ? -22.830 40.069  -10.173 1.00 21.30  ? 493  PRO A O     1 
ATOM   1420  C CB    . PRO A 1 185 ? -25.893 40.753  -10.113 1.00 21.19  ? 493  PRO A CB    1 
ATOM   1421  C CG    . PRO A 1 185 ? -26.885 40.147  -11.093 1.00 21.07  ? 493  PRO A CG    1 
ATOM   1422  C CD    . PRO A 1 185 ? -26.043 39.520  -12.171 1.00 19.36  ? 493  PRO A CD    1 
ATOM   1423  N N     . SER A 1 186 ? -22.941 42.278  -9.743  1.00 25.52  ? 494  SER A N     1 
ATOM   1424  C CA    . SER A 1 186 ? -21.664 42.336  -9.027  1.00 22.98  ? 494  SER A CA    1 
ATOM   1425  C C     . SER A 1 186 ? -21.767 41.884  -7.558  1.00 15.50  ? 494  SER A C     1 
ATOM   1426  O O     . SER A 1 186 ? -20.759 41.753  -6.881  1.00 18.62  ? 494  SER A O     1 
ATOM   1427  C CB    . SER A 1 186 ? -21.075 43.752  -9.105  1.00 23.94  ? 494  SER A CB    1 
ATOM   1428  O OG    . SER A 1 186 ? -20.803 44.107  -10.454 1.00 23.54  ? 494  SER A OG    1 
ATOM   1429  N N     . VAL A 1 187 ? -22.986 41.681  -7.067  1.00 17.59  ? 495  VAL A N     1 
ATOM   1430  C CA    . VAL A 1 187 ? -23.195 41.125  -5.720  1.00 13.53  ? 495  VAL A CA    1 
ATOM   1431  C C     . VAL A 1 187 ? -23.310 39.622  -5.869  1.00 9.76   ? 495  VAL A C     1 
ATOM   1432  O O     . VAL A 1 187 ? -24.131 39.130  -6.639  1.00 18.31  ? 495  VAL A O     1 
ATOM   1433  C CB    . VAL A 1 187 ? -24.464 41.678  -5.057  1.00 21.84  ? 495  VAL A CB    1 
ATOM   1434  C CG1   . VAL A 1 187 ? -24.812 40.894  -3.778  1.00 10.23  ? 495  VAL A CG1   1 
ATOM   1435  C CG2   . VAL A 1 187 ? -24.288 43.157  -4.744  1.00 17.64  ? 495  VAL A CG2   1 
ATOM   1436  N N     . HIS A 1 188 ? -22.452 38.887  -5.165  1.00 13.87  ? 496  HIS A N     1 
ATOM   1437  C CA    . HIS A 1 188 ? -22.440 37.444  -5.286  1.00 16.78  ? 496  HIS A CA    1 
ATOM   1438  C C     . HIS A 1 188 ? -23.679 36.859  -4.588  1.00 17.01  ? 496  HIS A C     1 
ATOM   1439  O O     . HIS A 1 188 ? -24.079 37.337  -3.523  1.00 14.36  ? 496  HIS A O     1 
ATOM   1440  C CB    . HIS A 1 188 ? -21.130 36.901  -4.717  1.00 8.31   ? 496  HIS A CB    1 
ATOM   1441  C CG    . HIS A 1 188 ? -20.918 35.442  -4.970  1.00 9.85   ? 496  HIS A CG    1 
ATOM   1442  N ND1   . HIS A 1 188 ? -21.643 34.463  -4.327  1.00 12.89  ? 496  HIS A ND1   1 
ATOM   1443  C CD2   . HIS A 1 188 ? -20.042 34.794  -5.780  1.00 12.60  ? 496  HIS A CD2   1 
ATOM   1444  C CE1   . HIS A 1 188 ? -21.233 33.274  -4.737  1.00 16.34  ? 496  HIS A CE1   1 
ATOM   1445  N NE2   . HIS A 1 188 ? -20.267 33.447  -5.625  1.00 16.78  ? 496  HIS A NE2   1 
ATOM   1446  N N     . PRO A 1 189 ? -24.306 35.835  -5.193  1.00 15.65  ? 497  PRO A N     1 
ATOM   1447  C CA    . PRO A 1 189 ? -25.536 35.283  -4.604  1.00 13.12  ? 497  PRO A CA    1 
ATOM   1448  C C     . PRO A 1 189 ? -25.342 34.809  -3.171  1.00 14.91  ? 497  PRO A C     1 
ATOM   1449  O O     . PRO A 1 189 ? -26.275 34.884  -2.379  1.00 17.25  ? 497  PRO A O     1 
ATOM   1450  C CB    . PRO A 1 189 ? -25.868 34.090  -5.515  1.00 18.75  ? 497  PRO A CB    1 
ATOM   1451  C CG    . PRO A 1 189 ? -24.625 33.834  -6.316  1.00 19.87  ? 497  PRO A CG    1 
ATOM   1452  C CD    . PRO A 1 189 ? -23.953 35.166  -6.453  1.00 19.48  ? 497  PRO A CD    1 
ATOM   1453  N N     . HIS A 1 190 ? -24.152 34.324  -2.837  1.00 14.30  ? 498  HIS A N     1 
ATOM   1454  C CA    . HIS A 1 190 ? -23.908 33.859  -1.476  1.00 10.51  ? 498  HIS A CA    1 
ATOM   1455  C C     . HIS A 1 190 ? -23.874 35.017  -0.476  1.00 16.82  ? 498  HIS A C     1 
ATOM   1456  O O     . HIS A 1 190 ? -23.965 34.801  0.734   1.00 18.99  ? 498  HIS A O     1 
ATOM   1457  C CB    . HIS A 1 190 ? -22.609 33.063  -1.414  1.00 12.39  ? 498  HIS A CB    1 
ATOM   1458  C CG    . HIS A 1 190 ? -22.390 32.360  -0.107  1.00 23.88  ? 498  HIS A CG    1 
ATOM   1459  N ND1   . HIS A 1 190 ? -23.361 31.587  0.494   1.00 24.91  ? 498  HIS A ND1   1 
ATOM   1460  C CD2   . HIS A 1 190 ? -21.304 32.294  0.701   1.00 23.39  ? 498  HIS A CD2   1 
ATOM   1461  C CE1   . HIS A 1 190 ? -22.888 31.085  1.621   1.00 28.69  ? 498  HIS A CE1   1 
ATOM   1462  N NE2   . HIS A 1 190 ? -21.642 31.499  1.770   1.00 24.58  ? 498  HIS A NE2   1 
ATOM   1463  N N     . HIS A 1 191 ? -23.734 36.241  -0.981  1.00 12.86  ? 499  HIS A N     1 
ATOM   1464  C CA    . HIS A 1 191 ? -23.663 37.414  -0.120  1.00 10.57  ? 499  HIS A CA    1 
ATOM   1465  C C     . HIS A 1 191 ? -24.983 38.195  -0.102  1.00 15.23  ? 499  HIS A C     1 
ATOM   1466  O O     . HIS A 1 191 ? -25.130 39.131  0.669   1.00 14.45  ? 499  HIS A O     1 
ATOM   1467  C CB    . HIS A 1 191 ? -22.542 38.368  -0.576  1.00 11.65  ? 499  HIS A CB    1 
ATOM   1468  C CG    . HIS A 1 191 ? -21.179 37.745  -0.592  1.00 15.99  ? 499  HIS A CG    1 
ATOM   1469  N ND1   . HIS A 1 191 ? -20.163 38.203  -1.405  1.00 15.07  ? 499  HIS A ND1   1 
ATOM   1470  C CD2   . HIS A 1 191 ? -20.664 36.702  0.105   1.00 19.19  ? 499  HIS A CD2   1 
ATOM   1471  C CE1   . HIS A 1 191 ? -19.084 37.459  -1.217  1.00 15.48  ? 499  HIS A CE1   1 
ATOM   1472  N NE2   . HIS A 1 191 ? -19.359 36.551  -0.296  1.00 18.12  ? 499  HIS A NE2   1 
ATOM   1473  N N     . SER A 1 192 ? -25.932 37.824  -0.962  1.00 14.58  ? 500  SER A N     1 
ATOM   1474  C CA    . SER A 1 192 ? -27.101 38.673  -1.205  1.00 9.93   ? 500  SER A CA    1 
ATOM   1475  C C     . SER A 1 192 ? -28.019 38.799  0.023   1.00 13.66  ? 500  SER A C     1 
ATOM   1476  O O     . SER A 1 192 ? -28.778 39.772  0.164   1.00 11.84  ? 500  SER A O     1 
ATOM   1477  C CB    . SER A 1 192 ? -27.887 38.181  -2.422  1.00 18.70  ? 500  SER A CB    1 
ATOM   1478  O OG    . SER A 1 192 ? -28.538 36.957  -2.140  1.00 19.72  ? 500  SER A OG    1 
ATOM   1479  N N     . MET A 1 193 ? -27.925 37.839  0.933   1.00 15.54  ? 501  MET A N     1 
ATOM   1480  C CA    . MET A 1 193 ? -28.727 37.914  2.149   1.00 26.69  ? 501  MET A CA    1 
ATOM   1481  C C     . MET A 1 193 ? -28.237 39.026  3.076   1.00 23.51  ? 501  MET A C     1 
ATOM   1482  O O     . MET A 1 193 ? -28.936 39.402  4.017   1.00 19.68  ? 501  MET A O     1 
ATOM   1483  C CB    . MET A 1 193 ? -28.713 36.583  2.902   1.00 19.33  ? 501  MET A CB    1 
ATOM   1484  C CG    . MET A 1 193 ? -27.485 36.404  3.763   1.00 25.11  ? 501  MET A CG    1 
ATOM   1485  S SD    . MET A 1 193 ? -26.074 35.910  2.765   1.00 24.63  ? 501  MET A SD    1 
ATOM   1486  C CE    . MET A 1 193 ? -26.450 34.151  2.657   1.00 17.33  ? 501  MET A CE    1 
ATOM   1487  N N     . LEU A 1 194 ? -27.041 39.554  2.822   1.00 13.42  ? 502  LEU A N     1 
ATOM   1488  C CA    . LEU A 1 194 ? -26.473 40.558  3.718   1.00 8.88   ? 502  LEU A CA    1 
ATOM   1489  C C     . LEU A 1 194 ? -26.987 41.986  3.480   1.00 14.47  ? 502  LEU A C     1 
ATOM   1490  O O     . LEU A 1 194 ? -26.788 42.869  4.320   1.00 16.51  ? 502  LEU A O     1 
ATOM   1491  C CB    . LEU A 1 194 ? -24.944 40.550  3.629   1.00 10.99  ? 502  LEU A CB    1 
ATOM   1492  C CG    . LEU A 1 194 ? -24.253 39.211  3.944   1.00 17.32  ? 502  LEU A CG    1 
ATOM   1493  C CD1   . LEU A 1 194 ? -22.763 39.309  3.689   1.00 15.88  ? 502  LEU A CD1   1 
ATOM   1494  C CD2   . LEU A 1 194 ? -24.514 38.768  5.375   1.00 15.95  ? 502  LEU A CD2   1 
ATOM   1495  N N     . TYR A 1 195 ? -27.633 42.207  2.339   1.00 10.65  ? 503  TYR A N     1 
ATOM   1496  C CA    . TYR A 1 195 ? -27.993 43.548  1.900   1.00 10.63  ? 503  TYR A CA    1 
ATOM   1497  C C     . TYR A 1 195 ? -29.503 43.572  1.667   1.00 17.08  ? 503  TYR A C     1 
ATOM   1498  O O     . TYR A 1 195 ? -30.096 42.535  1.380   1.00 18.15  ? 503  TYR A O     1 
ATOM   1499  C CB    . TYR A 1 195 ? -27.267 43.866  0.580   1.00 13.71  ? 503  TYR A CB    1 
ATOM   1500  C CG    . TYR A 1 195 ? -25.765 43.610  0.593   1.00 17.16  ? 503  TYR A CG    1 
ATOM   1501  C CD1   . TYR A 1 195 ? -24.971 43.979  1.681   1.00 13.52  ? 503  TYR A CD1   1 
ATOM   1502  C CD2   . TYR A 1 195 ? -25.143 42.994  -0.484  1.00 17.57  ? 503  TYR A CD2   1 
ATOM   1503  C CE1   . TYR A 1 195 ? -23.592 43.739  1.680   1.00 14.89  ? 503  TYR A CE1   1 
ATOM   1504  C CE2   . TYR A 1 195 ? -23.774 42.762  -0.494  1.00 11.20  ? 503  TYR A CE2   1 
ATOM   1505  C CZ    . TYR A 1 195 ? -23.007 43.135  0.581   1.00 17.43  ? 503  TYR A CZ    1 
ATOM   1506  O OH    . TYR A 1 195 ? -21.654 42.888  0.545   1.00 15.79  ? 503  TYR A OH    1 
ATOM   1507  N N     . PRO A 1 196 ? -30.138 44.747  1.795   1.00 16.42  ? 504  PRO A N     1 
ATOM   1508  C CA    . PRO A 1 196 ? -31.613 44.789  1.758   1.00 15.50  ? 504  PRO A CA    1 
ATOM   1509  C C     . PRO A 1 196 ? -32.175 44.729  0.341   1.00 19.90  ? 504  PRO A C     1 
ATOM   1510  O O     . PRO A 1 196 ? -32.927 45.614  -0.075  1.00 16.14  ? 504  PRO A O     1 
ATOM   1511  C CB    . PRO A 1 196 ? -31.934 46.134  2.406   1.00 24.43  ? 504  PRO A CB    1 
ATOM   1512  C CG    . PRO A 1 196 ? -30.746 46.983  2.090   1.00 21.15  ? 504  PRO A CG    1 
ATOM   1513  C CD    . PRO A 1 196 ? -29.555 46.054  2.139   1.00 19.74  ? 504  PRO A CD    1 
ATOM   1514  N N     . LEU A 1 197 ? -31.777 43.699  -0.396  1.00 23.68  ? 505  LEU A N     1 
ATOM   1515  C CA    . LEU A 1 197 ? -32.308 43.431  -1.725  1.00 18.52  ? 505  LEU A CA    1 
ATOM   1516  C C     . LEU A 1 197 ? -33.659 42.745  -1.565  1.00 19.84  ? 505  LEU A C     1 
ATOM   1517  O O     . LEU A 1 197 ? -33.897 42.057  -0.571  1.00 22.07  ? 505  LEU A O     1 
ATOM   1518  C CB    . LEU A 1 197 ? -31.354 42.510  -2.512  1.00 15.56  ? 505  LEU A CB    1 
ATOM   1519  C CG    . LEU A 1 197 ? -29.928 43.001  -2.758  1.00 16.82  ? 505  LEU A CG    1 
ATOM   1520  C CD1   . LEU A 1 197 ? -28.955 41.828  -3.031  1.00 13.99  ? 505  LEU A CD1   1 
ATOM   1521  C CD2   . LEU A 1 197 ? -29.903 44.012  -3.891  1.00 19.85  ? 505  LEU A CD2   1 
ATOM   1522  N N     . SER A 1 198 ? -34.549 42.923  -2.536  1.00 26.80  ? 506  SER A N     1 
ATOM   1523  C CA    . SER A 1 198 ? -35.813 42.199  -2.513  1.00 27.24  ? 506  SER A CA    1 
ATOM   1524  C C     . SER A 1 198 ? -35.543 40.700  -2.693  1.00 26.29  ? 506  SER A C     1 
ATOM   1525  O O     . SER A 1 198 ? -34.488 40.305  -3.180  1.00 19.03  ? 506  SER A O     1 
ATOM   1526  C CB    . SER A 1 198 ? -36.750 42.718  -3.606  1.00 19.76  ? 506  SER A CB    1 
ATOM   1527  O OG    . SER A 1 198 ? -36.146 42.581  -4.877  1.00 20.99  ? 506  SER A OG    1 
ATOM   1528  N N     . HIS A 1 199 ? -36.482 39.862  -2.277  1.00 23.40  ? 507  HIS A N     1 
ATOM   1529  C CA    . HIS A 1 199 ? -36.359 38.426  -2.517  1.00 22.51  ? 507  HIS A CA    1 
ATOM   1530  C C     . HIS A 1 199 ? -36.315 38.153  -4.015  1.00 24.12  ? 507  HIS A C     1 
ATOM   1531  O O     . HIS A 1 199 ? -35.646 37.217  -4.468  1.00 19.92  ? 507  HIS A O     1 
ATOM   1532  C CB    . HIS A 1 199 ? -37.524 37.675  -1.867  1.00 23.43  ? 507  HIS A CB    1 
ATOM   1533  C CG    . HIS A 1 199 ? -37.628 37.897  -0.390  1.00 27.77  ? 507  HIS A CG    1 
ATOM   1534  N ND1   . HIS A 1 199 ? -36.582 37.643  0.474   1.00 30.19  ? 507  HIS A ND1   1 
ATOM   1535  C CD2   . HIS A 1 199 ? -38.640 38.373  0.373   1.00 28.04  ? 507  HIS A CD2   1 
ATOM   1536  C CE1   . HIS A 1 199 ? -36.952 37.940  1.707   1.00 37.40  ? 507  HIS A CE1   1 
ATOM   1537  N NE2   . HIS A 1 199 ? -38.199 38.375  1.675   1.00 27.45  ? 507  HIS A NE2   1 
ATOM   1538  N N     . GLY A 1 200 ? -37.035 38.978  -4.777  1.00 21.22  ? 508  GLY A N     1 
ATOM   1539  C CA    . GLY A 1 200 ? -37.035 38.883  -6.224  1.00 23.02  ? 508  GLY A CA    1 
ATOM   1540  C C     . GLY A 1 200 ? -35.647 39.100  -6.794  1.00 24.05  ? 508  GLY A C     1 
ATOM   1541  O O     . GLY A 1 200 ? -35.191 38.340  -7.652  1.00 25.10  ? 508  GLY A O     1 
ATOM   1542  N N     . PHE A 1 201 ? -34.968 40.138  -6.312  1.00 16.38  ? 509  PHE A N     1 
ATOM   1543  C CA    . PHE A 1 201 ? -33.605 40.430  -6.760  1.00 14.76  ? 509  PHE A CA    1 
ATOM   1544  C C     . PHE A 1 201 ? -32.641 39.321  -6.349  1.00 12.66  ? 509  PHE A C     1 
ATOM   1545  O O     . PHE A 1 201 ? -31.763 38.939  -7.114  1.00 18.79  ? 509  PHE A O     1 
ATOM   1546  C CB    . PHE A 1 201 ? -33.100 41.748  -6.177  1.00 14.43  ? 509  PHE A CB    1 
ATOM   1547  C CG    . PHE A 1 201 ? -33.519 42.956  -6.952  1.00 24.06  ? 509  PHE A CG    1 
ATOM   1548  C CD1   . PHE A 1 201 ? -34.496 42.871  -7.922  1.00 24.24  ? 509  PHE A CD1   1 
ATOM   1549  C CD2   . PHE A 1 201 ? -32.908 44.178  -6.723  1.00 40.68  ? 509  PHE A CD2   1 
ATOM   1550  C CE1   . PHE A 1 201 ? -34.879 43.996  -8.638  1.00 30.61  ? 509  PHE A CE1   1 
ATOM   1551  C CE2   . PHE A 1 201 ? -33.273 45.299  -7.440  1.00 34.28  ? 509  PHE A CE2   1 
ATOM   1552  C CZ    . PHE A 1 201 ? -34.263 45.209  -8.396  1.00 36.75  ? 509  PHE A CZ    1 
ATOM   1553  N N     . ARG A 1 202 ? -32.801 38.821  -5.126  1.00 16.22  ? 510  ARG A N     1 
ATOM   1554  C CA    . ARG A 1 202 ? -31.911 37.776  -4.626  1.00 20.94  ? 510  ARG A CA    1 
ATOM   1555  C C     . ARG A 1 202 ? -32.058 36.509  -5.461  1.00 11.65  ? 510  ARG A C     1 
ATOM   1556  O O     . ARG A 1 202 ? -31.072 35.876  -5.823  1.00 12.94  ? 510  ARG A O     1 
ATOM   1557  C CB    . ARG A 1 202 ? -32.170 37.489  -3.142  1.00 23.26  ? 510  ARG A CB    1 
ATOM   1558  C CG    . ARG A 1 202 ? -31.871 38.663  -2.208  1.00 23.41  ? 510  ARG A CG    1 
ATOM   1559  C CD    . ARG A 1 202 ? -31.632 38.177  -0.774  1.00 28.15  ? 510  ARG A CD    1 
ATOM   1560  N NE    . ARG A 1 202 ? -31.563 39.271  0.195   1.00 22.62  ? 510  ARG A NE    1 
ATOM   1561  C CZ    . ARG A 1 202 ? -32.591 39.677  0.931   1.00 19.31  ? 510  ARG A CZ    1 
ATOM   1562  N NH1   . ARG A 1 202 ? -33.765 39.084  0.802   1.00 18.28  ? 510  ARG A NH1   1 
ATOM   1563  N NH2   . ARG A 1 202 ? -32.444 40.673  1.795   1.00 22.33  ? 510  ARG A NH2   1 
ATOM   1564  N N     . LYS A 1 203 ? -33.292 36.147  -5.786  1.00 19.42  ? 511  LYS A N     1 
ATOM   1565  C CA    . LYS A 1 203 ? -33.517 34.988  -6.640  1.00 24.77  ? 511  LYS A CA    1 
ATOM   1566  C C     . LYS A 1 203 ? -32.947 35.225  -8.045  1.00 17.64  ? 511  LYS A C     1 
ATOM   1567  O O     . LYS A 1 203 ? -32.352 34.324  -8.646  1.00 17.10  ? 511  LYS A O     1 
ATOM   1568  C CB    . LYS A 1 203 ? -35.008 34.638  -6.712  1.00 20.12  ? 511  LYS A CB    1 
ATOM   1569  C CG    . LYS A 1 203 ? -35.295 33.365  -7.521  1.00 21.94  ? 511  LYS A CG    1 
ATOM   1570  C CD    . LYS A 1 203 ? -36.712 32.835  -7.298  1.00 16.50  ? 511  LYS A CD    1 
ATOM   1571  C CE    . LYS A 1 203 ? -37.774 33.818  -7.764  1.00 25.84  ? 511  LYS A CE    1 
ATOM   1572  N NZ    . LYS A 1 203 ? -39.143 33.199  -7.759  1.00 29.22  ? 511  LYS A NZ    1 
ATOM   1573  N N     . ALA A 1 204 ? -33.122 36.442  -8.560  1.00 16.49  ? 512  ALA A N     1 
ATOM   1574  C CA    . ALA A 1 204 ? -32.646 36.782  -9.903  1.00 16.07  ? 512  ALA A CA    1 
ATOM   1575  C C     . ALA A 1 204 ? -31.126 36.747  -10.017 1.00 14.04  ? 512  ALA A C     1 
ATOM   1576  O O     . ALA A 1 204 ? -30.583 36.331  -11.046 1.00 15.99  ? 512  ALA A O     1 
ATOM   1577  C CB    . ALA A 1 204 ? -33.179 38.158  -10.323 1.00 14.51  ? 512  ALA A CB    1 
ATOM   1578  N N     . ILE A 1 205 ? -30.436 37.225  -8.989  1.00 17.37  ? 513  ILE A N     1 
ATOM   1579  C CA    . ILE A 1 205 ? -28.974 37.095  -8.956  1.00 16.23  ? 513  ILE A CA    1 
ATOM   1580  C C     . ILE A 1 205 ? -28.578 35.621  -9.046  1.00 16.72  ? 513  ILE A C     1 
ATOM   1581  O O     . ILE A 1 205 ? -27.715 35.243  -9.839  1.00 14.90  ? 513  ILE A O     1 
ATOM   1582  C CB    . ILE A 1 205 ? -28.364 37.692  -7.674  1.00 15.90  ? 513  ILE A CB    1 
ATOM   1583  C CG1   . ILE A 1 205 ? -28.580 39.209  -7.645  1.00 19.81  ? 513  ILE A CG1   1 
ATOM   1584  C CG2   . ILE A 1 205 ? -26.857 37.328  -7.577  1.00 11.45  ? 513  ILE A CG2   1 
ATOM   1585  C CD1   . ILE A 1 205 ? -28.442 39.844  -6.259  1.00 16.82  ? 513  ILE A CD1   1 
ATOM   1586  N N     . ALA A 1 206 ? -29.217 34.791  -8.226  1.00 14.29  ? 514  ALA A N     1 
ATOM   1587  C CA    . ALA A 1 206 ? -28.919 33.365  -8.228  1.00 14.60  ? 514  ALA A CA    1 
ATOM   1588  C C     . ALA A 1 206 ? -29.143 32.771  -9.611  1.00 17.53  ? 514  ALA A C     1 
ATOM   1589  O O     . ALA A 1 206 ? -28.313 32.002  -10.111 1.00 19.08  ? 514  ALA A O     1 
ATOM   1590  C CB    . ALA A 1 206 ? -29.761 32.633  -7.179  1.00 16.82  ? 514  ALA A CB    1 
ATOM   1591  N N     . GLU A 1 207 ? -30.266 33.127  -10.230 1.00 15.98  ? 515  GLU A N     1 
ATOM   1592  C CA    A GLU A 1 207 ? -30.603 32.620  -11.560 0.50 19.82  ? 515  GLU A CA    1 
ATOM   1593  C CA    B GLU A 1 207 ? -30.595 32.609  -11.556 0.50 19.77  ? 515  GLU A CA    1 
ATOM   1594  C C     . GLU A 1 207 ? -29.545 32.991  -12.596 1.00 16.86  ? 515  GLU A C     1 
ATOM   1595  O O     . GLU A 1 207 ? -29.272 32.222  -13.525 1.00 22.96  ? 515  GLU A O     1 
ATOM   1596  C CB    A GLU A 1 207 ? -31.972 33.142  -12.000 0.50 23.58  ? 515  GLU A CB    1 
ATOM   1597  C CB    B GLU A 1 207 ? -31.973 33.096  -12.003 0.50 23.45  ? 515  GLU A CB    1 
ATOM   1598  C CG    A GLU A 1 207 ? -32.505 32.517  -13.282 0.50 28.94  ? 515  GLU A CG    1 
ATOM   1599  C CG    B GLU A 1 207 ? -32.361 32.638  -13.401 0.50 26.92  ? 515  GLU A CG    1 
ATOM   1600  C CD    A GLU A 1 207 ? -32.003 33.196  -14.545 0.50 36.95  ? 515  GLU A CD    1 
ATOM   1601  C CD    B GLU A 1 207 ? -33.702 33.188  -13.842 0.50 33.79  ? 515  GLU A CD    1 
ATOM   1602  O OE1   A GLU A 1 207 ? -31.289 34.218  -14.450 0.50 35.60  ? 515  GLU A OE1   1 
ATOM   1603  O OE1   B GLU A 1 207 ? -34.057 34.306  -13.411 0.50 39.59  ? 515  GLU A OE1   1 
ATOM   1604  O OE2   A GLU A 1 207 ? -32.334 32.703  -15.644 0.50 50.54  ? 515  GLU A OE2   1 
ATOM   1605  O OE2   B GLU A 1 207 ? -34.404 32.503  -14.616 0.50 45.61  ? 515  GLU A OE2   1 
ATOM   1606  N N     . ARG A 1 208 ? -28.961 34.180  -12.454 1.00 16.77  ? 516  ARG A N     1 
ATOM   1607  C CA    . ARG A 1 208 ? -27.928 34.613  -13.398 1.00 21.70  ? 516  ARG A CA    1 
ATOM   1608  C C     . ARG A 1 208 ? -26.707 33.711  -13.277 1.00 26.98  ? 516  ARG A C     1 
ATOM   1609  O O     . ARG A 1 208 ? -26.039 33.414  -14.267 1.00 20.35  ? 516  ARG A O     1 
ATOM   1610  C CB    . ARG A 1 208 ? -27.537 36.074  -13.174 1.00 24.54  ? 516  ARG A CB    1 
ATOM   1611  C CG    . ARG A 1 208 ? -28.633 37.071  -13.499 1.00 26.88  ? 516  ARG A CG    1 
ATOM   1612  C CD    . ARG A 1 208 ? -29.065 36.954  -14.953 1.00 40.47  ? 516  ARG A CD    1 
ATOM   1613  N NE    . ARG A 1 208 ? -30.085 37.938  -15.301 1.00 58.22  ? 516  ARG A NE    1 
ATOM   1614  C CZ    . ARG A 1 208 ? -29.822 39.139  -15.808 1.00 65.92  ? 516  ARG A CZ    1 
ATOM   1615  N NH1   . ARG A 1 208 ? -28.567 39.508  -16.029 1.00 72.92  ? 516  ARG A NH1   1 
ATOM   1616  N NH2   . ARG A 1 208 ? -30.815 39.972  -16.095 1.00 51.16  ? 516  ARG A NH2   1 
ATOM   1617  N N     . HIS A 1 209 ? -26.418 33.269  -12.057 1.00 19.76  ? 517  HIS A N     1 
ATOM   1618  C CA    . HIS A 1 209 ? -25.296 32.362  -11.848 1.00 25.66  ? 517  HIS A CA    1 
ATOM   1619  C C     . HIS A 1 209 ? -25.607 30.971  -12.376 1.00 30.04  ? 517  HIS A C     1 
ATOM   1620  O O     . HIS A 1 209 ? -24.743 30.308  -12.949 1.00 31.41  ? 517  HIS A O     1 
ATOM   1621  C CB    . HIS A 1 209 ? -24.907 32.322  -10.373 1.00 23.44  ? 517  HIS A CB    1 
ATOM   1622  C CG    . HIS A 1 209 ? -24.081 33.493  -9.953  1.00 17.02  ? 517  HIS A CG    1 
ATOM   1623  N ND1   . HIS A 1 209 ? -22.734 33.390  -9.679  1.00 30.26  ? 517  HIS A ND1   1 
ATOM   1624  C CD2   . HIS A 1 209 ? -24.399 34.799  -9.804  1.00 21.81  ? 517  HIS A CD2   1 
ATOM   1625  C CE1   . HIS A 1 209 ? -22.263 34.582  -9.358  1.00 22.28  ? 517  HIS A CE1   1 
ATOM   1626  N NE2   . HIS A 1 209 ? -23.253 35.454  -9.430  1.00 25.76  ? 517  HIS A NE2   1 
ATOM   1627  N N     . GLY A 1 210 ? -26.849 30.534  -12.188 1.00 21.49  ? 518  GLY A N     1 
ATOM   1628  C CA    . GLY A 1 210 ? -27.295 29.279  -12.757 1.00 23.98  ? 518  GLY A CA    1 
ATOM   1629  C C     . GLY A 1 210 ? -27.096 29.301  -14.261 1.00 27.36  ? 518  GLY A C     1 
ATOM   1630  O O     . GLY A 1 210 ? -26.597 28.339  -14.841 1.00 27.15  ? 518  GLY A O     1 
ATOM   1631  N N     . ASN A 1 211 ? -27.478 30.408  -14.892 1.00 25.13  ? 519  ASN A N     1 
ATOM   1632  C CA    . ASN A 1 211 ? -27.333 30.561  -16.345 1.00 21.05  ? 519  ASN A CA    1 
ATOM   1633  C C     . ASN A 1 211 ? -25.889 30.499  -16.836 1.00 21.66  ? 519  ASN A C     1 
ATOM   1634  O O     . ASN A 1 211 ? -25.626 30.052  -17.955 1.00 29.75  ? 519  ASN A O     1 
ATOM   1635  C CB    . ASN A 1 211 ? -27.964 31.874  -16.818 1.00 33.76  ? 519  ASN A CB    1 
ATOM   1636  C CG    . ASN A 1 211 ? -29.478 31.857  -16.747 1.00 57.75  ? 519  ASN A CG    1 
ATOM   1637  O OD1   . ASN A 1 211 ? -30.096 30.799  -16.616 1.00 59.00  ? 519  ASN A OD1   1 
ATOM   1638  N ND2   . ASN A 1 211 ? -30.085 33.035  -16.847 1.00 66.21  ? 519  ASN A ND2   1 
ATOM   1639  N N     . LEU A 1 212 ? -24.959 30.976  -16.016 1.00 29.80  ? 520  LEU A N     1 
ATOM   1640  C CA    . LEU A 1 212 ? -23.539 30.857  -16.336 1.00 29.41  ? 520  LEU A CA    1 
ATOM   1641  C C     . LEU A 1 212 ? -23.161 29.394  -16.523 1.00 34.54  ? 520  LEU A C     1 
ATOM   1642  O O     . LEU A 1 212 ? -22.428 29.046  -17.452 1.00 29.32  ? 520  LEU A O     1 
ATOM   1643  C CB    . LEU A 1 212 ? -22.675 31.463  -15.229 1.00 29.66  ? 520  LEU A CB    1 
ATOM   1644  C CG    . LEU A 1 212 ? -22.611 32.985  -15.114 1.00 38.57  ? 520  LEU A CG    1 
ATOM   1645  C CD1   . LEU A 1 212 ? -21.756 33.375  -13.920 1.00 34.40  ? 520  LEU A CD1   1 
ATOM   1646  C CD2   . LEU A 1 212 ? -22.059 33.588  -16.399 1.00 48.42  ? 520  LEU A CD2   1 
ATOM   1647  N N     . CYS A 1 213 ? -23.656 28.541  -15.630 1.00 27.30  ? 521  CYS A N     1 
ATOM   1648  C CA    . CYS A 1 213 ? -23.372 27.112  -15.704 1.00 25.63  ? 521  CYS A CA    1 
ATOM   1649  C C     . CYS A 1 213 ? -23.976 26.491  -16.964 1.00 26.85  ? 521  CYS A C     1 
ATOM   1650  O O     . CYS A 1 213 ? -23.342 25.676  -17.624 1.00 29.28  ? 521  CYS A O     1 
ATOM   1651  C CB    . CYS A 1 213 ? -23.901 26.400  -14.458 1.00 28.98  ? 521  CYS A CB    1 
ATOM   1652  S SG    . CYS A 1 213 ? -23.147 26.990  -12.929 1.00 32.01  ? 521  CYS A SG    1 
ATOM   1653  N N     . LEU A 1 214 ? -25.209 26.873  -17.282 1.00 27.94  ? 522  LEU A N     1 
ATOM   1654  C CA    . LEU A 1 214 ? -25.872 26.372  -18.484 1.00 32.30  ? 522  LEU A CA    1 
ATOM   1655  C C     . LEU A 1 214 ? -25.105 26.759  -19.741 1.00 34.28  ? 522  LEU A C     1 
ATOM   1656  O O     . LEU A 1 214 ? -24.913 25.938  -20.641 1.00 32.05  ? 522  LEU A O     1 
ATOM   1657  C CB    . LEU A 1 214 ? -27.308 26.892  -18.568 1.00 32.27  ? 522  LEU A CB    1 
ATOM   1658  C CG    . LEU A 1 214 ? -28.343 26.136  -17.731 1.00 37.36  ? 522  LEU A CG    1 
ATOM   1659  C CD1   . LEU A 1 214 ? -29.611 26.958  -17.554 1.00 47.26  ? 522  LEU A CD1   1 
ATOM   1660  C CD2   . LEU A 1 214 ? -28.649 24.785  -18.361 1.00 29.88  ? 522  LEU A CD2   1 
ATOM   1661  N N     . ASP A 1 215 ? -24.672 28.014  -19.801 1.00 32.20  ? 523  ASP A N     1 
ATOM   1662  C CA    . ASP A 1 215 ? -23.896 28.493  -20.935 1.00 39.28  ? 523  ASP A CA    1 
ATOM   1663  C C     . ASP A 1 215 ? -22.640 27.658  -21.111 1.00 33.48  ? 523  ASP A C     1 
ATOM   1664  O O     . ASP A 1 215 ? -22.303 27.254  -22.222 1.00 37.71  ? 523  ASP A O     1 
ATOM   1665  C CB    . ASP A 1 215 ? -23.522 29.966  -20.760 1.00 39.48  ? 523  ASP A CB    1 
ATOM   1666  C CG    . ASP A 1 215 ? -24.699 30.895  -20.967 1.00 43.06  ? 523  ASP A CG    1 
ATOM   1667  O OD1   . ASP A 1 215 ? -24.562 32.099  -20.657 1.00 43.76  ? 523  ASP A OD1   1 
ATOM   1668  O OD2   . ASP A 1 215 ? -25.759 30.423  -21.434 1.00 41.92  ? 523  ASP A OD2   1 
ATOM   1669  N N     . LYS A 1 216 ? -21.948 27.402  -20.006 1.00 27.25  ? 524  LYS A N     1 
ATOM   1670  C CA    . LYS A 1 216 ? -20.718 26.620  -20.043 1.00 28.74  ? 524  LYS A CA    1 
ATOM   1671  C C     . LYS A 1 216 ? -20.936 25.213  -20.594 1.00 37.35  ? 524  LYS A C     1 
ATOM   1672  O O     . LYS A 1 216 ? -20.121 24.725  -21.376 1.00 46.55  ? 524  LYS A O     1 
ATOM   1673  C CB    . LYS A 1 216 ? -20.065 26.548  -18.659 1.00 37.21  ? 524  LYS A CB    1 
ATOM   1674  C CG    . LYS A 1 216 ? -19.409 27.844  -18.196 1.00 50.74  ? 524  LYS A CG    1 
ATOM   1675  C CD    . LYS A 1 216 ? -18.512 27.593  -16.987 1.00 59.41  ? 524  LYS A CD    1 
ATOM   1676  C CE    . LYS A 1 216 ? -17.866 28.876  -16.471 1.00 62.65  ? 524  LYS A CE    1 
ATOM   1677  N NZ    . LYS A 1 216 ? -18.786 29.695  -15.629 1.00 50.73  ? 524  LYS A NZ    1 
ATOM   1678  N N     . ILE A 1 217 ? -22.024 24.558  -20.189 1.00 24.84  ? 525  ILE A N     1 
ATOM   1679  C CA    . ILE A 1 217 ? -22.252 23.176  -20.620 1.00 23.85  ? 525  ILE A CA    1 
ATOM   1680  C C     . ILE A 1 217 ? -22.906 23.056  -22.001 1.00 34.23  ? 525  ILE A C     1 
ATOM   1681  O O     . ILE A 1 217 ? -22.828 22.007  -22.645 1.00 28.78  ? 525  ILE A O     1 
ATOM   1682  C CB    . ILE A 1 217 ? -23.027 22.343  -19.564 1.00 25.74  ? 525  ILE A CB    1 
ATOM   1683  C CG1   . ILE A 1 217 ? -24.446 22.878  -19.366 1.00 29.58  ? 525  ILE A CG1   1 
ATOM   1684  C CG2   . ILE A 1 217 ? -22.266 22.324  -18.254 1.00 27.16  ? 525  ILE A CG2   1 
ATOM   1685  C CD1   . ILE A 1 217 ? -25.537 21.939  -19.837 1.00 33.50  ? 525  ILE A CD1   1 
ATOM   1686  N N     . ASN A 1 218 ? -23.532 24.133  -22.463 1.00 29.55  ? 526  ASN A N     1 
ATOM   1687  C CA    . ASN A 1 218 ? -24.180 24.117  -23.771 1.00 35.67  ? 526  ASN A CA    1 
ATOM   1688  C C     . ASN A 1 218 ? -23.187 23.906  -24.912 1.00 40.66  ? 526  ASN A C     1 
ATOM   1689  O O     . ASN A 1 218 ? -23.535 23.338  -25.946 1.00 47.35  ? 526  ASN A O     1 
ATOM   1690  C CB    . ASN A 1 218 ? -24.996 25.396  -23.998 1.00 46.57  ? 526  ASN A CB    1 
ATOM   1691  C CG    . ASN A 1 218 ? -26.261 25.435  -23.165 1.00 62.87  ? 526  ASN A CG    1 
ATOM   1692  O OD1   . ASN A 1 218 ? -26.783 24.396  -22.755 1.00 57.71  ? 526  ASN A OD1   1 
ATOM   1693  N ND2   . ASN A 1 218 ? -26.766 26.638  -22.911 1.00 72.72  ? 526  ASN A ND2   1 
ATOM   1694  N N     . VAL A 1 219 ? -21.951 24.357  -24.711 1.00 32.72  ? 527  VAL A N     1 
ATOM   1695  C CA    . VAL A 1 219 ? -20.902 24.225  -25.718 1.00 40.08  ? 527  VAL A CA    1 
ATOM   1696  C C     . VAL A 1 219 ? -20.354 22.802  -25.808 1.00 43.72  ? 527  VAL A C     1 
ATOM   1697  O O     . VAL A 1 219 ? -19.579 22.481  -26.712 1.00 39.98  ? 527  VAL A O     1 
ATOM   1698  C CB    . VAL A 1 219 ? -19.736 25.197  -25.451 1.00 53.23  ? 527  VAL A CB    1 
ATOM   1699  C CG1   . VAL A 1 219 ? -20.270 26.593  -25.179 1.00 55.59  ? 527  VAL A CG1   1 
ATOM   1700  C CG2   . VAL A 1 219 ? -18.892 24.710  -24.285 1.00 54.03  ? 527  VAL A CG2   1 
ATOM   1701  N N     . LEU A 1 220 ? -20.752 21.951  -24.865 1.00 35.74  ? 528  LEU A N     1 
ATOM   1702  C CA    . LEU A 1 220 ? -20.420 20.531  -24.940 1.00 37.21  ? 528  LEU A CA    1 
ATOM   1703  C C     . LEU A 1 220 ? -21.355 19.831  -25.917 1.00 35.03  ? 528  LEU A C     1 
ATOM   1704  O O     . LEU A 1 220 ? -21.090 18.712  -26.357 1.00 35.55  ? 528  LEU A O     1 
ATOM   1705  C CB    . LEU A 1 220 ? -20.535 19.879  -23.560 1.00 39.24  ? 528  LEU A CB    1 
ATOM   1706  C CG    . LEU A 1 220 ? -19.548 20.363  -22.502 1.00 33.36  ? 528  LEU A CG    1 
ATOM   1707  C CD1   . LEU A 1 220 ? -19.963 19.886  -21.107 1.00 32.86  ? 528  LEU A CD1   1 
ATOM   1708  C CD2   . LEU A 1 220 ? -18.138 19.900  -22.844 1.00 47.09  ? 528  LEU A CD2   1 
ATOM   1709  N N     . HIS A 1 221 ? -22.457 20.499  -26.245 1.00 34.00  ? 529  HIS A N     1 
ATOM   1710  C CA    . HIS A 1 221 ? -23.455 19.953  -27.161 1.00 40.54  ? 529  HIS A CA    1 
ATOM   1711  C C     . HIS A 1 221 ? -23.841 18.517  -26.818 1.00 38.05  ? 529  HIS A C     1 
ATOM   1712  O O     . HIS A 1 221 ? -24.050 17.686  -27.703 1.00 40.82  ? 529  HIS A O     1 
ATOM   1713  C CB    . HIS A 1 221 ? -22.974 20.070  -28.611 1.00 40.20  ? 529  HIS A CB    1 
ATOM   1714  C CG    . HIS A 1 221 ? -22.730 21.484  -29.039 1.00 45.98  ? 529  HIS A CG    1 
ATOM   1715  N ND1   . HIS A 1 221 ? -21.465 22.009  -29.191 1.00 51.59  ? 529  HIS A ND1   1 
ATOM   1716  C CD2   . HIS A 1 221 ? -23.591 22.495  -29.303 1.00 41.58  ? 529  HIS A CD2   1 
ATOM   1717  C CE1   . HIS A 1 221 ? -21.556 23.277  -29.549 1.00 54.70  ? 529  HIS A CE1   1 
ATOM   1718  N NE2   . HIS A 1 221 ? -22.836 23.597  -29.624 1.00 53.10  ? 529  HIS A NE2   1 
ATOM   1719  N N     . LYS A 1 222 ? -23.937 18.235  -25.523 1.00 41.16  ? 530  LYS A N     1 
ATOM   1720  C CA    . LYS A 1 222 ? -24.380 16.927  -25.058 1.00 38.98  ? 530  LYS A CA    1 
ATOM   1721  C C     . LYS A 1 222 ? -25.896 16.820  -25.131 1.00 35.71  ? 530  LYS A C     1 
ATOM   1722  O O     . LYS A 1 222 ? -26.610 17.759  -24.777 1.00 36.80  ? 530  LYS A O     1 
ATOM   1723  C CB    . LYS A 1 222 ? -23.920 16.673  -23.618 1.00 45.13  ? 530  LYS A CB    1 
ATOM   1724  C CG    . LYS A 1 222 ? -22.417 16.549  -23.448 1.00 42.89  ? 530  LYS A CG    1 
ATOM   1725  C CD    . LYS A 1 222 ? -22.055 16.205  -22.011 1.00 37.53  ? 530  LYS A CD    1 
ATOM   1726  C CE    . LYS A 1 222 ? -22.170 14.716  -21.745 1.00 35.84  ? 530  LYS A CE    1 
ATOM   1727  N NZ    . LYS A 1 222 ? -21.038 13.959  -22.353 1.00 32.66  ? 530  LYS A NZ    1 
ATOM   1728  N N     . PRO A 1 223 ? -26.391 15.670  -25.598 1.00 34.53  ? 531  PRO A N     1 
ATOM   1729  C CA    . PRO A 1 223 ? -27.825 15.385  -25.565 1.00 37.98  ? 531  PRO A CA    1 
ATOM   1730  C C     . PRO A 1 223 ? -28.291 15.210  -24.125 1.00 42.32  ? 531  PRO A C     1 
ATOM   1731  O O     . PRO A 1 223 ? -27.470 14.961  -23.240 1.00 32.55  ? 531  PRO A O     1 
ATOM   1732  C CB    . PRO A 1 223 ? -27.924 14.049  -26.301 1.00 48.44  ? 531  PRO A CB    1 
ATOM   1733  C CG    . PRO A 1 223 ? -26.595 13.405  -26.077 1.00 51.32  ? 531  PRO A CG    1 
ATOM   1734  C CD    . PRO A 1 223 ? -25.612 14.538  -26.127 1.00 42.06  ? 531  PRO A CD    1 
ATOM   1735  N N     . PRO A 1 224 ? -29.600 15.353  -23.884 1.00 43.41  ? 532  PRO A N     1 
ATOM   1736  C CA    . PRO A 1 224 ? -30.136 15.059  -22.554 1.00 38.33  ? 532  PRO A CA    1 
ATOM   1737  C C     . PRO A 1 224 ? -29.936 13.588  -22.221 1.00 34.81  ? 532  PRO A C     1 
ATOM   1738  O O     . PRO A 1 224 ? -29.929 12.744  -23.116 1.00 31.23  ? 532  PRO A O     1 
ATOM   1739  C CB    . PRO A 1 224 ? -31.629 15.376  -22.694 1.00 39.51  ? 532  PRO A CB    1 
ATOM   1740  C CG    . PRO A 1 224 ? -31.897 15.372  -24.168 1.00 45.08  ? 532  PRO A CG    1 
ATOM   1741  C CD    . PRO A 1 224 ? -30.634 15.849  -24.806 1.00 37.71  ? 532  PRO A CD    1 
ATOM   1742  N N     . TYR A 1 225 ? -29.772 13.289  -20.940 1.00 25.24  ? 533  TYR A N     1 
ATOM   1743  C CA    . TYR A 1 225 ? -29.556 11.917  -20.497 1.00 30.65  ? 533  TYR A CA    1 
ATOM   1744  C C     . TYR A 1 225 ? -30.864 11.147  -20.358 1.00 31.48  ? 533  TYR A C     1 
ATOM   1745  O O     . TYR A 1 225 ? -31.882 11.700  -19.924 1.00 27.81  ? 533  TYR A O     1 
ATOM   1746  C CB    . TYR A 1 225 ? -28.855 11.905  -19.138 1.00 24.96  ? 533  TYR A CB    1 
ATOM   1747  C CG    . TYR A 1 225 ? -27.413 12.369  -19.149 1.00 27.13  ? 533  TYR A CG    1 
ATOM   1748  C CD1   . TYR A 1 225 ? -26.378 11.484  -19.445 1.00 27.60  ? 533  TYR A CD1   1 
ATOM   1749  C CD2   . TYR A 1 225 ? -27.087 13.686  -18.847 1.00 20.72  ? 533  TYR A CD2   1 
ATOM   1750  C CE1   . TYR A 1 225 ? -25.058 11.900  -19.443 1.00 26.06  ? 533  TYR A CE1   1 
ATOM   1751  C CE2   . TYR A 1 225 ? -25.775 14.109  -18.839 1.00 29.82  ? 533  TYR A CE2   1 
ATOM   1752  C CZ    . TYR A 1 225 ? -24.763 13.214  -19.135 1.00 27.76  ? 533  TYR A CZ    1 
ATOM   1753  O OH    . TYR A 1 225 ? -23.454 13.644  -19.132 1.00 28.07  ? 533  TYR A OH    1 
ATOM   1754  N N     . GLU A 1 226 ? -30.827 9.863   -20.706 1.00 24.02  ? 534  GLU A N     1 
ATOM   1755  C CA    . GLU A 1 226 ? -31.934 8.965   -20.405 1.00 31.25  ? 534  GLU A CA    1 
ATOM   1756  C C     . GLU A 1 226 ? -31.866 8.578   -18.933 1.00 27.95  ? 534  GLU A C     1 
ATOM   1757  O O     . GLU A 1 226 ? -30.856 8.057   -18.468 1.00 31.54  ? 534  GLU A O     1 
ATOM   1758  C CB    . GLU A 1 226 ? -31.867 7.708   -21.282 1.00 36.34  ? 534  GLU A CB    1 
ATOM   1759  C CG    . GLU A 1 226 ? -32.190 7.950   -22.748 1.00 51.15  ? 534  GLU A CG    1 
ATOM   1760  C CD    . GLU A 1 226 ? -32.162 6.669   -23.566 1.00 66.56  ? 534  GLU A CD    1 
ATOM   1761  O OE1   . GLU A 1 226 ? -31.508 5.697   -23.130 1.00 68.59  ? 534  GLU A OE1   1 
ATOM   1762  O OE2   . GLU A 1 226 ? -32.797 6.634   -24.643 1.00 72.00  ? 534  GLU A OE2   1 
ATOM   1763  N N     . HIS A 1 227 ? -32.941 8.838   -18.200 1.00 27.34  ? 535  HIS A N     1 
ATOM   1764  C CA    . HIS A 1 227 ? -32.953 8.609   -16.761 1.00 27.87  ? 535  HIS A CA    1 
ATOM   1765  C C     . HIS A 1 227 ? -33.679 7.307   -16.437 1.00 30.96  ? 535  HIS A C     1 
ATOM   1766  O O     . HIS A 1 227 ? -34.612 6.926   -17.141 1.00 30.69  ? 535  HIS A O     1 
ATOM   1767  C CB    . HIS A 1 227 ? -33.636 9.781   -16.046 1.00 22.75  ? 535  HIS A CB    1 
ATOM   1768  C CG    . HIS A 1 227 ? -32.898 11.079  -16.168 1.00 21.62  ? 535  HIS A CG    1 
ATOM   1769  N ND1   . HIS A 1 227 ? -33.527 12.269  -16.461 1.00 27.76  ? 535  HIS A ND1   1 
ATOM   1770  C CD2   . HIS A 1 227 ? -31.583 11.374  -16.029 1.00 25.51  ? 535  HIS A CD2   1 
ATOM   1771  C CE1   . HIS A 1 227 ? -32.633 13.241  -16.502 1.00 26.98  ? 535  HIS A CE1   1 
ATOM   1772  N NE2   . HIS A 1 227 ? -31.446 12.724  -16.240 1.00 22.31  ? 535  HIS A NE2   1 
ATOM   1773  N N     . PRO A 1 228 ? -33.249 6.618   -15.370 1.00 26.99  ? 536  PRO A N     1 
ATOM   1774  C CA    . PRO A 1 228 ? -33.963 5.412   -14.940 1.00 28.49  ? 536  PRO A CA    1 
ATOM   1775  C C     . PRO A 1 228 ? -35.415 5.751   -14.625 1.00 31.78  ? 536  PRO A C     1 
ATOM   1776  O O     . PRO A 1 228 ? -35.686 6.863   -14.178 1.00 28.95  ? 536  PRO A O     1 
ATOM   1777  C CB    . PRO A 1 228 ? -33.215 4.986   -13.666 1.00 25.57  ? 536  PRO A CB    1 
ATOM   1778  C CG    . PRO A 1 228 ? -32.456 6.200   -13.228 1.00 33.04  ? 536  PRO A CG    1 
ATOM   1779  C CD    . PRO A 1 228 ? -32.125 6.953   -14.477 1.00 27.12  ? 536  PRO A CD    1 
ATOM   1780  N N     . LYS A 1 229 ? -36.328 4.812   -14.855 1.00 30.08  ? 537  LYS A N     1 
ATOM   1781  C CA    . LYS A 1 229 ? -37.752 5.054   -14.627 1.00 38.62  ? 537  LYS A CA    1 
ATOM   1782  C C     . LYS A 1 229 ? -38.294 4.206   -13.483 1.00 32.67  ? 537  LYS A C     1 
ATOM   1783  O O     . LYS A 1 229 ? -39.465 4.310   -13.118 1.00 35.59  ? 537  LYS A O     1 
ATOM   1784  C CB    . LYS A 1 229 ? -38.558 4.772   -15.898 1.00 54.84  ? 537  LYS A CB    1 
ATOM   1785  C CG    . LYS A 1 229 ? -38.268 5.712   -17.053 1.00 73.07  ? 537  LYS A CG    1 
ATOM   1786  C CD    . LYS A 1 229 ? -39.169 5.390   -18.238 1.00 89.31  ? 537  LYS A CD    1 
ATOM   1787  C CE    . LYS A 1 229 ? -38.976 6.371   -19.383 1.00 92.50  ? 537  LYS A CE    1 
ATOM   1788  N NZ    . LYS A 1 229 ? -39.862 6.043   -20.535 1.00 87.36  ? 537  LYS A NZ    1 
ATOM   1789  N N     . ASP A 1 230 ? -37.435 3.366   -12.919 1.00 28.43  ? 538  ASP A N     1 
ATOM   1790  C CA    . ASP A 1 230 ? -37.818 2.510   -11.809 1.00 23.13  ? 538  ASP A CA    1 
ATOM   1791  C C     . ASP A 1 230 ? -36.569 2.101   -11.054 1.00 23.35  ? 538  ASP A C     1 
ATOM   1792  O O     . ASP A 1 230 ? -35.485 2.605   -11.335 1.00 31.95  ? 538  ASP A O     1 
ATOM   1793  C CB    . ASP A 1 230 ? -38.564 1.274   -12.320 1.00 33.36  ? 538  ASP A CB    1 
ATOM   1794  C CG    . ASP A 1 230 ? -37.823 0.563   -13.444 1.00 43.05  ? 538  ASP A CG    1 
ATOM   1795  O OD1   . ASP A 1 230 ? -38.448 0.330   -14.502 1.00 40.68  ? 538  ASP A OD1   1 
ATOM   1796  O OD2   . ASP A 1 230 ? -36.628 0.231   -13.274 1.00 33.40  ? 538  ASP A OD2   1 
ATOM   1797  N N     . LEU A 1 231 ? -36.714 1.171   -10.117 1.00 27.70  ? 539  LEU A N     1 
ATOM   1798  C CA    . LEU A 1 231 ? -35.591 0.758   -9.279  1.00 24.29  ? 539  LEU A CA    1 
ATOM   1799  C C     . LEU A 1 231 ? -35.138 -0.684  -9.553  1.00 32.17  ? 539  LEU A C     1 
ATOM   1800  O O     . LEU A 1 231 ? -34.426 -1.284  -8.744  1.00 30.76  ? 539  LEU A O     1 
ATOM   1801  C CB    . LEU A 1 231 ? -35.947 0.934   -7.798  1.00 27.56  ? 539  LEU A CB    1 
ATOM   1802  C CG    . LEU A 1 231 ? -36.560 2.277   -7.378  1.00 28.57  ? 539  LEU A CG    1 
ATOM   1803  C CD1   . LEU A 1 231 ? -36.871 2.290   -5.889  1.00 26.35  ? 539  LEU A CD1   1 
ATOM   1804  C CD2   . LEU A 1 231 ? -35.652 3.437   -7.740  1.00 14.98  ? 539  LEU A CD2   1 
ATOM   1805  N N     . LYS A 1 232 ? -35.530 -1.229  -10.702 1.00 35.14  ? 540  LYS A N     1 
ATOM   1806  C CA    . LYS A 1 232 ? -35.254 -2.634  -11.013 1.00 30.89  ? 540  LYS A CA    1 
ATOM   1807  C C     . LYS A 1 232 ? -33.770 -2.938  -11.220 1.00 28.47  ? 540  LYS A C     1 
ATOM   1808  O O     . LYS A 1 232 ? -33.258 -3.933  -10.709 1.00 38.86  ? 540  LYS A O     1 
ATOM   1809  C CB    . LYS A 1 232 ? -36.073 -3.091  -12.225 1.00 40.21  ? 540  LYS A CB    1 
ATOM   1810  C CG    . LYS A 1 232 ? -37.578 -2.995  -12.014 1.00 43.32  ? 540  LYS A CG    1 
ATOM   1811  C CD    . LYS A 1 232 ? -38.346 -3.590  -13.181 1.00 57.51  ? 540  LYS A CD    1 
ATOM   1812  C CE    . LYS A 1 232 ? -39.850 -3.497  -12.960 1.00 65.47  ? 540  LYS A CE    1 
ATOM   1813  N NZ    . LYS A 1 232 ? -40.320 -2.083  -12.872 1.00 72.90  ? 540  LYS A NZ    1 
ATOM   1814  N N     . LEU A 1 233 ? -33.082 -2.080  -11.963 1.00 26.58  ? 541  LEU A N     1 
ATOM   1815  C CA    . LEU A 1 233 ? -31.658 -2.268  -12.220 1.00 34.07  ? 541  LEU A CA    1 
ATOM   1816  C C     . LEU A 1 233 ? -30.804 -2.040  -10.977 1.00 33.62  ? 541  LEU A C     1 
ATOM   1817  O O     . LEU A 1 233 ? -29.633 -2.407  -10.943 1.00 31.92  ? 541  LEU A O     1 
ATOM   1818  C CB    . LEU A 1 233 ? -31.192 -1.352  -13.355 1.00 40.82  ? 541  LEU A CB    1 
ATOM   1819  C CG    . LEU A 1 233 ? -31.908 -1.563  -14.690 1.00 49.70  ? 541  LEU A CG    1 
ATOM   1820  C CD1   . LEU A 1 233 ? -31.364 -0.623  -15.753 1.00 54.34  ? 541  LEU A CD1   1 
ATOM   1821  C CD2   . LEU A 1 233 ? -31.774 -3.014  -15.130 1.00 49.32  ? 541  LEU A CD2   1 
ATOM   1822  N N     . SER A 1 234 ? -31.390 -1.429  -9.952  1.00 29.49  ? 542  SER A N     1 
ATOM   1823  C CA    . SER A 1 234 ? -30.666 -1.213  -8.703  1.00 26.45  ? 542  SER A CA    1 
ATOM   1824  C C     . SER A 1 234 ? -31.195 -2.114  -7.597  1.00 26.37  ? 542  SER A C     1 
ATOM   1825  O O     . SER A 1 234 ? -30.990 -1.844  -6.418  1.00 22.15  ? 542  SER A O     1 
ATOM   1826  C CB    . SER A 1 234 ? -30.716 0.262   -8.280  1.00 30.39  ? 542  SER A CB    1 
ATOM   1827  O OG    . SER A 1 234 ? -32.018 0.801   -8.424  1.00 24.50  ? 542  SER A OG    1 
ATOM   1828  N N     . ASP A 1 235 ? -31.878 -3.188  -7.984  1.00 26.86  ? 543  ASP A N     1 
ATOM   1829  C CA    . ASP A 1 235 ? -32.348 -4.180  -7.020  1.00 27.12  ? 543  ASP A CA    1 
ATOM   1830  C C     . ASP A 1 235 ? -33.279 -3.559  -5.972  1.00 22.56  ? 543  ASP A C     1 
ATOM   1831  O O     . ASP A 1 235 ? -33.230 -3.908  -4.791  1.00 25.68  ? 543  ASP A O     1 
ATOM   1832  C CB    . ASP A 1 235 ? -31.151 -4.860  -6.349  1.00 40.05  ? 543  ASP A CB    1 
ATOM   1833  C CG    . ASP A 1 235 ? -31.554 -6.026  -5.468  1.00 59.37  ? 543  ASP A CG    1 
ATOM   1834  O OD1   . ASP A 1 235 ? -30.729 -6.437  -4.624  1.00 62.25  ? 543  ASP A OD1   1 
ATOM   1835  O OD2   . ASP A 1 235 ? -32.691 -6.529  -5.613  1.00 65.46  ? 543  ASP A OD2   1 
ATOM   1836  N N     . GLY A 1 236 ? -34.123 -2.633  -6.416  1.00 23.90  ? 544  GLY A N     1 
ATOM   1837  C CA    . GLY A 1 236 ? -35.110 -2.017  -5.551  1.00 21.16  ? 544  GLY A CA    1 
ATOM   1838  C C     . GLY A 1 236 ? -34.558 -0.896  -4.680  1.00 26.85  ? 544  GLY A C     1 
ATOM   1839  O O     . GLY A 1 236 ? -35.285 -0.339  -3.857  1.00 21.91  ? 544  GLY A O     1 
ATOM   1840  N N     . ARG A 1 237 ? -33.279 -0.565  -4.857  1.00 18.35  ? 545  ARG A N     1 
ATOM   1841  C CA    . ARG A 1 237 ? -32.651 0.480   -4.054  1.00 17.13  ? 545  ARG A CA    1 
ATOM   1842  C C     . ARG A 1 237 ? -32.671 1.814   -4.783  1.00 17.03  ? 545  ARG A C     1 
ATOM   1843  O O     . ARG A 1 237 ? -32.490 1.858   -6.001  1.00 19.03  ? 545  ARG A O     1 
ATOM   1844  C CB    . ARG A 1 237 ? -31.201 0.116   -3.729  1.00 16.76  ? 545  ARG A CB    1 
ATOM   1845  C CG    . ARG A 1 237 ? -31.043 -1.138  -2.871  1.00 21.39  ? 545  ARG A CG    1 
ATOM   1846  C CD    . ARG A 1 237 ? -29.789 -1.030  -2.019  1.00 36.77  ? 545  ARG A CD    1 
ATOM   1847  N NE    . ARG A 1 237 ? -28.629 -1.602  -2.681  1.00 38.67  ? 545  ARG A NE    1 
ATOM   1848  C CZ    . ARG A 1 237 ? -27.369 -1.403  -2.306  1.00 30.74  ? 545  ARG A CZ    1 
ATOM   1849  N NH1   . ARG A 1 237 ? -27.069 -0.617  -1.273  1.00 22.34  ? 545  ARG A NH1   1 
ATOM   1850  N NH2   . ARG A 1 237 ? -26.401 -1.983  -2.988  1.00 24.47  ? 545  ARG A NH2   1 
ATOM   1851  N N     . LEU A 1 238 ? -32.883 2.897   -4.036  1.00 21.08  ? 546  LEU A N     1 
ATOM   1852  C CA    . LEU A 1 238 ? -32.777 4.243   -4.596  1.00 16.19  ? 546  LEU A CA    1 
ATOM   1853  C C     . LEU A 1 238 ? -31.324 4.686   -4.549  1.00 17.51  ? 546  LEU A C     1 
ATOM   1854  O O     . LEU A 1 238 ? -30.699 4.699   -3.482  1.00 19.53  ? 546  LEU A O     1 
ATOM   1855  C CB    . LEU A 1 238 ? -33.654 5.234   -3.823  1.00 20.72  ? 546  LEU A CB    1 
ATOM   1856  C CG    . LEU A 1 238 ? -33.856 6.633   -4.425  1.00 22.28  ? 546  LEU A CG    1 
ATOM   1857  C CD1   . LEU A 1 238 ? -34.744 6.595   -5.678  1.00 15.55  ? 546  LEU A CD1   1 
ATOM   1858  C CD2   . LEU A 1 238 ? -34.454 7.575   -3.388  1.00 22.38  ? 546  LEU A CD2   1 
ATOM   1859  N N     . ARG A 1 239 ? -30.783 5.042   -5.709  1.00 17.25  ? 547  ARG A N     1 
ATOM   1860  C CA    . ARG A 1 239 ? -29.399 5.482   -5.800  1.00 15.68  ? 547  ARG A CA    1 
ATOM   1861  C C     . ARG A 1 239 ? -29.319 6.984   -5.545  1.00 18.50  ? 547  ARG A C     1 
ATOM   1862  O O     . ARG A 1 239 ? -29.848 7.782   -6.318  1.00 19.23  ? 547  ARG A O     1 
ATOM   1863  C CB    . ARG A 1 239 ? -28.796 5.103   -7.164  1.00 17.49  ? 547  ARG A CB    1 
ATOM   1864  C CG    . ARG A 1 239 ? -28.605 3.596   -7.330  1.00 17.84  ? 547  ARG A CG    1 
ATOM   1865  C CD    . ARG A 1 239 ? -28.032 3.197   -8.691  1.00 14.34  ? 547  ARG A CD    1 
ATOM   1866  N NE    . ARG A 1 239 ? -27.489 1.839   -8.638  1.00 23.31  ? 547  ARG A NE    1 
ATOM   1867  C CZ    . ARG A 1 239 ? -27.438 1.004   -9.674  1.00 23.27  ? 547  ARG A CZ    1 
ATOM   1868  N NH1   . ARG A 1 239 ? -27.910 1.375   -10.850 1.00 20.14  ? 547  ARG A NH1   1 
ATOM   1869  N NH2   . ARG A 1 239 ? -26.922 -0.205  -9.527  1.00 17.40  ? 547  ARG A NH2   1 
ATOM   1870  N N     . VAL A 1 240 ? -28.684 7.361   -4.437  1.00 11.44  ? 548  VAL A N     1 
ATOM   1871  C CA    . VAL A 1 240 ? -28.556 8.772   -4.074  1.00 11.55  ? 548  VAL A CA    1 
ATOM   1872  C C     . VAL A 1 240 ? -27.099 9.202   -4.194  1.00 11.94  ? 548  VAL A C     1 
ATOM   1873  O O     . VAL A 1 240 ? -26.216 8.552   -3.645  1.00 15.23  ? 548  VAL A O     1 
ATOM   1874  C CB    . VAL A 1 240 ? -29.062 9.034   -2.640  1.00 16.20  ? 548  VAL A CB    1 
ATOM   1875  C CG1   . VAL A 1 240 ? -28.930 10.524  -2.278  1.00 13.77  ? 548  VAL A CG1   1 
ATOM   1876  C CG2   . VAL A 1 240 ? -30.502 8.575   -2.508  1.00 15.63  ? 548  VAL A CG2   1 
ATOM   1877  N N     . GLY A 1 241 ? -26.853 10.278  -4.937  1.00 15.06  ? 549  GLY A N     1 
ATOM   1878  C CA    . GLY A 1 241 ? -25.510 10.803  -5.087  1.00 17.63  ? 549  GLY A CA    1 
ATOM   1879  C C     . GLY A 1 241 ? -25.342 12.125  -4.348  1.00 13.96  ? 549  GLY A C     1 
ATOM   1880  O O     . GLY A 1 241 ? -26.037 13.094  -4.642  1.00 15.36  ? 549  GLY A O     1 
ATOM   1881  N N     . TYR A 1 242 ? -24.424 12.155  -3.387  1.00 13.65  ? 550  TYR A N     1 
ATOM   1882  C CA    . TYR A 1 242 ? -24.071 13.383  -2.679  1.00 11.50  ? 550  TYR A CA    1 
ATOM   1883  C C     . TYR A 1 242 ? -22.839 14.015  -3.322  1.00 13.43  ? 550  TYR A C     1 
ATOM   1884  O O     . TYR A 1 242 ? -21.755 13.423  -3.320  1.00 11.61  ? 550  TYR A O     1 
ATOM   1885  C CB    . TYR A 1 242 ? -23.776 13.070  -1.207  1.00 9.88   ? 550  TYR A CB    1 
ATOM   1886  C CG    . TYR A 1 242 ? -24.989 12.626  -0.415  1.00 11.93  ? 550  TYR A CG    1 
ATOM   1887  C CD1   . TYR A 1 242 ? -25.949 13.541  -0.027  1.00 11.94  ? 550  TYR A CD1   1 
ATOM   1888  C CD2   . TYR A 1 242 ? -25.158 11.296  -0.034  1.00 13.31  ? 550  TYR A CD2   1 
ATOM   1889  C CE1   . TYR A 1 242 ? -27.059 13.153  0.706   1.00 13.38  ? 550  TYR A CE1   1 
ATOM   1890  C CE2   . TYR A 1 242 ? -26.278 10.893  0.701   1.00 14.48  ? 550  TYR A CE2   1 
ATOM   1891  C CZ    . TYR A 1 242 ? -27.220 11.832  1.063   1.00 12.33  ? 550  TYR A CZ    1 
ATOM   1892  O OH    . TYR A 1 242 ? -28.331 11.474  1.789   1.00 13.39  ? 550  TYR A OH    1 
ATOM   1893  N N     . VAL A 1 243 ? -23.002 15.219  -3.861  1.00 14.97  ? 551  VAL A N     1 
ATOM   1894  C CA    . VAL A 1 243 ? -21.924 15.907  -4.549  1.00 9.66   ? 551  VAL A CA    1 
ATOM   1895  C C     . VAL A 1 243 ? -21.440 17.077  -3.706  1.00 12.14  ? 551  VAL A C     1 
ATOM   1896  O O     . VAL A 1 243 ? -22.209 17.983  -3.412  1.00 8.61   ? 551  VAL A O     1 
ATOM   1897  C CB    . VAL A 1 243 ? -22.398 16.459  -5.918  1.00 14.87  ? 551  VAL A CB    1 
ATOM   1898  C CG1   . VAL A 1 243 ? -21.231 17.048  -6.688  1.00 12.07  ? 551  VAL A CG1   1 
ATOM   1899  C CG2   . VAL A 1 243 ? -23.068 15.371  -6.728  1.00 15.05  ? 551  VAL A CG2   1 
ATOM   1900  N N     . SER A 1 244 ? -20.163 17.069  -3.336  1.00 10.95  ? 552  SER A N     1 
ATOM   1901  C CA    . SER A 1 244 ? -19.635 18.102  -2.458  1.00 15.94  ? 552  SER A CA    1 
ATOM   1902  C C     . SER A 1 244 ? -18.135 18.320  -2.621  1.00 18.54  ? 552  SER A C     1 
ATOM   1903  O O     . SER A 1 244 ? -17.376 17.370  -2.816  1.00 13.96  ? 552  SER A O     1 
ATOM   1904  C CB    . SER A 1 244 ? -19.937 17.733  -1.006  1.00 11.67  ? 552  SER A CB    1 
ATOM   1905  O OG    . SER A 1 244 ? -19.439 18.716  -0.132  1.00 12.59  ? 552  SER A OG    1 
ATOM   1906  N N     . SER A 1 245 ? -17.708 19.575  -2.527  1.00 11.90  ? 553  SER A N     1 
ATOM   1907  C CA    . SER A 1 245 ? -16.282 19.888  -2.508  1.00 15.45  ? 553  SER A CA    1 
ATOM   1908  C C     . SER A 1 245 ? -15.767 19.845  -1.075  1.00 14.58  ? 553  SER A C     1 
ATOM   1909  O O     . SER A 1 245 ? -14.592 20.125  -0.819  1.00 10.74  ? 553  SER A O     1 
ATOM   1910  C CB    . SER A 1 245 ? -16.032 21.285  -3.091  1.00 12.60  ? 553  SER A CB    1 
ATOM   1911  O OG    . SER A 1 245 ? -16.594 22.291  -2.251  1.00 15.05  ? 553  SER A OG    1 
ATOM   1912  N N     . ASP A 1 246 ? -16.649 19.501  -0.138  1.00 7.28   ? 554  ASP A N     1 
ATOM   1913  C CA    . ASP A 1 246 ? -16.334 19.656  1.289   1.00 8.58   ? 554  ASP A CA    1 
ATOM   1914  C C     . ASP A 1 246 ? -16.299 18.352  2.091   1.00 13.62  ? 554  ASP A C     1 
ATOM   1915  O O     . ASP A 1 246 ? -16.563 18.360  3.292   1.00 13.14  ? 554  ASP A O     1 
ATOM   1916  C CB    . ASP A 1 246 ? -17.318 20.637  1.937   1.00 11.95  ? 554  ASP A CB    1 
ATOM   1917  C CG    . ASP A 1 246 ? -17.359 21.981  1.220   1.00 15.92  ? 554  ASP A CG    1 
ATOM   1918  O OD1   . ASP A 1 246 ? -16.281 22.522  0.885   1.00 14.08  ? 554  ASP A OD1   1 
ATOM   1919  O OD2   . ASP A 1 246 ? -18.471 22.493  0.983   1.00 16.41  ? 554  ASP A OD2   1 
ATOM   1920  N N     . PHE A 1 247 ? -15.997 17.238  1.428   1.00 11.03  ? 555  PHE A N     1 
ATOM   1921  C CA    . PHE A 1 247 ? -15.737 15.986  2.141   1.00 10.90  ? 555  PHE A CA    1 
ATOM   1922  C C     . PHE A 1 247 ? -14.305 16.026  2.658   1.00 10.91  ? 555  PHE A C     1 
ATOM   1923  O O     . PHE A 1 247 ? -13.361 15.635  1.963   1.00 14.39  ? 555  PHE A O     1 
ATOM   1924  C CB    . PHE A 1 247 ? -15.923 14.785  1.215   1.00 11.58  ? 555  PHE A CB    1 
ATOM   1925  C CG    . PHE A 1 247 ? -17.343 14.586  0.753   1.00 11.52  ? 555  PHE A CG    1 
ATOM   1926  C CD1   . PHE A 1 247 ? -18.396 14.663  1.653   1.00 13.50  ? 555  PHE A CD1   1 
ATOM   1927  C CD2   . PHE A 1 247 ? -17.615 14.318  -0.575  1.00 10.13  ? 555  PHE A CD2   1 
ATOM   1928  C CE1   . PHE A 1 247 ? -19.703 14.477  1.238   1.00 12.74  ? 555  PHE A CE1   1 
ATOM   1929  C CE2   . PHE A 1 247 ? -18.925 14.134  -1.007  1.00 10.26  ? 555  PHE A CE2   1 
ATOM   1930  C CZ    . PHE A 1 247 ? -19.968 14.214  -0.097  1.00 15.99  ? 555  PHE A CZ    1 
ATOM   1931  N N     . GLY A 1 248 ? -14.148 16.509  3.882   1.00 9.81   ? 556  GLY A N     1 
ATOM   1932  C CA    . GLY A 1 248 ? -12.839 16.764  4.452   1.00 8.03   ? 556  GLY A CA    1 
ATOM   1933  C C     . GLY A 1 248 ? -13.033 17.723  5.610   1.00 8.84   ? 556  GLY A C     1 
ATOM   1934  O O     . GLY A 1 248 ? -14.140 17.832  6.118   1.00 8.20   ? 556  GLY A O     1 
ATOM   1935  N N     . ASN A 1 249 ? -11.972 18.416  6.020   1.00 10.05  ? 557  ASN A N     1 
ATOM   1936  C CA    . ASN A 1 249 ? -12.069 19.338  7.147   1.00 7.61   ? 557  ASN A CA    1 
ATOM   1937  C C     . ASN A 1 249 ? -12.772 20.628  6.725   1.00 12.73  ? 557  ASN A C     1 
ATOM   1938  O O     . ASN A 1 249 ? -12.139 21.566  6.253   1.00 11.57  ? 557  ASN A O     1 
ATOM   1939  C CB    . ASN A 1 249 ? -10.681 19.634  7.732   1.00 9.81   ? 557  ASN A CB    1 
ATOM   1940  C CG    . ASN A 1 249 ? -10.745 20.498  8.986   1.00 15.54  ? 557  ASN A CG    1 
ATOM   1941  O OD1   . ASN A 1 249 ? -11.757 20.522  9.684   1.00 10.04  ? 557  ASN A OD1   1 
ATOM   1942  N ND2   . ASN A 1 249 ? -9.654  21.205  9.278   1.00 13.23  ? 557  ASN A ND2   1 
ATOM   1943  N N     . HIS A 1 250 ? -14.089 20.656  6.901   1.00 9.60   ? 558  HIS A N     1 
ATOM   1944  C CA    . HIS A 1 250 ? -14.911 21.786  6.500   1.00 14.58  ? 558  HIS A CA    1 
ATOM   1945  C C     . HIS A 1 250 ? -16.237 21.674  7.239   1.00 10.57  ? 558  HIS A C     1 
ATOM   1946  O O     . HIS A 1 250 ? -16.684 20.575  7.530   1.00 7.61   ? 558  HIS A O     1 
ATOM   1947  C CB    . HIS A 1 250 ? -15.144 21.745  4.986   1.00 11.47  ? 558  HIS A CB    1 
ATOM   1948  C CG    . HIS A 1 250 ? -15.915 22.913  4.452   1.00 11.78  ? 558  HIS A CG    1 
ATOM   1949  N ND1   . HIS A 1 250 ? -17.292 22.974  4.477   1.00 11.05  ? 558  HIS A ND1   1 
ATOM   1950  C CD2   . HIS A 1 250 ? -15.498 24.064  3.869   1.00 10.01  ? 558  HIS A CD2   1 
ATOM   1951  C CE1   . HIS A 1 250 ? -17.690 24.114  3.936   1.00 14.89  ? 558  HIS A CE1   1 
ATOM   1952  N NE2   . HIS A 1 250 ? -16.621 24.789  3.552   1.00 15.27  ? 558  HIS A NE2   1 
ATOM   1953  N N     . PRO A 1 251 ? -16.873 22.812  7.549   1.00 9.99   ? 559  PRO A N     1 
ATOM   1954  C CA    . PRO A 1 251 ? -18.147 22.759  8.277   1.00 10.77  ? 559  PRO A CA    1 
ATOM   1955  C C     . PRO A 1 251 ? -19.141 21.730  7.715   1.00 7.76   ? 559  PRO A C     1 
ATOM   1956  O O     . PRO A 1 251 ? -19.864 21.100  8.482   1.00 10.69  ? 559  PRO A O     1 
ATOM   1957  C CB    . PRO A 1 251 ? -18.704 24.176  8.102   1.00 9.14   ? 559  PRO A CB    1 
ATOM   1958  C CG    . PRO A 1 251 ? -17.480 25.045  7.990   1.00 9.29   ? 559  PRO A CG    1 
ATOM   1959  C CD    . PRO A 1 251 ? -16.400 24.192  7.336   1.00 8.31   ? 559  PRO A CD    1 
ATOM   1960  N N     . THR A 1 252 ? -19.204 21.579  6.394   1.00 9.68   ? 560  THR A N     1 
ATOM   1961  C CA    . THR A 1 252 ? -20.166 20.650  5.802   1.00 14.08  ? 560  THR A CA    1 
ATOM   1962  C C     . THR A 1 252 ? -19.998 19.223  6.351   1.00 14.46  ? 560  THR A C     1 
ATOM   1963  O O     . THR A 1 252 ? -20.974 18.584  6.735   1.00 10.08  ? 560  THR A O     1 
ATOM   1964  C CB    . THR A 1 252 ? -20.081 20.613  4.263   1.00 16.24  ? 560  THR A CB    1 
ATOM   1965  O OG1   . THR A 1 252 ? -20.528 21.863  3.730   1.00 21.20  ? 560  THR A OG1   1 
ATOM   1966  C CG2   . THR A 1 252 ? -20.962 19.497  3.716   1.00 19.66  ? 560  THR A CG2   1 
ATOM   1967  N N     . SER A 1 253 ? -18.767 18.730  6.390   1.00 9.12   ? 561  SER A N     1 
ATOM   1968  C CA    . SER A 1 253 ? -18.521 17.404  6.951   1.00 10.71  ? 561  SER A CA    1 
ATOM   1969  C C     . SER A 1 253 ? -18.743 17.379  8.464   1.00 13.52  ? 561  SER A C     1 
ATOM   1970  O O     . SER A 1 253 ? -19.143 16.360  9.003   1.00 10.85  ? 561  SER A O     1 
ATOM   1971  C CB    . SER A 1 253 ? -17.113 16.910  6.615   1.00 9.57   ? 561  SER A CB    1 
ATOM   1972  O OG    . SER A 1 253 ? -17.014 16.597  5.228   1.00 10.41  ? 561  SER A OG    1 
ATOM   1973  N N     . HIS A 1 254 ? -18.470 18.490  9.150   1.00 7.26   ? 562  HIS A N     1 
ATOM   1974  C CA    . HIS A 1 254 ? -18.705 18.536  10.589  1.00 8.96   ? 562  HIS A CA    1 
ATOM   1975  C C     . HIS A 1 254 ? -20.195 18.414  10.876  1.00 9.77   ? 562  HIS A C     1 
ATOM   1976  O O     . HIS A 1 254 ? -20.586 18.147  12.011  1.00 13.16  ? 562  HIS A O     1 
ATOM   1977  C CB    . HIS A 1 254 ? -18.198 19.833  11.216  1.00 8.85   ? 562  HIS A CB    1 
ATOM   1978  C CG    . HIS A 1 254 ? -16.776 20.147  10.895  1.00 6.60   ? 562  HIS A CG    1 
ATOM   1979  N ND1   . HIS A 1 254 ? -16.270 21.426  10.965  1.00 8.06   ? 562  HIS A ND1   1 
ATOM   1980  C CD2   . HIS A 1 254 ? -15.750 19.352  10.494  1.00 9.30   ? 562  HIS A CD2   1 
ATOM   1981  C CE1   . HIS A 1 254 ? -14.994 21.410  10.621  1.00 5.22   ? 562  HIS A CE1   1 
ATOM   1982  N NE2   . HIS A 1 254 ? -14.655 20.166  10.325  1.00 11.42  ? 562  HIS A NE2   1 
ATOM   1983  N N     . LEU A 1 255 ? -21.028 18.666  9.869   1.00 9.49   ? 563  LEU A N     1 
ATOM   1984  C CA    . LEU A 1 255 ? -22.472 18.526  10.037  1.00 4.69   ? 563  LEU A CA    1 
ATOM   1985  C C     . LEU A 1 255 ? -22.975 17.135  9.660   1.00 12.67  ? 563  LEU A C     1 
ATOM   1986  O O     . LEU A 1 255 ? -23.773 16.541  10.396  1.00 9.84   ? 563  LEU A O     1 
ATOM   1987  C CB    . LEU A 1 255 ? -23.237 19.574  9.197   1.00 11.02  ? 563  LEU A CB    1 
ATOM   1988  C CG    . LEU A 1 255 ? -22.987 21.058  9.467   1.00 16.05  ? 563  LEU A CG    1 
ATOM   1989  C CD1   . LEU A 1 255 ? -23.825 21.927  8.531   1.00 14.34  ? 563  LEU A CD1   1 
ATOM   1990  C CD2   . LEU A 1 255 ? -23.255 21.400  10.937  1.00 7.19   ? 563  LEU A CD2   1 
ATOM   1991  N N     . MET A 1 256 ? -22.532 16.626  8.506   1.00 8.64   ? 564  MET A N     1 
ATOM   1992  C CA    . MET A 1 256 ? -23.189 15.462  7.922   1.00 13.37  ? 564  MET A CA    1 
ATOM   1993  C C     . MET A 1 256 ? -22.320 14.223  7.713   1.00 11.04  ? 564  MET A C     1 
ATOM   1994  O O     . MET A 1 256 ? -22.746 13.291  7.039   1.00 8.04   ? 564  MET A O     1 
ATOM   1995  C CB    . MET A 1 256 ? -23.904 15.830  6.605   1.00 8.87   ? 564  MET A CB    1 
ATOM   1996  C CG    . MET A 1 256 ? -23.033 16.505  5.531   1.00 8.81   ? 564  MET A CG    1 
ATOM   1997  S SD    . MET A 1 256 ? -21.604 15.556  5.003   1.00 11.91  ? 564  MET A SD    1 
ATOM   1998  C CE    . MET A 1 256 ? -22.392 14.228  4.094   1.00 12.17  ? 564  MET A CE    1 
ATOM   1999  N N     . GLN A 1 257 ? -21.120 14.182  8.281   1.00 9.39   ? 565  GLN A N     1 
ATOM   2000  C CA    . GLN A 1 257 ? -20.242 13.049  7.968   1.00 9.04   ? 565  GLN A CA    1 
ATOM   2001  C C     . GLN A 1 257 ? -20.817 11.684  8.372   1.00 10.80  ? 565  GLN A C     1 
ATOM   2002  O O     . GLN A 1 257 ? -20.416 10.668  7.811   1.00 12.55  ? 565  GLN A O     1 
ATOM   2003  C CB    . GLN A 1 257 ? -18.836 13.227  8.551   1.00 8.50   ? 565  GLN A CB    1 
ATOM   2004  C CG    . GLN A 1 257 ? -18.797 13.243  10.074  1.00 7.80   ? 565  GLN A CG    1 
ATOM   2005  C CD    . GLN A 1 257 ? -17.383 13.175  10.625  1.00 15.69  ? 565  GLN A CD    1 
ATOM   2006  O OE1   . GLN A 1 257 ? -16.439 12.803  9.917   1.00 10.68  ? 565  GLN A OE1   1 
ATOM   2007  N NE2   . GLN A 1 257 ? -17.232 13.518  11.900  1.00 13.20  ? 565  GLN A NE2   1 
ATOM   2008  N N     . SER A 1 258 ? -21.739 11.642  9.341   1.00 8.54   ? 566  SER A N     1 
ATOM   2009  C CA    . SER A 1 258 ? -22.281 10.350  9.771   1.00 9.33   ? 566  SER A CA    1 
ATOM   2010  C C     . SER A 1 258 ? -23.416 9.864   8.865   1.00 14.51  ? 566  SER A C     1 
ATOM   2011  O O     . SER A 1 258 ? -23.765 8.687   8.873   1.00 8.77   ? 566  SER A O     1 
ATOM   2012  C CB    . SER A 1 258 ? -22.769 10.388  11.232  1.00 8.85   ? 566  SER A CB    1 
ATOM   2013  O OG    . SER A 1 258 ? -21.690 10.489  12.144  1.00 8.29   ? 566  SER A OG    1 
ATOM   2014  N N     . ILE A 1 259 ? -23.985 10.766  8.079   1.00 9.73   ? 567  ILE A N     1 
ATOM   2015  C CA    . ILE A 1 259 ? -25.208 10.442  7.334   1.00 5.41   ? 567  ILE A CA    1 
ATOM   2016  C C     . ILE A 1 259 ? -25.062 9.342   6.269   1.00 13.35  ? 567  ILE A C     1 
ATOM   2017  O O     . ILE A 1 259 ? -25.887 8.428   6.200   1.00 11.93  ? 567  ILE A O     1 
ATOM   2018  C CB    . ILE A 1 259 ? -25.879 11.720  6.770   1.00 12.32  ? 567  ILE A CB    1 
ATOM   2019  C CG1   . ILE A 1 259 ? -26.533 12.492  7.920   1.00 21.51  ? 567  ILE A CG1   1 
ATOM   2020  C CG2   . ILE A 1 259 ? -26.913 11.367  5.705   1.00 17.18  ? 567  ILE A CG2   1 
ATOM   2021  C CD1   . ILE A 1 259 ? -27.131 13.805  7.519   1.00 24.89  ? 567  ILE A CD1   1 
ATOM   2022  N N     . PRO A 1 260 ? -24.001 9.400   5.455   1.00 11.45  ? 568  PRO A N     1 
ATOM   2023  C CA    . PRO A 1 260 ? -23.875 8.339   4.451   1.00 13.72  ? 568  PRO A CA    1 
ATOM   2024  C C     . PRO A 1 260 ? -23.872 6.926   5.045   1.00 11.99  ? 568  PRO A C     1 
ATOM   2025  O O     . PRO A 1 260 ? -24.508 6.032   4.488   1.00 15.03  ? 568  PRO A O     1 
ATOM   2026  C CB    . PRO A 1 260 ? -22.536 8.659   3.781   1.00 14.35  ? 568  PRO A CB    1 
ATOM   2027  C CG    . PRO A 1 260 ? -22.455 10.159  3.880   1.00 9.76   ? 568  PRO A CG    1 
ATOM   2028  C CD    . PRO A 1 260 ? -22.991 10.461  5.268   1.00 9.38   ? 568  PRO A CD    1 
ATOM   2029  N N     . GLY A 1 261 ? -23.198 6.731   6.171   1.00 12.60  ? 569  GLY A N     1 
ATOM   2030  C CA    . GLY A 1 261 ? -23.112 5.404   6.755   1.00 10.20  ? 569  GLY A CA    1 
ATOM   2031  C C     . GLY A 1 261 ? -24.348 5.000   7.534   1.00 11.88  ? 569  GLY A C     1 
ATOM   2032  O O     . GLY A 1 261 ? -24.470 3.854   7.954   1.00 14.41  ? 569  GLY A O     1 
ATOM   2033  N N     . MET A 1 262 ? -25.255 5.948   7.752   1.00 11.39  ? 570  MET A N     1 
ATOM   2034  C CA    . MET A 1 262 ? -26.521 5.651   8.419   1.00 12.88  ? 570  MET A CA    1 
ATOM   2035  C C     . MET A 1 262 ? -27.651 5.340   7.454   1.00 15.78  ? 570  MET A C     1 
ATOM   2036  O O     . MET A 1 262 ? -28.744 4.972   7.877   1.00 11.55  ? 570  MET A O     1 
ATOM   2037  C CB    . MET A 1 262 ? -26.922 6.788   9.351   1.00 10.80  ? 570  MET A CB    1 
ATOM   2038  C CG    . MET A 1 262 ? -26.063 6.807   10.609  1.00 12.06  ? 570  MET A CG    1 
ATOM   2039  S SD    . MET A 1 262 ? -26.437 8.222   11.621  1.00 17.07  ? 570  MET A SD    1 
ATOM   2040  C CE    . MET A 1 262 ? -25.585 7.755   13.139  1.00 19.02  ? 570  MET A CE    1 
ATOM   2041  N N     . HIS A 1 263 ? -27.393 5.478   6.159   1.00 7.17   ? 571  HIS A N     1 
ATOM   2042  C CA    . HIS A 1 263 ? -28.413 5.119   5.181   1.00 12.95  ? 571  HIS A CA    1 
ATOM   2043  C C     . HIS A 1 263 ? -28.725 3.623   5.248   1.00 19.02  ? 571  HIS A C     1 
ATOM   2044  O O     . HIS A 1 263 ? -27.833 2.805   5.465   1.00 14.83  ? 571  HIS A O     1 
ATOM   2045  C CB    . HIS A 1 263 ? -27.986 5.534   3.777   1.00 14.11  ? 571  HIS A CB    1 
ATOM   2046  C CG    . HIS A 1 263 ? -28.372 6.938   3.425   1.00 14.63  ? 571  HIS A CG    1 
ATOM   2047  N ND1   . HIS A 1 263 ? -29.682 7.318   3.244   1.00 14.30  ? 571  HIS A ND1   1 
ATOM   2048  C CD2   . HIS A 1 263 ? -27.624 8.048   3.204   1.00 15.82  ? 571  HIS A CD2   1 
ATOM   2049  C CE1   . HIS A 1 263 ? -29.730 8.601   2.933   1.00 13.60  ? 571  HIS A CE1   1 
ATOM   2050  N NE2   . HIS A 1 263 ? -28.494 9.069   2.904   1.00 14.01  ? 571  HIS A NE2   1 
ATOM   2051  N N     . ASN A 1 264 ? -29.998 3.276   5.080   1.00 13.27  ? 572  ASN A N     1 
ATOM   2052  C CA    . ASN A 1 264 ? -30.431 1.880   5.076   1.00 9.82   ? 572  ASN A CA    1 
ATOM   2053  C C     . ASN A 1 264 ? -30.086 1.203   3.755   1.00 16.05  ? 572  ASN A C     1 
ATOM   2054  O O     . ASN A 1 264 ? -30.689 1.505   2.727   1.00 15.21  ? 572  ASN A O     1 
ATOM   2055  C CB    . ASN A 1 264 ? -31.941 1.806   5.303   1.00 13.91  ? 572  ASN A CB    1 
ATOM   2056  C CG    . ASN A 1 264 ? -32.495 0.403   5.129   1.00 17.24  ? 572  ASN A CG    1 
ATOM   2057  O OD1   . ASN A 1 264 ? -31.752 -0.589  5.119   1.00 15.12  ? 572  ASN A OD1   1 
ATOM   2058  N ND2   . ASN A 1 264 ? -33.812 0.315   4.977   1.00 12.42  ? 572  ASN A ND2   1 
ATOM   2059  N N     . PRO A 1 265 ? -29.127 0.273   3.784   1.00 18.39  ? 573  PRO A N     1 
ATOM   2060  C CA    . PRO A 1 265 ? -28.620 -0.358  2.559   1.00 16.68  ? 573  PRO A CA    1 
ATOM   2061  C C     . PRO A 1 265 ? -29.635 -1.243  1.832   1.00 15.61  ? 573  PRO A C     1 
ATOM   2062  O O     . PRO A 1 265 ? -29.439 -1.534  0.656   1.00 15.66  ? 573  PRO A O     1 
ATOM   2063  C CB    . PRO A 1 265 ? -27.458 -1.216  3.068   1.00 20.51  ? 573  PRO A CB    1 
ATOM   2064  C CG    . PRO A 1 265 ? -27.785 -1.492  4.494   1.00 22.63  ? 573  PRO A CG    1 
ATOM   2065  C CD    . PRO A 1 265 ? -28.462 -0.248  4.993   1.00 11.18  ? 573  PRO A CD    1 
ATOM   2066  N N     . ASP A 1 266 ? -30.690 -1.672  2.515   1.00 16.23  ? 574  ASP A N     1 
ATOM   2067  C CA    . ASP A 1 266 ? -31.745 -2.457  1.872   1.00 18.79  ? 574  ASP A CA    1 
ATOM   2068  C C     . ASP A 1 266 ? -32.566 -1.622  0.877   1.00 16.97  ? 574  ASP A C     1 
ATOM   2069  O O     . ASP A 1 266 ? -33.166 -2.160  -0.059  1.00 14.93  ? 574  ASP A O     1 
ATOM   2070  C CB    . ASP A 1 266 ? -32.669 -3.076  2.936   1.00 20.88  ? 574  ASP A CB    1 
ATOM   2071  C CG    . ASP A 1 266 ? -33.744 -3.961  2.331   1.00 31.84  ? 574  ASP A CG    1 
ATOM   2072  O OD1   . ASP A 1 266 ? -33.407 -4.754  1.434   1.00 21.00  ? 574  ASP A OD1   1 
ATOM   2073  O OD2   . ASP A 1 266 ? -34.921 -3.861  2.739   1.00 19.75  ? 574  ASP A OD2   1 
ATOM   2074  N N     . LYS A 1 267 ? -32.591 -0.308  1.074   1.00 14.23  ? 575  LYS A N     1 
ATOM   2075  C CA    . LYS A 1 267 ? -33.449 0.560   0.265   1.00 20.92  ? 575  LYS A CA    1 
ATOM   2076  C C     . LYS A 1 267 ? -32.704 1.698   -0.431  1.00 22.04  ? 575  LYS A C     1 
ATOM   2077  O O     . LYS A 1 267 ? -33.274 2.395   -1.278  1.00 21.46  ? 575  LYS A O     1 
ATOM   2078  C CB    . LYS A 1 267 ? -34.568 1.157   1.123   1.00 16.91  ? 575  LYS A CB    1 
ATOM   2079  C CG    . LYS A 1 267 ? -35.531 0.136   1.719   1.00 19.02  ? 575  LYS A CG    1 
ATOM   2080  C CD    . LYS A 1 267 ? -36.418 -0.497  0.660   1.00 20.69  ? 575  LYS A CD    1 
ATOM   2081  C CE    . LYS A 1 267 ? -37.429 -1.441  1.295   1.00 26.76  ? 575  LYS A CE    1 
ATOM   2082  N NZ    . LYS A 1 267 ? -38.275 -2.121  0.279   1.00 28.43  ? 575  LYS A NZ    1 
ATOM   2083  N N     . PHE A 1 268 ? -31.445 1.905   -0.061  1.00 13.03  ? 576  PHE A N     1 
ATOM   2084  C CA    . PHE A 1 268 ? -30.664 3.009   -0.625  1.00 11.38  ? 576  PHE A CA    1 
ATOM   2085  C C     . PHE A 1 268 ? -29.260 2.553   -0.962  1.00 17.33  ? 576  PHE A C     1 
ATOM   2086  O O     . PHE A 1 268 ? -28.690 1.696   -0.287  1.00 16.06  ? 576  PHE A O     1 
ATOM   2087  C CB    . PHE A 1 268 ? -30.620 4.195   0.353   1.00 13.60  ? 576  PHE A CB    1 
ATOM   2088  C CG    . PHE A 1 268 ? -31.965 4.762   0.644   1.00 15.70  ? 576  PHE A CG    1 
ATOM   2089  C CD1   . PHE A 1 268 ? -32.458 5.828   -0.099  1.00 16.07  ? 576  PHE A CD1   1 
ATOM   2090  C CD2   . PHE A 1 268 ? -32.768 4.195   1.620   1.00 17.41  ? 576  PHE A CD2   1 
ATOM   2091  C CE1   . PHE A 1 268 ? -33.725 6.344   0.147   1.00 15.84  ? 576  PHE A CE1   1 
ATOM   2092  C CE2   . PHE A 1 268 ? -34.034 4.698   1.870   1.00 14.07  ? 576  PHE A CE2   1 
ATOM   2093  C CZ    . PHE A 1 268 ? -34.514 5.782   1.128   1.00 14.88  ? 576  PHE A CZ    1 
ATOM   2094  N N     . GLU A 1 269 ? -28.722 3.113   -2.033  1.00 14.76  ? 577  GLU A N     1 
ATOM   2095  C CA    . GLU A 1 269 ? -27.342 2.867   -2.409  1.00 18.51  ? 577  GLU A CA    1 
ATOM   2096  C C     . GLU A 1 269 ? -26.706 4.244   -2.518  1.00 17.64  ? 577  GLU A C     1 
ATOM   2097  O O     . GLU A 1 269 ? -27.127 5.063   -3.342  1.00 15.52  ? 577  GLU A O     1 
ATOM   2098  C CB    . GLU A 1 269 ? -27.258 2.131   -3.744  1.00 19.82  ? 577  GLU A CB    1 
ATOM   2099  C CG    . GLU A 1 269 ? -25.869 1.598   -4.047  1.00 22.70  ? 577  GLU A CG    1 
ATOM   2100  C CD    . GLU A 1 269 ? -25.791 0.815   -5.350  1.00 27.21  ? 577  GLU A CD    1 
ATOM   2101  O OE1   . GLU A 1 269 ? -26.781 0.780   -6.114  1.00 19.77  ? 577  GLU A OE1   1 
ATOM   2102  O OE2   . GLU A 1 269 ? -24.725 0.229   -5.609  1.00 20.34  ? 577  GLU A OE2   1 
ATOM   2103  N N     . VAL A 1 270 ? -25.708 4.499   -1.677  1.00 13.83  ? 578  VAL A N     1 
ATOM   2104  C CA    . VAL A 1 270 ? -25.167 5.854   -1.517  1.00 12.37  ? 578  VAL A CA    1 
ATOM   2105  C C     . VAL A 1 270 ? -23.867 6.037   -2.283  1.00 16.03  ? 578  VAL A C     1 
ATOM   2106  O O     . VAL A 1 270 ? -22.911 5.289   -2.084  1.00 13.76  ? 578  VAL A O     1 
ATOM   2107  C CB    . VAL A 1 270 ? -24.909 6.198   -0.025  1.00 18.83  ? 578  VAL A CB    1 
ATOM   2108  C CG1   . VAL A 1 270 ? -24.362 7.623   0.114   1.00 16.26  ? 578  VAL A CG1   1 
ATOM   2109  C CG2   . VAL A 1 270 ? -26.184 6.052   0.782   1.00 20.01  ? 578  VAL A CG2   1 
ATOM   2110  N N     . PHE A 1 271 ? -23.843 7.059   -3.136  1.00 15.08  ? 579  PHE A N     1 
ATOM   2111  C CA    . PHE A 1 271 ? -22.663 7.441   -3.886  1.00 11.48  ? 579  PHE A CA    1 
ATOM   2112  C C     . PHE A 1 271 ? -22.223 8.823   -3.424  1.00 17.01  ? 579  PHE A C     1 
ATOM   2113  O O     . PHE A 1 271 ? -23.013 9.757   -3.448  1.00 16.69  ? 579  PHE A O     1 
ATOM   2114  C CB    . PHE A 1 271 ? -22.983 7.519   -5.379  1.00 12.42  ? 579  PHE A CB    1 
ATOM   2115  C CG    . PHE A 1 271 ? -23.397 6.205   -5.998  1.00 17.34  ? 579  PHE A CG    1 
ATOM   2116  C CD1   . PHE A 1 271 ? -22.568 5.560   -6.908  1.00 13.87  ? 579  PHE A CD1   1 
ATOM   2117  C CD2   . PHE A 1 271 ? -24.626 5.641   -5.703  1.00 16.57  ? 579  PHE A CD2   1 
ATOM   2118  C CE1   . PHE A 1 271 ? -22.944 4.362   -7.496  1.00 20.17  ? 579  PHE A CE1   1 
ATOM   2119  C CE2   . PHE A 1 271 ? -25.018 4.438   -6.288  1.00 18.03  ? 579  PHE A CE2   1 
ATOM   2120  C CZ    . PHE A 1 271 ? -24.172 3.800   -7.191  1.00 18.98  ? 579  PHE A CZ    1 
ATOM   2121  N N     . CYS A 1 272 ? -20.969 8.959   -3.006  1.00 13.22  ? 580  CYS A N     1 
ATOM   2122  C CA    . CYS A 1 272 ? -20.440 10.273  -2.659  1.00 9.32   ? 580  CYS A CA    1 
ATOM   2123  C C     . CYS A 1 272 ? -19.473 10.709  -3.747  1.00 17.30  ? 580  CYS A C     1 
ATOM   2124  O O     . CYS A 1 272 ? -18.500 10.010  -4.028  1.00 14.96  ? 580  CYS A O     1 
ATOM   2125  C CB    . CYS A 1 272 ? -19.760 10.254  -1.286  1.00 8.09   ? 580  CYS A CB    1 
ATOM   2126  S SG    . CYS A 1 272 ? -20.945 10.151  0.078   1.00 17.74  ? 580  CYS A SG    1 
ATOM   2127  N N     . TYR A 1 273 ? -19.776 11.846  -4.371  1.00 14.40  ? 581  TYR A N     1 
ATOM   2128  C CA    . TYR A 1 273 ? -18.943 12.417  -5.421  1.00 11.71  ? 581  TYR A CA    1 
ATOM   2129  C C     . TYR A 1 273 ? -18.150 13.598  -4.879  1.00 13.18  ? 581  TYR A C     1 
ATOM   2130  O O     . TYR A 1 273 ? -18.691 14.683  -4.693  1.00 13.10  ? 581  TYR A O     1 
ATOM   2131  C CB    . TYR A 1 273 ? -19.797 12.847  -6.618  1.00 13.99  ? 581  TYR A CB    1 
ATOM   2132  C CG    . TYR A 1 273 ? -20.517 11.693  -7.272  1.00 17.35  ? 581  TYR A CG    1 
ATOM   2133  C CD1   . TYR A 1 273 ? -19.891 10.920  -8.248  1.00 17.29  ? 581  TYR A CD1   1 
ATOM   2134  C CD2   . TYR A 1 273 ? -21.819 11.368  -6.912  1.00 18.65  ? 581  TYR A CD2   1 
ATOM   2135  C CE1   . TYR A 1 273 ? -20.550 9.852   -8.855  1.00 14.28  ? 581  TYR A CE1   1 
ATOM   2136  C CE2   . TYR A 1 273 ? -22.482 10.300  -7.510  1.00 16.60  ? 581  TYR A CE2   1 
ATOM   2137  C CZ    . TYR A 1 273 ? -21.842 9.550   -8.477  1.00 13.46  ? 581  TYR A CZ    1 
ATOM   2138  O OH    . TYR A 1 273 ? -22.504 8.490   -9.057  1.00 18.59  ? 581  TYR A OH    1 
ATOM   2139  N N     . ALA A 1 274 ? -16.864 13.373  -4.619  1.00 11.68  ? 582  ALA A N     1 
ATOM   2140  C CA    . ALA A 1 274 ? -16.006 14.409  -4.064  1.00 14.32  ? 582  ALA A CA    1 
ATOM   2141  C C     . ALA A 1 274 ? -15.501 15.353  -5.157  1.00 13.29  ? 582  ALA A C     1 
ATOM   2142  O O     . ALA A 1 274 ? -15.006 14.909  -6.193  1.00 16.68  ? 582  ALA A O     1 
ATOM   2143  C CB    . ALA A 1 274 ? -14.840 13.777  -3.307  1.00 13.80  ? 582  ALA A CB    1 
ATOM   2144  N N     . LEU A 1 275 ? -15.639 16.656  -4.927  1.00 12.88  ? 583  LEU A N     1 
ATOM   2145  C CA    . LEU A 1 275 ? -15.134 17.646  -5.868  1.00 10.54  ? 583  LEU A CA    1 
ATOM   2146  C C     . LEU A 1 275 ? -13.749 18.149  -5.450  1.00 19.06  ? 583  LEU A C     1 
ATOM   2147  O O     . LEU A 1 275 ? -13.135 18.955  -6.148  1.00 22.27  ? 583  LEU A O     1 
ATOM   2148  C CB    . LEU A 1 275 ? -16.111 18.826  -5.996  1.00 11.31  ? 583  LEU A CB    1 
ATOM   2149  C CG    . LEU A 1 275 ? -17.550 18.483  -6.391  1.00 15.69  ? 583  LEU A CG    1 
ATOM   2150  C CD1   . LEU A 1 275 ? -18.397 19.752  -6.595  1.00 14.18  ? 583  LEU A CD1   1 
ATOM   2151  C CD2   . LEU A 1 275 ? -17.563 17.618  -7.659  1.00 13.68  ? 583  LEU A CD2   1 
ATOM   2152  N N     . SER A 1 276 ? -13.263 17.666  -4.312  1.00 12.11  ? 584  SER A N     1 
ATOM   2153  C CA    . SER A 1 276 ? -11.962 18.076  -3.804  1.00 9.61   ? 584  SER A CA    1 
ATOM   2154  C C     . SER A 1 276 ? -11.087 16.854  -3.646  1.00 13.49  ? 584  SER A C     1 
ATOM   2155  O O     . SER A 1 276 ? -11.598 15.753  -3.438  1.00 17.29  ? 584  SER A O     1 
ATOM   2156  C CB    . SER A 1 276 ? -12.105 18.781  -2.444  1.00 15.32  ? 584  SER A CB    1 
ATOM   2157  O OG    . SER A 1 276 ? -12.584 17.878  -1.455  1.00 19.82  ? 584  SER A OG    1 
ATOM   2158  N N     . PRO A 1 277 ? -9.762  17.042  -3.759  1.00 15.51  ? 585  PRO A N     1 
ATOM   2159  C CA    . PRO A 1 277 ? -8.799  15.986  -3.449  1.00 19.45  ? 585  PRO A CA    1 
ATOM   2160  C C     . PRO A 1 277 ? -8.847  15.640  -1.964  1.00 17.12  ? 585  PRO A C     1 
ATOM   2161  O O     . PRO A 1 277 ? -9.350  16.430  -1.155  1.00 12.28  ? 585  PRO A O     1 
ATOM   2162  C CB    . PRO A 1 277 ? -7.446  16.614  -3.822  1.00 23.28  ? 585  PRO A CB    1 
ATOM   2163  C CG    . PRO A 1 277 ? -7.668  18.071  -3.751  1.00 34.13  ? 585  PRO A CG    1 
ATOM   2164  C CD    . PRO A 1 277 ? -9.107  18.306  -4.134  1.00 20.74  ? 585  PRO A CD    1 
ATOM   2165  N N     . ASP A 1 278 ? -8.353  14.453  -1.628  1.00 13.90  ? 586  ASP A N     1 
ATOM   2166  C CA    . ASP A 1 278 ? -8.331  13.949  -0.259  1.00 19.73  ? 586  ASP A CA    1 
ATOM   2167  C C     . ASP A 1 278 ? -7.378  14.802  0.575   1.00 18.80  ? 586  ASP A C     1 
ATOM   2168  O O     . ASP A 1 278 ? -6.198  14.897  0.248   1.00 14.98  ? 586  ASP A O     1 
ATOM   2169  C CB    . ASP A 1 278 ? -7.864  12.487  -0.299  1.00 16.20  ? 586  ASP A CB    1 
ATOM   2170  C CG    . ASP A 1 278 ? -7.776  11.837  1.080   1.00 17.62  ? 586  ASP A CG    1 
ATOM   2171  O OD1   . ASP A 1 278 ? -7.775  12.546  2.100   1.00 17.27  ? 586  ASP A OD1   1 
ATOM   2172  O OD2   . ASP A 1 278 ? -7.690  10.595  1.132   1.00 20.55  ? 586  ASP A OD2   1 
ATOM   2173  N N     . ASP A 1 279 ? -7.881  15.427  1.639   1.00 16.54  ? 587  ASP A N     1 
ATOM   2174  C CA    . ASP A 1 279 ? -7.039  16.309  2.458   1.00 18.61  ? 587  ASP A CA    1 
ATOM   2175  C C     . ASP A 1 279 ? -6.333  15.606  3.616   1.00 19.71  ? 587  ASP A C     1 
ATOM   2176  O O     . ASP A 1 279 ? -5.703  16.257  4.444   1.00 14.31  ? 587  ASP A O     1 
ATOM   2177  C CB    . ASP A 1 279 ? -7.807  17.549  2.963   1.00 16.97  ? 587  ASP A CB    1 
ATOM   2178  C CG    . ASP A 1 279 ? -8.929  17.205  3.948   1.00 17.02  ? 587  ASP A CG    1 
ATOM   2179  O OD1   . ASP A 1 279 ? -9.120  16.013  4.277   1.00 12.57  ? 587  ASP A OD1   1 
ATOM   2180  O OD2   . ASP A 1 279 ? -9.618  18.152  4.401   1.00 11.75  ? 587  ASP A OD2   1 
ATOM   2181  N N     . GLY A 1 280 ? -6.441  14.280  3.661   1.00 17.56  ? 588  GLY A N     1 
ATOM   2182  C CA    . GLY A 1 280 ? -5.776  13.490  4.680   1.00 20.67  ? 588  GLY A CA    1 
ATOM   2183  C C     . GLY A 1 280 ? -6.457  13.451  6.045   1.00 17.24  ? 588  GLY A C     1 
ATOM   2184  O O     . GLY A 1 280 ? -5.924  12.833  6.956   1.00 20.34  ? 588  GLY A O     1 
ATOM   2185  N N     . THR A 1 281 ? -7.624  14.083  6.192   1.00 13.98  ? 589  THR A N     1 
ATOM   2186  C CA    . THR A 1 281 ? -8.271  14.159  7.506   1.00 12.92  ? 589  THR A CA    1 
ATOM   2187  C C     . THR A 1 281 ? -9.233  13.003  7.745   1.00 12.37  ? 589  THR A C     1 
ATOM   2188  O O     . THR A 1 281 ? -9.683  12.357  6.793   1.00 12.44  ? 589  THR A O     1 
ATOM   2189  C CB    . THR A 1 281 ? -9.038  15.485  7.705   1.00 10.23  ? 589  THR A CB    1 
ATOM   2190  O OG1   . THR A 1 281 ? -10.105 15.568  6.752   1.00 11.13  ? 589  THR A OG1   1 
ATOM   2191  C CG2   . THR A 1 281 ? -8.095  16.667  7.541   1.00 14.18  ? 589  THR A CG2   1 
ATOM   2192  N N     . ASN A 1 282 ? -9.557  12.753  9.013   1.00 11.20  ? 590  ASN A N     1 
ATOM   2193  C CA    . ASN A 1 282 ? -10.494 11.684  9.354   1.00 11.09  ? 590  ASN A CA    1 
ATOM   2194  C C     . ASN A 1 282 ? -11.894 11.907  8.795   1.00 12.27  ? 590  ASN A C     1 
ATOM   2195  O O     . ASN A 1 282 ? -12.664 10.956  8.652   1.00 10.03  ? 590  ASN A O     1 
ATOM   2196  C CB    . ASN A 1 282 ? -10.557 11.461  10.869  1.00 9.43   ? 590  ASN A CB    1 
ATOM   2197  C CG    . ASN A 1 282 ? -9.285  10.835  11.412  1.00 18.86  ? 590  ASN A CG    1 
ATOM   2198  O OD1   . ASN A 1 282 ? -8.434  10.397  10.644  1.00 18.18  ? 590  ASN A OD1   1 
ATOM   2199  N ND2   . ASN A 1 282 ? -9.157  10.777  12.734  1.00 11.17  ? 590  ASN A ND2   1 
ATOM   2200  N N     . PHE A 1 283 ? -12.238 13.157  8.505   1.00 10.18  ? 591  PHE A N     1 
ATOM   2201  C CA    . PHE A 1 283 ? -13.560 13.443  7.943   1.00 8.75   ? 591  PHE A CA    1 
ATOM   2202  C C     . PHE A 1 283 ? -13.670 12.795  6.566   1.00 12.91  ? 591  PHE A C     1 
ATOM   2203  O O     . PHE A 1 283 ? -14.688 12.194  6.201   1.00 10.50  ? 591  PHE A O     1 
ATOM   2204  C CB    . PHE A 1 283 ? -13.808 14.964  7.844   1.00 10.83  ? 591  PHE A CB    1 
ATOM   2205  C CG    . PHE A 1 283 ? -13.621 15.696  9.147   1.00 8.97   ? 591  PHE A CG    1 
ATOM   2206  C CD1   . PHE A 1 283 ? -14.525 15.536  10.184  1.00 8.52   ? 591  PHE A CD1   1 
ATOM   2207  C CD2   . PHE A 1 283 ? -12.521 16.534  9.339   1.00 11.17  ? 591  PHE A CD2   1 
ATOM   2208  C CE1   . PHE A 1 283 ? -14.348 16.203  11.394  1.00 12.56  ? 591  PHE A CE1   1 
ATOM   2209  C CE2   . PHE A 1 283 ? -12.332 17.197  10.544  1.00 12.71  ? 591  PHE A CE2   1 
ATOM   2210  C CZ    . PHE A 1 283 ? -13.245 17.034  11.576  1.00 10.03  ? 591  PHE A CZ    1 
ATOM   2211  N N     . ARG A 1 284 ? -12.600 12.898  5.799   1.00 11.77  ? 592  ARG A N     1 
ATOM   2212  C CA    . ARG A 1 284 ? -12.592 12.316  4.473   1.00 10.84  ? 592  ARG A CA    1 
ATOM   2213  C C     . ARG A 1 284 ? -12.506 10.786  4.583   1.00 9.23   ? 592  ARG A C     1 
ATOM   2214  O O     . ARG A 1 284 ? -13.228 10.071  3.889   1.00 11.42  ? 592  ARG A O     1 
ATOM   2215  C CB    . ARG A 1 284 ? -11.460 12.934  3.647   1.00 8.56   ? 592  ARG A CB    1 
ATOM   2216  C CG    . ARG A 1 284 ? -11.196 12.282  2.293   1.00 16.42  ? 592  ARG A CG    1 
ATOM   2217  C CD    . ARG A 1 284 ? -12.292 12.583  1.296   1.00 9.61   ? 592  ARG A CD    1 
ATOM   2218  N NE    . ARG A 1 284 ? -11.820 12.391  -0.081  1.00 11.47  ? 592  ARG A NE    1 
ATOM   2219  C CZ    . ARG A 1 284 ? -11.849 13.337  -1.018  1.00 12.45  ? 592  ARG A CZ    1 
ATOM   2220  N NH1   . ARG A 1 284 ? -12.319 14.554  -0.739  1.00 11.60  ? 592  ARG A NH1   1 
ATOM   2221  N NH2   . ARG A 1 284 ? -11.401 13.077  -2.238  1.00 10.87  ? 592  ARG A NH2   1 
ATOM   2222  N N     . VAL A 1 285 ? -11.675 10.291  5.495   1.00 9.33   ? 593  VAL A N     1 
ATOM   2223  C CA    . VAL A 1 285 ? -11.584 8.843   5.736   1.00 9.70   ? 593  VAL A CA    1 
ATOM   2224  C C     . VAL A 1 285 ? -12.966 8.258   6.029   1.00 15.70  ? 593  VAL A C     1 
ATOM   2225  O O     . VAL A 1 285 ? -13.358 7.214   5.485   1.00 10.24  ? 593  VAL A O     1 
ATOM   2226  C CB    . VAL A 1 285 ? -10.665 8.521   6.931   1.00 12.50  ? 593  VAL A CB    1 
ATOM   2227  C CG1   . VAL A 1 285 ? -10.761 7.028   7.292   1.00 13.94  ? 593  VAL A CG1   1 
ATOM   2228  C CG2   . VAL A 1 285 ? -9.212  8.915   6.622   1.00 14.70  ? 593  VAL A CG2   1 
ATOM   2229  N N     . LYS A 1 286 ? -13.709 8.928   6.901   1.00 11.84  ? 594  LYS A N     1 
ATOM   2230  C CA    . LYS A 1 286 ? -14.987 8.396   7.347   1.00 11.72  ? 594  LYS A CA    1 
ATOM   2231  C C     . LYS A 1 286 ? -15.974 8.259   6.195   1.00 12.92  ? 594  LYS A C     1 
ATOM   2232  O O     . LYS A 1 286 ? -16.584 7.208   6.009   1.00 15.12  ? 594  LYS A O     1 
ATOM   2233  C CB    . LYS A 1 286 ? -15.594 9.263   8.449   1.00 12.39  ? 594  LYS A CB    1 
ATOM   2234  C CG    . LYS A 1 286 ? -16.828 8.622   9.084   1.00 15.39  ? 594  LYS A CG    1 
ATOM   2235  C CD    . LYS A 1 286 ? -17.507 9.562   10.068  1.00 13.11  ? 594  LYS A CD    1 
ATOM   2236  C CE    . LYS A 1 286 ? -18.763 8.914   10.660  1.00 16.47  ? 594  LYS A CE    1 
ATOM   2237  N NZ    . LYS A 1 286 ? -18.431 7.692   11.455  1.00 13.98  ? 594  LYS A NZ    1 
ATOM   2238  N N     . VAL A 1 287 ? -16.145 9.325   5.427   1.00 11.42  ? 595  VAL A N     1 
ATOM   2239  C CA    . VAL A 1 287 ? -17.086 9.289   4.312   1.00 12.50  ? 595  VAL A CA    1 
ATOM   2240  C C     . VAL A 1 287 ? -16.639 8.285   3.234   1.00 13.60  ? 595  VAL A C     1 
ATOM   2241  O O     . VAL A 1 287 ? -17.460 7.563   2.680   1.00 10.48  ? 595  VAL A O     1 
ATOM   2242  C CB    . VAL A 1 287 ? -17.325 10.691  3.721   1.00 16.03  ? 595  VAL A CB    1 
ATOM   2243  C CG1   . VAL A 1 287 ? -18.207 10.603  2.491   1.00 18.47  ? 595  VAL A CG1   1 
ATOM   2244  C CG2   . VAL A 1 287 ? -17.963 11.599  4.775   1.00 19.59  ? 595  VAL A CG2   1 
ATOM   2245  N N     . MET A 1 288 ? -15.337 8.205   2.966   1.00 14.64  ? 596  MET A N     1 
ATOM   2246  C CA    . MET A 1 288 ? -14.842 7.192   2.029   1.00 16.92  ? 596  MET A CA    1 
ATOM   2247  C C     . MET A 1 288 ? -15.092 5.765   2.528   1.00 12.82  ? 596  MET A C     1 
ATOM   2248  O O     . MET A 1 288 ? -15.369 4.864   1.739   1.00 12.63  ? 596  MET A O     1 
ATOM   2249  C CB    . MET A 1 288 ? -13.353 7.398   1.721   1.00 14.55  ? 596  MET A CB    1 
ATOM   2250  C CG    . MET A 1 288 ? -13.072 8.705   1.000   1.00 15.99  ? 596  MET A CG    1 
ATOM   2251  S SD    . MET A 1 288 ? -11.335 8.915   0.613   1.00 20.38  ? 596  MET A SD    1 
ATOM   2252  C CE    . MET A 1 288 ? -11.058 7.507   -0.460  1.00 39.08  ? 596  MET A CE    1 
ATOM   2253  N N     . ALA A 1 289 ? -15.010 5.560   3.839   1.00 12.04  ? 597  ALA A N     1 
ATOM   2254  C CA    . ALA A 1 289 ? -15.188 4.224   4.404   1.00 14.77  ? 597  ALA A CA    1 
ATOM   2255  C C     . ALA A 1 289 ? -16.654 3.784   4.480   1.00 12.99  ? 597  ALA A C     1 
ATOM   2256  O O     . ALA A 1 289 ? -16.954 2.594   4.367   1.00 15.64  ? 597  ALA A O     1 
ATOM   2257  C CB    . ALA A 1 289 ? -14.544 4.139   5.790   1.00 17.83  ? 597  ALA A CB    1 
ATOM   2258  N N     . GLU A 1 290 ? -17.559 4.739   4.663   1.00 9.68   ? 598  GLU A N     1 
ATOM   2259  C CA    . GLU A 1 290 ? -18.957 4.421   4.959   1.00 15.03  ? 598  GLU A CA    1 
ATOM   2260  C C     . GLU A 1 290 ? -19.948 4.584   3.799   1.00 17.51  ? 598  GLU A C     1 
ATOM   2261  O O     . GLU A 1 290 ? -21.036 4.001   3.823   1.00 18.01  ? 598  GLU A O     1 
ATOM   2262  C CB    . GLU A 1 290 ? -19.420 5.192   6.200   1.00 12.77  ? 598  GLU A CB    1 
ATOM   2263  C CG    . GLU A 1 290 ? -18.588 4.838   7.437   1.00 11.90  ? 598  GLU A CG    1 
ATOM   2264  C CD    . GLU A 1 290 ? -19.067 5.519   8.710   1.00 11.02  ? 598  GLU A CD    1 
ATOM   2265  O OE1   . GLU A 1 290 ? -20.040 6.298   8.653   1.00 16.72  ? 598  GLU A OE1   1 
ATOM   2266  O OE2   . GLU A 1 290 ? -18.459 5.273   9.776   1.00 15.73  ? 598  GLU A OE2   1 
ATOM   2267  N N     . ALA A 1 291 ? -19.596 5.360   2.780   1.00 13.37  ? 599  ALA A N     1 
ATOM   2268  C CA    . ALA A 1 291 ? -20.476 5.417   1.614   1.00 14.42  ? 599  ALA A CA    1 
ATOM   2269  C C     . ALA A 1 291 ? -20.387 4.073   0.886   1.00 17.75  ? 599  ALA A C     1 
ATOM   2270  O O     . ALA A 1 291 ? -19.361 3.382   0.949   1.00 15.53  ? 599  ALA A O     1 
ATOM   2271  C CB    . ALA A 1 291 ? -20.100 6.566   0.686   1.00 12.30  ? 599  ALA A CB    1 
ATOM   2272  N N     . ASN A 1 292 ? -21.457 3.685   0.205   1.00 11.41  ? 600  ASN A N     1 
ATOM   2273  C CA    . ASN A 1 292 ? -21.388 2.458   -0.591  1.00 17.68  ? 600  ASN A CA    1 
ATOM   2274  C C     . ASN A 1 292 ? -20.374 2.608   -1.722  1.00 22.67  ? 600  ASN A C     1 
ATOM   2275  O O     . ASN A 1 292 ? -19.688 1.653   -2.091  1.00 19.86  ? 600  ASN A O     1 
ATOM   2276  C CB    . ASN A 1 292 ? -22.769 2.080   -1.139  1.00 17.74  ? 600  ASN A CB    1 
ATOM   2277  C CG    . ASN A 1 292 ? -23.784 1.831   -0.032  1.00 22.78  ? 600  ASN A CG    1 
ATOM   2278  O OD1   . ASN A 1 292 ? -24.823 2.482   0.028   1.00 20.39  ? 600  ASN A OD1   1 
ATOM   2279  N ND2   . ASN A 1 292 ? -23.477 0.888   0.856   1.00 24.26  ? 600  ASN A ND2   1 
ATOM   2280  N N     . HIS A 1 293 ? -20.273 3.822   -2.250  1.00 12.93  ? 601  HIS A N     1 
ATOM   2281  C CA    . HIS A 1 293 ? -19.346 4.140   -3.333  1.00 21.06  ? 601  HIS A CA    1 
ATOM   2282  C C     . HIS A 1 293 ? -18.815 5.549   -3.117  1.00 18.05  ? 601  HIS A C     1 
ATOM   2283  O O     . HIS A 1 293 ? -19.569 6.456   -2.756  1.00 17.27  ? 601  HIS A O     1 
ATOM   2284  C CB    . HIS A 1 293 ? -20.051 4.083   -4.692  1.00 17.04  ? 601  HIS A CB    1 
ATOM   2285  C CG    . HIS A 1 293 ? -20.767 2.792   -4.949  1.00 20.36  ? 601  HIS A CG    1 
ATOM   2286  N ND1   . HIS A 1 293 ? -20.114 1.642   -5.335  1.00 23.57  ? 601  HIS A ND1   1 
ATOM   2287  C CD2   . HIS A 1 293 ? -22.079 2.469   -4.863  1.00 17.64  ? 601  HIS A CD2   1 
ATOM   2288  C CE1   . HIS A 1 293 ? -20.994 0.666   -5.479  1.00 29.66  ? 601  HIS A CE1   1 
ATOM   2289  N NE2   . HIS A 1 293 ? -22.194 1.142   -5.196  1.00 24.43  ? 601  HIS A NE2   1 
ATOM   2290  N N     . PHE A 1 294 ? -17.519 5.734   -3.327  1.00 13.08  ? 602  PHE A N     1 
ATOM   2291  C CA    . PHE A 1 294 ? -16.920 7.058   -3.237  1.00 18.57  ? 602  PHE A CA    1 
ATOM   2292  C C     . PHE A 1 294 ? -16.141 7.320   -4.513  1.00 16.88  ? 602  PHE A C     1 
ATOM   2293  O O     . PHE A 1 294 ? -15.285 6.517   -4.896  1.00 18.42  ? 602  PHE A O     1 
ATOM   2294  C CB    . PHE A 1 294 ? -16.015 7.161   -2.010  1.00 18.05  ? 602  PHE A CB    1 
ATOM   2295  C CG    . PHE A 1 294 ? -15.610 8.574   -1.673  1.00 8.53   ? 602  PHE A CG    1 
ATOM   2296  C CD1   . PHE A 1 294 ? -16.277 9.274   -0.688  1.00 12.03  ? 602  PHE A CD1   1 
ATOM   2297  C CD2   . PHE A 1 294 ? -14.561 9.185   -2.334  1.00 17.76  ? 602  PHE A CD2   1 
ATOM   2298  C CE1   . PHE A 1 294 ? -15.912 10.572  -0.371  1.00 18.14  ? 602  PHE A CE1   1 
ATOM   2299  C CE2   . PHE A 1 294 ? -14.185 10.480  -2.023  1.00 18.46  ? 602  PHE A CE2   1 
ATOM   2300  C CZ    . PHE A 1 294 ? -14.864 11.173  -1.037  1.00 17.83  ? 602  PHE A CZ    1 
ATOM   2301  N N     . ILE A 1 295 ? -16.458 8.435   -5.176  1.00 14.49  ? 603  ILE A N     1 
ATOM   2302  C CA    . ILE A 1 295 ? -15.894 8.774   -6.486  1.00 16.81  ? 603  ILE A CA    1 
ATOM   2303  C C     . ILE A 1 295 ? -15.186 10.123  -6.421  1.00 15.64  ? 603  ILE A C     1 
ATOM   2304  O O     . ILE A 1 295 ? -15.797 11.142  -6.091  1.00 15.47  ? 603  ILE A O     1 
ATOM   2305  C CB    . ILE A 1 295 ? -16.988 8.850   -7.586  1.00 19.78  ? 603  ILE A CB    1 
ATOM   2306  C CG1   . ILE A 1 295 ? -17.731 7.518   -7.715  1.00 18.27  ? 603  ILE A CG1   1 
ATOM   2307  C CG2   . ILE A 1 295 ? -16.375 9.230   -8.935  1.00 17.16  ? 603  ILE A CG2   1 
ATOM   2308  C CD1   . ILE A 1 295 ? -18.826 7.322   -6.684  1.00 19.49  ? 603  ILE A CD1   1 
ATOM   2309  N N     . ASP A 1 296 ? -13.891 10.131  -6.718  1.00 18.25  ? 604  ASP A N     1 
ATOM   2310  C CA    . ASP A 1 296 ? -13.113 11.364  -6.638  1.00 19.22  ? 604  ASP A CA    1 
ATOM   2311  C C     . ASP A 1 296 ? -13.190 12.126  -7.948  1.00 20.56  ? 604  ASP A C     1 
ATOM   2312  O O     . ASP A 1 296 ? -12.399 11.894  -8.862  1.00 16.23  ? 604  ASP A O     1 
ATOM   2313  C CB    . ASP A 1 296 ? -11.656 11.059  -6.277  1.00 22.56  ? 604  ASP A CB    1 
ATOM   2314  C CG    . ASP A 1 296 ? -10.824 12.316  -6.098  1.00 29.10  ? 604  ASP A CG    1 
ATOM   2315  O OD1   . ASP A 1 296 ? -11.383 13.432  -6.218  1.00 20.12  ? 604  ASP A OD1   1 
ATOM   2316  O OD2   . ASP A 1 296 ? -9.609  12.186  -5.830  1.00 25.96  ? 604  ASP A OD2   1 
ATOM   2317  N N     . LEU A 1 297 ? -14.146 13.045  -8.049  1.00 12.33  ? 605  LEU A N     1 
ATOM   2318  C CA    . LEU A 1 297 ? -14.300 13.805  -9.285  1.00 14.19  ? 605  LEU A CA    1 
ATOM   2319  C C     . LEU A 1 297 ? -13.248 14.912  -9.423  1.00 20.78  ? 605  LEU A C     1 
ATOM   2320  O O     . LEU A 1 297 ? -13.160 15.558  -10.465 1.00 19.64  ? 605  LEU A O     1 
ATOM   2321  C CB    . LEU A 1 297 ? -15.708 14.405  -9.392  1.00 18.42  ? 605  LEU A CB    1 
ATOM   2322  C CG    . LEU A 1 297 ? -16.879 13.424  -9.530  1.00 17.88  ? 605  LEU A CG    1 
ATOM   2323  C CD1   . LEU A 1 297 ? -18.181 14.206  -9.683  1.00 14.57  ? 605  LEU A CD1   1 
ATOM   2324  C CD2   . LEU A 1 297 ? -16.671 12.470  -10.705 1.00 15.18  ? 605  LEU A CD2   1 
ATOM   2325  N N     . SER A 1 298 ? -12.461 15.145  -8.376  1.00 21.85  ? 606  SER A N     1 
ATOM   2326  C CA    . SER A 1 298 ? -11.386 16.131  -8.485  1.00 21.45  ? 606  SER A CA    1 
ATOM   2327  C C     . SER A 1 298 ? -10.403 15.661  -9.552  1.00 23.44  ? 606  SER A C     1 
ATOM   2328  O O     . SER A 1 298 ? -9.701  16.469  -10.149 1.00 19.43  ? 606  SER A O     1 
ATOM   2329  C CB    . SER A 1 298 ? -10.677 16.377  -7.138  1.00 14.64  ? 606  SER A CB    1 
ATOM   2330  O OG    . SER A 1 298 ? -9.783  15.325  -6.805  1.00 22.69  ? 606  SER A OG    1 
ATOM   2331  N N     . GLN A 1 299 ? -10.393 14.354  -9.811  1.00 15.74  ? 607  GLN A N     1 
ATOM   2332  C CA    . GLN A 1 299 ? -9.500  13.754  -10.812 1.00 24.07  ? 607  GLN A CA    1 
ATOM   2333  C C     . GLN A 1 299 ? -10.081 13.793  -12.224 1.00 23.38  ? 607  GLN A C     1 
ATOM   2334  O O     . GLN A 1 299 ? -9.436  13.373  -13.187 1.00 24.23  ? 607  GLN A O     1 
ATOM   2335  C CB    . GLN A 1 299 ? -9.197  12.297  -10.443 1.00 30.91  ? 607  GLN A CB    1 
ATOM   2336  C CG    . GLN A 1 299 ? -8.642  12.103  -9.044  1.00 44.48  ? 607  GLN A CG    1 
ATOM   2337  C CD    . GLN A 1 299 ? -7.137  12.235  -8.989  1.00 65.42  ? 607  GLN A CD    1 
ATOM   2338  O OE1   . GLN A 1 299 ? -6.570  13.208  -9.482  1.00 69.25  ? 607  GLN A OE1   1 
ATOM   2339  N NE2   . GLN A 1 299 ? -6.477  11.247  -8.392  1.00 78.86  ? 607  GLN A NE2   1 
ATOM   2340  N N     . ILE A 1 300 ? -11.309 14.284  -12.337 1.00 24.72  ? 608  ILE A N     1 
ATOM   2341  C CA    . ILE A 1 300 ? -12.013 14.340  -13.610 1.00 30.02  ? 608  ILE A CA    1 
ATOM   2342  C C     . ILE A 1 300 ? -12.481 15.777  -13.860 1.00 23.10  ? 608  ILE A C     1 
ATOM   2343  O O     . ILE A 1 300 ? -13.633 16.120  -13.591 1.00 25.69  ? 608  ILE A O     1 
ATOM   2344  C CB    . ILE A 1 300 ? -13.226 13.383  -13.608 1.00 22.40  ? 608  ILE A CB    1 
ATOM   2345  C CG1   . ILE A 1 300 ? -12.794 11.982  -13.161 1.00 30.09  ? 608  ILE A CG1   1 
ATOM   2346  C CG2   . ILE A 1 300 ? -13.879 13.330  -14.983 1.00 27.91  ? 608  ILE A CG2   1 
ATOM   2347  C CD1   . ILE A 1 300 ? -13.902 10.933  -13.242 1.00 24.06  ? 608  ILE A CD1   1 
ATOM   2348  N N     . PRO A 1 301 ? -11.574 16.628  -14.361 1.00 28.38  ? 609  PRO A N     1 
ATOM   2349  C CA    . PRO A 1 301 ? -11.858 18.062  -14.520 1.00 33.50  ? 609  PRO A CA    1 
ATOM   2350  C C     . PRO A 1 301 ? -12.968 18.365  -15.527 1.00 36.63  ? 609  PRO A C     1 
ATOM   2351  O O     . PRO A 1 301 ? -13.705 19.336  -15.338 1.00 29.92  ? 609  PRO A O     1 
ATOM   2352  C CB    . PRO A 1 301 ? -10.520 18.635  -15.007 1.00 45.30  ? 609  PRO A CB    1 
ATOM   2353  C CG    . PRO A 1 301 ? -9.772  17.467  -15.564 1.00 37.98  ? 609  PRO A CG    1 
ATOM   2354  C CD    . PRO A 1 301 ? -10.182 16.301  -14.713 1.00 34.13  ? 609  PRO A CD    1 
ATOM   2355  N N     . CYS A 1 302 ? -13.093 17.555  -16.575 1.00 27.66  ? 610  CYS A N     1 
ATOM   2356  C CA    . CYS A 1 302 ? -14.133 17.785  -17.572 1.00 32.62  ? 610  CYS A CA    1 
ATOM   2357  C C     . CYS A 1 302 ? -15.528 17.538  -16.991 1.00 32.33  ? 610  CYS A C     1 
ATOM   2358  O O     . CYS A 1 302 ? -15.842 16.433  -16.554 1.00 25.84  ? 610  CYS A O     1 
ATOM   2359  C CB    . CYS A 1 302 ? -13.917 16.904  -18.805 1.00 26.73  ? 610  CYS A CB    1 
ATOM   2360  S SG    . CYS A 1 302 ? -15.197 17.134  -20.048 1.00 38.59  ? 610  CYS A SG    1 
ATOM   2361  N N     . ASN A 1 303 ? -16.366 18.569  -16.984 1.00 26.90  ? 611  ASN A N     1 
ATOM   2362  C CA    . ASN A 1 303 ? -17.723 18.417  -16.466 1.00 22.12  ? 611  ASN A CA    1 
ATOM   2363  C C     . ASN A 1 303 ? -18.576 17.446  -17.286 1.00 26.87  ? 611  ASN A C     1 
ATOM   2364  O O     . ASN A 1 303 ? -19.495 16.815  -16.757 1.00 21.56  ? 611  ASN A O     1 
ATOM   2365  C CB    . ASN A 1 303 ? -18.406 19.776  -16.318 1.00 19.98  ? 611  ASN A CB    1 
ATOM   2366  C CG    . ASN A 1 303 ? -17.817 20.595  -15.183 1.00 20.10  ? 611  ASN A CG    1 
ATOM   2367  O OD1   . ASN A 1 303 ? -17.505 20.066  -14.113 1.00 27.48  ? 611  ASN A OD1   1 
ATOM   2368  N ND2   . ASN A 1 303 ? -17.655 21.888  -15.414 1.00 22.55  ? 611  ASN A ND2   1 
ATOM   2369  N N     . GLY A 1 304 ? -18.262 17.324  -18.571 1.00 22.11  ? 612  GLY A N     1 
ATOM   2370  C CA    . GLY A 1 304 ? -18.934 16.364  -19.429 1.00 24.30  ? 612  GLY A CA    1 
ATOM   2371  C C     . GLY A 1 304 ? -18.607 14.932  -19.041 1.00 28.92  ? 612  GLY A C     1 
ATOM   2372  O O     . GLY A 1 304 ? -19.496 14.103  -18.870 1.00 24.00  ? 612  GLY A O     1 
ATOM   2373  N N     . LYS A 1 305 ? -17.320 14.636  -18.896 1.00 20.42  ? 613  LYS A N     1 
ATOM   2374  C CA    . LYS A 1 305 ? -16.902 13.300  -18.490 1.00 20.78  ? 613  LYS A CA    1 
ATOM   2375  C C     . LYS A 1 305 ? -17.363 12.986  -17.068 1.00 22.89  ? 613  LYS A C     1 
ATOM   2376  O O     . LYS A 1 305 ? -17.770 11.864  -16.781 1.00 21.06  ? 613  LYS A O     1 
ATOM   2377  C CB    . LYS A 1 305 ? -15.387 13.138  -18.627 1.00 27.60  ? 613  LYS A CB    1 
ATOM   2378  C CG    . LYS A 1 305 ? -14.897 13.270  -20.072 1.00 39.61  ? 613  LYS A CG    1 
ATOM   2379  C CD    . LYS A 1 305 ? -13.382 13.184  -20.172 1.00 49.79  ? 613  LYS A CD    1 
ATOM   2380  C CE    . LYS A 1 305 ? -12.916 13.416  -21.604 1.00 61.89  ? 613  LYS A CE    1 
ATOM   2381  N NZ    . LYS A 1 305 ? -11.431 13.421  -21.708 1.00 65.70  ? 613  LYS A NZ    1 
ATOM   2382  N N     . ALA A 1 306 ? -17.319 13.977  -16.185 1.00 22.99  ? 614  ALA A N     1 
ATOM   2383  C CA    . ALA A 1 306 ? -17.774 13.773  -14.810 1.00 16.51  ? 614  ALA A CA    1 
ATOM   2384  C C     . ALA A 1 306 ? -19.284 13.506  -14.742 1.00 18.21  ? 614  ALA A C     1 
ATOM   2385  O O     . ALA A 1 306 ? -19.728 12.615  -14.017 1.00 20.88  ? 614  ALA A O     1 
ATOM   2386  C CB    . ALA A 1 306 ? -17.389 14.959  -13.927 1.00 19.10  ? 614  ALA A CB    1 
ATOM   2387  N N     . ALA A 1 307 ? -20.071 14.273  -15.496 1.00 24.92  ? 615  ALA A N     1 
ATOM   2388  C CA    . ALA A 1 307 ? -21.512 14.029  -15.562 1.00 20.59  ? 615  ALA A CA    1 
ATOM   2389  C C     . ALA A 1 307 ? -21.821 12.660  -16.167 1.00 28.68  ? 615  ALA A C     1 
ATOM   2390  O O     . ALA A 1 307 ? -22.763 11.986  -15.745 1.00 19.08  ? 615  ALA A O     1 
ATOM   2391  C CB    . ALA A 1 307 ? -22.215 15.127  -16.353 1.00 15.50  ? 615  ALA A CB    1 
ATOM   2392  N N     . ASP A 1 308 ? -21.041 12.257  -17.170 1.00 24.35  ? 616  ASP A N     1 
ATOM   2393  C CA    . ASP A 1 308 ? -21.205 10.933  -17.764 1.00 21.59  ? 616  ASP A CA    1 
ATOM   2394  C C     . ASP A 1 308 ? -21.025 9.877   -16.693 1.00 21.15  ? 616  ASP A C     1 
ATOM   2395  O O     . ASP A 1 308 ? -21.753 8.886   -16.654 1.00 23.91  ? 616  ASP A O     1 
ATOM   2396  C CB    . ASP A 1 308 ? -20.191 10.707  -18.893 1.00 22.71  ? 616  ASP A CB    1 
ATOM   2397  C CG    . ASP A 1 308 ? -20.573 11.421  -20.173 1.00 30.69  ? 616  ASP A CG    1 
ATOM   2398  O OD1   . ASP A 1 308 ? -19.783 11.370  -21.138 1.00 32.45  ? 616  ASP A OD1   1 
ATOM   2399  O OD2   . ASP A 1 308 ? -21.665 12.024  -20.222 1.00 33.05  ? 616  ASP A OD2   1 
ATOM   2400  N N     . ARG A 1 309 ? -20.045 10.101  -15.822 1.00 21.62  ? 617  ARG A N     1 
ATOM   2401  C CA    . ARG A 1 309 ? -19.746 9.167   -14.741 1.00 25.44  ? 617  ARG A CA    1 
ATOM   2402  C C     . ARG A 1 309 ? -20.916 9.034   -13.769 1.00 26.62  ? 617  ARG A C     1 
ATOM   2403  O O     . ARG A 1 309 ? -21.296 7.926   -13.371 1.00 23.47  ? 617  ARG A O     1 
ATOM   2404  C CB    . ARG A 1 309 ? -18.490 9.621   -13.993 1.00 23.75  ? 617  ARG A CB    1 
ATOM   2405  C CG    . ARG A 1 309 ? -18.109 8.727   -12.838 1.00 30.54  ? 617  ARG A CG    1 
ATOM   2406  C CD    . ARG A 1 309 ? -17.707 7.327   -13.294 1.00 36.32  ? 617  ARG A CD    1 
ATOM   2407  N NE    . ARG A 1 309 ? -17.270 6.556   -12.138 1.00 47.63  ? 617  ARG A NE    1 
ATOM   2408  C CZ    . ARG A 1 309 ? -16.033 6.586   -11.659 1.00 32.15  ? 617  ARG A CZ    1 
ATOM   2409  N NH1   . ARG A 1 309 ? -15.108 7.323   -12.265 1.00 28.56  ? 617  ARG A NH1   1 
ATOM   2410  N NH2   . ARG A 1 309 ? -15.720 5.870   -10.590 1.00 40.08  ? 617  ARG A NH2   1 
ATOM   2411  N N     . ILE A 1 310 ? -21.490 10.171  -13.386 1.00 18.15  ? 618  ILE A N     1 
ATOM   2412  C CA    . ILE A 1 310 ? -22.653 10.175  -12.509 1.00 16.23  ? 618  ILE A CA    1 
ATOM   2413  C C     . ILE A 1 310 ? -23.840 9.442   -13.128 1.00 21.65  ? 618  ILE A C     1 
ATOM   2414  O O     . ILE A 1 310 ? -24.520 8.663   -12.462 1.00 25.81  ? 618  ILE A O     1 
ATOM   2415  C CB    . ILE A 1 310 ? -23.071 11.620  -12.169 1.00 17.50  ? 618  ILE A CB    1 
ATOM   2416  C CG1   . ILE A 1 310 ? -21.982 12.299  -11.337 1.00 15.25  ? 618  ILE A CG1   1 
ATOM   2417  C CG2   . ILE A 1 310 ? -24.399 11.646  -11.427 1.00 17.75  ? 618  ILE A CG2   1 
ATOM   2418  C CD1   . ILE A 1 310 ? -22.239 13.796  -11.104 1.00 16.17  ? 618  ILE A CD1   1 
ATOM   2419  N N     . HIS A 1 311 ? -24.092 9.699   -14.408 1.00 22.98  ? 619  HIS A N     1 
ATOM   2420  C CA    . HIS A 1 311 ? -25.204 9.064   -15.101 1.00 21.40  ? 619  HIS A CA    1 
ATOM   2421  C C     . HIS A 1 311 ? -24.971 7.562   -15.262 1.00 23.19  ? 619  HIS A C     1 
ATOM   2422  O O     . HIS A 1 311 ? -25.901 6.765   -15.171 1.00 26.05  ? 619  HIS A O     1 
ATOM   2423  C CB    . HIS A 1 311 ? -25.421 9.708   -16.472 1.00 26.94  ? 619  HIS A CB    1 
ATOM   2424  C CG    . HIS A 1 311 ? -26.403 8.974   -17.325 1.00 31.74  ? 619  HIS A CG    1 
ATOM   2425  N ND1   . HIS A 1 311 ? -26.018 8.146   -18.358 1.00 35.52  ? 619  HIS A ND1   1 
ATOM   2426  C CD2   . HIS A 1 311 ? -27.755 8.927   -17.288 1.00 26.67  ? 619  HIS A CD2   1 
ATOM   2427  C CE1   . HIS A 1 311 ? -27.093 7.630   -18.928 1.00 37.69  ? 619  HIS A CE1   1 
ATOM   2428  N NE2   . HIS A 1 311 ? -28.159 8.085   -18.295 1.00 29.93  ? 619  HIS A NE2   1 
ATOM   2429  N N     . GLN A 1 312 ? -23.725 7.176   -15.502 1.00 25.99  ? 620  GLN A N     1 
ATOM   2430  C CA    . GLN A 1 312 ? -23.405 5.760   -15.648 1.00 26.00  ? 620  GLN A CA    1 
ATOM   2431  C C     . GLN A 1 312 ? -23.655 5.016   -14.332 1.00 32.34  ? 620  GLN A C     1 
ATOM   2432  O O     . GLN A 1 312 ? -24.045 3.847   -14.331 1.00 24.20  ? 620  GLN A O     1 
ATOM   2433  C CB    . GLN A 1 312 ? -21.961 5.576   -16.115 1.00 24.97  ? 620  GLN A CB    1 
ATOM   2434  C CG    . GLN A 1 312 ? -21.703 4.230   -16.762 1.00 50.86  ? 620  GLN A CG    1 
ATOM   2435  C CD    . GLN A 1 312 ? -22.649 3.957   -17.922 1.00 68.94  ? 620  GLN A CD    1 
ATOM   2436  O OE1   . GLN A 1 312 ? -22.614 4.646   -18.943 1.00 77.15  ? 620  GLN A OE1   1 
ATOM   2437  N NE2   . GLN A 1 312 ? -23.508 2.957   -17.763 1.00 68.74  ? 620  GLN A NE2   1 
ATOM   2438  N N     . ASP A 1 313 ? -23.447 5.699   -13.211 1.00 22.92  ? 621  ASP A N     1 
ATOM   2439  C CA    . ASP A 1 313 ? -23.711 5.084   -11.909 1.00 19.46  ? 621  ASP A CA    1 
ATOM   2440  C C     . ASP A 1 313 ? -25.206 4.873   -11.647 1.00 24.68  ? 621  ASP A C     1 
ATOM   2441  O O     . ASP A 1 313 ? -25.580 4.179   -10.704 1.00 26.76  ? 621  ASP A O     1 
ATOM   2442  C CB    . ASP A 1 313 ? -23.104 5.916   -10.779 1.00 21.15  ? 621  ASP A CB    1 
ATOM   2443  C CG    . ASP A 1 313 ? -21.604 5.791   -10.712 1.00 26.16  ? 621  ASP A CG    1 
ATOM   2444  O OD1   . ASP A 1 313 ? -21.079 4.764   -11.188 1.00 20.91  ? 621  ASP A OD1   1 
ATOM   2445  O OD2   . ASP A 1 313 ? -20.955 6.716   -10.179 1.00 25.35  ? 621  ASP A OD2   1 
ATOM   2446  N N     . GLY A 1 314 ? -26.056 5.487   -12.463 1.00 22.19  ? 622  GLY A N     1 
ATOM   2447  C CA    . GLY A 1 314 ? -27.487 5.257   -12.370 1.00 18.97  ? 622  GLY A CA    1 
ATOM   2448  C C     . GLY A 1 314 ? -28.205 6.061   -11.291 1.00 21.51  ? 622  GLY A C     1 
ATOM   2449  O O     . GLY A 1 314 ? -29.294 5.689   -10.851 1.00 19.16  ? 622  GLY A O     1 
ATOM   2450  N N     . ILE A 1 315 ? -27.607 7.173   -10.878 1.00 16.76  ? 623  ILE A N     1 
ATOM   2451  C CA    . ILE A 1 315 ? -28.168 8.007   -9.816  1.00 18.73  ? 623  ILE A CA    1 
ATOM   2452  C C     . ILE A 1 315 ? -29.634 8.411   -10.059 1.00 21.34  ? 623  ILE A C     1 
ATOM   2453  O O     . ILE A 1 315 ? -29.978 8.920   -11.129 1.00 17.12  ? 623  ILE A O     1 
ATOM   2454  C CB    . ILE A 1 315 ? -27.320 9.289   -9.613  1.00 17.71  ? 623  ILE A CB    1 
ATOM   2455  C CG1   . ILE A 1 315 ? -25.861 8.925   -9.297  1.00 17.64  ? 623  ILE A CG1   1 
ATOM   2456  C CG2   . ILE A 1 315 ? -27.919 10.173  -8.518  1.00 21.15  ? 623  ILE A CG2   1 
ATOM   2457  C CD1   . ILE A 1 315 ? -25.713 7.922   -8.179  1.00 13.64  ? 623  ILE A CD1   1 
ATOM   2458  N N     . HIS A 1 316 ? -30.481 8.198   -9.051  1.00 15.83  ? 624  HIS A N     1 
ATOM   2459  C CA    . HIS A 1 316 ? -31.878 8.647   -9.087  1.00 18.58  ? 624  HIS A CA    1 
ATOM   2460  C C     . HIS A 1 316 ? -32.033 10.072  -8.554  1.00 19.05  ? 624  HIS A C     1 
ATOM   2461  O O     . HIS A 1 316 ? -32.701 10.905  -9.167  1.00 18.54  ? 624  HIS A O     1 
ATOM   2462  C CB    . HIS A 1 316 ? -32.766 7.713   -8.260  1.00 19.82  ? 624  HIS A CB    1 
ATOM   2463  C CG    . HIS A 1 316 ? -32.799 6.304   -8.765  1.00 16.97  ? 624  HIS A CG    1 
ATOM   2464  N ND1   . HIS A 1 316 ? -32.112 5.275   -8.153  1.00 16.08  ? 624  HIS A ND1   1 
ATOM   2465  C CD2   . HIS A 1 316 ? -33.431 5.755   -9.830  1.00 22.59  ? 624  HIS A CD2   1 
ATOM   2466  C CE1   . HIS A 1 316 ? -32.322 4.154   -8.819  1.00 19.17  ? 624  HIS A CE1   1 
ATOM   2467  N NE2   . HIS A 1 316 ? -33.117 4.418   -9.842  1.00 21.81  ? 624  HIS A NE2   1 
ATOM   2468  N N     . ILE A 1 317 ? -31.437 10.338  -7.393  1.00 16.67  ? 625  ILE A N     1 
ATOM   2469  C CA    . ILE A 1 317 ? -31.484 11.674  -6.798  1.00 14.26  ? 625  ILE A CA    1 
ATOM   2470  C C     . ILE A 1 317 ? -30.065 12.194  -6.576  1.00 15.90  ? 625  ILE A C     1 
ATOM   2471  O O     . ILE A 1 317 ? -29.285 11.591  -5.834  1.00 16.27  ? 625  ILE A O     1 
ATOM   2472  C CB    . ILE A 1 317 ? -32.225 11.653  -5.455  1.00 19.11  ? 625  ILE A CB    1 
ATOM   2473  C CG1   . ILE A 1 317 ? -33.659 11.149  -5.650  1.00 18.37  ? 625  ILE A CG1   1 
ATOM   2474  C CG2   . ILE A 1 317 ? -32.184 13.028  -4.791  1.00 19.79  ? 625  ILE A CG2   1 
ATOM   2475  C CD1   . ILE A 1 317 ? -34.455 11.080  -4.363  1.00 24.63  ? 625  ILE A CD1   1 
ATOM   2476  N N     . LEU A 1 318 ? -29.725 13.291  -7.242  1.00 14.72  ? 626  LEU A N     1 
ATOM   2477  C CA    . LEU A 1 318 ? -28.394 13.878  -7.114  1.00 16.37  ? 626  LEU A CA    1 
ATOM   2478  C C     . LEU A 1 318 ? -28.509 15.094  -6.216  1.00 13.38  ? 626  LEU A C     1 
ATOM   2479  O O     . LEU A 1 318 ? -29.388 15.933  -6.414  1.00 14.96  ? 626  LEU A O     1 
ATOM   2480  C CB    . LEU A 1 318 ? -27.840 14.274  -8.485  1.00 17.26  ? 626  LEU A CB    1 
ATOM   2481  C CG    . LEU A 1 318 ? -26.345 14.604  -8.537  1.00 11.27  ? 626  LEU A CG    1 
ATOM   2482  C CD1   . LEU A 1 318 ? -25.510 13.372  -8.232  1.00 8.98   ? 626  LEU A CD1   1 
ATOM   2483  C CD2   . LEU A 1 318 ? -25.963 15.201  -9.889  1.00 16.75  ? 626  LEU A CD2   1 
ATOM   2484  N N     . VAL A 1 319 ? -27.635 15.179  -5.219  1.00 12.13  ? 627  VAL A N     1 
ATOM   2485  C CA    . VAL A 1 319 ? -27.781 16.175  -4.165  1.00 14.14  ? 627  VAL A CA    1 
ATOM   2486  C C     . VAL A 1 319 ? -26.666 17.214  -4.208  1.00 15.84  ? 627  VAL A C     1 
ATOM   2487  O O     . VAL A 1 319 ? -25.487 16.887  -4.071  1.00 13.97  ? 627  VAL A O     1 
ATOM   2488  C CB    . VAL A 1 319 ? -27.823 15.511  -2.777  1.00 16.37  ? 627  VAL A CB    1 
ATOM   2489  C CG1   . VAL A 1 319 ? -27.951 16.563  -1.692  1.00 11.57  ? 627  VAL A CG1   1 
ATOM   2490  C CG2   . VAL A 1 319 ? -28.987 14.510  -2.704  1.00 10.69  ? 627  VAL A CG2   1 
ATOM   2491  N N     . ASN A 1 320 ? -27.057 18.466  -4.409  1.00 14.31  ? 628  ASN A N     1 
ATOM   2492  C CA    . ASN A 1 320 ? -26.114 19.567  -4.522  1.00 12.93  ? 628  ASN A CA    1 
ATOM   2493  C C     . ASN A 1 320 ? -25.814 20.150  -3.143  1.00 14.22  ? 628  ASN A C     1 
ATOM   2494  O O     . ASN A 1 320 ? -26.666 20.809  -2.543  1.00 14.52  ? 628  ASN A O     1 
ATOM   2495  C CB    . ASN A 1 320 ? -26.696 20.639  -5.444  1.00 16.90  ? 628  ASN A CB    1 
ATOM   2496  C CG    . ASN A 1 320 ? -25.683 21.692  -5.826  1.00 24.55  ? 628  ASN A CG    1 
ATOM   2497  O OD1   . ASN A 1 320 ? -24.715 21.920  -5.106  1.00 12.39  ? 628  ASN A OD1   1 
ATOM   2498  N ND2   . ASN A 1 320 ? -25.907 22.350  -6.962  1.00 22.04  ? 628  ASN A ND2   1 
ATOM   2499  N N     . MET A 1 321 ? -24.614 19.889  -2.630  1.00 13.34  ? 629  MET A N     1 
ATOM   2500  C CA    . MET A 1 321 ? -24.247 20.362  -1.297  1.00 6.47   ? 629  MET A CA    1 
ATOM   2501  C C     . MET A 1 321 ? -23.433 21.667  -1.317  1.00 7.10   ? 629  MET A C     1 
ATOM   2502  O O     . MET A 1 321 ? -23.046 22.162  -0.271  1.00 12.85  ? 629  MET A O     1 
ATOM   2503  C CB    . MET A 1 321 ? -23.500 19.270  -0.512  1.00 5.41   ? 629  MET A CB    1 
ATOM   2504  C CG    . MET A 1 321 ? -24.336 17.985  -0.324  1.00 9.31   ? 629  MET A CG    1 
ATOM   2505  S SD    . MET A 1 321 ? -23.400 16.580  0.307   1.00 15.03  ? 629  MET A SD    1 
ATOM   2506  C CE    . MET A 1 321 ? -22.802 17.272  1.850   1.00 17.45  ? 629  MET A CE    1 
ATOM   2507  N N     . ASN A 1 322 ? -23.161 22.204  -2.505  1.00 8.00   ? 630  ASN A N     1 
ATOM   2508  C CA    . ASN A 1 322 ? -22.361 23.430  -2.621  1.00 10.46  ? 630  ASN A CA    1 
ATOM   2509  C C     . ASN A 1 322 ? -23.152 24.695  -2.929  1.00 13.59  ? 630  ASN A C     1 
ATOM   2510  O O     . ASN A 1 322 ? -22.888 25.749  -2.361  1.00 9.03   ? 630  ASN A O     1 
ATOM   2511  C CB    . ASN A 1 322 ? -21.295 23.282  -3.713  1.00 10.21  ? 630  ASN A CB    1 
ATOM   2512  C CG    . ASN A 1 322 ? -20.021 22.632  -3.209  1.00 17.44  ? 630  ASN A CG    1 
ATOM   2513  O OD1   . ASN A 1 322 ? -19.879 21.418  -3.262  1.00 16.80  ? 630  ASN A OD1   1 
ATOM   2514  N ND2   . ASN A 1 322 ? -19.078 23.448  -2.737  1.00 14.47  ? 630  ASN A ND2   1 
ATOM   2515  N N     . GLY A 1 323 ? -24.098 24.610  -3.858  1.00 17.58  ? 631  GLY A N     1 
ATOM   2516  C CA    . GLY A 1 323 ? -24.656 25.832  -4.418  1.00 15.86  ? 631  GLY A CA    1 
ATOM   2517  C C     . GLY A 1 323 ? -23.520 26.740  -4.884  1.00 19.52  ? 631  GLY A C     1 
ATOM   2518  O O     . GLY A 1 323 ? -22.527 26.274  -5.445  1.00 14.79  ? 631  GLY A O     1 
ATOM   2519  N N     . TYR A 1 324 ? -23.648 28.039  -4.638  1.00 7.91   ? 632  TYR A N     1 
ATOM   2520  C CA    . TYR A 1 324 ? -22.619 28.976  -5.057  1.00 13.71  ? 632  TYR A CA    1 
ATOM   2521  C C     . TYR A 1 324 ? -21.558 29.206  -3.978  1.00 8.70   ? 632  TYR A C     1 
ATOM   2522  O O     . TYR A 1 324 ? -21.362 30.320  -3.524  1.00 17.86  ? 632  TYR A O     1 
ATOM   2523  C CB    . TYR A 1 324 ? -23.265 30.278  -5.548  1.00 19.57  ? 632  TYR A CB    1 
ATOM   2524  C CG    . TYR A 1 324 ? -24.309 29.976  -6.592  1.00 20.37  ? 632  TYR A CG    1 
ATOM   2525  C CD1   . TYR A 1 324 ? -23.955 29.345  -7.786  1.00 15.68  ? 632  TYR A CD1   1 
ATOM   2526  C CD2   . TYR A 1 324 ? -25.646 30.279  -6.381  1.00 13.54  ? 632  TYR A CD2   1 
ATOM   2527  C CE1   . TYR A 1 324 ? -24.908 29.039  -8.743  1.00 23.44  ? 632  TYR A CE1   1 
ATOM   2528  C CE2   . TYR A 1 324 ? -26.610 29.978  -7.343  1.00 12.07  ? 632  TYR A CE2   1 
ATOM   2529  C CZ    . TYR A 1 324 ? -26.228 29.363  -8.520  1.00 11.49  ? 632  TYR A CZ    1 
ATOM   2530  O OH    . TYR A 1 324 ? -27.166 29.043  -9.470  1.00 14.02  ? 632  TYR A OH    1 
ATOM   2531  N N     . THR A 1 325 ? -20.864 28.126  -3.605  1.00 16.28  ? 633  THR A N     1 
ATOM   2532  C CA    . THR A 1 325 ? -19.748 28.181  -2.659  1.00 10.06  ? 633  THR A CA    1 
ATOM   2533  C C     . THR A 1 325 ? -18.473 27.599  -3.245  1.00 11.45  ? 633  THR A C     1 
ATOM   2534  O O     . THR A 1 325 ? -18.499 26.864  -4.246  1.00 16.28  ? 633  THR A O     1 
ATOM   2535  C CB    . THR A 1 325 ? -20.057 27.423  -1.355  1.00 17.40  ? 633  THR A CB    1 
ATOM   2536  O OG1   . THR A 1 325 ? -20.457 26.082  -1.671  1.00 12.14  ? 633  THR A OG1   1 
ATOM   2537  C CG2   . THR A 1 325 ? -21.161 28.127  -0.531  1.00 9.18   ? 633  THR A CG2   1 
ATOM   2538  N N     . LYS A 1 326 ? -17.349 27.924  -2.610  1.00 20.41  ? 634  LYS A N     1 
ATOM   2539  C CA    . LYS A 1 326 ? -16.043 27.553  -3.136  1.00 17.77  ? 634  LYS A CA    1 
ATOM   2540  C C     . LYS A 1 326 ? -15.959 26.068  -3.488  1.00 21.87  ? 634  LYS A C     1 
ATOM   2541  O O     . LYS A 1 326 ? -16.337 25.212  -2.696  1.00 14.19  ? 634  LYS A O     1 
ATOM   2542  C CB    . LYS A 1 326 ? -14.937 27.912  -2.138  1.00 15.83  ? 634  LYS A CB    1 
ATOM   2543  C CG    . LYS A 1 326 ? -13.546 27.534  -2.621  1.00 27.02  ? 634  LYS A CG    1 
ATOM   2544  C CD    . LYS A 1 326 ? -12.471 28.324  -1.888  1.00 42.79  ? 634  LYS A CD    1 
ATOM   2545  C CE    . LYS A 1 326 ? -11.774 27.479  -0.839  1.00 45.42  ? 634  LYS A CE    1 
ATOM   2546  N NZ    . LYS A 1 326 ? -10.909 26.432  -1.447  1.00 40.82  ? 634  LYS A NZ    1 
ATOM   2547  N N     . GLY A 1 327 ? -15.451 25.770  -4.677  1.00 16.36  ? 635  GLY A N     1 
ATOM   2548  C CA    . GLY A 1 327 ? -15.239 24.394  -5.082  1.00 18.80  ? 635  GLY A CA    1 
ATOM   2549  C C     . GLY A 1 327 ? -16.411 23.797  -5.839  1.00 16.63  ? 635  GLY A C     1 
ATOM   2550  O O     . GLY A 1 327 ? -16.336 22.667  -6.314  1.00 17.06  ? 635  GLY A O     1 
ATOM   2551  N N     . ALA A 1 328 ? -17.496 24.555  -5.958  1.00 12.50  ? 636  ALA A N     1 
ATOM   2552  C CA    . ALA A 1 328 ? -18.679 24.067  -6.660  1.00 14.61  ? 636  ALA A CA    1 
ATOM   2553  C C     . ALA A 1 328 ? -18.412 23.733  -8.117  1.00 19.51  ? 636  ALA A C     1 
ATOM   2554  O O     . ALA A 1 328 ? -17.586 24.371  -8.785  1.00 15.18  ? 636  ALA A O     1 
ATOM   2555  C CB    . ALA A 1 328 ? -19.803 25.087  -6.595  1.00 14.85  ? 636  ALA A CB    1 
ATOM   2556  N N     . ARG A 1 329 ? -19.161 22.756  -8.612  1.00 13.98  ? 637  ARG A N     1 
ATOM   2557  C CA    . ARG A 1 329 ? -19.189 22.447  -10.039 1.00 18.80  ? 637  ARG A CA    1 
ATOM   2558  C C     . ARG A 1 329 ? -20.643 22.244  -10.450 1.00 21.36  ? 637  ARG A C     1 
ATOM   2559  O O     . ARG A 1 329 ? -21.074 21.147  -10.782 1.00 16.82  ? 637  ARG A O     1 
ATOM   2560  C CB    . ARG A 1 329 ? -18.331 21.224  -10.354 1.00 18.87  ? 637  ARG A CB    1 
ATOM   2561  C CG    . ARG A 1 329 ? -16.837 21.500  -10.230 1.00 19.83  ? 637  ARG A CG    1 
ATOM   2562  C CD    . ARG A 1 329 ? -16.022 20.223  -10.333 1.00 20.30  ? 637  ARG A CD    1 
ATOM   2563  N NE    . ARG A 1 329 ? -16.161 19.593  -11.644 1.00 21.46  ? 637  ARG A NE    1 
ATOM   2564  C CZ    . ARG A 1 329 ? -15.521 18.485  -12.006 1.00 19.29  ? 637  ARG A CZ    1 
ATOM   2565  N NH1   . ARG A 1 329 ? -14.689 17.899  -11.161 1.00 19.15  ? 637  ARG A NH1   1 
ATOM   2566  N NH2   . ARG A 1 329 ? -15.712 17.975  -13.213 1.00 19.32  ? 637  ARG A NH2   1 
ATOM   2567  N N     . ASN A 1 330 ? -21.402 23.332  -10.407 1.00 14.47  ? 638  ASN A N     1 
ATOM   2568  C CA    . ASN A 1 330 ? -22.825 23.270  -10.680 1.00 13.72  ? 638  ASN A CA    1 
ATOM   2569  C C     . ASN A 1 330 ? -23.124 22.947  -12.139 1.00 18.92  ? 638  ASN A C     1 
ATOM   2570  O O     . ASN A 1 330 ? -24.248 22.584  -12.477 1.00 19.99  ? 638  ASN A O     1 
ATOM   2571  C CB    . ASN A 1 330 ? -23.492 24.566  -10.215 1.00 17.13  ? 638  ASN A CB    1 
ATOM   2572  C CG    . ASN A 1 330 ? -23.396 24.741  -8.710  1.00 15.21  ? 638  ASN A CG    1 
ATOM   2573  O OD1   . ASN A 1 330 ? -23.736 23.836  -7.956  1.00 16.56  ? 638  ASN A OD1   1 
ATOM   2574  N ND2   . ASN A 1 330 ? -22.910 25.895  -8.267  1.00 16.91  ? 638  ASN A ND2   1 
ATOM   2575  N N     . GLU A 1 331 ? -22.102 23.052  -12.989 1.00 14.42  ? 639  GLU A N     1 
ATOM   2576  C CA    . GLU A 1 331 ? -22.192 22.570  -14.361 1.00 15.01  ? 639  GLU A CA    1 
ATOM   2577  C C     . GLU A 1 331 ? -22.646 21.109  -14.387 1.00 20.96  ? 639  GLU A C     1 
ATOM   2578  O O     . GLU A 1 331 ? -23.382 20.696  -15.286 1.00 18.90  ? 639  GLU A O     1 
ATOM   2579  C CB    . GLU A 1 331 ? -20.834 22.698  -15.064 1.00 26.68  ? 639  GLU A CB    1 
ATOM   2580  C CG    . GLU A 1 331 ? -20.422 24.118  -15.416 1.00 23.79  ? 639  GLU A CG    1 
ATOM   2581  C CD    . GLU A 1 331 ? -20.014 24.952  -14.207 1.00 32.69  ? 639  GLU A CD    1 
ATOM   2582  O OE1   . GLU A 1 331 ? -19.945 26.191  -14.356 1.00 42.56  ? 639  GLU A OE1   1 
ATOM   2583  O OE2   . GLU A 1 331 ? -19.761 24.384  -13.117 1.00 22.53  ? 639  GLU A OE2   1 
ATOM   2584  N N     . LEU A 1 332 ? -22.206 20.331  -13.399 1.00 20.19  ? 640  LEU A N     1 
ATOM   2585  C CA    . LEU A 1 332 ? -22.586 18.921  -13.305 1.00 16.09  ? 640  LEU A CA    1 
ATOM   2586  C C     . LEU A 1 332 ? -24.093 18.778  -13.215 1.00 17.01  ? 640  LEU A C     1 
ATOM   2587  O O     . LEU A 1 332 ? -24.674 17.908  -13.846 1.00 21.40  ? 640  LEU A O     1 
ATOM   2588  C CB    . LEU A 1 332 ? -21.937 18.248  -12.091 1.00 14.73  ? 640  LEU A CB    1 
ATOM   2589  C CG    . LEU A 1 332 ? -20.412 18.174  -12.085 1.00 18.08  ? 640  LEU A CG    1 
ATOM   2590  C CD1   . LEU A 1 332 ? -19.887 17.776  -10.708 1.00 18.41  ? 640  LEU A CD1   1 
ATOM   2591  C CD2   . LEU A 1 332 ? -19.924 17.209  -13.165 1.00 20.89  ? 640  LEU A CD2   1 
ATOM   2592  N N     . PHE A 1 333 ? -24.722 19.640  -12.423 1.00 19.30  ? 641  PHE A N     1 
ATOM   2593  C CA    . PHE A 1 333 ? -26.174 19.644  -12.296 1.00 18.76  ? 641  PHE A CA    1 
ATOM   2594  C C     . PHE A 1 333 ? -26.872 20.276  -13.507 1.00 19.38  ? 641  PHE A C     1 
ATOM   2595  O O     . PHE A 1 333 ? -27.967 19.856  -13.885 1.00 15.80  ? 641  PHE A O     1 
ATOM   2596  C CB    . PHE A 1 333 ? -26.595 20.325  -10.992 1.00 17.67  ? 641  PHE A CB    1 
ATOM   2597  C CG    . PHE A 1 333 ? -26.190 19.565  -9.758  1.00 19.20  ? 641  PHE A CG    1 
ATOM   2598  C CD1   . PHE A 1 333 ? -27.081 18.710  -9.133  1.00 13.39  ? 641  PHE A CD1   1 
ATOM   2599  C CD2   . PHE A 1 333 ? -24.911 19.693  -9.236  1.00 16.48  ? 641  PHE A CD2   1 
ATOM   2600  C CE1   . PHE A 1 333 ? -26.708 17.995  -7.981  1.00 11.06  ? 641  PHE A CE1   1 
ATOM   2601  C CE2   . PHE A 1 333 ? -24.534 18.996  -8.098  1.00 17.28  ? 641  PHE A CE2   1 
ATOM   2602  C CZ    . PHE A 1 333 ? -25.431 18.134  -7.477  1.00 14.94  ? 641  PHE A CZ    1 
ATOM   2603  N N     . ALA A 1 334 ? -26.238 21.270  -14.124 1.00 15.14  ? 642  ALA A N     1 
ATOM   2604  C CA    . ALA A 1 334 ? -26.786 21.862  -15.346 1.00 18.30  ? 642  ALA A CA    1 
ATOM   2605  C C     . ALA A 1 334 ? -26.902 20.828  -16.468 1.00 24.33  ? 642  ALA A C     1 
ATOM   2606  O O     . ALA A 1 334 ? -27.760 20.949  -17.352 1.00 16.16  ? 642  ALA A O     1 
ATOM   2607  C CB    . ALA A 1 334 ? -25.942 23.057  -15.798 1.00 20.32  ? 642  ALA A CB    1 
ATOM   2608  N N     . LEU A 1 335 ? -26.034 19.819  -16.436 1.00 15.52  ? 643  LEU A N     1 
ATOM   2609  C CA    . LEU A 1 335 ? -26.086 18.733  -17.419 1.00 19.89  ? 643  LEU A CA    1 
ATOM   2610  C C     . LEU A 1 335 ? -27.214 17.737  -17.127 1.00 25.77  ? 643  LEU A C     1 
ATOM   2611  O O     . LEU A 1 335 ? -27.543 16.903  -17.970 1.00 23.23  ? 643  LEU A O     1 
ATOM   2612  C CB    . LEU A 1 335 ? -24.739 18.011  -17.509 1.00 19.86  ? 643  LEU A CB    1 
ATOM   2613  C CG    . LEU A 1 335 ? -23.660 18.760  -18.294 1.00 22.58  ? 643  LEU A CG    1 
ATOM   2614  C CD1   . LEU A 1 335 ? -22.269 18.251  -17.926 1.00 25.41  ? 643  LEU A CD1   1 
ATOM   2615  C CD2   . LEU A 1 335 ? -23.906 18.641  -19.795 1.00 23.72  ? 643  LEU A CD2   1 
ATOM   2616  N N     . ARG A 1 336 ? -27.806 17.841  -15.937 1.00 22.14  ? 644  ARG A N     1 
ATOM   2617  C CA    . ARG A 1 336 ? -28.931 16.983  -15.538 1.00 18.47  ? 644  ARG A CA    1 
ATOM   2618  C C     . ARG A 1 336 ? -28.714 15.472  -15.750 1.00 19.61  ? 644  ARG A C     1 
ATOM   2619  O O     . ARG A 1 336 ? -29.496 14.819  -16.452 1.00 23.78  ? 644  ARG A O     1 
ATOM   2620  C CB    . ARG A 1 336 ? -30.210 17.424  -16.254 1.00 22.03  ? 644  ARG A CB    1 
ATOM   2621  C CG    . ARG A 1 336 ? -30.797 18.730  -15.735 1.00 27.87  ? 644  ARG A CG    1 
ATOM   2622  C CD    . ARG A 1 336 ? -31.993 19.159  -16.576 1.00 42.41  ? 644  ARG A CD    1 
ATOM   2623  N NE    . ARG A 1 336 ? -32.436 20.515  -16.262 1.00 56.22  ? 644  ARG A NE    1 
ATOM   2624  C CZ    . ARG A 1 336 ? -33.501 21.097  -16.806 1.00 60.05  ? 644  ARG A CZ    1 
ATOM   2625  N NH1   . ARG A 1 336 ? -34.238 20.440  -17.694 1.00 72.82  ? 644  ARG A NH1   1 
ATOM   2626  N NH2   . ARG A 1 336 ? -33.831 22.336  -16.464 1.00 44.74  ? 644  ARG A NH2   1 
ATOM   2627  N N     . PRO A 1 337 ? -27.658 14.909  -15.138 1.00 20.71  ? 645  PRO A N     1 
ATOM   2628  C CA    . PRO A 1 337 ? -27.396 13.465  -15.241 1.00 21.43  ? 645  PRO A CA    1 
ATOM   2629  C C     . PRO A 1 337 ? -28.388 12.609  -14.449 1.00 21.28  ? 645  PRO A C     1 
ATOM   2630  O O     . PRO A 1 337 ? -28.386 11.382  -14.595 1.00 23.09  ? 645  PRO A O     1 
ATOM   2631  C CB    . PRO A 1 337 ? -25.991 13.318  -14.639 1.00 19.57  ? 645  PRO A CB    1 
ATOM   2632  C CG    . PRO A 1 337 ? -25.867 14.482  -13.705 1.00 16.97  ? 645  PRO A CG    1 
ATOM   2633  C CD    . PRO A 1 337 ? -26.605 15.609  -14.382 1.00 22.67  ? 645  PRO A CD    1 
ATOM   2634  N N     . ALA A 1 338 ? -29.211 13.243  -13.616 1.00 15.78  ? 646  ALA A N     1 
ATOM   2635  C CA    . ALA A 1 338 ? -30.166 12.519  -12.781 1.00 19.69  ? 646  ALA A CA    1 
ATOM   2636  C C     . ALA A 1 338 ? -31.560 13.120  -12.910 1.00 22.12  ? 646  ALA A C     1 
ATOM   2637  O O     . ALA A 1 338 ? -31.698 14.319  -13.147 1.00 20.68  ? 646  ALA A O     1 
ATOM   2638  C CB    . ALA A 1 338 ? -29.712 12.530  -11.316 1.00 26.98  ? 646  ALA A CB    1 
ATOM   2639  N N     . PRO A 1 339 ? -32.604 12.287  -12.751 1.00 19.44  ? 647  PRO A N     1 
ATOM   2640  C CA    . PRO A 1 339 ? -33.982 12.756  -12.957 1.00 20.76  ? 647  PRO A CA    1 
ATOM   2641  C C     . PRO A 1 339 ? -34.487 13.672  -11.841 1.00 26.61  ? 647  PRO A C     1 
ATOM   2642  O O     . PRO A 1 339 ? -35.429 14.427  -12.056 1.00 22.45  ? 647  PRO A O     1 
ATOM   2643  C CB    . PRO A 1 339 ? -34.793 11.454  -12.991 1.00 23.26  ? 647  PRO A CB    1 
ATOM   2644  C CG    . PRO A 1 339 ? -33.972 10.481  -12.176 1.00 23.09  ? 647  PRO A CG    1 
ATOM   2645  C CD    . PRO A 1 339 ? -32.539 10.835  -12.494 1.00 18.83  ? 647  PRO A CD    1 
ATOM   2646  N N     . ILE A 1 340 ? -33.874 13.602  -10.664 1.00 17.75  ? 648  ILE A N     1 
ATOM   2647  C CA    . ILE A 1 340 ? -34.248 14.476  -9.558  1.00 18.39  ? 648  ILE A CA    1 
ATOM   2648  C C     . ILE A 1 340 ? -32.995 15.068  -8.937  1.00 16.72  ? 648  ILE A C     1 
ATOM   2649  O O     . ILE A 1 340 ? -32.090 14.332  -8.529  1.00 19.96  ? 648  ILE A O     1 
ATOM   2650  C CB    . ILE A 1 340 ? -34.996 13.705  -8.451  1.00 17.96  ? 648  ILE A CB    1 
ATOM   2651  C CG1   . ILE A 1 340 ? -36.259 13.041  -9.010  1.00 22.54  ? 648  ILE A CG1   1 
ATOM   2652  C CG2   . ILE A 1 340 ? -35.328 14.640  -7.289  1.00 15.72  ? 648  ILE A CG2   1 
ATOM   2653  C CD1   . ILE A 1 340 ? -36.862 11.991  -8.083  1.00 27.55  ? 648  ILE A CD1   1 
ATOM   2654  N N     . GLN A 1 341 ? -32.942 16.390  -8.853  1.00 18.50  ? 649  GLN A N     1 
ATOM   2655  C CA    . GLN A 1 341 ? -31.781 17.054  -8.280  1.00 17.96  ? 649  GLN A CA    1 
ATOM   2656  C C     . GLN A 1 341 ? -32.224 18.034  -7.185  1.00 16.94  ? 649  GLN A C     1 
ATOM   2657  O O     . GLN A 1 341 ? -33.119 18.842  -7.388  1.00 19.12  ? 649  GLN A O     1 
ATOM   2658  C CB    . GLN A 1 341 ? -30.968 17.723  -9.395  1.00 17.97  ? 649  GLN A CB    1 
ATOM   2659  C CG    . GLN A 1 341 ? -30.718 16.751  -10.553 1.00 14.95  ? 649  GLN A CG    1 
ATOM   2660  C CD    . GLN A 1 341 ? -29.721 17.243  -11.587 1.00 18.78  ? 649  GLN A CD    1 
ATOM   2661  O OE1   . GLN A 1 341 ? -28.952 16.450  -12.136 1.00 17.00  ? 649  GLN A OE1   1 
ATOM   2662  N NE2   . GLN A 1 341 ? -29.746 18.543  -11.880 1.00 14.35  ? 649  GLN A NE2   1 
ATOM   2663  N N     . ALA A 1 342 ? -31.613 17.920  -6.013  1.00 15.53  ? 650  ALA A N     1 
ATOM   2664  C CA    . ALA A 1 342 ? -32.054 18.663  -4.838  1.00 10.03  ? 650  ALA A CA    1 
ATOM   2665  C C     . ALA A 1 342 ? -30.902 19.423  -4.192  1.00 16.40  ? 650  ALA A C     1 
ATOM   2666  O O     . ALA A 1 342 ? -29.782 18.906  -4.087  1.00 13.70  ? 650  ALA A O     1 
ATOM   2667  C CB    . ALA A 1 342 ? -32.679 17.698  -3.829  1.00 12.18  ? 650  ALA A CB    1 
ATOM   2668  N N     . MET A 1 343 ? -31.181 20.647  -3.755  1.00 10.43  ? 651  MET A N     1 
ATOM   2669  C CA    . MET A 1 343 ? -30.241 21.414  -2.938  1.00 13.66  ? 651  MET A CA    1 
ATOM   2670  C C     . MET A 1 343 ? -30.341 20.963  -1.494  1.00 15.56  ? 651  MET A C     1 
ATOM   2671  O O     . MET A 1 343 ? -31.445 20.819  -0.968  1.00 11.86  ? 651  MET A O     1 
ATOM   2672  C CB    . MET A 1 343 ? -30.575 22.909  -3.020  1.00 12.11  ? 651  MET A CB    1 
ATOM   2673  C CG    . MET A 1 343 ? -30.554 23.455  -4.461  1.00 11.19  ? 651  MET A CG    1 
ATOM   2674  S SD    . MET A 1 343 ? -28.871 23.695  -5.049  1.00 18.26  ? 651  MET A SD    1 
ATOM   2675  C CE    . MET A 1 343 ? -28.267 24.865  -3.829  1.00 13.71  ? 651  MET A CE    1 
ATOM   2676  N N     . TRP A 1 344 ? -29.201 20.748  -0.840  1.00 13.69  ? 652  TRP A N     1 
ATOM   2677  C CA    . TRP A 1 344 ? -29.226 20.300  0.552   1.00 9.10   ? 652  TRP A CA    1 
ATOM   2678  C C     . TRP A 1 344 ? -28.055 20.802  1.390   1.00 15.77  ? 652  TRP A C     1 
ATOM   2679  O O     . TRP A 1 344 ? -26.895 20.526  1.079   1.00 14.27  ? 652  TRP A O     1 
ATOM   2680  C CB    . TRP A 1 344 ? -29.276 18.768  0.624   1.00 7.72   ? 652  TRP A CB    1 
ATOM   2681  C CG    . TRP A 1 344 ? -29.209 18.197  2.042   1.00 12.23  ? 652  TRP A CG    1 
ATOM   2682  C CD1   . TRP A 1 344 ? -30.095 18.411  3.063   1.00 15.10  ? 652  TRP A CD1   1 
ATOM   2683  C CD2   . TRP A 1 344 ? -28.207 17.308  2.560   1.00 9.31   ? 652  TRP A CD2   1 
ATOM   2684  N NE1   . TRP A 1 344 ? -29.698 17.713  4.194   1.00 12.12  ? 652  TRP A NE1   1 
ATOM   2685  C CE2   . TRP A 1 344 ? -28.540 17.033  3.905   1.00 11.52  ? 652  TRP A CE2   1 
ATOM   2686  C CE3   . TRP A 1 344 ? -27.054 16.724  2.017   1.00 9.65   ? 652  TRP A CE3   1 
ATOM   2687  C CZ2   . TRP A 1 344 ? -27.769 16.192  4.708   1.00 10.34  ? 652  TRP A CZ2   1 
ATOM   2688  C CZ3   . TRP A 1 344 ? -26.289 15.893  2.819   1.00 13.46  ? 652  TRP A CZ3   1 
ATOM   2689  C CH2   . TRP A 1 344 ? -26.650 15.634  4.148   1.00 13.40  ? 652  TRP A CH2   1 
ATOM   2690  N N     . LEU A 1 345 ? -28.392 21.567  2.428   1.00 9.97   ? 653  LEU A N     1 
ATOM   2691  C CA    . LEU A 1 345 ? -27.542 21.777  3.604   1.00 10.49  ? 653  LEU A CA    1 
ATOM   2692  C C     . LEU A 1 345 ? -26.373 22.754  3.432   1.00 13.30  ? 653  LEU A C     1 
ATOM   2693  O O     . LEU A 1 345 ? -26.161 23.607  4.283   1.00 8.27   ? 653  LEU A O     1 
ATOM   2694  C CB    . LEU A 1 345 ? -27.046 20.433  4.180   1.00 10.10  ? 653  LEU A CB    1 
ATOM   2695  C CG    . LEU A 1 345 ? -26.386 20.538  5.562   1.00 13.03  ? 653  LEU A CG    1 
ATOM   2696  C CD1   . LEU A 1 345 ? -27.388 21.069  6.604   1.00 10.52  ? 653  LEU A CD1   1 
ATOM   2697  C CD2   . LEU A 1 345 ? -25.763 19.213  6.027   1.00 13.91  ? 653  LEU A CD2   1 
ATOM   2698  N N     . GLY A 1 346 ? -25.613 22.631  2.351   1.00 9.80   ? 654  GLY A N     1 
ATOM   2699  C CA    . GLY A 1 346 ? -24.414 23.437  2.210   1.00 10.61  ? 654  GLY A CA    1 
ATOM   2700  C C     . GLY A 1 346 ? -24.656 24.892  1.854   1.00 14.07  ? 654  GLY A C     1 
ATOM   2701  O O     . GLY A 1 346 ? -23.867 25.759  2.212   1.00 19.51  ? 654  GLY A O     1 
ATOM   2702  N N     . TYR A 1 347 ? -25.752 25.165  1.146   1.00 8.03   ? 655  TYR A N     1 
ATOM   2703  C CA    . TYR A 1 347 ? -25.985 26.487  0.584   1.00 10.53  ? 655  TYR A CA    1 
ATOM   2704  C C     . TYR A 1 347 ? -27.293 27.070  1.130   1.00 11.20  ? 655  TYR A C     1 
ATOM   2705  O O     . TYR A 1 347 ? -28.363 26.519  0.894   1.00 16.31  ? 655  TYR A O     1 
ATOM   2706  C CB    . TYR A 1 347 ? -26.060 26.420  -0.942  1.00 9.69   ? 655  TYR A CB    1 
ATOM   2707  C CG    . TYR A 1 347 ? -26.118 27.785  -1.554  1.00 15.67  ? 655  TYR A CG    1 
ATOM   2708  C CD1   . TYR A 1 347 ? -24.996 28.606  -1.551  1.00 12.92  ? 655  TYR A CD1   1 
ATOM   2709  C CD2   . TYR A 1 347 ? -27.299 28.273  -2.107  1.00 10.50  ? 655  TYR A CD2   1 
ATOM   2710  C CE1   . TYR A 1 347 ? -25.044 29.873  -2.093  1.00 13.93  ? 655  TYR A CE1   1 
ATOM   2711  C CE2   . TYR A 1 347 ? -27.359 29.537  -2.649  1.00 14.32  ? 655  TYR A CE2   1 
ATOM   2712  C CZ    . TYR A 1 347 ? -26.227 30.334  -2.639  1.00 13.12  ? 655  TYR A CZ    1 
ATOM   2713  O OH    . TYR A 1 347 ? -26.278 31.601  -3.180  1.00 21.61  ? 655  TYR A OH    1 
ATOM   2714  N N     . PRO A 1 348 ? -27.199 28.185  1.866   1.00 16.07  ? 656  PRO A N     1 
ATOM   2715  C CA    . PRO A 1 348 ? -28.366 28.746  2.556   1.00 16.91  ? 656  PRO A CA    1 
ATOM   2716  C C     . PRO A 1 348 ? -29.115 29.782  1.714   1.00 18.64  ? 656  PRO A C     1 
ATOM   2717  O O     . PRO A 1 348 ? -29.270 30.933  2.127   1.00 16.55  ? 656  PRO A O     1 
ATOM   2718  C CB    . PRO A 1 348 ? -27.736 29.395  3.784   1.00 6.62   ? 656  PRO A CB    1 
ATOM   2719  C CG    . PRO A 1 348 ? -26.420 29.894  3.264   1.00 17.11  ? 656  PRO A CG    1 
ATOM   2720  C CD    . PRO A 1 348 ? -25.953 28.866  2.252   1.00 12.20  ? 656  PRO A CD    1 
ATOM   2721  N N     . GLY A 1 349 ? -29.566 29.370  0.537   1.00 11.25  ? 657  GLY A N     1 
ATOM   2722  C CA    . GLY A 1 349 ? -30.396 30.219  -0.313  1.00 11.47  ? 657  GLY A CA    1 
ATOM   2723  C C     . GLY A 1 349 ? -30.845 29.454  -1.535  1.00 15.68  ? 657  GLY A C     1 
ATOM   2724  O O     . GLY A 1 349 ? -30.526 28.268  -1.679  1.00 15.12  ? 657  GLY A O     1 
ATOM   2725  N N     . THR A 1 350 ? -31.589 30.113  -2.423  1.00 12.94  ? 658  THR A N     1 
ATOM   2726  C CA    . THR A 1 350 ? -32.019 29.455  -3.643  1.00 19.02  ? 658  THR A CA    1 
ATOM   2727  C C     . THR A 1 350 ? -30.899 29.413  -4.672  1.00 12.71  ? 658  THR A C     1 
ATOM   2728  O O     . THR A 1 350 ? -30.068 30.313  -4.748  1.00 16.70  ? 658  THR A O     1 
ATOM   2729  C CB    . THR A 1 350 ? -33.269 30.128  -4.259  1.00 8.70   ? 658  THR A CB    1 
ATOM   2730  O OG1   . THR A 1 350 ? -33.719 29.369  -5.379  1.00 21.67  ? 658  THR A OG1   1 
ATOM   2731  C CG2   . THR A 1 350 ? -32.960 31.568  -4.704  1.00 16.28  ? 658  THR A CG2   1 
ATOM   2732  N N     . SER A 1 351 ? -30.867 28.347  -5.458  1.00 10.36  ? 659  SER A N     1 
ATOM   2733  C CA    . SER A 1 351 ? -29.953 28.276  -6.583  1.00 17.58  ? 659  SER A CA    1 
ATOM   2734  C C     . SER A 1 351 ? -30.479 29.152  -7.717  1.00 19.39  ? 659  SER A C     1 
ATOM   2735  O O     . SER A 1 351 ? -29.741 29.534  -8.618  1.00 15.79  ? 659  SER A O     1 
ATOM   2736  C CB    . SER A 1 351 ? -29.857 26.837  -7.082  1.00 14.23  ? 659  SER A CB    1 
ATOM   2737  O OG    . SER A 1 351 ? -31.055 26.493  -7.771  1.00 17.93  ? 659  SER A OG    1 
ATOM   2738  N N     . GLY A 1 352 ? -31.772 29.458  -7.676  1.00 17.54  ? 660  GLY A N     1 
ATOM   2739  C CA    . GLY A 1 352 ? -32.387 30.251  -8.725  1.00 18.35  ? 660  GLY A CA    1 
ATOM   2740  C C     . GLY A 1 352 ? -32.388 29.534  -10.062 1.00 23.70  ? 660  GLY A C     1 
ATOM   2741  O O     . GLY A 1 352 ? -32.805 30.098  -11.076 1.00 24.94  ? 660  GLY A O     1 
ATOM   2742  N N     . ALA A 1 353 ? -31.959 28.274  -10.061 1.00 18.03  ? 661  ALA A N     1 
ATOM   2743  C CA    . ALA A 1 353 ? -31.639 27.571  -11.305 1.00 19.62  ? 661  ALA A CA    1 
ATOM   2744  C C     . ALA A 1 353 ? -32.681 26.533  -11.725 1.00 21.48  ? 661  ALA A C     1 
ATOM   2745  O O     . ALA A 1 353 ? -33.140 25.735  -10.914 1.00 23.75  ? 661  ALA A O     1 
ATOM   2746  C CB    . ALA A 1 353 ? -30.270 26.910  -11.187 1.00 25.47  ? 661  ALA A CB    1 
ATOM   2747  N N     . LEU A 1 354 ? -33.013 26.519  -13.011 1.00 22.35  ? 662  LEU A N     1 
ATOM   2748  C CA    . LEU A 1 354 ? -34.000 25.578  -13.536 1.00 24.58  ? 662  LEU A CA    1 
ATOM   2749  C C     . LEU A 1 354 ? -33.584 24.109  -13.372 1.00 24.40  ? 662  LEU A C     1 
ATOM   2750  O O     . LEU A 1 354 ? -34.437 23.233  -13.237 1.00 26.01  ? 662  LEU A O     1 
ATOM   2751  C CB    . LEU A 1 354 ? -34.292 25.875  -15.010 1.00 47.88  ? 662  LEU A CB    1 
ATOM   2752  C CG    . LEU A 1 354 ? -35.165 27.095  -15.327 1.00 64.84  ? 662  LEU A CG    1 
ATOM   2753  C CD1   . LEU A 1 354 ? -34.647 28.360  -14.648 1.00 72.08  ? 662  LEU A CD1   1 
ATOM   2754  C CD2   . LEU A 1 354 ? -35.271 27.297  -16.832 1.00 66.86  ? 662  LEU A CD2   1 
ATOM   2755  N N     . PHE A 1 355 ? -32.281 23.836  -13.379 1.00 23.71  ? 663  PHE A N     1 
ATOM   2756  C CA    . PHE A 1 355 ? -31.818 22.446  -13.271 1.00 20.87  ? 663  PHE A CA    1 
ATOM   2757  C C     . PHE A 1 355 ? -31.900 21.865  -11.862 1.00 24.58  ? 663  PHE A C     1 
ATOM   2758  O O     . PHE A 1 355 ? -31.705 20.659  -11.668 1.00 21.89  ? 663  PHE A O     1 
ATOM   2759  C CB    . PHE A 1 355 ? -30.407 22.265  -13.845 1.00 22.08  ? 663  PHE A CB    1 
ATOM   2760  C CG    . PHE A 1 355 ? -29.395 23.260  -13.339 1.00 20.74  ? 663  PHE A CG    1 
ATOM   2761  C CD1   . PHE A 1 355 ? -28.737 23.049  -12.143 1.00 18.43  ? 663  PHE A CD1   1 
ATOM   2762  C CD2   . PHE A 1 355 ? -29.075 24.389  -14.087 1.00 22.85  ? 663  PHE A CD2   1 
ATOM   2763  C CE1   . PHE A 1 355 ? -27.784 23.953  -11.684 1.00 23.37  ? 663  PHE A CE1   1 
ATOM   2764  C CE2   . PHE A 1 355 ? -28.121 25.298  -13.634 1.00 16.81  ? 663  PHE A CE2   1 
ATOM   2765  C CZ    . PHE A 1 355 ? -27.477 25.078  -12.434 1.00 15.48  ? 663  PHE A CZ    1 
ATOM   2766  N N     . MET A 1 356 ? -32.182 22.707  -10.872 1.00 17.75  ? 664  MET A N     1 
ATOM   2767  C CA    . MET A 1 356 ? -32.432 22.184  -9.531  1.00 18.82  ? 664  MET A CA    1 
ATOM   2768  C C     . MET A 1 356 ? -33.933 22.031  -9.273  1.00 25.24  ? 664  MET A C     1 
ATOM   2769  O O     . MET A 1 356 ? -34.700 22.974  -9.449  1.00 20.81  ? 664  MET A O     1 
ATOM   2770  C CB    . MET A 1 356 ? -31.780 23.044  -8.458  1.00 13.37  ? 664  MET A CB    1 
ATOM   2771  C CG    . MET A 1 356 ? -30.252 23.182  -8.584  1.00 13.00  ? 664  MET A CG    1 
ATOM   2772  S SD    . MET A 1 356 ? -29.305 21.634  -8.654  1.00 16.42  ? 664  MET A SD    1 
ATOM   2773  C CE    . MET A 1 356 ? -29.839 20.745  -7.183  1.00 10.15  ? 664  MET A CE    1 
ATOM   2774  N N     . ASP A 1 357 ? -34.347 20.843  -8.840  1.00 16.87  ? 665  ASP A N     1 
ATOM   2775  C CA    . ASP A 1 357 ? -35.769 20.546  -8.689  1.00 19.72  ? 665  ASP A CA    1 
ATOM   2776  C C     . ASP A 1 357 ? -36.312 20.945  -7.326  1.00 25.86  ? 665  ASP A C     1 
ATOM   2777  O O     . ASP A 1 357 ? -37.399 21.532  -7.226  1.00 18.45  ? 665  ASP A O     1 
ATOM   2778  C CB    . ASP A 1 357 ? -36.017 19.060  -8.937  1.00 18.93  ? 665  ASP A CB    1 
ATOM   2779  C CG    . ASP A 1 357 ? -35.628 18.647  -10.337 1.00 24.44  ? 665  ASP A CG    1 
ATOM   2780  O OD1   . ASP A 1 357 ? -36.168 19.239  -11.292 1.00 20.89  ? 665  ASP A OD1   1 
ATOM   2781  O OD2   . ASP A 1 357 ? -34.763 17.765  -10.481 1.00 19.95  ? 665  ASP A OD2   1 
ATOM   2782  N N     . TYR A 1 358 ? -35.534 20.642  -6.287  1.00 16.86  ? 666  TYR A N     1 
ATOM   2783  C CA    . TYR A 1 358 ? -35.976 20.791  -4.905  1.00 18.06  ? 666  TYR A CA    1 
ATOM   2784  C C     . TYR A 1 358 ? -34.941 21.491  -4.040  1.00 14.31  ? 666  TYR A C     1 
ATOM   2785  O O     . TYR A 1 358 ? -33.755 21.430  -4.317  1.00 15.24  ? 666  TYR A O     1 
ATOM   2786  C CB    . TYR A 1 358 ? -36.226 19.417  -4.281  1.00 11.55  ? 666  TYR A CB    1 
ATOM   2787  C CG    . TYR A 1 358 ? -37.412 18.669  -4.834  1.00 19.17  ? 666  TYR A CG    1 
ATOM   2788  C CD1   . TYR A 1 358 ? -38.711 19.046  -4.507  1.00 22.90  ? 666  TYR A CD1   1 
ATOM   2789  C CD2   . TYR A 1 358 ? -37.237 17.566  -5.663  1.00 19.54  ? 666  TYR A CD2   1 
ATOM   2790  C CE1   . TYR A 1 358 ? -39.805 18.353  -5.006  1.00 17.67  ? 666  TYR A CE1   1 
ATOM   2791  C CE2   . TYR A 1 358 ? -38.330 16.865  -6.164  1.00 21.75  ? 666  TYR A CE2   1 
ATOM   2792  C CZ    . TYR A 1 358 ? -39.608 17.265  -5.830  1.00 21.62  ? 666  TYR A CZ    1 
ATOM   2793  O OH    . TYR A 1 358 ? -40.695 16.572  -6.326  1.00 21.96  ? 666  TYR A OH    1 
ATOM   2794  N N     . ILE A 1 359 ? -35.408 22.153  -2.989  1.00 12.66  ? 667  ILE A N     1 
ATOM   2795  C CA    . ILE A 1 359 ? -34.529 22.548  -1.902  1.00 14.18  ? 667  ILE A CA    1 
ATOM   2796  C C     . ILE A 1 359 ? -35.016 21.858  -0.628  1.00 16.78  ? 667  ILE A C     1 
ATOM   2797  O O     . ILE A 1 359 ? -36.205 21.899  -0.289  1.00 15.05  ? 667  ILE A O     1 
ATOM   2798  C CB    . ILE A 1 359 ? -34.421 24.082  -1.741  1.00 12.63  ? 667  ILE A CB    1 
ATOM   2799  C CG1   . ILE A 1 359 ? -33.466 24.418  -0.589  1.00 13.53  ? 667  ILE A CG1   1 
ATOM   2800  C CG2   . ILE A 1 359 ? -35.794 24.716  -1.531  1.00 13.44  ? 667  ILE A CG2   1 
ATOM   2801  C CD1   . ILE A 1 359 ? -33.095 25.900  -0.502  1.00 17.76  ? 667  ILE A CD1   1 
ATOM   2802  N N     . ILE A 1 360 ? -34.098 21.192  0.057   1.00 11.81  ? 668  ILE A N     1 
ATOM   2803  C CA    . ILE A 1 360 ? -34.444 20.474  1.262   1.00 10.30  ? 668  ILE A CA    1 
ATOM   2804  C C     . ILE A 1 360 ? -34.390 21.458  2.420   1.00 14.12  ? 668  ILE A C     1 
ATOM   2805  O O     . ILE A 1 360 ? -33.348 22.029  2.728   1.00 14.67  ? 668  ILE A O     1 
ATOM   2806  C CB    . ILE A 1 360 ? -33.536 19.232  1.466   1.00 13.53  ? 668  ILE A CB    1 
ATOM   2807  C CG1   . ILE A 1 360 ? -33.788 18.220  0.336   1.00 12.24  ? 668  ILE A CG1   1 
ATOM   2808  C CG2   . ILE A 1 360 ? -33.803 18.575  2.816   1.00 16.31  ? 668  ILE A CG2   1 
ATOM   2809  C CD1   . ILE A 1 360 ? -32.935 16.948  0.420   1.00 14.83  ? 668  ILE A CD1   1 
ATOM   2810  N N     . THR A 1 361 ? -35.538 21.674  3.042   1.00 12.65  ? 669  THR A N     1 
ATOM   2811  C CA    . THR A 1 361 ? -35.657 22.724  4.036   1.00 11.16  ? 669  THR A CA    1 
ATOM   2812  C C     . THR A 1 361 ? -36.712 22.273  5.031   1.00 10.37  ? 669  THR A C     1 
ATOM   2813  O O     . THR A 1 361 ? -36.894 21.076  5.225   1.00 13.14  ? 669  THR A O     1 
ATOM   2814  C CB    . THR A 1 361 ? -35.951 24.095  3.362   1.00 14.17  ? 669  THR A CB    1 
ATOM   2815  O OG1   . THR A 1 361 ? -36.010 25.137  4.338   1.00 10.82  ? 669  THR A OG1   1 
ATOM   2816  C CG2   . THR A 1 361 ? -37.253 24.067  2.545   1.00 14.86  ? 669  THR A CG2   1 
ATOM   2817  N N     . ASP A 1 362 ? -37.384 23.204  5.689   1.00 14.87  ? 670  ASP A N     1 
ATOM   2818  C CA    . ASP A 1 362 ? -38.472 22.831  6.592   1.00 17.26  ? 670  ASP A CA    1 
ATOM   2819  C C     . ASP A 1 362 ? -39.417 24.010  6.744   1.00 16.46  ? 670  ASP A C     1 
ATOM   2820  O O     . ASP A 1 362 ? -39.116 25.114  6.275   1.00 9.41   ? 670  ASP A O     1 
ATOM   2821  C CB    . ASP A 1 362 ? -37.939 22.394  7.965   1.00 10.72  ? 670  ASP A CB    1 
ATOM   2822  C CG    . ASP A 1 362 ? -37.154 23.483  8.658   1.00 17.24  ? 670  ASP A CG    1 
ATOM   2823  O OD1   . ASP A 1 362 ? -37.764 24.302  9.383   1.00 14.79  ? 670  ASP A OD1   1 
ATOM   2824  O OD2   . ASP A 1 362 ? -35.923 23.518  8.478   1.00 13.26  ? 670  ASP A OD2   1 
ATOM   2825  N N     . GLN A 1 363 ? -40.547 23.771  7.405   1.00 14.47  ? 671  GLN A N     1 
ATOM   2826  C CA    . GLN A 1 363 ? -41.622 24.757  7.486   1.00 18.17  ? 671  GLN A CA    1 
ATOM   2827  C C     . GLN A 1 363 ? -41.232 25.987  8.305   1.00 14.93  ? 671  GLN A C     1 
ATOM   2828  O O     . GLN A 1 363 ? -41.747 27.078  8.072   1.00 12.18  ? 671  GLN A O     1 
ATOM   2829  C CB    . GLN A 1 363 ? -42.895 24.115  8.065   1.00 16.47  ? 671  GLN A CB    1 
ATOM   2830  C CG    . GLN A 1 363 ? -44.076 25.072  8.155   1.00 30.48  ? 671  GLN A CG    1 
ATOM   2831  C CD    . GLN A 1 363 ? -45.234 24.495  8.951   1.00 51.59  ? 671  GLN A CD    1 
ATOM   2832  O OE1   . GLN A 1 363 ? -45.348 23.279  9.112   1.00 45.87  ? 671  GLN A OE1   1 
ATOM   2833  N NE2   . GLN A 1 363 ? -46.095 25.370  9.461   1.00 62.98  ? 671  GLN A NE2   1 
ATOM   2834  N N     . GLU A 1 364 ? -40.334 25.821  9.272   1.00 11.10  ? 672  GLU A N     1 
ATOM   2835  C CA    . GLU A 1 364 ? -39.845 26.983  10.042  1.00 12.00  ? 672  GLU A CA    1 
ATOM   2836  C C     . GLU A 1 364 ? -38.856 27.835  9.237   1.00 13.70  ? 672  GLU A C     1 
ATOM   2837  O O     . GLU A 1 364 ? -38.908 29.070  9.253   1.00 14.18  ? 672  GLU A O     1 
ATOM   2838  C CB    . GLU A 1 364 ? -39.186 26.541  11.361  1.00 18.62  ? 672  GLU A CB    1 
ATOM   2839  C CG    . GLU A 1 364 ? -40.103 25.779  12.311  1.00 16.20  ? 672  GLU A CG    1 
ATOM   2840  C CD    . GLU A 1 364 ? -41.327 26.584  12.735  1.00 20.52  ? 672  GLU A CD    1 
ATOM   2841  O OE1   . GLU A 1 364 ? -41.187 27.789  13.024  1.00 15.36  ? 672  GLU A OE1   1 
ATOM   2842  O OE2   . GLU A 1 364 ? -42.430 25.998  12.793  1.00 21.08  ? 672  GLU A OE2   1 
ATOM   2843  N N     . THR A 1 365 ? -37.945 27.170  8.533   1.00 12.95  ? 673  THR A N     1 
ATOM   2844  C CA    . THR A 1 365 ? -36.947 27.875  7.733   1.00 11.45  ? 673  THR A CA    1 
ATOM   2845  C C     . THR A 1 365 ? -37.609 28.543  6.541   1.00 13.54  ? 673  THR A C     1 
ATOM   2846  O O     . THR A 1 365 ? -37.324 29.692  6.213   1.00 16.57  ? 673  THR A O     1 
ATOM   2847  C CB    . THR A 1 365 ? -35.854 26.906  7.246   1.00 4.19   ? 673  THR A CB    1 
ATOM   2848  O OG1   . THR A 1 365 ? -35.259 26.278  8.390   1.00 10.69  ? 673  THR A OG1   1 
ATOM   2849  C CG2   . THR A 1 365 ? -34.785 27.644  6.432   1.00 6.05   ? 673  THR A CG2   1 
ATOM   2850  N N     . SER A 1 366 ? -38.508 27.812  5.897   1.00 12.23  ? 674  SER A N     1 
ATOM   2851  C CA    . SER A 1 366 ? -39.044 28.243  4.615   1.00 10.17  ? 674  SER A CA    1 
ATOM   2852  C C     . SER A 1 366 ? -40.548 28.030  4.554   1.00 15.04  ? 674  SER A C     1 
ATOM   2853  O O     . SER A 1 366 ? -41.025 27.126  3.866   1.00 14.98  ? 674  SER A O     1 
ATOM   2854  C CB    . SER A 1 366 ? -38.354 27.462  3.495   1.00 13.19  ? 674  SER A CB    1 
ATOM   2855  O OG    . SER A 1 366 ? -36.946 27.526  3.658   1.00 14.20  ? 674  SER A OG    1 
ATOM   2856  N N     . PRO A 1 367 ? -41.305 28.857  5.287   1.00 17.15  ? 675  PRO A N     1 
ATOM   2857  C CA    . PRO A 1 367 ? -42.768 28.732  5.288   1.00 17.01  ? 675  PRO A CA    1 
ATOM   2858  C C     . PRO A 1 367 ? -43.335 28.783  3.874   1.00 22.01  ? 675  PRO A C     1 
ATOM   2859  O O     . PRO A 1 367 ? -42.787 29.458  3.006   1.00 19.23  ? 675  PRO A O     1 
ATOM   2860  C CB    . PRO A 1 367 ? -43.231 29.945  6.114   1.00 18.54  ? 675  PRO A CB    1 
ATOM   2861  C CG    . PRO A 1 367 ? -42.040 30.843  6.223   1.00 20.29  ? 675  PRO A CG    1 
ATOM   2862  C CD    . PRO A 1 367 ? -40.839 29.957  6.146   1.00 17.53  ? 675  PRO A CD    1 
ATOM   2863  N N     . ALA A 1 368 ? -44.425 28.062  3.647   1.00 20.25  ? 676  ALA A N     1 
ATOM   2864  C CA    . ALA A 1 368 ? -44.988 27.945  2.307   1.00 31.45  ? 676  ALA A CA    1 
ATOM   2865  C C     . ALA A 1 368 ? -45.342 29.314  1.738   1.00 35.35  ? 676  ALA A C     1 
ATOM   2866  O O     . ALA A 1 368 ? -45.366 29.499  0.521   1.00 34.73  ? 676  ALA A O     1 
ATOM   2867  C CB    . ALA A 1 368 ? -46.203 27.035  2.319   1.00 42.66  ? 676  ALA A CB    1 
ATOM   2868  N N     . GLU A 1 369 ? -45.602 30.271  2.626   1.00 32.58  ? 677  GLU A N     1 
ATOM   2869  C CA    . GLU A 1 369 ? -45.933 31.632  2.216   1.00 38.81  ? 677  GLU A CA    1 
ATOM   2870  C C     . GLU A 1 369 ? -44.823 32.257  1.384   1.00 38.06  ? 677  GLU A C     1 
ATOM   2871  O O     . GLU A 1 369 ? -45.087 33.070  0.499   1.00 46.05  ? 677  GLU A O     1 
ATOM   2872  C CB    . GLU A 1 369 ? -46.216 32.520  3.430   1.00 43.75  ? 677  GLU A CB    1 
ATOM   2873  C CG    . GLU A 1 369 ? -47.288 31.989  4.365   1.00 52.20  ? 677  GLU A CG    1 
ATOM   2874  C CD    . GLU A 1 369 ? -46.727 31.066  5.432   1.00 52.12  ? 677  GLU A CD    1 
ATOM   2875  O OE1   . GLU A 1 369 ? -46.183 31.582  6.433   1.00 52.96  ? 677  GLU A OE1   1 
ATOM   2876  O OE2   . GLU A 1 369 ? -46.833 29.829  5.273   1.00 41.24  ? 677  GLU A OE2   1 
ATOM   2877  N N     . VAL A 1 370 ? -43.581 31.884  1.670   1.00 34.85  ? 678  VAL A N     1 
ATOM   2878  C CA    . VAL A 1 370 ? -42.441 32.485  0.981   1.00 29.18  ? 678  VAL A CA    1 
ATOM   2879  C C     . VAL A 1 370 ? -41.846 31.590  -0.103  1.00 23.51  ? 678  VAL A C     1 
ATOM   2880  O O     . VAL A 1 370 ? -40.705 31.787  -0.504  1.00 27.71  ? 678  VAL A O     1 
ATOM   2881  C CB    . VAL A 1 370 ? -41.325 32.886  1.959   1.00 32.50  ? 678  VAL A CB    1 
ATOM   2882  C CG1   . VAL A 1 370 ? -41.848 33.894  2.974   1.00 42.39  ? 678  VAL A CG1   1 
ATOM   2883  C CG2   . VAL A 1 370 ? -40.751 31.652  2.654   1.00 30.83  ? 678  VAL A CG2   1 
ATOM   2884  N N     . ALA A 1 371 ? -42.614 30.622  -0.585  1.00 23.66  ? 679  ALA A N     1 
ATOM   2885  C CA    . ALA A 1 371 ? -42.134 29.771  -1.671  1.00 35.67  ? 679  ALA A CA    1 
ATOM   2886  C C     . ALA A 1 371 ? -41.585 30.601  -2.838  1.00 31.60  ? 679  ALA A C     1 
ATOM   2887  O O     . ALA A 1 371 ? -40.717 30.144  -3.579  1.00 27.90  ? 679  ALA A O     1 
ATOM   2888  C CB    . ALA A 1 371 ? -43.239 28.829  -2.148  1.00 31.71  ? 679  ALA A CB    1 
ATOM   2889  N N     . GLU A 1 372 ? -42.095 31.823  -2.984  1.00 24.86  ? 680  GLU A N     1 
ATOM   2890  C CA    . GLU A 1 372 ? -41.701 32.734  -4.059  1.00 30.34  ? 680  GLU A CA    1 
ATOM   2891  C C     . GLU A 1 372 ? -40.223 33.139  -4.028  1.00 27.88  ? 680  GLU A C     1 
ATOM   2892  O O     . GLU A 1 372 ? -39.666 33.564  -5.044  1.00 22.79  ? 680  GLU A O     1 
ATOM   2893  C CB    . GLU A 1 372 ? -42.578 33.990  -4.018  1.00 39.63  ? 680  GLU A CB    1 
ATOM   2894  C CG    . GLU A 1 372 ? -42.217 35.056  -5.037  1.00 70.70  ? 680  GLU A CG    1 
ATOM   2895  C CD    . GLU A 1 372 ? -43.000 36.343  -4.826  1.00 88.30  ? 680  GLU A CD    1 
ATOM   2896  O OE1   . GLU A 1 372 ? -43.530 36.539  -3.712  1.00 91.55  ? 680  GLU A OE1   1 
ATOM   2897  O OE2   . GLU A 1 372 ? -43.089 37.153  -5.773  1.00 89.72  ? 680  GLU A OE2   1 
ATOM   2898  N N     . GLN A 1 373 ? -39.592 33.017  -2.867  1.00 21.99  ? 681  GLN A N     1 
ATOM   2899  C CA    . GLN A 1 373 ? -38.183 33.371  -2.731  1.00 25.31  ? 681  GLN A CA    1 
ATOM   2900  C C     . GLN A 1 373 ? -37.266 32.352  -3.411  1.00 19.02  ? 681  GLN A C     1 
ATOM   2901  O O     . GLN A 1 373 ? -36.093 32.632  -3.644  1.00 19.26  ? 681  GLN A O     1 
ATOM   2902  C CB    . GLN A 1 373 ? -37.803 33.483  -1.253  1.00 26.58  ? 681  GLN A CB    1 
ATOM   2903  C CG    . GLN A 1 373 ? -38.602 34.505  -0.469  1.00 39.73  ? 681  GLN A CG    1 
ATOM   2904  C CD    . GLN A 1 373 ? -38.304 34.468  1.022   1.00 46.00  ? 681  GLN A CD    1 
ATOM   2905  O OE1   . GLN A 1 373 ? -38.894 35.221  1.798   1.00 46.51  ? 681  GLN A OE1   1 
ATOM   2906  N NE2   . GLN A 1 373 ? -37.389 33.587  1.431   1.00 32.62  ? 681  GLN A NE2   1 
ATOM   2907  N N     . TYR A 1 374 ? -37.810 31.175  -3.708  1.00 13.52  ? 682  TYR A N     1 
ATOM   2908  C CA    . TYR A 1 374 ? -37.027 30.055  -4.232  1.00 17.41  ? 682  TYR A CA    1 
ATOM   2909  C C     . TYR A 1 374 ? -37.467 29.675  -5.630  1.00 22.65  ? 682  TYR A C     1 
ATOM   2910  O O     . TYR A 1 374 ? -38.644 29.751  -5.947  1.00 19.62  ? 682  TYR A O     1 
ATOM   2911  C CB    . TYR A 1 374 ? -37.210 28.825  -3.341  1.00 18.11  ? 682  TYR A CB    1 
ATOM   2912  C CG    . TYR A 1 374 ? -36.930 29.072  -1.886  1.00 18.60  ? 682  TYR A CG    1 
ATOM   2913  C CD1   . TYR A 1 374 ? -37.919 29.550  -1.041  1.00 20.67  ? 682  TYR A CD1   1 
ATOM   2914  C CD2   . TYR A 1 374 ? -35.671 28.832  -1.354  1.00 13.75  ? 682  TYR A CD2   1 
ATOM   2915  C CE1   . TYR A 1 374 ? -37.662 29.787  0.300   1.00 22.90  ? 682  TYR A CE1   1 
ATOM   2916  C CE2   . TYR A 1 374 ? -35.406 29.059  -0.015  1.00 19.13  ? 682  TYR A CE2   1 
ATOM   2917  C CZ    . TYR A 1 374 ? -36.402 29.542  0.804   1.00 18.23  ? 682  TYR A CZ    1 
ATOM   2918  O OH    . TYR A 1 374 ? -36.142 29.768  2.137   1.00 21.61  ? 682  TYR A OH    1 
ATOM   2919  N N     . SER A 1 375 ? -36.524 29.241  -6.458  1.00 16.72  ? 683  SER A N     1 
ATOM   2920  C CA    . SER A 1 375 ? -36.870 28.707  -7.764  1.00 17.67  ? 683  SER A CA    1 
ATOM   2921  C C     . SER A 1 375 ? -37.259 27.242  -7.622  1.00 20.39  ? 683  SER A C     1 
ATOM   2922  O O     . SER A 1 375 ? -38.067 26.726  -8.398  1.00 16.78  ? 683  SER A O     1 
ATOM   2923  C CB    . SER A 1 375 ? -35.701 28.857  -8.737  1.00 23.67  ? 683  SER A CB    1 
ATOM   2924  O OG    . SER A 1 375 ? -34.540 28.221  -8.222  1.00 26.70  ? 683  SER A OG    1 
ATOM   2925  N N     . GLU A 1 376 ? -36.674 26.574  -6.628  1.00 12.93  ? 684  GLU A N     1 
ATOM   2926  C CA    . GLU A 1 376 ? -36.945 25.159  -6.368  1.00 17.37  ? 684  GLU A CA    1 
ATOM   2927  C C     . GLU A 1 376 ? -38.298 24.958  -5.694  1.00 23.07  ? 684  GLU A C     1 
ATOM   2928  O O     . GLU A 1 376 ? -38.830 25.868  -5.050  1.00 18.64  ? 684  GLU A O     1 
ATOM   2929  C CB    . GLU A 1 376 ? -35.863 24.549  -5.454  1.00 14.15  ? 684  GLU A CB    1 
ATOM   2930  C CG    . GLU A 1 376 ? -34.418 24.769  -5.911  1.00 13.45  ? 684  GLU A CG    1 
ATOM   2931  C CD    . GLU A 1 376 ? -33.831 26.082  -5.426  1.00 23.06  ? 684  GLU A CD    1 
ATOM   2932  O OE1   . GLU A 1 376 ? -34.595 26.934  -4.909  1.00 21.00  ? 684  GLU A OE1   1 
ATOM   2933  O OE2   . GLU A 1 376 ? -32.600 26.266  -5.566  1.00 22.26  ? 684  GLU A OE2   1 
ATOM   2934  N N     . LYS A 1 377 ? -38.850 23.757  -5.837  1.00 15.74  ? 685  LYS A N     1 
ATOM   2935  C CA    . LYS A 1 377 ? -39.991 23.362  -5.022  1.00 19.26  ? 685  LYS A CA    1 
ATOM   2936  C C     . LYS A 1 377 ? -39.463 23.078  -3.630  1.00 21.12  ? 685  LYS A C     1 
ATOM   2937  O O     . LYS A 1 377 ? -38.329 22.616  -3.478  1.00 15.41  ? 685  LYS A O     1 
ATOM   2938  C CB    . LYS A 1 377 ? -40.671 22.120  -5.595  1.00 16.22  ? 685  LYS A CB    1 
ATOM   2939  C CG    . LYS A 1 377 ? -41.313 22.358  -6.968  1.00 15.64  ? 685  LYS A CG    1 
ATOM   2940  C CD    . LYS A 1 377 ? -42.389 23.445  -6.924  1.00 23.79  ? 685  LYS A CD    1 
ATOM   2941  C CE    . LYS A 1 377 ? -42.970 23.668  -8.327  1.00 27.46  ? 685  LYS A CE    1 
ATOM   2942  N NZ    . LYS A 1 377 ? -44.011 24.730  -8.366  1.00 31.25  ? 685  LYS A NZ    1 
ATOM   2943  N N     . LEU A 1 378 ? -40.267 23.376  -2.615  1.00 14.43  ? 686  LEU A N     1 
ATOM   2944  C CA    . LEU A 1 378 ? -39.857 23.125  -1.242  1.00 14.55  ? 686  LEU A CA    1 
ATOM   2945  C C     . LEU A 1 378 ? -40.052 21.661  -0.898  1.00 19.56  ? 686  LEU A C     1 
ATOM   2946  O O     . LEU A 1 378 ? -41.073 21.059  -1.229  1.00 20.72  ? 686  LEU A O     1 
ATOM   2947  C CB    . LEU A 1 378 ? -40.650 23.993  -0.261  1.00 14.47  ? 686  LEU A CB    1 
ATOM   2948  C CG    . LEU A 1 378 ? -40.678 25.492  -0.555  1.00 18.00  ? 686  LEU A CG    1 
ATOM   2949  C CD1   . LEU A 1 378 ? -41.657 26.199  0.382   1.00 22.75  ? 686  LEU A CD1   1 
ATOM   2950  C CD2   . LEU A 1 378 ? -39.271 26.093  -0.470  1.00 19.84  ? 686  LEU A CD2   1 
ATOM   2951  N N     . ALA A 1 379 ? -39.064 21.085  -0.229  1.00 16.42  ? 687  ALA A N     1 
ATOM   2952  C CA    . ALA A 1 379 ? -39.177 19.715  0.246   1.00 16.38  ? 687  ALA A CA    1 
ATOM   2953  C C     . ALA A 1 379 ? -38.871 19.709  1.734   1.00 15.95  ? 687  ALA A C     1 
ATOM   2954  O O     . ALA A 1 379 ? -37.728 19.913  2.143   1.00 13.01  ? 687  ALA A O     1 
ATOM   2955  C CB    . ALA A 1 379 ? -38.228 18.803  -0.518  1.00 18.37  ? 687  ALA A CB    1 
ATOM   2956  N N     . TYR A 1 380 ? -39.902 19.493  2.546   1.00 14.36  ? 688  TYR A N     1 
ATOM   2957  C CA    . TYR A 1 380 ? -39.784 19.673  3.991   1.00 14.26  ? 688  TYR A CA    1 
ATOM   2958  C C     . TYR A 1 380 ? -39.288 18.443  4.740   1.00 8.82   ? 688  TYR A C     1 
ATOM   2959  O O     . TYR A 1 380 ? -39.862 17.364  4.611   1.00 15.44  ? 688  TYR A O     1 
ATOM   2960  C CB    . TYR A 1 380 ? -41.145 20.028  4.586   1.00 19.48  ? 688  TYR A CB    1 
ATOM   2961  C CG    . TYR A 1 380 ? -41.591 21.456  4.414   1.00 17.01  ? 688  TYR A CG    1 
ATOM   2962  C CD1   . TYR A 1 380 ? -40.753 22.425  3.857   1.00 11.71  ? 688  TYR A CD1   1 
ATOM   2963  C CD2   . TYR A 1 380 ? -42.862 21.840  4.821   1.00 16.46  ? 688  TYR A CD2   1 
ATOM   2964  C CE1   . TYR A 1 380 ? -41.184 23.738  3.710   1.00 10.05  ? 688  TYR A CE1   1 
ATOM   2965  C CE2   . TYR A 1 380 ? -43.296 23.139  4.688   1.00 18.26  ? 688  TYR A CE2   1 
ATOM   2966  C CZ    . TYR A 1 380 ? -42.461 24.086  4.136   1.00 18.55  ? 688  TYR A CZ    1 
ATOM   2967  O OH    . TYR A 1 380 ? -42.929 25.372  4.012   1.00 19.43  ? 688  TYR A OH    1 
ATOM   2968  N N     . MET A 1 381 ? -38.243 18.624  5.544   1.00 13.64  ? 689  MET A N     1 
ATOM   2969  C CA    . MET A 1 381 ? -37.937 17.703  6.624   1.00 9.57   ? 689  MET A CA    1 
ATOM   2970  C C     . MET A 1 381 ? -38.908 18.039  7.744   1.00 10.21  ? 689  MET A C     1 
ATOM   2971  O O     . MET A 1 381 ? -39.353 19.181  7.851   1.00 15.08  ? 689  MET A O     1 
ATOM   2972  C CB    . MET A 1 381 ? -36.496 17.892  7.118   1.00 8.92   ? 689  MET A CB    1 
ATOM   2973  C CG    . MET A 1 381 ? -35.459 17.418  6.109   1.00 12.64  ? 689  MET A CG    1 
ATOM   2974  S SD    . MET A 1 381 ? -35.453 15.619  5.981   1.00 17.34  ? 689  MET A SD    1 
ATOM   2975  C CE    . MET A 1 381 ? -34.605 15.172  7.487   1.00 12.28  ? 689  MET A CE    1 
ATOM   2976  N N     . PRO A 1 382 ? -39.236 17.053  8.591   1.00 13.56  ? 690  PRO A N     1 
ATOM   2977  C CA    . PRO A 1 382 ? -40.346 17.252  9.535   1.00 12.33  ? 690  PRO A CA    1 
ATOM   2978  C C     . PRO A 1 382 ? -40.018 18.157  10.724  1.00 19.46  ? 690  PRO A C     1 
ATOM   2979  O O     . PRO A 1 382 ? -40.934 18.710  11.324  1.00 16.21  ? 690  PRO A O     1 
ATOM   2980  C CB    . PRO A 1 382 ? -40.666 15.824  10.004  1.00 17.44  ? 690  PRO A CB    1 
ATOM   2981  C CG    . PRO A 1 382 ? -39.380 15.084  9.858   1.00 17.60  ? 690  PRO A CG    1 
ATOM   2982  C CD    . PRO A 1 382 ? -38.703 15.681  8.636   1.00 17.14  ? 690  PRO A CD    1 
ATOM   2983  N N     . HIS A 1 383 ? -38.742 18.305  11.065  1.00 13.35  ? 691  HIS A N     1 
ATOM   2984  C CA    . HIS A 1 383 ? -38.362 19.199  12.160  1.00 14.79  ? 691  HIS A CA    1 
ATOM   2985  C C     . HIS A 1 383 ? -37.492 20.340  11.645  1.00 16.53  ? 691  HIS A C     1 
ATOM   2986  O O     . HIS A 1 383 ? -38.018 21.379  11.237  1.00 14.00  ? 691  HIS A O     1 
ATOM   2987  C CB    . HIS A 1 383 ? -37.714 18.411  13.299  1.00 13.46  ? 691  HIS A CB    1 
ATOM   2988  C CG    . HIS A 1 383 ? -38.648 17.411  13.911  1.00 24.55  ? 691  HIS A CG    1 
ATOM   2989  N ND1   . HIS A 1 383 ? -38.609 16.069  13.604  1.00 23.88  ? 691  HIS A ND1   1 
ATOM   2990  C CD2   . HIS A 1 383 ? -39.692 17.572  14.760  1.00 22.36  ? 691  HIS A CD2   1 
ATOM   2991  C CE1   . HIS A 1 383 ? -39.568 15.440  14.262  1.00 26.93  ? 691  HIS A CE1   1 
ATOM   2992  N NE2   . HIS A 1 383 ? -40.239 16.330  14.970  1.00 28.13  ? 691  HIS A NE2   1 
ATOM   2993  N N     . THR A 1 384 ? -36.177 20.161  11.628  1.00 11.02  ? 692  THR A N     1 
ATOM   2994  C CA    . THR A 1 384 ? -35.350 21.133  10.892  1.00 8.79   ? 692  THR A CA    1 
ATOM   2995  C C     . THR A 1 384 ? -34.566 20.410  9.796   1.00 9.42   ? 692  THR A C     1 
ATOM   2996  O O     . THR A 1 384 ? -34.343 19.214  9.898   1.00 10.74  ? 692  THR A O     1 
ATOM   2997  C CB    . THR A 1 384 ? -34.419 21.976  11.814  1.00 11.08  ? 692  THR A CB    1 
ATOM   2998  O OG1   . THR A 1 384 ? -33.654 22.899  11.022  1.00 15.44  ? 692  THR A OG1   1 
ATOM   2999  C CG2   . THR A 1 384 ? -33.471 21.109  12.610  1.00 10.96  ? 692  THR A CG2   1 
ATOM   3000  N N     . PHE A 1 385 ? -34.167 21.130  8.744   1.00 10.88  ? 693  PHE A N     1 
ATOM   3001  C CA    . PHE A 1 385 ? -33.295 20.532  7.735   1.00 12.32  ? 693  PHE A CA    1 
ATOM   3002  C C     . PHE A 1 385 ? -31.867 20.566  8.250   1.00 13.10  ? 693  PHE A C     1 
ATOM   3003  O O     . PHE A 1 385 ? -30.979 19.891  7.717   1.00 12.34  ? 693  PHE A O     1 
ATOM   3004  C CB    . PHE A 1 385 ? -33.380 21.272  6.399   1.00 9.00   ? 693  PHE A CB    1 
ATOM   3005  C CG    . PHE A 1 385 ? -32.551 22.516  6.340   1.00 12.21  ? 693  PHE A CG    1 
ATOM   3006  C CD1   . PHE A 1 385 ? -31.297 22.508  5.742   1.00 9.54   ? 693  PHE A CD1   1 
ATOM   3007  C CD2   . PHE A 1 385 ? -33.025 23.707  6.884   1.00 15.14  ? 693  PHE A CD2   1 
ATOM   3008  C CE1   . PHE A 1 385 ? -30.522 23.679  5.703   1.00 12.36  ? 693  PHE A CE1   1 
ATOM   3009  C CE2   . PHE A 1 385 ? -32.275 24.860  6.830   1.00 10.16  ? 693  PHE A CE2   1 
ATOM   3010  C CZ    . PHE A 1 385 ? -31.028 24.857  6.257   1.00 11.01  ? 693  PHE A CZ    1 
ATOM   3011  N N     . PHE A 1 386 ? -31.637 21.371  9.283   1.00 10.24  ? 694  PHE A N     1 
ATOM   3012  C CA    . PHE A 1 386 ? -30.292 21.436  9.832   1.00 11.63  ? 694  PHE A CA    1 
ATOM   3013  C C     . PHE A 1 386 ? -29.935 20.175  10.625  1.00 12.75  ? 694  PHE A C     1 
ATOM   3014  O O     . PHE A 1 386 ? -30.812 19.515  11.211  1.00 10.13  ? 694  PHE A O     1 
ATOM   3015  C CB    . PHE A 1 386 ? -30.026 22.744  10.596  1.00 5.97   ? 694  PHE A CB    1 
ATOM   3016  C CG    . PHE A 1 386 ? -28.744 23.397  10.179  1.00 8.80   ? 694  PHE A CG    1 
ATOM   3017  C CD1   . PHE A 1 386 ? -27.579 23.210  10.923  1.00 9.43   ? 694  PHE A CD1   1 
ATOM   3018  C CD2   . PHE A 1 386 ? -28.672 24.119  8.984   1.00 15.67  ? 694  PHE A CD2   1 
ATOM   3019  C CE1   . PHE A 1 386 ? -26.358 23.776  10.517  1.00 11.41  ? 694  PHE A CE1   1 
ATOM   3020  C CE2   . PHE A 1 386 ? -27.463 24.684  8.563   1.00 12.94  ? 694  PHE A CE2   1 
ATOM   3021  C CZ    . PHE A 1 386 ? -26.302 24.508  9.327   1.00 14.76  ? 694  PHE A CZ    1 
ATOM   3022  N N     . ILE A 1 387 ? -28.654 19.811  10.586  1.00 9.22   ? 695  ILE A N     1 
ATOM   3023  C CA    . ILE A 1 387 ? -28.146 18.677  11.352  1.00 9.09   ? 695  ILE A CA    1 
ATOM   3024  C C     . ILE A 1 387 ? -26.690 18.990  11.725  1.00 10.07  ? 695  ILE A C     1 
ATOM   3025  O O     . ILE A 1 387 ? -26.085 19.889  11.159  1.00 13.26  ? 695  ILE A O     1 
ATOM   3026  C CB    . ILE A 1 387 ? -28.243 17.361  10.524  1.00 12.16  ? 695  ILE A CB    1 
ATOM   3027  C CG1   . ILE A 1 387 ? -27.867 16.137  11.369  1.00 10.69  ? 695  ILE A CG1   1 
ATOM   3028  C CG2   . ILE A 1 387 ? -27.400 17.460  9.221   1.00 11.83  ? 695  ILE A CG2   1 
ATOM   3029  C CD1   . ILE A 1 387 ? -28.801 15.876  12.572  1.00 11.04  ? 695  ILE A CD1   1 
ATOM   3030  N N     . GLY A 1 388 ? -26.141 18.276  12.692  1.00 6.48   ? 696  GLY A N     1 
ATOM   3031  C CA    . GLY A 1 388 ? -24.745 18.454  13.054  1.00 9.88   ? 696  GLY A CA    1 
ATOM   3032  C C     . GLY A 1 388 ? -24.207 17.153  13.620  1.00 6.47   ? 696  GLY A C     1 
ATOM   3033  O O     . GLY A 1 388 ? -24.958 16.339  14.150  1.00 11.09  ? 696  GLY A O     1 
ATOM   3034  N N     . ASP A 1 389 ? -22.903 16.955  13.535  1.00 7.42   ? 697  ASP A N     1 
ATOM   3035  C CA    . ASP A 1 389 ? -22.343 15.683  13.976  1.00 11.13  ? 697  ASP A CA    1 
ATOM   3036  C C     . ASP A 1 389 ? -21.826 15.738  15.409  1.00 8.13   ? 697  ASP A C     1 
ATOM   3037  O O     . ASP A 1 389 ? -21.018 14.917  15.811  1.00 10.66  ? 697  ASP A O     1 
ATOM   3038  C CB    . ASP A 1 389 ? -21.237 15.223  13.020  1.00 8.00   ? 697  ASP A CB    1 
ATOM   3039  C CG    . ASP A 1 389 ? -20.979 13.731  13.111  1.00 7.60   ? 697  ASP A CG    1 
ATOM   3040  O OD1   . ASP A 1 389 ? -21.957 12.943  13.092  1.00 10.74  ? 697  ASP A OD1   1 
ATOM   3041  O OD2   . ASP A 1 389 ? -19.801 13.354  13.215  1.00 9.33   ? 697  ASP A OD2   1 
ATOM   3042  N N     . HIS A 1 390 ? -22.332 16.681  16.195  1.00 7.84   ? 698  HIS A N     1 
ATOM   3043  C CA    . HIS A 1 390 ? -21.805 16.903  17.543  1.00 7.80   ? 698  HIS A CA    1 
ATOM   3044  C C     . HIS A 1 390 ? -21.818 15.699  18.483  1.00 11.00  ? 698  HIS A C     1 
ATOM   3045  O O     . HIS A 1 390 ? -20.884 15.523  19.268  1.00 8.50   ? 698  HIS A O     1 
ATOM   3046  C CB    . HIS A 1 390 ? -22.505 18.098  18.188  1.00 8.87   ? 698  HIS A CB    1 
ATOM   3047  C CG    . HIS A 1 390 ? -22.354 19.355  17.391  1.00 8.18   ? 698  HIS A CG    1 
ATOM   3048  N ND1   . HIS A 1 390 ? -22.923 19.515  16.140  1.00 4.98   ? 698  HIS A ND1   1 
ATOM   3049  C CD2   . HIS A 1 390 ? -21.662 20.490  17.640  1.00 7.04   ? 698  HIS A CD2   1 
ATOM   3050  C CE1   . HIS A 1 390 ? -22.595 20.704  15.664  1.00 11.85  ? 698  HIS A CE1   1 
ATOM   3051  N NE2   . HIS A 1 390 ? -21.828 21.313  16.554  1.00 7.71   ? 698  HIS A NE2   1 
ATOM   3052  N N     . ALA A 1 391 ? -22.864 14.877  18.417  1.00 10.26  ? 699  ALA A N     1 
ATOM   3053  C CA    . ALA A 1 391 ? -22.969 13.729  19.325  1.00 12.91  ? 699  ALA A CA    1 
ATOM   3054  C C     . ALA A 1 391 ? -21.852 12.723  19.054  1.00 16.31  ? 699  ALA A C     1 
ATOM   3055  O O     . ALA A 1 391 ? -21.382 12.053  19.963  1.00 10.20  ? 699  ALA A O     1 
ATOM   3056  C CB    . ALA A 1 391 ? -24.341 13.050  19.205  1.00 15.49  ? 699  ALA A CB    1 
ATOM   3057  N N     . ASN A 1 392 ? -21.428 12.633  17.797  1.00 8.17   ? 700  ASN A N     1 
ATOM   3058  C CA    . ASN A 1 392 ? -20.319 11.755  17.406  1.00 9.35   ? 700  ASN A CA    1 
ATOM   3059  C C     . ASN A 1 392 ? -18.936 12.398  17.597  1.00 9.61   ? 700  ASN A C     1 
ATOM   3060  O O     . ASN A 1 392 ? -18.004 11.744  18.052  1.00 10.51  ? 700  ASN A O     1 
ATOM   3061  C CB    . ASN A 1 392 ? -20.489 11.302  15.940  1.00 12.18  ? 700  ASN A CB    1 
ATOM   3062  C CG    . ASN A 1 392 ? -19.311 10.465  15.435  1.00 18.91  ? 700  ASN A CG    1 
ATOM   3063  O OD1   . ASN A 1 392 ? -18.988 9.424   16.006  1.00 15.97  ? 700  ASN A OD1   1 
ATOM   3064  N ND2   . ASN A 1 392 ? -18.687 10.905  14.342  1.00 11.29  ? 700  ASN A ND2   1 
ATOM   3065  N N     . MET A 1 393 ? -18.805 13.670  17.227  1.00 9.93   ? 701  MET A N     1 
ATOM   3066  C CA    . MET A 1 393 ? -17.513 14.352  17.326  1.00 10.61  ? 701  MET A CA    1 
ATOM   3067  C C     . MET A 1 393 ? -17.174 14.781  18.744  1.00 7.21   ? 701  MET A C     1 
ATOM   3068  O O     . MET A 1 393 ? -16.012 14.748  19.137  1.00 9.39   ? 701  MET A O     1 
ATOM   3069  C CB    . MET A 1 393 ? -17.469 15.583  16.414  1.00 7.63   ? 701  MET A CB    1 
ATOM   3070  C CG    . MET A 1 393 ? -17.424 15.275  14.931  1.00 5.23   ? 701  MET A CG    1 
ATOM   3071  S SD    . MET A 1 393 ? -17.524 16.760  13.916  1.00 10.53  ? 701  MET A SD    1 
ATOM   3072  C CE    . MET A 1 393 ? -15.979 17.577  14.310  1.00 6.70   ? 701  MET A CE    1 
ATOM   3073  N N     . PHE A 1 394 ? -18.179 15.209  19.507  1.00 9.96   ? 702  PHE A N     1 
ATOM   3074  C CA    . PHE A 1 394 ? -17.918 15.778  20.834  1.00 3.09   ? 702  PHE A CA    1 
ATOM   3075  C C     . PHE A 1 394 ? -18.712 15.115  21.961  1.00 4.97   ? 702  PHE A C     1 
ATOM   3076  O O     . PHE A 1 394 ? -19.385 15.809  22.732  1.00 7.27   ? 702  PHE A O     1 
ATOM   3077  C CB    . PHE A 1 394 ? -18.220 17.294  20.841  1.00 3.83   ? 702  PHE A CB    1 
ATOM   3078  C CG    . PHE A 1 394 ? -17.687 18.031  19.622  1.00 11.97  ? 702  PHE A CG    1 
ATOM   3079  C CD1   . PHE A 1 394 ? -16.319 18.122  19.392  1.00 10.81  ? 702  PHE A CD1   1 
ATOM   3080  C CD2   . PHE A 1 394 ? -18.560 18.634  18.723  1.00 11.01  ? 702  PHE A CD2   1 
ATOM   3081  C CE1   . PHE A 1 394 ? -15.825 18.804  18.270  1.00 10.61  ? 702  PHE A CE1   1 
ATOM   3082  C CE2   . PHE A 1 394 ? -18.087 19.324  17.602  1.00 5.93   ? 702  PHE A CE2   1 
ATOM   3083  C CZ    . PHE A 1 394 ? -16.710 19.404  17.383  1.00 10.99  ? 702  PHE A CZ    1 
ATOM   3084  N N     . PRO A 1 395 ? -18.603 13.788  22.095  1.00 10.55  ? 703  PRO A N     1 
ATOM   3085  C CA    . PRO A 1 395 ? -19.354 13.082  23.143  1.00 12.64  ? 703  PRO A CA    1 
ATOM   3086  C C     . PRO A 1 395 ? -18.846 13.392  24.545  1.00 11.36  ? 703  PRO A C     1 
ATOM   3087  O O     . PRO A 1 395 ? -19.569 13.162  25.519  1.00 8.26   ? 703  PRO A O     1 
ATOM   3088  C CB    . PRO A 1 395 ? -19.123 11.598  22.803  1.00 7.10   ? 703  PRO A CB    1 
ATOM   3089  C CG    . PRO A 1 395 ? -17.811 11.573  22.127  1.00 10.23  ? 703  PRO A CG    1 
ATOM   3090  C CD    . PRO A 1 395 ? -17.703 12.884  21.356  1.00 12.14  ? 703  PRO A CD    1 
ATOM   3091  N N     . HIS A 1 396 ? -17.629 13.911  24.657  1.00 7.03   ? 704  HIS A N     1 
ATOM   3092  C CA    . HIS A 1 396 ? -17.107 14.300  25.968  1.00 10.45  ? 704  HIS A CA    1 
ATOM   3093  C C     . HIS A 1 396 ? -17.857 15.499  26.544  1.00 7.48   ? 704  HIS A C     1 
ATOM   3094  O O     . HIS A 1 396 ? -17.708 15.804  27.722  1.00 14.84  ? 704  HIS A O     1 
ATOM   3095  C CB    . HIS A 1 396 ? -15.594 14.583  25.919  1.00 12.69  ? 704  HIS A CB    1 
ATOM   3096  C CG    . HIS A 1 396 ? -15.212 15.723  25.021  1.00 17.51  ? 704  HIS A CG    1 
ATOM   3097  N ND1   . HIS A 1 396 ? -15.560 15.767  23.686  1.00 9.48   ? 704  HIS A ND1   1 
ATOM   3098  C CD2   . HIS A 1 396 ? -14.495 16.850  25.262  1.00 3.78   ? 704  HIS A CD2   1 
ATOM   3099  C CE1   . HIS A 1 396 ? -15.094 16.882  23.147  1.00 8.36   ? 704  HIS A CE1   1 
ATOM   3100  N NE2   . HIS A 1 396 ? -14.438 17.555  24.079  1.00 8.50   ? 704  HIS A NE2   1 
ATOM   3101  N N     . LEU A 1 397 ? -18.656 16.175  25.714  1.00 9.33   ? 705  LEU A N     1 
ATOM   3102  C CA    . LEU A 1 397 ? -19.426 17.345  26.163  1.00 7.60   ? 705  LEU A CA    1 
ATOM   3103  C C     . LEU A 1 397 ? -20.894 17.002  26.483  1.00 14.28  ? 705  LEU A C     1 
ATOM   3104  O O     . LEU A 1 397 ? -21.723 17.897  26.737  1.00 9.42   ? 705  LEU A O     1 
ATOM   3105  C CB    . LEU A 1 397 ? -19.342 18.491  25.139  1.00 6.99   ? 705  LEU A CB    1 
ATOM   3106  C CG    . LEU A 1 397 ? -17.930 18.904  24.675  1.00 7.17   ? 705  LEU A CG    1 
ATOM   3107  C CD1   . LEU A 1 397 ? -18.004 20.011  23.624  1.00 10.51  ? 705  LEU A CD1   1 
ATOM   3108  C CD2   . LEU A 1 397 ? -17.057 19.376  25.861  1.00 7.13   ? 705  LEU A CD2   1 
ATOM   3109  N N     . LYS A 1 398 ? -21.220 15.709  26.455  1.00 11.99  ? 706  LYS A N     1 
ATOM   3110  C CA    . LYS A 1 398 ? -22.553 15.270  26.846  1.00 9.63   ? 706  LYS A CA    1 
ATOM   3111  C C     . LYS A 1 398 ? -22.769 15.466  28.327  1.00 15.10  ? 706  LYS A C     1 
ATOM   3112  O O     . LYS A 1 398 ? -23.886 15.699  28.762  1.00 20.02  ? 706  LYS A O     1 
ATOM   3113  C CB    . LYS A 1 398 ? -22.792 13.796  26.513  1.00 11.89  ? 706  LYS A CB    1 
ATOM   3114  C CG    . LYS A 1 398 ? -22.931 13.500  25.044  1.00 23.19  ? 706  LYS A CG    1 
ATOM   3115  C CD    . LYS A 1 398 ? -23.271 12.026  24.857  1.00 44.54  ? 706  LYS A CD    1 
ATOM   3116  C CE    . LYS A 1 398 ? -22.599 11.448  23.623  1.00 48.16  ? 706  LYS A CE    1 
ATOM   3117  N NZ    . LYS A 1 398 ? -22.974 12.187  22.381  1.00 23.00  ? 706  LYS A NZ    1 
ATOM   3118  N N     . LYS A 1 399 ? -21.700 15.363  29.109  1.00 7.01   ? 707  LYS A N     1 
ATOM   3119  C CA    . LYS A 1 399 ? -21.821 15.572  30.534  1.00 8.55   ? 707  LYS A CA    1 
ATOM   3120  C C     . LYS A 1 399 ? -20.761 16.556  30.946  1.00 13.69  ? 707  LYS A C     1 
ATOM   3121  O O     . LYS A 1 399 ? -19.806 16.779  30.206  1.00 10.33  ? 707  LYS A O     1 
ATOM   3122  C CB    . LYS A 1 399 ? -21.632 14.256  31.302  1.00 13.47  ? 707  LYS A CB    1 
ATOM   3123  C CG    . LYS A 1 399 ? -22.782 13.271  31.126  1.00 29.53  ? 707  LYS A CG    1 
ATOM   3124  C CD    . LYS A 1 399 ? -22.559 12.027  31.966  1.00 41.01  ? 707  LYS A CD    1 
ATOM   3125  C CE    . LYS A 1 399 ? -23.578 10.947  31.647  1.00 47.93  ? 707  LYS A CE    1 
ATOM   3126  N NZ    . LYS A 1 399 ? -23.308 9.706   32.428  1.00 49.25  ? 707  LYS A NZ    1 
ATOM   3127  N N     . LYS A 1 400 ? -20.927 17.144  32.125  1.00 10.51  ? 708  LYS A N     1 
ATOM   3128  C CA    . LYS A 1 400 ? -19.933 18.067  32.650  1.00 12.47  ? 708  LYS A CA    1 
ATOM   3129  C C     . LYS A 1 400 ? -19.928 18.018  34.163  1.00 11.28  ? 708  LYS A C     1 
ATOM   3130  O O     . LYS A 1 400 ? -20.896 17.559  34.771  1.00 16.33  ? 708  LYS A O     1 
ATOM   3131  C CB    . LYS A 1 400 ? -20.217 19.505  32.165  1.00 13.58  ? 708  LYS A CB    1 
ATOM   3132  C CG    . LYS A 1 400 ? -21.494 20.156  32.733  1.00 11.17  ? 708  LYS A CG    1 
ATOM   3133  C CD    . LYS A 1 400 ? -21.560 21.641  32.326  1.00 16.46  ? 708  LYS A CD    1 
ATOM   3134  C CE    . LYS A 1 400 ? -22.740 22.374  32.985  1.00 11.98  ? 708  LYS A CE    1 
ATOM   3135  N NZ    . LYS A 1 400 ? -24.045 21.955  32.410  1.00 11.99  ? 708  LYS A NZ    1 
ATOM   3136  N N     . ALA A 1 401 ? -18.822 18.443  34.763  1.00 10.30  ? 709  ALA A N     1 
ATOM   3137  C CA    . ALA A 1 401 ? -18.766 18.688  36.201  1.00 12.42  ? 709  ALA A CA    1 
ATOM   3138  C C     . ALA A 1 401 ? -18.224 20.092  36.368  1.00 16.99  ? 709  ALA A C     1 
ATOM   3139  O O     . ALA A 1 401 ? -17.679 20.661  35.425  1.00 9.20   ? 709  ALA A O     1 
ATOM   3140  C CB    . ALA A 1 401 ? -17.862 17.673  36.910  1.00 15.94  ? 709  ALA A CB    1 
ATOM   3141  N N     . VAL A 1 402 ? -18.392 20.670  37.545  1.00 8.58   ? 710  VAL A N     1 
ATOM   3142  C CA    . VAL A 1 402 ? -17.865 21.997  37.777  1.00 10.45  ? 710  VAL A CA    1 
ATOM   3143  C C     . VAL A 1 402 ? -17.108 21.977  39.110  1.00 18.03  ? 710  VAL A C     1 
ATOM   3144  O O     . VAL A 1 402 ? -17.273 21.066  39.922  1.00 19.35  ? 710  VAL A O     1 
ATOM   3145  C CB    . VAL A 1 402 ? -18.958 23.079  37.771  1.00 14.76  ? 710  VAL A CB    1 
ATOM   3146  C CG1   . VAL A 1 402 ? -19.731 23.069  36.449  1.00 20.50  ? 710  VAL A CG1   1 
ATOM   3147  C CG2   . VAL A 1 402 ? -19.917 22.896  38.948  1.00 19.75  ? 710  VAL A CG2   1 
ATOM   3148  N N     . ILE A 1 403 ? -16.242 22.955  39.310  1.00 17.25  ? 711  ILE A N     1 
ATOM   3149  C CA    . ILE A 1 403 ? -15.523 23.080  40.568  1.00 14.33  ? 711  ILE A CA    1 
ATOM   3150  C C     . ILE A 1 403 ? -16.053 24.329  41.243  1.00 25.74  ? 711  ILE A C     1 
ATOM   3151  O O     . ILE A 1 403 ? -15.980 25.412  40.670  1.00 23.28  ? 711  ILE A O     1 
ATOM   3152  C CB    . ILE A 1 403 ? -14.011 23.255  40.344  1.00 27.46  ? 711  ILE A CB    1 
ATOM   3153  C CG1   . ILE A 1 403 ? -13.390 21.963  39.814  1.00 27.64  ? 711  ILE A CG1   1 
ATOM   3154  C CG2   . ILE A 1 403 ? -13.325 23.663  41.634  1.00 36.18  ? 711  ILE A CG2   1 
ATOM   3155  C CD1   . ILE A 1 403 ? -11.890 22.030  39.712  1.00 31.49  ? 711  ILE A CD1   1 
ATOM   3156  N N     . ASP A 1 404 ? -16.601 24.180  42.446  1.00 30.24  ? 712  ASP A N     1 
ATOM   3157  C CA    . ASP A 1 404 ? -17.121 25.323  43.186  1.00 28.97  ? 712  ASP A CA    1 
ATOM   3158  C C     . ASP A 1 404 ? -15.976 26.062  43.875  1.00 41.47  ? 712  ASP A C     1 
ATOM   3159  O O     . ASP A 1 404 ? -15.428 25.578  44.868  1.00 60.97  ? 712  ASP A O     1 
ATOM   3160  C CB    . ASP A 1 404 ? -18.153 24.870  44.218  1.00 28.05  ? 712  ASP A CB    1 
ATOM   3161  C CG    . ASP A 1 404 ? -18.563 25.989  45.160  1.00 46.26  ? 712  ASP A CG    1 
ATOM   3162  O OD1   . ASP A 1 404 ? -18.703 25.723  46.378  1.00 40.08  ? 712  ASP A OD1   1 
ATOM   3163  O OD2   . ASP A 1 404 ? -18.737 27.135  44.678  1.00 38.90  ? 712  ASP A OD2   1 
ATOM   3164  N N     . PHE A 1 405 ? -15.617 27.231  43.352  1.00 57.60  ? 713  PHE A N     1 
ATOM   3165  C CA    . PHE A 1 405 ? -14.435 27.934  43.836  1.00 62.84  ? 713  PHE A CA    1 
ATOM   3166  C C     . PHE A 1 405 ? -14.749 29.160  44.696  1.00 81.80  ? 713  PHE A C     1 
ATOM   3167  O O     . PHE A 1 405 ? -14.113 30.206  44.560  1.00 90.62  ? 713  PHE A O     1 
ATOM   3168  C CB    . PHE A 1 405 ? -13.515 28.315  42.673  1.00 62.52  ? 713  PHE A CB    1 
ATOM   3169  C CG    . PHE A 1 405 ? -14.013 29.467  41.858  1.00 56.12  ? 713  PHE A CG    1 
ATOM   3170  C CD1   . PHE A 1 405 ? -15.312 29.483  41.372  1.00 65.34  ? 713  PHE A CD1   1 
ATOM   3171  C CD2   . PHE A 1 405 ? -13.182 30.540  41.580  1.00 58.09  ? 713  PHE A CD2   1 
ATOM   3172  C CE1   . PHE A 1 405 ? -15.769 30.544  40.622  1.00 52.37  ? 713  PHE A CE1   1 
ATOM   3173  C CE2   . PHE A 1 405 ? -13.634 31.612  40.830  1.00 61.01  ? 713  PHE A CE2   1 
ATOM   3174  C CZ    . PHE A 1 405 ? -14.931 31.619  40.354  1.00 52.82  ? 713  PHE A CZ    1 
ATOM   3175  N N     . LYS A 1 406 ? -15.720 29.018  45.592  1.00 90.46  ? 714  LYS A N     1 
ATOM   3176  C CA    . LYS A 1 406 ? -16.073 30.086  46.523  1.00 83.89  ? 714  LYS A CA    1 
ATOM   3177  C C     . LYS A 1 406 ? -16.456 29.497  47.878  1.00 70.73  ? 714  LYS A C     1 
ATOM   3178  O O     . LYS A 1 406 ? -17.435 28.757  47.989  1.00 53.04  ? 714  LYS A O     1 
ATOM   3179  C CB    . LYS A 1 406 ? -17.231 30.925  45.975  1.00 82.06  ? 714  LYS A CB    1 
ATOM   3180  C CG    . LYS A 1 406 ? -17.005 31.481  44.577  1.00 82.68  ? 714  LYS A CG    1 
ATOM   3181  C CD    . LYS A 1 406 ? -18.304 32.000  43.984  1.00 77.25  ? 714  LYS A CD    1 
ATOM   3182  C CE    . LYS A 1 406 ? -19.431 30.986  44.161  1.00 72.21  ? 714  LYS A CE    1 
ATOM   3183  N NZ    . LYS A 1 406 ? -19.121 29.659  43.560  1.00 48.00  ? 714  LYS A NZ    1 
ATOM   3184  N N     . ILE A 1 411 ? -23.653 28.174  43.565  1.00 34.82  ? 719  ILE A N     1 
ATOM   3185  C CA    . ILE A 1 411 ? -23.068 27.197  42.657  1.00 35.44  ? 719  ILE A CA    1 
ATOM   3186  C C     . ILE A 1 411 ? -23.261 27.617  41.202  1.00 37.83  ? 719  ILE A C     1 
ATOM   3187  O O     . ILE A 1 411 ? -24.389 27.780  40.734  1.00 39.25  ? 719  ILE A O     1 
ATOM   3188  C CB    . ILE A 1 411 ? -23.650 25.787  42.901  1.00 28.69  ? 719  ILE A CB    1 
ATOM   3189  C CG1   . ILE A 1 411 ? -23.168 25.256  44.249  1.00 32.88  ? 719  ILE A CG1   1 
ATOM   3190  C CG2   . ILE A 1 411 ? -23.261 24.840  41.780  1.00 43.63  ? 719  ILE A CG2   1 
ATOM   3191  C CD1   . ILE A 1 411 ? -23.969 24.090  44.759  1.00 26.57  ? 719  ILE A CD1   1 
ATOM   3192  N N     . TYR A 1 412 ? -22.147 27.810  40.498  1.00 34.13  ? 720  TYR A N     1 
ATOM   3193  C CA    . TYR A 1 412 ? -22.167 28.244  39.106  1.00 25.98  ? 720  TYR A CA    1 
ATOM   3194  C C     . TYR A 1 412 ? -21.889 27.042  38.213  1.00 25.32  ? 720  TYR A C     1 
ATOM   3195  O O     . TYR A 1 412 ? -21.038 26.202  38.547  1.00 11.14  ? 720  TYR A O     1 
ATOM   3196  C CB    . TYR A 1 412 ? -21.085 29.297  38.864  1.00 25.49  ? 720  TYR A CB    1 
ATOM   3197  C CG    . TYR A 1 412 ? -21.360 30.661  39.459  1.00 24.14  ? 720  TYR A CG    1 
ATOM   3198  C CD1   . TYR A 1 412 ? -22.644 31.184  39.491  1.00 38.92  ? 720  TYR A CD1   1 
ATOM   3199  C CD2   . TYR A 1 412 ? -20.324 31.433  39.978  1.00 50.93  ? 720  TYR A CD2   1 
ATOM   3200  C CE1   . TYR A 1 412 ? -22.893 32.434  40.029  1.00 56.26  ? 720  TYR A CE1   1 
ATOM   3201  C CE2   . TYR A 1 412 ? -20.561 32.682  40.517  1.00 62.29  ? 720  TYR A CE2   1 
ATOM   3202  C CZ    . TYR A 1 412 ? -21.849 33.178  40.541  1.00 74.29  ? 720  TYR A CZ    1 
ATOM   3203  O OH    . TYR A 1 412 ? -22.097 34.422  41.078  1.00 87.54  ? 720  TYR A OH    1 
ATOM   3204  N N     . ASP A 1 413 ? -22.576 26.972  37.074  1.00 25.48  ? 721  ASP A N     1 
ATOM   3205  C CA    . ASP A 1 413 ? -22.365 25.868  36.132  1.00 22.97  ? 721  ASP A CA    1 
ATOM   3206  C C     . ASP A 1 413 ? -21.423 26.220  34.982  1.00 18.02  ? 721  ASP A C     1 
ATOM   3207  O O     . ASP A 1 413 ? -21.219 25.416  34.080  1.00 19.37  ? 721  ASP A O     1 
ATOM   3208  C CB    . ASP A 1 413 ? -23.700 25.366  35.560  1.00 11.93  ? 721  ASP A CB    1 
ATOM   3209  C CG    . ASP A 1 413 ? -24.353 26.363  34.593  1.00 26.41  ? 721  ASP A CG    1 
ATOM   3210  O OD1   . ASP A 1 413 ? -23.882 27.521  34.494  1.00 15.40  ? 721  ASP A OD1   1 
ATOM   3211  O OD2   . ASP A 1 413 ? -25.353 25.989  33.936  1.00 15.42  ? 721  ASP A OD2   1 
ATOM   3212  N N     . ASN A 1 414 ? -20.849 27.414  34.995  1.00 16.92  ? 722  ASN A N     1 
ATOM   3213  C CA    . ASN A 1 414 ? -20.129 27.855  33.801  1.00 19.59  ? 722  ASN A CA    1 
ATOM   3214  C C     . ASN A 1 414 ? -18.915 28.744  34.090  1.00 13.94  ? 722  ASN A C     1 
ATOM   3215  O O     . ASN A 1 414 ? -18.493 29.557  33.256  1.00 12.07  ? 722  ASN A O     1 
ATOM   3216  C CB    . ASN A 1 414 ? -21.092 28.522  32.811  1.00 7.56   ? 722  ASN A CB    1 
ATOM   3217  C CG    . ASN A 1 414 ? -21.766 29.760  33.393  1.00 12.57  ? 722  ASN A CG    1 
ATOM   3218  O OD1   . ASN A 1 414 ? -21.492 30.155  34.521  1.00 9.48   ? 722  ASN A OD1   1 
ATOM   3219  N ND2   . ASN A 1 414 ? -22.661 30.369  32.617  1.00 8.72   ? 722  ASN A ND2   1 
ATOM   3220  N N     . ARG A 1 415 ? -18.352 28.558  35.280  1.00 11.90  ? 723  ARG A N     1 
ATOM   3221  C CA    . ARG A 1 415 ? -17.159 29.285  35.701  1.00 16.24  ? 723  ARG A CA    1 
ATOM   3222  C C     . ARG A 1 415 ? -15.919 28.424  35.536  1.00 12.35  ? 723  ARG A C     1 
ATOM   3223  O O     . ARG A 1 415 ? -14.956 28.834  34.897  1.00 13.98  ? 723  ARG A O     1 
ATOM   3224  C CB    . ARG A 1 415 ? -17.293 29.706  37.163  1.00 17.26  ? 723  ARG A CB    1 
ATOM   3225  C CG    . ARG A 1 415 ? -17.790 31.125  37.341  1.00 21.70  ? 723  ARG A CG    1 
ATOM   3226  C CD    . ARG A 1 415 ? -19.116 31.366  36.633  1.00 18.93  ? 723  ARG A CD    1 
ATOM   3227  N NE    . ARG A 1 415 ? -19.617 32.710  36.947  1.00 35.68  ? 723  ARG A NE    1 
ATOM   3228  C CZ    . ARG A 1 415 ? -20.862 33.131  36.730  1.00 35.48  ? 723  ARG A CZ    1 
ATOM   3229  N NH1   . ARG A 1 415 ? -21.765 32.315  36.201  1.00 19.34  ? 723  ARG A NH1   1 
ATOM   3230  N NH2   . ARG A 1 415 ? -21.210 34.372  37.054  1.00 42.26  ? 723  ARG A NH2   1 
ATOM   3231  N N     A ILE A 1 416 ? -15.951 27.233  36.130  0.50 10.37  ? 724  ILE A N     1 
ATOM   3232  N N     B ILE A 1 416 ? -15.945 27.247  36.158  0.50 10.86  ? 724  ILE A N     1 
ATOM   3233  C CA    A ILE A 1 416 ? -14.870 26.257  35.997  0.50 14.69  ? 724  ILE A CA    1 
ATOM   3234  C CA    B ILE A 1 416 ? -14.893 26.248  35.994  0.50 14.23  ? 724  ILE A CA    1 
ATOM   3235  C C     A ILE A 1 416 ? -15.483 24.902  35.701  0.50 13.42  ? 724  ILE A C     1 
ATOM   3236  C C     B ILE A 1 416 ? -15.554 24.932  35.665  0.50 12.92  ? 724  ILE A C     1 
ATOM   3237  O O     A ILE A 1 416 ? -16.151 24.328  36.557  0.50 7.37   ? 724  ILE A O     1 
ATOM   3238  O O     B ILE A 1 416 ? -16.327 24.411  36.462  0.50 16.86  ? 724  ILE A O     1 
ATOM   3239  C CB    A ILE A 1 416 ? -14.042 26.132  37.288  0.50 18.90  ? 724  ILE A CB    1 
ATOM   3240  C CB    B ILE A 1 416 ? -14.069 26.034  37.271  0.50 17.16  ? 724  ILE A CB    1 
ATOM   3241  C CG1   A ILE A 1 416 ? -13.509 27.498  37.726  0.50 18.26  ? 724  ILE A CG1   1 
ATOM   3242  C CG1   B ILE A 1 416 ? -13.566 27.368  37.819  0.50 19.88  ? 724  ILE A CG1   1 
ATOM   3243  C CG2   A ILE A 1 416 ? -12.900 25.141  37.087  0.50 15.22  ? 724  ILE A CG2   1 
ATOM   3244  C CG2   B ILE A 1 416 ? -12.915 25.072  36.998  0.50 10.76  ? 724  ILE A CG2   1 
ATOM   3245  C CD1   A ILE A 1 416 ? -13.163 27.582  39.212  0.50 8.40   ? 724  ILE A CD1   1 
ATOM   3246  C CD1   B ILE A 1 416 ? -12.947 28.247  36.773  0.50 7.38   ? 724  ILE A CD1   1 
ATOM   3247  N N     . VAL A 1 417 ? -15.227 24.389  34.497  1.00 10.20  ? 725  VAL A N     1 
ATOM   3248  C CA    . VAL A 1 417 ? -15.942 23.243  33.973  1.00 10.51  ? 725  VAL A CA    1 
ATOM   3249  C C     . VAL A 1 417 ? -14.999 22.105  33.622  1.00 7.26   ? 725  VAL A C     1 
ATOM   3250  O O     . VAL A 1 417 ? -13.895 22.339  33.105  1.00 12.70  ? 725  VAL A O     1 
ATOM   3251  C CB    . VAL A 1 417 ? -16.683 23.644  32.667  1.00 8.19   ? 725  VAL A CB    1 
ATOM   3252  C CG1   . VAL A 1 417 ? -17.481 22.448  32.091  1.00 6.75   ? 725  VAL A CG1   1 
ATOM   3253  C CG2   . VAL A 1 417 ? -17.590 24.875  32.899  1.00 10.67  ? 725  VAL A CG2   1 
ATOM   3254  N N     . LEU A 1 418 ? -15.415 20.875  33.911  1.00 6.11   ? 726  LEU A N     1 
ATOM   3255  C CA    . LEU A 1 418 ? -14.648 19.697  33.480  1.00 6.11   ? 726  LEU A CA    1 
ATOM   3256  C C     . LEU A 1 418 ? -15.513 18.870  32.525  1.00 10.41  ? 726  LEU A C     1 
ATOM   3257  O O     . LEU A 1 418 ? -16.721 18.764  32.730  1.00 8.21   ? 726  LEU A O     1 
ATOM   3258  C CB    . LEU A 1 418 ? -14.267 18.814  34.668  1.00 6.72   ? 726  LEU A CB    1 
ATOM   3259  C CG    . LEU A 1 418 ? -13.389 19.302  35.834  1.00 28.30  ? 726  LEU A CG    1 
ATOM   3260  C CD1   . LEU A 1 418 ? -13.430 18.293  36.965  1.00 30.31  ? 726  LEU A CD1   1 
ATOM   3261  C CD2   . LEU A 1 418 ? -11.953 19.524  35.435  1.00 21.82  ? 726  LEU A CD2   1 
ATOM   3262  N N     . ASN A 1 419 ? -14.888 18.293  31.497  1.00 10.10  ? 727  ASN A N     1 
ATOM   3263  C CA    . ASN A 1 419 ? -15.518 17.328  30.598  1.00 10.25  ? 727  ASN A CA    1 
ATOM   3264  C C     . ASN A 1 419 ? -14.505 16.209  30.291  1.00 6.42   ? 727  ASN A C     1 
ATOM   3265  O O     . ASN A 1 419 ? -13.301 16.453  30.105  1.00 8.90   ? 727  ASN A O     1 
ATOM   3266  C CB    . ASN A 1 419 ? -15.910 17.941  29.244  1.00 9.90   ? 727  ASN A CB    1 
ATOM   3267  C CG    . ASN A 1 419 ? -16.766 19.180  29.363  1.00 9.43   ? 727  ASN A CG    1 
ATOM   3268  O OD1   . ASN A 1 419 ? -16.262 20.298  29.355  1.00 13.33  ? 727  ASN A OD1   1 
ATOM   3269  N ND2   . ASN A 1 419 ? -18.077 18.989  29.434  1.00 7.18   ? 727  ASN A ND2   1 
ATOM   3270  N N     . GLY A 1 420 ? -14.994 14.986  30.196  1.00 10.20  ? 728  GLY A N     1 
ATOM   3271  C CA    . GLY A 1 420 ? -14.158 13.922  29.685  1.00 5.83   ? 728  GLY A CA    1 
ATOM   3272  C C     . GLY A 1 420 ? -14.868 12.605  29.629  1.00 7.44   ? 728  GLY A C     1 
ATOM   3273  O O     . GLY A 1 420 ? -15.767 12.330  30.433  1.00 10.89  ? 728  GLY A O     1 
ATOM   3274  N N     . ILE A 1 421 ? -14.455 11.783  28.671  1.00 12.44  ? 729  ILE A N     1 
ATOM   3275  C CA    . ILE A 1 421 ? -14.921 10.404  28.590  1.00 15.55  ? 729  ILE A CA    1 
ATOM   3276  C C     . ILE A 1 421 ? -14.811 9.697   29.939  1.00 17.03  ? 729  ILE A C     1 
ATOM   3277  O O     . ILE A 1 421 ? -15.704 8.954   30.326  1.00 12.33  ? 729  ILE A O     1 
ATOM   3278  C CB    . ILE A 1 421 ? -14.113 9.615   27.534  1.00 9.93   ? 729  ILE A CB    1 
ATOM   3279  C CG1   . ILE A 1 421 ? -14.311 10.260  26.160  1.00 18.02  ? 729  ILE A CG1   1 
ATOM   3280  C CG2   . ILE A 1 421 ? -14.516 8.133   27.534  1.00 21.06  ? 729  ILE A CG2   1 
ATOM   3281  C CD1   . ILE A 1 421 ? -15.757 10.524  25.826  1.00 13.72  ? 729  ILE A CD1   1 
ATOM   3282  N N     . ASP A 1 422 ? -13.710 9.918   30.650  1.00 11.38  ? 730  ASP A N     1 
ATOM   3283  C CA    . ASP A 1 422 ? -13.505 9.260   31.947  1.00 14.07  ? 730  ASP A CA    1 
ATOM   3284  C C     . ASP A 1 422 ? -13.791 10.143  33.180  1.00 13.64  ? 730  ASP A C     1 
ATOM   3285  O O     . ASP A 1 422 ? -13.287 9.883   34.268  1.00 10.59  ? 730  ASP A O     1 
ATOM   3286  C CB    . ASP A 1 422 ? -12.081 8.710   32.008  1.00 14.57  ? 730  ASP A CB    1 
ATOM   3287  C CG    . ASP A 1 422 ? -11.778 7.791   30.838  1.00 20.27  ? 730  ASP A CG    1 
ATOM   3288  O OD1   . ASP A 1 422 ? -12.517 6.805   30.662  1.00 12.56  ? 730  ASP A OD1   1 
ATOM   3289  O OD2   . ASP A 1 422 ? -10.829 8.069   30.075  1.00 20.55  ? 730  ASP A OD2   1 
ATOM   3290  N N     . LEU A 1 423 ? -14.602 11.180  33.011  1.00 13.24  ? 731  LEU A N     1 
ATOM   3291  C CA    . LEU A 1 423 ? -14.881 12.104  34.117  1.00 12.18  ? 731  LEU A CA    1 
ATOM   3292  C C     . LEU A 1 423 ? -15.546 11.429  35.323  1.00 15.96  ? 731  LEU A C     1 
ATOM   3293  O O     . LEU A 1 423 ? -15.272 11.774  36.467  1.00 17.50  ? 731  LEU A O     1 
ATOM   3294  C CB    . LEU A 1 423 ? -15.766 13.259  33.646  1.00 15.50  ? 731  LEU A CB    1 
ATOM   3295  C CG    . LEU A 1 423 ? -16.140 14.287  34.740  1.00 10.17  ? 731  LEU A CG    1 
ATOM   3296  C CD1   . LEU A 1 423 ? -14.880 14.944  35.291  1.00 14.97  ? 731  LEU A CD1   1 
ATOM   3297  C CD2   . LEU A 1 423 ? -17.080 15.353  34.173  1.00 23.46  ? 731  LEU A CD2   1 
ATOM   3298  N N     . LYS A 1 424 ? -16.448 10.488  35.069  1.00 15.99  ? 732  LYS A N     1 
ATOM   3299  C CA    . LYS A 1 424 ? -17.131 9.834   36.181  1.00 14.09  ? 732  LYS A CA    1 
ATOM   3300  C C     . LYS A 1 424 ? -16.146 9.107   37.095  1.00 17.76  ? 732  LYS A C     1 
ATOM   3301  O O     . LYS A 1 424 ? -16.237 9.204   38.320  1.00 15.40  ? 732  LYS A O     1 
ATOM   3302  C CB    . LYS A 1 424 ? -18.180 8.862   35.678  1.00 10.20  ? 732  LYS A CB    1 
ATOM   3303  C CG    . LYS A 1 424 ? -18.977 8.207   36.795  1.00 20.40  ? 732  LYS A CG    1 
ATOM   3304  C CD    . LYS A 1 424 ? -19.971 7.203   36.238  1.00 45.37  ? 732  LYS A CD    1 
ATOM   3305  C CE    . LYS A 1 424 ? -20.718 6.487   37.352  1.00 67.68  ? 732  LYS A CE    1 
ATOM   3306  N NZ    . LYS A 1 424 ? -21.693 5.494   36.814  1.00 79.64  ? 732  LYS A NZ    1 
ATOM   3307  N N     . ALA A 1 425 ? -15.237 8.353   36.478  1.00 15.74  ? 733  ALA A N     1 
ATOM   3308  C CA    . ALA A 1 425 ? -14.185 7.623   37.182  1.00 15.70  ? 733  ALA A CA    1 
ATOM   3309  C C     . ALA A 1 425 ? -13.299 8.554   38.010  1.00 15.67  ? 733  ALA A C     1 
ATOM   3310  O O     . ALA A 1 425 ? -12.922 8.228   39.135  1.00 20.32  ? 733  ALA A O     1 
ATOM   3311  C CB    . ALA A 1 425 ? -13.344 6.830   36.187  1.00 14.40  ? 733  ALA A CB    1 
ATOM   3312  N N     . PHE A 1 426 ? -12.959 9.705   37.442  1.00 13.81  ? 734  PHE A N     1 
ATOM   3313  C CA    . PHE A 1 426 ? -12.197 10.714  38.157  1.00 15.10  ? 734  PHE A CA    1 
ATOM   3314  C C     . PHE A 1 426 ? -12.954 11.209  39.399  1.00 11.17  ? 734  PHE A C     1 
ATOM   3315  O O     . PHE A 1 426 ? -12.439 11.143  40.514  1.00 13.49  ? 734  PHE A O     1 
ATOM   3316  C CB    . PHE A 1 426 ? -11.866 11.884  37.231  1.00 14.17  ? 734  PHE A CB    1 
ATOM   3317  C CG    . PHE A 1 426 ? -11.214 13.044  37.930  1.00 14.73  ? 734  PHE A CG    1 
ATOM   3318  C CD1   . PHE A 1 426 ? -11.816 14.296  37.930  1.00 16.80  ? 734  PHE A CD1   1 
ATOM   3319  C CD2   . PHE A 1 426 ? -10.017 12.878  38.609  1.00 20.43  ? 734  PHE A CD2   1 
ATOM   3320  C CE1   . PHE A 1 426 ? -11.220 15.369  38.576  1.00 21.66  ? 734  PHE A CE1   1 
ATOM   3321  C CE2   . PHE A 1 426 ? -9.423  13.950  39.268  1.00 21.40  ? 734  PHE A CE2   1 
ATOM   3322  C CZ    . PHE A 1 426 ? -10.031 15.195  39.245  1.00 14.74  ? 734  PHE A CZ    1 
ATOM   3323  N N     . LEU A 1 427 ? -14.181 11.678  39.194  1.00 15.94  ? 735  LEU A N     1 
ATOM   3324  C CA    . LEU A 1 427 ? -15.023 12.118  40.295  1.00 20.09  ? 735  LEU A CA    1 
ATOM   3325  C C     . LEU A 1 427 ? -15.129 11.026  41.364  1.00 23.98  ? 735  LEU A C     1 
ATOM   3326  O O     . LEU A 1 427 ? -15.072 11.315  42.558  1.00 13.62  ? 735  LEU A O     1 
ATOM   3327  C CB    . LEU A 1 427 ? -16.409 12.527  39.778  1.00 22.64  ? 735  LEU A CB    1 
ATOM   3328  C CG    . LEU A 1 427 ? -16.459 13.673  38.752  1.00 23.80  ? 735  LEU A CG    1 
ATOM   3329  C CD1   . LEU A 1 427 ? -17.850 13.809  38.136  1.00 18.45  ? 735  LEU A CD1   1 
ATOM   3330  C CD2   . LEU A 1 427 ? -15.998 15.017  39.350  1.00 18.22  ? 735  LEU A CD2   1 
ATOM   3331  N N     . ASP A 1 428 ? -15.244 9.768   40.940  1.00 18.38  ? 736  ASP A N     1 
ATOM   3332  C CA    . ASP A 1 428 ? -15.352 8.667   41.894  1.00 27.63  ? 736  ASP A CA    1 
ATOM   3333  C C     . ASP A 1 428 ? -14.105 8.486   42.761  1.00 27.11  ? 736  ASP A C     1 
ATOM   3334  O O     . ASP A 1 428 ? -14.163 7.894   43.824  1.00 24.63  ? 736  ASP A O     1 
ATOM   3335  C CB    . ASP A 1 428 ? -15.705 7.352   41.191  1.00 30.96  ? 736  ASP A CB    1 
ATOM   3336  C CG    . ASP A 1 428 ? -17.151 7.305   40.750  1.00 30.94  ? 736  ASP A CG    1 
ATOM   3337  O OD1   . ASP A 1 428 ? -17.924 8.160   41.217  1.00 30.60  ? 736  ASP A OD1   1 
ATOM   3338  O OD2   . ASP A 1 428 ? -17.520 6.421   39.950  1.00 37.46  ? 736  ASP A OD2   1 
ATOM   3339  N N     . SER A 1 429 ? -12.973 8.981   42.296  1.00 13.50  ? 737  SER A N     1 
ATOM   3340  C CA    . SER A 1 429 ? -11.749 8.863   43.071  1.00 26.93  ? 737  SER A CA    1 
ATOM   3341  C C     . SER A 1 429 ? -11.660 10.013  44.060  1.00 30.40  ? 737  SER A C     1 
ATOM   3342  O O     . SER A 1 429 ? -10.733 10.079  44.861  1.00 29.82  ? 737  SER A O     1 
ATOM   3343  C CB    . SER A 1 429 ? -10.534 8.889   42.146  1.00 24.49  ? 737  SER A CB    1 
ATOM   3344  O OG    . SER A 1 429 ? -10.287 10.206  41.680  1.00 22.03  ? 737  SER A OG    1 
ATOM   3345  N N     . LEU A 1 430 ? -12.637 10.915  43.996  1.00 27.89  ? 738  LEU A N     1 
ATOM   3346  C CA    . LEU A 1 430 ? -12.669 12.093  44.848  1.00 30.95  ? 738  LEU A CA    1 
ATOM   3347  C C     . LEU A 1 430 ? -13.621 11.928  46.032  1.00 29.32  ? 738  LEU A C     1 
ATOM   3348  O O     . LEU A 1 430 ? -14.754 11.478  45.874  1.00 41.41  ? 738  LEU A O     1 
ATOM   3349  C CB    . LEU A 1 430 ? -13.079 13.317  44.036  1.00 22.19  ? 738  LEU A CB    1 
ATOM   3350  C CG    . LEU A 1 430 ? -12.148 13.687  42.880  1.00 27.44  ? 738  LEU A CG    1 
ATOM   3351  C CD1   . LEU A 1 430 ? -12.631 14.974  42.217  1.00 21.94  ? 738  LEU A CD1   1 
ATOM   3352  C CD2   . LEU A 1 430 ? -10.726 13.824  43.373  1.00 29.96  ? 738  LEU A CD2   1 
ATOM   3353  N N     . PRO A 1 431 ? -13.161 12.319  47.219  1.00 27.60  ? 739  PRO A N     1 
ATOM   3354  C CA    . PRO A 1 431 ? -13.907 12.178  48.477  1.00 38.20  ? 739  PRO A CA    1 
ATOM   3355  C C     . PRO A 1 431 ? -15.183 13.020  48.617  1.00 45.56  ? 739  PRO A C     1 
ATOM   3356  O O     . PRO A 1 431 ? -16.216 12.454  48.970  1.00 73.22  ? 739  PRO A O     1 
ATOM   3357  C CB    . PRO A 1 431 ? -12.881 12.592  49.542  1.00 47.98  ? 739  PRO A CB    1 
ATOM   3358  C CG    . PRO A 1 431 ? -11.898 13.448  48.815  1.00 45.83  ? 739  PRO A CG    1 
ATOM   3359  C CD    . PRO A 1 431 ? -11.813 12.872  47.430  1.00 34.76  ? 739  PRO A CD    1 
ATOM   3360  N N     . ASP A 1 432 ? -15.125 14.326  48.366  1.00 38.31  ? 740  ASP A N     1 
ATOM   3361  C CA    . ASP A 1 432 ? -16.210 15.220  48.799  1.00 48.53  ? 740  ASP A CA    1 
ATOM   3362  C C     . ASP A 1 432 ? -17.078 15.813  47.682  1.00 44.43  ? 740  ASP A C     1 
ATOM   3363  O O     . ASP A 1 432 ? -17.521 16.961  47.777  1.00 36.24  ? 740  ASP A O     1 
ATOM   3364  C CB    . ASP A 1 432 ? -15.649 16.361  49.656  1.00 55.36  ? 740  ASP A CB    1 
ATOM   3365  C CG    . ASP A 1 432 ? -15.057 15.875  50.964  1.00 63.72  ? 740  ASP A CG    1 
ATOM   3366  O OD1   . ASP A 1 432 ? -15.684 15.017  51.622  1.00 71.05  ? 740  ASP A OD1   1 
ATOM   3367  O OD2   . ASP A 1 432 ? -13.961 16.352  51.333  1.00 57.62  ? 740  ASP A OD2   1 
ATOM   3368  N N     . VAL A 1 433 ? -17.327 15.025  46.643  1.00 27.81  ? 741  VAL A N     1 
ATOM   3369  C CA    . VAL A 1 433 ? -18.127 15.465  45.502  1.00 30.24  ? 741  VAL A CA    1 
ATOM   3370  C C     . VAL A 1 433 ? -19.624 15.561  45.823  1.00 31.03  ? 741  VAL A C     1 
ATOM   3371  O O     . VAL A 1 433 ? -20.225 14.617  46.331  1.00 35.31  ? 741  VAL A O     1 
ATOM   3372  C CB    . VAL A 1 433 ? -17.920 14.523  44.292  1.00 27.34  ? 741  VAL A CB    1 
ATOM   3373  C CG1   . VAL A 1 433 ? -18.904 14.852  43.169  1.00 26.41  ? 741  VAL A CG1   1 
ATOM   3374  C CG2   . VAL A 1 433 ? -16.472 14.608  43.802  1.00 24.59  ? 741  VAL A CG2   1 
ATOM   3375  N N     . LYS A 1 434 ? -20.218 16.710  45.516  1.00 26.72  ? 742  LYS A N     1 
ATOM   3376  C CA    . LYS A 1 434 ? -21.655 16.903  45.691  1.00 32.81  ? 742  LYS A CA    1 
ATOM   3377  C C     . LYS A 1 434 ? -22.391 16.877  44.352  1.00 30.38  ? 742  LYS A C     1 
ATOM   3378  O O     . LYS A 1 434 ? -21.908 17.402  43.354  1.00 29.55  ? 742  LYS A O     1 
ATOM   3379  C CB    . LYS A 1 434 ? -21.933 18.209  46.443  1.00 40.88  ? 742  LYS A CB    1 
ATOM   3380  C CG    . LYS A 1 434 ? -21.301 18.235  47.830  1.00 69.53  ? 742  LYS A CG    1 
ATOM   3381  C CD    . LYS A 1 434 ? -21.965 19.243  48.753  1.00 78.31  ? 742  LYS A CD    1 
ATOM   3382  C CE    . LYS A 1 434 ? -21.500 19.045  50.189  1.00 82.63  ? 742  LYS A CE    1 
ATOM   3383  N NZ    . LYS A 1 434 ? -22.197 19.954  51.140  1.00 87.74  ? 742  LYS A NZ    1 
ATOM   3384  N N     . ILE A 1 435 ? -23.561 16.254  44.336  1.00 27.42  ? 743  ILE A N     1 
ATOM   3385  C CA    . ILE A 1 435 ? -24.333 16.115  43.110  1.00 29.53  ? 743  ILE A CA    1 
ATOM   3386  C C     . ILE A 1 435 ? -25.561 17.022  43.103  1.00 40.31  ? 743  ILE A C     1 
ATOM   3387  O O     . ILE A 1 435 ? -26.540 16.764  43.806  1.00 40.71  ? 743  ILE A O     1 
ATOM   3388  C CB    . ILE A 1 435 ? -24.799 14.654  42.920  1.00 25.35  ? 743  ILE A CB    1 
ATOM   3389  C CG1   . ILE A 1 435 ? -23.601 13.704  42.875  1.00 34.74  ? 743  ILE A CG1   1 
ATOM   3390  C CG2   . ILE A 1 435 ? -25.635 14.519  41.658  1.00 34.35  ? 743  ILE A CG2   1 
ATOM   3391  C CD1   . ILE A 1 435 ? -22.811 13.751  41.571  1.00 20.90  ? 743  ILE A CD1   1 
ATOM   3392  N N     . VAL A 1 436 ? -25.511 18.086  42.309  1.00 24.68  ? 744  VAL A N     1 
ATOM   3393  C CA    . VAL A 1 436 ? -26.649 18.981  42.195  1.00 34.93  ? 744  VAL A CA    1 
ATOM   3394  C C     . VAL A 1 436 ? -27.632 18.452  41.160  1.00 36.12  ? 744  VAL A C     1 
ATOM   3395  O O     . VAL A 1 436 ? -27.245 18.157  40.032  1.00 37.60  ? 744  VAL A O     1 
ATOM   3396  C CB    . VAL A 1 436 ? -26.189 20.392  41.811  1.00 38.93  ? 744  VAL A CB    1 
ATOM   3397  C CG1   . VAL A 1 436 ? -27.376 21.244  41.393  1.00 40.15  ? 744  VAL A CG1   1 
ATOM   3398  C CG2   . VAL A 1 436 ? -25.435 21.021  42.970  1.00 33.13  ? 744  VAL A CG2   1 
ATOM   3399  N N     . LYS A 1 437 ? -28.897 18.316  41.547  1.00 47.73  ? 745  LYS A N     1 
ATOM   3400  C CA    . LYS A 1 437 ? -29.927 17.799  40.644  1.00 52.10  ? 745  LYS A CA    1 
ATOM   3401  C C     . LYS A 1 437 ? -30.364 18.853  39.632  1.00 66.28  ? 745  LYS A C     1 
ATOM   3402  O O     . LYS A 1 437 ? -30.542 20.021  39.980  1.00 76.09  ? 745  LYS A O     1 
ATOM   3403  C CB    . LYS A 1 437 ? -31.146 17.282  41.425  1.00 55.80  ? 745  LYS A CB    1 
ATOM   3404  C CG    . LYS A 1 437 ? -31.017 15.856  41.965  1.00 50.30  ? 745  LYS A CG    1 
ATOM   3405  C CD    . LYS A 1 437 ? -32.348 15.346  42.543  1.00 46.80  ? 745  LYS A CD    1 
ATOM   3406  C CE    . LYS A 1 437 ? -32.238 13.905  43.047  1.00 49.20  ? 745  LYS A CE    1 
ATOM   3407  N NZ    . LYS A 1 437 ? -33.558 13.314  43.472  1.00 43.16  ? 745  LYS A NZ    1 
ATOM   3408  N N     . MET A 1 438 ? -30.537 18.429  38.382  1.00 68.81  ? 746  MET A N     1 
ATOM   3409  C CA    . MET A 1 438 ? -30.948 19.325  37.303  1.00 76.00  ? 746  MET A CA    1 
ATOM   3410  C C     . MET A 1 438 ? -32.441 19.189  37.008  1.00 75.06  ? 746  MET A C     1 
ATOM   3411  O O     . MET A 1 438 ? -33.288 19.597  37.806  1.00 73.39  ? 746  MET A O     1 
ATOM   3412  C CB    . MET A 1 438 ? -30.138 19.052  36.025  1.00 75.42  ? 746  MET A CB    1 
ATOM   3413  C CG    . MET A 1 438 ? -28.629 19.281  36.148  1.00 74.63  ? 746  MET A CG    1 
ATOM   3414  S SD    . MET A 1 438 ? -27.761 19.303  34.549  1.00 31.81  ? 746  MET A SD    1 
ATOM   3415  C CE    . MET A 1 438 ? -28.561 20.714  33.777  1.00 38.52  ? 746  MET A CE    1 
ATOM   3416  N N     . LEU A 1 454 ? -29.616 15.223  33.219  1.00 30.43  ? 762  LEU A N     1 
ATOM   3417  C CA    . LEU A 1 454 ? -29.032 14.332  34.218  1.00 56.25  ? 762  LEU A CA    1 
ATOM   3418  C C     . LEU A 1 454 ? -28.721 15.071  35.523  1.00 58.11  ? 762  LEU A C     1 
ATOM   3419  O O     . LEU A 1 454 ? -29.604 15.669  36.140  1.00 65.01  ? 762  LEU A O     1 
ATOM   3420  C CB    . LEU A 1 454 ? -27.761 13.671  33.669  1.00 62.79  ? 762  LEU A CB    1 
ATOM   3421  C CG    . LEU A 1 454 ? -27.273 12.394  34.362  1.00 54.12  ? 762  LEU A CG    1 
ATOM   3422  C CD1   . LEU A 1 454 ? -28.172 11.223  34.016  1.00 46.32  ? 762  LEU A CD1   1 
ATOM   3423  C CD2   . LEU A 1 454 ? -25.834 12.084  33.987  1.00 56.82  ? 762  LEU A CD2   1 
ATOM   3424  N N     . ASN A 1 455 ? -27.464 15.013  35.946  1.00 59.77  ? 763  ASN A N     1 
ATOM   3425  C CA    . ASN A 1 455 ? -27.023 15.725  37.141  1.00 48.04  ? 763  ASN A CA    1 
ATOM   3426  C C     . ASN A 1 455 ? -25.671 16.412  36.947  1.00 37.08  ? 763  ASN A C     1 
ATOM   3427  O O     . ASN A 1 455 ? -24.877 16.035  36.076  1.00 26.87  ? 763  ASN A O     1 
ATOM   3428  C CB    . ASN A 1 455 ? -27.000 14.800  38.372  1.00 53.86  ? 763  ASN A CB    1 
ATOM   3429  C CG    . ASN A 1 455 ? -26.079 13.598  38.199  1.00 51.87  ? 763  ASN A CG    1 
ATOM   3430  O OD1   . ASN A 1 455 ? -24.872 13.680  38.442  1.00 37.17  ? 763  ASN A OD1   1 
ATOM   3431  N ND2   . ASN A 1 455 ? -26.652 12.469  37.796  1.00 61.34  ? 763  ASN A ND2   1 
ATOM   3432  N N     . MET A 1 456 ? -25.417 17.432  37.754  1.00 26.84  ? 764  MET A N     1 
ATOM   3433  C CA    . MET A 1 456 ? -24.144 18.140  37.683  1.00 22.35  ? 764  MET A CA    1 
ATOM   3434  C C     . MET A 1 456 ? -23.345 17.930  38.957  1.00 24.64  ? 764  MET A C     1 
ATOM   3435  O O     . MET A 1 456 ? -23.678 18.486  40.014  1.00 26.17  ? 764  MET A O     1 
ATOM   3436  C CB    . MET A 1 456 ? -24.364 19.638  37.443  1.00 26.40  ? 764  MET A CB    1 
ATOM   3437  C CG    . MET A 1 456 ? -23.079 20.405  37.191  1.00 23.67  ? 764  MET A CG    1 
ATOM   3438  S SD    . MET A 1 456 ? -23.292 22.190  37.017  1.00 24.40  ? 764  MET A SD    1 
ATOM   3439  C CE    . MET A 1 456 ? -23.705 22.687  38.684  1.00 19.33  ? 764  MET A CE    1 
ATOM   3440  N N     . PRO A 1 457 ? -22.286 17.120  38.872  1.00 17.06  ? 765  PRO A N     1 
ATOM   3441  C CA    . PRO A 1 457 ? -21.387 16.938  40.017  1.00 24.98  ? 765  PRO A CA    1 
ATOM   3442  C C     . PRO A 1 457 ? -20.578 18.201  40.274  1.00 17.69  ? 765  PRO A C     1 
ATOM   3443  O O     . PRO A 1 457 ? -20.169 18.879  39.342  1.00 15.87  ? 765  PRO A O     1 
ATOM   3444  C CB    . PRO A 1 457 ? -20.454 15.807  39.554  1.00 18.07  ? 765  PRO A CB    1 
ATOM   3445  C CG    . PRO A 1 457 ? -21.136 15.201  38.357  1.00 18.14  ? 765  PRO A CG    1 
ATOM   3446  C CD    . PRO A 1 457 ? -21.852 16.332  37.713  1.00 11.87  ? 765  PRO A CD    1 
ATOM   3447  N N     . VAL A 1 458 ? -20.347 18.504  41.542  1.00 17.84  ? 766  VAL A N     1 
ATOM   3448  C CA    . VAL A 1 458 ? -19.625 19.704  41.935  1.00 25.39  ? 766  VAL A CA    1 
ATOM   3449  C C     . VAL A 1 458 ? -18.445 19.312  42.821  1.00 27.75  ? 766  VAL A C     1 
ATOM   3450  O O     . VAL A 1 458 ? -18.623 18.622  43.824  1.00 27.75  ? 766  VAL A O     1 
ATOM   3451  C CB    . VAL A 1 458 ? -20.537 20.661  42.727  1.00 29.12  ? 766  VAL A CB    1 
ATOM   3452  C CG1   . VAL A 1 458 ? -19.744 21.854  43.222  1.00 25.64  ? 766  VAL A CG1   1 
ATOM   3453  C CG2   . VAL A 1 458 ? -21.724 21.115  41.873  1.00 19.66  ? 766  VAL A CG2   1 
ATOM   3454  N N     . ILE A 1 459 ? -17.241 19.734  42.446  1.00 21.62  ? 767  ILE A N     1 
ATOM   3455  C CA    . ILE A 1 459 ? -16.050 19.456  43.255  1.00 21.20  ? 767  ILE A CA    1 
ATOM   3456  C C     . ILE A 1 459 ? -15.748 20.654  44.152  1.00 22.00  ? 767  ILE A C     1 
ATOM   3457  O O     . ILE A 1 459 ? -15.700 21.782  43.676  1.00 27.34  ? 767  ILE A O     1 
ATOM   3458  C CB    . ILE A 1 459 ? -14.828 19.198  42.360  1.00 31.53  ? 767  ILE A CB    1 
ATOM   3459  C CG1   . ILE A 1 459 ? -15.066 17.987  41.458  1.00 30.08  ? 767  ILE A CG1   1 
ATOM   3460  C CG2   . ILE A 1 459 ? -13.579 19.012  43.202  1.00 39.28  ? 767  ILE A CG2   1 
ATOM   3461  C CD1   . ILE A 1 459 ? -14.069 17.870  40.321  1.00 32.33  ? 767  ILE A CD1   1 
ATOM   3462  N N     . PRO A 1 460 ? -15.568 20.416  45.463  1.00 34.33  ? 768  PRO A N     1 
ATOM   3463  C CA    . PRO A 1 460 ? -15.339 21.501  46.433  1.00 39.61  ? 768  PRO A CA    1 
ATOM   3464  C C     . PRO A 1 460 ? -13.988 22.200  46.264  1.00 38.59  ? 768  PRO A C     1 
ATOM   3465  O O     . PRO A 1 460 ? -13.031 21.592  45.780  1.00 30.60  ? 768  PRO A O     1 
ATOM   3466  C CB    . PRO A 1 460 ? -15.393 20.778  47.785  1.00 49.55  ? 768  PRO A CB    1 
ATOM   3467  C CG    . PRO A 1 460 ? -15.030 19.364  47.471  1.00 51.24  ? 768  PRO A CG    1 
ATOM   3468  C CD    . PRO A 1 460 ? -15.610 19.095  46.111  1.00 42.95  ? 768  PRO A CD    1 
ATOM   3469  N N     . MET A 1 461 ? -13.919 23.464  46.678  1.00 53.45  ? 769  MET A N     1 
ATOM   3470  C CA    . MET A 1 461 ? -12.704 24.274  46.542  1.00 56.41  ? 769  MET A CA    1 
ATOM   3471  C C     . MET A 1 461 ? -11.587 23.845  47.500  1.00 51.71  ? 769  MET A C     1 
ATOM   3472  O O     . MET A 1 461 ? -11.100 24.635  48.313  1.00 46.88  ? 769  MET A O     1 
ATOM   3473  C CB    . MET A 1 461 ? -13.027 25.762  46.729  1.00 48.59  ? 769  MET A CB    1 
ATOM   3474  C CG    . MET A 1 461 ? -11.845 26.704  46.533  1.00 46.46  ? 769  MET A CG    1 
ATOM   3475  S SD    . MET A 1 461 ? -11.057 26.570  44.919  1.00 66.62  ? 769  MET A SD    1 
ATOM   3476  C CE    . MET A 1 461 ? -9.708  27.737  45.107  1.00 70.04  ? 769  MET A CE    1 
ATOM   3477  N N     . ASN A 1 462 ? -11.175 22.590  47.389  1.00 39.97  ? 770  ASN A N     1 
ATOM   3478  C CA    . ASN A 1 462 ? -10.097 22.089  48.215  1.00 31.94  ? 770  ASN A CA    1 
ATOM   3479  C C     . ASN A 1 462 ? -8.803  21.881  47.436  1.00 29.26  ? 770  ASN A C     1 
ATOM   3480  O O     . ASN A 1 462 ? -8.567  22.553  46.430  1.00 29.18  ? 770  ASN A O     1 
ATOM   3481  C CB    . ASN A 1 462 ? -10.520 20.818  48.950  1.00 47.69  ? 770  ASN A CB    1 
ATOM   3482  C CG    . ASN A 1 462 ? -11.657 21.067  49.921  1.00 54.65  ? 770  ASN A CG    1 
ATOM   3483  O OD1   . ASN A 1 462 ? -12.462 21.975  49.724  1.00 50.70  ? 770  ASN A OD1   1 
ATOM   3484  N ND2   . ASN A 1 462 ? -11.724 20.266  50.978  1.00 58.22  ? 770  ASN A ND2   1 
ATOM   3485  N N     . THR A 1 463 ? -7.963  20.975  47.939  1.00 46.27  ? 771  THR A N     1 
ATOM   3486  C CA    . THR A 1 463 ? -6.621  20.738  47.408  1.00 50.56  ? 771  THR A CA    1 
ATOM   3487  C C     . THR A 1 463 ? -6.617  20.431  45.915  1.00 56.04  ? 771  THR A C     1 
ATOM   3488  O O     . THR A 1 463 ? -5.902  21.068  45.138  1.00 48.67  ? 771  THR A O     1 
ATOM   3489  C CB    . THR A 1 463 ? -5.935  19.571  48.138  1.00 47.06  ? 771  THR A CB    1 
ATOM   3490  O OG1   . THR A 1 463 ? -6.113  19.714  49.553  1.00 48.44  ? 771  THR A OG1   1 
ATOM   3491  C CG2   . THR A 1 463 ? -4.453  19.545  47.815  1.00 50.52  ? 771  THR A CG2   1 
ATOM   3492  N N     . ILE A 1 464 ? -7.407  19.441  45.518  1.00 57.44  ? 772  ILE A N     1 
ATOM   3493  C CA    . ILE A 1 464 ? -7.536  19.099  44.108  1.00 42.69  ? 772  ILE A CA    1 
ATOM   3494  C C     . ILE A 1 464 ? -7.952  20.322  43.266  1.00 45.96  ? 772  ILE A C     1 
ATOM   3495  O O     . ILE A 1 464 ? -7.442  20.529  42.164  1.00 47.38  ? 772  ILE A O     1 
ATOM   3496  C CB    . ILE A 1 464 ? -8.517  17.920  43.904  1.00 50.60  ? 772  ILE A CB    1 
ATOM   3497  C CG1   . ILE A 1 464 ? -7.765  16.588  43.960  1.00 51.01  ? 772  ILE A CG1   1 
ATOM   3498  C CG2   . ILE A 1 464 ? -9.235  18.029  42.568  1.00 47.41  ? 772  ILE A CG2   1 
ATOM   3499  C CD1   . ILE A 1 464 ? -7.115  16.289  45.290  1.00 36.47  ? 772  ILE A CD1   1 
ATOM   3500  N N     . ALA A 1 465 ? -8.853  21.147  43.793  1.00 39.36  ? 773  ALA A N     1 
ATOM   3501  C CA    . ALA A 1 465 ? -9.326  22.321  43.053  1.00 32.45  ? 773  ALA A CA    1 
ATOM   3502  C C     . ALA A 1 465 ? -8.289  23.435  42.966  1.00 34.99  ? 773  ALA A C     1 
ATOM   3503  O O     . ALA A 1 465 ? -8.310  24.248  42.047  1.00 26.53  ? 773  ALA A O     1 
ATOM   3504  C CB    . ALA A 1 465 ? -10.607 22.854  43.648  1.00 24.43  ? 773  ALA A CB    1 
ATOM   3505  N N     . GLU A 1 466 ? -7.381  23.486  43.928  1.00 42.87  ? 774  GLU A N     1 
ATOM   3506  C CA    . GLU A 1 466 ? -6.344  24.502  43.884  1.00 32.26  ? 774  GLU A CA    1 
ATOM   3507  C C     . GLU A 1 466 ? -5.327  24.150  42.811  1.00 34.34  ? 774  GLU A C     1 
ATOM   3508  O O     . GLU A 1 466 ? -4.880  25.010  42.051  1.00 21.98  ? 774  GLU A O     1 
ATOM   3509  C CB    . GLU A 1 466 ? -5.674  24.619  45.241  1.00 35.67  ? 774  GLU A CB    1 
ATOM   3510  C CG    . GLU A 1 466 ? -6.590  25.201  46.303  1.00 33.80  ? 774  GLU A CG    1 
ATOM   3511  C CD    . GLU A 1 466 ? -5.919  25.262  47.666  1.00 43.94  ? 774  GLU A CD    1 
ATOM   3512  O OE1   . GLU A 1 466 ? -5.406  24.211  48.125  1.00 38.59  ? 774  GLU A OE1   1 
ATOM   3513  O OE2   . GLU A 1 466 ? -5.888  26.365  48.261  1.00 47.67  ? 774  GLU A OE2   1 
ATOM   3514  N N     . ALA A 1 467 ? -4.986  22.867  42.750  1.00 29.19  ? 775  ALA A N     1 
ATOM   3515  C CA    . ALA A 1 467 ? -4.020  22.358  41.786  1.00 37.29  ? 775  ALA A CA    1 
ATOM   3516  C C     . ALA A 1 467 ? -4.505  22.633  40.372  1.00 28.75  ? 775  ALA A C     1 
ATOM   3517  O O     . ALA A 1 467 ? -3.715  22.969  39.481  1.00 17.93  ? 775  ALA A O     1 
ATOM   3518  C CB    . ALA A 1 467 ? -3.791  20.870  41.999  1.00 29.57  ? 775  ALA A CB    1 
ATOM   3519  N N     . VAL A 1 468 ? -5.810  22.511  40.168  1.00 27.58  ? 776  VAL A N     1 
ATOM   3520  C CA    . VAL A 1 468 ? -6.384  22.803  38.857  1.00 25.95  ? 776  VAL A CA    1 
ATOM   3521  C C     . VAL A 1 468 ? -6.251  24.278  38.470  1.00 27.61  ? 776  VAL A C     1 
ATOM   3522  O O     . VAL A 1 468 ? -5.841  24.594  37.352  1.00 21.42  ? 776  VAL A O     1 
ATOM   3523  C CB    . VAL A 1 468 ? -7.859  22.353  38.746  1.00 29.28  ? 776  VAL A CB    1 
ATOM   3524  C CG1   . VAL A 1 468 ? -8.466  22.887  37.476  1.00 19.69  ? 776  VAL A CG1   1 
ATOM   3525  C CG2   . VAL A 1 468 ? -7.956  20.831  38.797  1.00 37.34  ? 776  VAL A CG2   1 
ATOM   3526  N N     . ILE A 1 469 ? -6.577  25.188  39.383  1.00 18.58  ? 777  ILE A N     1 
ATOM   3527  C CA    . ILE A 1 469 ? -6.493  26.599  39.044  1.00 21.29  ? 777  ILE A CA    1 
ATOM   3528  C C     . ILE A 1 469 ? -5.054  27.071  38.933  1.00 12.97  ? 777  ILE A C     1 
ATOM   3529  O O     . ILE A 1 469 ? -4.762  28.015  38.206  1.00 22.11  ? 777  ILE A O     1 
ATOM   3530  C CB    . ILE A 1 469 ? -7.285  27.515  40.011  1.00 25.69  ? 777  ILE A CB    1 
ATOM   3531  C CG1   . ILE A 1 469 ? -7.271  28.954  39.478  1.00 42.02  ? 777  ILE A CG1   1 
ATOM   3532  C CG2   . ILE A 1 469 ? -6.712  27.439  41.412  1.00 49.90  ? 777  ILE A CG2   1 
ATOM   3533  C CD1   . ILE A 1 469 ? -8.182  29.928  40.222  1.00 40.85  ? 777  ILE A CD1   1 
ATOM   3534  N N     . GLU A 1 470 ? -4.157  26.398  39.640  1.00 22.49  ? 778  GLU A N     1 
ATOM   3535  C CA    . GLU A 1 470 ? -2.740  26.722  39.549  1.00 30.66  ? 778  GLU A CA    1 
ATOM   3536  C C     . GLU A 1 470 ? -2.223  26.392  38.149  1.00 23.43  ? 778  GLU A C     1 
ATOM   3537  O O     . GLU A 1 470 ? -1.480  27.170  37.553  1.00 22.80  ? 778  GLU A O     1 
ATOM   3538  C CB    . GLU A 1 470 ? -1.941  25.962  40.609  1.00 32.44  ? 778  GLU A CB    1 
ATOM   3539  C CG    . GLU A 1 470 ? -0.438  26.201  40.536  1.00 54.49  ? 778  GLU A CG    1 
ATOM   3540  C CD    . GLU A 1 470 ? 0.345   25.365  41.532  1.00 65.49  ? 778  GLU A CD    1 
ATOM   3541  O OE1   . GLU A 1 470 ? -0.241  24.949  42.553  1.00 67.19  ? 778  GLU A OE1   1 
ATOM   3542  O OE2   . GLU A 1 470 ? 1.547   25.123  41.288  1.00 67.80  ? 778  GLU A OE2   1 
ATOM   3543  N N     . MET A 1 471 ? -2.613  25.230  37.636  1.00 18.06  ? 779  MET A N     1 
ATOM   3544  C CA    . MET A 1 471 ? -2.293  24.852  36.265  1.00 19.90  ? 779  MET A CA    1 
ATOM   3545  C C     . MET A 1 471 ? -2.692  25.962  35.300  1.00 18.99  ? 779  MET A C     1 
ATOM   3546  O O     . MET A 1 471 ? -1.884  26.426  34.498  1.00 20.47  ? 779  MET A O     1 
ATOM   3547  C CB    . MET A 1 471 ? -3.020  23.564  35.874  1.00 17.13  ? 779  MET A CB    1 
ATOM   3548  C CG    . MET A 1 471 ? -2.837  23.185  34.405  1.00 13.38  ? 779  MET A CG    1 
ATOM   3549  S SD    . MET A 1 471 ? -3.639  21.642  33.926  1.00 21.30  ? 779  MET A SD    1 
ATOM   3550  C CE    . MET A 1 471 ? -5.360  22.020  34.180  1.00 16.98  ? 779  MET A CE    1 
ATOM   3551  N N     . ILE A 1 472 ? -3.953  26.363  35.374  1.00 20.83  ? 780  ILE A N     1 
ATOM   3552  C CA    . ILE A 1 472 ? -4.487  27.414  34.520  1.00 20.88  ? 780  ILE A CA    1 
ATOM   3553  C C     . ILE A 1 472 ? -3.679  28.709  34.656  1.00 22.54  ? 780  ILE A C     1 
ATOM   3554  O O     . ILE A 1 472 ? -3.210  29.265  33.660  1.00 21.74  ? 780  ILE A O     1 
ATOM   3555  C CB    . ILE A 1 472 ? -5.958  27.708  34.859  1.00 35.93  ? 780  ILE A CB    1 
ATOM   3556  C CG1   . ILE A 1 472 ? -6.771  26.410  34.886  1.00 29.41  ? 780  ILE A CG1   1 
ATOM   3557  C CG2   . ILE A 1 472 ? -6.542  28.728  33.880  1.00 33.94  ? 780  ILE A CG2   1 
ATOM   3558  C CD1   . ILE A 1 472 ? -6.855  25.731  33.551  1.00 24.71  ? 780  ILE A CD1   1 
ATOM   3559  N N     . ASN A 1 473 ? -3.520  29.189  35.883  1.00 24.19  ? 781  ASN A N     1 
ATOM   3560  C CA    . ASN A 1 473 ? -2.781  30.439  36.115  1.00 28.06  ? 781  ASN A CA    1 
ATOM   3561  C C     . ASN A 1 473 ? -1.344  30.421  35.578  1.00 33.37  ? 781  ASN A C     1 
ATOM   3562  O O     . ASN A 1 473 ? -0.856  31.423  35.051  1.00 25.60  ? 781  ASN A O     1 
ATOM   3563  C CB    . ASN A 1 473 ? -2.780  30.815  37.605  1.00 25.11  ? 781  ASN A CB    1 
ATOM   3564  C CG    . ASN A 1 473 ? -4.157  31.212  38.112  1.00 28.81  ? 781  ASN A CG    1 
ATOM   3565  O OD1   . ASN A 1 473 ? -5.055  31.522  37.330  1.00 27.30  ? 781  ASN A OD1   1 
ATOM   3566  N ND2   . ASN A 1 473 ? -4.328  31.203  39.429  1.00 34.65  ? 781  ASN A ND2   1 
ATOM   3567  N N     . ARG A 1 474 ? -0.668  29.282  35.717  1.00 27.54  ? 782  ARG A N     1 
ATOM   3568  C CA    . ARG A 1 474 ? 0.729   29.161  35.303  1.00 22.87  ? 782  ARG A CA    1 
ATOM   3569  C C     . ARG A 1 474 ? 0.877   28.839  33.818  1.00 20.00  ? 782  ARG A C     1 
ATOM   3570  O O     . ARG A 1 474 ? 1.987   28.729  33.305  1.00 27.36  ? 782  ARG A O     1 
ATOM   3571  C CB    . ARG A 1 474 ? 1.441   28.092  36.141  1.00 24.98  ? 782  ARG A CB    1 
ATOM   3572  C CG    . ARG A 1 474 ? 1.606   28.466  37.611  1.00 26.31  ? 782  ARG A CG    1 
ATOM   3573  C CD    . ARG A 1 474 ? 2.129   27.300  38.435  1.00 33.00  ? 782  ARG A CD    1 
ATOM   3574  N NE    . ARG A 1 474 ? 3.365   26.745  37.890  1.00 43.84  ? 782  ARG A NE    1 
ATOM   3575  C CZ    . ARG A 1 474 ? 4.583   27.181  38.201  1.00 50.76  ? 782  ARG A CZ    1 
ATOM   3576  N NH1   . ARG A 1 474 ? 4.735   28.185  39.057  1.00 43.22  ? 782  ARG A NH1   1 
ATOM   3577  N NH2   . ARG A 1 474 ? 5.651   26.611  37.652  1.00 42.81  ? 782  ARG A NH2   1 
ATOM   3578  N N     . GLY A 1 475 ? -0.243  28.664  33.124  1.00 21.49  ? 783  GLY A N     1 
ATOM   3579  C CA    . GLY A 1 475 ? -0.181  28.300  31.719  1.00 16.60  ? 783  GLY A CA    1 
ATOM   3580  C C     . GLY A 1 475 ? 0.339   26.891  31.474  1.00 15.91  ? 783  GLY A C     1 
ATOM   3581  O O     . GLY A 1 475 ? 0.710   26.545  30.349  1.00 25.67  ? 783  GLY A O     1 
ATOM   3582  N N     . GLN A 1 476 ? 0.361   26.071  32.521  1.00 19.45  ? 784  GLN A N     1 
ATOM   3583  C CA    . GLN A 1 476 ? 0.764   24.668  32.401  1.00 18.89  ? 784  GLN A CA    1 
ATOM   3584  C C     . GLN A 1 476 ? -0.165  23.886  31.470  1.00 21.96  ? 784  GLN A C     1 
ATOM   3585  O O     . GLN A 1 476 ? -1.363  24.158  31.404  1.00 15.69  ? 784  GLN A O     1 
ATOM   3586  C CB    . GLN A 1 476 ? 0.839   23.999  33.786  1.00 27.46  ? 784  GLN A CB    1 
ATOM   3587  C CG    . GLN A 1 476 ? 1.872   24.636  34.717  1.00 42.12  ? 784  GLN A CG    1 
ATOM   3588  C CD    . GLN A 1 476 ? 1.855   24.079  36.140  1.00 52.21  ? 784  GLN A CD    1 
ATOM   3589  O OE1   . GLN A 1 476 ? 2.853   24.169  36.857  1.00 76.31  ? 784  GLN A OE1   1 
ATOM   3590  N NE2   . GLN A 1 476 ? 0.722   23.518  36.558  1.00 33.66  ? 784  GLN A NE2   1 
ATOM   3591  N N     . ILE A 1 477 ? 0.403   22.921  30.746  1.00 10.67  ? 785  ILE A N     1 
ATOM   3592  C CA    . ILE A 1 477 ? -0.329  22.185  29.716  1.00 14.15  ? 785  ILE A CA    1 
ATOM   3593  C C     . ILE A 1 477 ? -1.260  21.114  30.278  1.00 15.02  ? 785  ILE A C     1 
ATOM   3594  O O     . ILE A 1 477 ? -2.361  20.910  29.770  1.00 10.27  ? 785  ILE A O     1 
ATOM   3595  C CB    . ILE A 1 477 ? 0.643   21.512  28.733  1.00 18.54  ? 785  ILE A CB    1 
ATOM   3596  C CG1   . ILE A 1 477 ? 1.465   22.575  28.007  1.00 27.52  ? 785  ILE A CG1   1 
ATOM   3597  C CG2   . ILE A 1 477 ? -0.100  20.622  27.746  1.00 20.29  ? 785  ILE A CG2   1 
ATOM   3598  C CD1   . ILE A 1 477 ? 0.661   23.735  27.531  1.00 37.22  ? 785  ILE A CD1   1 
ATOM   3599  N N     . GLN A 1 478 ? -0.810  20.424  31.318  1.00 11.68  ? 786  GLN A N     1 
ATOM   3600  C CA    . GLN A 1 478 ? -1.595  19.333  31.896  1.00 10.99  ? 786  GLN A CA    1 
ATOM   3601  C C     . GLN A 1 478 ? -1.027  18.982  33.265  1.00 15.03  ? 786  GLN A C     1 
ATOM   3602  O O     . GLN A 1 478 ? 0.119   19.314  33.578  1.00 17.21  ? 786  GLN A O     1 
ATOM   3603  C CB    . GLN A 1 478 ? -1.487  18.104  30.993  1.00 10.11  ? 786  GLN A CB    1 
ATOM   3604  C CG    . GLN A 1 478 ? -0.057  17.583  30.895  1.00 18.89  ? 786  GLN A CG    1 
ATOM   3605  C CD    . GLN A 1 478 ? 0.228   16.843  29.606  1.00 29.10  ? 786  GLN A CD    1 
ATOM   3606  O OE1   . GLN A 1 478 ? -0.687  16.433  28.893  1.00 25.92  ? 786  GLN A OE1   1 
ATOM   3607  N NE2   . GLN A 1 478 ? 1.510   16.670  29.299  1.00 23.87  ? 786  GLN A NE2   1 
ATOM   3608  N N     . ILE A 1 479 ? -1.831  18.310  34.076  1.00 14.21  ? 787  ILE A N     1 
ATOM   3609  C CA    . ILE A 1 479 ? -1.364  17.771  35.345  1.00 17.57  ? 787  ILE A CA    1 
ATOM   3610  C C     . ILE A 1 479 ? -1.938  16.371  35.503  1.00 16.81  ? 787  ILE A C     1 
ATOM   3611  O O     . ILE A 1 479 ? -2.646  15.883  34.618  1.00 15.74  ? 787  ILE A O     1 
ATOM   3612  C CB    . ILE A 1 479 ? -1.783  18.657  36.537  1.00 19.80  ? 787  ILE A CB    1 
ATOM   3613  C CG1   . ILE A 1 479 ? -3.304  18.761  36.620  1.00 17.28  ? 787  ILE A CG1   1 
ATOM   3614  C CG2   . ILE A 1 479 ? -1.164  20.042  36.400  1.00 16.93  ? 787  ILE A CG2   1 
ATOM   3615  C CD1   . ILE A 1 479 ? -3.808  19.572  37.828  1.00 21.94  ? 787  ILE A CD1   1 
ATOM   3616  N N     . THR A 1 480 ? -1.619  15.723  36.614  1.00 17.34  ? 788  THR A N     1 
ATOM   3617  C CA    . THR A 1 480 ? -2.120  14.387  36.888  1.00 14.28  ? 788  THR A CA    1 
ATOM   3618  C C     . THR A 1 480 ? -2.734  14.419  38.274  1.00 21.36  ? 788  THR A C     1 
ATOM   3619  O O     . THR A 1 480 ? -2.115  14.913  39.208  1.00 18.95  ? 788  THR A O     1 
ATOM   3620  C CB    . THR A 1 480 ? -0.982  13.340  36.866  1.00 15.27  ? 788  THR A CB    1 
ATOM   3621  O OG1   . THR A 1 480 ? -0.402  13.270  35.557  1.00 14.33  ? 788  THR A OG1   1 
ATOM   3622  C CG2   . THR A 1 480 ? -1.509  11.958  37.255  1.00 20.54  ? 788  THR A CG2   1 
ATOM   3623  N N     . ILE A 1 481 ? -3.959  13.924  38.405  1.00 17.32  ? 789  ILE A N     1 
ATOM   3624  C CA    . ILE A 1 481 ? -4.585  13.811  39.722  1.00 15.88  ? 789  ILE A CA    1 
ATOM   3625  C C     . ILE A 1 481 ? -5.181  12.420  39.904  1.00 16.38  ? 789  ILE A C     1 
ATOM   3626  O O     . ILE A 1 481 ? -6.052  12.008  39.138  1.00 16.21  ? 789  ILE A O     1 
ATOM   3627  C CB    . ILE A 1 481 ? -5.688  14.874  39.939  1.00 18.25  ? 789  ILE A CB    1 
ATOM   3628  C CG1   . ILE A 1 481 ? -5.096  16.288  39.855  1.00 19.05  ? 789  ILE A CG1   1 
ATOM   3629  C CG2   . ILE A 1 481 ? -6.382  14.665  41.293  1.00 17.49  ? 789  ILE A CG2   1 
ATOM   3630  C CD1   . ILE A 1 481 ? -6.090  17.385  40.108  1.00 20.38  ? 789  ILE A CD1   1 
ATOM   3631  N N     . ASN A 1 482 ? -4.703  11.703  40.918  1.00 16.44  ? 790  ASN A N     1 
ATOM   3632  C CA    . ASN A 1 482 ? -5.151  10.341  41.172  1.00 19.07  ? 790  ASN A CA    1 
ATOM   3633  C C     . ASN A 1 482 ? -5.009  9.480   39.926  1.00 16.43  ? 790  ASN A C     1 
ATOM   3634  O O     . ASN A 1 482 ? -5.829  8.608   39.662  1.00 16.31  ? 790  ASN A O     1 
ATOM   3635  C CB    . ASN A 1 482 ? -6.592  10.326  41.692  1.00 16.69  ? 790  ASN A CB    1 
ATOM   3636  C CG    . ASN A 1 482 ? -6.733  11.031  43.037  1.00 15.08  ? 790  ASN A CG    1 
ATOM   3637  O OD1   . ASN A 1 482 ? -5.750  11.211  43.758  1.00 20.05  ? 790  ASN A OD1   1 
ATOM   3638  N ND2   . ASN A 1 482 ? -7.947  11.421  43.378  1.00 17.45  ? 790  ASN A ND2   1 
ATOM   3639  N N     . GLY A 1 483 ? -3.954  9.728   39.159  1.00 15.48  ? 791  GLY A N     1 
ATOM   3640  C CA    . GLY A 1 483 ? -3.659  8.906   38.000  1.00 19.20  ? 791  GLY A CA    1 
ATOM   3641  C C     . GLY A 1 483 ? -4.394  9.345   36.744  1.00 14.87  ? 791  GLY A C     1 
ATOM   3642  O O     . GLY A 1 483 ? -4.152  8.807   35.659  1.00 13.90  ? 791  GLY A O     1 
ATOM   3643  N N     . PHE A 1 484 ? -5.297  10.310  36.889  1.00 11.09  ? 792  PHE A N     1 
ATOM   3644  C CA    . PHE A 1 484 ? -6.056  10.829  35.751  1.00 13.28  ? 792  PHE A CA    1 
ATOM   3645  C C     . PHE A 1 484 ? -5.348  12.004  35.090  1.00 20.29  ? 792  PHE A C     1 
ATOM   3646  O O     . PHE A 1 484 ? -4.765  12.840  35.767  1.00 16.81  ? 792  PHE A O     1 
ATOM   3647  C CB    . PHE A 1 484 ? -7.463  11.246  36.183  1.00 13.32  ? 792  PHE A CB    1 
ATOM   3648  C CG    . PHE A 1 484 ? -8.332  10.090  36.583  1.00 15.84  ? 792  PHE A CG    1 
ATOM   3649  C CD1   . PHE A 1 484 ? -9.063  9.397   35.630  1.00 12.99  ? 792  PHE A CD1   1 
ATOM   3650  C CD2   . PHE A 1 484 ? -8.407  9.687   37.905  1.00 15.09  ? 792  PHE A CD2   1 
ATOM   3651  C CE1   . PHE A 1 484 ? -9.869  8.321   35.996  1.00 17.69  ? 792  PHE A CE1   1 
ATOM   3652  C CE2   . PHE A 1 484 ? -9.203  8.615   38.280  1.00 18.09  ? 792  PHE A CE2   1 
ATOM   3653  C CZ    . PHE A 1 484 ? -9.935  7.930   37.323  1.00 19.81  ? 792  PHE A CZ    1 
ATOM   3654  N N     . SER A 1 485 ? -5.403  12.053  33.762  1.00 13.98  ? 793  SER A N     1 
ATOM   3655  C CA    . SER A 1 485 ? -4.843  13.159  32.995  1.00 12.87  ? 793  SER A CA    1 
ATOM   3656  C C     . SER A 1 485 ? -5.805  14.344  32.985  1.00 13.49  ? 793  SER A C     1 
ATOM   3657  O O     . SER A 1 485 ? -6.914  14.237  32.471  1.00 22.34  ? 793  SER A O     1 
ATOM   3658  C CB    . SER A 1 485 ? -4.597  12.718  31.552  1.00 18.88  ? 793  SER A CB    1 
ATOM   3659  O OG    . SER A 1 485 ? -4.237  11.353  31.505  1.00 28.86  ? 793  SER A OG    1 
ATOM   3660  N N     . ILE A 1 486 ? -5.382  15.464  33.556  1.00 14.85  ? 794  ILE A N     1 
ATOM   3661  C CA    . ILE A 1 486 ? -6.183  16.690  33.552  1.00 9.94   ? 794  ILE A CA    1 
ATOM   3662  C C     . ILE A 1 486 ? -5.519  17.711  32.622  1.00 16.09  ? 794  ILE A C     1 
ATOM   3663  O O     . ILE A 1 486 ? -4.415  18.166  32.898  1.00 18.84  ? 794  ILE A O     1 
ATOM   3664  C CB    . ILE A 1 486 ? -6.264  17.318  34.950  1.00 12.68  ? 794  ILE A CB    1 
ATOM   3665  C CG1   . ILE A 1 486 ? -6.571  16.260  36.030  1.00 19.98  ? 794  ILE A CG1   1 
ATOM   3666  C CG2   . ILE A 1 486 ? -7.278  18.440  34.958  1.00 17.46  ? 794  ILE A CG2   1 
ATOM   3667  C CD1   . ILE A 1 486 ? -7.851  15.497  35.804  1.00 20.77  ? 794  ILE A CD1   1 
ATOM   3668  N N     . SER A 1 487 ? -6.194  18.079  31.533  1.00 9.31   ? 795  SER A N     1 
ATOM   3669  C CA    . SER A 1 487 ? -5.576  18.918  30.499  1.00 6.99   ? 795  SER A CA    1 
ATOM   3670  C C     . SER A 1 487 ? -6.063  20.363  30.565  1.00 12.69  ? 795  SER A C     1 
ATOM   3671  O O     . SER A 1 487 ? -7.249  20.609  30.783  1.00 11.71  ? 795  SER A O     1 
ATOM   3672  C CB    . SER A 1 487 ? -5.921  18.383  29.104  1.00 12.57  ? 795  SER A CB    1 
ATOM   3673  O OG    . SER A 1 487 ? -5.350  17.118  28.864  1.00 15.82  ? 795  SER A OG    1 
ATOM   3674  N N     . ASN A 1 488 ? -5.154  21.312  30.348  1.00 6.43   ? 796  ASN A N     1 
ATOM   3675  C CA    . ASN A 1 488 ? -5.521  22.715  30.161  1.00 9.90   ? 796  ASN A CA    1 
ATOM   3676  C C     . ASN A 1 488 ? -6.234  22.857  28.818  1.00 12.78  ? 796  ASN A C     1 
ATOM   3677  O O     . ASN A 1 488 ? -5.663  22.543  27.770  1.00 10.61  ? 796  ASN A O     1 
ATOM   3678  C CB    . ASN A 1 488 ? -4.260  23.598  30.172  1.00 9.24   ? 796  ASN A CB    1 
ATOM   3679  C CG    . ASN A 1 488 ? -4.567  25.090  30.183  1.00 17.06  ? 796  ASN A CG    1 
ATOM   3680  O OD1   . ASN A 1 488 ? -5.627  25.521  29.753  1.00 9.36   ? 796  ASN A OD1   1 
ATOM   3681  N ND2   . ASN A 1 488 ? -3.617  25.890  30.674  1.00 10.14  ? 796  ASN A ND2   1 
ATOM   3682  N N     . GLY A 1 489 ? -7.471  23.336  28.847  1.00 8.44   ? 797  GLY A N     1 
ATOM   3683  C CA    . GLY A 1 489 ? -8.266  23.439  27.637  1.00 7.02   ? 797  GLY A CA    1 
ATOM   3684  C C     . GLY A 1 489 ? -7.719  24.394  26.585  1.00 12.57  ? 797  GLY A C     1 
ATOM   3685  O O     . GLY A 1 489 ? -8.154  24.351  25.432  1.00 9.84   ? 797  GLY A O     1 
ATOM   3686  N N     . LEU A 1 490 ? -6.782  25.259  26.977  1.00 10.09  ? 798  LEU A N     1 
ATOM   3687  C CA    . LEU A 1 490 ? -6.147  26.169  26.023  1.00 9.24   ? 798  LEU A CA    1 
ATOM   3688  C C     . LEU A 1 490 ? -5.006  25.495  25.274  1.00 10.96  ? 798  LEU A C     1 
ATOM   3689  O O     . LEU A 1 490 ? -4.436  26.082  24.360  1.00 13.45  ? 798  LEU A O     1 
ATOM   3690  C CB    . LEU A 1 490 ? -5.603  27.412  26.725  1.00 9.75   ? 798  LEU A CB    1 
ATOM   3691  C CG    . LEU A 1 490 ? -6.644  28.368  27.285  1.00 9.74   ? 798  LEU A CG    1 
ATOM   3692  C CD1   . LEU A 1 490 ? -6.003  29.485  28.123  1.00 5.40   ? 798  LEU A CD1   1 
ATOM   3693  C CD2   . LEU A 1 490 ? -7.463  28.941  26.122  1.00 12.96  ? 798  LEU A CD2   1 
ATOM   3694  N N     . ALA A 1 491 ? -4.668  24.268  25.667  1.00 10.19  ? 799  ALA A N     1 
ATOM   3695  C CA    . ALA A 1 491 ? -3.456  23.629  25.150  1.00 9.80   ? 799  ALA A CA    1 
ATOM   3696  C C     . ALA A 1 491 ? -3.708  22.363  24.324  1.00 14.93  ? 799  ALA A C     1 
ATOM   3697  O O     . ALA A 1 491 ? -2.798  21.564  24.107  1.00 11.76  ? 799  ALA A O     1 
ATOM   3698  C CB    . ALA A 1 491 ? -2.505  23.316  26.300  1.00 13.62  ? 799  ALA A CB    1 
ATOM   3699  N N     . THR A 1 492 ? -4.923  22.191  23.830  1.00 7.48   ? 800  THR A N     1 
ATOM   3700  C CA    . THR A 1 492 ? -5.274  20.926  23.178  1.00 10.67  ? 800  THR A CA    1 
ATOM   3701  C C     . THR A 1 492 ? -4.388  20.606  21.973  1.00 19.92  ? 800  THR A C     1 
ATOM   3702  O O     . THR A 1 492 ? -4.108  19.436  21.693  1.00 13.80  ? 800  THR A O     1 
ATOM   3703  C CB    . THR A 1 492 ? -6.738  20.903  22.730  1.00 12.44  ? 800  THR A CB    1 
ATOM   3704  O OG1   . THR A 1 492 ? -6.966  21.955  21.788  1.00 16.99  ? 800  THR A OG1   1 
ATOM   3705  C CG2   . THR A 1 492 ? -7.678  21.080  23.931  1.00 10.75  ? 800  THR A CG2   1 
ATOM   3706  N N     . THR A 1 493 ? -3.939  21.626  21.248  1.00 7.73   ? 801  THR A N     1 
ATOM   3707  C CA    . THR A 1 493 ? -3.127  21.319  20.059  1.00 10.16  ? 801  THR A CA    1 
ATOM   3708  C C     . THR A 1 493 ? -1.779  20.714  20.441  1.00 11.93  ? 801  THR A C     1 
ATOM   3709  O O     . THR A 1 493 ? -1.165  20.007  19.645  1.00 13.12  ? 801  THR A O     1 
ATOM   3710  C CB    . THR A 1 493 ? -2.909  22.522  19.128  1.00 17.39  ? 801  THR A CB    1 
ATOM   3711  O OG1   . THR A 1 493 ? -2.169  23.539  19.811  1.00 14.37  ? 801  THR A OG1   1 
ATOM   3712  C CG2   . THR A 1 493 ? -4.243  23.076  18.638  1.00 13.71  ? 801  THR A CG2   1 
ATOM   3713  N N     . GLN A 1 494 ? -1.325  20.996  21.657  1.00 12.53  ? 802  GLN A N     1 
ATOM   3714  C CA    . GLN A 1 494 ? -0.055  20.473  22.151  1.00 15.47  ? 802  GLN A CA    1 
ATOM   3715  C C     . GLN A 1 494 ? -0.198  19.056  22.725  1.00 25.57  ? 802  GLN A C     1 
ATOM   3716  O O     . GLN A 1 494 ? 0.787   18.330  22.879  1.00 20.44  ? 802  GLN A O     1 
ATOM   3717  C CB    . GLN A 1 494 ? 0.503   21.409  23.225  1.00 9.29   ? 802  GLN A CB    1 
ATOM   3718  C CG    . GLN A 1 494 ? 0.908   22.800  22.710  1.00 12.82  ? 802  GLN A CG    1 
ATOM   3719  C CD    . GLN A 1 494 ? 1.206   23.772  23.846  1.00 16.23  ? 802  GLN A CD    1 
ATOM   3720  O OE1   . GLN A 1 494 ? 2.207   23.635  24.546  1.00 21.69  ? 802  GLN A OE1   1 
ATOM   3721  N NE2   . GLN A 1 494 ? 0.326   24.745  24.042  1.00 18.68  ? 802  GLN A NE2   1 
ATOM   3722  N N     . ILE A 1 495 ? -1.428  18.672  23.043  1.00 12.92  ? 803  ILE A N     1 
ATOM   3723  C CA    . ILE A 1 495 ? -1.706  17.370  23.652  1.00 9.90   ? 803  ILE A CA    1 
ATOM   3724  C C     . ILE A 1 495 ? -2.129  16.349  22.603  1.00 16.60  ? 803  ILE A C     1 
ATOM   3725  O O     . ILE A 1 495 ? -1.620  15.227  22.559  1.00 16.28  ? 803  ILE A O     1 
ATOM   3726  C CB    . ILE A 1 495 ? -2.815  17.512  24.724  1.00 16.07  ? 803  ILE A CB    1 
ATOM   3727  C CG1   . ILE A 1 495 ? -2.311  18.399  25.868  1.00 12.69  ? 803  ILE A CG1   1 
ATOM   3728  C CG2   . ILE A 1 495 ? -3.229  16.147  25.234  1.00 11.42  ? 803  ILE A CG2   1 
ATOM   3729  C CD1   . ILE A 1 495 ? -3.395  19.025  26.701  1.00 15.03  ? 803  ILE A CD1   1 
ATOM   3730  N N     . ASN A 1 496 ? -3.077  16.734  21.761  1.00 15.96  ? 804  ASN A N     1 
ATOM   3731  C CA    . ASN A 1 496 ? -3.519  15.861  20.675  1.00 15.50  ? 804  ASN A CA    1 
ATOM   3732  C C     . ASN A 1 496 ? -4.166  16.702  19.587  1.00 14.86  ? 804  ASN A C     1 
ATOM   3733  O O     . ASN A 1 496 ? -5.323  17.105  19.696  1.00 10.42  ? 804  ASN A O     1 
ATOM   3734  C CB    . ASN A 1 496 ? -4.487  14.783  21.190  1.00 13.52  ? 804  ASN A CB    1 
ATOM   3735  C CG    . ASN A 1 496 ? -5.034  13.896  20.068  1.00 14.61  ? 804  ASN A CG    1 
ATOM   3736  O OD1   . ASN A 1 496 ? -4.723  14.100  18.895  1.00 10.30  ? 804  ASN A OD1   1 
ATOM   3737  N ND2   . ASN A 1 496 ? -5.839  12.907  20.429  1.00 13.25  ? 804  ASN A ND2   1 
ATOM   3738  N N     . ASN A 1 497 ? -3.414  16.981  18.530  1.00 11.20  ? 805  ASN A N     1 
ATOM   3739  C CA    . ASN A 1 497 ? -3.899  17.897  17.509  1.00 12.87  ? 805  ASN A CA    1 
ATOM   3740  C C     . ASN A 1 497 ? -5.171  17.407  16.802  1.00 13.93  ? 805  ASN A C     1 
ATOM   3741  O O     . ASN A 1 497 ? -6.024  18.202  16.427  1.00 11.12  ? 805  ASN A O     1 
ATOM   3742  C CB    . ASN A 1 497 ? -2.793  18.197  16.496  1.00 21.55  ? 805  ASN A CB    1 
ATOM   3743  C CG    . ASN A 1 497 ? -3.072  19.447  15.697  1.00 36.06  ? 805  ASN A CG    1 
ATOM   3744  O OD1   . ASN A 1 497 ? -3.028  20.554  16.229  1.00 32.30  ? 805  ASN A OD1   1 
ATOM   3745  N ND2   . ASN A 1 497 ? -3.368  19.280  14.412  1.00 39.56  ? 805  ASN A ND2   1 
ATOM   3746  N N     . LYS A 1 498 ? -5.302  16.095  16.637  1.00 9.15   ? 806  LYS A N     1 
ATOM   3747  C CA    . LYS A 1 498 ? -6.506  15.522  16.043  1.00 10.61  ? 806  LYS A CA    1 
ATOM   3748  C C     . LYS A 1 498 ? -7.740  15.702  16.932  1.00 8.69   ? 806  LYS A C     1 
ATOM   3749  O O     . LYS A 1 498 ? -8.849  15.866  16.431  1.00 10.12  ? 806  LYS A O     1 
ATOM   3750  C CB    . LYS A 1 498 ? -6.293  14.034  15.714  1.00 9.88   ? 806  LYS A CB    1 
ATOM   3751  C CG    . LYS A 1 498 ? -5.264  13.803  14.621  1.00 19.27  ? 806  LYS A CG    1 
ATOM   3752  C CD    . LYS A 1 498 ? -5.902  13.242  13.367  1.00 30.56  ? 806  LYS A CD    1 
ATOM   3753  C CE    . LYS A 1 498 ? -4.841  12.931  12.315  1.00 45.62  ? 806  LYS A CE    1 
ATOM   3754  N NZ    . LYS A 1 498 ? -5.421  12.710  10.960  1.00 49.44  ? 806  LYS A NZ    1 
ATOM   3755  N N     . ALA A 1 499 ? -7.550  15.654  18.249  1.00 8.14   ? 807  ALA A N     1 
ATOM   3756  C CA    . ALA A 1 499 ? -8.637  15.970  19.178  1.00 14.31  ? 807  ALA A CA    1 
ATOM   3757  C C     . ALA A 1 499 ? -9.025  17.448  19.067  1.00 12.66  ? 807  ALA A C     1 
ATOM   3758  O O     . ALA A 1 499 ? -10.203 17.803  19.078  1.00 11.52  ? 807  ALA A O     1 
ATOM   3759  C CB    . ALA A 1 499 ? -8.229  15.625  20.616  1.00 13.59  ? 807  ALA A CB    1 
ATOM   3760  N N     . ALA A 1 500 ? -8.028  18.310  18.939  1.00 12.71  ? 808  ALA A N     1 
ATOM   3761  C CA    . ALA A 1 500 ? -8.288  19.745  18.798  1.00 15.57  ? 808  ALA A CA    1 
ATOM   3762  C C     . ALA A 1 500 ? -9.156  20.087  17.574  1.00 18.06  ? 808  ALA A C     1 
ATOM   3763  O O     . ALA A 1 500 ? -10.026 20.955  17.649  1.00 16.46  ? 808  ALA A O     1 
ATOM   3764  C CB    . ALA A 1 500 ? -6.979  20.512  18.752  1.00 10.82  ? 808  ALA A CB    1 
ATOM   3765  N N     . THR A 1 501 ? -8.934  19.406  16.452  1.00 9.76   ? 809  THR A N     1 
ATOM   3766  C CA    . THR A 1 501 ? -9.677  19.725  15.227  1.00 7.77   ? 809  THR A CA    1 
ATOM   3767  C C     . THR A 1 501 ? -10.982 18.957  15.108  1.00 8.91   ? 809  THR A C     1 
ATOM   3768  O O     . THR A 1 501 ? -11.741 19.158  14.164  1.00 11.50  ? 809  THR A O     1 
ATOM   3769  C CB    . THR A 1 501 ? -8.854  19.398  13.987  1.00 19.31  ? 809  THR A CB    1 
ATOM   3770  O OG1   . THR A 1 501 ? -8.593  17.987  13.969  1.00 16.45  ? 809  THR A OG1   1 
ATOM   3771  C CG2   . THR A 1 501 ? -7.543  20.168  14.010  1.00 21.03  ? 809  THR A CG2   1 
ATOM   3772  N N     . GLY A 1 502 ? -11.252 18.078  16.070  1.00 13.07  ? 810  GLY A N     1 
ATOM   3773  C CA    . GLY A 1 502 ? -12.472 17.296  16.051  1.00 11.85  ? 810  GLY A CA    1 
ATOM   3774  C C     . GLY A 1 502 ? -12.371 16.000  15.246  1.00 10.86  ? 810  GLY A C     1 
ATOM   3775  O O     . GLY A 1 502 ? -13.369 15.295  15.081  1.00 12.58  ? 810  GLY A O     1 
ATOM   3776  N N     . GLU A 1 503 ? -11.174 15.674  14.770  1.00 9.65   ? 811  GLU A N     1 
ATOM   3777  C CA    . GLU A 1 503 ? -10.952 14.406  14.048  1.00 10.96  ? 811  GLU A CA    1 
ATOM   3778  C C     . GLU A 1 503 ? -10.925 13.174  14.956  1.00 11.04  ? 811  GLU A C     1 
ATOM   3779  O O     . GLU A 1 503 ? -11.147 12.060  14.481  1.00 14.57  ? 811  GLU A O     1 
ATOM   3780  C CB    . GLU A 1 503 ? -9.639  14.445  13.266  1.00 12.10  ? 811  GLU A CB    1 
ATOM   3781  C CG    . GLU A 1 503 ? -9.660  15.317  12.017  1.00 13.66  ? 811  GLU A CG    1 
ATOM   3782  C CD    . GLU A 1 503 ? -8.306  15.320  11.350  1.00 18.55  ? 811  GLU A CD    1 
ATOM   3783  O OE1   . GLU A 1 503 ? -7.603  16.336  11.465  1.00 23.21  ? 811  GLU A OE1   1 
ATOM   3784  O OE2   . GLU A 1 503 ? -7.931  14.284  10.754  1.00 16.55  ? 811  GLU A OE2   1 
ATOM   3785  N N     . GLU A 1 504 ? -10.616 13.379  16.238  1.00 12.36  ? 812  GLU A N     1 
ATOM   3786  C CA    . GLU A 1 504 ? -10.611 12.322  17.254  1.00 11.51  ? 812  GLU A CA    1 
ATOM   3787  C C     . GLU A 1 504 ? -11.295 12.850  18.517  1.00 14.67  ? 812  GLU A C     1 
ATOM   3788  O O     . GLU A 1 504 ? -11.287 14.042  18.769  1.00 7.33   ? 812  GLU A O     1 
ATOM   3789  C CB    . GLU A 1 504 ? -9.176  11.919  17.632  1.00 12.53  ? 812  GLU A CB    1 
ATOM   3790  C CG    . GLU A 1 504 ? -8.440  11.054  16.622  1.00 14.68  ? 812  GLU A CG    1 
ATOM   3791  C CD    . GLU A 1 504 ? -7.050  10.640  17.114  1.00 17.25  ? 812  GLU A CD    1 
ATOM   3792  O OE1   . GLU A 1 504 ? -6.310  10.020  16.333  1.00 18.01  ? 812  GLU A OE1   1 
ATOM   3793  O OE2   . GLU A 1 504 ? -6.687  10.946  18.269  1.00 14.27  ? 812  GLU A OE2   1 
ATOM   3794  N N     . VAL A 1 505 ? -11.881 11.959  19.309  1.00 11.38  ? 813  VAL A N     1 
ATOM   3795  C CA    . VAL A 1 505 ? -12.448 12.348  20.595  1.00 10.12  ? 813  VAL A CA    1 
ATOM   3796  C C     . VAL A 1 505 ? -11.304 12.459  21.606  1.00 11.54  ? 813  VAL A C     1 
ATOM   3797  O O     . VAL A 1 505 ? -10.457 11.567  21.674  1.00 11.07  ? 813  VAL A O     1 
ATOM   3798  C CB    . VAL A 1 505 ? -13.479 11.307  21.069  1.00 10.76  ? 813  VAL A CB    1 
ATOM   3799  C CG1   . VAL A 1 505 ? -14.055 11.685  22.443  1.00 11.27  ? 813  VAL A CG1   1 
ATOM   3800  C CG2   . VAL A 1 505 ? -14.596 11.169  20.037  1.00 10.73  ? 813  VAL A CG2   1 
ATOM   3801  N N     . PRO A 1 506 ? -11.247 13.568  22.366  1.00 9.61   ? 814  PRO A N     1 
ATOM   3802  C CA    . PRO A 1 506 ? -10.181 13.693  23.370  1.00 13.76  ? 814  PRO A CA    1 
ATOM   3803  C C     . PRO A 1 506 ? -10.181 12.489  24.314  1.00 11.89  ? 814  PRO A C     1 
ATOM   3804  O O     . PRO A 1 506 ? -11.247 11.964  24.658  1.00 11.34  ? 814  PRO A O     1 
ATOM   3805  C CB    . PRO A 1 506 ? -10.569 14.953  24.149  1.00 16.33  ? 814  PRO A CB    1 
ATOM   3806  C CG    . PRO A 1 506 ? -11.498 15.711  23.238  1.00 14.76  ? 814  PRO A CG    1 
ATOM   3807  C CD    . PRO A 1 506 ? -12.209 14.686  22.425  1.00 10.42  ? 814  PRO A CD    1 
ATOM   3808  N N     . ARG A 1 507 ? -8.997  12.069  24.738  1.00 8.70   ? 815  ARG A N     1 
ATOM   3809  C CA    . ARG A 1 507 ? -8.879  10.922  25.626  1.00 14.16  ? 815  ARG A CA    1 
ATOM   3810  C C     . ARG A 1 507 ? -8.439  11.328  27.036  1.00 15.47  ? 815  ARG A C     1 
ATOM   3811  O O     . ARG A 1 507 ? -8.240  10.469  27.893  1.00 14.21  ? 815  ARG A O     1 
ATOM   3812  C CB    . ARG A 1 507 ? -7.954  9.847   25.021  1.00 7.60   ? 815  ARG A CB    1 
ATOM   3813  C CG    . ARG A 1 507 ? -8.501  9.238   23.743  1.00 9.94   ? 815  ARG A CG    1 
ATOM   3814  C CD    . ARG A 1 507 ? -7.612  8.113   23.188  1.00 11.86  ? 815  ARG A CD    1 
ATOM   3815  N NE    . ARG A 1 507 ? -6.268  8.559   22.825  1.00 12.16  ? 815  ARG A NE    1 
ATOM   3816  C CZ    . ARG A 1 507 ? -5.948  9.127   21.664  1.00 14.84  ? 815  ARG A CZ    1 
ATOM   3817  N NH1   . ARG A 1 507 ? -6.881  9.355   20.752  1.00 9.53   ? 815  ARG A NH1   1 
ATOM   3818  N NH2   . ARG A 1 507 ? -4.691  9.485   21.421  1.00 12.65  ? 815  ARG A NH2   1 
ATOM   3819  N N     . THR A 1 508 ? -8.323  12.637  27.275  1.00 8.62   ? 816  THR A N     1 
ATOM   3820  C CA    . THR A 1 508 ? -8.049  13.157  28.619  1.00 10.85  ? 816  THR A CA    1 
ATOM   3821  C C     . THR A 1 508 ? -9.240  13.965  29.145  1.00 12.73  ? 816  THR A C     1 
ATOM   3822  O O     . THR A 1 508 ? -10.185 14.250  28.418  1.00 14.29  ? 816  THR A O     1 
ATOM   3823  C CB    . THR A 1 508 ? -6.793  14.068  28.644  1.00 15.92  ? 816  THR A CB    1 
ATOM   3824  O OG1   . THR A 1 508 ? -7.063  15.299  27.949  1.00 13.15  ? 816  THR A OG1   1 
ATOM   3825  C CG2   . THR A 1 508 ? -5.606  13.365  28.005  1.00 16.89  ? 816  THR A CG2   1 
ATOM   3826  N N     . ILE A 1 509 ? -9.189  14.317  30.421  1.00 10.20  ? 817  ILE A N     1 
ATOM   3827  C CA    . ILE A 1 509 ? -10.196 15.179  31.023  1.00 12.45  ? 817  ILE A CA    1 
ATOM   3828  C C     . ILE A 1 509 ? -9.733  16.619  30.839  1.00 15.03  ? 817  ILE A C     1 
ATOM   3829  O O     . ILE A 1 509 ? -8.567  16.941  31.083  1.00 16.63  ? 817  ILE A O     1 
ATOM   3830  C CB    . ILE A 1 509 ? -10.359 14.856  32.514  1.00 8.38   ? 817  ILE A CB    1 
ATOM   3831  C CG1   . ILE A 1 509 ? -10.925 13.441  32.672  1.00 13.76  ? 817  ILE A CG1   1 
ATOM   3832  C CG2   . ILE A 1 509 ? -11.253 15.894  33.211  1.00 5.84   ? 817  ILE A CG2   1 
ATOM   3833  C CD1   . ILE A 1 509 ? -10.748 12.880  34.064  1.00 15.59  ? 817  ILE A CD1   1 
ATOM   3834  N N     . ILE A 1 510 ? -10.642 17.479  30.391  1.00 7.71   ? 818  ILE A N     1 
ATOM   3835  C CA    . ILE A 1 510 ? -10.263 18.822  29.997  1.00 8.61   ? 818  ILE A CA    1 
ATOM   3836  C C     . ILE A 1 510 ? -10.919 19.857  30.892  1.00 10.44  ? 818  ILE A C     1 
ATOM   3837  O O     . ILE A 1 510 ? -12.077 19.712  31.270  1.00 12.63  ? 818  ILE A O     1 
ATOM   3838  C CB    . ILE A 1 510 ? -10.642 19.108  28.532  1.00 7.88   ? 818  ILE A CB    1 
ATOM   3839  C CG1   . ILE A 1 510 ? -9.942  18.120  27.593  1.00 10.78  ? 818  ILE A CG1   1 
ATOM   3840  C CG2   . ILE A 1 510 ? -10.286 20.539  28.162  1.00 12.57  ? 818  ILE A CG2   1 
ATOM   3841  C CD1   . ILE A 1 510 ? -10.454 18.189  26.163  1.00 13.81  ? 818  ILE A CD1   1 
ATOM   3842  N N     A VAL A 1 511 ? -10.168 20.901  31.239  0.50 10.43  ? 819  VAL A N     1 
ATOM   3843  N N     B VAL A 1 511 ? -10.177 20.910  31.208  0.50 8.91   ? 819  VAL A N     1 
ATOM   3844  C CA    A VAL A 1 511 ? -10.658 21.950  32.135  0.50 5.98   ? 819  VAL A CA    1 
ATOM   3845  C CA    B VAL A 1 511 ? -10.682 21.932  32.108  0.50 6.23   ? 819  VAL A CA    1 
ATOM   3846  C C     A VAL A 1 511 ? -10.865 23.212  31.321  0.50 17.22  ? 819  VAL A C     1 
ATOM   3847  C C     B VAL A 1 511 ? -10.866 23.214  31.319  0.50 17.20  ? 819  VAL A C     1 
ATOM   3848  O O     A VAL A 1 511 ? -9.980  23.621  30.565  0.50 13.07  ? 819  VAL A O     1 
ATOM   3849  O O     B VAL A 1 511 ? -9.979  23.627  30.566  0.50 13.18  ? 819  VAL A O     1 
ATOM   3850  C CB    A VAL A 1 511 ? -9.653  22.248  33.257  0.50 12.21  ? 819  VAL A CB    1 
ATOM   3851  C CB    B VAL A 1 511 ? -9.735  22.146  33.286  0.50 10.42  ? 819  VAL A CB    1 
ATOM   3852  C CG1   A VAL A 1 511 ? -10.189 23.340  34.221  0.50 3.93   ? 819  VAL A CG1   1 
ATOM   3853  C CG1   B VAL A 1 511 ? -9.307  20.807  33.851  0.50 11.67  ? 819  VAL A CG1   1 
ATOM   3854  C CG2   A VAL A 1 511 ? -9.310  20.974  34.014  0.50 13.07  ? 819  VAL A CG2   1 
ATOM   3855  C CG2   B VAL A 1 511 ? -8.514  22.937  32.867  0.50 23.66  ? 819  VAL A CG2   1 
ATOM   3856  N N     . THR A 1 512 ? -12.035 23.821  31.474  1.00 9.31   ? 820  THR A N     1 
ATOM   3857  C CA    . THR A 1 512 ? -12.379 25.049  30.757  1.00 15.18  ? 820  THR A CA    1 
ATOM   3858  C C     . THR A 1 512 ? -12.847 26.060  31.782  1.00 12.59  ? 820  THR A C     1 
ATOM   3859  O O     . THR A 1 512 ? -13.647 25.722  32.649  1.00 8.96   ? 820  THR A O     1 
ATOM   3860  C CB    . THR A 1 512 ? -13.541 24.778  29.789  1.00 8.57   ? 820  THR A CB    1 
ATOM   3861  O OG1   . THR A 1 512 ? -13.251 23.587  29.050  1.00 8.66   ? 820  THR A OG1   1 
ATOM   3862  C CG2   . THR A 1 512 ? -13.749 25.960  28.836  1.00 9.69   ? 820  THR A CG2   1 
ATOM   3863  N N     . THR A 1 513 ? -12.355 27.295  31.701  1.00 11.46  ? 821  THR A N     1 
ATOM   3864  C CA    . THR A 1 513 ? -12.661 28.267  32.753  1.00 10.40  ? 821  THR A CA    1 
ATOM   3865  C C     . THR A 1 513 ? -12.786 29.677  32.216  1.00 10.91  ? 821  THR A C     1 
ATOM   3866  O O     . THR A 1 513 ? -12.196 30.024  31.192  1.00 11.84  ? 821  THR A O     1 
ATOM   3867  C CB    . THR A 1 513 ? -11.547 28.279  33.780  1.00 13.21  ? 821  THR A CB    1 
ATOM   3868  O OG1   . THR A 1 513 ? -10.437 29.004  33.241  1.00 13.64  ? 821  THR A OG1   1 
ATOM   3869  C CG2   . THR A 1 513 ? -11.131 26.844  34.094  1.00 10.15  ? 821  THR A CG2   1 
ATOM   3870  N N     . ARG A 1 514 ? -13.569 30.496  32.903  1.00 9.48   ? 822  ARG A N     1 
ATOM   3871  C CA    . ARG A 1 514 ? -13.702 31.887  32.497  1.00 12.06  ? 822  ARG A CA    1 
ATOM   3872  C C     . ARG A 1 514 ? -12.349 32.614  32.508  1.00 12.34  ? 822  ARG A C     1 
ATOM   3873  O O     . ARG A 1 514 ? -12.040 33.416  31.611  1.00 11.38  ? 822  ARG A O     1 
ATOM   3874  C CB    . ARG A 1 514 ? -14.764 32.583  33.354  1.00 4.41   ? 822  ARG A CB    1 
ATOM   3875  C CG    . ARG A 1 514 ? -16.181 32.222  32.864  1.00 7.88   ? 822  ARG A CG    1 
ATOM   3876  C CD    . ARG A 1 514 ? -17.306 32.919  33.619  1.00 12.30  ? 822  ARG A CD    1 
ATOM   3877  N NE    . ARG A 1 514 ? -18.575 32.640  32.953  1.00 15.88  ? 822  ARG A NE    1 
ATOM   3878  C CZ    . ARG A 1 514 ? -19.696 33.313  33.154  1.00 10.76  ? 822  ARG A CZ    1 
ATOM   3879  N NH1   . ARG A 1 514 ? -19.703 34.317  34.025  1.00 9.91   ? 822  ARG A NH1   1 
ATOM   3880  N NH2   . ARG A 1 514 ? -20.805 32.989  32.473  1.00 9.68   ? 822  ARG A NH2   1 
ATOM   3881  N N     . SER A 1 515 ? -11.512 32.312  33.497  1.00 10.64  ? 823  SER A N     1 
ATOM   3882  C CA    . SER A 1 515 ? -10.198 32.965  33.576  1.00 11.21  ? 823  SER A CA    1 
ATOM   3883  C C     . SER A 1 515 ? -9.315  32.712  32.342  1.00 16.04  ? 823  SER A C     1 
ATOM   3884  O O     . SER A 1 515 ? -8.485  33.543  32.015  1.00 14.09  ? 823  SER A O     1 
ATOM   3885  C CB    . SER A 1 515 ? -9.459  32.525  34.853  1.00 14.35  ? 823  SER A CB    1 
ATOM   3886  O OG    . SER A 1 515 ? -9.250  31.125  34.849  1.00 19.45  ? 823  SER A OG    1 
ATOM   3887  N N     . GLN A 1 516 ? -9.495  31.573  31.664  1.00 15.14  ? 824  GLN A N     1 
ATOM   3888  C CA    . GLN A 1 516 ? -8.734  31.260  30.435  1.00 13.08  ? 824  GLN A CA    1 
ATOM   3889  C C     . GLN A 1 516 ? -9.018  32.288  29.361  1.00 18.09  ? 824  GLN A C     1 
ATOM   3890  O O     . GLN A 1 516 ? -8.236  32.471  28.421  1.00 15.17  ? 824  GLN A O     1 
ATOM   3891  C CB    . GLN A 1 516 ? -9.130  29.890  29.860  1.00 13.00  ? 824  GLN A CB    1 
ATOM   3892  C CG    . GLN A 1 516 ? -8.533  28.671  30.540  1.00 5.80   ? 824  GLN A CG    1 
ATOM   3893  C CD    . GLN A 1 516 ? -9.149  27.396  30.063  1.00 8.83   ? 824  GLN A CD    1 
ATOM   3894  O OE1   . GLN A 1 516 ? -10.312 27.373  29.655  1.00 9.92   ? 824  GLN A OE1   1 
ATOM   3895  N NE2   . GLN A 1 516 ? -8.365  26.300  30.084  1.00 12.94  ? 824  GLN A NE2   1 
ATOM   3896  N N     . TYR A 1 517 ? -10.168 32.940  29.468  1.00 6.67   ? 825  TYR A N     1 
ATOM   3897  C CA    . TYR A 1 517 ? -10.552 33.867  28.407  1.00 11.61  ? 825  TYR A CA    1 
ATOM   3898  C C     . TYR A 1 517 ? -10.715 35.312  28.865  1.00 14.14  ? 825  TYR A C     1 
ATOM   3899  O O     . TYR A 1 517 ? -11.080 36.177  28.061  1.00 9.68   ? 825  TYR A O     1 
ATOM   3900  C CB    . TYR A 1 517 ? -11.813 33.364  27.691  1.00 12.49  ? 825  TYR A CB    1 
ATOM   3901  C CG    . TYR A 1 517 ? -11.586 32.009  27.057  1.00 9.62   ? 825  TYR A CG    1 
ATOM   3902  C CD1   . TYR A 1 517 ? -10.808 31.892  25.914  1.00 10.12  ? 825  TYR A CD1   1 
ATOM   3903  C CD2   . TYR A 1 517 ? -12.094 30.854  27.631  1.00 7.49   ? 825  TYR A CD2   1 
ATOM   3904  C CE1   . TYR A 1 517 ? -10.568 30.653  25.336  1.00 10.98  ? 825  TYR A CE1   1 
ATOM   3905  C CE2   . TYR A 1 517 ? -11.861 29.614  27.066  1.00 5.93   ? 825  TYR A CE2   1 
ATOM   3906  C CZ    . TYR A 1 517 ? -11.097 29.527  25.913  1.00 5.08   ? 825  TYR A CZ    1 
ATOM   3907  O OH    . TYR A 1 517 ? -10.856 28.318  25.329  1.00 7.04   ? 825  TYR A OH    1 
ATOM   3908  N N     . GLY A 1 518 ? -10.432 35.566  30.145  1.00 13.82  ? 826  GLY A N     1 
ATOM   3909  C CA    . GLY A 1 518 ? -10.578 36.899  30.706  1.00 20.58  ? 826  GLY A CA    1 
ATOM   3910  C C     . GLY A 1 518 ? -12.033 37.298  30.925  1.00 25.03  ? 826  GLY A C     1 
ATOM   3911  O O     . GLY A 1 518 ? -12.368 38.472  30.965  1.00 17.30  ? 826  GLY A O     1 
ATOM   3912  N N     A LEU A 1 519 ? -12.907 36.309  31.066  0.50 14.02  ? 827  LEU A N     1 
ATOM   3913  N N     B LEU A 1 519 ? -12.895 36.302  31.058  0.50 13.70  ? 827  LEU A N     1 
ATOM   3914  C CA    A LEU A 1 519 ? -14.330 36.574  31.280  0.50 13.84  ? 827  LEU A CA    1 
ATOM   3915  C CA    B LEU A 1 519 ? -14.303 36.548  31.331  0.50 14.73  ? 827  LEU A CA    1 
ATOM   3916  C C     A LEU A 1 519 ? -14.651 36.761  32.772  0.50 13.80  ? 827  LEU A C     1 
ATOM   3917  C C     B LEU A 1 519 ? -14.458 36.981  32.789  0.50 11.47  ? 827  LEU A C     1 
ATOM   3918  O O     A LEU A 1 519 ? -14.159 36.000  33.614  0.50 6.07   ? 827  LEU A O     1 
ATOM   3919  O O     B LEU A 1 519 ? -13.639 36.626  33.628  0.50 16.62  ? 827  LEU A O     1 
ATOM   3920  C CB    A LEU A 1 519 ? -15.163 35.422  30.705  0.50 16.73  ? 827  LEU A CB    1 
ATOM   3921  C CB    B LEU A 1 519 ? -15.102 35.263  31.081  0.50 16.98  ? 827  LEU A CB    1 
ATOM   3922  C CG    A LEU A 1 519 ? -15.207 35.270  29.183  0.50 3.71   ? 827  LEU A CG    1 
ATOM   3923  C CG    B LEU A 1 519 ? -15.308 34.815  29.630  0.50 13.33  ? 827  LEU A CG    1 
ATOM   3924  C CD1   A LEU A 1 519 ? -15.807 33.922  28.781  0.50 7.67   ? 827  LEU A CD1   1 
ATOM   3925  C CD1   B LEU A 1 519 ? -14.206 35.303  28.717  0.50 3.63   ? 827  LEU A CD1   1 
ATOM   3926  C CD2   A LEU A 1 519 ? -16.009 36.406  28.562  0.50 3.73   ? 827  LEU A CD2   1 
ATOM   3927  C CD2   B LEU A 1 519 ? -15.494 33.283  29.531  0.50 4.45   ? 827  LEU A CD2   1 
ATOM   3928  N N     . PRO A 1 520 ? -15.510 37.749  33.101  1.00 21.15  ? 828  PRO A N     1 
ATOM   3929  C CA    . PRO A 1 520 ? -15.764 38.062  34.520  1.00 26.26  ? 828  PRO A CA    1 
ATOM   3930  C C     . PRO A 1 520 ? -16.394 36.887  35.268  1.00 24.50  ? 828  PRO A C     1 
ATOM   3931  O O     . PRO A 1 520 ? -17.373 36.304  34.783  1.00 14.98  ? 828  PRO A O     1 
ATOM   3932  C CB    . PRO A 1 520 ? -16.769 39.216  34.448  1.00 20.65  ? 828  PRO A CB    1 
ATOM   3933  C CG    . PRO A 1 520 ? -17.533 38.939  33.161  1.00 20.11  ? 828  PRO A CG    1 
ATOM   3934  C CD    . PRO A 1 520 ? -16.497 38.386  32.207  1.00 11.55  ? 828  PRO A CD    1 
ATOM   3935  N N     . GLU A 1 521 ? -15.840 36.550  36.433  1.00 10.05  ? 829  GLU A N     1 
ATOM   3936  C CA    . GLU A 1 521 ? -16.412 35.510  37.301  1.00 16.81  ? 829  GLU A CA    1 
ATOM   3937  C C     . GLU A 1 521 ? -17.796 35.823  37.874  1.00 19.68  ? 829  GLU A C     1 
ATOM   3938  O O     . GLU A 1 521 ? -18.507 34.911  38.296  1.00 41.15  ? 829  GLU A O     1 
ATOM   3939  C CB    . GLU A 1 521 ? -15.467 35.203  38.468  1.00 22.60  ? 829  GLU A CB    1 
ATOM   3940  C CG    . GLU A 1 521 ? -14.028 34.951  38.053  1.00 41.40  ? 829  GLU A CG    1 
ATOM   3941  C CD    . GLU A 1 521 ? -13.846 33.631  37.309  1.00 43.42  ? 829  GLU A CD    1 
ATOM   3942  O OE1   . GLU A 1 521 ? -13.383 33.652  36.151  1.00 35.86  ? 829  GLU A OE1   1 
ATOM   3943  O OE2   . GLU A 1 521 ? -14.148 32.571  37.889  1.00 42.53  ? 829  GLU A OE2   1 
ATOM   3944  N N     . ASP A 1 522 ? -18.194 37.092  37.902  1.00 16.56  ? 830  ASP A N     1 
ATOM   3945  C CA    . ASP A 1 522 ? -19.455 37.450  38.558  1.00 20.52  ? 830  ASP A CA    1 
ATOM   3946  C C     . ASP A 1 522 ? -20.454 38.183  37.671  1.00 25.86  ? 830  ASP A C     1 
ATOM   3947  O O     . ASP A 1 522 ? -21.252 38.986  38.157  1.00 34.04  ? 830  ASP A O     1 
ATOM   3948  C CB    . ASP A 1 522 ? -19.172 38.298  39.805  1.00 34.56  ? 830  ASP A CB    1 
ATOM   3949  C CG    . ASP A 1 522 ? -18.509 39.618  39.469  1.00 46.70  ? 830  ASP A CG    1 
ATOM   3950  O OD1   . ASP A 1 522 ? -18.667 40.578  40.252  1.00 55.74  ? 830  ASP A OD1   1 
ATOM   3951  O OD2   . ASP A 1 522 ? -17.831 39.693  38.416  1.00 52.54  ? 830  ASP A OD2   1 
ATOM   3952  N N     . ALA A 1 523 ? -20.412 37.927  36.373  1.00 26.70  ? 831  ALA A N     1 
ATOM   3953  C CA    . ALA A 1 523 ? -21.300 38.638  35.470  1.00 35.78  ? 831  ALA A CA    1 
ATOM   3954  C C     . ALA A 1 523 ? -21.944 37.698  34.474  1.00 16.77  ? 831  ALA A C     1 
ATOM   3955  O O     . ALA A 1 523 ? -21.554 36.546  34.340  1.00 9.86   ? 831  ALA A O     1 
ATOM   3956  C CB    . ALA A 1 523 ? -20.559 39.761  34.745  1.00 30.99  ? 831  ALA A CB    1 
ATOM   3957  N N     . ILE A 1 524 ? -22.964 38.197  33.795  1.00 10.84  ? 832  ILE A N     1 
ATOM   3958  C CA    . ILE A 1 524 ? -23.649 37.422  32.785  1.00 8.42   ? 832  ILE A CA    1 
ATOM   3959  C C     . ILE A 1 524 ? -22.817 37.552  31.500  1.00 9.90   ? 832  ILE A C     1 
ATOM   3960  O O     . ILE A 1 524 ? -22.340 38.645  31.184  1.00 12.78  ? 832  ILE A O     1 
ATOM   3961  C CB    . ILE A 1 524 ? -25.052 38.014  32.575  1.00 20.36  ? 832  ILE A CB    1 
ATOM   3962  C CG1   . ILE A 1 524 ? -25.990 37.587  33.719  1.00 16.15  ? 832  ILE A CG1   1 
ATOM   3963  C CG2   . ILE A 1 524 ? -25.608 37.609  31.228  1.00 18.30  ? 832  ILE A CG2   1 
ATOM   3964  C CD1   . ILE A 1 524 ? -26.440 36.072  33.643  1.00 9.77   ? 832  ILE A CD1   1 
ATOM   3965  N N     . VAL A 1 525 ? -22.600 36.440  30.804  1.00 15.10  ? 833  VAL A N     1 
ATOM   3966  C CA    . VAL A 1 525 ? -21.836 36.442  29.555  1.00 8.62   ? 833  VAL A CA    1 
ATOM   3967  C C     . VAL A 1 525 ? -22.773 36.140  28.384  1.00 14.92  ? 833  VAL A C     1 
ATOM   3968  O O     . VAL A 1 525 ? -23.346 35.065  28.297  1.00 13.47  ? 833  VAL A O     1 
ATOM   3969  C CB    . VAL A 1 525 ? -20.668 35.389  29.564  1.00 12.28  ? 833  VAL A CB    1 
ATOM   3970  C CG1   . VAL A 1 525 ? -20.009 35.335  28.197  1.00 12.92  ? 833  VAL A CG1   1 
ATOM   3971  C CG2   . VAL A 1 525 ? -19.621 35.704  30.632  1.00 4.13   ? 833  VAL A CG2   1 
ATOM   3972  N N     . TYR A 1 526 ? -22.966 37.119  27.515  1.00 14.06  ? 834  TYR A N     1 
ATOM   3973  C CA    . TYR A 1 526 ? -23.679 36.916  26.270  1.00 3.76   ? 834  TYR A CA    1 
ATOM   3974  C C     . TYR A 1 526 ? -22.620 36.676  25.196  1.00 5.50   ? 834  TYR A C     1 
ATOM   3975  O O     . TYR A 1 526 ? -21.680 37.449  25.097  1.00 14.32  ? 834  TYR A O     1 
ATOM   3976  C CB    . TYR A 1 526 ? -24.443 38.186  25.910  1.00 6.25   ? 834  TYR A CB    1 
ATOM   3977  C CG    . TYR A 1 526 ? -25.578 38.547  26.848  1.00 7.27   ? 834  TYR A CG    1 
ATOM   3978  C CD1   . TYR A 1 526 ? -26.789 37.872  26.804  1.00 9.97   ? 834  TYR A CD1   1 
ATOM   3979  C CD2   . TYR A 1 526 ? -25.448 39.594  27.752  1.00 15.27  ? 834  TYR A CD2   1 
ATOM   3980  C CE1   . TYR A 1 526 ? -27.831 38.204  27.671  1.00 6.35   ? 834  TYR A CE1   1 
ATOM   3981  C CE2   . TYR A 1 526 ? -26.481 39.932  28.612  1.00 20.16  ? 834  TYR A CE2   1 
ATOM   3982  C CZ    . TYR A 1 526 ? -27.668 39.244  28.562  1.00 8.59   ? 834  TYR A CZ    1 
ATOM   3983  O OH    . TYR A 1 526 ? -28.691 39.608  29.425  1.00 7.15   ? 834  TYR A OH    1 
ATOM   3984  N N     . CYS A 1 527 ? -22.752 35.605  24.406  1.00 8.63   ? 835  CYS A N     1 
ATOM   3985  C CA    . CYS A 1 527 ? -21.724 35.305  23.412  1.00 4.64   ? 835  CYS A CA    1 
ATOM   3986  C C     . CYS A 1 527 ? -22.266 35.431  21.984  1.00 13.04  ? 835  CYS A C     1 
ATOM   3987  O O     . CYS A 1 527 ? -23.467 35.448  21.761  1.00 13.79  ? 835  CYS A O     1 
ATOM   3988  C CB    . CYS A 1 527 ? -21.089 33.913  23.651  1.00 6.00   ? 835  CYS A CB    1 
ATOM   3989  S SG    . CYS A 1 527 ? -22.211 32.521  23.357  1.00 11.95  ? 835  CYS A SG    1 
ATOM   3990  N N     . ASN A 1 528 ? -21.364 35.554  21.020  1.00 7.31   ? 836  ASN A N     1 
ATOM   3991  C CA    . ASN A 1 528 ? -21.710 35.282  19.631  1.00 12.39  ? 836  ASN A CA    1 
ATOM   3992  C C     . ASN A 1 528 ? -20.408 34.914  18.920  1.00 7.48   ? 836  ASN A C     1 
ATOM   3993  O O     . ASN A 1 528 ? -19.499 35.724  18.869  1.00 5.98   ? 836  ASN A O     1 
ATOM   3994  C CB    . ASN A 1 528 ? -22.407 36.481  18.978  1.00 7.88   ? 836  ASN A CB    1 
ATOM   3995  C CG    . ASN A 1 528 ? -22.801 36.202  17.533  1.00 17.21  ? 836  ASN A CG    1 
ATOM   3996  O OD1   . ASN A 1 528 ? -21.950 35.894  16.707  1.00 16.72  ? 836  ASN A OD1   1 
ATOM   3997  N ND2   . ASN A 1 528 ? -24.095 36.283  17.231  1.00 13.97  ? 836  ASN A ND2   1 
ATOM   3998  N N     . PHE A 1 529 ? -20.304 33.679  18.426  1.00 9.10   ? 837  PHE A N     1 
ATOM   3999  C CA    . PHE A 1 529 ? -19.024 33.168  17.918  1.00 9.43   ? 837  PHE A CA    1 
ATOM   4000  C C     . PHE A 1 529 ? -18.982 33.105  16.398  1.00 11.39  ? 837  PHE A C     1 
ATOM   4001  O O     . PHE A 1 529 ? -18.181 32.372  15.814  1.00 6.95   ? 837  PHE A O     1 
ATOM   4002  C CB    . PHE A 1 529 ? -18.757 31.784  18.506  1.00 8.93   ? 837  PHE A CB    1 
ATOM   4003  C CG    . PHE A 1 529 ? -18.574 31.782  20.014  1.00 14.20  ? 837  PHE A CG    1 
ATOM   4004  C CD1   . PHE A 1 529 ? -18.021 32.879  20.665  1.00 10.01  ? 837  PHE A CD1   1 
ATOM   4005  C CD2   . PHE A 1 529 ? -18.920 30.676  20.764  1.00 14.08  ? 837  PHE A CD2   1 
ATOM   4006  C CE1   . PHE A 1 529 ? -17.829 32.861  22.057  1.00 9.64   ? 837  PHE A CE1   1 
ATOM   4007  C CE2   . PHE A 1 529 ? -18.728 30.661  22.153  1.00 13.68  ? 837  PHE A CE2   1 
ATOM   4008  C CZ    . PHE A 1 529 ? -18.179 31.741  22.784  1.00 11.31  ? 837  PHE A CZ    1 
ATOM   4009  N N     . ASN A 1 530 ? -19.859 33.861  15.751  1.00 6.47   ? 838  ASN A N     1 
ATOM   4010  C CA    . ASN A 1 530 ? -19.854 33.906  14.290  1.00 11.91  ? 838  ASN A CA    1 
ATOM   4011  C C     . ASN A 1 530 ? -18.722 34.782  13.737  1.00 6.66   ? 838  ASN A C     1 
ATOM   4012  O O     . ASN A 1 530 ? -18.145 35.598  14.455  1.00 10.31  ? 838  ASN A O     1 
ATOM   4013  C CB    . ASN A 1 530 ? -21.198 34.429  13.778  1.00 11.83  ? 838  ASN A CB    1 
ATOM   4014  C CG    . ASN A 1 530 ? -22.326 33.437  13.999  1.00 11.95  ? 838  ASN A CG    1 
ATOM   4015  O OD1   . ASN A 1 530 ? -22.440 32.456  13.284  1.00 13.44  ? 838  ASN A OD1   1 
ATOM   4016  N ND2   . ASN A 1 530 ? -23.166 33.702  14.983  1.00 14.20  ? 838  ASN A ND2   1 
ATOM   4017  N N     . GLN A 1 531 ? -18.420 34.619  12.453  1.00 7.53   ? 839  GLN A N     1 
ATOM   4018  C CA    . GLN A 1 531 ? -17.601 35.602  11.758  1.00 5.41   ? 839  GLN A CA    1 
ATOM   4019  C C     . GLN A 1 531 ? -18.289 36.959  11.873  1.00 14.11  ? 839  GLN A C     1 
ATOM   4020  O O     . GLN A 1 531 ? -19.515 37.052  11.803  1.00 9.32   ? 839  GLN A O     1 
ATOM   4021  C CB    . GLN A 1 531 ? -17.457 35.236  10.291  1.00 8.11   ? 839  GLN A CB    1 
ATOM   4022  C CG    . GLN A 1 531 ? -16.961 33.820  10.053  1.00 6.94   ? 839  GLN A CG    1 
ATOM   4023  C CD    . GLN A 1 531 ? -16.555 33.627  8.610   1.00 16.57  ? 839  GLN A CD    1 
ATOM   4024  O OE1   . GLN A 1 531 ? -15.715 34.358  8.099   1.00 11.37  ? 839  GLN A OE1   1 
ATOM   4025  N NE2   . GLN A 1 531 ? -17.181 32.676  7.935   1.00 6.82   ? 839  GLN A NE2   1 
ATOM   4026  N N     . LEU A 1 532 ? -17.502 38.011  12.049  1.00 2.57   ? 840  LEU A N     1 
ATOM   4027  C CA    . LEU A 1 532 ? -18.062 39.339  12.318  1.00 7.40   ? 840  LEU A CA    1 
ATOM   4028  C C     . LEU A 1 532 ? -18.916 39.921  11.189  1.00 10.40  ? 840  LEU A C     1 
ATOM   4029  O O     . LEU A 1 532 ? -19.695 40.836  11.426  1.00 10.56  ? 840  LEU A O     1 
ATOM   4030  C CB    . LEU A 1 532 ? -16.938 40.323  12.696  1.00 11.14  ? 840  LEU A CB    1 
ATOM   4031  C CG    . LEU A 1 532 ? -16.165 39.913  13.954  1.00 11.40  ? 840  LEU A CG    1 
ATOM   4032  C CD1   . LEU A 1 532 ? -14.948 40.792  14.138  1.00 6.60   ? 840  LEU A CD1   1 
ATOM   4033  C CD2   . LEU A 1 532 ? -17.085 39.932  15.219  1.00 7.69   ? 840  LEU A CD2   1 
ATOM   4034  N N     . TYR A 1 533 ? -18.784 39.404  9.969   1.00 8.87   ? 841  TYR A N     1 
ATOM   4035  C CA    . TYR A 1 533 ? -19.518 39.979  8.840   1.00 11.15  ? 841  TYR A CA    1 
ATOM   4036  C C     . TYR A 1 533 ? -21.046 39.852  9.014   1.00 11.16  ? 841  TYR A C     1 
ATOM   4037  O O     . TYR A 1 533 ? -21.829 40.553  8.361   1.00 8.81   ? 841  TYR A O     1 
ATOM   4038  C CB    . TYR A 1 533 ? -19.063 39.341  7.524   1.00 10.59  ? 841  TYR A CB    1 
ATOM   4039  C CG    . TYR A 1 533 ? -19.664 37.969  7.273   1.00 13.66  ? 841  TYR A CG    1 
ATOM   4040  C CD1   . TYR A 1 533 ? -20.950 37.842  6.781   1.00 10.24  ? 841  TYR A CD1   1 
ATOM   4041  C CD2   . TYR A 1 533 ? -18.943 36.805  7.530   1.00 19.23  ? 841  TYR A CD2   1 
ATOM   4042  C CE1   . TYR A 1 533 ? -21.505 36.609  6.542   1.00 11.66  ? 841  TYR A CE1   1 
ATOM   4043  C CE2   . TYR A 1 533 ? -19.508 35.546  7.304   1.00 12.70  ? 841  TYR A CE2   1 
ATOM   4044  C CZ    . TYR A 1 533 ? -20.795 35.465  6.806   1.00 12.12  ? 841  TYR A CZ    1 
ATOM   4045  O OH    . TYR A 1 533 ? -21.387 34.231  6.553   1.00 14.84  ? 841  TYR A OH    1 
ATOM   4046  N N     . LYS A 1 534 ? -21.468 38.957  9.902   1.00 8.32   ? 842  LYS A N     1 
ATOM   4047  C CA    . LYS A 1 534 ? -22.894 38.731  10.154  1.00 10.23  ? 842  LYS A CA    1 
ATOM   4048  C C     . LYS A 1 534 ? -23.540 39.819  11.010  1.00 14.24  ? 842  LYS A C     1 
ATOM   4049  O O     . LYS A 1 534 ? -24.773 39.896  11.106  1.00 12.21  ? 842  LYS A O     1 
ATOM   4050  C CB    . LYS A 1 534 ? -23.105 37.375  10.835  1.00 8.53   ? 842  LYS A CB    1 
ATOM   4051  C CG    . LYS A 1 534 ? -22.601 36.207  9.988   1.00 11.63  ? 842  LYS A CG    1 
ATOM   4052  C CD    . LYS A 1 534 ? -23.022 34.884  10.606  1.00 16.40  ? 842  LYS A CD    1 
ATOM   4053  C CE    . LYS A 1 534 ? -22.722 33.712  9.689   1.00 9.82   ? 842  LYS A CE    1 
ATOM   4054  N NZ    . LYS A 1 534 ? -22.897 32.421  10.434  1.00 10.79  ? 842  LYS A NZ    1 
ATOM   4055  N N     . ILE A 1 535 ? -22.723 40.643  11.655  1.00 12.38  ? 843  ILE A N     1 
ATOM   4056  C CA    A ILE A 1 535 ? -23.203 41.757  12.472  0.50 13.55  ? 843  ILE A CA    1 
ATOM   4057  C CA    B ILE A 1 535 ? -23.302 41.721  12.443  0.50 13.48  ? 843  ILE A CA    1 
ATOM   4058  C C     . ILE A 1 535 ? -23.438 43.003  11.620  1.00 16.60  ? 843  ILE A C     1 
ATOM   4059  O O     . ILE A 1 535 ? -22.667 43.271  10.686  1.00 9.57   ? 843  ILE A O     1 
ATOM   4060  C CB    A ILE A 1 535 ? -22.178 42.113  13.578  0.50 3.13   ? 843  ILE A CB    1 
ATOM   4061  C CB    B ILE A 1 535 ? -22.610 41.920  13.843  0.50 15.14  ? 843  ILE A CB    1 
ATOM   4062  C CG1   A ILE A 1 535 ? -21.789 40.859  14.364  0.50 2.96   ? 843  ILE A CG1   1 
ATOM   4063  C CG1   B ILE A 1 535 ? -22.574 43.400  14.245  0.50 6.55   ? 843  ILE A CG1   1 
ATOM   4064  C CG2   A ILE A 1 535 ? -22.752 43.192  14.501  0.50 6.67   ? 843  ILE A CG2   1 
ATOM   4065  C CG2   B ILE A 1 535 ? -21.237 41.274  13.889  0.50 14.92  ? 843  ILE A CG2   1 
ATOM   4066  C CD1   A ILE A 1 535 ? -20.604 41.052  15.283  0.50 2.97   ? 843  ILE A CD1   1 
ATOM   4067  C CD1   B ILE A 1 535 ? -21.998 43.639  15.639  0.50 15.41  ? 843  ILE A CD1   1 
ATOM   4068  N N     . ASP A 1 536 ? -24.484 43.763  11.928  1.00 10.46  ? 844  ASP A N     1 
ATOM   4069  C CA    . ASP A 1 536 ? -24.705 45.051  11.255  1.00 10.73  ? 844  ASP A CA    1 
ATOM   4070  C C     . ASP A 1 536 ? -25.017 46.111  12.325  1.00 9.90   ? 844  ASP A C     1 
ATOM   4071  O O     . ASP A 1 536 ? -25.085 45.789  13.505  1.00 10.51  ? 844  ASP A O     1 
ATOM   4072  C CB    . ASP A 1 536 ? -25.826 44.938  10.208  1.00 13.19  ? 844  ASP A CB    1 
ATOM   4073  C CG    . ASP A 1 536 ? -27.145 44.477  10.808  1.00 22.52  ? 844  ASP A CG    1 
ATOM   4074  O OD1   . ASP A 1 536 ? -27.304 44.540  12.045  1.00 15.51  ? 844  ASP A OD1   1 
ATOM   4075  O OD2   . ASP A 1 536 ? -28.027 44.047  10.039  1.00 17.37  ? 844  ASP A OD2   1 
ATOM   4076  N N     . PRO A 1 537 ? -25.175 47.386  11.923  1.00 9.94   ? 845  PRO A N     1 
ATOM   4077  C CA    . PRO A 1 537 ? -25.386 48.434  12.931  1.00 9.83   ? 845  PRO A CA    1 
ATOM   4078  C C     . PRO A 1 537 ? -26.604 48.197  13.836  1.00 14.32  ? 845  PRO A C     1 
ATOM   4079  O O     . PRO A 1 537 ? -26.517 48.417  15.048  1.00 13.20  ? 845  PRO A O     1 
ATOM   4080  C CB    . PRO A 1 537 ? -25.585 49.696  12.088  1.00 20.70  ? 845  PRO A CB    1 
ATOM   4081  C CG    . PRO A 1 537 ? -24.787 49.441  10.837  1.00 19.21  ? 845  PRO A CG    1 
ATOM   4082  C CD    . PRO A 1 537 ? -24.902 47.938  10.583  1.00 11.38  ? 845  PRO A CD    1 
ATOM   4083  N N     . SER A 1 538 ? -27.725 47.778  13.255  1.00 11.39  ? 846  SER A N     1 
ATOM   4084  C CA    . SER A 1 538 ? -28.935 47.524  14.035  1.00 13.82  ? 846  SER A CA    1 
ATOM   4085  C C     . SER A 1 538 ? -28.697 46.442  15.074  1.00 15.94  ? 846  SER A C     1 
ATOM   4086  O O     . SER A 1 538 ? -29.177 46.542  16.207  1.00 12.06  ? 846  SER A O     1 
ATOM   4087  C CB    . SER A 1 538 ? -30.084 47.097  13.117  1.00 18.18  ? 846  SER A CB    1 
ATOM   4088  O OG    . SER A 1 538 ? -30.396 48.133  12.205  1.00 40.92  ? 846  SER A OG    1 
ATOM   4089  N N     . THR A 1 539 ? -27.969 45.397  14.679  1.00 12.03  ? 847  THR A N     1 
ATOM   4090  C CA    . THR A 1 539 ? -27.696 44.292  15.583  1.00 11.26  ? 847  THR A CA    1 
ATOM   4091  C C     . THR A 1 539 ? -26.844 44.761  16.759  1.00 11.65  ? 847  THR A C     1 
ATOM   4092  O O     . THR A 1 539 ? -27.161 44.481  17.916  1.00 9.76   ? 847  THR A O     1 
ATOM   4093  C CB    . THR A 1 539 ? -27.003 43.117  14.848  1.00 9.09   ? 847  THR A CB    1 
ATOM   4094  O OG1   . THR A 1 539 ? -27.900 42.567  13.869  1.00 15.21  ? 847  THR A OG1   1 
ATOM   4095  C CG2   . THR A 1 539 ? -26.611 42.027  15.833  1.00 9.94   ? 847  THR A CG2   1 
ATOM   4096  N N     . LEU A 1 540 ? -25.766 45.487  16.479  1.00 10.73  ? 848  LEU A N     1 
ATOM   4097  C CA    . LEU A 1 540 ? -24.906 45.925  17.578  1.00 19.90  ? 848  LEU A CA    1 
ATOM   4098  C C     . LEU A 1 540 ? -25.672 46.868  18.522  1.00 10.91  ? 848  LEU A C     1 
ATOM   4099  O O     . LEU A 1 540 ? -25.488 46.821  19.746  1.00 10.34  ? 848  LEU A O     1 
ATOM   4100  C CB    . LEU A 1 540 ? -23.609 46.558  17.067  1.00 12.18  ? 848  LEU A CB    1 
ATOM   4101  C CG    . LEU A 1 540 ? -22.584 46.961  18.138  1.00 15.68  ? 848  LEU A CG    1 
ATOM   4102  C CD1   . LEU A 1 540 ? -22.137 45.736  18.909  1.00 13.06  ? 848  LEU A CD1   1 
ATOM   4103  C CD2   . LEU A 1 540 ? -21.364 47.644  17.513  1.00 17.11  ? 848  LEU A CD2   1 
ATOM   4104  N N     . GLN A 1 541 ? -26.549 47.699  17.959  1.00 10.97  ? 849  GLN A N     1 
ATOM   4105  C CA    . GLN A 1 541 ? -27.386 48.577  18.780  1.00 11.29  ? 849  GLN A CA    1 
ATOM   4106  C C     . GLN A 1 541 ? -28.292 47.771  19.701  1.00 15.97  ? 849  GLN A C     1 
ATOM   4107  O O     . GLN A 1 541 ? -28.430 48.098  20.880  1.00 12.07  ? 849  GLN A O     1 
ATOM   4108  C CB    . GLN A 1 541 ? -28.219 49.548  17.922  1.00 11.37  ? 849  GLN A CB    1 
ATOM   4109  C CG    . GLN A 1 541 ? -29.087 50.516  18.768  1.00 19.55  ? 849  GLN A CG    1 
ATOM   4110  C CD    . GLN A 1 541 ? -28.257 51.408  19.668  1.00 29.03  ? 849  GLN A CD    1 
ATOM   4111  O OE1   . GLN A 1 541 ? -27.548 52.297  19.189  1.00 22.52  ? 849  GLN A OE1   1 
ATOM   4112  N NE2   . GLN A 1 541 ? -28.328 51.170  20.984  1.00 22.03  ? 849  GLN A NE2   1 
ATOM   4113  N N     . MET A 1 542 ? -28.906 46.716  19.162  1.00 14.23  ? 850  MET A N     1 
ATOM   4114  C CA    . MET A 1 542 ? -29.718 45.806  19.965  1.00 14.54  ? 850  MET A CA    1 
ATOM   4115  C C     . MET A 1 542 ? -28.920 45.248  21.137  1.00 14.13  ? 850  MET A C     1 
ATOM   4116  O O     . MET A 1 542 ? -29.411 45.188  22.276  1.00 11.62  ? 850  MET A O     1 
ATOM   4117  C CB    . MET A 1 542 ? -30.199 44.620  19.121  1.00 20.39  ? 850  MET A CB    1 
ATOM   4118  C CG    . MET A 1 542 ? -31.475 44.837  18.341  1.00 27.24  ? 850  MET A CG    1 
ATOM   4119  S SD    . MET A 1 542 ? -32.455 43.303  18.363  1.00 26.75  ? 850  MET A SD    1 
ATOM   4120  C CE    . MET A 1 542 ? -31.386 42.172  17.478  1.00 30.64  ? 850  MET A CE    1 
ATOM   4121  N N     . TRP A 1 543 ? -27.701 44.802  20.833  1.00 8.66   ? 851  TRP A N     1 
ATOM   4122  C CA    . TRP A 1 543 ? -26.811 44.238  21.830  1.00 7.33   ? 851  TRP A CA    1 
ATOM   4123  C C     . TRP A 1 543 ? -26.416 45.285  22.858  1.00 10.93  ? 851  TRP A C     1 
ATOM   4124  O O     . TRP A 1 543 ? -26.389 44.993  24.059  1.00 13.24  ? 851  TRP A O     1 
ATOM   4125  C CB    . TRP A 1 543 ? -25.564 43.626  21.164  1.00 7.11   ? 851  TRP A CB    1 
ATOM   4126  C CG    . TRP A 1 543 ? -25.897 42.409  20.344  1.00 8.84   ? 851  TRP A CG    1 
ATOM   4127  C CD1   . TRP A 1 543 ? -27.106 41.754  20.281  1.00 9.30   ? 851  TRP A CD1   1 
ATOM   4128  C CD2   . TRP A 1 543 ? -25.019 41.720  19.455  1.00 8.90   ? 851  TRP A CD2   1 
ATOM   4129  N NE1   . TRP A 1 543 ? -27.016 40.684  19.417  1.00 10.01  ? 851  TRP A NE1   1 
ATOM   4130  C CE2   . TRP A 1 543 ? -25.749 40.646  18.894  1.00 9.29   ? 851  TRP A CE2   1 
ATOM   4131  C CE3   . TRP A 1 543 ? -23.676 41.903  19.080  1.00 7.65   ? 851  TRP A CE3   1 
ATOM   4132  C CZ2   . TRP A 1 543 ? -25.188 39.763  17.971  1.00 11.49  ? 851  TRP A CZ2   1 
ATOM   4133  C CZ3   . TRP A 1 543 ? -23.120 41.018  18.154  1.00 6.90   ? 851  TRP A CZ3   1 
ATOM   4134  C CH2   . TRP A 1 543 ? -23.877 39.960  17.625  1.00 5.12   ? 851  TRP A CH2   1 
ATOM   4135  N N     . ALA A 1 544 ? -26.121 46.502  22.392  1.00 10.03  ? 852  ALA A N     1 
ATOM   4136  C CA    . ALA A 1 544 ? -25.766 47.573  23.314  1.00 11.06  ? 852  ALA A CA    1 
ATOM   4137  C C     . ALA A 1 544 ? -26.908 47.852  24.269  1.00 18.81  ? 852  ALA A C     1 
ATOM   4138  O O     . ALA A 1 544 ? -26.672 48.147  25.440  1.00 13.75  ? 852  ALA A O     1 
ATOM   4139  C CB    . ALA A 1 544 ? -25.385 48.865  22.557  1.00 13.55  ? 852  ALA A CB    1 
ATOM   4140  N N     . ASN A 1 545 ? -28.141 47.786  23.763  1.00 17.45  ? 853  ASN A N     1 
ATOM   4141  C CA    . ASN A 1 545 ? -29.312 48.071  24.590  1.00 20.99  ? 853  ASN A CA    1 
ATOM   4142  C C     . ASN A 1 545 ? -29.449 47.033  25.690  1.00 12.97  ? 853  ASN A C     1 
ATOM   4143  O O     . ASN A 1 545 ? -29.841 47.351  26.816  1.00 16.20  ? 853  ASN A O     1 
ATOM   4144  C CB    . ASN A 1 545 ? -30.595 48.111  23.750  1.00 15.39  ? 853  ASN A CB    1 
ATOM   4145  C CG    . ASN A 1 545 ? -30.650 49.309  22.829  1.00 20.54  ? 853  ASN A CG    1 
ATOM   4146  O OD1   . ASN A 1 545 ? -29.897 50.262  22.996  1.00 27.35  ? 853  ASN A OD1   1 
ATOM   4147  N ND2   . ASN A 1 545 ? -31.557 49.271  21.854  1.00 22.28  ? 853  ASN A ND2   1 
ATOM   4148  N N     A ILE A 1 546 ? -29.127 45.784  25.352  0.50 15.14  ? 854  ILE A N     1 
ATOM   4149  N N     B ILE A 1 546 ? -29.130 45.786  25.350  0.50 15.20  ? 854  ILE A N     1 
ATOM   4150  C CA    A ILE A 1 546 ? -29.204 44.673  26.293  0.50 8.00   ? 854  ILE A CA    1 
ATOM   4151  C CA    B ILE A 1 546 ? -29.172 44.679  26.294  0.50 8.39   ? 854  ILE A CA    1 
ATOM   4152  C C     A ILE A 1 546 ? -28.157 44.819  27.399  0.50 13.12  ? 854  ILE A C     1 
ATOM   4153  C C     B ILE A 1 546 ? -28.161 44.882  27.405  0.50 13.21  ? 854  ILE A C     1 
ATOM   4154  O O     A ILE A 1 546 ? -28.477 44.695  28.580  0.50 9.84   ? 854  ILE A O     1 
ATOM   4155  O O     B ILE A 1 546 ? -28.502 44.852  28.589  0.50 9.76   ? 854  ILE A O     1 
ATOM   4156  C CB    A ILE A 1 546 ? -29.027 43.322  25.578  0.50 11.33  ? 854  ILE A CB    1 
ATOM   4157  C CB    B ILE A 1 546 ? -28.868 43.360  25.591  0.50 8.61   ? 854  ILE A CB    1 
ATOM   4158  C CG1   A ILE A 1 546 ? -30.141 43.106  24.539  0.50 9.20   ? 854  ILE A CG1   1 
ATOM   4159  C CG1   B ILE A 1 546 ? -30.064 42.969  24.729  0.50 14.65  ? 854  ILE A CG1   1 
ATOM   4160  C CG2   A ILE A 1 546 ? -29.021 42.185  26.583  0.50 10.60  ? 854  ILE A CG2   1 
ATOM   4161  C CG2   B ILE A 1 546 ? -28.575 42.274  26.603  0.50 7.43   ? 854  ILE A CG2   1 
ATOM   4162  C CD1   A ILE A 1 546 ? -29.864 41.920  23.582  0.50 4.75   ? 854  ILE A CD1   1 
ATOM   4163  C CD1   B ILE A 1 546 ? -31.336 43.042  25.481  0.50 11.52  ? 854  ILE A CD1   1 
ATOM   4164  N N     . LEU A 1 547 ? -26.912 45.092  27.008  1.00 7.81   ? 855  LEU A N     1 
ATOM   4165  C CA    . LEU A 1 547 ? -25.828 45.301  27.959  1.00 18.07  ? 855  LEU A CA    1 
ATOM   4166  C C     . LEU A 1 547 ? -26.120 46.461  28.923  1.00 16.82  ? 855  LEU A C     1 
ATOM   4167  O O     . LEU A 1 547 ? -25.846 46.357  30.110  1.00 14.17  ? 855  LEU A O     1 
ATOM   4168  C CB    . LEU A 1 547 ? -24.511 45.538  27.220  1.00 10.76  ? 855  LEU A CB    1 
ATOM   4169  C CG    . LEU A 1 547 ? -23.912 44.350  26.452  1.00 16.83  ? 855  LEU A CG    1 
ATOM   4170  C CD1   . LEU A 1 547 ? -22.663 44.765  25.646  1.00 20.02  ? 855  LEU A CD1   1 
ATOM   4171  C CD2   . LEU A 1 547 ? -23.573 43.199  27.391  1.00 15.67  ? 855  LEU A CD2   1 
ATOM   4172  N N     . LYS A 1 548 ? -26.652 47.568  28.399  1.00 10.60  ? 856  LYS A N     1 
ATOM   4173  C CA    . LYS A 1 548 ? -27.081 48.699  29.235  1.00 15.70  ? 856  LYS A CA    1 
ATOM   4174  C C     . LYS A 1 548 ? -28.147 48.338  30.267  1.00 15.84  ? 856  LYS A C     1 
ATOM   4175  O O     . LYS A 1 548 ? -28.213 48.945  31.329  1.00 19.56  ? 856  LYS A O     1 
ATOM   4176  C CB    . LYS A 1 548 ? -27.594 49.846  28.361  1.00 17.61  ? 856  LYS A CB    1 
ATOM   4177  C CG    . LYS A 1 548 ? -26.511 50.477  27.491  1.00 33.36  ? 856  LYS A CG    1 
ATOM   4178  C CD    . LYS A 1 548 ? -27.114 51.378  26.432  1.00 36.94  ? 856  LYS A CD    1 
ATOM   4179  C CE    . LYS A 1 548 ? -26.022 52.064  25.647  1.00 43.27  ? 856  LYS A CE    1 
ATOM   4180  N NZ    . LYS A 1 548 ? -25.111 52.811  26.554  1.00 53.54  ? 856  LYS A NZ    1 
ATOM   4181  N N     . ARG A 1 549 ? -28.989 47.363  29.940  1.00 12.30  ? 857  ARG A N     1 
ATOM   4182  C CA    . ARG A 1 549 ? -30.061 46.939  30.842  1.00 15.26  ? 857  ARG A CA    1 
ATOM   4183  C C     . ARG A 1 549 ? -29.635 45.909  31.884  1.00 14.41  ? 857  ARG A C     1 
ATOM   4184  O O     . ARG A 1 549 ? -30.370 45.660  32.844  1.00 16.76  ? 857  ARG A O     1 
ATOM   4185  C CB    . ARG A 1 549 ? -31.263 46.399  30.049  1.00 14.49  ? 857  ARG A CB    1 
ATOM   4186  C CG    . ARG A 1 549 ? -32.187 47.501  29.534  1.00 16.84  ? 857  ARG A CG    1 
ATOM   4187  C CD    . ARG A 1 549 ? -33.419 46.930  28.844  1.00 18.87  ? 857  ARG A CD    1 
ATOM   4188  N NE    . ARG A 1 549 ? -34.239 46.154  29.768  1.00 21.06  ? 857  ARG A NE    1 
ATOM   4189  C CZ    . ARG A 1 549 ? -35.303 45.438  29.416  1.00 26.59  ? 857  ARG A CZ    1 
ATOM   4190  N NH1   . ARG A 1 549 ? -35.683 45.388  28.149  1.00 16.65  ? 857  ARG A NH1   1 
ATOM   4191  N NH2   . ARG A 1 549 ? -35.981 44.758  30.331  1.00 25.50  ? 857  ARG A NH2   1 
ATOM   4192  N N     . VAL A 1 550 ? -28.463 45.304  31.689  1.00 12.00  ? 858  VAL A N     1 
ATOM   4193  C CA    . VAL A 1 550 ? -28.004 44.206  32.544  1.00 13.48  ? 858  VAL A CA    1 
ATOM   4194  C C     . VAL A 1 550 ? -26.621 44.545  33.072  1.00 16.24  ? 858  VAL A C     1 
ATOM   4195  O O     . VAL A 1 550 ? -25.610 44.151  32.480  1.00 16.54  ? 858  VAL A O     1 
ATOM   4196  C CB    . VAL A 1 550 ? -27.959 42.859  31.764  1.00 9.13   ? 858  VAL A CB    1 
ATOM   4197  C CG1   . VAL A 1 550 ? -27.540 41.692  32.687  1.00 6.03   ? 858  VAL A CG1   1 
ATOM   4198  C CG2   . VAL A 1 550 ? -29.323 42.581  31.117  1.00 9.29   ? 858  VAL A CG2   1 
ATOM   4199  N N     . PRO A 1 551 ? -26.576 45.304  34.177  1.00 28.70  ? 859  PRO A N     1 
ATOM   4200  C CA    . PRO A 1 551 ? -25.364 45.870  34.776  1.00 26.93  ? 859  PRO A CA    1 
ATOM   4201  C C     . PRO A 1 551 ? -24.183 44.911  34.809  1.00 22.15  ? 859  PRO A C     1 
ATOM   4202  O O     . PRO A 1 551 ? -23.089 45.274  34.376  1.00 30.59  ? 859  PRO A O     1 
ATOM   4203  C CB    . PRO A 1 551 ? -25.813 46.202  36.201  1.00 32.45  ? 859  PRO A CB    1 
ATOM   4204  C CG    . PRO A 1 551 ? -27.241 46.570  36.041  1.00 23.29  ? 859  PRO A CG    1 
ATOM   4205  C CD    . PRO A 1 551 ? -27.789 45.707  34.919  1.00 28.06  ? 859  PRO A CD    1 
ATOM   4206  N N     . ASN A 1 552 ? -24.390 43.703  35.317  1.00 13.42  ? 860  ASN A N     1 
ATOM   4207  C CA    . ASN A 1 552 ? -23.278 42.787  35.429  1.00 42.40  ? 860  ASN A CA    1 
ATOM   4208  C C     . ASN A 1 552 ? -23.267 41.901  34.204  1.00 44.74  ? 860  ASN A C     1 
ATOM   4209  O O     . ASN A 1 552 ? -23.674 40.742  34.291  1.00 29.43  ? 860  ASN A O     1 
ATOM   4210  C CB    . ASN A 1 552 ? -23.404 41.953  36.703  1.00 52.17  ? 860  ASN A CB    1 
ATOM   4211  C CG    . ASN A 1 552 ? -23.675 42.803  37.927  1.00 45.75  ? 860  ASN A CG    1 
ATOM   4212  O OD1   . ASN A 1 552 ? -23.124 43.897  38.072  1.00 38.20  ? 860  ASN A OD1   1 
ATOM   4213  N ND2   . ASN A 1 552 ? -24.536 42.311  38.811  1.00 45.64  ? 860  ASN A ND2   1 
ATOM   4214  N N     . SER A 1 553 ? -22.831 42.456  33.065  1.00 18.20  ? 861  SER A N     1 
ATOM   4215  C CA    . SER A 1 553 ? -22.795 41.676  31.822  1.00 17.46  ? 861  SER A CA    1 
ATOM   4216  C C     . SER A 1 553 ? -21.735 42.113  30.790  1.00 14.14  ? 861  SER A C     1 
ATOM   4217  O O     . SER A 1 553 ? -21.339 43.302  30.679  1.00 9.72   ? 861  SER A O     1 
ATOM   4218  C CB    . SER A 1 553 ? -24.194 41.563  31.170  1.00 11.22  ? 861  SER A CB    1 
ATOM   4219  O OG    . SER A 1 553 ? -24.548 42.724  30.416  1.00 12.58  ? 861  SER A OG    1 
ATOM   4220  N N     . VAL A 1 554 ? -21.273 41.122  30.039  1.00 13.65  ? 862  VAL A N     1 
ATOM   4221  C CA    . VAL A 1 554 ? -20.300 41.341  28.993  1.00 12.82  ? 862  VAL A CA    1 
ATOM   4222  C C     . VAL A 1 554 ? -20.771 40.657  27.712  1.00 14.08  ? 862  VAL A C     1 
ATOM   4223  O O     . VAL A 1 554 ? -21.547 39.706  27.760  1.00 13.17  ? 862  VAL A O     1 
ATOM   4224  C CB    . VAL A 1 554 ? -18.901 40.808  29.392  1.00 16.17  ? 862  VAL A CB    1 
ATOM   4225  C CG1   . VAL A 1 554 ? -18.364 41.549  30.642  1.00 11.77  ? 862  VAL A CG1   1 
ATOM   4226  C CG2   . VAL A 1 554 ? -18.943 39.299  29.611  1.00 11.13  ? 862  VAL A CG2   1 
ATOM   4227  N N     . LEU A 1 555 ? -20.313 41.161  26.570  1.00 7.97   ? 863  LEU A N     1 
ATOM   4228  C CA    . LEU A 1 555 ? -20.581 40.522  25.283  1.00 8.20   ? 863  LEU A CA    1 
ATOM   4229  C C     . LEU A 1 555 ? -19.270 39.870  24.867  1.00 18.49  ? 863  LEU A C     1 
ATOM   4230  O O     . LEU A 1 555 ? -18.228 40.500  24.944  1.00 13.96  ? 863  LEU A O     1 
ATOM   4231  C CB    . LEU A 1 555 ? -20.999 41.567  24.242  1.00 15.91  ? 863  LEU A CB    1 
ATOM   4232  C CG    . LEU A 1 555 ? -21.186 41.129  22.779  1.00 14.53  ? 863  LEU A CG    1 
ATOM   4233  C CD1   . LEU A 1 555 ? -22.351 40.178  22.651  1.00 14.15  ? 863  LEU A CD1   1 
ATOM   4234  C CD2   . LEU A 1 555 ? -21.374 42.348  21.839  1.00 12.05  ? 863  LEU A CD2   1 
ATOM   4235  N N     . TRP A 1 556 ? -19.326 38.605  24.460  1.00 13.60  ? 864  TRP A N     1 
ATOM   4236  C CA    . TRP A 1 556 ? -18.136 37.833  24.148  1.00 8.30   ? 864  TRP A CA    1 
ATOM   4237  C C     . TRP A 1 556 ? -18.122 37.556  22.645  1.00 13.33  ? 864  TRP A C     1 
ATOM   4238  O O     . TRP A 1 556 ? -18.973 36.819  22.152  1.00 11.63  ? 864  TRP A O     1 
ATOM   4239  C CB    . TRP A 1 556 ? -18.203 36.508  24.923  1.00 11.03  ? 864  TRP A CB    1 
ATOM   4240  C CG    . TRP A 1 556 ? -16.978 35.621  24.881  1.00 10.23  ? 864  TRP A CG    1 
ATOM   4241  C CD1   . TRP A 1 556 ? -15.717 35.939  24.439  1.00 9.40   ? 864  TRP A CD1   1 
ATOM   4242  C CD2   . TRP A 1 556 ? -16.912 34.272  25.336  1.00 8.74   ? 864  TRP A CD2   1 
ATOM   4243  N NE1   . TRP A 1 556 ? -14.875 34.848  24.579  1.00 13.78  ? 864  TRP A NE1   1 
ATOM   4244  C CE2   . TRP A 1 556 ? -15.589 33.815  25.125  1.00 13.19  ? 864  TRP A CE2   1 
ATOM   4245  C CE3   . TRP A 1 556 ? -17.849 33.396  25.891  1.00 13.42  ? 864  TRP A CE3   1 
ATOM   4246  C CZ2   . TRP A 1 556 ? -15.182 32.522  25.462  1.00 9.64   ? 864  TRP A CZ2   1 
ATOM   4247  C CZ3   . TRP A 1 556 ? -17.442 32.102  26.217  1.00 12.16  ? 864  TRP A CZ3   1 
ATOM   4248  C CH2   . TRP A 1 556 ? -16.124 31.687  26.014  1.00 7.71   ? 864  TRP A CH2   1 
ATOM   4249  N N     . LEU A 1 557 ? -17.170 38.154  21.923  1.00 10.22  ? 865  LEU A N     1 
ATOM   4250  C CA    . LEU A 1 557 ? -17.059 37.985  20.455  1.00 2.90   ? 865  LEU A CA    1 
ATOM   4251  C C     . LEU A 1 557 ? -15.685 37.480  20.061  1.00 5.23   ? 865  LEU A C     1 
ATOM   4252  O O     . LEU A 1 557 ? -14.795 37.396  20.901  1.00 4.50   ? 865  LEU A O     1 
ATOM   4253  C CB    . LEU A 1 557 ? -17.289 39.333  19.760  1.00 6.83   ? 865  LEU A CB    1 
ATOM   4254  C CG    . LEU A 1 557 ? -18.578 40.093  20.087  1.00 10.74  ? 865  LEU A CG    1 
ATOM   4255  C CD1   . LEU A 1 557 ? -18.555 41.486  19.428  1.00 4.87   ? 865  LEU A CD1   1 
ATOM   4256  C CD2   . LEU A 1 557 ? -19.814 39.295  19.637  1.00 12.35  ? 865  LEU A CD2   1 
ATOM   4257  N N     . LEU A 1 558 ? -15.500 37.183  18.771  1.00 9.60   ? 866  LEU A N     1 
ATOM   4258  C CA    . LEU A 1 558 ? -14.251 36.596  18.282  1.00 7.30   ? 866  LEU A CA    1 
ATOM   4259  C C     . LEU A 1 558 ? -13.552 37.527  17.297  1.00 9.14   ? 866  LEU A C     1 
ATOM   4260  O O     . LEU A 1 558 ? -14.195 38.317  16.613  1.00 9.34   ? 866  LEU A O     1 
ATOM   4261  C CB    . LEU A 1 558 ? -14.490 35.251  17.585  1.00 7.23   ? 866  LEU A CB    1 
ATOM   4262  C CG    . LEU A 1 558 ? -15.165 34.161  18.430  1.00 13.46  ? 866  LEU A CG    1 
ATOM   4263  C CD1   . LEU A 1 558 ? -15.206 32.815  17.684  1.00 7.32   ? 866  LEU A CD1   1 
ATOM   4264  C CD2   . LEU A 1 558 ? -14.463 34.023  19.784  1.00 3.83   ? 866  LEU A CD2   1 
ATOM   4265  N N     . ARG A 1 559 ? -12.232 37.439  17.270  1.00 8.02   ? 867  ARG A N     1 
ATOM   4266  C CA    . ARG A 1 559 ? -11.426 38.178  16.316  1.00 11.33  ? 867  ARG A CA    1 
ATOM   4267  C C     . ARG A 1 559 ? -11.524 37.414  14.997  1.00 13.15  ? 867  ARG A C     1 
ATOM   4268  O O     . ARG A 1 559 ? -10.666 36.583  14.658  1.00 10.11  ? 867  ARG A O     1 
ATOM   4269  C CB    . ARG A 1 559 ? -9.983  38.294  16.808  1.00 10.52  ? 867  ARG A CB    1 
ATOM   4270  C CG    . ARG A 1 559 ? -9.834  38.976  18.184  1.00 8.31   ? 867  ARG A CG    1 
ATOM   4271  C CD    . ARG A 1 559 ? -8.365  39.277  18.518  1.00 12.31  ? 867  ARG A CD    1 
ATOM   4272  N NE    . ARG A 1 559 ? -8.230  39.779  19.880  1.00 13.98  ? 867  ARG A NE    1 
ATOM   4273  C CZ    . ARG A 1 559 ? -7.647  39.111  20.872  1.00 20.46  ? 867  ARG A CZ    1 
ATOM   4274  N NH1   . ARG A 1 559 ? -7.110  37.917  20.657  1.00 11.99  ? 867  ARG A NH1   1 
ATOM   4275  N NH2   . ARG A 1 559 ? -7.588  39.649  22.084  1.00 19.91  ? 867  ARG A NH2   1 
ATOM   4276  N N     . PHE A 1 560 ? -12.589 37.699  14.253  1.00 6.98   ? 868  PHE A N     1 
ATOM   4277  C CA    . PHE A 1 560 ? -12.990 36.828  13.139  1.00 8.21   ? 868  PHE A CA    1 
ATOM   4278  C C     . PHE A 1 560 ? -13.476 37.722  11.998  1.00 6.62   ? 868  PHE A C     1 
ATOM   4279  O O     . PHE A 1 560 ? -14.629 37.629  11.594  1.00 9.88   ? 868  PHE A O     1 
ATOM   4280  C CB    . PHE A 1 560 ? -14.143 35.918  13.636  1.00 8.61   ? 868  PHE A CB    1 
ATOM   4281  C CG    . PHE A 1 560 ? -14.220 34.543  12.991  1.00 10.25  ? 868  PHE A CG    1 
ATOM   4282  C CD1   . PHE A 1 560 ? -15.153 33.614  13.468  1.00 8.49   ? 868  PHE A CD1   1 
ATOM   4283  C CD2   . PHE A 1 560 ? -13.381 34.167  11.940  1.00 8.44   ? 868  PHE A CD2   1 
ATOM   4284  C CE1   . PHE A 1 560 ? -15.249 32.328  12.921  1.00 8.79   ? 868  PHE A CE1   1 
ATOM   4285  C CE2   . PHE A 1 560 ? -13.459 32.865  11.377  1.00 8.63   ? 868  PHE A CE2   1 
ATOM   4286  C CZ    . PHE A 1 560 ? -14.391 31.944  11.869  1.00 7.77   ? 868  PHE A CZ    1 
ATOM   4287  N N     . PRO A 1 561 ? -12.583 38.569  11.445  1.00 12.40  ? 869  PRO A N     1 
ATOM   4288  C CA    . PRO A 1 561 ? -11.155 38.622  11.788  1.00 11.61  ? 869  PRO A CA    1 
ATOM   4289  C C     . PRO A 1 561 ? -10.791 39.695  12.813  1.00 13.73  ? 869  PRO A C     1 
ATOM   4290  O O     . PRO A 1 561 ? -11.553 40.634  13.049  1.00 9.48   ? 869  PRO A O     1 
ATOM   4291  C CB    . PRO A 1 561 ? -10.507 38.972  10.442  1.00 18.22  ? 869  PRO A CB    1 
ATOM   4292  C CG    . PRO A 1 561 ? -11.534 39.890  9.792   1.00 11.59  ? 869  PRO A CG    1 
ATOM   4293  C CD    . PRO A 1 561 ? -12.883 39.368  10.235  1.00 10.18  ? 869  PRO A CD    1 
ATOM   4294  N N     . ALA A 1 562 ? -9.608  39.545  13.403  1.00 8.50   ? 870  ALA A N     1 
ATOM   4295  C CA    . ALA A 1 562 ? -9.030  40.529  14.309  1.00 9.79   ? 870  ALA A CA    1 
ATOM   4296  C C     . ALA A 1 562 ? -9.194  41.992  13.854  1.00 9.63   ? 870  ALA A C     1 
ATOM   4297  O O     . ALA A 1 562 ? -9.450  42.871  14.671  1.00 11.71  ? 870  ALA A O     1 
ATOM   4298  C CB    . ALA A 1 562 ? -7.535  40.202  14.557  1.00 11.68  ? 870  ALA A CB    1 
ATOM   4299  N N     . VAL A 1 563 ? -9.057  42.267  12.561  1.00 10.38  ? 871  VAL A N     1 
ATOM   4300  C CA    . VAL A 1 563 ? -9.143  43.662  12.108  1.00 14.33  ? 871  VAL A CA    1 
ATOM   4301  C C     . VAL A 1 563 ? -10.571 44.230  12.195  1.00 17.17  ? 871  VAL A C     1 
ATOM   4302  O O     . VAL A 1 563 ? -10.785 45.425  12.002  1.00 17.51  ? 871  VAL A O     1 
ATOM   4303  C CB    . VAL A 1 563 ? -8.502  43.883  10.709  1.00 19.24  ? 871  VAL A CB    1 
ATOM   4304  C CG1   . VAL A 1 563 ? -7.051  43.440  10.740  1.00 12.70  ? 871  VAL A CG1   1 
ATOM   4305  C CG2   . VAL A 1 563 ? -9.245  43.093  9.634   1.00 17.00  ? 871  VAL A CG2   1 
ATOM   4306  N N     . GLY A 1 564 ? -11.541 43.376  12.510  1.00 14.85  ? 872  GLY A N     1 
ATOM   4307  C CA    . GLY A 1 564 ? -12.879 43.839  12.849  1.00 6.56   ? 872  GLY A CA    1 
ATOM   4308  C C     . GLY A 1 564 ? -13.013 44.365  14.272  1.00 6.57   ? 872  GLY A C     1 
ATOM   4309  O O     . GLY A 1 564 ? -13.906 45.173  14.556  1.00 14.89  ? 872  GLY A O     1 
ATOM   4310  N N     . GLU A 1 565 ? -12.138 43.915  15.173  1.00 8.23   ? 873  GLU A N     1 
ATOM   4311  C CA    . GLU A 1 565 ? -12.231 44.282  16.598  1.00 10.03  ? 873  GLU A CA    1 
ATOM   4312  C C     . GLU A 1 565 ? -12.275 45.785  16.849  1.00 13.62  ? 873  GLU A C     1 
ATOM   4313  O O     . GLU A 1 565 ? -13.136 46.273  17.581  1.00 16.21  ? 873  GLU A O     1 
ATOM   4314  C CB    . GLU A 1 565 ? -11.089 43.665  17.414  1.00 6.93   ? 873  GLU A CB    1 
ATOM   4315  C CG    . GLU A 1 565 ? -11.102 44.069  18.893  1.00 9.15   ? 873  GLU A CG    1 
ATOM   4316  C CD    . GLU A 1 565 ? -10.103 43.296  19.770  1.00 16.87  ? 873  GLU A CD    1 
ATOM   4317  O OE1   . GLU A 1 565 ? -9.492  42.303  19.317  1.00 12.76  ? 873  GLU A OE1   1 
ATOM   4318  O OE2   . GLU A 1 565 ? -9.932  43.689  20.937  1.00 9.99   ? 873  GLU A OE2   1 
ATOM   4319  N N     . PRO A 1 566 ? -11.328 46.539  16.264  1.00 16.03  ? 874  PRO A N     1 
ATOM   4320  C CA    . PRO A 1 566 ? -11.330 47.965  16.589  1.00 6.83   ? 874  PRO A CA    1 
ATOM   4321  C C     . PRO A 1 566 ? -12.532 48.711  15.998  1.00 9.69   ? 874  PRO A C     1 
ATOM   4322  O O     . PRO A 1 566 ? -12.915 49.752  16.531  1.00 15.08  ? 874  PRO A O     1 
ATOM   4323  C CB    . PRO A 1 566 ? -10.003 48.459  15.988  1.00 16.85  ? 874  PRO A CB    1 
ATOM   4324  C CG    . PRO A 1 566 ? -9.711  47.530  14.895  1.00 19.23  ? 874  PRO A CG    1 
ATOM   4325  C CD    . PRO A 1 566 ? -10.190 46.176  15.402  1.00 22.64  ? 874  PRO A CD    1 
ATOM   4326  N N     . ASN A 1 567 ? -13.146 48.182  14.944  1.00 11.34  ? 875  ASN A N     1 
ATOM   4327  C CA    . ASN A 1 567 ? -14.352 48.810  14.397  1.00 14.29  ? 875  ASN A CA    1 
ATOM   4328  C C     . ASN A 1 567 ? -15.564 48.587  15.322  1.00 16.49  ? 875  ASN A C     1 
ATOM   4329  O O     . ASN A 1 567 ? -16.302 49.512  15.646  1.00 9.17   ? 875  ASN A O     1 
ATOM   4330  C CB    . ASN A 1 567 ? -14.627 48.321  12.955  1.00 12.99  ? 875  ASN A CB    1 
ATOM   4331  C CG    . ASN A 1 567 ? -13.711 48.980  11.929  1.00 16.44  ? 875  ASN A CG    1 
ATOM   4332  O OD1   . ASN A 1 567 ? -13.252 50.100  12.140  1.00 22.66  ? 875  ASN A OD1   1 
ATOM   4333  N ND2   . ASN A 1 567 ? -13.431 48.287  10.819  1.00 7.07   ? 875  ASN A ND2   1 
ATOM   4334  N N     . ILE A 1 568 ? -15.750 47.352  15.758  1.00 12.37  ? 876  ILE A N     1 
ATOM   4335  C CA    . ILE A 1 568 ? -16.790 47.023  16.724  1.00 12.81  ? 876  ILE A CA    1 
ATOM   4336  C C     . ILE A 1 568 ? -16.621 47.841  18.000  1.00 14.27  ? 876  ILE A C     1 
ATOM   4337  O O     . ILE A 1 568 ? -17.590 48.393  18.532  1.00 15.99  ? 876  ILE A O     1 
ATOM   4338  C CB    . ILE A 1 568 ? -16.788 45.513  17.057  1.00 8.90   ? 876  ILE A CB    1 
ATOM   4339  C CG1   . ILE A 1 568 ? -17.242 44.692  15.846  1.00 16.85  ? 876  ILE A CG1   1 
ATOM   4340  C CG2   . ILE A 1 568 ? -17.700 45.215  18.244  1.00 15.08  ? 876  ILE A CG2   1 
ATOM   4341  C CD1   . ILE A 1 568 ? -18.663 44.996  15.382  1.00 18.05  ? 876  ILE A CD1   1 
ATOM   4342  N N     . GLN A 1 569 ? -15.388 47.956  18.479  1.00 15.07  ? 877  GLN A N     1 
ATOM   4343  C CA    . GLN A 1 569 ? -15.157 48.673  19.731  1.00 18.02  ? 877  GLN A CA    1 
ATOM   4344  C C     . GLN A 1 569 ? -15.504 50.153  19.608  1.00 12.92  ? 877  GLN A C     1 
ATOM   4345  O O     . GLN A 1 569 ? -16.100 50.723  20.509  1.00 19.24  ? 877  GLN A O     1 
ATOM   4346  C CB    . GLN A 1 569 ? -13.721 48.489  20.225  1.00 16.66  ? 877  GLN A CB    1 
ATOM   4347  C CG    . GLN A 1 569 ? -13.318 47.040  20.489  1.00 31.00  ? 877  GLN A CG    1 
ATOM   4348  C CD    . GLN A 1 569 ? -13.510 46.612  21.941  1.00 44.25  ? 877  GLN A CD    1 
ATOM   4349  O OE1   . GLN A 1 569 ? -14.321 47.181  22.671  1.00 33.38  ? 877  GLN A OE1   1 
ATOM   4350  N NE2   . GLN A 1 569 ? -12.750 45.607  22.364  1.00 45.93  ? 877  GLN A NE2   1 
ATOM   4351  N N     . GLN A 1 570 ? -15.131 50.773  18.494  1.00 15.10  ? 878  GLN A N     1 
ATOM   4352  C CA    . GLN A 1 570 ? -15.451 52.179  18.270  1.00 16.59  ? 878  GLN A CA    1 
ATOM   4353  C C     . GLN A 1 570 ? -16.958 52.417  18.239  1.00 19.84  ? 878  GLN A C     1 
ATOM   4354  O O     . GLN A 1 570 ? -17.457 53.363  18.838  1.00 19.68  ? 878  GLN A O     1 
ATOM   4355  C CB    . GLN A 1 570 ? -14.828 52.687  16.966  1.00 21.21  ? 878  GLN A CB    1 
ATOM   4356  C CG    . GLN A 1 570 ? -15.017 54.184  16.758  1.00 29.48  ? 878  GLN A CG    1 
ATOM   4357  C CD    . GLN A 1 570 ? -14.376 54.994  17.873  1.00 45.80  ? 878  GLN A CD    1 
ATOM   4358  O OE1   . GLN A 1 570 ? -13.156 55.181  17.902  1.00 53.38  ? 878  GLN A OE1   1 
ATOM   4359  N NE2   . GLN A 1 570 ? -15.193 55.463  18.808  1.00 37.33  ? 878  GLN A NE2   1 
ATOM   4360  N N     . TYR A 1 571 ? -17.683 51.561  17.527  1.00 14.03  ? 879  TYR A N     1 
ATOM   4361  C CA    . TYR A 1 571 ? -19.130 51.706  17.443  1.00 15.13  ? 879  TYR A CA    1 
ATOM   4362  C C     . TYR A 1 571 ? -19.791 51.471  18.799  1.00 19.07  ? 879  TYR A C     1 
ATOM   4363  O O     . TYR A 1 571 ? -20.746 52.164  19.166  1.00 22.11  ? 879  TYR A O     1 
ATOM   4364  C CB    . TYR A 1 571 ? -19.706 50.775  16.369  1.00 21.24  ? 879  TYR A CB    1 
ATOM   4365  C CG    . TYR A 1 571 ? -19.303 51.171  14.962  1.00 24.17  ? 879  TYR A CG    1 
ATOM   4366  C CD1   . TYR A 1 571 ? -19.476 52.477  14.508  1.00 32.62  ? 879  TYR A CD1   1 
ATOM   4367  C CD2   . TYR A 1 571 ? -18.733 50.248  14.096  1.00 22.77  ? 879  TYR A CD2   1 
ATOM   4368  C CE1   . TYR A 1 571 ? -19.102 52.845  13.221  1.00 31.72  ? 879  TYR A CE1   1 
ATOM   4369  C CE2   . TYR A 1 571 ? -18.358 50.606  12.807  1.00 14.40  ? 879  TYR A CE2   1 
ATOM   4370  C CZ    . TYR A 1 571 ? -18.538 51.901  12.380  1.00 25.48  ? 879  TYR A CZ    1 
ATOM   4371  O OH    . TYR A 1 571 ? -18.163 52.247  11.103  1.00 26.32  ? 879  TYR A OH    1 
ATOM   4372  N N     . ALA A 1 572 ? -19.274 50.498  19.543  1.00 17.48  ? 880  ALA A N     1 
ATOM   4373  C CA    . ALA A 1 572 ? -19.750 50.234  20.897  1.00 20.55  ? 880  ALA A CA    1 
ATOM   4374  C C     . ALA A 1 572 ? -19.507 51.440  21.808  1.00 21.76  ? 880  ALA A C     1 
ATOM   4375  O O     . ALA A 1 572 ? -20.390 51.848  22.571  1.00 17.79  ? 880  ALA A O     1 
ATOM   4376  C CB    . ALA A 1 572 ? -19.075 48.986  21.466  1.00 18.09  ? 880  ALA A CB    1 
ATOM   4377  N N     . GLN A 1 573 ? -18.303 52.000  21.736  1.00 20.75  ? 881  GLN A N     1 
ATOM   4378  C CA    . GLN A 1 573 ? -17.967 53.179  22.530  1.00 26.71  ? 881  GLN A CA    1 
ATOM   4379  C C     . GLN A 1 573 ? -18.889 54.350  22.187  1.00 27.34  ? 881  GLN A C     1 
ATOM   4380  O O     . GLN A 1 573 ? -19.341 55.077  23.074  1.00 27.36  ? 881  GLN A O     1 
ATOM   4381  C CB    . GLN A 1 573 ? -16.505 53.576  22.315  1.00 31.72  ? 881  GLN A CB    1 
ATOM   4382  C CG    . GLN A 1 573 ? -16.061 54.784  23.125  1.00 45.21  ? 881  GLN A CG    1 
ATOM   4383  C CD    . GLN A 1 573 ? -14.639 55.213  22.800  1.00 65.74  ? 881  GLN A CD    1 
ATOM   4384  O OE1   . GLN A 1 573 ? -14.386 55.832  21.766  1.00 65.98  ? 881  GLN A OE1   1 
ATOM   4385  N NE2   . GLN A 1 573 ? -13.704 54.883  23.684  1.00 69.49  ? 881  GLN A NE2   1 
ATOM   4386  N N     . ASN A 1 574 ? -19.169 54.525  20.900  1.00 18.95  ? 882  ASN A N     1 
ATOM   4387  C CA    . ASN A 1 574 ? -20.098 55.563  20.457  1.00 23.77  ? 882  ASN A CA    1 
ATOM   4388  C C     . ASN A 1 574 ? -21.503 55.328  20.996  1.00 34.78  ? 882  ASN A C     1 
ATOM   4389  O O     . ASN A 1 574 ? -22.281 56.270  21.149  1.00 29.61  ? 882  ASN A O     1 
ATOM   4390  C CB    . ASN A 1 574 ? -20.157 55.634  18.932  1.00 24.19  ? 882  ASN A CB    1 
ATOM   4391  C CG    . ASN A 1 574 ? -18.867 56.145  18.312  1.00 32.70  ? 882  ASN A CG    1 
ATOM   4392  O OD1   . ASN A 1 574 ? -17.914 56.499  19.008  1.00 36.11  ? 882  ASN A OD1   1 
ATOM   4393  N ND2   . ASN A 1 574 ? -18.832 56.174  16.987  1.00 29.30  ? 882  ASN A ND2   1 
ATOM   4394  N N     . MET A 1 575 ? -21.830 54.066  21.267  1.00 28.34  ? 883  MET A N     1 
ATOM   4395  C CA    . MET A 1 575 ? -23.139 53.716  21.824  1.00 27.80  ? 883  MET A CA    1 
ATOM   4396  C C     . MET A 1 575 ? -23.151 53.843  23.344  1.00 31.35  ? 883  MET A C     1 
ATOM   4397  O O     . MET A 1 575 ? -24.155 53.555  23.992  1.00 33.31  ? 883  MET A O     1 
ATOM   4398  C CB    . MET A 1 575 ? -23.548 52.302  21.407  1.00 32.90  ? 883  MET A CB    1 
ATOM   4399  C CG    . MET A 1 575 ? -23.920 52.167  19.937  1.00 28.07  ? 883  MET A CG    1 
ATOM   4400  S SD    . MET A 1 575 ? -24.170 50.447  19.429  1.00 30.35  ? 883  MET A SD    1 
ATOM   4401  C CE    . MET A 1 575 ? -24.308 50.627  17.647  1.00 21.67  ? 883  MET A CE    1 
ATOM   4402  N N     . GLY A 1 576 ? -22.029 54.272  23.911  1.00 32.77  ? 884  GLY A N     1 
ATOM   4403  C CA    . GLY A 1 576 ? -21.945 54.487  25.345  1.00 36.86  ? 884  GLY A CA    1 
ATOM   4404  C C     . GLY A 1 576 ? -21.547 53.254  26.133  1.00 41.68  ? 884  GLY A C     1 
ATOM   4405  O O     . GLY A 1 576 ? -21.767 53.190  27.343  1.00 34.36  ? 884  GLY A O     1 
ATOM   4406  N N     . LEU A 1 577 ? -20.963 52.269  25.453  1.00 24.15  ? 885  LEU A N     1 
ATOM   4407  C CA    . LEU A 1 577 ? -20.432 51.091  26.132  1.00 31.70  ? 885  LEU A CA    1 
ATOM   4408  C C     . LEU A 1 577 ? -18.933 51.222  26.345  1.00 26.78  ? 885  LEU A C     1 
ATOM   4409  O O     . LEU A 1 577 ? -18.182 51.365  25.387  1.00 28.44  ? 885  LEU A O     1 
ATOM   4410  C CB    . LEU A 1 577 ? -20.694 49.816  25.327  1.00 25.11  ? 885  LEU A CB    1 
ATOM   4411  C CG    . LEU A 1 577 ? -22.109 49.318  25.046  1.00 29.21  ? 885  LEU A CG    1 
ATOM   4412  C CD1   . LEU A 1 577 ? -22.041 48.155  24.061  1.00 31.41  ? 885  LEU A CD1   1 
ATOM   4413  C CD2   . LEU A 1 577 ? -22.816 48.899  26.326  1.00 25.89  ? 885  LEU A CD2   1 
ATOM   4414  N N     . PRO A 1 578 ? -18.492 51.162  27.607  1.00 25.37  ? 886  PRO A N     1 
ATOM   4415  C CA    . PRO A 1 578 ? -17.060 51.134  27.924  1.00 31.15  ? 886  PRO A CA    1 
ATOM   4416  C C     . PRO A 1 578 ? -16.366 49.902  27.345  1.00 40.34  ? 886  PRO A C     1 
ATOM   4417  O O     . PRO A 1 578 ? -16.981 48.844  27.190  1.00 27.20  ? 886  PRO A O     1 
ATOM   4418  C CB    . PRO A 1 578 ? -17.043 51.073  29.451  1.00 27.51  ? 886  PRO A CB    1 
ATOM   4419  C CG    . PRO A 1 578 ? -18.326 51.683  29.865  1.00 33.70  ? 886  PRO A CG    1 
ATOM   4420  C CD    . PRO A 1 578 ? -19.325 51.301  28.812  1.00 22.88  ? 886  PRO A CD    1 
ATOM   4421  N N     . GLN A 1 579 ? -15.083 50.056  27.033  1.00 40.58  ? 887  GLN A N     1 
ATOM   4422  C CA    . GLN A 1 579 ? -14.277 48.996  26.443  1.00 42.11  ? 887  GLN A CA    1 
ATOM   4423  C C     . GLN A 1 579 ? -14.481 47.645  27.135  1.00 31.76  ? 887  GLN A C     1 
ATOM   4424  O O     . GLN A 1 579 ? -14.472 46.592  26.483  1.00 25.81  ? 887  GLN A O     1 
ATOM   4425  C CB    . GLN A 1 579 ? -12.796 49.398  26.478  1.00 36.96  ? 887  GLN A CB    1 
ATOM   4426  C CG    . GLN A 1 579 ? -11.879 48.536  25.636  1.00 49.25  ? 887  GLN A CG    1 
ATOM   4427  C CD    . GLN A 1 579 ? -10.503 49.161  25.467  1.00 63.10  ? 887  GLN A CD    1 
ATOM   4428  O OE1   . GLN A 1 579 ? -10.209 50.216  26.037  1.00 51.23  ? 887  GLN A OE1   1 
ATOM   4429  N NE2   . GLN A 1 579 ? -9.655  48.513  24.676  1.00 72.57  ? 887  GLN A NE2   1 
ATOM   4430  N N     . ASN A 1 580 ? -14.679 47.678  28.449  1.00 25.13  ? 888  ASN A N     1 
ATOM   4431  C CA    . ASN A 1 580 ? -14.757 46.446  29.235  1.00 28.10  ? 888  ASN A CA    1 
ATOM   4432  C C     . ASN A 1 580 ? -16.115 45.738  29.227  1.00 21.56  ? 888  ASN A C     1 
ATOM   4433  O O     . ASN A 1 580 ? -16.329 44.795  29.982  1.00 26.04  ? 888  ASN A O     1 
ATOM   4434  C CB    . ASN A 1 580 ? -14.303 46.693  30.675  1.00 33.47  ? 888  ASN A CB    1 
ATOM   4435  C CG    . ASN A 1 580 ? -15.311 47.503  31.480  1.00 52.91  ? 888  ASN A CG    1 
ATOM   4436  O OD1   . ASN A 1 580 ? -16.360 47.901  30.972  1.00 52.85  ? 888  ASN A OD1   1 
ATOM   4437  N ND2   . ASN A 1 580 ? -14.997 47.739  32.749  1.00 60.59  ? 888  ASN A ND2   1 
ATOM   4438  N N     . ARG A 1 581 ? -17.035 46.193  28.387  1.00 18.83  ? 889  ARG A N     1 
ATOM   4439  C CA    . ARG A 1 581 ? -18.308 45.497  28.239  1.00 24.35  ? 889  ARG A CA    1 
ATOM   4440  C C     . ARG A 1 581 ? -18.179 44.433  27.152  1.00 18.17  ? 889  ARG A C     1 
ATOM   4441  O O     . ARG A 1 581 ? -19.020 43.539  27.035  1.00 11.92  ? 889  ARG A O     1 
ATOM   4442  C CB    . ARG A 1 581 ? -19.443 46.462  27.870  1.00 33.21  ? 889  ARG A CB    1 
ATOM   4443  C CG    . ARG A 1 581 ? -19.687 47.622  28.830  1.00 28.81  ? 889  ARG A CG    1 
ATOM   4444  C CD    . ARG A 1 581 ? -19.934 47.159  30.251  1.00 20.01  ? 889  ARG A CD    1 
ATOM   4445  N NE    . ARG A 1 581 ? -21.056 46.235  30.383  1.00 21.74  ? 889  ARG A NE    1 
ATOM   4446  C CZ    . ARG A 1 581 ? -22.324 46.595  30.569  1.00 24.80  ? 889  ARG A CZ    1 
ATOM   4447  N NH1   . ARG A 1 581 ? -22.661 47.876  30.634  1.00 18.86  ? 889  ARG A NH1   1 
ATOM   4448  N NH2   . ARG A 1 581 ? -23.265 45.666  30.687  1.00 17.08  ? 889  ARG A NH2   1 
ATOM   4449  N N     . ILE A 1 582 ? -17.135 44.540  26.338  1.00 13.45  ? 890  ILE A N     1 
ATOM   4450  C CA    . ILE A 1 582 ? -16.966 43.597  25.242  1.00 12.23  ? 890  ILE A CA    1 
ATOM   4451  C C     . ILE A 1 582 ? -15.626 42.885  25.368  1.00 22.07  ? 890  ILE A C     1 
ATOM   4452  O O     . ILE A 1 582 ? -14.584 43.525  25.503  1.00 17.66  ? 890  ILE A O     1 
ATOM   4453  C CB    . ILE A 1 582 ? -17.089 44.304  23.864  1.00 17.09  ? 890  ILE A CB    1 
ATOM   4454  C CG1   . ILE A 1 582 ? -18.400 45.074  23.783  1.00 14.37  ? 890  ILE A CG1   1 
ATOM   4455  C CG2   . ILE A 1 582 ? -17.033 43.294  22.723  1.00 21.75  ? 890  ILE A CG2   1 
ATOM   4456  C CD1   . ILE A 1 582 ? -18.674 45.639  22.395  1.00 22.47  ? 890  ILE A CD1   1 
ATOM   4457  N N     . ILE A 1 583 ? -15.667 41.557  25.362  1.00 12.55  ? 891  ILE A N     1 
ATOM   4458  C CA    . ILE A 1 583 ? -14.458 40.759  25.462  1.00 10.71  ? 891  ILE A CA    1 
ATOM   4459  C C     . ILE A 1 583 ? -14.206 39.967  24.174  1.00 8.82   ? 891  ILE A C     1 
ATOM   4460  O O     . ILE A 1 583 ? -15.073 39.235  23.699  1.00 9.77   ? 891  ILE A O     1 
ATOM   4461  C CB    . ILE A 1 583 ? -14.547 39.770  26.627  1.00 5.21   ? 891  ILE A CB    1 
ATOM   4462  C CG1   . ILE A 1 583 ? -14.654 40.549  27.950  1.00 20.19  ? 891  ILE A CG1   1 
ATOM   4463  C CG2   . ILE A 1 583 ? -13.332 38.839  26.592  1.00 11.91  ? 891  ILE A CG2   1 
ATOM   4464  C CD1   . ILE A 1 583 ? -14.846 39.690  29.160  1.00 24.10  ? 891  ILE A CD1   1 
ATOM   4465  N N     . PHE A 1 584 ? -13.013 40.107  23.620  1.00 7.13   ? 892  PHE A N     1 
ATOM   4466  C CA    . PHE A 1 584 ? -12.675 39.403  22.382  1.00 13.49  ? 892  PHE A CA    1 
ATOM   4467  C C     . PHE A 1 584 ? -11.758 38.231  22.657  1.00 18.60  ? 892  PHE A C     1 
ATOM   4468  O O     . PHE A 1 584 ? -10.828 38.347  23.453  1.00 11.09  ? 892  PHE A O     1 
ATOM   4469  C CB    . PHE A 1 584 ? -12.013 40.349  21.384  1.00 12.72  ? 892  PHE A CB    1 
ATOM   4470  C CG    . PHE A 1 584 ? -12.995 41.141  20.570  1.00 15.51  ? 892  PHE A CG    1 
ATOM   4471  C CD1   . PHE A 1 584 ? -13.440 40.661  19.349  1.00 11.34  ? 892  PHE A CD1   1 
ATOM   4472  C CD2   . PHE A 1 584 ? -13.468 42.370  21.023  1.00 14.17  ? 892  PHE A CD2   1 
ATOM   4473  C CE1   . PHE A 1 584 ? -14.366 41.381  18.595  1.00 12.43  ? 892  PHE A CE1   1 
ATOM   4474  C CE2   . PHE A 1 584 ? -14.397 43.091  20.279  1.00 14.67  ? 892  PHE A CE2   1 
ATOM   4475  C CZ    . PHE A 1 584 ? -14.843 42.600  19.070  1.00 13.90  ? 892  PHE A CZ    1 
ATOM   4476  N N     . SER A 1 585 ? -12.034 37.101  22.009  1.00 11.97  ? 893  SER A N     1 
ATOM   4477  C CA    . SER A 1 585 ? -11.105 35.973  22.033  1.00 5.21   ? 893  SER A CA    1 
ATOM   4478  C C     . SER A 1 585 ? -10.649 35.655  20.601  1.00 11.62  ? 893  SER A C     1 
ATOM   4479  O O     . SER A 1 585 ? -11.373 35.927  19.617  1.00 5.64   ? 893  SER A O     1 
ATOM   4480  C CB    . SER A 1 585 ? -11.756 34.728  22.647  1.00 3.29   ? 893  SER A CB    1 
ATOM   4481  O OG    . SER A 1 585 ? -12.181 34.932  23.988  1.00 12.27  ? 893  SER A OG    1 
ATOM   4482  N N     . PRO A 1 586 ? -9.464  35.060  20.484  1.00 8.24   ? 894  PRO A N     1 
ATOM   4483  C CA    . PRO A 1 586 ? -9.016  34.519  19.195  1.00 5.40   ? 894  PRO A CA    1 
ATOM   4484  C C     . PRO A 1 586 ? -9.933  33.380  18.762  1.00 13.98  ? 894  PRO A C     1 
ATOM   4485  O O     . PRO A 1 586 ? -10.520 32.714  19.611  1.00 5.79   ? 894  PRO A O     1 
ATOM   4486  C CB    . PRO A 1 586 ? -7.640  33.940  19.505  1.00 11.80  ? 894  PRO A CB    1 
ATOM   4487  C CG    . PRO A 1 586 ? -7.269  34.410  20.872  1.00 15.07  ? 894  PRO A CG    1 
ATOM   4488  C CD    . PRO A 1 586 ? -8.535  34.736  21.591  1.00 6.49   ? 894  PRO A CD    1 
ATOM   4489  N N     . VAL A 1 587 ? -10.086 33.194  17.455  1.00 6.11   ? 895  VAL A N     1 
ATOM   4490  C CA    . VAL A 1 587 ? -10.720 31.989  16.910  1.00 2.41   ? 895  VAL A CA    1 
ATOM   4491  C C     . VAL A 1 587 ? -9.904  30.807  17.409  1.00 9.01   ? 895  VAL A C     1 
ATOM   4492  O O     . VAL A 1 587 ? -8.677  30.884  17.481  1.00 9.23   ? 895  VAL A O     1 
ATOM   4493  C CB    . VAL A 1 587 ? -10.675 31.995  15.373  1.00 4.06   ? 895  VAL A CB    1 
ATOM   4494  C CG1   . VAL A 1 587 ? -11.162 30.651  14.808  1.00 9.43   ? 895  VAL A CG1   1 
ATOM   4495  C CG2   . VAL A 1 587 ? -11.518 33.149  14.832  1.00 9.02   ? 895  VAL A CG2   1 
ATOM   4496  N N     . ALA A 1 588 ? -10.585 29.717  17.755  1.00 9.46   ? 896  ALA A N     1 
ATOM   4497  C CA    . ALA A 1 588 ? -9.936  28.567  18.358  1.00 4.87   ? 896  ALA A CA    1 
ATOM   4498  C C     . ALA A 1 588 ? -10.113 27.306  17.514  1.00 8.64   ? 896  ALA A C     1 
ATOM   4499  O O     . ALA A 1 588 ? -10.986 27.238  16.654  1.00 8.32   ? 896  ALA A O     1 
ATOM   4500  C CB    . ALA A 1 588 ? -10.510 28.341  19.783  1.00 7.30   ? 896  ALA A CB    1 
ATOM   4501  N N     . PRO A 1 589 ? -9.270  26.302  17.751  1.00 6.93   ? 897  PRO A N     1 
ATOM   4502  C CA    . PRO A 1 589 ? -9.498  24.985  17.133  1.00 10.58  ? 897  PRO A CA    1 
ATOM   4503  C C     . PRO A 1 589 ? -10.930 24.515  17.393  1.00 11.09  ? 897  PRO A C     1 
ATOM   4504  O O     . PRO A 1 589 ? -11.559 24.923  18.383  1.00 10.25  ? 897  PRO A O     1 
ATOM   4505  C CB    . PRO A 1 589 ? -8.522  24.059  17.873  1.00 12.25  ? 897  PRO A CB    1 
ATOM   4506  C CG    . PRO A 1 589 ? -7.488  24.965  18.481  1.00 13.45  ? 897  PRO A CG    1 
ATOM   4507  C CD    . PRO A 1 589 ? -8.149  26.306  18.711  1.00 7.73   ? 897  PRO A CD    1 
ATOM   4508  N N     . LYS A 1 590 ? -11.434 23.665  16.506  1.00 9.09   ? 898  LYS A N     1 
ATOM   4509  C CA    . LYS A 1 590 ? -12.844 23.275  16.501  1.00 7.54   ? 898  LYS A CA    1 
ATOM   4510  C C     . LYS A 1 590 ? -13.362 22.800  17.864  1.00 12.33  ? 898  LYS A C     1 
ATOM   4511  O O     . LYS A 1 590 ? -14.403 23.257  18.328  1.00 7.73   ? 898  LYS A O     1 
ATOM   4512  C CB    . LYS A 1 590 ? -13.062 22.168  15.470  1.00 12.01  ? 898  LYS A CB    1 
ATOM   4513  C CG    . LYS A 1 590 ? -14.523 21.713  15.319  1.00 14.25  ? 898  LYS A CG    1 
ATOM   4514  C CD    . LYS A 1 590 ? -15.313 22.640  14.381  1.00 14.27  ? 898  LYS A CD    1 
ATOM   4515  C CE    . LYS A 1 590 ? -16.747 22.148  14.182  1.00 16.29  ? 898  LYS A CE    1 
ATOM   4516  N NZ    . LYS A 1 590 ? -17.489 22.953  13.164  1.00 6.82   ? 898  LYS A NZ    1 
ATOM   4517  N N     . GLU A 1 591 ? -12.648 21.868  18.484  1.00 9.30   ? 899  GLU A N     1 
ATOM   4518  C CA    . GLU A 1 591 ? -13.093 21.290  19.760  1.00 8.70   ? 899  GLU A CA    1 
ATOM   4519  C C     . GLU A 1 591 ? -13.165 22.320  20.890  1.00 7.24   ? 899  GLU A C     1 
ATOM   4520  O O     . GLU A 1 591 ? -14.129 22.343  21.637  1.00 4.20   ? 899  GLU A O     1 
ATOM   4521  C CB    . GLU A 1 591 ? -12.217 20.089  20.149  1.00 14.33  ? 899  GLU A CB    1 
ATOM   4522  C CG    . GLU A 1 591 ? -12.693 19.304  21.401  1.00 10.93  ? 899  GLU A CG    1 
ATOM   4523  C CD    . GLU A 1 591 ? -12.201 19.925  22.712  1.00 10.51  ? 899  GLU A CD    1 
ATOM   4524  O OE1   . GLU A 1 591 ? -11.212 20.686  22.679  1.00 7.29   ? 899  GLU A OE1   1 
ATOM   4525  O OE2   . GLU A 1 591 ? -12.797 19.651  23.777  1.00 11.60  ? 899  GLU A OE2   1 
ATOM   4526  N N     . GLU A 1 592 ? -12.144 23.168  20.991  1.00 6.13   ? 900  GLU A N     1 
ATOM   4527  C CA    . GLU A 1 592 ? -12.088 24.225  22.002  1.00 13.43  ? 900  GLU A CA    1 
ATOM   4528  C C     . GLU A 1 592 ? -13.198 25.254  21.814  1.00 16.22  ? 900  GLU A C     1 
ATOM   4529  O O     . GLU A 1 592 ? -13.760 25.763  22.790  1.00 2.43   ? 900  GLU A O     1 
ATOM   4530  C CB    . GLU A 1 592 ? -10.722 24.943  21.985  1.00 6.54   ? 900  GLU A CB    1 
ATOM   4531  C CG    . GLU A 1 592 ? -10.655 26.153  22.959  1.00 9.00   ? 900  GLU A CG    1 
ATOM   4532  C CD    . GLU A 1 592 ? -9.430  27.040  22.749  1.00 16.38  ? 900  GLU A CD    1 
ATOM   4533  O OE1   . GLU A 1 592 ? -8.464  26.604  22.072  1.00 11.89  ? 900  GLU A OE1   1 
ATOM   4534  O OE2   . GLU A 1 592 ? -9.437  28.184  23.270  1.00 11.74  ? 900  GLU A OE2   1 
ATOM   4535  N N     . HIS A 1 593 ? -13.481 25.579  20.553  1.00 6.64   ? 901  HIS A N     1 
ATOM   4536  C CA    . HIS A 1 593 ? -14.566 26.502  20.198  1.00 12.22  ? 901  HIS A CA    1 
ATOM   4537  C C     . HIS A 1 593 ? -15.913 25.985  20.724  1.00 10.57  ? 901  HIS A C     1 
ATOM   4538  O O     . HIS A 1 593 ? -16.694 26.721  21.342  1.00 6.17   ? 901  HIS A O     1 
ATOM   4539  C CB    . HIS A 1 593 ? -14.603 26.686  18.660  1.00 7.22   ? 901  HIS A CB    1 
ATOM   4540  C CG    . HIS A 1 593 ? -15.950 27.064  18.113  1.00 5.91   ? 901  HIS A CG    1 
ATOM   4541  N ND1   . HIS A 1 593 ? -16.573 28.262  18.403  1.00 6.36   ? 901  HIS A ND1   1 
ATOM   4542  C CD2   . HIS A 1 593 ? -16.781 26.401  17.273  1.00 8.85   ? 901  HIS A CD2   1 
ATOM   4543  C CE1   . HIS A 1 593 ? -17.738 28.311  17.779  1.00 8.43   ? 901  HIS A CE1   1 
ATOM   4544  N NE2   . HIS A 1 593 ? -17.895 27.187  17.097  1.00 7.79   ? 901  HIS A NE2   1 
ATOM   4545  N N     . VAL A 1 594 ? -16.191 24.712  20.479  1.00 6.76   ? 902  VAL A N     1 
ATOM   4546  C CA    . VAL A 1 594 ? -17.469 24.148  20.908  1.00 9.56   ? 902  VAL A CA    1 
ATOM   4547  C C     . VAL A 1 594 ? -17.480 24.037  22.435  1.00 8.20   ? 902  VAL A C     1 
ATOM   4548  O O     . VAL A 1 594 ? -18.469 24.373  23.089  1.00 9.73   ? 902  VAL A O     1 
ATOM   4549  C CB    . VAL A 1 594 ? -17.759 22.774  20.252  1.00 4.71   ? 902  VAL A CB    1 
ATOM   4550  C CG1   . VAL A 1 594 ? -19.039 22.134  20.839  1.00 8.24   ? 902  VAL A CG1   1 
ATOM   4551  C CG2   . VAL A 1 594 ? -17.888 22.907  18.743  1.00 4.66   ? 902  VAL A CG2   1 
ATOM   4552  N N     . ARG A 1 595 ? -16.365 23.599  22.997  1.00 6.54   ? 903  ARG A N     1 
ATOM   4553  C CA    . ARG A 1 595 ? -16.268 23.378  24.449  1.00 9.02   ? 903  ARG A CA    1 
ATOM   4554  C C     . ARG A 1 595 ? -16.388 24.663  25.270  1.00 7.24   ? 903  ARG A C     1 
ATOM   4555  O O     . ARG A 1 595 ? -17.040 24.684  26.318  1.00 4.73   ? 903  ARG A O     1 
ATOM   4556  C CB    . ARG A 1 595 ? -14.954 22.675  24.789  1.00 7.89   ? 903  ARG A CB    1 
ATOM   4557  C CG    . ARG A 1 595 ? -14.686 22.490  26.278  1.00 5.82   ? 903  ARG A CG    1 
ATOM   4558  C CD    . ARG A 1 595 ? -13.548 21.479  26.507  1.00 9.08   ? 903  ARG A CD    1 
ATOM   4559  N NE    . ARG A 1 595 ? -12.451 21.656  25.551  1.00 9.11   ? 903  ARG A NE    1 
ATOM   4560  C CZ    . ARG A 1 595 ? -11.579 22.669  25.605  1.00 12.34  ? 903  ARG A CZ    1 
ATOM   4561  N NH1   . ARG A 1 595 ? -11.689 23.595  26.552  1.00 8.95   ? 903  ARG A NH1   1 
ATOM   4562  N NH2   . ARG A 1 595 ? -10.613 22.778  24.707  1.00 8.35   ? 903  ARG A NH2   1 
ATOM   4563  N N     . ARG A 1 596 ? -15.776 25.741  24.803  1.00 7.72   ? 904  ARG A N     1 
ATOM   4564  C CA    . ARG A 1 596 ? -15.816 26.980  25.568  1.00 12.43  ? 904  ARG A CA    1 
ATOM   4565  C C     . ARG A 1 596 ? -17.177 27.694  25.523  1.00 7.85   ? 904  ARG A C     1 
ATOM   4566  O O     . ARG A 1 596 ? -17.411 28.604  26.301  1.00 5.32   ? 904  ARG A O     1 
ATOM   4567  C CB    . ARG A 1 596 ? -14.678 27.927  25.170  1.00 6.16   ? 904  ARG A CB    1 
ATOM   4568  C CG    . ARG A 1 596 ? -14.878 28.630  23.837  1.00 4.71   ? 904  ARG A CG    1 
ATOM   4569  C CD    . ARG A 1 596 ? -13.591 29.389  23.425  1.00 9.49   ? 904  ARG A CD    1 
ATOM   4570  N NE    . ARG A 1 596 ? -13.692 29.921  22.060  1.00 9.85   ? 904  ARG A NE    1 
ATOM   4571  C CZ    . ARG A 1 596 ? -12.723 30.588  21.438  1.00 8.26   ? 904  ARG A CZ    1 
ATOM   4572  N NH1   . ARG A 1 596 ? -11.577 30.853  22.054  1.00 13.08  ? 904  ARG A NH1   1 
ATOM   4573  N NH2   . ARG A 1 596 ? -12.904 31.008  20.201  1.00 5.63   ? 904  ARG A NH2   1 
ATOM   4574  N N     . GLY A 1 597 ? -18.074 27.271  24.638  1.00 8.57   ? 905  GLY A N     1 
ATOM   4575  C CA    . GLY A 1 597 ? -19.449 27.753  24.683  1.00 7.85   ? 905  GLY A CA    1 
ATOM   4576  C C     . GLY A 1 597 ? -20.115 27.482  26.027  1.00 6.45   ? 905  GLY A C     1 
ATOM   4577  O O     . GLY A 1 597 ? -21.032 28.202  26.440  1.00 3.90   ? 905  GLY A O     1 
ATOM   4578  N N     . GLN A 1 598 ? -19.693 26.415  26.698  1.00 9.37   ? 906  GLN A N     1 
ATOM   4579  C CA    . GLN A 1 598 ? -20.159 26.142  28.065  1.00 9.19   ? 906  GLN A CA    1 
ATOM   4580  C C     . GLN A 1 598 ? -19.908 27.288  29.058  1.00 12.79  ? 906  GLN A C     1 
ATOM   4581  O O     . GLN A 1 598 ? -20.516 27.322  30.127  1.00 11.44  ? 906  GLN A O     1 
ATOM   4582  C CB    . GLN A 1 598 ? -19.461 24.908  28.619  1.00 8.97   ? 906  GLN A CB    1 
ATOM   4583  C CG    . GLN A 1 598 ? -19.823 23.628  27.909  1.00 7.47   ? 906  GLN A CG    1 
ATOM   4584  C CD    . GLN A 1 598 ? -19.057 22.472  28.461  1.00 6.18   ? 906  GLN A CD    1 
ATOM   4585  O OE1   . GLN A 1 598 ? -19.633 21.566  29.057  1.00 11.21  ? 906  GLN A OE1   1 
ATOM   4586  N NE2   . GLN A 1 598 ? -17.732 22.489  28.272  1.00 7.79   ? 906  GLN A NE2   1 
ATOM   4587  N N     . LEU A 1 599 ? -19.000 28.204  28.730  1.00 8.06   ? 907  LEU A N     1 
ATOM   4588  C CA    . LEU A 1 599 ? -18.668 29.294  29.670  1.00 4.65   ? 907  LEU A CA    1 
ATOM   4589  C C     . LEU A 1 599 ? -19.664 30.436  29.610  1.00 3.79   ? 907  LEU A C     1 
ATOM   4590  O O     . LEU A 1 599 ? -19.720 31.282  30.511  1.00 8.44   ? 907  LEU A O     1 
ATOM   4591  C CB    . LEU A 1 599 ? -17.263 29.854  29.384  1.00 5.40   ? 907  LEU A CB    1 
ATOM   4592  C CG    . LEU A 1 599 ? -16.169 28.821  29.606  1.00 12.11  ? 907  LEU A CG    1 
ATOM   4593  C CD1   . LEU A 1 599 ? -14.824 29.499  29.364  1.00 12.54  ? 907  LEU A CD1   1 
ATOM   4594  C CD2   . LEU A 1 599 ? -16.240 28.263  31.016  1.00 5.24   ? 907  LEU A CD2   1 
ATOM   4595  N N     . ALA A 1 600 ? -20.417 30.500  28.516  1.00 9.24   ? 908  ALA A N     1 
ATOM   4596  C CA    . ALA A 1 600 ? -21.365 31.597  28.337  1.00 9.77   ? 908  ALA A CA    1 
ATOM   4597  C C     . ALA A 1 600 ? -22.652 31.323  29.092  1.00 9.36   ? 908  ALA A C     1 
ATOM   4598  O O     . ALA A 1 600 ? -22.952 30.151  29.410  1.00 9.90   ? 908  ALA A O     1 
ATOM   4599  C CB    . ALA A 1 600 ? -21.674 31.797  26.853  1.00 8.77   ? 908  ALA A CB    1 
ATOM   4600  N N     . ASP A 1 601 ? -23.424 32.386  29.357  1.00 3.75   ? 909  ASP A N     1 
ATOM   4601  C CA    . ASP A 1 601 ? -24.762 32.229  29.918  1.00 12.28  ? 909  ASP A CA    1 
ATOM   4602  C C     . ASP A 1 601 ? -25.801 32.101  28.811  1.00 11.08  ? 909  ASP A C     1 
ATOM   4603  O O     . ASP A 1 601 ? -26.704 31.260  28.879  1.00 8.23   ? 909  ASP A O     1 
ATOM   4604  C CB    . ASP A 1 601 ? -25.118 33.394  30.865  1.00 10.97  ? 909  ASP A CB    1 
ATOM   4605  C CG    . ASP A 1 601 ? -24.285 33.369  32.139  1.00 15.29  ? 909  ASP A CG    1 
ATOM   4606  O OD1   . ASP A 1 601 ? -23.362 34.210  32.289  1.00 15.52  ? 909  ASP A OD1   1 
ATOM   4607  O OD2   . ASP A 1 601 ? -24.520 32.454  32.958  1.00 11.90  ? 909  ASP A OD2   1 
ATOM   4608  N N     . VAL A 1 602 ? -25.660 32.942  27.795  1.00 10.65  ? 910  VAL A N     1 
ATOM   4609  C CA    . VAL A 1 602 ? -26.653 33.080  26.725  1.00 11.02  ? 910  VAL A CA    1 
ATOM   4610  C C     . VAL A 1 602 ? -25.937 33.470  25.432  1.00 13.53  ? 910  VAL A C     1 
ATOM   4611  O O     . VAL A 1 602 ? -25.012 34.262  25.473  1.00 12.28  ? 910  VAL A O     1 
ATOM   4612  C CB    . VAL A 1 602 ? -27.645 34.223  27.049  1.00 15.66  ? 910  VAL A CB    1 
ATOM   4613  C CG1   . VAL A 1 602 ? -28.668 34.391  25.948  1.00 8.26   ? 910  VAL A CG1   1 
ATOM   4614  C CG2   . VAL A 1 602 ? -28.333 33.997  28.413  1.00 13.38  ? 910  VAL A CG2   1 
ATOM   4615  N N     . CYS A 1 603 ? -26.361 32.915  24.295  1.00 8.76   ? 911  CYS A N     1 
ATOM   4616  C CA    . CYS A 1 603 ? -25.851 33.327  22.974  1.00 4.78   ? 911  CYS A CA    1 
ATOM   4617  C C     . CYS A 1 603 ? -26.816 34.312  22.326  1.00 11.74  ? 911  CYS A C     1 
ATOM   4618  O O     . CYS A 1 603 ? -28.002 34.031  22.241  1.00 11.25  ? 911  CYS A O     1 
ATOM   4619  C CB    . CYS A 1 603 ? -25.707 32.121  22.038  1.00 13.40  ? 911  CYS A CB    1 
ATOM   4620  S SG    . CYS A 1 603 ? -25.231 32.604  20.336  1.00 17.82  ? 911  CYS A SG    1 
ATOM   4621  N N     . LEU A 1 604 ? -26.322 35.465  21.881  1.00 7.24   ? 912  LEU A N     1 
ATOM   4622  C CA    . LEU A 1 604 ? -27.165 36.395  21.148  1.00 6.25   ? 912  LEU A CA    1 
ATOM   4623  C C     . LEU A 1 604 ? -26.956 36.215  19.632  1.00 16.20  ? 912  LEU A C     1 
ATOM   4624  O O     . LEU A 1 604 ? -25.940 36.640  19.071  1.00 11.02  ? 912  LEU A O     1 
ATOM   4625  C CB    . LEU A 1 604 ? -26.876 37.841  21.559  1.00 6.60   ? 912  LEU A CB    1 
ATOM   4626  C CG    . LEU A 1 604 ? -27.086 38.211  23.028  1.00 12.63  ? 912  LEU A CG    1 
ATOM   4627  C CD1   . LEU A 1 604 ? -26.714 39.686  23.248  1.00 12.85  ? 912  LEU A CD1   1 
ATOM   4628  C CD2   . LEU A 1 604 ? -28.520 37.904  23.479  1.00 11.83  ? 912  LEU A CD2   1 
ATOM   4629  N N     . ASP A 1 605 ? -27.922 35.587  18.974  1.00 6.51   ? 913  ASP A N     1 
ATOM   4630  C CA    . ASP A 1 605 ? -27.773 35.261  17.552  1.00 13.65  ? 913  ASP A CA    1 
ATOM   4631  C C     . ASP A 1 605 ? -27.919 36.506  16.676  1.00 12.99  ? 913  ASP A C     1 
ATOM   4632  O O     . ASP A 1 605 ? -28.678 37.432  16.995  1.00 12.83  ? 913  ASP A O     1 
ATOM   4633  C CB    . ASP A 1 605 ? -28.774 34.160  17.141  1.00 13.96  ? 913  ASP A CB    1 
ATOM   4634  C CG    . ASP A 1 605 ? -28.658 33.770  15.682  1.00 12.85  ? 913  ASP A CG    1 
ATOM   4635  O OD1   . ASP A 1 605 ? -27.536 33.426  15.245  1.00 10.87  ? 913  ASP A OD1   1 
ATOM   4636  O OD2   . ASP A 1 605 ? -29.688 33.815  14.965  1.00 18.68  ? 913  ASP A OD2   1 
ATOM   4637  N N     . THR A 1 606 ? -27.174 36.524  15.573  1.00 9.76   ? 914  THR A N     1 
ATOM   4638  C CA    . THR A 1 606 ? -27.209 37.609  14.595  1.00 7.86   ? 914  THR A CA    1 
ATOM   4639  C C     . THR A 1 606 ? -28.428 37.501  13.668  1.00 11.35  ? 914  THR A C     1 
ATOM   4640  O O     . THR A 1 606 ? -28.582 36.518  12.968  1.00 12.03  ? 914  THR A O     1 
ATOM   4641  C CB    . THR A 1 606 ? -25.939 37.572  13.718  1.00 9.22   ? 914  THR A CB    1 
ATOM   4642  O OG1   . THR A 1 606 ? -25.596 36.204  13.443  1.00 10.17  ? 914  THR A OG1   1 
ATOM   4643  C CG2   . THR A 1 606 ? -24.787 38.228  14.436  1.00 9.66   ? 914  THR A CG2   1 
ATOM   4644  N N     . PRO A 1 607 ? -29.311 38.519  13.670  1.00 9.45   ? 915  PRO A N     1 
ATOM   4645  C CA    . PRO A 1 607 ? -30.536 38.446  12.857  1.00 10.88  ? 915  PRO A CA    1 
ATOM   4646  C C     . PRO A 1 607 ? -30.287 38.549  11.349  1.00 17.84  ? 915  PRO A C     1 
ATOM   4647  O O     . PRO A 1 607 ? -31.040 37.952  10.564  1.00 12.51  ? 915  PRO A O     1 
ATOM   4648  C CB    . PRO A 1 607 ? -31.352 39.664  13.340  1.00 12.12  ? 915  PRO A CB    1 
ATOM   4649  C CG    . PRO A 1 607 ? -30.837 39.941  14.712  1.00 14.82  ? 915  PRO A CG    1 
ATOM   4650  C CD    . PRO A 1 607 ? -29.353 39.654  14.610  1.00 10.16  ? 915  PRO A CD    1 
ATOM   4651  N N     . LEU A 1 608 ? -29.257 39.288  10.944  1.00 12.38  ? 916  LEU A N     1 
ATOM   4652  C CA    . LEU A 1 608 ? -28.995 39.477  9.515   1.00 16.96  ? 916  LEU A CA    1 
ATOM   4653  C C     . LEU A 1 608 ? -28.744 38.132  8.821   1.00 9.00   ? 916  LEU A C     1 
ATOM   4654  O O     . LEU A 1 608 ? -29.328 37.824  7.794   1.00 15.09  ? 916  LEU A O     1 
ATOM   4655  C CB    . LEU A 1 608 ? -27.794 40.405  9.312   1.00 7.38   ? 916  LEU A CB    1 
ATOM   4656  C CG    . LEU A 1 608 ? -27.458 40.736  7.862   1.00 12.09  ? 916  LEU A CG    1 
ATOM   4657  C CD1   . LEU A 1 608 ? -28.618 41.488  7.204   1.00 17.83  ? 916  LEU A CD1   1 
ATOM   4658  C CD2   . LEU A 1 608 ? -26.158 41.551  7.810   1.00 12.99  ? 916  LEU A CD2   1 
ATOM   4659  N N     . CYS A 1 609 ? -27.841 37.361  9.396   1.00 8.42   ? 917  CYS A N     1 
ATOM   4660  C CA    . CYS A 1 609 ? -27.518 36.020  8.945   1.00 14.01  ? 917  CYS A CA    1 
ATOM   4661  C C     . CYS A 1 609 ? -27.194 35.258  10.234  1.00 10.13  ? 917  CYS A C     1 
ATOM   4662  O O     . CYS A 1 609 ? -26.272 35.626  10.971  1.00 10.48  ? 917  CYS A O     1 
ATOM   4663  C CB    . CYS A 1 609 ? -26.322 36.053  7.990   1.00 11.42  ? 917  CYS A CB    1 
ATOM   4664  S SG    . CYS A 1 609 ? -25.783 34.419  7.419   1.00 18.04  ? 917  CYS A SG    1 
ATOM   4665  N N     . ASN A 1 610 ? -27.991 34.242  10.546  1.00 10.64  ? 918  ASN A N     1 
ATOM   4666  C CA    . ASN A 1 610 ? -27.843 33.532  11.811  1.00 8.42   ? 918  ASN A CA    1 
ATOM   4667  C C     . ASN A 1 610 ? -26.559 32.720  11.876  1.00 7.05   ? 918  ASN A C     1 
ATOM   4668  O O     . ASN A 1 610 ? -25.926 32.464  10.859  1.00 11.68  ? 918  ASN A O     1 
ATOM   4669  C CB    . ASN A 1 610 ? -28.983 32.518  12.013  1.00 2.91   ? 918  ASN A CB    1 
ATOM   4670  C CG    . ASN A 1 610 ? -30.386 33.127  11.930  1.00 8.16   ? 918  ASN A CG    1 
ATOM   4671  O OD1   . ASN A 1 610 ? -31.347 32.391  11.708  1.00 12.50  ? 918  ASN A OD1   1 
ATOM   4672  N ND2   . ASN A 1 610 ? -30.514 34.447  12.103  1.00 5.39   ? 918  ASN A ND2   1 
ATOM   4673  N N     . GLY A 1 611 ? -26.227 32.251  13.077  1.00 13.76  ? 919  GLY A N     1 
ATOM   4674  C CA    . GLY A 1 611 ? -25.333 31.110  13.224  1.00 11.57  ? 919  GLY A CA    1 
ATOM   4675  C C     . GLY A 1 611 ? -26.008 29.902  12.605  1.00 11.09  ? 919  GLY A C     1 
ATOM   4676  O O     . GLY A 1 611 ? -27.194 29.693  12.812  1.00 9.10   ? 919  GLY A O     1 
ATOM   4677  N N     . HIS A 1 612 ? -25.282 29.114  11.821  1.00 7.10   ? 920  HIS A N     1 
ATOM   4678  C CA    . HIS A 1 612 ? -25.871 27.909  11.248  1.00 10.60  ? 920  HIS A CA    1 
ATOM   4679  C C     . HIS A 1 612 ? -25.108 26.757  11.895  1.00 7.65   ? 920  HIS A C     1 
ATOM   4680  O O     . HIS A 1 612 ? -25.532 26.233  12.940  1.00 4.75   ? 920  HIS A O     1 
ATOM   4681  C CB    . HIS A 1 612 ? -25.802 27.902  9.709   1.00 10.16  ? 920  HIS A CB    1 
ATOM   4682  C CG    . HIS A 1 612 ? -26.570 29.021  9.061   1.00 12.35  ? 920  HIS A CG    1 
ATOM   4683  N ND1   . HIS A 1 612 ? -26.442 29.341  7.726   1.00 14.18  ? 920  HIS A ND1   1 
ATOM   4684  C CD2   . HIS A 1 612 ? -27.468 29.900  9.571   1.00 5.98   ? 920  HIS A CD2   1 
ATOM   4685  C CE1   . HIS A 1 612 ? -27.221 30.370  7.442   1.00 21.58  ? 920  HIS A CE1   1 
ATOM   4686  N NE2   . HIS A 1 612 ? -27.854 30.730  8.545   1.00 13.29  ? 920  HIS A NE2   1 
ATOM   4687  N N     . THR A 1 613 ? -23.948 26.423  11.339  1.00 7.03   ? 921  THR A N     1 
ATOM   4688  C CA    . THR A 1 613 ? -23.044 25.519  12.044  1.00 3.77   ? 921  THR A CA    1 
ATOM   4689  C C     . THR A 1 613 ? -22.831 26.053  13.468  1.00 10.65  ? 921  THR A C     1 
ATOM   4690  O O     . THR A 1 613 ? -22.815 25.302  14.445  1.00 11.31  ? 921  THR A O     1 
ATOM   4691  C CB    . THR A 1 613 ? -21.673 25.440  11.342  1.00 11.83  ? 921  THR A CB    1 
ATOM   4692  O OG1   . THR A 1 613 ? -21.855 25.044  9.973   1.00 11.12  ? 921  THR A OG1   1 
ATOM   4693  C CG2   . THR A 1 613 ? -20.749 24.441  12.052  1.00 6.95   ? 921  THR A CG2   1 
ATOM   4694  N N     . THR A 1 614 ? -22.632 27.363  13.556  1.00 7.46   ? 922  THR A N     1 
ATOM   4695  C CA    . THR A 1 614 ? -22.287 28.053  14.799  1.00 8.45   ? 922  THR A CA    1 
ATOM   4696  C C     . THR A 1 614 ? -23.397 27.986  15.842  1.00 3.60   ? 922  THR A C     1 
ATOM   4697  O O     . THR A 1 614 ? -23.133 27.928  17.048  1.00 4.79   ? 922  THR A O     1 
ATOM   4698  C CB    . THR A 1 614 ? -21.932 29.543  14.512  1.00 10.01  ? 922  THR A CB    1 
ATOM   4699  O OG1   . THR A 1 614 ? -20.990 29.601  13.432  1.00 10.62  ? 922  THR A OG1   1 
ATOM   4700  C CG2   . THR A 1 614 ? -21.313 30.194  15.739  1.00 6.05   ? 922  THR A CG2   1 
ATOM   4701  N N     . GLY A 1 615 ? -24.631 28.006  15.369  1.00 6.53   ? 923  GLY A N     1 
ATOM   4702  C CA    . GLY A 1 615 ? -25.784 27.783  16.219  1.00 13.11  ? 923  GLY A CA    1 
ATOM   4703  C C     . GLY A 1 615 ? -25.799 26.373  16.775  1.00 9.48   ? 923  GLY A C     1 
ATOM   4704  O O     . GLY A 1 615 ? -26.014 26.180  17.963  1.00 5.44   ? 923  GLY A O     1 
ATOM   4705  N N     . MET A 1 616 ? -25.570 25.378  15.923  1.00 9.43   ? 924  MET A N     1 
ATOM   4706  C CA    . MET A 1 616 ? -25.474 24.002  16.421  1.00 10.45  ? 924  MET A CA    1 
ATOM   4707  C C     . MET A 1 616 ? -24.350 23.886  17.455  1.00 8.48   ? 924  MET A C     1 
ATOM   4708  O O     . MET A 1 616 ? -24.495 23.195  18.467  1.00 8.51   ? 924  MET A O     1 
ATOM   4709  C CB    . MET A 1 616 ? -25.253 22.997  15.283  1.00 2.62   ? 924  MET A CB    1 
ATOM   4710  C CG    . MET A 1 616 ? -26.337 23.010  14.176  1.00 9.43   ? 924  MET A CG    1 
ATOM   4711  S SD    . MET A 1 616 ? -27.991 22.485  14.689  1.00 10.62  ? 924  MET A SD    1 
ATOM   4712  C CE    . MET A 1 616 ? -27.791 20.692  14.719  1.00 3.45   ? 924  MET A CE    1 
ATOM   4713  N N     . ASP A 1 617 ? -23.229 24.564  17.200  1.00 7.19   ? 925  ASP A N     1 
ATOM   4714  C CA    . ASP A 1 617 ? -22.094 24.487  18.111  1.00 7.87   ? 925  ASP A CA    1 
ATOM   4715  C C     . ASP A 1 617 ? -22.473 24.962  19.514  1.00 3.15   ? 925  ASP A C     1 
ATOM   4716  O O     . ASP A 1 617 ? -22.105 24.346  20.531  1.00 8.64   ? 925  ASP A O     1 
ATOM   4717  C CB    . ASP A 1 617 ? -20.942 25.350  17.605  1.00 6.55   ? 925  ASP A CB    1 
ATOM   4718  C CG    . ASP A 1 617 ? -20.303 24.812  16.306  1.00 6.37   ? 925  ASP A CG    1 
ATOM   4719  O OD1   . ASP A 1 617 ? -20.432 23.607  15.958  1.00 5.40   ? 925  ASP A OD1   1 
ATOM   4720  O OD2   . ASP A 1 617 ? -19.644 25.630  15.645  1.00 8.73   ? 925  ASP A OD2   1 
ATOM   4721  N N     . VAL A 1 618 ? -23.166 26.093  19.562  1.00 6.58   ? 926  VAL A N     1 
ATOM   4722  C CA    . VAL A 1 618 ? -23.457 26.750  20.829  1.00 11.09  ? 926  VAL A CA    1 
ATOM   4723  C C     . VAL A 1 618 ? -24.513 25.947  21.604  1.00 8.08   ? 926  VAL A C     1 
ATOM   4724  O O     . VAL A 1 618 ? -24.426 25.796  22.833  1.00 7.48   ? 926  VAL A O     1 
ATOM   4725  C CB    . VAL A 1 618 ? -23.860 28.239  20.605  1.00 16.25  ? 926  VAL A CB    1 
ATOM   4726  C CG1   . VAL A 1 618 ? -25.375 28.400  20.494  1.00 9.43   ? 926  VAL A CG1   1 
ATOM   4727  C CG2   . VAL A 1 618 ? -23.297 29.136  21.712  1.00 20.45  ? 926  VAL A CG2   1 
ATOM   4728  N N     . LEU A 1 619 ? -25.486 25.399  20.883  1.00 8.44   ? 927  LEU A N     1 
ATOM   4729  C CA    . LEU A 1 619 ? -26.528 24.584  21.515  1.00 9.12   ? 927  LEU A CA    1 
ATOM   4730  C C     . LEU A 1 619 ? -25.980 23.273  22.083  1.00 11.83  ? 927  LEU A C     1 
ATOM   4731  O O     . LEU A 1 619 ? -26.472 22.780  23.105  1.00 8.42   ? 927  LEU A O     1 
ATOM   4732  C CB    . LEU A 1 619 ? -27.677 24.310  20.541  1.00 12.13  ? 927  LEU A CB    1 
ATOM   4733  C CG    . LEU A 1 619 ? -28.510 25.538  20.147  1.00 16.20  ? 927  LEU A CG    1 
ATOM   4734  C CD1   . LEU A 1 619 ? -29.483 25.188  19.041  1.00 11.05  ? 927  LEU A CD1   1 
ATOM   4735  C CD2   . LEU A 1 619 ? -29.244 26.131  21.371  1.00 9.78   ? 927  LEU A CD2   1 
ATOM   4736  N N     . TRP A 1 620 ? -24.972 22.702  21.425  1.00 3.02   ? 928  TRP A N     1 
ATOM   4737  C CA    . TRP A 1 620 ? -24.386 21.458  21.931  1.00 4.05   ? 928  TRP A CA    1 
ATOM   4738  C C     . TRP A 1 620 ? -23.765 21.681  23.314  1.00 10.89  ? 928  TRP A C     1 
ATOM   4739  O O     . TRP A 1 620 ? -23.651 20.745  24.113  1.00 12.10  ? 928  TRP A O     1 
ATOM   4740  C CB    . TRP A 1 620 ? -23.353 20.868  20.965  1.00 9.85   ? 928  TRP A CB    1 
ATOM   4741  C CG    . TRP A 1 620 ? -22.901 19.500  21.383  1.00 9.38   ? 928  TRP A CG    1 
ATOM   4742  C CD1   . TRP A 1 620 ? -21.635 19.128  21.744  1.00 8.39   ? 928  TRP A CD1   1 
ATOM   4743  C CD2   . TRP A 1 620 ? -23.714 18.320  21.499  1.00 7.72   ? 928  TRP A CD2   1 
ATOM   4744  N NE1   . TRP A 1 620 ? -21.609 17.802  22.064  1.00 9.67   ? 928  TRP A NE1   1 
ATOM   4745  C CE2   . TRP A 1 620 ? -22.867 17.276  21.929  1.00 11.64  ? 928  TRP A CE2   1 
ATOM   4746  C CE3   . TRP A 1 620 ? -25.071 18.040  21.260  1.00 11.49  ? 928  TRP A CE3   1 
ATOM   4747  C CZ2   . TRP A 1 620 ? -23.325 15.969  22.143  1.00 12.52  ? 928  TRP A CZ2   1 
ATOM   4748  C CZ3   . TRP A 1 620 ? -25.536 16.721  21.473  1.00 4.97   ? 928  TRP A CZ3   1 
ATOM   4749  C CH2   . TRP A 1 620 ? -24.651 15.711  21.922  1.00 5.07   ? 928  TRP A CH2   1 
ATOM   4750  N N     . ALA A 1 621 ? -23.379 22.925  23.592  1.00 12.31  ? 929  ALA A N     1 
ATOM   4751  C CA    . ALA A 1 621 ? -22.774 23.286  24.882  1.00 2.58   ? 929  ALA A CA    1 
ATOM   4752  C C     . ALA A 1 621 ? -23.855 23.485  25.937  1.00 9.53   ? 929  ALA A C     1 
ATOM   4753  O O     . ALA A 1 621 ? -23.567 23.606  27.123  1.00 8.28   ? 929  ALA A O     1 
ATOM   4754  C CB    . ALA A 1 621 ? -21.944 24.539  24.737  1.00 8.80   ? 929  ALA A CB    1 
ATOM   4755  N N     . GLY A 1 622 ? -25.107 23.512  25.494  1.00 8.51   ? 930  GLY A N     1 
ATOM   4756  C CA    . GLY A 1 622 ? -26.229 23.720  26.399  1.00 11.59  ? 930  GLY A CA    1 
ATOM   4757  C C     . GLY A 1 622 ? -26.542 25.194  26.606  1.00 15.95  ? 930  GLY A C     1 
ATOM   4758  O O     . GLY A 1 622 ? -27.210 25.570  27.571  1.00 10.77  ? 930  GLY A O     1 
ATOM   4759  N N     . THR A 1 623 ? -26.080 26.031  25.684  1.00 8.07   ? 931  THR A N     1 
ATOM   4760  C CA    . THR A 1 623 ? -26.226 27.475  25.831  1.00 5.23   ? 931  THR A CA    1 
ATOM   4761  C C     . THR A 1 623 ? -27.442 27.954  25.046  1.00 11.46  ? 931  THR A C     1 
ATOM   4762  O O     . THR A 1 623 ? -27.474 27.834  23.822  1.00 8.50   ? 931  THR A O     1 
ATOM   4763  C CB    . THR A 1 623 ? -24.959 28.174  25.293  1.00 3.23   ? 931  THR A CB    1 
ATOM   4764  O OG1   . THR A 1 623 ? -23.821 27.718  26.037  1.00 17.22  ? 931  THR A OG1   1 
ATOM   4765  C CG2   . THR A 1 623 ? -25.062 29.688  25.416  1.00 16.31  ? 931  THR A CG2   1 
ATOM   4766  N N     . PRO A 1 624 ? -28.445 28.510  25.754  1.00 6.73   ? 932  PRO A N     1 
ATOM   4767  C CA    . PRO A 1 624 ? -29.608 29.127  25.124  1.00 12.69  ? 932  PRO A CA    1 
ATOM   4768  C C     . PRO A 1 624 ? -29.163 30.179  24.118  1.00 16.28  ? 932  PRO A C     1 
ATOM   4769  O O     . PRO A 1 624 ? -28.271 30.983  24.395  1.00 10.72  ? 932  PRO A O     1 
ATOM   4770  C CB    . PRO A 1 624 ? -30.330 29.809  26.297  1.00 13.59  ? 932  PRO A CB    1 
ATOM   4771  C CG    . PRO A 1 624 ? -29.896 29.045  27.514  1.00 18.25  ? 932  PRO A CG    1 
ATOM   4772  C CD    . PRO A 1 624 ? -28.468 28.652  27.221  1.00 11.15  ? 932  PRO A CD    1 
ATOM   4773  N N     . MET A 1 625 ? -29.796 30.170  22.957  1.00 13.18  ? 933  MET A N     1 
ATOM   4774  C CA    . MET A 1 625 ? -29.522 31.157  21.931  1.00 11.03  ? 933  MET A CA    1 
ATOM   4775  C C     . MET A 1 625 ? -30.785 31.966  21.703  1.00 10.23  ? 933  MET A C     1 
ATOM   4776  O O     . MET A 1 625 ? -31.849 31.394  21.506  1.00 9.04   ? 933  MET A O     1 
ATOM   4777  C CB    . MET A 1 625 ? -29.132 30.435  20.644  1.00 13.42  ? 933  MET A CB    1 
ATOM   4778  C CG    . MET A 1 625 ? -28.985 31.311  19.423  1.00 18.82  ? 933  MET A CG    1 
ATOM   4779  S SD    . MET A 1 625 ? -28.095 30.388  18.129  1.00 16.72  ? 933  MET A SD    1 
ATOM   4780  C CE    . MET A 1 625 ? -29.115 28.925  18.008  1.00 21.75  ? 933  MET A CE    1 
ATOM   4781  N N     . VAL A 1 626 ? -30.677 33.287  21.762  1.00 11.71  ? 934  VAL A N     1 
ATOM   4782  C CA    . VAL A 1 626 ? -31.815 34.160  21.452  1.00 11.67  ? 934  VAL A CA    1 
ATOM   4783  C C     . VAL A 1 626 ? -31.775 34.534  19.972  1.00 10.48  ? 934  VAL A C     1 
ATOM   4784  O O     . VAL A 1 626 ? -30.737 34.923  19.467  1.00 11.45  ? 934  VAL A O     1 
ATOM   4785  C CB    . VAL A 1 626 ? -31.811 35.434  22.328  1.00 11.88  ? 934  VAL A CB    1 
ATOM   4786  C CG1   . VAL A 1 626 ? -33.019 36.358  21.969  1.00 11.49  ? 934  VAL A CG1   1 
ATOM   4787  C CG2   . VAL A 1 626 ? -31.874 35.047  23.782  1.00 4.43   ? 934  VAL A CG2   1 
ATOM   4788  N N     . THR A 1 627 ? -32.901 34.410  19.269  1.00 14.94  ? 935  THR A N     1 
ATOM   4789  C CA    . THR A 1 627 ? -32.902 34.721  17.848  1.00 16.77  ? 935  THR A CA    1 
ATOM   4790  C C     . THR A 1 627 ? -34.131 35.526  17.422  1.00 15.09  ? 935  THR A C     1 
ATOM   4791  O O     . THR A 1 627 ? -35.172 35.485  18.072  1.00 13.16  ? 935  THR A O     1 
ATOM   4792  C CB    . THR A 1 627 ? -32.787 33.433  16.984  1.00 14.10  ? 935  THR A CB    1 
ATOM   4793  O OG1   . THR A 1 627 ? -32.616 33.794  15.610  1.00 11.13  ? 935  THR A OG1   1 
ATOM   4794  C CG2   . THR A 1 627 ? -34.034 32.588  17.133  1.00 4.31   ? 935  THR A CG2   1 
ATOM   4795  N N     . MET A 1 628 ? -33.979 36.279  16.342  1.00 12.24  ? 936  MET A N     1 
ATOM   4796  C CA    . MET A 1 628 ? -35.078 37.004  15.719  1.00 12.45  ? 936  MET A CA    1 
ATOM   4797  C C     . MET A 1 628 ? -35.123 36.618  14.246  1.00 15.70  ? 936  MET A C     1 
ATOM   4798  O O     . MET A 1 628 ? -34.390 37.192  13.436  1.00 16.40  ? 936  MET A O     1 
ATOM   4799  C CB    . MET A 1 628 ? -34.842 38.509  15.832  1.00 13.51  ? 936  MET A CB    1 
ATOM   4800  C CG    . MET A 1 628 ? -36.060 39.363  15.440  1.00 25.98  ? 936  MET A CG    1 
ATOM   4801  S SD    . MET A 1 628 ? -35.782 41.137  15.611  1.00 18.18  ? 936  MET A SD    1 
ATOM   4802  C CE    . MET A 1 628 ? -34.592 41.433  14.296  1.00 23.87  ? 936  MET A CE    1 
ATOM   4803  N N     . PRO A 1 629 ? -35.949 35.620  13.894  1.00 13.30  ? 937  PRO A N     1 
ATOM   4804  C CA    . PRO A 1 629 ? -35.965 35.169  12.494  1.00 10.41  ? 937  PRO A CA    1 
ATOM   4805  C C     . PRO A 1 629 ? -36.443 36.255  11.527  1.00 19.44  ? 937  PRO A C     1 
ATOM   4806  O O     . PRO A 1 629 ? -37.370 37.005  11.831  1.00 13.44  ? 937  PRO A O     1 
ATOM   4807  C CB    . PRO A 1 629 ? -36.946 33.991  12.503  1.00 12.50  ? 937  PRO A CB    1 
ATOM   4808  C CG    . PRO A 1 629 ? -37.793 34.200  13.756  1.00 15.65  ? 937  PRO A CG    1 
ATOM   4809  C CD    . PRO A 1 629 ? -36.843 34.822  14.752  1.00 12.99  ? 937  PRO A CD    1 
ATOM   4810  N N     . GLY A 1 630 ? -35.807 36.329  10.366  1.00 14.31  ? 938  GLY A N     1 
ATOM   4811  C CA    . GLY A 1 630 ? -36.160 37.332  9.375   1.00 13.98  ? 938  GLY A CA    1 
ATOM   4812  C C     . GLY A 1 630 ? -36.979 36.701  8.274   1.00 18.38  ? 938  GLY A C     1 
ATOM   4813  O O     . GLY A 1 630 ? -37.824 35.848  8.538   1.00 19.32  ? 938  GLY A O     1 
ATOM   4814  N N     . GLU A 1 631 ? -36.734 37.113  7.037   1.00 11.78  ? 939  GLU A N     1 
ATOM   4815  C CA    . GLU A 1 631 ? -37.436 36.521  5.900   1.00 21.70  ? 939  GLU A CA    1 
ATOM   4816  C C     . GLU A 1 631 ? -36.575 35.594  5.033   1.00 25.00  ? 939  GLU A C     1 
ATOM   4817  O O     . GLU A 1 631 ? -37.085 34.610  4.493   1.00 24.44  ? 939  GLU A O     1 
ATOM   4818  C CB    . GLU A 1 631 ? -38.073 37.611  5.048   1.00 21.56  ? 939  GLU A CB    1 
ATOM   4819  C CG    . GLU A 1 631 ? -39.136 38.407  5.806   1.00 31.26  ? 939  GLU A CG    1 
ATOM   4820  C CD    . GLU A 1 631 ? -39.848 39.422  4.933   1.00 44.89  ? 939  GLU A CD    1 
ATOM   4821  O OE1   . GLU A 1 631 ? -39.437 39.599  3.767   1.00 36.39  ? 939  GLU A OE1   1 
ATOM   4822  O OE2   . GLU A 1 631 ? -40.826 40.037  5.415   1.00 47.47  ? 939  GLU A OE2   1 
ATOM   4823  N N     . THR A 1 632 ? -35.280 35.887  4.904   1.00 19.30  ? 940  THR A N     1 
ATOM   4824  C CA    . THR A 1 632 ? -34.418 35.027  4.087   1.00 16.48  ? 940  THR A CA    1 
ATOM   4825  C C     . THR A 1 632 ? -34.168 33.703  4.797   1.00 21.20  ? 940  THR A C     1 
ATOM   4826  O O     . THR A 1 632 ? -34.237 33.624  6.030   1.00 10.36  ? 940  THR A O     1 
ATOM   4827  C CB    . THR A 1 632 ? -33.041 35.654  3.801   1.00 10.48  ? 940  THR A CB    1 
ATOM   4828  O OG1   . THR A 1 632 ? -32.361 35.868  5.044   1.00 18.42  ? 940  THR A OG1   1 
ATOM   4829  C CG2   . THR A 1 632 ? -33.179 36.986  3.068   1.00 21.70  ? 940  THR A CG2   1 
ATOM   4830  N N     . LEU A 1 633 ? -33.864 32.668  4.016   1.00 12.36  ? 941  LEU A N     1 
ATOM   4831  C CA    . LEU A 1 633 ? -33.466 31.387  4.583   1.00 11.90  ? 941  LEU A CA    1 
ATOM   4832  C C     . LEU A 1 633 ? -32.362 31.564  5.632   1.00 15.56  ? 941  LEU A C     1 
ATOM   4833  O O     . LEU A 1 633 ? -32.463 31.020  6.731   1.00 9.86   ? 941  LEU A O     1 
ATOM   4834  C CB    . LEU A 1 633 ? -33.001 30.446  3.469   1.00 19.15  ? 941  LEU A CB    1 
ATOM   4835  C CG    . LEU A 1 633 ? -32.854 28.955  3.813   1.00 16.37  ? 941  LEU A CG    1 
ATOM   4836  C CD1   . LEU A 1 633 ? -32.787 28.110  2.530   1.00 19.43  ? 941  LEU A CD1   1 
ATOM   4837  C CD2   . LEU A 1 633 ? -31.630 28.714  4.666   1.00 22.23  ? 941  LEU A CD2   1 
ATOM   4838  N N     . ALA A 1 634 ? -31.312 32.327  5.307   1.00 9.80   ? 942  ALA A N     1 
ATOM   4839  C CA    . ALA A 1 634 ? -30.160 32.442  6.220   1.00 15.95  ? 942  ALA A CA    1 
ATOM   4840  C C     . ALA A 1 634 ? -30.499 33.120  7.564   1.00 10.82  ? 942  ALA A C     1 
ATOM   4841  O O     . ALA A 1 634 ? -29.813 32.908  8.575   1.00 9.11   ? 942  ALA A O     1 
ATOM   4842  C CB    . ALA A 1 634 ? -29.006 33.162  5.532   1.00 13.13  ? 942  ALA A CB    1 
ATOM   4843  N N     . SER A 1 635 ? -31.565 33.911  7.572   1.00 12.59  ? 943  SER A N     1 
ATOM   4844  C CA    . SER A 1 635 ? -31.969 34.649  8.766   1.00 8.79   ? 943  SER A CA    1 
ATOM   4845  C C     . SER A 1 635 ? -32.961 33.881  9.631   1.00 9.21   ? 943  SER A C     1 
ATOM   4846  O O     . SER A 1 635 ? -33.382 34.379  10.681  1.00 12.05  ? 943  SER A O     1 
ATOM   4847  C CB    . SER A 1 635 ? -32.579 36.006  8.378   1.00 10.66  ? 943  SER A CB    1 
ATOM   4848  O OG    . SER A 1 635 ? -33.884 35.858  7.829   1.00 10.77  ? 943  SER A OG    1 
ATOM   4849  N N     . ARG A 1 636 ? -33.341 32.679  9.193   1.00 7.41   ? 944  ARG A N     1 
ATOM   4850  C CA    . ARG A 1 636 ? -34.371 31.892  9.892   1.00 11.76  ? 944  ARG A CA    1 
ATOM   4851  C C     . ARG A 1 636 ? -33.889 30.528  10.404  1.00 11.57  ? 944  ARG A C     1 
ATOM   4852  O O     . ARG A 1 636 ? -34.655 29.795  11.044  1.00 12.82  ? 944  ARG A O     1 
ATOM   4853  C CB    . ARG A 1 636 ? -35.576 31.667  8.975   1.00 11.36  ? 944  ARG A CB    1 
ATOM   4854  C CG    . ARG A 1 636 ? -36.366 32.945  8.616   1.00 15.28  ? 944  ARG A CG    1 
ATOM   4855  C CD    . ARG A 1 636 ? -37.564 32.621  7.717   1.00 10.95  ? 944  ARG A CD    1 
ATOM   4856  N NE    . ARG A 1 636 ? -38.585 31.835  8.408   1.00 10.91  ? 944  ARG A NE    1 
ATOM   4857  C CZ    . ARG A 1 636 ? -39.478 32.344  9.257   1.00 19.95  ? 944  ARG A CZ    1 
ATOM   4858  N NH1   . ARG A 1 636 ? -39.480 33.648  9.536   1.00 17.43  ? 944  ARG A NH1   1 
ATOM   4859  N NH2   . ARG A 1 636 ? -40.368 31.547  9.841   1.00 19.90  ? 944  ARG A NH2   1 
ATOM   4860  N N     . VAL A 1 637 ? -32.639 30.184  10.124  1.00 7.52   ? 945  VAL A N     1 
ATOM   4861  C CA    . VAL A 1 637 ? -32.111 28.866  10.483  1.00 9.49   ? 945  VAL A CA    1 
ATOM   4862  C C     . VAL A 1 637 ? -32.070 28.625  11.998  1.00 12.85  ? 945  VAL A C     1 
ATOM   4863  O O     . VAL A 1 637 ? -32.461 27.552  12.479  1.00 7.87   ? 945  VAL A O     1 
ATOM   4864  C CB    . VAL A 1 637 ? -30.716 28.608  9.850   1.00 11.06  ? 945  VAL A CB    1 
ATOM   4865  C CG1   . VAL A 1 637 ? -30.051 27.377  10.488  1.00 12.41  ? 945  VAL A CG1   1 
ATOM   4866  C CG2   . VAL A 1 637 ? -30.851 28.415  8.320   1.00 8.77   ? 945  VAL A CG2   1 
ATOM   4867  N N     . ALA A 1 638 ? -31.606 29.618  12.753  1.00 6.53   ? 946  ALA A N     1 
ATOM   4868  C CA    . ALA A 1 638 ? -31.523 29.478  14.202  1.00 15.79  ? 946  ALA A CA    1 
ATOM   4869  C C     . ALA A 1 638 ? -32.911 29.234  14.840  1.00 13.96  ? 946  ALA A C     1 
ATOM   4870  O O     . ALA A 1 638 ? -33.069 28.365  15.692  1.00 9.20   ? 946  ALA A O     1 
ATOM   4871  C CB    . ALA A 1 638 ? -30.825 30.703  14.831  1.00 12.12  ? 946  ALA A CB    1 
ATOM   4872  N N     . ALA A 1 639 ? -33.923 29.975  14.412  1.00 8.83   ? 947  ALA A N     1 
ATOM   4873  C CA    . ALA A 1 639 ? -35.274 29.725  14.929  1.00 13.29  ? 947  ALA A CA    1 
ATOM   4874  C C     . ALA A 1 639 ? -35.743 28.298  14.610  1.00 13.82  ? 947  ALA A C     1 
ATOM   4875  O O     . ALA A 1 639 ? -36.453 27.682  15.401  1.00 14.28  ? 947  ALA A O     1 
ATOM   4876  C CB    . ALA A 1 639 ? -36.257 30.730  14.383  1.00 8.99   ? 947  ALA A CB    1 
ATOM   4877  N N     . SER A 1 640 ? -35.356 27.781  13.448  1.00 12.43  ? 948  SER A N     1 
ATOM   4878  C CA    . SER A 1 640 ? -35.699 26.406  13.072  1.00 7.44   ? 948  SER A CA    1 
ATOM   4879  C C     . SER A 1 640 ? -35.020 25.418  14.022  1.00 12.44  ? 948  SER A C     1 
ATOM   4880  O O     . SER A 1 640 ? -35.634 24.449  14.464  1.00 12.60  ? 948  SER A O     1 
ATOM   4881  C CB    . SER A 1 640 ? -35.298 26.132  11.619  1.00 7.94   ? 948  SER A CB    1 
ATOM   4882  O OG    . SER A 1 640 ? -35.605 24.813  11.224  1.00 12.81  ? 948  SER A OG    1 
ATOM   4883  N N     . GLN A 1 641 ? -33.750 25.673  14.337  1.00 8.45   ? 949  GLN A N     1 
ATOM   4884  C CA    . GLN A 1 641 ? -33.005 24.824  15.257  1.00 5.66   ? 949  GLN A CA    1 
ATOM   4885  C C     . GLN A 1 641 ? -33.674 24.850  16.633  1.00 8.38   ? 949  GLN A C     1 
ATOM   4886  O O     . GLN A 1 641 ? -33.824 23.818  17.288  1.00 7.10   ? 949  GLN A O     1 
ATOM   4887  C CB    . GLN A 1 641 ? -31.554 25.321  15.386  1.00 12.67  ? 949  GLN A CB    1 
ATOM   4888  C CG    . GLN A 1 641 ? -30.675 25.121  14.137  1.00 9.72   ? 949  GLN A CG    1 
ATOM   4889  C CD    . GLN A 1 641 ? -29.328 25.850  14.223  1.00 11.16  ? 949  GLN A CD    1 
ATOM   4890  O OE1   . GLN A 1 641 ? -29.084 26.631  15.142  1.00 11.56  ? 949  GLN A OE1   1 
ATOM   4891  N NE2   . GLN A 1 641 ? -28.467 25.617  13.239  1.00 9.54   ? 949  GLN A NE2   1 
ATOM   4892  N N     . LEU A 1 642 ? -34.074 26.044  17.068  1.00 5.81   ? 950  LEU A N     1 
ATOM   4893  C CA    . LEU A 1 642 ? -34.672 26.232  18.392  1.00 5.43   ? 950  LEU A CA    1 
ATOM   4894  C C     . LEU A 1 642 ? -36.023 25.571  18.482  1.00 10.12  ? 950  LEU A C     1 
ATOM   4895  O O     . LEU A 1 642 ? -36.414 25.043  19.530  1.00 11.58  ? 950  LEU A O     1 
ATOM   4896  C CB    . LEU A 1 642 ? -34.802 27.729  18.708  1.00 9.11   ? 950  LEU A CB    1 
ATOM   4897  C CG    . LEU A 1 642 ? -33.448 28.360  19.032  1.00 11.08  ? 950  LEU A CG    1 
ATOM   4898  C CD1   . LEU A 1 642 ? -33.520 29.876  19.056  1.00 7.52   ? 950  LEU A CD1   1 
ATOM   4899  C CD2   . LEU A 1 642 ? -32.973 27.819  20.359  1.00 17.62  ? 950  LEU A CD2   1 
ATOM   4900  N N     . THR A 1 643 ? -36.748 25.629  17.375  1.00 8.04   ? 951  THR A N     1 
ATOM   4901  C CA    . THR A 1 643 ? -38.079 25.037  17.310  1.00 12.65  ? 951  THR A CA    1 
ATOM   4902  C C     . THR A 1 643 ? -37.966 23.521  17.408  1.00 19.60  ? 951  THR A C     1 
ATOM   4903  O O     . THR A 1 643 ? -38.726 22.873  18.127  1.00 11.68  ? 951  THR A O     1 
ATOM   4904  C CB    . THR A 1 643 ? -38.811 25.478  16.031  1.00 17.19  ? 951  THR A CB    1 
ATOM   4905  O OG1   . THR A 1 643 ? -39.074 26.888  16.114  1.00 11.63  ? 951  THR A OG1   1 
ATOM   4906  C CG2   . THR A 1 643 ? -40.141 24.729  15.863  1.00 19.48  ? 951  THR A CG2   1 
ATOM   4907  N N     . CYS A 1 644 ? -36.986 22.954  16.714  1.00 13.41  ? 952  CYS A N     1 
ATOM   4908  C CA    . CYS A 1 644 ? -36.774 21.515  16.792  1.00 12.09  ? 952  CYS A CA    1 
ATOM   4909  C C     . CYS A 1 644 ? -36.374 21.163  18.210  1.00 13.57  ? 952  CYS A C     1 
ATOM   4910  O O     . CYS A 1 644 ? -36.819 20.167  18.775  1.00 11.62  ? 952  CYS A O     1 
ATOM   4911  C CB    . CYS A 1 644 ? -35.681 21.084  15.819  1.00 11.50  ? 952  CYS A CB    1 
ATOM   4912  S SG    . CYS A 1 644 ? -35.234 19.328  16.001  1.00 13.36  ? 952  CYS A SG    1 
ATOM   4913  N N     . LEU A 1 645 ? -35.528 22.009  18.784  1.00 11.14  ? 953  LEU A N     1 
ATOM   4914  C CA    . LEU A 1 645 ? -35.013 21.790  20.119  1.00 13.80  ? 953  LEU A CA    1 
ATOM   4915  C C     . LEU A 1 645 ? -36.154 21.789  21.113  1.00 22.24  ? 953  LEU A C     1 
ATOM   4916  O O     . LEU A 1 645 ? -36.127 21.060  22.103  1.00 17.76  ? 953  LEU A O     1 
ATOM   4917  C CB    . LEU A 1 645 ? -34.006 22.883  20.493  1.00 12.02  ? 953  LEU A CB    1 
ATOM   4918  C CG    . LEU A 1 645 ? -33.298 22.687  21.835  1.00 16.50  ? 953  LEU A CG    1 
ATOM   4919  C CD1   . LEU A 1 645 ? -32.410 21.427  21.777  1.00 6.12   ? 953  LEU A CD1   1 
ATOM   4920  C CD2   . LEU A 1 645 ? -32.504 23.950  22.205  1.00 12.29  ? 953  LEU A CD2   1 
ATOM   4921  N N     . GLY A 1 646 ? -37.145 22.634  20.849  1.00 24.96  ? 954  GLY A N     1 
ATOM   4922  C CA    . GLY A 1 646 ? -38.318 22.745  21.691  1.00 21.33  ? 954  GLY A CA    1 
ATOM   4923  C C     . GLY A 1 646 ? -38.204 23.927  22.635  1.00 22.42  ? 954  GLY A C     1 
ATOM   4924  O O     . GLY A 1 646 ? -38.620 23.830  23.774  1.00 24.52  ? 954  GLY A O     1 
ATOM   4925  N N     . CYS A 1 647 ? -37.627 25.033  22.157  1.00 14.93  ? 955  CYS A N     1 
ATOM   4926  C CA    . CYS A 1 647 ? -37.460 26.243  22.946  1.00 18.55  ? 955  CYS A CA    1 
ATOM   4927  C C     . CYS A 1 647 ? -38.054 27.429  22.216  1.00 25.15  ? 955  CYS A C     1 
ATOM   4928  O O     . CYS A 1 647 ? -37.327 28.327  21.777  1.00 18.39  ? 955  CYS A O     1 
ATOM   4929  C CB    . CYS A 1 647 ? -35.978 26.524  23.247  1.00 21.10  ? 955  CYS A CB    1 
ATOM   4930  S SG    . CYS A 1 647 ? -35.225 25.384  24.430  1.00 24.03  ? 955  CYS A SG    1 
ATOM   4931  N N     . LEU A 1 648 ? -39.377 27.438  22.101  1.00 15.55  ? 956  LEU A N     1 
ATOM   4932  C CA    . LEU A 1 648 ? -40.077 28.514  21.403  1.00 14.33  ? 956  LEU A CA    1 
ATOM   4933  C C     . LEU A 1 648 ? -39.910 29.871  22.078  1.00 14.62  ? 956  LEU A C     1 
ATOM   4934  O O     . LEU A 1 648 ? -40.007 30.911  21.429  1.00 15.32  ? 956  LEU A O     1 
ATOM   4935  C CB    . LEU A 1 648 ? -41.569 28.185  21.286  1.00 18.83  ? 956  LEU A CB    1 
ATOM   4936  C CG    . LEU A 1 648 ? -41.869 26.960  20.420  1.00 29.11  ? 956  LEU A CG    1 
ATOM   4937  C CD1   . LEU A 1 648 ? -43.347 26.569  20.507  1.00 27.45  ? 956  LEU A CD1   1 
ATOM   4938  C CD2   . LEU A 1 648 ? -41.460 27.232  18.981  1.00 22.14  ? 956  LEU A CD2   1 
ATOM   4939  N N     . GLU A 1 649 ? -39.686 29.860  23.389  1.00 11.68  ? 957  GLU A N     1 
ATOM   4940  C CA    . GLU A 1 649 ? -39.533 31.098  24.152  1.00 19.28  ? 957  GLU A CA    1 
ATOM   4941  C C     . GLU A 1 649 ? -38.277 31.918  23.789  1.00 16.03  ? 957  GLU A C     1 
ATOM   4942  O O     . GLU A 1 649 ? -38.126 33.063  24.225  1.00 14.48  ? 957  GLU A O     1 
ATOM   4943  C CB    . GLU A 1 649 ? -39.553 30.793  25.663  1.00 20.11  ? 957  GLU A CB    1 
ATOM   4944  C CG    . GLU A 1 649 ? -38.350 29.966  26.168  1.00 29.06  ? 957  GLU A CG    1 
ATOM   4945  C CD    . GLU A 1 649 ? -38.503 28.456  25.973  1.00 33.84  ? 957  GLU A CD    1 
ATOM   4946  O OE1   . GLU A 1 649 ? -39.339 28.011  25.151  1.00 36.54  ? 957  GLU A OE1   1 
ATOM   4947  O OE2   . GLU A 1 649 ? -37.787 27.708  26.666  1.00 33.51  ? 957  GLU A OE2   1 
ATOM   4948  N N     . LEU A 1 650 ? -37.387 31.348  22.987  1.00 13.90  ? 958  LEU A N     1 
ATOM   4949  C CA    . LEU A 1 650 ? -36.116 32.015  22.661  1.00 17.19  ? 958  LEU A CA    1 
ATOM   4950  C C     . LEU A 1 650 ? -36.152 32.683  21.310  1.00 15.48  ? 958  LEU A C     1 
ATOM   4951  O O     . LEU A 1 650 ? -35.155 33.291  20.862  1.00 13.69  ? 958  LEU A O     1 
ATOM   4952  C CB    . LEU A 1 650 ? -34.960 31.006  22.712  1.00 12.00  ? 958  LEU A CB    1 
ATOM   4953  C CG    . LEU A 1 650 ? -34.605 30.578  24.137  1.00 15.48  ? 958  LEU A CG    1 
ATOM   4954  C CD1   . LEU A 1 650 ? -33.594 29.421  24.163  1.00 12.59  ? 958  LEU A CD1   1 
ATOM   4955  C CD2   . LEU A 1 650 ? -34.077 31.768  24.849  1.00 10.12  ? 958  LEU A CD2   1 
ATOM   4956  N N     . ILE A 1 651 ? -37.309 32.569  20.658  1.00 14.95  ? 959  ILE A N     1 
ATOM   4957  C CA    . ILE A 1 651 ? -37.528 33.143  19.341  1.00 5.52   ? 959  ILE A CA    1 
ATOM   4958  C C     . ILE A 1 651 ? -38.316 34.456  19.424  1.00 16.47  ? 959  ILE A C     1 
ATOM   4959  O O     . ILE A 1 651 ? -39.473 34.463  19.835  1.00 16.60  ? 959  ILE A O     1 
ATOM   4960  C CB    . ILE A 1 651 ? -38.285 32.147  18.456  1.00 10.23  ? 959  ILE A CB    1 
ATOM   4961  C CG1   . ILE A 1 651 ? -37.507 30.828  18.401  1.00 9.04   ? 959  ILE A CG1   1 
ATOM   4962  C CG2   . ILE A 1 651 ? -38.474 32.684  17.053  1.00 12.41  ? 959  ILE A CG2   1 
ATOM   4963  C CD1   . ILE A 1 651 ? -38.258 29.707  17.724  1.00 11.29  ? 959  ILE A CD1   1 
ATOM   4964  N N     . ALA A 1 652 ? -37.681 35.556  19.016  1.00 10.32  ? 960  ALA A N     1 
ATOM   4965  C CA    . ALA A 1 652 ? -38.257 36.887  19.095  1.00 19.68  ? 960  ALA A CA    1 
ATOM   4966  C C     . ALA A 1 652 ? -38.956 37.289  17.797  1.00 19.18  ? 960  ALA A C     1 
ATOM   4967  O O     . ALA A 1 652 ? -38.447 37.026  16.699  1.00 14.35  ? 960  ALA A O     1 
ATOM   4968  C CB    . ALA A 1 652 ? -37.175 37.898  19.443  1.00 14.88  ? 960  ALA A CB    1 
ATOM   4969  N N     . LYS A 1 653 ? -40.112 37.945  17.933  1.00 17.60  ? 961  LYS A N     1 
ATOM   4970  C CA    . LYS A 1 653 ? -40.874 38.431  16.786  1.00 14.61  ? 961  LYS A CA    1 
ATOM   4971  C C     . LYS A 1 653 ? -40.446 39.810  16.295  1.00 15.72  ? 961  LYS A C     1 
ATOM   4972  O O     . LYS A 1 653 ? -40.770 40.212  15.176  1.00 20.49  ? 961  LYS A O     1 
ATOM   4973  C CB    . LYS A 1 653 ? -42.380 38.436  17.100  1.00 20.00  ? 961  LYS A CB    1 
ATOM   4974  C CG    . LYS A 1 653 ? -42.989 37.039  17.195  1.00 25.08  ? 961  LYS A CG    1 
ATOM   4975  C CD    . LYS A 1 653 ? -44.504 37.081  17.319  1.00 40.87  ? 961  LYS A CD    1 
ATOM   4976  C CE    . LYS A 1 653 ? -45.056 35.708  17.665  1.00 43.95  ? 961  LYS A CE    1 
ATOM   4977  N NZ    . LYS A 1 653 ? -44.509 35.206  18.964  1.00 45.07  ? 961  LYS A NZ    1 
ATOM   4978  N N     . ASN A 1 654 ? -39.724 40.538  17.133  1.00 23.27  ? 962  ASN A N     1 
ATOM   4979  C CA    . ASN A 1 654 ? -39.244 41.868  16.773  1.00 22.73  ? 962  ASN A CA    1 
ATOM   4980  C C     . ASN A 1 654 ? -38.121 42.274  17.727  1.00 22.10  ? 962  ASN A C     1 
ATOM   4981  O O     . ASN A 1 654 ? -37.865 41.574  18.702  1.00 14.81  ? 962  ASN A O     1 
ATOM   4982  C CB    . ASN A 1 654 ? -40.398 42.877  16.820  1.00 19.46  ? 962  ASN A CB    1 
ATOM   4983  C CG    . ASN A 1 654 ? -41.094 42.900  18.166  1.00 25.33  ? 962  ASN A CG    1 
ATOM   4984  O OD1   . ASN A 1 654 ? -40.447 42.818  19.211  1.00 16.97  ? 962  ASN A OD1   1 
ATOM   4985  N ND2   . ASN A 1 654 ? -42.422 43.002  18.151  1.00 20.39  ? 962  ASN A ND2   1 
ATOM   4986  N N     . ARG A 1 655 ? -37.455 43.394  17.456  1.00 17.13  ? 963  ARG A N     1 
ATOM   4987  C CA    . ARG A 1 655 ? -36.284 43.803  18.254  1.00 18.34  ? 963  ARG A CA    1 
ATOM   4988  C C     . ARG A 1 655 ? -36.560 43.982  19.742  1.00 15.45  ? 963  ARG A C     1 
ATOM   4989  O O     . ARG A 1 655 ? -35.736 43.622  20.584  1.00 24.09  ? 963  ARG A O     1 
ATOM   4990  C CB    . ARG A 1 655 ? -35.659 45.076  17.691  1.00 10.25  ? 963  ARG A CB    1 
ATOM   4991  C CG    . ARG A 1 655 ? -34.869 44.803  16.439  1.00 24.96  ? 963  ARG A CG    1 
ATOM   4992  C CD    . ARG A 1 655 ? -34.496 46.067  15.690  1.00 39.01  ? 963  ARG A CD    1 
ATOM   4993  N NE    . ARG A 1 655 ? -33.588 45.762  14.585  1.00 49.24  ? 963  ARG A NE    1 
ATOM   4994  C CZ    . ARG A 1 655 ? -33.968 45.231  13.426  1.00 65.83  ? 963  ARG A CZ    1 
ATOM   4995  N NH1   . ARG A 1 655 ? -35.246 44.940  13.212  1.00 72.52  ? 963  ARG A NH1   1 
ATOM   4996  N NH2   . ARG A 1 655 ? -33.069 44.990  12.479  1.00 65.26  ? 963  ARG A NH2   1 
ATOM   4997  N N     . GLN A 1 656 ? -37.706 44.560  20.071  1.00 21.39  ? 964  GLN A N     1 
ATOM   4998  C CA    . GLN A 1 656 ? -38.046 44.736  21.473  1.00 22.19  ? 964  GLN A CA    1 
ATOM   4999  C C     . GLN A 1 656 ? -38.161 43.401  22.201  1.00 14.13  ? 964  GLN A C     1 
ATOM   5000  O O     . GLN A 1 656 ? -37.720 43.286  23.340  1.00 17.62  ? 964  GLN A O     1 
ATOM   5001  C CB    . GLN A 1 656 ? -39.338 45.549  21.644  1.00 19.90  ? 964  GLN A CB    1 
ATOM   5002  C CG    . GLN A 1 656 ? -39.577 45.967  23.090  1.00 29.25  ? 964  GLN A CG    1 
ATOM   5003  C CD    . GLN A 1 656 ? -38.425 46.793  23.646  1.00 31.06  ? 964  GLN A CD    1 
ATOM   5004  O OE1   . GLN A 1 656 ? -38.135 47.878  23.150  1.00 27.54  ? 964  GLN A OE1   1 
ATOM   5005  N NE2   . GLN A 1 656 ? -37.750 46.269  24.663  1.00 27.52  ? 964  GLN A NE2   1 
ATOM   5006  N N     . GLU A 1 657 ? -38.775 42.404  21.560  1.00 14.75  ? 965  GLU A N     1 
ATOM   5007  C CA    . GLU A 1 657 ? -38.893 41.094  22.187  1.00 20.18  ? 965  GLU A CA    1 
ATOM   5008  C C     . GLU A 1 657 ? -37.526 40.415  22.307  1.00 10.80  ? 965  GLU A C     1 
ATOM   5009  O O     . GLU A 1 657 ? -37.265 39.701  23.272  1.00 11.89  ? 965  GLU A O     1 
ATOM   5010  C CB    . GLU A 1 657 ? -39.899 40.180  21.464  1.00 19.50  ? 965  GLU A CB    1 
ATOM   5011  C CG    . GLU A 1 657 ? -40.322 38.958  22.309  1.00 30.26  ? 965  GLU A CG    1 
ATOM   5012  C CD    . GLU A 1 657 ? -41.183 37.926  21.557  1.00 41.36  ? 965  GLU A CD    1 
ATOM   5013  O OE1   . GLU A 1 657 ? -41.431 38.086  20.342  1.00 19.38  ? 965  GLU A OE1   1 
ATOM   5014  O OE2   . GLU A 1 657 ? -41.605 36.933  22.190  1.00 43.65  ? 965  GLU A OE2   1 
ATOM   5015  N N     . TYR A 1 658 ? -36.662 40.632  21.321  1.00 13.32  ? 966  TYR A N     1 
ATOM   5016  C CA    . TYR A 1 658 ? -35.319 40.066  21.354  1.00 11.92  ? 966  TYR A CA    1 
ATOM   5017  C C     . TYR A 1 658 ? -34.594 40.640  22.559  1.00 13.42  ? 966  TYR A C     1 
ATOM   5018  O O     . TYR A 1 658 ? -34.028 39.901  23.364  1.00 9.89   ? 966  TYR A O     1 
ATOM   5019  C CB    . TYR A 1 658 ? -34.580 40.402  20.049  1.00 13.31  ? 966  TYR A CB    1 
ATOM   5020  C CG    . TYR A 1 658 ? -33.157 39.887  19.910  1.00 12.69  ? 966  TYR A CG    1 
ATOM   5021  C CD1   . TYR A 1 658 ? -32.856 38.851  19.031  1.00 10.95  ? 966  TYR A CD1   1 
ATOM   5022  C CD2   . TYR A 1 658 ? -32.106 40.489  20.597  1.00 9.35   ? 966  TYR A CD2   1 
ATOM   5023  C CE1   . TYR A 1 658 ? -31.543 38.388  18.870  1.00 16.51  ? 966  TYR A CE1   1 
ATOM   5024  C CE2   . TYR A 1 658 ? -30.787 40.036  20.436  1.00 7.91   ? 966  TYR A CE2   1 
ATOM   5025  C CZ    . TYR A 1 658 ? -30.522 38.985  19.575  1.00 5.63   ? 966  TYR A CZ    1 
ATOM   5026  O OH    . TYR A 1 658 ? -29.226 38.552  19.408  1.00 8.99   ? 966  TYR A OH    1 
ATOM   5027  N N     . GLU A 1 659 ? -34.631 41.961  22.702  1.00 9.26   ? 967  GLU A N     1 
ATOM   5028  C CA    . GLU A 1 659 ? -34.030 42.589  23.875  1.00 9.55   ? 967  GLU A CA    1 
ATOM   5029  C C     . GLU A 1 659 ? -34.657 42.100  25.203  1.00 5.78   ? 967  GLU A C     1 
ATOM   5030  O O     . GLU A 1 659 ? -33.953 41.812  26.170  1.00 15.63  ? 967  GLU A O     1 
ATOM   5031  C CB    . GLU A 1 659 ? -34.116 44.123  23.754  1.00 14.63  ? 967  GLU A CB    1 
ATOM   5032  C CG    . GLU A 1 659 ? -33.357 44.673  22.525  1.00 21.40  ? 967  GLU A CG    1 
ATOM   5033  C CD    . GLU A 1 659 ? -33.555 46.165  22.314  1.00 19.69  ? 967  GLU A CD    1 
ATOM   5034  O OE1   . GLU A 1 659 ? -34.116 46.816  23.222  1.00 22.77  ? 967  GLU A OE1   1 
ATOM   5035  O OE2   . GLU A 1 659 ? -33.136 46.676  21.249  1.00 22.36  ? 967  GLU A OE2   1 
ATOM   5036  N N     . ASP A 1 660 ? -35.975 42.027  25.251  1.00 12.17  ? 968  ASP A N     1 
ATOM   5037  C CA    . ASP A 1 660 ? -36.654 41.667  26.488  1.00 18.54  ? 968  ASP A CA    1 
ATOM   5038  C C     . ASP A 1 660 ? -36.318 40.230  26.882  1.00 14.66  ? 968  ASP A C     1 
ATOM   5039  O O     . ASP A 1 660 ? -36.099 39.925  28.059  1.00 10.05  ? 968  ASP A O     1 
ATOM   5040  C CB    . ASP A 1 660 ? -38.167 41.817  26.348  1.00 18.35  ? 968  ASP A CB    1 
ATOM   5041  C CG    . ASP A 1 660 ? -38.615 43.251  26.371  1.00 23.64  ? 968  ASP A CG    1 
ATOM   5042  O OD1   . ASP A 1 660 ? -37.856 44.124  26.848  1.00 17.95  ? 968  ASP A OD1   1 
ATOM   5043  O OD2   . ASP A 1 660 ? -39.741 43.499  25.919  1.00 17.03  ? 968  ASP A OD2   1 
ATOM   5044  N N     . ILE A 1 661 ? -36.282 39.350  25.889  1.00 11.17  ? 969  ILE A N     1 
ATOM   5045  C CA    . ILE A 1 661 ? -35.902 37.961  26.109  1.00 12.30  ? 969  ILE A CA    1 
ATOM   5046  C C     . ILE A 1 661 ? -34.475 37.888  26.635  1.00 18.01  ? 969  ILE A C     1 
ATOM   5047  O O     . ILE A 1 661 ? -34.219 37.239  27.655  1.00 13.63  ? 969  ILE A O     1 
ATOM   5048  C CB    . ILE A 1 661 ? -36.023 37.139  24.814  1.00 21.05  ? 969  ILE A CB    1 
ATOM   5049  C CG1   . ILE A 1 661 ? -37.506 36.892  24.482  1.00 16.44  ? 969  ILE A CG1   1 
ATOM   5050  C CG2   . ILE A 1 661 ? -35.249 35.836  24.939  1.00 15.60  ? 969  ILE A CG2   1 
ATOM   5051  C CD1   . ILE A 1 661 ? -37.727 36.331  23.084  1.00 19.68  ? 969  ILE A CD1   1 
ATOM   5052  N N     . ALA A 1 662 ? -33.553 38.555  25.936  1.00 10.00  ? 970  ALA A N     1 
ATOM   5053  C CA    . ALA A 1 662 ? -32.156 38.606  26.364  1.00 14.37  ? 970  ALA A CA    1 
ATOM   5054  C C     . ALA A 1 662 ? -31.982 39.152  27.776  1.00 10.94  ? 970  ALA A C     1 
ATOM   5055  O O     . ALA A 1 662 ? -31.175 38.637  28.537  1.00 7.43   ? 970  ALA A O     1 
ATOM   5056  C CB    . ALA A 1 662 ? -31.333 39.445  25.383  1.00 6.19   ? 970  ALA A CB    1 
ATOM   5057  N N     . VAL A 1 663 ? -32.719 40.211  28.118  1.00 10.09  ? 971  VAL A N     1 
ATOM   5058  C CA    . VAL A 1 663 ? -32.576 40.826  29.445  1.00 14.33  ? 971  VAL A CA    1 
ATOM   5059  C C     . VAL A 1 663 ? -33.200 39.964  30.545  1.00 8.27   ? 971  VAL A C     1 
ATOM   5060  O O     . VAL A 1 663 ? -32.687 39.892  31.657  1.00 12.79  ? 971  VAL A O     1 
ATOM   5061  C CB    . VAL A 1 663 ? -33.182 42.255  29.510  1.00 13.64  ? 971  VAL A CB    1 
ATOM   5062  C CG1   . VAL A 1 663 ? -33.082 42.792  30.923  1.00 7.33   ? 971  VAL A CG1   1 
ATOM   5063  C CG2   . VAL A 1 663 ? -32.438 43.182  28.559  1.00 12.01  ? 971  VAL A CG2   1 
ATOM   5064  N N     . LYS A 1 664 ? -34.316 39.323  30.239  1.00 11.04  ? 972  LYS A N     1 
ATOM   5065  C CA    . LYS A 1 664 ? -34.931 38.410  31.208  1.00 19.11  ? 972  LYS A CA    1 
ATOM   5066  C C     . LYS A 1 664 ? -33.975 37.258  31.551  1.00 9.60   ? 972  LYS A C     1 
ATOM   5067  O O     . LYS A 1 664 ? -33.800 36.910  32.722  1.00 13.82  ? 972  LYS A O     1 
ATOM   5068  C CB    . LYS A 1 664 ? -36.276 37.874  30.686  1.00 9.82   ? 972  LYS A CB    1 
ATOM   5069  C CG    . LYS A 1 664 ? -37.024 36.930  31.652  1.00 9.94   ? 972  LYS A CG    1 
ATOM   5070  C CD    . LYS A 1 664 ? -38.398 36.569  31.084  1.00 23.10  ? 972  LYS A CD    1 
ATOM   5071  C CE    . LYS A 1 664 ? -39.061 35.473  31.910  1.00 26.67  ? 972  LYS A CE    1 
ATOM   5072  N NZ    . LYS A 1 664 ? -40.226 34.873  31.205  1.00 18.84  ? 972  LYS A NZ    1 
ATOM   5073  N N     . LEU A 1 665 ? -33.353 36.673  30.531  1.00 10.22  ? 973  LEU A N     1 
ATOM   5074  C CA    . LEU A 1 665 ? -32.366 35.605  30.759  1.00 10.01  ? 973  LEU A CA    1 
ATOM   5075  C C     . LEU A 1 665 ? -31.176 36.097  31.584  1.00 15.09  ? 973  LEU A C     1 
ATOM   5076  O O     . LEU A 1 665 ? -30.590 35.351  32.368  1.00 20.08  ? 973  LEU A O     1 
ATOM   5077  C CB    . LEU A 1 665 ? -31.849 35.050  29.420  1.00 5.62   ? 973  LEU A CB    1 
ATOM   5078  C CG    . LEU A 1 665 ? -32.873 34.244  28.625  1.00 17.42  ? 973  LEU A CG    1 
ATOM   5079  C CD1   . LEU A 1 665 ? -32.365 34.022  27.184  1.00 10.41  ? 973  LEU A CD1   1 
ATOM   5080  C CD2   . LEU A 1 665 ? -33.112 32.933  29.371  1.00 11.48  ? 973  LEU A CD2   1 
ATOM   5081  N N     . GLY A 1 666 ? -30.814 37.356  31.405  1.00 5.65   ? 974  GLY A N     1 
ATOM   5082  C CA    . GLY A 1 666 ? -29.666 37.889  32.120  1.00 10.22  ? 974  GLY A CA    1 
ATOM   5083  C C     . GLY A 1 666 ? -29.972 38.375  33.533  1.00 14.06  ? 974  GLY A C     1 
ATOM   5084  O O     . GLY A 1 666 ? -29.060 38.690  34.292  1.00 13.23  ? 974  GLY A O     1 
ATOM   5085  N N     . THR A 1 667 ? -31.247 38.453  33.897  1.00 12.53  ? 975  THR A N     1 
ATOM   5086  C CA    . THR A 1 667 ? -31.600 39.077  35.179  1.00 7.38   ? 975  THR A CA    1 
ATOM   5087  C C     . THR A 1 667 ? -32.489 38.233  36.050  1.00 14.20  ? 975  THR A C     1 
ATOM   5088  O O     . THR A 1 667 ? -32.474 38.375  37.277  1.00 19.52  ? 975  THR A O     1 
ATOM   5089  C CB    . THR A 1 667 ? -32.285 40.436  34.973  1.00 12.84  ? 975  THR A CB    1 
ATOM   5090  O OG1   . THR A 1 667 ? -33.409 40.290  34.100  1.00 14.54  ? 975  THR A OG1   1 
ATOM   5091  C CG2   . THR A 1 667 ? -31.317 41.444  34.383  1.00 9.93   ? 975  THR A CG2   1 
ATOM   5092  N N     . ASP A 1 668 ? -33.296 37.375  35.433  1.00 12.67  ? 976  ASP A N     1 
ATOM   5093  C CA    . ASP A 1 668 ? -34.146 36.472  36.215  1.00 9.81   ? 976  ASP A CA    1 
ATOM   5094  C C     . ASP A 1 668 ? -33.364 35.178  36.345  1.00 9.97   ? 976  ASP A C     1 
ATOM   5095  O O     . ASP A 1 668 ? -33.456 34.301  35.463  1.00 14.43  ? 976  ASP A O     1 
ATOM   5096  C CB    . ASP A 1 668 ? -35.479 36.270  35.482  1.00 14.13  ? 976  ASP A CB    1 
ATOM   5097  C CG    . ASP A 1 668 ? -36.428 35.359  36.214  1.00 13.42  ? 976  ASP A CG    1 
ATOM   5098  O OD1   . ASP A 1 668 ? -35.980 34.588  37.092  1.00 22.88  ? 976  ASP A OD1   1 
ATOM   5099  O OD2   . ASP A 1 668 ? -37.636 35.398  35.891  1.00 11.59  ? 976  ASP A OD2   1 
ATOM   5100  N N     . LEU A 1 669 ? -32.551 35.045  37.396  1.00 11.81  ? 977  LEU A N     1 
ATOM   5101  C CA    . LEU A 1 669 ? -31.577 33.922  37.400  1.00 11.97  ? 977  LEU A CA    1 
ATOM   5102  C C     . LEU A 1 669 ? -32.226 32.538  37.479  1.00 25.20  ? 977  LEU A C     1 
ATOM   5103  O O     . LEU A 1 669 ? -31.653 31.557  37.011  1.00 19.60  ? 977  LEU A O     1 
ATOM   5104  C CB    . LEU A 1 669 ? -30.475 34.081  38.474  1.00 16.10  ? 977  LEU A CB    1 
ATOM   5105  C CG    . LEU A 1 669 ? -29.496 35.278  38.516  1.00 22.79  ? 977  LEU A CG    1 
ATOM   5106  C CD1   . LEU A 1 669 ? -28.536 35.136  39.703  1.00 22.06  ? 977  LEU A CD1   1 
ATOM   5107  C CD2   . LEU A 1 669 ? -28.665 35.454  37.231  1.00 20.32  ? 977  LEU A CD2   1 
ATOM   5108  N N     . GLU A 1 670 ? -33.413 32.461  38.074  1.00 15.07  ? 978  GLU A N     1 
ATOM   5109  C CA    . GLU A 1 670 ? -34.140 31.211  38.178  1.00 18.24  ? 978  GLU A CA    1 
ATOM   5110  C C     . GLU A 1 670 ? -34.699 30.815  36.825  1.00 7.93   ? 978  GLU A C     1 
ATOM   5111  O O     . GLU A 1 670 ? -34.722 29.642  36.491  1.00 13.44  ? 978  GLU A O     1 
ATOM   5112  C CB    . GLU A 1 670 ? -35.273 31.340  39.199  1.00 20.87  ? 978  GLU A CB    1 
ATOM   5113  C CG    . GLU A 1 670 ? -34.760 31.347  40.619  1.00 14.61  ? 978  GLU A CG    1 
ATOM   5114  C CD    . GLU A 1 670 ? -34.082 30.038  40.968  1.00 14.99  ? 978  GLU A CD    1 
ATOM   5115  O OE1   . GLU A 1 670 ? -34.736 28.981  40.851  1.00 39.24  ? 978  GLU A OE1   1 
ATOM   5116  O OE2   . GLU A 1 670 ? -32.894 30.067  41.346  1.00 26.25  ? 978  GLU A OE2   1 
ATOM   5117  N N     . TYR A 1 671 ? -35.152 31.803  36.058  1.00 8.18   ? 979  TYR A N     1 
ATOM   5118  C CA    . TYR A 1 671 ? -35.550 31.577  34.679  1.00 8.42   ? 979  TYR A CA    1 
ATOM   5119  C C     . TYR A 1 671 ? -34.356 31.135  33.828  1.00 7.41   ? 979  TYR A C     1 
ATOM   5120  O O     . TYR A 1 671 ? -34.452 30.170  33.047  1.00 14.25  ? 979  TYR A O     1 
ATOM   5121  C CB    . TYR A 1 671 ? -36.132 32.858  34.080  1.00 6.82   ? 979  TYR A CB    1 
ATOM   5122  C CG    . TYR A 1 671 ? -36.674 32.651  32.678  1.00 10.10  ? 979  TYR A CG    1 
ATOM   5123  C CD1   . TYR A 1 671 ? -37.780 31.822  32.460  1.00 20.95  ? 979  TYR A CD1   1 
ATOM   5124  C CD2   . TYR A 1 671 ? -36.106 33.280  31.585  1.00 13.12  ? 979  TYR A CD2   1 
ATOM   5125  C CE1   . TYR A 1 671 ? -38.301 31.624  31.187  1.00 24.27  ? 979  TYR A CE1   1 
ATOM   5126  C CE2   . TYR A 1 671 ? -36.629 33.098  30.302  1.00 17.19  ? 979  TYR A CE2   1 
ATOM   5127  C CZ    . TYR A 1 671 ? -37.724 32.258  30.107  1.00 19.30  ? 979  TYR A CZ    1 
ATOM   5128  O OH    . TYR A 1 671 ? -38.245 32.062  28.831  1.00 18.69  ? 979  TYR A OH    1 
ATOM   5129  N N     . LEU A 1 672 ? -33.233 31.830  33.974  1.00 8.97   ? 980  LEU A N     1 
ATOM   5130  C CA    . LEU A 1 672 ? -32.010 31.416  33.270  1.00 12.63  ? 980  LEU A CA    1 
ATOM   5131  C C     . LEU A 1 672 ? -31.697 29.944  33.543  1.00 13.11  ? 980  LEU A C     1 
ATOM   5132  O O     . LEU A 1 672 ? -31.378 29.175  32.630  1.00 9.55   ? 980  LEU A O     1 
ATOM   5133  C CB    . LEU A 1 672 ? -30.813 32.287  33.682  1.00 7.08   ? 980  LEU A CB    1 
ATOM   5134  C CG    . LEU A 1 672 ? -29.471 31.905  33.059  1.00 11.76  ? 980  LEU A CG    1 
ATOM   5135  C CD1   . LEU A 1 672 ? -29.520 32.008  31.506  1.00 13.97  ? 980  LEU A CD1   1 
ATOM   5136  C CD2   . LEU A 1 672 ? -28.334 32.770  33.619  1.00 10.99  ? 980  LEU A CD2   1 
ATOM   5137  N N     . LYS A 1 673 ? -31.782 29.542  34.803  1.00 11.53  ? 981  LYS A N     1 
ATOM   5138  C CA    . LYS A 1 673 ? -31.440 28.170  35.156  1.00 14.73  ? 981  LYS A CA    1 
ATOM   5139  C C     . LYS A 1 673 ? -32.362 27.159  34.469  1.00 13.20  ? 981  LYS A C     1 
ATOM   5140  O O     . LYS A 1 673 ? -31.910 26.104  33.972  1.00 10.11  ? 981  LYS A O     1 
ATOM   5141  C CB    . LYS A 1 673 ? -31.437 28.001  36.675  1.00 18.87  ? 981  LYS A CB    1 
ATOM   5142  C CG    . LYS A 1 673 ? -31.446 26.586  37.141  1.00 23.27  ? 981  LYS A CG    1 
ATOM   5143  C CD    . LYS A 1 673 ? -31.499 26.533  38.664  1.00 41.69  ? 981  LYS A CD    1 
ATOM   5144  C CE    . LYS A 1 673 ? -30.422 27.416  39.288  1.00 23.96  ? 981  LYS A CE    1 
ATOM   5145  N NZ    . LYS A 1 673 ? -29.057 26.844  39.089  1.00 50.07  ? 981  LYS A NZ    1 
ATOM   5146  N N     . LYS A 1 674 ? -33.650 27.487  34.434  1.00 13.08  ? 982  LYS A N     1 
ATOM   5147  C CA    . LYS A 1 674 ? -34.656 26.640  33.816  1.00 15.17  ? 982  LYS A CA    1 
ATOM   5148  C C     . LYS A 1 674 ? -34.413 26.510  32.314  1.00 18.36  ? 982  LYS A C     1 
ATOM   5149  O O     . LYS A 1 674 ? -34.469 25.408  31.765  1.00 15.36  ? 982  LYS A O     1 
ATOM   5150  C CB    . LYS A 1 674 ? -36.062 27.198  34.083  1.00 8.16   ? 982  LYS A CB    1 
ATOM   5151  C CG    . LYS A 1 674 ? -37.187 26.413  33.407  1.00 20.67  ? 982  LYS A CG    1 
ATOM   5152  C CD    . LYS A 1 674 ? -38.514 27.167  33.504  1.00 34.12  ? 982  LYS A CD    1 
ATOM   5153  C CE    . LYS A 1 674 ? -39.620 26.452  32.747  1.00 54.49  ? 982  LYS A CE    1 
ATOM   5154  N NZ    . LYS A 1 674 ? -40.849 27.287  32.615  1.00 57.97  ? 982  LYS A NZ    1 
ATOM   5155  N N     . VAL A 1 675 ? -34.157 27.634  31.645  1.00 8.49   ? 983  VAL A N     1 
ATOM   5156  C CA    . VAL A 1 675 ? -33.907 27.606  30.211  1.00 5.40   ? 983  VAL A CA    1 
ATOM   5157  C C     . VAL A 1 675 ? -32.616 26.839  29.874  1.00 10.34  ? 983  VAL A C     1 
ATOM   5158  O O     . VAL A 1 675 ? -32.616 25.978  28.999  1.00 6.01   ? 983  VAL A O     1 
ATOM   5159  C CB    . VAL A 1 675 ? -33.890 29.027  29.595  1.00 17.02  ? 983  VAL A CB    1 
ATOM   5160  C CG1   . VAL A 1 675 ? -33.619 28.960  28.095  1.00 12.28  ? 983  VAL A CG1   1 
ATOM   5161  C CG2   . VAL A 1 675 ? -35.220 29.737  29.861  1.00 17.49  ? 983  VAL A CG2   1 
ATOM   5162  N N     . ARG A 1 676 ? -31.518 27.129  30.570  1.00 9.78   ? 984  ARG A N     1 
ATOM   5163  C CA    . ARG A 1 676 ? -30.269 26.382  30.312  1.00 6.62   ? 984  ARG A CA    1 
ATOM   5164  C C     . ARG A 1 676 ? -30.451 24.890  30.541  1.00 12.63  ? 984  ARG A C     1 
ATOM   5165  O O     . ARG A 1 676 ? -29.900 24.057  29.795  1.00 9.53   ? 984  ARG A O     1 
ATOM   5166  C CB    . ARG A 1 676 ? -29.144 26.896  31.181  1.00 6.10   ? 984  ARG A CB    1 
ATOM   5167  C CG    . ARG A 1 676 ? -28.763 28.328  30.857  1.00 10.19  ? 984  ARG A CG    1 
ATOM   5168  C CD    . ARG A 1 676 ? -27.638 28.788  31.738  1.00 12.09  ? 984  ARG A CD    1 
ATOM   5169  N NE    . ARG A 1 676 ? -26.505 27.869  31.739  1.00 7.61   ? 984  ARG A NE    1 
ATOM   5170  C CZ    . ARG A 1 676 ? -25.550 27.857  30.814  1.00 9.19   ? 984  ARG A CZ    1 
ATOM   5171  N NH1   . ARG A 1 676 ? -25.625 28.664  29.769  1.00 7.38   ? 984  ARG A NH1   1 
ATOM   5172  N NH2   . ARG A 1 676 ? -24.541 27.002  30.909  1.00 13.01  ? 984  ARG A NH2   1 
ATOM   5173  N N     . GLY A 1 677 ? -31.234 24.553  31.565  1.00 13.77  ? 985  GLY A N     1 
ATOM   5174  C CA    . GLY A 1 677 ? -31.559 23.168  31.855  1.00 14.46  ? 985  GLY A CA    1 
ATOM   5175  C C     . GLY A 1 677 ? -32.348 22.514  30.725  1.00 10.24  ? 985  GLY A C     1 
ATOM   5176  O O     . GLY A 1 677 ? -32.087 21.374  30.355  1.00 11.36  ? 985  GLY A O     1 
ATOM   5177  N N     . LYS A 1 678 ? -33.338 23.226  30.201  1.00 14.29  ? 986  LYS A N     1 
ATOM   5178  C CA    . LYS A 1 678 ? -34.067 22.765  29.027  1.00 14.35  ? 986  LYS A CA    1 
ATOM   5179  C C     . LYS A 1 678 ? -33.169 22.497  27.807  1.00 13.72  ? 986  LYS A C     1 
ATOM   5180  O O     . LYS A 1 678 ? -33.270 21.429  27.171  1.00 11.65  ? 986  LYS A O     1 
ATOM   5181  C CB    . LYS A 1 678 ? -35.180 23.758  28.676  1.00 21.19  ? 986  LYS A CB    1 
ATOM   5182  C CG    . LYS A 1 678 ? -36.168 23.268  27.630  1.00 24.61  ? 986  LYS A CG    1 
ATOM   5183  C CD    . LYS A 1 678 ? -37.272 24.321  27.457  1.00 36.99  ? 986  LYS A CD    1 
ATOM   5184  C CE    . LYS A 1 678 ? -38.388 23.853  26.544  1.00 30.54  ? 986  LYS A CE    1 
ATOM   5185  N NZ    . LYS A 1 678 ? -39.353 24.962  26.244  1.00 44.90  ? 986  LYS A NZ    1 
ATOM   5186  N N     . VAL A 1 679 ? -32.315 23.466  27.473  1.00 7.64   ? 987  VAL A N     1 
ATOM   5187  C CA    . VAL A 1 679 ? -31.343 23.319  26.387  1.00 6.06   ? 987  VAL A CA    1 
ATOM   5188  C C     . VAL A 1 679 ? -30.471 22.097  26.626  1.00 17.84  ? 987  VAL A C     1 
ATOM   5189  O O     . VAL A 1 679 ? -30.286 21.262  25.733  1.00 14.24  ? 987  VAL A O     1 
ATOM   5190  C CB    . VAL A 1 679 ? -30.418 24.594  26.293  1.00 6.49   ? 987  VAL A CB    1 
ATOM   5191  C CG1   . VAL A 1 679 ? -29.380 24.459  25.195  1.00 8.29   ? 987  VAL A CG1   1 
ATOM   5192  C CG2   . VAL A 1 679 ? -31.256 25.839  26.043  1.00 19.19  ? 987  VAL A CG2   1 
ATOM   5193  N N     . TRP A 1 680 ? -29.926 22.006  27.835  1.00 14.88  ? 988  TRP A N     1 
ATOM   5194  C CA    . TRP A 1 680 ? -28.986 20.941  28.207  1.00 12.50  ? 988  TRP A CA    1 
ATOM   5195  C C     . TRP A 1 680 ? -29.592 19.545  28.003  1.00 17.96  ? 988  TRP A C     1 
ATOM   5196  O O     . TRP A 1 680 ? -28.947 18.645  27.454  1.00 12.48  ? 988  TRP A O     1 
ATOM   5197  C CB    . TRP A 1 680 ? -28.537 21.124  29.664  1.00 14.66  ? 988  TRP A CB    1 
ATOM   5198  C CG    . TRP A 1 680 ? -27.540 20.098  30.153  1.00 13.55  ? 988  TRP A CG    1 
ATOM   5199  C CD1   . TRP A 1 680 ? -27.788 19.047  31.001  1.00 19.43  ? 988  TRP A CD1   1 
ATOM   5200  C CD2   . TRP A 1 680 ? -26.137 20.043  29.850  1.00 14.03  ? 988  TRP A CD2   1 
ATOM   5201  N NE1   . TRP A 1 680 ? -26.635 18.344  31.228  1.00 22.53  ? 988  TRP A NE1   1 
ATOM   5202  C CE2   . TRP A 1 680 ? -25.607 18.928  30.534  1.00 22.91  ? 988  TRP A CE2   1 
ATOM   5203  C CE3   . TRP A 1 680 ? -25.283 20.818  29.056  1.00 16.80  ? 988  TRP A CE3   1 
ATOM   5204  C CZ2   . TRP A 1 680 ? -24.262 18.568  30.448  1.00 17.15  ? 988  TRP A CZ2   1 
ATOM   5205  C CZ3   . TRP A 1 680 ? -23.935 20.459  28.978  1.00 16.58  ? 988  TRP A CZ3   1 
ATOM   5206  C CH2   . TRP A 1 680 ? -23.442 19.349  29.676  1.00 16.18  ? 988  TRP A CH2   1 
ATOM   5207  N N     . LYS A 1 681 ? -30.840 19.382  28.426  1.00 12.10  ? 989  LYS A N     1 
ATOM   5208  C CA    . LYS A 1 681 ? -31.541 18.095  28.314  1.00 9.88   ? 989  LYS A CA    1 
ATOM   5209  C C     . LYS A 1 681 ? -31.973 17.827  26.880  1.00 7.61   ? 989  LYS A C     1 
ATOM   5210  O O     . LYS A 1 681 ? -31.773 16.732  26.343  1.00 8.58   ? 989  LYS A O     1 
ATOM   5211  C CB    . LYS A 1 681 ? -32.768 18.102  29.231  1.00 15.21  ? 989  LYS A CB    1 
ATOM   5212  C CG    . LYS A 1 681 ? -33.410 16.740  29.432  1.00 28.34  ? 989  LYS A CG    1 
ATOM   5213  C CD    . LYS A 1 681 ? -34.566 16.523  28.487  1.00 46.42  ? 989  LYS A CD    1 
ATOM   5214  C CE    . LYS A 1 681 ? -35.257 15.203  28.769  1.00 53.05  ? 989  LYS A CE    1 
ATOM   5215  N NZ    . LYS A 1 681 ? -36.494 15.081  27.961  1.00 51.28  ? 989  LYS A NZ    1 
ATOM   5216  N N     . GLN A 1 682 ? -32.559 18.839  26.250  1.00 11.70  ? 990  GLN A N     1 
ATOM   5217  C CA    . GLN A 1 682 ? -33.170 18.672  24.932  1.00 10.80  ? 990  GLN A CA    1 
ATOM   5218  C C     . GLN A 1 682 ? -32.196 18.522  23.767  1.00 14.94  ? 990  GLN A C     1 
ATOM   5219  O O     . GLN A 1 682 ? -32.585 18.070  22.695  1.00 12.63  ? 990  GLN A O     1 
ATOM   5220  C CB    . GLN A 1 682 ? -34.145 19.823  24.648  1.00 15.87  ? 990  GLN A CB    1 
ATOM   5221  C CG    . GLN A 1 682 ? -35.348 19.787  25.547  1.00 16.87  ? 990  GLN A CG    1 
ATOM   5222  C CD    . GLN A 1 682 ? -36.266 18.627  25.216  1.00 33.28  ? 990  GLN A CD    1 
ATOM   5223  O OE1   . GLN A 1 682 ? -36.572 17.801  26.073  1.00 50.96  ? 990  GLN A OE1   1 
ATOM   5224  N NE2   . GLN A 1 682 ? -36.716 18.565  23.966  1.00 40.53  ? 990  GLN A NE2   1 
ATOM   5225  N N     . ARG A 1 683 ? -30.934 18.891  23.949  1.00 6.98   ? 991  ARG A N     1 
ATOM   5226  C CA    . ARG A 1 683 ? -29.992 18.660  22.852  1.00 10.84  ? 991  ARG A CA    1 
ATOM   5227  C C     . ARG A 1 683 ? -29.836 17.159  22.639  1.00 18.90  ? 991  ARG A C     1 
ATOM   5228  O O     . ARG A 1 683 ? -29.425 16.719  21.565  1.00 15.28  ? 991  ARG A O     1 
ATOM   5229  C CB    . ARG A 1 683 ? -28.651 19.353  23.094  1.00 24.94  ? 991  ARG A CB    1 
ATOM   5230  C CG    . ARG A 1 683 ? -27.774 18.639  24.074  1.00 23.22  ? 991  ARG A CG    1 
ATOM   5231  C CD    . ARG A 1 683 ? -26.898 19.577  24.908  1.00 17.73  ? 991  ARG A CD    1 
ATOM   5232  N NE    . ARG A 1 683 ? -26.619 18.876  26.155  1.00 14.29  ? 991  ARG A NE    1 
ATOM   5233  C CZ    . ARG A 1 683 ? -25.455 18.343  26.501  1.00 19.42  ? 991  ARG A CZ    1 
ATOM   5234  N NH1   . ARG A 1 683 ? -24.376 18.471  25.728  1.00 10.44  ? 991  ARG A NH1   1 
ATOM   5235  N NH2   . ARG A 1 683 ? -25.373 17.696  27.658  1.00 20.03  ? 991  ARG A NH2   1 
ATOM   5236  N N     . ILE A 1 684 ? -30.198 16.374  23.660  1.00 11.58  ? 992  ILE A N     1 
ATOM   5237  C CA    . ILE A 1 684 ? -30.181 14.911  23.580  1.00 10.74  ? 992  ILE A CA    1 
ATOM   5238  C C     . ILE A 1 684 ? -31.561 14.307  23.287  1.00 16.21  ? 992  ILE A C     1 
ATOM   5239  O O     . ILE A 1 684 ? -31.702 13.403  22.458  1.00 16.90  ? 992  ILE A O     1 
ATOM   5240  C CB    . ILE A 1 684 ? -29.654 14.290  24.898  1.00 18.49  ? 992  ILE A CB    1 
ATOM   5241  C CG1   . ILE A 1 684 ? -28.375 15.002  25.331  1.00 17.75  ? 992  ILE A CG1   1 
ATOM   5242  C CG2   . ILE A 1 684 ? -29.413 12.782  24.723  1.00 23.42  ? 992  ILE A CG2   1 
ATOM   5243  C CD1   . ILE A 1 684 ? -27.227 14.789  24.361  1.00 19.58  ? 992  ILE A CD1   1 
ATOM   5244  N N     . SER A 1 685 ? -32.585 14.802  23.972  1.00 12.63  ? 993  SER A N     1 
ATOM   5245  C CA    . SER A 1 685 ? -33.897 14.176  23.879  1.00 21.67  ? 993  SER A CA    1 
ATOM   5246  C C     . SER A 1 685 ? -34.722 14.662  22.683  1.00 17.49  ? 993  SER A C     1 
ATOM   5247  O O     . SER A 1 685 ? -35.690 14.019  22.291  1.00 20.35  ? 993  SER A O     1 
ATOM   5248  C CB    . SER A 1 685 ? -34.670 14.378  25.185  1.00 20.88  ? 993  SER A CB    1 
ATOM   5249  O OG    . SER A 1 685 ? -34.890 15.755  25.412  1.00 17.12  ? 993  SER A OG    1 
ATOM   5250  N N     . SER A 1 686 ? -34.351 15.801  22.108  1.00 10.76  ? 994  SER A N     1 
ATOM   5251  C CA    . SER A 1 686 ? -35.048 16.286  20.919  1.00 17.13  ? 994  SER A CA    1 
ATOM   5252  C C     . SER A 1 686 ? -34.402 15.670  19.672  1.00 11.70  ? 994  SER A C     1 
ATOM   5253  O O     . SER A 1 686 ? -33.391 14.977  19.764  1.00 13.96  ? 994  SER A O     1 
ATOM   5254  C CB    . SER A 1 686 ? -34.971 17.812  20.843  1.00 13.37  ? 994  SER A CB    1 
ATOM   5255  O OG    . SER A 1 686 ? -33.708 18.193  20.293  1.00 13.63  ? 994  SER A OG    1 
ATOM   5256  N N     . PRO A 1 687 ? -34.976 15.917  18.494  1.00 4.94   ? 995  PRO A N     1 
ATOM   5257  C CA    . PRO A 1 687 ? -34.313 15.356  17.304  1.00 10.08  ? 995  PRO A CA    1 
ATOM   5258  C C     . PRO A 1 687 ? -33.081 16.132  16.827  1.00 8.38   ? 995  PRO A C     1 
ATOM   5259  O O     . PRO A 1 687 ? -32.441 15.680  15.865  1.00 9.12   ? 995  PRO A O     1 
ATOM   5260  C CB    . PRO A 1 687 ? -35.402 15.445  16.215  1.00 11.34  ? 995  PRO A CB    1 
ATOM   5261  C CG    . PRO A 1 687 ? -36.693 15.757  16.946  1.00 16.36  ? 995  PRO A CG    1 
ATOM   5262  C CD    . PRO A 1 687 ? -36.291 16.502  18.177  1.00 13.15  ? 995  PRO A CD    1 
ATOM   5263  N N     . LEU A 1 688 ? -32.753 17.263  17.458  1.00 8.44   ? 996  LEU A N     1 
ATOM   5264  C CA    . LEU A 1 688 ? -31.804 18.217  16.854  1.00 10.13  ? 996  LEU A CA    1 
ATOM   5265  C C     . LEU A 1 688 ? -30.458 17.593  16.451  1.00 15.82  ? 996  LEU A C     1 
ATOM   5266  O O     . LEU A 1 688 ? -29.961 17.806  15.337  1.00 8.71   ? 996  LEU A O     1 
ATOM   5267  C CB    . LEU A 1 688 ? -31.612 19.456  17.753  1.00 3.82   ? 996  LEU A CB    1 
ATOM   5268  C CG    . LEU A 1 688 ? -30.752 20.568  17.146  1.00 9.80   ? 996  LEU A CG    1 
ATOM   5269  C CD1   . LEU A 1 688 ? -31.260 20.980  15.747  1.00 7.24   ? 996  LEU A CD1   1 
ATOM   5270  C CD2   . LEU A 1 688 ? -30.701 21.763  18.048  1.00 6.75   ? 996  LEU A CD2   1 
ATOM   5271  N N     . PHE A 1 689 ? -29.871 16.800  17.343  1.00 7.92   ? 997  PHE A N     1 
ATOM   5272  C CA    . PHE A 1 689 ? -28.566 16.216  17.052  1.00 7.21   ? 997  PHE A CA    1 
ATOM   5273  C C     . PHE A 1 689 ? -28.637 14.714  16.776  1.00 10.17  ? 997  PHE A C     1 
ATOM   5274  O O     . PHE A 1 689 ? -27.619 14.026  16.834  1.00 14.22  ? 997  PHE A O     1 
ATOM   5275  C CB    . PHE A 1 689 ? -27.596 16.485  18.205  1.00 8.82   ? 997  PHE A CB    1 
ATOM   5276  C CG    . PHE A 1 689 ? -27.263 17.936  18.400  1.00 11.70  ? 997  PHE A CG    1 
ATOM   5277  C CD1   . PHE A 1 689 ? -26.198 18.510  17.728  1.00 8.51   ? 997  PHE A CD1   1 
ATOM   5278  C CD2   . PHE A 1 689 ? -28.015 18.723  19.268  1.00 13.97  ? 997  PHE A CD2   1 
ATOM   5279  C CE1   . PHE A 1 689 ? -25.873 19.867  17.921  1.00 9.85   ? 997  PHE A CE1   1 
ATOM   5280  C CE2   . PHE A 1 689 ? -27.706 20.070  19.466  1.00 8.33   ? 997  PHE A CE2   1 
ATOM   5281  C CZ    . PHE A 1 689 ? -26.641 20.642  18.798  1.00 10.02  ? 997  PHE A CZ    1 
ATOM   5282  N N     . ASN A 1 690 ? -29.840 14.207  16.498  1.00 10.34  ? 998  ASN A N     1 
ATOM   5283  C CA    . ASN A 1 690 ? -30.043 12.772  16.287  1.00 11.13  ? 998  ASN A CA    1 
ATOM   5284  C C     . ASN A 1 690 ? -29.848 12.427  14.818  1.00 9.34   ? 998  ASN A C     1 
ATOM   5285  O O     . ASN A 1 690 ? -30.776 12.522  14.026  1.00 10.43  ? 998  ASN A O     1 
ATOM   5286  C CB    . ASN A 1 690 ? -31.453 12.350  16.745  1.00 10.60  ? 998  ASN A CB    1 
ATOM   5287  C CG    . ASN A 1 690 ? -31.610 10.845  16.855  1.00 14.47  ? 998  ASN A CG    1 
ATOM   5288  O OD1   . ASN A 1 690 ? -31.140 10.102  16.005  1.00 12.79  ? 998  ASN A OD1   1 
ATOM   5289  N ND2   . ASN A 1 690 ? -32.301 10.392  17.904  1.00 18.66  ? 998  ASN A ND2   1 
ATOM   5290  N N     . THR A 1 691 ? -28.632 12.037  14.456  1.00 10.34  ? 999  THR A N     1 
ATOM   5291  C CA    . THR A 1 691 ? -28.291 11.831  13.052  1.00 11.60  ? 999  THR A CA    1 
ATOM   5292  C C     . THR A 1 691 ? -28.984 10.616  12.444  1.00 11.20  ? 999  THR A C     1 
ATOM   5293  O O     . THR A 1 691 ? -29.295 10.609  11.250  1.00 13.99  ? 999  THR A O     1 
ATOM   5294  C CB    . THR A 1 691 ? -26.764 11.755  12.854  1.00 13.90  ? 999  THR A CB    1 
ATOM   5295  O OG1   . THR A 1 691 ? -26.206 10.827  13.786  1.00 17.84  ? 999  THR A OG1   1 
ATOM   5296  C CG2   . THR A 1 691 ? -26.150 13.127  13.106  1.00 7.38   ? 999  THR A CG2   1 
ATOM   5297  N N     . LYS A 1 692 ? -29.251 9.602   13.261  1.00 8.19   ? 1000 LYS A N     1 
ATOM   5298  C CA    . LYS A 1 692 ? -29.963 8.432   12.758  1.00 12.99  ? 1000 LYS A CA    1 
ATOM   5299  C C     . LYS A 1 692 ? -31.397 8.806   12.390  1.00 8.86   ? 1000 LYS A C     1 
ATOM   5300  O O     . LYS A 1 692 ? -31.862 8.490   11.295  1.00 10.89  ? 1000 LYS A O     1 
ATOM   5301  C CB    . LYS A 1 692 ? -29.944 7.279   13.759  1.00 13.26  ? 1000 LYS A CB    1 
ATOM   5302  C CG    . LYS A 1 692 ? -30.623 5.998   13.223  1.00 13.31  ? 1000 LYS A CG    1 
ATOM   5303  C CD    . LYS A 1 692 ? -29.874 5.470   11.988  1.00 12.56  ? 1000 LYS A CD    1 
ATOM   5304  C CE    . LYS A 1 692 ? -30.552 4.242   11.367  1.00 26.03  ? 1000 LYS A CE    1 
ATOM   5305  N NZ    . LYS A 1 692 ? -29.671 3.591   10.337  1.00 18.01  ? 1000 LYS A NZ    1 
ATOM   5306  N N     . GLN A 1 693 ? -32.088 9.491   13.296  1.00 12.98  ? 1001 GLN A N     1 
ATOM   5307  C CA    . GLN A 1 693 ? -33.441 9.954   13.010  1.00 14.77  ? 1001 GLN A CA    1 
ATOM   5308  C C     . GLN A 1 693 ? -33.460 10.886  11.798  1.00 8.60   ? 1001 GLN A C     1 
ATOM   5309  O O     . GLN A 1 693 ? -34.311 10.769  10.915  1.00 11.36  ? 1001 GLN A O     1 
ATOM   5310  C CB    . GLN A 1 693 ? -34.026 10.662  14.225  1.00 11.35  ? 1001 GLN A CB    1 
ATOM   5311  C CG    . GLN A 1 693 ? -35.440 11.216  13.999  1.00 19.71  ? 1001 GLN A CG    1 
ATOM   5312  C CD    . GLN A 1 693 ? -36.053 11.772  15.275  1.00 24.80  ? 1001 GLN A CD    1 
ATOM   5313  O OE1   . GLN A 1 693 ? -35.541 11.550  16.366  1.00 32.34  ? 1001 GLN A OE1   1 
ATOM   5314  N NE2   . GLN A 1 693 ? -37.152 12.495  15.139  1.00 25.63  ? 1001 GLN A NE2   1 
ATOM   5315  N N     . TYR A 1 694 ? -32.502 11.803  11.741  1.00 10.11  ? 1002 TYR A N     1 
ATOM   5316  C CA    . TYR A 1 694 ? -32.401 12.701  10.595  1.00 13.50  ? 1002 TYR A CA    1 
ATOM   5317  C C     . TYR A 1 694 ? -32.267 11.911  9.285   1.00 8.90   ? 1002 TYR A C     1 
ATOM   5318  O O     . TYR A 1 694 ? -33.000 12.152  8.319   1.00 12.59  ? 1002 TYR A O     1 
ATOM   5319  C CB    . TYR A 1 694 ? -31.220 13.663  10.752  1.00 11.12  ? 1002 TYR A CB    1 
ATOM   5320  C CG    . TYR A 1 694 ? -31.190 14.717  9.668   1.00 12.09  ? 1002 TYR A CG    1 
ATOM   5321  C CD1   . TYR A 1 694 ? -31.789 15.958  9.861   1.00 14.99  ? 1002 TYR A CD1   1 
ATOM   5322  C CD2   . TYR A 1 694 ? -30.599 14.457  8.438   1.00 7.86   ? 1002 TYR A CD2   1 
ATOM   5323  C CE1   . TYR A 1 694 ? -31.774 16.921  8.864   1.00 15.95  ? 1002 TYR A CE1   1 
ATOM   5324  C CE2   . TYR A 1 694 ? -30.583 15.407  7.442   1.00 11.39  ? 1002 TYR A CE2   1 
ATOM   5325  C CZ    . TYR A 1 694 ? -31.173 16.634  7.656   1.00 12.08  ? 1002 TYR A CZ    1 
ATOM   5326  O OH    . TYR A 1 694 ? -31.162 17.578  6.660   1.00 12.81  ? 1002 TYR A OH    1 
ATOM   5327  N N     . THR A 1 695 ? -31.339 10.963  9.256   1.00 7.00   ? 1003 THR A N     1 
ATOM   5328  C CA    . THR A 1 695 ? -31.135 10.159  8.048   1.00 11.78  ? 1003 THR A CA    1 
ATOM   5329  C C     . THR A 1 695 ? -32.419 9.431   7.642   1.00 16.30  ? 1003 THR A C     1 
ATOM   5330  O O     . THR A 1 695 ? -32.781 9.380   6.459   1.00 9.35   ? 1003 THR A O     1 
ATOM   5331  C CB    . THR A 1 695 ? -29.981 9.145   8.226   1.00 11.50  ? 1003 THR A CB    1 
ATOM   5332  O OG1   . THR A 1 695 ? -28.787 9.850   8.595   1.00 10.30  ? 1003 THR A OG1   1 
ATOM   5333  C CG2   . THR A 1 695 ? -29.731 8.384   6.922   1.00 9.04   ? 1003 THR A CG2   1 
ATOM   5334  N N     . MET A 1 696 ? -33.121 8.884   8.621   1.00 11.59  ? 1004 MET A N     1 
ATOM   5335  C CA    . MET A 1 696 ? -34.352 8.167   8.312   1.00 12.28  ? 1004 MET A CA    1 
ATOM   5336  C C     . MET A 1 696 ? -35.445 9.080   7.758   1.00 17.00  ? 1004 MET A C     1 
ATOM   5337  O O     . MET A 1 696 ? -36.234 8.673   6.900   1.00 11.63  ? 1004 MET A O     1 
ATOM   5338  C CB    . MET A 1 696 ? -34.836 7.372   9.525   1.00 10.93  ? 1004 MET A CB    1 
ATOM   5339  C CG    . MET A 1 696 ? -33.909 6.215   9.851   1.00 15.96  ? 1004 MET A CG    1 
ATOM   5340  S SD    . MET A 1 696 ? -34.360 5.328   11.345  1.00 15.81  ? 1004 MET A SD    1 
ATOM   5341  C CE    . MET A 1 696 ? -35.979 4.724   10.882  1.00 17.39  ? 1004 MET A CE    1 
ATOM   5342  N N     . GLU A 1 697 ? -35.488 10.315  8.234   1.00 12.89  ? 1005 GLU A N     1 
ATOM   5343  C CA    . GLU A 1 697 ? -36.480 11.266  7.738   1.00 20.23  ? 1005 GLU A CA    1 
ATOM   5344  C C     . GLU A 1 697 ? -36.101 11.765  6.350   1.00 18.74  ? 1005 GLU A C     1 
ATOM   5345  O O     . GLU A 1 697 ? -36.963 11.989  5.500   1.00 14.70  ? 1005 GLU A O     1 
ATOM   5346  C CB    . GLU A 1 697 ? -36.664 12.428  8.723   1.00 13.41  ? 1005 GLU A CB    1 
ATOM   5347  C CG    . GLU A 1 697 ? -37.296 12.006  10.041  1.00 19.86  ? 1005 GLU A CG    1 
ATOM   5348  C CD    . GLU A 1 697 ? -38.690 11.454  9.854   1.00 26.87  ? 1005 GLU A CD    1 
ATOM   5349  O OE1   . GLU A 1 697 ? -39.223 11.560  8.728   1.00 27.96  ? 1005 GLU A OE1   1 
ATOM   5350  O OE2   . GLU A 1 697 ? -39.259 10.916  10.826  1.00 51.70  ? 1005 GLU A OE2   1 
ATOM   5351  N N     . LEU A 1 698 ? -34.799 11.923  6.127   1.00 14.44  ? 1006 LEU A N     1 
ATOM   5352  C CA    . LEU A 1 698 ? -34.263 12.230  4.805   1.00 11.33  ? 1006 LEU A CA    1 
ATOM   5353  C C     . LEU A 1 698 ? -34.666 11.125  3.817   1.00 15.21  ? 1006 LEU A C     1 
ATOM   5354  O O     . LEU A 1 698 ? -35.098 11.391  2.688   1.00 14.71  ? 1006 LEU A O     1 
ATOM   5355  C CB    . LEU A 1 698 ? -32.737 12.336  4.914   1.00 8.84   ? 1006 LEU A CB    1 
ATOM   5356  C CG    . LEU A 1 698 ? -31.874 12.871  3.765   1.00 15.64  ? 1006 LEU A CG    1 
ATOM   5357  C CD1   . LEU A 1 698 ? -32.404 14.195  3.235   1.00 27.03  ? 1006 LEU A CD1   1 
ATOM   5358  C CD2   . LEU A 1 698 ? -30.455 13.041  4.269   1.00 11.87  ? 1006 LEU A CD2   1 
ATOM   5359  N N     . GLU A 1 699 ? -34.539 9.876   4.254   1.00 12.49  ? 1007 GLU A N     1 
ATOM   5360  C CA    . GLU A 1 699 ? -34.904 8.739   3.420   1.00 8.84   ? 1007 GLU A CA    1 
ATOM   5361  C C     . GLU A 1 699 ? -36.395 8.743   3.055   1.00 15.55  ? 1007 GLU A C     1 
ATOM   5362  O O     . GLU A 1 699 ? -36.751 8.498   1.908   1.00 11.99  ? 1007 GLU A O     1 
ATOM   5363  C CB    . GLU A 1 699 ? -34.485 7.421   4.098   1.00 10.50  ? 1007 GLU A CB    1 
ATOM   5364  C CG    . GLU A 1 699 ? -32.974 7.181   4.012   1.00 16.80  ? 1007 GLU A CG    1 
ATOM   5365  C CD    . GLU A 1 699 ? -32.478 6.038   4.896   1.00 18.67  ? 1007 GLU A CD    1 
ATOM   5366  O OE1   . GLU A 1 699 ? -33.114 5.737   5.924   1.00 17.19  ? 1007 GLU A OE1   1 
ATOM   5367  O OE2   . GLU A 1 699 ? -31.442 5.443   4.552   1.00 16.22  ? 1007 GLU A OE2   1 
ATOM   5368  N N     . ARG A 1 700 ? -37.258 9.023   4.028   1.00 16.94  ? 1008 ARG A N     1 
ATOM   5369  C CA    . ARG A 1 700 ? -38.692 9.165   3.754   1.00 20.29  ? 1008 ARG A CA    1 
ATOM   5370  C C     . ARG A 1 700 ? -38.940 10.224  2.686   1.00 20.95  ? 1008 ARG A C     1 
ATOM   5371  O O     . ARG A 1 700 ? -39.733 10.026  1.772   1.00 14.97  ? 1008 ARG A O     1 
ATOM   5372  C CB    . ARG A 1 700 ? -39.454 9.548   5.025   1.00 25.05  ? 1008 ARG A CB    1 
ATOM   5373  C CG    . ARG A 1 700 ? -39.449 8.490   6.112   1.00 44.51  ? 1008 ARG A CG    1 
ATOM   5374  C CD    . ARG A 1 700 ? -40.461 8.828   7.198   1.00 58.51  ? 1008 ARG A CD    1 
ATOM   5375  N NE    . ARG A 1 700 ? -41.828 8.815   6.682   1.00 73.95  ? 1008 ARG A NE    1 
ATOM   5376  C CZ    . ARG A 1 700 ? -42.631 7.757   6.724   1.00 85.49  ? 1008 ARG A CZ    1 
ATOM   5377  N NH1   . ARG A 1 700 ? -42.207 6.622   7.266   1.00 92.33  ? 1008 ARG A NH1   1 
ATOM   5378  N NH2   . ARG A 1 700 ? -43.860 7.830   6.228   1.00 83.02  ? 1008 ARG A NH2   1 
ATOM   5379  N N     . LEU A 1 701 ? -38.251 11.353  2.806   1.00 16.16  ? 1009 LEU A N     1 
ATOM   5380  C CA    . LEU A 1 701 ? -38.405 12.444  1.852   1.00 13.72  ? 1009 LEU A CA    1 
ATOM   5381  C C     . LEU A 1 701 ? -37.944 12.038  0.452   1.00 18.77  ? 1009 LEU A C     1 
ATOM   5382  O O     . LEU A 1 701 ? -38.638 12.306  -0.532  1.00 18.65  ? 1009 LEU A O     1 
ATOM   5383  C CB    . LEU A 1 701 ? -37.650 13.689  2.348   1.00 16.70  ? 1009 LEU A CB    1 
ATOM   5384  C CG    . LEU A 1 701 ? -37.795 14.976  1.535   1.00 16.37  ? 1009 LEU A CG    1 
ATOM   5385  C CD1   . LEU A 1 701 ? -39.267 15.373  1.385   1.00 16.78  ? 1009 LEU A CD1   1 
ATOM   5386  C CD2   . LEU A 1 701 ? -36.996 16.082  2.198   1.00 14.67  ? 1009 LEU A CD2   1 
ATOM   5387  N N     . TYR A 1 702 ? -36.788 11.376  0.367   1.00 12.56  ? 1010 TYR A N     1 
ATOM   5388  C CA    . TYR A 1 702 ? -36.268 10.866  -0.903  1.00 16.12  ? 1010 TYR A CA    1 
ATOM   5389  C C     . TYR A 1 702 ? -37.284 9.976   -1.606  1.00 20.74  ? 1010 TYR A C     1 
ATOM   5390  O O     . TYR A 1 702 ? -37.495 10.082  -2.820  1.00 18.13  ? 1010 TYR A O     1 
ATOM   5391  C CB    . TYR A 1 702 ? -34.971 10.063  -0.699  1.00 10.73  ? 1010 TYR A CB    1 
ATOM   5392  C CG    . TYR A 1 702 ? -33.724 10.879  -0.392  1.00 11.75  ? 1010 TYR A CG    1 
ATOM   5393  C CD1   . TYR A 1 702 ? -33.654 12.244  -0.672  1.00 12.24  ? 1010 TYR A CD1   1 
ATOM   5394  C CD2   . TYR A 1 702 ? -32.615 10.274  0.188   1.00 11.64  ? 1010 TYR A CD2   1 
ATOM   5395  C CE1   . TYR A 1 702 ? -32.499 12.975  -0.380  1.00 14.42  ? 1010 TYR A CE1   1 
ATOM   5396  C CE2   . TYR A 1 702 ? -31.475 10.989  0.479   1.00 12.61  ? 1010 TYR A CE2   1 
ATOM   5397  C CZ    . TYR A 1 702 ? -31.417 12.335  0.197   1.00 13.45  ? 1010 TYR A CZ    1 
ATOM   5398  O OH    . TYR A 1 702 ? -30.260 13.025  0.504   1.00 13.63  ? 1010 TYR A OH    1 
ATOM   5399  N N     . LEU A 1 703 ? -37.908 9.089   -0.842  1.00 20.21  ? 1011 LEU A N     1 
ATOM   5400  C CA    . LEU A 1 703 ? -38.880 8.168   -1.415  1.00 17.49  ? 1011 LEU A CA    1 
ATOM   5401  C C     . LEU A 1 703 ? -40.131 8.895   -1.912  1.00 27.51  ? 1011 LEU A C     1 
ATOM   5402  O O     . LEU A 1 703 ? -40.718 8.503   -2.920  1.00 23.02  ? 1011 LEU A O     1 
ATOM   5403  C CB    . LEU A 1 703 ? -39.236 7.056   -0.421  1.00 16.68  ? 1011 LEU A CB    1 
ATOM   5404  C CG    . LEU A 1 703 ? -38.097 6.064   -0.151  1.00 26.70  ? 1011 LEU A CG    1 
ATOM   5405  C CD1   . LEU A 1 703 ? -38.429 5.134   1.001   1.00 26.96  ? 1011 LEU A CD1   1 
ATOM   5406  C CD2   . LEU A 1 703 ? -37.770 5.272   -1.412  1.00 38.08  ? 1011 LEU A CD2   1 
ATOM   5407  N N     . GLN A 1 704 ? -40.533 9.949   -1.207  1.00 19.64  ? 1012 GLN A N     1 
ATOM   5408  C CA    . GLN A 1 704 ? -41.636 10.789  -1.664  1.00 23.49  ? 1012 GLN A CA    1 
ATOM   5409  C C     . GLN A 1 704 ? -41.304 11.415  -3.015  1.00 24.00  ? 1012 GLN A C     1 
ATOM   5410  O O     . GLN A 1 704 ? -42.110 11.377  -3.948  1.00 21.39  ? 1012 GLN A O     1 
ATOM   5411  C CB    . GLN A 1 704 ? -41.939 11.901  -0.655  1.00 27.08  ? 1012 GLN A CB    1 
ATOM   5412  C CG    . GLN A 1 704 ? -42.637 11.449  0.619   1.00 36.30  ? 1012 GLN A CG    1 
ATOM   5413  C CD    . GLN A 1 704 ? -42.866 12.597  1.589   1.00 53.83  ? 1012 GLN A CD    1 
ATOM   5414  O OE1   . GLN A 1 704 ? -42.691 12.446  2.798   1.00 62.09  ? 1012 GLN A OE1   1 
ATOM   5415  N NE2   . GLN A 1 704 ? -43.257 13.752  1.059   1.00 49.33  ? 1012 GLN A NE2   1 
ATOM   5416  N N     . MET A 1 705 ? -40.117 12.008  -3.108  1.00 21.34  ? 1013 MET A N     1 
ATOM   5417  C CA    . MET A 1 705 ? -39.651 12.594  -4.360  1.00 16.57  ? 1013 MET A CA    1 
ATOM   5418  C C     . MET A 1 705 ? -39.684 11.554  -5.462  1.00 25.14  ? 1013 MET A C     1 
ATOM   5419  O O     . MET A 1 705 ? -40.165 11.813  -6.568  1.00 23.03  ? 1013 MET A O     1 
ATOM   5420  C CB    . MET A 1 705 ? -38.211 13.096  -4.218  1.00 23.39  ? 1013 MET A CB    1 
ATOM   5421  C CG    . MET A 1 705 ? -38.027 14.288  -3.326  1.00 21.58  ? 1013 MET A CG    1 
ATOM   5422  S SD    . MET A 1 705 ? -36.274 14.682  -3.149  1.00 20.78  ? 1013 MET A SD    1 
ATOM   5423  C CE    . MET A 1 705 ? -36.372 16.153  -2.136  1.00 17.38  ? 1013 MET A CE    1 
ATOM   5424  N N     . TRP A 1 706 ? -39.154 10.372  -5.164  1.00 21.87  ? 1014 TRP A N     1 
ATOM   5425  C CA    . TRP A 1 706 ? -39.062 9.342   -6.186  1.00 23.36  ? 1014 TRP A CA    1 
ATOM   5426  C C     . TRP A 1 706 ? -40.423 8.849   -6.663  1.00 23.71  ? 1014 TRP A C     1 
ATOM   5427  O O     . TRP A 1 706 ? -40.643 8.722   -7.868  1.00 27.83  ? 1014 TRP A O     1 
ATOM   5428  C CB    . TRP A 1 706 ? -38.217 8.153   -5.742  1.00 17.82  ? 1014 TRP A CB    1 
ATOM   5429  C CG    . TRP A 1 706 ? -38.244 7.081   -6.788  1.00 24.56  ? 1014 TRP A CG    1 
ATOM   5430  C CD1   . TRP A 1 706 ? -38.918 5.895   -6.733  1.00 32.44  ? 1014 TRP A CD1   1 
ATOM   5431  C CD2   . TRP A 1 706 ? -37.611 7.124   -8.071  1.00 21.79  ? 1014 TRP A CD2   1 
ATOM   5432  N NE1   . TRP A 1 706 ? -38.727 5.189   -7.895  1.00 21.67  ? 1014 TRP A NE1   1 
ATOM   5433  C CE2   . TRP A 1 706 ? -37.928 5.921   -8.734  1.00 26.05  ? 1014 TRP A CE2   1 
ATOM   5434  C CE3   . TRP A 1 706 ? -36.801 8.061   -8.723  1.00 26.25  ? 1014 TRP A CE3   1 
ATOM   5435  C CZ2   . TRP A 1 706 ? -37.462 5.629   -10.012 1.00 22.20  ? 1014 TRP A CZ2   1 
ATOM   5436  C CZ3   . TRP A 1 706 ? -36.339 7.768   -9.992  1.00 25.04  ? 1014 TRP A CZ3   1 
ATOM   5437  C CH2   . TRP A 1 706 ? -36.672 6.561   -10.623 1.00 28.18  ? 1014 TRP A CH2   1 
ATOM   5438  N N     . GLU A 1 707 ? -41.325 8.558   -5.728  1.00 23.97  ? 1015 GLU A N     1 
ATOM   5439  C CA    . GLU A 1 707 ? -42.636 8.028   -6.101  1.00 32.00  ? 1015 GLU A CA    1 
ATOM   5440  C C     . GLU A 1 707 ? -43.391 9.056   -6.932  1.00 31.75  ? 1015 GLU A C     1 
ATOM   5441  O O     . GLU A 1 707 ? -44.126 8.704   -7.853  1.00 32.84  ? 1015 GLU A O     1 
ATOM   5442  C CB    . GLU A 1 707 ? -43.457 7.624   -4.868  1.00 26.00  ? 1015 GLU A CB    1 
ATOM   5443  C CG    . GLU A 1 707 ? -42.823 6.522   -4.015  1.00 39.83  ? 1015 GLU A CG    1 
ATOM   5444  C CD    . GLU A 1 707 ? -42.704 5.193   -4.747  1.00 60.72  ? 1015 GLU A CD    1 
ATOM   5445  O OE1   . GLU A 1 707 ? -43.529 4.927   -5.649  1.00 64.70  ? 1015 GLU A OE1   1 
ATOM   5446  O OE2   . GLU A 1 707 ? -41.784 4.412   -4.420  1.00 70.58  ? 1015 GLU A OE2   1 
ATOM   5447  N N     . HIS A 1 708 ? -43.196 10.330  -6.603  1.00 25.66  ? 1016 HIS A N     1 
ATOM   5448  C CA    . HIS A 1 708 ? -43.816 11.422  -7.342  1.00 24.91  ? 1016 HIS A CA    1 
ATOM   5449  C C     . HIS A 1 708 ? -43.344 11.413  -8.795  1.00 22.72  ? 1016 HIS A C     1 
ATOM   5450  O O     . HIS A 1 708 ? -44.151 11.467  -9.721  1.00 25.45  ? 1016 HIS A O     1 
ATOM   5451  C CB    . HIS A 1 708 ? -43.469 12.764  -6.681  1.00 24.39  ? 1016 HIS A CB    1 
ATOM   5452  C CG    . HIS A 1 708 ? -44.248 13.924  -7.215  1.00 25.45  ? 1016 HIS A CG    1 
ATOM   5453  N ND1   . HIS A 1 708 ? -45.610 14.048  -7.045  1.00 25.46  ? 1016 HIS A ND1   1 
ATOM   5454  C CD2   . HIS A 1 708 ? -43.854 15.019  -7.906  1.00 28.11  ? 1016 HIS A CD2   1 
ATOM   5455  C CE1   . HIS A 1 708 ? -46.023 15.167  -7.614  1.00 28.67  ? 1016 HIS A CE1   1 
ATOM   5456  N NE2   . HIS A 1 708 ? -44.978 15.773  -8.148  1.00 26.65  ? 1016 HIS A NE2   1 
ATOM   5457  N N     . TYR A 1 709 ? -42.030 11.340  -8.984  1.00 20.99  ? 1017 TYR A N     1 
ATOM   5458  C CA    . TYR A 1 709 ? -41.440 11.290  -10.321 1.00 19.59  ? 1017 TYR A CA    1 
ATOM   5459  C C     . TYR A 1 709 ? -41.800 10.004  -11.063 1.00 28.57  ? 1017 TYR A C     1 
ATOM   5460  O O     . TYR A 1 709 ? -42.110 10.035  -12.252 1.00 29.05  ? 1017 TYR A O     1 
ATOM   5461  C CB    . TYR A 1 709 ? -39.920 11.432  -10.240 1.00 27.79  ? 1017 TYR A CB    1 
ATOM   5462  C CG    . TYR A 1 709 ? -39.199 11.064  -11.519 1.00 32.16  ? 1017 TYR A CG    1 
ATOM   5463  C CD1   . TYR A 1 709 ? -39.074 11.979  -12.560 1.00 33.03  ? 1017 TYR A CD1   1 
ATOM   5464  C CD2   . TYR A 1 709 ? -38.647 9.802   -11.687 1.00 30.45  ? 1017 TYR A CD2   1 
ATOM   5465  C CE1   . TYR A 1 709 ? -38.418 11.646  -13.731 1.00 33.66  ? 1017 TYR A CE1   1 
ATOM   5466  C CE2   . TYR A 1 709 ? -37.990 9.461   -12.853 1.00 29.99  ? 1017 TYR A CE2   1 
ATOM   5467  C CZ    . TYR A 1 709 ? -37.873 10.385  -13.869 1.00 32.86  ? 1017 TYR A CZ    1 
ATOM   5468  O OH    . TYR A 1 709 ? -37.212 10.036  -15.026 1.00 42.04  ? 1017 TYR A OH    1 
ATOM   5469  N N     . ALA A 1 710 ? -41.744 8.880   -10.357 1.00 23.49  ? 1018 ALA A N     1 
ATOM   5470  C CA    . ALA A 1 710 ? -42.024 7.576   -10.951 1.00 29.37  ? 1018 ALA A CA    1 
ATOM   5471  C C     . ALA A 1 710 ? -43.440 7.507   -11.513 1.00 35.65  ? 1018 ALA A C     1 
ATOM   5472  O O     . ALA A 1 710 ? -43.688 6.814   -12.499 1.00 32.14  ? 1018 ALA A O     1 
ATOM   5473  C CB    . ALA A 1 710 ? -41.814 6.473   -9.931  1.00 26.04  ? 1018 ALA A CB    1 
ATOM   5474  N N     . ALA A 1 711 ? -44.361 8.223   -10.875 1.00 36.25  ? 1019 ALA A N     1 
ATOM   5475  C CA    . ALA A 1 711 ? -45.751 8.258   -11.309 1.00 30.94  ? 1019 ALA A CA    1 
ATOM   5476  C C     . ALA A 1 711 ? -45.934 9.231   -12.473 1.00 26.43  ? 1019 ALA A C     1 
ATOM   5477  O O     . ALA A 1 711 ? -47.050 9.451   -12.935 1.00 35.32  ? 1019 ALA A O     1 
ATOM   5478  C CB    . ALA A 1 711 ? -46.657 8.634   -10.149 1.00 30.22  ? 1019 ALA A CB    1 
ATOM   5479  N N     . GLY A 1 712 ? -44.834 9.822   -12.930 1.00 30.89  ? 1020 GLY A N     1 
ATOM   5480  C CA    . GLY A 1 712 ? -44.849 10.664  -14.113 1.00 38.35  ? 1020 GLY A CA    1 
ATOM   5481  C C     . GLY A 1 712 ? -45.123 12.139  -13.875 1.00 36.06  ? 1020 GLY A C     1 
ATOM   5482  O O     . GLY A 1 712 ? -45.486 12.862  -14.806 1.00 34.04  ? 1020 GLY A O     1 
ATOM   5483  N N     . ASN A 1 713 ? -44.946 12.592  -12.636 1.00 23.91  ? 1021 ASN A N     1 
ATOM   5484  C CA    . ASN A 1 713 ? -45.179 13.994  -12.300 1.00 27.13  ? 1021 ASN A CA    1 
ATOM   5485  C C     . ASN A 1 713 ? -43.899 14.819  -12.280 1.00 31.82  ? 1021 ASN A C     1 
ATOM   5486  O O     . ASN A 1 713 ? -42.828 14.319  -11.930 1.00 29.69  ? 1021 ASN A O     1 
ATOM   5487  C CB    . ASN A 1 713 ? -45.884 14.126  -10.947 1.00 27.93  ? 1021 ASN A CB    1 
ATOM   5488  C CG    . ASN A 1 713 ? -47.164 13.320  -10.874 1.00 37.27  ? 1021 ASN A CG    1 
ATOM   5489  O OD1   . ASN A 1 713 ? -48.155 13.651  -11.524 1.00 31.91  ? 1021 ASN A OD1   1 
ATOM   5490  N ND2   . ASN A 1 713 ? -47.155 12.262  -10.069 1.00 32.17  ? 1021 ASN A ND2   1 
ATOM   5491  N N     . LYS A 1 714 ? -44.017 16.088  -12.659 1.00 24.93  ? 1022 LYS A N     1 
ATOM   5492  C CA    . LYS A 1 714 ? -42.933 17.039  -12.479 1.00 26.15  ? 1022 LYS A CA    1 
ATOM   5493  C C     . LYS A 1 714 ? -42.885 17.427  -11.003 1.00 23.94  ? 1022 LYS A C     1 
ATOM   5494  O O     . LYS A 1 714 ? -43.865 17.247  -10.282 1.00 24.23  ? 1022 LYS A O     1 
ATOM   5495  C CB    . LYS A 1 714 ? -43.154 18.282  -13.343 1.00 33.87  ? 1022 LYS A CB    1 
ATOM   5496  C CG    . LYS A 1 714 ? -42.998 18.050  -14.841 1.00 38.53  ? 1022 LYS A CG    1 
ATOM   5497  C CD    . LYS A 1 714 ? -43.259 19.341  -15.610 1.00 52.07  ? 1022 LYS A CD    1 
ATOM   5498  C CE    . LYS A 1 714 ? -43.041 19.164  -17.106 1.00 63.78  ? 1022 LYS A CE    1 
ATOM   5499  N NZ    . LYS A 1 714 ? -43.267 20.438  -17.846 1.00 70.00  ? 1022 LYS A NZ    1 
ATOM   5500  N N     . PRO A 1 715 ? -41.749 17.969  -10.545 1.00 25.07  ? 1023 PRO A N     1 
ATOM   5501  C CA    . PRO A 1 715 ? -41.633 18.290  -9.120  1.00 15.48  ? 1023 PRO A CA    1 
ATOM   5502  C C     . PRO A 1 715 ? -42.724 19.231  -8.618  1.00 25.76  ? 1023 PRO A C     1 
ATOM   5503  O O     . PRO A 1 715 ? -43.108 20.184  -9.303  1.00 22.02  ? 1023 PRO A O     1 
ATOM   5504  C CB    . PRO A 1 715 ? -40.264 18.975  -9.030  1.00 24.98  ? 1023 PRO A CB    1 
ATOM   5505  C CG    . PRO A 1 715 ? -39.499 18.428  -10.181 1.00 21.67  ? 1023 PRO A CG    1 
ATOM   5506  C CD    . PRO A 1 715 ? -40.514 18.284  -11.282 1.00 21.00  ? 1023 PRO A CD    1 
ATOM   5507  N N     . ASP A 1 716 ? -43.212 18.954  -7.415  1.00 24.90  ? 1024 ASP A N     1 
ATOM   5508  C CA    . ASP A 1 716 ? -44.152 19.834  -6.734  1.00 27.73  ? 1024 ASP A CA    1 
ATOM   5509  C C     . ASP A 1 716 ? -43.733 19.891  -5.273  1.00 27.48  ? 1024 ASP A C     1 
ATOM   5510  O O     . ASP A 1 716 ? -42.965 19.042  -4.819  1.00 21.56  ? 1024 ASP A O     1 
ATOM   5511  C CB    . ASP A 1 716 ? -45.578 19.293  -6.855  1.00 31.45  ? 1024 ASP A CB    1 
ATOM   5512  C CG    . ASP A 1 716 ? -46.630 20.324  -6.485  1.00 42.57  ? 1024 ASP A CG    1 
ATOM   5513  O OD1   . ASP A 1 716 ? -46.279 21.515  -6.338  1.00 33.65  ? 1024 ASP A OD1   1 
ATOM   5514  O OD2   . ASP A 1 716 ? -47.812 19.943  -6.350  1.00 47.59  ? 1024 ASP A OD2   1 
ATOM   5515  N N     . HIS A 1 717 ? -44.231 20.880  -4.536  1.00 15.31  ? 1025 HIS A N     1 
ATOM   5516  C CA    . HIS A 1 717 ? -43.869 21.025  -3.125  1.00 24.54  ? 1025 HIS A CA    1 
ATOM   5517  C C     . HIS A 1 717 ? -44.192 19.762  -2.323  1.00 28.10  ? 1025 HIS A C     1 
ATOM   5518  O O     . HIS A 1 717 ? -45.275 19.177  -2.458  1.00 20.61  ? 1025 HIS A O     1 
ATOM   5519  C CB    . HIS A 1 717 ? -44.569 22.235  -2.492  1.00 23.51  ? 1025 HIS A CB    1 
ATOM   5520  C CG    . HIS A 1 717 ? -44.309 23.532  -3.198  1.00 26.84  ? 1025 HIS A CG    1 
ATOM   5521  N ND1   . HIS A 1 717 ? -43.073 24.142  -3.206  1.00 21.25  ? 1025 HIS A ND1   1 
ATOM   5522  C CD2   . HIS A 1 717 ? -45.133 24.342  -3.906  1.00 25.05  ? 1025 HIS A CD2   1 
ATOM   5523  C CE1   . HIS A 1 717 ? -43.143 25.268  -3.895  1.00 24.13  ? 1025 HIS A CE1   1 
ATOM   5524  N NE2   . HIS A 1 717 ? -44.382 25.412  -4.332  1.00 26.87  ? 1025 HIS A NE2   1 
ATOM   5525  N N     . MET A 1 718 ? -43.241 19.345  -1.495  1.00 23.76  ? 1026 MET A N     1 
ATOM   5526  C CA    . MET A 1 718 ? -43.432 18.213  -0.598  1.00 24.11  ? 1026 MET A CA    1 
ATOM   5527  C C     . MET A 1 718 ? -43.479 18.762  0.815   1.00 32.62  ? 1026 MET A C     1 
ATOM   5528  O O     . MET A 1 718 ? -42.472 18.771  1.525   1.00 25.12  ? 1026 MET A O     1 
ATOM   5529  C CB    . MET A 1 718 ? -42.276 17.215  -0.722  1.00 23.12  ? 1026 MET A CB    1 
ATOM   5530  C CG    . MET A 1 718 ? -42.078 16.632  -2.115  1.00 29.66  ? 1026 MET A CG    1 
ATOM   5531  S SD    . MET A 1 718 ? -43.382 15.469  -2.576  1.00 45.35  ? 1026 MET A SD    1 
ATOM   5532  C CE    . MET A 1 718 ? -42.958 15.172  -4.297  1.00 48.22  ? 1026 MET A CE    1 
ATOM   5533  N N     . ILE A 1 719 ? -44.651 19.233  1.221   1.00 23.12  ? 1027 ILE A N     1 
ATOM   5534  C CA    . ILE A 1 719 ? -44.780 19.946  2.481   1.00 33.34  ? 1027 ILE A CA    1 
ATOM   5535  C C     . ILE A 1 719 ? -45.656 19.187  3.472   1.00 39.46  ? 1027 ILE A C     1 
ATOM   5536  O O     . ILE A 1 719 ? -46.214 19.783  4.392   1.00 35.94  ? 1027 ILE A O     1 
ATOM   5537  C CB    . ILE A 1 719 ? -45.340 21.364  2.263   1.00 39.67  ? 1027 ILE A CB    1 
ATOM   5538  C CG1   . ILE A 1 719 ? -46.670 21.307  1.506   1.00 38.80  ? 1027 ILE A CG1   1 
ATOM   5539  C CG2   . ILE A 1 719 ? -44.330 22.222  1.506   1.00 24.28  ? 1027 ILE A CG2   1 
ATOM   5540  C CD1   . ILE A 1 719 ? -47.365 22.653  1.391   1.00 40.96  ? 1027 ILE A CD1   1 
ATOM   5541  N N     . LYS A 1 720 ? -45.740 17.871  3.276   1.00 41.81  ? 1028 LYS A N     1 
ATOM   5542  C CA    . LYS A 1 720 ? -46.587 16.972  4.062   1.00 50.74  ? 1028 LYS A CA    1 
ATOM   5543  C C     . LYS A 1 720 ? -47.704 17.686  4.817   1.00 57.66  ? 1028 LYS A C     1 
ATOM   5544  O O     . LYS A 1 720 ? -48.822 17.812  4.311   1.00 60.72  ? 1028 LYS A O     1 
ATOM   5545  C CB    . LYS A 1 720 ? -45.751 16.104  5.016   1.00 57.38  ? 1028 LYS A CB    1 
ATOM   5546  C CG    . LYS A 1 720 ? -45.356 16.783  6.319   1.00 60.40  ? 1028 LYS A CG    1 
ATOM   5547  C CD    . LYS A 1 720 ? -44.217 17.776  6.131   1.00 56.21  ? 1028 LYS A CD    1 
ATOM   5548  C CE    . LYS A 1 720 ? -42.929 17.072  5.744   1.00 56.39  ? 1028 LYS A CE    1 
ATOM   5549  N NZ    . LYS A 1 720 ? -42.436 16.120  6.783   1.00 43.82  ? 1028 LYS A NZ    1 
ATOM   5550  N N     . TYR B 2 1   ? -7.842  29.268  12.974  1.00 14.32  ? 13   TYR B N     1 
ATOM   5551  C CA    . TYR B 2 1   ? -7.295  29.791  14.227  1.00 15.92  ? 13   TYR B CA    1 
ATOM   5552  C C     . TYR B 2 1   ? -5.813  30.134  14.065  1.00 11.74  ? 13   TYR B C     1 
ATOM   5553  O O     . TYR B 2 1   ? -5.117  29.549  13.244  1.00 15.45  ? 13   TYR B O     1 
ATOM   5554  C CB    . TYR B 2 1   ? -7.492  28.779  15.370  1.00 11.73  ? 13   TYR B CB    1 
ATOM   5555  C CG    . TYR B 2 1   ? -6.815  27.432  15.155  1.00 9.92   ? 13   TYR B CG    1 
ATOM   5556  C CD1   . TYR B 2 1   ? -5.542  27.176  15.663  1.00 14.39  ? 13   TYR B CD1   1 
ATOM   5557  C CD2   . TYR B 2 1   ? -7.464  26.408  14.470  1.00 12.27  ? 13   TYR B CD2   1 
ATOM   5558  C CE1   . TYR B 2 1   ? -4.921  25.937  15.466  1.00 19.62  ? 13   TYR B CE1   1 
ATOM   5559  C CE2   . TYR B 2 1   ? -6.854  25.166  14.275  1.00 16.24  ? 13   TYR B CE2   1 
ATOM   5560  C CZ    . TYR B 2 1   ? -5.588  24.940  14.779  1.00 19.74  ? 13   TYR B CZ    1 
ATOM   5561  O OH    . TYR B 2 1   ? -4.997  23.710  14.582  1.00 19.91  ? 13   TYR B OH    1 
ATOM   5562  N N     . PRO B 2 2   ? -5.329  31.095  14.849  1.00 12.24  ? 14   PRO B N     1 
ATOM   5563  C CA    . PRO B 2 2   ? -3.929  31.492  14.680  1.00 22.94  ? 14   PRO B CA    1 
ATOM   5564  C C     . PRO B 2 2   ? -2.994  30.309  14.935  1.00 26.72  ? 14   PRO B C     1 
ATOM   5565  O O     . PRO B 2 2   ? -3.074  29.655  15.974  1.00 27.06  ? 14   PRO B O     1 
ATOM   5566  C CB    . PRO B 2 2   ? -3.761  32.609  15.714  1.00 17.97  ? 14   PRO B CB    1 
ATOM   5567  C CG    . PRO B 2 2   ? -5.159  33.210  15.821  1.00 12.10  ? 14   PRO B CG    1 
ATOM   5568  C CD    . PRO B 2 2   ? -6.049  31.980  15.781  1.00 12.52  ? 14   PRO B CD    1 
ATOM   5569  N N     . GLY B 2 3   ? -2.139  30.018  13.962  1.00 14.43  ? 15   GLY B N     1 
ATOM   5570  C CA    . GLY B 2 3   ? -1.246  28.878  14.046  1.00 23.78  ? 15   GLY B CA    1 
ATOM   5571  C C     . GLY B 2 3   ? -1.794  27.634  13.367  1.00 26.41  ? 15   GLY B C     1 
ATOM   5572  O O     . GLY B 2 3   ? -1.120  26.613  13.298  1.00 27.31  ? 15   GLY B O     1 
ATOM   5573  N N     . GLY B 2 4   ? -3.024  27.715  12.870  1.00 15.61  ? 16   GLY B N     1 
ATOM   5574  C CA    . GLY B 2 4   ? -3.642  26.590  12.188  1.00 11.09  ? 16   GLY B CA    1 
ATOM   5575  C C     . GLY B 2 4   ? -4.601  27.130  11.147  1.00 18.59  ? 16   GLY B C     1 
ATOM   5576  O O     . GLY B 2 4   ? -4.357  28.176  10.536  1.00 23.14  ? 16   GLY B O     1 
ATOM   5577  N N     . SER B 2 5   ? -5.711  26.438  10.949  1.00 13.32  ? 17   SER B N     1 
ATOM   5578  C CA    . SER B 2 5   ? -6.699  26.927  10.005  1.00 16.04  ? 17   SER B CA    1 
ATOM   5579  C C     . SER B 2 5   ? -8.107  26.606  10.484  1.00 18.20  ? 17   SER B C     1 
ATOM   5580  O O     . SER B 2 5   ? -8.348  25.569  11.099  1.00 15.08  ? 17   SER B O     1 
ATOM   5581  C CB    . SER B 2 5   ? -6.461  26.314  8.624   1.00 25.78  ? 17   SER B CB    1 
ATOM   5582  O OG    . SER B 2 5   ? -6.831  24.947  8.619   1.00 43.72  ? 17   SER B OG    1 
ATOM   5583  N N     . THR B 2 6   ? -9.036  27.512  10.206  1.00 9.59   ? 18   THR B N     1 
ATOM   5584  C CA    . THR B 2 6   ? -10.447 27.276  10.510  1.00 9.85   ? 18   THR B CA    1 
ATOM   5585  C C     . THR B 2 6   ? -11.223 27.442  9.219   1.00 15.66  ? 18   THR B C     1 
ATOM   5586  O O     . THR B 2 6   ? -11.433 28.563  8.753   1.00 9.02   ? 18   THR B O     1 
ATOM   5587  C CB    . THR B 2 6   ? -10.968 28.270  11.572  1.00 11.86  ? 18   THR B CB    1 
ATOM   5588  O OG1   . THR B 2 6   ? -10.323 27.990  12.815  1.00 11.59  ? 18   THR B OG1   1 
ATOM   5589  C CG2   . THR B 2 6   ? -12.468 28.127  11.754  1.00 8.47   ? 18   THR B CG2   1 
ATOM   5590  N N     . PRO B 2 7   ? -11.618 26.324  8.607   1.00 11.51  ? 19   PRO B N     1 
ATOM   5591  C CA    . PRO B 2 7   ? -12.335 26.426  7.332   1.00 11.69  ? 19   PRO B CA    1 
ATOM   5592  C C     . PRO B 2 7   ? -13.733 26.957  7.563   1.00 12.29  ? 19   PRO B C     1 
ATOM   5593  O O     . PRO B 2 7   ? -14.340 26.665  8.597   1.00 9.33   ? 19   PRO B O     1 
ATOM   5594  C CB    . PRO B 2 7   ? -12.406 24.977  6.860   1.00 17.79  ? 19   PRO B CB    1 
ATOM   5595  C CG    . PRO B 2 7   ? -12.349 24.168  8.145   1.00 15.05  ? 19   PRO B CG    1 
ATOM   5596  C CD    . PRO B 2 7   ? -11.411 24.923  9.021   1.00 8.57   ? 19   PRO B CD    1 
ATOM   5597  N N     . VAL B 2 8   ? -14.239 27.727  6.606   1.00 7.91   ? 20   VAL B N     1 
ATOM   5598  C CA    . VAL B 2 8   ? -15.557 28.302  6.733   1.00 8.49   ? 20   VAL B CA    1 
ATOM   5599  C C     . VAL B 2 8   ? -16.264 28.161  5.397   1.00 7.93   ? 20   VAL B C     1 
ATOM   5600  O O     . VAL B 2 8   ? -15.639 27.857  4.380   1.00 10.55  ? 20   VAL B O     1 
ATOM   5601  C CB    . VAL B 2 8   ? -15.446 29.787  7.068   1.00 14.84  ? 20   VAL B CB    1 
ATOM   5602  C CG1   . VAL B 2 8   ? -14.829 29.954  8.451   1.00 8.82   ? 20   VAL B CG1   1 
ATOM   5603  C CG2   . VAL B 2 8   ? -14.608 30.496  5.995   1.00 12.63  ? 20   VAL B CG2   1 
ATOM   5604  N N     . SER B 2 9   ? -17.569 28.384  5.393   1.00 7.83   ? 21   SER B N     1 
ATOM   5605  C CA    . SER B 2 9   ? -18.307 28.424  4.135   1.00 14.09  ? 21   SER B CA    1 
ATOM   5606  C C     . SER B 2 9   ? -17.933 29.708  3.411   1.00 16.44  ? 21   SER B C     1 
ATOM   5607  O O     . SER B 2 9   ? -17.850 30.759  4.027   1.00 12.38  ? 21   SER B O     1 
ATOM   5608  C CB    . SER B 2 9   ? -19.810 28.412  4.413   1.00 21.63  ? 21   SER B CB    1 
ATOM   5609  O OG    . SER B 2 9   ? -20.544 28.490  3.201   1.00 35.46  ? 21   SER B OG    1 
ATOM   5610  N N     . SER B 2 10  ? -17.698 29.652  2.111   1.00 11.05  ? 22   SER B N     1 
ATOM   5611  C CA    . SER B 2 10  ? -17.431 30.903  1.425   1.00 10.17  ? 22   SER B CA    1 
ATOM   5612  C C     . SER B 2 10  ? -17.849 30.855  -0.039  1.00 15.86  ? 22   SER B C     1 
ATOM   5613  O O     . SER B 2 10  ? -18.066 29.779  -0.600  1.00 9.49   ? 22   SER B O     1 
ATOM   5614  C CB    . SER B 2 10  ? -15.953 31.275  1.536   1.00 28.81  ? 22   SER B CB    1 
ATOM   5615  O OG    . SER B 2 10  ? -15.158 30.374  0.802   1.00 20.82  ? 22   SER B OG    1 
ATOM   5616  N N     . ALA B 2 11  ? -17.938 32.029  -0.649  1.00 14.92  ? 23   ALA B N     1 
ATOM   5617  C CA    . ALA B 2 11  ? -18.471 32.155  -2.000  1.00 21.54  ? 23   ALA B CA    1 
ATOM   5618  C C     . ALA B 2 11  ? -17.479 31.603  -3.018  1.00 16.47  ? 23   ALA B C     1 
ATOM   5619  O O     . ALA B 2 11  ? -16.273 31.663  -2.793  1.00 16.79  ? 23   ALA B O     1 
ATOM   5620  C CB    . ALA B 2 11  ? -18.787 33.626  -2.294  1.00 15.90  ? 23   ALA B CB    1 
ATOM   5621  N N     . ASN B 2 12  ? -17.979 31.054  -4.127  1.00 12.59  ? 24   ASN B N     1 
ATOM   5622  C CA    . ASN B 2 12  ? -17.091 30.652  -5.217  1.00 14.64  ? 24   ASN B CA    1 
ATOM   5623  C C     . ASN B 2 12  ? -16.693 31.871  -6.049  1.00 21.72  ? 24   ASN B C     1 
ATOM   5624  O O     . ASN B 2 12  ? -17.365 32.899  -6.014  1.00 17.21  ? 24   ASN B O     1 
ATOM   5625  C CB    . ASN B 2 12  ? -17.695 29.544  -6.098  1.00 13.44  ? 24   ASN B CB    1 
ATOM   5626  C CG    . ASN B 2 12  ? -18.965 29.972  -6.813  1.00 26.17  ? 24   ASN B CG    1 
ATOM   5627  O OD1   . ASN B 2 12  ? -19.620 30.945  -6.433  1.00 20.69  ? 24   ASN B OD1   1 
ATOM   5628  N ND2   . ASN B 2 12  ? -19.329 29.223  -7.845  1.00 21.45  ? 24   ASN B ND2   1 
ATOM   5629  N N     . MET B 2 13  ? -15.584 31.774  -6.772  1.00 23.20  ? 25   MET B N     1 
ATOM   5630  C CA    . MET B 2 13  ? -15.112 32.928  -7.529  1.00 31.81  ? 25   MET B CA    1 
ATOM   5631  C C     . MET B 2 13  ? -16.043 33.200  -8.706  1.00 34.63  ? 25   MET B C     1 
ATOM   5632  O O     . MET B 2 13  ? -16.708 32.287  -9.202  1.00 30.38  ? 25   MET B O     1 
ATOM   5633  C CB    . MET B 2 13  ? -13.671 32.718  -8.005  1.00 45.17  ? 25   MET B CB    1 
ATOM   5634  C CG    . MET B 2 13  ? -12.641 32.597  -6.876  1.00 53.20  ? 25   MET B CG    1 
ATOM   5635  S SD    . MET B 2 13  ? -12.073 34.170  -6.164  1.00 50.68  ? 25   MET B SD    1 
ATOM   5636  C CE    . MET B 2 13  ? -13.533 34.745  -5.297  1.00 100.41 ? 25   MET B CE    1 
ATOM   5637  N N     . MET B 2 14  ? -16.105 34.457  -9.135  1.00 30.43  ? 26   MET B N     1 
ATOM   5638  C CA    . MET B 2 14  ? -16.914 34.827  -10.293 1.00 38.96  ? 26   MET B CA    1 
ATOM   5639  C C     . MET B 2 14  ? -16.248 35.971  -11.050 1.00 39.61  ? 26   MET B C     1 
ATOM   5640  O O     . MET B 2 14  ? -15.082 36.291  -10.798 1.00 35.07  ? 26   MET B O     1 
ATOM   5641  C CB    . MET B 2 14  ? -18.345 35.212  -9.879  1.00 31.87  ? 26   MET B CB    1 
ATOM   5642  C CG    . MET B 2 14  ? -18.463 36.577  -9.213  1.00 36.50  ? 26   MET B CG    1 
ATOM   5643  S SD    . MET B 2 14  ? -20.166 37.184  -9.081  1.00 38.40  ? 26   MET B SD    1 
ATOM   5644  C CE    . MET B 2 14  ? -19.908 38.694  -8.153  1.00 33.81  ? 26   MET B CE    1 
ATOM   5645  N N     . ALA C 1 28  ? 35.900  -19.281 10.296  1.00 49.74  ? 336  ALA C N     1 
ATOM   5646  C CA    . ALA C 1 28  ? 35.323  -20.431 9.605   1.00 54.49  ? 336  ALA C CA    1 
ATOM   5647  C C     . ALA C 1 28  ? 34.957  -20.095 8.163   1.00 51.67  ? 336  ALA C C     1 
ATOM   5648  O O     . ALA C 1 28  ? 35.350  -20.805 7.238   1.00 41.69  ? 336  ALA C O     1 
ATOM   5649  C CB    . ALA C 1 28  ? 34.102  -20.955 10.359  1.00 51.49  ? 336  ALA C CB    1 
ATOM   5650  N N     . VAL C 1 29  ? 34.200  -19.014 7.979   1.00 52.59  ? 337  VAL C N     1 
ATOM   5651  C CA    . VAL C 1 29  ? 33.806  -18.564 6.646   1.00 47.07  ? 337  VAL C CA    1 
ATOM   5652  C C     . VAL C 1 29  ? 35.029  -18.266 5.785   1.00 46.75  ? 337  VAL C C     1 
ATOM   5653  O O     . VAL C 1 29  ? 35.101  -18.672 4.621   1.00 47.91  ? 337  VAL C O     1 
ATOM   5654  C CB    . VAL C 1 29  ? 32.913  -17.305 6.708   1.00 48.72  ? 337  VAL C CB    1 
ATOM   5655  C CG1   . VAL C 1 29  ? 32.722  -16.716 5.315   1.00 41.68  ? 337  VAL C CG1   1 
ATOM   5656  C CG2   . VAL C 1 29  ? 31.568  -17.633 7.350   1.00 43.23  ? 337  VAL C CG2   1 
ATOM   5657  N N     . ARG C 1 30  ? 35.993  -17.554 6.361   1.00 45.77  ? 338  ARG C N     1 
ATOM   5658  C CA    . ARG C 1 30  ? 37.216  -17.228 5.642   1.00 44.71  ? 338  ARG C CA    1 
ATOM   5659  C C     . ARG C 1 30  ? 37.916  -18.501 5.182   1.00 41.67  ? 338  ARG C C     1 
ATOM   5660  O O     . ARG C 1 30  ? 38.509  -18.541 4.102   1.00 34.88  ? 338  ARG C O     1 
ATOM   5661  C CB    . ARG C 1 30  ? 38.163  -16.401 6.514   1.00 46.91  ? 338  ARG C CB    1 
ATOM   5662  C CG    . ARG C 1 30  ? 39.388  -15.891 5.765   1.00 59.81  ? 338  ARG C CG    1 
ATOM   5663  C CD    . ARG C 1 30  ? 40.364  -15.187 6.692   1.00 70.16  ? 338  ARG C CD    1 
ATOM   5664  N NE    . ARG C 1 30  ? 40.950  -16.103 7.666   1.00 75.70  ? 338  ARG C NE    1 
ATOM   5665  C CZ    . ARG C 1 30  ? 42.085  -16.769 7.477   1.00 77.39  ? 338  ARG C CZ    1 
ATOM   5666  N NH1   . ARG C 1 30  ? 42.765  -16.622 6.348   1.00 68.51  ? 338  ARG C NH1   1 
ATOM   5667  N NH2   . ARG C 1 30  ? 42.543  -17.583 8.419   1.00 77.66  ? 338  ARG C NH2   1 
ATOM   5668  N N     . LEU C 1 31  ? 37.840  -19.543 6.006   1.00 36.40  ? 339  LEU C N     1 
ATOM   5669  C CA    . LEU C 1 31  ? 38.540  -20.794 5.716   1.00 46.96  ? 339  LEU C CA    1 
ATOM   5670  C C     . LEU C 1 31  ? 37.805  -21.659 4.689   1.00 45.85  ? 339  LEU C C     1 
ATOM   5671  O O     . LEU C 1 31  ? 38.432  -22.291 3.827   1.00 41.39  ? 339  LEU C O     1 
ATOM   5672  C CB    . LEU C 1 31  ? 38.801  -21.576 7.007   1.00 50.35  ? 339  LEU C CB    1 
ATOM   5673  C CG    . LEU C 1 31  ? 39.811  -20.925 7.965   1.00 53.05  ? 339  LEU C CG    1 
ATOM   5674  C CD1   . LEU C 1 31  ? 39.815  -21.608 9.329   1.00 49.21  ? 339  LEU C CD1   1 
ATOM   5675  C CD2   . LEU C 1 31  ? 41.215  -20.913 7.366   1.00 54.03  ? 339  LEU C CD2   1 
ATOM   5676  N N     . TYR C 1 32  ? 36.480  -21.693 4.783   1.00 38.91  ? 340  TYR C N     1 
ATOM   5677  C CA    . TYR C 1 32  ? 35.692  -22.383 3.779   1.00 30.66  ? 340  TYR C CA    1 
ATOM   5678  C C     . TYR C 1 32  ? 35.952  -21.753 2.417   1.00 37.91  ? 340  TYR C C     1 
ATOM   5679  O O     . TYR C 1 32  ? 36.113  -22.460 1.421   1.00 42.83  ? 340  TYR C O     1 
ATOM   5680  C CB    . TYR C 1 32  ? 34.206  -22.308 4.103   1.00 29.31  ? 340  TYR C CB    1 
ATOM   5681  C CG    . TYR C 1 32  ? 33.767  -23.186 5.251   1.00 42.49  ? 340  TYR C CG    1 
ATOM   5682  C CD1   . TYR C 1 32  ? 33.994  -24.557 5.229   1.00 40.22  ? 340  TYR C CD1   1 
ATOM   5683  C CD2   . TYR C 1 32  ? 33.096  -22.649 6.343   1.00 41.95  ? 340  TYR C CD2   1 
ATOM   5684  C CE1   . TYR C 1 32  ? 33.584  -25.367 6.271   1.00 43.56  ? 340  TYR C CE1   1 
ATOM   5685  C CE2   . TYR C 1 32  ? 32.682  -23.451 7.389   1.00 53.35  ? 340  TYR C CE2   1 
ATOM   5686  C CZ    . TYR C 1 32  ? 32.927  -24.809 7.347   1.00 50.94  ? 340  TYR C CZ    1 
ATOM   5687  O OH    . TYR C 1 32  ? 32.516  -25.612 8.383   1.00 48.00  ? 340  TYR C OH    1 
ATOM   5688  N N     . ARG C 1 33  ? 35.997  -20.423 2.377   1.00 32.92  ? 341  ARG C N     1 
ATOM   5689  C CA    . ARG C 1 33  ? 36.207  -19.708 1.120   1.00 32.97  ? 341  ARG C CA    1 
ATOM   5690  C C     . ARG C 1 33  ? 37.575  -20.027 0.540   1.00 34.72  ? 341  ARG C C     1 
ATOM   5691  O O     . ARG C 1 33  ? 37.727  -20.180 -0.672  1.00 40.49  ? 341  ARG C O     1 
ATOM   5692  C CB    . ARG C 1 33  ? 36.054  -18.196 1.310   1.00 40.36  ? 341  ARG C CB    1 
ATOM   5693  C CG    . ARG C 1 33  ? 34.653  -17.750 1.722   1.00 38.54  ? 341  ARG C CG    1 
ATOM   5694  C CD    . ARG C 1 33  ? 34.541  -16.235 1.661   1.00 43.45  ? 341  ARG C CD    1 
ATOM   5695  N NE    . ARG C 1 33  ? 33.310  -15.754 2.278   1.00 44.52  ? 341  ARG C NE    1 
ATOM   5696  C CZ    . ARG C 1 33  ? 32.123  -15.768 1.683   1.00 39.61  ? 341  ARG C CZ    1 
ATOM   5697  N NH1   . ARG C 1 33  ? 32.003  -16.249 0.449   1.00 34.72  ? 341  ARG C NH1   1 
ATOM   5698  N NH2   . ARG C 1 33  ? 31.060  -15.305 2.325   1.00 41.27  ? 341  ARG C NH2   1 
ATOM   5699  N N     . LYS C 1 34  ? 38.575  -20.115 1.413   1.00 34.23  ? 342  LYS C N     1 
ATOM   5700  C CA    . LYS C 1 34  ? 39.916  -20.506 0.993   1.00 43.50  ? 342  LYS C CA    1 
ATOM   5701  C C     . LYS C 1 34  ? 39.902  -21.910 0.373   1.00 38.60  ? 342  LYS C C     1 
ATOM   5702  O O     . LYS C 1 34  ? 40.599  -22.173 -0.613  1.00 37.18  ? 342  LYS C O     1 
ATOM   5703  C CB    . LYS C 1 34  ? 40.883  -20.453 2.176   1.00 51.04  ? 342  LYS C CB    1 
ATOM   5704  C CG    . LYS C 1 34  ? 42.344  -20.616 1.785   1.00 63.61  ? 342  LYS C CG    1 
ATOM   5705  C CD    . LYS C 1 34  ? 42.807  -19.471 0.899   1.00 72.39  ? 342  LYS C CD    1 
ATOM   5706  C CE    . LYS C 1 34  ? 44.282  -19.600 0.560   1.00 85.86  ? 342  LYS C CE    1 
ATOM   5707  N NZ    . LYS C 1 34  ? 44.767  -18.457 -0.266  1.00 92.41  ? 342  LYS C NZ    1 
ATOM   5708  N N     . ALA C 1 35  ? 39.097  -22.802 0.952   1.00 41.38  ? 343  ALA C N     1 
ATOM   5709  C CA    . ALA C 1 35  ? 38.937  -24.158 0.429   1.00 35.41  ? 343  ALA C CA    1 
ATOM   5710  C C     . ALA C 1 35  ? 38.370  -24.125 -0.984  1.00 34.91  ? 343  ALA C C     1 
ATOM   5711  O O     . ALA C 1 35  ? 38.832  -24.848 -1.872  1.00 31.96  ? 343  ALA C O     1 
ATOM   5712  C CB    . ALA C 1 35  ? 38.030  -24.978 1.343   1.00 30.36  ? 343  ALA C CB    1 
ATOM   5713  N N     . LEU C 1 36  ? 37.363  -23.280 -1.184  1.00 42.72  ? 344  LEU C N     1 
ATOM   5714  C CA    . LEU C 1 36  ? 36.746  -23.114 -2.497  1.00 38.61  ? 344  LEU C CA    1 
ATOM   5715  C C     . LEU C 1 36  ? 37.725  -22.493 -3.485  1.00 32.04  ? 344  LEU C C     1 
ATOM   5716  O O     . LEU C 1 36  ? 37.763  -22.866 -4.660  1.00 37.22  ? 344  LEU C O     1 
ATOM   5717  C CB    . LEU C 1 36  ? 35.489  -22.247 -2.388  1.00 37.41  ? 344  LEU C CB    1 
ATOM   5718  C CG    . LEU C 1 36  ? 34.375  -22.817 -1.510  1.00 36.61  ? 344  LEU C CG    1 
ATOM   5719  C CD1   . LEU C 1 36  ? 33.226  -21.827 -1.387  1.00 35.71  ? 344  LEU C CD1   1 
ATOM   5720  C CD2   . LEU C 1 36  ? 33.893  -24.149 -2.073  1.00 35.32  ? 344  LEU C CD2   1 
ATOM   5721  N N     . GLU C 1 37  ? 38.516  -21.539 -3.004  1.00 32.25  ? 345  GLU C N     1 
ATOM   5722  C CA    . GLU C 1 37  ? 39.520  -20.889 -3.838  1.00 39.90  ? 345  GLU C CA    1 
ATOM   5723  C C     . GLU C 1 37  ? 40.517  -21.914 -4.379  1.00 48.78  ? 345  GLU C C     1 
ATOM   5724  O O     . GLU C 1 37  ? 40.914  -21.864 -5.545  1.00 48.60  ? 345  GLU C O     1 
ATOM   5725  C CB    . GLU C 1 37  ? 40.257  -19.809 -3.042  1.00 40.52  ? 345  GLU C CB    1 
ATOM   5726  C CG    . GLU C 1 37  ? 41.227  -18.989 -3.871  1.00 42.92  ? 345  GLU C CG    1 
ATOM   5727  C CD    . GLU C 1 37  ? 41.977  -17.961 -3.045  1.00 56.89  ? 345  GLU C CD    1 
ATOM   5728  O OE1   . GLU C 1 37  ? 43.150  -17.683 -3.369  1.00 64.15  ? 345  GLU C OE1   1 
ATOM   5729  O OE2   . GLU C 1 37  ? 41.393  -17.428 -2.078  1.00 55.24  ? 345  GLU C OE2   1 
ATOM   5730  N N     . VAL C 1 38  ? 40.911  -22.847 -3.517  1.00 43.97  ? 346  VAL C N     1 
ATOM   5731  C CA    . VAL C 1 38  ? 41.843  -23.908 -3.883  1.00 39.74  ? 346  VAL C CA    1 
ATOM   5732  C C     . VAL C 1 38  ? 41.195  -24.959 -4.780  1.00 41.25  ? 346  VAL C C     1 
ATOM   5733  O O     . VAL C 1 38  ? 41.801  -25.424 -5.744  1.00 45.53  ? 346  VAL C O     1 
ATOM   5734  C CB    . VAL C 1 38  ? 42.388  -24.607 -2.626  1.00 54.43  ? 346  VAL C CB    1 
ATOM   5735  C CG1   . VAL C 1 38  ? 43.034  -25.936 -2.990  1.00 59.10  ? 346  VAL C CG1   1 
ATOM   5736  C CG2   . VAL C 1 38  ? 43.366  -23.692 -1.894  1.00 57.16  ? 346  VAL C CG2   1 
ATOM   5737  N N     . PHE C 1 39  ? 39.957  -25.322 -4.460  1.00 37.43  ? 347  PHE C N     1 
ATOM   5738  C CA    . PHE C 1 39  ? 39.253  -26.388 -5.163  1.00 38.06  ? 347  PHE C CA    1 
ATOM   5739  C C     . PHE C 1 39  ? 37.770  -26.031 -5.269  1.00 35.70  ? 347  PHE C C     1 
ATOM   5740  O O     . PHE C 1 39  ? 36.985  -26.381 -4.398  1.00 34.44  ? 347  PHE C O     1 
ATOM   5741  C CB    . PHE C 1 39  ? 39.452  -27.708 -4.406  1.00 50.74  ? 347  PHE C CB    1 
ATOM   5742  C CG    . PHE C 1 39  ? 38.714  -28.876 -4.995  1.00 57.17  ? 347  PHE C CG    1 
ATOM   5743  C CD1   . PHE C 1 39  ? 38.682  -29.081 -6.366  1.00 57.87  ? 347  PHE C CD1   1 
ATOM   5744  C CD2   . PHE C 1 39  ? 38.076  -29.790 -4.168  1.00 58.77  ? 347  PHE C CD2   1 
ATOM   5745  C CE1   . PHE C 1 39  ? 38.008  -30.165 -6.902  1.00 57.49  ? 347  PHE C CE1   1 
ATOM   5746  C CE2   . PHE C 1 39  ? 37.403  -30.875 -4.697  1.00 57.84  ? 347  PHE C CE2   1 
ATOM   5747  C CZ    . PHE C 1 39  ? 37.368  -31.063 -6.065  1.00 54.68  ? 347  PHE C CZ    1 
ATOM   5748  N N     . PRO C 1 40  ? 37.393  -25.314 -6.341  1.00 46.42  ? 348  PRO C N     1 
ATOM   5749  C CA    . PRO C 1 40  ? 36.054  -24.731 -6.537  1.00 45.73  ? 348  PRO C CA    1 
ATOM   5750  C C     . PRO C 1 40  ? 34.885  -25.724 -6.557  1.00 44.95  ? 348  PRO C C     1 
ATOM   5751  O O     . PRO C 1 40  ? 33.772  -25.342 -6.184  1.00 40.45  ? 348  PRO C O     1 
ATOM   5752  C CB    . PRO C 1 40  ? 36.175  -24.031 -7.897  1.00 50.58  ? 348  PRO C CB    1 
ATOM   5753  C CG    . PRO C 1 40  ? 37.637  -23.731 -8.034  1.00 50.33  ? 348  PRO C CG    1 
ATOM   5754  C CD    . PRO C 1 40  ? 38.334  -24.899 -7.398  1.00 49.13  ? 348  PRO C CD    1 
ATOM   5755  N N     . GLU C 1 41  ? 35.121  -26.959 -6.991  1.00 46.40  ? 349  GLU C N     1 
ATOM   5756  C CA    . GLU C 1 41  ? 34.048  -27.949 -7.087  1.00 45.60  ? 349  GLU C CA    1 
ATOM   5757  C C     . GLU C 1 41  ? 34.005  -28.858 -5.856  1.00 37.99  ? 349  GLU C C     1 
ATOM   5758  O O     . GLU C 1 41  ? 33.964  -30.082 -5.972  1.00 40.83  ? 349  GLU C O     1 
ATOM   5759  C CB    . GLU C 1 41  ? 34.204  -28.784 -8.361  1.00 43.28  ? 349  GLU C CB    1 
ATOM   5760  C CG    . GLU C 1 41  ? 34.223  -27.963 -9.638  1.00 33.57  ? 349  GLU C CG    1 
ATOM   5761  C CD    . GLU C 1 41  ? 32.872  -27.371 -9.973  1.00 46.77  ? 349  GLU C CD    1 
ATOM   5762  O OE1   . GLU C 1 41  ? 31.931  -28.147 -10.239 1.00 49.78  ? 349  GLU C OE1   1 
ATOM   5763  O OE2   . GLU C 1 41  ? 32.751  -26.129 -9.971  1.00 55.91  ? 349  GLU C OE2   1 
ATOM   5764  N N     . PHE C 1 42  ? 34.007  -28.250 -4.676  1.00 41.48  ? 350  PHE C N     1 
ATOM   5765  C CA    . PHE C 1 42  ? 34.039  -28.994 -3.419  1.00 37.89  ? 350  PHE C CA    1 
ATOM   5766  C C     . PHE C 1 42  ? 32.653  -28.993 -2.759  1.00 40.28  ? 350  PHE C C     1 
ATOM   5767  O O     . PHE C 1 42  ? 32.308  -28.066 -2.019  1.00 32.75  ? 350  PHE C O     1 
ATOM   5768  C CB    . PHE C 1 42  ? 35.075  -28.366 -2.486  1.00 42.99  ? 350  PHE C CB    1 
ATOM   5769  C CG    . PHE C 1 42  ? 35.435  -29.217 -1.297  1.00 36.66  ? 350  PHE C CG    1 
ATOM   5770  C CD1   . PHE C 1 42  ? 34.739  -30.380 -1.012  1.00 43.03  ? 350  PHE C CD1   1 
ATOM   5771  C CD2   . PHE C 1 42  ? 36.467  -28.839 -0.458  1.00 33.59  ? 350  PHE C CD2   1 
ATOM   5772  C CE1   . PHE C 1 42  ? 35.070  -31.154 0.086   1.00 40.78  ? 350  PHE C CE1   1 
ATOM   5773  C CE2   . PHE C 1 42  ? 36.812  -29.610 0.642   1.00 34.25  ? 350  PHE C CE2   1 
ATOM   5774  C CZ    . PHE C 1 42  ? 36.113  -30.770 0.914   1.00 36.52  ? 350  PHE C CZ    1 
ATOM   5775  N N     . ALA C 1 43  ? 31.869  -30.037 -3.023  1.00 26.19  ? 351  ALA C N     1 
ATOM   5776  C CA    . ALA C 1 43  ? 30.475  -30.091 -2.581  1.00 27.58  ? 351  ALA C CA    1 
ATOM   5777  C C     . ALA C 1 43  ? 30.313  -29.898 -1.075  1.00 34.12  ? 351  ALA C C     1 
ATOM   5778  O O     . ALA C 1 43  ? 29.394  -29.216 -0.626  1.00 33.26  ? 351  ALA C O     1 
ATOM   5779  C CB    . ALA C 1 43  ? 29.831  -31.391 -3.019  1.00 29.62  ? 351  ALA C CB    1 
ATOM   5780  N N     . ALA C 1 44  ? 31.201  -30.506 -0.295  1.00 32.67  ? 352  ALA C N     1 
ATOM   5781  C CA    . ALA C 1 44  ? 31.101  -30.438 1.162   1.00 31.55  ? 352  ALA C CA    1 
ATOM   5782  C C     . ALA C 1 44  ? 31.434  -29.050 1.710   1.00 33.55  ? 352  ALA C C     1 
ATOM   5783  O O     . ALA C 1 44  ? 30.819  -28.593 2.676   1.00 37.38  ? 352  ALA C O     1 
ATOM   5784  C CB    . ALA C 1 44  ? 31.987  -31.491 1.802   1.00 47.33  ? 352  ALA C CB    1 
ATOM   5785  N N     . ALA C 1 45  ? 32.412  -28.383 1.105   1.00 35.29  ? 353  ALA C N     1 
ATOM   5786  C CA    . ALA C 1 45  ? 32.763  -27.032 1.531   1.00 38.98  ? 353  ALA C CA    1 
ATOM   5787  C C     . ALA C 1 45  ? 31.590  -26.096 1.287   1.00 36.46  ? 353  ALA C C     1 
ATOM   5788  O O     . ALA C 1 45  ? 31.272  -25.247 2.124   1.00 34.29  ? 353  ALA C O     1 
ATOM   5789  C CB    . ALA C 1 45  ? 34.005  -26.533 0.800   1.00 34.04  ? 353  ALA C CB    1 
ATOM   5790  N N     . HIS C 1 46  ? 30.944  -26.265 0.137   1.00 31.99  ? 354  HIS C N     1 
ATOM   5791  C CA    . HIS C 1 46  ? 29.793  -25.446 -0.210  1.00 26.08  ? 354  HIS C CA    1 
ATOM   5792  C C     . HIS C 1 46  ? 28.637  -25.714 0.748   1.00 34.10  ? 354  HIS C C     1 
ATOM   5793  O O     . HIS C 1 46  ? 28.017  -24.782 1.265   1.00 30.91  ? 354  HIS C O     1 
ATOM   5794  C CB    . HIS C 1 46  ? 29.364  -25.696 -1.658  1.00 30.36  ? 354  HIS C CB    1 
ATOM   5795  C CG    . HIS C 1 46  ? 30.127  -24.886 -2.664  1.00 29.18  ? 354  HIS C CG    1 
ATOM   5796  N ND1   . HIS C 1 46  ? 30.068  -23.508 -2.708  1.00 25.12  ? 354  HIS C ND1   1 
ATOM   5797  C CD2   . HIS C 1 46  ? 30.954  -25.260 -3.669  1.00 24.90  ? 354  HIS C CD2   1 
ATOM   5798  C CE1   . HIS C 1 46  ? 30.828  -23.069 -3.697  1.00 28.61  ? 354  HIS C CE1   1 
ATOM   5799  N NE2   . HIS C 1 46  ? 31.380  -24.112 -4.293  1.00 30.30  ? 354  HIS C NE2   1 
ATOM   5800  N N     . SER C 1 47  ? 28.353  -26.988 0.991   1.00 22.77  ? 355  SER C N     1 
ATOM   5801  C CA    . SER C 1 47  ? 27.253  -27.345 1.876   1.00 27.63  ? 355  SER C CA    1 
ATOM   5802  C C     . SER C 1 47  ? 27.513  -26.883 3.314   1.00 31.86  ? 355  SER C C     1 
ATOM   5803  O O     . SER C 1 47  ? 26.579  -26.527 4.038   1.00 34.03  ? 355  SER C O     1 
ATOM   5804  C CB    . SER C 1 47  ? 26.977  -28.850 1.817   1.00 30.83  ? 355  SER C CB    1 
ATOM   5805  O OG    . SER C 1 47  ? 25.977  -29.217 2.749   1.00 52.76  ? 355  SER C OG    1 
ATOM   5806  N N     . ASN C 1 48  ? 28.781  -26.883 3.725   1.00 32.29  ? 356  ASN C N     1 
ATOM   5807  C CA    . ASN C 1 48  ? 29.151  -26.407 5.056   1.00 30.77  ? 356  ASN C CA    1 
ATOM   5808  C C     . ASN C 1 48  ? 29.053  -24.897 5.189   1.00 35.30  ? 356  ASN C C     1 
ATOM   5809  O O     . ASN C 1 48  ? 28.526  -24.383 6.177   1.00 33.74  ? 356  ASN C O     1 
ATOM   5810  C CB    . ASN C 1 48  ? 30.576  -26.829 5.412   1.00 43.91  ? 356  ASN C CB    1 
ATOM   5811  C CG    . ASN C 1 48  ? 30.665  -28.271 5.861   1.00 43.17  ? 356  ASN C CG    1 
ATOM   5812  O OD1   . ASN C 1 48  ? 29.692  -28.842 6.351   1.00 41.13  ? 356  ASN C OD1   1 
ATOM   5813  N ND2   . ASN C 1 48  ? 31.845  -28.866 5.705   1.00 45.50  ? 356  ASN C ND2   1 
ATOM   5814  N N     . LEU C 1 49  ? 29.604  -24.190 4.209   1.00 26.37  ? 357  LEU C N     1 
ATOM   5815  C CA    . LEU C 1 49  ? 29.522  -22.739 4.194   1.00 34.45  ? 357  LEU C CA    1 
ATOM   5816  C C     . LEU C 1 49  ? 28.055  -22.304 4.151   1.00 27.95  ? 357  LEU C C     1 
ATOM   5817  O O     . LEU C 1 49  ? 27.677  -21.340 4.812   1.00 29.40  ? 357  LEU C O     1 
ATOM   5818  C CB    . LEU C 1 49  ? 30.315  -22.163 3.015   1.00 31.98  ? 357  LEU C CB    1 
ATOM   5819  C CG    . LEU C 1 49  ? 30.338  -20.643 2.830   1.00 35.86  ? 357  LEU C CG    1 
ATOM   5820  C CD1   . LEU C 1 49  ? 30.802  -19.940 4.106   1.00 33.89  ? 357  LEU C CD1   1 
ATOM   5821  C CD2   . LEU C 1 49  ? 31.231  -20.274 1.653   1.00 39.03  ? 357  LEU C CD2   1 
ATOM   5822  N N     . ALA C 1 50  ? 27.232  -23.026 3.387   1.00 30.31  ? 358  ALA C N     1 
ATOM   5823  C CA    . ALA C 1 50  ? 25.801  -22.703 3.288   1.00 29.12  ? 358  ALA C CA    1 
ATOM   5824  C C     . ALA C 1 50  ? 25.102  -22.804 4.643   1.00 29.81  ? 358  ALA C C     1 
ATOM   5825  O O     . ALA C 1 50  ? 24.354  -21.909 5.051   1.00 26.55  ? 358  ALA C O     1 
ATOM   5826  C CB    . ALA C 1 50  ? 25.107  -23.604 2.260   1.00 21.33  ? 358  ALA C CB    1 
ATOM   5827  N N     . SER C 1 51  ? 25.344  -23.908 5.336   1.00 29.90  ? 359  SER C N     1 
ATOM   5828  C CA    . SER C 1 51  ? 24.767  -24.122 6.657   1.00 36.55  ? 359  SER C CA    1 
ATOM   5829  C C     . SER C 1 51  ? 25.151  -22.986 7.611   1.00 38.74  ? 359  SER C C     1 
ATOM   5830  O O     . SER C 1 51  ? 24.304  -22.454 8.338   1.00 35.87  ? 359  SER C O     1 
ATOM   5831  C CB    . SER C 1 51  ? 25.231  -25.468 7.211   1.00 44.70  ? 359  SER C CB    1 
ATOM   5832  O OG    . SER C 1 51  ? 24.835  -25.634 8.557   1.00 53.42  ? 359  SER C OG    1 
ATOM   5833  N N     . VAL C 1 52  ? 26.430  -22.617 7.590   1.00 33.75  ? 360  VAL C N     1 
ATOM   5834  C CA    . VAL C 1 52  ? 26.962  -21.550 8.436   1.00 31.52  ? 360  VAL C CA    1 
ATOM   5835  C C     . VAL C 1 52  ? 26.304  -20.211 8.141   1.00 39.83  ? 360  VAL C C     1 
ATOM   5836  O O     . VAL C 1 52  ? 25.864  -19.508 9.058   1.00 31.52  ? 360  VAL C O     1 
ATOM   5837  C CB    . VAL C 1 52  ? 28.481  -21.390 8.239   1.00 46.97  ? 360  VAL C CB    1 
ATOM   5838  C CG1   . VAL C 1 52  ? 28.955  -20.048 8.788   1.00 51.29  ? 360  VAL C CG1   1 
ATOM   5839  C CG2   . VAL C 1 52  ? 29.223  -22.545 8.892   1.00 50.22  ? 360  VAL C CG2   1 
ATOM   5840  N N     . LEU C 1 53  ? 26.258  -19.858 6.860   1.00 25.16  ? 361  LEU C N     1 
ATOM   5841  C CA    . LEU C 1 53  ? 25.604  -18.633 6.433   1.00 28.99  ? 361  LEU C CA    1 
ATOM   5842  C C     . LEU C 1 53  ? 24.146  -18.667 6.880   1.00 25.30  ? 361  LEU C C     1 
ATOM   5843  O O     . LEU C 1 53  ? 23.625  -17.671 7.390   1.00 32.53  ? 361  LEU C O     1 
ATOM   5844  C CB    . LEU C 1 53  ? 25.726  -18.452 4.908   1.00 29.77  ? 361  LEU C CB    1 
ATOM   5845  C CG    . LEU C 1 53  ? 27.126  -18.138 4.348   1.00 37.52  ? 361  LEU C CG    1 
ATOM   5846  C CD1   . LEU C 1 53  ? 27.206  -18.282 2.813   1.00 24.03  ? 361  LEU C CD1   1 
ATOM   5847  C CD2   . LEU C 1 53  ? 27.598  -16.746 4.774   1.00 34.39  ? 361  LEU C CD2   1 
ATOM   5848  N N     . GLN C 1 54  ? 23.495  -19.818 6.707   1.00 23.29  ? 362  GLN C N     1 
ATOM   5849  C CA    . GLN C 1 54  ? 22.088  -19.953 7.080   1.00 25.42  ? 362  GLN C CA    1 
ATOM   5850  C C     . GLN C 1 54  ? 21.890  -19.659 8.559   1.00 29.24  ? 362  GLN C C     1 
ATOM   5851  O O     . GLN C 1 54  ? 20.909  -19.033 8.951   1.00 33.65  ? 362  GLN C O     1 
ATOM   5852  C CB    . GLN C 1 54  ? 21.538  -21.348 6.763   1.00 23.44  ? 362  GLN C CB    1 
ATOM   5853  C CG    . GLN C 1 54  ? 20.041  -21.464 7.076   1.00 30.30  ? 362  GLN C CG    1 
ATOM   5854  C CD    . GLN C 1 54  ? 19.507  -22.891 7.029   1.00 50.33  ? 362  GLN C CD    1 
ATOM   5855  O OE1   . GLN C 1 54  ? 20.046  -23.756 6.334   1.00 48.10  ? 362  GLN C OE1   1 
ATOM   5856  N NE2   . GLN C 1 54  ? 18.434  -23.140 7.774   1.00 51.13  ? 362  GLN C NE2   1 
ATOM   5857  N N     . GLN C 1 55  ? 22.826  -20.115 9.381   1.00 36.59  ? 363  GLN C N     1 
ATOM   5858  C CA    . GLN C 1 55  ? 22.727  -19.885 10.817  1.00 42.18  ? 363  GLN C CA    1 
ATOM   5859  C C     . GLN C 1 55  ? 23.001  -18.431 11.173  1.00 40.67  ? 363  GLN C C     1 
ATOM   5860  O O     . GLN C 1 55  ? 22.522  -17.935 12.193  1.00 34.46  ? 363  GLN C O     1 
ATOM   5861  C CB    . GLN C 1 55  ? 23.666  -20.810 11.586  1.00 46.99  ? 363  GLN C CB    1 
ATOM   5862  C CG    . GLN C 1 55  ? 23.273  -22.273 11.508  1.00 57.67  ? 363  GLN C CG    1 
ATOM   5863  C CD    . GLN C 1 55  ? 24.120  -23.152 12.404  1.00 71.75  ? 363  GLN C CD    1 
ATOM   5864  O OE1   . GLN C 1 55  ? 24.227  -24.360 12.186  1.00 75.22  ? 363  GLN C OE1   1 
ATOM   5865  N NE2   . GLN C 1 55  ? 24.724  -22.551 13.425  1.00 74.22  ? 363  GLN C NE2   1 
ATOM   5866  N N     . GLN C 1 56  ? 23.770  -17.749 10.331  1.00 35.14  ? 364  GLN C N     1 
ATOM   5867  C CA    . GLN C 1 56  ? 24.045  -16.333 10.540  1.00 34.35  ? 364  GLN C CA    1 
ATOM   5868  C C     . GLN C 1 56  ? 22.873  -15.476 10.084  1.00 35.23  ? 364  GLN C C     1 
ATOM   5869  O O     . GLN C 1 56  ? 22.867  -14.261 10.291  1.00 39.32  ? 364  GLN C O     1 
ATOM   5870  C CB    . GLN C 1 56  ? 25.315  -15.910 9.803   1.00 35.92  ? 364  GLN C CB    1 
ATOM   5871  C CG    . GLN C 1 56  ? 26.599  -16.477 10.386  1.00 49.17  ? 364  GLN C CG    1 
ATOM   5872  C CD    . GLN C 1 56  ? 27.844  -15.865 9.764   1.00 51.62  ? 364  GLN C CD    1 
ATOM   5873  O OE1   . GLN C 1 56  ? 27.975  -15.793 8.542   1.00 43.58  ? 364  GLN C OE1   1 
ATOM   5874  N NE2   . GLN C 1 56  ? 28.762  -15.412 10.606  1.00 56.81  ? 364  GLN C NE2   1 
ATOM   5875  N N     . GLY C 1 57  ? 21.884  -16.112 9.459   1.00 26.14  ? 365  GLY C N     1 
ATOM   5876  C CA    . GLY C 1 57  ? 20.735  -15.399 8.928   1.00 28.82  ? 365  GLY C CA    1 
ATOM   5877  C C     . GLY C 1 57  ? 21.017  -14.809 7.559   1.00 29.78  ? 365  GLY C C     1 
ATOM   5878  O O     . GLY C 1 57  ? 20.261  -13.968 7.061   1.00 32.52  ? 365  GLY C O     1 
ATOM   5879  N N     . LYS C 1 58  ? 22.112  -15.254 6.949   1.00 27.10  ? 366  LYS C N     1 
ATOM   5880  C CA    . LYS C 1 58  ? 22.470  -14.820 5.603   1.00 21.72  ? 366  LYS C CA    1 
ATOM   5881  C C     . LYS C 1 58  ? 21.924  -15.819 4.592   1.00 27.38  ? 366  LYS C C     1 
ATOM   5882  O O     . LYS C 1 58  ? 22.670  -16.601 3.997   1.00 26.80  ? 366  LYS C O     1 
ATOM   5883  C CB    . LYS C 1 58  ? 23.983  -14.678 5.471   1.00 24.55  ? 366  LYS C CB    1 
ATOM   5884  C CG    . LYS C 1 58  ? 24.562  -13.634 6.422   1.00 32.75  ? 366  LYS C CG    1 
ATOM   5885  C CD    . LYS C 1 58  ? 26.070  -13.515 6.302   1.00 35.05  ? 366  LYS C CD    1 
ATOM   5886  C CE    . LYS C 1 58  ? 26.611  -12.515 7.318   1.00 42.83  ? 366  LYS C CE    1 
ATOM   5887  N NZ    . LYS C 1 58  ? 28.074  -12.292 7.159   1.00 47.42  ? 366  LYS C NZ    1 
ATOM   5888  N N     . LEU C 1 59  ? 20.611  -15.776 4.409   1.00 24.85  ? 367  LEU C N     1 
ATOM   5889  C CA    . LEU C 1 59  ? 19.896  -16.785 3.642   1.00 24.75  ? 367  LEU C CA    1 
ATOM   5890  C C     . LEU C 1 59  ? 20.178  -16.729 2.138   1.00 27.38  ? 367  LEU C C     1 
ATOM   5891  O O     . LEU C 1 59  ? 20.423  -17.760 1.518   1.00 25.05  ? 367  LEU C O     1 
ATOM   5892  C CB    . LEU C 1 59  ? 18.401  -16.663 3.910   1.00 20.52  ? 367  LEU C CB    1 
ATOM   5893  C CG    . LEU C 1 59  ? 18.022  -16.566 5.393   1.00 18.76  ? 367  LEU C CG    1 
ATOM   5894  C CD1   . LEU C 1 59  ? 16.517  -16.460 5.553   1.00 20.79  ? 367  LEU C CD1   1 
ATOM   5895  C CD2   . LEU C 1 59  ? 18.571  -17.750 6.171   1.00 18.31  ? 367  LEU C CD2   1 
ATOM   5896  N N     . GLN C 1 60  ? 20.129  -15.538 1.551   1.00 23.03  ? 368  GLN C N     1 
ATOM   5897  C CA    . GLN C 1 60  ? 20.389  -15.404 0.122   1.00 23.21  ? 368  GLN C CA    1 
ATOM   5898  C C     . GLN C 1 60  ? 21.787  -15.928 -0.214  1.00 23.37  ? 368  GLN C C     1 
ATOM   5899  O O     . GLN C 1 60  ? 22.006  -16.579 -1.236  1.00 26.40  ? 368  GLN C O     1 
ATOM   5900  C CB    . GLN C 1 60  ? 20.252  -13.946 -0.309  1.00 19.72  ? 368  GLN C CB    1 
ATOM   5901  C CG    . GLN C 1 60  ? 18.816  -13.475 -0.452  1.00 22.77  ? 368  GLN C CG    1 
ATOM   5902  C CD    . GLN C 1 60  ? 18.744  -12.006 -0.815  1.00 36.99  ? 368  GLN C CD    1 
ATOM   5903  O OE1   . GLN C 1 60  ? 18.154  -11.631 -1.827  1.00 51.71  ? 368  GLN C OE1   1 
ATOM   5904  N NE2   . GLN C 1 60  ? 19.350  -11.165 0.014   1.00 35.68  ? 368  GLN C NE2   1 
ATOM   5905  N N     . GLU C 1 61  ? 22.738  -15.638 0.659   1.00 21.38  ? 369  GLU C N     1 
ATOM   5906  C CA    . GLU C 1 61  ? 24.101  -16.082 0.444   1.00 21.68  ? 369  GLU C CA    1 
ATOM   5907  C C     . GLU C 1 61  ? 24.230  -17.593 0.606   1.00 24.63  ? 369  GLU C C     1 
ATOM   5908  O O     . GLU C 1 61  ? 24.915  -18.257 -0.172  1.00 28.29  ? 369  GLU C O     1 
ATOM   5909  C CB    . GLU C 1 61  ? 25.055  -15.354 1.388   1.00 24.05  ? 369  GLU C CB    1 
ATOM   5910  C CG    . GLU C 1 61  ? 26.452  -15.313 0.862   1.00 26.68  ? 369  GLU C CG    1 
ATOM   5911  C CD    . GLU C 1 61  ? 27.375  -14.452 1.692   1.00 38.67  ? 369  GLU C CD    1 
ATOM   5912  O OE1   . GLU C 1 61  ? 26.897  -13.728 2.596   1.00 34.46  ? 369  GLU C OE1   1 
ATOM   5913  O OE2   . GLU C 1 61  ? 28.593  -14.508 1.434   1.00 31.03  ? 369  GLU C OE2   1 
ATOM   5914  N N     . ALA C 1 62  ? 23.571  -18.136 1.623   1.00 19.16  ? 370  ALA C N     1 
ATOM   5915  C CA    . ALA C 1 62  ? 23.540  -19.585 1.828   1.00 22.85  ? 370  ALA C CA    1 
ATOM   5916  C C     . ALA C 1 62  ? 22.994  -20.312 0.592   1.00 17.10  ? 370  ALA C C     1 
ATOM   5917  O O     . ALA C 1 62  ? 23.526  -21.346 0.188   1.00 23.62  ? 370  ALA C O     1 
ATOM   5918  C CB    . ALA C 1 62  ? 22.705  -19.924 3.059   1.00 27.62  ? 370  ALA C CB    1 
ATOM   5919  N N     . LEU C 1 63  ? 21.942  -19.755 -0.002  1.00 17.77  ? 371  LEU C N     1 
ATOM   5920  C CA    . LEU C 1 63  ? 21.313  -20.312 -1.206  1.00 17.22  ? 371  LEU C CA    1 
ATOM   5921  C C     . LEU C 1 63  ? 22.302  -20.514 -2.356  1.00 26.54  ? 371  LEU C C     1 
ATOM   5922  O O     . LEU C 1 63  ? 22.262  -21.535 -3.052  1.00 20.60  ? 371  LEU C O     1 
ATOM   5923  C CB    . LEU C 1 63  ? 20.177  -19.390 -1.657  1.00 21.38  ? 371  LEU C CB    1 
ATOM   5924  C CG    . LEU C 1 63  ? 18.835  -20.022 -1.995  1.00 33.07  ? 371  LEU C CG    1 
ATOM   5925  C CD1   . LEU C 1 63  ? 18.295  -20.790 -0.784  1.00 31.22  ? 371  LEU C CD1   1 
ATOM   5926  C CD2   . LEU C 1 63  ? 17.869  -18.939 -2.458  1.00 13.20  ? 371  LEU C CD2   1 
ATOM   5927  N N     . MET C 1 64  ? 23.185  -19.537 -2.565  1.00 24.02  ? 372  MET C N     1 
ATOM   5928  C CA    . MET C 1 64  ? 24.206  -19.646 -3.609  1.00 18.03  ? 372  MET C CA    1 
ATOM   5929  C C     . MET C 1 64  ? 25.006  -20.933 -3.469  1.00 22.59  ? 372  MET C C     1 
ATOM   5930  O O     . MET C 1 64  ? 25.321  -21.612 -4.449  1.00 24.14  ? 372  MET C O     1 
ATOM   5931  C CB    . MET C 1 64  ? 25.195  -18.474 -3.538  1.00 20.11  ? 372  MET C CB    1 
ATOM   5932  C CG    . MET C 1 64  ? 24.724  -17.190 -4.189  1.00 25.67  ? 372  MET C CG    1 
ATOM   5933  S SD    . MET C 1 64  ? 26.020  -15.931 -4.117  1.00 32.97  ? 372  MET C SD    1 
ATOM   5934  C CE    . MET C 1 64  ? 27.333  -16.729 -5.030  1.00 71.72  ? 372  MET C CE    1 
ATOM   5935  N N     . HIS C 1 65  ? 25.361  -21.249 -2.234  1.00 28.14  ? 373  HIS C N     1 
ATOM   5936  C CA    . HIS C 1 65  ? 26.220  -22.391 -1.968  1.00 22.12  ? 373  HIS C CA    1 
ATOM   5937  C C     . HIS C 1 65  ? 25.448  -23.705 -1.977  1.00 26.42  ? 373  HIS C C     1 
ATOM   5938  O O     . HIS C 1 65  ? 25.957  -24.735 -2.423  1.00 20.15  ? 373  HIS C O     1 
ATOM   5939  C CB    . HIS C 1 65  ? 26.982  -22.171 -0.666  1.00 22.14  ? 373  HIS C CB    1 
ATOM   5940  C CG    . HIS C 1 65  ? 27.945  -21.027 -0.742  1.00 29.91  ? 373  HIS C CG    1 
ATOM   5941  N ND1   . HIS C 1 65  ? 29.200  -21.152 -1.298  1.00 27.81  ? 373  HIS C ND1   1 
ATOM   5942  C CD2   . HIS C 1 65  ? 27.822  -19.728 -0.379  1.00 28.38  ? 373  HIS C CD2   1 
ATOM   5943  C CE1   . HIS C 1 65  ? 29.815  -19.983 -1.259  1.00 29.31  ? 373  HIS C CE1   1 
ATOM   5944  N NE2   . HIS C 1 65  ? 29.002  -19.102 -0.704  1.00 30.33  ? 373  HIS C NE2   1 
ATOM   5945  N N     . TYR C 1 66  ? 24.209  -23.676 -1.513  1.00 18.62  ? 374  TYR C N     1 
ATOM   5946  C CA    . TYR C 1 66  ? 23.378  -24.856 -1.651  1.00 16.32  ? 374  TYR C CA    1 
ATOM   5947  C C     . TYR C 1 66  ? 23.246  -25.201 -3.129  1.00 23.58  ? 374  TYR C C     1 
ATOM   5948  O O     . TYR C 1 66  ? 23.294  -26.376 -3.502  1.00 20.01  ? 374  TYR C O     1 
ATOM   5949  C CB    . TYR C 1 66  ? 22.001  -24.631 -1.021  1.00 17.70  ? 374  TYR C CB    1 
ATOM   5950  C CG    . TYR C 1 66  ? 22.008  -24.788 0.482   1.00 21.98  ? 374  TYR C CG    1 
ATOM   5951  C CD1   . TYR C 1 66  ? 22.573  -25.906 1.075   1.00 30.09  ? 374  TYR C CD1   1 
ATOM   5952  C CD2   . TYR C 1 66  ? 21.469  -23.813 1.306   1.00 12.87  ? 374  TYR C CD2   1 
ATOM   5953  C CE1   . TYR C 1 66  ? 22.589  -26.051 2.448   1.00 24.84  ? 374  TYR C CE1   1 
ATOM   5954  C CE2   . TYR C 1 66  ? 21.481  -23.949 2.666   1.00 19.88  ? 374  TYR C CE2   1 
ATOM   5955  C CZ    . TYR C 1 66  ? 22.040  -25.064 3.237   1.00 26.94  ? 374  TYR C CZ    1 
ATOM   5956  O OH    . TYR C 1 66  ? 22.054  -25.192 4.609   1.00 23.17  ? 374  TYR C OH    1 
ATOM   5957  N N     . LYS C 1 67  ? 23.086  -24.182 -3.971  1.00 14.22  ? 375  LYS C N     1 
ATOM   5958  C CA    . LYS C 1 67  ? 22.932  -24.418 -5.405  1.00 19.07  ? 375  LYS C CA    1 
ATOM   5959  C C     . LYS C 1 67  ? 24.178  -25.069 -6.016  1.00 24.52  ? 375  LYS C C     1 
ATOM   5960  O O     . LYS C 1 67  ? 24.087  -25.954 -6.865  1.00 16.22  ? 375  LYS C O     1 
ATOM   5961  C CB    . LYS C 1 67  ? 22.533  -23.122 -6.139  1.00 20.13  ? 375  LYS C CB    1 
ATOM   5962  C CG    . LYS C 1 67  ? 21.080  -22.725 -5.888  1.00 18.27  ? 375  LYS C CG    1 
ATOM   5963  C CD    . LYS C 1 67  ? 20.707  -21.368 -6.518  1.00 16.23  ? 375  LYS C CD    1 
ATOM   5964  C CE    . LYS C 1 67  ? 19.352  -20.904 -5.979  1.00 17.34  ? 375  LYS C CE    1 
ATOM   5965  N NZ    . LYS C 1 67  ? 18.979  -19.553 -6.484  1.00 23.75  ? 375  LYS C NZ    1 
ATOM   5966  N N     . GLU C 1 68  ? 25.350  -24.639 -5.569  1.00 15.32  ? 376  GLU C N     1 
ATOM   5967  C CA    . GLU C 1 68  ? 26.582  -25.275 -6.000  1.00 19.04  ? 376  GLU C CA    1 
ATOM   5968  C C     . GLU C 1 68  ? 26.618  -26.749 -5.610  1.00 32.23  ? 376  GLU C C     1 
ATOM   5969  O O     . GLU C 1 68  ? 26.888  -27.617 -6.444  1.00 30.99  ? 376  GLU C O     1 
ATOM   5970  C CB    . GLU C 1 68  ? 27.785  -24.543 -5.412  1.00 31.20  ? 376  GLU C CB    1 
ATOM   5971  C CG    . GLU C 1 68  ? 28.003  -23.191 -6.049  1.00 38.53  ? 376  GLU C CG    1 
ATOM   5972  C CD    . GLU C 1 68  ? 27.986  -23.287 -7.561  1.00 44.89  ? 376  GLU C CD    1 
ATOM   5973  O OE1   . GLU C 1 68  ? 28.934  -23.898 -8.107  1.00 27.88  ? 376  GLU C OE1   1 
ATOM   5974  O OE2   . GLU C 1 68  ? 27.019  -22.784 -8.192  1.00 35.83  ? 376  GLU C OE2   1 
ATOM   5975  N N     . ALA C 1 69  ? 26.335  -27.030 -4.344  1.00 19.27  ? 377  ALA C N     1 
ATOM   5976  C CA    . ALA C 1 69  ? 26.421  -28.395 -3.838  1.00 18.81  ? 377  ALA C CA    1 
ATOM   5977  C C     . ALA C 1 69  ? 25.550  -29.356 -4.645  1.00 30.93  ? 377  ALA C C     1 
ATOM   5978  O O     . ALA C 1 69  ? 26.014  -30.420 -5.075  1.00 19.25  ? 377  ALA C O     1 
ATOM   5979  C CB    . ALA C 1 69  ? 26.042  -28.438 -2.350  1.00 17.73  ? 377  ALA C CB    1 
ATOM   5980  N N     . ILE C 1 70  ? 24.293  -28.984 -4.862  1.00 28.08  ? 378  ILE C N     1 
ATOM   5981  C CA    . ILE C 1 70  ? 23.381  -29.865 -5.581  1.00 26.88  ? 378  ILE C CA    1 
ATOM   5982  C C     . ILE C 1 70  ? 23.780  -30.083 -7.033  1.00 21.67  ? 378  ILE C C     1 
ATOM   5983  O O     . ILE C 1 70  ? 23.519  -31.145 -7.585  1.00 31.37  ? 378  ILE C O     1 
ATOM   5984  C CB    . ILE C 1 70  ? 21.913  -29.398 -5.510  1.00 25.41  ? 378  ILE C CB    1 
ATOM   5985  C CG1   . ILE C 1 70  ? 21.757  -27.991 -6.094  1.00 17.71  ? 378  ILE C CG1   1 
ATOM   5986  C CG2   . ILE C 1 70  ? 21.410  -29.474 -4.077  1.00 24.83  ? 378  ILE C CG2   1 
ATOM   5987  C CD1   . ILE C 1 70  ? 20.251  -27.590 -6.309  1.00 20.92  ? 378  ILE C CD1   1 
ATOM   5988  N N     . ARG C 1 71  ? 24.415  -29.093 -7.660  1.00 26.61  ? 379  ARG C N     1 
ATOM   5989  C CA    . ARG C 1 71  ? 24.892  -29.294 -9.020  1.00 29.56  ? 379  ARG C CA    1 
ATOM   5990  C C     . ARG C 1 71  ? 25.975  -30.371 -9.002  1.00 36.94  ? 379  ARG C C     1 
ATOM   5991  O O     . ARG C 1 71  ? 25.859  -31.409 -9.659  1.00 36.28  ? 379  ARG C O     1 
ATOM   5992  C CB    . ARG C 1 71  ? 25.452  -27.999 -9.629  1.00 19.14  ? 379  ARG C CB    1 
ATOM   5993  C CG    . ARG C 1 71  ? 25.962  -28.181 -11.050 1.00 24.11  ? 379  ARG C CG    1 
ATOM   5994  C CD    . ARG C 1 71  ? 26.445  -26.865 -11.674 1.00 32.16  ? 379  ARG C CD    1 
ATOM   5995  N NE    . ARG C 1 71  ? 27.439  -26.150 -10.868 1.00 28.73  ? 379  ARG C NE    1 
ATOM   5996  C CZ    . ARG C 1 71  ? 28.703  -26.532 -10.717 1.00 30.77  ? 379  ARG C CZ    1 
ATOM   5997  N NH1   . ARG C 1 71  ? 29.139  -27.642 -11.296 1.00 39.89  ? 379  ARG C NH1   1 
ATOM   5998  N NH2   . ARG C 1 71  ? 29.532  -25.811 -9.974  1.00 31.86  ? 379  ARG C NH2   1 
ATOM   5999  N N     . ILE C 1 72  ? 27.019  -30.104 -8.228  1.00 32.99  ? 380  ILE C N     1 
ATOM   6000  C CA    . ILE C 1 72  ? 28.192  -30.963 -8.141  1.00 23.46  ? 380  ILE C CA    1 
ATOM   6001  C C     . ILE C 1 72  ? 27.799  -32.406 -7.792  1.00 37.69  ? 380  ILE C C     1 
ATOM   6002  O O     . ILE C 1 72  ? 28.176  -33.344 -8.494  1.00 37.67  ? 380  ILE C O     1 
ATOM   6003  C CB    . ILE C 1 72  ? 29.190  -30.394 -7.100  1.00 27.43  ? 380  ILE C CB    1 
ATOM   6004  C CG1   . ILE C 1 72  ? 29.631  -28.988 -7.508  1.00 18.51  ? 380  ILE C CG1   1 
ATOM   6005  C CG2   . ILE C 1 72  ? 30.417  -31.290 -6.943  1.00 26.51  ? 380  ILE C CG2   1 
ATOM   6006  C CD1   . ILE C 1 72  ? 30.283  -28.201 -6.383  1.00 26.04  ? 380  ILE C CD1   1 
ATOM   6007  N N     . SER C 1 73  ? 27.028  -32.576 -6.722  1.00 31.16  ? 381  SER C N     1 
ATOM   6008  C CA    A SER C 1 73  ? 26.609  -33.901 -6.275  0.50 27.91  ? 381  SER C CA    1 
ATOM   6009  C CA    B SER C 1 73  ? 26.609  -33.901 -6.269  0.50 27.93  ? 381  SER C CA    1 
ATOM   6010  C C     . SER C 1 73  ? 25.101  -34.065 -6.434  1.00 36.00  ? 381  SER C C     1 
ATOM   6011  O O     . SER C 1 73  ? 24.347  -33.750 -5.526  1.00 33.78  ? 381  SER C O     1 
ATOM   6012  C CB    A SER C 1 73  ? 27.003  -34.111 -4.812  0.50 27.52  ? 381  SER C CB    1 
ATOM   6013  C CB    B SER C 1 73  ? 26.982  -34.100 -4.797  0.50 27.37  ? 381  SER C CB    1 
ATOM   6014  O OG    A SER C 1 73  ? 26.715  -35.428 -4.384  0.50 23.34  ? 381  SER C OG    1 
ATOM   6015  O OG    B SER C 1 73  ? 28.297  -33.639 -4.529  0.50 32.44  ? 381  SER C OG    1 
ATOM   6016  N N     . PRO C 1 74  ? 24.659  -34.563 -7.601  1.00 32.91  ? 382  PRO C N     1 
ATOM   6017  C CA    . PRO C 1 74  ? 23.231  -34.685 -7.914  1.00 28.31  ? 382  PRO C CA    1 
ATOM   6018  C C     . PRO C 1 74  ? 22.496  -35.729 -7.071  1.00 31.61  ? 382  PRO C C     1 
ATOM   6019  O O     . PRO C 1 74  ? 21.266  -35.792 -7.131  1.00 35.90  ? 382  PRO C O     1 
ATOM   6020  C CB    . PRO C 1 74  ? 23.228  -35.118 -9.387  1.00 26.53  ? 382  PRO C CB    1 
ATOM   6021  C CG    . PRO C 1 74  ? 24.619  -34.866 -9.890  1.00 38.21  ? 382  PRO C CG    1 
ATOM   6022  C CD    . PRO C 1 74  ? 25.504  -35.046 -8.703  1.00 41.99  ? 382  PRO C CD    1 
ATOM   6023  N N     . THR C 1 75  ? 23.229  -36.543 -6.318  1.00 38.15  ? 383  THR C N     1 
ATOM   6024  C CA    . THR C 1 75  ? 22.603  -37.529 -5.436  1.00 40.24  ? 383  THR C CA    1 
ATOM   6025  C C     . THR C 1 75  ? 22.669  -37.048 -3.987  1.00 41.19  ? 383  THR C C     1 
ATOM   6026  O O     . THR C 1 75  ? 22.410  -37.805 -3.050  1.00 49.77  ? 383  THR C O     1 
ATOM   6027  C CB    . THR C 1 75  ? 23.268  -38.931 -5.569  1.00 29.66  ? 383  THR C CB    1 
ATOM   6028  O OG1   . THR C 1 75  ? 24.626  -38.870 -5.115  1.00 27.30  ? 383  THR C OG1   1 
ATOM   6029  C CG2   . THR C 1 75  ? 23.239  -39.417 -7.015  1.00 18.48  ? 383  THR C CG2   1 
ATOM   6030  N N     . PHE C 1 76  ? 23.018  -35.774 -3.826  1.00 34.27  ? 384  PHE C N     1 
ATOM   6031  C CA    . PHE C 1 76  ? 23.178  -35.137 -2.520  1.00 38.64  ? 384  PHE C CA    1 
ATOM   6032  C C     . PHE C 1 76  ? 21.816  -34.745 -1.947  1.00 26.05  ? 384  PHE C C     1 
ATOM   6033  O O     . PHE C 1 76  ? 21.449  -33.567 -1.957  1.00 23.40  ? 384  PHE C O     1 
ATOM   6034  C CB    . PHE C 1 76  ? 24.028  -33.870 -2.683  1.00 41.22  ? 384  PHE C CB    1 
ATOM   6035  C CG    . PHE C 1 76  ? 24.769  -33.452 -1.442  1.00 36.43  ? 384  PHE C CG    1 
ATOM   6036  C CD1   . PHE C 1 76  ? 25.714  -32.441 -1.505  1.00 33.20  ? 384  PHE C CD1   1 
ATOM   6037  C CD2   . PHE C 1 76  ? 24.539  -34.071 -0.224  1.00 38.48  ? 384  PHE C CD2   1 
ATOM   6038  C CE1   . PHE C 1 76  ? 26.409  -32.048 -0.379  1.00 37.98  ? 384  PHE C CE1   1 
ATOM   6039  C CE2   . PHE C 1 76  ? 25.232  -33.680 0.913   1.00 33.08  ? 384  PHE C CE2   1 
ATOM   6040  C CZ    . PHE C 1 76  ? 26.164  -32.670 0.836   1.00 41.17  ? 384  PHE C CZ    1 
ATOM   6041  N N     . ALA C 1 77  ? 21.068  -35.721 -1.446  1.00 25.18  ? 385  ALA C N     1 
ATOM   6042  C CA    . ALA C 1 77  ? 19.732  -35.435 -0.928  1.00 21.41  ? 385  ALA C CA    1 
ATOM   6043  C C     . ALA C 1 77  ? 19.794  -34.458 0.241   1.00 23.06  ? 385  ALA C C     1 
ATOM   6044  O O     . ALA C 1 77  ? 18.915  -33.597 0.412   1.00 16.56  ? 385  ALA C O     1 
ATOM   6045  C CB    . ALA C 1 77  ? 19.023  -36.720 -0.537  1.00 29.45  ? 385  ALA C CB    1 
ATOM   6046  N N     . ASP C 1 78  ? 20.849  -34.583 1.038   1.00 16.85  ? 386  ASP C N     1 
ATOM   6047  C CA    . ASP C 1 78  ? 21.008  -33.764 2.234   1.00 24.72  ? 386  ASP C CA    1 
ATOM   6048  C C     . ASP C 1 78  ? 21.040  -32.297 1.885   1.00 23.59  ? 386  ASP C C     1 
ATOM   6049  O O     . ASP C 1 78  ? 20.522  -31.465 2.625   1.00 19.78  ? 386  ASP C O     1 
ATOM   6050  C CB    . ASP C 1 78  ? 22.294  -34.134 2.963   1.00 29.57  ? 386  ASP C CB    1 
ATOM   6051  C CG    . ASP C 1 78  ? 22.035  -34.782 4.295   1.00 47.96  ? 386  ASP C CG    1 
ATOM   6052  O OD1   . ASP C 1 78  ? 22.482  -35.931 4.490   1.00 56.44  ? 386  ASP C OD1   1 
ATOM   6053  O OD2   . ASP C 1 78  ? 21.389  -34.143 5.151   1.00 59.39  ? 386  ASP C OD2   1 
ATOM   6054  N N     . ALA C 1 79  ? 21.662  -31.981 0.756   1.00 17.63  ? 387  ALA C N     1 
ATOM   6055  C CA    . ALA C 1 79  ? 21.773  -30.594 0.330   1.00 18.08  ? 387  ALA C CA    1 
ATOM   6056  C C     . ALA C 1 79  ? 20.425  -30.049 -0.118  1.00 15.33  ? 387  ALA C C     1 
ATOM   6057  O O     . ALA C 1 79  ? 20.085  -28.913 0.203   1.00 16.94  ? 387  ALA C O     1 
ATOM   6058  C CB    . ALA C 1 79  ? 22.832  -30.435 -0.768  1.00 22.78  ? 387  ALA C CB    1 
ATOM   6059  N N     . TYR C 1 80  ? 19.669  -30.852 -0.864  1.00 17.80  ? 388  TYR C N     1 
ATOM   6060  C CA    . TYR C 1 80  ? 18.308  -30.474 -1.242  1.00 17.10  ? 388  TYR C CA    1 
ATOM   6061  C C     . TYR C 1 80  ? 17.453  -30.175 -0.014  1.00 18.88  ? 388  TYR C C     1 
ATOM   6062  O O     . TYR C 1 80  ? 16.777  -29.146 0.045   1.00 14.22  ? 388  TYR C O     1 
ATOM   6063  C CB    . TYR C 1 80  ? 17.648  -31.557 -2.104  1.00 12.93  ? 388  TYR C CB    1 
ATOM   6064  C CG    . TYR C 1 80  ? 17.959  -31.390 -3.577  1.00 15.69  ? 388  TYR C CG    1 
ATOM   6065  C CD1   . TYR C 1 80  ? 17.237  -30.491 -4.361  1.00 20.15  ? 388  TYR C CD1   1 
ATOM   6066  C CD2   . TYR C 1 80  ? 18.978  -32.114 -4.179  1.00 14.54  ? 388  TYR C CD2   1 
ATOM   6067  C CE1   . TYR C 1 80  ? 17.525  -30.317 -5.713  1.00 20.92  ? 388  TYR C CE1   1 
ATOM   6068  C CE2   . TYR C 1 80  ? 19.269  -31.952 -5.533  1.00 21.17  ? 388  TYR C CE2   1 
ATOM   6069  C CZ    . TYR C 1 80  ? 18.539  -31.052 -6.292  1.00 18.28  ? 388  TYR C CZ    1 
ATOM   6070  O OH    . TYR C 1 80  ? 18.837  -30.870 -7.632  1.00 18.61  ? 388  TYR C OH    1 
ATOM   6071  N N     . SER C 1 81  ? 17.494  -31.087 0.957   1.00 19.83  ? 389  SER C N     1 
ATOM   6072  C CA    . SER C 1 81  ? 16.725  -30.961 2.188   1.00 10.83  ? 389  SER C CA    1 
ATOM   6073  C C     . SER C 1 81  ? 17.122  -29.700 2.958   1.00 13.25  ? 389  SER C C     1 
ATOM   6074  O O     . SER C 1 81  ? 16.276  -28.913 3.379   1.00 17.42  ? 389  SER C O     1 
ATOM   6075  C CB    . SER C 1 81  ? 16.964  -32.182 3.072   1.00 21.36  ? 389  SER C CB    1 
ATOM   6076  O OG    . SER C 1 81  ? 16.247  -32.065 4.289   1.00 19.10  ? 389  SER C OG    1 
ATOM   6077  N N     . ASN C 1 82  ? 18.424  -29.528 3.156   1.00 15.93  ? 390  ASN C N     1 
ATOM   6078  C CA    . ASN C 1 82  ? 18.918  -28.340 3.820   1.00 16.94  ? 390  ASN C CA    1 
ATOM   6079  C C     . ASN C 1 82  ? 18.595  -27.070 3.060   1.00 18.57  ? 390  ASN C C     1 
ATOM   6080  O O     . ASN C 1 82  ? 18.249  -26.080 3.671   1.00 10.89  ? 390  ASN C O     1 
ATOM   6081  C CB    . ASN C 1 82  ? 20.418  -28.451 4.103   1.00 16.92  ? 390  ASN C CB    1 
ATOM   6082  C CG    . ASN C 1 82  ? 20.704  -29.300 5.328   1.00 26.01  ? 390  ASN C CG    1 
ATOM   6083  O OD1   . ASN C 1 82  ? 19.979  -29.232 6.314   1.00 30.23  ? 390  ASN C OD1   1 
ATOM   6084  N ND2   . ASN C 1 82  ? 21.748  -30.114 5.265   1.00 23.50  ? 390  ASN C ND2   1 
ATOM   6085  N N     . MET C 1 83  ? 18.714  -27.090 1.734   1.00 16.10  ? 391  MET C N     1 
ATOM   6086  C CA    . MET C 1 83  ? 18.339  -25.916 0.953   1.00 11.33  ? 391  MET C CA    1 
ATOM   6087  C C     . MET C 1 83  ? 16.857  -25.644 1.165   1.00 18.71  ? 391  MET C C     1 
ATOM   6088  O O     . MET C 1 83  ? 16.428  -24.497 1.235   1.00 15.58  ? 391  MET C O     1 
ATOM   6089  C CB    . MET C 1 83  ? 18.630  -26.157 -0.529  1.00 14.26  ? 391  MET C CB    1 
ATOM   6090  C CG    . MET C 1 83  ? 18.222  -25.031 -1.448  1.00 23.57  ? 391  MET C CG    1 
ATOM   6091  S SD    . MET C 1 83  ? 18.850  -25.302 -3.129  1.00 21.19  ? 391  MET C SD    1 
ATOM   6092  C CE    . MET C 1 83  ? 17.682  -24.292 -4.028  1.00 13.47  ? 391  MET C CE    1 
ATOM   6093  N N     . GLY C 1 84  ? 16.076  -26.710 1.273   1.00 13.08  ? 392  GLY C N     1 
ATOM   6094  C CA    . GLY C 1 84  ? 14.652  -26.561 1.516   1.00 16.31  ? 392  GLY C CA    1 
ATOM   6095  C C     . GLY C 1 84  ? 14.396  -25.780 2.800   1.00 19.50  ? 392  GLY C C     1 
ATOM   6096  O O     . GLY C 1 84  ? 13.573  -24.877 2.820   1.00 13.99  ? 392  GLY C O     1 
ATOM   6097  N N     . ASN C 1 85  ? 15.100  -26.134 3.874   1.00 13.83  ? 393  ASN C N     1 
ATOM   6098  C CA    . ASN C 1 85  ? 14.995  -25.400 5.137   1.00 13.90  ? 393  ASN C CA    1 
ATOM   6099  C C     . ASN C 1 85  ? 15.291  -23.914 4.988   1.00 11.05  ? 393  ASN C C     1 
ATOM   6100  O O     . ASN C 1 85  ? 14.663  -23.080 5.629   1.00 13.37  ? 393  ASN C O     1 
ATOM   6101  C CB    . ASN C 1 85  ? 15.956  -25.963 6.171   1.00 13.29  ? 393  ASN C CB    1 
ATOM   6102  C CG    . ASN C 1 85  ? 15.538  -27.322 6.674   1.00 16.38  ? 393  ASN C CG    1 
ATOM   6103  O OD1   . ASN C 1 85  ? 14.415  -27.762 6.454   1.00 21.29  ? 393  ASN C OD1   1 
ATOM   6104  N ND2   . ASN C 1 85  ? 16.447  -27.997 7.343   1.00 15.84  ? 393  ASN C ND2   1 
ATOM   6105  N N     . THR C 1 86  ? 16.261  -23.585 4.150   1.00 18.09  ? 394  THR C N     1 
ATOM   6106  C CA    . THR C 1 86  ? 16.593  -22.179 3.927   1.00 15.05  ? 394  THR C CA    1 
ATOM   6107  C C     . THR C 1 86  ? 15.476  -21.442 3.160   1.00 11.92  ? 394  THR C C     1 
ATOM   6108  O O     . THR C 1 86  ? 15.083  -20.331 3.541   1.00 16.11  ? 394  THR C O     1 
ATOM   6109  C CB    . THR C 1 86  ? 17.950  -22.039 3.223   1.00 21.55  ? 394  THR C CB    1 
ATOM   6110  O OG1   . THR C 1 86  ? 18.985  -22.487 4.113   1.00 18.70  ? 394  THR C OG1   1 
ATOM   6111  C CG2   . THR C 1 86  ? 18.215  -20.585 2.844   1.00 17.59  ? 394  THR C CG2   1 
ATOM   6112  N N     . LEU C 1 87  ? 14.945  -22.060 2.107   1.00 11.14  ? 395  LEU C N     1 
ATOM   6113  C CA    . LEU C 1 87  ? 13.800  -21.466 1.402   1.00 11.32  ? 395  LEU C CA    1 
ATOM   6114  C C     . LEU C 1 87  ? 12.600  -21.286 2.317   1.00 15.52  ? 395  LEU C C     1 
ATOM   6115  O O     . LEU C 1 87  ? 11.886  -20.284 2.231   1.00 19.54  ? 395  LEU C O     1 
ATOM   6116  C CB    . LEU C 1 87  ? 13.402  -22.291 0.196   1.00 11.89  ? 395  LEU C CB    1 
ATOM   6117  C CG    . LEU C 1 87  ? 14.461  -22.326 -0.914  1.00 22.37  ? 395  LEU C CG    1 
ATOM   6118  C CD1   . LEU C 1 87  ? 13.985  -23.160 -2.099  1.00 13.05  ? 395  LEU C CD1   1 
ATOM   6119  C CD2   . LEU C 1 87  ? 14.816  -20.914 -1.352  1.00 14.45  ? 395  LEU C CD2   1 
ATOM   6120  N N     . LYS C 1 88  ? 12.361  -22.262 3.183   1.00 14.51  ? 396  LYS C N     1 
ATOM   6121  C CA    . LYS C 1 88  ? 11.247  -22.151 4.124   1.00 17.86  ? 396  LYS C CA    1 
ATOM   6122  C C     . LYS C 1 88  ? 11.442  -20.899 4.984   1.00 21.68  ? 396  LYS C C     1 
ATOM   6123  O O     . LYS C 1 88  ? 10.509  -20.138 5.232   1.00 16.47  ? 396  LYS C O     1 
ATOM   6124  C CB    . LYS C 1 88  ? 11.143  -23.410 4.993   1.00 17.25  ? 396  LYS C CB    1 
ATOM   6125  C CG    . LYS C 1 88  ? 9.907   -23.473 5.907   1.00 23.26  ? 396  LYS C CG    1 
ATOM   6126  C CD    . LYS C 1 88  ? 9.977   -24.696 6.819   1.00 25.41  ? 396  LYS C CD    1 
ATOM   6127  C CE    . LYS C 1 88  ? 8.917   -24.662 7.911   1.00 36.42  ? 396  LYS C CE    1 
ATOM   6128  N NZ    . LYS C 1 88  ? 7.541   -24.657 7.353   1.00 43.97  ? 396  LYS C NZ    1 
ATOM   6129  N N     . GLU C 1 89  ? 12.671  -20.674 5.422   1.00 18.54  ? 397  GLU C N     1 
ATOM   6130  C CA    . GLU C 1 89  ? 12.947  -19.518 6.263   1.00 26.57  ? 397  GLU C CA    1 
ATOM   6131  C C     . GLU C 1 89  ? 12.812  -18.211 5.481   1.00 29.60  ? 397  GLU C C     1 
ATOM   6132  O O     . GLU C 1 89  ? 12.486  -17.169 6.049   1.00 24.02  ? 397  GLU C O     1 
ATOM   6133  C CB    . GLU C 1 89  ? 14.325  -19.634 6.902   1.00 27.58  ? 397  GLU C CB    1 
ATOM   6134  C CG    . GLU C 1 89  ? 14.627  -18.521 7.884   1.00 38.12  ? 397  GLU C CG    1 
ATOM   6135  C CD    . GLU C 1 89  ? 15.851  -18.806 8.726   1.00 38.71  ? 397  GLU C CD    1 
ATOM   6136  O OE1   . GLU C 1 89  ? 16.356  -19.952 8.678   1.00 40.68  ? 397  GLU C OE1   1 
ATOM   6137  O OE2   . GLU C 1 89  ? 16.304  -17.883 9.440   1.00 31.65  ? 397  GLU C OE2   1 
ATOM   6138  N N     . MET C 1 90  ? 13.055  -18.276 4.175   1.00 18.91  ? 398  MET C N     1 
ATOM   6139  C CA    . MET C 1 90  ? 12.880  -17.123 3.299   1.00 22.03  ? 398  MET C CA    1 
ATOM   6140  C C     . MET C 1 90  ? 11.424  -16.911 2.897   1.00 16.43  ? 398  MET C C     1 
ATOM   6141  O O     . MET C 1 90  ? 11.120  -15.998 2.125   1.00 23.84  ? 398  MET C O     1 
ATOM   6142  C CB    . MET C 1 90  ? 13.736  -17.290 2.044   1.00 23.00  ? 398  MET C CB    1 
ATOM   6143  C CG    . MET C 1 90  ? 15.220  -17.380 2.339   1.00 19.65  ? 398  MET C CG    1 
ATOM   6144  S SD    . MET C 1 90  ? 16.220  -17.715 0.891   1.00 21.39  ? 398  MET C SD    1 
ATOM   6145  C CE    . MET C 1 90  ? 15.968  -16.216 -0.066  1.00 25.61  ? 398  MET C CE    1 
ATOM   6146  N N     . GLN C 1 91  ? 10.536  -17.758 3.413   1.00 14.70  ? 399  GLN C N     1 
ATOM   6147  C CA    . GLN C 1 91  ? 9.104   -17.699 3.102   1.00 19.52  ? 399  GLN C CA    1 
ATOM   6148  C C     . GLN C 1 91  ? 8.804   -18.089 1.661   1.00 29.18  ? 399  GLN C C     1 
ATOM   6149  O O     . GLN C 1 91  ? 7.771   -17.703 1.114   1.00 23.08  ? 399  GLN C O     1 
ATOM   6150  C CB    . GLN C 1 91  ? 8.528   -16.300 3.371   1.00 26.70  ? 399  GLN C CB    1 
ATOM   6151  C CG    . GLN C 1 91  ? 8.932   -15.681 4.695   1.00 42.59  ? 399  GLN C CG    1 
ATOM   6152  C CD    . GLN C 1 91  ? 8.008   -16.073 5.827   1.00 60.85  ? 399  GLN C CD    1 
ATOM   6153  O OE1   . GLN C 1 91  ? 7.255   -17.041 5.722   1.00 69.72  ? 399  GLN C OE1   1 
ATOM   6154  N NE2   . GLN C 1 91  ? 8.053   -15.313 6.917   1.00 65.29  ? 399  GLN C NE2   1 
ATOM   6155  N N     . ASP C 1 92  ? 9.711   -18.840 1.041   1.00 27.04  ? 400  ASP C N     1 
ATOM   6156  C CA    . ASP C 1 92  ? 9.433   -19.427 -0.264  1.00 23.59  ? 400  ASP C CA    1 
ATOM   6157  C C     . ASP C 1 92  ? 8.902   -20.832 -0.020  1.00 29.13  ? 400  ASP C C     1 
ATOM   6158  O O     . ASP C 1 92  ? 9.678   -21.784 0.015   1.00 20.61  ? 400  ASP C O     1 
ATOM   6159  C CB    . ASP C 1 92  ? 10.708  -19.466 -1.105  1.00 15.57  ? 400  ASP C CB    1 
ATOM   6160  C CG    . ASP C 1 92  ? 10.496  -20.079 -2.487  1.00 24.15  ? 400  ASP C CG    1 
ATOM   6161  O OD1   . ASP C 1 92  ? 9.349   -20.428 -2.855  1.00 22.31  ? 400  ASP C OD1   1 
ATOM   6162  O OD2   . ASP C 1 92  ? 11.509  -20.214 -3.207  1.00 17.13  ? 400  ASP C OD2   1 
ATOM   6163  N N     . VAL C 1 93  ? 7.586   -20.944 0.166   1.00 23.46  ? 401  VAL C N     1 
ATOM   6164  C CA    . VAL C 1 93  ? 6.937   -22.200 0.550   1.00 27.39  ? 401  VAL C CA    1 
ATOM   6165  C C     . VAL C 1 93  ? 6.925   -23.257 -0.554  1.00 15.36  ? 401  VAL C C     1 
ATOM   6166  O O     . VAL C 1 93  ? 7.205   -24.425 -0.290  1.00 19.96  ? 401  VAL C O     1 
ATOM   6167  C CB    . VAL C 1 93  ? 5.486   -21.980 1.074   1.00 25.54  ? 401  VAL C CB    1 
ATOM   6168  C CG1   . VAL C 1 93  ? 4.676   -23.258 0.925   1.00 44.96  ? 401  VAL C CG1   1 
ATOM   6169  C CG2   . VAL C 1 93  ? 5.506   -21.541 2.545   1.00 22.20  ? 401  VAL C CG2   1 
ATOM   6170  N N     . GLN C 1 94  ? 6.619   -22.841 -1.778  1.00 20.72  ? 402  GLN C N     1 
ATOM   6171  C CA    . GLN C 1 94  ? 6.648   -23.737 -2.927  1.00 24.38  ? 402  GLN C CA    1 
ATOM   6172  C C     . GLN C 1 94  ? 8.069   -24.224 -3.193  1.00 14.72  ? 402  GLN C C     1 
ATOM   6173  O O     . GLN C 1 94  ? 8.303   -25.402 -3.468  1.00 14.50  ? 402  GLN C O     1 
ATOM   6174  C CB    . GLN C 1 94  ? 6.113   -23.037 -4.178  1.00 23.27  ? 402  GLN C CB    1 
ATOM   6175  C CG    . GLN C 1 94  ? 4.593   -22.933 -4.259  1.00 29.60  ? 402  GLN C CG    1 
ATOM   6176  C CD    . GLN C 1 94  ? 4.109   -22.562 -5.656  1.00 44.67  ? 402  GLN C CD    1 
ATOM   6177  O OE1   . GLN C 1 94  ? 4.910   -22.351 -6.570  1.00 54.37  ? 402  GLN C OE1   1 
ATOM   6178  N NE2   . GLN C 1 94  ? 2.794   -22.484 -5.825  1.00 51.54  ? 402  GLN C NE2   1 
ATOM   6179  N N     . GLY C 1 95  ? 9.014   -23.303 -3.133  1.00 15.48  ? 403  GLY C N     1 
ATOM   6180  C CA    . GLY C 1 95  ? 10.394  -23.646 -3.393  1.00 19.54  ? 403  GLY C CA    1 
ATOM   6181  C C     . GLY C 1 95  ? 10.858  -24.717 -2.431  1.00 12.97  ? 403  GLY C C     1 
ATOM   6182  O O     . GLY C 1 95  ? 11.522  -25.672 -2.831  1.00 17.85  ? 403  GLY C O     1 
ATOM   6183  N N     . ALA C 1 96  ? 10.513  -24.557 -1.155  1.00 13.52  ? 404  ALA C N     1 
ATOM   6184  C CA    . ALA C 1 96  ? 10.990  -25.472 -0.121  1.00 18.83  ? 404  ALA C CA    1 
ATOM   6185  C C     . ALA C 1 96  ? 10.398  -26.829 -0.354  1.00 16.96  ? 404  ALA C C     1 
ATOM   6186  O O     . ALA C 1 96  ? 11.077  -27.837 -0.241  1.00 13.30  ? 404  ALA C O     1 
ATOM   6187  C CB    . ALA C 1 96  ? 10.602  -24.978 1.284   1.00 15.81  ? 404  ALA C CB    1 
ATOM   6188  N N     . LEU C 1 97  ? 9.108   -26.855 -0.656  1.00 11.00  ? 405  LEU C N     1 
ATOM   6189  C CA    . LEU C 1 97  ? 8.451   -28.112 -0.950  1.00 15.33  ? 405  LEU C CA    1 
ATOM   6190  C C     . LEU C 1 97  ? 9.107   -28.800 -2.133  1.00 15.37  ? 405  LEU C C     1 
ATOM   6191  O O     . LEU C 1 97  ? 9.311   -30.009 -2.116  1.00 17.41  ? 405  LEU C O     1 
ATOM   6192  C CB    . LEU C 1 97  ? 6.965   -27.907 -1.233  1.00 21.83  ? 405  LEU C CB    1 
ATOM   6193  C CG    . LEU C 1 97  ? 6.162   -29.200 -1.105  1.00 24.73  ? 405  LEU C CG    1 
ATOM   6194  C CD1   . LEU C 1 97  ? 4.872   -28.926 -0.351  1.00 25.06  ? 405  LEU C CD1   1 
ATOM   6195  C CD2   . LEU C 1 97  ? 5.900   -29.844 -2.473  1.00 32.55  ? 405  LEU C CD2   1 
ATOM   6196  N N     . GLN C 1 98  ? 9.409   -28.038 -3.174  1.00 20.33  ? 406  GLN C N     1 
ATOM   6197  C CA    . GLN C 1 98  ? 10.071  -28.607 -4.335  1.00 14.34  ? 406  GLN C CA    1 
ATOM   6198  C C     . GLN C 1 98  ? 11.375  -29.273 -3.890  1.00 16.66  ? 406  GLN C C     1 
ATOM   6199  O O     . GLN C 1 98  ? 11.696  -30.375 -4.316  1.00 16.41  ? 406  GLN C O     1 
ATOM   6200  C CB    . GLN C 1 98  ? 10.336  -27.509 -5.379  1.00 23.43  ? 406  GLN C CB    1 
ATOM   6201  C CG    . GLN C 1 98  ? 10.874  -28.005 -6.708  1.00 42.53  ? 406  GLN C CG    1 
ATOM   6202  C CD    . GLN C 1 98  ? 9.829   -28.711 -7.560  1.00 41.15  ? 406  GLN C CD    1 
ATOM   6203  O OE1   . GLN C 1 98  ? 10.144  -29.193 -8.655  1.00 18.70  ? 406  GLN C OE1   1 
ATOM   6204  N NE2   . GLN C 1 98  ? 8.580   -28.783 -7.059  1.00 19.62  ? 406  GLN C NE2   1 
ATOM   6205  N N     . CYS C 1 99  ? 12.113  -28.622 -2.994  1.00 9.54   ? 407  CYS C N     1 
ATOM   6206  C CA    . CYS C 1 99  ? 13.396  -29.182 -2.551  1.00 9.11   ? 407  CYS C CA    1 
ATOM   6207  C C     . CYS C 1 99  ? 13.245  -30.454 -1.740  1.00 8.47   ? 407  CYS C C     1 
ATOM   6208  O O     . CYS C 1 99  ? 14.028  -31.399 -1.898  1.00 13.77  ? 407  CYS C O     1 
ATOM   6209  C CB    . CYS C 1 99  ? 14.207  -28.158 -1.740  1.00 13.76  ? 407  CYS C CB    1 
ATOM   6210  S SG    . CYS C 1 99  ? 14.963  -26.777 -2.729  1.00 17.33  ? 407  CYS C SG    1 
ATOM   6211  N N     . TYR C 1 100 ? 12.269  -30.474 -0.830  1.00 13.95  ? 408  TYR C N     1 
ATOM   6212  C CA    . TYR C 1 100 ? 12.044  -31.669 -0.019  1.00 14.76  ? 408  TYR C CA    1 
ATOM   6213  C C     . TYR C 1 100 ? 11.594  -32.809 -0.916  1.00 8.69   ? 408  TYR C C     1 
ATOM   6214  O O     . TYR C 1 100 ? 11.954  -33.948 -0.705  1.00 8.50   ? 408  TYR C O     1 
ATOM   6215  C CB    . TYR C 1 100 ? 10.983  -31.424 1.065   1.00 12.50  ? 408  TYR C CB    1 
ATOM   6216  C CG    . TYR C 1 100 ? 11.344  -30.360 2.079   1.00 8.19   ? 408  TYR C CG    1 
ATOM   6217  C CD1   . TYR C 1 100 ? 12.643  -30.228 2.558   1.00 15.62  ? 408  TYR C CD1   1 
ATOM   6218  C CD2   . TYR C 1 100 ? 10.374  -29.484 2.570   1.00 10.61  ? 408  TYR C CD2   1 
ATOM   6219  C CE1   . TYR C 1 100 ? 12.967  -29.243 3.498   1.00 9.55   ? 408  TYR C CE1   1 
ATOM   6220  C CE2   . TYR C 1 100 ? 10.687  -28.518 3.493   1.00 12.91  ? 408  TYR C CE2   1 
ATOM   6221  C CZ    . TYR C 1 100 ? 11.977  -28.405 3.964   1.00 12.87  ? 408  TYR C CZ    1 
ATOM   6222  O OH    . TYR C 1 100 ? 12.266  -27.429 4.889   1.00 19.12  ? 408  TYR C OH    1 
ATOM   6223  N N     . THR C 1 101 ? 10.791  -32.483 -1.918  1.00 11.86  ? 409  THR C N     1 
ATOM   6224  C CA    . THR C 1 101 ? 10.268  -33.469 -2.833  1.00 15.03  ? 409  THR C CA    1 
ATOM   6225  C C     . THR C 1 101 ? 11.406  -34.111 -3.611  1.00 10.24  ? 409  THR C C     1 
ATOM   6226  O O     . THR C 1 101 ? 11.453  -35.325 -3.777  1.00 13.49  ? 409  THR C O     1 
ATOM   6227  C CB    . THR C 1 101 ? 9.228   -32.816 -3.776  1.00 10.32  ? 409  THR C CB    1 
ATOM   6228  O OG1   . THR C 1 101 ? 8.169   -32.296 -2.984  1.00 13.62  ? 409  THR C OG1   1 
ATOM   6229  C CG2   . THR C 1 101 ? 8.662   -33.841 -4.773  1.00 18.83  ? 409  THR C CG2   1 
ATOM   6230  N N     . ARG C 1 102 ? 12.344  -33.297 -4.063  1.00 14.64  ? 410  ARG C N     1 
ATOM   6231  C CA    . ARG C 1 102 ? 13.497  -33.813 -4.781  1.00 17.67  ? 410  ARG C CA    1 
ATOM   6232  C C     . ARG C 1 102 ? 14.345  -34.692 -3.856  1.00 13.96  ? 410  ARG C C     1 
ATOM   6233  O O     . ARG C 1 102 ? 14.826  -35.747 -4.259  1.00 13.23  ? 410  ARG C O     1 
ATOM   6234  C CB    . ARG C 1 102 ? 14.349  -32.663 -5.354  1.00 16.09  ? 410  ARG C CB    1 
ATOM   6235  C CG    . ARG C 1 102 ? 13.773  -31.956 -6.586  1.00 14.61  ? 410  ARG C CG    1 
ATOM   6236  C CD    . ARG C 1 102 ? 13.655  -32.909 -7.777  1.00 18.61  ? 410  ARG C CD    1 
ATOM   6237  N NE    . ARG C 1 102 ? 14.959  -33.370 -8.257  1.00 21.10  ? 410  ARG C NE    1 
ATOM   6238  C CZ    . ARG C 1 102 ? 15.367  -34.640 -8.273  1.00 16.79  ? 410  ARG C CZ    1 
ATOM   6239  N NH1   . ARG C 1 102 ? 14.583  -35.612 -7.842  1.00 24.08  ? 410  ARG C NH1   1 
ATOM   6240  N NH2   . ARG C 1 102 ? 16.577  -34.934 -8.727  1.00 18.50  ? 410  ARG C NH2   1 
ATOM   6241  N N     . ALA C 1 103 ? 14.524  -34.251 -2.612  1.00 14.63  ? 411  ALA C N     1 
ATOM   6242  C CA    . ALA C 1 103 ? 15.299  -35.002 -1.634  1.00 14.96  ? 411  ALA C CA    1 
ATOM   6243  C C     . ALA C 1 103 ? 14.762  -36.420 -1.433  1.00 17.52  ? 411  ALA C C     1 
ATOM   6244  O O     . ALA C 1 103 ? 15.528  -37.375 -1.363  1.00 19.41  ? 411  ALA C O     1 
ATOM   6245  C CB    . ALA C 1 103 ? 15.334  -34.248 -0.285  1.00 11.64  ? 411  ALA C CB    1 
ATOM   6246  N N     . ILE C 1 104 ? 13.444  -36.543 -1.336  1.00 16.65  ? 412  ILE C N     1 
ATOM   6247  C CA    . ILE C 1 104 ? 12.796  -37.825 -1.108  1.00 14.00  ? 412  ILE C CA    1 
ATOM   6248  C C     . ILE C 1 104 ? 12.842  -38.688 -2.375  1.00 17.50  ? 412  ILE C C     1 
ATOM   6249  O O     . ILE C 1 104 ? 12.931  -39.923 -2.304  1.00 17.68  ? 412  ILE C O     1 
ATOM   6250  C CB    . ILE C 1 104 ? 11.345  -37.619 -0.623  1.00 13.18  ? 412  ILE C CB    1 
ATOM   6251  C CG1   . ILE C 1 104 ? 11.328  -37.060 0.815   1.00 10.89  ? 412  ILE C CG1   1 
ATOM   6252  C CG2   . ILE C 1 104 ? 10.562  -38.928 -0.692  1.00 29.53  ? 412  ILE C CG2   1 
ATOM   6253  C CD1   . ILE C 1 104 ? 10.081  -36.228 1.128   1.00 14.64  ? 412  ILE C CD1   1 
ATOM   6254  N N     . GLN C 1 105 ? 12.830  -38.037 -3.531  1.00 9.95   ? 413  GLN C N     1 
ATOM   6255  C CA    . GLN C 1 105 ? 12.939  -38.756 -4.808  1.00 15.36  ? 413  GLN C CA    1 
ATOM   6256  C C     . GLN C 1 105 ? 14.335  -39.348 -4.974  1.00 21.76  ? 413  GLN C C     1 
ATOM   6257  O O     . GLN C 1 105 ? 14.508  -40.483 -5.430  1.00 19.94  ? 413  GLN C O     1 
ATOM   6258  C CB    . GLN C 1 105 ? 12.621  -37.823 -5.980  1.00 16.88  ? 413  GLN C CB    1 
ATOM   6259  C CG    . GLN C 1 105 ? 11.178  -37.401 -6.106  1.00 17.46  ? 413  GLN C CG    1 
ATOM   6260  C CD    . GLN C 1 105 ? 10.917  -36.567 -7.366  1.00 29.87  ? 413  GLN C CD    1 
ATOM   6261  O OE1   . GLN C 1 105 ? 11.793  -35.827 -7.826  1.00 18.98  ? 413  GLN C OE1   1 
ATOM   6262  N NE2   . GLN C 1 105 ? 9.711   -36.688 -7.925  1.00 17.38  ? 413  GLN C NE2   1 
ATOM   6263  N N     . ILE C 1 106 ? 15.334  -38.570 -4.580  1.00 19.06  ? 414  ILE C N     1 
ATOM   6264  C CA    . ILE C 1 106 ? 16.725  -39.004 -4.645  1.00 19.20  ? 414  ILE C CA    1 
ATOM   6265  C C     . ILE C 1 106 ? 17.006  -40.110 -3.629  1.00 23.13  ? 414  ILE C C     1 
ATOM   6266  O O     . ILE C 1 106 ? 17.706  -41.069 -3.932  1.00 21.88  ? 414  ILE C O     1 
ATOM   6267  C CB    . ILE C 1 106 ? 17.678  -37.813 -4.423  1.00 25.08  ? 414  ILE C CB    1 
ATOM   6268  C CG1   . ILE C 1 106 ? 17.587  -36.847 -5.613  1.00 15.18  ? 414  ILE C CG1   1 
ATOM   6269  C CG2   . ILE C 1 106 ? 19.117  -38.296 -4.206  1.00 25.19  ? 414  ILE C CG2   1 
ATOM   6270  C CD1   . ILE C 1 106 ? 18.198  -35.487 -5.352  1.00 15.74  ? 414  ILE C CD1   1 
ATOM   6271  N N     . ASN C 1 107 ? 16.450  -39.974 -2.426  1.00 17.63  ? 415  ASN C N     1 
ATOM   6272  C CA    . ASN C 1 107 ? 16.632  -40.970 -1.373  1.00 23.86  ? 415  ASN C CA    1 
ATOM   6273  C C     . ASN C 1 107 ? 15.332  -41.167 -0.602  1.00 26.45  ? 415  ASN C C     1 
ATOM   6274  O O     . ASN C 1 107 ? 15.045  -40.411 0.318   1.00 18.77  ? 415  ASN C O     1 
ATOM   6275  C CB    . ASN C 1 107 ? 17.748  -40.541 -0.420  1.00 27.12  ? 415  ASN C CB    1 
ATOM   6276  C CG    . ASN C 1 107 ? 18.012  -41.558 0.670   1.00 30.79  ? 415  ASN C CG    1 
ATOM   6277  O OD1   . ASN C 1 107 ? 17.404  -42.630 0.701   1.00 29.17  ? 415  ASN C OD1   1 
ATOM   6278  N ND2   . ASN C 1 107 ? 18.942  -41.236 1.564   1.00 34.74  ? 415  ASN C ND2   1 
ATOM   6279  N N     . PRO C 1 108 ? 14.539  -42.180 -0.992  1.00 23.94  ? 416  PRO C N     1 
ATOM   6280  C CA    . PRO C 1 108 ? 13.217  -42.455 -0.416  1.00 29.61  ? 416  PRO C CA    1 
ATOM   6281  C C     . PRO C 1 108 ? 13.313  -42.880 1.048   1.00 25.91  ? 416  PRO C C     1 
ATOM   6282  O O     . PRO C 1 108 ? 12.301  -42.905 1.755   1.00 30.50  ? 416  PRO C O     1 
ATOM   6283  C CB    . PRO C 1 108 ? 12.687  -43.606 -1.281  1.00 29.31  ? 416  PRO C CB    1 
ATOM   6284  C CG    . PRO C 1 108 ? 13.489  -43.529 -2.562  1.00 25.88  ? 416  PRO C CG    1 
ATOM   6285  C CD    . PRO C 1 108 ? 14.851  -43.085 -2.113  1.00 22.21  ? 416  PRO C CD    1 
ATOM   6286  N N     . ALA C 1 109 ? 14.529  -43.167 1.496   1.00 22.28  ? 417  ALA C N     1 
ATOM   6287  C CA    . ALA C 1 109 ? 14.788  -43.628 2.854   1.00 20.92  ? 417  ALA C CA    1 
ATOM   6288  C C     . ALA C 1 109 ? 15.201  -42.480 3.753   1.00 22.40  ? 417  ALA C C     1 
ATOM   6289  O O     . ALA C 1 109 ? 15.697  -42.696 4.861   1.00 21.96  ? 417  ALA C O     1 
ATOM   6290  C CB    . ALA C 1 109 ? 15.891  -44.687 2.839   1.00 24.26  ? 417  ALA C CB    1 
ATOM   6291  N N     . PHE C 1 110 ? 15.019  -41.258 3.267   1.00 16.91  ? 418  PHE C N     1 
ATOM   6292  C CA    . PHE C 1 110 ? 15.600  -40.091 3.923   1.00 18.32  ? 418  PHE C CA    1 
ATOM   6293  C C     . PHE C 1 110 ? 14.564  -39.564 4.906   1.00 10.51  ? 418  PHE C C     1 
ATOM   6294  O O     . PHE C 1 110 ? 13.686  -38.810 4.528   1.00 17.27  ? 418  PHE C O     1 
ATOM   6295  C CB    . PHE C 1 110 ? 15.961  -39.027 2.869   1.00 21.59  ? 418  PHE C CB    1 
ATOM   6296  C CG    . PHE C 1 110 ? 16.778  -37.857 3.399   1.00 23.27  ? 418  PHE C CG    1 
ATOM   6297  C CD1   . PHE C 1 110 ? 17.356  -37.891 4.656   1.00 24.20  ? 418  PHE C CD1   1 
ATOM   6298  C CD2   . PHE C 1 110 ? 16.951  -36.721 2.623   1.00 30.04  ? 418  PHE C CD2   1 
ATOM   6299  C CE1   . PHE C 1 110 ? 18.094  -36.819 5.125   1.00 32.63  ? 418  PHE C CE1   1 
ATOM   6300  C CE2   . PHE C 1 110 ? 17.691  -35.646 3.088   1.00 23.06  ? 418  PHE C CE2   1 
ATOM   6301  C CZ    . PHE C 1 110 ? 18.261  -35.696 4.338   1.00 24.14  ? 418  PHE C CZ    1 
ATOM   6302  N N     . ALA C 1 111 ? 14.687  -39.989 6.162   1.00 13.92  ? 419  ALA C N     1 
ATOM   6303  C CA    . ALA C 1 111 ? 13.707  -39.705 7.212   1.00 26.06  ? 419  ALA C CA    1 
ATOM   6304  C C     . ALA C 1 111 ? 13.501  -38.205 7.428   1.00 25.66  ? 419  ALA C C     1 
ATOM   6305  O O     . ALA C 1 111 ? 12.360  -37.723 7.486   1.00 19.95  ? 419  ALA C O     1 
ATOM   6306  C CB    . ALA C 1 111 ? 14.138  -40.393 8.523   1.00 22.77  ? 419  ALA C CB    1 
ATOM   6307  N N     . ASP C 1 112 ? 14.607  -37.466 7.526   1.00 19.31  ? 420  ASP C N     1 
ATOM   6308  C CA    . ASP C 1 112 ? 14.542  -36.019 7.734   1.00 21.07  ? 420  ASP C CA    1 
ATOM   6309  C C     . ASP C 1 112 ? 13.719  -35.281 6.684   1.00 13.93  ? 420  ASP C C     1 
ATOM   6310  O O     . ASP C 1 112 ? 12.962  -34.368 7.022   1.00 9.70   ? 420  ASP C O     1 
ATOM   6311  C CB    . ASP C 1 112 ? 15.936  -35.397 7.811   1.00 26.30  ? 420  ASP C CB    1 
ATOM   6312  C CG    . ASP C 1 112 ? 16.693  -35.814 9.053   1.00 38.56  ? 420  ASP C CG    1 
ATOM   6313  O OD1   . ASP C 1 112 ? 16.105  -36.509 9.904   1.00 32.94  ? 420  ASP C OD1   1 
ATOM   6314  O OD2   . ASP C 1 112 ? 17.876  -35.439 9.180   1.00 41.01  ? 420  ASP C OD2   1 
ATOM   6315  N N     . ALA C 1 113 ? 13.874  -35.659 5.419   1.00 11.32  ? 421  ALA C N     1 
ATOM   6316  C CA    . ALA C 1 113 ? 13.194  -34.939 4.350   1.00 14.71  ? 421  ALA C CA    1 
ATOM   6317  C C     . ALA C 1 113 ? 11.685  -35.137 4.406   1.00 16.64  ? 421  ALA C C     1 
ATOM   6318  O O     . ALA C 1 113 ? 10.913  -34.230 4.047   1.00 13.40  ? 421  ALA C O     1 
ATOM   6319  C CB    . ALA C 1 113 ? 13.760  -35.338 2.978   1.00 13.72  ? 421  ALA C CB    1 
ATOM   6320  N N     . HIS C 1 114 ? 11.257  -36.320 4.839   1.00 18.09  ? 422  HIS C N     1 
ATOM   6321  C CA    . HIS C 1 114 ? 9.826   -36.588 4.992   1.00 22.68  ? 422  HIS C CA    1 
ATOM   6322  C C     . HIS C 1 114 ? 9.257   -35.732 6.111   1.00 16.76  ? 422  HIS C C     1 
ATOM   6323  O O     . HIS C 1 114 ? 8.145   -35.218 6.014   1.00 16.19  ? 422  HIS C O     1 
ATOM   6324  C CB    . HIS C 1 114 ? 9.569   -38.064 5.295   1.00 20.85  ? 422  HIS C CB    1 
ATOM   6325  C CG    . HIS C 1 114 ? 9.726   -38.958 4.105   1.00 20.96  ? 422  HIS C CG    1 
ATOM   6326  N ND1   . HIS C 1 114 ? 8.755   -39.074 3.137   1.00 17.58  ? 422  HIS C ND1   1 
ATOM   6327  C CD2   . HIS C 1 114 ? 10.744  -39.759 3.714   1.00 19.18  ? 422  HIS C CD2   1 
ATOM   6328  C CE1   . HIS C 1 114 ? 9.155   -39.928 2.214   1.00 10.40  ? 422  HIS C CE1   1 
ATOM   6329  N NE2   . HIS C 1 114 ? 10.362  -40.350 2.533   1.00 13.52  ? 422  HIS C NE2   1 
ATOM   6330  N N     . SER C 1 115 ? 10.036  -35.605 7.175   1.00 7.61   ? 423  SER C N     1 
ATOM   6331  C CA    . SER C 1 115 ? 9.657   -34.801 8.346   1.00 11.10  ? 423  SER C CA    1 
ATOM   6332  C C     . SER C 1 115 ? 9.562   -33.318 7.976   1.00 12.58  ? 423  SER C C     1 
ATOM   6333  O O     . SER C 1 115 ? 8.637   -32.608 8.382   1.00 11.28  ? 423  SER C O     1 
ATOM   6334  C CB    . SER C 1 115 ? 10.710  -35.013 9.461   1.00 12.00  ? 423  SER C CB    1 
ATOM   6335  O OG    . SER C 1 115 ? 10.281  -34.445 10.701  1.00 14.49  ? 423  SER C OG    1 
ATOM   6336  N N     . ASN C 1 116 ? 10.524  -32.852 7.186   1.00 13.04  ? 424  ASN C N     1 
ATOM   6337  C CA    . ASN C 1 116 ? 10.505  -31.479 6.695   1.00 13.62  ? 424  ASN C CA    1 
ATOM   6338  C C     . ASN C 1 116 ? 9.324   -31.239 5.759   1.00 9.38   ? 424  ASN C C     1 
ATOM   6339  O O     . ASN C 1 116 ? 8.682   -30.192 5.817   1.00 11.00  ? 424  ASN C O     1 
ATOM   6340  C CB    . ASN C 1 116 ? 11.818  -31.142 5.981   1.00 19.09  ? 424  ASN C CB    1 
ATOM   6341  C CG    . ASN C 1 116 ? 13.007  -31.128 6.922   1.00 24.21  ? 424  ASN C CG    1 
ATOM   6342  O OD1   . ASN C 1 116 ? 12.872  -30.845 8.110   1.00 24.44  ? 424  ASN C OD1   1 
ATOM   6343  N ND2   . ASN C 1 116 ? 14.180  -31.429 6.392   1.00 16.58  ? 424  ASN C ND2   1 
ATOM   6344  N N     . LEU C 1 117 ? 9.019   -32.216 4.916   1.00 9.15   ? 425  LEU C N     1 
ATOM   6345  C CA    . LEU C 1 117 ? 7.849   -32.103 4.043   1.00 14.76  ? 425  LEU C CA    1 
ATOM   6346  C C     . LEU C 1 117 ? 6.576   -32.102 4.860   1.00 16.77  ? 425  LEU C C     1 
ATOM   6347  O O     . LEU C 1 117 ? 5.650   -31.342 4.573   1.00 12.56  ? 425  LEU C O     1 
ATOM   6348  C CB    . LEU C 1 117 ? 7.792   -33.238 3.043   1.00 11.81  ? 425  LEU C CB    1 
ATOM   6349  C CG    . LEU C 1 117 ? 6.643   -33.184 2.029   1.00 19.57  ? 425  LEU C CG    1 
ATOM   6350  C CD1   . LEU C 1 117 ? 6.672   -31.879 1.270   1.00 19.44  ? 425  LEU C CD1   1 
ATOM   6351  C CD2   . LEU C 1 117 ? 6.763   -34.365 1.080   1.00 17.74  ? 425  LEU C CD2   1 
ATOM   6352  N N     . ALA C 1 118 ? 6.525   -32.972 5.865   1.00 5.88   ? 426  ALA C N     1 
ATOM   6353  C CA    . ALA C 1 118 ? 5.395   -32.998 6.807   1.00 11.57  ? 426  ALA C CA    1 
ATOM   6354  C C     . ALA C 1 118 ? 5.198   -31.627 7.426   1.00 18.62  ? 426  ALA C C     1 
ATOM   6355  O O     . ALA C 1 118 ? 4.069   -31.149 7.557   1.00 11.42  ? 426  ALA C O     1 
ATOM   6356  C CB    . ALA C 1 118 ? 5.644   -34.016 7.907   1.00 9.92   ? 426  ALA C CB    1 
ATOM   6357  N N     . SER C 1 119 ? 6.299   -30.997 7.823   1.00 12.78  ? 427  SER C N     1 
ATOM   6358  C CA    . SER C 1 119 ? 6.214   -29.657 8.407   1.00 16.72  ? 427  SER C CA    1 
ATOM   6359  C C     . SER C 1 119 ? 5.590   -28.591 7.485   1.00 16.98  ? 427  SER C C     1 
ATOM   6360  O O     . SER C 1 119 ? 4.889   -27.685 7.970   1.00 16.58  ? 427  SER C O     1 
ATOM   6361  C CB    . SER C 1 119 ? 7.583   -29.202 8.906   1.00 26.65  ? 427  SER C CB    1 
ATOM   6362  O OG    . SER C 1 119 ? 8.127   -30.169 9.783   1.00 40.16  ? 427  SER C OG    1 
ATOM   6363  N N     . ILE C 1 120 ? 5.834   -28.693 6.175   1.00 15.69  ? 428  ILE C N     1 
ATOM   6364  C CA    . ILE C 1 120 ? 5.214   -27.788 5.197   1.00 11.64  ? 428  ILE C CA    1 
ATOM   6365  C C     . ILE C 1 120 ? 3.722   -28.033 5.149   1.00 10.51  ? 428  ILE C C     1 
ATOM   6366  O O     . ILE C 1 120 ? 2.915   -27.086 5.082   1.00 14.26  ? 428  ILE C O     1 
ATOM   6367  C CB    . ILE C 1 120 ? 5.766   -27.976 3.745   1.00 8.71   ? 428  ILE C CB    1 
ATOM   6368  C CG1   . ILE C 1 120 ? 7.255   -27.691 3.688   1.00 17.42  ? 428  ILE C CG1   1 
ATOM   6369  C CG2   . ILE C 1 120 ? 5.056   -27.013 2.790   1.00 15.77  ? 428  ILE C CG2   1 
ATOM   6370  C CD1   . ILE C 1 120 ? 7.607   -26.250 4.017   1.00 29.42  ? 428  ILE C CD1   1 
ATOM   6371  N N     . HIS C 1 121 ? 3.337   -29.301 5.153   1.00 14.47  ? 429  HIS C N     1 
ATOM   6372  C CA    . HIS C 1 121 ? 1.914   -29.633 5.125   1.00 15.86  ? 429  HIS C CA    1 
ATOM   6373  C C     . HIS C 1 121 ? 1.276   -29.085 6.409   1.00 21.50  ? 429  HIS C C     1 
ATOM   6374  O O     . HIS C 1 121 ? 0.245   -28.397 6.381   1.00 19.86  ? 429  HIS C O     1 
ATOM   6375  C CB    . HIS C 1 121 ? 1.697   -31.150 4.972   1.00 12.69  ? 429  HIS C CB    1 
ATOM   6376  C CG    . HIS C 1 121 ? 2.093   -31.698 3.625   1.00 15.41  ? 429  HIS C CG    1 
ATOM   6377  N ND1   . HIS C 1 121 ? 1.731   -31.095 2.440   1.00 28.26  ? 429  HIS C ND1   1 
ATOM   6378  C CD2   . HIS C 1 121 ? 2.809   -32.797 3.279   1.00 25.33  ? 429  HIS C CD2   1 
ATOM   6379  C CE1   . HIS C 1 121 ? 2.211   -31.790 1.424   1.00 26.63  ? 429  HIS C CE1   1 
ATOM   6380  N NE2   . HIS C 1 121 ? 2.869   -32.829 1.903   1.00 15.24  ? 429  HIS C NE2   1 
ATOM   6381  N N     . LYS C 1 122 ? 1.927   -29.348 7.537   1.00 14.93  ? 430  LYS C N     1 
ATOM   6382  C CA    . LYS C 1 122 ? 1.439   -28.851 8.828   1.00 13.24  ? 430  LYS C CA    1 
ATOM   6383  C C     . LYS C 1 122 ? 1.246   -27.342 8.802   1.00 16.27  ? 430  LYS C C     1 
ATOM   6384  O O     . LYS C 1 122 ? 0.169   -26.833 9.121   1.00 18.85  ? 430  LYS C O     1 
ATOM   6385  C CB    . LYS C 1 122 ? 2.403   -29.234 9.963   1.00 12.43  ? 430  LYS C CB    1 
ATOM   6386  C CG    . LYS C 1 122 ? 1.869   -28.909 11.367  1.00 24.94  ? 430  LYS C CG    1 
ATOM   6387  C CD    . LYS C 1 122 ? 2.807   -29.431 12.449  1.00 21.77  ? 430  LYS C CD    1 
ATOM   6388  C CE    . LYS C 1 122 ? 2.158   -29.406 13.836  1.00 16.04  ? 430  LYS C CE    1 
ATOM   6389  N NZ    . LYS C 1 122 ? 1.940   -28.029 14.403  1.00 12.50  ? 430  LYS C NZ    1 
ATOM   6390  N N     . ASP C 1 123 ? 2.297   -26.629 8.435   1.00 13.97  ? 431  ASP C N     1 
ATOM   6391  C CA    . ASP C 1 123 ? 2.280   -25.172 8.483   1.00 17.21  ? 431  ASP C CA    1 
ATOM   6392  C C     . ASP C 1 123 ? 1.272   -24.597 7.504   1.00 31.26  ? 431  ASP C C     1 
ATOM   6393  O O     . ASP C 1 123 ? 0.813   -23.467 7.661   1.00 37.48  ? 431  ASP C O     1 
ATOM   6394  C CB    . ASP C 1 123 ? 3.681   -24.599 8.230   1.00 21.68  ? 431  ASP C CB    1 
ATOM   6395  C CG    . ASP C 1 123 ? 4.620   -24.823 9.405   1.00 45.79  ? 431  ASP C CG    1 
ATOM   6396  O OD1   . ASP C 1 123 ? 4.131   -24.930 10.549  1.00 45.41  ? 431  ASP C OD1   1 
ATOM   6397  O OD2   . ASP C 1 123 ? 5.846   -24.890 9.188   1.00 60.52  ? 431  ASP C OD2   1 
ATOM   6398  N N     . SER C 1 124 ? 0.924   -25.392 6.502   1.00 30.53  ? 432  SER C N     1 
ATOM   6399  C CA    . SER C 1 124 ? -0.072  -25.005 5.518   1.00 35.98  ? 432  SER C CA    1 
ATOM   6400  C C     . SER C 1 124 ? -1.479  -25.437 5.933   1.00 41.59  ? 432  SER C C     1 
ATOM   6401  O O     . SER C 1 124 ? -2.433  -25.262 5.173   1.00 38.50  ? 432  SER C O     1 
ATOM   6402  C CB    . SER C 1 124 ? 0.288   -25.614 4.161   1.00 37.64  ? 432  SER C CB    1 
ATOM   6403  O OG    . SER C 1 124 ? 1.526   -25.096 3.712   1.00 28.91  ? 432  SER C OG    1 
ATOM   6404  N N     . GLY C 1 125 ? -1.605  -26.006 7.132   1.00 26.33  ? 433  GLY C N     1 
ATOM   6405  C CA    . GLY C 1 125 ? -2.898  -26.433 7.642   1.00 33.75  ? 433  GLY C CA    1 
ATOM   6406  C C     . GLY C 1 125 ? -3.389  -27.814 7.224   1.00 38.08  ? 433  GLY C C     1 
ATOM   6407  O O     . GLY C 1 125 ? -4.403  -28.285 7.736   1.00 51.29  ? 433  GLY C O     1 
ATOM   6408  N N     . ASN C 1 126 ? -2.674  -28.465 6.306   1.00 21.55  ? 434  ASN C N     1 
ATOM   6409  C CA    . ASN C 1 126 ? -3.057  -29.783 5.800   1.00 22.59  ? 434  ASN C CA    1 
ATOM   6410  C C     . ASN C 1 126 ? -2.598  -30.900 6.729   1.00 30.27  ? 434  ASN C C     1 
ATOM   6411  O O     . ASN C 1 126 ? -1.652  -31.625 6.432   1.00 12.99  ? 434  ASN C O     1 
ATOM   6412  C CB    . ASN C 1 126 ? -2.448  -29.989 4.415   1.00 28.68  ? 434  ASN C CB    1 
ATOM   6413  C CG    . ASN C 1 126 ? -2.949  -31.232 3.736   1.00 20.27  ? 434  ASN C CG    1 
ATOM   6414  O OD1   . ASN C 1 126 ? -3.486  -32.148 4.375   1.00 22.22  ? 434  ASN C OD1   1 
ATOM   6415  N ND2   . ASN C 1 126 ? -2.746  -31.296 2.425   1.00 18.69  ? 434  ASN C ND2   1 
ATOM   6416  N N     . ILE C 1 127 ? -3.279  -31.041 7.856   1.00 31.57  ? 435  ILE C N     1 
ATOM   6417  C CA    . ILE C 1 127 ? -2.790  -31.895 8.919   1.00 13.45  ? 435  ILE C CA    1 
ATOM   6418  C C     . ILE C 1 127 ? -2.705  -33.382 8.589   1.00 9.54   ? 435  ILE C C     1 
ATOM   6419  O O     . ILE C 1 127 ? -1.760  -34.028 8.993   1.00 18.69  ? 435  ILE C O     1 
ATOM   6420  C CB    . ILE C 1 127 ? -3.612  -31.720 10.227  1.00 13.75  ? 435  ILE C CB    1 
ATOM   6421  C CG1   . ILE C 1 127 ? -3.663  -30.257 10.656  1.00 13.21  ? 435  ILE C CG1   1 
ATOM   6422  C CG2   . ILE C 1 127 ? -3.053  -32.605 11.333  1.00 18.57  ? 435  ILE C CG2   1 
ATOM   6423  C CD1   . ILE C 1 127 ? -2.335  -29.592 10.890  1.00 16.82  ? 435  ILE C CD1   1 
ATOM   6424  N N     . PRO C 1 128 ? -3.719  -33.944 7.887   1.00 20.10  ? 436  PRO C N     1 
ATOM   6425  C CA    . PRO C 1 128 ? -3.661  -35.370 7.526   1.00 24.94  ? 436  PRO C CA    1 
ATOM   6426  C C     . PRO C 1 128 ? -2.476  -35.741 6.642   1.00 6.38   ? 436  PRO C C     1 
ATOM   6427  O O     . PRO C 1 128 ? -1.932  -36.800 6.834   1.00 14.09  ? 436  PRO C O     1 
ATOM   6428  C CB    . PRO C 1 128 ? -4.976  -35.600 6.775   1.00 27.56  ? 436  PRO C CB    1 
ATOM   6429  C CG    . PRO C 1 128 ? -5.898  -34.575 7.363   1.00 26.12  ? 436  PRO C CG    1 
ATOM   6430  C CD    . PRO C 1 128 ? -5.026  -33.358 7.544   1.00 21.94  ? 436  PRO C CD    1 
ATOM   6431  N N     . GLU C 1 129 ? -2.110  -34.908 5.675   1.00 21.77  ? 437  GLU C N     1 
ATOM   6432  C CA    . GLU C 1 129 ? -0.910  -35.181 4.893   1.00 19.46  ? 437  GLU C CA    1 
ATOM   6433  C C     . GLU C 1 129 ? 0.327   -34.960 5.760   1.00 13.31  ? 437  GLU C C     1 
ATOM   6434  O O     . GLU C 1 129 ? 1.337   -35.642 5.585   1.00 15.62  ? 437  GLU C O     1 
ATOM   6435  C CB    . GLU C 1 129 ? -0.843  -34.299 3.648   1.00 26.66  ? 437  GLU C CB    1 
ATOM   6436  C CG    . GLU C 1 129 ? -1.899  -34.626 2.590   1.00 49.14  ? 437  GLU C CG    1 
ATOM   6437  C CD    . GLU C 1 129 ? -1.587  -35.866 1.761   1.00 41.71  ? 437  GLU C CD    1 
ATOM   6438  O OE1   . GLU C 1 129 ? -2.134  -35.971 0.638   1.00 27.79  ? 437  GLU C OE1   1 
ATOM   6439  O OE2   . GLU C 1 129 ? -0.809  -36.734 2.221   1.00 39.27  ? 437  GLU C OE2   1 
ATOM   6440  N N     . ALA C 1 130 ? 0.243   -34.015 6.694   1.00 17.28  ? 438  ALA C N     1 
ATOM   6441  C CA    . ALA C 1 130 ? 1.331   -33.807 7.650   1.00 18.61  ? 438  ALA C CA    1 
ATOM   6442  C C     . ALA C 1 130 ? 1.501   -35.042 8.515   1.00 26.53  ? 438  ALA C C     1 
ATOM   6443  O O     . ALA C 1 130 ? 2.608   -35.541 8.686   1.00 11.97  ? 438  ALA C O     1 
ATOM   6444  C CB    . ALA C 1 130 ? 1.062   -32.587 8.502   1.00 13.99  ? 438  ALA C CB    1 
ATOM   6445  N N     . ILE C 1 131 ? 0.392   -35.535 9.054   1.00 17.65  ? 439  ILE C N     1 
ATOM   6446  C CA    . ILE C 1 131 ? 0.405   -36.782 9.799   1.00 27.24  ? 439  ILE C CA    1 
ATOM   6447  C C     . ILE C 1 131 ? 0.964   -37.943 8.975   1.00 22.13  ? 439  ILE C C     1 
ATOM   6448  O O     . ILE C 1 131 ? 1.708   -38.743 9.503   1.00 13.10  ? 439  ILE C O     1 
ATOM   6449  C CB    . ILE C 1 131 ? -0.994  -37.119 10.369  1.00 21.48  ? 439  ILE C CB    1 
ATOM   6450  C CG1   . ILE C 1 131 ? -1.348  -36.131 11.490  1.00 13.47  ? 439  ILE C CG1   1 
ATOM   6451  C CG2   . ILE C 1 131 ? -1.053  -38.550 10.884  1.00 17.39  ? 439  ILE C CG2   1 
ATOM   6452  C CD1   . ILE C 1 131 ? -2.858  -36.065 11.770  1.00 11.94  ? 439  ILE C CD1   1 
ATOM   6453  N N     . ALA C 1 132 ? 0.647   -38.011 7.681   1.00 14.92  ? 440  ALA C N     1 
ATOM   6454  C CA    . ALA C 1 132 ? 1.129   -39.124 6.855   1.00 14.81  ? 440  ALA C CA    1 
ATOM   6455  C C     . ALA C 1 132 ? 2.645   -39.120 6.669   1.00 12.93  ? 440  ALA C C     1 
ATOM   6456  O O     . ALA C 1 132 ? 3.329   -40.148 6.819   1.00 11.18  ? 440  ALA C O     1 
ATOM   6457  C CB    . ALA C 1 132 ? 0.432   -39.116 5.500   1.00 23.03  ? 440  ALA C CB    1 
ATOM   6458  N N     . SER C 1 133 ? 3.174   -37.954 6.333   1.00 9.69   ? 441  SER C N     1 
ATOM   6459  C CA    . SER C 1 133 ? 4.610   -37.801 6.157   1.00 17.21  ? 441  SER C CA    1 
ATOM   6460  C C     . SER C 1 133 ? 5.434   -38.021 7.444   1.00 10.71  ? 441  SER C C     1 
ATOM   6461  O O     . SER C 1 133 ? 6.492   -38.633 7.383   1.00 12.31  ? 441  SER C O     1 
ATOM   6462  C CB    . SER C 1 133 ? 4.916   -36.448 5.508   1.00 15.50  ? 441  SER C CB    1 
ATOM   6463  O OG    . SER C 1 133 ? 4.509   -36.441 4.132   1.00 21.79  ? 441  SER C OG    1 
ATOM   6464  N N     . TYR C 1 134 ? 4.967   -37.534 8.598   1.00 9.59   ? 442  TYR C N     1 
ATOM   6465  C CA    . TYR C 1 134 ? 5.660   -37.806 9.868   1.00 18.18  ? 442  TYR C CA    1 
ATOM   6466  C C     . TYR C 1 134 ? 5.725   -39.297 10.183  1.00 17.84  ? 442  TYR C C     1 
ATOM   6467  O O     . TYR C 1 134 ? 6.751   -39.797 10.640  1.00 15.74  ? 442  TYR C O     1 
ATOM   6468  C CB    . TYR C 1 134 ? 4.991   -37.096 11.048  1.00 20.80  ? 442  TYR C CB    1 
ATOM   6469  C CG    . TYR C 1 134 ? 5.313   -35.631 11.136  1.00 11.67  ? 442  TYR C CG    1 
ATOM   6470  C CD1   . TYR C 1 134 ? 6.613   -35.189 11.073  1.00 11.44  ? 442  TYR C CD1   1 
ATOM   6471  C CD2   . TYR C 1 134 ? 4.296   -34.689 11.254  1.00 14.21  ? 442  TYR C CD2   1 
ATOM   6472  C CE1   . TYR C 1 134 ? 6.915   -33.840 11.146  1.00 13.23  ? 442  TYR C CE1   1 
ATOM   6473  C CE2   . TYR C 1 134 ? 4.572   -33.349 11.327  1.00 11.04  ? 442  TYR C CE2   1 
ATOM   6474  C CZ    . TYR C 1 134 ? 5.886   -32.925 11.258  1.00 11.77  ? 442  TYR C CZ    1 
ATOM   6475  O OH    . TYR C 1 134 ? 6.169   -31.595 11.308  1.00 14.95  ? 442  TYR C OH    1 
ATOM   6476  N N     . ARG C 1 135 ? 4.629   -40.007 9.938   1.00 12.28  ? 443  ARG C N     1 
ATOM   6477  C CA    . ARG C 1 135 ? 4.589   -41.447 10.209  1.00 8.05   ? 443  ARG C CA    1 
ATOM   6478  C C     . ARG C 1 135 ? 5.575   -42.156 9.299   1.00 11.33  ? 443  ARG C C     1 
ATOM   6479  O O     . ARG C 1 135 ? 6.277   -43.061 9.726   1.00 15.05  ? 443  ARG C O     1 
ATOM   6480  C CB    . ARG C 1 135 ? 3.175   -42.006 9.985   1.00 17.54  ? 443  ARG C CB    1 
ATOM   6481  C CG    . ARG C 1 135 ? 2.177   -41.714 11.098  1.00 30.32  ? 443  ARG C CG    1 
ATOM   6482  C CD    . ARG C 1 135 ? 0.807   -42.280 10.722  1.00 36.15  ? 443  ARG C CD    1 
ATOM   6483  N NE    . ARG C 1 135 ? -0.285  -41.732 11.519  1.00 39.92  ? 443  ARG C NE    1 
ATOM   6484  C CZ    . ARG C 1 135 ? -0.460  -41.995 12.804  1.00 29.29  ? 443  ARG C CZ    1 
ATOM   6485  N NH1   . ARG C 1 135 ? 0.402   -42.795 13.422  1.00 53.65  ? 443  ARG C NH1   1 
ATOM   6486  N NH2   . ARG C 1 135 ? -1.485  -41.475 13.470  1.00 31.11  ? 443  ARG C NH2   1 
ATOM   6487  N N     . THR C 1 136 ? 5.657   -41.731 8.038   1.00 29.21  ? 444  THR C N     1 
ATOM   6488  C CA    . THR C 1 136 ? 6.673   -42.285 7.143   1.00 20.84  ? 444  THR C CA    1 
ATOM   6489  C C     . THR C 1 136 ? 8.074   -42.017 7.719   1.00 18.93  ? 444  THR C C     1 
ATOM   6490  O O     . THR C 1 136 ? 8.898   -42.911 7.764   1.00 17.10  ? 444  THR C O     1 
ATOM   6491  C CB    . THR C 1 136 ? 6.579   -41.710 5.714   1.00 18.28  ? 444  THR C CB    1 
ATOM   6492  O OG1   . THR C 1 136 ? 5.359   -42.131 5.104   1.00 13.15  ? 444  THR C OG1   1 
ATOM   6493  C CG2   . THR C 1 136 ? 7.731   -42.198 4.858   1.00 20.52  ? 444  THR C CG2   1 
ATOM   6494  N N     . ALA C 1 137 ? 8.331   -40.791 8.173   1.00 14.27  ? 445  ALA C N     1 
ATOM   6495  C CA    . ALA C 1 137 ? 9.629   -40.466 8.765   1.00 15.42  ? 445  ALA C CA    1 
ATOM   6496  C C     . ALA C 1 137 ? 9.960   -41.416 9.903   1.00 15.13  ? 445  ALA C C     1 
ATOM   6497  O O     . ALA C 1 137 ? 11.077  -41.916 10.006  1.00 18.46  ? 445  ALA C O     1 
ATOM   6498  C CB    . ALA C 1 137 ? 9.646   -39.022 9.277   1.00 15.06  ? 445  ALA C CB    1 
ATOM   6499  N N     . LEU C 1 138 ? 8.974   -41.628 10.769  1.00 15.94  ? 446  LEU C N     1 
ATOM   6500  C CA    . LEU C 1 138 ? 9.124   -42.462 11.948  1.00 15.19  ? 446  LEU C CA    1 
ATOM   6501  C C     . LEU C 1 138 ? 9.188   -43.957 11.586  1.00 22.28  ? 446  LEU C C     1 
ATOM   6502  O O     . LEU C 1 138 ? 9.780   -44.753 12.312  1.00 18.48  ? 446  LEU C O     1 
ATOM   6503  C CB    . LEU C 1 138 ? 7.988   -42.171 12.935  1.00 14.04  ? 446  LEU C CB    1 
ATOM   6504  C CG    . LEU C 1 138 ? 8.071   -40.810 13.641  1.00 16.21  ? 446  LEU C CG    1 
ATOM   6505  C CD1   . LEU C 1 138 ? 6.725   -40.375 14.201  1.00 17.13  ? 446  LEU C CD1   1 
ATOM   6506  C CD2   . LEU C 1 138 ? 9.145   -40.867 14.747  1.00 23.86  ? 446  LEU C CD2   1 
ATOM   6507  N N     . LYS C 1 139 ? 8.597   -44.326 10.453  1.00 22.76  ? 447  LYS C N     1 
ATOM   6508  C CA    . LYS C 1 139 ? 8.766   -45.676 9.908   1.00 24.06  ? 447  LYS C CA    1 
ATOM   6509  C C     . LYS C 1 139 ? 10.244  -45.882 9.571   1.00 22.08  ? 447  LYS C C     1 
ATOM   6510  O O     . LYS C 1 139 ? 10.868  -46.855 10.002  1.00 22.01  ? 447  LYS C O     1 
ATOM   6511  C CB    . LYS C 1 139 ? 7.887   -45.861 8.662   1.00 20.96  ? 447  LYS C CB    1 
ATOM   6512  C CG    . LYS C 1 139 ? 7.749   -47.311 8.219   1.00 45.02  ? 447  LYS C CG    1 
ATOM   6513  C CD    . LYS C 1 139 ? 6.670   -47.478 7.159   1.00 50.23  ? 447  LYS C CD    1 
ATOM   6514  C CE    . LYS C 1 139 ? 6.501   -48.949 6.788   1.00 66.70  ? 447  LYS C CE    1 
ATOM   6515  N NZ    . LYS C 1 139 ? 5.437   -49.164 5.768   1.00 68.70  ? 447  LYS C NZ    1 
ATOM   6516  N N     . LEU C 1 140 ? 10.796  -44.931 8.820   1.00 25.31  ? 448  LEU C N     1 
ATOM   6517  C CA    . LEU C 1 140 ? 12.212  -44.910 8.446   1.00 24.48  ? 448  LEU C CA    1 
ATOM   6518  C C     . LEU C 1 140 ? 13.180  -44.794 9.622   1.00 27.94  ? 448  LEU C C     1 
ATOM   6519  O O     . LEU C 1 140 ? 14.227  -45.447 9.640   1.00 22.67  ? 448  LEU C O     1 
ATOM   6520  C CB    . LEU C 1 140 ? 12.466  -43.747 7.480   1.00 16.99  ? 448  LEU C CB    1 
ATOM   6521  C CG    . LEU C 1 140 ? 11.871  -43.953 6.091   1.00 25.31  ? 448  LEU C CG    1 
ATOM   6522  C CD1   . LEU C 1 140 ? 11.848  -42.646 5.281   1.00 14.84  ? 448  LEU C CD1   1 
ATOM   6523  C CD2   . LEU C 1 140 ? 12.668  -45.025 5.393   1.00 16.30  ? 448  LEU C CD2   1 
ATOM   6524  N N     . LYS C 1 141 ? 12.837  -43.951 10.593  1.00 21.25  ? 449  LYS C N     1 
ATOM   6525  C CA    . LYS C 1 141 ? 13.720  -43.679 11.725  1.00 25.43  ? 449  LYS C CA    1 
ATOM   6526  C C     . LYS C 1 141 ? 12.910  -43.592 13.011  1.00 21.48  ? 449  LYS C C     1 
ATOM   6527  O O     . LYS C 1 141 ? 12.473  -42.500 13.403  1.00 20.96  ? 449  LYS C O     1 
ATOM   6528  C CB    . LYS C 1 141 ? 14.495  -42.372 11.504  1.00 25.46  ? 449  LYS C CB    1 
ATOM   6529  C CG    . LYS C 1 141 ? 15.578  -42.119 12.552  1.00 30.22  ? 449  LYS C CG    1 
ATOM   6530  C CD    . LYS C 1 141 ? 16.671  -41.204 12.018  1.00 31.18  ? 449  LYS C CD    1 
ATOM   6531  C CE    . LYS C 1 141 ? 16.277  -39.742 12.110  1.00 18.55  ? 449  LYS C CE    1 
ATOM   6532  N NZ    . LYS C 1 141 ? 17.155  -38.896 11.224  1.00 16.66  ? 449  LYS C NZ    1 
ATOM   6533  N N     . PRO C 1 142 ? 12.703  -44.748 13.667  1.00 23.52  ? 450  PRO C N     1 
ATOM   6534  C CA    . PRO C 1 142 ? 11.894  -44.907 14.880  1.00 19.54  ? 450  PRO C CA    1 
ATOM   6535  C C     . PRO C 1 142 ? 12.285  -43.924 15.979  1.00 24.42  ? 450  PRO C C     1 
ATOM   6536  O O     . PRO C 1 142 ? 11.419  -43.410 16.683  1.00 19.78  ? 450  PRO C O     1 
ATOM   6537  C CB    . PRO C 1 142 ? 12.223  -46.333 15.333  1.00 28.85  ? 450  PRO C CB    1 
ATOM   6538  C CG    . PRO C 1 142 ? 12.559  -47.044 14.072  1.00 37.48  ? 450  PRO C CG    1 
ATOM   6539  C CD    . PRO C 1 142 ? 13.267  -46.034 13.213  1.00 38.09  ? 450  PRO C CD    1 
ATOM   6540  N N     . ASP C 1 143 ? 13.583  -43.682 16.116  1.00 20.96  ? 451  ASP C N     1 
ATOM   6541  C CA    . ASP C 1 143 ? 14.089  -42.734 17.090  1.00 17.64  ? 451  ASP C CA    1 
ATOM   6542  C C     . ASP C 1 143 ? 14.303  -41.370 16.441  1.00 15.32  ? 451  ASP C C     1 
ATOM   6543  O O     . ASP C 1 143 ? 15.363  -41.092 15.877  1.00 17.81  ? 451  ASP C O     1 
ATOM   6544  C CB    . ASP C 1 143 ? 15.401  -43.258 17.687  1.00 25.67  ? 451  ASP C CB    1 
ATOM   6545  C CG    . ASP C 1 143 ? 15.717  -42.644 19.023  1.00 25.37  ? 451  ASP C CG    1 
ATOM   6546  O OD1   . ASP C 1 143 ? 15.411  -41.445 19.226  1.00 31.45  ? 451  ASP C OD1   1 
ATOM   6547  O OD2   . ASP C 1 143 ? 16.273  -43.358 19.879  1.00 49.05  ? 451  ASP C OD2   1 
ATOM   6548  N N     . PHE C 1 144 ? 13.281  -40.524 16.516  1.00 17.72  ? 452  PHE C N     1 
ATOM   6549  C CA    . PHE C 1 144 ? 13.283  -39.251 15.792  1.00 20.47  ? 452  PHE C CA    1 
ATOM   6550  C C     . PHE C 1 144 ? 12.437  -38.229 16.557  1.00 20.98  ? 452  PHE C C     1 
ATOM   6551  O O     . PHE C 1 144 ? 11.277  -38.019 16.237  1.00 16.95  ? 452  PHE C O     1 
ATOM   6552  C CB    . PHE C 1 144 ? 12.713  -39.469 14.386  1.00 17.56  ? 452  PHE C CB    1 
ATOM   6553  C CG    . PHE C 1 144 ? 13.006  -38.356 13.411  1.00 15.27  ? 452  PHE C CG    1 
ATOM   6554  C CD1   . PHE C 1 144 ? 13.554  -37.156 13.832  1.00 20.27  ? 452  PHE C CD1   1 
ATOM   6555  C CD2   . PHE C 1 144 ? 12.739  -38.527 12.071  1.00 16.03  ? 452  PHE C CD2   1 
ATOM   6556  C CE1   . PHE C 1 144 ? 13.816  -36.141 12.928  1.00 13.36  ? 452  PHE C CE1   1 
ATOM   6557  C CE2   . PHE C 1 144 ? 12.997  -37.515 11.156  1.00 23.66  ? 452  PHE C CE2   1 
ATOM   6558  C CZ    . PHE C 1 144 ? 13.543  -36.320 11.587  1.00 25.53  ? 452  PHE C CZ    1 
ATOM   6559  N N     . PRO C 1 145 ? 13.026  -37.594 17.578  1.00 18.23  ? 453  PRO C N     1 
ATOM   6560  C CA    . PRO C 1 145 ? 12.296  -36.682 18.457  1.00 22.10  ? 453  PRO C CA    1 
ATOM   6561  C C     . PRO C 1 145 ? 11.522  -35.588 17.721  1.00 20.66  ? 453  PRO C C     1 
ATOM   6562  O O     . PRO C 1 145 ? 10.362  -35.361 18.064  1.00 20.62  ? 453  PRO C O     1 
ATOM   6563  C CB    . PRO C 1 145 ? 13.404  -36.078 19.313  1.00 24.17  ? 453  PRO C CB    1 
ATOM   6564  C CG    . PRO C 1 145 ? 14.402  -37.172 19.421  1.00 24.65  ? 453  PRO C CG    1 
ATOM   6565  C CD    . PRO C 1 145 ? 14.406  -37.817 18.049  1.00 22.61  ? 453  PRO C CD    1 
ATOM   6566  N N     . ASP C 1 146 ? 12.132  -34.911 16.751  1.00 20.95  ? 454  ASP C N     1 
ATOM   6567  C CA    . ASP C 1 146 ? 11.421  -33.825 16.073  1.00 22.70  ? 454  ASP C CA    1 
ATOM   6568  C C     . ASP C 1 146 ? 10.135  -34.313 15.446  1.00 15.61  ? 454  ASP C C     1 
ATOM   6569  O O     . ASP C 1 146 ? 9.087   -33.684 15.575  1.00 19.21  ? 454  ASP C O     1 
ATOM   6570  C CB    . ASP C 1 146 ? 12.270  -33.168 14.993  1.00 25.28  ? 454  ASP C CB    1 
ATOM   6571  C CG    . ASP C 1 146 ? 13.376  -32.316 15.563  1.00 29.81  ? 454  ASP C CG    1 
ATOM   6572  O OD1   . ASP C 1 146 ? 13.385  -32.081 16.790  1.00 27.90  ? 454  ASP C OD1   1 
ATOM   6573  O OD2   . ASP C 1 146 ? 14.229  -31.873 14.775  1.00 30.19  ? 454  ASP C OD2   1 
ATOM   6574  N N     . ALA C 1 147 ? 10.223  -35.429 14.743  1.00 11.12  ? 455  ALA C N     1 
ATOM   6575  C CA    . ALA C 1 147 ? 9.075   -35.933 14.028  1.00 12.55  ? 455  ALA C CA    1 
ATOM   6576  C C     . ALA C 1 147 ? 8.033   -36.462 15.023  1.00 14.24  ? 455  ALA C C     1 
ATOM   6577  O O     . ALA C 1 147 ? 6.843   -36.213 14.867  1.00 14.55  ? 455  ALA C O     1 
ATOM   6578  C CB    . ALA C 1 147 ? 9.493   -37.022 13.063  1.00 18.63  ? 455  ALA C CB    1 
ATOM   6579  N N     . TYR C 1 148 ? 8.470   -37.185 16.044  1.00 10.41  ? 456  TYR C N     1 
ATOM   6580  C CA    . TYR C 1 148 ? 7.492   -37.726 16.996  1.00 15.82  ? 456  TYR C CA    1 
ATOM   6581  C C     . TYR C 1 148 ? 6.706   -36.596 17.654  1.00 17.17  ? 456  TYR C C     1 
ATOM   6582  O O     . TYR C 1 148 ? 5.473   -36.659 17.774  1.00 11.82  ? 456  TYR C O     1 
ATOM   6583  C CB    . TYR C 1 148 ? 8.164   -38.576 18.077  1.00 12.98  ? 456  TYR C CB    1 
ATOM   6584  C CG    . TYR C 1 148 ? 7.158   -39.267 18.967  1.00 11.46  ? 456  TYR C CG    1 
ATOM   6585  C CD1   . TYR C 1 148 ? 6.648   -40.511 18.628  1.00 20.32  ? 456  TYR C CD1   1 
ATOM   6586  C CD2   . TYR C 1 148 ? 6.686   -38.656 20.118  1.00 14.90  ? 456  TYR C CD2   1 
ATOM   6587  C CE1   . TYR C 1 148 ? 5.711   -41.143 19.434  1.00 23.35  ? 456  TYR C CE1   1 
ATOM   6588  C CE2   . TYR C 1 148 ? 5.755   -39.278 20.931  1.00 17.45  ? 456  TYR C CE2   1 
ATOM   6589  C CZ    . TYR C 1 148 ? 5.276   -40.520 20.583  1.00 19.69  ? 456  TYR C CZ    1 
ATOM   6590  O OH    . TYR C 1 148 ? 4.344   -41.135 21.374  1.00 18.98  ? 456  TYR C OH    1 
ATOM   6591  N N     . CYS C 1 149 ? 7.422   -35.569 18.101  1.00 12.08  ? 457  CYS C N     1 
ATOM   6592  C CA    . CYS C 1 149 ? 6.778   -34.464 18.817  1.00 14.71  ? 457  CYS C CA    1 
ATOM   6593  C C     . CYS C 1 149 ? 5.917   -33.595 17.907  1.00 18.73  ? 457  CYS C C     1 
ATOM   6594  O O     . CYS C 1 149 ? 4.870   -33.090 18.321  1.00 12.85  ? 457  CYS C O     1 
ATOM   6595  C CB    . CYS C 1 149 ? 7.818   -33.615 19.541  1.00 19.25  ? 457  CYS C CB    1 
ATOM   6596  S SG    . CYS C 1 149 ? 8.629   -34.513 20.891  1.00 18.25  ? 457  CYS C SG    1 
ATOM   6597  N N     . ASN C 1 150 ? 6.352   -33.411 16.667  1.00 13.44  ? 458  ASN C N     1 
ATOM   6598  C CA    . ASN C 1 150 ? 5.551   -32.639 15.728  1.00 7.89   ? 458  ASN C CA    1 
ATOM   6599  C C     . ASN C 1 150 ? 4.314   -33.423 15.341  1.00 11.20  ? 458  ASN C C     1 
ATOM   6600  O O     . ASN C 1 150 ? 3.220   -32.860 15.171  1.00 11.33  ? 458  ASN C O     1 
ATOM   6601  C CB    . ASN C 1 150 ? 6.386   -32.211 14.505  1.00 10.08  ? 458  ASN C CB    1 
ATOM   6602  C CG    . ASN C 1 150 ? 7.254   -30.985 14.791  1.00 22.90  ? 458  ASN C CG    1 
ATOM   6603  O OD1   . ASN C 1 150 ? 6.876   -30.121 15.575  1.00 27.60  ? 458  ASN C OD1   1 
ATOM   6604  N ND2   . ASN C 1 150 ? 8.421   -30.915 14.163  1.00 17.97  ? 458  ASN C ND2   1 
ATOM   6605  N N     . LEU C 1 151 ? 4.476   -34.732 15.201  1.00 15.47  ? 459  LEU C N     1 
ATOM   6606  C CA    . LEU C 1 151 ? 3.327   -35.606 14.967  1.00 13.16  ? 459  LEU C CA    1 
ATOM   6607  C C     . LEU C 1 151 ? 2.363   -35.538 16.168  1.00 15.15  ? 459  LEU C C     1 
ATOM   6608  O O     . LEU C 1 151 ? 1.146   -35.440 16.002  1.00 13.02  ? 459  LEU C O     1 
ATOM   6609  C CB    . LEU C 1 151 ? 3.785   -37.052 14.712  1.00 7.37   ? 459  LEU C CB    1 
ATOM   6610  C CG    . LEU C 1 151 ? 2.691   -38.118 14.792  1.00 12.92  ? 459  LEU C CG    1 
ATOM   6611  C CD1   . LEU C 1 151 ? 1.571   -37.841 13.792  1.00 6.02   ? 459  LEU C CD1   1 
ATOM   6612  C CD2   . LEU C 1 151 ? 3.288   -39.505 14.604  1.00 16.16  ? 459  LEU C CD2   1 
ATOM   6613  N N     . ALA C 1 152 ? 2.906   -35.570 17.377  1.00 5.63   ? 460  ALA C N     1 
ATOM   6614  C CA    . ALA C 1 152 ? 2.059   -35.471 18.575  1.00 9.09   ? 460  ALA C CA    1 
ATOM   6615  C C     . ALA C 1 152 ? 1.206   -34.191 18.541  1.00 12.52  ? 460  ALA C C     1 
ATOM   6616  O O     . ALA C 1 152 ? 0.018   -34.204 18.879  1.00 13.85  ? 460  ALA C O     1 
ATOM   6617  C CB    . ALA C 1 152 ? 2.911   -35.508 19.847  1.00 11.60  ? 460  ALA C CB    1 
ATOM   6618  N N     . HIS C 1 153 ? 1.809   -33.083 18.128  1.00 13.57  ? 461  HIS C N     1 
ATOM   6619  C CA    . HIS C 1 153 ? 1.055   -31.843 18.049  1.00 9.50   ? 461  HIS C CA    1 
ATOM   6620  C C     . HIS C 1 153 ? -0.041  -31.910 16.980  1.00 15.56  ? 461  HIS C C     1 
ATOM   6621  O O     . HIS C 1 153 ? -1.154  -31.438 17.205  1.00 6.71   ? 461  HIS C O     1 
ATOM   6622  C CB    . HIS C 1 153 ? 1.966   -30.630 17.825  1.00 10.69  ? 461  HIS C CB    1 
ATOM   6623  C CG    . HIS C 1 153 ? 1.273   -29.329 18.054  1.00 17.72  ? 461  HIS C CG    1 
ATOM   6624  N ND1   . HIS C 1 153 ? 1.166   -28.356 17.082  1.00 15.28  ? 461  HIS C ND1   1 
ATOM   6625  C CD2   . HIS C 1 153 ? 0.621   -28.852 19.142  1.00 19.88  ? 461  HIS C CD2   1 
ATOM   6626  C CE1   . HIS C 1 153 ? 0.480   -27.334 17.565  1.00 19.04  ? 461  HIS C CE1   1 
ATOM   6627  N NE2   . HIS C 1 153 ? 0.138   -27.610 18.813  1.00 11.10  ? 461  HIS C NE2   1 
ATOM   6628  N N     . CYS C 1 154 ? 0.257   -32.501 15.822  1.00 11.04  ? 462  CYS C N     1 
ATOM   6629  C CA    . CYS C 1 154 ? -0.786  -32.703 14.810  1.00 13.88  ? 462  CYS C CA    1 
ATOM   6630  C C     . CYS C 1 154 ? -1.954  -33.518 15.369  1.00 10.20  ? 462  CYS C C     1 
ATOM   6631  O O     . CYS C 1 154 ? -3.130  -33.232 15.092  1.00 10.04  ? 462  CYS C O     1 
ATOM   6632  C CB    . CYS C 1 154 ? -0.239  -33.431 13.576  1.00 11.58  ? 462  CYS C CB    1 
ATOM   6633  S SG    . CYS C 1 154 ? 1.002   -32.537 12.601  1.00 15.17  ? 462  CYS C SG    1 
ATOM   6634  N N     . LEU C 1 155 ? -1.637  -34.566 16.118  1.00 9.24   ? 463  LEU C N     1 
ATOM   6635  C CA    . LEU C 1 155 ? -2.693  -35.413 16.666  1.00 10.17  ? 463  LEU C CA    1 
ATOM   6636  C C     . LEU C 1 155 ? -3.511  -34.617 17.664  1.00 8.31   ? 463  LEU C C     1 
ATOM   6637  O O     . LEU C 1 155 ? -4.721  -34.785 17.747  1.00 15.91  ? 463  LEU C O     1 
ATOM   6638  C CB    . LEU C 1 155 ? -2.121  -36.661 17.328  1.00 7.96   ? 463  LEU C CB    1 
ATOM   6639  C CG    . LEU C 1 155 ? -1.325  -37.526 16.357  1.00 7.18   ? 463  LEU C CG    1 
ATOM   6640  C CD1   . LEU C 1 155 ? -0.663  -38.673 17.116  1.00 10.96  ? 463  LEU C CD1   1 
ATOM   6641  C CD2   . LEU C 1 155 ? -2.216  -38.043 15.234  1.00 15.46  ? 463  LEU C CD2   1 
ATOM   6642  N N     . GLN C 1 156 ? -2.850  -33.719 18.387  1.00 12.41  ? 464  GLN C N     1 
ATOM   6643  C CA    . GLN C 1 156 ? -3.538  -32.840 19.333  1.00 13.97  ? 464  GLN C CA    1 
ATOM   6644  C C     . GLN C 1 156 ? -4.520  -31.908 18.621  1.00 8.23   ? 464  GLN C C     1 
ATOM   6645  O O     . GLN C 1 156 ? -5.673  -31.750 19.040  1.00 10.59  ? 464  GLN C O     1 
ATOM   6646  C CB    . GLN C 1 156 ? -2.525  -32.028 20.150  1.00 14.25  ? 464  GLN C CB    1 
ATOM   6647  C CG    . GLN C 1 156 ? -3.150  -31.252 21.318  1.00 15.54  ? 464  GLN C CG    1 
ATOM   6648  C CD    . GLN C 1 156 ? -3.351  -32.116 22.556  1.00 12.20  ? 464  GLN C CD    1 
ATOM   6649  O OE1   . GLN C 1 156 ? -2.734  -33.177 22.699  1.00 12.27  ? 464  GLN C OE1   1 
ATOM   6650  N NE2   . GLN C 1 156 ? -4.218  -31.660 23.459  1.00 12.50  ? 464  GLN C NE2   1 
ATOM   6651  N N     . ILE C 1 157 ? -4.065  -31.314 17.527  1.00 7.40   ? 465  ILE C N     1 
ATOM   6652  C CA    . ILE C 1 157 ? -4.869  -30.364 16.753  1.00 8.09   ? 465  ILE C CA    1 
ATOM   6653  C C     . ILE C 1 157 ? -6.180  -30.975 16.273  1.00 11.59  ? 465  ILE C C     1 
ATOM   6654  O O     . ILE C 1 157 ? -7.214  -30.298 16.242  1.00 10.38  ? 465  ILE C O     1 
ATOM   6655  C CB    . ILE C 1 157 ? -4.056  -29.827 15.525  1.00 10.89  ? 465  ILE C CB    1 
ATOM   6656  C CG1   . ILE C 1 157 ? -2.952  -28.875 15.987  1.00 10.75  ? 465  ILE C CG1   1 
ATOM   6657  C CG2   . ILE C 1 157 ? -4.972  -29.164 14.496  1.00 5.33   ? 465  ILE C CG2   1 
ATOM   6658  C CD1   . ILE C 1 157 ? -1.834  -28.632 14.953  1.00 14.33  ? 465  ILE C CD1   1 
ATOM   6659  N N     . VAL C 1 158 ? -6.153  -32.251 15.895  1.00 7.10   ? 466  VAL C N     1 
ATOM   6660  C CA    . VAL C 1 158 ? -7.362  -32.878 15.347  1.00 12.82  ? 466  VAL C CA    1 
ATOM   6661  C C     . VAL C 1 158 ? -8.084  -33.787 16.342  1.00 13.73  ? 466  VAL C C     1 
ATOM   6662  O O     . VAL C 1 158 ? -9.020  -34.496 15.974  1.00 13.72  ? 466  VAL C O     1 
ATOM   6663  C CB    . VAL C 1 158 ? -7.086  -33.630 14.029  1.00 12.00  ? 466  VAL C CB    1 
ATOM   6664  C CG1   . VAL C 1 158 ? -6.426  -32.674 13.023  1.00 6.23   ? 466  VAL C CG1   1 
ATOM   6665  C CG2   . VAL C 1 158 ? -6.216  -34.879 14.277  1.00 11.11  ? 466  VAL C CG2   1 
ATOM   6666  N N     . CYS C 1 159 ? -7.643  -33.754 17.598  1.00 6.98   ? 467  CYS C N     1 
ATOM   6667  C CA    . CYS C 1 159 ? -8.239  -34.578 18.650  1.00 10.17  ? 467  CYS C CA    1 
ATOM   6668  C C     . CYS C 1 159 ? -8.196  -36.067 18.325  1.00 14.54  ? 467  CYS C C     1 
ATOM   6669  O O     . CYS C 1 159 ? -9.156  -36.797 18.569  1.00 8.80   ? 467  CYS C O     1 
ATOM   6670  C CB    . CYS C 1 159 ? -9.674  -34.124 18.956  1.00 17.61  ? 467  CYS C CB    1 
ATOM   6671  S SG    . CYS C 1 159 ? -9.781  -32.401 19.573  1.00 14.96  ? 467  CYS C SG    1 
ATOM   6672  N N     . ASP C 1 160 ? -7.073  -36.505 17.767  1.00 9.99   ? 468  ASP C N     1 
ATOM   6673  C CA    . ASP C 1 160 ? -6.783  -37.937 17.642  1.00 12.41  ? 468  ASP C CA    1 
ATOM   6674  C C     . ASP C 1 160 ? -6.114  -38.375 18.927  1.00 15.52  ? 468  ASP C C     1 
ATOM   6675  O O     . ASP C 1 160 ? -4.987  -37.982 19.196  1.00 12.66  ? 468  ASP C O     1 
ATOM   6676  C CB    . ASP C 1 160 ? -5.847  -38.199 16.451  1.00 5.37   ? 468  ASP C CB    1 
ATOM   6677  C CG    . ASP C 1 160 ? -5.584  -39.702 16.226  1.00 12.30  ? 468  ASP C CG    1 
ATOM   6678  O OD1   . ASP C 1 160 ? -5.528  -40.457 17.214  1.00 18.92  ? 468  ASP C OD1   1 
ATOM   6679  O OD2   . ASP C 1 160 ? -5.427  -40.107 15.069  1.00 21.01  ? 468  ASP C OD2   1 
ATOM   6680  N N     . TRP C 1 161 ? -6.813  -39.173 19.732  1.00 8.17   ? 469  TRP C N     1 
ATOM   6681  C CA    . TRP C 1 161 ? -6.283  -39.594 21.021  1.00 11.19  ? 469  TRP C CA    1 
ATOM   6682  C C     . TRP C 1 161 ? -5.936  -41.087 21.064  1.00 14.55  ? 469  TRP C C     1 
ATOM   6683  O O     . TRP C 1 161 ? -5.979  -41.703 22.122  1.00 14.49  ? 469  TRP C O     1 
ATOM   6684  C CB    . TRP C 1 161 ? -7.268  -39.236 22.146  1.00 11.15  ? 469  TRP C CB    1 
ATOM   6685  C CG    . TRP C 1 161 ? -7.594  -37.745 22.181  1.00 13.08  ? 469  TRP C CG    1 
ATOM   6686  C CD1   . TRP C 1 161 ? -6.748  -36.707 21.885  1.00 11.07  ? 469  TRP C CD1   1 
ATOM   6687  C CD2   . TRP C 1 161 ? -8.853  -37.154 22.506  1.00 11.43  ? 469  TRP C CD2   1 
ATOM   6688  N NE1   . TRP C 1 161 ? -7.411  -35.500 22.013  1.00 11.21  ? 469  TRP C NE1   1 
ATOM   6689  C CE2   . TRP C 1 161 ? -8.702  -35.749 22.396  1.00 13.86  ? 469  TRP C CE2   1 
ATOM   6690  C CE3   . TRP C 1 161 ? -10.099 -37.672 22.881  1.00 14.37  ? 469  TRP C CE3   1 
ATOM   6691  C CZ2   . TRP C 1 161 ? -9.747  -34.866 22.646  1.00 13.34  ? 469  TRP C CZ2   1 
ATOM   6692  C CZ3   . TRP C 1 161 ? -11.139 -36.783 23.129  1.00 13.16  ? 469  TRP C CZ3   1 
ATOM   6693  C CH2   . TRP C 1 161 ? -10.952 -35.402 23.015  1.00 12.05  ? 469  TRP C CH2   1 
ATOM   6694  N N     . THR C 1 162 ? -5.578  -41.661 19.919  1.00 16.00  ? 470  THR C N     1 
ATOM   6695  C CA    . THR C 1 162 ? -5.111  -43.048 19.886  1.00 16.08  ? 470  THR C CA    1 
ATOM   6696  C C     . THR C 1 162 ? -3.867  -43.214 20.768  1.00 21.96  ? 470  THR C C     1 
ATOM   6697  O O     . THR C 1 162 ? -2.888  -42.471 20.616  1.00 13.23  ? 470  THR C O     1 
ATOM   6698  C CB    . THR C 1 162 ? -4.744  -43.491 18.462  1.00 21.85  ? 470  THR C CB    1 
ATOM   6699  O OG1   . THR C 1 162 ? -5.825  -43.205 17.566  1.00 19.52  ? 470  THR C OG1   1 
ATOM   6700  C CG2   . THR C 1 162 ? -4.407  -44.998 18.427  1.00 16.77  ? 470  THR C CG2   1 
ATOM   6701  N N     . ASP C 1 163 ? -3.919  -44.173 21.695  1.00 12.56  ? 471  ASP C N     1 
ATOM   6702  C CA    . ASP C 1 163 ? -2.781  -44.485 22.556  1.00 20.95  ? 471  ASP C CA    1 
ATOM   6703  C C     . ASP C 1 163 ? -2.257  -43.236 23.260  1.00 26.40  ? 471  ASP C C     1 
ATOM   6704  O O     . ASP C 1 163 ? -1.045  -43.051 23.371  1.00 16.18  ? 471  ASP C O     1 
ATOM   6705  C CB    . ASP C 1 163 ? -1.650  -45.131 21.745  1.00 20.00  ? 471  ASP C CB    1 
ATOM   6706  C CG    . ASP C 1 163 ? -2.059  -46.450 21.113  1.00 40.26  ? 471  ASP C CG    1 
ATOM   6707  O OD1   . ASP C 1 163 ? -3.000  -47.089 21.624  1.00 48.24  ? 471  ASP C OD1   1 
ATOM   6708  O OD2   . ASP C 1 163 ? -1.436  -46.851 20.105  1.00 57.27  ? 471  ASP C OD2   1 
ATOM   6709  N N     . TYR C 1 164 ? -3.178  -42.405 23.749  1.00 24.94  ? 472  TYR C N     1 
ATOM   6710  C CA    . TYR C 1 164 ? -2.864  -41.076 24.295  1.00 14.57  ? 472  TYR C CA    1 
ATOM   6711  C C     . TYR C 1 164 ? -1.918  -41.092 25.500  1.00 20.95  ? 472  TYR C C     1 
ATOM   6712  O O     . TYR C 1 164 ? -0.932  -40.355 25.526  1.00 16.85  ? 472  TYR C O     1 
ATOM   6713  C CB    . TYR C 1 164 ? -4.165  -40.334 24.637  1.00 16.98  ? 472  TYR C CB    1 
ATOM   6714  C CG    . TYR C 1 164 ? -3.977  -38.962 25.270  1.00 18.87  ? 472  TYR C CG    1 
ATOM   6715  C CD1   . TYR C 1 164 ? -3.837  -37.822 24.489  1.00 21.37  ? 472  TYR C CD1   1 
ATOM   6716  C CD2   . TYR C 1 164 ? -3.948  -38.816 26.653  1.00 21.08  ? 472  TYR C CD2   1 
ATOM   6717  C CE1   . TYR C 1 164 ? -3.666  -36.564 25.070  1.00 13.51  ? 472  TYR C CE1   1 
ATOM   6718  C CE2   . TYR C 1 164 ? -3.770  -37.575 27.234  1.00 21.40  ? 472  TYR C CE2   1 
ATOM   6719  C CZ    . TYR C 1 164 ? -3.641  -36.456 26.437  1.00 15.63  ? 472  TYR C CZ    1 
ATOM   6720  O OH    . TYR C 1 164 ? -3.469  -35.229 27.031  1.00 19.71  ? 472  TYR C OH    1 
ATOM   6721  N N     . ASP C 1 165 ? -2.216  -41.938 26.488  1.00 13.64  ? 473  ASP C N     1 
ATOM   6722  C CA    . ASP C 1 165 ? -1.415  -42.033 27.705  1.00 17.24  ? 473  ASP C CA    1 
ATOM   6723  C C     . ASP C 1 165 ? 0.039   -42.408 27.437  1.00 12.42  ? 473  ASP C C     1 
ATOM   6724  O O     . ASP C 1 165 ? 0.948   -41.827 28.024  1.00 22.76  ? 473  ASP C O     1 
ATOM   6725  C CB    . ASP C 1 165 ? -2.031  -43.053 28.684  1.00 25.79  ? 473  ASP C CB    1 
ATOM   6726  C CG    . ASP C 1 165 ? -3.399  -42.635 29.171  1.00 36.28  ? 473  ASP C CG    1 
ATOM   6727  O OD1   . ASP C 1 165 ? -3.646  -41.413 29.259  1.00 28.10  ? 473  ASP C OD1   1 
ATOM   6728  O OD2   . ASP C 1 165 ? -4.225  -43.525 29.461  1.00 52.87  ? 473  ASP C OD2   1 
ATOM   6729  N N     . GLU C 1 166 ? 0.253   -43.401 26.577  1.00 14.03  ? 474  GLU C N     1 
ATOM   6730  C CA    . GLU C 1 166 ? 1.609   -43.803 26.192  1.00 16.79  ? 474  GLU C CA    1 
ATOM   6731  C C     . GLU C 1 166 ? 2.266   -42.695 25.367  1.00 9.66   ? 474  GLU C C     1 
ATOM   6732  O O     . GLU C 1 166 ? 3.472   -42.470 25.450  1.00 16.37  ? 474  GLU C O     1 
ATOM   6733  C CB    . GLU C 1 166 ? 1.578   -45.097 25.381  1.00 20.44  ? 474  GLU C CB    1 
ATOM   6734  C CG    . GLU C 1 166 ? 2.954   -45.726 25.185  1.00 35.47  ? 474  GLU C CG    1 
ATOM   6735  C CD    . GLU C 1 166 ? 2.994   -46.737 24.052  1.00 52.21  ? 474  GLU C CD    1 
ATOM   6736  O OE1   . GLU C 1 166 ? 2.553   -46.396 22.935  1.00 45.29  ? 474  GLU C OE1   1 
ATOM   6737  O OE2   . GLU C 1 166 ? 3.470   -47.873 24.279  1.00 58.12  ? 474  GLU C OE2   1 
ATOM   6738  N N     . ARG C 1 167 ? 1.465   -42.014 24.550  1.00 17.39  ? 475  ARG C N     1 
ATOM   6739  C CA    . ARG C 1 167 ? 1.976   -40.876 23.779  1.00 16.70  ? 475  ARG C CA    1 
ATOM   6740  C C     . ARG C 1 167 ? 2.513   -39.817 24.741  1.00 18.41  ? 475  ARG C C     1 
ATOM   6741  O O     . ARG C 1 167 ? 3.632   -39.319 24.580  1.00 13.16  ? 475  ARG C O     1 
ATOM   6742  C CB    . ARG C 1 167 ? 0.870   -40.262 22.915  1.00 12.37  ? 475  ARG C CB    1 
ATOM   6743  C CG    . ARG C 1 167 ? 1.382   -39.193 21.918  1.00 18.65  ? 475  ARG C CG    1 
ATOM   6744  C CD    . ARG C 1 167 ? 0.229   -38.392 21.324  1.00 20.23  ? 475  ARG C CD    1 
ATOM   6745  N NE    . ARG C 1 167 ? -0.762  -39.241 20.661  1.00 13.82  ? 475  ARG C NE    1 
ATOM   6746  C CZ    . ARG C 1 167 ? -2.017  -38.862 20.406  1.00 15.61  ? 475  ARG C CZ    1 
ATOM   6747  N NH1   . ARG C 1 167 ? -2.447  -37.653 20.761  1.00 13.76  ? 475  ARG C NH1   1 
ATOM   6748  N NH2   . ARG C 1 167 ? -2.845  -39.693 19.795  1.00 24.07  ? 475  ARG C NH2   1 
ATOM   6749  N N     . MET C 1 168 ? 1.709   -39.491 25.754  1.00 13.24  ? 476  MET C N     1 
ATOM   6750  C CA    . MET C 1 168 ? 2.096   -38.476 26.724  1.00 15.42  ? 476  MET C CA    1 
ATOM   6751  C C     . MET C 1 168 ? 3.342   -38.920 27.484  1.00 20.45  ? 476  MET C C     1 
ATOM   6752  O O     . MET C 1 168 ? 4.230   -38.113 27.747  1.00 16.31  ? 476  MET C O     1 
ATOM   6753  C CB    . MET C 1 168 ? 0.960   -38.169 27.701  1.00 18.54  ? 476  MET C CB    1 
ATOM   6754  C CG    . MET C 1 168 ? -0.255  -37.485 27.090  1.00 17.98  ? 476  MET C CG    1 
ATOM   6755  S SD    . MET C 1 168 ? 0.112   -35.921 26.244  1.00 17.63  ? 476  MET C SD    1 
ATOM   6756  C CE    . MET C 1 168 ? 0.106   -36.489 24.542  1.00 16.65  ? 476  MET C CE    1 
ATOM   6757  N N     . LYS C 1 169 ? 3.419   -40.203 27.827  1.00 9.91   ? 477  LYS C N     1 
ATOM   6758  C CA    . LYS C 1 169 ? 4.608   -40.708 28.538  1.00 18.61  ? 477  LYS C CA    1 
ATOM   6759  C C     . LYS C 1 169 ? 5.872   -40.607 27.677  1.00 15.45  ? 477  LYS C C     1 
ATOM   6760  O O     . LYS C 1 169 ? 6.956   -40.243 28.155  1.00 15.90  ? 477  LYS C O     1 
ATOM   6761  C CB    . LYS C 1 169 ? 4.405   -42.154 29.018  1.00 17.53  ? 477  LYS C CB    1 
ATOM   6762  C CG    . LYS C 1 169 ? 3.503   -42.279 30.246  1.00 30.25  ? 477  LYS C CG    1 
ATOM   6763  C CD    . LYS C 1 169 ? 3.429   -43.720 30.775  1.00 34.40  ? 477  LYS C CD    1 
ATOM   6764  C CE    . LYS C 1 169 ? 2.742   -43.758 32.138  1.00 49.31  ? 477  LYS C CE    1 
ATOM   6765  N NZ    . LYS C 1 169 ? 2.533   -45.144 32.650  1.00 58.32  ? 477  LYS C NZ    1 
ATOM   6766  N N     . LYS C 1 170 ? 5.739   -40.943 26.403  1.00 14.67  ? 478  LYS C N     1 
ATOM   6767  C CA    . LYS C 1 170 ? 6.874   -40.865 25.497  1.00 19.17  ? 478  LYS C CA    1 
ATOM   6768  C C     . LYS C 1 170 ? 7.347   -39.432 25.291  1.00 13.11  ? 478  LYS C C     1 
ATOM   6769  O O     . LYS C 1 170 ? 8.552   -39.190 25.209  1.00 17.05  ? 478  LYS C O     1 
ATOM   6770  C CB    . LYS C 1 170 ? 6.590   -41.543 24.149  1.00 19.07  ? 478  LYS C CB    1 
ATOM   6771  C CG    . LYS C 1 170 ? 7.822   -41.585 23.264  1.00 25.90  ? 478  LYS C CG    1 
ATOM   6772  C CD    . LYS C 1 170 ? 7.615   -42.415 22.024  1.00 37.79  ? 478  LYS C CD    1 
ATOM   6773  C CE    . LYS C 1 170 ? 8.935   -42.621 21.298  1.00 44.44  ? 478  LYS C CE    1 
ATOM   6774  N NZ    . LYS C 1 170 ? 8.792   -43.526 20.123  1.00 39.61  ? 478  LYS C NZ    1 
ATOM   6775  N N     . LEU C 1 171 ? 6.410   -38.483 25.223  1.00 16.59  ? 479  LEU C N     1 
ATOM   6776  C CA    . LEU C 1 171 ? 6.762   -37.073 25.055  1.00 17.13  ? 479  LEU C CA    1 
ATOM   6777  C C     . LEU C 1 171 ? 7.604   -36.592 26.229  1.00 20.06  ? 479  LEU C C     1 
ATOM   6778  O O     . LEU C 1 171 ? 8.588   -35.881 26.053  1.00 11.71  ? 479  LEU C O     1 
ATOM   6779  C CB    . LEU C 1 171 ? 5.510   -36.188 24.968  1.00 20.88  ? 479  LEU C CB    1 
ATOM   6780  C CG    . LEU C 1 171 ? 4.668   -36.154 23.691  1.00 26.01  ? 479  LEU C CG    1 
ATOM   6781  C CD1   . LEU C 1 171 ? 3.414   -35.277 23.886  1.00 21.24  ? 479  LEU C CD1   1 
ATOM   6782  C CD2   . LEU C 1 171 ? 5.487   -35.641 22.530  1.00 16.79  ? 479  LEU C CD2   1 
ATOM   6783  N N     . VAL C 1 172 ? 7.174   -36.962 27.428  1.00 19.39  ? 480  VAL C N     1 
ATOM   6784  C CA    . VAL C 1 172 ? 7.870   -36.609 28.648  1.00 22.82  ? 480  VAL C CA    1 
ATOM   6785  C C     . VAL C 1 172 ? 9.273   -37.212 28.645  1.00 17.26  ? 480  VAL C C     1 
ATOM   6786  O O     . VAL C 1 172 ? 10.247  -36.548 29.013  1.00 19.78  ? 480  VAL C O     1 
ATOM   6787  C CB    . VAL C 1 172 ? 7.077   -37.093 29.890  1.00 18.84  ? 480  VAL C CB    1 
ATOM   6788  C CG1   . VAL C 1 172 ? 7.873   -36.862 31.170  1.00 28.48  ? 480  VAL C CG1   1 
ATOM   6789  C CG2   . VAL C 1 172 ? 5.729   -36.384 29.955  1.00 18.06  ? 480  VAL C CG2   1 
ATOM   6790  N N     . SER C 1 173 ? 9.363   -38.470 28.229  1.00 15.70  ? 481  SER C N     1 
ATOM   6791  C CA    A SER C 1 173 ? 10.630  -39.185 28.213  0.50 13.51  ? 481  SER C CA    1 
ATOM   6792  C CA    B SER C 1 173 ? 10.629  -39.188 28.210  0.50 13.52  ? 481  SER C CA    1 
ATOM   6793  C C     . SER C 1 173 ? 11.588  -38.569 27.202  1.00 16.72  ? 481  SER C C     1 
ATOM   6794  O O     . SER C 1 173 ? 12.786  -38.445 27.459  1.00 16.27  ? 481  SER C O     1 
ATOM   6795  C CB    A SER C 1 173 ? 10.409  -40.664 27.895  0.50 16.52  ? 481  SER C CB    1 
ATOM   6796  C CB    B SER C 1 173 ? 10.403  -40.666 27.888  0.50 16.48  ? 481  SER C CB    1 
ATOM   6797  O OG    A SER C 1 173 ? 11.644  -41.358 27.890  0.50 23.57  ? 481  SER C OG    1 
ATOM   6798  O OG    B SER C 1 173 ? 9.719   -41.313 28.945  0.50 23.18  ? 481  SER C OG    1 
ATOM   6799  N N     . ILE C 1 174 ? 11.052  -38.174 26.053  1.00 18.83  ? 482  ILE C N     1 
ATOM   6800  C CA    . ILE C 1 174 ? 11.851  -37.520 25.027  1.00 19.90  ? 482  ILE C CA    1 
ATOM   6801  C C     . ILE C 1 174 ? 12.436  -36.191 25.520  1.00 21.67  ? 482  ILE C C     1 
ATOM   6802  O O     . ILE C 1 174 ? 13.623  -35.927 25.338  1.00 18.01  ? 482  ILE C O     1 
ATOM   6803  C CB    . ILE C 1 174 ? 11.016  -37.281 23.753  1.00 24.90  ? 482  ILE C CB    1 
ATOM   6804  C CG1   . ILE C 1 174 ? 10.782  -38.605 23.023  1.00 24.27  ? 482  ILE C CG1   1 
ATOM   6805  C CG2   . ILE C 1 174 ? 11.695  -36.261 22.854  1.00 23.67  ? 482  ILE C CG2   1 
ATOM   6806  C CD1   . ILE C 1 174 ? 9.631   -38.558 22.014  1.00 24.84  ? 482  ILE C CD1   1 
ATOM   6807  N N     . VAL C 1 175 ? 11.601  -35.357 26.134  1.00 22.37  ? 483  VAL C N     1 
ATOM   6808  C CA    . VAL C 1 175 ? 12.060  -34.096 26.726  1.00 28.55  ? 483  VAL C CA    1 
ATOM   6809  C C     . VAL C 1 175 ? 13.108  -34.308 27.831  1.00 24.36  ? 483  VAL C C     1 
ATOM   6810  O O     . VAL C 1 175 ? 14.116  -33.609 27.879  1.00 20.03  ? 483  VAL C O     1 
ATOM   6811  C CB    . VAL C 1 175 ? 10.873  -33.265 27.272  1.00 24.90  ? 483  VAL C CB    1 
ATOM   6812  C CG1   . VAL C 1 175 ? 11.358  -32.103 28.155  1.00 13.17  ? 483  VAL C CG1   1 
ATOM   6813  C CG2   . VAL C 1 175 ? 10.016  -32.756 26.119  1.00 24.19  ? 483  VAL C CG2   1 
ATOM   6814  N N     . ALA C 1 176 ? 12.865  -35.274 28.712  1.00 16.31  ? 484  ALA C N     1 
ATOM   6815  C CA    . ALA C 1 176 ? 13.810  -35.589 29.783  1.00 25.08  ? 484  ALA C CA    1 
ATOM   6816  C C     . ALA C 1 176 ? 15.202  -35.909 29.223  1.00 32.64  ? 484  ALA C C     1 
ATOM   6817  O O     . ALA C 1 176 ? 16.215  -35.433 29.739  1.00 22.25  ? 484  ALA C O     1 
ATOM   6818  C CB    . ALA C 1 176 ? 13.289  -36.748 30.621  1.00 20.05  ? 484  ALA C CB    1 
ATOM   6819  N N     . ASP C 1 177 ? 15.234  -36.711 28.161  1.00 22.02  ? 485  ASP C N     1 
ATOM   6820  C CA    . ASP C 1 177 ? 16.479  -37.122 27.510  1.00 22.06  ? 485  ASP C CA    1 
ATOM   6821  C C     . ASP C 1 177 ? 17.164  -35.958 26.809  1.00 21.65  ? 485  ASP C C     1 
ATOM   6822  O O     . ASP C 1 177 ? 18.386  -35.818 26.850  1.00 28.44  ? 485  ASP C O     1 
ATOM   6823  C CB    . ASP C 1 177 ? 16.196  -38.229 26.491  1.00 24.70  ? 485  ASP C CB    1 
ATOM   6824  C CG    . ASP C 1 177 ? 17.456  -38.763 25.845  1.00 45.15  ? 485  ASP C CG    1 
ATOM   6825  O OD1   . ASP C 1 177 ? 18.384  -39.144 26.587  1.00 53.79  ? 485  ASP C OD1   1 
ATOM   6826  O OD2   . ASP C 1 177 ? 17.522  -38.794 24.597  1.00 42.25  ? 485  ASP C OD2   1 
ATOM   6827  N N     . GLN C 1 178 ? 16.380  -35.117 26.146  1.00 18.65  ? 486  GLN C N     1 
ATOM   6828  C CA    . GLN C 1 178 ? 16.966  -33.979 25.445  1.00 21.67  ? 486  GLN C CA    1 
ATOM   6829  C C     . GLN C 1 178 ? 17.542  -32.928 26.401  1.00 18.16  ? 486  GLN C C     1 
ATOM   6830  O O     . GLN C 1 178 ? 18.624  -32.386 26.160  1.00 29.23  ? 486  GLN C O     1 
ATOM   6831  C CB    . GLN C 1 178 ? 15.961  -33.356 24.475  1.00 18.15  ? 486  GLN C CB    1 
ATOM   6832  C CG    . GLN C 1 178 ? 15.735  -34.200 23.229  1.00 23.65  ? 486  GLN C CG    1 
ATOM   6833  C CD    . GLN C 1 178 ? 14.625  -33.671 22.361  1.00 32.96  ? 486  GLN C CD    1 
ATOM   6834  O OE1   . GLN C 1 178 ? 13.636  -33.125 22.858  1.00 20.76  ? 486  GLN C OE1   1 
ATOM   6835  N NE2   . GLN C 1 178 ? 14.780  -33.821 21.049  1.00 24.02  ? 486  GLN C NE2   1 
ATOM   6836  N N     . LEU C 1 179 ? 16.826  -32.638 27.477  1.00 21.49  ? 487  LEU C N     1 
ATOM   6837  C CA    . LEU C 1 179 ? 17.333  -31.710 28.484  1.00 27.85  ? 487  LEU C CA    1 
ATOM   6838  C C     . LEU C 1 179 ? 18.623  -32.247 29.102  1.00 32.20  ? 487  LEU C C     1 
ATOM   6839  O O     . LEU C 1 179 ? 19.578  -31.505 29.311  1.00 31.42  ? 487  LEU C O     1 
ATOM   6840  C CB    . LEU C 1 179 ? 16.284  -31.456 29.570  1.00 25.75  ? 487  LEU C CB    1 
ATOM   6841  C CG    . LEU C 1 179 ? 15.067  -30.612 29.169  1.00 25.12  ? 487  LEU C CG    1 
ATOM   6842  C CD1   . LEU C 1 179 ? 14.055  -30.579 30.292  1.00 13.72  ? 487  LEU C CD1   1 
ATOM   6843  C CD2   . LEU C 1 179 ? 15.490  -29.192 28.771  1.00 26.92  ? 487  LEU C CD2   1 
ATOM   6844  N N     . GLU C 1 180 ? 18.639  -33.544 29.388  1.00 26.42  ? 488  GLU C N     1 
ATOM   6845  C CA    . GLU C 1 180 ? 19.794  -34.188 29.994  1.00 34.82  ? 488  GLU C CA    1 
ATOM   6846  C C     . GLU C 1 180 ? 20.996  -34.174 29.051  1.00 45.06  ? 488  GLU C C     1 
ATOM   6847  O O     . GLU C 1 180 ? 22.128  -33.957 29.476  1.00 49.46  ? 488  GLU C O     1 
ATOM   6848  C CB    . GLU C 1 180 ? 19.438  -35.621 30.382  1.00 24.48  ? 488  GLU C CB    1 
ATOM   6849  C CG    . GLU C 1 180 ? 20.635  -36.521 30.653  1.00 51.07  ? 488  GLU C CG    1 
ATOM   6850  C CD    . GLU C 1 180 ? 20.226  -37.963 30.903  1.00 53.00  ? 488  GLU C CD    1 
ATOM   6851  O OE1   . GLU C 1 180 ? 19.107  -38.183 31.413  1.00 59.39  ? 488  GLU C OE1   1 
ATOM   6852  O OE2   . GLU C 1 180 ? 21.015  -38.874 30.580  1.00 49.76  ? 488  GLU C OE2   1 
ATOM   6853  N N     . LYS C 1 181 ? 20.745  -34.400 27.767  1.00 36.95  ? 489  LYS C N     1 
ATOM   6854  C CA    . LYS C 1 181 ? 21.819  -34.437 26.785  1.00 33.13  ? 489  LYS C CA    1 
ATOM   6855  C C     . LYS C 1 181 ? 22.057  -33.070 26.151  1.00 42.61  ? 489  LYS C C     1 
ATOM   6856  O O     . LYS C 1 181 ? 22.776  -32.954 25.162  1.00 48.37  ? 489  LYS C O     1 
ATOM   6857  C CB    . LYS C 1 181 ? 21.531  -35.491 25.719  1.00 29.41  ? 489  LYS C CB    1 
ATOM   6858  C CG    . LYS C 1 181 ? 21.485  -36.903 26.280  1.00 40.36  ? 489  LYS C CG    1 
ATOM   6859  C CD    . LYS C 1 181 ? 21.127  -37.919 25.217  1.00 50.33  ? 489  LYS C CD    1 
ATOM   6860  C CE    . LYS C 1 181 ? 21.157  -39.326 25.784  1.00 55.57  ? 489  LYS C CE    1 
ATOM   6861  N NZ    . LYS C 1 181 ? 20.603  -40.313 24.816  1.00 66.66  ? 489  LYS C NZ    1 
ATOM   6862  N N     . ASN C 1 182 ? 21.445  -32.042 26.731  1.00 43.34  ? 490  ASN C N     1 
ATOM   6863  C CA    . ASN C 1 182 ? 21.680  -30.660 26.320  1.00 45.60  ? 490  ASN C CA    1 
ATOM   6864  C C     . ASN C 1 182 ? 21.417  -30.388 24.838  1.00 51.76  ? 490  ASN C C     1 
ATOM   6865  O O     . ASN C 1 182 ? 22.187  -29.689 24.180  1.00 59.07  ? 490  ASN C O     1 
ATOM   6866  C CB    . ASN C 1 182 ? 23.101  -30.227 26.692  1.00 57.01  ? 490  ASN C CB    1 
ATOM   6867  C CG    . ASN C 1 182 ? 23.251  -28.720 26.770  1.00 67.81  ? 490  ASN C CG    1 
ATOM   6868  O OD1   . ASN C 1 182 ? 22.755  -28.083 27.700  1.00 73.67  ? 490  ASN C OD1   1 
ATOM   6869  N ND2   . ASN C 1 182 ? 23.945  -28.144 25.797  1.00 67.01  ? 490  ASN C ND2   1 
ATOM   6870  N N     . ARG C 1 183 ? 20.332  -30.948 24.315  1.00 35.51  ? 491  ARG C N     1 
ATOM   6871  C CA    . ARG C 1 183 ? 19.904  -30.657 22.957  1.00 34.76  ? 491  ARG C CA    1 
ATOM   6872  C C     . ARG C 1 183 ? 18.556  -29.943 23.001  1.00 32.13  ? 491  ARG C C     1 
ATOM   6873  O O     . ARG C 1 183 ? 17.756  -30.182 23.899  1.00 31.14  ? 491  ARG C O     1 
ATOM   6874  C CB    . ARG C 1 183 ? 19.804  -31.940 22.131  1.00 46.18  ? 491  ARG C CB    1 
ATOM   6875  C CG    . ARG C 1 183 ? 21.107  -32.730 22.050  1.00 56.28  ? 491  ARG C CG    1 
ATOM   6876  C CD    . ARG C 1 183 ? 21.187  -33.505 20.748  1.00 64.11  ? 491  ARG C CD    1 
ATOM   6877  N NE    . ARG C 1 183 ? 21.142  -32.607 19.598  1.00 72.06  ? 491  ARG C NE    1 
ATOM   6878  C CZ    . ARG C 1 183 ? 20.778  -32.974 18.375  1.00 81.61  ? 491  ARG C CZ    1 
ATOM   6879  N NH1   . ARG C 1 183 ? 20.419  -34.229 18.135  1.00 86.87  ? 491  ARG C NH1   1 
ATOM   6880  N NH2   . ARG C 1 183 ? 20.765  -32.084 17.391  1.00 82.11  ? 491  ARG C NH2   1 
ATOM   6881  N N     . LEU C 1 184 ? 18.307  -29.059 22.041  1.00 30.01  ? 492  LEU C N     1 
ATOM   6882  C CA    . LEU C 1 184 ? 17.070  -28.278 22.047  1.00 30.18  ? 492  LEU C CA    1 
ATOM   6883  C C     . LEU C 1 184 ? 15.844  -29.198 22.050  1.00 30.70  ? 492  LEU C C     1 
ATOM   6884  O O     . LEU C 1 184 ? 15.677  -30.023 21.146  1.00 22.69  ? 492  LEU C O     1 
ATOM   6885  C CB    . LEU C 1 184 ? 17.025  -27.335 20.845  1.00 31.29  ? 492  LEU C CB    1 
ATOM   6886  C CG    . LEU C 1 184 ? 15.855  -26.347 20.828  1.00 26.73  ? 492  LEU C CG    1 
ATOM   6887  C CD1   . LEU C 1 184 ? 16.055  -25.279 21.885  1.00 26.52  ? 492  LEU C CD1   1 
ATOM   6888  C CD2   . LEU C 1 184 ? 15.686  -25.724 19.447  1.00 38.73  ? 492  LEU C CD2   1 
ATOM   6889  N N     . PRO C 1 185 ? 14.985  -29.071 23.076  1.00 25.56  ? 493  PRO C N     1 
ATOM   6890  C CA    . PRO C 1 185 ? 13.839  -29.988 23.153  1.00 20.48  ? 493  PRO C CA    1 
ATOM   6891  C C     . PRO C 1 185 ? 12.953  -29.912 21.918  1.00 20.39  ? 493  PRO C C     1 
ATOM   6892  O O     . PRO C 1 185 ? 12.807  -28.843 21.327  1.00 19.56  ? 493  PRO C O     1 
ATOM   6893  C CB    . PRO C 1 185 ? 13.098  -29.513 24.406  1.00 17.52  ? 493  PRO C CB    1 
ATOM   6894  C CG    . PRO C 1 185 ? 14.199  -28.946 25.281  1.00 18.60  ? 493  PRO C CG    1 
ATOM   6895  C CD    . PRO C 1 185 ? 15.152  -28.279 24.309  1.00 19.12  ? 493  PRO C CD    1 
ATOM   6896  N N     . SER C 1 186 ? 12.367  -31.045 21.532  1.00 22.82  ? 494  SER C N     1 
ATOM   6897  C CA    . SER C 1 186 ? 11.513  -31.105 20.346  1.00 21.31  ? 494  SER C CA    1 
ATOM   6898  C C     . SER C 1 186 ? 10.074  -30.642 20.610  1.00 16.41  ? 494  SER C C     1 
ATOM   6899  O O     . SER C 1 186 ? 9.289   -30.485 19.675  1.00 20.49  ? 494  SER C O     1 
ATOM   6900  C CB    . SER C 1 186 ? 11.518  -32.519 19.752  1.00 19.95  ? 494  SER C CB    1 
ATOM   6901  O OG    . SER C 1 186 ? 12.825  -32.879 19.315  1.00 22.43  ? 494  SER C OG    1 
ATOM   6902  N N     . VAL C 1 187 ? 9.724   -30.455 21.880  1.00 15.33  ? 495  VAL C N     1 
ATOM   6903  C CA    . VAL C 1 187 ? 8.422   -29.886 22.243  1.00 11.07  ? 495  VAL C CA    1 
ATOM   6904  C C     . VAL C 1 187 ? 8.593   -28.373 22.329  1.00 6.76   ? 495  VAL C C     1 
ATOM   6905  O O     . VAL C 1 187 ? 9.451   -27.878 23.057  1.00 13.64  ? 495  VAL C O     1 
ATOM   6906  C CB    . VAL C 1 187 ? 7.927   -30.428 23.589  1.00 19.05  ? 495  VAL C CB    1 
ATOM   6907  C CG1   . VAL C 1 187 ? 6.711   -29.633 24.082  1.00 11.86  ? 495  VAL C CG1   1 
ATOM   6908  C CG2   . VAL C 1 187 ? 7.595   -31.913 23.464  1.00 12.31  ? 495  VAL C CG2   1 
ATOM   6909  N N     . HIS C 1 188 ? 7.780   -27.642 21.576  1.00 12.94  ? 496  HIS C N     1 
ATOM   6910  C CA    . HIS C 1 188 ? 7.893   -26.196 21.549  1.00 15.29  ? 496  HIS C CA    1 
ATOM   6911  C C     . HIS C 1 188 ? 7.345   -25.613 22.858  1.00 15.49  ? 496  HIS C C     1 
ATOM   6912  O O     . HIS C 1 188 ? 6.336   -26.094 23.381  1.00 13.75  ? 496  HIS C O     1 
ATOM   6913  C CB    . HIS C 1 188 ? 7.148   -25.658 20.337  1.00 12.85  ? 496  HIS C CB    1 
ATOM   6914  C CG    . HIS C 1 188 ? 7.379   -24.201 20.085  1.00 10.39  ? 496  HIS C CG    1 
ATOM   6915  N ND1   . HIS C 1 188 ? 6.846   -23.216 20.884  1.00 13.56  ? 496  HIS C ND1   1 
ATOM   6916  C CD2   . HIS C 1 188 ? 8.076   -23.563 19.113  1.00 12.42  ? 496  HIS C CD2   1 
ATOM   6917  C CE1   . HIS C 1 188 ? 7.208   -22.031 20.423  1.00 13.88  ? 496  HIS C CE1   1 
ATOM   6918  N NE2   . HIS C 1 188 ? 7.955   -22.214 19.347  1.00 17.00  ? 496  HIS C NE2   1 
ATOM   6919  N N     . PRO C 1 189 ? 8.016   -24.582 23.403  1.00 12.35  ? 497  PRO C N     1 
ATOM   6920  C CA    . PRO C 1 189 ? 7.593   -24.035 24.697  1.00 12.39  ? 497  PRO C CA    1 
ATOM   6921  C C     . PRO C 1 189 ? 6.139   -23.562 24.682  1.00 14.09  ? 497  PRO C C     1 
ATOM   6922  O O     . PRO C 1 189 ? 5.467   -23.627 25.700  1.00 13.71  ? 497  PRO C O     1 
ATOM   6923  C CB    . PRO C 1 189 ? 8.544   -22.848 24.919  1.00 18.54  ? 497  PRO C CB    1 
ATOM   6924  C CG    . PRO C 1 189 ? 9.190   -22.583 23.571  1.00 18.61  ? 497  PRO C CG    1 
ATOM   6925  C CD    . PRO C 1 189 ? 9.218   -23.912 22.877  1.00 18.89  ? 497  PRO C CD    1 
ATOM   6926  N N     . HIS C 1 190 ? 5.653   -23.097 23.537  1.00 13.38  ? 498  HIS C N     1 
ATOM   6927  C CA    . HIS C 1 190 ? 4.273   -22.628 23.467  1.00 9.56   ? 498  HIS C CA    1 
ATOM   6928  C C     . HIS C 1 190 ? 3.279   -23.784 23.553  1.00 18.46  ? 498  HIS C C     1 
ATOM   6929  O O     . HIS C 1 190 ? 2.090   -23.568 23.788  1.00 17.92  ? 498  HIS C O     1 
ATOM   6930  C CB    . HIS C 1 190 ? 4.052   -21.842 22.180  1.00 11.69  ? 498  HIS C CB    1 
ATOM   6931  C CG    . HIS C 1 190 ? 2.738   -21.132 22.122  1.00 22.98  ? 498  HIS C CG    1 
ATOM   6932  N ND1   . HIS C 1 190 ? 2.267   -20.352 23.157  1.00 21.37  ? 498  HIS C ND1   1 
ATOM   6933  C CD2   . HIS C 1 190 ? 1.802   -21.067 21.145  1.00 26.10  ? 498  HIS C CD2   1 
ATOM   6934  C CE1   . HIS C 1 190 ? 1.092   -19.845 22.823  1.00 30.43  ? 498  HIS C CE1   1 
ATOM   6935  N NE2   . HIS C 1 190 ? 0.788   -20.262 21.607  1.00 25.77  ? 498  HIS C NE2   1 
ATOM   6936  N N     . HIS C 1 191 ? 3.769   -25.010 23.370  1.00 14.34  ? 499  HIS C N     1 
ATOM   6937  C CA    . HIS C 1 191 ? 2.908   -26.181 23.404  1.00 6.56   ? 499  HIS C CA    1 
ATOM   6938  C C     . HIS C 1 191 ? 3.057   -26.960 24.704  1.00 14.05  ? 499  HIS C C     1 
ATOM   6939  O O     . HIS C 1 191 ? 2.317   -27.908 24.939  1.00 14.88  ? 499  HIS C O     1 
ATOM   6940  C CB    . HIS C 1 191 ? 3.237   -27.132 22.231  1.00 9.64   ? 499  HIS C CB    1 
ATOM   6941  C CG    . HIS C 1 191 ? 3.083   -26.508 20.878  1.00 12.53  ? 499  HIS C CG    1 
ATOM   6942  N ND1   . HIS C 1 191 ? 3.766   -26.964 19.769  1.00 12.53  ? 499  HIS C ND1   1 
ATOM   6943  C CD2   . HIS C 1 191 ? 2.321   -25.472 20.451  1.00 17.33  ? 499  HIS C CD2   1 
ATOM   6944  C CE1   . HIS C 1 191 ? 3.439   -26.228 18.721  1.00 15.68  ? 499  HIS C CE1   1 
ATOM   6945  N NE2   . HIS C 1 191 ? 2.559   -25.322 19.106  1.00 15.13  ? 499  HIS C NE2   1 
ATOM   6946  N N     . SER C 1 192 ? 4.021   -26.577 25.540  1.00 12.81  ? 500  SER C N     1 
ATOM   6947  C CA    . SER C 1 192 ? 4.407   -27.425 26.673  1.00 9.24   ? 500  SER C CA    1 
ATOM   6948  C C     . SER C 1 192 ? 3.305   -27.547 27.729  1.00 12.72  ? 500  SER C C     1 
ATOM   6949  O O     . SER C 1 192 ? 3.259   -28.520 28.493  1.00 11.55  ? 500  SER C O     1 
ATOM   6950  C CB    . SER C 1 192 ? 5.722   -26.942 27.300  1.00 16.15  ? 500  SER C CB    1 
ATOM   6951  O OG    . SER C 1 192 ? 5.555   -25.709 27.975  1.00 18.93  ? 500  SER C OG    1 
ATOM   6952  N N     . MET C 1 193 ? 2.390   -26.581 27.753  1.00 15.08  ? 501  MET C N     1 
ATOM   6953  C CA    . MET C 1 193 ? 1.280   -26.664 28.697  1.00 24.06  ? 501  MET C CA    1 
ATOM   6954  C C     . MET C 1 193 ? 0.299   -27.776 28.332  1.00 22.63  ? 501  MET C C     1 
ATOM   6955  O O     . MET C 1 193 ? -0.558  -28.132 29.136  1.00 16.95  ? 501  MET C O     1 
ATOM   6956  C CB    . MET C 1 193 ? 0.522   -25.341 28.770  1.00 20.11  ? 501  MET C CB    1 
ATOM   6957  C CG    . MET C 1 193 ? -0.477  -25.171 27.652  1.00 22.27  ? 501  MET C CG    1 
ATOM   6958  S SD    . MET C 1 193 ? 0.347   -24.682 26.126  1.00 21.27  ? 501  MET C SD    1 
ATOM   6959  C CE    . MET C 1 193 ? 0.490   -22.908 26.472  1.00 17.76  ? 501  MET C CE    1 
ATOM   6960  N N     . LEU C 1 194 ? 0.410   -28.319 27.121  1.00 12.39  ? 502  LEU C N     1 
ATOM   6961  C CA    . LEU C 1 194 ? -0.555  -29.324 26.658  1.00 6.53   ? 502  LEU C CA    1 
ATOM   6962  C C     . LEU C 1 194 ? -0.256  -30.752 27.122  1.00 11.61  ? 502  LEU C C     1 
ATOM   6963  O O     . LEU C 1 194 ? -1.109  -31.635 27.015  1.00 14.04  ? 502  LEU C O     1 
ATOM   6964  C CB    . LEU C 1 194 ? -0.647  -29.311 25.129  1.00 13.66  ? 502  LEU C CB    1 
ATOM   6965  C CG    . LEU C 1 194 ? -1.046  -27.970 24.494  1.00 16.09  ? 502  LEU C CG    1 
ATOM   6966  C CD1   . LEU C 1 194 ? -0.960  -28.055 22.977  1.00 14.70  ? 502  LEU C CD1   1 
ATOM   6967  C CD2   . LEU C 1 194 ? -2.434  -27.541 24.928  1.00 12.21  ? 502  LEU C CD2   1 
ATOM   6968  N N     . TYR C 1 195 ? 0.951   -30.971 27.632  1.00 10.10  ? 503  TYR C N     1 
ATOM   6969  C CA    . TYR C 1 195 ? 1.438   -32.307 27.946  1.00 13.20  ? 503  TYR C CA    1 
ATOM   6970  C C     . TYR C 1 195 ? 1.853   -32.320 29.413  1.00 15.69  ? 503  TYR C C     1 
ATOM   6971  O O     . TYR C 1 195 ? 2.209   -31.274 29.956  1.00 17.64  ? 503  TYR C O     1 
ATOM   6972  C CB    . TYR C 1 195 ? 2.666   -32.618 27.076  1.00 13.82  ? 503  TYR C CB    1 
ATOM   6973  C CG    . TYR C 1 195 ? 2.469   -32.370 25.588  1.00 14.78  ? 503  TYR C CG    1 
ATOM   6974  C CD1   . TYR C 1 195 ? 1.294   -32.740 24.936  1.00 12.30  ? 503  TYR C CD1   1 
ATOM   6975  C CD2   . TYR C 1 195 ? 3.462   -31.757 24.838  1.00 18.42  ? 503  TYR C CD2   1 
ATOM   6976  C CE1   . TYR C 1 195 ? 1.126   -32.507 23.567  1.00 16.10  ? 503  TYR C CE1   1 
ATOM   6977  C CE2   . TYR C 1 195 ? 3.300   -31.521 23.478  1.00 13.05  ? 503  TYR C CE2   1 
ATOM   6978  C CZ    . TYR C 1 195 ? 2.140   -31.899 22.849  1.00 18.86  ? 503  TYR C CZ    1 
ATOM   6979  O OH    . TYR C 1 195 ? 2.011   -31.659 21.493  1.00 13.54  ? 503  TYR C OH    1 
ATOM   6980  N N     . PRO C 1 196 ? 1.820   -33.498 30.059  1.00 17.19  ? 504  PRO C N     1 
ATOM   6981  C CA    . PRO C 1 196 ? 2.027   -33.535 31.518  1.00 16.27  ? 504  PRO C CA    1 
ATOM   6982  C C     . PRO C 1 196 ? 3.498   -33.477 31.907  1.00 20.10  ? 504  PRO C C     1 
ATOM   6983  O O     . PRO C 1 196 ? 3.992   -34.351 32.621  1.00 16.04  ? 504  PRO C O     1 
ATOM   6984  C CB    . PRO C 1 196 ? 1.412   -34.879 31.916  1.00 23.00  ? 504  PRO C CB    1 
ATOM   6985  C CG    . PRO C 1 196 ? 1.595   -35.730 30.704  1.00 20.67  ? 504  PRO C CG    1 
ATOM   6986  C CD    . PRO C 1 196 ? 1.392   -34.805 29.531  1.00 16.95  ? 504  PRO C CD    1 
ATOM   6987  N N     . LEU C 1 197 ? 4.186   -32.454 31.411  1.00 20.68  ? 505  LEU C N     1 
ATOM   6988  C CA    . LEU C 1 197 ? 5.566   -32.175 31.785  1.00 17.07  ? 505  LEU C CA    1 
ATOM   6989  C C     . LEU C 1 197 ? 5.567   -31.486 33.153  1.00 19.00  ? 505  LEU C C     1 
ATOM   6990  O O     . LEU C 1 197 ? 4.607   -30.803 33.515  1.00 21.88  ? 505  LEU C O     1 
ATOM   6991  C CB    . LEU C 1 197 ? 6.221   -31.251 30.738  1.00 15.35  ? 505  LEU C CB    1 
ATOM   6992  C CG    . LEU C 1 197 ? 6.291   -31.752 29.292  1.00 16.08  ? 505  LEU C CG    1 
ATOM   6993  C CD1   . LEU C 1 197 ? 6.455   -30.599 28.301  1.00 15.41  ? 505  LEU C CD1   1 
ATOM   6994  C CD2   . LEU C 1 197 ? 7.410   -32.762 29.139  1.00 18.46  ? 505  LEU C CD2   1 
ATOM   6995  N N     . SER C 1 198 ? 6.636   -31.660 33.917  1.00 22.82  ? 506  SER C N     1 
ATOM   6996  C CA    . SER C 1 198 ? 6.754   -30.940 35.176  1.00 25.88  ? 506  SER C CA    1 
ATOM   6997  C C     . SER C 1 198 ? 6.907   -29.447 34.880  1.00 24.39  ? 506  SER C C     1 
ATOM   6998  O O     . SER C 1 198 ? 7.294   -29.067 33.777  1.00 16.43  ? 506  SER C O     1 
ATOM   6999  C CB    . SER C 1 198 ? 7.957   -31.451 35.966  1.00 19.04  ? 506  SER C CB    1 
ATOM   7000  O OG    . SER C 1 198 ? 9.141   -31.312 35.199  1.00 20.33  ? 506  SER C OG    1 
ATOM   7001  N N     . HIS C 1 199 ? 6.588   -28.600 35.853  1.00 18.97  ? 507  HIS C N     1 
ATOM   7002  C CA    . HIS C 1 199 ? 6.821   -27.166 35.708  1.00 22.65  ? 507  HIS C CA    1 
ATOM   7003  C C     . HIS C 1 199 ? 8.300   -26.895 35.474  1.00 23.09  ? 507  HIS C C     1 
ATOM   7004  O O     . HIS C 1 199 ? 8.664   -25.970 34.749  1.00 19.48  ? 507  HIS C O     1 
ATOM   7005  C CB    . HIS C 1 199 ? 6.326   -26.412 36.946  1.00 22.24  ? 507  HIS C CB    1 
ATOM   7006  C CG    . HIS C 1 199 ? 4.874   -26.628 37.231  1.00 26.07  ? 507  HIS C CG    1 
ATOM   7007  N ND1   . HIS C 1 199 ? 3.890   -26.371 36.300  1.00 31.84  ? 507  HIS C ND1   1 
ATOM   7008  C CD2   . HIS C 1 199 ? 4.241   -27.106 38.328  1.00 27.77  ? 507  HIS C CD2   1 
ATOM   7009  C CE1   . HIS C 1 199 ? 2.710   -26.666 36.818  1.00 34.56  ? 507  HIS C CE1   1 
ATOM   7010  N NE2   . HIS C 1 199 ? 2.895   -27.112 38.047  1.00 30.58  ? 507  HIS C NE2   1 
ATOM   7011  N N     . GLY C 1 200 ? 9.149   -27.710 36.094  1.00 21.93  ? 508  GLY C N     1 
ATOM   7012  C CA    . GLY C 1 200 ? 10.583  -27.584 35.928  1.00 20.49  ? 508  GLY C CA    1 
ATOM   7013  C C     . GLY C 1 200 ? 10.988  -27.817 34.485  1.00 23.69  ? 508  GLY C C     1 
ATOM   7014  O O     . GLY C 1 200 ? 11.779  -27.055 33.926  1.00 21.96  ? 508  GLY C O     1 
ATOM   7015  N N     . PHE C 1 201 ? 10.445  -28.870 33.878  1.00 14.06  ? 509  PHE C N     1 
ATOM   7016  C CA    . PHE C 1 201 ? 10.719  -29.169 32.468  1.00 17.49  ? 509  PHE C CA    1 
ATOM   7017  C C     . PHE C 1 201 ? 10.179  -28.066 31.557  1.00 13.90  ? 509  PHE C C     1 
ATOM   7018  O O     . PHE C 1 201 ? 10.828  -27.668 30.587  1.00 17.00  ? 509  PHE C O     1 
ATOM   7019  C CB    . PHE C 1 201 ? 10.078  -30.493 32.049  1.00 13.45  ? 509  PHE C CB    1 
ATOM   7020  C CG    . PHE C 1 201 ? 10.896  -31.699 32.373  1.00 26.82  ? 509  PHE C CG    1 
ATOM   7021  C CD1   . PHE C 1 201 ? 11.971  -31.615 33.232  1.00 25.85  ? 509  PHE C CD1   1 
ATOM   7022  C CD2   . PHE C 1 201 ? 10.599  -32.922 31.788  1.00 40.93  ? 509  PHE C CD2   1 
ATOM   7023  C CE1   . PHE C 1 201 ? 12.726  -32.738 33.522  1.00 32.23  ? 509  PHE C CE1   1 
ATOM   7024  C CE2   . PHE C 1 201 ? 11.351  -34.041 32.065  1.00 36.95  ? 509  PHE C CE2   1 
ATOM   7025  C CZ    . PHE C 1 201 ? 12.416  -33.949 32.936  1.00 36.64  ? 509  PHE C CZ    1 
ATOM   7026  N N     . ARG C 1 202 ? 8.981   -27.584 31.863  1.00 14.54  ? 510  ARG C N     1 
ATOM   7027  C CA    . ARG C 1 202 ? 8.384   -26.532 31.050  1.00 18.46  ? 510  ARG C CA    1 
ATOM   7028  C C     . ARG C 1 202 ? 9.246   -25.275 31.084  1.00 12.83  ? 510  ARG C C     1 
ATOM   7029  O O     . ARG C 1 202 ? 9.504   -24.673 30.048  1.00 12.59  ? 510  ARG C O     1 
ATOM   7030  C CB    . ARG C 1 202 ? 6.946   -26.233 31.484  1.00 21.71  ? 510  ARG C CB    1 
ATOM   7031  C CG    . ARG C 1 202 ? 5.980   -27.404 31.276  1.00 19.97  ? 510  ARG C CG    1 
ATOM   7032  C CD    . ARG C 1 202 ? 4.530   -26.924 31.234  1.00 23.98  ? 510  ARG C CD    1 
ATOM   7033  N NE    . ARG C 1 202 ? 3.563   -28.020 31.287  1.00 20.35  ? 510  ARG C NE    1 
ATOM   7034  C CZ    . ARG C 1 202 ? 2.961   -28.429 32.396  1.00 21.48  ? 510  ARG C CZ    1 
ATOM   7035  N NH1   . ARG C 1 202 ? 3.239   -27.846 33.554  1.00 17.86  ? 510  ARG C NH1   1 
ATOM   7036  N NH2   . ARG C 1 202 ? 2.086   -29.423 32.350  1.00 21.49  ? 510  ARG C NH2   1 
ATOM   7037  N N     . LYS C 1 203 ? 9.709   -24.894 32.270  1.00 18.47  ? 511  LYS C N     1 
ATOM   7038  C CA    . LYS C 1 203 ? 10.590  -23.736 32.377  1.00 24.97  ? 511  LYS C CA    1 
ATOM   7039  C C     . LYS C 1 203 ? 11.909  -23.976 31.634  1.00 17.51  ? 511  LYS C C     1 
ATOM   7040  O O     . LYS C 1 203 ? 12.432  -23.080 30.963  1.00 16.59  ? 511  LYS C O     1 
ATOM   7041  C CB    . LYS C 1 203 ? 10.850  -23.378 33.844  1.00 19.66  ? 511  LYS C CB    1 
ATOM   7042  C CG    . LYS C 1 203 ? 11.681  -22.106 34.029  1.00 18.81  ? 511  LYS C CG    1 
ATOM   7043  C CD    . LYS C 1 203 ? 11.620  -21.575 35.475  1.00 18.46  ? 511  LYS C CD    1 
ATOM   7044  C CE    . LYS C 1 203 ? 12.219  -22.545 36.466  1.00 24.91  ? 511  LYS C CE    1 
ATOM   7045  N NZ    . LYS C 1 203 ? 12.364  -21.932 37.827  1.00 30.40  ? 511  LYS C NZ    1 
ATOM   7046  N N     . ALA C 1 204 ? 12.445  -25.191 31.745  1.00 14.66  ? 512  ALA C N     1 
ATOM   7047  C CA    . ALA C 1 204 ? 13.719  -25.519 31.114  1.00 16.85  ? 512  ALA C CA    1 
ATOM   7048  C C     . ALA C 1 204 ? 13.640  -25.493 29.592  1.00 16.79  ? 512  ALA C C     1 
ATOM   7049  O O     . ALA C 1 204 ? 14.593  -25.092 28.919  1.00 13.47  ? 512  ALA C O     1 
ATOM   7050  C CB    . ALA C 1 204 ? 14.213  -26.887 31.598  1.00 16.90  ? 512  ALA C CB    1 
ATOM   7051  N N     . ILE C 1 205 ? 12.525  -25.955 29.039  1.00 16.46  ? 513  ILE C N     1 
ATOM   7052  C CA    . ILE C 1 205 ? 12.320  -25.848 27.595  1.00 14.66  ? 513  ILE C CA    1 
ATOM   7053  C C     . ILE C 1 205 ? 12.362  -24.380 27.177  1.00 15.80  ? 513  ILE C C     1 
ATOM   7054  O O     . ILE C 1 205 ? 13.041  -24.020 26.214  1.00 14.93  ? 513  ILE C O     1 
ATOM   7055  C CB    . ILE C 1 205 ? 10.976  -26.447 27.156  1.00 14.86  ? 513  ILE C CB    1 
ATOM   7056  C CG1   . ILE C 1 205 ? 10.988  -27.965 27.353  1.00 14.20  ? 513  ILE C CG1   1 
ATOM   7057  C CG2   . ILE C 1 205 ? 10.689  -26.091 25.681  1.00 11.27  ? 513  ILE C CG2   1 
ATOM   7058  C CD1   . ILE C 1 205 ? 9.592   -28.596 27.398  1.00 16.54  ? 513  ILE C CD1   1 
ATOM   7059  N N     . ALA C 1 206 ? 11.631  -23.540 27.907  1.00 12.66  ? 514  ALA C N     1 
ATOM   7060  C CA    . ALA C 1 206 ? 11.599  -22.109 27.616  1.00 16.72  ? 514  ALA C CA    1 
ATOM   7061  C C     . ALA C 1 206 ? 13.004  -21.525 27.668  1.00 15.58  ? 514  ALA C C     1 
ATOM   7062  O O     . ALA C 1 206 ? 13.410  -20.789 26.773  1.00 18.60  ? 514  ALA C O     1 
ATOM   7063  C CB    . ALA C 1 206 ? 10.667  -21.373 28.588  1.00 14.35  ? 514  ALA C CB    1 
ATOM   7064  N N     . GLU C 1 207 ? 13.743  -21.861 28.718  1.00 14.86  ? 515  GLU C N     1 
ATOM   7065  C CA    A GLU C 1 207 ? 15.107  -21.364 28.892  0.50 20.15  ? 515  GLU C CA    1 
ATOM   7066  C CA    B GLU C 1 207 ? 15.102  -21.354 28.885  0.50 20.04  ? 515  GLU C CA    1 
ATOM   7067  C C     . GLU C 1 207 ? 16.005  -21.743 27.716  1.00 15.67  ? 515  GLU C C     1 
ATOM   7068  O O     . GLU C 1 207 ? 16.896  -20.981 27.330  1.00 19.77  ? 515  GLU C O     1 
ATOM   7069  C CB    A GLU C 1 207 ? 15.708  -21.892 30.199  0.50 23.86  ? 515  GLU C CB    1 
ATOM   7070  C CB    B GLU C 1 207 ? 15.713  -21.849 30.198  0.50 23.99  ? 515  GLU C CB    1 
ATOM   7071  C CG    A GLU C 1 207 ? 17.041  -21.258 30.579  0.50 29.10  ? 515  GLU C CG    1 
ATOM   7072  C CG    B GLU C 1 207 ? 17.144  -21.379 30.420  0.50 27.10  ? 515  GLU C CG    1 
ATOM   7073  C CD    A GLU C 1 207 ? 18.237  -21.931 29.931  0.50 36.73  ? 515  GLU C CD    1 
ATOM   7074  C CD    B GLU C 1 207 ? 17.745  -21.927 31.700  0.50 36.11  ? 515  GLU C CD    1 
ATOM   7075  O OE1   A GLU C 1 207 ? 18.056  -22.953 29.234  0.50 35.39  ? 515  GLU C OE1   1 
ATOM   7076  O OE1   B GLU C 1 207 ? 17.365  -23.048 32.101  0.50 39.12  ? 515  GLU C OE1   1 
ATOM   7077  O OE2   A GLU C 1 207 ? 19.365  -21.435 30.127  0.50 48.57  ? 515  GLU C OE2   1 
ATOM   7078  O OE2   B GLU C 1 207 ? 18.593  -21.236 32.304  0.50 44.72  ? 515  GLU C OE2   1 
ATOM   7079  N N     . ARG C 1 208 ? 15.785  -22.931 27.153  1.00 14.59  ? 516  ARG C N     1 
ATOM   7080  C CA    . ARG C 1 208 ? 16.605  -23.364 26.014  1.00 20.36  ? 516  ARG C CA    1 
ATOM   7081  C C     . ARG C 1 208 ? 16.335  -22.469 24.810  1.00 24.49  ? 516  ARG C C     1 
ATOM   7082  O O     . ARG C 1 208 ? 17.233  -22.172 24.021  1.00 19.77  ? 516  ARG C O     1 
ATOM   7083  C CB    . ARG C 1 208 ? 16.352  -24.829 25.654  1.00 20.86  ? 516  ARG C CB    1 
ATOM   7084  C CG    . ARG C 1 208 ? 16.804  -25.828 26.710  1.00 28.18  ? 516  ARG C CG    1 
ATOM   7085  C CD    . ARG C 1 208 ? 18.294  -25.708 26.974  1.00 40.91  ? 516  ARG C CD    1 
ATOM   7086  N NE    . ARG C 1 208 ? 18.760  -26.691 27.948  1.00 58.88  ? 516  ARG C NE    1 
ATOM   7087  C CZ    . ARG C 1 208 ? 19.233  -27.892 27.629  1.00 66.78  ? 516  ARG C CZ    1 
ATOM   7088  N NH1   . ARG C 1 208 ? 19.300  -28.263 26.356  1.00 73.18  ? 516  ARG C NH1   1 
ATOM   7089  N NH2   . ARG C 1 208 ? 19.639  -28.725 28.581  1.00 48.55  ? 516  ARG C NH2   1 
ATOM   7090  N N     . HIS C 1 209 ? 15.089  -22.041 24.662  1.00 19.55  ? 517  HIS C N     1 
ATOM   7091  C CA    . HIS C 1 209 ? 14.742  -21.120 23.587  1.00 27.47  ? 517  HIS C CA    1 
ATOM   7092  C C     . HIS C 1 209 ? 15.294  -19.726 23.826  1.00 25.69  ? 517  HIS C C     1 
ATOM   7093  O O     . HIS C 1 209 ? 15.736  -19.064 22.895  1.00 31.55  ? 517  HIS C O     1 
ATOM   7094  C CB    . HIS C 1 209 ? 13.232  -21.081 23.376  1.00 23.83  ? 517  HIS C CB    1 
ATOM   7095  C CG    . HIS C 1 209 ? 12.719  -22.254 22.609  1.00 18.24  ? 517  HIS C CG    1 
ATOM   7096  N ND1   . HIS C 1 209 ? 12.277  -22.153 21.307  1.00 27.52  ? 517  HIS C ND1   1 
ATOM   7097  C CD2   . HIS C 1 209 ? 12.614  -23.560 22.945  1.00 19.19  ? 517  HIS C CD2   1 
ATOM   7098  C CE1   . HIS C 1 209 ? 11.907  -23.347 20.880  1.00 23.66  ? 517  HIS C CE1   1 
ATOM   7099  N NE2   . HIS C 1 209 ? 12.106  -24.219 21.853  1.00 24.22  ? 517  HIS C NE2   1 
ATOM   7100  N N     . GLY C 1 210 ? 15.270  -19.286 25.077  1.00 19.85  ? 518  GLY C N     1 
ATOM   7101  C CA    . GLY C 1 210 ? 15.891  -18.030 25.439  1.00 19.77  ? 518  GLY C CA    1 
ATOM   7102  C C     . GLY C 1 210 ? 17.360  -18.056 25.059  1.00 26.33  ? 518  GLY C C     1 
ATOM   7103  O O     . GLY C 1 210 ? 17.873  -17.099 24.480  1.00 25.35  ? 518  GLY C O     1 
ATOM   7104  N N     . ASN C 1 211 ? 18.034  -19.162 25.368  1.00 24.05  ? 519  ASN C N     1 
ATOM   7105  C CA    . ASN C 1 211 ? 19.461  -19.310 25.062  1.00 15.79  ? 519  ASN C CA    1 
ATOM   7106  C C     . ASN C 1 211 ? 19.773  -19.249 23.570  1.00 20.36  ? 519  ASN C C     1 
ATOM   7107  O O     . ASN C 1 211 ? 20.850  -18.805 23.178  1.00 28.12  ? 519  ASN C O     1 
ATOM   7108  C CB    . ASN C 1 211 ? 20.010  -20.625 25.637  1.00 31.40  ? 519  ASN C CB    1 
ATOM   7109  C CG    . ASN C 1 211 ? 20.119  -20.607 27.152  1.00 57.74  ? 519  ASN C CG    1 
ATOM   7110  O OD1   . ASN C 1 211 ? 20.055  -19.548 27.784  1.00 58.82  ? 519  ASN C OD1   1 
ATOM   7111  N ND2   . ASN C 1 211 ? 20.299  -21.785 27.743  1.00 66.70  ? 519  ASN C ND2   1 
ATOM   7112  N N     . LEU C 1 212 ? 18.843  -19.718 22.744  1.00 26.48  ? 520  LEU C N     1 
ATOM   7113  C CA    . LEU C 1 212 ? 18.991  -19.611 21.298  1.00 27.60  ? 520  LEU C CA    1 
ATOM   7114  C C     . LEU C 1 212 ? 19.127  -18.151 20.892  1.00 34.33  ? 520  LEU C C     1 
ATOM   7115  O O     . LEU C 1 212 ? 19.945  -17.805 20.042  1.00 27.67  ? 520  LEU C O     1 
ATOM   7116  C CB    . LEU C 1 212 ? 17.792  -20.226 20.578  1.00 31.55  ? 520  LEU C CB    1 
ATOM   7117  C CG    . LEU C 1 212 ? 17.674  -21.748 20.533  1.00 38.85  ? 520  LEU C CG    1 
ATOM   7118  C CD1   . LEU C 1 212 ? 16.382  -22.143 19.832  1.00 36.48  ? 520  LEU C CD1   1 
ATOM   7119  C CD2   . LEU C 1 212 ? 18.880  -22.356 19.831  1.00 48.19  ? 520  LEU C CD2   1 
ATOM   7120  N N     . CYS C 1 213 ? 18.307  -17.296 21.497  1.00 26.76  ? 521  CYS C N     1 
ATOM   7121  C CA    . CYS C 1 213 ? 18.346  -15.870 21.205  1.00 25.41  ? 521  CYS C CA    1 
ATOM   7122  C C     . CYS C 1 213 ? 19.664  -15.250 21.649  1.00 27.89  ? 521  CYS C C     1 
ATOM   7123  O O     . CYS C 1 213 ? 20.244  -14.440 20.926  1.00 28.84  ? 521  CYS C O     1 
ATOM   7124  C CB    . CYS C 1 213 ? 17.174  -15.152 21.878  1.00 26.87  ? 521  CYS C CB    1 
ATOM   7125  S SG    . CYS C 1 213 ? 15.567  -15.730 21.311  1.00 31.42  ? 521  CYS C SG    1 
ATOM   7126  N N     . LEU C 1 214 ? 20.126  -15.624 22.839  1.00 25.52  ? 522  LEU C N     1 
ATOM   7127  C CA    . LEU C 1 214 ? 21.406  -15.131 23.355  1.00 32.16  ? 522  LEU C CA    1 
ATOM   7128  C C     . LEU C 1 214 ? 22.568  -15.517 22.443  1.00 33.51  ? 522  LEU C C     1 
ATOM   7129  O O     . LEU C 1 214 ? 23.435  -14.694 22.134  1.00 32.20  ? 522  LEU C O     1 
ATOM   7130  C CB    . LEU C 1 214 ? 21.659  -15.649 24.773  1.00 30.49  ? 522  LEU C CB    1 
ATOM   7131  C CG    . LEU C 1 214 ? 20.957  -14.892 25.899  1.00 37.66  ? 522  LEU C CG    1 
ATOM   7132  C CD1   . LEU C 1 214 ? 20.934  -15.716 27.179  1.00 47.16  ? 522  LEU C CD1   1 
ATOM   7133  C CD2   . LEU C 1 214 ? 21.622  -13.543 26.129  1.00 32.27  ? 522  LEU C CD2   1 
ATOM   7134  N N     . ASP C 1 215 ? 22.582  -16.775 22.016  1.00 33.74  ? 523  ASP C N     1 
ATOM   7135  C CA    . ASP C 1 215 ? 23.606  -17.256 21.101  1.00 39.39  ? 523  ASP C CA    1 
ATOM   7136  C C     . ASP C 1 215 ? 23.628  -16.423 19.830  1.00 34.02  ? 523  ASP C C     1 
ATOM   7137  O O     . ASP C 1 215 ? 24.691  -16.025 19.359  1.00 37.11  ? 523  ASP C O     1 
ATOM   7138  C CB    . ASP C 1 215 ? 23.379  -18.729 20.754  1.00 38.38  ? 523  ASP C CB    1 
ATOM   7139  C CG    . ASP C 1 215 ? 23.733  -19.660 21.899  1.00 41.87  ? 523  ASP C CG    1 
ATOM   7140  O OD1   . ASP C 1 215 ? 23.421  -20.863 21.793  1.00 40.77  ? 523  ASP C OD1   1 
ATOM   7141  O OD2   . ASP C 1 215 ? 24.318  -19.190 22.904  1.00 38.11  ? 523  ASP C OD2   1 
ATOM   7142  N N     . LYS C 1 216 ? 22.448  -16.158 19.280  1.00 26.46  ? 524  LYS C N     1 
ATOM   7143  C CA    . LYS C 1 216 ? 22.338  -15.388 18.047  1.00 27.30  ? 524  LYS C CA    1 
ATOM   7144  C C     . LYS C 1 216 ? 22.903  -13.977 18.188  1.00 36.93  ? 524  LYS C C     1 
ATOM   7145  O O     . LYS C 1 216 ? 23.564  -13.485 17.275  1.00 43.91  ? 524  LYS C O     1 
ATOM   7146  C CB    . LYS C 1 216 ? 20.886  -15.323 17.560  1.00 38.29  ? 524  LYS C CB    1 
ATOM   7147  C CG    . LYS C 1 216 ? 20.345  -16.623 16.973  1.00 49.27  ? 524  LYS C CG    1 
ATOM   7148  C CD    . LYS C 1 216 ? 19.040  -16.374 16.225  1.00 59.05  ? 524  LYS C CD    1 
ATOM   7149  C CE    . LYS C 1 216 ? 18.450  -17.659 15.652  1.00 62.13  ? 524  LYS C CE    1 
ATOM   7150  N NZ    . LYS C 1 216 ? 17.717  -18.474 16.666  1.00 49.39  ? 524  LYS C NZ    1 
ATOM   7151  N N     . ILE C 1 217 ? 22.645  -13.325 19.320  1.00 24.36  ? 525  ILE C N     1 
ATOM   7152  C CA    . ILE C 1 217 ? 23.092  -11.943 19.495  1.00 21.99  ? 525  ILE C CA    1 
ATOM   7153  C C     . ILE C 1 217 ? 24.542  -11.817 19.973  1.00 35.73  ? 525  ILE C C     1 
ATOM   7154  O O     . ILE C 1 217 ? 25.173  -10.766 19.802  1.00 29.88  ? 525  ILE C O     1 
ATOM   7155  C CB    . ILE C 1 217 ? 22.139  -11.114 20.390  1.00 27.18  ? 525  ILE C CB    1 
ATOM   7156  C CG1   . ILE C 1 217 ? 22.123  -11.645 21.825  1.00 30.84  ? 525  ILE C CG1   1 
ATOM   7157  C CG2   . ILE C 1 217 ? 20.735  -11.096 19.791  1.00 26.66  ? 525  ILE C CG2   1 
ATOM   7158  C CD1   . ILE C 1 217 ? 22.710  -10.696 22.841  1.00 34.41  ? 525  ILE C CD1   1 
ATOM   7159  N N     . ASN C 1 218 ? 25.075  -12.890 20.552  1.00 29.31  ? 526  ASN C N     1 
ATOM   7160  C CA    . ASN C 1 218 ? 26.455  -12.875 21.035  1.00 34.45  ? 526  ASN C CA    1 
ATOM   7161  C C     . ASN C 1 218 ? 27.463  -12.668 19.906  1.00 41.90  ? 526  ASN C C     1 
ATOM   7162  O O     . ASN C 1 218 ? 28.539  -12.102 20.120  1.00 47.68  ? 526  ASN C O     1 
ATOM   7163  C CB    . ASN C 1 218 ? 26.778  -14.152 21.819  1.00 45.72  ? 526  ASN C CB    1 
ATOM   7164  C CG    . ASN C 1 218 ? 26.096  -14.192 23.174  1.00 62.28  ? 526  ASN C CG    1 
ATOM   7165  O OD1   . ASN C 1 218 ? 25.747  -13.155 23.740  1.00 57.24  ? 526  ASN C OD1   1 
ATOM   7166  N ND2   . ASN C 1 218 ? 25.904  -15.395 23.703  1.00 71.67  ? 526  ASN C ND2   1 
ATOM   7167  N N     . VAL C 1 219 ? 27.108  -13.120 18.705  1.00 31.94  ? 527  VAL C N     1 
ATOM   7168  C CA    . VAL C 1 219 ? 27.986  -12.990 17.542  1.00 40.14  ? 527  VAL C CA    1 
ATOM   7169  C C     . VAL C 1 219 ? 28.021  -11.568 16.986  1.00 44.32  ? 527  VAL C C     1 
ATOM   7170  O O     . VAL C 1 219 ? 28.834  -11.252 16.112  1.00 40.64  ? 527  VAL C O     1 
ATOM   7171  C CB    . VAL C 1 219 ? 27.582  -13.963 16.419  1.00 54.49  ? 527  VAL C CB    1 
ATOM   7172  C CG1   . VAL C 1 219 ? 27.378  -15.362 16.984  1.00 55.00  ? 527  VAL C CG1   1 
ATOM   7173  C CG2   . VAL C 1 219 ? 26.323  -13.474 15.720  1.00 53.08  ? 527  VAL C CG2   1 
ATOM   7174  N N     . LEU C 1 220 ? 27.134  -10.714 17.487  1.00 37.06  ? 528  LEU C N     1 
ATOM   7175  C CA    . LEU C 1 220 ? 27.165  -9.297  17.145  1.00 37.99  ? 528  LEU C CA    1 
ATOM   7176  C C     . LEU C 1 220 ? 28.251  -8.596  17.953  1.00 33.87  ? 528  LEU C C     1 
ATOM   7177  O O     . LEU C 1 220 ? 28.669  -7.484  17.630  1.00 34.63  ? 528  LEU C O     1 
ATOM   7178  C CB    . LEU C 1 220 ? 25.805  -8.651  17.428  1.00 39.44  ? 528  LEU C CB    1 
ATOM   7179  C CG    . LEU C 1 220 ? 24.630  -9.138  16.582  1.00 34.32  ? 528  LEU C CG    1 
ATOM   7180  C CD1   . LEU C 1 220 ? 23.307  -8.646  17.159  1.00 32.79  ? 528  LEU C CD1   1 
ATOM   7181  C CD2   . LEU C 1 220 ? 24.798  -8.684  15.134  1.00 47.66  ? 528  LEU C CD2   1 
ATOM   7182  N N     . HIS C 1 221 ? 28.696  -9.258  19.016  1.00 32.88  ? 529  HIS C N     1 
ATOM   7183  C CA    . HIS C 1 221 ? 29.720  -8.713  19.901  1.00 40.22  ? 529  HIS C CA    1 
ATOM   7184  C C     . HIS C 1 221 ? 29.423  -7.277  20.320  1.00 38.86  ? 529  HIS C C     1 
ATOM   7185  O O     . HIS C 1 221 ? 30.325  -6.442  20.416  1.00 42.61  ? 529  HIS C O     1 
ATOM   7186  C CB    . HIS C 1 221 ? 31.102  -8.834  19.255  1.00 40.15  ? 529  HIS C CB    1 
ATOM   7187  C CG    . HIS C 1 221 ? 31.495  -10.248 18.959  1.00 46.32  ? 529  HIS C CG    1 
ATOM   7188  N ND1   . HIS C 1 221 ? 31.489  -10.772 17.684  1.00 51.49  ? 529  HIS C ND1   1 
ATOM   7189  C CD2   . HIS C 1 221 ? 31.871  -11.256 19.780  1.00 41.62  ? 529  HIS C CD2   1 
ATOM   7190  C CE1   . HIS C 1 221 ? 31.862  -12.039 17.731  1.00 55.77  ? 529  HIS C CE1   1 
ATOM   7191  N NE2   . HIS C 1 221 ? 32.097  -12.358 18.991  1.00 52.68  ? 529  HIS C NE2   1 
ATOM   7192  N N     . LYS C 1 222 ? 28.149  -6.997  20.572  1.00 39.85  ? 530  LYS C N     1 
ATOM   7193  C CA    . LYS C 1 222 ? 27.746  -5.687  21.061  1.00 38.63  ? 530  LYS C CA    1 
ATOM   7194  C C     . LYS C 1 222 ? 28.008  -5.579  22.557  1.00 35.30  ? 530  LYS C C     1 
ATOM   7195  O O     . LYS C 1 222 ? 27.762  -6.524  23.313  1.00 37.79  ? 530  LYS C O     1 
ATOM   7196  C CB    . LYS C 1 222 ? 26.265  -5.423  20.774  1.00 43.49  ? 530  LYS C CB    1 
ATOM   7197  C CG    . LYS C 1 222 ? 25.921  -5.304  19.299  1.00 43.40  ? 530  LYS C CG    1 
ATOM   7198  C CD    . LYS C 1 222 ? 24.452  -4.963  19.106  1.00 36.79  ? 530  LYS C CD    1 
ATOM   7199  C CE    . LYS C 1 222 ? 24.195  -3.476  19.258  1.00 35.28  ? 530  LYS C CE    1 
ATOM   7200  N NZ    . LYS C 1 222 ? 24.652  -2.716  18.062  1.00 36.18  ? 530  LYS C NZ    1 
ATOM   7201  N N     . PRO C 1 223 ? 28.522  -4.424  22.989  1.00 35.02  ? 531  PRO C N     1 
ATOM   7202  C CA    . PRO C 1 223 ? 28.667  -4.135  24.415  1.00 38.67  ? 531  PRO C CA    1 
ATOM   7203  C C     . PRO C 1 223 ? 27.293  -3.951  25.047  1.00 41.80  ? 531  PRO C C     1 
ATOM   7204  O O     . PRO C 1 223 ? 26.325  -3.683  24.332  1.00 28.92  ? 531  PRO C O     1 
ATOM   7205  C CB    . PRO C 1 223 ? 29.412  -2.800  24.420  1.00 49.28  ? 531  PRO C CB    1 
ATOM   7206  C CG    . PRO C 1 223 ? 29.022  -2.155  23.127  1.00 51.63  ? 531  PRO C CG    1 
ATOM   7207  C CD    . PRO C 1 223 ? 28.944  -3.292  22.146  1.00 42.41  ? 531  PRO C CD    1 
ATOM   7208  N N     . PRO C 1 224 ? 27.206  -4.099  26.375  1.00 41.34  ? 532  PRO C N     1 
ATOM   7209  C CA    . PRO C 1 224 ? 25.953  -3.799  27.069  1.00 34.16  ? 532  PRO C CA    1 
ATOM   7210  C C     . PRO C 1 224 ? 25.600  -2.331  26.907  1.00 35.45  ? 532  PRO C C     1 
ATOM   7211  O O     . PRO C 1 224 ? 26.492  -1.489  26.795  1.00 30.94  ? 532  PRO C O     1 
ATOM   7212  C CB    . PRO C 1 224 ? 26.273  -4.111  28.536  1.00 37.73  ? 532  PRO C CB    1 
ATOM   7213  C CG    . PRO C 1 224 ? 27.771  -4.111  28.622  1.00 48.00  ? 532  PRO C CG    1 
ATOM   7214  C CD    . PRO C 1 224 ? 28.251  -4.590  27.290  1.00 38.60  ? 532  PRO C CD    1 
ATOM   7215  N N     . TYR C 1 225 ? 24.307  -2.030  26.889  1.00 23.94  ? 533  TYR C N     1 
ATOM   7216  C CA    . TYR C 1 225 ? 23.847  -0.659  26.727  1.00 30.65  ? 533  TYR C CA    1 
ATOM   7217  C C     . TYR C 1 225 ? 23.872  0.101   28.045  1.00 32.66  ? 533  TYR C C     1 
ATOM   7218  O O     . TYR C 1 225 ? 23.582  -0.463  29.105  1.00 26.57  ? 533  TYR C O     1 
ATOM   7219  C CB    . TYR C 1 225 ? 22.414  -0.638  26.192  1.00 25.88  ? 533  TYR C CB    1 
ATOM   7220  C CG    . TYR C 1 225 ? 22.254  -1.110  24.764  1.00 24.40  ? 533  TYR C CG    1 
ATOM   7221  C CD1   . TYR C 1 225 ? 22.421  -0.231  23.700  1.00 24.04  ? 533  TYR C CD1   1 
ATOM   7222  C CD2   . TYR C 1 225 ? 21.910  -2.426  24.482  1.00 21.09  ? 533  TYR C CD2   1 
ATOM   7223  C CE1   . TYR C 1 225 ? 22.259  -0.649  22.393  1.00 24.93  ? 533  TYR C CE1   1 
ATOM   7224  C CE2   . TYR C 1 225 ? 21.738  -2.853  23.181  1.00 28.72  ? 533  TYR C CE2   1 
ATOM   7225  C CZ    . TYR C 1 225 ? 21.916  -1.965  22.140  1.00 25.38  ? 533  TYR C CZ    1 
ATOM   7226  O OH    . TYR C 1 225 ? 21.755  -2.392  20.842  1.00 26.50  ? 533  TYR C OH    1 
ATOM   7227  N N     . GLU C 1 226 ? 24.207  1.386   27.970  1.00 26.16  ? 534  GLU C N     1 
ATOM   7228  C CA    . GLU C 1 226 ? 24.043  2.285   29.104  1.00 32.38  ? 534  GLU C CA    1 
ATOM   7229  C C     . GLU C 1 226 ? 22.577  2.673   29.216  1.00 26.96  ? 534  GLU C C     1 
ATOM   7230  O O     . GLU C 1 226 ? 21.994  3.201   28.268  1.00 31.54  ? 534  GLU C O     1 
ATOM   7231  C CB    . GLU C 1 226 ? 24.900  3.546   28.930  1.00 34.55  ? 534  GLU C CB    1 
ATOM   7232  C CG    . GLU C 1 226 ? 26.394  3.308   29.068  1.00 50.43  ? 534  GLU C CG    1 
ATOM   7233  C CD    . GLU C 1 226 ? 27.199  4.588   28.937  1.00 65.43  ? 534  GLU C CD    1 
ATOM   7234  O OE1   . GLU C 1 226 ? 26.685  5.557   28.337  1.00 68.51  ? 534  GLU C OE1   1 
ATOM   7235  O OE2   . GLU C 1 226 ? 28.342  4.628   29.439  1.00 71.02  ? 534  GLU C OE2   1 
ATOM   7236  N N     . HIS C 1 227 ? 21.981  2.410   30.373  1.00 29.09  ? 535  HIS C N     1 
ATOM   7237  C CA    . HIS C 1 227 ? 20.552  2.653   30.554  1.00 29.24  ? 535  HIS C CA    1 
ATOM   7238  C C     . HIS C 1 227 ? 20.306  3.964   31.305  1.00 30.10  ? 535  HIS C C     1 
ATOM   7239  O O     . HIS C 1 227 ? 21.112  4.359   32.148  1.00 27.03  ? 535  HIS C O     1 
ATOM   7240  C CB    . HIS C 1 227 ? 19.921  1.483   31.311  1.00 20.82  ? 535  HIS C CB    1 
ATOM   7241  C CG    . HIS C 1 227 ? 19.958  0.184   30.564  1.00 18.70  ? 535  HIS C CG    1 
ATOM   7242  N ND1   . HIS C 1 227 ? 20.330  -1.004  31.154  1.00 28.10  ? 535  HIS C ND1   1 
ATOM   7243  C CD2   . HIS C 1 227 ? 19.656  -0.114  29.278  1.00 22.98  ? 535  HIS C CD2   1 
ATOM   7244  C CE1   . HIS C 1 227 ? 20.262  -1.979  30.264  1.00 26.37  ? 535  HIS C CE1   1 
ATOM   7245  N NE2   . HIS C 1 227 ? 19.849  -1.466  29.118  1.00 21.64  ? 535  HIS C NE2   1 
ATOM   7246  N N     . PRO C 1 228 ? 19.187  4.644   31.006  1.00 27.07  ? 536  PRO C N     1 
ATOM   7247  C CA    . PRO C 1 228 ? 18.851  5.853   31.762  1.00 28.70  ? 536  PRO C CA    1 
ATOM   7248  C C     . PRO C 1 228 ? 18.722  5.518   33.246  1.00 30.09  ? 536  PRO C C     1 
ATOM   7249  O O     . PRO C 1 228 ? 18.331  4.403   33.576  1.00 27.35  ? 536  PRO C O     1 
ATOM   7250  C CB    . PRO C 1 228 ? 17.491  6.272   31.178  1.00 27.57  ? 536  PRO C CB    1 
ATOM   7251  C CG    . PRO C 1 228 ? 16.971  5.065   30.479  1.00 28.75  ? 536  PRO C CG    1 
ATOM   7252  C CD    . PRO C 1 228 ? 18.164  4.312   30.001  1.00 25.57  ? 536  PRO C CD    1 
ATOM   7253  N N     . LYS C 1 229 ? 19.048  6.463   34.122  1.00 29.16  ? 537  LYS C N     1 
ATOM   7254  C CA    . LYS C 1 229 ? 18.997  6.218   35.563  1.00 36.97  ? 537  LYS C CA    1 
ATOM   7255  C C     . LYS C 1 229 ? 17.935  7.067   36.244  1.00 30.56  ? 537  LYS C C     1 
ATOM   7256  O O     . LYS C 1 229 ? 17.740  6.982   37.455  1.00 27.88  ? 537  LYS C O     1 
ATOM   7257  C CB    . LYS C 1 229 ? 20.355  6.497   36.208  1.00 55.59  ? 537  LYS C CB    1 
ATOM   7258  C CG    . LYS C 1 229 ? 21.469  5.555   35.784  1.00 73.19  ? 537  LYS C CG    1 
ATOM   7259  C CD    . LYS C 1 229 ? 22.751  5.882   36.535  1.00 88.78  ? 537  LYS C CD    1 
ATOM   7260  C CE    . LYS C 1 229 ? 23.864  4.901   36.210  1.00 93.13  ? 537  LYS C CE    1 
ATOM   7261  N NZ    . LYS C 1 229 ? 25.114  5.236   36.947  1.00 88.04  ? 537  LYS C NZ    1 
ATOM   7262  N N     . ASP C 1 230 ? 17.251  7.886   35.456  1.00 28.65  ? 538  ASP C N     1 
ATOM   7263  C CA    . ASP C 1 230 ? 16.206  8.762   35.967  1.00 24.02  ? 538  ASP C CA    1 
ATOM   7264  C C     . ASP C 1 230 ? 15.308  9.174   34.810  1.00 20.76  ? 538  ASP C C     1 
ATOM   7265  O O     . ASP C 1 230 ? 15.465  8.685   33.697  1.00 30.22  ? 538  ASP C O     1 
ATOM   7266  C CB    . ASP C 1 230 ? 16.809  9.999   36.638  1.00 28.96  ? 538  ASP C CB    1 
ATOM   7267  C CG    . ASP C 1 230 ? 17.829  10.704  35.759  1.00 42.80  ? 538  ASP C CG    1 
ATOM   7268  O OD1   . ASP C 1 230 ? 18.958  10.943  36.244  1.00 38.68  ? 538  ASP C OD1   1 
ATOM   7269  O OD2   . ASP C 1 230 ? 17.506  11.028  34.591  1.00 32.73  ? 538  ASP C OD2   1 
ATOM   7270  N N     . LEU C 1 231 ? 14.386  10.092  35.066  1.00 25.36  ? 539  LEU C N     1 
ATOM   7271  C CA    . LEU C 1 231 ? 13.424  10.496  34.050  1.00 24.81  ? 539  LEU C CA    1 
ATOM   7272  C C     . LEU C 1 231 ? 13.639  11.938  33.563  1.00 33.47  ? 539  LEU C C     1 
ATOM   7273  O O     . LEU C 1 231 ? 12.750  12.528  32.949  1.00 30.99  ? 539  LEU C O     1 
ATOM   7274  C CB    . LEU C 1 231 ? 12.001  10.327  34.585  1.00 24.64  ? 539  LEU C CB    1 
ATOM   7275  C CG    . LEU C 1 231 ? 11.660  8.984   35.239  1.00 28.22  ? 539  LEU C CG    1 
ATOM   7276  C CD1   . LEU C 1 231 ? 10.212  8.976   35.724  1.00 27.67  ? 539  LEU C CD1   1 
ATOM   7277  C CD2   . LEU C 1 231 ? 11.914  7.821   34.296  1.00 16.98  ? 539  LEU C CD2   1 
ATOM   7278  N N     . LYS C 1 232 ? 14.821  12.491  33.823  1.00 33.18  ? 540  LYS C N     1 
ATOM   7279  C CA    . LYS C 1 232 ? 15.097  13.891  33.500  1.00 31.52  ? 540  LYS C CA    1 
ATOM   7280  C C     . LYS C 1 232 ? 15.128  14.188  32.000  1.00 29.51  ? 540  LYS C C     1 
ATOM   7281  O O     . LYS C 1 232 ? 14.570  15.188  31.549  1.00 41.48  ? 540  LYS C O     1 
ATOM   7282  C CB    . LYS C 1 232 ? 16.398  14.349  34.166  1.00 42.02  ? 540  LYS C CB    1 
ATOM   7283  C CG    . LYS C 1 232 ? 16.375  14.255  35.686  1.00 43.73  ? 540  LYS C CG    1 
ATOM   7284  C CD    . LYS C 1 232 ? 17.628  14.857  36.307  1.00 58.10  ? 540  LYS C CD    1 
ATOM   7285  C CE    . LYS C 1 232 ? 17.590  14.771  37.827  1.00 65.52  ? 540  LYS C CE    1 
ATOM   7286  N NZ    . LYS C 1 232 ? 17.557  13.363  38.312  1.00 71.99  ? 540  LYS C NZ    1 
ATOM   7287  N N     . LEU C 1 233 ? 15.781  13.324  31.229  1.00 26.67  ? 541  LEU C N     1 
ATOM   7288  C CA    . LEU C 1 233 ? 15.871  13.519  29.785  1.00 32.11  ? 541  LEU C CA    1 
ATOM   7289  C C     . LEU C 1 233 ? 14.535  13.300  29.088  1.00 33.23  ? 541  LEU C C     1 
ATOM   7290  O O     . LEU C 1 233 ? 14.360  13.677  27.930  1.00 34.43  ? 541  LEU C O     1 
ATOM   7291  C CB    . LEU C 1 233 ? 16.940  12.603  29.184  1.00 40.93  ? 541  LEU C CB    1 
ATOM   7292  C CG    . LEU C 1 233 ? 18.353  12.817  29.733  1.00 50.23  ? 541  LEU C CG    1 
ATOM   7293  C CD1   . LEU C 1 233 ? 19.343  11.876  29.070  1.00 54.91  ? 541  LEU C CD1   1 
ATOM   7294  C CD2   . LEU C 1 233 ? 18.775  14.266  29.544  1.00 48.84  ? 541  LEU C CD2   1 
ATOM   7295  N N     . SER C 1 234 ? 13.590  12.684  29.792  1.00 27.66  ? 542  SER C N     1 
ATOM   7296  C CA    . SER C 1 234 ? 12.266  12.466  29.228  1.00 24.55  ? 542  SER C CA    1 
ATOM   7297  C C     . SER C 1 234 ? 11.231  13.359  29.895  1.00 23.95  ? 542  SER C C     1 
ATOM   7298  O O     . SER C 1 234 ? 10.041  13.072  29.851  1.00 23.44  ? 542  SER C O     1 
ATOM   7299  C CB    . SER C 1 234 ? 11.860  10.987  29.320  1.00 29.71  ? 542  SER C CB    1 
ATOM   7300  O OG    . SER C 1 234 ? 12.151  10.445  30.595  1.00 22.94  ? 542  SER C OG    1 
ATOM   7301  N N     . ASP C 1 235 ? 11.692  14.446  30.512  1.00 25.44  ? 543  ASP C N     1 
ATOM   7302  C CA    . ASP C 1 235 ? 10.785  15.432  31.097  1.00 25.34  ? 543  ASP C CA    1 
ATOM   7303  C C     . ASP C 1 235 ? 9.858   14.803  32.144  1.00 20.67  ? 543  ASP C C     1 
ATOM   7304  O O     . ASP C 1 235 ? 8.675   15.137  32.235  1.00 23.37  ? 543  ASP C O     1 
ATOM   7305  C CB    . ASP C 1 235 ? 9.977   16.113  29.989  1.00 38.00  ? 543  ASP C CB    1 
ATOM   7306  C CG    . ASP C 1 235 ? 9.153   17.281  30.492  1.00 59.18  ? 543  ASP C CG    1 
ATOM   7307  O OD1   . ASP C 1 235 ? 8.218   17.693  29.770  1.00 61.98  ? 543  ASP C OD1   1 
ATOM   7308  O OD2   . ASP C 1 235 ? 9.434   17.784  31.602  1.00 65.44  ? 543  ASP C OD2   1 
ATOM   7309  N N     . GLY C 1 236 ? 10.407  13.886  32.933  1.00 22.84  ? 544  GLY C N     1 
ATOM   7310  C CA    . GLY C 1 236 ? 9.661   13.271  34.017  1.00 22.63  ? 544  GLY C CA    1 
ATOM   7311  C C     . GLY C 1 236 ? 8.726   12.155  33.574  1.00 25.17  ? 544  GLY C C     1 
ATOM   7312  O O     . GLY C 1 236 ? 7.978   11.609  34.384  1.00 22.00  ? 544  GLY C O     1 
ATOM   7313  N N     . ARG C 1 237 ? 8.766   11.816  32.289  1.00 17.38  ? 545  ARG C N     1 
ATOM   7314  C CA    . ARG C 1 237 ? 7.896   10.770  31.756  1.00 17.87  ? 545  ARG C CA    1 
ATOM   7315  C C     . ARG C 1 237 ? 8.624   9.435   31.695  1.00 18.90  ? 545  ARG C C     1 
ATOM   7316  O O     . ARG C 1 237 ? 9.815   9.388   31.379  1.00 16.85  ? 545  ARG C O     1 
ATOM   7317  C CB    . ARG C 1 237 ? 7.394   11.134  30.356  1.00 15.89  ? 545  ARG C CB    1 
ATOM   7318  C CG    . ARG C 1 237 ? 6.519   12.387  30.305  1.00 18.91  ? 545  ARG C CG    1 
ATOM   7319  C CD    . ARG C 1 237 ? 5.519   12.282  29.167  1.00 35.53  ? 545  ARG C CD    1 
ATOM   7320  N NE    . ARG C 1 237 ? 6.040   12.837  27.933  1.00 37.16  ? 545  ARG C NE    1 
ATOM   7321  C CZ    . ARG C 1 237 ? 5.507   12.637  26.730  1.00 31.71  ? 545  ARG C CZ    1 
ATOM   7322  N NH1   . ARG C 1 237 ? 4.433   11.870  26.571  1.00 22.29  ? 545  ARG C NH1   1 
ATOM   7323  N NH2   . ARG C 1 237 ? 6.062   13.206  25.678  1.00 23.71  ? 545  ARG C NH2   1 
ATOM   7324  N N     . LEU C 1 238 ? 7.908   8.354   31.995  1.00 17.72  ? 546  LEU C N     1 
ATOM   7325  C CA    . LEU C 1 238 ? 8.458   7.013   31.827  1.00 16.89  ? 546  LEU C CA    1 
ATOM   7326  C C     . LEU C 1 238 ? 8.220   6.577   30.391  1.00 14.66  ? 546  LEU C C     1 
ATOM   7327  O O     . LEU C 1 238 ? 7.079   6.557   29.916  1.00 15.68  ? 546  LEU C O     1 
ATOM   7328  C CB    . LEU C 1 238 ? 7.804   6.020   32.796  1.00 16.53  ? 546  LEU C CB    1 
ATOM   7329  C CG    . LEU C 1 238 ? 8.414   4.619   32.922  1.00 22.75  ? 546  LEU C CG    1 
ATOM   7330  C CD1   . LEU C 1 238 ? 9.759   4.655   33.657  1.00 15.18  ? 546  LEU C CD1   1 
ATOM   7331  C CD2   . LEU C 1 238 ? 7.448   3.692   33.644  1.00 23.22  ? 546  LEU C CD2   1 
ATOM   7332  N N     . ARG C 1 239 ? 9.300   6.236   29.700  1.00 16.62  ? 547  ARG C N     1 
ATOM   7333  C CA    . ARG C 1 239 ? 9.216   5.778   28.322  1.00 15.33  ? 547  ARG C CA    1 
ATOM   7334  C C     . ARG C 1 239 ? 8.964   4.274   28.272  1.00 15.94  ? 547  ARG C C     1 
ATOM   7335  O O     . ARG C 1 239 ? 9.799   3.476   28.703  1.00 16.08  ? 547  ARG C O     1 
ATOM   7336  C CB    . ARG C 1 239 ? 10.495  6.155   27.555  1.00 17.85  ? 547  ARG C CB    1 
ATOM   7337  C CG    . ARG C 1 239 ? 10.643  7.657   27.357  1.00 17.71  ? 547  ARG C CG    1 
ATOM   7338  C CD    . ARG C 1 239 ? 11.921  8.052   26.599  1.00 18.15  ? 547  ARG C CD    1 
ATOM   7339  N NE    . ARG C 1 239 ? 11.816  9.415   26.070  1.00 23.53  ? 547  ARG C NE    1 
ATOM   7340  C CZ    . ARG C 1 239 ? 12.845  10.246  25.898  1.00 22.08  ? 547  ARG C CZ    1 
ATOM   7341  N NH1   . ARG C 1 239 ? 14.074  9.870   26.216  1.00 19.18  ? 547  ARG C NH1   1 
ATOM   7342  N NH2   . ARG C 1 239 ? 12.647  11.459  25.405  1.00 19.70  ? 547  ARG C NH2   1 
ATOM   7343  N N     . VAL C 1 240 ? 7.793   3.891   27.763  1.00 9.35   ? 548  VAL C N     1 
ATOM   7344  C CA    . VAL C 1 240 ? 7.424   2.475   27.699  1.00 9.88   ? 548  VAL C CA    1 
ATOM   7345  C C     . VAL C 1 240 ? 7.355   2.044   26.243  1.00 11.80  ? 548  VAL C C     1 
ATOM   7346  O O     . VAL C 1 240 ? 6.707   2.702   25.428  1.00 13.45  ? 548  VAL C O     1 
ATOM   7347  C CB    . VAL C 1 240 ? 6.067   2.222   28.378  1.00 15.00  ? 548  VAL C CB    1 
ATOM   7348  C CG1   . VAL C 1 240 ? 5.677   0.735   28.288  1.00 14.01  ? 548  VAL C CG1   1 
ATOM   7349  C CG2   . VAL C 1 240 ? 6.122   2.680   29.830  1.00 15.05  ? 548  VAL C CG2   1 
ATOM   7350  N N     . GLY C 1 241 ? 8.050   0.960   25.913  1.00 17.78  ? 549  GLY C N     1 
ATOM   7351  C CA    . GLY C 1 241 ? 8.036   0.437   24.563  1.00 19.79  ? 549  GLY C CA    1 
ATOM   7352  C C     . GLY C 1 241 ? 7.295   -0.890  24.486  1.00 14.41  ? 549  GLY C C     1 
ATOM   7353  O O     . GLY C 1 241 ? 7.673   -1.856  25.141  1.00 14.53  ? 549  GLY C O     1 
ATOM   7354  N N     . TYR C 1 242 ? 6.224   -0.921  23.700  1.00 11.67  ? 550  TYR C N     1 
ATOM   7355  C CA    . TYR C 1 242 ? 5.475   -2.149  23.450  1.00 12.44  ? 550  TYR C CA    1 
ATOM   7356  C C     . TYR C 1 242 ? 5.969   -2.782  22.152  1.00 14.56  ? 550  TYR C C     1 
ATOM   7357  O O     . TYR C 1 242 ? 5.841   -2.177  21.085  1.00 10.53  ? 550  TYR C O     1 
ATOM   7358  C CB    . TYR C 1 242 ? 3.979   -1.834  23.325  1.00 9.68   ? 550  TYR C CB    1 
ATOM   7359  C CG    . TYR C 1 242 ? 3.338   -1.391  24.629  1.00 14.37  ? 550  TYR C CG    1 
ATOM   7360  C CD1   . TYR C 1 242 ? 3.079   -2.308  25.638  1.00 11.66  ? 550  TYR C CD1   1 
ATOM   7361  C CD2   . TYR C 1 242 ? 2.985   -0.061  24.846  1.00 14.59  ? 550  TYR C CD2   1 
ATOM   7362  C CE1   . TYR C 1 242 ? 2.491   -1.914  26.830  1.00 13.72  ? 550  TYR C CE1   1 
ATOM   7363  C CE2   . TYR C 1 242 ? 2.391   0.342   26.048  1.00 13.15  ? 550  TYR C CE2   1 
ATOM   7364  C CZ    . TYR C 1 242 ? 2.159   -0.589  27.032  1.00 9.87   ? 550  TYR C CZ    1 
ATOM   7365  O OH    . TYR C 1 242 ? 1.573   -0.218  28.225  1.00 10.57  ? 550  TYR C OH    1 
ATOM   7366  N N     . VAL C 1 243 ? 6.524   -3.991  22.247  1.00 11.87  ? 551  VAL C N     1 
ATOM   7367  C CA    . VAL C 1 243 ? 7.084   -4.680  21.095  1.00 7.69   ? 551  VAL C CA    1 
ATOM   7368  C C     . VAL C 1 243 ? 6.179   -5.850  20.706  1.00 12.35  ? 551  VAL C C     1 
ATOM   7369  O O     . VAL C 1 243 ? 5.951   -6.748  21.505  1.00 8.82   ? 551  VAL C O     1 
ATOM   7370  C CB    . VAL C 1 243 ? 8.493   -5.232  21.402  1.00 16.96  ? 551  VAL C CB    1 
ATOM   7371  C CG1   . VAL C 1 243 ? 9.117   -5.828  20.145  1.00 13.61  ? 551  VAL C CG1   1 
ATOM   7372  C CG2   . VAL C 1 243 ? 9.383   -4.139  21.966  1.00 13.41  ? 551  VAL C CG2   1 
ATOM   7373  N N     . SER C 1 244 ? 5.664   -5.840  19.482  1.00 10.82  ? 552  SER C N     1 
ATOM   7374  C CA    . SER C 1 244 ? 4.731   -6.878  19.070  1.00 13.98  ? 552  SER C CA    1 
ATOM   7375  C C     . SER C 1 244 ? 4.723   -7.103  17.561  1.00 15.03  ? 552  SER C C     1 
ATOM   7376  O O     . SER C 1 244 ? 4.830   -6.161  16.788  1.00 10.81  ? 552  SER C O     1 
ATOM   7377  C CB    . SER C 1 244 ? 3.328   -6.503  19.546  1.00 13.08  ? 552  SER C CB    1 
ATOM   7378  O OG    . SER C 1 244 ? 2.373   -7.458  19.135  1.00 13.18  ? 552  SER C OG    1 
ATOM   7379  N N     . SER C 1 245 ? 4.572   -8.355  17.147  1.00 10.51  ? 553  SER C N     1 
ATOM   7380  C CA    . SER C 1 245 ? 4.385   -8.671  15.738  1.00 12.42  ? 553  SER C CA    1 
ATOM   7381  C C     . SER C 1 245 ? 2.898   -8.633  15.402  1.00 15.47  ? 553  SER C C     1 
ATOM   7382  O O     . SER C 1 245 ? 2.511   -8.918  14.271  1.00 9.82   ? 553  SER C O     1 
ATOM   7383  C CB    . SER C 1 245 ? 4.931   -10.069 15.425  1.00 12.19  ? 553  SER C CB    1 
ATOM   7384  O OG    . SER C 1 245 ? 4.174   -11.063 16.111  1.00 13.12  ? 553  SER C OG    1 
ATOM   7385  N N     . ASP C 1 246 ? 2.071   -8.278  16.385  1.00 7.09   ? 554  ASP C N     1 
ATOM   7386  C CA    . ASP C 1 246 ? 0.619   -8.438  16.254  1.00 11.52  ? 554  ASP C CA    1 
ATOM   7387  C C     . ASP C 1 246 ? -0.179  -7.127  16.310  1.00 10.33  ? 554  ASP C C     1 
ATOM   7388  O O     . ASP C 1 246 ? -1.344  -7.124  16.704  1.00 10.34  ? 554  ASP C O     1 
ATOM   7389  C CB    . ASP C 1 246 ? 0.093   -9.420  17.311  1.00 12.91  ? 554  ASP C CB    1 
ATOM   7390  C CG    . ASP C 1 246 ? 0.801   -10.758 17.265  1.00 13.70  ? 554  ASP C CG    1 
ATOM   7391  O OD1   . ASP C 1 246 ? 0.993   -11.302 16.149  1.00 11.46  ? 554  ASP C OD1   1 
ATOM   7392  O OD2   . ASP C 1 246 ? 1.186   -11.258 18.339  1.00 16.99  ? 554  ASP C OD2   1 
ATOM   7393  N N     . PHE C 1 247 ? 0.441   -6.015  15.919  1.00 12.28  ? 555  PHE C N     1 
ATOM   7394  C CA    . PHE C 1 247 ? -0.308  -4.764  15.752  1.00 8.82   ? 555  PHE C CA    1 
ATOM   7395  C C     . PHE C 1 247 ? -0.992  -4.807  14.397  1.00 10.07  ? 555  PHE C C     1 
ATOM   7396  O O     . PHE C 1 247 ? -0.405  -4.430  13.382  1.00 13.24  ? 555  PHE C O     1 
ATOM   7397  C CB    . PHE C 1 247 ? 0.624   -3.552  15.823  1.00 10.71  ? 555  PHE C CB    1 
ATOM   7398  C CG    . PHE C 1 247 ? 1.263   -3.350  17.172  1.00 12.24  ? 555  PHE C CG    1 
ATOM   7399  C CD1   . PHE C 1 247 ? 0.509   -3.447  18.330  1.00 12.74  ? 555  PHE C CD1   1 
ATOM   7400  C CD2   . PHE C 1 247 ? 2.614   -3.071  17.277  1.00 9.07   ? 555  PHE C CD2   1 
ATOM   7401  C CE1   . PHE C 1 247 ? 1.087   -3.257  19.575  1.00 13.11  ? 555  PHE C CE1   1 
ATOM   7402  C CE2   . PHE C 1 247 ? 3.207   -2.889  18.523  1.00 12.29  ? 555  PHE C CE2   1 
ATOM   7403  C CZ    . PHE C 1 247 ? 2.434   -2.989  19.675  1.00 14.72  ? 555  PHE C CZ    1 
ATOM   7404  N N     . GLY C 1 248 ? -2.236  -5.265  14.387  1.00 9.37   ? 556  GLY C N     1 
ATOM   7405  C CA    . GLY C 1 248 ? -2.943  -5.562  13.158  1.00 8.81   ? 556  GLY C CA    1 
ATOM   7406  C C     . GLY C 1 248 ? -4.076  -6.514  13.491  1.00 10.96  ? 556  GLY C C     1 
ATOM   7407  O O     . GLY C 1 248 ? -4.457  -6.612  14.648  1.00 6.90   ? 556  GLY C O     1 
ATOM   7408  N N     . ASN C 1 249 ? -4.615  -7.210  12.491  1.00 10.00  ? 557  ASN C N     1 
ATOM   7409  C CA    . ASN C 1 249 ? -5.725  -8.124  12.729  1.00 7.59   ? 557  ASN C CA    1 
ATOM   7410  C C     . ASN C 1 249 ? -5.224  -9.417  13.367  1.00 11.38  ? 557  ASN C C     1 
ATOM   7411  O O     . ASN C 1 249 ? -4.836  -10.355 12.674  1.00 12.08  ? 557  ASN C O     1 
ATOM   7412  C CB    . ASN C 1 249 ? -6.484  -8.415  11.428  1.00 11.61  ? 557  ASN C CB    1 
ATOM   7413  C CG    . ASN C 1 249 ? -7.713  -9.300  11.653  1.00 15.53  ? 557  ASN C CG    1 
ATOM   7414  O OD1   . ASN C 1 249 ? -8.281  -9.339  12.758  1.00 9.81   ? 557  ASN C OD1   1 
ATOM   7415  N ND2   . ASN C 1 249 ? -8.127  -10.016 10.607  1.00 10.27  ? 557  ASN C ND2   1 
ATOM   7416  N N     . HIS C 1 250 ? -5.223  -9.444  14.699  1.00 9.04   ? 558  HIS C N     1 
ATOM   7417  C CA    . HIS C 1 250 ? -4.721  -10.576 15.467  1.00 14.49  ? 558  HIS C CA    1 
ATOM   7418  C C     . HIS C 1 250 ? -5.301  -10.460 16.869  1.00 8.48   ? 558  HIS C C     1 
ATOM   7419  O O     . HIS C 1 250 ? -5.524  -9.353  17.346  1.00 7.20   ? 558  HIS C O     1 
ATOM   7420  C CB    . HIS C 1 250 ? -3.189  -10.525 15.520  1.00 11.37  ? 558  HIS C CB    1 
ATOM   7421  C CG    . HIS C 1 250 ? -2.564  -11.689 16.226  1.00 10.81  ? 558  HIS C CG    1 
ATOM   7422  N ND1   . HIS C 1 250 ? -2.423  -11.744 17.598  1.00 10.82  ? 558  HIS C ND1   1 
ATOM   7423  C CD2   . HIS C 1 250 ? -2.040  -12.842 15.747  1.00 11.45  ? 558  HIS C CD2   1 
ATOM   7424  C CE1   . HIS C 1 250 ? -1.844  -12.885 17.931  1.00 15.49  ? 558  HIS C CE1   1 
ATOM   7425  N NE2   . HIS C 1 250 ? -1.600  -13.566 16.825  1.00 13.18  ? 558  HIS C NE2   1 
ATOM   7426  N N     . PRO C 1 251 ? -5.548  -11.598 17.536  1.00 11.97  ? 559  PRO C N     1 
ATOM   7427  C CA    . PRO C 1 251 ? -6.103  -11.538 18.892  1.00 11.35  ? 559  PRO C CA    1 
ATOM   7428  C C     . PRO C 1 251 ? -5.426  -10.509 19.806  1.00 9.12   ? 559  PRO C C     1 
ATOM   7429  O O     . PRO C 1 251 ? -6.110  -9.886  20.617  1.00 9.33   ? 559  PRO C O     1 
ATOM   7430  C CB    . PRO C 1 251 ? -5.871  -12.960 19.425  1.00 9.25   ? 559  PRO C CB    1 
ATOM   7431  C CG    . PRO C 1 251 ? -5.909  -13.827 18.192  1.00 9.63   ? 559  PRO C CG    1 
ATOM   7432  C CD    . PRO C 1 251 ? -5.377  -12.988 17.060  1.00 10.19  ? 559  PRO C CD    1 
ATOM   7433  N N     . THR C 1 252 ? -4.111  -10.343 19.702  1.00 11.09  ? 560  THR C N     1 
ATOM   7434  C CA    . THR C 1 252 ? -3.416  -9.416  20.587  1.00 12.82  ? 560  THR C CA    1 
ATOM   7435  C C     . THR C 1 252 ? -3.984  -7.999  20.490  1.00 14.06  ? 560  THR C C     1 
ATOM   7436  O O     . THR C 1 252 ? -4.253  -7.363  21.503  1.00 8.52   ? 560  THR C O     1 
ATOM   7437  C CB    . THR C 1 252 ? -1.898  -9.380  20.331  1.00 16.35  ? 560  THR C CB    1 
ATOM   7438  O OG1   . THR C 1 252 ? -1.321  -10.634 20.717  1.00 20.40  ? 560  THR C OG1   1 
ATOM   7439  C CG2   . THR C 1 252 ? -1.262  -8.259  21.143  1.00 17.62  ? 560  THR C CG2   1 
ATOM   7440  N N     . SER C 1 253 ? -4.173  -7.506  19.271  1.00 11.28  ? 561  SER C N     1 
ATOM   7441  C CA    . SER C 1 253 ? -4.752  -6.184  19.092  1.00 12.65  ? 561  SER C CA    1 
ATOM   7442  C C     . SER C 1 253 ? -6.222  -6.152  19.504  1.00 13.63  ? 561  SER C C     1 
ATOM   7443  O O     . SER C 1 253 ? -6.697  -5.134  19.981  1.00 8.95   ? 561  SER C O     1 
ATOM   7444  C CB    . SER C 1 253 ? -4.585  -5.697  17.646  1.00 9.18   ? 561  SER C CB    1 
ATOM   7445  O OG    . SER C 1 253 ? -3.225  -5.361  17.400  1.00 11.63  ? 561  SER C OG    1 
ATOM   7446  N N     . HIS C 1 254 ? -6.943  -7.256  19.309  1.00 6.21   ? 562  HIS C N     1 
ATOM   7447  C CA    . HIS C 1 254 ? -8.334  -7.316  19.728  1.00 7.18   ? 562  HIS C CA    1 
ATOM   7448  C C     . HIS C 1 254 ? -8.440  -7.208  21.243  1.00 8.76   ? 562  HIS C C     1 
ATOM   7449  O O     . HIS C 1 254 ? -9.525  -6.958  21.774  1.00 10.41  ? 562  HIS C O     1 
ATOM   7450  C CB    . HIS C 1 254 ? -9.003  -8.620  19.305  1.00 8.54   ? 562  HIS C CB    1 
ATOM   7451  C CG    . HIS C 1 254 ? -8.857  -8.936  17.856  1.00 6.50   ? 562  HIS C CG    1 
ATOM   7452  N ND1   . HIS C 1 254 ? -9.004  -10.215 17.364  1.00 7.53   ? 562  HIS C ND1   1 
ATOM   7453  C CD2   . HIS C 1 254 ? -8.593  -8.143  16.787  1.00 8.96   ? 562  HIS C CD2   1 
ATOM   7454  C CE1   . HIS C 1 254 ? -8.816  -10.199 16.053  1.00 8.48   ? 562  HIS C CE1   1 
ATOM   7455  N NE2   . HIS C 1 254 ? -8.572  -8.955  15.679  1.00 11.60  ? 562  HIS C NE2   1 
ATOM   7456  N N     . LEU C 1 255 ? -7.335  -7.446  21.942  1.00 8.56   ? 563  LEU C N     1 
ATOM   7457  C CA    . LEU C 1 255 ? -7.326  -7.305  23.399  1.00 7.44   ? 563  LEU C CA    1 
ATOM   7458  C C     . LEU C 1 255 ? -6.896  -5.908  23.857  1.00 12.22  ? 563  LEU C C     1 
ATOM   7459  O O     . LEU C 1 255 ? -7.539  -5.306  24.724  1.00 9.52   ? 563  LEU C O     1 
ATOM   7460  C CB    . LEU C 1 255 ? -6.396  -8.352  24.054  1.00 11.58  ? 563  LEU C CB    1 
ATOM   7461  C CG    . LEU C 1 255 ? -6.695  -9.836  23.839  1.00 18.31  ? 563  LEU C CG    1 
ATOM   7462  C CD1   . LEU C 1 255 ? -5.661  -10.702 24.555  1.00 14.71  ? 563  LEU C CD1   1 
ATOM   7463  C CD2   . LEU C 1 255 ? -8.119  -10.176 24.284  1.00 10.67  ? 563  LEU C CD2   1 
ATOM   7464  N N     . MET C 1 256 ? -5.802  -5.399  23.289  1.00 6.82   ? 564  MET C N     1 
ATOM   7465  C CA    . MET C 1 256 ? -5.154  -4.231  23.864  1.00 11.37  ? 564  MET C CA    1 
ATOM   7466  C C     . MET C 1 256 ? -5.053  -2.991  22.972  1.00 11.26  ? 564  MET C C     1 
ATOM   7467  O O     . MET C 1 256 ? -4.362  -2.051  23.333  1.00 7.92   ? 564  MET C O     1 
ATOM   7468  C CB    . MET C 1 256 ? -3.753  -4.594  24.408  1.00 9.38   ? 564  MET C CB    1 
ATOM   7469  C CG    . MET C 1 256 ? -2.812  -5.276  23.409  1.00 11.94  ? 564  MET C CG    1 
ATOM   7470  S SD    . MET C 1 256 ? -2.457  -4.343  21.913  1.00 11.58  ? 564  MET C SD    1 
ATOM   7471  C CE    . MET C 1 256 ? -1.438  -3.012  22.569  1.00 11.32  ? 564  MET C CE    1 
ATOM   7472  N N     . GLN C 1 257 ? -5.733  -2.965  21.832  1.00 7.83   ? 565  GLN C N     1 
ATOM   7473  C CA    . GLN C 1 257 ? -5.541  -1.833  20.920  1.00 8.18   ? 565  GLN C CA    1 
ATOM   7474  C C     . GLN C 1 257 ? -5.891  -0.463  21.534  1.00 10.16  ? 565  GLN C C     1 
ATOM   7475  O O     . GLN C 1 257 ? -5.406  0.551   21.051  1.00 10.26  ? 565  GLN C O     1 
ATOM   7476  C CB    . GLN C 1 257 ? -6.297  -2.027  19.602  1.00 7.08   ? 565  GLN C CB    1 
ATOM   7477  C CG    . GLN C 1 257 ? -7.811  -2.027  19.742  1.00 8.27   ? 565  GLN C CG    1 
ATOM   7478  C CD    . GLN C 1 257 ? -8.536  -1.931  18.409  1.00 16.29  ? 565  GLN C CD    1 
ATOM   7479  O OE1   . GLN C 1 257 ? -7.950  -1.561  17.386  1.00 12.41  ? 565  GLN C OE1   1 
ATOM   7480  N NE2   . GLN C 1 257 ? -9.821  -2.254  18.418  1.00 12.43  ? 565  GLN C NE2   1 
ATOM   7481  N N     . SER C 1 258 ? -6.725  -0.419  22.580  1.00 8.45   ? 566  SER C N     1 
ATOM   7482  C CA    . SER C 1 258 ? -7.091  0.871   23.174  1.00 9.99   ? 566  SER C CA    1 
ATOM   7483  C C     . SER C 1 258 ? -6.058  1.361   24.185  1.00 14.31  ? 566  SER C C     1 
ATOM   7484  O O     . SER C 1 258 ? -6.032  2.540   24.536  1.00 9.89   ? 566  SER C O     1 
ATOM   7485  C CB    . SER C 1 258 ? -8.486  0.836   23.831  1.00 6.99   ? 566  SER C CB    1 
ATOM   7486  O OG    . SER C 1 258 ? -9.521  0.730   22.860  1.00 9.30   ? 566  SER C OG    1 
ATOM   7487  N N     . ILE C 1 259 ? -5.200  0.464   24.649  1.00 9.26   ? 567  ILE C N     1 
ATOM   7488  C CA    . ILE C 1 259 ? -4.317  0.800   25.772  1.00 6.96   ? 567  ILE C CA    1 
ATOM   7489  C C     . ILE C 1 259 ? -3.275  1.899   25.484  1.00 9.65   ? 567  ILE C C     1 
ATOM   7490  O O     . ILE C 1 259 ? -3.103  2.825   26.281  1.00 10.95  ? 567  ILE C O     1 
ATOM   7491  C CB    . ILE C 1 259 ? -3.680  -0.483  26.382  1.00 14.10  ? 567  ILE C CB    1 
ATOM   7492  C CG1   . ILE C 1 259 ? -4.753  -1.258  27.154  1.00 20.30  ? 567  ILE C CG1   1 
ATOM   7493  C CG2   . ILE C 1 259 ? -2.516  -0.137  27.280  1.00 16.62  ? 567  ILE C CG2   1 
ATOM   7494  C CD1   . ILE C 1 259 ? -4.272  -2.568  27.726  1.00 27.56  ? 567  ILE C CD1   1 
ATOM   7495  N N     . PRO C 1 260 ? -2.600  1.832   24.333  1.00 13.02  ? 568  PRO C N     1 
ATOM   7496  C CA    . PRO C 1 260 ? -1.623  2.897   24.082  1.00 11.46  ? 568  PRO C CA    1 
ATOM   7497  C C     . PRO C 1 260 ? -2.214  4.308   24.161  1.00 14.28  ? 568  PRO C C     1 
ATOM   7498  O O     . PRO C 1 260 ? -1.605  5.199   24.746  1.00 13.97  ? 568  PRO C O     1 
ATOM   7499  C CB    . PRO C 1 260 ? -1.129  2.578   22.670  1.00 11.19  ? 568  PRO C CB    1 
ATOM   7500  C CG    . PRO C 1 260 ? -1.232  1.086   22.594  1.00 12.59  ? 568  PRO C CG    1 
ATOM   7501  C CD    . PRO C 1 260 ? -2.533  0.770   23.311  1.00 9.25   ? 568  PRO C CD    1 
ATOM   7502  N N     . GLY C 1 261 ? -3.402  4.503   23.609  1.00 8.85   ? 569  GLY C N     1 
ATOM   7503  C CA    . GLY C 1 261 ? -4.009  5.820   23.608  1.00 9.93   ? 569  GLY C CA    1 
ATOM   7504  C C     . GLY C 1 261 ? -4.628  6.227   24.926  1.00 10.68  ? 569  GLY C C     1 
ATOM   7505  O O     . GLY C 1 261 ? -5.031  7.373   25.088  1.00 12.27  ? 569  GLY C O     1 
ATOM   7506  N N     . MET C 1 262 ? -4.730  5.285   25.862  1.00 8.07   ? 570  MET C N     1 
ATOM   7507  C CA    . MET C 1 262 ? -5.239  5.587   27.195  1.00 8.21   ? 570  MET C CA    1 
ATOM   7508  C C     . MET C 1 262 ? -4.151  5.898   28.208  1.00 15.51  ? 570  MET C C     1 
ATOM   7509  O O     . MET C 1 262 ? -4.446  6.252   29.350  1.00 10.18  ? 570  MET C O     1 
ATOM   7510  C CB    . MET C 1 262 ? -6.116  4.444   27.706  1.00 10.31  ? 570  MET C CB    1 
ATOM   7511  C CG    . MET C 1 262 ? -7.474  4.434   27.015  1.00 11.80  ? 570  MET C CG    1 
ATOM   7512  S SD    . MET C 1 262 ? -8.435  2.993   27.495  1.00 15.25  ? 570  MET C SD    1 
ATOM   7513  C CE    . MET C 1 262 ? -10.034 3.468   26.828  1.00 17.18  ? 570  MET C CE    1 
ATOM   7514  N N     . HIS C 1 263 ? -2.897  5.775   27.794  1.00 5.34   ? 571  HIS C N     1 
ATOM   7515  C CA    . HIS C 1 263 ? -1.794  6.129   28.687  1.00 12.39  ? 571  HIS C CA    1 
ATOM   7516  C C     . HIS C 1 263 ? -1.811  7.624   29.002  1.00 20.98  ? 571  HIS C C     1 
ATOM   7517  O O     . HIS C 1 263 ? -2.125  8.441   28.143  1.00 15.11  ? 571  HIS C O     1 
ATOM   7518  C CB    . HIS C 1 263 ? -0.458  5.714   28.082  1.00 14.02  ? 571  HIS C CB    1 
ATOM   7519  C CG    . HIS C 1 263 ? -0.055  4.316   28.428  1.00 15.55  ? 571  HIS C CG    1 
ATOM   7520  N ND1   . HIS C 1 263 ? 0.293   3.944   29.708  1.00 14.50  ? 571  HIS C ND1   1 
ATOM   7521  C CD2   . HIS C 1 263 ? 0.065   3.203   27.665  1.00 14.04  ? 571  HIS C CD2   1 
ATOM   7522  C CE1   . HIS C 1 263 ? 0.615   2.663   29.720  1.00 13.43  ? 571  HIS C CE1   1 
ATOM   7523  N NE2   . HIS C 1 263 ? 0.478   2.188   28.495  1.00 16.23  ? 571  HIS C NE2   1 
ATOM   7524  N N     . ASN C 1 264 ? -1.492  7.968   30.245  1.00 13.37  ? 572  ASN C N     1 
ATOM   7525  C CA    . ASN C 1 264 ? -1.447  9.365   30.675  1.00 11.62  ? 572  ASN C CA    1 
ATOM   7526  C C     . ASN C 1 264 ? -0.185  10.050  30.176  1.00 16.07  ? 572  ASN C C     1 
ATOM   7527  O O     . ASN C 1 264 ? 0.906   9.760   30.654  1.00 13.77  ? 572  ASN C O     1 
ATOM   7528  C CB    . ASN C 1 264 ? -1.499  9.440   32.201  1.00 13.32  ? 572  ASN C CB    1 
ATOM   7529  C CG    . ASN C 1 264 ? -1.240  10.841  32.730  1.00 18.74  ? 572  ASN C CG    1 
ATOM   7530  O OD1   . ASN C 1 264 ? -1.298  11.830  31.992  1.00 12.59  ? 572  ASN C OD1   1 
ATOM   7531  N ND2   . ASN C 1 264 ? -0.945  10.926  34.019  1.00 13.46  ? 572  ASN C ND2   1 
ATOM   7532  N N     . PRO C 1 265 ? -0.332  10.973  29.218  1.00 21.40  ? 573  PRO C N     1 
ATOM   7533  C CA    . PRO C 1 265 ? 0.825   11.600  28.566  1.00 16.70  ? 573  PRO C CA    1 
ATOM   7534  C C     . PRO C 1 265 ? 1.666   12.485  29.491  1.00 15.46  ? 573  PRO C C     1 
ATOM   7535  O O     . PRO C 1 265 ? 2.803   12.779  29.163  1.00 16.31  ? 573  PRO C O     1 
ATOM   7536  C CB    . PRO C 1 265 ? 0.186   12.450  27.461  1.00 21.73  ? 573  PRO C CB    1 
ATOM   7537  C CG    . PRO C 1 265 ? -1.192  12.735  27.957  1.00 23.56  ? 573  PRO C CG    1 
ATOM   7538  C CD    . PRO C 1 265 ? -1.613  11.499  28.714  1.00 14.32  ? 573  PRO C CD    1 
ATOM   7539  N N     . ASP C 1 266 ? 1.115   12.913  30.619  1.00 13.94  ? 574  ASP C N     1 
ATOM   7540  C CA    . ASP C 1 266 ? 1.884   13.702  31.582  1.00 17.71  ? 574  ASP C CA    1 
ATOM   7541  C C     . ASP C 1 266 ? 2.976   12.868  32.266  1.00 16.64  ? 574  ASP C C     1 
ATOM   7542  O O     . ASP C 1 266 ? 3.986   13.407  32.729  1.00 14.11  ? 574  ASP C O     1 
ATOM   7543  C CB    . ASP C 1 266 ? 0.944   14.312  32.634  1.00 21.27  ? 574  ASP C CB    1 
ATOM   7544  C CG    . ASP C 1 266 ? 1.670   15.202  33.627  1.00 29.70  ? 574  ASP C CG    1 
ATOM   7545  O OD1   . ASP C 1 266 ? 2.521   16.001  33.194  1.00 20.49  ? 574  ASP C OD1   1 
ATOM   7546  O OD2   . ASP C 1 266 ? 1.385   15.101  34.843  1.00 18.31  ? 574  ASP C OD2   1 
ATOM   7547  N N     . LYS C 1 267 ? 2.783   11.554  32.325  1.00 13.38  ? 575  LYS C N     1 
ATOM   7548  C CA    . LYS C 1 267 ? 3.704   10.700  33.073  1.00 17.18  ? 575  LYS C CA    1 
ATOM   7549  C C     . LYS C 1 267 ? 4.300   9.563   32.251  1.00 19.51  ? 575  LYS C C     1 
ATOM   7550  O O     . LYS C 1 267 ? 5.208   8.873   32.713  1.00 18.74  ? 575  LYS C O     1 
ATOM   7551  C CB    . LYS C 1 267 ? 3.004   10.101  34.299  1.00 19.71  ? 575  LYS C CB    1 
ATOM   7552  C CG    . LYS C 1 267 ? 2.516   11.119  35.321  1.00 15.70  ? 575  LYS C CG    1 
ATOM   7553  C CD    . LYS C 1 267 ? 3.671   11.751  36.085  1.00 22.60  ? 575  LYS C CD    1 
ATOM   7554  C CE    . LYS C 1 267 ? 3.150   12.702  37.153  1.00 27.26  ? 575  LYS C CE    1 
ATOM   7555  N NZ    . LYS C 1 267 ? 4.253   13.382  37.879  1.00 27.46  ? 575  LYS C NZ    1 
ATOM   7556  N N     . PHE C 1 268 ? 3.779   9.348   31.048  1.00 13.18  ? 576  PHE C N     1 
ATOM   7557  C CA    . PHE C 1 268 ? 4.258   8.243   30.213  1.00 10.24  ? 576  PHE C CA    1 
ATOM   7558  C C     . PHE C 1 268 ? 4.423   8.698   28.777  1.00 13.56  ? 576  PHE C C     1 
ATOM   7559  O O     . PHE C 1 268 ? 3.692   9.563   28.298  1.00 15.52  ? 576  PHE C O     1 
ATOM   7560  C CB    . PHE C 1 268 ? 3.285   7.057   30.288  1.00 12.61  ? 576  PHE C CB    1 
ATOM   7561  C CG    . PHE C 1 268 ? 3.160   6.493   31.660  1.00 13.13  ? 576  PHE C CG    1 
ATOM   7562  C CD1   . PHE C 1 268 ? 3.962   5.435   32.062  1.00 14.33  ? 576  PHE C CD1   1 
ATOM   7563  C CD2   . PHE C 1 268 ? 2.281   7.055   32.571  1.00 13.28  ? 576  PHE C CD2   1 
ATOM   7564  C CE1   . PHE C 1 268 ? 3.871   4.927   33.347  1.00 15.64  ? 576  PHE C CE1   1 
ATOM   7565  C CE2   . PHE C 1 268 ? 2.188   6.554   33.857  1.00 11.24  ? 576  PHE C CE2   1 
ATOM   7566  C CZ    . PHE C 1 268 ? 2.985   5.485   34.243  1.00 11.09  ? 576  PHE C CZ    1 
ATOM   7567  N N     . GLU C 1 269 ? 5.406   8.119   28.105  1.00 12.99  ? 577  GLU C N     1 
ATOM   7568  C CA    . GLU C 1 269 ? 5.613   8.359   26.692  1.00 16.09  ? 577  GLU C CA    1 
ATOM   7569  C C     . GLU C 1 269 ? 5.635   6.985   26.048  1.00 13.93  ? 577  GLU C C     1 
ATOM   7570  O O     . GLU C 1 269 ? 6.487   6.159   26.364  1.00 15.46  ? 577  GLU C O     1 
ATOM   7571  C CB    . GLU C 1 269 ? 6.927   9.103   26.446  1.00 15.99  ? 577  GLU C CB    1 
ATOM   7572  C CG    . GLU C 1 269 ? 7.048   9.632   25.033  1.00 22.78  ? 577  GLU C CG    1 
ATOM   7573  C CD    . GLU C 1 269 ? 8.328   10.420  24.791  1.00 27.15  ? 577  GLU C CD    1 
ATOM   7574  O OE1   . GLU C 1 269 ? 9.212   10.468  25.674  1.00 18.04  ? 577  GLU C OE1   1 
ATOM   7575  O OE2   . GLU C 1 269 ? 8.442   10.992  23.695  1.00 18.76  ? 577  GLU C OE2   1 
ATOM   7576  N N     . VAL C 1 270 ? 4.680   6.733   25.163  1.00 12.88  ? 578  VAL C N     1 
ATOM   7577  C CA    . VAL C 1 270 ? 4.470   5.382   24.650  1.00 12.21  ? 578  VAL C CA    1 
ATOM   7578  C C     . VAL C 1 270 ? 5.069   5.203   23.266  1.00 13.37  ? 578  VAL C C     1 
ATOM   7579  O O     . VAL C 1 270 ? 4.742   5.948   22.344  1.00 13.02  ? 578  VAL C O     1 
ATOM   7580  C CB    . VAL C 1 270 ? 2.963   5.034   24.577  1.00 19.05  ? 578  VAL C CB    1 
ATOM   7581  C CG1   . VAL C 1 270 ? 2.761   3.606   24.044  1.00 17.20  ? 578  VAL C CG1   1 
ATOM   7582  C CG2   . VAL C 1 270 ? 2.316   5.193   25.944  1.00 18.15  ? 578  VAL C CG2   1 
ATOM   7583  N N     . PHE C 1 271 ? 5.920   4.188   23.139  1.00 11.18  ? 579  PHE C N     1 
ATOM   7584  C CA    . PHE C 1 271 ? 6.514   3.795   21.878  1.00 10.18  ? 579  PHE C CA    1 
ATOM   7585  C C     . PHE C 1 271 ? 5.999   2.410   21.503  1.00 13.10  ? 579  PHE C C     1 
ATOM   7586  O O     . PHE C 1 271 ? 6.111   1.478   22.291  1.00 19.18  ? 579  PHE C O     1 
ATOM   7587  C CB    . PHE C 1 271 ? 8.034   3.711   22.017  1.00 11.91  ? 579  PHE C CB    1 
ATOM   7588  C CG    . PHE C 1 271 ? 8.701   5.022   22.345  1.00 13.97  ? 579  PHE C CG    1 
ATOM   7589  C CD1   . PHE C 1 271 ? 9.494   5.662   21.407  1.00 12.96  ? 579  PHE C CD1   1 
ATOM   7590  C CD2   . PHE C 1 271 ? 8.556   5.595   23.598  1.00 14.90  ? 579  PHE C CD2   1 
ATOM   7591  C CE1   . PHE C 1 271 ? 10.125  6.869   21.710  1.00 17.60  ? 579  PHE C CE1   1 
ATOM   7592  C CE2   . PHE C 1 271 ? 9.180   6.803   23.911  1.00 16.49  ? 579  PHE C CE2   1 
ATOM   7593  C CZ    . PHE C 1 271 ? 9.972   7.432   22.968  1.00 14.98  ? 579  PHE C CZ    1 
ATOM   7594  N N     . CYS C 1 272 ? 5.449   2.271   20.304  1.00 12.62  ? 580  CYS C N     1 
ATOM   7595  C CA    . CYS C 1 272 ? 5.044   0.950   19.824  1.00 9.15   ? 580  CYS C CA    1 
ATOM   7596  C C     . CYS C 1 272 ? 6.000   0.516   18.734  1.00 15.26  ? 580  CYS C C     1 
ATOM   7597  O O     . CYS C 1 272 ? 6.171   1.212   17.733  1.00 15.60  ? 580  CYS C O     1 
ATOM   7598  C CB    . CYS C 1 272 ? 3.600   0.952   19.324  1.00 10.42  ? 580  CYS C CB    1 
ATOM   7599  S SG    . CYS C 1 272 ? 2.414   1.075   20.665  1.00 15.84  ? 580  CYS C SG    1 
ATOM   7600  N N     . TYR C 1 273 ? 6.643   -0.624  18.957  1.00 11.80  ? 581  TYR C N     1 
ATOM   7601  C CA    . TYR C 1 273 ? 7.592   -1.184  18.008  1.00 11.60  ? 581  TYR C CA    1 
ATOM   7602  C C     . TYR C 1 273 ? 6.970   -2.372  17.290  1.00 13.49  ? 581  TYR C C     1 
ATOM   7603  O O     . TYR C 1 273 ? 6.864   -3.455  17.853  1.00 13.57  ? 581  TYR C O     1 
ATOM   7604  C CB    . TYR C 1 273 ? 8.871   -1.610  18.728  1.00 17.28  ? 581  TYR C CB    1 
ATOM   7605  C CG    . TYR C 1 273 ? 9.612   -0.453  19.357  1.00 19.05  ? 581  TYR C CG    1 
ATOM   7606  C CD1   . TYR C 1 273 ? 10.504  0.311   18.615  1.00 17.15  ? 581  TYR C CD1   1 
ATOM   7607  C CD2   . TYR C 1 273 ? 9.414   -0.122  20.693  1.00 19.04  ? 581  TYR C CD2   1 
ATOM   7608  C CE1   . TYR C 1 273 ? 11.187  1.384   19.190  1.00 17.79  ? 581  TYR C CE1   1 
ATOM   7609  C CE2   . TYR C 1 273 ? 10.089  0.938   21.277  1.00 16.22  ? 581  TYR C CE2   1 
ATOM   7610  C CZ    . TYR C 1 273 ? 10.977  1.686   20.522  1.00 13.80  ? 581  TYR C CZ    1 
ATOM   7611  O OH    . TYR C 1 273 ? 11.636  2.749   21.108  1.00 16.95  ? 581  TYR C OH    1 
ATOM   7612  N N     . ALA C 1 274 ? 6.550   -2.154  16.048  1.00 13.51  ? 582  ALA C N     1 
ATOM   7613  C CA    . ALA C 1 274 ? 5.891   -3.193  15.264  1.00 11.99  ? 582  ALA C CA    1 
ATOM   7614  C C     . ALA C 1 274 ? 6.916   -4.136  14.632  1.00 13.16  ? 582  ALA C C     1 
ATOM   7615  O O     . ALA C 1 274 ? 7.880   -3.685  14.019  1.00 17.06  ? 582  ALA C O     1 
ATOM   7616  C CB    . ALA C 1 274 ? 5.016   -2.555  14.195  1.00 11.09  ? 582  ALA C CB    1 
ATOM   7617  N N     . LEU C 1 275 ? 6.705   -5.441  14.788  1.00 12.70  ? 583  LEU C N     1 
ATOM   7618  C CA    . LEU C 1 275 ? 7.580   -6.427  14.179  1.00 12.81  ? 583  LEU C CA    1 
ATOM   7619  C C     . LEU C 1 275 ? 6.987   -6.928  12.865  1.00 18.03  ? 583  LEU C C     1 
ATOM   7620  O O     . LEU C 1 275 ? 7.585   -7.750  12.178  1.00 23.85  ? 583  LEU C O     1 
ATOM   7621  C CB    . LEU C 1 275 ? 7.828   -7.603  15.140  1.00 11.67  ? 583  LEU C CB    1 
ATOM   7622  C CG    . LEU C 1 275 ? 8.387   -7.256  16.528  1.00 13.33  ? 583  LEU C CG    1 
ATOM   7623  C CD1   . LEU C 1 275 ? 8.699   -8.512  17.347  1.00 10.83  ? 583  LEU C CD1   1 
ATOM   7624  C CD2   . LEU C 1 275 ? 9.645   -6.386  16.405  1.00 16.13  ? 583  LEU C CD2   1 
ATOM   7625  N N     . SER C 1 276 ? 5.805   -6.429  12.521  1.00 10.68  ? 584  SER C N     1 
ATOM   7626  C CA    . SER C 1 276 ? 5.133   -6.847  11.297  1.00 10.90  ? 584  SER C CA    1 
ATOM   7627  C C     . SER C 1 276 ? 4.861   -5.632  10.427  1.00 13.07  ? 584  SER C C     1 
ATOM   7628  O O     . SER C 1 276 ? 4.693   -4.524  10.939  1.00 14.99  ? 584  SER C O     1 
ATOM   7629  C CB    . SER C 1 276 ? 3.811   -7.556  11.615  1.00 15.51  ? 584  SER C CB    1 
ATOM   7630  O OG    . SER C 1 276 ? 2.877   -6.648  12.188  1.00 16.28  ? 584  SER C OG    1 
ATOM   7631  N N     . PRO C 1 277 ? 4.839   -5.838  9.105   1.00 15.18  ? 585  PRO C N     1 
ATOM   7632  C CA    . PRO C 1 277 ? 4.409   -4.788  8.183   1.00 20.68  ? 585  PRO C CA    1 
ATOM   7633  C C     . PRO C 1 277 ? 2.938   -4.436  8.418   1.00 14.88  ? 585  PRO C C     1 
ATOM   7634  O O     . PRO C 1 277 ? 2.195   -5.214  9.022   1.00 10.58  ? 585  PRO C O     1 
ATOM   7635  C CB    . PRO C 1 277 ? 4.607   -5.425  6.801   1.00 26.92  ? 585  PRO C CB    1 
ATOM   7636  C CG    . PRO C 1 277 ? 4.580   -6.888  7.039   1.00 33.52  ? 585  PRO C CG    1 
ATOM   7637  C CD    . PRO C 1 277 ? 5.142   -7.105  8.419   1.00 19.75  ? 585  PRO C CD    1 
ATOM   7638  N N     . ASP C 1 278 ? 2.546   -3.253  7.961   1.00 13.65  ? 586  ASP C N     1 
ATOM   7639  C CA    . ASP C 1 278 ? 1.181   -2.748  8.098   1.00 17.05  ? 586  ASP C CA    1 
ATOM   7640  C C     . ASP C 1 278 ? 0.231   -3.599  7.258   1.00 18.67  ? 586  ASP C C     1 
ATOM   7641  O O     . ASP C 1 278 ? 0.412   -3.703  6.043   1.00 14.93  ? 586  ASP C O     1 
ATOM   7642  C CB    . ASP C 1 278 ? 1.172   -1.284  7.631   1.00 15.82  ? 586  ASP C CB    1 
ATOM   7643  C CG    . ASP C 1 278 ? -0.204  -0.631  7.710   1.00 19.36  ? 586  ASP C CG    1 
ATOM   7644  O OD1   . ASP C 1 278 ? -1.223  -1.336  7.833   1.00 17.25  ? 586  ASP C OD1   1 
ATOM   7645  O OD2   . ASP C 1 278 ? -0.255  0.614   7.628   1.00 22.56  ? 586  ASP C OD2   1 
ATOM   7646  N N     . ASP C 1 279 ? -0.766  -4.221  7.892   1.00 15.21  ? 587  ASP C N     1 
ATOM   7647  C CA    . ASP C 1 279 ? -1.684  -5.108  7.169   1.00 15.52  ? 587  ASP C CA    1 
ATOM   7648  C C     . ASP C 1 279 ? -2.926  -4.409  6.616   1.00 17.66  ? 587  ASP C C     1 
ATOM   7649  O O     . ASP C 1 279 ? -3.832  -5.057  6.103   1.00 14.35  ? 587  ASP C O     1 
ATOM   7650  C CB    . ASP C 1 279 ? -2.075  -6.349  7.998   1.00 13.39  ? 587  ASP C CB    1 
ATOM   7651  C CG    . ASP C 1 279 ? -2.938  -6.010  9.218   1.00 17.68  ? 587  ASP C CG    1 
ATOM   7652  O OD1   . ASP C 1 279 ? -3.211  -4.818  9.469   1.00 14.75  ? 587  ASP C OD1   1 
ATOM   7653  O OD2   . ASP C 1 279 ? -3.337  -6.951  9.935   1.00 14.27  ? 587  ASP C OD2   1 
ATOM   7654  N N     . GLY C 1 280 ? -2.957  -3.086  6.720   1.00 16.17  ? 588  GLY C N     1 
ATOM   7655  C CA    . GLY C 1 280 ? -4.048  -2.304  6.173   1.00 22.22  ? 588  GLY C CA    1 
ATOM   7656  C C     . GLY C 1 280 ? -5.321  -2.272  7.009   1.00 19.38  ? 588  GLY C C     1 
ATOM   7657  O O     . GLY C 1 280 ? -6.296  -1.658  6.588   1.00 20.32  ? 588  GLY C O     1 
ATOM   7658  N N     . THR C 1 281 ? -5.326  -2.912  8.179   1.00 15.81  ? 589  THR C N     1 
ATOM   7659  C CA    . THR C 1 281 ? -6.538  -2.976  9.006   1.00 14.74  ? 589  THR C CA    1 
ATOM   7660  C C     . THR C 1 281 ? -6.664  -1.809  9.990   1.00 14.48  ? 589  THR C C     1 
ATOM   7661  O O     . THR C 1 281 ? -5.678  -1.160  10.329  1.00 9.60   ? 589  THR C O     1 
ATOM   7662  C CB    . THR C 1 281 ? -6.631  -4.306  9.798   1.00 10.52  ? 589  THR C CB    1 
ATOM   7663  O OG1   . THR C 1 281 ? -5.539  -4.400  10.729  1.00 10.60  ? 589  THR C OG1   1 
ATOM   7664  C CG2   . THR C 1 281 ? -6.605  -5.500  8.842   1.00 14.58  ? 589  THR C CG2   1 
ATOM   7665  N N     . ASN C 1 282 ? -7.886  -1.556  10.457  1.00 11.42  ? 590  ASN C N     1 
ATOM   7666  C CA    . ASN C 1 282 ? -8.110  -0.487  11.428  1.00 12.19  ? 590  ASN C CA    1 
ATOM   7667  C C     . ASN C 1 282 ? -7.386  -0.705  12.752  1.00 12.50  ? 590  ASN C C     1 
ATOM   7668  O O     . ASN C 1 282 ? -7.126  0.249   13.483  1.00 10.16  ? 590  ASN C O     1 
ATOM   7669  C CB    . ASN C 1 282 ? -9.609  -0.270  11.670  1.00 10.09  ? 590  ASN C CB    1 
ATOM   7670  C CG    . ASN C 1 282 ? -10.296 0.342   10.466  1.00 18.82  ? 590  ASN C CG    1 
ATOM   7671  O OD1   . ASN C 1 282 ? -9.632  0.787   9.535   1.00 15.82  ? 590  ASN C OD1   1 
ATOM   7672  N ND2   . ASN C 1 282 ? -11.622 0.380   10.482  1.00 13.34  ? 590  ASN C ND2   1 
ATOM   7673  N N     . PHE C 1 283 ? -7.062  -1.956  13.067  1.00 10.23  ? 591  PHE C N     1 
ATOM   7674  C CA    . PHE C 1 283 ? -6.338  -2.241  14.302  1.00 11.65  ? 591  PHE C CA    1 
ATOM   7675  C C     . PHE C 1 283 ? -4.960  -1.588  14.231  1.00 10.25  ? 591  PHE C C     1 
ATOM   7676  O O     . PHE C 1 283 ? -4.479  -0.976  15.188  1.00 10.02  ? 591  PHE C O     1 
ATOM   7677  C CB    . PHE C 1 283 ? -6.203  -3.758  14.521  1.00 11.69  ? 591  PHE C CB    1 
ATOM   7678  C CG    . PHE C 1 283 ? -7.522  -4.492  14.503  1.00 10.38  ? 591  PHE C CG    1 
ATOM   7679  C CD1   . PHE C 1 283 ? -8.426  -4.344  15.538  1.00 8.88   ? 591  PHE C CD1   1 
ATOM   7680  C CD2   . PHE C 1 283 ? -7.853  -5.324  13.436  1.00 8.47   ? 591  PHE C CD2   1 
ATOM   7681  C CE1   . PHE C 1 283 ? -9.653  -5.014  15.517  1.00 8.46   ? 591  PHE C CE1   1 
ATOM   7682  C CE2   . PHE C 1 283 ? -9.067  -5.989  13.393  1.00 13.55  ? 591  PHE C CE2   1 
ATOM   7683  C CZ    . PHE C 1 283 ? -9.979  -5.836  14.435  1.00 12.01  ? 591  PHE C CZ    1 
ATOM   7684  N N     . ARG C 1 284 ? -4.332  -1.693  13.072  1.00 9.26   ? 592  ARG C N     1 
ATOM   7685  C CA    . ARG C 1 284 ? -3.010  -1.111  12.900  1.00 9.73   ? 592  ARG C CA    1 
ATOM   7686  C C     . ARG C 1 284 ? -3.114  0.424   12.819  1.00 7.68   ? 592  ARG C C     1 
ATOM   7687  O O     . ARG C 1 284 ? -2.319  1.139   13.430  1.00 13.68  ? 592  ARG C O     1 
ATOM   7688  C CB    . ARG C 1 284 ? -2.332  -1.735  11.670  1.00 11.30  ? 592  ARG C CB    1 
ATOM   7689  C CG    . ARG C 1 284 ? -1.009  -1.089  11.253  1.00 16.67  ? 592  ARG C CG    1 
ATOM   7690  C CD    . ARG C 1 284 ? 0.112   -1.370  12.243  1.00 11.18  ? 592  ARG C CD    1 
ATOM   7691  N NE    . ARG C 1 284 ? 1.423   -1.171  11.611  1.00 10.12  ? 592  ARG C NE    1 
ATOM   7692  C CZ    . ARG C 1 284 ? 2.354   -2.118  11.515  1.00 13.02  ? 592  ARG C CZ    1 
ATOM   7693  N NH1   . ARG C 1 284 ? 2.133   -3.334  12.021  1.00 10.84  ? 592  ARG C NH1   1 
ATOM   7694  N NH2   . ARG C 1 284 ? 3.509   -1.851  10.927  1.00 9.22   ? 592  ARG C NH2   1 
ATOM   7695  N N     . VAL C 1 285 ? -4.124  0.924   12.109  1.00 10.68  ? 593  VAL C N     1 
ATOM   7696  C CA    . VAL C 1 285 ? -4.383  2.364   12.053  1.00 8.46   ? 593  VAL C CA    1 
ATOM   7697  C C     . VAL C 1 285 ? -4.509  2.947   13.459  1.00 12.60  ? 593  VAL C C     1 
ATOM   7698  O O     . VAL C 1 285 ? -3.921  3.984   13.785  1.00 9.30   ? 593  VAL C O     1 
ATOM   7699  C CB    . VAL C 1 285 ? -5.691  2.686   11.275  1.00 14.34  ? 593  VAL C CB    1 
ATOM   7700  C CG1   . VAL C 1 285 ? -6.032  4.173   11.398  1.00 14.04  ? 593  VAL C CG1   1 
ATOM   7701  C CG2   . VAL C 1 285 ? -5.569  2.283   9.797   1.00 12.57  ? 593  VAL C CG2   1 
ATOM   7702  N N     . LYS C 1 286 ? -5.280  2.273   14.306  1.00 11.68  ? 594  LYS C N     1 
ATOM   7703  C CA    . LYS C 1 286 ? -5.569  2.811   15.622  1.00 9.98   ? 594  LYS C CA    1 
ATOM   7704  C C     . LYS C 1 286 ? -4.301  2.953   16.455  1.00 13.07  ? 594  LYS C C     1 
ATOM   7705  O O     . LYS C 1 286 ? -4.042  4.008   17.021  1.00 13.43  ? 594  LYS C O     1 
ATOM   7706  C CB    . LYS C 1 286 ? -6.586  1.944   16.368  1.00 10.66  ? 594  LYS C CB    1 
ATOM   7707  C CG    . LYS C 1 286 ? -7.044  2.576   17.681  1.00 13.57  ? 594  LYS C CG    1 
ATOM   7708  C CD    . LYS C 1 286 ? -7.975  1.657   18.447  1.00 12.77  ? 594  LYS C CD    1 
ATOM   7709  C CE    . LYS C 1 286 ? -8.415  2.293   19.773  1.00 17.84  ? 594  LYS C CE    1 
ATOM   7710  N NZ    . LYS C 1 286 ? -9.242  3.513   19.554  1.00 14.54  ? 594  LYS C NZ    1 
ATOM   7711  N N     . VAL C 1 287 ? -3.515  1.888   16.536  1.00 11.05  ? 595  VAL C N     1 
ATOM   7712  C CA    . VAL C 1 287 ? -2.297  1.934   17.345  1.00 11.26  ? 595  VAL C CA    1 
ATOM   7713  C C     . VAL C 1 287 ? -1.278  2.939   16.777  1.00 12.90  ? 595  VAL C C     1 
ATOM   7714  O O     . VAL C 1 287 ? -0.606  3.650   17.527  1.00 12.20  ? 595  VAL C O     1 
ATOM   7715  C CB    . VAL C 1 287 ? -1.690  0.534   17.524  1.00 15.22  ? 595  VAL C CB    1 
ATOM   7716  C CG1   . VAL C 1 287 ? -0.362  0.612   18.246  1.00 17.24  ? 595  VAL C CG1   1 
ATOM   7717  C CG2   . VAL C 1 287 ? -2.674  -0.365  18.292  1.00 16.52  ? 595  VAL C CG2   1 
ATOM   7718  N N     . MET C 1 288 ? -1.172  3.018   15.454  1.00 12.76  ? 596  MET C N     1 
ATOM   7719  C CA    . MET C 1 288 ? -0.308  4.025   14.843  1.00 17.08  ? 596  MET C CA    1 
ATOM   7720  C C     . MET C 1 288 ? -0.782  5.452   15.151  1.00 13.65  ? 596  MET C C     1 
ATOM   7721  O O     . MET C 1 288 ? 0.027   6.358   15.337  1.00 12.82  ? 596  MET C O     1 
ATOM   7722  C CB    . MET C 1 288 ? -0.194  3.806   13.331  1.00 12.37  ? 596  MET C CB    1 
ATOM   7723  C CG    . MET C 1 288 ? 0.495   2.505   12.959  1.00 17.19  ? 596  MET C CG    1 
ATOM   7724  S SD    . MET C 1 288 ? 0.647   2.299   11.174  1.00 20.30  ? 596  MET C SD    1 
ATOM   7725  C CE    . MET C 1 288 ? 1.712   3.688   10.780  1.00 41.34  ? 596  MET C CE    1 
ATOM   7726  N N     . ALA C 1 289 ? -2.094  5.650   15.220  1.00 11.03  ? 597  ALA C N     1 
ATOM   7727  C CA    . ALA C 1 289 ? -2.632  6.985   15.460  1.00 13.69  ? 597  ALA C CA    1 
ATOM   7728  C C     . ALA C 1 289 ? -2.529  7.433   16.917  1.00 12.82  ? 597  ALA C C     1 
ATOM   7729  O O     . ALA C 1 289 ? -2.396  8.626   17.187  1.00 16.03  ? 597  ALA C O     1 
ATOM   7730  C CB    . ALA C 1 289 ? -4.078  7.075   14.996  1.00 14.35  ? 597  ALA C CB    1 
ATOM   7731  N N     . GLU C 1 290 ? -2.589  6.485   17.847  1.00 9.01   ? 598  GLU C N     1 
ATOM   7732  C CA    . GLU C 1 290 ? -2.718  6.815   19.269  1.00 14.38  ? 598  GLU C CA    1 
ATOM   7733  C C     . GLU C 1 290 ? -1.437  6.658   20.105  1.00 15.67  ? 598  GLU C C     1 
ATOM   7734  O O     . GLU C 1 290 ? -1.315  7.258   21.171  1.00 16.11  ? 598  GLU C O     1 
ATOM   7735  C CB    . GLU C 1 290 ? -3.890  6.041   19.889  1.00 12.30  ? 598  GLU C CB    1 
ATOM   7736  C CG    . GLU C 1 290 ? -5.224  6.379   19.211  1.00 10.72  ? 598  GLU C CG    1 
ATOM   7737  C CD    . GLU C 1 290 ? -6.432  5.702   19.844  1.00 13.40  ? 598  GLU C CD    1 
ATOM   7738  O OE1   . GLU C 1 290 ? -6.252  4.925   20.801  1.00 16.99  ? 598  GLU C OE1   1 
ATOM   7739  O OE2   . GLU C 1 290 ? -7.572  5.950   19.377  1.00 13.72  ? 598  GLU C OE2   1 
ATOM   7740  N N     . ALA C 1 291 ? -0.479  5.866   19.643  1.00 13.36  ? 599  ALA C N     1 
ATOM   7741  C CA    . ALA C 1 291 ? 0.784   5.800   20.369  1.00 10.88  ? 599  ALA C CA    1 
ATOM   7742  C C     . ALA C 1 291 ? 1.493   7.145   20.200  1.00 18.29  ? 599  ALA C C     1 
ATOM   7743  O O     . ALA C 1 291 ? 1.291   7.841   19.198  1.00 14.33  ? 599  ALA C O     1 
ATOM   7744  C CB    . ALA C 1 291 ? 1.652   4.651   19.861  1.00 14.20  ? 599  ALA C CB    1 
ATOM   7745  N N     . ASN C 1 292 ? 2.307   7.530   21.176  1.00 13.88  ? 600  ASN C N     1 
ATOM   7746  C CA    . ASN C 1 292 ? 3.087   8.760   21.011  1.00 18.49  ? 600  ASN C CA    1 
ATOM   7747  C C     . ASN C 1 292 ? 4.090   8.606   19.874  1.00 24.46  ? 600  ASN C C     1 
ATOM   7748  O O     . ASN C 1 292 ? 4.391   9.564   19.163  1.00 18.07  ? 600  ASN C O     1 
ATOM   7749  C CB    . ASN C 1 292 ? 3.796   9.144   22.311  1.00 17.42  ? 600  ASN C CB    1 
ATOM   7750  C CG    . ASN C 1 292 ? 2.818   9.400   23.447  1.00 23.05  ? 600  ASN C CG    1 
ATOM   7751  O OD1   . ASN C 1 292 ? 2.878   8.754   24.487  1.00 17.97  ? 600  ASN C OD1   1 
ATOM   7752  N ND2   . ASN C 1 292 ? 1.902   10.339  23.241  1.00 21.77  ? 600  ASN C ND2   1 
ATOM   7753  N N     . HIS C 1 293 ? 4.600   7.387   19.707  1.00 12.61  ? 601  HIS C N     1 
ATOM   7754  C CA    . HIS C 1 293 ? 5.555   7.084   18.652  1.00 17.26  ? 601  HIS C CA    1 
ATOM   7755  C C     . HIS C 1 293 ? 5.274   5.684   18.144  1.00 18.61  ? 601  HIS C C     1 
ATOM   7756  O O     . HIS C 1 293 ? 4.989   4.784   18.930  1.00 15.67  ? 601  HIS C O     1 
ATOM   7757  C CB    . HIS C 1 293 ? 6.992   7.142   19.190  1.00 15.53  ? 601  HIS C CB    1 
ATOM   7758  C CG    . HIS C 1 293 ? 7.331   8.435   19.866  1.00 17.51  ? 601  HIS C CG    1 
ATOM   7759  N ND1   . HIS C 1 293 ? 7.622   9.586   19.166  1.00 24.34  ? 601  HIS C ND1   1 
ATOM   7760  C CD2   . HIS C 1 293 ? 7.414   8.760   21.178  1.00 16.58  ? 601  HIS C CD2   1 
ATOM   7761  C CE1   . HIS C 1 293 ? 7.871   10.564  20.020  1.00 28.14  ? 601  HIS C CE1   1 
ATOM   7762  N NE2   . HIS C 1 293 ? 7.749   10.089  21.246  1.00 24.83  ? 601  HIS C NE2   1 
ATOM   7763  N N     . PHE C 1 294 ? 5.350   5.495   16.833  1.00 13.05  ? 602  PHE C N     1 
ATOM   7764  C CA    . PHE C 1 294 ? 5.175   4.165   16.261  1.00 16.99  ? 602  PHE C CA    1 
ATOM   7765  C C     . PHE C 1 294 ? 6.348   3.890   15.333  1.00 18.91  ? 602  PHE C C     1 
ATOM   7766  O O     . PHE C 1 294 ? 6.619   4.685   14.429  1.00 18.74  ? 602  PHE C O     1 
ATOM   7767  C CB    . PHE C 1 294 ? 3.842   4.066   15.508  1.00 15.68  ? 602  PHE C CB    1 
ATOM   7768  C CG    . PHE C 1 294 ? 3.456   2.655   15.148  1.00 8.16   ? 602  PHE C CG    1 
ATOM   7769  C CD1   . PHE C 1 294 ? 2.566   1.948   15.945  1.00 9.95   ? 602  PHE C CD1   1 
ATOM   7770  C CD2   . PHE C 1 294 ? 3.984   2.038   14.028  1.00 15.82  ? 602  PHE C CD2   1 
ATOM   7771  C CE1   . PHE C 1 294 ? 2.215   0.644   15.624  1.00 17.26  ? 602  PHE C CE1   1 
ATOM   7772  C CE2   . PHE C 1 294 ? 3.633   0.740   13.699  1.00 15.04  ? 602  PHE C CE2   1 
ATOM   7773  C CZ    . PHE C 1 294 ? 2.753   0.043   14.500  1.00 16.93  ? 602  PHE C CZ    1 
ATOM   7774  N N     . ILE C 1 295 ? 7.053   2.782   15.582  1.00 13.18  ? 603  ILE C N     1 
ATOM   7775  C CA    . ILE C 1 295 ? 8.278   2.446   14.860  1.00 14.82  ? 603  ILE C CA    1 
ATOM   7776  C C     . ILE C 1 295 ? 8.117   1.098   14.165  1.00 15.71  ? 603  ILE C C     1 
ATOM   7777  O O     . ILE C 1 295 ? 7.885   0.076   14.818  1.00 15.03  ? 603  ILE C O     1 
ATOM   7778  C CB    . ILE C 1 295 ? 9.510   2.378   15.805  1.00 21.12  ? 603  ILE C CB    1 
ATOM   7779  C CG1   . ILE C 1 295 ? 9.733   3.712   16.529  1.00 16.58  ? 603  ILE C CG1   1 
ATOM   7780  C CG2   . ILE C 1 295 ? 10.774  1.998   15.030  1.00 16.72  ? 603  ILE C CG2   1 
ATOM   7781  C CD1   . ILE C 1 295 ? 8.825   3.919   17.738  1.00 17.47  ? 603  ILE C CD1   1 
ATOM   7782  N N     . ASP C 1 296 ? 8.222   1.091   12.841  1.00 17.41  ? 604  ASP C N     1 
ATOM   7783  C CA    . ASP C 1 296 ? 8.080   -0.150  12.081  1.00 19.91  ? 604  ASP C CA    1 
ATOM   7784  C C     . ASP C 1 296 ? 9.403   -0.903  12.007  1.00 16.65  ? 604  ASP C C     1 
ATOM   7785  O O     . ASP C 1 296 ? 10.209  -0.668  11.106  1.00 15.35  ? 604  ASP C O     1 
ATOM   7786  C CB    . ASP C 1 296 ? 7.570   0.144   10.667  1.00 21.77  ? 604  ASP C CB    1 
ATOM   7787  C CG    . ASP C 1 296 ? 7.269   -1.119  9.880   1.00 29.03  ? 604  ASP C CG    1 
ATOM   7788  O OD1   . ASP C 1 296 ? 7.489   -2.233  10.411  1.00 22.72  ? 604  ASP C OD1   1 
ATOM   7789  O OD2   . ASP C 1 296 ? 6.818   -0.999  8.720   1.00 26.52  ? 604  ASP C OD2   1 
ATOM   7790  N N     . LEU C 1 297 ? 9.625   -1.825  12.937  1.00 12.23  ? 605  LEU C N     1 
ATOM   7791  C CA    . LEU C 1 297 ? 10.877  -2.584  12.942  1.00 11.55  ? 605  LEU C CA    1 
ATOM   7792  C C     . LEU C 1 297 ? 10.875  -3.695  11.886  1.00 21.78  ? 605  LEU C C     1 
ATOM   7793  O O     . LEU C 1 297 ? 11.903  -4.337  11.656  1.00 17.96  ? 605  LEU C O     1 
ATOM   7794  C CB    . LEU C 1 297 ? 11.168  -3.177  14.323  1.00 15.16  ? 605  LEU C CB    1 
ATOM   7795  C CG    . LEU C 1 297 ? 11.427  -2.211  15.477  1.00 17.53  ? 605  LEU C CG    1 
ATOM   7796  C CD1   . LEU C 1 297 ? 11.730  -3.007  16.742  1.00 14.53  ? 605  LEU C CD1   1 
ATOM   7797  C CD2   . LEU C 1 297 ? 12.555  -1.244  15.152  1.00 14.52  ? 605  LEU C CD2   1 
ATOM   7798  N N     . SER C 1 298 ? 9.736   -3.926  11.236  1.00 19.54  ? 606  SER C N     1 
ATOM   7799  C CA    . SER C 1 298 ? 9.722   -4.911  10.153  1.00 23.44  ? 606  SER C CA    1 
ATOM   7800  C C     . SER C 1 298 ? 10.666  -4.440  9.048   1.00 24.88  ? 606  SER C C     1 
ATOM   7801  O O     . SER C 1 298 ? 11.170  -5.243  8.274   1.00 20.52  ? 606  SER C O     1 
ATOM   7802  C CB    . SER C 1 298 ? 8.304   -5.185  9.611   1.00 13.63  ? 606  SER C CB    1 
ATOM   7803  O OG    . SER C 1 298 ? 7.838   -4.149  8.757   1.00 17.97  ? 606  SER C OG    1 
ATOM   7804  N N     . GLN C 1 299 ? 10.925  -3.135  9.007   1.00 18.41  ? 607  GLN C N     1 
ATOM   7805  C CA    . GLN C 1 299 ? 11.804  -2.541  7.996   1.00 23.84  ? 607  GLN C CA    1 
ATOM   7806  C C     . GLN C 1 299 ? 13.276  -2.583  8.403   1.00 26.46  ? 607  GLN C C     1 
ATOM   7807  O O     . GLN C 1 299 ? 14.158  -2.170  7.641   1.00 24.67  ? 607  GLN C O     1 
ATOM   7808  C CB    . GLN C 1 299 ? 11.400  -1.088  7.737   1.00 29.28  ? 607  GLN C CB    1 
ATOM   7809  C CG    . GLN C 1 299 ? 9.945   -0.900  7.353   1.00 44.82  ? 607  GLN C CG    1 
ATOM   7810  C CD    . GLN C 1 299 ? 9.712   -1.038  5.866   1.00 65.52  ? 607  GLN C CD    1 
ATOM   7811  O OE1   . GLN C 1 299 ? 10.134  -2.014  5.247   1.00 68.51  ? 607  GLN C OE1   1 
ATOM   7812  N NE2   . GLN C 1 299 ? 9.041   -0.052  5.279   1.00 78.96  ? 607  GLN C NE2   1 
ATOM   7813  N N     . ILE C 1 300 ? 13.533  -3.070  9.610   1.00 21.78  ? 608  ILE C N     1 
ATOM   7814  C CA    . ILE C 1 300 ? 14.884  -3.128  10.155  1.00 27.21  ? 608  ILE C CA    1 
ATOM   7815  C C     . ILE C 1 300 ? 15.184  -4.564  10.593  1.00 21.59  ? 608  ILE C C     1 
ATOM   7816  O O     . ILE C 1 300 ? 15.047  -4.903  11.771  1.00 24.24  ? 608  ILE C O     1 
ATOM   7817  C CB    . ILE C 1 300 ? 15.037  -2.158  11.355  1.00 20.03  ? 608  ILE C CB    1 
ATOM   7818  C CG1   . ILE C 1 300 ? 14.540  -0.761  10.974  1.00 27.54  ? 608  ILE C CG1   1 
ATOM   7819  C CG2   . ILE C 1 300 ? 16.480  -2.090  11.830  1.00 24.13  ? 608  ILE C CG2   1 
ATOM   7820  C CD1   . ILE C 1 300 ? 14.752  0.297   12.058  1.00 23.16  ? 608  ILE C CD1   1 
ATOM   7821  N N     . PRO C 1 301 ? 15.583  -5.415  9.637   1.00 27.54  ? 609  PRO C N     1 
ATOM   7822  C CA    . PRO C 1 301 ? 15.776  -6.847  9.903   1.00 34.26  ? 609  PRO C CA    1 
ATOM   7823  C C     . PRO C 1 301 ? 16.911  -7.151  10.886  1.00 37.38  ? 609  PRO C C     1 
ATOM   7824  O O     . PRO C 1 301 ? 16.819  -8.125  11.637  1.00 28.88  ? 609  PRO C O     1 
ATOM   7825  C CB    . PRO C 1 301 ? 16.092  -7.424  8.515   1.00 43.88  ? 609  PRO C CB    1 
ATOM   7826  C CG    . PRO C 1 301 ? 16.561  -6.261  7.708   1.00 38.20  ? 609  PRO C CG    1 
ATOM   7827  C CD    . PRO C 1 301 ? 15.767  -5.092  8.213   1.00 34.22  ? 609  PRO C CD    1 
ATOM   7828  N N     . CYS C 1 302 ? 17.962  -6.337  10.885  1.00 27.72  ? 610  CYS C N     1 
ATOM   7829  C CA    . CYS C 1 302 ? 19.083  -6.568  11.792  1.00 29.90  ? 610  CYS C CA    1 
ATOM   7830  C C     . CYS C 1 302 ? 18.678  -6.312  13.243  1.00 29.91  ? 610  CYS C C     1 
ATOM   7831  O O     . CYS C 1 302 ? 18.290  -5.203  13.599  1.00 24.25  ? 610  CYS C O     1 
ATOM   7832  C CB    . CYS C 1 302 ? 20.281  -5.686  11.424  1.00 25.59  ? 610  CYS C CB    1 
ATOM   7833  S SG    . CYS C 1 302 ? 21.678  -5.900  12.547  1.00 36.42  ? 610  CYS C SG    1 
ATOM   7834  N N     . ASN C 1 303 ? 18.762  -7.339  14.078  1.00 25.53  ? 611  ASN C N     1 
ATOM   7835  C CA    . ASN C 1 303 ? 18.415  -7.183  15.487  1.00 23.32  ? 611  ASN C CA    1 
ATOM   7836  C C     . ASN C 1 303 ? 19.334  -6.214  16.230  1.00 26.34  ? 611  ASN C C     1 
ATOM   7837  O O     . ASN C 1 303 ? 18.924  -5.577  17.202  1.00 19.69  ? 611  ASN C O     1 
ATOM   7838  C CB    . ASN C 1 303 ? 18.352  -8.542  16.183  1.00 21.38  ? 611  ASN C CB    1 
ATOM   7839  C CG    . ASN C 1 303 ? 17.153  -9.357  15.738  1.00 21.18  ? 611  ASN C CG    1 
ATOM   7840  O OD1   . ASN C 1 303 ? 16.063  -8.817  15.548  1.00 27.33  ? 611  ASN C OD1   1 
ATOM   7841  N ND2   . ASN C 1 303 ? 17.350  -10.654 15.559  1.00 21.11  ? 611  ASN C ND2   1 
ATOM   7842  N N     . GLY C 1 304 ? 20.572  -6.090  15.763  1.00 22.54  ? 612  GLY C N     1 
ATOM   7843  C CA    . GLY C 1 304 ? 21.493  -5.123  16.334  1.00 26.30  ? 612  GLY C CA    1 
ATOM   7844  C C     . GLY C 1 304 ? 21.064  -3.692  16.049  1.00 29.53  ? 612  GLY C C     1 
ATOM   7845  O O     . GLY C 1 304 ? 21.004  -2.846  16.944  1.00 24.15  ? 612  GLY C O     1 
ATOM   7846  N N     . LYS C 1 305 ? 20.765  -3.410  14.789  1.00 20.20  ? 613  LYS C N     1 
ATOM   7847  C CA    . LYS C 1 305 ? 20.314  -2.076  14.418  1.00 21.16  ? 613  LYS C CA    1 
ATOM   7848  C C     . LYS C 1 305 ? 18.958  -1.771  15.050  1.00 22.84  ? 613  LYS C C     1 
ATOM   7849  O O     . LYS C 1 305 ? 18.710  -0.653  15.484  1.00 19.79  ? 613  LYS C O     1 
ATOM   7850  C CB    . LYS C 1 305 ? 20.265  -1.919  12.899  1.00 25.65  ? 613  LYS C CB    1 
ATOM   7851  C CG    . LYS C 1 305 ? 21.642  -2.043  12.238  1.00 39.51  ? 613  LYS C CG    1 
ATOM   7852  C CD    . LYS C 1 305 ? 21.562  -1.960  10.722  1.00 49.61  ? 613  LYS C CD    1 
ATOM   7853  C CE    . LYS C 1 305 ? 22.927  -2.197  10.085  1.00 61.82  ? 613  LYS C CE    1 
ATOM   7854  N NZ    . LYS C 1 305 ? 22.847  -2.204  8.597   1.00 65.29  ? 613  LYS C NZ    1 
ATOM   7855  N N     . ALA C 1 306 ? 18.081  -2.771  15.118  1.00 24.80  ? 614  ALA C N     1 
ATOM   7856  C CA    . ALA C 1 306 ? 16.773  -2.563  15.730  1.00 15.71  ? 614  ALA C CA    1 
ATOM   7857  C C     . ALA C 1 306 ? 16.902  -2.279  17.232  1.00 18.54  ? 614  ALA C C     1 
ATOM   7858  O O     . ALA C 1 306 ? 16.248  -1.382  17.752  1.00 17.02  ? 614  ALA C O     1 
ATOM   7859  C CB    . ALA C 1 306 ? 15.839  -3.755  15.465  1.00 17.80  ? 614  ALA C CB    1 
ATOM   7860  N N     . ALA C 1 307 ? 17.755  -3.034  17.923  1.00 21.81  ? 615  ALA C N     1 
ATOM   7861  C CA    . ALA C 1 307 ? 17.987  -2.794  19.347  1.00 17.87  ? 615  ALA C CA    1 
ATOM   7862  C C     . ALA C 1 307 ? 18.622  -1.420  19.581  1.00 26.91  ? 615  ALA C C     1 
ATOM   7863  O O     . ALA C 1 307 ? 18.327  -0.749  20.571  1.00 16.10  ? 615  ALA C O     1 
ATOM   7864  C CB    . ALA C 1 307 ? 18.857  -3.890  19.943  1.00 16.10  ? 615  ALA C CB    1 
ATOM   7865  N N     . ASP C 1 308 ? 19.502  -1.004  18.673  1.00 21.34  ? 616  ASP C N     1 
ATOM   7866  C CA    . ASP C 1 308 ? 20.113  0.318   18.776  1.00 17.94  ? 616  ASP C CA    1 
ATOM   7867  C C     . ASP C 1 308 ? 19.025  1.377   18.714  1.00 23.14  ? 616  ASP C C     1 
ATOM   7868  O O     . ASP C 1 308 ? 19.058  2.373   19.436  1.00 21.76  ? 616  ASP C O     1 
ATOM   7869  C CB    . ASP C 1 308 ? 21.118  0.552   17.644  1.00 22.23  ? 616  ASP C CB    1 
ATOM   7870  C CG    . ASP C 1 308 ? 22.429  -0.181  17.859  1.00 29.76  ? 616  ASP C CG    1 
ATOM   7871  O OD1   . ASP C 1 308 ? 23.269  -0.159  16.937  1.00 29.84  ? 616  ASP C OD1   1 
ATOM   7872  O OD2   . ASP C 1 308 ? 22.620  -0.776  18.943  1.00 32.35  ? 616  ASP C OD2   1 
ATOM   7873  N N     . ARG C 1 309 ? 18.056  1.152   17.837  1.00 20.89  ? 617  ARG C N     1 
ATOM   7874  C CA    . ARG C 1 309 ? 16.942  2.074   17.675  1.00 23.44  ? 617  ARG C CA    1 
ATOM   7875  C C     . ARG C 1 309 ? 16.123  2.211   18.955  1.00 21.42  ? 617  ARG C C     1 
ATOM   7876  O O     . ARG C 1 309 ? 15.785  3.321   19.374  1.00 21.47  ? 617  ARG C O     1 
ATOM   7877  C CB    . ARG C 1 309 ? 16.054  1.617   16.520  1.00 21.64  ? 617  ARG C CB    1 
ATOM   7878  C CG    . ARG C 1 309 ? 14.852  2.495   16.285  1.00 27.21  ? 617  ARG C CG    1 
ATOM   7879  C CD    . ARG C 1 309 ? 15.254  3.898   15.834  1.00 38.05  ? 617  ARG C CD    1 
ATOM   7880  N NE    . ARG C 1 309 ? 14.055  4.669   15.539  1.00 47.42  ? 617  ARG C NE    1 
ATOM   7881  C CZ    . ARG C 1 309 ? 13.425  4.629   14.373  1.00 31.09  ? 617  ARG C CZ    1 
ATOM   7882  N NH1   . ARG C 1 309 ? 13.905  3.879   13.387  1.00 28.97  ? 617  ARG C NH1   1 
ATOM   7883  N NH2   . ARG C 1 309 ? 12.330  5.348   14.190  1.00 38.75  ? 617  ARG C NH2   1 
ATOM   7884  N N     . ILE C 1 310 ? 15.798  1.079   19.570  1.00 19.49  ? 618  ILE C N     1 
ATOM   7885  C CA    . ILE C 1 310 ? 15.076  1.072   20.840  1.00 16.39  ? 618  ILE C CA    1 
ATOM   7886  C C     . ILE C 1 310 ? 15.834  1.813   21.937  1.00 22.65  ? 618  ILE C C     1 
ATOM   7887  O O     . ILE C 1 310 ? 15.254  2.616   22.676  1.00 24.04  ? 618  ILE C O     1 
ATOM   7888  C CB    . ILE C 1 310 ? 14.794  -0.371  21.301  1.00 17.12  ? 618  ILE C CB    1 
ATOM   7889  C CG1   . ILE C 1 310 ? 13.842  -1.063  20.315  1.00 14.20  ? 618  ILE C CG1   1 
ATOM   7890  C CG2   . ILE C 1 310 ? 14.217  -0.385  22.711  1.00 14.96  ? 618  ILE C CG2   1 
ATOM   7891  C CD1   . ILE C 1 310 ? 13.641  -2.566  20.600  1.00 15.09  ? 618  ILE C CD1   1 
ATOM   7892  N N     . HIS C 1 311 ? 17.132  1.543   22.042  1.00 19.70  ? 619  HIS C N     1 
ATOM   7893  C CA    . HIS C 1 311 ? 17.960  2.181   23.059  1.00 21.40  ? 619  HIS C CA    1 
ATOM   7894  C C     . HIS C 1 311 ? 18.099  3.674   22.793  1.00 21.99  ? 619  HIS C C     1 
ATOM   7895  O O     . HIS C 1 311 ? 18.115  4.487   23.715  1.00 25.00  ? 619  HIS C O     1 
ATOM   7896  C CB    . HIS C 1 311 ? 19.344  1.539   23.104  1.00 27.26  ? 619  HIS C CB    1 
ATOM   7897  C CG    . HIS C 1 311 ? 20.311  2.273   23.977  1.00 31.44  ? 619  HIS C CG    1 
ATOM   7898  N ND1   . HIS C 1 311 ? 21.284  3.106   23.470  1.00 32.11  ? 619  HIS C ND1   1 
ATOM   7899  C CD2   . HIS C 1 311 ? 20.441  2.316   25.323  1.00 24.78  ? 619  HIS C CD2   1 
ATOM   7900  C CE1   . HIS C 1 311 ? 21.982  3.622   24.467  1.00 34.08  ? 619  HIS C CE1   1 
ATOM   7901  N NE2   . HIS C 1 311 ? 21.490  3.159   25.602  1.00 29.63  ? 619  HIS C NE2   1 
ATOM   7902  N N     . GLN C 1 312 ? 18.202  4.029   21.519  1.00 22.54  ? 620  GLN C N     1 
ATOM   7903  C CA    . GLN C 1 312 ? 18.271  5.431   21.113  1.00 28.65  ? 620  GLN C CA    1 
ATOM   7904  C C     . GLN C 1 312 ? 17.008  6.194   21.539  1.00 29.41  ? 620  GLN C C     1 
ATOM   7905  O O     . GLN C 1 312 ? 17.070  7.374   21.882  1.00 25.32  ? 620  GLN C O     1 
ATOM   7906  C CB    . GLN C 1 312 ? 18.497  5.505   19.597  1.00 32.78  ? 620  GLN C CB    1 
ATOM   7907  C CG    . GLN C 1 312 ? 18.244  6.842   18.942  1.00 46.68  ? 620  GLN C CG    1 
ATOM   7908  C CD    . GLN C 1 312 ? 18.118  6.710   17.433  1.00 53.42  ? 620  GLN C CD    1 
ATOM   7909  O OE1   . GLN C 1 312 ? 18.714  5.813   16.819  1.00 35.18  ? 620  GLN C OE1   1 
ATOM   7910  N NE2   . GLN C 1 312 ? 17.325  7.589   16.827  1.00 53.26  ? 620  GLN C NE2   1 
ATOM   7911  N N     . ASP C 1 313 ? 15.865  5.513   21.543  1.00 22.51  ? 621  ASP C N     1 
ATOM   7912  C CA    . ASP C 1 313 ? 14.611  6.149   21.949  1.00 20.67  ? 621  ASP C CA    1 
ATOM   7913  C C     . ASP C 1 313 ? 14.532  6.372   23.462  1.00 21.70  ? 621  ASP C C     1 
ATOM   7914  O O     . ASP C 1 313 ? 13.648  7.072   23.944  1.00 23.58  ? 621  ASP C O     1 
ATOM   7915  C CB    . ASP C 1 313 ? 13.406  5.325   21.483  1.00 17.81  ? 621  ASP C CB    1 
ATOM   7916  C CG    . ASP C 1 313 ? 13.163  5.439   19.995  1.00 25.92  ? 621  ASP C CG    1 
ATOM   7917  O OD1   . ASP C 1 313 ? 13.567  6.460   19.402  1.00 23.16  ? 621  ASP C OD1   1 
ATOM   7918  O OD2   . ASP C 1 313 ? 12.558  4.511   19.418  1.00 27.28  ? 621  ASP C OD2   1 
ATOM   7919  N N     . GLY C 1 314 ? 15.445  5.757   24.209  1.00 18.67  ? 622  GLY C N     1 
ATOM   7920  C CA    . GLY C 1 314 ? 15.526  5.980   25.643  1.00 18.02  ? 622  GLY C CA    1 
ATOM   7921  C C     . GLY C 1 314 ? 14.532  5.189   26.479  1.00 18.02  ? 622  GLY C C     1 
ATOM   7922  O O     . GLY C 1 314 ? 14.208  5.579   27.600  1.00 18.96  ? 622  GLY C O     1 
ATOM   7923  N N     . ILE C 1 315 ? 14.064  4.064   25.948  1.00 19.76  ? 623  ILE C N     1 
ATOM   7924  C CA    . ILE C 1 315 ? 13.066  3.240   26.633  1.00 16.33  ? 623  ILE C CA    1 
ATOM   7925  C C     . ILE C 1 315 ? 13.482  2.838   28.053  1.00 18.23  ? 623  ILE C C     1 
ATOM   7926  O O     . ILE C 1 315 ? 14.590  2.323   28.262  1.00 16.86  ? 623  ILE C O     1 
ATOM   7927  C CB    . ILE C 1 315 ? 12.763  1.956   25.819  1.00 15.94  ? 623  ILE C CB    1 
ATOM   7928  C CG1   . ILE C 1 315 ? 12.272  2.317   24.413  1.00 14.14  ? 623  ILE C CG1   1 
ATOM   7929  C CG2   . ILE C 1 315 ? 11.763  1.062   26.553  1.00 18.45  ? 623  ILE C CG2   1 
ATOM   7930  C CD1   . ILE C 1 315 ? 11.155  3.345   24.398  1.00 15.04  ? 623  ILE C CD1   1 
ATOM   7931  N N     . HIS C 1 316 ? 12.584  3.056   29.018  1.00 11.59  ? 624  HIS C N     1 
ATOM   7932  C CA    . HIS C 1 316 ? 12.790  2.603   30.403  1.00 12.86  ? 624  HIS C CA    1 
ATOM   7933  C C     . HIS C 1 316 ? 12.277  1.175   30.624  1.00 19.26  ? 624  HIS C C     1 
ATOM   7934  O O     . HIS C 1 316 ? 12.950  0.336   31.238  1.00 18.36  ? 624  HIS C O     1 
ATOM   7935  C CB    . HIS C 1 316 ? 12.072  3.541   31.383  1.00 16.48  ? 624  HIS C CB    1 
ATOM   7936  C CG    . HIS C 1 316 ? 12.579  4.955   31.351  1.00 12.40  ? 624  HIS C CG    1 
ATOM   7937  N ND1   . HIS C 1 316 ? 11.889  5.981   30.740  1.00 13.98  ? 624  HIS C ND1   1 
ATOM   7938  C CD2   . HIS C 1 316 ? 13.712  5.506   31.848  1.00 22.09  ? 624  HIS C CD2   1 
ATOM   7939  C CE1   . HIS C 1 316 ? 12.578  7.104   30.859  1.00 18.55  ? 624  HIS C CE1   1 
ATOM   7940  N NE2   . HIS C 1 316 ? 13.687  6.844   31.529  1.00 16.40  ? 624  HIS C NE2   1 
ATOM   7941  N N     . ILE C 1 317 ? 11.060  0.911   30.160  1.00 15.17  ? 625  ILE C N     1 
ATOM   7942  C CA    . ILE C 1 317 ? 10.480  -0.426  30.288  1.00 12.72  ? 625  ILE C CA    1 
ATOM   7943  C C     . ILE C 1 317 ? 10.086  -0.949  28.911  1.00 15.47  ? 625  ILE C C     1 
ATOM   7944  O O     . ILE C 1 317 ? 9.248   -0.357  28.231  1.00 13.20  ? 625  ILE C O     1 
ATOM   7945  C CB    . ILE C 1 317 ? 9.240   -0.405  31.187  1.00 13.74  ? 625  ILE C CB    1 
ATOM   7946  C CG1   . ILE C 1 317 ? 9.606   0.103   32.580  1.00 14.75  ? 625  ILE C CG1   1 
ATOM   7947  C CG2   . ILE C 1 317 ? 8.591   -1.795  31.238  1.00 17.19  ? 625  ILE C CG2   1 
ATOM   7948  C CD1   . ILE C 1 317 ? 8.420   0.162   33.533  1.00 23.65  ? 625  ILE C CD1   1 
ATOM   7949  N N     . LEU C 1 318 ? 10.707  -2.043  28.494  1.00 13.87  ? 626  LEU C N     1 
ATOM   7950  C CA    . LEU C 1 318 ? 10.417  -2.628  27.194  1.00 16.46  ? 626  LEU C CA    1 
ATOM   7951  C C     . LEU C 1 318 ? 9.543   -3.851  27.420  1.00 13.34  ? 626  LEU C C     1 
ATOM   7952  O O     . LEU C 1 318 ? 9.852   -4.693  28.258  1.00 12.50  ? 626  LEU C O     1 
ATOM   7953  C CB    . LEU C 1 318 ? 11.708  -3.012  26.469  1.00 16.82  ? 626  LEU C CB    1 
ATOM   7954  C CG    . LEU C 1 318 ? 11.577  -3.338  24.973  1.00 8.45   ? 626  LEU C CG    1 
ATOM   7955  C CD1   . LEU C 1 318 ? 11.192  -2.110  24.174  1.00 10.19  ? 626  LEU C CD1   1 
ATOM   7956  C CD2   . LEU C 1 318 ? 12.870  -3.969  24.434  1.00 15.99  ? 626  LEU C CD2   1 
ATOM   7957  N N     . VAL C 1 319 ? 8.446   -3.932  26.680  1.00 11.71  ? 627  VAL C N     1 
ATOM   7958  C CA    . VAL C 1 319 ? 7.420   -4.931  26.951  1.00 12.46  ? 627  VAL C CA    1 
ATOM   7959  C C     . VAL C 1 319 ? 7.327   -5.964  25.837  1.00 14.34  ? 627  VAL C C     1 
ATOM   7960  O O     . VAL C 1 319 ? 7.041   -5.630  24.690  1.00 12.80  ? 627  VAL C O     1 
ATOM   7961  C CB    . VAL C 1 319 ? 6.050   -4.265  27.148  1.00 13.54  ? 627  VAL C CB    1 
ATOM   7962  C CG1   . VAL C 1 319 ? 4.979   -5.324  27.438  1.00 11.40  ? 627  VAL C CG1   1 
ATOM   7963  C CG2   . VAL C 1 319 ? 6.132   -3.241  28.290  1.00 11.99  ? 627  VAL C CG2   1 
ATOM   7964  N N     . ASN C 1 320 ? 7.568   -7.219  26.198  1.00 14.42  ? 628  ASN C N     1 
ATOM   7965  C CA    . ASN C 1 320 ? 7.565   -8.326  25.255  1.00 12.59  ? 628  ASN C CA    1 
ATOM   7966  C C     . ASN C 1 320 ? 6.159   -8.916  25.127  1.00 13.56  ? 628  ASN C C     1 
ATOM   7967  O O     . ASN C 1 320 ? 5.671   -9.579  26.040  1.00 12.24  ? 628  ASN C O     1 
ATOM   7968  C CB    . ASN C 1 320 ? 8.548   -9.401  25.728  1.00 15.27  ? 628  ASN C CB    1 
ATOM   7969  C CG    . ASN C 1 320 ? 8.803   -10.451 24.681  1.00 21.84  ? 628  ASN C CG    1 
ATOM   7970  O OD1   . ASN C 1 320 ? 7.984   -10.656 23.790  1.00 12.88  ? 628  ASN C OD1   1 
ATOM   7971  N ND2   . ASN C 1 320 ? 9.948   -11.120 24.775  1.00 19.43  ? 628  ASN C ND2   1 
ATOM   7972  N N     . MET C 1 321 ? 5.500   -8.648  24.003  1.00 11.98  ? 629  MET C N     1 
ATOM   7973  C CA    . MET C 1 321 ? 4.140   -9.128  23.789  1.00 4.98   ? 629  MET C CA    1 
ATOM   7974  C C     . MET C 1 321 ? 4.058   -10.414 22.962  1.00 5.94   ? 629  MET C C     1 
ATOM   7975  O O     . MET C 1 321 ? 2.964   -10.891 22.692  1.00 13.89  ? 629  MET C O     1 
ATOM   7976  C CB    . MET C 1 321 ? 3.266   -8.029  23.151  1.00 7.84   ? 629  MET C CB    1 
ATOM   7977  C CG    . MET C 1 321 ? 3.191   -6.752  23.991  1.00 8.54   ? 629  MET C CG    1 
ATOM   7978  S SD    . MET C 1 321 ? 2.479   -5.341  23.116  1.00 13.81  ? 629  MET C SD    1 
ATOM   7979  C CE    . MET C 1 321 ? 0.867   -6.041  22.729  1.00 15.98  ? 629  MET C CE    1 
ATOM   7980  N N     . ASN C 1 322 ? 5.202   -10.974 22.572  1.00 8.78   ? 630  ASN C N     1 
ATOM   7981  C CA    . ASN C 1 322 ? 5.227   -12.196 21.762  1.00 9.17   ? 630  ASN C CA    1 
ATOM   7982  C C     . ASN C 1 322 ? 5.638   -13.462 22.503  1.00 12.56  ? 630  ASN C C     1 
ATOM   7983  O O     . ASN C 1 322 ? 5.050   -14.526 22.308  1.00 9.45   ? 630  ASN C O     1 
ATOM   7984  C CB    . ASN C 1 322 ? 6.186   -12.036 20.577  1.00 9.01   ? 630  ASN C CB    1 
ATOM   7985  C CG    . ASN C 1 322 ? 5.525   -11.400 19.377  1.00 16.45  ? 630  ASN C CG    1 
ATOM   7986  O OD1   . ASN C 1 322 ? 5.536   -10.187 19.228  1.00 15.12  ? 630  ASN C OD1   1 
ATOM   7987  N ND2   . ASN C 1 322 ? 4.937   -12.222 18.516  1.00 12.47  ? 630  ASN C ND2   1 
ATOM   7988  N N     . GLY C 1 323 ? 6.680   -13.372 23.318  1.00 14.64  ? 631  GLY C N     1 
ATOM   7989  C CA    . GLY C 1 323 ? 7.283   -14.594 23.824  1.00 14.90  ? 631  GLY C CA    1 
ATOM   7990  C C     . GLY C 1 323 ? 7.614   -15.495 22.638  1.00 20.75  ? 631  GLY C C     1 
ATOM   7991  O O     . GLY C 1 323 ? 8.058   -15.015 21.580  1.00 12.58  ? 631  GLY C O     1 
ATOM   7992  N N     . TYR C 1 324 ? 7.387   -16.796 22.794  1.00 9.91   ? 632  TYR C N     1 
ATOM   7993  C CA    . TYR C 1 324 ? 7.690   -17.737 21.729  1.00 12.23  ? 632  TYR C CA    1 
ATOM   7994  C C     . TYR C 1 324 ? 6.493   -17.972 20.806  1.00 9.50   ? 632  TYR C C     1 
ATOM   7995  O O     . TYR C 1 324 ? 6.020   -19.089 20.675  1.00 16.31  ? 632  TYR C O     1 
ATOM   7996  C CB    . TYR C 1 324 ? 8.258   -19.040 22.317  1.00 18.87  ? 632  TYR C CB    1 
ATOM   7997  C CG    . TYR C 1 324 ? 9.423   -18.736 23.235  1.00 21.26  ? 632  TYR C CG    1 
ATOM   7998  C CD1   . TYR C 1 324 ? 10.561  -18.102 22.744  1.00 17.49  ? 632  TYR C CD1   1 
ATOM   7999  C CD2   . TYR C 1 324 ? 9.371   -19.033 24.594  1.00 13.64  ? 632  TYR C CD2   1 
ATOM   8000  C CE1   . TYR C 1 324 ? 11.621  -17.792 23.574  1.00 20.33  ? 632  TYR C CE1   1 
ATOM   8001  C CE2   . TYR C 1 324 ? 10.434  -18.732 25.434  1.00 14.03  ? 632  TYR C CE2   1 
ATOM   8002  C CZ    . TYR C 1 324 ? 11.557  -18.115 24.914  1.00 14.17  ? 632  TYR C CZ    1 
ATOM   8003  O OH    . TYR C 1 324 ? 12.612  -17.787 25.728  1.00 12.67  ? 632  TYR C OH    1 
ATOM   8004  N N     . THR C 1 325 ? 6.033   -16.894 20.160  1.00 16.81  ? 633  THR C N     1 
ATOM   8005  C CA    . THR C 1 325 ? 4.950   -16.953 19.173  1.00 8.70   ? 633  THR C CA    1 
ATOM   8006  C C     . THR C 1 325 ? 5.373   -16.361 17.827  1.00 10.63  ? 633  THR C C     1 
ATOM   8007  O O     . THR C 1 325 ? 6.377   -15.634 17.728  1.00 15.54  ? 633  THR C O     1 
ATOM   8008  C CB    . THR C 1 325 ? 3.687   -16.203 19.632  1.00 17.87  ? 633  THR C CB    1 
ATOM   8009  O OG1   . THR C 1 325 ? 4.019   -14.842 19.927  1.00 12.72  ? 633  THR C OG1   1 
ATOM   8010  C CG2   . THR C 1 325 ? 3.015   -16.887 20.855  1.00 7.78   ? 633  THR C CG2   1 
ATOM   8011  N N     . LYS C 1 326 ? 4.594   -16.671 16.793  1.00 14.70  ? 634  LYS C N     1 
ATOM   8012  C CA    . LYS C 1 326 ? 4.936   -16.302 15.426  1.00 13.46  ? 634  LYS C CA    1 
ATOM   8013  C C     . LYS C 1 326 ? 5.292   -14.816 15.296  1.00 17.47  ? 634  LYS C C     1 
ATOM   8014  O O     . LYS C 1 326 ? 4.560   -13.937 15.766  1.00 15.15  ? 634  LYS C O     1 
ATOM   8015  C CB    . LYS C 1 326 ? 3.786   -16.659 14.468  1.00 14.92  ? 634  LYS C CB    1 
ATOM   8016  C CG    . LYS C 1 326 ? 4.085   -16.306 13.009  1.00 18.61  ? 634  LYS C CG    1 
ATOM   8017  C CD    . LYS C 1 326 ? 2.840   -16.417 12.140  1.00 22.03  ? 634  LYS C CD    1 
ATOM   8018  C CE    . LYS C 1 326 ? 3.154   -16.100 10.684  1.00 41.85  ? 634  LYS C CE    1 
ATOM   8019  N NZ    . LYS C 1 326 ? 1.929   -16.141 9.841   1.00 53.02  ? 634  LYS C NZ    1 
ATOM   8020  N N     . GLY C 1 327 ? 6.418   -14.536 14.656  1.00 18.47  ? 635  GLY C N     1 
ATOM   8021  C CA    . GLY C 1 327 ? 6.810   -13.163 14.390  1.00 16.19  ? 635  GLY C CA    1 
ATOM   8022  C C     . GLY C 1 327 ? 7.702   -12.573 15.466  1.00 16.92  ? 635  GLY C C     1 
ATOM   8023  O O     . GLY C 1 327 ? 8.170   -11.442 15.337  1.00 16.10  ? 635  GLY C O     1 
ATOM   8024  N N     . ALA C 1 328 ? 7.943   -13.332 16.530  1.00 11.48  ? 636  ALA C N     1 
ATOM   8025  C CA    . ALA C 1 328 ? 8.790   -12.845 17.621  1.00 12.02  ? 636  ALA C CA    1 
ATOM   8026  C C     . ALA C 1 328 ? 10.204  -12.517 17.174  1.00 17.04  ? 636  ALA C C     1 
ATOM   8027  O O     . ALA C 1 328 ? 10.755  -13.158 16.269  1.00 14.44  ? 636  ALA C O     1 
ATOM   8028  C CB    . ALA C 1 328 ? 8.854   -13.849 18.744  1.00 13.27  ? 636  ALA C CB    1 
ATOM   8029  N N     . ARG C 1 329 ? 10.785  -11.526 17.841  1.00 11.37  ? 637  ARG C N     1 
ATOM   8030  C CA    . ARG C 1 329 ? 12.205  -11.212 17.716  1.00 16.53  ? 637  ARG C CA    1 
ATOM   8031  C C     . ARG C 1 329 ? 12.794  -11.010 19.106  1.00 19.17  ? 637  ARG C C     1 
ATOM   8032  O O     . ARG C 1 329 ? 13.185  -9.910  19.486  1.00 14.10  ? 637  ARG C O     1 
ATOM   8033  C CB    . ARG C 1 329 ? 12.414  -9.982  16.835  1.00 18.62  ? 637  ARG C CB    1 
ATOM   8034  C CG    . ARG C 1 329 ? 12.109  -10.261 15.370  1.00 20.91  ? 637  ARG C CG    1 
ATOM   8035  C CD    . ARG C 1 329 ? 12.118  -9.003  14.530  1.00 21.36  ? 637  ARG C CD    1 
ATOM   8036  N NE    . ARG C 1 329 ? 13.429  -8.359  14.516  1.00 19.64  ? 637  ARG C NE    1 
ATOM   8037  C CZ    . ARG C 1 329 ? 13.707  -7.250  13.836  1.00 16.79  ? 637  ARG C CZ    1 
ATOM   8038  N NH1   . ARG C 1 329 ? 12.773  -6.667  13.100  1.00 17.92  ? 637  ARG C NH1   1 
ATOM   8039  N NH2   . ARG C 1 329 ? 14.923  -6.729  13.886  1.00 21.83  ? 637  ARG C NH2   1 
ATOM   8040  N N     . ASN C 1 330 ? 12.850  -12.097 19.864  1.00 13.58  ? 638  ASN C N     1 
ATOM   8041  C CA    . ASN C 1 330 ? 13.293  -12.036 21.243  1.00 13.52  ? 638  ASN C CA    1 
ATOM   8042  C C     . ASN C 1 330 ? 14.772  -11.697 21.366  1.00 15.76  ? 638  ASN C C     1 
ATOM   8043  O O     . ASN C 1 330 ? 15.241  -11.322 22.435  1.00 18.54  ? 638  ASN C O     1 
ATOM   8044  C CB    . ASN C 1 330 ? 12.916  -13.332 21.961  1.00 14.55  ? 638  ASN C CB    1 
ATOM   8045  C CG    . ASN C 1 330 ? 11.411  -13.504 22.056  1.00 15.61  ? 638  ASN C CG    1 
ATOM   8046  O OD1   . ASN C 1 330 ? 10.712  -12.599 22.497  1.00 16.77  ? 638  ASN C OD1   1 
ATOM   8047  N ND2   . ASN C 1 330 ? 10.904  -14.647 21.614  1.00 15.82  ? 638  ASN C ND2   1 
ATOM   8048  N N     . GLU C 1 331 ? 15.491  -11.801 20.251  1.00 15.67  ? 639  GLU C N     1 
ATOM   8049  C CA    . GLU C 1 331 ? 16.866  -11.321 20.174  1.00 16.57  ? 639  GLU C CA    1 
ATOM   8050  C C     . GLU C 1 331 ? 16.945  -9.857  20.613  1.00 20.64  ? 639  GLU C C     1 
ATOM   8051  O O     . GLU C 1 331 ? 17.929  -9.427  21.218  1.00 18.64  ? 639  GLU C O     1 
ATOM   8052  C CB    . GLU C 1 331 ? 17.398  -11.457 18.744  1.00 25.17  ? 639  GLU C CB    1 
ATOM   8053  C CG    . GLU C 1 331 ? 17.700  -12.882 18.300  1.00 25.75  ? 639  GLU C CG    1 
ATOM   8054  C CD    . GLU C 1 331 ? 16.457  -13.717 18.037  1.00 30.97  ? 639  GLU C CD    1 
ATOM   8055  O OE1   . GLU C 1 331 ? 16.595  -14.957 17.964  1.00 43.13  ? 639  GLU C OE1   1 
ATOM   8056  O OE2   . GLU C 1 331 ? 15.349  -13.147 17.899  1.00 21.04  ? 639  GLU C OE2   1 
ATOM   8057  N N     . LEU C 1 332 ? 15.904  -9.091  20.300  1.00 18.39  ? 640  LEU C N     1 
ATOM   8058  C CA    . LEU C 1 332 ? 15.855  -7.685  20.694  1.00 17.25  ? 640  LEU C CA    1 
ATOM   8059  C C     . LEU C 1 332 ? 15.955  -7.545  22.200  1.00 20.15  ? 640  LEU C C     1 
ATOM   8060  O O     . LEU C 1 332 ? 16.652  -6.666  22.697  1.00 19.42  ? 640  LEU C O     1 
ATOM   8061  C CB    . LEU C 1 332 ? 14.566  -7.016  20.206  1.00 13.03  ? 640  LEU C CB    1 
ATOM   8062  C CG    . LEU C 1 332 ? 14.390  -6.948  18.692  1.00 17.46  ? 640  LEU C CG    1 
ATOM   8063  C CD1   . LEU C 1 332 ? 12.956  -6.556  18.337  1.00 15.49  ? 640  LEU C CD1   1 
ATOM   8064  C CD2   . LEU C 1 332 ? 15.391  -5.978  18.094  1.00 19.72  ? 640  LEU C CD2   1 
ATOM   8065  N N     . PHE C 1 333 ? 15.248  -8.412  22.924  1.00 18.90  ? 641  PHE C N     1 
ATOM   8066  C CA    . PHE C 1 333 ? 15.298  -8.403  24.385  1.00 16.43  ? 641  PHE C CA    1 
ATOM   8067  C C     . PHE C 1 333 ? 16.591  -9.017  24.929  1.00 22.34  ? 641  PHE C C     1 
ATOM   8068  O O     . PHE C 1 333 ? 17.108  -8.581  25.962  1.00 16.02  ? 641  PHE C O     1 
ATOM   8069  C CB    . PHE C 1 333 ? 14.064  -9.088  24.974  1.00 15.17  ? 641  PHE C CB    1 
ATOM   8070  C CG    . PHE C 1 333 ? 12.783  -8.338  24.712  1.00 19.53  ? 641  PHE C CG    1 
ATOM   8071  C CD1   . PHE C 1 333 ? 12.263  -7.481  25.666  1.00 12.58  ? 641  PHE C CD1   1 
ATOM   8072  C CD2   . PHE C 1 333 ? 12.122  -8.465  23.497  1.00 15.98  ? 641  PHE C CD2   1 
ATOM   8073  C CE1   . PHE C 1 333 ? 11.089  -6.766  25.423  1.00 10.30  ? 641  PHE C CE1   1 
ATOM   8074  C CE2   . PHE C 1 333 ? 10.943  -7.769  23.255  1.00 16.97  ? 641  PHE C CE2   1 
ATOM   8075  C CZ    . PHE C 1 333 ? 10.436  -6.909  24.221  1.00 13.74  ? 641  PHE C CZ    1 
ATOM   8076  N N     . ALA C 1 334 ? 17.121  -10.016 24.228  1.00 16.14  ? 642  ALA C N     1 
ATOM   8077  C CA    . ALA C 1 334 ? 18.398  -10.608 24.619  1.00 15.18  ? 642  ALA C CA    1 
ATOM   8078  C C     . ALA C 1 334 ? 19.524  -9.580  24.588  1.00 21.75  ? 642  ALA C C     1 
ATOM   8079  O O     . ALA C 1 334 ? 20.498  -9.700  25.332  1.00 16.24  ? 642  ALA C O     1 
ATOM   8080  C CB    . ALA C 1 334 ? 18.737  -11.798 23.730  1.00 17.42  ? 642  ALA C CB    1 
ATOM   8081  N N     . LEU C 1 335 ? 19.398  -8.582  23.717  1.00 15.97  ? 643  LEU C N     1 
ATOM   8082  C CA    . LEU C 1 335 ? 20.362  -7.477  23.663  1.00 19.93  ? 643  LEU C CA    1 
ATOM   8083  C C     . LEU C 1 335 ? 20.210  -6.481  24.812  1.00 23.70  ? 643  LEU C C     1 
ATOM   8084  O O     . LEU C 1 335 ? 21.085  -5.641  25.021  1.00 21.64  ? 643  LEU C O     1 
ATOM   8085  C CB    . LEU C 1 335 ? 20.290  -6.750  22.313  1.00 16.60  ? 643  LEU C CB    1 
ATOM   8086  C CG    . LEU C 1 335 ? 20.940  -7.509  21.153  1.00 21.91  ? 643  LEU C CG    1 
ATOM   8087  C CD1   . LEU C 1 335 ? 20.413  -7.009  19.816  1.00 23.85  ? 643  LEU C CD1   1 
ATOM   8088  C CD2   . LEU C 1 335 ? 22.462  -7.398  21.226  1.00 23.02  ? 643  LEU C CD2   1 
ATOM   8089  N N     . ARG C 1 336 ? 19.100  -6.577  25.546  1.00 17.66  ? 644  ARG C N     1 
ATOM   8090  C CA    . ARG C 1 336 ? 18.851  -5.729  26.712  1.00 13.74  ? 644  ARG C CA    1 
ATOM   8091  C C     . ARG C 1 336 ? 19.036  -4.217  26.466  1.00 24.00  ? 644  ARG C C     1 
ATOM   8092  O O     . ARG C 1 336 ? 19.833  -3.563  27.147  1.00 23.86  ? 644  ARG C O     1 
ATOM   8093  C CB    . ARG C 1 336 ? 19.719  -6.176  27.897  1.00 19.54  ? 644  ARG C CB    1 
ATOM   8094  C CG    . ARG C 1 336 ? 19.262  -7.470  28.557  1.00 25.85  ? 644  ARG C CG    1 
ATOM   8095  C CD    . ARG C 1 336 ? 20.241  -7.899  29.646  1.00 42.96  ? 644  ARG C CD    1 
ATOM   8096  N NE    . ARG C 1 336 ? 19.987  -9.256  30.123  1.00 56.54  ? 644  ARG C NE    1 
ATOM   8097  C CZ    . ARG C 1 336 ? 20.654  -9.837  31.118  1.00 59.58  ? 644  ARG C CZ    1 
ATOM   8098  N NH1   . ARG C 1 336 ? 21.618  -9.178  31.748  1.00 73.85  ? 644  ARG C NH1   1 
ATOM   8099  N NH2   . ARG C 1 336 ? 20.356  -11.075 31.484  1.00 43.73  ? 644  ARG C NH2   1 
ATOM   8100  N N     . PRO C 1 337 ? 18.299  -3.655  25.493  1.00 19.96  ? 645  PRO C N     1 
ATOM   8101  C CA    . PRO C 1 337 ? 18.372  -2.210  25.220  1.00 19.43  ? 645  PRO C CA    1 
ATOM   8102  C C     . PRO C 1 337 ? 17.698  -1.355  26.298  1.00 21.67  ? 645  PRO C C     1 
ATOM   8103  O O     . PRO C 1 337 ? 17.835  -0.127  26.273  1.00 23.60  ? 645  PRO C O     1 
ATOM   8104  C CB    . PRO C 1 337 ? 17.610  -2.063  23.896  1.00 18.32  ? 645  PRO C CB    1 
ATOM   8105  C CG    . PRO C 1 337 ? 16.658  -3.244  23.888  1.00 13.60  ? 645  PRO C CG    1 
ATOM   8106  C CD    . PRO C 1 337 ? 17.429  -4.361  24.534  1.00 21.15  ? 645  PRO C CD    1 
ATOM   8107  N N     . ALA C 1 338 ? 16.972  -1.987  27.217  1.00 15.51  ? 646  ALA C N     1 
ATOM   8108  C CA    . ALA C 1 338 ? 16.263  -1.255  28.268  1.00 20.35  ? 646  ALA C CA    1 
ATOM   8109  C C     . ALA C 1 338 ? 16.567  -1.851  29.638  1.00 22.57  ? 646  ALA C C     1 
ATOM   8110  O O     . ALA C 1 338 ? 16.829  -3.046  29.750  1.00 20.21  ? 646  ALA C O     1 
ATOM   8111  C CB    . ALA C 1 338 ? 14.751  -1.265  28.002  1.00 21.23  ? 646  ALA C CB    1 
ATOM   8112  N N     . PRO C 1 339 ? 16.521  -1.018  30.692  1.00 22.28  ? 647  PRO C N     1 
ATOM   8113  C CA    . PRO C 1 339 ? 16.889  -1.491  32.035  1.00 21.87  ? 647  PRO C CA    1 
ATOM   8114  C C     . PRO C 1 339 ? 15.856  -2.418  32.668  1.00 21.32  ? 647  PRO C C     1 
ATOM   8115  O O     . PRO C 1 339 ? 16.197  -3.166  33.574  1.00 19.39  ? 647  PRO C O     1 
ATOM   8116  C CB    . PRO C 1 339 ? 17.011  -0.195  32.843  1.00 21.24  ? 647  PRO C CB    1 
ATOM   8117  C CG    . PRO C 1 339 ? 16.100  0.781   32.115  1.00 21.55  ? 647  PRO C CG    1 
ATOM   8118  C CD    . PRO C 1 339 ? 16.257  0.435   30.662  1.00 19.67  ? 647  PRO C CD    1 
ATOM   8119  N N     . ILE C 1 340 ? 14.614  -2.364  32.199  1.00 18.37  ? 648  ILE C N     1 
ATOM   8120  C CA    . ILE C 1 340 ? 13.560  -3.229  32.715  1.00 19.30  ? 648  ILE C CA    1 
ATOM   8121  C C     . ILE C 1 340 ? 12.783  -3.824  31.551  1.00 19.21  ? 648  ILE C C     1 
ATOM   8122  O O     . ILE C 1 340 ? 12.263  -3.091  30.703  1.00 17.88  ? 648  ILE C O     1 
ATOM   8123  C CB    . ILE C 1 340 ? 12.549  -2.449  33.583  1.00 18.49  ? 648  ILE C CB    1 
ATOM   8124  C CG1   . ILE C 1 340 ? 13.250  -1.763  34.759  1.00 18.19  ? 648  ILE C CG1   1 
ATOM   8125  C CG2   . ILE C 1 340 ? 11.430  -3.392  34.056  1.00 15.81  ? 648  ILE C CG2   1 
ATOM   8126  C CD1   . ILE C 1 340 ? 12.393  -0.714  35.469  1.00 24.01  ? 648  ILE C CD1   1 
ATOM   8127  N N     . GLN C 1 341 ? 12.696  -5.146  31.508  1.00 16.18  ? 649  GLN C N     1 
ATOM   8128  C CA    . GLN C 1 341 ? 11.991  -5.812  30.423  1.00 13.58  ? 649  GLN C CA    1 
ATOM   8129  C C     . GLN C 1 341 ? 10.959  -6.787  30.992  1.00 19.32  ? 649  GLN C C     1 
ATOM   8130  O O     . GLN C 1 341 ? 11.274  -7.605  31.844  1.00 15.89  ? 649  GLN C O     1 
ATOM   8131  C CB    . GLN C 1 341 ? 13.000  -6.479  29.480  1.00 16.38  ? 649  GLN C CB    1 
ATOM   8132  C CG    . GLN C 1 341 ? 14.140  -5.511  29.106  1.00 14.34  ? 649  GLN C CG    1 
ATOM   8133  C CD    . GLN C 1 341 ? 15.041  -5.998  27.979  1.00 19.54  ? 649  GLN C CD    1 
ATOM   8134  O OE1   . GLN C 1 341 ? 15.469  -5.205  27.138  1.00 15.23  ? 649  GLN C OE1   1 
ATOM   8135  N NE2   . GLN C 1 341 ? 15.365  -7.296  27.978  1.00 14.85  ? 649  GLN C NE2   1 
ATOM   8136  N N     . ALA C 1 342 ? 9.716   -6.664  30.535  1.00 13.47  ? 650  ALA C N     1 
ATOM   8137  C CA    . ALA C 1 342 ? 8.605   -7.406  31.122  1.00 11.18  ? 650  ALA C CA    1 
ATOM   8138  C C     . ALA C 1 342 ? 7.825   -8.174  30.059  1.00 15.05  ? 650  ALA C C     1 
ATOM   8139  O O     . ALA C 1 342 ? 7.593   -7.656  28.964  1.00 11.82  ? 650  ALA C O     1 
ATOM   8140  C CB    . ALA C 1 342 ? 7.668   -6.435  31.866  1.00 14.77  ? 650  ALA C CB    1 
ATOM   8141  N N     . MET C 1 343 ? 7.425   -9.403  30.387  1.00 9.69   ? 651  MET C N     1 
ATOM   8142  C CA    . MET C 1 343 ? 6.499   -10.170 29.557  1.00 11.61  ? 651  MET C CA    1 
ATOM   8143  C C     . MET C 1 343 ? 5.073   -9.714  29.827  1.00 14.58  ? 651  MET C C     1 
ATOM   8144  O O     . MET C 1 343 ? 4.674   -9.574  30.986  1.00 13.89  ? 651  MET C O     1 
ATOM   8145  C CB    . MET C 1 343 ? 6.617   -11.667 29.878  1.00 8.31   ? 651  MET C CB    1 
ATOM   8146  C CG    . MET C 1 343 ? 8.042   -12.215 29.680  1.00 10.35  ? 651  MET C CG    1 
ATOM   8147  S SD    . MET C 1 343 ? 8.427   -12.429 27.935  1.00 16.13  ? 651  MET C SD    1 
ATOM   8148  C CE    . MET C 1 343 ? 7.143   -13.609 27.504  1.00 11.32  ? 651  MET C CE    1 
ATOM   8149  N N     . TRP C 1 344 ? 4.294   -9.497  28.770  1.00 14.63  ? 652  TRP C N     1 
ATOM   8150  C CA    . TRP C 1 344 ? 2.911   -9.052  28.953  1.00 9.07   ? 652  TRP C CA    1 
ATOM   8151  C C     . TRP C 1 344 ? 1.941   -9.561  27.890  1.00 12.36  ? 652  TRP C C     1 
ATOM   8152  O O     . TRP C 1 344 ? 2.104   -9.290  26.698  1.00 10.74  ? 652  TRP C O     1 
ATOM   8153  C CB    . TRP C 1 344 ? 2.840   -7.517  29.013  1.00 8.97   ? 652  TRP C CB    1 
ATOM   8154  C CG    . TRP C 1 344 ? 1.431   -6.951  29.115  1.00 13.76  ? 652  TRP C CG    1 
ATOM   8155  C CD1   . TRP C 1 344 ? 0.524   -7.160  30.122  1.00 13.23  ? 652  TRP C CD1   1 
ATOM   8156  C CD2   . TRP C 1 344 ? 0.792   -6.067  28.178  1.00 9.35   ? 652  TRP C CD2   1 
ATOM   8157  N NE1   . TRP C 1 344 ? -0.645  -6.463  29.859  1.00 11.98  ? 652  TRP C NE1   1 
ATOM   8158  C CE2   . TRP C 1 344 ? -0.499  -5.786  28.675  1.00 9.42   ? 652  TRP C CE2   1 
ATOM   8159  C CE3   . TRP C 1 344 ? 1.189   -5.490  26.964  1.00 11.63  ? 652  TRP C CE3   1 
ATOM   8160  C CZ2   . TRP C 1 344 ? -1.395  -4.953  28.002  1.00 11.49  ? 652  TRP C CZ2   1 
ATOM   8161  C CZ3   . TRP C 1 344 ? 0.295   -4.660  26.298  1.00 16.02  ? 652  TRP C CZ3   1 
ATOM   8162  C CH2   . TRP C 1 344 ? -0.977  -4.397  26.821  1.00 14.36  ? 652  TRP C CH2   1 
ATOM   8163  N N     . LEU C 1 345 ? 0.957   -10.325 28.349  1.00 8.30   ? 653  LEU C N     1 
ATOM   8164  C CA    . LEU C 1 345 ? -0.312  -10.540 27.649  1.00 10.98  ? 653  LEU C CA    1 
ATOM   8165  C C     . LEU C 1 345 ? -0.281  -11.514 26.466  1.00 12.16  ? 653  LEU C C     1 
ATOM   8166  O O     . LEU C 1 345 ? -1.145  -12.373 26.356  1.00 12.34  ? 653  LEU C O     1 
ATOM   8167  C CB    . LEU C 1 345 ? -0.952  -9.199  27.231  1.00 9.86   ? 653  LEU C CB    1 
ATOM   8168  C CG    . LEU C 1 345 ? -2.411  -9.298  26.752  1.00 13.01  ? 653  LEU C CG    1 
ATOM   8169  C CD1   . LEU C 1 345 ? -3.329  -9.831  27.877  1.00 10.58  ? 653  LEU C CD1   1 
ATOM   8170  C CD2   . LEU C 1 345 ? -2.942  -7.979  26.184  1.00 13.58  ? 653  LEU C CD2   1 
ATOM   8171  N N     . GLY C 1 346 ? 0.683   -11.372 25.570  1.00 10.57  ? 654  GLY C N     1 
ATOM   8172  C CA    . GLY C 1 346 ? 0.689   -12.192 24.367  1.00 11.19  ? 654  GLY C CA    1 
ATOM   8173  C C     . GLY C 1 346 ? 1.076   -13.650 24.578  1.00 14.67  ? 654  GLY C C     1 
ATOM   8174  O O     . GLY C 1 346 ? 0.612   -14.532 23.857  1.00 16.99  ? 654  GLY C O     1 
ATOM   8175  N N     . TYR C 1 347 ? 1.929   -13.908 25.567  1.00 8.94   ? 655  TYR C N     1 
ATOM   8176  C CA    . TYR C 1 347 ? 2.494   -15.236 25.763  1.00 10.58  ? 655  TYR C CA    1 
ATOM   8177  C C     . TYR C 1 347 ? 2.101   -15.822 27.128  1.00 11.61  ? 655  TYR C C     1 
ATOM   8178  O O     . TYR C 1 347 ? 2.488   -15.288 28.163  1.00 12.97  ? 655  TYR C O     1 
ATOM   8179  C CB    . TYR C 1 347 ? 4.013   -15.174 25.659  1.00 7.37   ? 655  TYR C CB    1 
ATOM   8180  C CG    . TYR C 1 347 ? 4.628   -16.542 25.637  1.00 18.02  ? 655  TYR C CG    1 
ATOM   8181  C CD1   . TYR C 1 347 ? 4.501   -17.357 24.517  1.00 11.69  ? 655  TYR C CD1   1 
ATOM   8182  C CD2   . TYR C 1 347 ? 5.308   -17.034 26.742  1.00 11.38  ? 655  TYR C CD2   1 
ATOM   8183  C CE1   . TYR C 1 347 ? 5.047   -18.622 24.495  1.00 14.58  ? 655  TYR C CE1   1 
ATOM   8184  C CE2   . TYR C 1 347 ? 5.855   -18.303 26.738  1.00 13.07  ? 655  TYR C CE2   1 
ATOM   8185  C CZ    . TYR C 1 347 ? 5.723   -19.092 25.610  1.00 13.28  ? 655  TYR C CZ    1 
ATOM   8186  O OH    . TYR C 1 347 ? 6.262   -20.357 25.596  1.00 20.61  ? 655  TYR C OH    1 
ATOM   8187  N N     . PRO C 1 348 ? 1.347   -16.932 27.126  1.00 15.12  ? 656  PRO C N     1 
ATOM   8188  C CA    . PRO C 1 348 ? 0.818   -17.503 28.371  1.00 15.55  ? 656  PRO C CA    1 
ATOM   8189  C C     . PRO C 1 348 ? 1.752   -18.533 29.007  1.00 15.44  ? 656  PRO C C     1 
ATOM   8190  O O     . PRO C 1 348 ? 1.373   -19.687 29.200  1.00 15.51  ? 656  PRO C O     1 
ATOM   8191  C CB    . PRO C 1 348 ? -0.475  -18.167 27.910  1.00 10.44  ? 656  PRO C CB    1 
ATOM   8192  C CG    . PRO C 1 348 ? -0.139  -18.657 26.527  1.00 16.57  ? 656  PRO C CG    1 
ATOM   8193  C CD    . PRO C 1 348 ? 0.807   -17.613 25.936  1.00 14.05  ? 656  PRO C CD    1 
ATOM   8194  N N     . GLY C 1 349 ? 2.964   -18.109 29.330  1.00 11.30  ? 657  GLY C N     1 
ATOM   8195  C CA    . GLY C 1 349 ? 3.920   -18.970 30.013  1.00 11.13  ? 657  GLY C CA    1 
ATOM   8196  C C     . GLY C 1 349 ? 5.190   -18.206 30.307  1.00 15.28  ? 657  GLY C C     1 
ATOM   8197  O O     . GLY C 1 349 ? 5.302   -17.023 29.957  1.00 13.05  ? 657  GLY C O     1 
ATOM   8198  N N     . THR C 1 350 ? 6.148   -18.862 30.957  1.00 14.21  ? 658  THR C N     1 
ATOM   8199  C CA    . THR C 1 350 ? 7.412   -18.204 31.249  1.00 21.47  ? 658  THR C CA    1 
ATOM   8200  C C     . THR C 1 350 ? 8.297   -18.162 30.010  1.00 14.95  ? 658  THR C C     1 
ATOM   8201  O O     . THR C 1 350 ? 8.269   -19.068 29.180  1.00 14.81  ? 658  THR C O     1 
ATOM   8202  C CB    . THR C 1 350 ? 8.166   -18.875 32.418  1.00 8.38   ? 658  THR C CB    1 
ATOM   8203  O OG1   . THR C 1 350 ? 9.338   -18.120 32.739  1.00 19.46  ? 658  THR C OG1   1 
ATOM   8204  C CG2   . THR C 1 350 ? 8.579   -20.308 32.060  1.00 16.18  ? 658  THR C CG2   1 
ATOM   8205  N N     . SER C 1 351 ? 9.070   -17.092 29.877  1.00 10.49  ? 659  SER C N     1 
ATOM   8206  C CA    . SER C 1 351 ? 10.077  -17.023 28.832  1.00 16.62  ? 659  SER C CA    1 
ATOM   8207  C C     . SER C 1 351 ? 11.263  -17.904 29.205  1.00 15.79  ? 659  SER C C     1 
ATOM   8208  O O     . SER C 1 351 ? 12.053  -18.291 28.348  1.00 13.52  ? 659  SER C O     1 
ATOM   8209  C CB    . SER C 1 351 ? 10.570  -15.591 28.675  1.00 14.62  ? 659  SER C CB    1 
ATOM   8210  O OG    . SER C 1 351 ? 11.413  -15.232 29.760  1.00 17.91  ? 659  SER C OG    1 
ATOM   8211  N N     . GLY C 1 352 ? 11.392  -18.204 30.493  1.00 14.97  ? 660  GLY C N     1 
ATOM   8212  C CA    . GLY C 1 352 ? 12.511  -18.997 30.977  1.00 15.34  ? 660  GLY C CA    1 
ATOM   8213  C C     . GLY C 1 352 ? 13.835  -18.268 30.831  1.00 23.28  ? 660  GLY C C     1 
ATOM   8214  O O     . GLY C 1 352 ? 14.892  -18.820 31.149  1.00 25.45  ? 660  GLY C O     1 
ATOM   8215  N N     . ALA C 1 353 ? 13.780  -17.012 30.385  1.00 17.70  ? 661  ALA C N     1 
ATOM   8216  C CA    . ALA C 1 353 ? 14.979  -16.307 29.928  1.00 20.28  ? 661  ALA C CA    1 
ATOM   8217  C C     . ALA C 1 353 ? 15.517  -15.269 30.905  1.00 22.96  ? 661  ALA C C     1 
ATOM   8218  O O     . ALA C 1 353 ? 14.767  -14.469 31.453  1.00 26.45  ? 661  ALA C O     1 
ATOM   8219  C CB    . ALA C 1 353 ? 14.716  -15.656 28.577  1.00 24.40  ? 661  ALA C CB    1 
ATOM   8220  N N     . LEU C 1 354 ? 16.833  -15.253 31.076  1.00 23.47  ? 662  LEU C N     1 
ATOM   8221  C CA    . LEU C 1 354 ? 17.476  -14.315 31.999  1.00 27.34  ? 662  LEU C CA    1 
ATOM   8222  C C     . LEU C 1 354 ? 17.272  -12.850 31.607  1.00 22.30  ? 662  LEU C C     1 
ATOM   8223  O O     . LEU C 1 354 ? 17.244  -11.973 32.470  1.00 25.99  ? 662  LEU C O     1 
ATOM   8224  C CB    . LEU C 1 354 ? 18.974  -14.618 32.118  1.00 47.32  ? 662  LEU C CB    1 
ATOM   8225  C CG    . LEU C 1 354 ? 19.391  -15.830 32.961  1.00 63.84  ? 662  LEU C CG    1 
ATOM   8226  C CD1   . LEU C 1 354 ? 18.655  -17.097 32.540  1.00 73.08  ? 662  LEU C CD1   1 
ATOM   8227  C CD2   . LEU C 1 354 ? 20.898  -16.036 32.889  1.00 66.66  ? 662  LEU C CD2   1 
ATOM   8228  N N     . PHE C 1 355 ? 17.133  -12.577 30.312  1.00 22.94  ? 663  PHE C N     1 
ATOM   8229  C CA    . PHE C 1 355 ? 16.967  -11.187 29.866  1.00 19.18  ? 663  PHE C CA    1 
ATOM   8230  C C     . PHE C 1 355 ? 15.575  -10.598 30.132  1.00 23.11  ? 663  PHE C C     1 
ATOM   8231  O O     . PHE C 1 355 ? 15.373  -9.386  29.989  1.00 22.23  ? 663  PHE C O     1 
ATOM   8232  C CB    . PHE C 1 355 ? 17.369  -11.011 28.395  1.00 17.61  ? 663  PHE C CB    1 
ATOM   8233  C CG    . PHE C 1 355 ? 16.730  -12.005 27.448  1.00 16.21  ? 663  PHE C CG    1 
ATOM   8234  C CD1   . PHE C 1 355 ? 15.460  -11.789 26.941  1.00 20.30  ? 663  PHE C CD1   1 
ATOM   8235  C CD2   . PHE C 1 355 ? 17.424  -13.129 27.036  1.00 22.31  ? 663  PHE C CD2   1 
ATOM   8236  C CE1   . PHE C 1 355 ? 14.883  -12.688 26.054  1.00 24.00  ? 663  PHE C CE1   1 
ATOM   8237  C CE2   . PHE C 1 355 ? 16.854  -14.037 26.151  1.00 16.98  ? 663  PHE C CE2   1 
ATOM   8238  C CZ    . PHE C 1 355 ? 15.588  -13.817 25.659  1.00 16.11  ? 663  PHE C CZ    1 
ATOM   8239  N N     . MET C 1 356 ? 14.617  -11.436 30.519  1.00 18.29  ? 664  MET C N     1 
ATOM   8240  C CA    . MET C 1 356 ? 13.308  -10.917 30.921  1.00 17.78  ? 664  MET C CA    1 
ATOM   8241  C C     . MET C 1 356 ? 13.233  -10.773 32.439  1.00 21.18  ? 664  MET C C     1 
ATOM   8242  O O     . MET C 1 356 ? 13.487  -11.726 33.173  1.00 23.02  ? 664  MET C O     1 
ATOM   8243  C CB    . MET C 1 356 ? 12.172  -11.796 30.412  1.00 14.47  ? 664  MET C CB    1 
ATOM   8244  C CG    . MET C 1 356 ? 12.097  -11.938 28.886  1.00 13.63  ? 664  MET C CG    1 
ATOM   8245  S SD    . MET C 1 356 ? 12.067  -10.402 27.926  1.00 15.97  ? 664  MET C SD    1 
ATOM   8246  C CE    . MET C 1 356 ? 10.668  -9.513  28.638  1.00 9.62   ? 664  MET C CE    1 
ATOM   8247  N N     . ASP C 1 357 ? 12.885  -9.578  32.904  1.00 14.31  ? 665  ASP C N     1 
ATOM   8248  C CA    . ASP C 1 357 ? 12.883  -9.282  34.340  1.00 17.55  ? 665  ASP C CA    1 
ATOM   8249  C C     . ASP C 1 357 ? 11.592  -9.678  35.045  1.00 22.58  ? 665  ASP C C     1 
ATOM   8250  O O     . ASP C 1 357 ? 11.625  -10.241 36.145  1.00 15.83  ? 665  ASP C O     1 
ATOM   8251  C CB    . ASP C 1 357 ? 13.156  -7.796  34.557  1.00 17.50  ? 665  ASP C CB    1 
ATOM   8252  C CG    . ASP C 1 357 ? 14.498  -7.377  33.999  1.00 26.02  ? 665  ASP C CG    1 
ATOM   8253  O OD1   . ASP C 1 357 ? 15.516  -7.951  34.430  1.00 21.40  ? 665  ASP C OD1   1 
ATOM   8254  O OD2   . ASP C 1 357 ? 14.537  -6.503  33.111  1.00 19.87  ? 665  ASP C OD2   1 
ATOM   8255  N N     . TYR C 1 358 ? 10.462  -9.390  34.397  1.00 15.94  ? 666  TYR C N     1 
ATOM   8256  C CA    . TYR C 1 358 ? 9.142   -9.537  35.008  1.00 17.00  ? 666  TYR C CA    1 
ATOM   8257  C C     . TYR C 1 358 ? 8.170   -10.231 34.077  1.00 13.28  ? 666  TYR C C     1 
ATOM   8258  O O     . TYR C 1 358 ? 8.321   -10.170 32.859  1.00 12.76  ? 666  TYR C O     1 
ATOM   8259  C CB    . TYR C 1 358 ? 8.550   -8.161  35.329  1.00 9.98   ? 666  TYR C CB    1 
ATOM   8260  C CG    . TYR C 1 358 ? 9.247   -7.412  36.441  1.00 19.08  ? 666  TYR C CG    1 
ATOM   8261  C CD1   . TYR C 1 358 ? 9.091   -7.797  37.768  1.00 19.71  ? 666  TYR C CD1   1 
ATOM   8262  C CD2   . TYR C 1 358 ? 10.039  -6.300  36.168  1.00 17.92  ? 666  TYR C CD2   1 
ATOM   8263  C CE1   . TYR C 1 358 ? 9.716   -7.099  38.789  1.00 17.31  ? 666  TYR C CE1   1 
ATOM   8264  C CE2   . TYR C 1 358 ? 10.666  -5.600  37.183  1.00 18.96  ? 666  TYR C CE2   1 
ATOM   8265  C CZ    . TYR C 1 358 ? 10.502  -6.005  38.491  1.00 21.21  ? 666  TYR C CZ    1 
ATOM   8266  O OH    . TYR C 1 358 ? 11.131  -5.312  39.506  1.00 21.28  ? 666  TYR C OH    1 
ATOM   8267  N N     . ILE C 1 359 ? 7.186   -10.906 34.657  1.00 10.10  ? 667  ILE C N     1 
ATOM   8268  C CA    . ILE C 1 359 ? 5.999   -11.297 33.911  1.00 13.02  ? 667  ILE C CA    1 
ATOM   8269  C C     . ILE C 1 359 ? 4.796   -10.594 34.548  1.00 14.31  ? 667  ILE C C     1 
ATOM   8270  O O     . ILE C 1 359 ? 4.620   -10.619 35.766  1.00 13.52  ? 667  ILE C O     1 
ATOM   8271  C CB    . ILE C 1 359 ? 5.820   -12.836 33.821  1.00 11.89  ? 667  ILE C CB    1 
ATOM   8272  C CG1   . ILE C 1 359 ? 4.568   -13.172 33.006  1.00 15.22  ? 667  ILE C CG1   1 
ATOM   8273  C CG2   . ILE C 1 359 ? 5.776   -13.482 35.218  1.00 14.78  ? 667  ILE C CG2   1 
ATOM   8274  C CD1   . ILE C 1 359 ? 4.408   -14.658 32.693  1.00 17.74  ? 667  ILE C CD1   1 
ATOM   8275  N N     . ILE C 1 360 ? 4.003   -9.922  33.722  1.00 12.45  ? 668  ILE C N     1 
ATOM   8276  C CA    . ILE C 1 360 ? 2.842   -9.213  34.219  1.00 10.05  ? 668  ILE C CA    1 
ATOM   8277  C C     . ILE C 1 360 ? 1.683   -10.197 34.300  1.00 13.80  ? 668  ILE C C     1 
ATOM   8278  O O     . ILE C 1 360 ? 1.244   -10.753 33.296  1.00 13.45  ? 668  ILE C O     1 
ATOM   8279  C CB    . ILE C 1 360 ? 2.520   -7.975  33.342  1.00 13.21  ? 668  ILE C CB    1 
ATOM   8280  C CG1   . ILE C 1 360 ? 3.677   -6.966  33.426  1.00 11.59  ? 668  ILE C CG1   1 
ATOM   8281  C CG2   . ILE C 1 360 ? 1.222   -7.315  33.784  1.00 16.91  ? 668  ILE C CG2   1 
ATOM   8282  C CD1   . ILE C 1 360 ? 3.470   -5.705  32.606  1.00 13.29  ? 668  ILE C CD1   1 
ATOM   8283  N N     . THR C 1 361 ? 1.210   -10.428 35.517  1.00 11.40  ? 669  THR C N     1 
ATOM   8284  C CA    . THR C 1 361 ? 0.236   -11.472 35.768  1.00 7.60   ? 669  THR C CA    1 
ATOM   8285  C C     . THR C 1 361 ? -0.604  -11.009 36.950  1.00 9.59   ? 669  THR C C     1 
ATOM   8286  O O     . THR C 1 361 ? -0.755  -9.808  37.150  1.00 15.33  ? 669  THR C O     1 
ATOM   8287  C CB    . THR C 1 361 ? 0.949   -12.837 35.975  1.00 14.85  ? 669  THR C CB    1 
ATOM   8288  O OG1   . THR C 1 361 ? -0.003  -13.885 36.164  1.00 10.60  ? 669  THR C OG1   1 
ATOM   8289  C CG2   . THR C 1 361 ? 1.926   -12.802 37.161  1.00 11.41  ? 669  THR C CG2   1 
ATOM   8290  N N     . ASP C 1 362 ? -1.186  -11.935 37.702  1.00 12.76  ? 670  ASP C N     1 
ATOM   8291  C CA    . ASP C 1 362 ? -1.963  -11.565 38.881  1.00 19.41  ? 670  ASP C CA    1 
ATOM   8292  C C     . ASP C 1 362 ? -1.994  -12.743 39.842  1.00 18.13  ? 670  ASP C C     1 
ATOM   8293  O O     . ASP C 1 362 ? -1.554  -13.848 39.502  1.00 9.83   ? 670  ASP C O     1 
ATOM   8294  C CB    . ASP C 1 362 ? -3.391  -11.128 38.513  1.00 11.09  ? 670  ASP C CB    1 
ATOM   8295  C CG    . ASP C 1 362 ? -4.169  -12.218 37.808  1.00 16.67  ? 670  ASP C CG    1 
ATOM   8296  O OD1   . ASP C 1 362 ? -4.824  -13.039 38.492  1.00 13.19  ? 670  ASP C OD1   1 
ATOM   8297  O OD2   . ASP C 1 362 ? -4.120  -12.255 36.562  1.00 11.48  ? 670  ASP C OD2   1 
ATOM   8298  N N     . GLN C 1 363 ? -2.522  -12.503 41.036  1.00 12.83  ? 671  GLN C N     1 
ATOM   8299  C CA    . GLN C 1 363 ? -2.472  -13.490 42.110  1.00 18.72  ? 671  GLN C CA    1 
ATOM   8300  C C     . GLN C 1 363 ? -3.327  -14.720 41.812  1.00 14.21  ? 671  GLN C C     1 
ATOM   8301  O O     . GLN C 1 363 ? -3.035  -15.808 42.297  1.00 12.41  ? 671  GLN C O     1 
ATOM   8302  C CB    . GLN C 1 363 ? -2.874  -12.850 43.455  1.00 13.15  ? 671  GLN C CB    1 
ATOM   8303  C CG    . GLN C 1 363 ? -2.824  -13.799 44.638  1.00 29.62  ? 671  GLN C CG    1 
ATOM   8304  C CD    . GLN C 1 363 ? -3.484  -13.220 45.884  1.00 51.20  ? 671  GLN C CD    1 
ATOM   8305  O OE1   . GLN C 1 363 ? -3.626  -12.004 46.020  1.00 48.09  ? 671  GLN C OE1   1 
ATOM   8306  N NE2   . GLN C 1 363 ? -3.895  -14.095 46.797  1.00 62.44  ? 671  GLN C NE2   1 
ATOM   8307  N N     . GLU C 1 364 ? -4.391  -14.559 41.029  1.00 10.25  ? 672  GLU C N     1 
ATOM   8308  C CA    . GLU C 1 364 ? -5.225  -15.720 40.663  1.00 9.39   ? 672  GLU C CA    1 
ATOM   8309  C C     . GLU C 1 364 ? -4.547  -16.574 39.585  1.00 13.69  ? 672  GLU C C     1 
ATOM   8310  O O     . GLU C 1 364 ? -4.569  -17.806 39.633  1.00 14.76  ? 672  GLU C O     1 
ATOM   8311  C CB    . GLU C 1 364 ? -6.618  -15.285 40.170  1.00 13.52  ? 672  GLU C CB    1 
ATOM   8312  C CG    . GLU C 1 364 ? -7.462  -14.520 41.183  1.00 13.74  ? 672  GLU C CG    1 
ATOM   8313  C CD    . GLU C 1 364 ? -7.721  -15.320 42.461  1.00 20.98  ? 672  GLU C CD    1 
ATOM   8314  O OE1   . GLU C 1 364 ? -8.001  -16.530 42.372  1.00 14.62  ? 672  GLU C OE1   1 
ATOM   8315  O OE2   . GLU C 1 364 ? -7.647  -14.732 43.557  1.00 21.85  ? 672  GLU C OE2   1 
ATOM   8316  N N     . THR C 1 365 ? -3.953  -15.912 38.601  1.00 10.30  ? 673  THR C N     1 
ATOM   8317  C CA    . THR C 1 365 ? -3.287  -16.614 37.505  1.00 11.22  ? 673  THR C CA    1 
ATOM   8318  C C     . THR C 1 365 ? -2.014  -17.274 38.003  1.00 11.70  ? 673  THR C C     1 
ATOM   8319  O O     . THR C 1 365 ? -1.713  -18.419 37.664  1.00 14.57  ? 673  THR C O     1 
ATOM   8320  C CB    . THR C 1 365 ? -2.946  -15.637 36.367  1.00 5.15   ? 673  THR C CB    1 
ATOM   8321  O OG1   . THR C 1 365 ? -4.160  -15.035 35.889  1.00 11.46  ? 673  THR C OG1   1 
ATOM   8322  C CG2   . THR C 1 365 ? -2.249  -16.375 35.205  1.00 8.40   ? 673  THR C CG2   1 
ATOM   8323  N N     . SER C 1 366 ? -1.266  -16.539 38.815  1.00 10.05  ? 674  SER C N     1 
ATOM   8324  C CA    . SER C 1 366 ? 0.070   -16.965 39.204  1.00 11.17  ? 674  SER C CA    1 
ATOM   8325  C C     . SER C 1 366 ? 0.313   -16.766 40.695  1.00 13.18  ? 674  SER C C     1 
ATOM   8326  O O     . SER C 1 366 ? 1.062   -15.870 41.091  1.00 14.86  ? 674  SER C O     1 
ATOM   8327  C CB    . SER C 1 366 ? 1.103   -16.167 38.402  1.00 12.99  ? 674  SER C CB    1 
ATOM   8328  O OG    . SER C 1 366 ? 0.803   -16.216 37.012  1.00 16.17  ? 674  SER C OG    1 
ATOM   8329  N N     . PRO C 1 367 ? -0.316  -17.602 41.529  1.00 14.90  ? 675  PRO C N     1 
ATOM   8330  C CA    . PRO C 1 367 ? -0.142  -17.465 42.982  1.00 13.76  ? 675  PRO C CA    1 
ATOM   8331  C C     . PRO C 1 367 ? 1.331   -17.500 43.376  1.00 23.73  ? 675  PRO C C     1 
ATOM   8332  O O     . PRO C 1 367 ? 2.137   -18.166 42.726  1.00 17.77  ? 675  PRO C O     1 
ATOM   8333  C CB    . PRO C 1 367 ? -0.906  -18.673 43.553  1.00 20.46  ? 675  PRO C CB    1 
ATOM   8334  C CG    . PRO C 1 367 ? -1.173  -19.580 42.388  1.00 21.03  ? 675  PRO C CG    1 
ATOM   8335  C CD    . PRO C 1 367 ? -1.232  -18.697 41.176  1.00 16.67  ? 675  PRO C CD    1 
ATOM   8336  N N     . ALA C 1 368 ? 1.679   -16.774 44.430  1.00 21.15  ? 676  ALA C N     1 
ATOM   8337  C CA    . ALA C 1 368 ? 3.072   -16.661 44.846  1.00 33.30  ? 676  ALA C CA    1 
ATOM   8338  C C     . ALA C 1 368 ? 3.683   -18.028 45.126  1.00 34.57  ? 676  ALA C C     1 
ATOM   8339  O O     . ALA C 1 368 ? 4.893   -18.210 44.993  1.00 33.46  ? 676  ALA C O     1 
ATOM   8340  C CB    . ALA C 1 368 ? 3.194   -15.755 46.062  1.00 40.82  ? 676  ALA C CB    1 
ATOM   8341  N N     . GLU C 1 369 ? 2.837   -18.987 45.499  1.00 32.15  ? 677  GLU C N     1 
ATOM   8342  C CA    . GLU C 1 369 ? 3.283   -20.346 45.780  1.00 37.82  ? 677  GLU C CA    1 
ATOM   8343  C C     . GLU C 1 369 ? 3.969   -20.975 44.574  1.00 39.44  ? 677  GLU C C     1 
ATOM   8344  O O     . GLU C 1 369 ? 4.879   -21.788 44.725  1.00 44.76  ? 677  GLU C O     1 
ATOM   8345  C CB    . GLU C 1 369 ? 2.112   -21.234 46.213  1.00 43.55  ? 677  GLU C CB    1 
ATOM   8346  C CG    . GLU C 1 369 ? 1.309   -20.695 47.385  1.00 51.84  ? 677  GLU C CG    1 
ATOM   8347  C CD    . GLU C 1 369 ? 0.179   -19.778 46.945  1.00 52.18  ? 677  GLU C CD    1 
ATOM   8348  O OE1   . GLU C 1 369 ? -0.879  -20.299 46.531  1.00 52.30  ? 677  GLU C OE1   1 
ATOM   8349  O OE2   . GLU C 1 369 ? 0.349   -18.541 47.011  1.00 39.31  ? 677  GLU C OE2   1 
ATOM   8350  N N     . VAL C 1 370 ? 3.527   -20.606 43.376  1.00 31.72  ? 678  VAL C N     1 
ATOM   8351  C CA    . VAL C 1 370 ? 4.076   -21.202 42.163  1.00 27.52  ? 678  VAL C CA    1 
ATOM   8352  C C     . VAL C 1 370 ? 5.085   -20.315 41.439  1.00 24.58  ? 678  VAL C C     1 
ATOM   8353  O O     . VAL C 1 370 ? 5.338   -20.513 40.252  1.00 25.39  ? 678  VAL C O     1 
ATOM   8354  C CB    . VAL C 1 370 ? 2.975   -21.610 41.174  1.00 31.30  ? 678  VAL C CB    1 
ATOM   8355  C CG1   . VAL C 1 370 ? 2.035   -22.614 41.821  1.00 41.37  ? 678  VAL C CG1   1 
ATOM   8356  C CG2   . VAL C 1 370 ? 2.216   -20.385 40.681  1.00 33.51  ? 678  VAL C CG2   1 
ATOM   8357  N N     . ALA C 1 371 ? 5.675   -19.356 42.146  1.00 24.21  ? 679  ALA C N     1 
ATOM   8358  C CA    . ALA C 1 371 ? 6.684   -18.496 41.528  1.00 34.25  ? 679  ALA C CA    1 
ATOM   8359  C C     . ALA C 1 371 ? 7.777   -19.317 40.836  1.00 30.36  ? 679  ALA C C     1 
ATOM   8360  O O     . ALA C 1 371 ? 8.396   -18.857 39.876  1.00 26.40  ? 679  ALA C O     1 
ATOM   8361  C CB    . ALA C 1 371 ? 7.288   -17.548 42.552  1.00 31.27  ? 679  ALA C CB    1 
ATOM   8362  N N     . GLU C 1 372 ? 7.994   -20.535 41.328  1.00 25.84  ? 680  GLU C N     1 
ATOM   8363  C CA    . GLU C 1 372 ? 9.008   -21.452 40.808  1.00 30.78  ? 680  GLU C CA    1 
ATOM   8364  C C     . GLU C 1 372 ? 8.793   -21.854 39.344  1.00 26.27  ? 680  GLU C C     1 
ATOM   8365  O O     . GLU C 1 372 ? 9.733   -22.255 38.658  1.00 24.63  ? 680  GLU C O     1 
ATOM   8366  C CB    . GLU C 1 372 ? 9.066   -22.707 41.688  1.00 39.84  ? 680  GLU C CB    1 
ATOM   8367  C CG    . GLU C 1 372 ? 10.036  -23.775 41.221  1.00 70.68  ? 680  GLU C CG    1 
ATOM   8368  C CD    . GLU C 1 372 ? 9.919   -25.059 42.029  1.00 88.83  ? 680  GLU C CD    1 
ATOM   8369  O OE1   . GLU C 1 372 ? 8.873   -25.257 42.686  1.00 91.83  ? 680  GLU C OE1   1 
ATOM   8370  O OE2   . GLU C 1 372 ? 10.872  -25.868 42.008  1.00 90.27  ? 680  GLU C OE2   1 
ATOM   8371  N N     . GLN C 1 373 ? 7.561   -21.752 38.864  1.00 24.66  ? 681  GLN C N     1 
ATOM   8372  C CA    . GLN C 1 373 ? 7.259   -22.100 37.478  1.00 23.37  ? 681  GLN C CA    1 
ATOM   8373  C C     . GLN C 1 373 ? 7.830   -21.078 36.487  1.00 18.58  ? 681  GLN C C     1 
ATOM   8374  O O     . GLN C 1 373 ? 7.930   -21.347 35.287  1.00 19.23  ? 681  GLN C O     1 
ATOM   8375  C CB    . GLN C 1 373 ? 5.747   -22.211 37.282  1.00 23.42  ? 681  GLN C CB    1 
ATOM   8376  C CG    . GLN C 1 373 ? 5.068   -23.227 38.185  1.00 40.93  ? 681  GLN C CG    1 
ATOM   8377  C CD    . GLN C 1 373 ? 3.551   -23.194 38.069  1.00 43.83  ? 681  GLN C CD    1 
ATOM   8378  O OE1   . GLN C 1 373 ? 2.850   -23.948 38.745  1.00 45.33  ? 681  GLN C OE1   1 
ATOM   8379  N NE2   . GLN C 1 373 ? 3.038   -22.312 37.214  1.00 30.34  ? 681  GLN C NE2   1 
ATOM   8380  N N     . TYR C 1 374 ? 8.196   -19.906 36.992  1.00 13.90  ? 682  TYR C N     1 
ATOM   8381  C CA    . TYR C 1 374 ? 8.615   -18.792 36.140  1.00 13.83  ? 682  TYR C CA    1 
ATOM   8382  C C     . TYR C 1 374 ? 10.053  -18.404 36.405  1.00 23.12  ? 682  TYR C C     1 
ATOM   8383  O O     . TYR C 1 374 ? 10.514  -18.461 37.536  1.00 18.32  ? 682  TYR C O     1 
ATOM   8384  C CB    . TYR C 1 374 ? 7.749   -17.564 36.428  1.00 17.89  ? 682  TYR C CB    1 
ATOM   8385  C CG    . TYR C 1 374 ? 6.267   -17.813 36.329  1.00 18.34  ? 682  TYR C CG    1 
ATOM   8386  C CD1   . TYR C 1 374 ? 5.550   -18.288 37.417  1.00 20.90  ? 682  TYR C CD1   1 
ATOM   8387  C CD2   . TYR C 1 374 ? 5.583   -17.567 35.146  1.00 13.07  ? 682  TYR C CD2   1 
ATOM   8388  C CE1   . TYR C 1 374 ? 4.185   -18.518 37.326  1.00 22.01  ? 682  TYR C CE1   1 
ATOM   8389  C CE2   . TYR C 1 374 ? 4.221   -17.792 35.045  1.00 19.21  ? 682  TYR C CE2   1 
ATOM   8390  C CZ    . TYR C 1 374 ? 3.529   -18.267 36.135  1.00 16.99  ? 682  TYR C CZ    1 
ATOM   8391  O OH    . TYR C 1 374 ? 2.171   -18.489 36.033  1.00 21.04  ? 682  TYR C OH    1 
ATOM   8392  N N     . SER C 1 375 ? 10.756  -17.972 35.364  1.00 19.31  ? 683  SER C N     1 
ATOM   8393  C CA    . SER C 1 375 ? 12.092  -17.441 35.554  1.00 16.24  ? 683  SER C CA    1 
ATOM   8394  C C     . SER C 1 375 ? 12.002  -15.981 35.962  1.00 21.97  ? 683  SER C C     1 
ATOM   8395  O O     . SER C 1 375 ? 12.874  -15.476 36.672  1.00 16.22  ? 683  SER C O     1 
ATOM   8396  C CB    . SER C 1 375 ? 12.924  -17.590 34.283  1.00 22.83  ? 683  SER C CB    1 
ATOM   8397  O OG    . SER C 1 375 ? 12.288  -16.955 33.184  1.00 26.16  ? 683  SER C OG    1 
ATOM   8398  N N     . GLU C 1 376 ? 10.940  -15.310 35.506  1.00 13.81  ? 684  GLU C N     1 
ATOM   8399  C CA    . GLU C 1 376 ? 10.718  -13.899 35.794  1.00 15.77  ? 684  GLU C CA    1 
ATOM   8400  C C     . GLU C 1 376 ? 10.210  -13.700 37.215  1.00 23.88  ? 684  GLU C C     1 
ATOM   8401  O O     . GLU C 1 376 ? 9.625   -14.606 37.808  1.00 19.60  ? 684  GLU C O     1 
ATOM   8402  C CB    . GLU C 1 376 ? 9.679   -13.287 34.829  1.00 12.00  ? 684  GLU C CB    1 
ATOM   8403  C CG    . GLU C 1 376 ? 9.945   -13.492 33.340  1.00 13.67  ? 684  GLU C CG    1 
ATOM   8404  C CD    . GLU C 1 376 ? 9.412   -14.819 32.816  1.00 20.22  ? 684  GLU C CD    1 
ATOM   8405  O OE1   . GLU C 1 376 ? 9.012   -15.680 33.632  1.00 19.84  ? 684  GLU C OE1   1 
ATOM   8406  O OE2   . GLU C 1 376 ? 9.404   -15.001 31.581  1.00 19.99  ? 684  GLU C OE2   1 
ATOM   8407  N N     . LYS C 1 377 ? 10.422  -12.502 37.753  1.00 13.01  ? 685  LYS C N     1 
ATOM   8408  C CA    . LYS C 1 377 ? 9.751   -12.113 38.985  1.00 17.43  ? 685  LYS C CA    1 
ATOM   8409  C C     . LYS C 1 377 ? 8.314   -11.813 38.613  1.00 18.93  ? 685  LYS C C     1 
ATOM   8410  O O     . LYS C 1 377 ? 8.050   -11.317 37.515  1.00 14.79  ? 685  LYS C O     1 
ATOM   8411  C CB    . LYS C 1 377 ? 10.401  -10.865 39.589  1.00 18.10  ? 685  LYS C CB    1 
ATOM   8412  C CG    . LYS C 1 377 ? 11.844  -11.091 40.055  1.00 14.54  ? 685  LYS C CG    1 
ATOM   8413  C CD    . LYS C 1 377 ? 11.936  -12.162 41.131  1.00 22.03  ? 685  LYS C CD    1 
ATOM   8414  C CE    . LYS C 1 377 ? 13.403  -12.391 41.531  1.00 27.14  ? 685  LYS C CE    1 
ATOM   8415  N NZ    . LYS C 1 377 ? 13.546  -13.450 42.566  1.00 32.15  ? 685  LYS C NZ    1 
ATOM   8416  N N     . LEU C 1 378 ? 7.392   -12.109 39.521  1.00 16.07  ? 686  LEU C N     1 
ATOM   8417  C CA    . LEU C 1 378 ? 5.977   -11.855 39.283  1.00 13.63  ? 686  LEU C CA    1 
ATOM   8418  C C     . LEU C 1 378 ? 5.663   -10.392 39.530  1.00 19.90  ? 686  LEU C C     1 
ATOM   8419  O O     . LEU C 1 378 ? 6.118   -9.802  40.512  1.00 19.57  ? 686  LEU C O     1 
ATOM   8420  C CB    . LEU C 1 378 ? 5.114   -12.722 40.205  1.00 14.38  ? 686  LEU C CB    1 
ATOM   8421  C CG    . LEU C 1 378 ? 5.394   -14.226 40.204  1.00 19.99  ? 686  LEU C CG    1 
ATOM   8422  C CD1   . LEU C 1 378 ? 4.556   -14.924 41.279  1.00 20.13  ? 686  LEU C CD1   1 
ATOM   8423  C CD2   . LEU C 1 378 ? 5.149   -14.834 38.823  1.00 16.39  ? 686  LEU C CD2   1 
ATOM   8424  N N     . ALA C 1 379 ? 4.888   -9.807  38.626  1.00 15.63  ? 687  ALA C N     1 
ATOM   8425  C CA    . ALA C 1 379 ? 4.418   -8.443  38.797  1.00 17.87  ? 687  ALA C CA    1 
ATOM   8426  C C     . ALA C 1 379 ? 2.899   -8.448  38.663  1.00 17.21  ? 687  ALA C C     1 
ATOM   8427  O O     . ALA C 1 379 ? 2.363   -8.664  37.574  1.00 12.53  ? 687  ALA C O     1 
ATOM   8428  C CB    . ALA C 1 379 ? 5.058   -7.527  37.754  1.00 19.55  ? 687  ALA C CB    1 
ATOM   8429  N N     . TYR C 1 380 ? 2.212   -8.231  39.780  1.00 14.38  ? 688  TYR C N     1 
ATOM   8430  C CA    . TYR C 1 380 ? 0.767   -8.404  39.849  1.00 14.07  ? 688  TYR C CA    1 
ATOM   8431  C C     . TYR C 1 380 ? -0.031  -7.175  39.443  1.00 9.60   ? 688  TYR C C     1 
ATOM   8432  O O     . TYR C 1 380 ? 0.163   -6.096  39.994  1.00 11.42  ? 688  TYR C O     1 
ATOM   8433  C CB    . TYR C 1 380 ? 0.352   -8.752  41.278  1.00 16.43  ? 688  TYR C CB    1 
ATOM   8434  C CG    . TYR C 1 380 ? 0.582   -10.176 41.710  1.00 18.13  ? 688  TYR C CG    1 
ATOM   8435  C CD1   . TYR C 1 380 ? 1.025   -11.149 40.811  1.00 12.63  ? 688  TYR C CD1   1 
ATOM   8436  C CD2   . TYR C 1 380 ? 0.335   -10.557 43.026  1.00 17.95  ? 688  TYR C CD2   1 
ATOM   8437  C CE1   . TYR C 1 380 ? 1.225   -12.459 41.218  1.00 10.82  ? 688  TYR C CE1   1 
ATOM   8438  C CE2   . TYR C 1 380 ? 0.523   -11.859 43.441  1.00 16.95  ? 688  TYR C CE2   1 
ATOM   8439  C CZ    . TYR C 1 380 ? 0.968   -12.805 42.543  1.00 17.65  ? 688  TYR C CZ    1 
ATOM   8440  O OH    . TYR C 1 380 ? 1.150   -14.094 42.979  1.00 19.70  ? 688  TYR C OH    1 
ATOM   8441  N N     . MET C 1 381 ? -0.950  -7.356  38.495  1.00 15.10  ? 689  MET C N     1 
ATOM   8442  C CA    . MET C 1 381 ? -2.068  -6.440  38.326  1.00 13.94  ? 689  MET C CA    1 
ATOM   8443  C C     . MET C 1 381 ? -3.062  -6.777  39.427  1.00 12.38  ? 689  MET C C     1 
ATOM   8444  O O     . MET C 1 381 ? -3.105  -7.913  39.882  1.00 13.46  ? 689  MET C O     1 
ATOM   8445  C CB    . MET C 1 381 ? -2.724  -6.633  36.960  1.00 11.54  ? 689  MET C CB    1 
ATOM   8446  C CG    . MET C 1 381 ? -1.843  -6.172  35.810  1.00 15.08  ? 689  MET C CG    1 
ATOM   8447  S SD    . MET C 1 381 ? -1.710  -4.374  35.760  1.00 15.83  ? 689  MET C SD    1 
ATOM   8448  C CE    . MET C 1 381 ? -3.308  -3.914  35.111  1.00 13.25  ? 689  MET C CE    1 
ATOM   8449  N N     . PRO C 1 382 ? -3.869  -5.794  39.854  1.00 13.01  ? 690  PRO C N     1 
ATOM   8450  C CA    . PRO C 1 382 ? -4.671  -5.997  41.073  1.00 12.72  ? 690  PRO C CA    1 
ATOM   8451  C C     . PRO C 1 382 ? -5.886  -6.902  40.893  1.00 18.43  ? 690  PRO C C     1 
ATOM   8452  O O     . PRO C 1 382 ? -6.381  -7.440  41.877  1.00 13.62  ? 690  PRO C O     1 
ATOM   8453  C CB    . PRO C 1 382 ? -5.124  -4.571  41.437  1.00 19.51  ? 690  PRO C CB    1 
ATOM   8454  C CG    . PRO C 1 382 ? -5.110  -3.828  40.149  1.00 19.75  ? 690  PRO C CG    1 
ATOM   8455  C CD    . PRO C 1 382 ? -3.962  -4.412  39.351  1.00 16.05  ? 690  PRO C CD    1 
ATOM   8456  N N     . HIS C 1 383 ? -6.374  -7.052  39.668  1.00 11.53  ? 691  HIS C N     1 
ATOM   8457  C CA    . HIS C 1 383 ? -7.511  -7.939  39.424  1.00 13.55  ? 691  HIS C CA    1 
ATOM   8458  C C     . HIS C 1 383 ? -7.101  -9.082  38.510  1.00 19.30  ? 691  HIS C C     1 
ATOM   8459  O O     . HIS C 1 383 ? -6.636  -10.118 38.996  1.00 16.17  ? 691  HIS C O     1 
ATOM   8460  C CB    . HIS C 1 383 ? -8.718  -7.147  38.922  1.00 14.83  ? 691  HIS C CB    1 
ATOM   8461  C CG    . HIS C 1 383 ? -9.215  -6.146  39.921  1.00 20.82  ? 691  HIS C CG    1 
ATOM   8462  N ND1   . HIS C 1 383 ? -8.915  -4.804  39.845  1.00 26.77  ? 691  HIS C ND1   1 
ATOM   8463  C CD2   . HIS C 1 383 ? -9.941  -6.305  41.053  1.00 24.54  ? 691  HIS C CD2   1 
ATOM   8464  C CE1   . HIS C 1 383 ? -9.459  -4.172  40.872  1.00 24.13  ? 691  HIS C CE1   1 
ATOM   8465  N NE2   . HIS C 1 383 ? -10.088 -5.061  41.619  1.00 28.01  ? 691  HIS C NE2   1 
ATOM   8466  N N     . THR C 1 384 ? -7.236  -8.911  37.199  1.00 11.20  ? 692  THR C N     1 
ATOM   8467  C CA    . THR C 1 384 ? -6.608  -9.879  36.287  1.00 11.28  ? 692  THR C CA    1 
ATOM   8468  C C     . THR C 1 384 ? -5.621  -9.155  35.367  1.00 11.67  ? 692  THR C C     1 
ATOM   8469  O O     . THR C 1 384 ? -5.762  -7.966  35.133  1.00 10.94  ? 692  THR C O     1 
ATOM   8470  C CB    . THR C 1 384 ? -7.638  -10.730 35.478  1.00 11.33  ? 692  THR C CB    1 
ATOM   8471  O OG1   . THR C 1 384 ? -6.949  -11.650 34.616  1.00 14.96  ? 692  THR C OG1   1 
ATOM   8472  C CG2   . THR C 1 384 ? -8.547  -9.868  34.638  1.00 10.11  ? 692  THR C CG2   1 
ATOM   8473  N N     . PHE C 1 385 ? -4.613  -9.864  34.863  1.00 11.39  ? 693  PHE C N     1 
ATOM   8474  C CA    . PHE C 1 385 ? -3.731  -9.275  33.862  1.00 11.91  ? 693  PHE C CA    1 
ATOM   8475  C C     . PHE C 1 385 ? -4.418  -9.307  32.506  1.00 12.14  ? 693  PHE C C     1 
ATOM   8476  O O     . PHE C 1 385 ? -4.003  -8.622  31.554  1.00 12.10  ? 693  PHE C O     1 
ATOM   8477  C CB    . PHE C 1 385 ? -2.391  -10.017 33.791  1.00 7.00   ? 693  PHE C CB    1 
ATOM   8478  C CG    . PHE C 1 385 ? -2.433  -11.272 32.966  1.00 11.64  ? 693  PHE C CG    1 
ATOM   8479  C CD1   . PHE C 1 385 ? -2.007  -11.265 31.643  1.00 8.92   ? 693  PHE C CD1   1 
ATOM   8480  C CD2   . PHE C 1 385 ? -2.909  -12.456 33.511  1.00 12.41  ? 693  PHE C CD2   1 
ATOM   8481  C CE1   . PHE C 1 385 ? -2.059  -12.431 30.875  1.00 12.63  ? 693  PHE C CE1   1 
ATOM   8482  C CE2   . PHE C 1 385 ? -2.949  -13.610 32.765  1.00 12.09  ? 693  PHE C CE2   1 
ATOM   8483  C CZ    . PHE C 1 385 ? -2.535  -13.605 31.446  1.00 14.32  ? 693  PHE C CZ    1 
ATOM   8484  N N     . PHE C 1 386 ? -5.463  -10.119 32.403  1.00 10.48  ? 694  PHE C N     1 
ATOM   8485  C CA    . PHE C 1 386 ? -6.165  -10.194 31.135  1.00 11.55  ? 694  PHE C CA    1 
ATOM   8486  C C     . PHE C 1 386 ? -6.989  -8.933  30.880  1.00 12.54  ? 694  PHE C C     1 
ATOM   8487  O O     . PHE C 1 386 ? -7.466  -8.282  31.822  1.00 8.91   ? 694  PHE C O     1 
ATOM   8488  C CB    . PHE C 1 386 ? -6.966  -11.503 30.967  1.00 5.79   ? 694  PHE C CB    1 
ATOM   8489  C CG    . PHE C 1 386 ? -6.706  -12.159 29.641  1.00 9.98   ? 694  PHE C CG    1 
ATOM   8490  C CD1   . PHE C 1 386 ? -7.587  -11.987 28.579  1.00 10.12  ? 694  PHE C CD1   1 
ATOM   8491  C CD2   . PHE C 1 386 ? -5.525  -12.865 29.425  1.00 15.86  ? 694  PHE C CD2   1 
ATOM   8492  C CE1   . PHE C 1 386 ? -7.325  -12.547 27.323  1.00 12.10  ? 694  PHE C CE1   1 
ATOM   8493  C CE2   . PHE C 1 386 ? -5.252  -13.426 28.181  1.00 14.37  ? 694  PHE C CE2   1 
ATOM   8494  C CZ    . PHE C 1 386 ? -6.153  -13.265 27.126  1.00 9.24   ? 694  PHE C CZ    1 
ATOM   8495  N N     . ILE C 1 387 ? -7.095  -8.559  29.607  1.00 8.35   ? 695  ILE C N     1 
ATOM   8496  C CA    . ILE C 1 387 ? -7.934  -7.430  29.190  1.00 8.22   ? 695  ILE C CA    1 
ATOM   8497  C C     . ILE C 1 387 ? -8.494  -7.759  27.797  1.00 14.66  ? 695  ILE C C     1 
ATOM   8498  O O     . ILE C 1 387 ? -8.010  -8.671  27.127  1.00 14.12  ? 695  ILE C O     1 
ATOM   8499  C CB    . ILE C 1 387 ? -7.116  -6.110  29.173  1.00 13.90  ? 695  ILE C CB    1 
ATOM   8500  C CG1   . ILE C 1 387 ? -8.015  -4.888  28.916  1.00 10.85  ? 695  ILE C CG1   1 
ATOM   8501  C CG2   . ILE C 1 387 ? -5.939  -6.205  28.167  1.00 11.52  ? 695  ILE C CG2   1 
ATOM   8502  C CD1   . ILE C 1 387 ? -9.065  -4.639  30.021  1.00 10.30  ? 695  ILE C CD1   1 
ATOM   8503  N N     . GLY C 1 388 ? -9.532  -7.053  27.374  1.00 5.34   ? 696  GLY C N     1 
ATOM   8504  C CA    . GLY C 1 388 ? -10.045 -7.218  26.021  1.00 9.96   ? 696  GLY C CA    1 
ATOM   8505  C C     . GLY C 1 388 ? -10.664 -5.918  25.555  1.00 6.96   ? 696  GLY C C     1 
ATOM   8506  O O     . GLY C 1 388 ? -11.094 -5.109  26.368  1.00 11.26  ? 696  GLY C O     1 
ATOM   8507  N N     . ASP C 1 389 ? -10.739 -5.716  24.250  1.00 6.48   ? 697  ASP C N     1 
ATOM   8508  C CA    . ASP C 1 389 ? -11.256 -4.447  23.746  1.00 9.22   ? 697  ASP C CA    1 
ATOM   8509  C C     . ASP C 1 389 ? -12.741 -4.501  23.398  1.00 10.33  ? 697  ASP C C     1 
ATOM   8510  O O     . ASP C 1 389 ? -13.245 -3.679  22.636  1.00 11.48  ? 697  ASP C O     1 
ATOM   8511  C CB    . ASP C 1 389 ? -10.448 -3.991  22.526  1.00 7.85   ? 697  ASP C CB    1 
ATOM   8512  C CG    . ASP C 1 389 ? -10.576 -2.505  22.282  1.00 9.66   ? 697  ASP C CG    1 
ATOM   8513  O OD1   . ASP C 1 389 ? -10.423 -1.732  23.256  1.00 12.80  ? 697  ASP C OD1   1 
ATOM   8514  O OD2   . ASP C 1 389 ? -10.821 -2.117  21.121  1.00 10.16  ? 697  ASP C OD2   1 
ATOM   8515  N N     . HIS C 1 390 ? -13.455 -5.444  23.993  1.00 7.93   ? 698  HIS C N     1 
ATOM   8516  C CA    . HIS C 1 390 ? -14.850 -5.676  23.635  1.00 7.44   ? 698  HIS C CA    1 
ATOM   8517  C C     . HIS C 1 390 ? -15.792 -4.489  23.768  1.00 8.77   ? 698  HIS C C     1 
ATOM   8518  O O     . HIS C 1 390 ? -16.679 -4.337  22.942  1.00 7.42   ? 698  HIS C O     1 
ATOM   8519  C CB    . HIS C 1 390 ? -15.397 -6.865  24.414  1.00 10.04  ? 698  HIS C CB    1 
ATOM   8520  C CG    . HIS C 1 390 ? -14.633 -8.125  24.166  1.00 6.97   ? 698  HIS C CG    1 
ATOM   8521  N ND1   . HIS C 1 390 ? -13.323 -8.288  24.571  1.00 5.82   ? 698  HIS C ND1   1 
ATOM   8522  C CD2   . HIS C 1 390 ? -14.979 -9.269  23.531  1.00 9.26   ? 698  HIS C CD2   1 
ATOM   8523  C CE1   . HIS C 1 390 ? -12.898 -9.483  24.196  1.00 11.14  ? 698  HIS C CE1   1 
ATOM   8524  N NE2   . HIS C 1 390 ? -13.885 -10.098 23.564  1.00 6.32   ? 698  HIS C NE2   1 
ATOM   8525  N N     . ALA C 1 391 ? -15.611 -3.662  24.796  1.00 9.25   ? 699  ALA C N     1 
ATOM   8526  C CA    . ALA C 1 391 ? -16.495 -2.506  25.005  1.00 13.83  ? 699  ALA C CA    1 
ATOM   8527  C C     . ALA C 1 391 ? -16.360 -1.493  23.864  1.00 16.85  ? 699  ALA C C     1 
ATOM   8528  O O     . ALA C 1 391 ? -17.318 -0.814  23.516  1.00 12.81  ? 699  ALA C O     1 
ATOM   8529  C CB    . ALA C 1 391 ? -16.207 -1.830  26.346  1.00 15.56  ? 699  ALA C CB    1 
ATOM   8530  N N     . ASN C 1 392 ? -15.166 -1.400  23.289  1.00 9.69   ? 700  ASN C N     1 
ATOM   8531  C CA    . ASN C 1 392 ? -14.911 -0.536  22.131  1.00 8.89   ? 700  ASN C CA    1 
ATOM   8532  C C     . ASN C 1 392 ? -15.272 -1.190  20.787  1.00 7.37   ? 700  ASN C C     1 
ATOM   8533  O O     . ASN C 1 392 ? -15.859 -0.549  19.908  1.00 12.48  ? 700  ASN C O     1 
ATOM   8534  C CB    . ASN C 1 392 ? -13.430 -0.113  22.111  1.00 11.58  ? 700  ASN C CB    1 
ATOM   8535  C CG    . ASN C 1 392 ? -13.078 0.745   20.901  1.00 18.85  ? 700  ASN C CG    1 
ATOM   8536  O OD1   . ASN C 1 392 ? -13.681 1.796   20.676  1.00 15.67  ? 700  ASN C OD1   1 
ATOM   8537  N ND2   . ASN C 1 392 ? -12.075 0.314   20.136  1.00 12.02  ? 700  ASN C ND2   1 
ATOM   8538  N N     . MET C 1 393 ? -14.911 -2.458  20.620  1.00 6.38   ? 701  MET C N     1 
ATOM   8539  C CA    . MET C 1 393 ? -15.156 -3.141  19.346  1.00 11.02  ? 701  MET C CA    1 
ATOM   8540  C C     . MET C 1 393 ? -16.606 -3.568  19.182  1.00 6.99   ? 701  MET C C     1 
ATOM   8541  O O     . MET C 1 393 ? -17.137 -3.543  18.076  1.00 10.75  ? 701  MET C O     1 
ATOM   8542  C CB    . MET C 1 393 ? -14.259 -4.373  19.205  1.00 5.78   ? 701  MET C CB    1 
ATOM   8543  C CG    . MET C 1 393 ? -12.789 -4.065  19.005  1.00 6.51   ? 701  MET C CG    1 
ATOM   8544  S SD    . MET C 1 393 ? -11.792 -5.553  18.961  1.00 9.80   ? 701  MET C SD    1 
ATOM   8545  C CE    . MET C 1 393 ? -12.378 -6.348  17.468  1.00 7.21   ? 701  MET C CE    1 
ATOM   8546  N N     . PHE C 1 394 ? -17.241 -3.985  20.278  1.00 9.76   ? 702  PHE C N     1 
ATOM   8547  C CA    . PHE C 1 394 ? -18.589 -4.555  20.191  1.00 3.87   ? 702  PHE C CA    1 
ATOM   8548  C C     . PHE C 1 394 ? -19.607 -3.891  21.124  1.00 7.95   ? 702  PHE C C     1 
ATOM   8549  O O     . PHE C 1 394 ? -20.270 -4.581  21.907  1.00 6.94   ? 702  PHE C O     1 
ATOM   8550  C CB    . PHE C 1 394 ? -18.557 -6.066  20.488  1.00 4.29   ? 702  PHE C CB    1 
ATOM   8551  C CG    . PHE C 1 394 ? -17.419 -6.809  19.807  1.00 12.00  ? 702  PHE C CG    1 
ATOM   8552  C CD1   . PHE C 1 394 ? -17.363 -6.910  18.427  1.00 11.23  ? 702  PHE C CD1   1 
ATOM   8553  C CD2   . PHE C 1 394 ? -16.421 -7.417  20.565  1.00 10.53  ? 702  PHE C CD2   1 
ATOM   8554  C CE1   . PHE C 1 394 ? -16.309 -7.598  17.799  1.00 12.37  ? 702  PHE C CE1   1 
ATOM   8555  C CE2   . PHE C 1 394 ? -15.373 -8.113  19.959  1.00 6.29   ? 702  PHE C CE2   1 
ATOM   8556  C CZ    . PHE C 1 394 ? -15.324 -8.204  18.567  1.00 9.10   ? 702  PHE C CZ    1 
ATOM   8557  N N     . PRO C 1 395 ? -19.768 -2.564  21.015  1.00 12.31  ? 703  PRO C N     1 
ATOM   8558  C CA    . PRO C 1 395 ? -20.717 -1.860  21.886  1.00 12.16  ? 703  PRO C CA    1 
ATOM   8559  C C     . PRO C 1 395 ? -22.175 -2.181  21.554  1.00 13.81  ? 703  PRO C C     1 
ATOM   8560  O O     . PRO C 1 395 ? -23.056 -1.964  22.384  1.00 8.56   ? 703  PRO C O     1 
ATOM   8561  C CB    . PRO C 1 395 ? -20.406 -0.373  21.617  1.00 8.43   ? 703  PRO C CB    1 
ATOM   8562  C CG    . PRO C 1 395 ? -19.871 -0.342  20.235  1.00 9.45   ? 703  PRO C CG    1 
ATOM   8563  C CD    . PRO C 1 395 ? -19.136 -1.660  20.034  1.00 13.75  ? 703  PRO C CD    1 
ATOM   8564  N N     . HIS C 1 396 ? -22.431 -2.713  20.366  1.00 6.05   ? 704  HIS C N     1 
ATOM   8565  C CA    . HIS C 1 396 ? -23.793 -3.081  19.999  1.00 8.00   ? 704  HIS C CA    1 
ATOM   8566  C C     . HIS C 1 396 ? -24.283 -4.278  20.822  1.00 7.55   ? 704  HIS C C     1 
ATOM   8567  O O     . HIS C 1 396 ? -25.473 -4.554  20.845  1.00 14.98  ? 704  HIS C O     1 
ATOM   8568  C CB    . HIS C 1 396 ? -23.918 -3.363  18.493  1.00 13.16  ? 704  HIS C CB    1 
ATOM   8569  C CG    . HIS C 1 396 ? -23.079 -4.509  18.011  1.00 16.68  ? 704  HIS C CG    1 
ATOM   8570  N ND1   . HIS C 1 396 ? -21.713 -4.565  18.200  1.00 11.45  ? 704  HIS C ND1   1 
ATOM   8571  C CD2   . HIS C 1 396 ? -23.412 -5.632  17.326  1.00 4.02   ? 704  HIS C CD2   1 
ATOM   8572  C CE1   . HIS C 1 396 ? -21.243 -5.682  17.671  1.00 9.97   ? 704  HIS C CE1   1 
ATOM   8573  N NE2   . HIS C 1 396 ? -22.253 -6.350  17.138  1.00 8.23   ? 704  HIS C NE2   1 
ATOM   8574  N N     . LEU C 1 397 ? -23.358 -4.978  21.487  1.00 8.98   ? 705  LEU C N     1 
ATOM   8575  C CA    . LEU C 1 397 ? -23.698 -6.132  22.329  1.00 6.76   ? 705  LEU C CA    1 
ATOM   8576  C C     . LEU C 1 397 ? -23.837 -5.780  23.822  1.00 15.10  ? 705  LEU C C     1 
ATOM   8577  O O     . LEU C 1 397 ? -24.015 -6.671  24.669  1.00 11.82  ? 705  LEU C O     1 
ATOM   8578  C CB    . LEU C 1 397 ? -22.693 -7.284  22.132  1.00 5.93   ? 705  LEU C CB    1 
ATOM   8579  C CG    . LEU C 1 397 ? -22.402 -7.700  20.667  1.00 5.39   ? 705  LEU C CG    1 
ATOM   8580  C CD1   . LEU C 1 397 ? -21.382 -8.824  20.631  1.00 10.13  ? 705  LEU C CD1   1 
ATOM   8581  C CD2   . LEU C 1 397 ? -23.688 -8.150  19.935  1.00 5.70   ? 705  LEU C CD2   1 
ATOM   8582  N N     . LYS C 1 398 ? -23.767 -4.488  24.143  1.00 13.30  ? 706  LYS C N     1 
ATOM   8583  C CA    . LYS C 1 398 ? -24.003 -4.043  25.517  1.00 9.00   ? 706  LYS C CA    1 
ATOM   8584  C C     . LYS C 1 398 ? -25.446 -4.235  25.924  1.00 13.68  ? 706  LYS C C     1 
ATOM   8585  O O     . LYS C 1 398 ? -25.730 -4.456  27.089  1.00 20.27  ? 706  LYS C O     1 
ATOM   8586  C CB    . LYS C 1 398 ? -23.645 -2.567  25.715  1.00 11.04  ? 706  LYS C CB    1 
ATOM   8587  C CG    . LYS C 1 398 ? -22.174 -2.272  25.660  1.00 22.20  ? 706  LYS C CG    1 
ATOM   8588  C CD    . LYS C 1 398 ? -21.946 -0.798  25.969  1.00 44.42  ? 706  LYS C CD    1 
ATOM   8589  C CE    . LYS C 1 398 ? -20.804 -0.219  25.152  1.00 47.51  ? 706  LYS C CE    1 
ATOM   8590  N NZ    . LYS C 1 398 ? -19.528 -0.940  25.392  1.00 24.44  ? 706  LYS C NZ    1 
ATOM   8591  N N     . LYS C 1 399 ? -26.358 -4.132  24.962  1.00 7.60   ? 707  LYS C N     1 
ATOM   8592  C CA    . LYS C 1 399 ? -27.760 -4.350  25.237  1.00 7.87   ? 707  LYS C CA    1 
ATOM   8593  C C     . LYS C 1 399 ? -28.311 -5.335  24.232  1.00 14.97  ? 707  LYS C C     1 
ATOM   8594  O O     . LYS C 1 399 ? -27.714 -5.548  23.183  1.00 10.09  ? 707  LYS C O     1 
ATOM   8595  C CB    . LYS C 1 399 ? -28.545 -3.036  25.135  1.00 12.92  ? 707  LYS C CB    1 
ATOM   8596  C CG    . LYS C 1 399 ? -28.235 -2.046  26.250  1.00 30.39  ? 707  LYS C CG    1 
ATOM   8597  C CD    . LYS C 1 399 ? -29.089 -0.802  26.116  1.00 39.38  ? 707  LYS C CD    1 
ATOM   8598  C CE    . LYS C 1 399 ? -28.652 0.275   27.093  1.00 46.99  ? 707  LYS C CE    1 
ATOM   8599  N NZ    . LYS C 1 399 ? -29.458 1.514   26.914  1.00 51.47  ? 707  LYS C NZ    1 
ATOM   8600  N N     . LYS C 1 400 ? -29.464 -5.919  24.547  1.00 11.58  ? 708  LYS C N     1 
ATOM   8601  C CA    . LYS C 1 400 ? -30.105 -6.845  23.623  1.00 12.67  ? 708  LYS C CA    1 
ATOM   8602  C C     . LYS C 1 400 ? -31.598 -6.799  23.786  1.00 12.31  ? 708  LYS C C     1 
ATOM   8603  O O     . LYS C 1 400 ? -32.100 -6.333  24.816  1.00 18.83  ? 708  LYS C O     1 
ATOM   8604  C CB    . LYS C 1 400 ? -29.596 -8.282  23.841  1.00 15.63  ? 708  LYS C CB    1 
ATOM   8605  C CG    . LYS C 1 400 ? -29.991 -8.929  25.181  1.00 12.38  ? 708  LYS C CG    1 
ATOM   8606  C CD    . LYS C 1 400 ? -29.554 -10.400 25.213  1.00 18.79  ? 708  LYS C CD    1 
ATOM   8607  C CE    . LYS C 1 400 ? -30.087 -11.134 26.451  1.00 13.30  ? 708  LYS C CE    1 
ATOM   8608  N NZ    . LYS C 1 400 ? -29.363 -10.709 27.686  1.00 13.54  ? 708  LYS C NZ    1 
ATOM   8609  N N     . ALA C 1 401 ? -32.315 -7.249  22.763  1.00 9.80   ? 709  ALA C N     1 
ATOM   8610  C CA    . ALA C 1 401 ? -33.747 -7.497  22.892  1.00 15.64  ? 709  ALA C CA    1 
ATOM   8611  C C     . ALA C 1 401 ? -33.981 -8.898  22.375  1.00 13.58  ? 709  ALA C C     1 
ATOM   8612  O O     . ALA C 1 401 ? -33.114 -9.468  21.716  1.00 12.78  ? 709  ALA C O     1 
ATOM   8613  C CB    . ALA C 1 401 ? -34.575 -6.473  22.102  1.00 14.82  ? 709  ALA C CB    1 
ATOM   8614  N N     . VAL C 1 402 ? -35.129 -9.476  22.697  1.00 8.33   ? 710  VAL C N     1 
ATOM   8615  C CA    . VAL C 1 402 ? -35.433 -10.796 22.195  1.00 8.77   ? 710  VAL C CA    1 
ATOM   8616  C C     . VAL C 1 402 ? -36.848 -10.774 21.610  1.00 20.11  ? 710  VAL C C     1 
ATOM   8617  O O     . VAL C 1 402 ? -37.634 -9.867  21.883  1.00 17.94  ? 710  VAL C O     1 
ATOM   8618  C CB    . VAL C 1 402 ? -35.285 -11.880 23.278  1.00 13.15  ? 710  VAL C CB    1 
ATOM   8619  C CG1   . VAL C 1 402 ? -33.874 -11.860 23.865  1.00 17.50  ? 710  VAL C CG1   1 
ATOM   8620  C CG2   . VAL C 1 402 ? -36.317 -11.689 24.380  1.00 17.20  ? 710  VAL C CG2   1 
ATOM   8621  N N     . ILE C 1 403 ? -37.151 -11.749 20.770  1.00 17.35  ? 711  ILE C N     1 
ATOM   8622  C CA    . ILE C 1 403 ? -38.483 -11.877 20.206  1.00 15.84  ? 711  ILE C CA    1 
ATOM   8623  C C     . ILE C 1 403 ? -39.075 -13.125 20.816  1.00 24.22  ? 711  ILE C C     1 
ATOM   8624  O O     . ILE C 1 403 ? -38.501 -14.200 20.688  1.00 27.60  ? 711  ILE C O     1 
ATOM   8625  C CB    . ILE C 1 403 ? -38.440 -12.050 18.674  1.00 27.47  ? 711  ILE C CB    1 
ATOM   8626  C CG1   . ILE C 1 403 ? -37.992 -10.755 17.994  1.00 27.18  ? 711  ILE C CG1   1 
ATOM   8627  C CG2   . ILE C 1 403 ? -39.792 -12.461 18.144  1.00 35.89  ? 711  ILE C CG2   1 
ATOM   8628  C CD1   . ILE C 1 403 ? -38.060 -10.828 16.486  1.00 30.63  ? 711  ILE C CD1   1 
ATOM   8629  N N     . ASP C 1 404 ? -40.208 -12.981 21.497  1.00 30.99  ? 712  ASP C N     1 
ATOM   8630  C CA    . ASP C 1 404 ? -40.874 -14.121 22.112  1.00 30.94  ? 712  ASP C CA    1 
ATOM   8631  C C     . ASP C 1 404 ? -41.694 -14.870 21.063  1.00 40.99  ? 712  ASP C C     1 
ATOM   8632  O O     . ASP C 1 404 ? -42.746 -14.393 20.636  1.00 62.15  ? 712  ASP C O     1 
ATOM   8633  C CB    . ASP C 1 404 ? -41.776 -13.664 23.261  1.00 29.37  ? 712  ASP C CB    1 
ATOM   8634  C CG    . ASP C 1 404 ? -42.672 -14.782 23.775  1.00 47.19  ? 712  ASP C CG    1 
ATOM   8635  O OD1   . ASP C 1 404 ? -43.867 -14.516 24.054  1.00 42.84  ? 712  ASP C OD1   1 
ATOM   8636  O OD2   . ASP C 1 404 ? -42.182 -15.930 23.894  1.00 38.19  ? 712  ASP C OD2   1 
ATOM   8637  N N     . PHE C 1 405 ? -41.213 -16.038 20.645  1.00 53.99  ? 713  PHE C N     1 
ATOM   8638  C CA    . PHE C 1 405 ? -41.836 -16.739 19.529  1.00 62.72  ? 713  PHE C CA    1 
ATOM   8639  C C     . PHE C 1 405 ? -42.651 -17.963 19.944  1.00 81.30  ? 713  PHE C C     1 
ATOM   8640  O O     . PHE C 1 405 ? -42.589 -19.009 19.299  1.00 90.67  ? 713  PHE C O     1 
ATOM   8641  C CB    . PHE C 1 405 ? -40.793 -17.122 18.475  1.00 60.86  ? 713  PHE C CB    1 
ATOM   8642  C CG    . PHE C 1 405 ? -39.925 -18.271 18.871  1.00 56.95  ? 713  PHE C CG    1 
ATOM   8643  C CD1   . PHE C 1 405 ? -39.283 -18.284 20.102  1.00 66.09  ? 713  PHE C CD1   1 
ATOM   8644  C CD2   . PHE C 1 405 ? -39.751 -19.347 18.015  1.00 59.87  ? 713  PHE C CD2   1 
ATOM   8645  C CE1   . PHE C 1 405 ? -38.482 -19.345 20.468  1.00 51.49  ? 713  PHE C CE1   1 
ATOM   8646  C CE2   . PHE C 1 405 ? -38.947 -20.419 18.377  1.00 60.32  ? 713  PHE C CE2   1 
ATOM   8647  C CZ    . PHE C 1 405 ? -38.318 -20.422 19.605  1.00 50.32  ? 713  PHE C CZ    1 
ATOM   8648  N N     . LYS C 1 406 ? -43.424 -17.820 21.015  1.00 90.06  ? 714  LYS C N     1 
ATOM   8649  C CA    . LYS C 1 406 ? -44.306 -18.887 21.479  1.00 84.00  ? 714  LYS C CA    1 
ATOM   8650  C C     . LYS C 1 406 ? -45.595 -18.289 22.029  1.00 69.70  ? 714  LYS C C     1 
ATOM   8651  O O     . LYS C 1 406 ? -45.571 -17.562 23.023  1.00 47.83  ? 714  LYS C O     1 
ATOM   8652  C CB    . LYS C 1 406 ? -43.623 -19.722 22.563  1.00 80.97  ? 714  LYS C CB    1 
ATOM   8653  C CG    . LYS C 1 406 ? -42.263 -20.274 22.174  1.00 82.39  ? 714  LYS C CG    1 
ATOM   8654  C CD    . LYS C 1 406 ? -41.520 -20.791 23.395  1.00 77.81  ? 714  LYS C CD    1 
ATOM   8655  C CE    . LYS C 1 406 ? -41.555 -19.772 24.529  1.00 72.36  ? 714  LYS C CE    1 
ATOM   8656  N NZ    . LYS C 1 406 ? -41.022 -18.438 24.122  1.00 47.52  ? 714  LYS C NZ    1 
ATOM   8657  N N     . ILE C 1 411 ? -40.454 -16.959 28.643  1.00 37.21  ? 719  ILE C N     1 
ATOM   8658  C CA    . ILE C 1 411 ? -39.634 -15.979 27.946  1.00 35.35  ? 719  ILE C CA    1 
ATOM   8659  C C     . ILE C 1 411 ? -38.164 -16.393 27.966  1.00 37.21  ? 719  ILE C C     1 
ATOM   8660  O O     . ILE C 1 411 ? -37.559 -16.532 29.030  1.00 37.62  ? 719  ILE C O     1 
ATOM   8661  C CB    . ILE C 1 411 ? -39.812 -14.570 28.548  1.00 25.51  ? 719  ILE C CB    1 
ATOM   8662  C CG1   . ILE C 1 411 ? -41.209 -14.041 28.230  1.00 35.16  ? 719  ILE C CG1   1 
ATOM   8663  C CG2   . ILE C 1 411 ? -38.745 -13.620 28.026  1.00 44.01  ? 719  ILE C CG2   1 
ATOM   8664  C CD1   . ILE C 1 411 ? -41.614 -12.871 29.078  1.00 26.83  ? 719  ILE C CD1   1 
ATOM   8665  N N     . TYR C 1 412 ? -37.603 -16.603 26.779  1.00 31.48  ? 720  TYR C N     1 
ATOM   8666  C CA    . TYR C 1 412 ? -36.217 -17.028 26.640  1.00 23.44  ? 720  TYR C CA    1 
ATOM   8667  C C     . TYR C 1 412 ? -35.373 -15.822 26.249  1.00 26.55  ? 720  TYR C C     1 
ATOM   8668  O O     . TYR C 1 412 ? -35.821 -14.985 25.437  1.00 13.26  ? 720  TYR C O     1 
ATOM   8669  C CB    . TYR C 1 412 ? -36.101 -18.081 25.536  1.00 26.85  ? 720  TYR C CB    1 
ATOM   8670  C CG    . TYR C 1 412 ? -36.658 -19.444 25.879  1.00 23.01  ? 720  TYR C CG    1 
ATOM   8671  C CD1   . TYR C 1 412 ? -36.528 -19.969 27.156  1.00 37.68  ? 720  TYR C CD1   1 
ATOM   8672  C CD2   . TYR C 1 412 ? -37.300 -20.215 24.914  1.00 51.33  ? 720  TYR C CD2   1 
ATOM   8673  C CE1   . TYR C 1 412 ? -37.029 -21.218 27.469  1.00 54.99  ? 720  TYR C CE1   1 
ATOM   8674  C CE2   . TYR C 1 412 ? -37.805 -21.466 25.217  1.00 63.37  ? 720  TYR C CE2   1 
ATOM   8675  C CZ    . TYR C 1 412 ? -37.667 -21.962 26.498  1.00 74.49  ? 720  TYR C CZ    1 
ATOM   8676  O OH    . TYR C 1 412 ? -38.168 -23.206 26.812  1.00 87.54  ? 720  TYR C OH    1 
ATOM   8677  N N     . ASP C 1 413 ? -34.157 -15.744 26.794  1.00 23.46  ? 721  ASP C N     1 
ATOM   8678  C CA    . ASP C 1 413 ? -33.242 -14.644 26.469  1.00 25.80  ? 721  ASP C CA    1 
ATOM   8679  C C     . ASP C 1 413 ? -32.218 -14.999 25.390  1.00 14.69  ? 721  ASP C C     1 
ATOM   8680  O O     . ASP C 1 413 ? -31.344 -14.203 25.076  1.00 19.77  ? 721  ASP C O     1 
ATOM   8681  C CB    . ASP C 1 413 ? -32.514 -14.134 27.728  1.00 10.53  ? 721  ASP C CB    1 
ATOM   8682  C CG    . ASP C 1 413 ? -31.484 -15.132 28.281  1.00 27.39  ? 721  ASP C CG    1 
ATOM   8683  O OD1   . ASP C 1 413 ? -31.448 -16.291 27.821  1.00 16.36  ? 721  ASP C OD1   1 
ATOM   8684  O OD2   . ASP C 1 413 ? -30.709 -14.752 29.194  1.00 15.30  ? 721  ASP C OD2   1 
ATOM   8685  N N     . ASN C 1 414 ? -32.302 -16.195 24.828  1.00 17.38  ? 722  ASN C N     1 
ATOM   8686  C CA    . ASN C 1 414 ? -31.204 -16.642 23.978  1.00 22.48  ? 722  ASN C CA    1 
ATOM   8687  C C     . ASN C 1 414 ? -31.647 -17.524 22.811  1.00 15.04  ? 722  ASN C C     1 
ATOM   8688  O O     . ASN C 1 414 ? -30.875 -18.331 22.286  1.00 13.24  ? 722  ASN C O     1 
ATOM   8689  C CB    . ASN C 1 414 ? -30.110 -17.314 24.827  1.00 7.89   ? 722  ASN C CB    1 
ATOM   8690  C CG    . ASN C 1 414 ? -30.613 -18.558 25.566  1.00 11.12  ? 722  ASN C CG    1 
ATOM   8691  O OD1   . ASN C 1 414 ? -31.768 -18.942 25.446  1.00 9.19   ? 722  ASN C OD1   1 
ATOM   8692  N ND2   . ASN C 1 414 ? -29.732 -19.188 26.331  1.00 10.92  ? 722  ASN C ND2   1 
ATOM   8693  N N     . ARG C 1 415 ? -32.903 -17.345 22.406  1.00 11.63  ? 723  ARG C N     1 
ATOM   8694  C CA    . ARG C 1 415 ? -33.455 -18.072 21.268  1.00 16.07  ? 723  ARG C CA    1 
ATOM   8695  C C     . ARG C 1 415 ? -33.447 -17.225 20.006  1.00 13.43  ? 723  ARG C C     1 
ATOM   8696  O O     . ARG C 1 415 ? -32.949 -17.653 18.971  1.00 13.85  ? 723  ARG C O     1 
ATOM   8697  C CB    . ARG C 1 415 ? -34.889 -18.506 21.569  1.00 15.45  ? 723  ARG C CB    1 
ATOM   8698  C CG    . ARG C 1 415 ? -35.000 -19.922 22.094  1.00 20.39  ? 723  ARG C CG    1 
ATOM   8699  C CD    . ARG C 1 415 ? -34.136 -20.155 23.323  1.00 21.03  ? 723  ARG C CD    1 
ATOM   8700  N NE    . ARG C 1 415 ? -34.376 -21.499 23.860  1.00 35.05  ? 723  ARG C NE    1 
ATOM   8701  C CZ    . ARG C 1 415 ? -34.015 -21.918 25.072  1.00 34.95  ? 723  ARG C CZ    1 
ATOM   8702  N NH1   . ARG C 1 415 ? -33.393 -21.101 25.916  1.00 18.43  ? 723  ARG C NH1   1 
ATOM   8703  N NH2   . ARG C 1 415 ? -34.293 -23.162 25.453  1.00 41.94  ? 723  ARG C NH2   1 
ATOM   8704  N N     A ILE C 1 416 ? -34.019 -16.028 20.103  0.50 10.63  ? 724  ILE C N     1 
ATOM   8705  N N     B ILE C 1 416 ? -34.048 -16.042 20.100  0.50 10.95  ? 724  ILE C N     1 
ATOM   8706  C CA    A ILE C 1 416 ? -34.012 -15.058 19.009  0.50 16.80  ? 724  ILE C CA    1 
ATOM   8707  C CA    B ILE C 1 416 ? -34.006 -15.050 19.030  0.50 16.67  ? 724  ILE C CA    1 
ATOM   8708  C C     A ILE C 1 416 ? -33.649 -13.699 19.581  0.50 15.27  ? 724  ILE C C     1 
ATOM   8709  C C     B ILE C 1 416 ? -33.602 -13.733 19.649  0.50 14.75  ? 724  ILE C C     1 
ATOM   8710  O O     A ILE C 1 416 ? -34.421 -13.122 20.348  0.50 9.90   ? 724  ILE C O     1 
ATOM   8711  O O     B ILE C 1 416 ? -34.299 -13.215 20.519  0.50 17.90  ? 724  ILE C O     1 
ATOM   8712  C CB    A ILE C 1 416 ? -35.389 -14.934 18.340  0.50 20.81  ? 724  ILE C CB    1 
ATOM   8713  C CB    B ILE C 1 416 ? -35.370 -14.835 18.367  0.50 19.64  ? 724  ILE C CB    1 
ATOM   8714  C CG1   A ILE C 1 416 ? -35.884 -16.301 17.860  0.50 17.46  ? 724  ILE C CG1   1 
ATOM   8715  C CG1   B ILE C 1 416 ? -35.975 -16.171 17.936  0.50 19.83  ? 724  ILE C CG1   1 
ATOM   8716  C CG2   A ILE C 1 416 ? -35.329 -13.930 17.187  0.50 16.59  ? 724  ILE C CG2   1 
ATOM   8717  C CG2   B ILE C 1 416 ? -35.240 -13.859 17.190  0.50 11.85  ? 724  ILE C CG2   1 
ATOM   8718  C CD1   A ILE C 1 416 ? -37.405 -16.375 17.694  0.50 7.94   ? 724  ILE C CD1   1 
ATOM   8719  C CD1   B ILE C 1 416 ? -35.031 -17.041 17.179  0.50 8.39   ? 724  ILE C CD1   1 
ATOM   8720  N N     . VAL C 1 417 ? -32.487 -13.186 19.185  1.00 7.33   ? 725  VAL C N     1 
ATOM   8721  C CA    . VAL C 1 417 ? -31.889 -12.034 19.825  1.00 11.31  ? 725  VAL C CA    1 
ATOM   8722  C C     . VAL C 1 417 ? -31.660 -10.911 18.831  1.00 8.66   ? 725  VAL C C     1 
ATOM   8723  O O     . VAL C 1 417 ? -31.273 -11.160 17.681  1.00 12.78  ? 725  VAL C O     1 
ATOM   8724  C CB    . VAL C 1 417 ? -30.503 -12.430 20.413  1.00 11.63  ? 725  VAL C CB    1 
ATOM   8725  C CG1   . VAL C 1 417 ? -29.856 -11.237 21.134  1.00 10.78  ? 725  VAL C CG1   1 
ATOM   8726  C CG2   . VAL C 1 417 ? -30.640 -13.648 21.355  1.00 14.59  ? 725  VAL C CG2   1 
ATOM   8727  N N     . LEU C 1 418 ? -31.910 -9.677  19.262  1.00 6.11   ? 726  LEU C N     1 
ATOM   8728  C CA    . LEU C 1 418 ? -31.551 -8.505  18.462  1.00 5.84   ? 726  LEU C CA    1 
ATOM   8729  C C     . LEU C 1 418 ? -30.495 -7.680  19.217  1.00 12.02  ? 726  LEU C C     1 
ATOM   8730  O O     . LEU C 1 418 ? -30.551 -7.574  20.446  1.00 9.98   ? 726  LEU C O     1 
ATOM   8731  C CB    . LEU C 1 418 ? -32.768 -7.611  18.208  1.00 7.08   ? 726  LEU C CB    1 
ATOM   8732  C CG    . LEU C 1 418 ? -34.037 -8.107  17.500  1.00 29.05  ? 726  LEU C CG    1 
ATOM   8733  C CD1   . LEU C 1 418 ? -35.146 -7.097  17.684  1.00 30.37  ? 726  LEU C CD1   1 
ATOM   8734  C CD2   . LEU C 1 418 ? -33.815 -8.338  16.029  1.00 29.51  ? 726  LEU C CD2   1 
ATOM   8735  N N     . ASN C 1 419 ? -29.552 -7.096  18.474  1.00 11.56  ? 727  ASN C N     1 
ATOM   8736  C CA    . ASN C 1 419 ? -28.595 -6.128  18.999  1.00 7.84   ? 727  ASN C CA    1 
ATOM   8737  C C     . ASN C 1 419 ? -28.434 -5.005  17.959  1.00 6.38   ? 727  ASN C C     1 
ATOM   8738  O O     . ASN C 1 419 ? -28.410 -5.258  16.754  1.00 9.46   ? 727  ASN C O     1 
ATOM   8739  C CB    . ASN C 1 419 ? -27.202 -6.747  19.199  1.00 10.29  ? 727  ASN C CB    1 
ATOM   8740  C CG    . ASN C 1 419 ? -27.212 -7.991  20.073  1.00 9.95   ? 727  ASN C CG    1 
ATOM   8741  O OD1   . ASN C 1 419 ? -27.259 -9.110  19.576  1.00 11.97  ? 727  ASN C OD1   1 
ATOM   8742  N ND2   . ASN C 1 419 ? -27.146 -7.799  21.375  1.00 7.53   ? 727  ASN C ND2   1 
ATOM   8743  N N     . GLY C 1 420 ? -28.274 -3.778  18.424  1.00 11.38  ? 728  GLY C N     1 
ATOM   8744  C CA    . GLY C 1 420 ? -27.862 -2.718  17.522  1.00 8.72   ? 728  GLY C CA    1 
ATOM   8745  C C     . GLY C 1 420 ? -27.711 -1.403  18.217  1.00 8.58   ? 728  GLY C C     1 
ATOM   8746  O O     . GLY C 1 420 ? -28.399 -1.133  19.209  1.00 12.51  ? 728  GLY C O     1 
ATOM   8747  N N     . ILE C 1 421 ? -26.812 -0.579  17.689  1.00 11.01  ? 729  ILE C N     1 
ATOM   8748  C CA    . ILE C 1 421 ? -26.671 0.797   18.138  1.00 14.37  ? 729  ILE C CA    1 
ATOM   8749  C C     . ILE C 1 421 ? -28.019 1.498   18.197  1.00 18.62  ? 729  ILE C C     1 
ATOM   8750  O O     . ILE C 1 421 ? -28.294 2.230   19.142  1.00 12.59  ? 729  ILE C O     1 
ATOM   8751  C CB    . ILE C 1 421 ? -25.719 1.587   17.208  1.00 9.27   ? 729  ILE C CB    1 
ATOM   8752  C CG1   . ILE C 1 421 ? -24.326 0.940   17.235  1.00 20.76  ? 729  ILE C CG1   1 
ATOM   8753  C CG2   . ILE C 1 421 ? -25.659 3.063   17.606  1.00 20.30  ? 729  ILE C CG2   1 
ATOM   8754  C CD1   . ILE C 1 421 ? -23.805 0.700   18.630  1.00 16.70  ? 729  ILE C CD1   1 
ATOM   8755  N N     . ASP C 1 422 ? -28.860 1.276   17.190  1.00 11.69  ? 730  ASP C N     1 
ATOM   8756  C CA    . ASP C 1 422 ? -30.174 1.930   17.135  1.00 12.73  ? 730  ASP C CA    1 
ATOM   8757  C C     . ASP C 1 422 ? -31.367 1.056   17.583  1.00 14.50  ? 730  ASP C C     1 
ATOM   8758  O O     . ASP C 1 422 ? -32.519 1.325   17.247  1.00 10.16  ? 730  ASP C O     1 
ATOM   8759  C CB    . ASP C 1 422 ? -30.407 2.484   15.728  1.00 15.51  ? 730  ASP C CB    1 
ATOM   8760  C CG    . ASP C 1 422 ? -29.281 3.410   15.282  1.00 23.05  ? 730  ASP C CG    1 
ATOM   8761  O OD1   . ASP C 1 422 ? -29.037 4.401   15.992  1.00 14.38  ? 730  ASP C OD1   1 
ATOM   8762  O OD2   . ASP C 1 422 ? -28.622 3.131   14.253  1.00 19.00  ? 730  ASP C OD2   1 
ATOM   8763  N N     . LEU C 1 423 ? -31.096 0.022   18.362  1.00 13.16  ? 731  LEU C N     1 
ATOM   8764  C CA    . LEU C 1 423 ? -32.152 -0.904  18.769  1.00 11.33  ? 731  LEU C CA    1 
ATOM   8765  C C     . LEU C 1 423 ? -33.274 -0.243  19.570  1.00 16.40  ? 731  LEU C C     1 
ATOM   8766  O O     . LEU C 1 423 ? -34.439 -0.597  19.427  1.00 17.38  ? 731  LEU C O     1 
ATOM   8767  C CB    . LEU C 1 423 ? -31.574 -2.056  19.589  1.00 12.08  ? 731  LEU C CB    1 
ATOM   8768  C CG    . LEU C 1 423 ? -32.619 -3.080  20.085  1.00 10.25  ? 731  LEU C CG    1 
ATOM   8769  C CD1   . LEU C 1 423 ? -33.335 -3.737  18.913  1.00 14.16  ? 731  LEU C CD1   1 
ATOM   8770  C CD2   . LEU C 1 423 ? -31.921 -4.152  20.939  1.00 23.76  ? 731  LEU C CD2   1 
ATOM   8771  N N     . LYS C 1 424 ? -32.922 0.699   20.438  1.00 15.18  ? 732  LYS C N     1 
ATOM   8772  C CA    . LYS C 1 424 ? -33.944 1.362   21.242  1.00 15.40  ? 732  LYS C CA    1 
ATOM   8773  C C     . LYS C 1 424 ? -34.962 2.100   20.377  1.00 18.64  ? 732  LYS C C     1 
ATOM   8774  O O     . LYS C 1 424 ? -36.163 2.011   20.621  1.00 15.50  ? 732  LYS C O     1 
ATOM   8775  C CB    . LYS C 1 424 ? -33.310 2.326   22.224  1.00 8.80   ? 732  LYS C CB    1 
ATOM   8776  C CG    . LYS C 1 424 ? -34.327 2.995   23.156  1.00 16.67  ? 732  LYS C CG    1 
ATOM   8777  C CD    . LYS C 1 424 ? -33.647 4.006   24.059  1.00 43.70  ? 732  LYS C CD    1 
ATOM   8778  C CE    . LYS C 1 424 ? -34.658 4.728   24.932  1.00 67.53  ? 732  LYS C CE    1 
ATOM   8779  N NZ    . LYS C 1 424 ? -34.002 5.720   25.828  1.00 79.60  ? 732  LYS C NZ    1 
ATOM   8780  N N     . ALA C 1 425 ? -34.459 2.854   19.397  1.00 15.05  ? 733  ALA C N     1 
ATOM   8781  C CA    . ALA C 1 425 ? -35.284 3.574   18.433  1.00 15.84  ? 733  ALA C CA    1 
ATOM   8782  C C     . ALA C 1 425 ? -36.216 2.635   17.664  1.00 15.32  ? 733  ALA C C     1 
ATOM   8783  O O     . ALA C 1 425 ? -37.375 2.959   17.420  1.00 19.82  ? 733  ALA C O     1 
ATOM   8784  C CB    . ALA C 1 425 ? -34.387 4.348   17.459  1.00 16.08  ? 733  ALA C CB    1 
ATOM   8785  N N     . PHE C 1 426 ? -35.695 1.481   17.261  1.00 14.14  ? 734  PHE C N     1 
ATOM   8786  C CA    . PHE C 1 426 ? -36.501 0.473   16.590  1.00 12.60  ? 734  PHE C CA    1 
ATOM   8787  C C     . PHE C 1 426 ? -37.627 -0.036  17.498  1.00 10.75  ? 734  PHE C C     1 
ATOM   8788  O O     . PHE C 1 426 ? -38.801 -0.009  17.131  1.00 13.29  ? 734  PHE C O     1 
ATOM   8789  C CB    . PHE C 1 426 ? -35.618 -0.696  16.142  1.00 15.01  ? 734  PHE C CB    1 
ATOM   8790  C CG    . PHE C 1 426 ? -36.393 -1.859  15.586  1.00 13.03  ? 734  PHE C CG    1 
ATOM   8791  C CD1   . PHE C 1 426 ? -36.305 -3.109  16.174  1.00 18.57  ? 734  PHE C CD1   1 
ATOM   8792  C CD2   . PHE C 1 426 ? -37.218 -1.695  14.489  1.00 20.62  ? 734  PHE C CD2   1 
ATOM   8793  C CE1   . PHE C 1 426 ? -37.020 -4.182  15.670  1.00 21.25  ? 734  PHE C CE1   1 
ATOM   8794  C CE2   . PHE C 1 426 ? -37.944 -2.767  13.979  1.00 21.39  ? 734  PHE C CE2   1 
ATOM   8795  C CZ    . PHE C 1 426 ? -37.839 -4.012  14.573  1.00 14.28  ? 734  PHE C CZ    1 
ATOM   8796  N N     . LEU C 1 427 ? -37.266 -0.482  18.692  1.00 16.03  ? 735  LEU C N     1 
ATOM   8797  C CA    . LEU C 1 427 ? -38.268 -0.913  19.660  1.00 20.93  ? 735  LEU C CA    1 
ATOM   8798  C C     . LEU C 1 427 ? -39.321 0.182   19.889  1.00 25.04  ? 735  LEU C C     1 
ATOM   8799  O O     . LEU C 1 427 ? -40.517 -0.105  19.967  1.00 14.26  ? 735  LEU C O     1 
ATOM   8800  C CB    . LEU C 1 427 ? -37.595 -1.322  20.978  1.00 23.19  ? 735  LEU C CB    1 
ATOM   8801  C CG    . LEU C 1 427 ? -36.563 -2.461  20.903  1.00 22.16  ? 735  LEU C CG    1 
ATOM   8802  C CD1   . LEU C 1 427 ? -35.786 -2.602  22.212  1.00 17.90  ? 735  LEU C CD1   1 
ATOM   8803  C CD2   . LEU C 1 427 ? -37.213 -3.805  20.517  1.00 19.99  ? 735  LEU C CD2   1 
ATOM   8804  N N     . ASP C 1 428 ? -38.885 1.437   19.969  1.00 17.69  ? 736  ASP C N     1 
ATOM   8805  C CA    . ASP C 1 428 ? -39.820 2.544   20.162  1.00 26.21  ? 736  ASP C CA    1 
ATOM   8806  C C     . ASP C 1 428 ? -40.828 2.724   19.022  1.00 24.25  ? 736  ASP C C     1 
ATOM   8807  O O     . ASP C 1 428 ? -41.881 3.310   19.209  1.00 20.33  ? 736  ASP C O     1 
ATOM   8808  C CB    . ASP C 1 428 ? -39.078 3.852   20.423  1.00 30.18  ? 736  ASP C CB    1 
ATOM   8809  C CG    . ASP C 1 428 ? -38.471 3.899   21.806  1.00 30.32  ? 736  ASP C CG    1 
ATOM   8810  O OD1   . ASP C 1 428 ? -38.850 3.046   22.631  1.00 26.43  ? 736  ASP C OD1   1 
ATOM   8811  O OD2   . ASP C 1 428 ? -37.634 4.783   22.075  1.00 37.93  ? 736  ASP C OD2   1 
ATOM   8812  N N     . SER C 1 429 ? -40.502 2.234   17.840  1.00 15.01  ? 737  SER C N     1 
ATOM   8813  C CA    . SER C 1 429 ? -41.430 2.338   16.722  1.00 26.41  ? 737  SER C CA    1 
ATOM   8814  C C     . SER C 1 429 ? -42.428 1.191   16.779  1.00 33.07  ? 737  SER C C     1 
ATOM   8815  O O     . SER C 1 429 ? -43.359 1.128   15.977  1.00 26.85  ? 737  SER C O     1 
ATOM   8816  C CB    . SER C 1 429 ? -40.676 2.294   15.391  1.00 24.71  ? 737  SER C CB    1 
ATOM   8817  O OG    . SER C 1 429 ? -40.223 0.979   15.099  1.00 22.86  ? 737  SER C OG    1 
ATOM   8818  N N     . LEU C 1 430 ? -42.224 0.282   17.732  1.00 29.40  ? 738  LEU C N     1 
ATOM   8819  C CA    . LEU C 1 430 ? -43.070 -0.900  17.865  1.00 31.01  ? 738  LEU C CA    1 
ATOM   8820  C C     . LEU C 1 430 ? -44.136 -0.738  18.949  1.00 28.24  ? 738  LEU C C     1 
ATOM   8821  O O     . LEU C 1 430 ? -43.852 -0.275  20.053  1.00 40.40  ? 738  LEU C O     1 
ATOM   8822  C CB    . LEU C 1 430 ? -42.223 -2.133  18.159  1.00 20.53  ? 738  LEU C CB    1 
ATOM   8823  C CG    . LEU C 1 430 ? -41.181 -2.500  17.104  1.00 28.00  ? 738  LEU C CG    1 
ATOM   8824  C CD1   . LEU C 1 430 ? -40.459 -3.775  17.508  1.00 27.77  ? 738  LEU C CD1   1 
ATOM   8825  C CD2   . LEU C 1 430 ? -41.835 -2.652  15.745  1.00 32.58  ? 738  LEU C CD2   1 
ATOM   8826  N N     . PRO C 1 431 ? -45.368 -1.137  18.630  1.00 27.70  ? 739  PRO C N     1 
ATOM   8827  C CA    . PRO C 1 431 ? -46.525 -0.986  19.522  1.00 38.92  ? 739  PRO C CA    1 
ATOM   8828  C C     . PRO C 1 431 ? -46.508 -1.827  20.805  1.00 45.70  ? 739  PRO C C     1 
ATOM   8829  O O     . PRO C 1 431 ? -46.736 -1.263  21.873  1.00 73.09  ? 739  PRO C O     1 
ATOM   8830  C CB    . PRO C 1 431 ? -47.706 -1.402  18.635  1.00 46.50  ? 739  PRO C CB    1 
ATOM   8831  C CG    . PRO C 1 431 ? -47.103 -2.261  17.573  1.00 45.57  ? 739  PRO C CG    1 
ATOM   8832  C CD    . PRO C 1 431 ? -45.747 -1.683  17.318  1.00 35.08  ? 739  PRO C CD    1 
ATOM   8833  N N     . ASP C 1 432 ? -46.255 -3.130  20.720  1.00 40.45  ? 740  ASP C N     1 
ATOM   8834  C CA    . ASP C 1 432 ? -46.558 -4.019  21.852  1.00 51.55  ? 740  ASP C CA    1 
ATOM   8835  C C     . ASP C 1 432 ? -45.350 -4.599  22.587  1.00 43.57  ? 740  ASP C C     1 
ATOM   8836  O O     . ASP C 1 432 ? -45.391 -5.742  23.048  1.00 36.28  ? 740  ASP C O     1 
ATOM   8837  C CB    . ASP C 1 432 ? -47.477 -5.163  21.404  1.00 54.55  ? 740  ASP C CB    1 
ATOM   8838  C CG    . ASP C 1 432 ? -48.849 -4.679  20.976  1.00 63.40  ? 740  ASP C CG    1 
ATOM   8839  O OD1   . ASP C 1 432 ? -49.423 -3.821  21.679  1.00 71.35  ? 740  ASP C OD1   1 
ATOM   8840  O OD2   . ASP C 1 432 ? -49.352 -5.155  19.936  1.00 59.06  ? 740  ASP C OD2   1 
ATOM   8841  N N     . VAL C 1 433 ? -44.293 -3.806  22.711  1.00 28.41  ? 741  VAL C N     1 
ATOM   8842  C CA    . VAL C 1 433 ? -43.066 -4.248  23.370  1.00 30.67  ? 741  VAL C CA    1 
ATOM   8843  C C     . VAL C 1 433 ? -43.204 -4.345  24.896  1.00 31.92  ? 741  VAL C C     1 
ATOM   8844  O O     . VAL C 1 433 ? -43.633 -3.399  25.559  1.00 36.49  ? 741  VAL C O     1 
ATOM   8845  C CB    . VAL C 1 433 ? -41.882 -3.318  23.015  1.00 26.84  ? 741  VAL C CB    1 
ATOM   8846  C CG1   . VAL C 1 433 ? -40.660 -3.653  23.859  1.00 26.10  ? 741  VAL C CG1   1 
ATOM   8847  C CG2   . VAL C 1 433 ? -41.559 -3.421  21.519  1.00 25.15  ? 741  VAL C CG2   1 
ATOM   8848  N N     . LYS C 1 434 ? -42.841 -5.495  25.448  1.00 23.61  ? 742  LYS C N     1 
ATOM   8849  C CA    . LYS C 1 434 ? -42.828 -5.680  26.894  1.00 29.20  ? 742  LYS C CA    1 
ATOM   8850  C C     . LYS C 1 434 ? -41.406 -5.654  27.453  1.00 28.59  ? 742  LYS C C     1 
ATOM   8851  O O     . LYS C 1 434 ? -40.474 -6.180  26.847  1.00 28.51  ? 742  LYS C O     1 
ATOM   8852  C CB    . LYS C 1 434 ? -43.534 -6.986  27.266  1.00 42.22  ? 742  LYS C CB    1 
ATOM   8853  C CG    . LYS C 1 434 ? -44.984 -7.022  26.801  1.00 70.44  ? 742  LYS C CG    1 
ATOM   8854  C CD    . LYS C 1 434 ? -45.816 -8.031  27.571  1.00 77.99  ? 742  LYS C CD    1 
ATOM   8855  C CE    . LYS C 1 434 ? -47.297 -7.836  27.280  1.00 82.89  ? 742  LYS C CE    1 
ATOM   8856  N NZ    . LYS C 1 434 ? -48.153 -8.743  28.091  1.00 87.59  ? 742  LYS C NZ    1 
ATOM   8857  N N     . ILE C 1 435 ? -41.246 -5.034  28.613  1.00 25.95  ? 743  ILE C N     1 
ATOM   8858  C CA    . ILE C 1 435 ? -39.939 -4.892  29.235  1.00 31.06  ? 743  ILE C CA    1 
ATOM   8859  C C     . ILE C 1 435 ? -39.787 -5.802  30.454  1.00 40.05  ? 743  ILE C C     1 
ATOM   8860  O O     . ILE C 1 435 ? -40.366 -5.546  31.510  1.00 37.64  ? 743  ILE C O     1 
ATOM   8861  C CB    . ILE C 1 435 ? -39.696 -3.430  29.676  1.00 26.75  ? 743  ILE C CB    1 
ATOM   8862  C CG1   . ILE C 1 435 ? -39.801 -2.476  28.482  1.00 36.82  ? 743  ILE C CG1   1 
ATOM   8863  C CG2   . ILE C 1 435 ? -38.342 -3.294  30.355  1.00 35.63  ? 743  ILE C CG2   1 
ATOM   8864  C CD1   . ILE C 1 435 ? -38.614 -2.530  27.522  1.00 21.51  ? 743  ILE C CD1   1 
ATOM   8865  N N     . VAL C 1 436 ? -39.004 -6.866  30.309  1.00 25.40  ? 744  VAL C N     1 
ATOM   8866  C CA    . VAL C 1 436 ? -38.746 -7.758  31.427  1.00 33.87  ? 744  VAL C CA    1 
ATOM   8867  C C     . VAL C 1 436 ? -37.601 -7.227  32.282  1.00 37.32  ? 744  VAL C C     1 
ATOM   8868  O O     . VAL C 1 436 ? -36.528 -6.930  31.762  1.00 37.06  ? 744  VAL C O     1 
ATOM   8869  C CB    . VAL C 1 436 ? -38.411 -9.169  30.931  1.00 37.44  ? 744  VAL C CB    1 
ATOM   8870  C CG1   . VAL C 1 436 ? -37.866 -10.017 32.068  1.00 39.72  ? 744  VAL C CG1   1 
ATOM   8871  C CG2   . VAL C 1 436 ? -39.643 -9.805  30.313  1.00 36.53  ? 744  VAL C CG2   1 
ATOM   8872  N N     . LYS C 1 437 ? -37.834 -7.090  33.586  1.00 49.11  ? 745  LYS C N     1 
ATOM   8873  C CA    . LYS C 1 437 ? -36.814 -6.572  34.501  1.00 52.02  ? 745  LYS C CA    1 
ATOM   8874  C C     . LYS C 1 437 ? -35.753 -7.626  34.818  1.00 65.83  ? 745  LYS C C     1 
ATOM   8875  O O     . LYS C 1 437 ? -36.075 -8.795  35.030  1.00 75.16  ? 745  LYS C O     1 
ATOM   8876  C CB    . LYS C 1 437 ? -37.441 -6.047  35.802  1.00 55.47  ? 745  LYS C CB    1 
ATOM   8877  C CG    . LYS C 1 437 ? -37.991 -4.621  35.732  1.00 51.77  ? 745  LYS C CG    1 
ATOM   8878  C CD    . LYS C 1 437 ? -38.404 -4.107  37.119  1.00 47.88  ? 745  LYS C CD    1 
ATOM   8879  C CE    . LYS C 1 437 ? -38.925 -2.666  37.061  1.00 49.54  ? 745  LYS C CE    1 
ATOM   8880  N NZ    . LYS C 1 437 ? -39.173 -2.066  38.416  1.00 41.65  ? 745  LYS C NZ    1 
ATOM   8881  N N     . MET C 1 438 ? -34.492 -7.199  34.851  1.00 68.90  ? 746  MET C N     1 
ATOM   8882  C CA    . MET C 1 438 ? -33.368 -8.093  35.119  1.00 75.58  ? 746  MET C CA    1 
ATOM   8883  C C     . MET C 1 438 ? -32.892 -7.952  36.562  1.00 74.52  ? 746  MET C C     1 
ATOM   8884  O O     . MET C 1 438 ? -33.584 -8.350  37.500  1.00 71.79  ? 746  MET C O     1 
ATOM   8885  C CB    . MET C 1 438 ? -32.203 -7.815  34.158  1.00 74.83  ? 746  MET C CB    1 
ATOM   8886  C CG    . MET C 1 438 ? -32.516 -8.048  32.682  1.00 75.06  ? 746  MET C CG    1 
ATOM   8887  S SD    . MET C 1 438 ? -31.040 -8.055  31.637  1.00 32.08  ? 746  MET C SD    1 
ATOM   8888  C CE    . MET C 1 438 ? -30.168 -9.473  32.314  1.00 39.23  ? 746  MET C CE    1 
ATOM   8889  N N     . LEU C 1 454 ? -29.484 -3.985  33.294  1.00 29.87  ? 762  LEU C N     1 
ATOM   8890  C CA    . LEU C 1 454 ? -30.540 -3.091  32.822  1.00 57.29  ? 762  LEU C CA    1 
ATOM   8891  C C     . LEU C 1 454 ? -31.870 -3.829  32.668  1.00 58.09  ? 762  LEU C C     1 
ATOM   8892  O O     . LEU C 1 454 ? -32.374 -4.426  33.618  1.00 66.46  ? 762  LEU C O     1 
ATOM   8893  C CB    . LEU C 1 454 ? -30.144 -2.437  31.491  1.00 63.93  ? 762  LEU C CB    1 
ATOM   8894  C CG    . LEU C 1 454 ? -30.901 -1.166  31.086  1.00 54.86  ? 762  LEU C CG    1 
ATOM   8895  C CD1   . LEU C 1 454 ? -30.462 0.012   31.935  1.00 46.63  ? 762  LEU C CD1   1 
ATOM   8896  C CD2   . LEU C 1 454 ? -30.702 -0.857  29.613  1.00 57.70  ? 762  LEU C CD2   1 
ATOM   8897  N N     . ASN C 1 455 ? -32.440 -3.770  31.468  1.00 59.42  ? 763  ASN C N     1 
ATOM   8898  C CA    . ASN C 1 455 ? -33.679 -4.480  31.168  1.00 47.48  ? 763  ASN C CA    1 
ATOM   8899  C C     . ASN C 1 455 ? -33.662 -5.189  29.820  1.00 38.48  ? 763  ASN C C     1 
ATOM   8900  O O     . ASN C 1 455 ? -32.895 -4.832  28.927  1.00 27.97  ? 763  ASN C O     1 
ATOM   8901  C CB    . ASN C 1 455 ? -34.907 -3.562  31.298  1.00 54.41  ? 763  ASN C CB    1 
ATOM   8902  C CG    . ASN C 1 455 ? -34.856 -2.363  30.365  1.00 53.06  ? 763  ASN C CG    1 
ATOM   8903  O OD1   . ASN C 1 455 ? -35.263 -2.444  29.204  1.00 38.56  ? 763  ASN C OD1   1 
ATOM   8904  N ND2   . ASN C 1 455 ? -34.378 -1.235  30.878  1.00 61.92  ? 763  ASN C ND2   1 
ATOM   8905  N N     . MET C 1 456 ? -34.499 -6.209  29.679  1.00 24.08  ? 764  MET C N     1 
ATOM   8906  C CA    . MET C 1 456 ? -34.580 -6.921  28.412  1.00 19.64  ? 764  MET C CA    1 
ATOM   8907  C C     . MET C 1 456 ? -35.939 -6.711  27.764  1.00 26.08  ? 764  MET C C     1 
ATOM   8908  O O     . MET C 1 456 ? -36.947 -7.265  28.220  1.00 28.63  ? 764  MET C O     1 
ATOM   8909  C CB    . MET C 1 456 ? -34.318 -8.418  28.602  1.00 23.29  ? 764  MET C CB    1 
ATOM   8910  C CG    . MET C 1 456 ? -34.203 -9.178  27.286  1.00 20.04  ? 764  MET C CG    1 
ATOM   8911  S SD    . MET C 1 456 ? -34.003 -10.953 27.491  1.00 25.10  ? 764  MET C SD    1 
ATOM   8912  C CE    . MET C 1 456 ? -35.608 -11.456 28.102  1.00 19.07  ? 764  MET C CE    1 
ATOM   8913  N N     . PRO C 1 457 ? -35.978 -5.900  26.703  1.00 14.73  ? 765  PRO C N     1 
ATOM   8914  C CA    . PRO C 1 457 ? -37.217 -5.723  25.944  1.00 23.75  ? 765  PRO C CA    1 
ATOM   8915  C C     . PRO C 1 457 ? -37.569 -6.991  25.170  1.00 19.04  ? 765  PRO C C     1 
ATOM   8916  O O     . PRO C 1 457 ? -36.685 -7.660  24.651  1.00 13.72  ? 765  PRO C O     1 
ATOM   8917  C CB    . PRO C 1 457 ? -36.866 -4.595  24.962  1.00 20.65  ? 765  PRO C CB    1 
ATOM   8918  C CG    . PRO C 1 457 ? -35.611 -3.987  25.493  1.00 19.34  ? 765  PRO C CG    1 
ATOM   8919  C CD    . PRO C 1 457 ? -34.883 -5.109  26.134  1.00 13.71  ? 765  PRO C CD    1 
ATOM   8920  N N     . VAL C 1 458 ? -38.858 -7.292  25.084  1.00 17.41  ? 766  VAL C N     1 
ATOM   8921  C CA    . VAL C 1 458 ? -39.341 -8.497  24.432  1.00 25.10  ? 766  VAL C CA    1 
ATOM   8922  C C     . VAL C 1 458 ? -40.370 -8.113  23.369  1.00 28.63  ? 766  VAL C C     1 
ATOM   8923  O O     . VAL C 1 458 ? -41.349 -7.430  23.667  1.00 27.10  ? 766  VAL C O     1 
ATOM   8924  C CB    . VAL C 1 458 ? -40.019 -9.440  25.446  1.00 27.70  ? 766  VAL C CB    1 
ATOM   8925  C CG1   . VAL C 1 458 ? -40.634 -10.634 24.727  1.00 24.07  ? 766  VAL C CG1   1 
ATOM   8926  C CG2   . VAL C 1 458 ? -39.023 -9.895  26.520  1.00 16.57  ? 766  VAL C CG2   1 
ATOM   8927  N N     . ILE C 1 459 ? -40.141 -8.534  22.129  1.00 22.61  ? 767  ILE C N     1 
ATOM   8928  C CA    . ILE C 1 459 ? -41.080 -8.262  21.040  1.00 22.26  ? 767  ILE C CA    1 
ATOM   8929  C C     . ILE C 1 459 ? -42.006 -9.461  20.854  1.00 22.48  ? 767  ILE C C     1 
ATOM   8930  O O     . ILE C 1 459 ? -41.540 -10.587 20.738  1.00 26.65  ? 767  ILE C O     1 
ATOM   8931  C CB    . ILE C 1 459 ? -40.331 -8.010  19.719  1.00 30.49  ? 767  ILE C CB    1 
ATOM   8932  C CG1   . ILE C 1 459 ? -39.402 -6.802  19.853  1.00 29.61  ? 767  ILE C CG1   1 
ATOM   8933  C CG2   . ILE C 1 459 ? -41.312 -7.825  18.577  1.00 37.45  ? 767  ILE C CG2   1 
ATOM   8934  C CD1   . ILE C 1 459 ? -38.395 -6.675  18.715  1.00 32.58  ? 767  ILE C CD1   1 
ATOM   8935  N N     . PRO C 1 460 ? -43.327 -9.225  20.837  1.00 36.44  ? 768  PRO C N     1 
ATOM   8936  C CA    . PRO C 1 460 ? -44.318 -10.307 20.725  1.00 40.40  ? 768  PRO C CA    1 
ATOM   8937  C C     . PRO C 1 460 ? -44.315 -11.001 19.360  1.00 40.62  ? 768  PRO C C     1 
ATOM   8938  O O     . PRO C 1 460 ? -43.950 -10.390 18.350  1.00 36.19  ? 768  PRO C O     1 
ATOM   8939  C CB    . PRO C 1 460 ? -45.650 -9.580  20.940  1.00 48.71  ? 768  PRO C CB    1 
ATOM   8940  C CG    . PRO C 1 460 ? -45.378 -8.171  20.530  1.00 51.78  ? 768  PRO C CG    1 
ATOM   8941  C CD    . PRO C 1 460 ? -43.962 -7.901  20.947  1.00 42.66  ? 768  PRO C CD    1 
ATOM   8942  N N     . MET C 1 461 ? -44.740 -12.262 19.341  1.00 52.52  ? 769  MET C N     1 
ATOM   8943  C CA    . MET C 1 461 ? -44.741 -13.079 18.124  1.00 55.92  ? 769  MET C CA    1 
ATOM   8944  C C     . MET C 1 461 ? -45.829 -12.658 17.136  1.00 50.88  ? 769  MET C C     1 
ATOM   8945  O O     . MET C 1 461 ? -46.700 -13.448 16.768  1.00 50.26  ? 769  MET C O     1 
ATOM   8946  C CB    . MET C 1 461 ? -44.887 -14.567 18.477  1.00 49.78  ? 769  MET C CB    1 
ATOM   8947  C CG    . MET C 1 461 ? -44.828 -15.519 17.286  1.00 45.99  ? 769  MET C CG    1 
ATOM   8948  S SD    . MET C 1 461 ? -43.324 -15.385 16.306  1.00 69.59  ? 769  MET C SD    1 
ATOM   8949  C CE    . MET C 1 461 ? -43.675 -16.553 14.990  1.00 70.54  ? 769  MET C CE    1 
ATOM   8950  N N     . ASN C 1 462 ? -45.769 -11.408 16.700  1.00 40.08  ? 770  ASN C N     1 
ATOM   8951  C CA    . ASN C 1 462 ? -46.728 -10.914 15.730  1.00 31.82  ? 770  ASN C CA    1 
ATOM   8952  C C     . ASN C 1 462 ? -46.113 -10.707 14.345  1.00 30.58  ? 770  ASN C C     1 
ATOM   8953  O O     . ASN C 1 462 ? -45.136 -11.372 13.990  1.00 32.63  ? 770  ASN C O     1 
ATOM   8954  C CB    . ASN C 1 462 ? -47.401 -9.640  16.236  1.00 48.66  ? 770  ASN C CB    1 
ATOM   8955  C CG    . ASN C 1 462 ? -48.226 -9.882  17.484  1.00 56.94  ? 770  ASN C CG    1 
ATOM   8956  O OD1   . ASN C 1 462 ? -47.935 -10.791 18.263  1.00 53.39  ? 770  ASN C OD1   1 
ATOM   8957  N ND2   . ASN C 1 462 ? -49.266 -9.075  17.677  1.00 59.01  ? 770  ASN C ND2   1 
ATOM   8958  N N     . THR C 1 463 ? -46.713 -9.804  13.571  1.00 44.59  ? 771  THR C N     1 
ATOM   8959  C CA    . THR C 1 463 ? -46.337 -9.561  12.179  1.00 50.83  ? 771  THR C CA    1 
ATOM   8960  C C     . THR C 1 463 ? -44.852 -9.255  11.996  1.00 57.47  ? 771  THR C C     1 
ATOM   8961  O O     . THR C 1 463 ? -44.164 -9.899  11.200  1.00 51.76  ? 771  THR C O     1 
ATOM   8962  C CB    . THR C 1 463 ? -47.146 -8.396  11.585  1.00 47.06  ? 771  THR C CB    1 
ATOM   8963  O OG1   . THR C 1 463 ? -48.530 -8.549  11.922  1.00 49.11  ? 771  THR C OG1   1 
ATOM   8964  C CG2   . THR C 1 463 ? -46.995 -8.361  10.071  1.00 51.62  ? 771  THR C CG2   1 
ATOM   8965  N N     . ILE C 1 464 ? -44.365 -8.258  12.725  1.00 59.31  ? 772  ILE C N     1 
ATOM   8966  C CA    . ILE C 1 464 ? -42.950 -7.916  12.684  1.00 44.95  ? 772  ILE C CA    1 
ATOM   8967  C C     . ILE C 1 464 ? -42.068 -9.135  12.998  1.00 45.98  ? 772  ILE C C     1 
ATOM   8968  O O     . ILE C 1 464 ? -41.035 -9.341  12.360  1.00 47.00  ? 772  ILE C O     1 
ATOM   8969  C CB    . ILE C 1 464 ? -42.628 -6.739  13.635  1.00 51.20  ? 772  ILE C CB    1 
ATOM   8970  C CG1   . ILE C 1 464 ? -42.783 -5.407  12.900  1.00 50.83  ? 772  ILE C CG1   1 
ATOM   8971  C CG2   . ILE C 1 464 ? -41.216 -6.849  14.183  1.00 47.05  ? 772  ILE C CG2   1 
ATOM   8972  C CD1   . ILE C 1 464 ? -44.186 -5.122  12.419  1.00 38.28  ? 772  ILE C CD1   1 
ATOM   8973  N N     . ALA C 1 465 ? -42.485 -9.956  13.958  1.00 41.73  ? 773  ALA C N     1 
ATOM   8974  C CA    . ALA C 1 465 ? -41.690 -11.127 14.352  1.00 34.97  ? 773  ALA C CA    1 
ATOM   8975  C C     . ALA C 1 465 ? -41.718 -12.248 13.320  1.00 34.61  ? 773  ALA C C     1 
ATOM   8976  O O     . ALA C 1 465 ? -40.798 -13.056 13.245  1.00 31.66  ? 773  ALA C O     1 
ATOM   8977  C CB    . ALA C 1 465 ? -42.137 -11.649 15.695  1.00 25.67  ? 773  ALA C CB    1 
ATOM   8978  N N     . GLU C 1 466 ? -42.784 -12.311 12.535  1.00 43.01  ? 774  GLU C N     1 
ATOM   8979  C CA    . GLU C 1 466 ? -42.869 -13.328 11.498  1.00 34.51  ? 774  GLU C CA    1 
ATOM   8980  C C     . GLU C 1 466 ? -41.933 -12.971 10.357  1.00 30.78  ? 774  GLU C C     1 
ATOM   8981  O O     . GLU C 1 466 ? -41.234 -13.832 9.820   1.00 21.66  ? 774  GLU C O     1 
ATOM   8982  C CB    . GLU C 1 466 ? -44.301 -13.448 10.993  1.00 36.06  ? 774  GLU C CB    1 
ATOM   8983  C CG    . GLU C 1 466 ? -45.250 -14.028 12.026  1.00 35.73  ? 774  GLU C CG    1 
ATOM   8984  C CD    . GLU C 1 466 ? -46.685 -14.083 11.530  1.00 45.60  ? 774  GLU C CD    1 
ATOM   8985  O OE1   . GLU C 1 466 ? -47.203 -13.036 11.080  1.00 43.24  ? 774  GLU C OE1   1 
ATOM   8986  O OE2   . GLU C 1 466 ? -47.288 -15.177 11.577  1.00 48.55  ? 774  GLU C OE2   1 
ATOM   8987  N N     . ALA C 1 467 ? -41.923 -11.689 10.004  1.00 28.37  ? 775  ALA C N     1 
ATOM   8988  C CA    . ALA C 1 467 ? -41.083 -11.188 8.925   1.00 37.01  ? 775  ALA C CA    1 
ATOM   8989  C C     . ALA C 1 467 ? -39.617 -11.462 9.237   1.00 31.33  ? 775  ALA C C     1 
ATOM   8990  O O     . ALA C 1 467 ? -38.832 -11.802 8.346   1.00 23.49  ? 775  ALA C O     1 
ATOM   8991  C CB    . ALA C 1 467 ? -41.320 -9.705  8.717   1.00 32.63  ? 775  ALA C CB    1 
ATOM   8992  N N     . VAL C 1 468 ? -39.253 -11.330 10.508  1.00 32.40  ? 776  VAL C N     1 
ATOM   8993  C CA    . VAL C 1 468 ? -37.882 -11.612 10.921  1.00 27.64  ? 776  VAL C CA    1 
ATOM   8994  C C     . VAL C 1 468 ? -37.517 -13.085 10.753  1.00 28.36  ? 776  VAL C C     1 
ATOM   8995  O O     . VAL C 1 468 ? -36.456 -13.395 10.216  1.00 21.76  ? 776  VAL C O     1 
ATOM   8996  C CB    . VAL C 1 468 ? -37.591 -11.155 12.368  1.00 30.28  ? 776  VAL C CB    1 
ATOM   8997  C CG1   . VAL C 1 468 ? -36.252 -11.681 12.823  1.00 21.60  ? 776  VAL C CG1   1 
ATOM   8998  C CG2   . VAL C 1 468 ? -37.638 -9.641  12.461  1.00 36.80  ? 776  VAL C CG2   1 
ATOM   8999  N N     . ILE C 1 469 ? -38.388 -13.998 11.183  1.00 20.18  ? 777  ILE C N     1 
ATOM   9000  C CA    . ILE C 1 469 ? -38.043 -15.410 11.063  1.00 20.37  ? 777  ILE C CA    1 
ATOM   9001  C C     . ILE C 1 469 ? -38.103 -15.887 9.623   1.00 13.39  ? 777  ILE C C     1 
ATOM   9002  O O     . ILE C 1 469 ? -37.419 -16.829 9.245   1.00 25.35  ? 777  ILE C O     1 
ATOM   9003  C CB    . ILE C 1 469 ? -38.900 -16.331 11.966  1.00 29.55  ? 777  ILE C CB    1 
ATOM   9004  C CG1   . ILE C 1 469 ? -38.363 -17.767 11.897  1.00 43.12  ? 777  ILE C CG1   1 
ATOM   9005  C CG2   . ILE C 1 469 ? -40.363 -16.264 11.564  1.00 52.01  ? 777  ILE C CG2   1 
ATOM   9006  C CD1   . ILE C 1 469 ? -39.010 -18.748 12.873  1.00 42.18  ? 777  ILE C CD1   1 
ATOM   9007  N N     . GLU C 1 470 ? -38.929 -15.232 8.819   1.00 29.01  ? 778  GLU C N     1 
ATOM   9008  C CA    . GLU C 1 470 ? -39.002 -15.553 7.400   1.00 33.04  ? 778  GLU C CA    1 
ATOM   9009  C C     . GLU C 1 470 ? -37.674 -15.218 6.723   1.00 23.06  ? 778  GLU C C     1 
ATOM   9010  O O     . GLU C 1 470 ? -37.171 -15.984 5.905   1.00 23.47  ? 778  GLU C O     1 
ATOM   9011  C CB    . GLU C 1 470 ? -40.151 -14.794 6.733   1.00 31.58  ? 778  GLU C CB    1 
ATOM   9012  C CG    . GLU C 1 470 ? -40.255 -15.033 5.230   1.00 53.49  ? 778  GLU C CG    1 
ATOM   9013  C CD    . GLU C 1 470 ? -41.341 -14.201 4.566   1.00 66.22  ? 778  GLU C CD    1 
ATOM   9014  O OE1   . GLU C 1 470 ? -42.287 -13.783 5.266   1.00 68.37  ? 778  GLU C OE1   1 
ATOM   9015  O OE2   . GLU C 1 470 ? -41.243 -13.964 3.342   1.00 66.44  ? 778  GLU C OE2   1 
ATOM   9016  N N     . MET C 1 471 ? -37.115 -14.061 7.061   1.00 21.56  ? 779  MET C N     1 
ATOM   9017  C CA    . MET C 1 471 ? -35.799 -13.678 6.558   1.00 23.58  ? 779  MET C CA    1 
ATOM   9018  C C     . MET C 1 471 ? -34.787 -14.784 6.843   1.00 18.79  ? 779  MET C C     1 
ATOM   9019  O O     . MET C 1 471 ? -34.080 -15.243 5.951   1.00 18.68  ? 779  MET C O     1 
ATOM   9020  C CB    . MET C 1 471 ? -35.327 -12.375 7.215   1.00 21.00  ? 779  MET C CB    1 
ATOM   9021  C CG    . MET C 1 471 ? -33.913 -11.992 6.849   1.00 13.98  ? 779  MET C CG    1 
ATOM   9022  S SD    . MET C 1 471 ? -33.351 -10.447 7.590   1.00 24.58  ? 779  MET C SD    1 
ATOM   9023  C CE    . MET C 1 471 ? -33.376 -10.823 9.337   1.00 16.61  ? 779  MET C CE    1 
ATOM   9024  N N     . ILE C 1 472 ? -34.724 -15.200 8.102   1.00 22.48  ? 780  ILE C N     1 
ATOM   9025  C CA    . ILE C 1 472 ? -33.806 -16.246 8.525   1.00 19.26  ? 780  ILE C CA    1 
ATOM   9026  C C     . ILE C 1 472 ? -34.044 -17.540 7.746   1.00 22.97  ? 780  ILE C C     1 
ATOM   9027  O O     . ILE C 1 472 ? -33.123 -18.100 7.145   1.00 22.87  ? 780  ILE C O     1 
ATOM   9028  C CB    . ILE C 1 472 ? -33.958 -16.527 10.033  1.00 36.92  ? 780  ILE C CB    1 
ATOM   9029  C CG1   . ILE C 1 472 ? -33.878 -15.222 10.828  1.00 29.13  ? 780  ILE C CG1   1 
ATOM   9030  C CG2   . ILE C 1 472 ? -32.918 -17.543 10.502  1.00 34.61  ? 780  ILE C CG2   1 
ATOM   9031  C CD1   . ILE C 1 472 ? -32.539 -14.549 10.743  1.00 29.99  ? 780  ILE C CD1   1 
ATOM   9032  N N     . ASN C 1 473 ? -35.281 -18.019 7.749   1.00 28.25  ? 781  ASN C N     1 
ATOM   9033  C CA    . ASN C 1 473 ? -35.598 -19.259 7.032   1.00 29.32  ? 781  ASN C CA    1 
ATOM   9034  C C     . ASN C 1 473 ? -35.232 -19.242 5.546   1.00 34.00  ? 781  ASN C C     1 
ATOM   9035  O O     . ASN C 1 473 ? -34.748 -20.238 5.007   1.00 29.70  ? 781  ASN C O     1 
ATOM   9036  C CB    . ASN C 1 473 ? -37.072 -19.641 7.214   1.00 29.02  ? 781  ASN C CB    1 
ATOM   9037  C CG    . ASN C 1 473 ? -37.404 -20.021 8.646   1.00 31.59  ? 781  ASN C CG    1 
ATOM   9038  O OD1   . ASN C 1 473 ? -36.515 -20.311 9.448   1.00 32.26  ? 781  ASN C OD1   1 
ATOM   9039  N ND2   . ASN C 1 473 ? -38.689 -20.014 8.976   1.00 37.95  ? 781  ASN C ND2   1 
ATOM   9040  N N     . ARG C 1 474 ? -35.456 -18.108 4.890   1.00 27.04  ? 782  ARG C N     1 
ATOM   9041  C CA    . ARG C 1 474 ? -35.209 -17.999 3.456   1.00 28.24  ? 782  ARG C CA    1 
ATOM   9042  C C     . ARG C 1 474 ? -33.758 -17.668 3.123   1.00 25.56  ? 782  ARG C C     1 
ATOM   9043  O O     . ARG C 1 474 ? -33.393 -17.572 1.954   1.00 32.05  ? 782  ARG C O     1 
ATOM   9044  C CB    . ARG C 1 474 ? -36.133 -16.944 2.835   1.00 29.75  ? 782  ARG C CB    1 
ATOM   9045  C CG    . ARG C 1 474 ? -37.612 -17.323 2.860   1.00 28.24  ? 782  ARG C CG    1 
ATOM   9046  C CD    . ARG C 1 474 ? -38.496 -16.164 2.429   1.00 32.69  ? 782  ARG C CD    1 
ATOM   9047  N NE    . ARG C 1 474 ? -38.095 -15.607 1.139   1.00 47.20  ? 782  ARG C NE    1 
ATOM   9048  C CZ    . ARG C 1 474 ? -38.545 -16.040 -0.036  1.00 52.16  ? 782  ARG C CZ    1 
ATOM   9049  N NH1   . ARG C 1 474 ? -39.413 -17.043 -0.087  1.00 46.20  ? 782  ARG C NH1   1 
ATOM   9050  N NH2   . ARG C 1 474 ? -38.126 -15.471 -1.161  1.00 44.99  ? 782  ARG C NH2   1 
ATOM   9051  N N     . GLY C 1 475 ? -32.932 -17.479 4.147   1.00 27.10  ? 783  GLY C N     1 
ATOM   9052  C CA    . GLY C 1 475 ? -31.543 -17.127 3.913   1.00 20.91  ? 783  GLY C CA    1 
ATOM   9053  C C     . GLY C 1 475 ? -31.369 -15.721 3.361   1.00 16.45  ? 783  GLY C C     1 
ATOM   9054  O O     . GLY C 1 475 ? -30.305 -15.377 2.849   1.00 29.23  ? 783  GLY C O     1 
ATOM   9055  N N     . GLN C 1 476 ? -32.410 -14.903 3.474   1.00 21.27  ? 784  GLN C N     1 
ATOM   9056  C CA    . GLN C 1 476 ? -32.333 -13.501 3.057   1.00 16.85  ? 784  GLN C CA    1 
ATOM   9057  C C     . GLN C 1 476 ? -31.297 -12.722 3.872   1.00 21.74  ? 784  GLN C C     1 
ATOM   9058  O O     . GLN C 1 476 ? -31.096 -12.989 5.059   1.00 17.63  ? 784  GLN C O     1 
ATOM   9059  C CB    . GLN C 1 476 ? -33.712 -12.829 3.139   1.00 26.76  ? 784  GLN C CB    1 
ATOM   9060  C CG    . GLN C 1 476 ? -34.763 -13.478 2.230   1.00 42.79  ? 784  GLN C CG    1 
ATOM   9061  C CD    . GLN C 1 476 ? -36.174 -12.924 2.417   1.00 51.80  ? 784  GLN C CD    1 
ATOM   9062  O OE1   . GLN C 1 476 ? -37.006 -13.018 1.512   1.00 74.96  ? 784  GLN C OE1   1 
ATOM   9063  N NE2   . GLN C 1 476 ? -36.453 -12.358 3.592   1.00 33.43  ? 784  GLN C NE2   1 
ATOM   9064  N N     . ILE C 1 477 ? -30.648 -11.757 3.225   1.00 11.95  ? 785  ILE C N     1 
ATOM   9065  C CA    . ILE C 1 477 ? -29.539 -11.011 3.828   1.00 16.46  ? 785  ILE C CA    1 
ATOM   9066  C C     . ILE C 1 477 ? -30.001 -9.934  4.815   1.00 14.85  ? 785  ILE C C     1 
ATOM   9067  O O     . ILE C 1 477 ? -29.384 -9.716  5.855   1.00 11.78  ? 785  ILE C O     1 
ATOM   9068  C CB    . ILE C 1 477 ? -28.681 -10.338 2.730   1.00 21.60  ? 785  ILE C CB    1 
ATOM   9069  C CG1   . ILE C 1 477 ? -28.065 -11.400 1.813   1.00 27.89  ? 785  ILE C CG1   1 
ATOM   9070  C CG2   . ILE C 1 477 ? -27.610 -9.440  3.335   1.00 20.85  ? 785  ILE C CG2   1 
ATOM   9071  C CD1   . ILE C 1 477 ? -27.483 -12.569 2.547   1.00 39.14  ? 785  ILE C CD1   1 
ATOM   9072  N N     . GLN C 1 478 ? -31.090 -9.256  4.482   1.00 13.35  ? 786  GLN C N     1 
ATOM   9073  C CA    . GLN C 1 478 ? -31.569 -8.158  5.316   1.00 13.63  ? 786  GLN C CA    1 
ATOM   9074  C C     . GLN C 1 478 ? -33.000 -7.814  4.923   1.00 15.02  ? 786  GLN C C     1 
ATOM   9075  O O     . GLN C 1 478 ? -33.452 -8.156  3.833   1.00 19.82  ? 786  GLN C O     1 
ATOM   9076  C CB    . GLN C 1 478 ? -30.676 -6.930  5.095   1.00 10.86  ? 786  GLN C CB    1 
ATOM   9077  C CG    . GLN C 1 478 ? -30.743 -6.421  3.659   1.00 19.84  ? 786  GLN C CG    1 
ATOM   9078  C CD    . GLN C 1 478 ? -29.501 -5.674  3.225   1.00 29.60  ? 786  GLN C CD    1 
ATOM   9079  O OE1   . GLN C 1 478 ? -28.693 -5.252  4.050   1.00 29.71  ? 786  GLN C OE1   1 
ATOM   9080  N NE2   . GLN C 1 478 ? -29.338 -5.516  1.916   1.00 23.96  ? 786  GLN C NE2   1 
ATOM   9081  N N     . ILE C 1 479 ? -33.708 -7.137  5.817   1.00 14.43  ? 787  ILE C N     1 
ATOM   9082  C CA    . ILE C 1 479 ? -35.017 -6.592  5.506   1.00 19.27  ? 787  ILE C CA    1 
ATOM   9083  C C     . ILE C 1 479 ? -35.102 -5.195  6.101   1.00 20.77  ? 787  ILE C C     1 
ATOM   9084  O O     . ILE C 1 479 ? -34.149 -4.713  6.719   1.00 19.12  ? 787  ILE C O     1 
ATOM   9085  C CB    . ILE C 1 479 ? -36.156 -7.468  6.069   1.00 19.11  ? 787  ILE C CB    1 
ATOM   9086  C CG1   . ILE C 1 479 ? -36.052 -7.562  7.594   1.00 19.33  ? 787  ILE C CG1   1 
ATOM   9087  C CG2   . ILE C 1 479 ? -36.106 -8.859  5.451   1.00 16.75  ? 787  ILE C CG2   1 
ATOM   9088  C CD1   . ILE C 1 479 ? -37.177 -8.388  8.236   1.00 22.69  ? 787  ILE C CD1   1 
ATOM   9089  N N     . THR C 1 480 ? -36.240 -4.543  5.901   1.00 17.59  ? 788  THR C N     1 
ATOM   9090  C CA    . THR C 1 480 ? -36.462 -3.212  6.436   1.00 16.10  ? 788  THR C CA    1 
ATOM   9091  C C     . THR C 1 480 ? -37.765 -3.235  7.213   1.00 22.88  ? 788  THR C C     1 
ATOM   9092  O O     . THR C 1 480 ? -38.773 -3.725  6.715   1.00 20.83  ? 788  THR C O     1 
ATOM   9093  C CB    . THR C 1 480 ? -36.560 -2.163  5.303   1.00 17.04  ? 788  THR C CB    1 
ATOM   9094  O OG1   . THR C 1 480 ? -35.317 -2.091  4.602   1.00 14.68  ? 788  THR C OG1   1 
ATOM   9095  C CG2   . THR C 1 480 ? -36.887 -0.786  5.866   1.00 19.05  ? 788  THR C CG2   1 
ATOM   9096  N N     . ILE C 1 481 ? -37.742 -2.738  8.443   1.00 19.19  ? 789  ILE C N     1 
ATOM   9097  C CA    . ILE C 1 481 ? -38.967 -2.627  9.227   1.00 19.51  ? 789  ILE C CA    1 
ATOM   9098  C C     . ILE C 1 481 ? -39.081 -1.240  9.846   1.00 16.90  ? 789  ILE C C     1 
ATOM   9099  O O     . ILE C 1 481 ? -38.227 -0.827  10.628  1.00 16.40  ? 789  ILE C O     1 
ATOM   9100  C CB    . ILE C 1 481 ? -39.041 -3.688  10.353  1.00 17.90  ? 789  ILE C CB    1 
ATOM   9101  C CG1   . ILE C 1 481 ? -39.029 -5.103  9.761   1.00 18.28  ? 789  ILE C CG1   1 
ATOM   9102  C CG2   . ILE C 1 481 ? -40.298 -3.465  11.207  1.00 17.95  ? 789  ILE C CG2   1 
ATOM   9103  C CD1   . ILE C 1 481 ? -39.166 -6.197  10.784  1.00 20.55  ? 789  ILE C CD1   1 
ATOM   9104  N N     . ASN C 1 482 ? -40.148 -0.531  9.502   1.00 15.12  ? 790  ASN C N     1 
ATOM   9105  C CA    . ASN C 1 482 ? -40.339 0.834   9.960   1.00 20.64  ? 790  ASN C CA    1 
ATOM   9106  C C     . ASN C 1 482 ? -39.121 1.704   9.670   1.00 17.13  ? 790  ASN C C     1 
ATOM   9107  O O     . ASN C 1 482 ? -38.776 2.578   10.457  1.00 16.69  ? 790  ASN C O     1 
ATOM   9108  C CB    . ASN C 1 482 ? -40.687 0.871   11.453  1.00 17.98  ? 790  ASN C CB    1 
ATOM   9109  C CG    . ASN C 1 482 ? -42.002 0.169   11.766  1.00 18.50  ? 790  ASN C CG    1 
ATOM   9110  O OD1   . ASN C 1 482 ? -42.838 -0.034  10.884  1.00 17.91  ? 790  ASN C OD1   1 
ATOM   9111  N ND2   . ASN C 1 482 ? -42.186 -0.200  13.019  1.00 19.72  ? 790  ASN C ND2   1 
ATOM   9112  N N     . GLY C 1 483 ? -38.485 1.463   8.531   1.00 15.17  ? 791  GLY C N     1 
ATOM   9113  C CA    . GLY C 1 483 ? -37.367 2.280   8.094   1.00 20.48  ? 791  GLY C CA    1 
ATOM   9114  C C     . GLY C 1 483 ? -36.028 1.841   8.673   1.00 15.93  ? 791  GLY C C     1 
ATOM   9115  O O     . GLY C 1 483 ? -34.979 2.368   8.296   1.00 14.65  ? 791  GLY C O     1 
ATOM   9116  N N     . PHE C 1 484 ? -36.065 0.895   9.605   1.00 11.67  ? 792  PHE C N     1 
ATOM   9117  C CA    . PHE C 1 484 ? -34.841 0.359   10.209  1.00 17.54  ? 792  PHE C CA    1 
ATOM   9118  C C     . PHE C 1 484 ? -34.269 -0.818  9.424   1.00 21.60  ? 792  PHE C C     1 
ATOM   9119  O O     . PHE C 1 484 ? -35.011 -1.661  8.923   1.00 17.91  ? 792  PHE C O     1 
ATOM   9120  C CB    . PHE C 1 484 ? -35.090 -0.052  11.661  1.00 11.03  ? 792  PHE C CB    1 
ATOM   9121  C CG    . PHE C 1 484 ? -35.388 1.103   12.567  1.00 15.70  ? 792  PHE C CG    1 
ATOM   9122  C CD1   . PHE C 1 484 ? -34.359 1.799   13.185  1.00 11.85  ? 792  PHE C CD1   1 
ATOM   9123  C CD2   . PHE C 1 484 ? -36.692 1.504   12.793  1.00 15.70  ? 792  PHE C CD2   1 
ATOM   9124  C CE1   . PHE C 1 484 ? -34.626 2.866   14.021  1.00 16.31  ? 792  PHE C CE1   1 
ATOM   9125  C CE2   . PHE C 1 484 ? -36.974 2.579   13.628  1.00 20.18  ? 792  PHE C CE2   1 
ATOM   9126  C CZ    . PHE C 1 484 ? -35.941 3.263   14.243  1.00 19.12  ? 792  PHE C CZ    1 
ATOM   9127  N N     . SER C 1 485 ? -32.943 -0.860  9.316   1.00 14.12  ? 793  SER C N     1 
ATOM   9128  C CA    . SER C 1 485 ? -32.249 -1.974  8.677   1.00 16.58  ? 793  SER C CA    1 
ATOM   9129  C C     . SER C 1 485 ? -32.127 -3.155  9.642   1.00 14.56  ? 793  SER C C     1 
ATOM   9130  O O     . SER C 1 485 ? -31.498 -3.037  10.686  1.00 20.46  ? 793  SER C O     1 
ATOM   9131  C CB    . SER C 1 485 ? -30.846 -1.540  8.241   1.00 20.18  ? 793  SER C CB    1 
ATOM   9132  O OG    . SER C 1 485 ? -30.820 -0.166  7.910   1.00 23.51  ? 793  SER C OG    1 
ATOM   9133  N N     . ILE C 1 486 ? -32.742 -4.281  9.293   1.00 15.19  ? 794  ILE C N     1 
ATOM   9134  C CA    . ILE C 1 486 ? -32.645 -5.506  10.080  1.00 13.63  ? 794  ILE C CA    1 
ATOM   9135  C C     . ILE C 1 486 ? -31.811 -6.530  9.305   1.00 16.44  ? 794  ILE C C     1 
ATOM   9136  O O     . ILE C 1 486 ? -32.227 -6.986  8.247   1.00 19.49  ? 794  ILE C O     1 
ATOM   9137  C CB    . ILE C 1 486 ? -34.024 -6.135  10.325  1.00 18.44  ? 794  ILE C CB    1 
ATOM   9138  C CG1   . ILE C 1 486 ? -35.064 -5.082  10.760  1.00 22.47  ? 794  ILE C CG1   1 
ATOM   9139  C CG2   . ILE C 1 486 ? -33.909 -7.257  11.333  1.00 16.72  ? 794  ILE C CG2   1 
ATOM   9140  C CD1   . ILE C 1 486 ? -34.683 -4.288  11.997  1.00 18.07  ? 794  ILE C CD1   1 
ATOM   9141  N N     . SER C 1 487 ? -30.643 -6.889  9.834   1.00 9.51   ? 795  SER C N     1 
ATOM   9142  C CA    . SER C 1 487 ? -29.702 -7.739  9.107   1.00 6.69   ? 795  SER C CA    1 
ATOM   9143  C C     . SER C 1 487 ? -29.712 -9.179  9.608   1.00 10.23  ? 795  SER C C     1 
ATOM   9144  O O     . SER C 1 487 ? -29.788 -9.419  10.814  1.00 12.29  ? 795  SER C O     1 
ATOM   9145  C CB    . SER C 1 487 ? -28.276 -7.208  9.263   1.00 12.12  ? 795  SER C CB    1 
ATOM   9146  O OG    . SER C 1 487 ? -28.139 -5.925  8.691   1.00 16.72  ? 795  SER C OG    1 
ATOM   9147  N N     . ASN C 1 488 ? -29.609 -10.127 8.680   1.00 9.60   ? 796  ASN C N     1 
ATOM   9148  C CA    . ASN C 1 488 ? -29.357 -11.531 9.017   1.00 10.07  ? 796  ASN C CA    1 
ATOM   9149  C C     . ASN C 1 488 ? -27.938 -11.666 9.561   1.00 14.08  ? 796  ASN C C     1 
ATOM   9150  O O     . ASN C 1 488 ? -26.972 -11.340 8.870   1.00 10.59  ? 796  ASN C O     1 
ATOM   9151  C CB    . ASN C 1 488 ? -29.515 -12.420 7.771   1.00 11.09  ? 796  ASN C CB    1 
ATOM   9152  C CG    . ASN C 1 488 ? -29.511 -13.912 8.103   1.00 16.64  ? 796  ASN C CG    1 
ATOM   9153  O OD1   . ASN C 1 488 ? -28.954 -14.328 9.114   1.00 11.17  ? 796  ASN C OD1   1 
ATOM   9154  N ND2   . ASN C 1 488 ? -30.136 -14.721 7.246   1.00 13.62  ? 796  ASN C ND2   1 
ATOM   9155  N N     . GLY C 1 489 ? -27.812 -12.141 10.796  1.00 8.61   ? 797  GLY C N     1 
ATOM   9156  C CA    . GLY C 1 489 ? -26.515 -12.242 11.435  1.00 4.79   ? 797  GLY C CA    1 
ATOM   9157  C C     . GLY C 1 489 ? -25.545 -13.211 10.763  1.00 11.50  ? 797  GLY C C     1 
ATOM   9158  O O     . GLY C 1 489 ? -24.355 -13.172 11.059  1.00 9.22   ? 797  GLY C O     1 
ATOM   9159  N N     . LEU C 1 490 ? -26.045 -14.077 9.874   1.00 10.30  ? 798  LEU C N     1 
ATOM   9160  C CA    . LEU C 1 490 ? -25.172 -14.999 9.142   1.00 7.77   ? 798  LEU C CA    1 
ATOM   9161  C C     . LEU C 1 490 ? -24.569 -14.326 7.919   1.00 9.49   ? 798  LEU C C     1 
ATOM   9162  O O     . LEU C 1 490 ? -23.729 -14.910 7.241   1.00 15.20  ? 798  LEU C O     1 
ATOM   9163  C CB    . LEU C 1 490 ? -25.928 -16.247 8.690   1.00 9.17   ? 798  LEU C CB    1 
ATOM   9164  C CG    . LEU C 1 490 ? -26.367 -17.199 9.799   1.00 8.34   ? 798  LEU C CG    1 
ATOM   9165  C CD1   . LEU C 1 490 ? -27.248 -18.311 9.261   1.00 9.17   ? 798  LEU C CD1   1 
ATOM   9166  C CD2   . LEU C 1 490 ? -25.113 -17.766 10.464  1.00 11.92  ? 798  LEU C CD2   1 
ATOM   9167  N N     . ALA C 1 491 ? -25.004 -13.100 7.635   1.00 11.13  ? 799  ALA C N     1 
ATOM   9168  C CA    . ALA C 1 491 ? -24.642 -12.453 6.373   1.00 9.95   ? 799  ALA C CA    1 
ATOM   9169  C C     . ALA C 1 491 ? -23.800 -11.181 6.513   1.00 13.67  ? 799  ALA C C     1 
ATOM   9170  O O     . ALA C 1 491 ? -23.701 -10.391 5.566   1.00 14.55  ? 799  ALA C O     1 
ATOM   9171  C CB    . ALA C 1 491 ? -25.923 -12.151 5.558   1.00 14.72  ? 799  ALA C CB    1 
ATOM   9172  N N     . THR C 1 492 ? -23.172 -10.991 7.666   1.00 8.90   ? 800  THR C N     1 
ATOM   9173  C CA    . THR C 1 492 ? -22.456 -9.738  7.928   1.00 12.81  ? 800  THR C CA    1 
ATOM   9174  C C     . THR C 1 492 ? -21.366 -9.420  6.906   1.00 19.03  ? 800  THR C C     1 
ATOM   9175  O O     . THR C 1 492 ? -21.117 -8.248  6.601   1.00 16.19  ? 800  THR C O     1 
ATOM   9176  C CB    . THR C 1 492 ? -21.820 -9.731  9.323   1.00 10.10  ? 800  THR C CB    1 
ATOM   9177  O OG1   . THR C 1 492 ? -20.881 -10.802 9.418   1.00 16.07  ? 800  THR C OG1   1 
ATOM   9178  C CG2   . THR C 1 492 ? -22.883 -9.903  10.399  1.00 12.05  ? 800  THR C CG2   1 
ATOM   9179  N N     . THR C 1 493 ? -20.702 -10.441 6.373   1.00 10.72  ? 801  THR C N     1 
ATOM   9180  C CA    . THR C 1 493 ? -19.620 -10.145 5.414   1.00 12.62  ? 801  THR C CA    1 
ATOM   9181  C C     . THR C 1 493 ? -20.171 -9.544  4.120   1.00 14.85  ? 801  THR C C     1 
ATOM   9182  O O     . THR C 1 493 ? -19.462 -8.846  3.403   1.00 17.11  ? 801  THR C O     1 
ATOM   9183  C CB    . THR C 1 493 ? -18.731 -11.359 5.085   1.00 18.63  ? 801  THR C CB    1 
ATOM   9184  O OG1   . THR C 1 493 ? -19.515 -12.382 4.464   1.00 17.77  ? 801  THR C OG1   1 
ATOM   9185  C CG2   . THR C 1 493 ? -18.061 -11.906 6.348   1.00 16.35  ? 801  THR C CG2   1 
ATOM   9186  N N     . GLN C 1 494 ? -21.436 -9.822  3.829   1.00 15.32  ? 802  GLN C N     1 
ATOM   9187  C CA    . GLN C 1 494 ? -22.084 -9.307  2.630   1.00 16.90  ? 802  GLN C CA    1 
ATOM   9188  C C     . GLN C 1 494 ? -22.638 -7.892  2.838   1.00 26.75  ? 802  GLN C C     1 
ATOM   9189  O O     . GLN C 1 494 ? -22.914 -7.176  1.876   1.00 20.13  ? 802  GLN C O     1 
ATOM   9190  C CB    . GLN C 1 494 ? -23.215 -10.244 2.206   1.00 13.98  ? 802  GLN C CB    1 
ATOM   9191  C CG    . GLN C 1 494 ? -22.749 -11.636 1.747   1.00 15.29  ? 802  GLN C CG    1 
ATOM   9192  C CD    . GLN C 1 494 ? -23.913 -12.605 1.594   1.00 17.64  ? 802  GLN C CD    1 
ATOM   9193  O OE1   . GLN C 1 494 ? -24.724 -12.476 0.680   1.00 21.09  ? 802  GLN C OE1   1 
ATOM   9194  N NE2   . GLN C 1 494 ? -24.004 -13.571 2.500   1.00 18.83  ? 802  GLN C NE2   1 
ATOM   9195  N N     . ILE C 1 495 ? -22.805 -7.500  4.097   1.00 11.59  ? 803  ILE C N     1 
ATOM   9196  C CA    . ILE C 1 495 ? -23.372 -6.189  4.439   1.00 8.48   ? 803  ILE C CA    1 
ATOM   9197  C C     . ILE C 1 495 ? -22.274 -5.165  4.714   1.00 15.72  ? 803  ILE C C     1 
ATOM   9198  O O     . ILE C 1 495 ? -22.295 -4.052  4.184   1.00 17.56  ? 803  ILE C O     1 
ATOM   9199  C CB    . ILE C 1 495 ? -24.302 -6.326  5.665   1.00 17.35  ? 803  ILE C CB    1 
ATOM   9200  C CG1   . ILE C 1 495 ? -25.499 -7.209  5.298   1.00 16.73  ? 803  ILE C CG1   1 
ATOM   9201  C CG2   . ILE C 1 495 ? -24.747 -4.964  6.160   1.00 15.11  ? 803  ILE C CG2   1 
ATOM   9202  C CD1   . ILE C 1 495 ? -26.192 -7.852  6.485   1.00 17.14  ? 803  ILE C CD1   1 
ATOM   9203  N N     . ASN C 1 496 ? -21.314 -5.542  5.549   1.00 12.18  ? 804  ASN C N     1 
ATOM   9204  C CA    . ASN C 1 496 ? -20.179 -4.675  5.854   1.00 14.38  ? 804  ASN C CA    1 
ATOM   9205  C C     . ASN C 1 496 ? -19.034 -5.528  6.376   1.00 14.81  ? 804  ASN C C     1 
ATOM   9206  O O     . ASN C 1 496 ? -19.023 -5.919  7.536   1.00 10.19  ? 804  ASN C O     1 
ATOM   9207  C CB    . ASN C 1 496 ? -20.571 -3.604  6.882   1.00 11.21  ? 804  ASN C CB    1 
ATOM   9208  C CG    . ASN C 1 496 ? -19.399 -2.718  7.298   1.00 12.79  ? 804  ASN C CG    1 
ATOM   9209  O OD1   . ASN C 1 496 ? -18.262 -2.908  6.860   1.00 10.61  ? 804  ASN C OD1   1 
ATOM   9210  N ND2   . ASN C 1 496 ? -19.683 -1.734  8.149   1.00 17.22  ? 804  ASN C ND2   1 
ATOM   9211  N N     . ASN C 1 497 ? -18.077 -5.828  5.510   1.00 13.27  ? 805  ASN C N     1 
ATOM   9212  C CA    . ASN C 1 497 ? -16.994 -6.732  5.876   1.00 13.09  ? 805  ASN C CA    1 
ATOM   9213  C C     . ASN C 1 497 ? -16.148 -6.222  7.054   1.00 16.58  ? 805  ASN C C     1 
ATOM   9214  O O     . ASN C 1 497 ? -15.675 -7.004  7.875   1.00 12.33  ? 805  ASN C O     1 
ATOM   9215  C CB    . ASN C 1 497 ? -16.109 -7.020  4.656   1.00 19.48  ? 805  ASN C CB    1 
ATOM   9216  C CG    . ASN C 1 497 ? -15.281 -8.272  4.828   1.00 36.03  ? 805  ASN C CG    1 
ATOM   9217  O OD1   . ASN C 1 497 ? -15.816 -9.381  4.843   1.00 31.78  ? 805  ASN C OD1   1 
ATOM   9218  N ND2   . ASN C 1 497 ? -13.969 -8.105  4.960   1.00 36.67  ? 805  ASN C ND2   1 
ATOM   9219  N N     . LYS C 1 498 ? -15.958 -4.911  7.138   1.00 11.11  ? 806  LYS C N     1 
ATOM   9220  C CA    . LYS C 1 498 ? -15.236 -4.335  8.267   1.00 9.58   ? 806  LYS C CA    1 
ATOM   9221  C C     . LYS C 1 498 ? -15.979 -4.516  9.596   1.00 8.85   ? 806  LYS C C     1 
ATOM   9222  O O     . LYS C 1 498 ? -15.355 -4.666  10.643  1.00 11.73  ? 806  LYS C O     1 
ATOM   9223  C CB    . LYS C 1 498 ? -14.932 -2.854  8.012   1.00 9.35   ? 806  LYS C CB    1 
ATOM   9224  C CG    . LYS C 1 498 ? -13.951 -2.629  6.867   1.00 20.00  ? 806  LYS C CG    1 
ATOM   9225  C CD    . LYS C 1 498 ? -12.637 -2.040  7.352   1.00 28.17  ? 806  LYS C CD    1 
ATOM   9226  C CE    . LYS C 1 498 ? -11.717 -1.744  6.168   1.00 44.89  ? 806  LYS C CE    1 
ATOM   9227  N NZ    . LYS C 1 498 ? -10.301 -1.528  6.576   1.00 50.73  ? 806  LYS C NZ    1 
ATOM   9228  N N     . ALA C 1 499 ? -17.309 -4.502  9.557   1.00 8.46   ? 807  ALA C N     1 
ATOM   9229  C CA    . ALA C 1 499 ? -18.086 -4.779  10.762  1.00 12.33  ? 807  ALA C CA    1 
ATOM   9230  C C     . ALA C 1 499 ? -17.937 -6.257  11.141  1.00 11.26  ? 807  ALA C C     1 
ATOM   9231  O O     . ALA C 1 499 ? -17.819 -6.604  12.314  1.00 12.02  ? 807  ALA C O     1 
ATOM   9232  C CB    . ALA C 1 499 ? -19.561 -4.415  10.554  1.00 13.88  ? 807  ALA C CB    1 
ATOM   9233  N N     . ALA C 1 500 ? -17.912 -7.121  10.138  1.00 11.96  ? 808  ALA C N     1 
ATOM   9234  C CA    . ALA C 1 500 ? -17.740 -8.555  10.374  1.00 16.77  ? 808  ALA C CA    1 
ATOM   9235  C C     . ALA C 1 500 ? -16.422 -8.895  11.093  1.00 16.16  ? 808  ALA C C     1 
ATOM   9236  O O     . ALA C 1 500 ? -16.395 -9.753  11.969  1.00 16.34  ? 808  ALA C O     1 
ATOM   9237  C CB    . ALA C 1 500 ? -17.850 -9.322  9.069   1.00 11.55  ? 808  ALA C CB    1 
ATOM   9238  N N     . THR C 1 501 ? -15.336 -8.219  10.734  1.00 7.27   ? 809  THR C N     1 
ATOM   9239  C CA    . THR C 1 501 ? -14.031 -8.533  11.327  1.00 7.07   ? 809  THR C CA    1 
ATOM   9240  C C     . THR C 1 501 ? -13.758 -7.768  12.611  1.00 6.87   ? 809  THR C C     1 
ATOM   9241  O O     . THR C 1 501 ? -12.727 -7.970  13.251  1.00 11.53  ? 809  THR C O     1 
ATOM   9242  C CB    . THR C 1 501 ? -12.899 -8.208  10.355  1.00 19.09  ? 809  THR C CB    1 
ATOM   9243  O OG1   . THR C 1 501 ? -12.912 -6.799  10.095  1.00 16.59  ? 809  THR C OG1   1 
ATOM   9244  C CG2   . THR C 1 501 ? -13.088 -8.977  9.053   1.00 20.07  ? 809  THR C CG2   1 
ATOM   9245  N N     . GLY C 1 502 ? -14.674 -6.884  12.992  1.00 14.30  ? 810  GLY C N     1 
ATOM   9246  C CA    . GLY C 1 502 ? -14.498 -6.101  14.206  1.00 10.59  ? 810  GLY C CA    1 
ATOM   9247  C C     . GLY C 1 502 ? -13.723 -4.800  14.007  1.00 9.55   ? 810  GLY C C     1 
ATOM   9248  O O     . GLY C 1 502 ? -13.459 -4.082  14.973  1.00 10.98  ? 810  GLY C O     1 
ATOM   9249  N N     . GLU C 1 503 ? -13.382 -4.485  12.760  1.00 10.81  ? 811  GLU C N     1 
ATOM   9250  C CA    . GLU C 1 503 ? -12.705 -3.216  12.444  1.00 10.14  ? 811  GLU C CA    1 
ATOM   9251  C C     . GLU C 1 503 ? -13.612 -1.990  12.528  1.00 10.60  ? 811  GLU C C     1 
ATOM   9252  O O     . GLU C 1 503 ? -13.120 -0.878  12.703  1.00 14.01  ? 811  GLU C O     1 
ATOM   9253  C CB    . GLU C 1 503 ? -12.097 -3.260  11.042  1.00 13.50  ? 811  GLU C CB    1 
ATOM   9254  C CG    . GLU C 1 503 ? -10.866 -4.126  10.908  1.00 13.98  ? 811  GLU C CG    1 
ATOM   9255  C CD    . GLU C 1 503 ? -10.368 -4.122  9.481   1.00 19.13  ? 811  GLU C CD    1 
ATOM   9256  O OE1   . GLU C 1 503 ? -10.529 -5.147  8.800   1.00 22.93  ? 811  GLU C OE1   1 
ATOM   9257  O OE2   . GLU C 1 503 ? -9.860  -3.074  9.037   1.00 14.11  ? 811  GLU C OE2   1 
ATOM   9258  N N     . GLU C 1 504 ? -14.920 -2.197  12.357  1.00 11.65  ? 812  GLU C N     1 
ATOM   9259  C CA    . GLU C 1 504 ? -15.933 -1.138  12.486  1.00 15.32  ? 812  GLU C CA    1 
ATOM   9260  C C     . GLU C 1 504 ? -17.103 -1.660  13.315  1.00 13.64  ? 812  GLU C C     1 
ATOM   9261  O O     . GLU C 1 504 ? -17.360 -2.854  13.327  1.00 8.49   ? 812  GLU C O     1 
ATOM   9262  C CB    . GLU C 1 504 ? -16.492 -0.724  11.114  1.00 13.63  ? 812  GLU C CB    1 
ATOM   9263  C CG    . GLU C 1 504 ? -15.580 0.153   10.264  1.00 13.23  ? 812  GLU C CG    1 
ATOM   9264  C CD    . GLU C 1 504 ? -16.233 0.546   8.938   1.00 20.10  ? 812  GLU C CD    1 
ATOM   9265  O OE1   . GLU C 1 504 ? -15.548 1.166   8.107   1.00 17.47  ? 812  GLU C OE1   1 
ATOM   9266  O OE2   . GLU C 1 504 ? -17.429 0.224   8.724   1.00 12.19  ? 812  GLU C OE2   1 
ATOM   9267  N N     . VAL C 1 505 ? -17.821 -0.766  13.987  1.00 11.21  ? 813  VAL C N     1 
ATOM   9268  C CA    . VAL C 1 505 ? -19.033 -1.149  14.715  1.00 12.49  ? 813  VAL C CA    1 
ATOM   9269  C C     . VAL C 1 505 ? -20.179 -1.263  13.706  1.00 10.26  ? 813  VAL C C     1 
ATOM   9270  O O     . VAL C 1 505 ? -20.354 -0.373  12.871  1.00 10.38  ? 813  VAL C O     1 
ATOM   9271  C CB    . VAL C 1 505 ? -19.372 -0.113  15.798  1.00 14.49  ? 813  VAL C CB    1 
ATOM   9272  C CG1   . VAL C 1 505 ? -20.673 -0.474  16.535  1.00 11.25  ? 813  VAL C CG1   1 
ATOM   9273  C CG2   . VAL C 1 505 ? -18.216 -0.004  16.784  1.00 13.29  ? 813  VAL C CG2   1 
ATOM   9274  N N     . PRO C 1 506 ? -20.935 -2.375  13.746  1.00 10.45  ? 814  PRO C N     1 
ATOM   9275  C CA    . PRO C 1 506 ? -22.050 -2.506  12.796  1.00 11.54  ? 814  PRO C CA    1 
ATOM   9276  C C     . PRO C 1 506 ? -22.993 -1.310  12.906  1.00 10.32  ? 814  PRO C C     1 
ATOM   9277  O O     . PRO C 1 506 ? -23.207 -0.799  14.008  1.00 12.20  ? 814  PRO C O     1 
ATOM   9278  C CB    . PRO C 1 506 ? -22.780 -3.767  13.270  1.00 14.25  ? 814  PRO C CB    1 
ATOM   9279  C CG    . PRO C 1 506 ? -21.748 -4.531  14.080  1.00 14.68  ? 814  PRO C CG    1 
ATOM   9280  C CD    . PRO C 1 506 ? -20.876 -3.494  14.705  1.00 9.68   ? 814  PRO C CD    1 
ATOM   9281  N N     . ARG C 1 507 ? -23.560 -0.884  11.782  1.00 9.12   ? 815  ARG C N     1 
ATOM   9282  C CA    . ARG C 1 507 ? -24.463 0.266   11.784  1.00 12.26  ? 815  ARG C CA    1 
ATOM   9283  C C     . ARG C 1 507 ? -25.919 -0.137  11.522  1.00 17.27  ? 815  ARG C C     1 
ATOM   9284  O O     . ARG C 1 507 ? -26.796 0.717   11.420  1.00 15.82  ? 815  ARG C O     1 
ATOM   9285  C CB    . ARG C 1 507 ? -23.984 1.343   10.797  1.00 10.77  ? 815  ARG C CB    1 
ATOM   9286  C CG    . ARG C 1 507 ? -22.637 1.960   11.174  1.00 13.30  ? 815  ARG C CG    1 
ATOM   9287  C CD    . ARG C 1 507 ? -22.209 3.087   10.215  1.00 15.21  ? 815  ARG C CD    1 
ATOM   9288  N NE    . ARG C 1 507 ? -22.007 2.633   8.836   1.00 11.82  ? 815  ARG C NE    1 
ATOM   9289  C CZ    . ARG C 1 507 ? -20.893 2.057   8.389   1.00 12.59  ? 815  ARG C CZ    1 
ATOM   9290  N NH1   . ARG C 1 507 ? -19.880 1.825   9.216   1.00 11.06  ? 815  ARG C NH1   1 
ATOM   9291  N NH2   . ARG C 1 507 ? -20.802 1.701   7.115   1.00 14.87  ? 815  ARG C NH2   1 
ATOM   9292  N N     . THR C 1 508 ? -26.170 -1.444  11.441  1.00 7.41   ? 816  THR C N     1 
ATOM   9293  C CA    . THR C 1 508 ? -27.533 -1.960  11.326  1.00 9.90   ? 816  THR C CA    1 
ATOM   9294  C C     . THR C 1 508 ? -27.900 -2.779  12.573  1.00 11.39  ? 816  THR C C     1 
ATOM   9295  O O     . THR C 1 508 ? -27.057 -3.075  13.408  1.00 13.54  ? 816  THR C O     1 
ATOM   9296  C CB    . THR C 1 508 ? -27.704 -2.872  10.089  1.00 15.20  ? 816  THR C CB    1 
ATOM   9297  O OG1   . THR C 1 508 ? -26.994 -4.106  10.290  1.00 15.00  ? 816  THR C OG1   1 
ATOM   9298  C CG2   . THR C 1 508 ? -27.179 -2.179  8.828   1.00 19.45  ? 816  THR C CG2   1 
ATOM   9299  N N     . ILE C 1 509 ? -29.170 -3.127  12.683  1.00 11.00  ? 817  ILE C N     1 
ATOM   9300  C CA    . ILE C 1 509 ? -29.649 -3.991  13.755  1.00 11.46  ? 817  ILE C CA    1 
ATOM   9301  C C     . ILE C 1 509 ? -29.537 -5.428  13.273  1.00 11.72  ? 817  ILE C C     1 
ATOM   9302  O O     . ILE C 1 509 ? -29.916 -5.740  12.145  1.00 16.03  ? 817  ILE C O     1 
ATOM   9303  C CB    . ILE C 1 509 ? -31.104 -3.661  14.096  1.00 9.27   ? 817  ILE C CB    1 
ATOM   9304  C CG1   . ILE C 1 509 ? -31.191 -2.262  14.713  1.00 14.36  ? 817  ILE C CG1   1 
ATOM   9305  C CG2   . ILE C 1 509 ? -31.706 -4.705  15.044  1.00 5.77   ? 817  ILE C CG2   1 
ATOM   9306  C CD1   . ILE C 1 509 ? -32.589 -1.667  14.659  1.00 16.64  ? 817  ILE C CD1   1 
ATOM   9307  N N     . ILE C 1 510 ? -28.994 -6.293  14.123  1.00 9.77   ? 818  ILE C N     1 
ATOM   9308  C CA    . ILE C 1 510 ? -28.625 -7.633  13.694  1.00 10.36  ? 818  ILE C CA    1 
ATOM   9309  C C     . ILE C 1 510 ? -29.444 -8.660  14.460  1.00 9.56   ? 818  ILE C C     1 
ATOM   9310  O O     . ILE C 1 510 ? -29.686 -8.510  15.655  1.00 11.94  ? 818  ILE C O     1 
ATOM   9311  C CB    . ILE C 1 510 ? -27.127 -7.912  13.903  1.00 7.86   ? 818  ILE C CB    1 
ATOM   9312  C CG1   . ILE C 1 510 ? -26.281 -6.922  13.092  1.00 10.59  ? 818  ILE C CG1   1 
ATOM   9313  C CG2   . ILE C 1 510 ? -26.799 -9.339  13.499  1.00 10.44  ? 818  ILE C CG2   1 
ATOM   9314  C CD1   . ILE C 1 510 ? -24.783 -6.999  13.395  1.00 15.81  ? 818  ILE C CD1   1 
ATOM   9315  N N     A VAL C 1 511 ? -29.893 -9.694  13.754  0.50 9.93   ? 819  VAL C N     1 
ATOM   9316  N N     B VAL C 1 511 ? -29.862 -9.702  13.759  0.50 9.09   ? 819  VAL C N     1 
ATOM   9317  C CA    A VAL C 1 511 ? -30.707 -10.749 14.352  0.50 7.67   ? 819  VAL C CA    1 
ATOM   9318  C CA    B VAL C 1 511 ? -30.680 -10.731 14.372  0.50 7.93   ? 819  VAL C CA    1 
ATOM   9319  C C     A VAL C 1 511 ? -29.877 -12.011 14.466  0.50 16.82  ? 819  VAL C C     1 
ATOM   9320  C C     B VAL C 1 511 ? -29.876 -12.013 14.466  0.50 16.83  ? 819  VAL C C     1 
ATOM   9321  O O     A VAL C 1 511 ? -29.237 -12.426 13.497  0.50 10.19  ? 819  VAL C O     1 
ATOM   9322  O O     B VAL C 1 511 ? -29.237 -12.431 13.497  0.50 10.29  ? 819  VAL C O     1 
ATOM   9323  C CB    A VAL C 1 511 ? -31.939 -11.054 13.489  0.50 10.62  ? 819  VAL C CB    1 
ATOM   9324  C CB    B VAL C 1 511 ? -31.958 -10.950 13.568  0.50 8.14   ? 819  VAL C CB    1 
ATOM   9325  C CG1   A VAL C 1 511 ? -32.833 -12.141 14.147  0.50 3.86   ? 819  VAL C CG1   1 
ATOM   9326  C CG1   B VAL C 1 511 ? -32.555 -9.619  13.198  0.50 11.45  ? 819  VAL C CG1   1 
ATOM   9327  C CG2   A VAL C 1 511 ? -32.719 -9.788  13.227  0.50 12.26  ? 819  VAL C CG2   1 
ATOM   9328  C CG2   B VAL C 1 511 ? -31.675 -11.754 12.312  0.50 25.58  ? 819  VAL C CG2   1 
ATOM   9329  N N     . THR C 1 512 ? -29.893 -12.618 15.648  1.00 12.00  ? 820  THR C N     1 
ATOM   9330  C CA    . THR C 1 512 ? -29.130 -13.845 15.905  1.00 13.61  ? 820  THR C CA    1 
ATOM   9331  C C     . THR C 1 512 ? -30.078 -14.861 16.499  1.00 12.47  ? 820  THR C C     1 
ATOM   9332  O O     . THR C 1 512 ? -30.839 -14.524 17.406  1.00 8.83   ? 820  THR C O     1 
ATOM   9333  C CB    . THR C 1 512 ? -28.024 -13.566 16.933  1.00 8.69   ? 820  THR C CB    1 
ATOM   9334  O OG1   . THR C 1 512 ? -27.337 -12.370 16.547  1.00 8.99   ? 820  THR C OG1   1 
ATOM   9335  C CG2   . THR C 1 512 ? -27.039 -14.744 17.013  1.00 9.60   ? 820  THR C CG2   1 
ATOM   9336  N N     . THR C 1 513 ? -30.052 -16.099 16.003  1.00 13.99  ? 821  THR C N     1 
ATOM   9337  C CA    . THR C 1 513 ? -31.051 -17.074 16.436  1.00 11.09  ? 821  THR C CA    1 
ATOM   9338  C C     . THR C 1 513 ? -30.506 -18.482 16.490  1.00 12.30  ? 821  THR C C     1 
ATOM   9339  O O     . THR C 1 513 ? -29.580 -18.832 15.760  1.00 11.01  ? 821  THR C O     1 
ATOM   9340  C CB    . THR C 1 513 ? -32.225 -17.087 15.460  1.00 14.63  ? 821  THR C CB    1 
ATOM   9341  O OG1   . THR C 1 513 ? -31.847 -17.822 14.292  1.00 12.87  ? 821  THR C OG1   1 
ATOM   9342  C CG2   . THR C 1 513 ? -32.584 -15.642 15.075  1.00 9.63   ? 821  THR C CG2   1 
ATOM   9343  N N     . ARG C 1 514 ? -31.078 -19.295 17.368  1.00 8.81   ? 822  ARG C N     1 
ATOM   9344  C CA    . ARG C 1 514 ? -30.664 -20.685 17.450  1.00 11.84  ? 822  ARG C CA    1 
ATOM   9345  C C     . ARG C 1 514 ? -30.840 -21.410 16.108  1.00 11.03  ? 822  ARG C C     1 
ATOM   9346  O O     . ARG C 1 514 ? -29.999 -22.209 15.703  1.00 12.10  ? 822  ARG C O     1 
ATOM   9347  C CB    . ARG C 1 514 ? -31.397 -21.379 18.598  1.00 6.14   ? 822  ARG C CB    1 
ATOM   9348  C CG    . ARG C 1 514 ? -30.759 -21.003 19.945  1.00 9.68   ? 822  ARG C CG    1 
ATOM   9349  C CD    . ARG C 1 514 ? -31.369 -21.700 21.157  1.00 13.95  ? 822  ARG C CD    1 
ATOM   9350  N NE    . ARG C 1 514 ? -30.539 -21.419 22.327  1.00 14.49  ? 822  ARG C NE    1 
ATOM   9351  C CZ    . ARG C 1 514 ? -30.609 -22.079 23.470  1.00 11.38  ? 822  ARG C CZ    1 
ATOM   9352  N NH1   . ARG C 1 514 ? -31.486 -23.071 23.593  1.00 9.44   ? 822  ARG C NH1   1 
ATOM   9353  N NH2   . ARG C 1 514 ? -29.791 -21.756 24.477  1.00 10.45  ? 822  ARG C NH2   1 
ATOM   9354  N N     . SER C 1 515 ? -31.916 -21.100 15.391  1.00 11.95  ? 823  SER C N     1 
ATOM   9355  C CA    . SER C 1 515 ? -32.166 -21.766 14.113  1.00 8.81   ? 823  SER C CA    1 
ATOM   9356  C C     . SER C 1 515 ? -31.065 -21.510 13.072  1.00 15.39  ? 823  SER C C     1 
ATOM   9357  O O     . SER C 1 515 ? -30.869 -22.331 12.197  1.00 13.01  ? 823  SER C O     1 
ATOM   9358  C CB    . SER C 1 515 ? -33.528 -21.334 13.548  1.00 15.65  ? 823  SER C CB    1 
ATOM   9359  O OG    . SER C 1 515 ? -33.539 -19.941 13.291  1.00 19.66  ? 823  SER C OG    1 
ATOM   9360  N N     . GLN C 1 516 ? -30.359 -20.378 13.166  1.00 18.62  ? 824  GLN C N     1 
ATOM   9361  C CA    . GLN C 1 516 ? -29.236 -20.078 12.259  1.00 14.69  ? 824  GLN C CA    1 
ATOM   9362  C C     . GLN C 1 516 ? -28.136 -21.114 12.412  1.00 17.02  ? 824  GLN C C     1 
ATOM   9363  O O     . GLN C 1 516 ? -27.307 -21.302 11.518  1.00 20.51  ? 824  GLN C O     1 
ATOM   9364  C CB    . GLN C 1 516 ? -28.615 -18.705 12.557  1.00 12.30  ? 824  GLN C CB    1 
ATOM   9365  C CG    . GLN C 1 516 ? -29.377 -17.490 12.049  1.00 6.85   ? 824  GLN C CG    1 
ATOM   9366  C CD    . GLN C 1 516 ? -28.841 -16.202 12.618  1.00 8.88   ? 824  GLN C CD    1 
ATOM   9367  O OE1   . GLN C 1 516 ? -28.300 -16.177 13.728  1.00 13.33  ? 824  GLN C OE1   1 
ATOM   9368  N NE2   . GLN C 1 516 ? -28.956 -15.118 11.853  1.00 16.05  ? 824  GLN C NE2   1 
ATOM   9369  N N     . TYR C 1 517 ? -28.101 -21.762 13.569  1.00 6.59   ? 825  TYR C N     1 
ATOM   9370  C CA    . TYR C 1 517 ? -26.996 -22.674 13.836  1.00 15.13  ? 825  TYR C CA    1 
ATOM   9371  C C     . TYR C 1 517 ? -27.435 -24.119 14.060  1.00 14.70  ? 825  TYR C C     1 
ATOM   9372  O O     . TYR C 1 517 ? -26.603 -24.980 14.356  1.00 9.28   ? 825  TYR C O     1 
ATOM   9373  C CB    . TYR C 1 517 ? -26.147 -22.155 15.003  1.00 11.94  ? 825  TYR C CB    1 
ATOM   9374  C CG    . TYR C 1 517 ? -25.535 -20.805 14.695  1.00 9.73   ? 825  TYR C CG    1 
ATOM   9375  C CD1   . TYR C 1 517 ? -24.496 -20.691 13.782  1.00 9.93   ? 825  TYR C CD1   1 
ATOM   9376  C CD2   . TYR C 1 517 ? -26.035 -19.642 15.275  1.00 10.80  ? 825  TYR C CD2   1 
ATOM   9377  C CE1   . TYR C 1 517 ? -23.948 -19.451 13.474  1.00 11.01  ? 825  TYR C CE1   1 
ATOM   9378  C CE2   . TYR C 1 517 ? -25.497 -18.405 14.973  1.00 8.28   ? 825  TYR C CE2   1 
ATOM   9379  C CZ    . TYR C 1 517 ? -24.455 -18.314 14.081  1.00 6.23   ? 825  TYR C CZ    1 
ATOM   9380  O OH    . TYR C 1 517 ? -23.913 -17.092 13.779  1.00 8.34   ? 825  TYR C OH    1 
ATOM   9381  N N     . GLY C 1 518 ? -28.738 -24.370 13.924  1.00 10.68  ? 826  GLY C N     1 
ATOM   9382  C CA    . GLY C 1 518 ? -29.282 -25.704 14.142  1.00 19.79  ? 826  GLY C CA    1 
ATOM   9383  C C     . GLY C 1 518 ? -29.322 -26.107 15.611  1.00 22.54  ? 826  GLY C C     1 
ATOM   9384  O O     . GLY C 1 518 ? -29.323 -27.280 15.951  1.00 18.17  ? 826  GLY C O     1 
ATOM   9385  N N     A LEU C 1 519 ? -29.357 -25.117 16.493  0.50 13.70  ? 827  LEU C N     1 
ATOM   9386  N N     B LEU C 1 519 ? -29.352 -25.110 16.480  0.50 13.43  ? 827  LEU C N     1 
ATOM   9387  C CA    A LEU C 1 519 ? -29.397 -25.371 17.934  0.50 11.72  ? 827  LEU C CA    1 
ATOM   9388  C CA    B LEU C 1 519 ? -29.452 -25.348 17.911  0.50 12.99  ? 827  LEU C CA    1 
ATOM   9389  C C     A LEU C 1 519 ? -30.842 -25.562 18.444  0.50 14.73  ? 827  LEU C C     1 
ATOM   9390  C C     B LEU C 1 519 ? -30.883 -25.777 18.254  0.50 14.45  ? 827  LEU C C     1 
ATOM   9391  O O     A LEU C 1 519 ? -31.752 -24.820 18.060  0.50 7.51   ? 827  LEU C O     1 
ATOM   9392  O O     B LEU C 1 519 ? -31.826 -25.427 17.551  0.50 15.68  ? 827  LEU C O     1 
ATOM   9393  C CB    A LEU C 1 519 ? -28.722 -24.213 18.684  0.50 15.74  ? 827  LEU C CB    1 
ATOM   9394  C CB    B LEU C 1 519 ? -29.099 -24.058 18.664  0.50 14.27  ? 827  LEU C CB    1 
ATOM   9395  C CG    A LEU C 1 519 ? -27.200 -24.074 18.570  0.50 3.65   ? 827  LEU C CG    1 
ATOM   9396  C CG    B LEU C 1 519 ? -27.630 -23.618 18.688  0.50 14.04  ? 827  LEU C CG    1 
ATOM   9397  C CD1   A LEU C 1 519 ? -26.713 -22.719 19.103  0.50 7.11   ? 827  LEU C CD1   1 
ATOM   9398  C CD1   B LEU C 1 519 ? -26.855 -24.105 17.467  0.50 3.59   ? 827  LEU C CD1   1 
ATOM   9399  C CD2   A LEU C 1 519 ? -26.498 -25.203 19.299  0.50 3.70   ? 827  LEU C CD2   1 
ATOM   9400  C CD2   B LEU C 1 519 ? -27.511 -22.087 18.860  0.50 8.76   ? 827  LEU C CD2   1 
ATOM   9401  N N     . PRO C 1 520 ? -31.055 -26.544 19.337  1.00 21.67  ? 828  PRO C N     1 
ATOM   9402  C CA    . PRO C 1 520 ? -32.428 -26.858 19.762  1.00 28.83  ? 828  PRO C CA    1 
ATOM   9403  C C     . PRO C 1 520 ? -33.100 -25.679 20.471  1.00 23.60  ? 828  PRO C C     1 
ATOM   9404  O O     . PRO C 1 520 ? -32.507 -25.080 21.372  1.00 18.21  ? 828  PRO C O     1 
ATOM   9405  C CB    . PRO C 1 520 ? -32.226 -28.003 20.757  1.00 23.07  ? 828  PRO C CB    1 
ATOM   9406  C CG    . PRO C 1 520 ? -30.866 -27.715 21.350  1.00 18.08  ? 828  PRO C CG    1 
ATOM   9407  C CD    . PRO C 1 520 ? -30.048 -27.197 20.193  1.00 11.00  ? 828  PRO C CD    1 
ATOM   9408  N N     . GLU C 1 521 ? -34.331 -25.362 20.074  1.00 11.60  ? 829  GLU C N     1 
ATOM   9409  C CA    . GLU C 1 521 ? -35.114 -24.298 20.720  1.00 17.51  ? 829  GLU C CA    1 
ATOM   9410  C C     . GLU C 1 521 ? -35.513 -24.607 22.155  1.00 17.07  ? 829  GLU C C     1 
ATOM   9411  O O     . GLU C 1 521 ? -35.848 -23.697 22.907  1.00 39.07  ? 829  GLU C O     1 
ATOM   9412  C CB    . GLU C 1 521 ? -36.388 -24.004 19.923  1.00 20.37  ? 829  GLU C CB    1 
ATOM   9413  C CG    . GLU C 1 521 ? -36.158 -23.753 18.444  1.00 43.30  ? 829  GLU C CG    1 
ATOM   9414  C CD    . GLU C 1 521 ? -35.437 -22.439 18.163  1.00 43.25  ? 829  GLU C CD    1 
ATOM   9415  O OE1   . GLU C 1 521 ? -34.353 -22.475 17.542  1.00 36.84  ? 829  GLU C OE1   1 
ATOM   9416  O OE2   . GLU C 1 521 ? -35.963 -21.374 18.542  1.00 41.21  ? 829  GLU C OE2   1 
ATOM   9417  N N     . ASP C 1 522 ? -35.487 -25.878 22.554  1.00 17.34  ? 830  ASP C N     1 
ATOM   9418  C CA    . ASP C 1 522 ? -35.993 -26.236 23.885  1.00 20.23  ? 830  ASP C CA    1 
ATOM   9419  C C     . ASP C 1 522 ? -35.000 -26.974 24.774  1.00 24.96  ? 830  ASP C C     1 
ATOM   9420  O O     . ASP C 1 522 ? -35.395 -27.782 25.616  1.00 30.37  ? 830  ASP C O     1 
ATOM   9421  C CB    . ASP C 1 522 ? -37.267 -27.081 23.752  1.00 33.52  ? 830  ASP C CB    1 
ATOM   9422  C CG    . ASP C 1 522 ? -37.010 -28.408 23.068  1.00 47.92  ? 830  ASP C CG    1 
ATOM   9423  O OD1   . ASP C 1 522 ? -37.769 -29.366 23.327  1.00 58.46  ? 830  ASP C OD1   1 
ATOM   9424  O OD2   . ASP C 1 522 ? -36.043 -28.493 22.276  1.00 52.10  ? 830  ASP C OD2   1 
ATOM   9425  N N     . ALA C 1 523 ? -33.714 -26.718 24.588  1.00 26.98  ? 831  ALA C N     1 
ATOM   9426  C CA    . ALA C 1 523 ? -32.714 -27.436 25.363  1.00 34.75  ? 831  ALA C CA    1 
ATOM   9427  C C     . ALA C 1 523 ? -31.657 -26.491 25.885  1.00 13.81  ? 831  ALA C C     1 
ATOM   9428  O O     . ALA C 1 523 ? -31.583 -25.351 25.466  1.00 10.39  ? 831  ALA C O     1 
ATOM   9429  C CB    . ALA C 1 523 ? -32.074 -28.548 24.535  1.00 29.12  ? 831  ALA C CB    1 
ATOM   9430  N N     . ILE C 1 524 ? -30.853 -26.981 26.818  1.00 12.19  ? 832  ILE C N     1 
ATOM   9431  C CA    . ILE C 1 524 ? -29.762 -26.205 27.369  1.00 8.58   ? 832  ILE C CA    1 
ATOM   9432  C C     . ILE C 1 524 ? -28.604 -26.322 26.373  1.00 9.94   ? 832  ILE C C     1 
ATOM   9433  O O     . ILE C 1 524 ? -28.357 -27.414 25.852  1.00 12.03  ? 832  ILE C O     1 
ATOM   9434  C CB    . ILE C 1 524 ? -29.370 -26.788 28.729  1.00 15.86  ? 832  ILE C CB    1 
ATOM   9435  C CG1   . ILE C 1 524 ? -30.384 -26.353 29.804  1.00 17.97  ? 832  ILE C CG1   1 
ATOM   9436  C CG2   . ILE C 1 524 ? -27.965 -26.370 29.108  1.00 16.75  ? 832  ILE C CG2   1 
ATOM   9437  C CD1   . ILE C 1 524 ? -30.252 -24.850 30.218  1.00 12.24  ? 832  ILE C CD1   1 
ATOM   9438  N N     . VAL C 1 525 ? -27.931 -25.207 26.083  1.00 14.41  ? 833  VAL C N     1 
ATOM   9439  C CA    . VAL C 1 525 ? -26.787 -25.213 25.171  1.00 8.47   ? 833  VAL C CA    1 
ATOM   9440  C C     . VAL C 1 525 ? -25.507 -24.913 25.954  1.00 14.57  ? 833  VAL C C     1 
ATOM   9441  O O     . VAL C 1 525 ? -25.350 -23.833 26.494  1.00 11.60  ? 833  VAL C O     1 
ATOM   9442  C CB    . VAL C 1 525 ? -26.942 -24.167 24.010  1.00 12.29  ? 833  VAL C CB    1 
ATOM   9443  C CG1   . VAL C 1 525 ? -25.664 -24.109 23.192  1.00 12.93  ? 833  VAL C CG1   1 
ATOM   9444  C CG2   . VAL C 1 525 ? -28.130 -24.499 23.102  1.00 4.04   ? 833  VAL C CG2   1 
ATOM   9445  N N     . TYR C 1 526 ? -24.621 -25.896 26.050  1.00 12.73  ? 834  TYR C N     1 
ATOM   9446  C CA    . TYR C 1 526 ? -23.302 -25.696 26.601  1.00 4.34   ? 834  TYR C CA    1 
ATOM   9447  C C     . TYR C 1 526 ? -22.365 -25.461 25.412  1.00 5.33   ? 834  TYR C C     1 
ATOM   9448  O O     . TYR C 1 526 ? -22.389 -26.234 24.470  1.00 15.60  ? 834  TYR C O     1 
ATOM   9449  C CB    . TYR C 1 526 ? -22.838 -26.960 27.320  1.00 6.90   ? 834  TYR C CB    1 
ATOM   9450  C CG    . TYR C 1 526 ? -23.627 -27.319 28.567  1.00 7.87   ? 834  TYR C CG    1 
ATOM   9451  C CD1   . TYR C 1 526 ? -23.445 -26.628 29.756  1.00 11.55  ? 834  TYR C CD1   1 
ATOM   9452  C CD2   . TYR C 1 526 ? -24.531 -28.374 28.555  1.00 13.28  ? 834  TYR C CD2   1 
ATOM   9453  C CE1   . TYR C 1 526 ? -24.181 -26.961 30.905  1.00 5.26   ? 834  TYR C CE1   1 
ATOM   9454  C CE2   . TYR C 1 526 ? -25.258 -28.709 29.690  1.00 18.73  ? 834  TYR C CE2   1 
ATOM   9455  C CZ    . TYR C 1 526 ? -25.078 -28.000 30.858  1.00 8.68   ? 834  TYR C CZ    1 
ATOM   9456  O OH    . TYR C 1 526 ? -25.802 -28.345 32.003  1.00 7.45   ? 834  TYR C OH    1 
ATOM   9457  N N     . CYS C 1 527 ? -21.571 -24.387 25.437  1.00 8.46   ? 835  CYS C N     1 
ATOM   9458  C CA    . CYS C 1 527 ? -20.701 -24.086 24.300  1.00 4.91   ? 835  CYS C CA    1 
ATOM   9459  C C     . CYS C 1 527 ? -19.218 -24.205 24.679  1.00 12.42  ? 835  CYS C C     1 
ATOM   9460  O O     . CYS C 1 527 ? -18.862 -24.220 25.852  1.00 15.17  ? 835  CYS C O     1 
ATOM   9461  C CB    . CYS C 1 527 ? -21.013 -22.694 23.705  1.00 8.66   ? 835  CYS C CB    1 
ATOM   9462  S SG    . CYS C 1 527 ? -20.584 -21.295 24.793  1.00 12.95  ? 835  CYS C SG    1 
ATOM   9463  N N     . ASN C 1 528 ? -18.361 -24.334 23.673  1.00 6.16   ? 836  ASN C N     1 
ATOM   9464  C CA    . ASN C 1 528 ? -16.939 -24.065 23.851  1.00 9.70   ? 836  ASN C CA    1 
ATOM   9465  C C     . ASN C 1 528 ? -16.395 -23.690 22.467  1.00 7.52   ? 836  ASN C C     1 
ATOM   9466  O O     . ASN C 1 528 ? -16.453 -24.499 21.558  1.00 5.87   ? 836  ASN C O     1 
ATOM   9467  C CB    . ASN C 1 528 ? -16.209 -25.270 24.460  1.00 7.96   ? 836  ASN C CB    1 
ATOM   9468  C CG    . ASN C 1 528 ? -14.729 -24.988 24.673  1.00 19.72  ? 836  ASN C CG    1 
ATOM   9469  O OD1   . ASN C 1 528 ? -14.022 -24.646 23.735  1.00 15.93  ? 836  ASN C OD1   1 
ATOM   9470  N ND2   . ASN C 1 528 ? -14.270 -25.087 25.914  1.00 13.93  ? 836  ASN C ND2   1 
ATOM   9471  N N     . PHE C 1 529 ? -15.924 -22.452 22.299  1.00 8.29   ? 837  PHE C N     1 
ATOM   9472  C CA    . PHE C 1 529 ? -15.575 -21.946 20.969  1.00 11.83  ? 837  PHE C CA    1 
ATOM   9473  C C     . PHE C 1 529 ? -14.073 -21.893 20.739  1.00 12.12  ? 837  PHE C C     1 
ATOM   9474  O O     . PHE C 1 529 ? -13.591 -21.164 19.868  1.00 8.09   ? 837  PHE C O     1 
ATOM   9475  C CB    . PHE C 1 529 ? -16.180 -20.555 20.776  1.00 10.14  ? 837  PHE C CB    1 
ATOM   9476  C CG    . PHE C 1 529 ? -17.693 -20.547 20.763  1.00 12.80  ? 837  PHE C CG    1 
ATOM   9477  C CD1   . PHE C 1 529 ? -18.401 -21.637 20.292  1.00 7.42   ? 837  PHE C CD1   1 
ATOM   9478  C CD2   . PHE C 1 529 ? -18.397 -19.442 21.203  1.00 12.30  ? 837  PHE C CD2   1 
ATOM   9479  C CE1   . PHE C 1 529 ? -19.801 -21.621 20.262  1.00 11.93  ? 837  PHE C CE1   1 
ATOM   9480  C CE2   . PHE C 1 529 ? -19.793 -19.427 21.178  1.00 17.15  ? 837  PHE C CE2   1 
ATOM   9481  C CZ    . PHE C 1 529 ? -20.486 -20.505 20.710  1.00 12.91  ? 837  PHE C CZ    1 
ATOM   9482  N N     . ASN C 1 530 ? -13.326 -22.653 21.530  1.00 7.87   ? 838  ASN C N     1 
ATOM   9483  C CA    . ASN C 1 530 ? -11.876 -22.685 21.356  1.00 13.19  ? 838  ASN C CA    1 
ATOM   9484  C C     . ASN C 1 530 ? -11.461 -23.570 20.169  1.00 6.87   ? 838  ASN C C     1 
ATOM   9485  O O     . ASN C 1 530 ? -12.244 -24.399 19.696  1.00 8.51   ? 838  ASN C O     1 
ATOM   9486  C CB    . ASN C 1 530 ? -11.209 -23.202 22.629  1.00 11.29  ? 838  ASN C CB    1 
ATOM   9487  C CG    . ASN C 1 530 ? -11.288 -22.205 23.772  1.00 13.79  ? 838  ASN C CG    1 
ATOM   9488  O OD1   . ASN C 1 530 ? -10.561 -21.225 23.798  1.00 15.06  ? 838  ASN C OD1   1 
ATOM   9489  N ND2   . ASN C 1 530 ? -12.156 -22.470 24.728  1.00 13.39  ? 838  ASN C ND2   1 
ATOM   9490  N N     . GLN C 1 531 ? -10.225 -23.403 19.708  1.00 4.80   ? 839  GLN C N     1 
ATOM   9491  C CA    . GLN C 1 531 ? -9.629  -24.386 18.816  1.00 4.66   ? 839  GLN C CA    1 
ATOM   9492  C C     . GLN C 1 531 ? -9.652  -25.736 19.509  1.00 15.26  ? 839  GLN C C     1 
ATOM   9493  O O     . GLN C 1 531 ? -9.429  -25.822 20.708  1.00 7.31   ? 839  GLN C O     1 
ATOM   9494  C CB    . GLN C 1 531 ? -8.194  -24.015 18.482  1.00 9.35   ? 839  GLN C CB    1 
ATOM   9495  C CG    . GLN C 1 531 ? -8.026  -22.612 17.934  1.00 8.99   ? 839  GLN C CG    1 
ATOM   9496  C CD    . GLN C 1 531 ? -6.643  -22.406 17.377  1.00 14.84  ? 839  GLN C CD    1 
ATOM   9497  O OE1   . GLN C 1 531 ? -6.227  -23.112 16.464  1.00 12.36  ? 839  GLN C OE1   1 
ATOM   9498  N NE2   . GLN C 1 531 ? -5.911  -21.460 17.941  1.00 4.95   ? 839  GLN C NE2   1 
ATOM   9499  N N     . LEU C 1 532 ? -9.907  -26.791 18.748  1.00 3.81   ? 840  LEU C N     1 
ATOM   9500  C CA    . LEU C 1 532 ? -10.099 -28.122 19.335  1.00 7.48   ? 840  LEU C CA    1 
ATOM   9501  C C     . LEU C 1 532 ? -8.870  -28.698 20.045  1.00 12.48  ? 840  LEU C C     1 
ATOM   9502  O O     . LEU C 1 532 ? -8.997  -29.609 20.862  1.00 8.75   ? 840  LEU C O     1 
ATOM   9503  C CB    . LEU C 1 532 ? -10.615 -29.101 18.269  1.00 9.99   ? 840  LEU C CB    1 
ATOM   9504  C CG    . LEU C 1 532 ? -11.965 -28.688 17.660  1.00 8.54   ? 840  LEU C CG    1 
ATOM   9505  C CD1   . LEU C 1 532 ? -12.313 -29.578 16.484  1.00 7.18   ? 840  LEU C CD1   1 
ATOM   9506  C CD2   . LEU C 1 532 ? -13.109 -28.702 18.742  1.00 7.01   ? 840  LEU C CD2   1 
ATOM   9507  N N     . TYR C 1 533 ? -7.681  -28.183 19.748  1.00 8.96   ? 841  TYR C N     1 
ATOM   9508  C CA    . TYR C 1 533 ? -6.474  -28.753 20.355  1.00 13.36  ? 841  TYR C CA    1 
ATOM   9509  C C     . TYR C 1 533 ? -6.478  -28.633 21.896  1.00 11.02  ? 841  TYR C C     1 
ATOM   9510  O O     . TYR C 1 533 ? -5.761  -29.360 22.599  1.00 9.42   ? 841  TYR C O     1 
ATOM   9511  C CB    . TYR C 1 533 ? -5.218  -28.116 19.759  1.00 6.40   ? 841  TYR C CB    1 
ATOM   9512  C CG    . TYR C 1 533 ? -4.900  -26.746 20.329  1.00 12.30  ? 841  TYR C CG    1 
ATOM   9513  C CD1   . TYR C 1 533 ? -4.262  -26.618 21.554  1.00 10.67  ? 841  TYR C CD1   1 
ATOM   9514  C CD2   . TYR C 1 533 ? -5.232  -25.586 19.642  1.00 17.90  ? 841  TYR C CD2   1 
ATOM   9515  C CE1   . TYR C 1 533 ? -3.959  -25.376 22.079  1.00 10.78  ? 841  TYR C CE1   1 
ATOM   9516  C CE2   . TYR C 1 533 ? -4.933  -24.325 20.169  1.00 14.29  ? 841  TYR C CE2   1 
ATOM   9517  C CZ    . TYR C 1 533 ? -4.297  -24.238 21.395  1.00 13.43  ? 841  TYR C CZ    1 
ATOM   9518  O OH    . TYR C 1 533 ? -3.972  -23.003 21.935  1.00 15.55  ? 841  TYR C OH    1 
ATOM   9519  N N     . LYS C 1 534 ? -7.301  -27.727 22.416  1.00 8.88   ? 842  LYS C N     1 
ATOM   9520  C CA    . LYS C 1 534 ? -7.391  -27.507 23.868  1.00 8.42   ? 842  LYS C CA    1 
ATOM   9521  C C     . LYS C 1 534 ? -8.147  -28.593 24.616  1.00 12.50  ? 842  LYS C C     1 
ATOM   9522  O O     . LYS C 1 534 ? -8.086  -28.669 25.855  1.00 10.89  ? 842  LYS C O     1 
ATOM   9523  C CB    . LYS C 1 534 ? -8.043  -26.152 24.163  1.00 8.45   ? 842  LYS C CB    1 
ATOM   9524  C CG    . LYS C 1 534 ? -7.235  -24.974 23.589  1.00 8.78   ? 842  LYS C CG    1 
ATOM   9525  C CD    . LYS C 1 534 ? -7.824  -23.653 24.034  1.00 13.08  ? 842  LYS C CD    1 
ATOM   9526  C CE    . LYS C 1 534 ? -6.950  -22.478 23.618  1.00 11.13  ? 842  LYS C CE    1 
ATOM   9527  N NZ    . LYS C 1 534 ? -7.636  -21.182 23.931  1.00 11.80  ? 842  LYS C NZ    1 
ATOM   9528  N N     . ILE C 1 535 ? -8.876  -29.427 23.884  1.00 14.16  ? 843  ILE C N     1 
ATOM   9529  C CA    A ILE C 1 535 ? -9.626  -30.539 24.464  0.50 10.51  ? 843  ILE C CA    1 
ATOM   9530  C CA    B ILE C 1 535 ? -9.586  -30.505 24.555  0.50 10.57  ? 843  ILE C CA    1 
ATOM   9531  C C     . ILE C 1 535 ? -8.755  -31.790 24.592  1.00 15.77  ? 843  ILE C C     1 
ATOM   9532  O O     . ILE C 1 535 ? -7.920  -32.062 23.718  1.00 8.75   ? 843  ILE C O     1 
ATOM   9533  C CB    A ILE C 1 535 ? -10.861 -30.888 23.597  0.50 4.17   ? 843  ILE C CB    1 
ATOM   9534  C CB    B ILE C 1 535 ? -11.063 -30.701 24.049  0.50 12.95  ? 843  ILE C CB    1 
ATOM   9535  C CG1   A ILE C 1 535 ? -11.698 -29.632 23.321  0.50 4.03   ? 843  ILE C CG1   1 
ATOM   9536  C CG1   B ILE C 1 535 ? -11.472 -32.178 24.066  0.50 6.29   ? 843  ILE C CG1   1 
ATOM   9537  C CG2   A ILE C 1 535 ? -11.692 -31.970 24.276  0.50 7.80   ? 843  ILE C CG2   1 
ATOM   9538  C CG2   B ILE C 1 535 ? -11.280 -30.065 22.690  0.50 20.08  ? 843  ILE C CG2   1 
ATOM   9539  C CD1   A ILE C 1 535 ? -12.754 -29.810 22.246  0.50 3.93   ? 843  ILE C CD1   1 
ATOM   9540  C CD1   B ILE C 1 535 ? -12.929 -32.407 23.652  0.50 16.04  ? 843  ILE C CD1   1 
ATOM   9541  N N     . ASP C 1 536 ? -8.939  -32.546 25.663  1.00 11.80  ? 844  ASP C N     1 
ATOM   9542  C CA    . ASP C 1 536 ? -8.243  -33.817 25.819  1.00 10.20  ? 844  ASP C CA    1 
ATOM   9543  C C     . ASP C 1 536 ? -9.271  -34.859 26.278  1.00 8.08   ? 844  ASP C C     1 
ATOM   9544  O O     . ASP C 1 536 ? -10.430 -34.513 26.499  1.00 11.60  ? 844  ASP C O     1 
ATOM   9545  C CB    . ASP C 1 536 ? -7.076  -33.680 26.805  1.00 11.25  ? 844  ASP C CB    1 
ATOM   9546  C CG    . ASP C 1 536 ? -7.525  -33.226 28.190  1.00 19.84  ? 844  ASP C CG    1 
ATOM   9547  O OD1   . ASP C 1 536 ? -8.729  -33.296 28.496  1.00 14.44  ? 844  ASP C OD1   1 
ATOM   9548  O OD2   . ASP C 1 536 ? -6.666  -32.804 28.979  1.00 16.84  ? 844  ASP C OD2   1 
ATOM   9549  N N     . PRO C 1 537 ? -8.865  -36.142 26.376  1.00 9.45   ? 845  PRO C N     1 
ATOM   9550  C CA    . PRO C 1 537 ? -9.835  -37.190 26.708  1.00 12.38  ? 845  PRO C CA    1 
ATOM   9551  C C     . PRO C 1 537 ? -10.582 -36.948 28.029  1.00 15.58  ? 845  PRO C C     1 
ATOM   9552  O O     . PRO C 1 537 ? -11.787 -37.169 28.087  1.00 12.41  ? 845  PRO C O     1 
ATOM   9553  C CB    . PRO C 1 537 ? -8.971  -38.450 26.806  1.00 20.53  ? 845  PRO C CB    1 
ATOM   9554  C CG    . PRO C 1 537 ? -7.829  -38.195 25.858  1.00 19.20  ? 845  PRO C CG    1 
ATOM   9555  C CD    . PRO C 1 537 ? -7.563  -36.694 25.954  1.00 9.78   ? 845  PRO C CD    1 
ATOM   9556  N N     . SER C 1 538 ? -9.873  -36.517 29.067  1.00 13.03  ? 846  SER C N     1 
ATOM   9557  C CA    . SER C 1 538 ? -10.499 -36.275 30.368  1.00 14.31  ? 846  SER C CA    1 
ATOM   9558  C C     . SER C 1 538 ? -11.556 -35.190 30.259  1.00 16.23  ? 846  SER C C     1 
ATOM   9559  O O     . SER C 1 538 ? -12.606 -35.267 30.892  1.00 13.17  ? 846  SER C O     1 
ATOM   9560  C CB    . SER C 1 538 ? -9.452  -35.858 31.400  1.00 17.83  ? 846  SER C CB    1 
ATOM   9561  O OG    . SER C 1 538 ? -8.508  -36.897 31.596  1.00 40.48  ? 846  SER C OG    1 
ATOM   9562  N N     . THR C 1 539 ? -11.271 -34.174 29.452  1.00 11.82  ? 847  THR C N     1 
ATOM   9563  C CA    . THR C 1 539 ? -12.186 -33.055 29.313  1.00 11.10  ? 847  THR C CA    1 
ATOM   9564  C C     . THR C 1 539 ? -13.456 -33.518 28.611  1.00 10.73  ? 847  THR C C     1 
ATOM   9565  O O     . THR C 1 539 ? -14.559 -33.232 29.065  1.00 10.15  ? 847  THR C O     1 
ATOM   9566  C CB    . THR C 1 539 ? -11.543 -31.886 28.541  1.00 11.33  ? 847  THR C CB    1 
ATOM   9567  O OG1   . THR C 1 539 ? -10.459 -31.335 29.304  1.00 15.19  ? 847  THR C OG1   1 
ATOM   9568  C CG2   . THR C 1 539 ? -12.563 -30.789 28.281  1.00 12.94  ? 847  THR C CG2   1 
ATOM   9569  N N     . LEU C 1 540 ? -13.315 -34.236 27.501  1.00 9.71   ? 848  LEU C N     1 
ATOM   9570  C CA    . LEU C 1 540 ? -14.514 -34.688 26.793  1.00 17.24  ? 848  LEU C CA    1 
ATOM   9571  C C     . LEU C 1 540 ? -15.345 -35.639 27.672  1.00 9.88   ? 848  LEU C C     1 
ATOM   9572  O O     . LEU C 1 540 ? -16.583 -35.618 27.636  1.00 10.18  ? 848  LEU C O     1 
ATOM   9573  C CB    . LEU C 1 540 ? -14.160 -35.329 25.446  1.00 14.57  ? 848  LEU C CB    1 
ATOM   9574  C CG    . LEU C 1 540 ? -15.347 -35.736 24.560  1.00 15.83  ? 848  LEU C CG    1 
ATOM   9575  C CD1   . LEU C 1 540 ? -16.163 -34.516 24.208  1.00 13.89  ? 848  LEU C CD1   1 
ATOM   9576  C CD2   . LEU C 1 540 ? -14.861 -36.421 23.286  1.00 18.80  ? 848  LEU C CD2   1 
ATOM   9577  N N     . GLN C 1 541 ? -14.672 -36.462 28.473  1.00 11.67  ? 849  GLN C N     1 
ATOM   9578  C CA    . GLN C 1 541 ? -15.395 -37.350 29.388  1.00 13.54  ? 849  GLN C CA    1 
ATOM   9579  C C     . GLN C 1 541 ? -16.192 -36.535 30.403  1.00 15.71  ? 849  GLN C C     1 
ATOM   9580  O O     . GLN C 1 541 ? -17.334 -36.865 30.706  1.00 13.31  ? 849  GLN C O     1 
ATOM   9581  C CB    . GLN C 1 541 ? -14.445 -38.319 30.119  1.00 12.44  ? 849  GLN C CB    1 
ATOM   9582  C CG    . GLN C 1 541 ? -15.181 -39.265 31.095  1.00 20.23  ? 849  GLN C CG    1 
ATOM   9583  C CD    . GLN C 1 541 ? -16.164 -40.174 30.386  1.00 32.10  ? 849  GLN C CD    1 
ATOM   9584  O OE1   . GLN C 1 541 ? -15.764 -41.050 29.620  1.00 22.15  ? 849  GLN C OE1   1 
ATOM   9585  N NE2   . GLN C 1 541 ? -17.462 -39.957 30.621  1.00 25.51  ? 849  GLN C NE2   1 
ATOM   9586  N N     . MET C 1 542 ? -15.582 -35.478 30.935  1.00 12.84  ? 850  MET C N     1 
ATOM   9587  C CA    . MET C 1 542 ? -16.287 -34.568 31.841  1.00 16.70  ? 850  MET C CA    1 
ATOM   9588  C C     . MET C 1 542 ? -17.545 -34.009 31.194  1.00 13.52  ? 850  MET C C     1 
ATOM   9589  O O     . MET C 1 542 ? -18.617 -33.945 31.821  1.00 11.32  ? 850  MET C O     1 
ATOM   9590  C CB    . MET C 1 542 ? -15.396 -33.384 32.221  1.00 23.13  ? 850  MET C CB    1 
ATOM   9591  C CG    . MET C 1 542 ? -14.474 -33.605 33.398  1.00 30.12  ? 850  MET C CG    1 
ATOM   9592  S SD    . MET C 1 542 ? -14.379 -32.080 34.366  1.00 28.66  ? 850  MET C SD    1 
ATOM   9593  C CE    . MET C 1 542 ? -13.628 -30.946 33.199  1.00 30.62  ? 850  MET C CE    1 
ATOM   9594  N N     . TRP C 1 543 ? -17.396 -33.574 29.943  1.00 8.45   ? 851  TRP C N     1 
ATOM   9595  C CA    . TRP C 1 543 ? -18.504 -33.009 29.188  1.00 8.84   ? 851  TRP C CA    1 
ATOM   9596  C C     . TRP C 1 543 ? -19.567 -34.057 28.925  1.00 14.22  ? 851  TRP C C     1 
ATOM   9597  O O     . TRP C 1 543 ? -20.760 -33.768 29.021  1.00 12.98  ? 851  TRP C O     1 
ATOM   9598  C CB    . TRP C 1 543 ? -18.013 -32.393 27.867  1.00 7.21   ? 851  TRP C CB    1 
ATOM   9599  C CG    . TRP C 1 543 ? -17.145 -31.176 28.095  1.00 11.94  ? 851  TRP C CG    1 
ATOM   9600  C CD1   . TRP C 1 543 ? -16.944 -30.515 29.283  1.00 10.43  ? 851  TRP C CD1   1 
ATOM   9601  C CD2   . TRP C 1 543 ? -16.361 -30.493 27.120  1.00 9.68   ? 851  TRP C CD2   1 
ATOM   9602  N NE1   . TRP C 1 543 ? -16.088 -29.456 29.095  1.00 7.47   ? 851  TRP C NE1   1 
ATOM   9603  C CE2   . TRP C 1 543 ? -15.715 -29.420 27.778  1.00 9.35   ? 851  TRP C CE2   1 
ATOM   9604  C CE3   . TRP C 1 543 ? -16.141 -30.681 25.745  1.00 8.72   ? 851  TRP C CE3   1 
ATOM   9605  C CZ2   . TRP C 1 543 ? -14.860 -28.542 27.113  1.00 13.67  ? 851  TRP C CZ2   1 
ATOM   9606  C CZ3   . TRP C 1 543 ? -15.285 -29.806 25.088  1.00 7.90   ? 851  TRP C CZ3   1 
ATOM   9607  C CH2   . TRP C 1 543 ? -14.672 -28.741 25.774  1.00 6.09   ? 851  TRP C CH2   1 
ATOM   9608  N N     . ALA C 1 544 ? -19.137 -35.275 28.588  1.00 9.37   ? 852  ALA C N     1 
ATOM   9609  C CA    . ALA C 1 544 ? -20.095 -36.348 28.347  1.00 10.20  ? 852  ALA C CA    1 
ATOM   9610  C C     . ALA C 1 544 ? -20.905 -36.631 29.602  1.00 18.45  ? 852  ALA C C     1 
ATOM   9611  O O     . ALA C 1 544 ? -22.099 -36.919 29.518  1.00 13.57  ? 852  ALA C O     1 
ATOM   9612  C CB    . ALA C 1 544 ? -19.376 -37.624 27.882  1.00 12.46  ? 852  ALA C CB    1 
ATOM   9613  N N     . ASN C 1 545 ? -20.252 -36.564 30.761  1.00 15.79  ? 853  ASN C N     1 
ATOM   9614  C CA    . ASN C 1 545 ? -20.934 -36.831 32.030  1.00 15.60  ? 853  ASN C CA    1 
ATOM   9615  C C     . ASN C 1 545 ? -22.005 -35.785 32.295  1.00 13.39  ? 853  ASN C C     1 
ATOM   9616  O O     . ASN C 1 545 ? -23.076 -36.096 32.818  1.00 15.92  ? 853  ASN C O     1 
ATOM   9617  C CB    . ASN C 1 545 ? -19.943 -36.870 33.201  1.00 13.02  ? 853  ASN C CB    1 
ATOM   9618  C CG    . ASN C 1 545 ? -19.017 -38.059 33.129  1.00 20.56  ? 853  ASN C CG    1 
ATOM   9619  O OD1   . ASN C 1 545 ? -19.278 -39.007 32.387  1.00 26.41  ? 853  ASN C OD1   1 
ATOM   9620  N ND2   . ASN C 1 545 ? -17.932 -38.027 33.908  1.00 17.69  ? 853  ASN C ND2   1 
ATOM   9621  N N     A ILE C 1 546 ? -21.706 -34.539 31.931  0.50 12.17  ? 854  ILE C N     1 
ATOM   9622  N N     B ILE C 1 546 ? -21.703 -34.540 31.934  0.50 12.25  ? 854  ILE C N     1 
ATOM   9623  C CA    A ILE C 1 546 ? -22.633 -33.434 32.109  0.50 6.38   ? 854  ILE C CA    1 
ATOM   9624  C CA    B ILE C 1 546 ? -22.639 -33.441 32.079  0.50 6.38   ? 854  ILE C CA    1 
ATOM   9625  C C     A ILE C 1 546 ? -23.853 -33.587 31.194  0.50 13.31  ? 854  ILE C C     1 
ATOM   9626  C C     B ILE C 1 546 ? -23.859 -33.651 31.200  0.50 13.45  ? 854  ILE C C     1 
ATOM   9627  O O     A ILE C 1 546 ? -24.989 -33.465 31.643  0.50 9.01   ? 854  ILE C O     1 
ATOM   9628  O O     B ILE C 1 546 ? -24.995 -33.624 31.670  0.50 8.73   ? 854  ILE C O     1 
ATOM   9629  C CB    A ILE C 1 546 ? -21.942 -32.080 31.843  0.50 10.45  ? 854  ILE C CB    1 
ATOM   9630  C CB    B ILE C 1 546 ? -21.978 -32.119 31.687  0.50 7.28   ? 854  ILE C CB    1 
ATOM   9631  C CG1   A ILE C 1 546 ? -20.768 -31.866 32.814  0.50 10.69  ? 854  ILE C CG1   1 
ATOM   9632  C CG1   B ILE C 1 546 ? -20.977 -31.722 32.766  0.50 15.16  ? 854  ILE C CG1   1 
ATOM   9633  C CG2   A ILE C 1 546 ? -22.937 -30.943 31.970  0.50 10.76  ? 854  ILE C CG2   1 
ATOM   9634  C CG2   B ILE C 1 546 ? -23.022 -31.030 31.512  0.50 9.16   ? 854  ILE C CG2   1 
ATOM   9635  C CD1   A ILE C 1 546 ? -19.860 -30.665 32.444  0.50 5.82   ? 854  ILE C CD1   1 
ATOM   9636  C CD1   B ILE C 1 546 ? -21.563 -31.808 34.129  0.50 12.52  ? 854  ILE C CD1   1 
ATOM   9637  N N     . LEU C 1 547 ? -23.610 -33.867 29.915  1.00 8.46   ? 855  LEU C N     1 
ATOM   9638  C CA    . LEU C 1 547 ? -24.687 -34.067 28.956  1.00 14.94  ? 855  LEU C CA    1 
ATOM   9639  C C     . LEU C 1 547 ? -25.614 -35.219 29.372  1.00 12.65  ? 855  LEU C C     1 
ATOM   9640  O O     . LEU C 1 547 ? -26.824 -35.110 29.245  1.00 11.89  ? 855  LEU C O     1 
ATOM   9641  C CB    . LEU C 1 547 ? -24.116 -34.311 27.558  1.00 11.77  ? 855  LEU C CB    1 
ATOM   9642  C CG    . LEU C 1 547 ? -23.434 -33.123 26.864  1.00 15.78  ? 855  LEU C CG    1 
ATOM   9643  C CD1   . LEU C 1 547 ? -22.782 -33.552 25.539  1.00 19.35  ? 855  LEU C CD1   1 
ATOM   9644  C CD2   . LEU C 1 547 ? -24.414 -31.990 26.631  1.00 15.47  ? 855  LEU C CD2   1 
ATOM   9645  N N     . LYS C 1 548 ? -25.031 -36.324 29.844  1.00 10.05  ? 856  LYS C N     1 
ATOM   9646  C CA    . LYS C 1 548 ? -25.808 -37.461 30.359  1.00 14.66  ? 856  LYS C CA    1 
ATOM   9647  C C     . LYS C 1 548 ? -26.703 -37.100 31.544  1.00 15.56  ? 856  LYS C C     1 
ATOM   9648  O O     . LYS C 1 548 ? -27.751 -37.707 31.733  1.00 22.03  ? 856  LYS C O     1 
ATOM   9649  C CB    . LYS C 1 548 ? -24.880 -38.605 30.766  1.00 14.78  ? 856  LYS C CB    1 
ATOM   9650  C CG    . LYS C 1 548 ? -24.150 -39.237 29.585  1.00 30.56  ? 856  LYS C CG    1 
ATOM   9651  C CD    . LYS C 1 548 ? -23.021 -40.134 30.055  1.00 36.11  ? 856  LYS C CD    1 
ATOM   9652  C CE    . LYS C 1 548 ? -22.374 -40.825 28.880  1.00 43.67  ? 856  LYS C CE    1 
ATOM   9653  N NZ    . LYS C 1 548 ? -23.380 -41.581 28.087  1.00 53.17  ? 856  LYS C NZ    1 
ATOM   9654  N N     . ARG C 1 549 ? -26.278 -36.129 32.346  1.00 14.17  ? 857  ARG C N     1 
ATOM   9655  C CA    . ARG C 1 549 ? -27.056 -35.703 33.517  1.00 14.35  ? 857  ARG C CA    1 
ATOM   9656  C C     . ARG C 1 549 ? -28.136 -34.672 33.213  1.00 14.43  ? 857  ARG C C     1 
ATOM   9657  O O     . ARG C 1 549 ? -29.013 -34.425 34.050  1.00 16.93  ? 857  ARG C O     1 
ATOM   9658  C CB    . ARG C 1 549 ? -26.136 -35.160 34.623  1.00 13.45  ? 857  ARG C CB    1 
ATOM   9659  C CG    . ARG C 1 549 ? -25.501 -36.257 35.468  1.00 14.99  ? 857  ARG C CG    1 
ATOM   9660  C CD    . ARG C 1 549 ? -24.664 -35.679 36.598  1.00 17.36  ? 857  ARG C CD    1 
ATOM   9661  N NE    . ARG C 1 549 ? -25.485 -34.900 37.522  1.00 24.87  ? 857  ARG C NE    1 
ATOM   9662  C CZ    . ARG C 1 549 ? -25.004 -34.178 38.527  1.00 25.90  ? 857  ARG C CZ    1 
ATOM   9663  N NH1   . ARG C 1 549 ? -23.699 -34.130 38.738  1.00 18.07  ? 857  ARG C NH1   1 
ATOM   9664  N NH2   . ARG C 1 549 ? -25.829 -33.497 39.317  1.00 26.04  ? 857  ARG C NH2   1 
ATOM   9665  N N     . VAL C 1 550 ? -28.072 -34.064 32.029  1.00 14.76  ? 858  VAL C N     1 
ATOM   9666  C CA    . VAL C 1 550 ? -28.987 -32.973 31.668  1.00 14.17  ? 858  VAL C CA    1 
ATOM   9667  C C     . VAL C 1 550 ? -29.672 -33.314 30.357  1.00 19.82  ? 858  VAL C C     1 
ATOM   9668  O O     . VAL C 1 550 ? -29.194 -32.940 29.276  1.00 18.70  ? 858  VAL C O     1 
ATOM   9669  C CB    . VAL C 1 550 ? -28.235 -31.618 31.537  1.00 14.86  ? 858  VAL C CB    1 
ATOM   9670  C CG1   . VAL C 1 550 ? -29.215 -30.466 31.243  1.00 6.30   ? 858  VAL C CG1   1 
ATOM   9671  C CG2   . VAL C 1 550 ? -27.426 -31.335 32.807  1.00 7.73   ? 858  VAL C CG2   1 
ATOM   9672  N N     . PRO C 1 551 ? -30.778 -34.063 30.448  1.00 30.35  ? 859  PRO C N     1 
ATOM   9673  C CA    . PRO C 1 551 ? -31.520 -34.632 29.322  1.00 30.46  ? 859  PRO C CA    1 
ATOM   9674  C C     . PRO C 1 551 ? -31.690 -33.678 28.152  1.00 23.69  ? 859  PRO C C     1 
ATOM   9675  O O     . PRO C 1 551 ? -31.387 -34.044 27.016  1.00 28.99  ? 859  PRO C O     1 
ATOM   9676  C CB    . PRO C 1 551 ? -32.879 -34.956 29.945  1.00 33.37  ? 859  PRO C CB    1 
ATOM   9677  C CG    . PRO C 1 551 ? -32.542 -35.321 31.338  1.00 25.89  ? 859  PRO C CG    1 
ATOM   9678  C CD    . PRO C 1 551 ? -31.365 -34.466 31.742  1.00 28.44  ? 859  PRO C CD    1 
ATOM   9679  N N     . ASN C 1 552 ? -32.172 -32.469 28.414  1.00 10.95  ? 860  ASN C N     1 
ATOM   9680  C CA    . ASN C 1 552 ? -32.422 -31.564 27.321  1.00 41.76  ? 860  ASN C CA    1 
ATOM   9681  C C     . ASN C 1 552 ? -31.209 -30.677 27.167  1.00 46.15  ? 860  ASN C C     1 
ATOM   9682  O O     . ASN C 1 552 ? -31.245 -29.521 27.600  1.00 30.80  ? 860  ASN C O     1 
ATOM   9683  C CB    . ASN C 1 552 ? -33.672 -30.733 27.604  1.00 50.97  ? 860  ASN C CB    1 
ATOM   9684  C CG    . ASN C 1 552 ? -34.848 -31.586 28.026  1.00 47.20  ? 860  ASN C CG    1 
ATOM   9685  O OD1   . ASN C 1 552 ? -35.049 -32.687 27.507  1.00 39.18  ? 860  ASN C OD1   1 
ATOM   9686  N ND2   . ASN C 1 552 ? -35.623 -31.093 28.986  1.00 46.88  ? 860  ASN C ND2   1 
ATOM   9687  N N     . SER C 1 553 ? -30.134 -31.226 26.586  1.00 18.20  ? 861  SER C N     1 
ATOM   9688  C CA    . SER C 1 553 ? -28.906 -30.444 26.407  1.00 15.58  ? 861  SER C CA    1 
ATOM   9689  C C     . SER C 1 553 ? -28.014 -30.884 25.236  1.00 14.06  ? 861  SER C C     1 
ATOM   9690  O O     . SER C 1 553 ? -27.967 -32.067 24.844  1.00 10.67  ? 861  SER C O     1 
ATOM   9691  C CB    . SER C 1 553 ? -28.095 -30.338 27.716  1.00 12.53  ? 861  SER C CB    1 
ATOM   9692  O OG    . SER C 1 553 ? -27.287 -31.479 27.972  1.00 12.16  ? 861  SER C OG    1 
ATOM   9693  N N     . VAL C 1 554 ? -27.326 -29.899 24.672  1.00 14.70  ? 862  VAL C N     1 
ATOM   9694  C CA    . VAL C 1 554 ? -26.400 -30.127 23.582  1.00 14.24  ? 862  VAL C CA    1 
ATOM   9695  C C     . VAL C 1 554 ? -25.066 -29.450 23.901  1.00 17.30  ? 862  VAL C C     1 
ATOM   9696  O O     . VAL C 1 554 ? -25.015 -28.498 24.677  1.00 13.58  ? 862  VAL C O     1 
ATOM   9697  C CB    . VAL C 1 554 ? -26.954 -29.599 22.242  1.00 12.83  ? 862  VAL C CB    1 
ATOM   9698  C CG1   . VAL C 1 554 ? -28.270 -30.326 21.867  1.00 11.60  ? 862  VAL C CG1   1 
ATOM   9699  C CG2   . VAL C 1 554 ? -27.151 -28.077 22.296  1.00 10.33  ? 862  VAL C CG2   1 
ATOM   9700  N N     . LEU C 1 555 ? -23.987 -29.964 23.318  1.00 8.36   ? 863  LEU C N     1 
ATOM   9701  C CA    . LEU C 1 555 ? -22.679 -29.319 23.422  1.00 6.48   ? 863  LEU C CA    1 
ATOM   9702  C C     . LEU C 1 555 ? -22.438 -28.661 22.068  1.00 16.01  ? 863  LEU C C     1 
ATOM   9703  O O     . LEU C 1 555 ? -22.656 -29.286 21.036  1.00 12.06  ? 863  LEU C O     1 
ATOM   9704  C CB    . LEU C 1 555 ? -21.594 -30.356 23.707  1.00 14.07  ? 863  LEU C CB    1 
ATOM   9705  C CG    . LEU C 1 555 ? -20.123 -29.918 23.706  1.00 14.40  ? 863  LEU C CG    1 
ATOM   9706  C CD1   . LEU C 1 555 ? -19.857 -28.970 24.857  1.00 16.56  ? 863  LEU C CD1   1 
ATOM   9707  C CD2   . LEU C 1 555 ? -19.168 -31.146 23.773  1.00 8.52   ? 863  LEU C CD2   1 
ATOM   9708  N N     . TRP C 1 556 ? -22.022 -27.399 22.076  1.00 12.41  ? 864  TRP C N     1 
ATOM   9709  C CA    . TRP C 1 556 ? -21.853 -26.624 20.847  1.00 7.69   ? 864  TRP C CA    1 
ATOM   9710  C C     . TRP C 1 556 ? -20.359 -26.347 20.656  1.00 11.84  ? 864  TRP C C     1 
ATOM   9711  O O     . TRP C 1 556 ? -19.777 -25.607 21.440  1.00 10.86  ? 864  TRP C O     1 
ATOM   9712  C CB    . TRP C 1 556 ? -22.603 -25.300 21.007  1.00 10.39  ? 864  TRP C CB    1 
ATOM   9713  C CG    . TRP C 1 556 ? -22.707 -24.410 19.788  1.00 9.60   ? 864  TRP C CG    1 
ATOM   9714  C CD1   . TRP C 1 556 ? -22.424 -24.730 18.480  1.00 8.52   ? 864  TRP C CD1   1 
ATOM   9715  C CD2   . TRP C 1 556 ? -23.169 -23.057 19.775  1.00 8.62   ? 864  TRP C CD2   1 
ATOM   9716  N NE1   . TRP C 1 556 ? -22.664 -23.641 17.665  1.00 14.94  ? 864  TRP C NE1   1 
ATOM   9717  C CE2   . TRP C 1 556 ? -23.122 -22.607 18.436  1.00 13.29  ? 864  TRP C CE2   1 
ATOM   9718  C CE3   . TRP C 1 556 ? -23.610 -22.178 20.767  1.00 14.70  ? 864  TRP C CE3   1 
ATOM   9719  C CZ2   . TRP C 1 556 ? -23.509 -21.313 18.067  1.00 12.65  ? 864  TRP C CZ2   1 
ATOM   9720  C CZ3   . TRP C 1 556 ? -23.981 -20.882 20.398  1.00 9.42   ? 864  TRP C CZ3   1 
ATOM   9721  C CH2   . TRP C 1 556 ? -23.939 -20.474 19.060  1.00 9.60   ? 864  TRP C CH2   1 
ATOM   9722  N N     . LEU C 1 557 ? -19.754 -26.941 19.625  1.00 10.57  ? 865  LEU C N     1 
ATOM   9723  C CA    . LEU C 1 557 ? -18.321 -26.772 19.334  1.00 5.87   ? 865  LEU C CA    1 
ATOM   9724  C C     . LEU C 1 557 ? -18.093 -26.266 17.919  1.00 6.68   ? 865  LEU C C     1 
ATOM   9725  O O     . LEU C 1 557 ? -19.037 -26.181 17.126  1.00 3.38   ? 865  LEU C O     1 
ATOM   9726  C CB    . LEU C 1 557 ? -17.600 -28.121 19.488  1.00 8.18   ? 865  LEU C CB    1 
ATOM   9727  C CG    . LEU C 1 557 ? -17.746 -28.874 20.810  1.00 12.68  ? 865  LEU C CG    1 
ATOM   9728  C CD1   . LEU C 1 557 ? -17.100 -30.280 20.705  1.00 6.75   ? 865  LEU C CD1   1 
ATOM   9729  C CD2   . LEU C 1 557 ? -17.145 -28.074 21.966  1.00 11.52  ? 865  LEU C CD2   1 
ATOM   9730  N N     . LEU C 1 558 ? -16.835 -25.961 17.590  1.00 10.23  ? 866  LEU C N     1 
ATOM   9731  C CA    . LEU C 1 558 ? -16.496 -25.391 16.280  1.00 9.38   ? 866  LEU C CA    1 
ATOM   9732  C C     . LEU C 1 558 ? -15.608 -26.333 15.472  1.00 8.67   ? 866  LEU C C     1 
ATOM   9733  O O     . LEU C 1 558 ? -14.848 -27.119 16.032  1.00 6.28   ? 866  LEU C O     1 
ATOM   9734  C CB    . LEU C 1 558 ? -15.779 -24.046 16.413  1.00 5.19   ? 866  LEU C CB    1 
ATOM   9735  C CG    . LEU C 1 558 ? -16.533 -22.966 17.200  1.00 14.09  ? 866  LEU C CG    1 
ATOM   9736  C CD1   . LEU C 1 558 ? -15.781 -21.633 17.173  1.00 6.48   ? 866  LEU C CD1   1 
ATOM   9737  C CD2   . LEU C 1 558 ? -17.953 -22.819 16.644  1.00 5.71   ? 866  LEU C CD2   1 
ATOM   9738  N N     . ARG C 1 559 ? -15.741 -26.247 14.155  1.00 6.84   ? 867  ARG C N     1 
ATOM   9739  C CA    . ARG C 1 559 ? -14.881 -26.972 13.242  1.00 11.77  ? 867  ARG C CA    1 
ATOM   9740  C C     . ARG C 1 559 ? -13.565 -26.213 13.178  1.00 11.26  ? 867  ARG C C     1 
ATOM   9741  O O     . ARG C 1 559 ? -13.336 -25.393 12.279  1.00 7.20   ? 867  ARG C O     1 
ATOM   9742  C CB    . ARG C 1 559 ? -15.546 -27.069 11.863  1.00 9.28   ? 867  ARG C CB    1 
ATOM   9743  C CG    . ARG C 1 559 ? -16.917 -27.779 11.877  1.00 9.59   ? 867  ARG C CG    1 
ATOM   9744  C CD    . ARG C 1 559 ? -17.427 -28.067 10.449  1.00 15.00  ? 867  ARG C CD    1 
ATOM   9745  N NE    . ARG C 1 559 ? -18.790 -28.587 10.485  1.00 12.45  ? 867  ARG C NE    1 
ATOM   9746  C CZ    . ARG C 1 559 ? -19.861 -27.924 10.042  1.00 22.19  ? 867  ARG C CZ    1 
ATOM   9747  N NH1   . ARG C 1 559 ? -19.731 -26.731 9.482   1.00 14.28  ? 867  ARG C NH1   1 
ATOM   9748  N NH2   . ARG C 1 559 ? -21.069 -28.469 10.138  1.00 19.51  ? 867  ARG C NH2   1 
ATOM   9749  N N     . PHE C 1 560 ? -12.691 -26.490 14.144  1.00 8.08   ? 868  PHE C N     1 
ATOM   9750  C CA    . PHE C 1 560 ? -11.543 -25.612 14.397  1.00 10.33  ? 868  PHE C CA    1 
ATOM   9751  C C     . PHE C 1 560 ? -10.344 -26.493 14.747  1.00 9.27   ? 868  PHE C C     1 
ATOM   9752  O O     . PHE C 1 560 ? -9.809  -26.391 15.845  1.00 9.63   ? 868  PHE C O     1 
ATOM   9753  C CB    . PHE C 1 560 ? -11.911 -24.697 15.591  1.00 7.67   ? 868  PHE C CB    1 
ATOM   9754  C CG    . PHE C 1 560 ? -11.257 -23.325 15.594  1.00 7.64   ? 868  PHE C CG    1 
ATOM   9755  C CD1   . PHE C 1 560 ? -11.622 -22.394 16.569  1.00 7.75   ? 868  PHE C CD1   1 
ATOM   9756  C CD2   . PHE C 1 560 ? -10.312 -22.956 14.645  1.00 7.72   ? 868  PHE C CD2   1 
ATOM   9757  C CE1   . PHE C 1 560 ? -11.051 -21.114 16.610  1.00 8.18   ? 868  PHE C CE1   1 
ATOM   9758  C CE2   . PHE C 1 560 ? -9.725  -21.663 14.662  1.00 12.06  ? 868  PHE C CE2   1 
ATOM   9759  C CZ    . PHE C 1 560 ? -10.101 -20.737 15.643  1.00 7.22   ? 868  PHE C CZ    1 
ATOM   9760  N N     . PRO C 1 561 ? -9.908  -27.360 13.808  1.00 12.97  ? 869  PRO C N     1 
ATOM   9761  C CA    . PRO C 1 561 ? -10.418 -27.426 12.430  1.00 10.75  ? 869  PRO C CA    1 
ATOM   9762  C C     . PRO C 1 561 ? -11.488 -28.491 12.194  1.00 14.01  ? 869  PRO C C     1 
ATOM   9763  O O     . PRO C 1 561 ? -11.653 -29.413 12.987  1.00 11.14  ? 869  PRO C O     1 
ATOM   9764  C CB    . PRO C 1 561 ? -9.162  -27.786 11.627  1.00 17.85  ? 869  PRO C CB    1 
ATOM   9765  C CG    . PRO C 1 561 ? -8.385  -28.688 12.576  1.00 10.26  ? 869  PRO C CG    1 
ATOM   9766  C CD    . PRO C 1 561 ? -8.683  -28.172 13.976  1.00 11.89  ? 869  PRO C CD    1 
ATOM   9767  N N     . ALA C 1 562 ? -12.197 -28.354 11.075  1.00 7.94   ? 870  ALA C N     1 
ATOM   9768  C CA    . ALA C 1 562 ? -13.184 -29.328 10.623  1.00 12.45  ? 870  ALA C CA    1 
ATOM   9769  C C     . ALA C 1 562 ? -12.721 -30.789 10.737  1.00 10.77  ? 870  ALA C C     1 
ATOM   9770  O O     . ALA C 1 562 ? -13.520 -31.666 11.077  1.00 13.18  ? 870  ALA C O     1 
ATOM   9771  C CB    . ALA C 1 562 ? -13.613 -29.003 9.160   1.00 10.45  ? 870  ALA C CB    1 
ATOM   9772  N N     . VAL C 1 563 ? -11.448 -31.065 10.459  1.00 9.63   ? 871  VAL C N     1 
ATOM   9773  C CA    . VAL C 1 563 ? -10.974 -32.453 10.486  1.00 13.31  ? 871  VAL C CA    1 
ATOM   9774  C C     . VAL C 1 563 ? -10.890 -33.029 11.910  1.00 18.18  ? 871  VAL C C     1 
ATOM   9775  O O     . VAL C 1 563 ? -10.687 -34.223 12.092  1.00 18.28  ? 871  VAL C O     1 
ATOM   9776  C CB    . VAL C 1 563 ? -9.664  -32.674 9.686   1.00 17.86  ? 871  VAL C CB    1 
ATOM   9777  C CG1   . VAL C 1 563 ? -9.872  -32.255 8.247   1.00 12.35  ? 871  VAL C CG1   1 
ATOM   9778  C CG2   . VAL C 1 563 ? -8.495  -31.875 10.288  1.00 15.80  ? 871  VAL C CG2   1 
ATOM   9779  N N     . GLY C 1 564 ? -11.084 -32.178 12.910  1.00 14.34  ? 872  GLY C N     1 
ATOM   9780  C CA    . GLY C 1 564 ? -11.259 -32.640 14.281  1.00 8.67   ? 872  GLY C CA    1 
ATOM   9781  C C     . GLY C 1 564 ? -12.660 -33.155 14.586  1.00 6.90   ? 872  GLY C C     1 
ATOM   9782  O O     . GLY C 1 564 ? -12.841 -33.949 15.514  1.00 16.04  ? 872  GLY C O     1 
ATOM   9783  N N     . GLU C 1 565 ? -13.660 -32.719 13.811  1.00 8.46   ? 873  GLU C N     1 
ATOM   9784  C CA    . GLU C 1 565 ? -15.063 -33.080 14.087  1.00 8.68   ? 873  GLU C CA    1 
ATOM   9785  C C     . GLU C 1 565 ? -15.308 -34.583 14.169  1.00 12.55  ? 873  GLU C C     1 
ATOM   9786  O O     . GLU C 1 565 ? -15.928 -35.067 15.121  1.00 15.10  ? 873  GLU C O     1 
ATOM   9787  C CB    . GLU C 1 565 ? -16.024 -32.455 13.051  1.00 6.79   ? 873  GLU C CB    1 
ATOM   9788  C CG    . GLU C 1 565 ? -17.484 -32.876 13.233  1.00 10.14  ? 873  GLU C CG    1 
ATOM   9789  C CD    . GLU C 1 565 ? -18.468 -32.108 12.347  1.00 16.93  ? 873  GLU C CD    1 
ATOM   9790  O OE1   . GLU C 1 565 ? -18.089 -31.108 11.692  1.00 12.59  ? 873  GLU C OE1   1 
ATOM   9791  O OE2   . GLU C 1 565 ? -19.642 -32.503 12.318  1.00 11.68  ? 873  GLU C OE2   1 
ATOM   9792  N N     . PRO C 1 566 ? -14.839 -35.338 13.164  1.00 13.87  ? 874  PRO C N     1 
ATOM   9793  C CA    . PRO C 1 566 ? -15.160 -36.763 13.210  1.00 9.64   ? 874  PRO C CA    1 
ATOM   9794  C C     . PRO C 1 566 ? -14.437 -37.500 14.342  1.00 12.85  ? 874  PRO C C     1 
ATOM   9795  O O     . PRO C 1 566 ? -14.927 -38.544 14.789  1.00 15.87  ? 874  PRO C O     1 
ATOM   9796  C CB    . PRO C 1 566 ? -14.724 -37.266 11.818  1.00 16.03  ? 874  PRO C CB    1 
ATOM   9797  C CG    . PRO C 1 566 ? -13.677 -36.335 11.386  1.00 18.10  ? 874  PRO C CG    1 
ATOM   9798  C CD    . PRO C 1 566 ? -14.113 -34.978 11.931  1.00 18.41  ? 874  PRO C CD    1 
ATOM   9799  N N     . ASN C 1 567 ? -13.316 -36.966 14.822  1.00 10.96  ? 875  ASN C N     1 
ATOM   9800  C CA    . ASN C 1 567 ? -12.615 -37.600 15.941  1.00 13.37  ? 875  ASN C CA    1 
ATOM   9801  C C     . ASN C 1 567 ? -13.378 -37.380 17.255  1.00 16.41  ? 875  ASN C C     1 
ATOM   9802  O O     . ASN C 1 567 ? -13.615 -38.311 18.028  1.00 8.97   ? 875  ASN C O     1 
ATOM   9803  C CB    . ASN C 1 567 ? -11.150 -37.107 16.033  1.00 11.36  ? 875  ASN C CB    1 
ATOM   9804  C CG    . ASN C 1 567 ? -10.245 -37.766 14.997  1.00 14.46  ? 875  ASN C CG    1 
ATOM   9805  O OD1   . ASN C 1 567 ? -10.514 -38.883 14.568  1.00 21.18  ? 875  ASN C OD1   1 
ATOM   9806  N ND2   . ASN C 1 567 ? -9.179  -37.065 14.574  1.00 7.78   ? 875  ASN C ND2   1 
ATOM   9807  N N     . ILE C 1 568 ? -13.794 -36.144 17.485  1.00 11.22  ? 876  ILE C N     1 
ATOM   9808  C CA    . ILE C 1 568 ? -14.623 -35.813 18.643  1.00 13.82  ? 876  ILE C CA    1 
ATOM   9809  C C     . ILE C 1 568 ? -15.914 -36.628 18.637  1.00 14.08  ? 876  ILE C C     1 
ATOM   9810  O O     . ILE C 1 568 ? -16.333 -37.155 19.672  1.00 16.86  ? 876  ILE C O     1 
ATOM   9811  C CB    . ILE C 1 568 ? -14.953 -34.305 18.680  1.00 9.25   ? 876  ILE C CB    1 
ATOM   9812  C CG1   . ILE C 1 568 ? -13.689 -33.480 18.968  1.00 16.33  ? 876  ILE C CG1   1 
ATOM   9813  C CG2   . ILE C 1 568 ? -16.024 -33.997 19.730  1.00 13.46  ? 876  ILE C CG2   1 
ATOM   9814  C CD1   . ILE C 1 568 ? -13.066 -33.765 20.331  1.00 17.38  ? 876  ILE C CD1   1 
ATOM   9815  N N     . GLN C 1 569 ? -16.534 -36.762 17.468  1.00 13.80  ? 877  GLN C N     1 
ATOM   9816  C CA    . GLN C 1 569 ? -17.805 -37.474 17.388  1.00 15.71  ? 877  GLN C CA    1 
ATOM   9817  C C     . GLN C 1 569 ? -17.636 -38.958 17.720  1.00 14.44  ? 877  GLN C C     1 
ATOM   9818  O O     . GLN C 1 569 ? -18.443 -39.534 18.442  1.00 18.87  ? 877  GLN C O     1 
ATOM   9819  C CB    . GLN C 1 569 ? -18.462 -37.286 16.014  1.00 15.73  ? 877  GLN C CB    1 
ATOM   9820  C CG    . GLN C 1 569 ? -18.777 -35.836 15.648  1.00 30.05  ? 877  GLN C CG    1 
ATOM   9821  C CD    . GLN C 1 569 ? -20.194 -35.406 16.019  1.00 43.26  ? 877  GLN C CD    1 
ATOM   9822  O OE1   . GLN C 1 569 ? -20.813 -35.964 16.925  1.00 33.07  ? 877  GLN C OE1   1 
ATOM   9823  N NE2   . GLN C 1 569 ? -20.712 -34.409 15.306  1.00 46.33  ? 877  GLN C NE2   1 
ATOM   9824  N N     . GLN C 1 570 ? -16.583 -39.575 17.200  1.00 15.50  ? 878  GLN C N     1 
ATOM   9825  C CA    . GLN C 1 570 ? -16.317 -40.976 17.501  1.00 18.52  ? 878  GLN C CA    1 
ATOM   9826  C C     . GLN C 1 570 ? -16.122 -41.219 18.992  1.00 19.31  ? 878  GLN C C     1 
ATOM   9827  O O     . GLN C 1 570 ? -16.671 -42.161 19.551  1.00 18.07  ? 878  GLN C O     1 
ATOM   9828  C CB    . GLN C 1 570 ? -15.093 -41.481 16.744  1.00 20.69  ? 878  GLN C CB    1 
ATOM   9829  C CG    . GLN C 1 570 ? -14.875 -42.981 16.904  1.00 29.31  ? 878  GLN C CG    1 
ATOM   9830  C CD    . GLN C 1 570 ? -16.063 -43.788 16.398  1.00 44.35  ? 878  GLN C CD    1 
ATOM   9831  O OE1   . GLN C 1 570 ? -16.235 -43.972 15.192  1.00 53.85  ? 878  GLN C OE1   1 
ATOM   9832  N NE2   . GLN C 1 570 ? -16.896 -44.258 17.320  1.00 36.90  ? 878  GLN C NE2   1 
ATOM   9833  N N     . TYR C 1 571 ? -15.321 -40.378 19.630  1.00 12.05  ? 879  TYR C N     1 
ATOM   9834  C CA    . TYR C 1 571 ? -15.063 -40.518 21.052  1.00 13.77  ? 879  TYR C CA    1 
ATOM   9835  C C     . TYR C 1 571 ? -16.335 -40.274 21.860  1.00 18.54  ? 879  TYR C C     1 
ATOM   9836  O O     . TYR C 1 571 ? -16.595 -40.969 22.844  1.00 21.71  ? 879  TYR C O     1 
ATOM   9837  C CB    . TYR C 1 571 ? -13.932 -39.574 21.490  1.00 21.28  ? 879  TYR C CB    1 
ATOM   9838  C CG    . TYR C 1 571 ? -12.582 -39.962 20.922  1.00 24.54  ? 879  TYR C CG    1 
ATOM   9839  C CD1   . TYR C 1 571 ? -12.104 -41.265 21.043  1.00 32.56  ? 879  TYR C CD1   1 
ATOM   9840  C CD2   . TYR C 1 571 ? -11.794 -39.036 20.247  1.00 24.47  ? 879  TYR C CD2   1 
ATOM   9841  C CE1   . TYR C 1 571 ? -10.871 -41.631 20.513  1.00 30.34  ? 879  TYR C CE1   1 
ATOM   9842  C CE2   . TYR C 1 571 ? -10.560 -39.393 19.717  1.00 14.72  ? 879  TYR C CE2   1 
ATOM   9843  C CZ    . TYR C 1 571 ? -10.108 -40.688 19.848  1.00 25.58  ? 879  TYR C CZ    1 
ATOM   9844  O OH    . TYR C 1 571 ? -8.885  -41.031 19.319  1.00 25.63  ? 879  TYR C OH    1 
ATOM   9845  N N     . ALA C 1 572 ? -17.130 -39.295 21.437  1.00 19.22  ? 880  ALA C N     1 
ATOM   9846  C CA    . ALA C 1 572 ? -18.413 -39.017 22.081  1.00 19.78  ? 880  ALA C CA    1 
ATOM   9847  C C     . ALA C 1 572 ? -19.355 -40.214 21.959  1.00 22.79  ? 880  ALA C C     1 
ATOM   9848  O O     . ALA C 1 572 ? -20.019 -40.600 22.930  1.00 18.37  ? 880  ALA C O     1 
ATOM   9849  C CB    . ALA C 1 572 ? -19.060 -37.761 21.476  1.00 16.33  ? 880  ALA C CB    1 
ATOM   9850  N N     . GLN C 1 573 ? -19.423 -40.788 20.760  1.00 21.36  ? 881  GLN C N     1 
ATOM   9851  C CA    . GLN C 1 573 ? -20.252 -41.968 20.523  1.00 23.41  ? 881  GLN C CA    1 
ATOM   9852  C C     . GLN C 1 573 ? -19.801 -43.136 21.400  1.00 26.59  ? 881  GLN C C     1 
ATOM   9853  O O     . GLN C 1 573 ? -20.626 -43.854 21.967  1.00 28.08  ? 881  GLN C O     1 
ATOM   9854  C CB    . GLN C 1 573 ? -20.215 -42.368 19.047  1.00 27.90  ? 881  GLN C CB    1 
ATOM   9855  C CG    . GLN C 1 573 ? -21.074 -43.572 18.707  1.00 44.23  ? 881  GLN C CG    1 
ATOM   9856  C CD    . GLN C 1 573 ? -20.919 -44.011 17.259  1.00 66.41  ? 881  GLN C CD    1 
ATOM   9857  O OE1   . GLN C 1 573 ? -19.921 -44.632 16.887  1.00 65.02  ? 881  GLN C OE1   1 
ATOM   9858  N NE2   . GLN C 1 573 ? -21.910 -43.687 16.433  1.00 70.78  ? 881  GLN C NE2   1 
ATOM   9859  N N     . ASN C 1 574 ? -18.492 -43.321 21.510  1.00 20.73  ? 882  ASN C N     1 
ATOM   9860  C CA    . ASN C 1 574 ? -17.939 -44.348 22.386  1.00 25.60  ? 882  ASN C CA    1 
ATOM   9861  C C     . ASN C 1 574 ? -18.303 -44.105 23.847  1.00 35.74  ? 882  ASN C C     1 
ATOM   9862  O O     . ASN C 1 574 ? -18.358 -45.043 24.639  1.00 30.85  ? 882  ASN C O     1 
ATOM   9863  C CB    . ASN C 1 574 ? -16.415 -44.420 22.255  1.00 23.64  ? 882  ASN C CB    1 
ATOM   9864  C CG    . ASN C 1 574 ? -15.957 -44.935 20.899  1.00 33.19  ? 882  ASN C CG    1 
ATOM   9865  O OD1   . ASN C 1 574 ? -16.766 -45.291 20.039  1.00 34.86  ? 882  ASN C OD1   1 
ATOM   9866  N ND2   . ASN C 1 574 ? -14.644 -44.965 20.700  1.00 27.48  ? 882  ASN C ND2   1 
ATOM   9867  N N     . MET C 1 575 ? -18.536 -42.843 24.204  1.00 29.72  ? 883  MET C N     1 
ATOM   9868  C CA    . MET C 1 575 ? -18.929 -42.496 25.572  1.00 25.12  ? 883  MET C CA    1 
ATOM   9869  C C     . MET C 1 575 ? -20.432 -42.630 25.772  1.00 33.04  ? 883  MET C C     1 
ATOM   9870  O O     . MET C 1 575 ? -20.954 -42.346 26.850  1.00 33.79  ? 883  MET C O     1 
ATOM   9871  C CB    . MET C 1 575 ? -18.470 -41.076 25.923  1.00 33.10  ? 883  MET C CB    1 
ATOM   9872  C CG    . MET C 1 575 ? -16.965 -40.932 26.117  1.00 28.00  ? 883  MET C CG    1 
ATOM   9873  S SD    . MET C 1 575 ? -16.422 -39.210 26.294  1.00 31.42  ? 883  MET C SD    1 
ATOM   9874  C CE    . MET C 1 575 ? -14.642 -39.401 26.234  1.00 24.21  ? 883  MET C CE    1 
ATOM   9875  N N     . GLY C 1 576 ? -21.130 -43.064 24.729  1.00 32.25  ? 884  GLY C N     1 
ATOM   9876  C CA    . GLY C 1 576 ? -22.563 -43.277 24.815  1.00 36.76  ? 884  GLY C CA    1 
ATOM   9877  C C     . GLY C 1 576 ? -23.395 -42.041 24.515  1.00 43.14  ? 884  GLY C C     1 
ATOM   9878  O O     . GLY C 1 576 ? -24.569 -41.972 24.889  1.00 36.73  ? 884  GLY C O     1 
ATOM   9879  N N     . LEU C 1 577 ? -22.793 -41.062 23.844  1.00 24.03  ? 885  LEU C N     1 
ATOM   9880  C CA    . LEU C 1 577 ? -23.536 -39.886 23.397  1.00 30.38  ? 885  LEU C CA    1 
ATOM   9881  C C     . LEU C 1 577 ? -23.919 -40.019 21.932  1.00 28.17  ? 885  LEU C C     1 
ATOM   9882  O O     . LEU C 1 577 ? -23.052 -40.161 21.074  1.00 28.38  ? 885  LEU C O     1 
ATOM   9883  C CB    . LEU C 1 577 ? -22.717 -38.603 23.562  1.00 26.00  ? 885  LEU C CB    1 
ATOM   9884  C CG    . LEU C 1 577 ? -22.254 -38.096 24.926  1.00 30.58  ? 885  LEU C CG    1 
ATOM   9885  C CD1   . LEU C 1 577 ? -21.279 -36.929 24.730  1.00 30.33  ? 885  LEU C CD1   1 
ATOM   9886  C CD2   . LEU C 1 577 ? -23.434 -37.674 25.787  1.00 24.56  ? 885  LEU C CD2   1 
ATOM   9887  N N     . PRO C 1 578 ? -25.222 -39.960 21.640  1.00 26.48  ? 886  PRO C N     1 
ATOM   9888  C CA    . PRO C 1 578 ? -25.711 -39.933 20.259  1.00 31.34  ? 886  PRO C CA    1 
ATOM   9889  C C     . PRO C 1 578 ? -25.215 -38.703 19.504  1.00 40.36  ? 886  PRO C C     1 
ATOM   9890  O O     . PRO C 1 578 ? -24.983 -37.651 20.101  1.00 28.96  ? 886  PRO C O     1 
ATOM   9891  C CB    . PRO C 1 578 ? -27.228 -39.861 20.431  1.00 29.25  ? 886  PRO C CB    1 
ATOM   9892  C CG    . PRO C 1 578 ? -27.483 -40.467 21.750  1.00 33.67  ? 886  PRO C CG    1 
ATOM   9893  C CD    . PRO C 1 578 ? -26.322 -40.074 22.612  1.00 23.75  ? 886  PRO C CD    1 
ATOM   9894  N N     . GLN C 1 579 ? -25.066 -38.853 18.192  1.00 39.74  ? 887  GLN C N     1 
ATOM   9895  C CA    . GLN C 1 579 ? -24.577 -37.794 17.318  1.00 42.28  ? 887  GLN C CA    1 
ATOM   9896  C C     . GLN C 1 579 ? -25.236 -36.444 17.601  1.00 31.62  ? 887  GLN C C     1 
ATOM   9897  O O     . GLN C 1 579 ? -24.588 -35.393 17.512  1.00 26.33  ? 887  GLN C O     1 
ATOM   9898  C CB    . GLN C 1 579 ? -24.801 -38.194 15.853  1.00 37.94  ? 887  GLN C CB    1 
ATOM   9899  C CG    . GLN C 1 579 ? -24.068 -37.340 14.841  1.00 50.22  ? 887  GLN C CG    1 
ATOM   9900  C CD    . GLN C 1 579 ? -24.064 -37.969 13.456  1.00 63.84  ? 887  GLN C CD    1 
ATOM   9901  O OE1   . GLN C 1 579 ? -24.666 -39.024 13.235  1.00 52.70  ? 887  GLN C OE1   1 
ATOM   9902  N NE2   . GLN C 1 579 ? -23.380 -37.324 12.517  1.00 72.23  ? 887  GLN C NE2   1 
ATOM   9903  N N     . ASN C 1 580 ? -26.515 -36.477 17.958  1.00 25.17  ? 888  ASN C N     1 
ATOM   9904  C CA    . ASN C 1 580 ? -27.288 -35.242 18.117  1.00 31.04  ? 888  ASN C CA    1 
ATOM   9905  C C     . ASN C 1 580 ? -27.113 -34.526 19.461  1.00 22.84  ? 888  ASN C C     1 
ATOM   9906  O O     . ASN C 1 580 ? -27.839 -33.580 19.759  1.00 23.93  ? 888  ASN C O     1 
ATOM   9907  C CB    . ASN C 1 580 ? -28.775 -35.496 17.843  1.00 33.88  ? 888  ASN C CB    1 
ATOM   9908  C CG    . ASN C 1 580 ? -29.449 -36.300 18.946  1.00 52.76  ? 888  ASN C CG    1 
ATOM   9909  O OD1   . ASN C 1 580 ? -28.814 -36.696 19.923  1.00 52.77  ? 888  ASN C OD1   1 
ATOM   9910  N ND2   . ASN C 1 580 ? -30.748 -36.533 18.795  1.00 61.33  ? 888  ASN C ND2   1 
ATOM   9911  N N     . ARG C 1 581 ? -26.166 -34.979 20.276  1.00 21.32  ? 889  ARG C N     1 
ATOM   9912  C CA    . ARG C 1 581 ? -25.875 -34.290 21.528  1.00 22.74  ? 889  ARG C CA    1 
ATOM   9913  C C     . ARG C 1 581 ? -24.811 -33.232 21.269  1.00 20.41  ? 889  ARG C C     1 
ATOM   9914  O O     . ARG C 1 581 ? -24.588 -32.344 22.088  1.00 11.52  ? 889  ARG C O     1 
ATOM   9915  C CB    . ARG C 1 581 ? -25.370 -35.259 22.603  1.00 31.36  ? 889  ARG C CB    1 
ATOM   9916  C CG    . ARG C 1 581 ? -26.299 -36.408 22.968  1.00 28.33  ? 889  ARG C CG    1 
ATOM   9917  C CD    . ARG C 1 581 ? -27.681 -35.946 23.382  1.00 18.67  ? 889  ARG C CD    1 
ATOM   9918  N NE    . ARG C 1 581 ? -27.679 -35.016 24.509  1.00 21.78  ? 889  ARG C NE    1 
ATOM   9919  C CZ    . ARG C 1 581 ? -27.713 -35.362 25.793  1.00 25.45  ? 889  ARG C CZ    1 
ATOM   9920  N NH1   . ARG C 1 581 ? -27.741 -36.640 26.157  1.00 20.90  ? 889  ARG C NH1   1 
ATOM   9921  N NH2   . ARG C 1 581 ? -27.723 -34.415 26.723  1.00 18.34  ? 889  ARG C NH2   1 
ATOM   9922  N N     . ILE C 1 582 ? -24.126 -33.343 20.134  1.00 10.73  ? 890  ILE C N     1 
ATOM   9923  C CA    . ILE C 1 582 ? -23.066 -32.391 19.838  1.00 12.52  ? 890  ILE C CA    1 
ATOM   9924  C C     . ILE C 1 582 ? -23.356 -31.692 18.523  1.00 23.30  ? 890  ILE C C     1 
ATOM   9925  O O     . ILE C 1 582 ? -23.591 -32.348 17.511  1.00 16.77  ? 890  ILE C O     1 
ATOM   9926  C CB    . ILE C 1 582 ? -21.684 -33.091 19.792  1.00 16.67  ? 890  ILE C CB    1 
ATOM   9927  C CG1   . ILE C 1 582 ? -21.441 -33.855 21.086  1.00 15.98  ? 890  ILE C CG1   1 
ATOM   9928  C CG2   . ILE C 1 582 ? -20.575 -32.067 19.598  1.00 23.83  ? 890  ILE C CG2   1 
ATOM   9929  C CD1   . ILE C 1 582 ? -20.029 -34.426 21.202  1.00 22.25  ? 890  ILE C CD1   1 
ATOM   9930  N N     . ILE C 1 583 ? -23.366 -30.359 18.550  1.00 11.54  ? 891  ILE C N     1 
ATOM   9931  C CA    . ILE C 1 583 ? -23.606 -29.576 17.354  1.00 7.97   ? 891  ILE C CA    1 
ATOM   9932  C C     . ILE C 1 583 ? -22.366 -28.778 16.947  1.00 9.55   ? 891  ILE C C     1 
ATOM   9933  O O     . ILE C 1 583 ? -21.805 -28.042 17.755  1.00 10.84  ? 891  ILE C O     1 
ATOM   9934  C CB    . ILE C 1 583 ? -24.745 -28.577 17.583  1.00 4.11   ? 891  ILE C CB    1 
ATOM   9935  C CG1   . ILE C 1 583 ? -26.044 -29.346 17.870  1.00 17.54  ? 891  ILE C CG1   1 
ATOM   9936  C CG2   . ILE C 1 583 ? -24.841 -27.654 16.364  1.00 9.23   ? 891  ILE C CG2   1 
ATOM   9937  C CD1   . ILE C 1 583 ? -27.221 -28.479 18.174  1.00 24.45  ? 891  ILE C CD1   1 
ATOM   9938  N N     . PHE C 1 584 ? -21.944 -28.923 15.698  1.00 7.38   ? 892  PHE C N     1 
ATOM   9939  C CA    . PHE C 1 584 ? -20.759 -28.215 15.213  1.00 14.44  ? 892  PHE C CA    1 
ATOM   9940  C C     . PHE C 1 584 ? -21.139 -27.041 14.328  1.00 21.14  ? 892  PHE C C     1 
ATOM   9941  O O     . PHE C 1 584 ? -22.047 -27.154 13.498  1.00 13.41  ? 892  PHE C O     1 
ATOM   9942  C CB    . PHE C 1 584 ? -19.843 -29.163 14.445  1.00 14.16  ? 892  PHE C CB    1 
ATOM   9943  C CG    . PHE C 1 584 ? -18.916 -29.946 15.327  1.00 15.79  ? 892  PHE C CG    1 
ATOM   9944  C CD1   . PHE C 1 584 ? -17.647 -29.466 15.612  1.00 12.29  ? 892  PHE C CD1   1 
ATOM   9945  C CD2   . PHE C 1 584 ? -19.309 -31.166 15.865  1.00 15.46  ? 892  PHE C CD2   1 
ATOM   9946  C CE1   . PHE C 1 584 ? -16.778 -30.189 16.437  1.00 13.70  ? 892  PHE C CE1   1 
ATOM   9947  C CE2   . PHE C 1 584 ? -18.457 -31.883 16.701  1.00 15.84  ? 892  PHE C CE2   1 
ATOM   9948  C CZ    . PHE C 1 584 ? -17.190 -31.398 16.979  1.00 15.49  ? 892  PHE C CZ    1 
ATOM   9949  N N     . SER C 1 585 ? -20.462 -25.910 14.522  1.00 10.26  ? 893  SER C N     1 
ATOM   9950  C CA    . SER C 1 585 ? -20.604 -24.780 13.606  1.00 4.21   ? 893  SER C CA    1 
ATOM   9951  C C     . SER C 1 585 ? -19.236 -24.469 12.980  1.00 9.49   ? 893  SER C C     1 
ATOM   9952  O O     . SER C 1 585 ? -18.179 -24.756 13.589  1.00 6.63   ? 893  SER C O     1 
ATOM   9953  C CB    . SER C 1 585 ? -21.131 -23.537 14.336  1.00 4.24   ? 893  SER C CB    1 
ATOM   9954  O OG    . SER C 1 585 ? -22.406 -23.769 14.922  1.00 13.46  ? 893  SER C OG    1 
ATOM   9955  N N     . PRO C 1 586 ? -19.254 -23.876 11.779  1.00 9.39   ? 894  PRO C N     1 
ATOM   9956  C CA    . PRO C 1 586 ? -18.025 -23.334 11.184  1.00 6.60   ? 894  PRO C CA    1 
ATOM   9957  C C     . PRO C 1 586 ? -17.499 -22.179 12.026  1.00 11.11  ? 894  PRO C C     1 
ATOM   9958  O O     . PRO C 1 586 ? -18.286 -21.512 12.699  1.00 9.14   ? 894  PRO C O     1 
ATOM   9959  C CB    . PRO C 1 586 ? -18.480 -22.778 9.835   1.00 13.00  ? 894  PRO C CB    1 
ATOM   9960  C CG    . PRO C 1 586 ? -19.919 -23.180 9.658   1.00 17.45  ? 894  PRO C CG    1 
ATOM   9961  C CD    . PRO C 1 586 ? -20.466 -23.515 11.007  1.00 7.57   ? 894  PRO C CD    1 
ATOM   9962  N N     . VAL C 1 587 ? -16.183 -21.985 12.020  1.00 5.30   ? 895  VAL C N     1 
ATOM   9963  C CA    . VAL C 1 587 ? -15.565 -20.787 12.575  1.00 3.10   ? 895  VAL C CA    1 
ATOM   9964  C C     . VAL C 1 587 ? -16.167 -19.598 11.845  1.00 9.61   ? 895  VAL C C     1 
ATOM   9965  O O     . VAL C 1 587 ? -16.408 -19.658 10.642  1.00 12.91  ? 895  VAL C O     1 
ATOM   9966  C CB    . VAL C 1 587 ? -14.047 -20.800 12.361  1.00 5.73   ? 895  VAL C CB    1 
ATOM   9967  C CG1   . VAL C 1 587 ? -13.424 -19.448 12.752  1.00 7.67   ? 895  VAL C CG1   1 
ATOM   9968  C CG2   . VAL C 1 587 ? -13.411 -21.948 13.162  1.00 9.34   ? 895  VAL C CG2   1 
ATOM   9969  N N     . ALA C 1 588 ? -16.427 -18.515 12.575  1.00 9.47   ? 896  ALA C N     1 
ATOM   9970  C CA    . ALA C 1 588 ? -17.114 -17.373 11.991  1.00 5.83   ? 896  ALA C CA    1 
ATOM   9971  C C     . ALA C 1 588 ? -16.259 -16.112 12.057  1.00 8.10   ? 896  ALA C C     1 
ATOM   9972  O O     . ALA C 1 588 ? -15.303 -16.041 12.820  1.00 9.43   ? 896  ALA C O     1 
ATOM   9973  C CB    . ALA C 1 588 ? -18.448 -17.145 12.725  1.00 8.05   ? 896  ALA C CB    1 
ATOM   9974  N N     . PRO C 1 589 ? -16.606 -15.103 11.251  1.00 9.13   ? 897  PRO C N     1 
ATOM   9975  C CA    . PRO C 1 589 ? -15.956 -13.789 11.391  1.00 8.07   ? 897  PRO C CA    1 
ATOM   9976  C C     . PRO C 1 589 ? -16.047 -13.307 12.842  1.00 10.83  ? 897  PRO C C     1 
ATOM   9977  O O     . PRO C 1 589 ? -16.962 -13.706 13.568  1.00 10.11  ? 897  PRO C O     1 
ATOM   9978  C CB    . PRO C 1 589 ? -16.803 -12.866 10.506  1.00 14.58  ? 897  PRO C CB    1 
ATOM   9979  C CG    . PRO C 1 589 ? -17.539 -13.770 9.565   1.00 14.77  ? 897  PRO C CG    1 
ATOM   9980  C CD    . PRO C 1 589 ? -17.682 -15.109 10.245  1.00 6.77   ? 897  PRO C CD    1 
ATOM   9981  N N     . LYS C 1 590 ? -15.107 -12.457 13.241  1.00 9.49   ? 898  LYS C N     1 
ATOM   9982  C CA    . LYS C 1 590 ? -14.913 -12.078 14.634  1.00 7.35   ? 898  LYS C CA    1 
ATOM   9983  C C     . LYS C 1 590 ? -16.200 -11.593 15.305  1.00 11.80  ? 898  LYS C C     1 
ATOM   9984  O O     . LYS C 1 590 ? -16.553 -12.063 16.383  1.00 7.98   ? 898  LYS C O     1 
ATOM   9985  C CB    . LYS C 1 590 ? -13.845 -10.981 14.719  1.00 11.28  ? 898  LYS C CB    1 
ATOM   9986  C CG    . LYS C 1 590 ? -13.517 -10.505 16.141  1.00 13.24  ? 898  LYS C CG    1 
ATOM   9987  C CD    . LYS C 1 590 ? -12.497 -11.432 16.833  1.00 15.03  ? 898  LYS C CD    1 
ATOM   9988  C CE    . LYS C 1 590 ? -12.152 -10.931 18.251  1.00 14.16  ? 898  LYS C CE    1 
ATOM   9989  N NZ    . LYS C 1 590 ? -11.035 -11.710 18.892  1.00 7.45   ? 898  LYS C NZ    1 
ATOM   9990  N N     . GLU C 1 591 ? -16.893 -10.652 14.677  1.00 9.66   ? 899  GLU C N     1 
ATOM   9991  C CA    . GLU C 1 591 ? -18.121 -10.086 15.272  1.00 8.34   ? 899  GLU C CA    1 
ATOM   9992  C C     . GLU C 1 591 ? -19.238 -11.115 15.482  1.00 10.36  ? 899  GLU C C     1 
ATOM   9993  O O     . GLU C 1 591 ? -19.873 -11.136 16.528  1.00 4.68   ? 899  GLU C O     1 
ATOM   9994  C CB    . GLU C 1 591 ? -18.627 -8.891  14.449  1.00 14.18  ? 899  GLU C CB    1 
ATOM   9995  C CG    . GLU C 1 591 ? -19.803 -8.118  15.075  1.00 10.59  ? 899  GLU C CG    1 
ATOM   9996  C CD    . GLU C 1 591 ? -21.172 -8.723  14.742  1.00 11.84  ? 899  GLU C CD    1 
ATOM   9997  O OE1   . GLU C 1 591 ? -21.254 -9.473  13.758  1.00 9.99   ? 899  GLU C OE1   1 
ATOM   9998  O OE2   . GLU C 1 591 ? -22.165 -8.454  15.466  1.00 10.43  ? 899  GLU C OE2   1 
ATOM   9999  N N     . GLU C 1 592 ? -19.480 -11.943 14.470  1.00 7.64   ? 900  GLU C N     1 
ATOM   10000 C CA    . GLU C 1 592 ? -20.474 -13.013 14.537  1.00 12.71  ? 900  GLU C CA    1 
ATOM   10001 C C     . GLU C 1 592 ? -20.152 -14.038 15.623  1.00 14.35  ? 900  GLU C C     1 
ATOM   10002 O O     . GLU C 1 592 ? -21.062 -14.536 16.297  1.00 2.91   ? 900  GLU C O     1 
ATOM   10003 C CB    . GLU C 1 592 ? -20.611 -13.737 13.184  1.00 8.38   ? 900  GLU C CB    1 
ATOM   10004 C CG    . GLU C 1 592 ? -21.569 -14.966 13.244  1.00 5.30   ? 900  GLU C CG    1 
ATOM   10005 C CD    . GLU C 1 592 ? -21.525 -15.833 11.996  1.00 14.91  ? 900  GLU C CD    1 
ATOM   10006 O OE1   . GLU C 1 592 ? -20.986 -15.378 10.953  1.00 10.10  ? 900  GLU C OE1   1 
ATOM   10007 O OE2   . GLU C 1 592 ? -22.037 -16.979 12.061  1.00 12.73  ? 900  GLU C OE2   1 
ATOM   10008 N N     . HIS C 1 593 ? -18.866 -14.367 15.759  1.00 6.58   ? 901  HIS C N     1 
ATOM   10009 C CA    . HIS C 1 593 ? -18.381 -15.298 16.794  1.00 9.98   ? 901  HIS C CA    1 
ATOM   10010 C C     . HIS C 1 593 ? -18.738 -14.776 18.194  1.00 11.29  ? 901  HIS C C     1 
ATOM   10011 O O     . HIS C 1 593 ? -19.251 -15.510 19.048  1.00 5.42   ? 901  HIS C O     1 
ATOM   10012 C CB    . HIS C 1 593 ? -16.852 -15.477 16.648  1.00 8.09   ? 901  HIS C CB    1 
ATOM   10013 C CG    . HIS C 1 593 ? -16.140 -15.838 17.922  1.00 6.82   ? 901  HIS C CG    1 
ATOM   10014 N ND1   . HIS C 1 593 ? -16.347 -17.027 18.589  1.00 9.17   ? 901  HIS C ND1   1 
ATOM   10015 C CD2   . HIS C 1 593 ? -15.209 -15.161 18.640  1.00 8.49   ? 901  HIS C CD2   1 
ATOM   10016 C CE1   . HIS C 1 593 ? -15.573 -17.068 19.660  1.00 8.85   ? 901  HIS C CE1   1 
ATOM   10017 N NE2   . HIS C 1 593 ? -14.880 -15.943 19.720  1.00 6.75   ? 901  HIS C NE2   1 
ATOM   10018 N N     . VAL C 1 594 ? -18.478 -13.497 18.428  1.00 9.50   ? 902  VAL C N     1 
ATOM   10019 C CA    . VAL C 1 594 ? -18.747 -12.930 19.751  1.00 12.59  ? 902  VAL C CA    1 
ATOM   10020 C C     . VAL C 1 594 ? -20.251 -12.818 19.950  1.00 8.53   ? 902  VAL C C     1 
ATOM   10021 O O     . VAL C 1 594 ? -20.779 -13.150 21.009  1.00 10.26  ? 902  VAL C O     1 
ATOM   10022 C CB    . VAL C 1 594 ? -18.054 -11.560 19.955  1.00 7.64   ? 902  VAL C CB    1 
ATOM   10023 C CG1   . VAL C 1 594 ? -18.482 -10.917 21.295  1.00 9.25   ? 902  VAL C CG1   1 
ATOM   10024 C CG2   . VAL C 1 594 ? -16.523 -11.726 19.918  1.00 5.57   ? 902  VAL C CG2   1 
ATOM   10025 N N     . ARG C 1 595 ? -20.944 -12.367 18.911  1.00 7.24   ? 903  ARG C N     1 
ATOM   10026 C CA    . ARG C 1 595 ? -22.399 -12.161 18.990  1.00 11.04  ? 903  ARG C CA    1 
ATOM   10027 C C     . ARG C 1 595 ? -23.194 -13.451 19.213  1.00 9.95   ? 903  ARG C C     1 
ATOM   10028 O O     . ARG C 1 595 ? -24.150 -13.478 20.000  1.00 5.98   ? 903  ARG C O     1 
ATOM   10029 C CB    . ARG C 1 595 ? -22.892 -11.461 17.724  1.00 7.37   ? 903  ARG C CB    1 
ATOM   10030 C CG    . ARG C 1 595 ? -24.386 -11.272 17.635  1.00 6.39   ? 903  ARG C CG    1 
ATOM   10031 C CD    . ARG C 1 595 ? -24.749 -10.271 16.540  1.00 8.25   ? 903  ARG C CD    1 
ATOM   10032 N NE    . ARG C 1 595 ? -23.952 -10.448 15.325  1.00 7.41   ? 903  ARG C NE    1 
ATOM   10033 C CZ    . ARG C 1 595 ? -24.107 -11.460 14.471  1.00 9.13   ? 903  ARG C CZ    1 
ATOM   10034 N NH1   . ARG C 1 595 ? -25.011 -12.397 14.716  1.00 8.93   ? 903  ARG C NH1   1 
ATOM   10035 N NH2   . ARG C 1 595 ? -23.334 -11.561 13.393  1.00 7.67   ? 903  ARG C NH2   1 
ATOM   10036 N N     . ARG C 1 596 ? -22.799 -14.530 18.552  1.00 9.49   ? 904  ARG C N     1 
ATOM   10037 C CA    . ARG C 1 596 ? -23.550 -15.773 18.685  1.00 11.67  ? 904  ARG C CA    1 
ATOM   10038 C C     . ARG C 1 596 ? -23.330 -16.483 20.040  1.00 9.44   ? 904  ARG C C     1 
ATOM   10039 O O     . ARG C 1 596 ? -24.062 -17.397 20.370  1.00 6.82   ? 904  ARG C O     1 
ATOM   10040 C CB    . ARG C 1 596 ? -23.291 -16.719 17.499  1.00 5.51   ? 904  ARG C CB    1 
ATOM   10041 C CG    . ARG C 1 596 ? -21.956 -17.440 17.552  1.00 3.87   ? 904  ARG C CG    1 
ATOM   10042 C CD    . ARG C 1 596 ? -21.691 -18.186 16.226  1.00 6.46   ? 904  ARG C CD    1 
ATOM   10043 N NE    . ARG C 1 596 ? -20.332 -18.719 16.160  1.00 11.24  ? 904  ARG C NE    1 
ATOM   10044 C CZ    . ARG C 1 596 ? -19.836 -19.388 15.121  1.00 10.95  ? 904  ARG C CZ    1 
ATOM   10045 N NH1   . ARG C 1 596 ? -20.599 -19.655 14.061  1.00 10.00  ? 904  ARG C NH1   1 
ATOM   10046 N NH2   . ARG C 1 596 ? -18.588 -19.818 15.157  1.00 5.50   ? 904  ARG C NH2   1 
ATOM   10047 N N     . GLY C 1 597 ? -22.349 -16.051 20.822  1.00 7.32   ? 905  GLY C N     1 
ATOM   10048 C CA    . GLY C 1 597 ? -22.227 -16.524 22.204  1.00 8.52   ? 905  GLY C CA    1 
ATOM   10049 C C     . GLY C 1 597 ? -23.487 -16.252 23.021  1.00 7.06   ? 905  GLY C C     1 
ATOM   10050 O O     . GLY C 1 597 ? -23.799 -16.956 23.982  1.00 4.03   ? 905  GLY C O     1 
ATOM   10051 N N     . GLN C 1 598 ? -24.215 -15.203 22.658  1.00 8.20   ? 906  GLN C N     1 
ATOM   10052 C CA    . GLN C 1 598 ? -25.506 -14.927 23.290  1.00 8.08   ? 906  GLN C CA    1 
ATOM   10053 C C     . GLN C 1 598 ? -26.518 -16.081 23.173  1.00 12.46  ? 906  GLN C C     1 
ATOM   10054 O O     . GLN C 1 598 ? -27.504 -16.110 23.907  1.00 12.73  ? 906  GLN C O     1 
ATOM   10055 C CB    . GLN C 1 598 ? -26.142 -13.701 22.664  1.00 6.95   ? 906  GLN C CB    1 
ATOM   10056 C CG    . GLN C 1 598 ? -25.371 -12.417 22.911  1.00 7.29   ? 906  GLN C CG    1 
ATOM   10057 C CD    . GLN C 1 598 ? -26.027 -11.262 22.231  1.00 6.76   ? 906  GLN C CD    1 
ATOM   10058 O OE1   . GLN C 1 598 ? -26.550 -10.370 22.884  1.00 8.95   ? 906  GLN C OE1   1 
ATOM   10059 N NE2   . GLN C 1 598 ? -25.997 -11.260 20.884  1.00 6.74   ? 906  GLN C NE2   1 
ATOM   10060 N N     . LEU C 1 599 ? -26.299 -17.011 22.249  1.00 9.24   ? 907  LEU C N     1 
ATOM   10061 C CA    . LEU C 1 599 ? -27.276 -18.088 22.033  1.00 3.37   ? 907  LEU C CA    1 
ATOM   10062 C C     . LEU C 1 599 ? -27.107 -19.227 23.026  1.00 5.04   ? 907  LEU C C     1 
ATOM   10063 O O     . LEU C 1 599 ? -28.004 -20.064 23.190  1.00 8.59   ? 907  LEU C O     1 
ATOM   10064 C CB    . LEU C 1 599 ? -27.188 -18.652 20.603  1.00 6.61   ? 907  LEU C CB    1 
ATOM   10065 C CG    . LEU C 1 599 ? -27.533 -17.623 19.535  1.00 13.06  ? 907  LEU C CG    1 
ATOM   10066 C CD1   . LEU C 1 599 ? -27.497 -18.306 18.183  1.00 11.18  ? 907  LEU C CD1   1 
ATOM   10067 C CD2   . LEU C 1 599 ? -28.918 -17.041 19.781  1.00 11.54  ? 907  LEU C CD2   1 
ATOM   10068 N N     . ALA C 1 600 ? -25.936 -19.293 23.649  1.00 10.00  ? 908  ALA C N     1 
ATOM   10069 C CA    . ALA C 1 600 ? -25.636 -20.397 24.557  1.00 11.28  ? 908  ALA C CA    1 
ATOM   10070 C C     . ALA C 1 600 ? -26.232 -20.116 25.922  1.00 7.98   ? 908  ALA C C     1 
ATOM   10071 O O     . ALA C 1 600 ? -26.518 -18.945 26.258  1.00 11.60  ? 908  ALA C O     1 
ATOM   10072 C CB    . ALA C 1 600 ? -24.122 -20.579 24.689  1.00 7.99   ? 908  ALA C CB    1 
ATOM   10073 N N     . ASP C 1 601 ? -26.379 -21.172 26.723  1.00 4.08   ? 909  ASP C N     1 
ATOM   10074 C CA    . ASP C 1 601 ? -26.787 -21.014 28.116  1.00 9.82   ? 909  ASP C CA    1 
ATOM   10075 C C     . ASP C 1 601 ? -25.573 -20.885 29.020  1.00 14.29  ? 909  ASP C C     1 
ATOM   10076 O O     . ASP C 1 601 ? -25.540 -20.035 29.910  1.00 7.99   ? 909  ASP C O     1 
ATOM   10077 C CB    . ASP C 1 601 ? -27.671 -22.188 28.571  1.00 9.79   ? 909  ASP C CB    1 
ATOM   10078 C CG    . ASP C 1 601 ? -29.042 -22.151 27.917  1.00 16.24  ? 909  ASP C CG    1 
ATOM   10079 O OD1   . ASP C 1 601 ? -29.310 -22.967 27.002  1.00 15.48  ? 909  ASP C OD1   1 
ATOM   10080 O OD2   . ASP C 1 601 ? -29.827 -21.249 28.283  1.00 12.43  ? 909  ASP C OD2   1 
ATOM   10081 N N     . VAL C 1 602 ? -24.576 -21.729 28.766  1.00 11.22  ? 910  VAL C N     1 
ATOM   10082 C CA    . VAL C 1 602 ? -23.386 -21.855 29.607  1.00 10.72  ? 910  VAL C CA    1 
ATOM   10083 C C     . VAL C 1 602 ? -22.181 -22.246 28.735  1.00 14.39  ? 910  VAL C C     1 
ATOM   10084 O O     . VAL C 1 602 ? -22.332 -23.041 27.815  1.00 13.58  ? 910  VAL C O     1 
ATOM   10085 C CB    . VAL C 1 602 ? -23.581 -22.989 30.639  1.00 15.37  ? 910  VAL C CB    1 
ATOM   10086 C CG1   . VAL C 1 602 ? -22.360 -23.136 31.521  1.00 8.36   ? 910  VAL C CG1   1 
ATOM   10087 C CG2   . VAL C 1 602 ? -24.853 -22.768 31.488  1.00 11.03  ? 910  VAL C CG2   1 
ATOM   10088 N N     . CYS C 1 603 ? -21.001 -21.689 29.020  1.00 9.57   ? 911  CYS C N     1 
ATOM   10089 C CA    . CYS C 1 603 ? -19.754 -22.105 28.355  1.00 10.87  ? 911  CYS C CA    1 
ATOM   10090 C C     . CYS C 1 603 ? -19.004 -23.084 29.245  1.00 13.71  ? 911  CYS C C     1 
ATOM   10091 O O     . CYS C 1 603 ? -18.789 -22.804 30.419  1.00 10.63  ? 911  CYS C O     1 
ATOM   10092 C CB    . CYS C 1 603 ? -18.835 -20.898 28.082  1.00 14.05  ? 911  CYS C CB    1 
ATOM   10093 S SG    . CYS C 1 603 ? -17.192 -21.368 27.401  1.00 17.23  ? 911  CYS C SG    1 
ATOM   10094 N N     . LEU C 1 604 ? -18.615 -24.233 28.702  1.00 9.31   ? 912  LEU C N     1 
ATOM   10095 C CA    . LEU C 1 604 ? -17.778 -25.158 29.450  1.00 6.26   ? 912  LEU C CA    1 
ATOM   10096 C C     . LEU C 1 604 ? -16.292 -24.980 29.069  1.00 16.04  ? 912  LEU C C     1 
ATOM   10097 O O     . LEU C 1 604 ? -15.839 -25.431 28.011  1.00 9.59   ? 912  LEU C O     1 
ATOM   10098 C CB    . LEU C 1 604 ? -18.218 -26.609 29.205  1.00 8.50   ? 912  LEU C CB    1 
ATOM   10099 C CG    . LEU C 1 604 ? -19.649 -26.989 29.600  1.00 13.81  ? 912  LEU C CG    1 
ATOM   10100 C CD1   . LEU C 1 604 ? -19.908 -28.459 29.265  1.00 11.96  ? 912  LEU C CD1   1 
ATOM   10101 C CD2   . LEU C 1 604 ? -19.941 -26.691 31.074  1.00 11.39  ? 912  LEU C CD2   1 
ATOM   10102 N N     . ASP C 1 605 ? -15.531 -24.337 29.944  1.00 6.48   ? 913  ASP C N     1 
ATOM   10103 C CA    . ASP C 1 605 ? -14.136 -24.024 29.631  1.00 13.33  ? 913  ASP C CA    1 
ATOM   10104 C C     . ASP C 1 605 ? -13.252 -25.261 29.657  1.00 11.89  ? 913  ASP C C     1 
ATOM   10105 O O     . ASP C 1 605 ? -13.472 -26.179 30.450  1.00 11.62  ? 913  ASP C O     1 
ATOM   10106 C CB    . ASP C 1 605 ? -13.595 -22.943 30.585  1.00 16.63  ? 913  ASP C CB    1 
ATOM   10107 C CG    . ASP C 1 605 ? -12.157 -22.556 30.283  1.00 17.34  ? 913  ASP C CG    1 
ATOM   10108 O OD1   . ASP C 1 605 ? -11.856 -22.198 29.119  1.00 10.82  ? 913  ASP C OD1   1 
ATOM   10109 O OD2   . ASP C 1 605 ? -11.320 -22.613 31.215  1.00 17.66  ? 913  ASP C OD2   1 
ATOM   10110 N N     . THR C 1 606 ? -12.249 -25.273 28.775  1.00 11.30  ? 914  THR C N     1 
ATOM   10111 C CA    . THR C 1 606 ? -11.273 -26.354 28.687  1.00 5.70   ? 914  THR C CA    1 
ATOM   10112 C C     . THR C 1 606 ? -10.206 -26.253 29.785  1.00 10.46  ? 914  THR C C     1 
ATOM   10113 O O     . THR C 1 606 ? -9.500  -25.269 29.856  1.00 12.19  ? 914  THR C O     1 
ATOM   10114 C CB    . THR C 1 606 ? -10.553 -26.318 27.320  1.00 7.36   ? 914  THR C CB    1 
ATOM   10115 O OG1   . THR C 1 606 ? -10.320 -24.950 26.940  1.00 8.56   ? 914  THR C OG1   1 
ATOM   10116 C CG2   . THR C 1 606 ? -11.397 -26.973 26.261  1.00 8.79   ? 914  THR C CG2   1 
ATOM   10117 N N     . PRO C 1 607 ? -10.091 -27.282 30.654  1.00 8.90   ? 915  PRO C N     1 
ATOM   10118 C CA    . PRO C 1 607 ? -9.137  -27.210 31.777  1.00 11.64  ? 915  PRO C CA    1 
ATOM   10119 C C     . PRO C 1 607 ? -7.670  -27.307 31.358  1.00 15.93  ? 915  PRO C C     1 
ATOM   10120 O O     . PRO C 1 607 ? -6.805  -26.702 32.008  1.00 12.45  ? 915  PRO C O     1 
ATOM   10121 C CB    . PRO C 1 607 ? -9.521  -28.426 32.644  1.00 13.49  ? 915  PRO C CB    1 
ATOM   10122 C CG    . PRO C 1 607 ? -10.945 -28.693 32.300  1.00 14.99  ? 915  PRO C CG    1 
ATOM   10123 C CD    . PRO C 1 607 ? -11.022 -28.410 30.813  1.00 8.08   ? 915  PRO C CD    1 
ATOM   10124 N N     . LEU C 1 608 ? -7.388  -28.053 30.295  1.00 10.68  ? 916  LEU C N     1 
ATOM   10125 C CA    . LEU C 1 608 ? -6.003  -28.230 29.853  1.00 13.57  ? 916  LEU C CA    1 
ATOM   10126 C C     . LEU C 1 608 ? -5.364  -26.878 29.528  1.00 12.92  ? 916  LEU C C     1 
ATOM   10127 O O     . LEU C 1 608 ? -4.278  -26.561 29.981  1.00 13.41  ? 916  LEU C O     1 
ATOM   10128 C CB    . LEU C 1 608 ? -5.944  -29.140 28.623  1.00 7.47   ? 916  LEU C CB    1 
ATOM   10129 C CG    . LEU C 1 608 ? -4.545  -29.512 28.130  1.00 12.01  ? 916  LEU C CG    1 
ATOM   10130 C CD1   . LEU C 1 608 ? -3.756  -30.257 29.217  1.00 14.16  ? 916  LEU C CD1   1 
ATOM   10131 C CD2   . LEU C 1 608 ? -4.626  -30.344 26.841  1.00 11.52  ? 916  LEU C CD2   1 
ATOM   10132 N N     . CYS C 1 609 ? -6.053  -26.105 28.707  1.00 11.60  ? 917  CYS C N     1 
ATOM   10133 C CA    . CYS C 1 609 ? -5.624  -24.772 28.319  1.00 10.69  ? 917  CYS C CA    1 
ATOM   10134 C C     . CYS C 1 609 ? -6.935  -24.004 28.147  1.00 5.04   ? 917  CYS C C     1 
ATOM   10135 O O     . CYS C 1 609 ? -7.775  -24.372 27.325  1.00 8.71   ? 917  CYS C O     1 
ATOM   10136 C CB    . CYS C 1 609 ? -4.827  -24.827 27.017  1.00 10.56  ? 917  CYS C CB    1 
ATOM   10137 S SG    . CYS C 1 609 ? -4.294  -23.208 26.408  1.00 18.49  ? 917  CYS C SG    1 
ATOM   10138 N N     . ASN C 1 610 ? -7.147  -22.985 28.973  1.00 9.16   ? 918  ASN C N     1 
ATOM   10139 C CA    . ASN C 1 610 ? -8.426  -22.281 28.984  1.00 9.82   ? 918  ASN C CA    1 
ATOM   10140 C C     . ASN C 1 610 ? -8.642  -21.458 27.722  1.00 9.41   ? 918  ASN C C     1 
ATOM   10141 O O     . ASN C 1 610 ? -7.703  -21.195 26.976  1.00 12.31  ? 918  ASN C O     1 
ATOM   10142 C CB    . ASN C 1 610 ? -8.490  -21.275 30.135  1.00 4.17   ? 918  ASN C CB    1 
ATOM   10143 C CG    . ASN C 1 610 ? -8.254  -21.882 31.514  1.00 8.90   ? 918  ASN C CG    1 
ATOM   10144 O OD1   . ASN C 1 610 ? -7.944  -21.140 32.436  1.00 14.01  ? 918  ASN C OD1   1 
ATOM   10145 N ND2   . ASN C 1 610 ? -8.413  -23.206 31.669  1.00 5.75   ? 918  ASN C ND2   1 
ATOM   10146 N N     . GLY C 1 611 ? -9.876  -21.002 27.526  1.00 11.47  ? 919  GLY C N     1 
ATOM   10147 C CA    . GLY C 1 611 ? -10.138 -19.877 26.640  1.00 12.56  ? 919  GLY C CA    1 
ATOM   10148 C C     . GLY C 1 611 ? -9.439  -18.661 27.219  1.00 11.92  ? 919  GLY C C     1 
ATOM   10149 O O     . GLY C 1 611 ? -9.483  -18.444 28.421  1.00 9.11   ? 919  GLY C O     1 
ATOM   10150 N N     . HIS C 1 612 ? -8.751  -17.882 26.395  1.00 9.41   ? 920  HIS C N     1 
ATOM   10151 C CA    . HIS C 1 612 ? -8.115  -16.679 26.924  1.00 9.91   ? 920  HIS C CA    1 
ATOM   10152 C C     . HIS C 1 612 ? -8.852  -15.534 26.252  1.00 9.94   ? 920  HIS C C     1 
ATOM   10153 O O     . HIS C 1 612 ? -9.828  -14.999 26.803  1.00 4.62   ? 920  HIS C O     1 
ATOM   10154 C CB    . HIS C 1 612 ? -6.598  -16.668 26.680  1.00 9.66   ? 920  HIS C CB    1 
ATOM   10155 C CG    . HIS C 1 612 ? -5.860  -17.789 27.366  1.00 14.97  ? 920  HIS C CG    1 
ATOM   10156 N ND1   . HIS C 1 612 ? -4.551  -18.109 27.074  1.00 15.37  ? 920  HIS C ND1   1 
ATOM   10157 C CD2   . HIS C 1 612 ? -6.250  -18.659 28.330  1.00 6.85   ? 920  HIS C CD2   1 
ATOM   10158 C CE1   . HIS C 1 612 ? -4.170  -19.135 27.817  1.00 21.09  ? 920  HIS C CE1   1 
ATOM   10159 N NE2   . HIS C 1 612 ? -5.183  -19.493 28.584  1.00 12.56  ? 920  HIS C NE2   1 
ATOM   10160 N N     . THR C 1 613 ? -8.453  -15.211 25.030  1.00 5.34   ? 921  THR C N     1 
ATOM   10161 C CA    . THR C 1 613 ? -9.250  -14.289 24.229  1.00 5.12   ? 921  THR C CA    1 
ATOM   10162 C C     . THR C 1 613 ? -10.685 -14.820 24.190  1.00 9.72   ? 921  THR C C     1 
ATOM   10163 O O     . THR C 1 613 ? -11.655 -14.065 24.309  1.00 10.68  ? 921  THR C O     1 
ATOM   10164 C CB    . THR C 1 613 ? -8.721  -14.214 22.780  1.00 10.60  ? 921  THR C CB    1 
ATOM   10165 O OG1   . THR C 1 613 ? -7.349  -13.797 22.804  1.00 10.82  ? 921  THR C OG1   1 
ATOM   10166 C CG2   . THR C 1 613 ? -9.550  -13.225 21.931  1.00 4.72   ? 921  THR C CG2   1 
ATOM   10167 N N     . THR C 1 614 ? -10.796 -16.129 24.001  1.00 7.31   ? 922  THR C N     1 
ATOM   10168 C CA    . THR C 1 614 ? -12.072 -16.821 23.800  1.00 7.80   ? 922  THR C CA    1 
ATOM   10169 C C     . THR C 1 614 ? -12.978 -16.749 25.032  1.00 6.28   ? 922  THR C C     1 
ATOM   10170 O O     . THR C 1 614 ? -14.213 -16.693 24.925  1.00 6.33   ? 922  THR C O     1 
ATOM   10171 C CB    . THR C 1 614 ? -11.811 -18.316 23.423  1.00 10.30  ? 922  THR C CB    1 
ATOM   10172 O OG1   . THR C 1 614 ? -10.866 -18.366 22.341  1.00 9.47   ? 922  THR C OG1   1 
ATOM   10173 C CG2   . THR C 1 614 ? -13.082 -18.995 22.979  1.00 8.12   ? 922  THR C CG2   1 
ATOM   10174 N N     . GLY C 1 615 ? -12.355 -16.769 26.197  1.00 6.24   ? 923  GLY C N     1 
ATOM   10175 C CA    . GLY C 1 615 ? -13.054 -16.550 27.450  1.00 11.65  ? 923  GLY C CA    1 
ATOM   10176 C C     . GLY C 1 615 ? -13.603 -15.142 27.535  1.00 8.19   ? 923  GLY C C     1 
ATOM   10177 O O     . GLY C 1 615 ? -14.756 -14.954 27.900  1.00 3.86   ? 923  GLY C O     1 
ATOM   10178 N N     . MET C 1 616 ? -12.780 -14.139 27.215  1.00 9.53   ? 924  MET C N     1 
ATOM   10179 C CA    . MET C 1 616 ? -13.292 -12.765 27.168  1.00 9.78   ? 924  MET C CA    1 
ATOM   10180 C C     . MET C 1 616 ? -14.455 -12.653 26.177  1.00 9.73   ? 924  MET C C     1 
ATOM   10181 O O     . MET C 1 616 ? -15.435 -11.947 26.443  1.00 8.06   ? 924  MET C O     1 
ATOM   10182 C CB    . MET C 1 616 ? -12.199 -11.755 26.804  1.00 4.32   ? 924  MET C CB    1 
ATOM   10183 C CG    . MET C 1 616 ? -10.967 -11.757 27.744  1.00 7.47   ? 924  MET C CG    1 
ATOM   10184 S SD    . MET C 1 616 ? -11.285 -11.228 29.453  1.00 10.13  ? 924  MET C SD    1 
ATOM   10185 C CE    . MET C 1 616 ? -11.321 -9.440  29.257  1.00 3.43   ? 924  MET C CE    1 
ATOM   10186 N N     . ASP C 1 617 ? -14.338 -13.327 25.029  1.00 6.32   ? 925  ASP C N     1 
ATOM   10187 C CA    . ASP C 1 617 ? -15.395 -13.267 24.020  1.00 8.50   ? 925  ASP C CA    1 
ATOM   10188 C C     . ASP C 1 617 ? -16.742 -13.742 24.576  1.00 3.93   ? 925  ASP C C     1 
ATOM   10189 O O     . ASP C 1 617 ? -17.802 -13.126 24.347  1.00 8.56   ? 925  ASP C O     1 
ATOM   10190 C CB    . ASP C 1 617 ? -15.035 -14.124 22.810  1.00 8.27   ? 925  ASP C CB    1 
ATOM   10191 C CG    . ASP C 1 617 ? -13.807 -13.598 22.041  1.00 7.35   ? 925  ASP C CG    1 
ATOM   10192 O OD1   . ASP C 1 617 ? -13.431 -12.403 22.156  1.00 6.61   ? 925  ASP C OD1   1 
ATOM   10193 O OD2   . ASP C 1 617 ? -13.222 -14.414 21.315  1.00 6.73   ? 925  ASP C OD2   1 
ATOM   10194 N N     . VAL C 1 618 ? -16.700 -14.868 25.277  1.00 6.65   ? 926  VAL C N     1 
ATOM   10195 C CA    . VAL C 1 618 ? -17.919 -15.533 25.699  1.00 9.83   ? 926  VAL C CA    1 
ATOM   10196 C C     . VAL C 1 618 ? -18.570 -14.735 26.837  1.00 8.89   ? 926  VAL C C     1 
ATOM   10197 O O     . VAL C 1 618 ? -19.806 -14.590 26.894  1.00 9.43   ? 926  VAL C O     1 
ATOM   10198 C CB    . VAL C 1 618 ? -17.639 -17.022 26.077  1.00 17.14  ? 926  VAL C CB    1 
ATOM   10199 C CG1   . VAL C 1 618 ? -17.384 -17.183 27.569  1.00 7.38   ? 926  VAL C CG1   1 
ATOM   10200 C CG2   . VAL C 1 618 ? -18.796 -17.923 25.640  1.00 20.84  ? 926  VAL C CG2   1 
ATOM   10201 N N     . LEU C 1 619 ? -17.739 -14.188 27.716  1.00 7.43   ? 927  LEU C N     1 
ATOM   10202 C CA    . LEU C 1 619 ? -18.231 -13.348 28.820  1.00 8.45   ? 927  LEU C CA    1 
ATOM   10203 C C     . LEU C 1 619 ? -18.846 -12.027 28.348  1.00 9.97   ? 927  LEU C C     1 
ATOM   10204 O O     . LEU C 1 619 ? -19.784 -11.506 28.969  1.00 8.93   ? 927  LEU C O     1 
ATOM   10205 C CB    . LEU C 1 619 ? -17.110 -13.090 29.835  1.00 13.74  ? 927  LEU C CB    1 
ATOM   10206 C CG    . LEU C 1 619 ? -16.612 -14.314 30.609  1.00 14.81  ? 927  LEU C CG    1 
ATOM   10207 C CD1   . LEU C 1 619 ? -15.410 -13.948 31.440  1.00 10.79  ? 927  LEU C CD1   1 
ATOM   10208 C CD2   . LEU C 1 619 ? -17.732 -14.922 31.493  1.00 9.84   ? 927  LEU C CD2   1 
ATOM   10209 N N     . TRP C 1 620 ? -18.328 -11.468 27.253  1.00 3.56   ? 928  TRP C N     1 
ATOM   10210 C CA    . TRP C 1 620 ? -18.900 -10.228 26.749  1.00 4.11   ? 928  TRP C CA    1 
ATOM   10211 C C     . TRP C 1 620 ? -20.350 -10.454 26.313  1.00 10.07  ? 928  TRP C C     1 
ATOM   10212 O O     . TRP C 1 620 ? -21.166 -9.525  26.327  1.00 12.67  ? 928  TRP C O     1 
ATOM   10213 C CB    . TRP C 1 620 ? -18.070 -9.636  25.605  1.00 13.63  ? 928  TRP C CB    1 
ATOM   10214 C CG    . TRP C 1 620 ? -18.541 -8.278  25.207  1.00 9.13   ? 928  TRP C CG    1 
ATOM   10215 C CD1   . TRP C 1 620 ? -19.054 -7.913  23.998  1.00 8.07   ? 928  TRP C CD1   1 
ATOM   10216 C CD2   . TRP C 1 620 ? -18.552 -7.092  26.024  1.00 6.71   ? 928  TRP C CD2   1 
ATOM   10217 N NE1   . TRP C 1 620 ? -19.375 -6.589  24.005  1.00 8.95   ? 928  TRP C NE1   1 
ATOM   10218 C CE2   . TRP C 1 620 ? -19.087 -6.055  25.234  1.00 12.08  ? 928  TRP C CE2   1 
ATOM   10219 C CE3   . TRP C 1 620 ? -18.158 -6.810  27.343  1.00 12.78  ? 928  TRP C CE3   1 
ATOM   10220 C CZ2   . TRP C 1 620 ? -19.248 -4.749  25.708  1.00 11.39  ? 928  TRP C CZ2   1 
ATOM   10221 C CZ3   . TRP C 1 620 ? -18.328 -5.491  27.831  1.00 7.00   ? 928  TRP C CZ3   1 
ATOM   10222 C CH2   . TRP C 1 620 ? -18.872 -4.484  26.997  1.00 5.90   ? 928  TRP C CH2   1 
ATOM   10223 N N     . ALA C 1 621 ? -20.669 -11.694 25.953  1.00 14.03  ? 929  ALA C N     1 
ATOM   10224 C CA    . ALA C 1 621 ? -22.017 -12.053 25.506  1.00 3.21   ? 929  ALA C CA    1 
ATOM   10225 C C     . ALA C 1 621 ? -22.934 -12.265 26.707  1.00 11.63  ? 929  ALA C C     1 
ATOM   10226 O O     . ALA C 1 621 ? -24.150 -12.388 26.555  1.00 8.04   ? 929  ALA C O     1 
ATOM   10227 C CB    . ALA C 1 621 ? -21.974 -13.306 24.661  1.00 11.93  ? 929  ALA C CB    1 
ATOM   10228 N N     . GLY C 1 622 ? -22.345 -12.291 27.902  1.00 7.83   ? 930  GLY C N     1 
ATOM   10229 C CA    . GLY C 1 622 ? -23.113 -12.496 29.127  1.00 8.77   ? 930  GLY C CA    1 
ATOM   10230 C C     . GLY C 1 622 ? -23.284 -13.968 29.473  1.00 13.60  ? 930  GLY C C     1 
ATOM   10231 O O     . GLY C 1 622 ? -24.167 -14.344 30.250  1.00 11.56  ? 930  GLY C O     1 
ATOM   10232 N N     . THR C 1 623 ? -22.420 -14.804 28.916  1.00 6.52   ? 931  THR C N     1 
ATOM   10233 C CA    . THR C 1 623 ? -22.544 -16.250 29.065  1.00 3.83   ? 931  THR C CA    1 
ATOM   10234 C C     . THR C 1 623 ? -21.611 -16.719 30.177  1.00 10.12  ? 931  THR C C     1 
ATOM   10235 O O     . THR C 1 623 ? -20.393 -16.597 30.058  1.00 8.22   ? 931  THR C O     1 
ATOM   10236 C CB    . THR C 1 623 ? -22.168 -16.945 27.731  1.00 3.96   ? 931  THR C CB    1 
ATOM   10237 O OG1   . THR C 1 623 ? -23.067 -16.502 26.707  1.00 16.59  ? 931  THR C OG1   1 
ATOM   10238 C CG2   . THR C 1 623 ? -22.265 -18.454 27.849  1.00 17.66  ? 931  THR C CG2   1 
ATOM   10239 N N     . PRO C 1 624 ? -22.189 -17.264 31.262  1.00 5.59   ? 932  PRO C N     1 
ATOM   10240 C CA    . PRO C 1 624 ? -21.429 -17.881 32.343  1.00 11.10  ? 932  PRO C CA    1 
ATOM   10241 C C     . PRO C 1 624 ? -20.491 -18.931 31.774  1.00 13.17  ? 932  PRO C C     1 
ATOM   10242 O O     . PRO C 1 624 ? -20.884 -19.719 30.915  1.00 12.40  ? 932  PRO C O     1 
ATOM   10243 C CB    . PRO C 1 624 ? -22.507 -18.567 33.187  1.00 13.13  ? 932  PRO C CB    1 
ATOM   10244 C CG    . PRO C 1 624 ? -23.767 -17.798 32.901  1.00 21.05  ? 932  PRO C CG    1 
ATOM   10245 C CD    . PRO C 1 624 ? -23.643 -17.392 31.455  1.00 12.15  ? 932  PRO C CD    1 
ATOM   10246 N N     . MET C 1 625 ? -19.263 -18.936 32.265  1.00 11.13  ? 933  MET C N     1 
ATOM   10247 C CA    . MET C 1 625 ? -18.282 -19.922 31.868  1.00 11.25  ? 933  MET C CA    1 
ATOM   10248 C C     . MET C 1 625 ? -17.914 -20.727 33.102  1.00 11.70  ? 933  MET C C     1 
ATOM   10249 O O     . MET C 1 625 ? -17.596 -20.153 34.133  1.00 8.54   ? 933  MET C O     1 
ATOM   10250 C CB    . MET C 1 625 ? -17.045 -19.192 31.332  1.00 13.71  ? 933  MET C CB    1 
ATOM   10251 C CG    . MET C 1 625 ? -15.854 -20.064 31.004  1.00 17.39  ? 933  MET C CG    1 
ATOM   10252 S SD    . MET C 1 625 ? -14.669 -19.133 29.972  1.00 17.09  ? 933  MET C SD    1 
ATOM   10253 C CE    . MET C 1 625 ? -14.416 -17.679 30.984  1.00 20.73  ? 933  MET C CE    1 
ATOM   10254 N N     . VAL C 1 626 ? -17.981 -22.050 33.006  1.00 9.34   ? 934  VAL C N     1 
ATOM   10255 C CA    . VAL C 1 626 ? -17.511 -22.923 34.085  1.00 12.21  ? 934  VAL C CA    1 
ATOM   10256 C C     . VAL C 1 626 ? -16.047 -23.297 33.858  1.00 13.98  ? 934  VAL C C     1 
ATOM   10257 O O     . VAL C 1 626 ? -15.674 -23.688 32.761  1.00 12.38  ? 934  VAL C O     1 
ATOM   10258 C CB    . VAL C 1 626 ? -18.365 -24.212 34.192  1.00 13.75  ? 934  VAL C CB    1 
ATOM   10259 C CG1   . VAL C 1 626 ? -17.844 -25.112 35.338  1.00 13.10  ? 934  VAL C CG1   1 
ATOM   10260 C CG2   . VAL C 1 626 ? -19.803 -23.854 34.409  1.00 5.86   ? 934  VAL C CG2   1 
ATOM   10261 N N     . THR C 1 627 ? -15.211 -23.171 34.886  1.00 14.25  ? 935  THR C N     1 
ATOM   10262 C CA    . THR C 1 627 ? -13.799 -23.474 34.712  1.00 14.45  ? 935  THR C CA    1 
ATOM   10263 C C     . THR C 1 627 ? -13.230 -24.273 35.881  1.00 13.92  ? 935  THR C C     1 
ATOM   10264 O O     . THR C 1 627 ? -13.758 -24.233 36.997  1.00 13.26  ? 935  THR C O     1 
ATOM   10265 C CB    . THR C 1 627 ? -12.962 -22.176 34.487  1.00 13.70  ? 935  THR C CB    1 
ATOM   10266 O OG1   . THR C 1 627 ? -11.616 -22.522 34.137  1.00 9.61   ? 935  THR C OG1   1 
ATOM   10267 C CG2   . THR C 1 627 ? -12.961 -21.302 35.743  1.00 5.08   ? 935  THR C CG2   1 
ATOM   10268 N N     . MET C 1 628 ? -12.175 -25.027 35.599  1.00 12.86  ? 936  MET C N     1 
ATOM   10269 C CA    . MET C 1 628 ? -11.426 -25.749 36.625  1.00 14.97  ? 936  MET C CA    1 
ATOM   10270 C C     . MET C 1 628 ? -9.961  -25.348 36.491  1.00 15.44  ? 936  MET C C     1 
ATOM   10271 O O     . MET C 1 628 ? -9.247  -25.902 35.654  1.00 15.91  ? 936  MET C O     1 
ATOM   10272 C CB    . MET C 1 628 ? -11.555 -27.257 36.413  1.00 15.03  ? 936  MET C CB    1 
ATOM   10273 C CG    . MET C 1 628 ? -11.035 -28.107 37.582  1.00 26.74  ? 936  MET C CG    1 
ATOM   10274 S SD    . MET C 1 628 ? -11.251 -29.880 37.310  1.00 19.05  ? 936  MET C SD    1 
ATOM   10275 C CE    . MET C 1 628 ? -10.079 -30.168 35.981  1.00 26.08  ? 936  MET C CE    1 
ATOM   10276 N N     . PRO C 1 629 ? -9.514  -24.360 37.281  1.00 14.34  ? 937  PRO C N     1 
ATOM   10277 C CA    . PRO C 1 629 ? -8.123  -23.906 37.133  1.00 12.57  ? 937  PRO C CA    1 
ATOM   10278 C C     . PRO C 1 629 ? -7.100  -24.999 37.483  1.00 20.93  ? 937  PRO C C     1 
ATOM   10279 O O     . PRO C 1 629 ? -7.289  -25.762 38.428  1.00 13.54  ? 937  PRO C O     1 
ATOM   10280 C CB    . PRO C 1 629 ? -8.019  -22.729 38.109  1.00 13.11  ? 937  PRO C CB    1 
ATOM   10281 C CG    . PRO C 1 629 ? -9.169  -22.922 39.083  1.00 18.01  ? 937  PRO C CG    1 
ATOM   10282 C CD    . PRO C 1 629 ? -10.266 -23.566 38.273  1.00 13.35  ? 937  PRO C CD    1 
ATOM   10283 N N     . GLY C 1 630 ? -6.024  -25.067 36.713  1.00 12.03  ? 938  GLY C N     1 
ATOM   10284 C CA    . GLY C 1 630 ? -4.996  -26.074 36.929  1.00 12.37  ? 938  GLY C CA    1 
ATOM   10285 C C     . GLY C 1 630 ? -3.804  -25.443 37.621  1.00 15.82  ? 938  GLY C C     1 
ATOM   10286 O O     . GLY C 1 630 ? -3.969  -24.590 38.493  1.00 19.17  ? 938  GLY C O     1 
ATOM   10287 N N     . GLU C 1 631 ? -2.603  -25.856 37.232  1.00 11.77  ? 939  GLU C N     1 
ATOM   10288 C CA    . GLU C 1 631 ? -1.396  -25.255 37.792  1.00 20.64  ? 939  GLU C CA    1 
ATOM   10289 C C     . GLU C 1 631 ? -0.649  -24.325 36.830  1.00 21.33  ? 939  GLU C C     1 
ATOM   10290 O O     . GLU C 1 631 ? -0.072  -23.322 37.262  1.00 26.42  ? 939  GLU C O     1 
ATOM   10291 C CB    . GLU C 1 631 ? -0.466  -26.335 38.334  1.00 20.96  ? 939  GLU C CB    1 
ATOM   10292 C CG    . GLU C 1 631 ? -1.104  -27.143 39.466  1.00 29.86  ? 939  GLU C CG    1 
ATOM   10293 C CD    . GLU C 1 631 ? -0.156  -28.152 40.075  1.00 41.68  ? 939  GLU C CD    1 
ATOM   10294 O OE1   . GLU C 1 631 ? 0.947   -28.339 39.522  1.00 35.86  ? 939  GLU C OE1   1 
ATOM   10295 O OE2   . GLU C 1 631 ? -0.514  -28.750 41.110  1.00 43.80  ? 939  GLU C OE2   1 
ATOM   10296 N N     . THR C 1 632 ? -0.658  -24.635 35.536  1.00 16.66  ? 940  THR C N     1 
ATOM   10297 C CA    . THR C 1 632 ? 0.046   -23.773 34.572  1.00 13.49  ? 940  THR C CA    1 
ATOM   10298 C C     . THR C 1 632 ? -0.686  -22.452 34.399  1.00 18.64  ? 940  THR C C     1 
ATOM   10299 O O     . THR C 1 632 ? -1.898  -22.377 34.605  1.00 10.74  ? 940  THR C O     1 
ATOM   10300 C CB    . THR C 1 632 ? 0.161   -24.406 33.177  1.00 10.87  ? 940  THR C CB    1 
ATOM   10301 O OG1   . THR C 1 632 ? -1.158  -24.609 32.641  1.00 17.83  ? 940  THR C OG1   1 
ATOM   10302 C CG2   . THR C 1 632 ? 0.899   -25.740 33.240  1.00 17.81  ? 940  THR C CG2   1 
ATOM   10303 N N     . LEU C 1 633 ? 0.048   -21.414 33.999  1.00 11.34  ? 941  LEU C N     1 
ATOM   10304 C CA    . LEU C 1 633 ? -0.578  -20.140 33.682  1.00 10.51  ? 941  LEU C CA    1 
ATOM   10305 C C     . LEU C 1 633 ? -1.764  -20.319 32.722  1.00 11.75  ? 941  LEU C C     1 
ATOM   10306 O O     . LEU C 1 633 ? -2.845  -19.776 32.955  1.00 9.18   ? 941  LEU C O     1 
ATOM   10307 C CB    . LEU C 1 633 ? 0.465   -19.187 33.089  1.00 19.95  ? 941  LEU C CB    1 
ATOM   10308 C CG    . LEU C 1 633 ? 0.108   -17.702 32.990  1.00 15.80  ? 941  LEU C CG    1 
ATOM   10309 C CD1   . LEU C 1 633 ? 1.372   -16.851 32.764  1.00 16.89  ? 941  LEU C CD1   1 
ATOM   10310 C CD2   . LEU C 1 633 ? -0.901  -17.473 31.881  1.00 21.36  ? 941  LEU C CD2   1 
ATOM   10311 N N     . ALA C 1 634 ? -1.572  -21.085 31.648  1.00 8.22   ? 942  ALA C N     1 
ATOM   10312 C CA    . ALA C 1 634 ? -2.601  -21.196 30.607  1.00 13.46  ? 942  ALA C CA    1 
ATOM   10313 C C     . ALA C 1 634 ? -3.893  -21.885 31.090  1.00 11.74  ? 942  ALA C C     1 
ATOM   10314 O O     . ALA C 1 634 ? -4.980  -21.690 30.519  1.00 9.26   ? 942  ALA C O     1 
ATOM   10315 C CB    . ALA C 1 634 ? -2.036  -21.910 29.384  1.00 12.12  ? 942  ALA C CB    1 
ATOM   10316 N N     . SER C 1 635 ? -3.773  -22.679 32.144  1.00 11.49  ? 943  SER C N     1 
ATOM   10317 C CA    . SER C 1 635 ? -4.907  -23.409 32.700  1.00 8.66   ? 943  SER C CA    1 
ATOM   10318 C C     . SER C 1 635 ? -5.651  -22.633 33.786  1.00 9.52   ? 943  SER C C     1 
ATOM   10319 O O     . SER C 1 635 ? -6.627  -23.147 34.353  1.00 11.48  ? 943  SER C O     1 
ATOM   10320 C CB    . SER C 1 635 ? -4.440  -24.755 33.273  1.00 12.35  ? 943  SER C CB    1 
ATOM   10321 O OG    . SER C 1 635 ? -3.756  -24.593 34.516  1.00 12.79  ? 943  SER C OG    1 
ATOM   10322 N N     . ARG C 1 636 ? -5.185  -21.422 34.096  1.00 8.05   ? 944  ARG C N     1 
ATOM   10323 C CA    . ARG C 1 636 ? -5.748  -20.636 35.214  1.00 8.58   ? 944  ARG C CA    1 
ATOM   10324 C C     . ARG C 1 636 ? -6.316  -19.275 34.794  1.00 11.16  ? 944  ARG C C     1 
ATOM   10325 O O     . ARG C 1 636 ? -6.860  -18.536 35.622  1.00 11.12  ? 944  ARG C O     1 
ATOM   10326 C CB    . ARG C 1 636 ? -4.688  -20.410 36.303  1.00 11.38  ? 944  ARG C CB    1 
ATOM   10327 C CG    . ARG C 1 636 ? -4.235  -21.686 37.041  1.00 12.72  ? 944  ARG C CG    1 
ATOM   10328 C CD    . ARG C 1 636 ? -3.195  -21.371 38.124  1.00 12.48  ? 944  ARG C CD    1 
ATOM   10329 N NE    . ARG C 1 636 ? -3.757  -20.576 39.216  1.00 12.53  ? 944  ARG C NE    1 
ATOM   10330 C CZ    . ARG C 1 636 ? -4.491  -21.073 40.206  1.00 17.65  ? 944  ARG C CZ    1 
ATOM   10331 N NH1   . ARG C 1 636 ? -4.767  -22.375 40.250  1.00 15.66  ? 944  ARG C NH1   1 
ATOM   10332 N NH2   . ARG C 1 636 ? -4.957  -20.266 41.153  1.00 18.57  ? 944  ARG C NH2   1 
ATOM   10333 N N     . VAL C 1 637 ? -6.172  -18.930 33.523  1.00 8.53   ? 945  VAL C N     1 
ATOM   10334 C CA    . VAL C 1 637 ? -6.590  -17.607 33.041  1.00 11.85  ? 945  VAL C CA    1 
ATOM   10335 C C     . VAL C 1 637 ? -8.104  -17.372 33.172  1.00 13.60  ? 945  VAL C C     1 
ATOM   10336 O O     . VAL C 1 637 ? -8.549  -16.292 33.588  1.00 6.37   ? 945  VAL C O     1 
ATOM   10337 C CB    . VAL C 1 637 ? -6.136  -17.362 31.581  1.00 9.83   ? 945  VAL C CB    1 
ATOM   10338 C CG1   . VAL C 1 637 ? -6.844  -16.138 30.999  1.00 11.83  ? 945  VAL C CG1   1 
ATOM   10339 C CG2   . VAL C 1 637 ? -4.593  -17.178 31.528  1.00 6.17   ? 945  VAL C CG2   1 
ATOM   10340 N N     . ALA C 1 638 ? -8.897  -18.380 32.826  1.00 6.03   ? 946  ALA C N     1 
ATOM   10341 C CA    . ALA C 1 638 ? -10.350 -18.240 32.912  1.00 13.89  ? 946  ALA C CA    1 
ATOM   10342 C C     . ALA C 1 638 ? -10.824 -17.993 34.366  1.00 13.76  ? 946  ALA C C     1 
ATOM   10343 O O     . ALA C 1 638 ? -11.659 -17.134 34.616  1.00 5.95   ? 946  ALA C O     1 
ATOM   10344 C CB    . ALA C 1 638 ? -11.052 -19.465 32.308  1.00 11.88  ? 946  ALA C CB    1 
ATOM   10345 N N     . ALA C 1 639 ? -10.285 -18.735 35.323  1.00 9.72   ? 947  ALA C N     1 
ATOM   10346 C CA    . ALA C 1 639 ? -10.632 -18.485 36.728  1.00 11.81  ? 947  ALA C CA    1 
ATOM   10347 C C     . ALA C 1 639 ? -10.261 -17.060 37.149  1.00 12.66  ? 947  ALA C C     1 
ATOM   10348 O O     . ALA C 1 639 ? -10.951 -16.449 37.970  1.00 14.51  ? 947  ALA C O     1 
ATOM   10349 C CB    . ALA C 1 639 ? -9.966  -19.499 37.637  1.00 9.12   ? 947  ALA C CB    1 
ATOM   10350 N N     . SER C 1 640 ? -9.172  -16.528 36.590  1.00 12.27  ? 948  SER C N     1 
ATOM   10351 C CA    . SER C 1 640 ? -8.749  -15.159 36.907  1.00 8.89   ? 948  SER C CA    1 
ATOM   10352 C C     . SER C 1 640 ? -9.776  -14.161 36.351  1.00 12.71  ? 948  SER C C     1 
ATOM   10353 O O     . SER C 1 640 ? -10.142 -13.189 37.016  1.00 11.33  ? 948  SER C O     1 
ATOM   10354 C CB    . SER C 1 640 ? -7.355  -14.883 36.330  1.00 9.86   ? 948  SER C CB    1 
ATOM   10355 O OG    . SER C 1 640 ? -6.921  -13.567 36.604  1.00 11.84  ? 948  SER C OG    1 
ATOM   10356 N N     . GLN C 1 641 ? -10.243 -14.416 35.129  1.00 9.42   ? 949  GLN C N     1 
ATOM   10357 C CA    . GLN C 1 641 ? -11.228 -13.559 34.492  1.00 4.60   ? 949  GLN C CA    1 
ATOM   10358 C C     . GLN C 1 641 ? -12.512 -13.588 35.317  1.00 7.69   ? 949  GLN C C     1 
ATOM   10359 O O     . GLN C 1 641 ? -13.134 -12.563 35.539  1.00 8.58   ? 949  GLN C O     1 
ATOM   10360 C CB    . GLN C 1 641 ? -11.538 -14.061 33.070  1.00 11.13  ? 949  GLN C CB    1 
ATOM   10361 C CG    . GLN C 1 641 ? -10.396 -13.893 32.057  1.00 7.65   ? 949  GLN C CG    1 
ATOM   10362 C CD    . GLN C 1 641 ? -10.644 -14.621 30.743  1.00 11.11  ? 949  GLN C CD    1 
ATOM   10363 O OE1   . GLN C 1 641 ? -11.595 -15.399 30.618  1.00 10.65  ? 949  GLN C OE1   1 
ATOM   10364 N NE2   . GLN C 1 641 ? -9.757  -14.403 29.763  1.00 11.20  ? 949  GLN C NE2   1 
ATOM   10365 N N     . LEU C 1 642 ? -12.895 -14.783 35.768  1.00 7.60   ? 950  LEU C N     1 
ATOM   10366 C CA    . LEU C 1 642 ? -14.127 -14.974 36.530  1.00 4.68   ? 950  LEU C CA    1 
ATOM   10367 C C     . LEU C 1 642 ? -14.071 -14.312 37.880  1.00 9.38   ? 950  LEU C C     1 
ATOM   10368 O O     . LEU C 1 642 ? -15.079 -13.799 38.386  1.00 9.96   ? 950  LEU C O     1 
ATOM   10369 C CB    . LEU C 1 642 ? -14.414 -16.477 36.701  1.00 10.41  ? 950  LEU C CB    1 
ATOM   10370 C CG    . LEU C 1 642 ? -14.919 -17.102 35.405  1.00 6.88   ? 950  LEU C CG    1 
ATOM   10371 C CD1   . LEU C 1 642 ? -14.913 -18.627 35.453  1.00 6.45   ? 950  LEU C CD1   1 
ATOM   10372 C CD2   . LEU C 1 642 ? -16.309 -16.567 35.101  1.00 16.41  ? 950  LEU C CD2   1 
ATOM   10373 N N     . THR C 1 643 ? -12.888 -14.360 38.477  1.00 7.83   ? 951  THR C N     1 
ATOM   10374 C CA    . THR C 1 643 ? -12.665 -13.776 39.793  1.00 15.61  ? 951  THR C CA    1 
ATOM   10375 C C     . THR C 1 643 ? -12.772 -12.258 39.699  1.00 17.20  ? 951  THR C C     1 
ATOM   10376 O O     . THR C 1 643 ? -13.377 -11.613 40.556  1.00 13.46  ? 951  THR C O     1 
ATOM   10377 C CB    . THR C 1 643 ? -11.297 -14.222 40.359  1.00 15.54  ? 951  THR C CB    1 
ATOM   10378 O OG1   . THR C 1 643 ? -11.336 -15.637 40.613  1.00 11.45  ? 951  THR C OG1   1 
ATOM   10379 C CG2   . THR C 1 643 ? -10.950 -13.480 41.652  1.00 18.84  ? 951  THR C CG2   1 
ATOM   10380 N N     . CYS C 1 644 ? -12.215 -11.690 38.634  1.00 12.43  ? 952  CYS C N     1 
ATOM   10381 C CA    . CYS C 1 644 ? -12.298 -10.250 38.433  1.00 9.88   ? 952  CYS C CA    1 
ATOM   10382 C C     . CYS C 1 644 ? -13.749 -9.901  38.199  1.00 10.39  ? 952  CYS C C     1 
ATOM   10383 O O     . CYS C 1 644 ? -14.248 -8.892  38.689  1.00 10.44  ? 952  CYS C O     1 
ATOM   10384 C CB    . CYS C 1 644 ? -11.465 -9.823  37.220  1.00 13.76  ? 952  CYS C CB    1 
ATOM   10385 S SG    . CYS C 1 644 ? -11.701 -8.070  36.751  1.00 13.32  ? 952  CYS C SG    1 
ATOM   10386 N N     . LEU C 1 645 ? -14.423 -10.757 37.438  1.00 9.89   ? 953  LEU C N     1 
ATOM   10387 C CA    . LEU C 1 645 ? -15.807 -10.536 37.079  1.00 5.88   ? 953  LEU C CA    1 
ATOM   10388 C C     . LEU C 1 645 ? -16.656 -10.531 38.331  1.00 20.67  ? 953  LEU C C     1 
ATOM   10389 O O     . LEU C 1 645 ? -17.641 -9.800  38.423  1.00 19.86  ? 953  LEU C O     1 
ATOM   10390 C CB    . LEU C 1 645 ? -16.307 -11.643 36.134  1.00 7.64   ? 953  LEU C CB    1 
ATOM   10391 C CG    . LEU C 1 645 ? -17.715 -11.446 35.568  1.00 18.99  ? 953  LEU C CG    1 
ATOM   10392 C CD1   . LEU C 1 645 ? -17.747 -10.212 34.650  1.00 4.46   ? 953  LEU C CD1   1 
ATOM   10393 C CD2   . LEU C 1 645 ? -18.187 -12.726 34.846  1.00 12.20  ? 953  LEU C CD2   1 
ATOM   10394 N N     . GLY C 1 646 ? -16.276 -11.375 39.284  1.00 26.98  ? 954  GLY C N     1 
ATOM   10395 C CA    . GLY C 1 646 ? -16.974 -11.487 40.549  1.00 17.79  ? 954  GLY C CA    1 
ATOM   10396 C C     . GLY C 1 646 ? -17.921 -12.669 40.549  1.00 22.40  ? 954  GLY C C     1 
ATOM   10397 O O     . GLY C 1 646 ? -19.001 -12.575 41.100  1.00 24.30  ? 954  GLY C O     1 
ATOM   10398 N N     . CYS C 1 647 ? -17.507 -13.776 39.925  1.00 14.84  ? 955  CYS C N     1 
ATOM   10399 C CA    . CYS C 1 647 ? -18.308 -14.987 39.850  1.00 14.92  ? 955  CYS C CA    1 
ATOM   10400 C C     . CYS C 1 647 ? -17.522 -16.175 40.356  1.00 25.15  ? 955  CYS C C     1 
ATOM   10401 O O     . CYS C 1 647 ? -17.192 -17.083 39.588  1.00 15.63  ? 955  CYS C O     1 
ATOM   10402 C CB    . CYS C 1 647 ? -18.782 -15.262 38.415  1.00 20.56  ? 955  CYS C CB    1 
ATOM   10403 S SG    . CYS C 1 647 ? -20.083 -14.120 37.845  1.00 23.52  ? 955  CYS C SG    1 
ATOM   10404 N N     . LEU C 1 648 ? -17.252 -16.183 41.657  1.00 13.89  ? 956  LEU C N     1 
ATOM   10405 C CA    . LEU C 1 648 ? -16.469 -17.255 42.269  1.00 11.95  ? 956  LEU C CA    1 
ATOM   10406 C C     . LEU C 1 648 ? -17.160 -18.607 42.181  1.00 17.01  ? 956  LEU C C     1 
ATOM   10407 O O     . LEU C 1 648 ? -16.501 -19.647 42.205  1.00 13.01  ? 956  LEU C O     1 
ATOM   10408 C CB    . LEU C 1 648 ? -16.177 -16.933 43.742  1.00 17.96  ? 956  LEU C CB    1 
ATOM   10409 C CG    . LEU C 1 648 ? -15.288 -15.700 43.936  1.00 29.21  ? 956  LEU C CG    1 
ATOM   10410 C CD1   . LEU C 1 648 ? -15.206 -15.297 45.406  1.00 28.36  ? 956  LEU C CD1   1 
ATOM   10411 C CD2   . LEU C 1 648 ? -13.897 -15.964 43.359  1.00 23.89  ? 956  LEU C CD2   1 
ATOM   10412 N N     . GLU C 1 649 ? -18.489 -18.591 42.109  1.00 11.76  ? 957  GLU C N     1 
ATOM   10413 C CA    . GLU C 1 649 ? -19.266 -19.828 42.059  1.00 17.01  ? 957  GLU C CA    1 
ATOM   10414 C C     . GLU C 1 649 ? -19.060 -20.655 40.774  1.00 14.57  ? 957  GLU C C     1 
ATOM   10415 O O     . GLU C 1 649 ? -19.528 -21.781 40.675  1.00 13.24  ? 957  GLU C O     1 
ATOM   10416 C CB    . GLU C 1 649 ? -20.759 -19.520 42.266  1.00 21.22  ? 957  GLU C CB    1 
ATOM   10417 C CG    . GLU C 1 649 ? -21.406 -18.695 41.134  1.00 30.99  ? 957  GLU C CG    1 
ATOM   10418 C CD    . GLU C 1 649 ? -21.198 -17.183 41.263  1.00 33.95  ? 957  GLU C CD    1 
ATOM   10419 O OE1   . GLU C 1 649 ? -20.272 -16.732 41.979  1.00 31.70  ? 957  GLU C OE1   1 
ATOM   10420 O OE2   . GLU C 1 649 ? -21.985 -16.439 40.647  1.00 36.52  ? 957  GLU C OE2   1 
ATOM   10421 N N     . LEU C 1 650 ? -18.357 -20.105 39.798  1.00 13.19  ? 958  LEU C N     1 
ATOM   10422 C CA    . LEU C 1 650 ? -18.197 -20.771 38.501  1.00 15.67  ? 958  LEU C CA    1 
ATOM   10423 C C     . LEU C 1 650 ? -16.843 -21.427 38.360  1.00 16.82  ? 958  LEU C C     1 
ATOM   10424 O O     . LEU C 1 650 ? -16.512 -22.010 37.310  1.00 13.78  ? 958  LEU C O     1 
ATOM   10425 C CB    . LEU C 1 650 ? -18.398 -19.753 37.373  1.00 13.45  ? 958  LEU C CB    1 
ATOM   10426 C CG    . LEU C 1 650 ? -19.849 -19.320 37.182  1.00 14.12  ? 958  LEU C CG    1 
ATOM   10427 C CD1   . LEU C 1 650 ? -19.995 -18.178 36.187  1.00 11.90  ? 958  LEU C CD1   1 
ATOM   10428 C CD2   . LEU C 1 650 ? -20.620 -20.525 36.750  1.00 11.81  ? 958  LEU C CD2   1 
ATOM   10429 N N     . ILE C 1 651 ? -16.057 -21.315 39.427  1.00 15.35  ? 959  ILE C N     1 
ATOM   10430 C CA    . ILE C 1 651 ? -14.727 -21.880 39.494  1.00 5.96   ? 959  ILE C CA    1 
ATOM   10431 C C     . ILE C 1 651 ? -14.716 -23.191 40.291  1.00 19.15  ? 959  ILE C C     1 
ATOM   10432 O O     . ILE C 1 651 ? -14.985 -23.197 41.497  1.00 14.63  ? 959  ILE C O     1 
ATOM   10433 C CB    . ILE C 1 651 ? -13.760 -20.874 40.153  1.00 10.72  ? 959  ILE C CB    1 
ATOM   10434 C CG1   . ILE C 1 651 ? -13.800 -19.553 39.385  1.00 9.76   ? 959  ILE C CG1   1 
ATOM   10435 C CG2   . ILE C 1 651 ? -12.338 -21.410 40.193  1.00 12.27  ? 959  ILE C CG2   1 
ATOM   10436 C CD1   . ILE C 1 651 ? -13.032 -18.430 40.047  1.00 12.21  ? 959  ILE C CD1   1 
ATOM   10437 N N     . ALA C 1 652 ? -14.382 -24.290 39.608  1.00 7.55   ? 960  ALA C N     1 
ATOM   10438 C CA    . ALA C 1 652 ? -14.403 -25.618 40.201  1.00 17.42  ? 960  ALA C CA    1 
ATOM   10439 C C     . ALA C 1 652 ? -13.033 -26.028 40.734  1.00 14.81  ? 960  ALA C C     1 
ATOM   10440