data_3QPV
# 
_entry.id   3QPV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3QPV         
RCSB  RCSB063952   
WWPDB D_1000063952 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3QPU . unspecified 
PDB 3QPW . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3QPV 
_pdbx_database_status.recvd_initial_deposition_date   2011-02-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cavalier, M.C.' 1 
'Kim, S.G.'      2 
'Neau, D.'       3 
'Lee, Y.H.'      4 
# 
_citation.id                        primary 
_citation.title                     
'Molecular basis of the fructose-2,6-bisphosphatase reaction of PFKFB3: Transition state and the C-terminal function.' 
_citation.journal_abbrev            Proteins 
_citation.journal_volume            80 
_citation.page_first                1143 
_citation.page_last                 1153 
_citation.year                      2012 
_citation.journal_id_ASTM           PSFGEY 
_citation.country                   US 
_citation.journal_id_ISSN           0887-3585 
_citation.journal_id_CSD            0867 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22275052 
_citation.pdbx_database_id_DOI      10.1002/prot.24015 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Cavalier, M.C.' 1 ? 
primary 'Kim, S.G.'      2 ? 
primary 'Neau, D.'       3 ? 
primary 'Lee, Y.H.'      4 ? 
# 
_cell.entry_id           3QPV 
_cell.length_a           102.146 
_cell.length_b           102.146 
_cell.length_c           259.439 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3QPV 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3' 59694.137 1   '2.7.1.105, 3.1.3.46' ? ? ? 
2 non-polymer man 2,6-di-O-phosphono-beta-D-fructofuranose                 340.116   1   ?                     ? ? ? 
3 non-polymer syn 'PHOSPHONIC ACID'                                        81.996    1   ?                     ? ? ? 
4 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                               427.201   1   ?                     ? ? ? 
5 non-polymer man 6-O-phosphono-beta-D-fructofuranose                      260.136   1   ?                     ? ? ? 
6 water       nat water                                                    18.015    175 ?                     ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;6PF-2-K/Fru-2,6-P2ase 3, PFK/FBPase 3, 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme, Renal carcinoma antigen NY-REN-56, iPFK-2, 6-phosphofructo-2-kinase, Fructose-2,6-bisphosphatase
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVK
QYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTV
VASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKA
LNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFL
DKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFE
EHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVK
QYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTV
VASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKA
LNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFL
DKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFE
EHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   LEU n 
1 4   GLU n 
1 5   LEU n 
1 6   THR n 
1 7   GLN n 
1 8   SER n 
1 9   ARG n 
1 10  VAL n 
1 11  GLN n 
1 12  LYS n 
1 13  ILE n 
1 14  TRP n 
1 15  VAL n 
1 16  PRO n 
1 17  VAL n 
1 18  ASP n 
1 19  HIS n 
1 20  ARG n 
1 21  PRO n 
1 22  SER n 
1 23  LEU n 
1 24  PRO n 
1 25  ARG n 
1 26  SER n 
1 27  CYS n 
1 28  GLY n 
1 29  PRO n 
1 30  LYS n 
1 31  LEU n 
1 32  THR n 
1 33  ASN n 
1 34  SER n 
1 35  PRO n 
1 36  THR n 
1 37  VAL n 
1 38  ILE n 
1 39  VAL n 
1 40  MET n 
1 41  VAL n 
1 42  GLY n 
1 43  LEU n 
1 44  PRO n 
1 45  ALA n 
1 46  ARG n 
1 47  GLY n 
1 48  LYS n 
1 49  THR n 
1 50  TYR n 
1 51  ILE n 
1 52  SER n 
1 53  LYS n 
1 54  LYS n 
1 55  LEU n 
1 56  THR n 
1 57  ARG n 
1 58  TYR n 
1 59  LEU n 
1 60  ASN n 
1 61  TRP n 
1 62  ILE n 
1 63  GLY n 
1 64  VAL n 
1 65  PRO n 
1 66  THR n 
1 67  LYS n 
1 68  VAL n 
1 69  PHE n 
1 70  ASN n 
1 71  VAL n 
1 72  GLY n 
1 73  GLU n 
1 74  TYR n 
1 75  ARG n 
1 76  ARG n 
1 77  GLU n 
1 78  ALA n 
1 79  VAL n 
1 80  LYS n 
1 81  GLN n 
1 82  TYR n 
1 83  SER n 
1 84  SER n 
1 85  TYR n 
1 86  ASN n 
1 87  PHE n 
1 88  PHE n 
1 89  ARG n 
1 90  PRO n 
1 91  ASP n 
1 92  ASN n 
1 93  GLU n 
1 94  GLU n 
1 95  ALA n 
1 96  MET n 
1 97  LYS n 
1 98  VAL n 
1 99  ARG n 
1 100 LYS n 
1 101 GLN n 
1 102 CYS n 
1 103 ALA n 
1 104 LEU n 
1 105 ALA n 
1 106 ALA n 
1 107 LEU n 
1 108 ARG n 
1 109 ASP n 
1 110 VAL n 
1 111 LYS n 
1 112 SER n 
1 113 TYR n 
1 114 LEU n 
1 115 ALA n 
1 116 LYS n 
1 117 GLU n 
1 118 GLY n 
1 119 GLY n 
1 120 GLN n 
1 121 ILE n 
1 122 ALA n 
1 123 VAL n 
1 124 PHE n 
1 125 ASP n 
1 126 ALA n 
1 127 THR n 
1 128 ASN n 
1 129 THR n 
1 130 THR n 
1 131 ARG n 
1 132 GLU n 
1 133 ARG n 
1 134 ARG n 
1 135 HIS n 
1 136 MET n 
1 137 ILE n 
1 138 LEU n 
1 139 HIS n 
1 140 PHE n 
1 141 ALA n 
1 142 LYS n 
1 143 GLU n 
1 144 ASN n 
1 145 ASP n 
1 146 PHE n 
1 147 LYS n 
1 148 ALA n 
1 149 PHE n 
1 150 PHE n 
1 151 ILE n 
1 152 GLU n 
1 153 SER n 
1 154 VAL n 
1 155 CYS n 
1 156 ASP n 
1 157 ASP n 
1 158 PRO n 
1 159 THR n 
1 160 VAL n 
1 161 VAL n 
1 162 ALA n 
1 163 SER n 
1 164 ASN n 
1 165 ILE n 
1 166 MET n 
1 167 GLU n 
1 168 VAL n 
1 169 LYS n 
1 170 ILE n 
1 171 SER n 
1 172 SER n 
1 173 PRO n 
1 174 ASP n 
1 175 TYR n 
1 176 LYS n 
1 177 ASP n 
1 178 CYS n 
1 179 ASN n 
1 180 SER n 
1 181 ALA n 
1 182 GLU n 
1 183 ALA n 
1 184 MET n 
1 185 ASP n 
1 186 ASP n 
1 187 PHE n 
1 188 MET n 
1 189 LYS n 
1 190 ARG n 
1 191 ILE n 
1 192 SER n 
1 193 CYS n 
1 194 TYR n 
1 195 GLU n 
1 196 ALA n 
1 197 SER n 
1 198 TYR n 
1 199 GLN n 
1 200 PRO n 
1 201 LEU n 
1 202 ASP n 
1 203 PRO n 
1 204 ASP n 
1 205 LYS n 
1 206 CYS n 
1 207 ASP n 
1 208 ARG n 
1 209 ASP n 
1 210 LEU n 
1 211 SER n 
1 212 LEU n 
1 213 ILE n 
1 214 LYS n 
1 215 VAL n 
1 216 ILE n 
1 217 ASP n 
1 218 VAL n 
1 219 GLY n 
1 220 ARG n 
1 221 ARG n 
1 222 PHE n 
1 223 LEU n 
1 224 VAL n 
1 225 ASN n 
1 226 ARG n 
1 227 VAL n 
1 228 GLN n 
1 229 ASP n 
1 230 HIS n 
1 231 ILE n 
1 232 GLN n 
1 233 SER n 
1 234 ARG n 
1 235 ILE n 
1 236 VAL n 
1 237 TYR n 
1 238 TYR n 
1 239 LEU n 
1 240 MET n 
1 241 ASN n 
1 242 ILE n 
1 243 HIS n 
1 244 VAL n 
1 245 GLN n 
1 246 PRO n 
1 247 ARG n 
1 248 THR n 
1 249 ILE n 
1 250 TYR n 
1 251 LEU n 
1 252 CYS n 
1 253 ARG n 
1 254 HIS n 
1 255 GLY n 
1 256 GLU n 
1 257 ASN n 
1 258 GLU n 
1 259 HIS n 
1 260 ASN n 
1 261 LEU n 
1 262 GLN n 
1 263 GLY n 
1 264 ARG n 
1 265 ILE n 
1 266 GLY n 
1 267 GLY n 
1 268 ASP n 
1 269 SER n 
1 270 GLY n 
1 271 LEU n 
1 272 SER n 
1 273 SER n 
1 274 ARG n 
1 275 GLY n 
1 276 LYS n 
1 277 LYS n 
1 278 PHE n 
1 279 ALA n 
1 280 SER n 
1 281 ALA n 
1 282 LEU n 
1 283 SER n 
1 284 LYS n 
1 285 PHE n 
1 286 VAL n 
1 287 GLU n 
1 288 GLU n 
1 289 GLN n 
1 290 ASN n 
1 291 LEU n 
1 292 LYS n 
1 293 ASP n 
1 294 LEU n 
1 295 ARG n 
1 296 VAL n 
1 297 TRP n 
1 298 THR n 
1 299 SER n 
1 300 GLN n 
1 301 LEU n 
1 302 LYS n 
1 303 SER n 
1 304 THR n 
1 305 ILE n 
1 306 GLN n 
1 307 THR n 
1 308 ALA n 
1 309 GLU n 
1 310 ALA n 
1 311 LEU n 
1 312 ARG n 
1 313 LEU n 
1 314 PRO n 
1 315 TYR n 
1 316 GLU n 
1 317 GLN n 
1 318 TRP n 
1 319 LYS n 
1 320 ALA n 
1 321 LEU n 
1 322 ASN n 
1 323 GLU n 
1 324 ILE n 
1 325 ASP n 
1 326 ALA n 
1 327 GLY n 
1 328 VAL n 
1 329 CYS n 
1 330 GLU n 
1 331 GLU n 
1 332 LEU n 
1 333 THR n 
1 334 TYR n 
1 335 GLU n 
1 336 GLU n 
1 337 ILE n 
1 338 ARG n 
1 339 ASP n 
1 340 THR n 
1 341 TYR n 
1 342 PRO n 
1 343 GLU n 
1 344 GLU n 
1 345 TYR n 
1 346 ALA n 
1 347 LEU n 
1 348 ARG n 
1 349 GLU n 
1 350 GLN n 
1 351 ASP n 
1 352 LYS n 
1 353 TYR n 
1 354 TYR n 
1 355 TYR n 
1 356 ARG n 
1 357 TYR n 
1 358 PRO n 
1 359 THR n 
1 360 GLY n 
1 361 GLU n 
1 362 SER n 
1 363 TYR n 
1 364 GLN n 
1 365 ASP n 
1 366 LEU n 
1 367 VAL n 
1 368 GLN n 
1 369 ARG n 
1 370 LEU n 
1 371 GLU n 
1 372 PRO n 
1 373 VAL n 
1 374 ILE n 
1 375 MET n 
1 376 GLU n 
1 377 LEU n 
1 378 GLU n 
1 379 ARG n 
1 380 GLN n 
1 381 GLU n 
1 382 ASN n 
1 383 VAL n 
1 384 LEU n 
1 385 VAL n 
1 386 ILE n 
1 387 CYS n 
1 388 HIS n 
1 389 GLN n 
1 390 ALA n 
1 391 VAL n 
1 392 LEU n 
1 393 ARG n 
1 394 CYS n 
1 395 LEU n 
1 396 LEU n 
1 397 ALA n 
1 398 TYR n 
1 399 PHE n 
1 400 LEU n 
1 401 ASP n 
1 402 LYS n 
1 403 SER n 
1 404 ALA n 
1 405 GLU n 
1 406 GLU n 
1 407 MET n 
1 408 PRO n 
1 409 TYR n 
1 410 LEU n 
1 411 LYS n 
1 412 CYS n 
1 413 PRO n 
1 414 LEU n 
1 415 HIS n 
1 416 THR n 
1 417 VAL n 
1 418 LEU n 
1 419 LYS n 
1 420 LEU n 
1 421 THR n 
1 422 PRO n 
1 423 VAL n 
1 424 ALA n 
1 425 TYR n 
1 426 GLY n 
1 427 CYS n 
1 428 ARG n 
1 429 VAL n 
1 430 GLU n 
1 431 SER n 
1 432 ILE n 
1 433 TYR n 
1 434 LEU n 
1 435 ASN n 
1 436 VAL n 
1 437 GLU n 
1 438 SER n 
1 439 VAL n 
1 440 CYS n 
1 441 THR n 
1 442 HIS n 
1 443 ARG n 
1 444 GLU n 
1 445 ARG n 
1 446 SER n 
1 447 GLU n 
1 448 ASP n 
1 449 ALA n 
1 450 LYS n 
1 451 LYS n 
1 452 GLY n 
1 453 PRO n 
1 454 ASN n 
1 455 PRO n 
1 456 LEU n 
1 457 MET n 
1 458 ARG n 
1 459 ARG n 
1 460 ASN n 
1 461 SER n 
1 462 VAL n 
1 463 THR n 
1 464 PRO n 
1 465 LEU n 
1 466 ALA n 
1 467 SER n 
1 468 PRO n 
1 469 GLU n 
1 470 PRO n 
1 471 THR n 
1 472 LYS n 
1 473 LYS n 
1 474 PRO n 
1 475 ARG n 
1 476 ILE n 
1 477 ASN n 
1 478 SER n 
1 479 PHE n 
1 480 GLU n 
1 481 GLU n 
1 482 HIS n 
1 483 VAL n 
1 484 ALA n 
1 485 SER n 
1 486 THR n 
1 487 SER n 
1 488 ALA n 
1 489 ALA n 
1 490 LEU n 
1 491 PRO n 
1 492 SER n 
1 493 CYS n 
1 494 LEU n 
1 495 PRO n 
1 496 PRO n 
1 497 GLU n 
1 498 VAL n 
1 499 PRO n 
1 500 THR n 
1 501 GLN n 
1 502 LEU n 
1 503 PRO n 
1 504 GLY n 
1 505 GLN n 
1 506 ASN n 
1 507 MET n 
1 508 LYS n 
1 509 GLY n 
1 510 SER n 
1 511 ARG n 
1 512 SER n 
1 513 SER n 
1 514 ALA n 
1 515 ASP n 
1 516 SER n 
1 517 SER n 
1 518 ARG n 
1 519 LYS n 
1 520 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PFKFB3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    F263_HUMAN 
_struct_ref.pdbx_db_accession          Q16875 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVK
QYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTV
VASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKA
LNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFL
DKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFE
EHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3QPV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 520 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q16875 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  520 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       519 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer                  n "ADENOSINE-5'-DIPHOSPHATE"               ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'      121.158 
F6P 'D-saccharide, beta linking' n 6-O-phosphono-beta-D-fructofuranose      ? 'C6 H13 O9 P'       260.136 
FDP 'D-saccharide, beta linking' n 2,6-di-O-phosphono-beta-D-fructofuranose ? 'C6 H14 O12 P2'     340.116 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'              18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'       165.189 
PHS non-polymer                  . 'PHOSPHONIC ACID'                        ? 'H3 O3 P'           81.996  
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3QPV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.27 
_exptl_crystal.density_percent_sol   62.42 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;100 mM Tris-HCl,20-25% ethylene glycol, 200-400mM Tartaric Acid, 5% glycerol, and 12% polyethylene glycol 4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 300K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2007-07-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111) Channel Cut Crystal Monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.3808 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CAMD BEAMLINE GCPCC' 
_diffrn_source.pdbx_synchrotron_site       CAMD 
_diffrn_source.pdbx_synchrotron_beamline   GCPCC 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.3808 
# 
_reflns.entry_id                     3QPV 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.45 
_reflns.number_obs                   30381 
_reflns.number_all                   30381 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.45 
_reflns_shell.d_res_low              2.54 
_reflns_shell.percent_possible_all   98.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3QPV 
_refine.ls_number_reflns_obs                     24542 
_refine.ls_number_reflns_all                     30381 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    95.43 
_refine.ls_R_factor_obs                          0.19916 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19370 
_refine.ls_R_factor_R_free                       0.24750 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  2741 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.913 
_refine.B_iso_mean                               42.457 
_refine.aniso_B[1][1]                            0.44 
_refine.aniso_B[2][2]                            0.44 
_refine.aniso_B[3][3]                            -0.66 
_refine.aniso_B[1][2]                            0.22 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.331 
_refine.pdbx_overall_ESU_R_Free                  0.258 
_refine.overall_SU_ML                            0.161 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.164 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3597 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         67 
_refine_hist.number_atoms_solvent             175 
_refine_hist.number_atoms_total               3839 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.024  0.022  ? 3749 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.179  1.984  ? 5080 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.816  5.000  ? 440  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.867 23.441 ? 186  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.834 15.000 ? 669  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.446 15.000 ? 35   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.143  0.200  ? 554  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.020  ? 2805 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.263  0.200  ? 1903 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.322  0.200  ? 2547 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.185  0.200  ? 270  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.217  0.200  ? 52   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.177  0.200  ? 13   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.346  1.500  ? 2281 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.201  2.000  ? 3588 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.357  3.000  ? 1678 'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.148  4.500  ? 1491 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.500 
_refine_ls_shell.d_res_low                        2.564 
_refine_ls_shell.number_reflns_R_work             1610 
_refine_ls_shell.R_factor_R_work                  0.261 
_refine_ls_shell.percent_reflns_obs               87.08 
_refine_ls_shell.R_factor_R_free                  0.344 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             183 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3QPV 
_struct.title                     'PFKFB3 trapped in a phospho-enzyme intermediate state' 
_struct.pdbx_descriptor           '6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (E.C.2.7.1.105, 3.1.3.46)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3QPV 
_struct_keywords.pdbx_keywords   TRANSFERASE,HYDROLASE 
_struct_keywords.text            'kinase/bisphosphatase, TRANSFERASE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 47  ? ILE A 62  ? GLY A 46  ILE A 61  1 ? 16 
HELX_P HELX_P2  2  VAL A 71  ? VAL A 79  ? VAL A 70  VAL A 78  1 ? 9  
HELX_P HELX_P3  3  SER A 84  ? ARG A 89  ? SER A 83  ARG A 88  5 ? 6  
HELX_P HELX_P4  4  ASN A 92  ? GLU A 117 ? ASN A 91  GLU A 116 1 ? 26 
HELX_P HELX_P5  5  THR A 130 ? ASN A 144 ? THR A 129 ASN A 143 1 ? 15 
HELX_P HELX_P6  6  ASP A 157 ? LYS A 169 ? ASP A 156 LYS A 168 1 ? 13 
HELX_P HELX_P7  7  SER A 172 ? LYS A 176 ? SER A 171 LYS A 175 5 ? 5  
HELX_P HELX_P8  8  ASN A 179 ? ALA A 196 ? ASN A 178 ALA A 195 1 ? 18 
HELX_P HELX_P9  9  ASP A 229 ? MET A 240 ? ASP A 228 MET A 239 1 ? 12 
HELX_P HELX_P10 10 ASN A 257 ? GLN A 262 ? ASN A 256 GLN A 261 1 ? 6  
HELX_P HELX_P11 11 SER A 272 ? GLN A 289 ? SER A 271 GLN A 288 1 ? 18 
HELX_P HELX_P12 12 LEU A 301 ? ALA A 310 ? LEU A 300 ALA A 309 1 ? 10 
HELX_P HELX_P13 13 LYS A 319 ? ASN A 322 ? LYS A 318 ASN A 321 5 ? 4  
HELX_P HELX_P14 14 ALA A 326 ? GLU A 330 ? ALA A 325 GLU A 329 5 ? 5  
HELX_P HELX_P15 15 THR A 333 ? TYR A 341 ? THR A 332 TYR A 340 1 ? 9  
HELX_P HELX_P16 16 TYR A 341 ? ASP A 351 ? TYR A 340 ASP A 350 1 ? 11 
HELX_P HELX_P17 17 SER A 362 ? GLN A 380 ? SER A 361 GLN A 379 1 ? 19 
HELX_P HELX_P18 18 HIS A 388 ? LEU A 400 ? HIS A 387 LEU A 399 1 ? 13 
HELX_P HELX_P19 19 GLU A 406 ? LEU A 410 ? GLU A 405 LEU A 409 5 ? 5  
HELX_P HELX_P20 20 ASN A 454 ? ARG A 458 ? ASN A 453 ARG A 457 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 6 ? 
C ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 6   ? GLN A 7   ? THR A 5   GLN A 6   
A 2 TRP A 14  ? VAL A 15  ? TRP A 13  VAL A 14  
B 1 THR A 66  ? ASN A 70  ? THR A 65  ASN A 69  
B 2 ILE A 121 ? ASP A 125 ? ILE A 120 ASP A 124 
B 3 THR A 36  ? VAL A 41  ? THR A 35  VAL A 40  
B 4 LYS A 147 ? VAL A 154 ? LYS A 146 VAL A 153 
B 5 LEU A 212 ? ILE A 216 ? LEU A 211 ILE A 215 
B 6 ARG A 221 ? ASN A 225 ? ARG A 220 ASN A 224 
C 1 GLU A 316 ? GLN A 317 ? GLU A 315 GLN A 316 
C 2 ARG A 295 ? THR A 298 ? ARG A 294 THR A 297 
C 3 VAL A 383 ? CYS A 387 ? VAL A 382 CYS A 386 
C 4 ILE A 249 ? ARG A 253 ? ILE A 248 ARG A 252 
C 5 THR A 416 ? VAL A 423 ? THR A 415 VAL A 422 
C 6 GLY A 426 ? TYR A 433 ? GLY A 425 TYR A 432 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 6   ? N THR A 5   O VAL A 15  ? O VAL A 14  
B 1 2 N LYS A 67  ? N LYS A 66  O VAL A 123 ? O VAL A 122 
B 2 3 O PHE A 124 ? O PHE A 123 N ILE A 38  ? N ILE A 37  
B 3 4 N VAL A 41  ? N VAL A 40  O ILE A 151 ? O ILE A 150 
B 4 5 N GLU A 152 ? N GLU A 151 O VAL A 215 ? O VAL A 214 
B 5 6 N LEU A 212 ? N LEU A 211 O ASN A 225 ? O ASN A 224 
C 1 2 O GLU A 316 ? O GLU A 315 N VAL A 296 ? N VAL A 295 
C 2 3 N ARG A 295 ? N ARG A 294 O LEU A 384 ? O LEU A 383 
C 3 4 O VAL A 383 ? O VAL A 382 N TYR A 250 ? N TYR A 249 
C 4 5 N LEU A 251 ? N LEU A 250 O LEU A 418 ? O LEU A 417 
C 5 6 N LYS A 419 ? N LYS A 418 O GLU A 430 ? O GLU A 429 
# 
_database_PDB_matrix.entry_id          3QPV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3QPV 
_atom_sites.fract_transf_matrix[1][1]   0.009790 
_atom_sites.fract_transf_matrix[1][2]   0.005652 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011304 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003854 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLU A 1 4   ? -24.002 98.787  7.045   1.00 65.58 ? 3   GLU A N     1 
ATOM   2    C CA    . GLU A 1 4   ? -25.195 99.227  7.796   1.00 61.70 ? 3   GLU A CA    1 
ATOM   3    C C     . GLU A 1 4   ? -25.976 97.954  8.267   1.00 58.28 ? 3   GLU A C     1 
ATOM   4    O O     . GLU A 1 4   ? -26.615 97.930  9.370   1.00 57.30 ? 3   GLU A O     1 
ATOM   5    C CB    . GLU A 1 4   ? -25.993 100.310 7.060   1.00 61.71 ? 3   GLU A CB    1 
ATOM   6    C CG    . GLU A 1 4   ? -27.309 99.868  6.456   1.00 66.51 ? 3   GLU A CG    1 
ATOM   7    C CD    . GLU A 1 4   ? -27.676 100.545 5.098   1.00 72.27 ? 3   GLU A CD    1 
ATOM   8    O OE1   . GLU A 1 4   ? -26.771 100.820 4.252   1.00 73.78 ? 3   GLU A OE1   1 
ATOM   9    O OE2   . GLU A 1 4   ? -28.896 100.747 4.860   1.00 73.14 ? 3   GLU A OE2   1 
ATOM   10   N N     . LEU A 1 5   ? -25.802 96.882  7.474   1.00 53.58 ? 4   LEU A N     1 
ATOM   11   C CA    . LEU A 1 5   ? -26.244 95.474  7.782   1.00 48.36 ? 4   LEU A CA    1 
ATOM   12   C C     . LEU A 1 5   ? -27.676 95.137  7.425   1.00 45.36 ? 4   LEU A C     1 
ATOM   13   O O     . LEU A 1 5   ? -28.572 95.901  7.771   1.00 44.41 ? 4   LEU A O     1 
ATOM   14   C CB    . LEU A 1 5   ? -25.966 95.048  9.217   1.00 47.17 ? 4   LEU A CB    1 
ATOM   15   C CG    . LEU A 1 5   ? -24.519 95.030  9.643   1.00 43.95 ? 4   LEU A CG    1 
ATOM   16   C CD1   . LEU A 1 5   ? -24.464 94.531  11.025  1.00 45.13 ? 4   LEU A CD1   1 
ATOM   17   C CD2   . LEU A 1 5   ? -23.842 94.110  8.848   1.00 42.15 ? 4   LEU A CD2   1 
ATOM   18   N N     . THR A 1 6   ? -27.857 94.007  6.717   1.00 42.33 ? 5   THR A N     1 
ATOM   19   C CA    . THR A 1 6   ? -29.199 93.451  6.385   1.00 40.14 ? 5   THR A CA    1 
ATOM   20   C C     . THR A 1 6   ? -29.375 91.949  6.778   1.00 39.21 ? 5   THR A C     1 
ATOM   21   O O     . THR A 1 6   ? -28.460 91.147  6.630   1.00 39.25 ? 5   THR A O     1 
ATOM   22   C CB    . THR A 1 6   ? -29.567 93.673  4.849   1.00 40.83 ? 5   THR A CB    1 
ATOM   23   O OG1   . THR A 1 6   ? -30.937 93.341  4.642   1.00 41.06 ? 5   THR A OG1   1 
ATOM   24   C CG2   . THR A 1 6   ? -28.674 92.841  3.864   1.00 35.66 ? 5   THR A CG2   1 
ATOM   25   N N     . GLN A 1 7   ? -30.544 91.543  7.248   1.00 37.08 ? 6   GLN A N     1 
ATOM   26   C CA    . GLN A 1 7   ? -30.686 90.174  7.672   1.00 36.29 ? 6   GLN A CA    1 
ATOM   27   C C     . GLN A 1 7   ? -31.084 89.165  6.554   1.00 36.69 ? 6   GLN A C     1 
ATOM   28   O O     . GLN A 1 7   ? -32.223 89.213  6.062   1.00 36.42 ? 6   GLN A O     1 
ATOM   29   C CB    . GLN A 1 7   ? -31.665 90.091  8.811   1.00 36.24 ? 6   GLN A CB    1 
ATOM   30   C CG    . GLN A 1 7   ? -31.814 88.656  9.307   1.00 38.79 ? 6   GLN A CG    1 
ATOM   31   C CD    . GLN A 1 7   ? -32.509 88.600  10.619  1.00 39.92 ? 6   GLN A CD    1 
ATOM   32   O OE1   . GLN A 1 7   ? -33.578 89.153  10.757  1.00 42.09 ? 6   GLN A OE1   1 
ATOM   33   N NE2   . GLN A 1 7   ? -31.905 87.954  11.599  1.00 36.46 ? 6   GLN A NE2   1 
ATOM   34   N N     . SER A 1 8   ? -30.178 88.227  6.205   1.00 35.53 ? 7   SER A N     1 
ATOM   35   C CA    . SER A 1 8   ? -30.417 87.337  5.046   1.00 35.51 ? 7   SER A CA    1 
ATOM   36   C C     . SER A 1 8   ? -31.747 86.602  5.212   1.00 35.51 ? 7   SER A C     1 
ATOM   37   O O     . SER A 1 8   ? -32.148 86.293  6.337   1.00 36.40 ? 7   SER A O     1 
ATOM   38   C CB    . SER A 1 8   ? -29.232 86.377  4.819   1.00 34.26 ? 7   SER A CB    1 
ATOM   39   O OG    . SER A 1 8   ? -29.306 85.274  5.707   1.00 34.61 ? 7   SER A OG    1 
ATOM   40   N N     . ARG A 1 9   ? -32.472 86.316  4.152   1.00 35.58 ? 8   ARG A N     1 
ATOM   41   C CA    . ARG A 1 9   ? -33.872 85.835  4.411   1.00 36.32 ? 8   ARG A CA    1 
ATOM   42   C C     . ARG A 1 9   ? -34.091 84.390  4.858   1.00 34.97 ? 8   ARG A C     1 
ATOM   43   O O     . ARG A 1 9   ? -35.046 84.067  5.577   1.00 33.74 ? 8   ARG A O     1 
ATOM   44   C CB    . ARG A 1 9   ? -34.792 86.225  3.271   1.00 37.84 ? 8   ARG A CB    1 
ATOM   45   C CG    . ARG A 1 9   ? -35.274 87.672  3.478   1.00 42.75 ? 8   ARG A CG    1 
ATOM   46   C CD    . ARG A 1 9   ? -36.520 87.803  2.702   1.00 54.07 ? 8   ARG A CD    1 
ATOM   47   N NE    . ARG A 1 9   ? -36.295 87.196  1.375   1.00 56.39 ? 8   ARG A NE    1 
ATOM   48   C CZ    . ARG A 1 9   ? -37.262 86.727  0.584   1.00 56.71 ? 8   ARG A CZ    1 
ATOM   49   N NH1   . ARG A 1 9   ? -38.544 86.758  0.994   1.00 51.68 ? 8   ARG A NH1   1 
ATOM   50   N NH2   . ARG A 1 9   ? -36.923 86.219  -0.609  1.00 55.64 ? 8   ARG A NH2   1 
ATOM   51   N N     . VAL A 1 10  ? -33.153 83.530  4.488   1.00 35.37 ? 9   VAL A N     1 
ATOM   52   C CA    . VAL A 1 10  ? -33.256 82.103  4.759   1.00 35.16 ? 9   VAL A CA    1 
ATOM   53   C C     . VAL A 1 10  ? -32.588 81.753  6.047   1.00 35.03 ? 9   VAL A C     1 
ATOM   54   O O     . VAL A 1 10  ? -33.271 81.295  6.950   1.00 35.72 ? 9   VAL A O     1 
ATOM   55   C CB    . VAL A 1 10  ? -32.693 81.290  3.553   1.00 35.99 ? 9   VAL A CB    1 
ATOM   56   C CG1   . VAL A 1 10  ? -32.442 79.840  3.916   1.00 36.40 ? 9   VAL A CG1   1 
ATOM   57   C CG2   . VAL A 1 10  ? -33.687 81.368  2.387   1.00 34.53 ? 9   VAL A CG2   1 
ATOM   58   N N     . GLN A 1 11  ? -31.257 81.946  6.107   1.00 34.79 ? 10  GLN A N     1 
ATOM   59   C CA    . GLN A 1 11  ? -30.432 81.718  7.304   1.00 34.79 ? 10  GLN A CA    1 
ATOM   60   C C     . GLN A 1 11  ? -30.572 82.772  8.458   1.00 33.83 ? 10  GLN A C     1 
ATOM   61   O O     . GLN A 1 11  ? -30.054 82.539  9.528   1.00 33.86 ? 10  GLN A O     1 
ATOM   62   C CB    . GLN A 1 11  ? -28.956 81.609  6.934   1.00 34.00 ? 10  GLN A CB    1 
ATOM   63   C CG    . GLN A 1 11  ? -28.547 80.388  6.141   1.00 39.01 ? 10  GLN A CG    1 
ATOM   64   C CD    . GLN A 1 11  ? -27.007 80.078  6.206   1.00 39.10 ? 10  GLN A CD    1 
ATOM   65   O OE1   . GLN A 1 11  ? -26.203 80.619  5.446   1.00 47.02 ? 10  GLN A OE1   1 
ATOM   66   N NE2   . GLN A 1 11  ? -26.622 79.157  7.091   1.00 44.36 ? 10  GLN A NE2   1 
ATOM   67   N N     . LYS A 1 12  ? -31.259 83.895  8.240   1.00 33.38 ? 11  LYS A N     1 
ATOM   68   C CA    . LYS A 1 12  ? -31.368 84.999  9.224   1.00 33.09 ? 11  LYS A CA    1 
ATOM   69   C C     . LYS A 1 12  ? -30.027 85.518  9.774   1.00 33.34 ? 11  LYS A C     1 
ATOM   70   O O     . LYS A 1 12  ? -29.939 85.869  10.968  1.00 34.81 ? 11  LYS A O     1 
ATOM   71   C CB    . LYS A 1 12  ? -32.317 84.670  10.405  1.00 33.35 ? 11  LYS A CB    1 
ATOM   72   C CG    . LYS A 1 12  ? -33.688 84.004  10.114  1.00 31.29 ? 11  LYS A CG    1 
ATOM   73   C CD    . LYS A 1 12  ? -34.604 84.859  9.255   1.00 31.05 ? 11  LYS A CD    1 
ATOM   74   C CE    . LYS A 1 12  ? -35.995 84.263  9.058   1.00 32.85 ? 11  LYS A CE    1 
ATOM   75   N NZ    . LYS A 1 12  ? -35.979 83.059  8.122   1.00 33.17 ? 11  LYS A NZ    1 
ATOM   76   N N     . ILE A 1 13  ? -28.995 85.517  8.934   1.00 33.25 ? 12  ILE A N     1 
ATOM   77   C CA    . ILE A 1 13  ? -27.652 86.034  9.223   1.00 33.82 ? 12  ILE A CA    1 
ATOM   78   C C     . ILE A 1 13  ? -27.498 87.499  8.809   1.00 34.73 ? 12  ILE A C     1 
ATOM   79   O O     . ILE A 1 13  ? -27.860 87.889  7.690   1.00 35.41 ? 12  ILE A O     1 
ATOM   80   C CB    . ILE A 1 13  ? -26.577 85.150  8.479   1.00 34.85 ? 12  ILE A CB    1 
ATOM   81   C CG1   . ILE A 1 13  ? -26.594 83.716  9.035   1.00 34.51 ? 12  ILE A CG1   1 
ATOM   82   C CG2   . ILE A 1 13  ? -25.177 85.684  8.575   1.00 32.04 ? 12  ILE A CG2   1 
ATOM   83   C CD1   . ILE A 1 13  ? -26.560 83.602  10.589  1.00 33.56 ? 12  ILE A CD1   1 
ATOM   84   N N     . TRP A 1 14  ? -27.041 88.332  9.741   1.00 35.23 ? 13  TRP A N     1 
ATOM   85   C CA    . TRP A 1 14  ? -26.747 89.731  9.452   1.00 35.43 ? 13  TRP A CA    1 
ATOM   86   C C     . TRP A 1 14  ? -25.452 89.882  8.644   1.00 37.95 ? 13  TRP A C     1 
ATOM   87   O O     . TRP A 1 14  ? -24.331 89.495  9.100   1.00 38.15 ? 13  TRP A O     1 
ATOM   88   C CB    . TRP A 1 14  ? -26.630 90.526  10.734  1.00 33.39 ? 13  TRP A CB    1 
ATOM   89   C CG    . TRP A 1 14  ? -27.913 90.621  11.472  1.00 30.73 ? 13  TRP A CG    1 
ATOM   90   C CD1   . TRP A 1 14  ? -28.283 89.865  12.511  1.00 29.53 ? 13  TRP A CD1   1 
ATOM   91   C CD2   . TRP A 1 14  ? -28.981 91.503  11.219  1.00 27.64 ? 13  TRP A CD2   1 
ATOM   92   N NE1   . TRP A 1 14  ? -29.529 90.210  12.962  1.00 27.69 ? 13  TRP A NE1   1 
ATOM   93   C CE2   . TRP A 1 14  ? -29.989 91.224  12.168  1.00 33.18 ? 13  TRP A CE2   1 
ATOM   94   C CE3   . TRP A 1 14  ? -29.219 92.492  10.261  1.00 32.32 ? 13  TRP A CE3   1 
ATOM   95   C CZ2   . TRP A 1 14  ? -31.232 91.919  12.191  1.00 30.54 ? 13  TRP A CZ2   1 
ATOM   96   C CZ3   . TRP A 1 14  ? -30.453 93.221  10.305  1.00 28.50 ? 13  TRP A CZ3   1 
ATOM   97   C CH2   . TRP A 1 14  ? -31.412 92.925  11.270  1.00 30.97 ? 13  TRP A CH2   1 
ATOM   98   N N     . VAL A 1 15  ? -25.607 90.419  7.436   1.00 40.15 ? 14  VAL A N     1 
ATOM   99   C CA    . VAL A 1 15  ? -24.484 90.639  6.523   1.00 43.41 ? 14  VAL A CA    1 
ATOM   100  C C     . VAL A 1 15  ? -24.444 92.106  6.131   1.00 46.01 ? 14  VAL A C     1 
ATOM   101  O O     . VAL A 1 15  ? -25.483 92.792  6.181   1.00 45.54 ? 14  VAL A O     1 
ATOM   102  C CB    . VAL A 1 15  ? -24.518 89.686  5.289   1.00 43.66 ? 14  VAL A CB    1 
ATOM   103  C CG1   . VAL A 1 15  ? -24.432 88.209  5.757   1.00 41.95 ? 14  VAL A CG1   1 
ATOM   104  C CG2   . VAL A 1 15  ? -25.762 89.911  4.472   1.00 40.95 ? 14  VAL A CG2   1 
ATOM   105  N N     . PRO A 1 16  ? -23.245 92.612  5.811   1.00 49.09 ? 15  PRO A N     1 
ATOM   106  C CA    . PRO A 1 16  ? -23.118 94.014  5.379   1.00 54.20 ? 15  PRO A CA    1 
ATOM   107  C C     . PRO A 1 16  ? -23.739 94.227  3.978   1.00 55.75 ? 15  PRO A C     1 
ATOM   108  O O     . PRO A 1 16  ? -23.324 93.513  3.038   1.00 56.09 ? 15  PRO A O     1 
ATOM   109  C CB    . PRO A 1 16  ? -21.590 94.212  5.331   1.00 53.21 ? 15  PRO A CB    1 
ATOM   110  C CG    . PRO A 1 16  ? -21.049 92.861  5.002   1.00 50.51 ? 15  PRO A CG    1 
ATOM   111  C CD    . PRO A 1 16  ? -21.938 91.933  5.805   1.00 49.81 ? 15  PRO A CD    1 
ATOM   112  N N     . VAL A 1 17  ? -24.728 95.139  3.878   1.00 58.90 ? 16  VAL A N     1 
ATOM   113  C CA    . VAL A 1 17  ? -25.414 95.522  2.610   1.00 61.59 ? 16  VAL A CA    1 
ATOM   114  C C     . VAL A 1 17  ? -24.422 95.725  1.477   1.00 66.56 ? 16  VAL A C     1 
ATOM   115  O O     . VAL A 1 17  ? -23.510 96.561  1.599   1.00 67.25 ? 16  VAL A O     1 
ATOM   116  C CB    . VAL A 1 17  ? -26.092 96.888  2.692   1.00 61.73 ? 16  VAL A CB    1 
ATOM   117  C CG1   . VAL A 1 17  ? -27.208 96.905  3.701   1.00 60.45 ? 16  VAL A CG1   1 
ATOM   118  C CG2   . VAL A 1 17  ? -25.026 98.000  2.970   1.00 62.60 ? 16  VAL A CG2   1 
ATOM   119  N N     . ASP A 1 18  ? -24.583 94.987  0.383   1.00 71.42 ? 17  ASP A N     1 
ATOM   120  C CA    . ASP A 1 18  ? -23.591 95.063  -0.703  1.00 76.78 ? 17  ASP A CA    1 
ATOM   121  C C     . ASP A 1 18  ? -24.036 95.986  -1.859  1.00 79.34 ? 17  ASP A C     1 
ATOM   122  O O     . ASP A 1 18  ? -24.574 95.529  -2.876  1.00 79.89 ? 17  ASP A O     1 
ATOM   123  C CB    . ASP A 1 18  ? -23.202 93.664  -1.210  1.00 77.23 ? 17  ASP A CB    1 
ATOM   124  C CG    . ASP A 1 18  ? -21.905 93.670  -2.021  1.00 80.03 ? 17  ASP A CG    1 
ATOM   125  O OD1   . ASP A 1 18  ? -21.218 94.726  -2.094  1.00 82.62 ? 17  ASP A OD1   1 
ATOM   126  O OD2   . ASP A 1 18  ? -21.572 92.607  -2.593  1.00 82.90 ? 17  ASP A OD2   1 
ATOM   127  N N     . HIS A 1 19  ? -23.793 97.280  -1.680  1.00 82.29 ? 18  HIS A N     1 
ATOM   128  C CA    . HIS A 1 19  ? -24.197 98.299  -2.624  1.00 85.20 ? 18  HIS A CA    1 
ATOM   129  C C     . HIS A 1 19  ? -23.100 98.404  -3.660  1.00 87.32 ? 18  HIS A C     1 
ATOM   130  O O     . HIS A 1 19  ? -22.226 99.261  -3.491  1.00 88.22 ? 18  HIS A O     1 
ATOM   131  C CB    . HIS A 1 19  ? -24.212 99.658  -1.900  1.00 85.36 ? 18  HIS A CB    1 
ATOM   132  C CG    . HIS A 1 19  ? -25.437 99.934  -1.078  1.00 85.59 ? 18  HIS A CG    1 
ATOM   133  N ND1   . HIS A 1 19  ? -26.680 99.402  -1.363  1.00 85.38 ? 18  HIS A ND1   1 
ATOM   134  C CD2   . HIS A 1 19  ? -25.618 100.760 -0.016  1.00 85.62 ? 18  HIS A CD2   1 
ATOM   135  C CE1   . HIS A 1 19  ? -27.567 99.868  -0.497  1.00 85.77 ? 18  HIS A CE1   1 
ATOM   136  N NE2   . HIS A 1 19  ? -26.949 100.696 0.328   1.00 86.39 ? 18  HIS A NE2   1 
ATOM   137  N N     . ARG A 1 20  ? -23.096 97.566  -4.702  1.00 89.62 ? 19  ARG A N     1 
ATOM   138  C CA    . ARG A 1 20  ? -22.000 97.592  -5.724  1.00 92.24 ? 19  ARG A CA    1 
ATOM   139  C C     . ARG A 1 20  ? -21.631 99.022  -6.249  1.00 93.17 ? 19  ARG A C     1 
ATOM   140  O O     . ARG A 1 20  ? -22.562 99.785  -6.533  1.00 93.58 ? 19  ARG A O     1 
ATOM   141  C CB    . ARG A 1 20  ? -22.338 96.653  -6.895  1.00 92.18 ? 19  ARG A CB    1 
ATOM   142  C CG    . ARG A 1 20  ? -21.877 95.211  -6.655  1.00 92.12 ? 19  ARG A CG    1 
ATOM   143  C CD    . ARG A 1 20  ? -23.021 94.301  -6.196  1.00 90.90 ? 19  ARG A CD    1 
ATOM   144  N NE    . ARG A 1 20  ? -22.570 93.038  -5.577  1.00 90.32 ? 19  ARG A NE    1 
ATOM   145  C CZ    . ARG A 1 20  ? -21.807 92.097  -6.157  1.00 88.89 ? 19  ARG A CZ    1 
ATOM   146  N NH1   . ARG A 1 20  ? -21.332 92.248  -7.399  1.00 85.16 ? 19  ARG A NH1   1 
ATOM   147  N NH2   . ARG A 1 20  ? -21.498 90.989  -5.477  1.00 87.44 ? 19  ARG A NH2   1 
ATOM   148  N N     . PRO A 1 21  ? -20.301 99.360  -6.434  1.00 93.96 ? 20  PRO A N     1 
ATOM   149  C CA    . PRO A 1 21  ? -19.789 100.785 -6.422  1.00 93.99 ? 20  PRO A CA    1 
ATOM   150  C C     . PRO A 1 21  ? -20.530 101.784 -7.323  1.00 94.24 ? 20  PRO A C     1 
ATOM   151  O O     . PRO A 1 21  ? -20.848 101.455 -8.472  1.00 94.31 ? 20  PRO A O     1 
ATOM   152  C CB    . PRO A 1 21  ? -18.303 100.662 -6.871  1.00 94.22 ? 20  PRO A CB    1 
ATOM   153  C CG    . PRO A 1 21  ? -18.179 99.276  -7.515  1.00 93.92 ? 20  PRO A CG    1 
ATOM   154  C CD    . PRO A 1 21  ? -19.203 98.412  -6.752  1.00 94.41 ? 20  PRO A CD    1 
ATOM   155  N N     . ASN A 1 33  ? -9.191  77.829  5.830   1.00 64.57 ? 32  ASN A N     1 
ATOM   156  C CA    . ASN A 1 33  ? -7.866  78.092  5.226   1.00 63.37 ? 32  ASN A CA    1 
ATOM   157  C C     . ASN A 1 33  ? -7.423  76.892  4.321   1.00 62.74 ? 32  ASN A C     1 
ATOM   158  O O     . ASN A 1 33  ? -8.283  76.344  3.592   1.00 62.49 ? 32  ASN A O     1 
ATOM   159  C CB    . ASN A 1 33  ? -6.809  78.516  6.300   1.00 65.41 ? 32  ASN A CB    1 
ATOM   160  C CG    . ASN A 1 33  ? -6.718  77.513  7.504   1.00 69.29 ? 32  ASN A CG    1 
ATOM   161  O OD1   . ASN A 1 33  ? -6.549  77.943  8.660   1.00 73.53 ? 32  ASN A OD1   1 
ATOM   162  N ND2   . ASN A 1 33  ? -6.840  76.186  7.228   1.00 70.54 ? 32  ASN A ND2   1 
ATOM   163  N N     . SER A 1 34  ? -6.130  76.489  4.384   1.00 60.12 ? 33  SER A N     1 
ATOM   164  C CA    . SER A 1 34  ? -5.592  75.382  3.566   1.00 57.56 ? 33  SER A CA    1 
ATOM   165  C C     . SER A 1 34  ? -6.354  74.054  3.663   1.00 52.87 ? 33  SER A C     1 
ATOM   166  O O     . SER A 1 34  ? -6.655  73.589  4.748   1.00 52.57 ? 33  SER A O     1 
ATOM   167  C CB    . SER A 1 34  ? -4.115  75.142  3.858   1.00 57.17 ? 33  SER A CB    1 
ATOM   168  O OG    . SER A 1 34  ? -3.359  75.808  2.881   1.00 57.93 ? 33  SER A OG    1 
ATOM   169  N N     . PRO A 1 35  ? -6.655  73.456  2.503   1.00 49.22 ? 34  PRO A N     1 
ATOM   170  C CA    . PRO A 1 35  ? -7.204  72.123  2.388   1.00 45.66 ? 34  PRO A CA    1 
ATOM   171  C C     . PRO A 1 35  ? -6.240  71.067  2.958   1.00 42.48 ? 34  PRO A C     1 
ATOM   172  O O     . PRO A 1 35  ? -5.017  71.274  3.055   1.00 40.15 ? 34  PRO A O     1 
ATOM   173  C CB    . PRO A 1 35  ? -7.353  71.933  0.878   1.00 46.24 ? 34  PRO A CB    1 
ATOM   174  C CG    . PRO A 1 35  ? -7.283  73.313  0.292   1.00 47.92 ? 34  PRO A CG    1 
ATOM   175  C CD    . PRO A 1 35  ? -6.423  74.086  1.185   1.00 48.87 ? 34  PRO A CD    1 
ATOM   176  N N     . THR A 1 36  ? -6.813  69.944  3.362   1.00 40.13 ? 35  THR A N     1 
ATOM   177  C CA    . THR A 1 36  ? -6.024  68.868  3.931   1.00 39.11 ? 35  THR A CA    1 
ATOM   178  C C     . THR A 1 36  ? -6.064  67.541  3.190   1.00 37.62 ? 35  THR A C     1 
ATOM   179  O O     . THR A 1 36  ? -7.126  67.032  2.814   1.00 38.28 ? 35  THR A O     1 
ATOM   180  C CB    . THR A 1 36  ? -6.319  68.656  5.381   1.00 38.86 ? 35  THR A CB    1 
ATOM   181  O OG1   . THR A 1 36  ? -6.038  69.884  6.100   1.00 40.87 ? 35  THR A OG1   1 
ATOM   182  C CG2   . THR A 1 36  ? -5.416  67.559  5.882   1.00 39.04 ? 35  THR A CG2   1 
ATOM   183  N N     . VAL A 1 37  ? -4.886  66.994  2.969   1.00 35.75 ? 36  VAL A N     1 
ATOM   184  C CA    . VAL A 1 37  ? -4.810  65.646  2.447   1.00 34.89 ? 36  VAL A CA    1 
ATOM   185  C C     . VAL A 1 37  ? -4.514  64.771  3.639   1.00 34.41 ? 36  VAL A C     1 
ATOM   186  O O     . VAL A 1 37  ? -3.492  64.949  4.310   1.00 33.82 ? 36  VAL A O     1 
ATOM   187  C CB    . VAL A 1 37  ? -3.666  65.480  1.346   1.00 35.84 ? 36  VAL A CB    1 
ATOM   188  C CG1   . VAL A 1 37  ? -3.458  64.015  0.999   1.00 30.71 ? 36  VAL A CG1   1 
ATOM   189  C CG2   . VAL A 1 37  ? -4.017  66.293  0.081   1.00 33.51 ? 36  VAL A CG2   1 
ATOM   190  N N     . ILE A 1 38  ? -5.427  63.844  3.909   1.00 34.23 ? 37  ILE A N     1 
ATOM   191  C CA    . ILE A 1 38  ? -5.187  62.825  4.926   1.00 34.11 ? 37  ILE A CA    1 
ATOM   192  C C     . ILE A 1 38  ? -4.651  61.573  4.233   1.00 33.80 ? 37  ILE A C     1 
ATOM   193  O O     . ILE A 1 38  ? -5.214  61.087  3.248   1.00 33.10 ? 37  ILE A O     1 
ATOM   194  C CB    . ILE A 1 38  ? -6.478  62.469  5.699   1.00 34.68 ? 37  ILE A CB    1 
ATOM   195  C CG1   . ILE A 1 38  ? -7.075  63.722  6.372   1.00 35.68 ? 37  ILE A CG1   1 
ATOM   196  C CG2   . ILE A 1 38  ? -6.210  61.351  6.718   1.00 31.98 ? 37  ILE A CG2   1 
ATOM   197  C CD1   . ILE A 1 38  ? -8.090  63.374  7.460   1.00 35.01 ? 37  ILE A CD1   1 
ATOM   198  N N     . VAL A 1 39  ? -3.543  61.094  4.748   1.00 33.45 ? 38  VAL A N     1 
ATOM   199  C CA    . VAL A 1 39  ? -2.818  59.993  4.171   1.00 33.59 ? 38  VAL A CA    1 
ATOM   200  C C     . VAL A 1 39  ? -2.944  58.769  5.048   1.00 33.56 ? 38  VAL A C     1 
ATOM   201  O O     . VAL A 1 39  ? -2.427  58.777  6.188   1.00 34.36 ? 38  VAL A O     1 
ATOM   202  C CB    . VAL A 1 39  ? -1.296  60.383  4.005   1.00 34.05 ? 38  VAL A CB    1 
ATOM   203  C CG1   . VAL A 1 39  ? -0.496  59.262  3.401   1.00 31.30 ? 38  VAL A CG1   1 
ATOM   204  C CG2   . VAL A 1 39  ? -1.202  61.611  3.142   1.00 32.65 ? 38  VAL A CG2   1 
ATOM   205  N N     . MET A 1 40  ? -3.628  57.737  4.555   1.00 32.44 ? 39  MET A N     1 
ATOM   206  C CA    . MET A 1 40  ? -3.745  56.502  5.340   1.00 32.78 ? 39  MET A CA    1 
ATOM   207  C C     . MET A 1 40  ? -2.480  55.722  5.179   1.00 33.80 ? 39  MET A C     1 
ATOM   208  O O     . MET A 1 40  ? -1.882  55.658  4.069   1.00 34.99 ? 39  MET A O     1 
ATOM   209  C CB    . MET A 1 40  ? -4.897  55.654  4.878   1.00 31.93 ? 39  MET A CB    1 
ATOM   210  C CG    . MET A 1 40  ? -6.237  56.376  4.855   1.00 32.60 ? 39  MET A CG    1 
ATOM   211  S SD    . MET A 1 40  ? -6.696  57.175  6.469   1.00 31.19 ? 39  MET A SD    1 
ATOM   212  C CE    . MET A 1 40  ? -6.503  55.838  7.668   1.00 26.29 ? 39  MET A CE    1 
ATOM   213  N N     . VAL A 1 41  ? -2.063  55.099  6.261   1.00 33.44 ? 40  VAL A N     1 
ATOM   214  C CA    . VAL A 1 41  ? -0.888  54.248  6.216   1.00 33.31 ? 40  VAL A CA    1 
ATOM   215  C C     . VAL A 1 41  ? -1.107  52.863  6.853   1.00 34.97 ? 40  VAL A C     1 
ATOM   216  O O     . VAL A 1 41  ? -1.730  52.774  7.917   1.00 36.23 ? 40  VAL A O     1 
ATOM   217  C CB    . VAL A 1 41  ? 0.334   54.923  6.911   1.00 33.58 ? 40  VAL A CB    1 
ATOM   218  C CG1   . VAL A 1 41  ? 1.516   53.985  6.836   1.00 28.03 ? 40  VAL A CG1   1 
ATOM   219  C CG2   . VAL A 1 41  ? 0.612   56.323  6.265   1.00 28.25 ? 40  VAL A CG2   1 
ATOM   220  N N     . GLY A 1 42  ? -0.592  51.800  6.215   1.00 34.57 ? 41  GLY A N     1 
ATOM   221  C CA    . GLY A 1 42  ? -0.562  50.491  6.838   1.00 33.99 ? 41  GLY A CA    1 
ATOM   222  C C     . GLY A 1 42  ? -0.802  49.293  5.926   1.00 34.78 ? 41  GLY A C     1 
ATOM   223  O O     . GLY A 1 42  ? -1.340  49.418  4.808   1.00 33.24 ? 41  GLY A O     1 
ATOM   224  N N     . LEU A 1 43  ? -0.436  48.107  6.425   1.00 34.71 ? 42  LEU A N     1 
ATOM   225  C CA    . LEU A 1 43  ? -0.618  46.876  5.660   1.00 34.39 ? 42  LEU A CA    1 
ATOM   226  C C     . LEU A 1 43  ? -2.101  46.726  5.361   1.00 34.39 ? 42  LEU A C     1 
ATOM   227  O O     . LEU A 1 43  ? -2.947  47.401  6.033   1.00 35.38 ? 42  LEU A O     1 
ATOM   228  C CB    . LEU A 1 43  ? -0.132  45.670  6.464   1.00 34.35 ? 42  LEU A CB    1 
ATOM   229  C CG    . LEU A 1 43  ? 1.369   45.742  6.735   1.00 35.95 ? 42  LEU A CG    1 
ATOM   230  C CD1   . LEU A 1 43  ? 1.793   44.590  7.656   1.00 38.15 ? 42  LEU A CD1   1 
ATOM   231  C CD2   . LEU A 1 43  ? 2.149   45.732  5.474   1.00 34.01 ? 42  LEU A CD2   1 
ATOM   232  N N     . PRO A 1 44  ? -2.436  45.914  4.342   1.00 32.02 ? 43  PRO A N     1 
ATOM   233  C CA    . PRO A 1 44  ? -3.831  45.680  4.078   1.00 31.28 ? 43  PRO A CA    1 
ATOM   234  C C     . PRO A 1 44  ? -4.540  45.023  5.216   1.00 31.67 ? 43  PRO A C     1 
ATOM   235  O O     . PRO A 1 44  ? -3.874  44.342  6.037   1.00 30.83 ? 43  PRO A O     1 
ATOM   236  C CB    . PRO A 1 44  ? -3.815  44.773  2.830   1.00 31.06 ? 43  PRO A CB    1 
ATOM   237  C CG    . PRO A 1 44  ? -2.561  45.170  2.157   1.00 31.47 ? 43  PRO A CG    1 
ATOM   238  C CD    . PRO A 1 44  ? -1.586  45.326  3.307   1.00 31.50 ? 43  PRO A CD    1 
ATOM   239  N N     . ALA A 1 45  ? -5.884  45.243  5.250   1.00 31.48 ? 44  ALA A N     1 
ATOM   240  C CA    . ALA A 1 45  ? -6.779  44.692  6.242   1.00 30.70 ? 44  ALA A CA    1 
ATOM   241  C C     . ALA A 1 45  ? -6.359  45.256  7.576   1.00 31.44 ? 44  ALA A C     1 
ATOM   242  O O     . ALA A 1 45  ? -6.263  44.528  8.559   1.00 32.21 ? 44  ALA A O     1 
ATOM   243  C CB    . ALA A 1 45  ? -6.696  43.170  6.281   1.00 30.66 ? 44  ALA A CB    1 
ATOM   244  N N     . ARG A 1 46  ? -6.051  46.541  7.639   1.00 31.49 ? 45  ARG A N     1 
ATOM   245  C CA    . ARG A 1 46  ? -5.729  47.119  8.948   1.00 31.56 ? 45  ARG A CA    1 
ATOM   246  C C     . ARG A 1 46  ? -6.832  48.134  9.331   1.00 32.68 ? 45  ARG A C     1 
ATOM   247  O O     . ARG A 1 46  ? -6.678  48.880  10.251  1.00 33.61 ? 45  ARG A O     1 
ATOM   248  C CB    . ARG A 1 46  ? -4.369  47.794  8.934   1.00 31.01 ? 45  ARG A CB    1 
ATOM   249  C CG    . ARG A 1 46  ? -3.214  46.973  9.478   1.00 32.89 ? 45  ARG A CG    1 
ATOM   250  C CD    . ARG A 1 46  ? -3.194  45.552  8.890   1.00 35.47 ? 45  ARG A CD    1 
ATOM   251  N NE    . ARG A 1 46  ? -2.159  44.800  9.568   1.00 37.82 ? 45  ARG A NE    1 
ATOM   252  C CZ    . ARG A 1 46  ? -1.749  43.579  9.220   1.00 39.34 ? 45  ARG A CZ    1 
ATOM   253  N NH1   . ARG A 1 46  ? -2.286  42.939  8.174   1.00 35.92 ? 45  ARG A NH1   1 
ATOM   254  N NH2   . ARG A 1 46  ? -0.800  42.993  9.953   1.00 36.71 ? 45  ARG A NH2   1 
ATOM   255  N N     . GLY A 1 47  ? -7.931  48.185  8.594   1.00 33.04 ? 46  GLY A N     1 
ATOM   256  C CA    . GLY A 1 47  ? -8.980  49.116  8.915   1.00 34.39 ? 46  GLY A CA    1 
ATOM   257  C C     . GLY A 1 47  ? -8.848  50.473  8.233   1.00 35.29 ? 46  GLY A C     1 
ATOM   258  O O     . GLY A 1 47  ? -9.650  51.407  8.520   1.00 38.12 ? 46  GLY A O     1 
ATOM   259  N N     . LYS A 1 48  ? -7.898  50.614  7.320   1.00 34.06 ? 47  LYS A N     1 
ATOM   260  C CA    . LYS A 1 48  ? -7.741  51.901  6.647   1.00 34.29 ? 47  LYS A CA    1 
ATOM   261  C C     . LYS A 1 48  ? -8.985  52.414  5.899   1.00 35.13 ? 47  LYS A C     1 
ATOM   262  O O     . LYS A 1 48  ? -9.336  53.595  6.053   1.00 34.32 ? 47  LYS A O     1 
ATOM   263  C CB    . LYS A 1 48  ? -6.505  51.921  5.769   1.00 33.73 ? 47  LYS A CB    1 
ATOM   264  C CG    . LYS A 1 48  ? -5.178  51.686  6.611   1.00 32.03 ? 47  LYS A CG    1 
ATOM   265  C CD    . LYS A 1 48  ? -3.980  51.771  5.642   1.00 31.57 ? 47  LYS A CD    1 
ATOM   266  C CE    . LYS A 1 48  ? -4.247  51.027  4.300   1.00 27.51 ? 47  LYS A CE    1 
ATOM   267  N NZ    . LYS A 1 48  ? -4.383  49.488  4.521   1.00 23.70 ? 47  LYS A NZ    1 
ATOM   268  N N     . THR A 1 49  ? -9.631  51.547  5.108   1.00 34.15 ? 48  THR A N     1 
ATOM   269  C CA    . THR A 1 49  ? -10.768 51.971  4.321   1.00 34.74 ? 48  THR A CA    1 
ATOM   270  C C     . THR A 1 49  ? -11.922 52.309  5.240   1.00 34.68 ? 48  THR A C     1 
ATOM   271  O O     . THR A 1 49  ? -12.621 53.311  5.045   1.00 35.77 ? 48  THR A O     1 
ATOM   272  C CB    . THR A 1 49  ? -11.197 50.888  3.352   1.00 34.72 ? 48  THR A CB    1 
ATOM   273  O OG1   . THR A 1 49  ? -10.192 50.818  2.359   1.00 37.52 ? 48  THR A OG1   1 
ATOM   274  C CG2   . THR A 1 49  ? -12.518 51.237  2.616   1.00 33.18 ? 48  THR A CG2   1 
ATOM   275  N N     . TYR A 1 50  ? -12.086 51.469  6.250   1.00 34.24 ? 49  TYR A N     1 
ATOM   276  C CA    . TYR A 1 50  ? -13.097 51.590  7.277   1.00 33.27 ? 49  TYR A CA    1 
ATOM   277  C C     . TYR A 1 50  ? -12.965 52.986  8.002   1.00 32.89 ? 49  TYR A C     1 
ATOM   278  O O     . TYR A 1 50  ? -13.873 53.793  7.950   1.00 32.12 ? 49  TYR A O     1 
ATOM   279  C CB    . TYR A 1 50  ? -12.923 50.422  8.215   1.00 33.19 ? 49  TYR A CB    1 
ATOM   280  C CG    . TYR A 1 50  ? -13.799 50.503  9.416   1.00 36.38 ? 49  TYR A CG    1 
ATOM   281  C CD1   . TYR A 1 50  ? -13.436 51.300  10.532  1.00 34.17 ? 49  TYR A CD1   1 
ATOM   282  C CD2   . TYR A 1 50  ? -15.040 49.817  9.433   1.00 35.67 ? 49  TYR A CD2   1 
ATOM   283  C CE1   . TYR A 1 50  ? -14.258 51.393  11.616  1.00 33.71 ? 49  TYR A CE1   1 
ATOM   284  C CE2   . TYR A 1 50  ? -15.867 49.917  10.479  1.00 33.38 ? 49  TYR A CE2   1 
ATOM   285  C CZ    . TYR A 1 50  ? -15.476 50.696  11.581  1.00 36.37 ? 49  TYR A CZ    1 
ATOM   286  O OH    . TYR A 1 50  ? -16.306 50.750  12.650  1.00 38.55 ? 49  TYR A OH    1 
ATOM   287  N N     . ILE A 1 51  ? -11.804 53.277  8.582   1.00 31.53 ? 50  ILE A N     1 
ATOM   288  C CA    . ILE A 1 51  ? -11.511 54.597  9.101   1.00 30.94 ? 50  ILE A CA    1 
ATOM   289  C C     . ILE A 1 51  ? -11.730 55.697  8.057   1.00 31.14 ? 50  ILE A C     1 
ATOM   290  O O     . ILE A 1 51  ? -12.355 56.727  8.384   1.00 31.04 ? 50  ILE A O     1 
ATOM   291  C CB    . ILE A 1 51  ? -10.086 54.640  9.628   1.00 31.64 ? 50  ILE A CB    1 
ATOM   292  C CG1   . ILE A 1 51  ? -9.906  53.614  10.743  1.00 30.52 ? 50  ILE A CG1   1 
ATOM   293  C CG2   . ILE A 1 51  ? -9.564  56.082  9.919   1.00 29.09 ? 50  ILE A CG2   1 
ATOM   294  C CD1   . ILE A 1 51  ? -8.496  53.675  11.321  1.00 34.65 ? 50  ILE A CD1   1 
ATOM   295  N N     . SER A 1 52  ? -11.308 55.471  6.809   1.00 31.03 ? 51  SER A N     1 
ATOM   296  C CA    . SER A 1 52  ? -11.490 56.485  5.773   1.00 31.78 ? 51  SER A CA    1 
ATOM   297  C C     . SER A 1 52  ? -12.965 56.784  5.629   1.00 32.23 ? 51  SER A C     1 
ATOM   298  O O     . SER A 1 52  ? -13.364 57.951  5.710   1.00 31.41 ? 51  SER A O     1 
ATOM   299  C CB    . SER A 1 52  ? -10.912 56.084  4.404   1.00 31.85 ? 51  SER A CB    1 
ATOM   300  O OG    . SER A 1 52  ? -9.524  55.764  4.493   1.00 35.43 ? 51  SER A OG    1 
ATOM   301  N N     . LYS A 1 53  ? -13.789 55.743  5.448   1.00 32.60 ? 52  LYS A N     1 
ATOM   302  C CA    . LYS A 1 53  ? -15.221 56.008  5.131   1.00 34.09 ? 52  LYS A CA    1 
ATOM   303  C C     . LYS A 1 53  ? -15.927 56.645  6.330   1.00 33.55 ? 52  LYS A C     1 
ATOM   304  O O     . LYS A 1 53  ? -16.743 57.551  6.143   1.00 32.81 ? 52  LYS A O     1 
ATOM   305  C CB    . LYS A 1 53  ? -15.998 54.762  4.656   1.00 33.86 ? 52  LYS A CB    1 
ATOM   306  C CG    . LYS A 1 53  ? -15.573 54.282  3.188   1.00 36.64 ? 52  LYS A CG    1 
ATOM   307  C CD    . LYS A 1 53  ? -16.222 52.878  2.827   1.00 36.36 ? 52  LYS A CD    1 
ATOM   308  C CE    . LYS A 1 53  ? -15.835 52.398  1.415   1.00 39.97 ? 52  LYS A CE    1 
ATOM   309  N NZ    . LYS A 1 53  ? -16.309 53.294  0.310   1.00 42.46 ? 52  LYS A NZ    1 
ATOM   310  N N     . LYS A 1 54  ? -15.597 56.148  7.541   1.00 32.64 ? 53  LYS A N     1 
ATOM   311  C CA    . LYS A 1 54  ? -16.277 56.524  8.724   1.00 32.17 ? 53  LYS A CA    1 
ATOM   312  C C     . LYS A 1 54  ? -15.914 58.015  9.025   1.00 32.95 ? 53  LYS A C     1 
ATOM   313  O O     . LYS A 1 54  ? -16.797 58.890  9.202   1.00 30.67 ? 53  LYS A O     1 
ATOM   314  C CB    . LYS A 1 54  ? -15.899 55.610  9.854   1.00 32.06 ? 53  LYS A CB    1 
ATOM   315  C CG    . LYS A 1 54  ? -16.694 55.926  11.074  1.00 31.72 ? 53  LYS A CG    1 
ATOM   316  C CD    . LYS A 1 54  ? -17.052 54.729  11.873  1.00 29.98 ? 53  LYS A CD    1 
ATOM   317  C CE    . LYS A 1 54  ? -17.788 55.260  13.096  1.00 28.04 ? 53  LYS A CE    1 
ATOM   318  N NZ    . LYS A 1 54  ? -18.114 54.285  14.125  1.00 23.51 ? 53  LYS A NZ    1 
ATOM   319  N N     . LEU A 1 55  ? -14.609 58.293  8.997   1.00 32.44 ? 54  LEU A N     1 
ATOM   320  C CA    . LEU A 1 55  ? -14.156 59.618  9.227   1.00 31.76 ? 54  LEU A CA    1 
ATOM   321  C C     . LEU A 1 55  ? -14.761 60.597  8.229   1.00 31.33 ? 54  LEU A C     1 
ATOM   322  O O     . LEU A 1 55  ? -15.086 61.701  8.607   1.00 31.03 ? 54  LEU A O     1 
ATOM   323  C CB    . LEU A 1 55  ? -12.667 59.600  9.180   1.00 32.85 ? 54  LEU A CB    1 
ATOM   324  C CG    . LEU A 1 55  ? -11.915 60.876  9.403   1.00 36.52 ? 54  LEU A CG    1 
ATOM   325  C CD1   . LEU A 1 55  ? -12.296 61.424  10.822  1.00 38.68 ? 54  LEU A CD1   1 
ATOM   326  C CD2   . LEU A 1 55  ? -10.461 60.487  9.285   1.00 36.93 ? 54  LEU A CD2   1 
ATOM   327  N N     . THR A 1 56  ? -15.009 60.164  6.990   1.00 30.69 ? 55  THR A N     1 
ATOM   328  C CA    . THR A 1 56  ? -15.541 61.038  5.907   1.00 30.73 ? 55  THR A CA    1 
ATOM   329  C C     . THR A 1 56  ? -16.991 61.319  6.177   1.00 31.91 ? 55  THR A C     1 
ATOM   330  O O     . THR A 1 56  ? -17.488 62.454  5.990   1.00 32.25 ? 55  THR A O     1 
ATOM   331  C CB    . THR A 1 56  ? -15.263 60.407  4.479   1.00 30.64 ? 55  THR A CB    1 
ATOM   332  O OG1   . THR A 1 56  ? -13.848 60.488  4.206   1.00 33.32 ? 55  THR A OG1   1 
ATOM   333  C CG2   . THR A 1 56  ? -15.995 61.058  3.307   1.00 28.64 ? 55  THR A CG2   1 
ATOM   334  N N     . ARG A 1 57  ? -17.662 60.278  6.666   1.00 32.13 ? 56  ARG A N     1 
ATOM   335  C CA    . ARG A 1 57  ? -19.060 60.331  7.034   1.00 31.62 ? 56  ARG A CA    1 
ATOM   336  C C     . ARG A 1 57  ? -19.246 61.418  8.117   1.00 30.52 ? 56  ARG A C     1 
ATOM   337  O O     . ARG A 1 57  ? -20.088 62.274  7.983   1.00 29.39 ? 56  ARG A O     1 
ATOM   338  C CB    . ARG A 1 57  ? -19.481 58.923  7.470   1.00 32.51 ? 56  ARG A CB    1 
ATOM   339  C CG    . ARG A 1 57  ? -20.933 58.725  7.735   1.00 35.66 ? 56  ARG A CG    1 
ATOM   340  C CD    . ARG A 1 57  ? -21.352 57.245  7.543   1.00 36.12 ? 56  ARG A CD    1 
ATOM   341  N NE    . ARG A 1 57  ? -20.728 56.291  8.478   1.00 37.13 ? 56  ARG A NE    1 
ATOM   342  C CZ    . ARG A 1 57  ? -20.921 56.197  9.812   1.00 37.62 ? 56  ARG A CZ    1 
ATOM   343  N NH1   . ARG A 1 57  ? -21.717 57.048  10.479  1.00 39.08 ? 56  ARG A NH1   1 
ATOM   344  N NH2   . ARG A 1 57  ? -20.294 55.225  10.497  1.00 35.97 ? 56  ARG A NH2   1 
ATOM   345  N N     . TYR A 1 58  ? -18.390 61.410  9.125   1.00 30.06 ? 57  TYR A N     1 
ATOM   346  C CA    . TYR A 1 58  ? -18.443 62.336  10.221  1.00 31.45 ? 57  TYR A CA    1 
ATOM   347  C C     . TYR A 1 58  ? -18.230 63.798  9.727   1.00 32.47 ? 57  TYR A C     1 
ATOM   348  O O     . TYR A 1 58  ? -19.091 64.707  9.912   1.00 33.07 ? 57  TYR A O     1 
ATOM   349  C CB    . TYR A 1 58  ? -17.450 61.873  11.325  1.00 32.58 ? 57  TYR A CB    1 
ATOM   350  C CG    . TYR A 1 58  ? -17.257 62.901  12.433  1.00 32.70 ? 57  TYR A CG    1 
ATOM   351  C CD1   . TYR A 1 58  ? -18.189 63.027  13.479  1.00 30.35 ? 57  TYR A CD1   1 
ATOM   352  C CD2   . TYR A 1 58  ? -16.178 63.786  12.394  1.00 33.09 ? 57  TYR A CD2   1 
ATOM   353  C CE1   . TYR A 1 58  ? -18.052 64.025  14.438  1.00 29.78 ? 57  TYR A CE1   1 
ATOM   354  C CE2   . TYR A 1 58  ? -15.980 64.752  13.393  1.00 29.05 ? 57  TYR A CE2   1 
ATOM   355  C CZ    . TYR A 1 58  ? -16.935 64.881  14.375  1.00 31.05 ? 57  TYR A CZ    1 
ATOM   356  O OH    . TYR A 1 58  ? -16.746 65.805  15.330  1.00 32.51 ? 57  TYR A OH    1 
ATOM   357  N N     . LEU A 1 59  ? -17.169 63.975  8.955   1.00 32.54 ? 58  LEU A N     1 
ATOM   358  C CA    . LEU A 1 59  ? -16.736 65.269  8.493   1.00 31.66 ? 58  LEU A CA    1 
ATOM   359  C C     . LEU A 1 59  ? -17.777 65.937  7.621   1.00 32.29 ? 58  LEU A C     1 
ATOM   360  O O     . LEU A 1 59  ? -18.098 67.162  7.789   1.00 32.49 ? 58  LEU A O     1 
ATOM   361  C CB    . LEU A 1 59  ? -15.417 65.110  7.765   1.00 30.69 ? 58  LEU A CB    1 
ATOM   362  C CG    . LEU A 1 59  ? -14.296 64.887  8.810   1.00 28.37 ? 58  LEU A CG    1 
ATOM   363  C CD1   . LEU A 1 59  ? -12.991 64.522  8.125   1.00 28.20 ? 58  LEU A CD1   1 
ATOM   364  C CD2   . LEU A 1 59  ? -14.013 66.058  9.703   1.00 26.82 ? 58  LEU A CD2   1 
ATOM   365  N N     . ASN A 1 60  ? -18.308 65.163  6.684   1.00 31.70 ? 59  ASN A N     1 
ATOM   366  C CA    . ASN A 1 60  ? -19.334 65.712  5.834   1.00 31.72 ? 59  ASN A CA    1 
ATOM   367  C C     . ASN A 1 60  ? -20.540 66.103  6.691   1.00 32.12 ? 59  ASN A C     1 
ATOM   368  O O     . ASN A 1 60  ? -21.053 67.181  6.534   1.00 32.79 ? 59  ASN A O     1 
ATOM   369  C CB    . ASN A 1 60  ? -19.758 64.766  4.706   1.00 30.51 ? 59  ASN A CB    1 
ATOM   370  C CG    . ASN A 1 60  ? -18.757 64.772  3.530   1.00 32.29 ? 59  ASN A CG    1 
ATOM   371  O OD1   . ASN A 1 60  ? -18.204 63.706  3.155   1.00 34.69 ? 59  ASN A OD1   1 
ATOM   372  N ND2   . ASN A 1 60  ? -18.468 65.960  2.988   1.00 25.04 ? 59  ASN A ND2   1 
ATOM   373  N N     . TRP A 1 61  ? -20.954 65.253  7.620   1.00 30.87 ? 60  TRP A N     1 
ATOM   374  C CA    . TRP A 1 61  ? -22.150 65.548  8.397   1.00 31.04 ? 60  TRP A CA    1 
ATOM   375  C C     . TRP A 1 61  ? -21.944 66.873  9.200   1.00 30.85 ? 60  TRP A C     1 
ATOM   376  O O     . TRP A 1 61  ? -22.816 67.731  9.190   1.00 28.95 ? 60  TRP A O     1 
ATOM   377  C CB    . TRP A 1 61  ? -22.514 64.334  9.281   1.00 29.82 ? 60  TRP A CB    1 
ATOM   378  C CG    . TRP A 1 61  ? -23.695 64.507  10.164  1.00 29.96 ? 60  TRP A CG    1 
ATOM   379  C CD1   . TRP A 1 61  ? -25.053 64.292  9.850   1.00 27.12 ? 60  TRP A CD1   1 
ATOM   380  C CD2   . TRP A 1 61  ? -23.646 64.852  11.559  1.00 25.37 ? 60  TRP A CD2   1 
ATOM   381  N NE1   . TRP A 1 61  ? -25.824 64.523  10.993  1.00 28.55 ? 60  TRP A NE1   1 
ATOM   382  C CE2   . TRP A 1 61  ? -24.987 64.889  12.035  1.00 26.89 ? 60  TRP A CE2   1 
ATOM   383  C CE3   . TRP A 1 61  ? -22.601 65.147  12.435  1.00 26.42 ? 60  TRP A CE3   1 
ATOM   384  C CZ2   . TRP A 1 61  ? -25.298 65.191  13.371  1.00 28.75 ? 60  TRP A CZ2   1 
ATOM   385  C CZ3   . TRP A 1 61  ? -22.896 65.467  13.765  1.00 27.24 ? 60  TRP A CZ3   1 
ATOM   386  C CH2   . TRP A 1 61  ? -24.245 65.489  14.223  1.00 27.20 ? 60  TRP A CH2   1 
ATOM   387  N N     . ILE A 1 62  ? -20.786 67.052  9.834   1.00 30.83 ? 61  ILE A N     1 
ATOM   388  C CA    . ILE A 1 62  ? -20.561 68.331  10.521  1.00 32.34 ? 61  ILE A CA    1 
ATOM   389  C C     . ILE A 1 62  ? -20.296 69.501  9.575   1.00 33.82 ? 61  ILE A C     1 
ATOM   390  O O     . ILE A 1 62  ? -20.031 70.560  10.060  1.00 35.82 ? 61  ILE A O     1 
ATOM   391  C CB    . ILE A 1 62  ? -19.414 68.310  11.577  1.00 31.50 ? 61  ILE A CB    1 
ATOM   392  C CG1   . ILE A 1 62  ? -18.053 68.126  10.870  1.00 32.47 ? 61  ILE A CG1   1 
ATOM   393  C CG2   . ILE A 1 62  ? -19.664 67.269  12.610  1.00 28.72 ? 61  ILE A CG2   1 
ATOM   394  C CD1   . ILE A 1 62  ? -16.780 68.131  11.830  1.00 32.11 ? 61  ILE A CD1   1 
ATOM   395  N N     . GLY A 1 63  ? -20.355 69.327  8.253   1.00 34.67 ? 62  GLY A N     1 
ATOM   396  C CA    . GLY A 1 63  ? -20.236 70.439  7.299   1.00 34.23 ? 62  GLY A CA    1 
ATOM   397  C C     . GLY A 1 63  ? -18.810 70.697  6.738   1.00 35.49 ? 62  GLY A C     1 
ATOM   398  O O     . GLY A 1 63  ? -18.590 71.691  6.021   1.00 35.89 ? 62  GLY A O     1 
ATOM   399  N N     . VAL A 1 64  ? -17.838 69.822  7.038   1.00 35.13 ? 63  VAL A N     1 
ATOM   400  C CA    . VAL A 1 64  ? -16.525 69.861  6.342   1.00 34.85 ? 63  VAL A CA    1 
ATOM   401  C C     . VAL A 1 64  ? -16.468 68.949  5.094   1.00 34.85 ? 63  VAL A C     1 
ATOM   402  O O     . VAL A 1 64  ? -16.347 67.749  5.236   1.00 34.93 ? 63  VAL A O     1 
ATOM   403  C CB    . VAL A 1 64  ? -15.383 69.485  7.306   1.00 35.02 ? 63  VAL A CB    1 
ATOM   404  C CG1   . VAL A 1 64  ? -14.068 69.670  6.594   1.00 33.01 ? 63  VAL A CG1   1 
ATOM   405  C CG2   . VAL A 1 64  ? -15.474 70.338  8.609   1.00 30.77 ? 63  VAL A CG2   1 
ATOM   406  N N     . PRO A 1 65  ? -16.544 69.519  3.874   1.00 35.53 ? 64  PRO A N     1 
ATOM   407  C CA    . PRO A 1 65  ? -16.590 68.646  2.676   1.00 35.03 ? 64  PRO A CA    1 
ATOM   408  C C     . PRO A 1 65  ? -15.311 67.803  2.465   1.00 35.00 ? 64  PRO A C     1 
ATOM   409  O O     . PRO A 1 65  ? -14.159 68.303  2.461   1.00 33.35 ? 64  PRO A O     1 
ATOM   410  C CB    . PRO A 1 65  ? -16.869 69.601  1.508   1.00 35.86 ? 64  PRO A CB    1 
ATOM   411  C CG    . PRO A 1 65  ? -16.911 71.021  2.052   1.00 34.05 ? 64  PRO A CG    1 
ATOM   412  C CD    . PRO A 1 65  ? -16.495 70.963  3.518   1.00 36.71 ? 64  PRO A CD    1 
ATOM   413  N N     . THR A 1 66  ? -15.565 66.502  2.367   1.00 35.24 ? 65  THR A N     1 
ATOM   414  C CA    . THR A 1 66  ? -14.572 65.485  2.456   1.00 35.46 ? 65  THR A CA    1 
ATOM   415  C C     . THR A 1 66  ? -14.898 64.346  1.487   1.00 36.10 ? 65  THR A C     1 
ATOM   416  O O     . THR A 1 66  ? -16.075 63.915  1.324   1.00 35.22 ? 65  THR A O     1 
ATOM   417  C CB    . THR A 1 66  ? -14.492 64.982  3.914   1.00 36.72 ? 65  THR A CB    1 
ATOM   418  O OG1   . THR A 1 66  ? -14.046 66.062  4.759   1.00 36.53 ? 65  THR A OG1   1 
ATOM   419  C CG2   . THR A 1 66  ? -13.495 63.778  4.073   1.00 35.41 ? 65  THR A CG2   1 
ATOM   420  N N     . LYS A 1 67  ? -13.846 63.858  0.839   1.00 36.05 ? 66  LYS A N     1 
ATOM   421  C CA    . LYS A 1 67  ? -13.996 62.780  -0.140  1.00 36.00 ? 66  LYS A CA    1 
ATOM   422  C C     . LYS A 1 67  ? -12.889 61.752  0.000   1.00 36.07 ? 66  LYS A C     1 
ATOM   423  O O     . LYS A 1 67  ? -11.691 62.087  0.243   1.00 33.61 ? 66  LYS A O     1 
ATOM   424  C CB    . LYS A 1 67  ? -14.006 63.328  -1.561  1.00 36.30 ? 66  LYS A CB    1 
ATOM   425  C CG    . LYS A 1 67  ? -14.539 62.344  -2.513  1.00 37.39 ? 66  LYS A CG    1 
ATOM   426  C CD    . LYS A 1 67  ? -14.847 63.013  -3.812  1.00 39.74 ? 66  LYS A CD    1 
ATOM   427  C CE    . LYS A 1 67  ? -14.723 61.955  -4.885  1.00 39.33 ? 66  LYS A CE    1 
ATOM   428  N NZ    . LYS A 1 67  ? -15.394 62.374  -6.116  1.00 42.85 ? 66  LYS A NZ    1 
ATOM   429  N N     . VAL A 1 68  ? -13.303 60.488  -0.124  1.00 36.45 ? 67  VAL A N     1 
ATOM   430  C CA    . VAL A 1 68  ? -12.321 59.372  -0.107  1.00 36.89 ? 67  VAL A CA    1 
ATOM   431  C C     . VAL A 1 68  ? -11.768 59.077  -1.531  1.00 36.75 ? 67  VAL A C     1 
ATOM   432  O O     . VAL A 1 68  ? -12.528 58.966  -2.460  1.00 36.28 ? 67  VAL A O     1 
ATOM   433  C CB    . VAL A 1 68  ? -12.930 58.089  0.491   1.00 37.16 ? 67  VAL A CB    1 
ATOM   434  C CG1   . VAL A 1 68  ? -11.885 56.911  0.430   1.00 35.02 ? 67  VAL A CG1   1 
ATOM   435  C CG2   . VAL A 1 68  ? -13.411 58.344  1.906   1.00 34.21 ? 67  VAL A CG2   1 
ATOM   436  N N     . PHE A 1 69  ? -10.449 59.017  -1.685  1.00 36.82 ? 68  PHE A N     1 
ATOM   437  C CA    . PHE A 1 69  ? -9.786  58.521  -2.920  1.00 36.16 ? 68  PHE A CA    1 
ATOM   438  C C     . PHE A 1 69  ? -9.110  57.178  -2.590  1.00 36.30 ? 68  PHE A C     1 
ATOM   439  O O     . PHE A 1 69  ? -8.009  57.144  -1.959  1.00 34.45 ? 68  PHE A O     1 
ATOM   440  C CB    . PHE A 1 69  ? -8.786  59.583  -3.395  1.00 35.66 ? 68  PHE A CB    1 
ATOM   441  C CG    . PHE A 1 69  ? -9.462  60.864  -3.700  1.00 35.80 ? 68  PHE A CG    1 
ATOM   442  C CD1   . PHE A 1 69  ? -9.701  61.814  -2.668  1.00 35.54 ? 68  PHE A CD1   1 
ATOM   443  C CD2   . PHE A 1 69  ? -10.001 61.075  -4.967  1.00 31.98 ? 68  PHE A CD2   1 
ATOM   444  C CE1   . PHE A 1 69  ? -10.412 62.997  -2.941  1.00 37.32 ? 68  PHE A CE1   1 
ATOM   445  C CE2   . PHE A 1 69  ? -10.746 62.233  -5.263  1.00 34.51 ? 68  PHE A CE2   1 
ATOM   446  C CZ    . PHE A 1 69  ? -10.966 63.200  -4.233  1.00 35.93 ? 68  PHE A CZ    1 
ATOM   447  N N     . ASN A 1 70  ? -9.823  56.097  -2.944  1.00 36.12 ? 69  ASN A N     1 
ATOM   448  C CA    . ASN A 1 70  ? -9.353  54.720  -2.730  1.00 36.30 ? 69  ASN A CA    1 
ATOM   449  C C     . ASN A 1 70  ? -8.581  54.309  -4.010  1.00 36.40 ? 69  ASN A C     1 
ATOM   450  O O     . ASN A 1 70  ? -9.177  54.167  -5.097  1.00 35.59 ? 69  ASN A O     1 
ATOM   451  C CB    . ASN A 1 70  ? -10.521 53.783  -2.460  1.00 36.31 ? 69  ASN A CB    1 
ATOM   452  C CG    . ASN A 1 70  ? -10.083 52.338  -2.324  1.00 40.43 ? 69  ASN A CG    1 
ATOM   453  O OD1   . ASN A 1 70  ? -9.858  51.831  -1.220  1.00 44.41 ? 69  ASN A OD1   1 
ATOM   454  N ND2   . ASN A 1 70  ? -9.935  51.666  -3.449  1.00 44.33 ? 69  ASN A ND2   1 
ATOM   455  N N     . VAL A 1 71  ? -7.254  54.168  -3.869  1.00 36.14 ? 70  VAL A N     1 
ATOM   456  C CA    . VAL A 1 71  ? -6.354  53.872  -4.984  1.00 34.59 ? 70  VAL A CA    1 
ATOM   457  C C     . VAL A 1 71  ? -6.668  52.459  -5.601  1.00 35.99 ? 70  VAL A C     1 
ATOM   458  O O     . VAL A 1 71  ? -6.618  52.262  -6.841  1.00 35.69 ? 70  VAL A O     1 
ATOM   459  C CB    . VAL A 1 71  ? -4.894  54.061  -4.528  1.00 33.67 ? 70  VAL A CB    1 
ATOM   460  C CG1   . VAL A 1 71  ? -3.976  53.663  -5.579  1.00 31.09 ? 70  VAL A CG1   1 
ATOM   461  C CG2   . VAL A 1 71  ? -4.659  55.502  -4.157  1.00 29.60 ? 70  VAL A CG2   1 
ATOM   462  N N     . GLY A 1 72  ? -7.074  51.532  -4.741  1.00 35.88 ? 71  GLY A N     1 
ATOM   463  C CA    . GLY A 1 72  ? -7.591  50.283  -5.185  1.00 38.99 ? 71  GLY A CA    1 
ATOM   464  C C     . GLY A 1 72  ? -8.732  50.366  -6.211  1.00 41.59 ? 71  GLY A C     1 
ATOM   465  O O     . GLY A 1 72  ? -8.882  49.465  -7.066  1.00 43.51 ? 71  GLY A O     1 
ATOM   466  N N     . GLU A 1 73  ? -9.570  51.395  -6.141  1.00 41.98 ? 72  GLU A N     1 
ATOM   467  C CA    . GLU A 1 73  ? -10.711 51.476  -7.046  1.00 42.38 ? 72  GLU A CA    1 
ATOM   468  C C     . GLU A 1 73  ? -10.224 52.002  -8.352  1.00 41.98 ? 72  GLU A C     1 
ATOM   469  O O     . GLU A 1 73  ? -10.790 51.663  -9.367  1.00 42.48 ? 72  GLU A O     1 
ATOM   470  C CB    . GLU A 1 73  ? -11.825 52.345  -6.487  1.00 42.16 ? 72  GLU A CB    1 
ATOM   471  C CG    . GLU A 1 73  ? -12.861 51.555  -5.694  1.00 46.02 ? 72  GLU A CG    1 
ATOM   472  C CD    . GLU A 1 73  ? -13.628 52.472  -4.714  1.00 56.66 ? 72  GLU A CD    1 
ATOM   473  O OE1   . GLU A 1 73  ? -13.707 53.706  -4.951  1.00 56.85 ? 72  GLU A OE1   1 
ATOM   474  O OE2   . GLU A 1 73  ? -14.140 51.982  -3.668  1.00 61.79 ? 72  GLU A OE2   1 
ATOM   475  N N     . TYR A 1 74  ? -9.182  52.833  -8.320  1.00 41.26 ? 73  TYR A N     1 
ATOM   476  C CA    . TYR A 1 74  ? -8.488  53.254  -9.541  1.00 42.42 ? 73  TYR A CA    1 
ATOM   477  C C     . TYR A 1 74  ? -7.863  52.034  -10.261 1.00 43.02 ? 73  TYR A C     1 
ATOM   478  O O     . TYR A 1 74  ? -7.955  51.889  -11.465 1.00 43.11 ? 73  TYR A O     1 
ATOM   479  C CB    . TYR A 1 74  ? -7.395  54.310  -9.257  1.00 41.65 ? 73  TYR A CB    1 
ATOM   480  C CG    . TYR A 1 74  ? -7.971  55.687  -8.986  1.00 42.60 ? 73  TYR A CG    1 
ATOM   481  C CD1   . TYR A 1 74  ? -8.674  55.926  -7.796  1.00 42.08 ? 73  TYR A CD1   1 
ATOM   482  C CD2   . TYR A 1 74  ? -7.877  56.744  -9.938  1.00 42.04 ? 73  TYR A CD2   1 
ATOM   483  C CE1   . TYR A 1 74  ? -9.228  57.144  -7.515  1.00 40.19 ? 73  TYR A CE1   1 
ATOM   484  C CE2   . TYR A 1 74  ? -8.463  57.988  -9.680  1.00 41.33 ? 73  TYR A CE2   1 
ATOM   485  C CZ    . TYR A 1 74  ? -9.134  58.174  -8.431  1.00 43.17 ? 73  TYR A CZ    1 
ATOM   486  O OH    . TYR A 1 74  ? -9.729  59.344  -8.047  1.00 39.99 ? 73  TYR A OH    1 
ATOM   487  N N     . ARG A 1 75  ? -7.248  51.159  -9.481  1.00 43.69 ? 74  ARG A N     1 
ATOM   488  C CA    . ARG A 1 75  ? -6.666  49.949  -9.966  1.00 43.42 ? 74  ARG A CA    1 
ATOM   489  C C     . ARG A 1 75  ? -7.723  49.070  -10.628 1.00 43.78 ? 74  ARG A C     1 
ATOM   490  O O     . ARG A 1 75  ? -7.502  48.537  -11.713 1.00 42.01 ? 74  ARG A O     1 
ATOM   491  C CB    . ARG A 1 75  ? -6.055  49.286  -8.767  1.00 43.62 ? 74  ARG A CB    1 
ATOM   492  C CG    . ARG A 1 75  ? -4.991  48.311  -9.070  1.00 42.81 ? 74  ARG A CG    1 
ATOM   493  C CD    . ARG A 1 75  ? -5.528  46.984  -8.869  1.00 39.47 ? 74  ARG A CD    1 
ATOM   494  N NE    . ARG A 1 75  ? -5.881  46.745  -7.481  1.00 38.21 ? 74  ARG A NE    1 
ATOM   495  C CZ    . ARG A 1 75  ? -6.807  45.855  -7.136  1.00 38.14 ? 74  ARG A CZ    1 
ATOM   496  N NH1   . ARG A 1 75  ? -7.434  45.159  -8.084  1.00 39.45 ? 74  ARG A NH1   1 
ATOM   497  N NH2   . ARG A 1 75  ? -7.128  45.678  -5.867  1.00 36.49 ? 74  ARG A NH2   1 
ATOM   498  N N     . ARG A 1 76  ? -8.896  48.966  -10.006 1.00 44.32 ? 75  ARG A N     1 
ATOM   499  C CA    . ARG A 1 76  ? -9.917  48.089  -10.550 1.00 45.79 ? 75  ARG A CA    1 
ATOM   500  C C     . ARG A 1 76  ? -10.527 48.655  -11.810 1.00 47.31 ? 75  ARG A C     1 
ATOM   501  O O     . ARG A 1 76  ? -11.133 47.931  -12.592 1.00 47.75 ? 75  ARG A O     1 
ATOM   502  C CB    . ARG A 1 76  ? -11.003 47.817  -9.545  1.00 44.84 ? 75  ARG A CB    1 
ATOM   503  C CG    . ARG A 1 76  ? -10.832 46.488  -8.904  1.00 47.89 ? 75  ARG A CG    1 
ATOM   504  C CD    . ARG A 1 76  ? -12.024 46.143  -7.958  1.00 54.76 ? 75  ARG A CD    1 
ATOM   505  N NE    . ARG A 1 76  ? -12.192 47.139  -6.899  1.00 55.81 ? 75  ARG A NE    1 
ATOM   506  C CZ    . ARG A 1 76  ? -11.492 47.175  -5.771  1.00 56.55 ? 75  ARG A CZ    1 
ATOM   507  N NH1   . ARG A 1 76  ? -10.564 46.262  -5.507  1.00 56.78 ? 75  ARG A NH1   1 
ATOM   508  N NH2   . ARG A 1 76  ? -11.740 48.142  -4.903  1.00 58.14 ? 75  ARG A NH2   1 
ATOM   509  N N     . GLU A 1 77  ? -10.359 49.949  -12.007 1.00 48.76 ? 76  GLU A N     1 
ATOM   510  C CA    . GLU A 1 77  ? -10.876 50.600  -13.167 1.00 50.71 ? 76  GLU A CA    1 
ATOM   511  C C     . GLU A 1 77  ? -9.871  50.415  -14.299 1.00 50.77 ? 76  GLU A C     1 
ATOM   512  O O     . GLU A 1 77  ? -10.254 50.377  -15.440 1.00 50.71 ? 76  GLU A O     1 
ATOM   513  C CB    . GLU A 1 77  ? -11.111 52.109  -12.854 1.00 51.90 ? 76  GLU A CB    1 
ATOM   514  C CG    . GLU A 1 77  ? -11.460 53.065  -14.034 1.00 56.82 ? 76  GLU A CG    1 
ATOM   515  C CD    . GLU A 1 77  ? -12.694 52.593  -14.850 1.00 66.08 ? 76  GLU A CD    1 
ATOM   516  O OE1   . GLU A 1 77  ? -13.593 51.952  -14.223 1.00 67.78 ? 76  GLU A OE1   1 
ATOM   517  O OE2   . GLU A 1 77  ? -12.748 52.848  -16.112 1.00 67.82 ? 76  GLU A OE2   1 
ATOM   518  N N     . ALA A 1 78  ? -8.579  50.361  -14.006 1.00 50.44 ? 77  ALA A N     1 
ATOM   519  C CA    . ALA A 1 78  ? -7.621  50.304  -15.083 1.00 50.71 ? 77  ALA A CA    1 
ATOM   520  C C     . ALA A 1 78  ? -7.256  48.837  -15.441 1.00 52.12 ? 77  ALA A C     1 
ATOM   521  O O     . ALA A 1 78  ? -6.654  48.572  -16.468 1.00 51.50 ? 77  ALA A O     1 
ATOM   522  C CB    . ALA A 1 78  ? -6.399  51.134  -14.748 1.00 49.17 ? 77  ALA A CB    1 
ATOM   523  N N     . VAL A 1 79  ? -7.656  47.871  -14.636 1.00 54.20 ? 78  VAL A N     1 
ATOM   524  C CA    . VAL A 1 79  ? -7.159  46.542  -14.908 1.00 57.82 ? 78  VAL A CA    1 
ATOM   525  C C     . VAL A 1 79  ? -8.200  45.452  -15.168 1.00 60.51 ? 78  VAL A C     1 
ATOM   526  O O     . VAL A 1 79  ? -7.888  44.266  -15.020 1.00 63.01 ? 78  VAL A O     1 
ATOM   527  C CB    . VAL A 1 79  ? -6.053  46.117  -13.886 1.00 57.25 ? 78  VAL A CB    1 
ATOM   528  C CG1   . VAL A 1 79  ? -5.628  44.688  -14.106 1.00 56.84 ? 78  VAL A CG1   1 
ATOM   529  C CG2   . VAL A 1 79  ? -4.863  47.033  -14.063 1.00 55.25 ? 78  VAL A CG2   1 
ATOM   530  N N     . LYS A 1 80  ? -9.408  45.815  -15.597 1.00 62.82 ? 79  LYS A N     1 
ATOM   531  C CA    . LYS A 1 80  ? -10.387 44.813  -16.075 1.00 64.70 ? 79  LYS A CA    1 
ATOM   532  C C     . LYS A 1 80  ? -10.660 43.778  -15.000 1.00 64.68 ? 79  LYS A C     1 
ATOM   533  O O     . LYS A 1 80  ? -11.491 44.012  -14.143 1.00 65.29 ? 79  LYS A O     1 
ATOM   534  C CB    . LYS A 1 80  ? -9.924  44.094  -17.376 1.00 65.92 ? 79  LYS A CB    1 
ATOM   535  C CG    . LYS A 1 80  ? -9.929  44.934  -18.721 1.00 69.78 ? 79  LYS A CG    1 
ATOM   536  C CD    . LYS A 1 80  ? -8.478  45.403  -19.138 1.00 74.30 ? 79  LYS A CD    1 
ATOM   537  C CE    . LYS A 1 80  ? -8.259  46.951  -19.013 1.00 75.37 ? 79  LYS A CE    1 
ATOM   538  N NZ    . LYS A 1 80  ? -9.118  47.637  -17.966 1.00 76.76 ? 79  LYS A NZ    1 
ATOM   539  N N     . GLN A 1 81  ? -9.981  42.628  -15.047 1.00 64.90 ? 80  GLN A N     1 
ATOM   540  C CA    . GLN A 1 81  ? -10.218 41.580  -14.035 1.00 64.34 ? 80  GLN A CA    1 
ATOM   541  C C     . GLN A 1 81  ? -8.949  41.235  -13.266 1.00 63.54 ? 80  GLN A C     1 
ATOM   542  O O     . GLN A 1 81  ? -7.891  41.000  -13.860 1.00 63.96 ? 80  GLN A O     1 
ATOM   543  C CB    . GLN A 1 81  ? -10.885 40.293  -14.612 1.00 65.03 ? 80  GLN A CB    1 
ATOM   544  C CG    . GLN A 1 81  ? -11.488 39.289  -13.509 1.00 65.98 ? 80  GLN A CG    1 
ATOM   545  C CD    . GLN A 1 81  ? -12.279 39.983  -12.281 1.00 68.57 ? 80  GLN A CD    1 
ATOM   546  O OE1   . GLN A 1 81  ? -11.991 39.723  -11.104 1.00 65.13 ? 80  GLN A OE1   1 
ATOM   547  N NE2   . GLN A 1 81  ? -13.269 40.833  -12.595 1.00 69.30 ? 80  GLN A NE2   1 
ATOM   548  N N     . TYR A 1 82  ? -9.075  41.263  -11.939 1.00 61.56 ? 81  TYR A N     1 
ATOM   549  C CA    . TYR A 1 82  ? -8.042  40.830  -11.038 1.00 59.52 ? 81  TYR A CA    1 
ATOM   550  C C     . TYR A 1 82  ? -7.948  39.322  -11.165 1.00 58.87 ? 81  TYR A C     1 
ATOM   551  O O     . TYR A 1 82  ? -8.983  38.610  -11.348 1.00 59.33 ? 81  TYR A O     1 
ATOM   552  C CB    . TYR A 1 82  ? -8.426  41.197  -9.599  1.00 58.67 ? 81  TYR A CB    1 
ATOM   553  C CG    . TYR A 1 82  ? -7.467  40.722  -8.503  1.00 56.83 ? 81  TYR A CG    1 
ATOM   554  C CD1   . TYR A 1 82  ? -6.303  41.427  -8.223  1.00 56.66 ? 81  TYR A CD1   1 
ATOM   555  C CD2   . TYR A 1 82  ? -7.741  39.565  -7.725  1.00 55.41 ? 81  TYR A CD2   1 
ATOM   556  C CE1   . TYR A 1 82  ? -5.420  41.004  -7.184  1.00 55.34 ? 81  TYR A CE1   1 
ATOM   557  C CE2   . TYR A 1 82  ? -6.867  39.134  -6.697  1.00 49.11 ? 81  TYR A CE2   1 
ATOM   558  C CZ    . TYR A 1 82  ? -5.716  39.869  -6.424  1.00 53.62 ? 81  TYR A CZ    1 
ATOM   559  O OH    . TYR A 1 82  ? -4.814  39.503  -5.399  1.00 55.10 ? 81  TYR A OH    1 
ATOM   560  N N     . SER A 1 83  ? -6.722  38.825  -11.058 1.00 56.60 ? 82  SER A N     1 
ATOM   561  C CA    . SER A 1 83  ? -6.542  37.383  -11.076 1.00 54.75 ? 82  SER A CA    1 
ATOM   562  C C     . SER A 1 83  ? -5.913  36.838  -9.833  1.00 51.96 ? 82  SER A C     1 
ATOM   563  O O     . SER A 1 83  ? -6.349  35.765  -9.379  1.00 52.42 ? 82  SER A O     1 
ATOM   564  C CB    . SER A 1 83  ? -5.824  36.903  -12.356 1.00 55.94 ? 82  SER A CB    1 
ATOM   565  O OG    . SER A 1 83  ? -4.991  37.928  -12.893 1.00 57.60 ? 82  SER A OG    1 
ATOM   566  N N     . SER A 1 84  ? -4.905  37.548  -9.285  1.00 48.48 ? 83  SER A N     1 
ATOM   567  C CA    . SER A 1 84  ? -4.195  37.063  -8.083  1.00 44.94 ? 83  SER A CA    1 
ATOM   568  C C     . SER A 1 84  ? -3.117  37.975  -7.536  1.00 43.90 ? 83  SER A C     1 
ATOM   569  O O     . SER A 1 84  ? -2.764  38.994  -8.122  1.00 44.00 ? 83  SER A O     1 
ATOM   570  C CB    . SER A 1 84  ? -3.568  35.687  -8.315  1.00 44.79 ? 83  SER A CB    1 
ATOM   571  O OG    . SER A 1 84  ? -2.283  35.824  -8.913  1.00 40.39 ? 83  SER A OG    1 
ATOM   572  N N     . TYR A 1 85  ? -2.558  37.556  -6.420  1.00 41.51 ? 84  TYR A N     1 
ATOM   573  C CA    . TYR A 1 85  ? -1.666  38.392  -5.703  1.00 42.19 ? 84  TYR A CA    1 
ATOM   574  C C     . TYR A 1 85  ? -0.382  38.622  -6.494  1.00 41.32 ? 84  TYR A C     1 
ATOM   575  O O     . TYR A 1 85  ? 0.425   39.510  -6.151  1.00 40.59 ? 84  TYR A O     1 
ATOM   576  C CB    . TYR A 1 85  ? -1.370  37.735  -4.374  1.00 43.35 ? 84  TYR A CB    1 
ATOM   577  C CG    . TYR A 1 85  ? -0.482  36.549  -4.550  1.00 48.07 ? 84  TYR A CG    1 
ATOM   578  C CD1   . TYR A 1 85  ? -1.018  35.273  -4.854  1.00 48.20 ? 84  TYR A CD1   1 
ATOM   579  C CD2   . TYR A 1 85  ? 0.923   36.705  -4.490  1.00 47.71 ? 84  TYR A CD2   1 
ATOM   580  C CE1   . TYR A 1 85  ? -0.192  34.217  -5.062  1.00 46.94 ? 84  TYR A CE1   1 
ATOM   581  C CE2   . TYR A 1 85  ? 1.734   35.666  -4.676  1.00 48.38 ? 84  TYR A CE2   1 
ATOM   582  C CZ    . TYR A 1 85  ? 1.185   34.427  -4.957  1.00 48.92 ? 84  TYR A CZ    1 
ATOM   583  O OH    . TYR A 1 85  ? 2.067   33.393  -5.109  1.00 52.04 ? 84  TYR A OH    1 
ATOM   584  N N     . ASN A 1 86  ? -0.186  37.828  -7.556  1.00 39.55 ? 85  ASN A N     1 
ATOM   585  C CA    . ASN A 1 86  ? 0.990   38.022  -8.400  1.00 38.27 ? 85  ASN A CA    1 
ATOM   586  C C     . ASN A 1 86  ? 1.077   39.461  -8.889  1.00 37.33 ? 85  ASN A C     1 
ATOM   587  O O     . ASN A 1 86  ? 2.168   39.970  -9.102  1.00 35.56 ? 85  ASN A O     1 
ATOM   588  C CB    . ASN A 1 86  ? 0.994   37.068  -9.598  1.00 37.69 ? 85  ASN A CB    1 
ATOM   589  C CG    . ASN A 1 86  ? 1.419   35.670  -9.238  1.00 37.31 ? 85  ASN A CG    1 
ATOM   590  O OD1   . ASN A 1 86  ? 2.449   35.436  -8.637  1.00 33.72 ? 85  ASN A OD1   1 
ATOM   591  N ND2   . ASN A 1 86  ? 0.629   34.723  -9.653  1.00 41.11 ? 85  ASN A ND2   1 
ATOM   592  N N     . PHE A 1 87  ? -0.093  40.096  -9.053  1.00 37.15 ? 86  PHE A N     1 
ATOM   593  C CA    . PHE A 1 87  ? -0.165  41.504  -9.493  1.00 37.00 ? 86  PHE A CA    1 
ATOM   594  C C     . PHE A 1 87  ? 0.634   42.414  -8.534  1.00 36.49 ? 86  PHE A C     1 
ATOM   595  O O     . PHE A 1 87  ? 1.236   43.411  -8.954  1.00 34.80 ? 86  PHE A O     1 
ATOM   596  C CB    . PHE A 1 87  ? -1.642  41.993  -9.647  1.00 37.51 ? 86  PHE A CB    1 
ATOM   597  C CG    . PHE A 1 87  ? -1.747  43.388  -10.162 1.00 36.92 ? 86  PHE A CG    1 
ATOM   598  C CD1   . PHE A 1 87  ? -1.694  44.479  -9.281  1.00 37.59 ? 86  PHE A CD1   1 
ATOM   599  C CD2   . PHE A 1 87  ? -1.835  43.628  -11.537 1.00 35.82 ? 86  PHE A CD2   1 
ATOM   600  C CE1   . PHE A 1 87  ? -1.705  45.819  -9.777  1.00 37.53 ? 86  PHE A CE1   1 
ATOM   601  C CE2   . PHE A 1 87  ? -1.870  44.936  -12.065 1.00 34.91 ? 86  PHE A CE2   1 
ATOM   602  C CZ    . PHE A 1 87  ? -1.798  46.050  -11.174 1.00 38.47 ? 86  PHE A CZ    1 
ATOM   603  N N     . PHE A 1 88  ? 0.685   42.021  -7.262  1.00 36.10 ? 87  PHE A N     1 
ATOM   604  C CA    . PHE A 1 88  ? 1.266   42.882  -6.217  1.00 37.09 ? 87  PHE A CA    1 
ATOM   605  C C     . PHE A 1 88  ? 2.727   42.612  -5.846  1.00 37.14 ? 87  PHE A C     1 
ATOM   606  O O     . PHE A 1 88  ? 3.269   43.257  -4.974  1.00 36.88 ? 87  PHE A O     1 
ATOM   607  C CB    . PHE A 1 88  ? 0.381   42.830  -4.956  1.00 35.78 ? 87  PHE A CB    1 
ATOM   608  C CG    . PHE A 1 88  ? -0.917  43.510  -5.135  1.00 37.77 ? 87  PHE A CG    1 
ATOM   609  C CD1   . PHE A 1 88  ? -1.010  44.907  -5.007  1.00 39.35 ? 87  PHE A CD1   1 
ATOM   610  C CD2   . PHE A 1 88  ? -2.059  42.792  -5.444  1.00 39.82 ? 87  PHE A CD2   1 
ATOM   611  C CE1   . PHE A 1 88  ? -2.233  45.593  -5.183  1.00 37.57 ? 87  PHE A CE1   1 
ATOM   612  C CE2   . PHE A 1 88  ? -3.310  43.460  -5.631  1.00 40.45 ? 87  PHE A CE2   1 
ATOM   613  C CZ    . PHE A 1 88  ? -3.385  44.882  -5.508  1.00 37.29 ? 87  PHE A CZ    1 
ATOM   614  N N     . ARG A 1 89  ? 3.358   41.648  -6.503  1.00 38.27 ? 88  ARG A N     1 
ATOM   615  C CA    . ARG A 1 89  ? 4.722   41.230  -6.137  1.00 37.63 ? 88  ARG A CA    1 
ATOM   616  C C     . ARG A 1 89  ? 5.648   42.386  -6.376  1.00 36.46 ? 88  ARG A C     1 
ATOM   617  O O     . ARG A 1 89  ? 5.455   43.113  -7.300  1.00 37.25 ? 88  ARG A O     1 
ATOM   618  C CB    . ARG A 1 89  ? 5.160   40.030  -6.989  1.00 37.74 ? 88  ARG A CB    1 
ATOM   619  C CG    . ARG A 1 89  ? 4.573   38.693  -6.641  1.00 36.93 ? 88  ARG A CG    1 
ATOM   620  C CD    . ARG A 1 89  ? 4.511   37.779  -7.913  1.00 36.85 ? 88  ARG A CD    1 
ATOM   621  N NE    . ARG A 1 89  ? 5.833   37.623  -8.497  1.00 38.44 ? 88  ARG A NE    1 
ATOM   622  C CZ    . ARG A 1 89  ? 6.230   36.618  -9.299  1.00 42.32 ? 88  ARG A CZ    1 
ATOM   623  N NH1   . ARG A 1 89  ? 5.372   35.666  -9.668  1.00 41.00 ? 88  ARG A NH1   1 
ATOM   624  N NH2   . ARG A 1 89  ? 7.499   36.572  -9.754  1.00 37.04 ? 88  ARG A NH2   1 
ATOM   625  N N     . PRO A 1 90  ? 6.646   42.579  -5.529  1.00 37.34 ? 89  PRO A N     1 
ATOM   626  C CA    . PRO A 1 90  ? 7.721   43.608  -5.811  1.00 37.35 ? 89  PRO A CA    1 
ATOM   627  C C     . PRO A 1 90  ? 8.479   43.414  -7.109  1.00 38.95 ? 89  PRO A C     1 
ATOM   628  O O     . PRO A 1 90  ? 9.049   44.406  -7.608  1.00 40.16 ? 89  PRO A O     1 
ATOM   629  C CB    . PRO A 1 90  ? 8.746   43.439  -4.666  1.00 36.85 ? 89  PRO A CB    1 
ATOM   630  C CG    . PRO A 1 90  ? 7.993   42.603  -3.562  1.00 38.06 ? 89  PRO A CG    1 
ATOM   631  C CD    . PRO A 1 90  ? 6.796   41.873  -4.231  1.00 36.44 ? 89  PRO A CD    1 
ATOM   632  N N     . ASP A 1 91  ? 8.585   42.169  -7.632  1.00 38.69 ? 90  ASP A N     1 
ATOM   633  C CA    . ASP A 1 91  ? 9.358   41.951  -8.894  1.00 38.51 ? 90  ASP A CA    1 
ATOM   634  C C     . ASP A 1 91  ? 8.540   42.309  -10.149 1.00 39.06 ? 90  ASP A C     1 
ATOM   635  O O     . ASP A 1 91  ? 9.081   42.242  -11.287 1.00 38.00 ? 90  ASP A O     1 
ATOM   636  C CB    . ASP A 1 91  ? 10.030  40.549  -8.997  1.00 36.72 ? 90  ASP A CB    1 
ATOM   637  C CG    . ASP A 1 91  ? 9.039   39.408  -8.855  1.00 40.23 ? 90  ASP A CG    1 
ATOM   638  O OD1   . ASP A 1 91  ? 7.810   39.661  -8.719  1.00 38.82 ? 90  ASP A OD1   1 
ATOM   639  O OD2   . ASP A 1 91  ? 9.461   38.223  -8.889  1.00 40.81 ? 90  ASP A OD2   1 
ATOM   640  N N     . ASN A 1 92  ? 7.254   42.677  -9.943  1.00 39.19 ? 91  ASN A N     1 
ATOM   641  C CA    . ASN A 1 92  ? 6.311   42.779  -11.061 1.00 39.95 ? 91  ASN A CA    1 
ATOM   642  C C     . ASN A 1 92  ? 6.411   44.147  -11.664 1.00 41.69 ? 91  ASN A C     1 
ATOM   643  O O     . ASN A 1 92  ? 5.592   44.984  -11.376 1.00 44.06 ? 91  ASN A O     1 
ATOM   644  C CB    . ASN A 1 92  ? 4.865   42.530  -10.627 1.00 38.86 ? 91  ASN A CB    1 
ATOM   645  C CG    . ASN A 1 92  ? 3.881   42.513  -11.840 1.00 36.93 ? 91  ASN A CG    1 
ATOM   646  O OD1   . ASN A 1 92  ? 4.129   43.133  -12.906 1.00 31.54 ? 91  ASN A OD1   1 
ATOM   647  N ND2   . ASN A 1 92  ? 2.785   41.799  -11.678 1.00 31.02 ? 91  ASN A ND2   1 
ATOM   648  N N     . GLU A 1 93  ? 7.440   44.409  -12.450 1.00 42.76 ? 92  GLU A N     1 
ATOM   649  C CA    . GLU A 1 93  ? 7.710   45.741  -12.936 1.00 43.73 ? 92  GLU A CA    1 
ATOM   650  C C     . GLU A 1 93  ? 6.524   46.379  -13.692 1.00 43.00 ? 92  GLU A C     1 
ATOM   651  O O     . GLU A 1 93  ? 6.237   47.544  -13.452 1.00 43.32 ? 92  GLU A O     1 
ATOM   652  C CB    . GLU A 1 93  ? 8.973   45.665  -13.774 1.00 43.22 ? 92  GLU A CB    1 
ATOM   653  C CG    . GLU A 1 93  ? 9.520   46.873  -14.440 1.00 45.13 ? 92  GLU A CG    1 
ATOM   654  C CD    . GLU A 1 93  ? 10.681  46.435  -15.376 1.00 49.04 ? 92  GLU A CD    1 
ATOM   655  O OE1   . GLU A 1 93  ? 11.834  46.274  -14.891 1.00 57.16 ? 92  GLU A OE1   1 
ATOM   656  O OE2   . GLU A 1 93  ? 10.445  46.174  -16.581 1.00 52.80 ? 92  GLU A OE2   1 
ATOM   657  N N     . GLU A 1 94  ? 5.832   45.664  -14.579 1.00 42.37 ? 93  GLU A N     1 
ATOM   658  C CA    . GLU A 1 94  ? 4.674   46.255  -15.261 1.00 43.15 ? 93  GLU A CA    1 
ATOM   659  C C     . GLU A 1 94  ? 3.571   46.701  -14.249 1.00 42.86 ? 93  GLU A C     1 
ATOM   660  O O     . GLU A 1 94  ? 3.063   47.829  -14.327 1.00 43.26 ? 93  GLU A O     1 
ATOM   661  C CB    . GLU A 1 94  ? 4.098   45.363  -16.362 1.00 41.26 ? 93  GLU A CB    1 
ATOM   662  C CG    . GLU A 1 94  ? 3.182   46.100  -17.343 1.00 45.00 ? 93  GLU A CG    1 
ATOM   663  C CD    . GLU A 1 94  ? 2.467   45.172  -18.393 1.00 47.50 ? 93  GLU A CD    1 
ATOM   664  O OE1   . GLU A 1 94  ? 2.759   45.317  -19.601 1.00 56.06 ? 93  GLU A OE1   1 
ATOM   665  O OE2   . GLU A 1 94  ? 1.598   44.329  -18.050 1.00 48.40 ? 93  GLU A OE2   1 
ATOM   666  N N     . ALA A 1 95  ? 3.233   45.845  -13.293 1.00 42.04 ? 94  ALA A N     1 
ATOM   667  C CA    . ALA A 1 95  ? 2.227   46.197  -12.325 1.00 42.10 ? 94  ALA A CA    1 
ATOM   668  C C     . ALA A 1 95  ? 2.658   47.352  -11.419 1.00 43.21 ? 94  ALA A C     1 
ATOM   669  O O     . ALA A 1 95  ? 1.794   48.122  -10.980 1.00 43.36 ? 94  ALA A O     1 
ATOM   670  C CB    . ALA A 1 95  ? 1.788   45.014  -11.502 1.00 40.07 ? 94  ALA A CB    1 
ATOM   671  N N     . MET A 1 96  ? 3.954   47.442  -11.101 1.00 43.81 ? 95  MET A N     1 
ATOM   672  C CA    . MET A 1 96  ? 4.487   48.571  -10.349 1.00 44.81 ? 95  MET A CA    1 
ATOM   673  C C     . MET A 1 96  ? 4.246   49.867  -11.164 1.00 45.29 ? 95  MET A C     1 
ATOM   674  O O     . MET A 1 96  ? 3.905   50.879  -10.590 1.00 45.16 ? 95  MET A O     1 
ATOM   675  C CB    . MET A 1 96  ? 5.989   48.405  -10.002 1.00 44.47 ? 95  MET A CB    1 
ATOM   676  C CG    . MET A 1 96  ? 6.358   47.300  -8.967  1.00 46.79 ? 95  MET A CG    1 
ATOM   677  S SD    . MET A 1 96  ? 5.837   47.619  -7.254  1.00 54.16 ? 95  MET A SD    1 
ATOM   678  C CE    . MET A 1 96  ? 7.067   48.786  -6.628  1.00 49.62 ? 95  MET A CE    1 
ATOM   679  N N     . LYS A 1 97  ? 4.405   49.837  -12.490 1.00 45.76 ? 96  LYS A N     1 
ATOM   680  C CA    . LYS A 1 97  ? 4.077   51.005  -13.322 1.00 46.35 ? 96  LYS A CA    1 
ATOM   681  C C     . LYS A 1 97  ? 2.575   51.346  -13.219 1.00 44.48 ? 96  LYS A C     1 
ATOM   682  O O     . LYS A 1 97  ? 2.212   52.511  -13.187 1.00 43.90 ? 96  LYS A O     1 
ATOM   683  C CB    . LYS A 1 97  ? 4.470   50.780  -14.784 1.00 45.35 ? 96  LYS A CB    1 
ATOM   684  C CG    . LYS A 1 97  ? 5.805   51.399  -15.158 1.00 49.67 ? 96  LYS A CG    1 
ATOM   685  C CD    . LYS A 1 97  ? 6.271   51.064  -16.656 1.00 51.02 ? 96  LYS A CD    1 
ATOM   686  C CE    . LYS A 1 97  ? 7.198   49.766  -16.808 1.00 57.97 ? 96  LYS A CE    1 
ATOM   687  N NZ    . LYS A 1 97  ? 7.221   49.267  -18.244 1.00 55.74 ? 96  LYS A NZ    1 
ATOM   688  N N     . VAL A 1 98  ? 1.719   50.332  -13.142 1.00 42.45 ? 97  VAL A N     1 
ATOM   689  C CA    . VAL A 1 98  ? 0.304   50.607  -13.128 1.00 42.67 ? 97  VAL A CA    1 
ATOM   690  C C     . VAL A 1 98  ? -0.158  51.174  -11.759 1.00 43.02 ? 97  VAL A C     1 
ATOM   691  O O     . VAL A 1 98  ? -0.925  52.156  -11.676 1.00 43.68 ? 97  VAL A O     1 
ATOM   692  C CB    . VAL A 1 98  ? -0.545  49.414  -13.586 1.00 42.40 ? 97  VAL A CB    1 
ATOM   693  C CG1   . VAL A 1 98  ? -2.002  49.698  -13.341 1.00 41.04 ? 97  VAL A CG1   1 
ATOM   694  C CG2   . VAL A 1 98  ? -0.335  49.166  -15.086 1.00 43.27 ? 97  VAL A CG2   1 
ATOM   695  N N     . ARG A 1 99  ? 0.360   50.568  -10.700 1.00 41.84 ? 98  ARG A N     1 
ATOM   696  C CA    . ARG A 1 99  ? 0.139   51.001  -9.365  1.00 39.95 ? 98  ARG A CA    1 
ATOM   697  C C     . ARG A 1 99  ? 0.613   52.436  -9.182  1.00 39.74 ? 98  ARG A C     1 
ATOM   698  O O     . ARG A 1 99  ? -0.147  53.290  -8.768  1.00 39.11 ? 98  ARG A O     1 
ATOM   699  C CB    . ARG A 1 99  ? 0.789   50.021  -8.400  1.00 39.88 ? 98  ARG A CB    1 
ATOM   700  C CG    . ARG A 1 99  ? 0.146   48.623  -8.425  1.00 38.44 ? 98  ARG A CG    1 
ATOM   701  C CD    . ARG A 1 99  ? 0.964   47.635  -7.591  1.00 37.50 ? 98  ARG A CD    1 
ATOM   702  N NE    . ARG A 1 99  ? 1.087   48.108  -6.212  1.00 41.29 ? 98  ARG A NE    1 
ATOM   703  C CZ    . ARG A 1 99  ? 1.940   47.638  -5.297  1.00 43.55 ? 98  ARG A CZ    1 
ATOM   704  N NH1   . ARG A 1 99  ? 2.784   46.662  -5.613  1.00 47.59 ? 98  ARG A NH1   1 
ATOM   705  N NH2   . ARG A 1 99  ? 1.938   48.124  -4.051  1.00 42.18 ? 98  ARG A NH2   1 
ATOM   706  N N     . LYS A 1 100 ? 1.840   52.737  -9.528  1.00 39.55 ? 99  LYS A N     1 
ATOM   707  C CA    . LYS A 1 100 ? 2.279   54.139  -9.450  1.00 39.95 ? 99  LYS A CA    1 
ATOM   708  C C     . LYS A 1 100 ? 1.330   55.136  -10.171 1.00 40.22 ? 99  LYS A C     1 
ATOM   709  O O     . LYS A 1 100 ? 0.990   56.203  -9.593  1.00 40.16 ? 99  LYS A O     1 
ATOM   710  C CB    . LYS A 1 100 ? 3.693   54.282  -9.968  1.00 38.92 ? 99  LYS A CB    1 
ATOM   711  C CG    . LYS A 1 100 ? 4.131   55.672  -10.150 1.00 44.10 ? 99  LYS A CG    1 
ATOM   712  C CD    . LYS A 1 100 ? 5.641   55.781  -10.049 1.00 52.03 ? 99  LYS A CD    1 
ATOM   713  C CE    . LYS A 1 100 ? 6.084   57.129  -10.621 1.00 56.34 ? 99  LYS A CE    1 
ATOM   714  N NZ    . LYS A 1 100 ? 7.156   57.803  -9.782  1.00 59.21 ? 99  LYS A NZ    1 
ATOM   715  N N     . GLN A 1 101 ? 0.937   54.790  -11.408 1.00 39.65 ? 100 GLN A N     1 
ATOM   716  C CA    . GLN A 1 101 ? 0.080   55.613  -12.256 1.00 41.14 ? 100 GLN A CA    1 
ATOM   717  C C     . GLN A 1 101 ? -1.319  55.778  -11.653 1.00 40.44 ? 100 GLN A C     1 
ATOM   718  O O     . GLN A 1 101 ? -1.951  56.842  -11.787 1.00 38.92 ? 100 GLN A O     1 
ATOM   719  C CB    . GLN A 1 101 ? -0.079  54.998  -13.661 1.00 41.06 ? 100 GLN A CB    1 
ATOM   720  C CG    . GLN A 1 101 ? 0.993   55.364  -14.692 1.00 43.24 ? 100 GLN A CG    1 
ATOM   721  C CD    . GLN A 1 101 ? 1.042   54.361  -15.939 1.00 45.66 ? 100 GLN A CD    1 
ATOM   722  O OE1   . GLN A 1 101 ? 0.295   53.321  -16.041 1.00 49.15 ? 100 GLN A OE1   1 
ATOM   723  N NE2   . GLN A 1 101 ? 1.958   54.680  -16.878 1.00 47.37 ? 100 GLN A NE2   1 
ATOM   724  N N     . CYS A 1 102 ? -1.791  54.690  -11.035 1.00 40.11 ? 101 CYS A N     1 
ATOM   725  C CA    . CYS A 1 102 ? -3.021  54.660  -10.258 1.00 40.17 ? 101 CYS A CA    1 
ATOM   726  C C     . CYS A 1 102 ? -2.976  55.650  -9.066  1.00 39.38 ? 101 CYS A C     1 
ATOM   727  O O     . CYS A 1 102 ? -3.855  56.501  -8.951  1.00 38.55 ? 101 CYS A O     1 
ATOM   728  C CB    . CYS A 1 102 ? -3.274  53.233  -9.769  1.00 40.50 ? 101 CYS A CB    1 
ATOM   729  S SG    . CYS A 1 102 ? -4.093  52.245  -11.000 1.00 41.82 ? 101 CYS A SG    1 
ATOM   730  N N     . ALA A 1 103 ? -1.937  55.560  -8.230  1.00 38.28 ? 102 ALA A N     1 
ATOM   731  C CA    . ALA A 1 103 ? -1.676  56.579  -7.191  1.00 38.68 ? 102 ALA A CA    1 
ATOM   732  C C     . ALA A 1 103 ? -1.715  58.006  -7.759  1.00 39.04 ? 102 ALA A C     1 
ATOM   733  O O     . ALA A 1 103 ? -2.515  58.835  -7.269  1.00 39.82 ? 102 ALA A O     1 
ATOM   734  C CB    . ALA A 1 103 ? -0.362  56.318  -6.437  1.00 37.66 ? 102 ALA A CB    1 
ATOM   735  N N     . LEU A 1 104 ? -0.914  58.275  -8.806  1.00 38.25 ? 103 LEU A N     1 
ATOM   736  C CA    . LEU A 1 104 ? -0.812  59.629  -9.404  1.00 37.05 ? 103 LEU A CA    1 
ATOM   737  C C     . LEU A 1 104 ? -2.113  60.095  -9.960  1.00 35.35 ? 103 LEU A C     1 
ATOM   738  O O     . LEU A 1 104 ? -2.407  61.268  -9.877  1.00 33.79 ? 103 LEU A O     1 
ATOM   739  C CB    . LEU A 1 104 ? 0.240   59.708  -10.517 1.00 37.55 ? 103 LEU A CB    1 
ATOM   740  C CG    . LEU A 1 104 ? 1.686   59.566  -9.962  1.00 40.56 ? 103 LEU A CG    1 
ATOM   741  C CD1   . LEU A 1 104 ? 2.657   59.297  -11.098 1.00 36.02 ? 103 LEU A CD1   1 
ATOM   742  C CD2   . LEU A 1 104 ? 2.185   60.711  -8.991  1.00 33.16 ? 103 LEU A CD2   1 
ATOM   743  N N     . ALA A 1 105 ? -2.914  59.178  -10.490 1.00 35.21 ? 104 ALA A N     1 
ATOM   744  C CA    . ALA A 1 105 ? -4.216  59.577  -11.051 1.00 34.92 ? 104 ALA A CA    1 
ATOM   745  C C     . ALA A 1 105 ? -5.175  59.981  -9.893  1.00 36.93 ? 104 ALA A C     1 
ATOM   746  O O     . ALA A 1 105 ? -5.887  61.007  -10.019 1.00 37.72 ? 104 ALA A O     1 
ATOM   747  C CB    . ALA A 1 105 ? -4.797  58.536  -11.913 1.00 31.25 ? 104 ALA A CB    1 
ATOM   748  N N     . ALA A 1 106 ? -5.106  59.232  -8.770  1.00 36.69 ? 105 ALA A N     1 
ATOM   749  C CA    . ALA A 1 106 ? -5.857  59.521  -7.567  1.00 37.14 ? 105 ALA A CA    1 
ATOM   750  C C     . ALA A 1 106 ? -5.445  60.876  -7.053  1.00 37.76 ? 105 ALA A C     1 
ATOM   751  O O     . ALA A 1 106 ? -6.318  61.712  -6.764  1.00 38.55 ? 105 ALA A O     1 
ATOM   752  C CB    . ALA A 1 106 ? -5.673  58.437  -6.495  1.00 36.40 ? 105 ALA A CB    1 
ATOM   753  N N     . LEU A 1 107 ? -4.142  61.127  -6.987  1.00 38.06 ? 106 LEU A N     1 
ATOM   754  C CA    . LEU A 1 107 ? -3.649  62.441  -6.598  1.00 38.56 ? 106 LEU A CA    1 
ATOM   755  C C     . LEU A 1 107 ? -4.153  63.610  -7.501  1.00 40.86 ? 106 LEU A C     1 
ATOM   756  O O     . LEU A 1 107 ? -4.460  64.690  -7.019  1.00 42.21 ? 106 LEU A O     1 
ATOM   757  C CB    . LEU A 1 107 ? -2.151  62.439  -6.499  1.00 36.55 ? 106 LEU A CB    1 
ATOM   758  C CG    . LEU A 1 107 ? -1.652  61.696  -5.265  1.00 35.94 ? 106 LEU A CG    1 
ATOM   759  C CD1   . LEU A 1 107 ? -0.124  61.630  -5.273  1.00 30.05 ? 106 LEU A CD1   1 
ATOM   760  C CD2   . LEU A 1 107 ? -2.170  62.367  -3.965  1.00 29.47 ? 106 LEU A CD2   1 
ATOM   761  N N     . ARG A 1 108 ? -4.235  63.380  -8.804  1.00 41.52 ? 107 ARG A N     1 
ATOM   762  C CA    . ARG A 1 108 ? -4.684  64.363  -9.721  1.00 42.21 ? 107 ARG A CA    1 
ATOM   763  C C     . ARG A 1 108 ? -6.087  64.759  -9.315  1.00 41.46 ? 107 ARG A C     1 
ATOM   764  O O     . ARG A 1 108 ? -6.398  65.949  -9.287  1.00 40.36 ? 107 ARG A O     1 
ATOM   765  C CB    . ARG A 1 108 ? -4.630  63.762  -11.115 1.00 41.95 ? 107 ARG A CB    1 
ATOM   766  C CG    . ARG A 1 108 ? -5.468  64.350  -12.272 1.00 45.61 ? 107 ARG A CG    1 
ATOM   767  C CD    . ARG A 1 108 ? -4.787  63.830  -13.630 1.00 47.96 ? 107 ARG A CD    1 
ATOM   768  N NE    . ARG A 1 108 ? -3.382  63.342  -13.411 1.00 53.96 ? 107 ARG A NE    1 
ATOM   769  C CZ    . ARG A 1 108 ? -2.908  62.117  -13.771 1.00 57.85 ? 107 ARG A CZ    1 
ATOM   770  N NH1   . ARG A 1 108 ? -3.678  61.225  -14.417 1.00 56.40 ? 107 ARG A NH1   1 
ATOM   771  N NH2   . ARG A 1 108 ? -1.642  61.768  -13.504 1.00 55.47 ? 107 ARG A NH2   1 
ATOM   772  N N     . ASP A 1 109 ? -6.917  63.755  -8.992  1.00 41.31 ? 108 ASP A N     1 
ATOM   773  C CA    . ASP A 1 109 ? -8.290  63.951  -8.559  1.00 39.81 ? 108 ASP A CA    1 
ATOM   774  C C     . ASP A 1 109 ? -8.363  64.737  -7.223  1.00 39.73 ? 108 ASP A C     1 
ATOM   775  O O     . ASP A 1 109 ? -9.117  65.718  -7.106  1.00 38.95 ? 108 ASP A O     1 
ATOM   776  C CB    . ASP A 1 109 ? -8.953  62.604  -8.511  1.00 39.56 ? 108 ASP A CB    1 
ATOM   777  C CG    . ASP A 1 109 ? -9.293  62.087  -9.923  1.00 39.22 ? 108 ASP A CG    1 
ATOM   778  O OD1   . ASP A 1 109 ? -9.104  62.866  -10.872 1.00 41.59 ? 108 ASP A OD1   1 
ATOM   779  O OD2   . ASP A 1 109 ? -9.777  60.947  -10.109 1.00 32.69 ? 108 ASP A OD2   1 
ATOM   780  N N     . VAL A 1 110 ? -7.498  64.371  -6.277  1.00 38.42 ? 109 VAL A N     1 
ATOM   781  C CA    . VAL A 1 110 ? -7.367  65.074  -5.026  1.00 37.48 ? 109 VAL A CA    1 
ATOM   782  C C     . VAL A 1 110 ? -7.142  66.562  -5.314  1.00 39.74 ? 109 VAL A C     1 
ATOM   783  O O     . VAL A 1 110 ? -7.732  67.409  -4.646  1.00 40.21 ? 109 VAL A O     1 
ATOM   784  C CB    . VAL A 1 110 ? -6.159  64.562  -4.245  1.00 37.54 ? 109 VAL A CB    1 
ATOM   785  C CG1   . VAL A 1 110 ? -5.793  65.521  -3.112  1.00 34.46 ? 109 VAL A CG1   1 
ATOM   786  C CG2   . VAL A 1 110 ? -6.383  63.144  -3.778  1.00 31.99 ? 109 VAL A CG2   1 
ATOM   787  N N     . LYS A 1 111 ? -6.309  66.871  -6.320  1.00 40.01 ? 110 LYS A N     1 
ATOM   788  C CA    . LYS A 1 111 ? -5.950  68.239  -6.673  1.00 40.62 ? 110 LYS A CA    1 
ATOM   789  C C     . LYS A 1 111 ? -7.174  68.936  -7.196  1.00 40.69 ? 110 LYS A C     1 
ATOM   790  O O     . LYS A 1 111 ? -7.600  70.004  -6.742  1.00 41.24 ? 110 LYS A O     1 
ATOM   791  C CB    . LYS A 1 111 ? -4.840  68.262  -7.712  1.00 40.45 ? 110 LYS A CB    1 
ATOM   792  C CG    . LYS A 1 111 ? -4.238  69.620  -7.896  1.00 40.81 ? 110 LYS A CG    1 
ATOM   793  C CD    . LYS A 1 111 ? -3.206  69.658  -9.010  1.00 43.57 ? 110 LYS A CD    1 
ATOM   794  C CE    . LYS A 1 111 ? -3.266  70.998  -9.701  1.00 47.05 ? 110 LYS A CE    1 
ATOM   795  N NZ    . LYS A 1 111 ? -1.872  71.425  -9.983  1.00 52.09 ? 110 LYS A NZ    1 
ATOM   796  N N     . SER A 1 112 ? -7.789  68.275  -8.114  1.00 40.09 ? 111 SER A N     1 
ATOM   797  C CA    . SER A 1 112 ? -8.979  68.757  -8.645  1.00 41.28 ? 111 SER A CA    1 
ATOM   798  C C     . SER A 1 112 ? -10.033 69.050  -7.541  1.00 41.98 ? 111 SER A C     1 
ATOM   799  O O     . SER A 1 112 ? -10.829 70.018  -7.624  1.00 42.13 ? 111 SER A O     1 
ATOM   800  C CB    . SER A 1 112 ? -9.461  67.690  -9.564  1.00 40.93 ? 111 SER A CB    1 
ATOM   801  O OG    . SER A 1 112 ? -10.440 68.226  -10.380 1.00 47.26 ? 111 SER A OG    1 
ATOM   802  N N     . TYR A 1 113 ? -10.029 68.236  -6.494  1.00 41.59 ? 112 TYR A N     1 
ATOM   803  C CA    . TYR A 1 113 ? -11.149 68.265  -5.554  1.00 41.00 ? 112 TYR A CA    1 
ATOM   804  C C     . TYR A 1 113 ? -10.872 69.339  -4.521  1.00 41.30 ? 112 TYR A C     1 
ATOM   805  O O     . TYR A 1 113 ? -11.742 70.136  -4.217  1.00 42.01 ? 112 TYR A O     1 
ATOM   806  C CB    . TYR A 1 113 ? -11.348 66.889  -4.903  1.00 39.99 ? 112 TYR A CB    1 
ATOM   807  C CG    . TYR A 1 113 ? -12.349 66.845  -3.780  1.00 37.24 ? 112 TYR A CG    1 
ATOM   808  C CD1   . TYR A 1 113 ? -13.736 66.859  -4.039  1.00 36.77 ? 112 TYR A CD1   1 
ATOM   809  C CD2   . TYR A 1 113 ? -11.925 66.778  -2.475  1.00 34.54 ? 112 TYR A CD2   1 
ATOM   810  C CE1   . TYR A 1 113 ? -14.664 66.803  -3.007  1.00 35.97 ? 112 TYR A CE1   1 
ATOM   811  C CE2   . TYR A 1 113 ? -12.859 66.737  -1.390  1.00 36.16 ? 112 TYR A CE2   1 
ATOM   812  C CZ    . TYR A 1 113 ? -14.217 66.747  -1.678  1.00 37.63 ? 112 TYR A CZ    1 
ATOM   813  O OH    . TYR A 1 113 ? -15.115 66.681  -0.646  1.00 36.27 ? 112 TYR A OH    1 
ATOM   814  N N     . LEU A 1 114 ? -9.665  69.370  -3.998  1.00 41.16 ? 113 LEU A N     1 
ATOM   815  C CA    . LEU A 1 114 ? -9.281  70.414  -3.090  1.00 42.38 ? 113 LEU A CA    1 
ATOM   816  C C     . LEU A 1 114 ? -9.183  71.799  -3.740  1.00 44.27 ? 113 LEU A C     1 
ATOM   817  O O     . LEU A 1 114 ? -9.593  72.759  -3.129  1.00 46.96 ? 113 LEU A O     1 
ATOM   818  C CB    . LEU A 1 114 ? -7.993  70.061  -2.350  1.00 41.06 ? 113 LEU A CB    1 
ATOM   819  C CG    . LEU A 1 114 ? -8.147  68.759  -1.545  1.00 42.11 ? 113 LEU A CG    1 
ATOM   820  C CD1   . LEU A 1 114 ? -6.947  68.500  -0.658  1.00 41.95 ? 113 LEU A CD1   1 
ATOM   821  C CD2   . LEU A 1 114 ? -9.513  68.648  -0.754  1.00 38.69 ? 113 LEU A CD2   1 
ATOM   822  N N     . ALA A 1 115 ? -8.660  71.924  -4.957  1.00 44.81 ? 114 ALA A N     1 
ATOM   823  C CA    . ALA A 1 115 ? -8.434  73.234  -5.544  1.00 44.45 ? 114 ALA A CA    1 
ATOM   824  C C     . ALA A 1 115 ? -9.530  73.678  -6.506  1.00 44.78 ? 114 ALA A C     1 
ATOM   825  O O     . ALA A 1 115 ? -9.637  74.834  -6.781  1.00 43.81 ? 114 ALA A O     1 
ATOM   826  C CB    . ALA A 1 115 ? -7.072  73.309  -6.192  1.00 43.50 ? 114 ALA A CB    1 
ATOM   827  N N     . LYS A 1 116 ? -10.374 72.790  -7.009  1.00 46.09 ? 115 LYS A N     1 
ATOM   828  C CA    . LYS A 1 116 ? -11.365 73.272  -7.969  1.00 46.84 ? 115 LYS A CA    1 
ATOM   829  C C     . LYS A 1 116 ? -12.815 72.938  -7.604  1.00 47.09 ? 115 LYS A C     1 
ATOM   830  O O     . LYS A 1 116 ? -13.762 73.430  -8.242  1.00 47.99 ? 115 LYS A O     1 
ATOM   831  C CB    . LYS A 1 116 ? -11.054 72.774  -9.402  1.00 47.66 ? 115 LYS A CB    1 
ATOM   832  C CG    . LYS A 1 116 ? -9.547  72.935  -9.894  1.00 48.84 ? 115 LYS A CG    1 
ATOM   833  C CD    . LYS A 1 116 ? -9.294  72.490  -11.402 1.00 48.79 ? 115 LYS A CD    1 
ATOM   834  C CE    . LYS A 1 116 ? -7.751  72.338  -11.676 1.00 54.28 ? 115 LYS A CE    1 
ATOM   835  N NZ    . LYS A 1 116 ? -7.064  71.017  -11.213 1.00 56.64 ? 115 LYS A NZ    1 
ATOM   836  N N     . GLU A 1 117 ? -13.028 72.093  -6.605  1.00 46.46 ? 116 GLU A N     1 
ATOM   837  C CA    . GLU A 1 117 ? -14.377 71.576  -6.429  1.00 45.88 ? 116 GLU A CA    1 
ATOM   838  C C     . GLU A 1 117 ? -15.018 71.958  -5.144  1.00 44.54 ? 116 GLU A C     1 
ATOM   839  O O     . GLU A 1 117 ? -16.180 71.671  -4.953  1.00 43.65 ? 116 GLU A O     1 
ATOM   840  C CB    . GLU A 1 117 ? -14.461 70.067  -6.659  1.00 46.37 ? 116 GLU A CB    1 
ATOM   841  C CG    . GLU A 1 117 ? -14.470 69.739  -8.163  1.00 47.80 ? 116 GLU A CG    1 
ATOM   842  C CD    . GLU A 1 117 ? -14.108 68.292  -8.500  1.00 49.70 ? 116 GLU A CD    1 
ATOM   843  O OE1   . GLU A 1 117 ? -14.349 67.351  -7.710  1.00 48.63 ? 116 GLU A OE1   1 
ATOM   844  O OE2   . GLU A 1 117 ? -13.587 68.098  -9.601  1.00 52.54 ? 116 GLU A OE2   1 
ATOM   845  N N     . GLY A 1 118 ? -14.276 72.634  -4.297  1.00 42.80 ? 117 GLY A N     1 
ATOM   846  C CA    . GLY A 1 118 ? -14.847 73.074  -3.067  1.00 43.60 ? 117 GLY A CA    1 
ATOM   847  C C     . GLY A 1 118 ? -14.521 72.195  -1.897  1.00 44.53 ? 117 GLY A C     1 
ATOM   848  O O     . GLY A 1 118 ? -14.925 72.494  -0.782  1.00 45.87 ? 117 GLY A O     1 
ATOM   849  N N     . GLY A 1 119 ? -13.749 71.127  -2.120  1.00 44.58 ? 118 GLY A N     1 
ATOM   850  C CA    . GLY A 1 119 ? -13.491 70.124  -1.088  1.00 42.56 ? 118 GLY A CA    1 
ATOM   851  C C     . GLY A 1 119 ? -12.503 70.665  -0.123  1.00 42.21 ? 118 GLY A C     1 
ATOM   852  O O     . GLY A 1 119 ? -11.665 71.459  -0.493  1.00 43.03 ? 118 GLY A O     1 
ATOM   853  N N     . GLN A 1 120 ? -12.584 70.234  1.129   1.00 42.19 ? 119 GLN A N     1 
ATOM   854  C CA    . GLN A 1 120 ? -11.709 70.753  2.138   1.00 41.05 ? 119 GLN A CA    1 
ATOM   855  C C     . GLN A 1 120 ? -10.784 69.670  2.621   1.00 40.31 ? 119 GLN A C     1 
ATOM   856  O O     . GLN A 1 120 ? -9.650  69.986  2.976   1.00 40.94 ? 119 GLN A O     1 
ATOM   857  C CB    . GLN A 1 120 ? -12.543 71.318  3.297   1.00 42.70 ? 119 GLN A CB    1 
ATOM   858  C CG    . GLN A 1 120 ? -11.701 71.883  4.511   1.00 49.31 ? 119 GLN A CG    1 
ATOM   859  C CD    . GLN A 1 120 ? -10.881 73.145  4.135   1.00 57.53 ? 119 GLN A CD    1 
ATOM   860  O OE1   . GLN A 1 120 ? -11.298 73.925  3.244   1.00 60.87 ? 119 GLN A OE1   1 
ATOM   861  N NE2   . GLN A 1 120 ? -9.718  73.344  4.800   1.00 56.24 ? 119 GLN A NE2   1 
ATOM   862  N N     . ILE A 1 121 ? -11.256 68.402  2.676   1.00 38.13 ? 120 ILE A N     1 
ATOM   863  C CA    . ILE A 1 121 ? -10.409 67.278  3.083   1.00 35.89 ? 120 ILE A CA    1 
ATOM   864  C C     . ILE A 1 121 ? -10.479 66.157  2.060   1.00 35.97 ? 120 ILE A C     1 
ATOM   865  O O     . ILE A 1 121 ? -11.582 65.745  1.618   1.00 36.06 ? 120 ILE A O     1 
ATOM   866  C CB    . ILE A 1 121 ? -10.847 66.620  4.385   1.00 35.93 ? 120 ILE A CB    1 
ATOM   867  C CG1   . ILE A 1 121 ? -11.174 67.644  5.432   1.00 33.68 ? 120 ILE A CG1   1 
ATOM   868  C CG2   . ILE A 1 121 ? -9.784  65.572  4.880   1.00 32.66 ? 120 ILE A CG2   1 
ATOM   869  C CD1   . ILE A 1 121 ? -10.073 67.820  6.392   1.00 38.76 ? 120 ILE A CD1   1 
ATOM   870  N N     . ALA A 1 122 ? -9.304  65.629  1.718   1.00 34.74 ? 121 ALA A N     1 
ATOM   871  C CA    . ALA A 1 122 ? -9.243  64.509  0.808   1.00 34.18 ? 121 ALA A CA    1 
ATOM   872  C C     . ALA A 1 122 ? -8.571  63.397  1.564   1.00 33.37 ? 121 ALA A C     1 
ATOM   873  O O     . ALA A 1 122 ? -7.490  63.600  2.184   1.00 34.98 ? 121 ALA A O     1 
ATOM   874  C CB    . ALA A 1 122 ? -8.445  64.902  -0.462  1.00 34.84 ? 121 ALA A CB    1 
ATOM   875  N N     . VAL A 1 123 ? -9.187  62.233  1.569   1.00 31.60 ? 122 VAL A N     1 
ATOM   876  C CA    . VAL A 1 123 ? -8.572  61.120  2.273   1.00 31.07 ? 122 VAL A CA    1 
ATOM   877  C C     . VAL A 1 123 ? -7.957  60.197  1.258   1.00 30.68 ? 122 VAL A C     1 
ATOM   878  O O     . VAL A 1 123 ? -8.650  59.599  0.446   1.00 31.11 ? 122 VAL A O     1 
ATOM   879  C CB    . VAL A 1 123 ? -9.552  60.335  3.154   1.00 31.57 ? 122 VAL A CB    1 
ATOM   880  C CG1   . VAL A 1 123 ? -8.784  59.248  3.984   1.00 33.04 ? 122 VAL A CG1   1 
ATOM   881  C CG2   . VAL A 1 123 ? -10.315 61.282  4.113   1.00 31.39 ? 122 VAL A CG2   1 
ATOM   882  N N     . PHE A 1 124 ? -6.639  60.106  1.310   1.00 30.69 ? 123 PHE A N     1 
ATOM   883  C CA    . PHE A 1 124 ? -5.869  59.392  0.345   1.00 30.07 ? 123 PHE A CA    1 
ATOM   884  C C     . PHE A 1 124 ? -5.654  58.001  0.913   1.00 31.02 ? 123 PHE A C     1 
ATOM   885  O O     . PHE A 1 124 ? -4.781  57.794  1.798   1.00 29.55 ? 123 PHE A O     1 
ATOM   886  C CB    . PHE A 1 124 ? -4.514  60.078  0.040   1.00 30.79 ? 123 PHE A CB    1 
ATOM   887  C CG    . PHE A 1 124 ? -3.810  59.482  -1.162  1.00 31.84 ? 123 PHE A CG    1 
ATOM   888  C CD1   . PHE A 1 124 ? -4.349  59.624  -2.436  1.00 32.05 ? 123 PHE A CD1   1 
ATOM   889  C CD2   . PHE A 1 124 ? -2.652  58.728  -1.009  1.00 35.54 ? 123 PHE A CD2   1 
ATOM   890  C CE1   . PHE A 1 124 ? -3.755  59.067  -3.536  1.00 35.10 ? 123 PHE A CE1   1 
ATOM   891  C CE2   . PHE A 1 124 ? -2.026  58.175  -2.103  1.00 35.87 ? 123 PHE A CE2   1 
ATOM   892  C CZ    . PHE A 1 124 ? -2.576  58.336  -3.392  1.00 33.50 ? 123 PHE A CZ    1 
ATOM   893  N N     . ASP A 1 125 ? -6.455  57.057  0.384   1.00 30.43 ? 124 ASP A N     1 
ATOM   894  C CA    . ASP A 1 125 ? -6.601  55.744  0.949   1.00 30.80 ? 124 ASP A CA    1 
ATOM   895  C C     . ASP A 1 125 ? -5.880  54.655  0.133   1.00 31.30 ? 124 ASP A C     1 
ATOM   896  O O     . ASP A 1 125 ? -6.402  54.152  -0.882  1.00 31.13 ? 124 ASP A O     1 
ATOM   897  C CB    . ASP A 1 125 ? -8.115  55.399  1.114   1.00 31.48 ? 124 ASP A CB    1 
ATOM   898  C CG    . ASP A 1 125 ? -8.307  54.021  1.706   1.00 30.23 ? 124 ASP A CG    1 
ATOM   899  O OD1   . ASP A 1 125 ? -7.380  53.679  2.453   1.00 28.07 ? 124 ASP A OD1   1 
ATOM   900  O OD2   . ASP A 1 125 ? -9.322  53.317  1.436   1.00 28.23 ? 124 ASP A OD2   1 
ATOM   901  N N     . ALA A 1 126 ? -4.692  54.299  0.619   1.00 31.61 ? 125 ALA A N     1 
ATOM   902  C CA    . ALA A 1 126 ? -3.803  53.341  0.020   1.00 32.34 ? 125 ALA A CA    1 
ATOM   903  C C     . ALA A 1 126 ? -2.875  52.848  1.145   1.00 33.20 ? 125 ALA A C     1 
ATOM   904  O O     . ALA A 1 126 ? -2.897  53.422  2.246   1.00 33.66 ? 125 ALA A O     1 
ATOM   905  C CB    . ALA A 1 126 ? -3.002  54.027  -1.041  1.00 31.71 ? 125 ALA A CB    1 
ATOM   906  N N     . THR A 1 127 ? -2.029  51.852  0.882   1.00 31.97 ? 126 THR A N     1 
ATOM   907  C CA    . THR A 1 127 ? -1.164  51.354  1.966   1.00 31.87 ? 126 THR A CA    1 
ATOM   908  C C     . THR A 1 127 ? -0.175  52.436  2.356   1.00 31.17 ? 126 THR A C     1 
ATOM   909  O O     . THR A 1 127 ? 0.179   52.559  3.516   1.00 29.95 ? 126 THR A O     1 
ATOM   910  C CB    . THR A 1 127 ? -0.388  49.997  1.636   1.00 31.02 ? 126 THR A CB    1 
ATOM   911  O OG1   . THR A 1 127 ? 0.839   50.267  0.956   1.00 33.30 ? 126 THR A OG1   1 
ATOM   912  C CG2   . THR A 1 127 ? -1.176  49.122  0.728   1.00 31.85 ? 126 THR A CG2   1 
ATOM   913  N N     . ASN A 1 128 ? 0.255   53.231  1.371   1.00 32.50 ? 127 ASN A N     1 
ATOM   914  C CA    . ASN A 1 128 ? 1.232   54.280  1.612   1.00 33.75 ? 127 ASN A CA    1 
ATOM   915  C C     . ASN A 1 128 ? 2.319   53.870  2.628   1.00 34.68 ? 127 ASN A C     1 
ATOM   916  O O     . ASN A 1 128 ? 2.788   54.663  3.464   1.00 34.38 ? 127 ASN A O     1 
ATOM   917  C CB    . ASN A 1 128 ? 0.481   55.551  1.991   1.00 33.04 ? 127 ASN A CB    1 
ATOM   918  C CG    . ASN A 1 128 ? -0.376  56.003  0.862   1.00 35.97 ? 127 ASN A CG    1 
ATOM   919  O OD1   . ASN A 1 128 ? 0.113   56.066  -0.256  1.00 39.00 ? 127 ASN A OD1   1 
ATOM   920  N ND2   . ASN A 1 128 ? -1.668  56.257  1.103   1.00 39.69 ? 127 ASN A ND2   1 
ATOM   921  N N     . THR A 1 129 ? 2.754   52.615  2.476   1.00 36.48 ? 128 THR A N     1 
ATOM   922  C CA    . THR A 1 129 ? 3.698   51.927  3.403   1.00 37.39 ? 128 THR A CA    1 
ATOM   923  C C     . THR A 1 129 ? 5.231   52.191  3.291   1.00 38.61 ? 128 THR A C     1 
ATOM   924  O O     . THR A 1 129 ? 6.024   51.782  4.174   1.00 39.45 ? 128 THR A O     1 
ATOM   925  C CB    . THR A 1 129 ? 3.481   50.432  3.308   1.00 37.80 ? 128 THR A CB    1 
ATOM   926  O OG1   . THR A 1 129 ? 3.305   50.071  1.923   1.00 36.11 ? 128 THR A OG1   1 
ATOM   927  C CG2   . THR A 1 129 ? 2.251   49.985  4.190   1.00 36.07 ? 128 THR A CG2   1 
ATOM   928  N N     . THR A 1 130 ? 5.652   52.894  2.250   1.00 40.16 ? 129 THR A N     1 
ATOM   929  C CA    . THR A 1 130 ? 7.079   53.230  2.075   1.00 41.83 ? 129 THR A CA    1 
ATOM   930  C C     . THR A 1 130 ? 7.345   54.724  2.336   1.00 43.27 ? 129 THR A C     1 
ATOM   931  O O     . THR A 1 130 ? 6.468   55.547  2.099   1.00 44.86 ? 129 THR A O     1 
ATOM   932  C CB    . THR A 1 130 ? 7.556   52.810  0.645   1.00 40.88 ? 129 THR A CB    1 
ATOM   933  O OG1   . THR A 1 130 ? 6.850   53.578  -0.332  1.00 38.93 ? 129 THR A OG1   1 
ATOM   934  C CG2   . THR A 1 130 ? 7.277   51.300  0.411   1.00 37.20 ? 129 THR A CG2   1 
ATOM   935  N N     . ARG A 1 131 ? 8.536   55.071  2.817   1.00 44.90 ? 130 ARG A N     1 
ATOM   936  C CA    . ARG A 1 131 ? 8.985   56.486  2.884   1.00 46.71 ? 130 ARG A CA    1 
ATOM   937  C C     . ARG A 1 131 ? 8.939   57.162  1.517   1.00 47.36 ? 130 ARG A C     1 
ATOM   938  O O     . ARG A 1 131 ? 8.522   58.315  1.384   1.00 47.27 ? 130 ARG A O     1 
ATOM   939  C CB    . ARG A 1 131 ? 10.389  56.570  3.450   1.00 46.79 ? 130 ARG A CB    1 
ATOM   940  C CG    . ARG A 1 131 ? 10.414  56.248  4.924   1.00 48.27 ? 130 ARG A CG    1 
ATOM   941  C CD    . ARG A 1 131 ? 11.791  56.207  5.536   1.00 50.13 ? 130 ARG A CD    1 
ATOM   942  N NE    . ARG A 1 131 ? 11.686  55.602  6.863   1.00 55.70 ? 130 ARG A NE    1 
ATOM   943  C CZ    . ARG A 1 131 ? 12.688  55.377  7.716   1.00 57.49 ? 130 ARG A CZ    1 
ATOM   944  N NH1   . ARG A 1 131 ? 13.936  55.723  7.390   1.00 60.71 ? 130 ARG A NH1   1 
ATOM   945  N NH2   . ARG A 1 131 ? 12.435  54.814  8.912   1.00 52.44 ? 130 ARG A NH2   1 
ATOM   946  N N     . GLU A 1 132 ? 9.305   56.393  0.493   1.00 47.48 ? 131 GLU A N     1 
ATOM   947  C CA    . GLU A 1 132 ? 9.348   56.888  -0.850  1.00 47.77 ? 131 GLU A CA    1 
ATOM   948  C C     . GLU A 1 132 ? 7.947   57.317  -1.212  1.00 45.88 ? 131 GLU A C     1 
ATOM   949  O O     . GLU A 1 132 ? 7.766   58.406  -1.747  1.00 46.63 ? 131 GLU A O     1 
ATOM   950  C CB    . GLU A 1 132 ? 9.864   55.784  -1.789  1.00 47.93 ? 131 GLU A CB    1 
ATOM   951  C CG    . GLU A 1 132 ? 10.248  56.212  -3.225  1.00 50.93 ? 131 GLU A CG    1 
ATOM   952  C CD    . GLU A 1 132 ? 10.127  55.026  -4.237  1.00 51.84 ? 131 GLU A CD    1 
ATOM   953  O OE1   . GLU A 1 132 ? 9.518   53.999  -3.874  1.00 57.22 ? 131 GLU A OE1   1 
ATOM   954  O OE2   . GLU A 1 132 ? 10.618  55.100  -5.386  1.00 57.02 ? 131 GLU A OE2   1 
ATOM   955  N N     . ARG A 1 133 ? 6.941   56.499  -0.917  1.00 43.75 ? 132 ARG A N     1 
ATOM   956  C CA    . ARG A 1 133 ? 5.591   56.893  -1.315  1.00 42.14 ? 132 ARG A CA    1 
ATOM   957  C C     . ARG A 1 133 ? 5.127   58.138  -0.515  1.00 41.81 ? 132 ARG A C     1 
ATOM   958  O O     . ARG A 1 133 ? 4.611   59.096  -1.075  1.00 39.74 ? 132 ARG A O     1 
ATOM   959  C CB    . ARG A 1 133 ? 4.621   55.739  -1.211  1.00 41.40 ? 132 ARG A CB    1 
ATOM   960  C CG    . ARG A 1 133 ? 3.195   56.144  -1.340  1.00 41.27 ? 132 ARG A CG    1 
ATOM   961  C CD    . ARG A 1 133 ? 2.855   56.690  -2.710  1.00 40.97 ? 132 ARG A CD    1 
ATOM   962  N NE    . ARG A 1 133 ? 2.708   55.581  -3.615  1.00 40.65 ? 132 ARG A NE    1 
ATOM   963  C CZ    . ARG A 1 133 ? 1.755   54.645  -3.535  1.00 42.84 ? 132 ARG A CZ    1 
ATOM   964  N NH1   . ARG A 1 133 ? 0.799   54.667  -2.599  1.00 40.69 ? 132 ARG A NH1   1 
ATOM   965  N NH2   . ARG A 1 133 ? 1.759   53.667  -4.422  1.00 36.96 ? 132 ARG A NH2   1 
ATOM   966  N N     . ARG A 1 134 ? 5.382   58.150  0.784   1.00 41.79 ? 133 ARG A N     1 
ATOM   967  C CA    . ARG A 1 134 ? 4.932   59.280  1.581   1.00 42.93 ? 133 ARG A CA    1 
ATOM   968  C C     . ARG A 1 134 ? 5.619   60.572  1.182   1.00 44.41 ? 133 ARG A C     1 
ATOM   969  O O     . ARG A 1 134 ? 4.976   61.665  1.104   1.00 44.25 ? 133 ARG A O     1 
ATOM   970  C CB    . ARG A 1 134 ? 5.069   58.962  3.065   1.00 41.90 ? 133 ARG A CB    1 
ATOM   971  C CG    . ARG A 1 134 ? 4.269   57.748  3.382   1.00 40.50 ? 133 ARG A CG    1 
ATOM   972  C CD    . ARG A 1 134 ? 4.142   57.521  4.792   1.00 36.06 ? 133 ARG A CD    1 
ATOM   973  N NE    . ARG A 1 134 ? 5.386   57.083  5.388   1.00 38.61 ? 133 ARG A NE    1 
ATOM   974  C CZ    . ARG A 1 134 ? 5.686   55.812  5.614   1.00 40.01 ? 133 ARG A CZ    1 
ATOM   975  N NH1   . ARG A 1 134 ? 4.841   54.825  5.220   1.00 39.23 ? 133 ARG A NH1   1 
ATOM   976  N NH2   . ARG A 1 134 ? 6.833   55.537  6.198   1.00 34.54 ? 133 ARG A NH2   1 
ATOM   977  N N     . HIS A 1 135 ? 6.911   60.432  0.890   1.00 45.98 ? 134 HIS A N     1 
ATOM   978  C CA    . HIS A 1 135 ? 7.739   61.574  0.516   1.00 48.89 ? 134 HIS A CA    1 
ATOM   979  C C     . HIS A 1 135 ? 7.178   62.232  -0.739  1.00 47.47 ? 134 HIS A C     1 
ATOM   980  O O     . HIS A 1 135 ? 7.074   63.466  -0.797  1.00 47.74 ? 134 HIS A O     1 
ATOM   981  C CB    . HIS A 1 135 ? 9.241   61.189  0.393   1.00 50.87 ? 134 HIS A CB    1 
ATOM   982  C CG    . HIS A 1 135 ? 10.131  62.348  0.054   1.00 60.26 ? 134 HIS A CG    1 
ATOM   983  N ND1   . HIS A 1 135 ? 11.015  62.901  0.965   1.00 69.07 ? 134 HIS A ND1   1 
ATOM   984  C CD2   . HIS A 1 135 ? 10.255  63.084  -1.090  1.00 65.92 ? 134 HIS A CD2   1 
ATOM   985  C CE1   . HIS A 1 135 ? 11.663  63.909  0.389   1.00 70.61 ? 134 HIS A CE1   1 
ATOM   986  N NE2   . HIS A 1 135 ? 11.211  64.049  -0.853  1.00 70.45 ? 134 HIS A NE2   1 
ATOM   987  N N     . MET A 1 136 ? 6.757   61.413  -1.706  1.00 46.07 ? 135 MET A N     1 
ATOM   988  C CA    . MET A 1 136 ? 6.109   61.907  -2.901  1.00 45.93 ? 135 MET A CA    1 
ATOM   989  C C     . MET A 1 136 ? 4.796   62.646  -2.620  1.00 44.81 ? 135 MET A C     1 
ATOM   990  O O     . MET A 1 136 ? 4.535   63.744  -3.215  1.00 44.14 ? 135 MET A O     1 
ATOM   991  C CB    . MET A 1 136 ? 5.832   60.760  -3.849  1.00 44.76 ? 135 MET A CB    1 
ATOM   992  C CG    . MET A 1 136 ? 4.942   61.162  -5.017  1.00 46.71 ? 135 MET A CG    1 
ATOM   993  S SD    . MET A 1 136 ? 4.462   59.655  -5.936  1.00 54.58 ? 135 MET A SD    1 
ATOM   994  C CE    . MET A 1 136 ? 2.754   59.370  -5.449  1.00 49.97 ? 135 MET A CE    1 
ATOM   995  N N     . ILE A 1 137 ? 3.963   62.046  -1.740  1.00 42.82 ? 136 ILE A N     1 
ATOM   996  C CA    . ILE A 1 137 ? 2.686   62.622  -1.385  1.00 41.04 ? 136 ILE A CA    1 
ATOM   997  C C     . ILE A 1 137 ? 2.951   63.992  -0.741  1.00 40.98 ? 136 ILE A C     1 
ATOM   998  O O     . ILE A 1 137 ? 2.315   64.971  -1.081  1.00 39.73 ? 136 ILE A O     1 
ATOM   999  C CB    . ILE A 1 137 ? 1.879   61.691  -0.461  1.00 41.12 ? 136 ILE A CB    1 
ATOM   1000 C CG1   . ILE A 1 137 ? 1.358   60.494  -1.261  1.00 41.78 ? 136 ILE A CG1   1 
ATOM   1001 C CG2   . ILE A 1 137 ? 0.689   62.420  0.076   1.00 37.92 ? 136 ILE A CG2   1 
ATOM   1002 C CD1   . ILE A 1 137 ? 0.678   59.413  -0.429  1.00 40.08 ? 136 ILE A CD1   1 
ATOM   1003 N N     . LEU A 1 138 ? 3.918   64.047  0.161   1.00 41.17 ? 137 LEU A N     1 
ATOM   1004 C CA    . LEU A 1 138 ? 4.346   65.305  0.740   1.00 42.63 ? 137 LEU A CA    1 
ATOM   1005 C C     . LEU A 1 138 ? 4.742   66.332  -0.327  1.00 43.98 ? 137 LEU A C     1 
ATOM   1006 O O     . LEU A 1 138 ? 4.388   67.529  -0.250  1.00 44.23 ? 137 LEU A O     1 
ATOM   1007 C CB    . LEU A 1 138 ? 5.554   65.081  1.652   1.00 42.50 ? 137 LEU A CB    1 
ATOM   1008 C CG    . LEU A 1 138 ? 5.558   65.168  3.175   1.00 42.56 ? 137 LEU A CG    1 
ATOM   1009 C CD1   . LEU A 1 138 ? 4.154   65.015  3.739   1.00 41.31 ? 137 LEU A CD1   1 
ATOM   1010 C CD2   . LEU A 1 138 ? 6.561   64.136  3.751   1.00 42.47 ? 137 LEU A CD2   1 
ATOM   1011 N N     . HIS A 1 139 ? 5.505   65.884  -1.316  1.00 44.99 ? 138 HIS A N     1 
ATOM   1012 C CA    . HIS A 1 139 ? 5.964   66.810  -2.340  1.00 45.76 ? 138 HIS A CA    1 
ATOM   1013 C C     . HIS A 1 139 ? 4.755   67.445  -3.028  1.00 43.97 ? 138 HIS A C     1 
ATOM   1014 O O     . HIS A 1 139 ? 4.686   68.662  -3.218  1.00 44.08 ? 138 HIS A O     1 
ATOM   1015 C CB    . HIS A 1 139 ? 6.915   66.100  -3.310  1.00 47.57 ? 138 HIS A CB    1 
ATOM   1016 C CG    . HIS A 1 139 ? 7.268   66.915  -4.502  1.00 52.80 ? 138 HIS A CG    1 
ATOM   1017 N ND1   . HIS A 1 139 ? 8.363   67.753  -4.527  1.00 59.25 ? 138 HIS A ND1   1 
ATOM   1018 C CD2   . HIS A 1 139 ? 6.664   67.045  -5.710  1.00 56.86 ? 138 HIS A CD2   1 
ATOM   1019 C CE1   . HIS A 1 139 ? 8.425   68.362  -5.701  1.00 58.00 ? 138 HIS A CE1   1 
ATOM   1020 N NE2   . HIS A 1 139 ? 7.407   67.951  -6.434  1.00 58.57 ? 138 HIS A NE2   1 
ATOM   1021 N N     . PHE A 1 140 ? 3.785   66.606  -3.325  1.00 42.85 ? 139 PHE A N     1 
ATOM   1022 C CA    . PHE A 1 140 ? 2.538   66.990  -3.954  1.00 42.25 ? 139 PHE A CA    1 
ATOM   1023 C C     . PHE A 1 140 ? 1.662   67.933  -3.098  1.00 44.11 ? 139 PHE A C     1 
ATOM   1024 O O     . PHE A 1 140 ? 1.039   68.858  -3.635  1.00 44.15 ? 139 PHE A O     1 
ATOM   1025 C CB    . PHE A 1 140 ? 1.772   65.710  -4.268  1.00 40.55 ? 139 PHE A CB    1 
ATOM   1026 C CG    . PHE A 1 140 ? 0.322   65.924  -4.561  1.00 38.01 ? 139 PHE A CG    1 
ATOM   1027 C CD1   . PHE A 1 140 ? -0.608  65.960  -3.521  1.00 37.11 ? 139 PHE A CD1   1 
ATOM   1028 C CD2   . PHE A 1 140 ? -0.125  66.064  -5.869  1.00 31.86 ? 139 PHE A CD2   1 
ATOM   1029 C CE1   . PHE A 1 140 ? -1.969  66.138  -3.789  1.00 34.91 ? 139 PHE A CE1   1 
ATOM   1030 C CE2   . PHE A 1 140 ? -1.465  66.190  -6.172  1.00 36.72 ? 139 PHE A CE2   1 
ATOM   1031 C CZ    . PHE A 1 140 ? -2.408  66.269  -5.116  1.00 39.83 ? 139 PHE A CZ    1 
ATOM   1032 N N     . ALA A 1 141 ? 1.578   67.673  -1.788  1.00 44.99 ? 140 ALA A N     1 
ATOM   1033 C CA    . ALA A 1 141 ? 0.877   68.558  -0.859  1.00 46.53 ? 140 ALA A CA    1 
ATOM   1034 C C     . ALA A 1 141 ? 1.532   69.962  -0.885  1.00 48.03 ? 140 ALA A C     1 
ATOM   1035 O O     . ALA A 1 141 ? 0.873   70.975  -1.192  1.00 47.80 ? 140 ALA A O     1 
ATOM   1036 C CB    . ALA A 1 141 ? 0.868   67.959  0.616   1.00 44.26 ? 140 ALA A CB    1 
ATOM   1037 N N     . LYS A 1 142 ? 2.811   69.980  -0.523  1.00 50.02 ? 141 LYS A N     1 
ATOM   1038 C CA    . LYS A 1 142 ? 3.690   71.133  -0.597  1.00 53.12 ? 141 LYS A CA    1 
ATOM   1039 C C     . LYS A 1 142 ? 3.456   71.983  -1.844  1.00 53.80 ? 141 LYS A C     1 
ATOM   1040 O O     . LYS A 1 142 ? 3.174   73.171  -1.744  1.00 54.30 ? 141 LYS A O     1 
ATOM   1041 C CB    . LYS A 1 142 ? 5.135   70.646  -0.582  1.00 54.82 ? 141 LYS A CB    1 
ATOM   1042 C CG    . LYS A 1 142 ? 6.181   71.721  -0.779  1.00 59.26 ? 141 LYS A CG    1 
ATOM   1043 C CD    . LYS A 1 142 ? 6.433   72.511  0.523   1.00 65.04 ? 141 LYS A CD    1 
ATOM   1044 C CE    . LYS A 1 142 ? 7.634   73.485  0.406   1.00 64.83 ? 141 LYS A CE    1 
ATOM   1045 N NZ    . LYS A 1 142 ? 8.950   72.749  0.381   1.00 67.47 ? 141 LYS A NZ    1 
ATOM   1046 N N     . GLU A 1 143 ? 3.522   71.377  -3.017  1.00 53.90 ? 142 GLU A N     1 
ATOM   1047 C CA    . GLU A 1 143 ? 3.468   72.172  -4.202  1.00 54.03 ? 142 GLU A CA    1 
ATOM   1048 C C     . GLU A 1 143 ? 2.068   72.607  -4.464  1.00 52.87 ? 142 GLU A C     1 
ATOM   1049 O O     . GLU A 1 143 ? 1.855   73.451  -5.331  1.00 54.03 ? 142 GLU A O     1 
ATOM   1050 C CB    . GLU A 1 143 ? 4.050   71.430  -5.409  1.00 54.12 ? 142 GLU A CB    1 
ATOM   1051 C CG    . GLU A 1 143 ? 3.019   70.742  -6.325  1.00 57.32 ? 142 GLU A CG    1 
ATOM   1052 C CD    . GLU A 1 143 ? 3.619   69.591  -7.147  1.00 58.66 ? 142 GLU A CD    1 
ATOM   1053 O OE1   . GLU A 1 143 ? 4.873   69.638  -7.329  1.00 62.33 ? 142 GLU A OE1   1 
ATOM   1054 O OE2   . GLU A 1 143 ? 2.849   68.647  -7.563  1.00 61.13 ? 142 GLU A OE2   1 
ATOM   1055 N N     . ASN A 1 144 ? 1.079   72.060  -3.773  1.00 50.98 ? 143 ASN A N     1 
ATOM   1056 C CA    . ASN A 1 144 ? -0.273  72.526  -4.062  1.00 49.10 ? 143 ASN A CA    1 
ATOM   1057 C C     . ASN A 1 144 ? -0.834  73.373  -2.969  1.00 49.40 ? 143 ASN A C     1 
ATOM   1058 O O     . ASN A 1 144 ? -1.964  73.912  -3.070  1.00 48.69 ? 143 ASN A O     1 
ATOM   1059 C CB    . ASN A 1 144 ? -1.210  71.405  -4.368  1.00 48.38 ? 143 ASN A CB    1 
ATOM   1060 C CG    . ASN A 1 144 ? -0.955  70.813  -5.720  1.00 49.77 ? 143 ASN A CG    1 
ATOM   1061 O OD1   . ASN A 1 144 ? -1.278  71.410  -6.749  1.00 51.39 ? 143 ASN A OD1   1 
ATOM   1062 N ND2   . ASN A 1 144 ? -0.393  69.614  -5.737  1.00 48.17 ? 143 ASN A ND2   1 
ATOM   1063 N N     . ASP A 1 145 ? -0.029  73.488  -1.924  1.00 49.54 ? 144 ASP A N     1 
ATOM   1064 C CA    . ASP A 1 145 ? -0.438  74.196  -0.739  1.00 50.68 ? 144 ASP A CA    1 
ATOM   1065 C C     . ASP A 1 145 ? -1.516  73.561  0.121   1.00 49.92 ? 144 ASP A C     1 
ATOM   1066 O O     . ASP A 1 145 ? -2.479  74.196  0.554   1.00 50.62 ? 144 ASP A O     1 
ATOM   1067 C CB    . ASP A 1 145 ? -0.865  75.584  -1.107  1.00 50.95 ? 144 ASP A CB    1 
ATOM   1068 C CG    . ASP A 1 145 ? 0.064   76.518  -0.590  1.00 53.02 ? 144 ASP A CG    1 
ATOM   1069 O OD1   . ASP A 1 145 ? 0.687   77.192  -1.409  1.00 57.94 ? 144 ASP A OD1   1 
ATOM   1070 O OD2   . ASP A 1 145 ? 0.272   76.451  0.638   1.00 55.43 ? 144 ASP A OD2   1 
ATOM   1071 N N     . PHE A 1 146 ? -1.314  72.283  0.337   1.00 48.61 ? 145 PHE A N     1 
ATOM   1072 C CA    . PHE A 1 146 ? -2.178  71.473  1.114   1.00 45.98 ? 145 PHE A CA    1 
ATOM   1073 C C     . PHE A 1 146 ? -1.382  71.113  2.326   1.00 45.38 ? 145 PHE A C     1 
ATOM   1074 O O     . PHE A 1 146 ? -0.203  70.796  2.250   1.00 44.50 ? 145 PHE A O     1 
ATOM   1075 C CB    . PHE A 1 146 ? -2.504  70.206  0.335   1.00 44.33 ? 145 PHE A CB    1 
ATOM   1076 C CG    . PHE A 1 146 ? -3.227  70.434  -0.980  1.00 42.25 ? 145 PHE A CG    1 
ATOM   1077 C CD1   . PHE A 1 146 ? -3.940  71.607  -1.243  1.00 40.87 ? 145 PHE A CD1   1 
ATOM   1078 C CD2   . PHE A 1 146 ? -3.214  69.437  -1.953  1.00 37.77 ? 145 PHE A CD2   1 
ATOM   1079 C CE1   . PHE A 1 146 ? -4.672  71.776  -2.491  1.00 36.13 ? 145 PHE A CE1   1 
ATOM   1080 C CE2   . PHE A 1 146 ? -3.894  69.597  -3.155  1.00 37.54 ? 145 PHE A CE2   1 
ATOM   1081 C CZ    . PHE A 1 146 ? -4.633  70.790  -3.424  1.00 39.74 ? 145 PHE A CZ    1 
ATOM   1082 N N     . LYS A 1 147 ? -2.039  71.160  3.460   1.00 45.92 ? 146 LYS A N     1 
ATOM   1083 C CA    . LYS A 1 147 ? -1.542  70.498  4.620   1.00 46.14 ? 146 LYS A CA    1 
ATOM   1084 C C     . LYS A 1 147 ? -1.660  68.994  4.401   1.00 45.53 ? 146 LYS A C     1 
ATOM   1085 O O     . LYS A 1 147 ? -2.508  68.482  3.600   1.00 45.17 ? 146 LYS A O     1 
ATOM   1086 C CB    . LYS A 1 147 ? -2.418  70.891  5.797   1.00 48.16 ? 146 LYS A CB    1 
ATOM   1087 C CG    . LYS A 1 147 ? -2.144  72.299  6.361   1.00 50.51 ? 146 LYS A CG    1 
ATOM   1088 C CD    . LYS A 1 147 ? -3.262  72.675  7.344   1.00 56.60 ? 146 LYS A CD    1 
ATOM   1089 C CE    . LYS A 1 147 ? -2.815  73.715  8.364   1.00 57.14 ? 146 LYS A CE    1 
ATOM   1090 N NZ    . LYS A 1 147 ? -4.066  74.458  8.670   1.00 58.77 ? 146 LYS A NZ    1 
ATOM   1091 N N     . ALA A 1 148 ? -0.822  68.278  5.129   1.00 44.15 ? 147 ALA A N     1 
ATOM   1092 C CA    . ALA A 1 148 ? -0.816  66.831  5.061   1.00 42.67 ? 147 ALA A CA    1 
ATOM   1093 C C     . ALA A 1 148 ? -0.851  66.297  6.470   1.00 41.94 ? 147 ALA A C     1 
ATOM   1094 O O     . ALA A 1 148 ? -0.091  66.790  7.338   1.00 41.08 ? 147 ALA A O     1 
ATOM   1095 C CB    . ALA A 1 148 ? 0.429   66.351  4.403   1.00 42.58 ? 147 ALA A CB    1 
ATOM   1096 N N     . PHE A 1 149 ? -1.673  65.252  6.681   1.00 40.35 ? 148 PHE A N     1 
ATOM   1097 C CA    . PHE A 1 149 ? -1.835  64.635  7.987   1.00 38.84 ? 148 PHE A CA    1 
ATOM   1098 C C     . PHE A 1 149 ? -1.849  63.101  7.853   1.00 38.62 ? 148 PHE A C     1 
ATOM   1099 O O     . PHE A 1 149 ? -2.593  62.582  7.039   1.00 39.39 ? 148 PHE A O     1 
ATOM   1100 C CB    . PHE A 1 149 ? -3.165  65.139  8.575   1.00 38.95 ? 148 PHE A CB    1 
ATOM   1101 C CG    . PHE A 1 149 ? -3.493  64.558  9.926   1.00 37.69 ? 148 PHE A CG    1 
ATOM   1102 C CD1   . PHE A 1 149 ? -2.699  64.840  11.034  1.00 39.12 ? 148 PHE A CD1   1 
ATOM   1103 C CD2   . PHE A 1 149 ? -4.554  63.708  10.073  1.00 34.87 ? 148 PHE A CD2   1 
ATOM   1104 C CE1   . PHE A 1 149 ? -2.988  64.286  12.288  1.00 39.39 ? 148 PHE A CE1   1 
ATOM   1105 C CE2   . PHE A 1 149 ? -4.831  63.113  11.317  1.00 35.70 ? 148 PHE A CE2   1 
ATOM   1106 C CZ    . PHE A 1 149 ? -4.059  63.405  12.411  1.00 37.31 ? 148 PHE A CZ    1 
ATOM   1107 N N     . PHE A 1 150 ? -1.080  62.366  8.648   1.00 37.26 ? 149 PHE A N     1 
ATOM   1108 C CA    . PHE A 1 150 ? -0.997  60.917  8.442   1.00 37.06 ? 149 PHE A CA    1 
ATOM   1109 C C     . PHE A 1 150 ? -1.697  60.118  9.520   1.00 36.65 ? 149 PHE A C     1 
ATOM   1110 O O     . PHE A 1 150 ? -1.614  60.460  10.710  1.00 37.28 ? 149 PHE A O     1 
ATOM   1111 C CB    . PHE A 1 150 ? 0.440   60.435  8.315   1.00 36.05 ? 149 PHE A CB    1 
ATOM   1112 C CG    . PHE A 1 150 ? 1.195   61.044  7.153   1.00 39.01 ? 149 PHE A CG    1 
ATOM   1113 C CD1   . PHE A 1 150 ? 1.708   62.356  7.228   1.00 39.18 ? 149 PHE A CD1   1 
ATOM   1114 C CD2   . PHE A 1 150 ? 1.448   60.288  5.986   1.00 38.29 ? 149 PHE A CD2   1 
ATOM   1115 C CE1   . PHE A 1 150 ? 2.426   62.909  6.162   1.00 37.44 ? 149 PHE A CE1   1 
ATOM   1116 C CE2   . PHE A 1 150 ? 2.191   60.820  4.959   1.00 36.01 ? 149 PHE A CE2   1 
ATOM   1117 C CZ    . PHE A 1 150 ? 2.667   62.127  5.028   1.00 36.30 ? 149 PHE A CZ    1 
ATOM   1118 N N     . ILE A 1 151 ? -2.411  59.071  9.081   1.00 35.91 ? 150 ILE A N     1 
ATOM   1119 C CA    . ILE A 1 151 ? -3.108  58.150  9.964   1.00 35.05 ? 150 ILE A CA    1 
ATOM   1120 C C     . ILE A 1 151 ? -2.692  56.710  9.638   1.00 35.05 ? 150 ILE A C     1 
ATOM   1121 O O     . ILE A 1 151 ? -3.031  56.181  8.574   1.00 34.48 ? 150 ILE A O     1 
ATOM   1122 C CB    . ILE A 1 151 ? -4.654  58.238  9.870   1.00 35.30 ? 150 ILE A CB    1 
ATOM   1123 C CG1   . ILE A 1 151 ? -5.147  59.653  10.177  1.00 35.24 ? 150 ILE A CG1   1 
ATOM   1124 C CG2   . ILE A 1 151 ? -5.276  57.192  10.858  1.00 34.39 ? 150 ILE A CG2   1 
ATOM   1125 C CD1   . ILE A 1 151 ? -6.638  59.867  9.948   1.00 32.62 ? 150 ILE A CD1   1 
ATOM   1126 N N     . GLU A 1 152 ? -1.984  56.101  10.569  1.00 35.03 ? 151 GLU A N     1 
ATOM   1127 C CA    . GLU A 1 152 ? -1.435  54.784  10.398  1.00 36.91 ? 151 GLU A CA    1 
ATOM   1128 C C     . GLU A 1 152 ? -2.135  53.838  11.359  1.00 38.10 ? 151 GLU A C     1 
ATOM   1129 O O     . GLU A 1 152 ? -2.262  54.128  12.571  1.00 37.87 ? 151 GLU A O     1 
ATOM   1130 C CB    . GLU A 1 152 ? 0.074   54.768  10.702  1.00 36.84 ? 151 GLU A CB    1 
ATOM   1131 C CG    . GLU A 1 152 ? 0.670   53.386  10.471  1.00 38.89 ? 151 GLU A CG    1 
ATOM   1132 C CD    . GLU A 1 152 ? 2.167   53.346  10.585  1.00 40.26 ? 151 GLU A CD    1 
ATOM   1133 O OE1   . GLU A 1 152 ? 2.691   54.178  11.343  1.00 42.39 ? 151 GLU A OE1   1 
ATOM   1134 O OE2   . GLU A 1 152 ? 2.815   52.480  9.921   1.00 42.84 ? 151 GLU A OE2   1 
ATOM   1135 N N     . SER A 1 153 ? -2.579  52.704  10.809  1.00 39.20 ? 152 SER A N     1 
ATOM   1136 C CA    . SER A 1 153 ? -3.212  51.644  11.600  1.00 39.83 ? 152 SER A CA    1 
ATOM   1137 C C     . SER A 1 153 ? -2.198  50.510  11.728  1.00 41.87 ? 152 SER A C     1 
ATOM   1138 O O     . SER A 1 153 ? -1.734  49.975  10.699  1.00 41.73 ? 152 SER A O     1 
ATOM   1139 C CB    . SER A 1 153 ? -4.480  51.155  10.903  1.00 38.89 ? 152 SER A CB    1 
ATOM   1140 O OG    . SER A 1 153 ? -5.197  50.299  11.754  1.00 35.45 ? 152 SER A OG    1 
ATOM   1141 N N     . VAL A 1 154 ? -1.810  50.196  12.961  1.00 42.80 ? 153 VAL A N     1 
ATOM   1142 C CA    . VAL A 1 154 ? -0.885  49.116  13.217  1.00 45.08 ? 153 VAL A CA    1 
ATOM   1143 C C     . VAL A 1 154 ? -1.590  48.020  13.977  1.00 46.70 ? 153 VAL A C     1 
ATOM   1144 O O     . VAL A 1 154 ? -2.100  48.218  15.089  1.00 47.17 ? 153 VAL A O     1 
ATOM   1145 C CB    . VAL A 1 154 ? 0.407   49.576  13.979  1.00 45.07 ? 153 VAL A CB    1 
ATOM   1146 C CG1   . VAL A 1 154 ? 1.348   48.391  14.212  1.00 44.94 ? 153 VAL A CG1   1 
ATOM   1147 C CG2   . VAL A 1 154 ? 1.161   50.589  13.157  1.00 45.07 ? 153 VAL A CG2   1 
ATOM   1148 N N     . CYS A 1 155 ? -1.611  46.845  13.382  1.00 50.18 ? 154 CYS A N     1 
ATOM   1149 C CA    . CYS A 1 155 ? -2.237  45.697  14.046  1.00 51.66 ? 154 CYS A CA    1 
ATOM   1150 C C     . CYS A 1 155 ? -1.664  44.371  13.609  1.00 51.70 ? 154 CYS A C     1 
ATOM   1151 O O     . CYS A 1 155 ? -1.927  43.952  12.495  1.00 51.37 ? 154 CYS A O     1 
ATOM   1152 C CB    . CYS A 1 155 ? -3.729  45.672  13.765  1.00 51.91 ? 154 CYS A CB    1 
ATOM   1153 S SG    . CYS A 1 155 ? -4.500  44.256  14.608  1.00 55.85 ? 154 CYS A SG    1 
ATOM   1154 N N     . ASP A 1 156 ? -0.893  43.717  14.478  1.00 52.93 ? 155 ASP A N     1 
ATOM   1155 C CA    . ASP A 1 156 ? -0.422  42.340  14.189  1.00 54.46 ? 155 ASP A CA    1 
ATOM   1156 C C     . ASP A 1 156 ? -1.022  41.356  15.180  1.00 54.19 ? 155 ASP A C     1 
ATOM   1157 O O     . ASP A 1 156 ? -0.309  40.611  15.866  1.00 55.90 ? 155 ASP A O     1 
ATOM   1158 C CB    . ASP A 1 156 ? 1.111   42.278  14.190  1.00 55.40 ? 155 ASP A CB    1 
ATOM   1159 C CG    . ASP A 1 156 ? 1.731   43.650  13.903  1.00 57.50 ? 155 ASP A CG    1 
ATOM   1160 O OD1   . ASP A 1 156 ? 1.981   44.343  14.938  1.00 57.68 ? 155 ASP A OD1   1 
ATOM   1161 O OD2   . ASP A 1 156 ? 1.861   44.042  12.673  1.00 55.87 ? 155 ASP A OD2   1 
ATOM   1162 N N     . ASP A 1 157 ? -2.336  41.406  15.315  1.00 52.75 ? 156 ASP A N     1 
ATOM   1163 C CA    . ASP A 1 157 ? -3.027  40.350  15.958  1.00 52.14 ? 156 ASP A CA    1 
ATOM   1164 C C     . ASP A 1 157 ? -3.706  39.520  14.838  1.00 51.80 ? 156 ASP A C     1 
ATOM   1165 O O     . ASP A 1 157 ? -4.629  40.029  14.158  1.00 51.59 ? 156 ASP A O     1 
ATOM   1166 C CB    . ASP A 1 157 ? -4.010  40.889  16.963  1.00 52.04 ? 156 ASP A CB    1 
ATOM   1167 C CG    . ASP A 1 157 ? -4.867  39.791  17.565  1.00 53.64 ? 156 ASP A CG    1 
ATOM   1168 O OD1   . ASP A 1 157 ? -5.144  38.747  16.911  1.00 56.14 ? 156 ASP A OD1   1 
ATOM   1169 O OD2   . ASP A 1 157 ? -5.270  39.979  18.712  1.00 53.42 ? 156 ASP A OD2   1 
ATOM   1170 N N     . PRO A 1 158 ? -3.219  38.254  14.625  1.00 50.69 ? 157 PRO A N     1 
ATOM   1171 C CA    . PRO A 1 158 ? -3.650  37.434  13.466  1.00 49.08 ? 157 PRO A CA    1 
ATOM   1172 C C     . PRO A 1 158 ? -5.136  37.195  13.447  1.00 48.58 ? 157 PRO A C     1 
ATOM   1173 O O     . PRO A 1 158 ? -5.741  37.131  12.346  1.00 49.74 ? 157 PRO A O     1 
ATOM   1174 C CB    . PRO A 1 158 ? -2.866  36.124  13.601  1.00 48.97 ? 157 PRO A CB    1 
ATOM   1175 C CG    . PRO A 1 158 ? -1.722  36.430  14.626  1.00 49.82 ? 157 PRO A CG    1 
ATOM   1176 C CD    . PRO A 1 158 ? -2.215  37.570  15.483  1.00 50.04 ? 157 PRO A CD    1 
ATOM   1177 N N     . THR A 1 159 ? -5.756  37.138  14.621  1.00 47.30 ? 158 THR A N     1 
ATOM   1178 C CA    . THR A 1 159 ? -7.196  36.921  14.682  1.00 46.31 ? 158 THR A CA    1 
ATOM   1179 C C     . THR A 1 159 ? -7.957  38.117  14.135  1.00 45.67 ? 158 THR A C     1 
ATOM   1180 O O     . THR A 1 159 ? -9.002  37.967  13.466  1.00 45.70 ? 158 THR A O     1 
ATOM   1181 C CB    . THR A 1 159 ? -7.629  36.640  16.106  1.00 47.27 ? 158 THR A CB    1 
ATOM   1182 O OG1   . THR A 1 159 ? -6.693  35.716  16.657  1.00 47.49 ? 158 THR A OG1   1 
ATOM   1183 C CG2   . THR A 1 159 ? -9.063  36.001  16.130  1.00 46.98 ? 158 THR A CG2   1 
ATOM   1184 N N     . VAL A 1 160 ? -7.395  39.299  14.373  1.00 44.44 ? 159 VAL A N     1 
ATOM   1185 C CA    . VAL A 1 160 ? -7.997  40.545  13.897  1.00 43.16 ? 159 VAL A CA    1 
ATOM   1186 C C     . VAL A 1 160 ? -7.852  40.678  12.401  1.00 42.19 ? 159 VAL A C     1 
ATOM   1187 O O     . VAL A 1 160 ? -8.859  40.913  11.646  1.00 41.58 ? 159 VAL A O     1 
ATOM   1188 C CB    . VAL A 1 160 ? -7.357  41.798  14.590  1.00 44.01 ? 159 VAL A CB    1 
ATOM   1189 C CG1   . VAL A 1 160 ? -7.731  43.116  13.819  1.00 43.56 ? 159 VAL A CG1   1 
ATOM   1190 C CG2   . VAL A 1 160 ? -7.708  41.839  16.126  1.00 41.43 ? 159 VAL A CG2   1 
ATOM   1191 N N     . VAL A 1 161 ? -6.613  40.513  11.961  1.00 40.18 ? 160 VAL A N     1 
ATOM   1192 C CA    . VAL A 1 161 ? -6.359  40.504  10.534  1.00 39.37 ? 160 VAL A CA    1 
ATOM   1193 C C     . VAL A 1 161 ? -7.248  39.482  9.898   1.00 39.68 ? 160 VAL A C     1 
ATOM   1194 O O     . VAL A 1 161 ? -7.896  39.823  8.948   1.00 39.22 ? 160 VAL A O     1 
ATOM   1195 C CB    . VAL A 1 161 ? -4.886  40.195  10.177  1.00 39.81 ? 160 VAL A CB    1 
ATOM   1196 C CG1   . VAL A 1 161 ? -4.751  39.917  8.676   1.00 35.77 ? 160 VAL A CG1   1 
ATOM   1197 C CG2   . VAL A 1 161 ? -4.025  41.361  10.612  1.00 37.46 ? 160 VAL A CG2   1 
ATOM   1198 N N     . ALA A 1 162 ? -7.321  38.249  10.430  1.00 40.12 ? 161 ALA A N     1 
ATOM   1199 C CA    . ALA A 1 162 ? -8.140  37.188  9.746   1.00 41.21 ? 161 ALA A CA    1 
ATOM   1200 C C     . ALA A 1 162 ? -9.628  37.565  9.647   1.00 41.53 ? 161 ALA A C     1 
ATOM   1201 O O     . ALA A 1 162 ? -10.320 37.464  8.579   1.00 41.17 ? 161 ALA A O     1 
ATOM   1202 C CB    . ALA A 1 162 ? -7.950  35.759  10.422  1.00 40.24 ? 161 ALA A CB    1 
ATOM   1203 N N     . SER A 1 163 ? -10.131 37.981  10.796  1.00 42.27 ? 162 SER A N     1 
ATOM   1204 C CA    . SER A 1 163 ? -11.525 38.353  10.901  1.00 43.09 ? 162 SER A CA    1 
ATOM   1205 C C     . SER A 1 163 ? -11.836 39.490  9.907   1.00 43.74 ? 162 SER A C     1 
ATOM   1206 O O     . SER A 1 163 ? -12.841 39.439  9.177   1.00 45.79 ? 162 SER A O     1 
ATOM   1207 C CB    . SER A 1 163 ? -11.757 38.743  12.345  1.00 42.18 ? 162 SER A CB    1 
ATOM   1208 O OG    . SER A 1 163 ? -12.782 39.651  12.393  1.00 46.70 ? 162 SER A OG    1 
ATOM   1209 N N     . ASN A 1 164 ? -10.940 40.479  9.829   1.00 43.32 ? 163 ASN A N     1 
ATOM   1210 C CA    . ASN A 1 164 ? -11.110 41.574  8.913   1.00 43.84 ? 163 ASN A CA    1 
ATOM   1211 C C     . ASN A 1 164 ? -11.166 41.140  7.467   1.00 44.73 ? 163 ASN A C     1 
ATOM   1212 O O     . ASN A 1 164 ? -11.976 41.653  6.681   1.00 44.31 ? 163 ASN A O     1 
ATOM   1213 C CB    . ASN A 1 164 ? -9.967  42.581  9.056   1.00 43.99 ? 163 ASN A CB    1 
ATOM   1214 C CG    . ASN A 1 164 ? -10.073 43.454  10.307  1.00 43.49 ? 163 ASN A CG    1 
ATOM   1215 O OD1   . ASN A 1 164 ? -9.090  44.061  10.706  1.00 43.83 ? 163 ASN A OD1   1 
ATOM   1216 N ND2   . ASN A 1 164 ? -11.253 43.520  10.916  1.00 45.29 ? 163 ASN A ND2   1 
ATOM   1217 N N     . ILE A 1 165 ? -10.253 40.254  7.093   1.00 45.71 ? 164 ILE A N     1 
ATOM   1218 C CA    . ILE A 1 165 ? -10.286 39.646  5.767   1.00 47.86 ? 164 ILE A CA    1 
ATOM   1219 C C     . ILE A 1 165 ? -11.643 38.947  5.448   1.00 48.97 ? 164 ILE A C     1 
ATOM   1220 O O     . ILE A 1 165 ? -12.233 39.153  4.370   1.00 47.67 ? 164 ILE A O     1 
ATOM   1221 C CB    . ILE A 1 165 ? -9.154  38.664  5.603   1.00 47.66 ? 164 ILE A CB    1 
ATOM   1222 C CG1   . ILE A 1 165 ? -7.822  39.398  5.539   1.00 45.97 ? 164 ILE A CG1   1 
ATOM   1223 C CG2   . ILE A 1 165 ? -9.390  37.867  4.342   1.00 49.07 ? 164 ILE A CG2   1 
ATOM   1224 C CD1   . ILE A 1 165 ? -6.648  38.505  5.642   1.00 43.25 ? 164 ILE A CD1   1 
ATOM   1225 N N     . MET A 1 166 ? -12.154 38.179  6.410   1.00 51.50 ? 165 MET A N     1 
ATOM   1226 C CA    . MET A 1 166 ? -13.494 37.576  6.271   1.00 54.13 ? 165 MET A CA    1 
ATOM   1227 C C     . MET A 1 166 ? -14.573 38.617  6.090   1.00 55.31 ? 165 MET A C     1 
ATOM   1228 O O     . MET A 1 166 ? -15.498 38.438  5.263   1.00 56.03 ? 165 MET A O     1 
ATOM   1229 C CB    . MET A 1 166 ? -13.850 36.713  7.476   1.00 54.62 ? 165 MET A CB    1 
ATOM   1230 C CG    . MET A 1 166 ? -13.003 35.447  7.654   1.00 57.80 ? 165 MET A CG    1 
ATOM   1231 S SD    . MET A 1 166 ? -13.022 34.442  6.145   1.00 68.93 ? 165 MET A SD    1 
ATOM   1232 C CE    . MET A 1 166 ? -14.752 33.840  5.982   1.00 62.94 ? 165 MET A CE    1 
ATOM   1233 N N     . GLU A 1 167 ? -14.492 39.708  6.855   1.00 56.11 ? 166 GLU A N     1 
ATOM   1234 C CA    . GLU A 1 167 ? -15.613 40.651  6.796   1.00 56.69 ? 166 GLU A CA    1 
ATOM   1235 C C     . GLU A 1 167 ? -15.694 41.502  5.553   1.00 55.31 ? 166 GLU A C     1 
ATOM   1236 O O     . GLU A 1 167 ? -16.788 41.871  5.152   1.00 55.74 ? 166 GLU A O     1 
ATOM   1237 C CB    . GLU A 1 167 ? -15.752 41.567  8.035   1.00 57.99 ? 166 GLU A CB    1 
ATOM   1238 C CG    . GLU A 1 167 ? -16.976 42.548  7.801   1.00 62.54 ? 166 GLU A CG    1 
ATOM   1239 C CD    . GLU A 1 167 ? -17.778 42.908  9.052   1.00 68.11 ? 166 GLU A CD    1 
ATOM   1240 O OE1   . GLU A 1 167 ? -17.128 42.973  10.133  1.00 70.78 ? 166 GLU A OE1   1 
ATOM   1241 O OE2   . GLU A 1 167 ? -19.027 43.149  8.936   1.00 67.14 ? 166 GLU A OE2   1 
ATOM   1242 N N     . VAL A 1 168 ? -14.564 41.879  4.966   1.00 53.70 ? 167 VAL A N     1 
ATOM   1243 C CA    . VAL A 1 168 ? -14.641 42.836  3.864   1.00 52.33 ? 167 VAL A CA    1 
ATOM   1244 C C     . VAL A 1 168 ? -13.823 42.460  2.676   1.00 51.65 ? 167 VAL A C     1 
ATOM   1245 O O     . VAL A 1 168 ? -14.037 43.034  1.634   1.00 53.00 ? 167 VAL A O     1 
ATOM   1246 C CB    . VAL A 1 168 ? -14.171 44.280  4.262   1.00 52.19 ? 167 VAL A CB    1 
ATOM   1247 C CG1   . VAL A 1 168 ? -15.204 45.017  5.055   1.00 51.64 ? 167 VAL A CG1   1 
ATOM   1248 C CG2   . VAL A 1 168 ? -12.888 44.210  5.027   1.00 51.98 ? 167 VAL A CG2   1 
ATOM   1249 N N     . LYS A 1 169 ? -12.852 41.567  2.806   1.00 50.33 ? 168 LYS A N     1 
ATOM   1250 C CA    . LYS A 1 169 ? -11.952 41.383  1.678   1.00 50.48 ? 168 LYS A CA    1 
ATOM   1251 C C     . LYS A 1 169 ? -12.486 40.335  0.716   1.00 50.96 ? 168 LYS A C     1 
ATOM   1252 O O     . LYS A 1 169 ? -12.648 40.605  -0.478  1.00 50.21 ? 168 LYS A O     1 
ATOM   1253 C CB    . LYS A 1 169 ? -10.496 41.092  2.119   1.00 50.95 ? 168 LYS A CB    1 
ATOM   1254 C CG    . LYS A 1 169 ? -9.855  42.208  3.006   1.00 46.95 ? 168 LYS A CG    1 
ATOM   1255 C CD    . LYS A 1 169 ? -10.053 43.591  2.364   1.00 40.66 ? 168 LYS A CD    1 
ATOM   1256 C CE    . LYS A 1 169 ? -9.017  44.543  2.812   1.00 37.96 ? 168 LYS A CE    1 
ATOM   1257 N NZ    . LYS A 1 169 ? -9.225  45.819  2.159   1.00 34.21 ? 168 LYS A NZ    1 
ATOM   1258 N N     . ILE A 1 170 ? -12.820 39.169  1.258   1.00 51.59 ? 169 ILE A N     1 
ATOM   1259 C CA    . ILE A 1 170 ? -13.265 38.032  0.453   1.00 52.44 ? 169 ILE A CA    1 
ATOM   1260 C C     . ILE A 1 170 ? -14.509 38.335  -0.389  1.00 53.36 ? 169 ILE A C     1 
ATOM   1261 O O     . ILE A 1 170 ? -14.706 37.755  -1.428  1.00 53.89 ? 169 ILE A O     1 
ATOM   1262 C CB    . ILE A 1 170 ? -13.407 36.781  1.288   1.00 52.07 ? 169 ILE A CB    1 
ATOM   1263 C CG1   . ILE A 1 170 ? -14.373 37.043  2.425   1.00 52.72 ? 169 ILE A CG1   1 
ATOM   1264 C CG2   . ILE A 1 170 ? -12.021 36.353  1.833   1.00 49.50 ? 169 ILE A CG2   1 
ATOM   1265 C CD1   . ILE A 1 170 ? -14.986 35.820  2.970   1.00 54.89 ? 169 ILE A CD1   1 
ATOM   1266 N N     . SER A 1 171 ? -15.299 39.317  -0.012  1.00 55.17 ? 170 SER A N     1 
ATOM   1267 C CA    . SER A 1 171 ? -16.437 39.639  -0.850  1.00 56.18 ? 170 SER A CA    1 
ATOM   1268 C C     . SER A 1 171 ? -16.228 40.918  -1.666  1.00 57.46 ? 170 SER A C     1 
ATOM   1269 O O     . SER A 1 171 ? -17.212 41.575  -2.034  1.00 58.23 ? 170 SER A O     1 
ATOM   1270 C CB    . SER A 1 171 ? -17.688 39.724  0.000   1.00 56.11 ? 170 SER A CB    1 
ATOM   1271 O OG    . SER A 1 171 ? -17.484 40.711  0.992   1.00 56.56 ? 170 SER A OG    1 
ATOM   1272 N N     . SER A 1 172 ? -14.963 41.266  -1.945  1.00 58.62 ? 171 SER A N     1 
ATOM   1273 C CA    . SER A 1 172 ? -14.561 42.351  -2.880  1.00 59.10 ? 171 SER A CA    1 
ATOM   1274 C C     . SER A 1 172 ? -14.773 41.865  -4.296  1.00 60.19 ? 171 SER A C     1 
ATOM   1275 O O     . SER A 1 172 ? -14.726 40.661  -4.517  1.00 61.19 ? 171 SER A O     1 
ATOM   1276 C CB    . SER A 1 172 ? -13.062 42.703  -2.706  1.00 59.36 ? 171 SER A CB    1 
ATOM   1277 O OG    . SER A 1 172 ? -12.453 43.253  -3.902  1.00 57.37 ? 171 SER A OG    1 
ATOM   1278 N N     . PRO A 1 173 ? -15.000 42.786  -5.269  1.00 60.84 ? 172 PRO A N     1 
ATOM   1279 C CA    . PRO A 1 173 ? -15.049 42.357  -6.703  1.00 60.75 ? 172 PRO A CA    1 
ATOM   1280 C C     . PRO A 1 173 ? -13.796 41.622  -7.210  1.00 60.44 ? 172 PRO A C     1 
ATOM   1281 O O     . PRO A 1 173 ? -13.892 40.862  -8.174  1.00 61.36 ? 172 PRO A O     1 
ATOM   1282 C CB    . PRO A 1 173 ? -15.232 43.669  -7.498  1.00 61.13 ? 172 PRO A CB    1 
ATOM   1283 C CG    . PRO A 1 173 ? -15.692 44.732  -6.475  1.00 62.41 ? 172 PRO A CG    1 
ATOM   1284 C CD    . PRO A 1 173 ? -15.263 44.237  -5.080  1.00 60.94 ? 172 PRO A CD    1 
ATOM   1285 N N     . ASP A 1 174 ? -12.640 41.842  -6.590  1.00 59.75 ? 173 ASP A N     1 
ATOM   1286 C CA    . ASP A 1 174 ? -11.401 41.105  -6.955  1.00 59.54 ? 173 ASP A CA    1 
ATOM   1287 C C     . ASP A 1 174 ? -11.561 39.583  -6.866  1.00 59.17 ? 173 ASP A C     1 
ATOM   1288 O O     . ASP A 1 174 ? -10.872 38.854  -7.570  1.00 58.79 ? 173 ASP A O     1 
ATOM   1289 C CB    . ASP A 1 174 ? -10.234 41.447  -6.029  1.00 59.02 ? 173 ASP A CB    1 
ATOM   1290 C CG    . ASP A 1 174 ? -9.730  42.877  -6.176  1.00 60.20 ? 173 ASP A CG    1 
ATOM   1291 O OD1   . ASP A 1 174 ? -9.898  43.495  -7.260  1.00 62.24 ? 173 ASP A OD1   1 
ATOM   1292 O OD2   . ASP A 1 174 ? -9.124  43.361  -5.178  1.00 60.41 ? 173 ASP A OD2   1 
ATOM   1293 N N     . TYR A 1 175 ? -12.462 39.129  -5.988  1.00 58.25 ? 174 TYR A N     1 
ATOM   1294 C CA    . TYR A 1 175 ? -12.607 37.731  -5.669  1.00 57.89 ? 174 TYR A CA    1 
ATOM   1295 C C     . TYR A 1 175 ? -13.972 37.155  -6.139  1.00 60.66 ? 174 TYR A C     1 
ATOM   1296 O O     . TYR A 1 175 ? -14.467 36.153  -5.585  1.00 60.34 ? 174 TYR A O     1 
ATOM   1297 C CB    . TYR A 1 175 ? -12.354 37.521  -4.155  1.00 54.93 ? 174 TYR A CB    1 
ATOM   1298 C CG    . TYR A 1 175 ? -10.941 37.862  -3.723  1.00 50.85 ? 174 TYR A CG    1 
ATOM   1299 C CD1   . TYR A 1 175 ? -9.868  37.052  -4.121  1.00 47.80 ? 174 TYR A CD1   1 
ATOM   1300 C CD2   . TYR A 1 175 ? -10.656 39.012  -2.946  1.00 47.62 ? 174 TYR A CD2   1 
ATOM   1301 C CE1   . TYR A 1 175 ? -8.566  37.335  -3.751  1.00 45.70 ? 174 TYR A CE1   1 
ATOM   1302 C CE2   . TYR A 1 175 ? -9.335  39.327  -2.578  1.00 45.29 ? 174 TYR A CE2   1 
ATOM   1303 C CZ    . TYR A 1 175 ? -8.296  38.471  -2.999  1.00 47.79 ? 174 TYR A CZ    1 
ATOM   1304 O OH    . TYR A 1 175 ? -7.001  38.685  -2.672  1.00 45.57 ? 174 TYR A OH    1 
ATOM   1305 N N     . LYS A 1 176 ? -14.554 37.765  -7.180  1.00 63.74 ? 175 LYS A N     1 
ATOM   1306 C CA    . LYS A 1 176 ? -15.888 37.360  -7.687  1.00 67.27 ? 175 LYS A CA    1 
ATOM   1307 C C     . LYS A 1 176 ? -16.077 35.862  -8.047  1.00 68.93 ? 175 LYS A C     1 
ATOM   1308 O O     . LYS A 1 176 ? -17.084 35.260  -7.677  1.00 69.14 ? 175 LYS A O     1 
ATOM   1309 C CB    . LYS A 1 176 ? -16.364 38.259  -8.847  1.00 67.49 ? 175 LYS A CB    1 
ATOM   1310 C CG    . LYS A 1 176 ? -15.569 38.115  -10.158 1.00 69.87 ? 175 LYS A CG    1 
ATOM   1311 C CD    . LYS A 1 176 ? -16.441 38.430  -11.386 1.00 74.17 ? 175 LYS A CD    1 
ATOM   1312 C CE    . LYS A 1 176 ? -16.217 39.833  -11.958 1.00 76.55 ? 175 LYS A CE    1 
ATOM   1313 N NZ    . LYS A 1 176 ? -16.499 40.964  -10.992 1.00 78.56 ? 175 LYS A NZ    1 
ATOM   1314 N N     . ASP A 1 177 ? -15.139 35.265  -8.773  1.00 71.17 ? 176 ASP A N     1 
ATOM   1315 C CA    . ASP A 1 177 ? -15.354 33.900  -9.260  1.00 73.73 ? 176 ASP A CA    1 
ATOM   1316 C C     . ASP A 1 177 ? -14.484 32.982  -8.394  1.00 74.64 ? 176 ASP A C     1 
ATOM   1317 O O     . ASP A 1 177 ? -13.577 32.271  -8.893  1.00 75.46 ? 176 ASP A O     1 
ATOM   1318 C CB    . ASP A 1 177 ? -15.005 33.736  -10.771 1.00 74.63 ? 176 ASP A CB    1 
ATOM   1319 C CG    . ASP A 1 177 ? -15.274 35.009  -11.615 1.00 77.10 ? 176 ASP A CG    1 
ATOM   1320 O OD1   . ASP A 1 177 ? -16.426 35.516  -11.667 1.00 79.34 ? 176 ASP A OD1   1 
ATOM   1321 O OD2   . ASP A 1 177 ? -14.315 35.492  -12.259 1.00 79.76 ? 176 ASP A OD2   1 
ATOM   1322 N N     . CYS A 1 178 ? -14.754 32.989  -7.091  1.00 74.49 ? 177 CYS A N     1 
ATOM   1323 C CA    . CYS A 1 178 ? -13.733 32.585  -6.147  1.00 73.40 ? 177 CYS A CA    1 
ATOM   1324 C C     . CYS A 1 178 ? -14.349 32.302  -4.776  1.00 72.34 ? 177 CYS A C     1 
ATOM   1325 O O     . CYS A 1 178 ? -15.284 32.968  -4.373  1.00 72.31 ? 177 CYS A O     1 
ATOM   1326 C CB    . CYS A 1 178 ? -12.709 33.717  -6.106  1.00 73.66 ? 177 CYS A CB    1 
ATOM   1327 S SG    . CYS A 1 178 ? -11.222 33.328  -5.261  1.00 75.29 ? 177 CYS A SG    1 
ATOM   1328 N N     . ASN A 1 179 ? -13.871 31.283  -4.073  1.00 71.61 ? 178 ASN A N     1 
ATOM   1329 C CA    . ASN A 1 179 ? -14.422 30.985  -2.760  1.00 70.40 ? 178 ASN A CA    1 
ATOM   1330 C C     . ASN A 1 179 ? -13.538 31.474  -1.646  1.00 69.17 ? 178 ASN A C     1 
ATOM   1331 O O     . ASN A 1 179 ? -12.332 31.689  -1.800  1.00 68.51 ? 178 ASN A O     1 
ATOM   1332 C CB    . ASN A 1 179 ? -14.615 29.482  -2.562  1.00 71.26 ? 178 ASN A CB    1 
ATOM   1333 C CG    . ASN A 1 179 ? -13.314 28.780  -2.150  1.00 73.03 ? 178 ASN A CG    1 
ATOM   1334 O OD1   . ASN A 1 179 ? -12.993 28.641  -0.948  1.00 76.97 ? 178 ASN A OD1   1 
ATOM   1335 N ND2   . ASN A 1 179 ? -12.544 28.372  -3.138  1.00 72.22 ? 178 ASN A ND2   1 
ATOM   1336 N N     . SER A 1 180 ? -14.171 31.556  -0.493  1.00 68.54 ? 179 SER A N     1 
ATOM   1337 C CA    . SER A 1 180 ? -13.549 31.870  0.792   1.00 67.54 ? 179 SER A CA    1 
ATOM   1338 C C     . SER A 1 180 ? -12.101 31.445  0.987   1.00 66.94 ? 179 SER A C     1 
ATOM   1339 O O     . SER A 1 180 ? -11.238 32.311  1.123   1.00 67.32 ? 179 SER A O     1 
ATOM   1340 C CB    . SER A 1 180 ? -14.428 31.328  1.930   1.00 67.68 ? 179 SER A CB    1 
ATOM   1341 O OG    . SER A 1 180 ? -15.698 31.948  1.838   1.00 65.77 ? 179 SER A OG    1 
ATOM   1342 N N     . ALA A 1 181 ? -11.837 30.140  0.995   1.00 66.04 ? 180 ALA A N     1 
ATOM   1343 C CA    . ALA A 1 181 ? -10.532 29.619  1.410   1.00 65.39 ? 180 ALA A CA    1 
ATOM   1344 C C     . ALA A 1 181 ? -9.371  30.096  0.530   1.00 64.91 ? 180 ALA A C     1 
ATOM   1345 O O     . ALA A 1 181 ? -8.215  30.221  0.987   1.00 64.79 ? 180 ALA A O     1 
ATOM   1346 C CB    . ALA A 1 181 ? -10.567 28.108  1.449   1.00 65.24 ? 180 ALA A CB    1 
ATOM   1347 N N     . GLU A 1 182 ? -9.677  30.337  -0.740  1.00 63.93 ? 181 GLU A N     1 
ATOM   1348 C CA    . GLU A 1 182 ? -8.632  30.675  -1.690  1.00 63.29 ? 181 GLU A CA    1 
ATOM   1349 C C     . GLU A 1 182 ? -8.513  32.206  -1.853  1.00 61.62 ? 181 GLU A C     1 
ATOM   1350 O O     . GLU A 1 182 ? -7.400  32.740  -2.004  1.00 61.10 ? 181 GLU A O     1 
ATOM   1351 C CB    . GLU A 1 182 ? -8.807  29.898  -3.005  1.00 63.56 ? 181 GLU A CB    1 
ATOM   1352 C CG    . GLU A 1 182 ? -9.741  30.550  -4.011  1.00 65.84 ? 181 GLU A CG    1 
ATOM   1353 C CD    . GLU A 1 182 ? -10.632 29.534  -4.734  1.00 69.69 ? 181 GLU A CD    1 
ATOM   1354 O OE1   . GLU A 1 182 ? -10.177 28.369  -5.011  1.00 64.57 ? 181 GLU A OE1   1 
ATOM   1355 O OE2   . GLU A 1 182 ? -11.804 29.934  -5.007  1.00 69.70 ? 181 GLU A OE2   1 
ATOM   1356 N N     . ALA A 1 183 ? -9.652  32.889  -1.773  1.00 60.09 ? 182 ALA A N     1 
ATOM   1357 C CA    . ALA A 1 183 ? -9.674  34.332  -1.558  1.00 59.02 ? 182 ALA A CA    1 
ATOM   1358 C C     . ALA A 1 183 ? -8.848  34.679  -0.306  1.00 58.64 ? 182 ALA A C     1 
ATOM   1359 O O     . ALA A 1 183 ? -7.892  35.445  -0.401  1.00 58.34 ? 182 ALA A O     1 
ATOM   1360 C CB    . ALA A 1 183 ? -11.101 34.842  -1.472  1.00 58.57 ? 182 ALA A CB    1 
ATOM   1361 N N     . MET A 1 184 ? -9.158  34.065  0.834   1.00 58.00 ? 183 MET A N     1 
ATOM   1362 C CA    . MET A 1 184 ? -8.374  34.252  2.059   1.00 58.39 ? 183 MET A CA    1 
ATOM   1363 C C     . MET A 1 184 ? -6.873  33.945  1.891   1.00 57.91 ? 183 MET A C     1 
ATOM   1364 O O     . MET A 1 184 ? -5.999  34.649  2.407   1.00 58.51 ? 183 MET A O     1 
ATOM   1365 C CB    . MET A 1 184 ? -8.982  33.420  3.210   1.00 58.90 ? 183 MET A CB    1 
ATOM   1366 C CG    . MET A 1 184 ? -8.034  33.127  4.427   1.00 61.87 ? 183 MET A CG    1 
ATOM   1367 S SD    . MET A 1 184 ? -7.694  34.551  5.512   1.00 67.37 ? 183 MET A SD    1 
ATOM   1368 C CE    . MET A 1 184 ? -9.283  34.668  6.368   1.00 62.79 ? 183 MET A CE    1 
ATOM   1369 N N     . ASP A 1 185 ? -6.572  32.870  1.185   1.00 57.54 ? 184 ASP A N     1 
ATOM   1370 C CA    . ASP A 1 185 ? -5.187  32.452  0.990   1.00 56.20 ? 184 ASP A CA    1 
ATOM   1371 C C     . ASP A 1 185 ? -4.485  33.498  0.090   1.00 54.71 ? 184 ASP A C     1 
ATOM   1372 O O     . ASP A 1 185 ? -3.369  33.966  0.403   1.00 54.61 ? 184 ASP A O     1 
ATOM   1373 C CB    . ASP A 1 185 ? -5.126  31.004  0.411   1.00 56.64 ? 184 ASP A CB    1 
ATOM   1374 C CG    . ASP A 1 185 ? -3.677  30.555  0.057   1.00 58.02 ? 184 ASP A CG    1 
ATOM   1375 O OD1   . ASP A 1 185 ? -2.944  30.218  1.006   1.00 61.84 ? 184 ASP A OD1   1 
ATOM   1376 O OD2   . ASP A 1 185 ? -3.256  30.557  -1.147  1.00 57.90 ? 184 ASP A OD2   1 
ATOM   1377 N N     . ASP A 1 186 ? -5.155  33.881  -1.005  1.00 52.47 ? 185 ASP A N     1 
ATOM   1378 C CA    . ASP A 1 186 ? -4.609  34.892  -1.925  1.00 50.75 ? 185 ASP A CA    1 
ATOM   1379 C C     . ASP A 1 186 ? -4.304  36.252  -1.216  1.00 49.70 ? 185 ASP A C     1 
ATOM   1380 O O     . ASP A 1 186 ? -3.249  36.890  -1.427  1.00 49.12 ? 185 ASP A O     1 
ATOM   1381 C CB    . ASP A 1 186 ? -5.523  35.073  -3.131  1.00 49.34 ? 185 ASP A CB    1 
ATOM   1382 C CG    . ASP A 1 186 ? -5.031  36.140  -4.049  1.00 51.35 ? 185 ASP A CG    1 
ATOM   1383 O OD1   . ASP A 1 186 ? -4.153  35.867  -4.879  1.00 52.53 ? 185 ASP A OD1   1 
ATOM   1384 O OD2   . ASP A 1 186 ? -5.454  37.312  -3.902  1.00 57.59 ? 185 ASP A OD2   1 
ATOM   1385 N N     . PHE A 1 187 ? -5.217  36.653  -0.334  1.00 48.16 ? 186 PHE A N     1 
ATOM   1386 C CA    . PHE A 1 187 ? -5.105  37.935  0.293   1.00 46.31 ? 186 PHE A CA    1 
ATOM   1387 C C     . PHE A 1 187 ? -3.989  37.902  1.334   1.00 45.99 ? 186 PHE A C     1 
ATOM   1388 O O     . PHE A 1 187 ? -3.313  38.926  1.537   1.00 45.81 ? 186 PHE A O     1 
ATOM   1389 C CB    . PHE A 1 187 ? -6.455  38.406  0.874   1.00 45.50 ? 186 PHE A CB    1 
ATOM   1390 C CG    . PHE A 1 187 ? -6.518  39.900  1.103   1.00 43.71 ? 186 PHE A CG    1 
ATOM   1391 C CD1   . PHE A 1 187 ? -6.925  40.748  0.081   1.00 40.43 ? 186 PHE A CD1   1 
ATOM   1392 C CD2   . PHE A 1 187 ? -6.149  40.446  2.325   1.00 41.39 ? 186 PHE A CD2   1 
ATOM   1393 C CE1   . PHE A 1 187 ? -6.975  42.094  0.239   1.00 39.54 ? 186 PHE A CE1   1 
ATOM   1394 C CE2   . PHE A 1 187 ? -6.177  41.820  2.506   1.00 45.44 ? 186 PHE A CE2   1 
ATOM   1395 C CZ    . PHE A 1 187 ? -6.598  42.655  1.438   1.00 44.21 ? 186 PHE A CZ    1 
ATOM   1396 N N     . MET A 1 188 ? -3.767  36.744  1.966   1.00 45.38 ? 187 MET A N     1 
ATOM   1397 C CA    . MET A 1 188 ? -2.631  36.633  2.879   1.00 46.12 ? 187 MET A CA    1 
ATOM   1398 C C     . MET A 1 188 ? -1.314  36.799  2.120   1.00 46.46 ? 187 MET A C     1 
ATOM   1399 O O     . MET A 1 188 ? -0.399  37.450  2.571   1.00 46.94 ? 187 MET A O     1 
ATOM   1400 C CB    . MET A 1 188 ? -2.673  35.333  3.661   1.00 46.40 ? 187 MET A CB    1 
ATOM   1401 C CG    . MET A 1 188 ? -3.680  35.281  4.838   1.00 49.08 ? 187 MET A CG    1 
ATOM   1402 S SD    . MET A 1 188 ? -3.371  36.501  6.186   1.00 58.52 ? 187 MET A SD    1 
ATOM   1403 C CE    . MET A 1 188 ? -1.837  36.030  7.054   1.00 53.31 ? 187 MET A CE    1 
ATOM   1404 N N     . LYS A 1 189 ? -1.236  36.260  0.912   1.00 47.22 ? 188 LYS A N     1 
ATOM   1405 C CA    . LYS A 1 189 ? -0.048  36.500  0.112   1.00 47.12 ? 188 LYS A CA    1 
ATOM   1406 C C     . LYS A 1 189 ? 0.063   37.972  -0.377  1.00 45.53 ? 188 LYS A C     1 
ATOM   1407 O O     . LYS A 1 189 ? 1.156   38.557  -0.371  1.00 45.11 ? 188 LYS A O     1 
ATOM   1408 C CB    . LYS A 1 189 ? 0.011   35.506  -1.045  1.00 48.16 ? 188 LYS A CB    1 
ATOM   1409 C CG    . LYS A 1 189 ? -0.172  34.062  -0.627  1.00 50.87 ? 188 LYS A CG    1 
ATOM   1410 C CD    . LYS A 1 189 ? 0.904   33.143  -1.236  1.00 55.09 ? 188 LYS A CD    1 
ATOM   1411 C CE    . LYS A 1 189 ? 0.286   31.856  -1.853  1.00 57.85 ? 188 LYS A CE    1 
ATOM   1412 N NZ    . LYS A 1 189 ? -0.556  31.113  -0.863  1.00 58.79 ? 188 LYS A NZ    1 
ATOM   1413 N N     . ARG A 1 190 ? -1.048  38.578  -0.796  1.00 43.90 ? 189 ARG A N     1 
ATOM   1414 C CA    . ARG A 1 190 ? -1.022  40.028  -1.088  1.00 42.68 ? 189 ARG A CA    1 
ATOM   1415 C C     . ARG A 1 190 ? -0.460  40.801  0.091   1.00 42.10 ? 189 ARG A C     1 
ATOM   1416 O O     . ARG A 1 190 ? 0.409   41.635  -0.098  1.00 41.99 ? 189 ARG A O     1 
ATOM   1417 C CB    . ARG A 1 190 ? -2.398  40.517  -1.331  1.00 42.98 ? 189 ARG A CB    1 
ATOM   1418 C CG    . ARG A 1 190 ? -2.575  41.844  -2.077  1.00 44.39 ? 189 ARG A CG    1 
ATOM   1419 C CD    . ARG A 1 190 ? -3.959  41.614  -2.735  1.00 46.23 ? 189 ARG A CD    1 
ATOM   1420 N NE    . ARG A 1 190 ? -4.818  42.754  -2.630  1.00 43.80 ? 189 ARG A NE    1 
ATOM   1421 C CZ    . ARG A 1 190 ? -6.020  42.831  -3.181  1.00 47.31 ? 189 ARG A CZ    1 
ATOM   1422 N NH1   . ARG A 1 190 ? -6.548  41.794  -3.873  1.00 41.07 ? 189 ARG A NH1   1 
ATOM   1423 N NH2   . ARG A 1 190 ? -6.718  43.971  -3.010  1.00 51.79 ? 189 ARG A NH2   1 
ATOM   1424 N N     . ILE A 1 191 ? -0.924  40.508  1.310   1.00 41.06 ? 190 ILE A N     1 
ATOM   1425 C CA    . ILE A 1 191 ? -0.279  41.104  2.484   1.00 40.27 ? 190 ILE A CA    1 
ATOM   1426 C C     . ILE A 1 191 ? 1.244   40.868  2.557   1.00 40.63 ? 190 ILE A C     1 
ATOM   1427 O O     . ILE A 1 191 ? 2.019   41.835  2.839   1.00 40.53 ? 190 ILE A O     1 
ATOM   1428 C CB    . ILE A 1 191 ? -0.991  40.790  3.863   1.00 39.86 ? 190 ILE A CB    1 
ATOM   1429 C CG1   . ILE A 1 191 ? -2.397  41.375  3.829   1.00 39.55 ? 190 ILE A CG1   1 
ATOM   1430 C CG2   . ILE A 1 191 ? -0.243  41.446  5.029   1.00 32.47 ? 190 ILE A CG2   1 
ATOM   1431 C CD1   . ILE A 1 191 ? -3.353  40.704  4.870   1.00 38.88 ? 190 ILE A CD1   1 
ATOM   1432 N N     . SER A 1 192 ? 1.692   39.633  2.307   1.00 40.79 ? 191 SER A N     1 
ATOM   1433 C CA    . SER A 1 192 ? 3.141   39.411  2.431   1.00 42.22 ? 191 SER A CA    1 
ATOM   1434 C C     . SER A 1 192 ? 3.889   40.240  1.409   1.00 41.63 ? 191 SER A C     1 
ATOM   1435 O O     . SER A 1 192 ? 4.951   40.745  1.728   1.00 41.31 ? 191 SER A O     1 
ATOM   1436 C CB    . SER A 1 192 ? 3.566   37.934  2.441   1.00 42.96 ? 191 SER A CB    1 
ATOM   1437 O OG    . SER A 1 192 ? 3.188   37.333  1.222   1.00 47.58 ? 191 SER A OG    1 
ATOM   1438 N N     . CYS A 1 193 ? 3.315   40.460  0.225   1.00 41.90 ? 192 CYS A N     1 
ATOM   1439 C CA    . CYS A 1 193 ? 3.973   41.360  -0.746  1.00 43.45 ? 192 CYS A CA    1 
ATOM   1440 C C     . CYS A 1 193 ? 4.430   42.688  -0.146  1.00 43.32 ? 192 CYS A C     1 
ATOM   1441 O O     . CYS A 1 193 ? 5.575   43.115  -0.419  1.00 44.68 ? 192 CYS A O     1 
ATOM   1442 C CB    . CYS A 1 193 ? 3.149   41.606  -2.002  1.00 43.35 ? 192 CYS A CB    1 
ATOM   1443 S SG    . CYS A 1 193 ? 2.853   40.042  -2.896  1.00 47.56 ? 192 CYS A SG    1 
ATOM   1444 N N     . TYR A 1 194 ? 3.591   43.281  0.715   1.00 41.06 ? 193 TYR A N     1 
ATOM   1445 C CA    . TYR A 1 194 ? 3.861   44.572  1.289   1.00 39.67 ? 193 TYR A CA    1 
ATOM   1446 C C     . TYR A 1 194 ? 4.739   44.539  2.519   1.00 41.13 ? 193 TYR A C     1 
ATOM   1447 O O     . TYR A 1 194 ? 5.360   45.546  2.857   1.00 40.42 ? 193 TYR A O     1 
ATOM   1448 C CB    . TYR A 1 194 ? 2.529   45.197  1.719   1.00 38.67 ? 193 TYR A CB    1 
ATOM   1449 C CG    . TYR A 1 194 ? 1.696   45.745  0.594   1.00 32.73 ? 193 TYR A CG    1 
ATOM   1450 C CD1   . TYR A 1 194 ? 1.969   47.013  0.043   1.00 25.07 ? 193 TYR A CD1   1 
ATOM   1451 C CD2   . TYR A 1 194 ? 0.652   44.990  0.078   1.00 25.65 ? 193 TYR A CD2   1 
ATOM   1452 C CE1   . TYR A 1 194 ? 1.157   47.513  -1.003  1.00 27.57 ? 193 TYR A CE1   1 
ATOM   1453 C CE2   . TYR A 1 194 ? -0.141  45.460  -0.962  1.00 25.89 ? 193 TYR A CE2   1 
ATOM   1454 C CZ    . TYR A 1 194 ? 0.100   46.720  -1.493  1.00 29.43 ? 193 TYR A CZ    1 
ATOM   1455 O OH    . TYR A 1 194 ? -0.722  47.163  -2.507  1.00 31.62 ? 193 TYR A OH    1 
ATOM   1456 N N     . GLU A 1 195 ? 4.739   43.411  3.239   1.00 43.61 ? 194 GLU A N     1 
ATOM   1457 C CA    . GLU A 1 195 ? 5.578   43.273  4.440   1.00 45.28 ? 194 GLU A CA    1 
ATOM   1458 C C     . GLU A 1 195 ? 7.038   43.615  4.224   1.00 46.11 ? 194 GLU A C     1 
ATOM   1459 O O     . GLU A 1 195 ? 7.610   44.342  5.002   1.00 46.82 ? 194 GLU A O     1 
ATOM   1460 C CB    . GLU A 1 195 ? 5.402   41.927  5.112   1.00 45.11 ? 194 GLU A CB    1 
ATOM   1461 C CG    . GLU A 1 195 ? 4.145   41.967  5.977   1.00 47.96 ? 194 GLU A CG    1 
ATOM   1462 C CD    . GLU A 1 195 ? 3.589   40.593  6.398   1.00 52.57 ? 194 GLU A CD    1 
ATOM   1463 O OE1   . GLU A 1 195 ? 3.795   39.586  5.672   1.00 53.82 ? 194 GLU A OE1   1 
ATOM   1464 O OE2   . GLU A 1 195 ? 2.898   40.539  7.447   1.00 52.28 ? 194 GLU A OE2   1 
ATOM   1465 N N     . ALA A 1 196 ? 7.641   43.176  3.137   1.00 47.36 ? 195 ALA A N     1 
ATOM   1466 C CA    . ALA A 1 196 ? 9.106   43.437  2.990   1.00 47.53 ? 195 ALA A CA    1 
ATOM   1467 C C     . ALA A 1 196 ? 9.472   44.907  2.994   1.00 47.38 ? 195 ALA A C     1 
ATOM   1468 O O     . ALA A 1 196 ? 10.382  45.281  3.674   1.00 48.57 ? 195 ALA A O     1 
ATOM   1469 C CB    . ALA A 1 196 ? 9.733   42.702  1.759   1.00 46.22 ? 195 ALA A CB    1 
ATOM   1470 N N     . SER A 1 197 ? 8.811   45.790  2.268   1.00 47.91 ? 196 SER A N     1 
ATOM   1471 C CA    . SER A 1 197 ? 9.346   47.159  2.396   1.00 47.57 ? 196 SER A CA    1 
ATOM   1472 C C     . SER A 1 197 ? 8.479   48.158  3.181   1.00 46.70 ? 196 SER A C     1 
ATOM   1473 O O     . SER A 1 197 ? 8.586   49.382  2.996   1.00 45.90 ? 196 SER A O     1 
ATOM   1474 C CB    . SER A 1 197 ? 9.831   47.703  1.079   1.00 47.79 ? 196 SER A CB    1 
ATOM   1475 O OG    . SER A 1 197 ? 8.759   47.590  0.193   1.00 53.55 ? 196 SER A OG    1 
ATOM   1476 N N     . TYR A 1 198 ? 7.695   47.616  4.116   1.00 45.43 ? 197 TYR A N     1 
ATOM   1477 C CA    . TYR A 1 198 ? 6.849   48.421  4.937   1.00 44.91 ? 197 TYR A CA    1 
ATOM   1478 C C     . TYR A 1 198 ? 7.711   49.151  5.970   1.00 45.61 ? 197 TYR A C     1 
ATOM   1479 O O     . TYR A 1 198 ? 8.327   48.505  6.855   1.00 45.39 ? 197 TYR A O     1 
ATOM   1480 C CB    . TYR A 1 198 ? 5.813   47.523  5.624   1.00 43.94 ? 197 TYR A CB    1 
ATOM   1481 C CG    . TYR A 1 198 ? 4.949   48.188  6.687   1.00 42.75 ? 197 TYR A CG    1 
ATOM   1482 C CD1   . TYR A 1 198 ? 4.604   49.562  6.601   1.00 43.61 ? 197 TYR A CD1   1 
ATOM   1483 C CD2   . TYR A 1 198 ? 4.469   47.456  7.770   1.00 41.56 ? 197 TYR A CD2   1 
ATOM   1484 C CE1   . TYR A 1 198 ? 3.806   50.168  7.571   1.00 42.02 ? 197 TYR A CE1   1 
ATOM   1485 C CE2   . TYR A 1 198 ? 3.663   48.047  8.744   1.00 40.12 ? 197 TYR A CE2   1 
ATOM   1486 C CZ    . TYR A 1 198 ? 3.334   49.396  8.633   1.00 41.89 ? 197 TYR A CZ    1 
ATOM   1487 O OH    . TYR A 1 198 ? 2.521   49.983  9.562   1.00 40.74 ? 197 TYR A OH    1 
ATOM   1488 N N     . GLN A 1 199 ? 7.684   50.485  5.908   1.00 45.26 ? 198 GLN A N     1 
ATOM   1489 C CA    . GLN A 1 199 ? 8.393   51.336  6.874   1.00 45.67 ? 198 GLN A CA    1 
ATOM   1490 C C     . GLN A 1 199 ? 7.363   52.128  7.661   1.00 45.87 ? 198 GLN A C     1 
ATOM   1491 O O     . GLN A 1 199 ? 6.858   53.149  7.174   1.00 45.68 ? 198 GLN A O     1 
ATOM   1492 C CB    . GLN A 1 199 ? 9.416   52.268  6.185   1.00 45.00 ? 198 GLN A CB    1 
ATOM   1493 C CG    . GLN A 1 199 ? 10.237  51.516  5.092   1.00 46.47 ? 198 GLN A CG    1 
ATOM   1494 C CD    . GLN A 1 199 ? 11.134  52.413  4.270   1.00 46.67 ? 198 GLN A CD    1 
ATOM   1495 O OE1   . GLN A 1 199 ? 10.699  53.110  3.347   1.00 48.02 ? 198 GLN A OE1   1 
ATOM   1496 N NE2   . GLN A 1 199 ? 12.421  52.388  4.593   1.00 50.80 ? 198 GLN A NE2   1 
ATOM   1497 N N     . PRO A 1 200 ? 7.063   51.681  8.894   1.00 46.37 ? 199 PRO A N     1 
ATOM   1498 C CA    . PRO A 1 200 ? 6.000   52.327  9.689   1.00 47.23 ? 199 PRO A CA    1 
ATOM   1499 C C     . PRO A 1 200 ? 6.379   53.782  9.959   1.00 47.48 ? 199 PRO A C     1 
ATOM   1500 O O     . PRO A 1 200 ? 7.540   54.140  9.794   1.00 46.29 ? 199 PRO A O     1 
ATOM   1501 C CB    . PRO A 1 200 ? 6.000   51.531  11.018  1.00 47.15 ? 199 PRO A CB    1 
ATOM   1502 C CG    . PRO A 1 200 ? 6.799   50.312  10.751  1.00 46.18 ? 199 PRO A CG    1 
ATOM   1503 C CD    . PRO A 1 200 ? 7.750   50.617  9.651   1.00 45.84 ? 199 PRO A CD    1 
ATOM   1504 N N     . LEU A 1 201 ? 5.418   54.611  10.366  1.00 48.65 ? 200 LEU A N     1 
ATOM   1505 C CA    . LEU A 1 201 ? 5.750   56.005  10.677  1.00 50.13 ? 200 LEU A CA    1 
ATOM   1506 C C     . LEU A 1 201 ? 6.666   55.946  11.880  1.00 52.23 ? 200 LEU A C     1 
ATOM   1507 O O     . LEU A 1 201 ? 6.404   55.189  12.822  1.00 51.76 ? 200 LEU A O     1 
ATOM   1508 C CB    . LEU A 1 201 ? 4.492   56.842  10.972  1.00 48.77 ? 200 LEU A CB    1 
ATOM   1509 C CG    . LEU A 1 201 ? 3.511   57.041  9.798   1.00 48.89 ? 200 LEU A CG    1 
ATOM   1510 C CD1   . LEU A 1 201 ? 2.205   57.749  10.202  1.00 46.09 ? 200 LEU A CD1   1 
ATOM   1511 C CD2   . LEU A 1 201 ? 4.206   57.741  8.584   1.00 45.33 ? 200 LEU A CD2   1 
ATOM   1512 N N     . ASP A 1 202 ? 7.771   56.682  11.827  1.00 55.12 ? 201 ASP A N     1 
ATOM   1513 C CA    . ASP A 1 202 ? 8.652   56.812  13.000  1.00 58.25 ? 201 ASP A CA    1 
ATOM   1514 C C     . ASP A 1 202 ? 8.592   58.228  13.584  1.00 59.92 ? 201 ASP A C     1 
ATOM   1515 O O     . ASP A 1 202 ? 9.400   59.100  13.242  1.00 59.82 ? 201 ASP A O     1 
ATOM   1516 C CB    . ASP A 1 202 ? 10.094  56.463  12.675  1.00 57.90 ? 201 ASP A CB    1 
ATOM   1517 C CG    . ASP A 1 202 ? 10.885  56.144  13.923  1.00 61.09 ? 201 ASP A CG    1 
ATOM   1518 O OD1   . ASP A 1 202 ? 10.296  56.105  15.036  1.00 62.33 ? 201 ASP A OD1   1 
ATOM   1519 O OD2   . ASP A 1 202 ? 12.102  55.925  13.791  1.00 64.43 ? 201 ASP A OD2   1 
ATOM   1520 N N     . PRO A 1 203 ? 7.624   58.471  14.464  1.00 61.80 ? 202 PRO A N     1 
ATOM   1521 C CA    . PRO A 1 203 ? 7.540   59.855  14.924  1.00 63.89 ? 202 PRO A CA    1 
ATOM   1522 C C     . PRO A 1 203 ? 8.819   60.230  15.726  1.00 66.55 ? 202 PRO A C     1 
ATOM   1523 O O     . PRO A 1 203 ? 9.190   61.406  15.824  1.00 66.17 ? 202 PRO A O     1 
ATOM   1524 C CB    . PRO A 1 203 ? 6.291   59.852  15.808  1.00 63.42 ? 202 PRO A CB    1 
ATOM   1525 C CG    . PRO A 1 203 ? 6.087   58.382  16.183  1.00 62.64 ? 202 PRO A CG    1 
ATOM   1526 C CD    . PRO A 1 203 ? 6.629   57.576  15.083  1.00 61.41 ? 202 PRO A CD    1 
ATOM   1527 N N     . ASP A 1 204 ? 9.502   59.211  16.256  1.00 69.24 ? 203 ASP A N     1 
ATOM   1528 C CA    . ASP A 1 204 ? 10.644  59.441  17.148  1.00 71.19 ? 203 ASP A CA    1 
ATOM   1529 C C     . ASP A 1 204 ? 11.886  59.926  16.445  1.00 71.08 ? 203 ASP A C     1 
ATOM   1530 O O     . ASP A 1 204 ? 12.710  60.569  17.077  1.00 71.87 ? 203 ASP A O     1 
ATOM   1531 C CB    . ASP A 1 204 ? 10.935  58.242  18.082  1.00 71.84 ? 203 ASP A CB    1 
ATOM   1532 C CG    . ASP A 1 204 ? 10.232  58.375  19.431  1.00 74.20 ? 203 ASP A CG    1 
ATOM   1533 O OD1   . ASP A 1 204 ? 8.980   58.500  19.501  1.00 77.10 ? 203 ASP A OD1   1 
ATOM   1534 O OD2   . ASP A 1 204 ? 10.941  58.363  20.446  1.00 78.47 ? 203 ASP A OD2   1 
ATOM   1535 N N     . LYS A 1 205 ? 12.050  59.669  15.157  1.00 71.09 ? 204 LYS A N     1 
ATOM   1536 C CA    . LYS A 1 205 ? 13.105  60.436  14.500  1.00 71.21 ? 204 LYS A CA    1 
ATOM   1537 C C     . LYS A 1 205 ? 12.867  60.907  13.076  1.00 69.68 ? 204 LYS A C     1 
ATOM   1538 O O     . LYS A 1 205 ? 12.688  62.099  12.844  1.00 70.26 ? 204 LYS A O     1 
ATOM   1539 C CB    . LYS A 1 205 ? 14.538  59.907  14.762  1.00 71.79 ? 204 LYS A CB    1 
ATOM   1540 C CG    . LYS A 1 205 ? 14.756  58.374  14.910  1.00 73.16 ? 204 LYS A CG    1 
ATOM   1541 C CD    . LYS A 1 205 ? 16.293  58.060  14.702  1.00 73.06 ? 204 LYS A CD    1 
ATOM   1542 C CE    . LYS A 1 205 ? 16.545  56.675  14.100  1.00 75.90 ? 204 LYS A CE    1 
ATOM   1543 N NZ    . LYS A 1 205 ? 15.882  55.615  14.934  1.00 77.01 ? 204 LYS A NZ    1 
ATOM   1544 N N     . CYS A 1 206 ? 12.866  59.970  12.146  1.00 68.19 ? 205 CYS A N     1 
ATOM   1545 C CA    . CYS A 1 206 ? 12.598  60.211  10.727  1.00 65.52 ? 205 CYS A CA    1 
ATOM   1546 C C     . CYS A 1 206 ? 11.257  60.924  10.419  1.00 63.40 ? 205 CYS A C     1 
ATOM   1547 O O     . CYS A 1 206 ? 11.212  61.836  9.575   1.00 62.74 ? 205 CYS A O     1 
ATOM   1548 C CB    . CYS A 1 206 ? 12.665  58.848  10.049  1.00 66.44 ? 205 CYS A CB    1 
ATOM   1549 S SG    . CYS A 1 206 ? 12.181  58.753  8.338   1.00 70.54 ? 205 CYS A SG    1 
ATOM   1550 N N     . ASP A 1 207 ? 10.160  60.568  11.104  1.00 60.61 ? 206 ASP A N     1 
ATOM   1551 C CA    . ASP A 1 207 ? 8.902   61.313  10.881  1.00 57.81 ? 206 ASP A CA    1 
ATOM   1552 C C     . ASP A 1 207 ? 8.589   62.403  11.914  1.00 58.38 ? 206 ASP A C     1 
ATOM   1553 O O     . ASP A 1 207 ? 7.436   62.853  12.037  1.00 58.79 ? 206 ASP A O     1 
ATOM   1554 C CB    . ASP A 1 207 ? 7.744   60.370  10.683  1.00 56.01 ? 206 ASP A CB    1 
ATOM   1555 C CG    . ASP A 1 207 ? 8.005   59.382  9.591   1.00 51.25 ? 206 ASP A CG    1 
ATOM   1556 O OD1   . ASP A 1 207 ? 8.045   58.169  9.897   1.00 47.30 ? 206 ASP A OD1   1 
ATOM   1557 O OD2   . ASP A 1 207 ? 8.180   59.818  8.440   1.00 40.72 ? 206 ASP A OD2   1 
ATOM   1558 N N     . ARG A 1 208 ? 9.648   62.869  12.589  1.00 58.50 ? 207 ARG A N     1 
ATOM   1559 C CA    . ARG A 1 208 ? 9.620   63.925  13.606  1.00 58.04 ? 207 ARG A CA    1 
ATOM   1560 C C     . ARG A 1 208 ? 8.716   65.097  13.231  1.00 56.49 ? 207 ARG A C     1 
ATOM   1561 O O     . ARG A 1 208 ? 8.037   65.644  14.085  1.00 55.90 ? 207 ARG A O     1 
ATOM   1562 C CB    . ARG A 1 208 ? 11.043  64.430  13.805  1.00 59.44 ? 207 ARG A CB    1 
ATOM   1563 C CG    . ARG A 1 208 ? 11.405  64.825  15.212  1.00 63.70 ? 207 ARG A CG    1 
ATOM   1564 C CD    . ARG A 1 208 ? 12.695  64.047  15.672  1.00 71.24 ? 207 ARG A CD    1 
ATOM   1565 N NE    . ARG A 1 208 ? 12.877  64.035  17.147  1.00 75.67 ? 207 ARG A NE    1 
ATOM   1566 C CZ    . ARG A 1 208 ? 12.060  63.464  18.055  1.00 76.75 ? 207 ARG A CZ    1 
ATOM   1567 N NH1   . ARG A 1 208 ? 10.947  62.834  17.691  1.00 78.46 ? 207 ARG A NH1   1 
ATOM   1568 N NH2   . ARG A 1 208 ? 12.347  63.530  19.355  1.00 77.99 ? 207 ARG A NH2   1 
ATOM   1569 N N     . ASP A 1 209 ? 8.692   65.465  11.954  1.00 54.58 ? 208 ASP A N     1 
ATOM   1570 C CA    . ASP A 1 209 ? 8.013   66.702  11.532  1.00 53.44 ? 208 ASP A CA    1 
ATOM   1571 C C     . ASP A 1 209 ? 6.678   66.463  10.872  1.00 51.06 ? 208 ASP A C     1 
ATOM   1572 O O     . ASP A 1 209 ? 6.018   67.416  10.437  1.00 50.37 ? 208 ASP A O     1 
ATOM   1573 C CB    . ASP A 1 209 ? 8.899   67.576  10.593  1.00 54.33 ? 208 ASP A CB    1 
ATOM   1574 C CG    . ASP A 1 209 ? 10.214  68.052  11.264  1.00 57.37 ? 208 ASP A CG    1 
ATOM   1575 O OD1   . ASP A 1 209 ? 10.203  68.366  12.487  1.00 59.90 ? 208 ASP A OD1   1 
ATOM   1576 O OD2   . ASP A 1 209 ? 11.265  68.063  10.562  1.00 58.22 ? 208 ASP A OD2   1 
ATOM   1577 N N     . LEU A 1 210 ? 6.285   65.202  10.773  1.00 48.65 ? 209 LEU A N     1 
ATOM   1578 C CA    . LEU A 1 210 ? 4.979   64.922  10.185  1.00 47.16 ? 209 LEU A CA    1 
ATOM   1579 C C     . LEU A 1 210 ? 3.916   65.046  11.274  1.00 45.40 ? 209 LEU A C     1 
ATOM   1580 O O     . LEU A 1 210 ? 4.164   64.715  12.441  1.00 45.82 ? 209 LEU A O     1 
ATOM   1581 C CB    . LEU A 1 210 ? 4.977   63.553  9.461   1.00 47.57 ? 209 LEU A CB    1 
ATOM   1582 C CG    . LEU A 1 210 ? 6.062   63.349  8.366   1.00 47.97 ? 209 LEU A CG    1 
ATOM   1583 C CD1   . LEU A 1 210 ? 5.612   62.259  7.479   1.00 47.93 ? 209 LEU A CD1   1 
ATOM   1584 C CD2   . LEU A 1 210 ? 6.318   64.619  7.519   1.00 45.29 ? 209 LEU A CD2   1 
ATOM   1585 N N     . SER A 1 211 ? 2.773   65.596  10.908  1.00 43.22 ? 210 SER A N     1 
ATOM   1586 C CA    . SER A 1 211 ? 1.543   65.502  11.692  1.00 41.32 ? 210 SER A CA    1 
ATOM   1587 C C     . SER A 1 211 ? 0.849   64.147  11.499  1.00 41.04 ? 210 SER A C     1 
ATOM   1588 O O     . SER A 1 211 ? 0.361   63.805  10.396  1.00 41.48 ? 210 SER A O     1 
ATOM   1589 C CB    . SER A 1 211 ? 0.576   66.591  11.268  1.00 40.61 ? 210 SER A CB    1 
ATOM   1590 O OG    . SER A 1 211 ? 1.111   67.863  11.556  1.00 41.55 ? 210 SER A OG    1 
ATOM   1591 N N     . LEU A 1 212 ? 0.735   63.393  12.573  1.00 39.43 ? 211 LEU A N     1 
ATOM   1592 C CA    . LEU A 1 212 ? 0.195   62.056  12.421  1.00 38.43 ? 211 LEU A CA    1 
ATOM   1593 C C     . LEU A 1 212 ? -0.379  61.528  13.727  1.00 37.90 ? 211 LEU A C     1 
ATOM   1594 O O     . LEU A 1 212 ? -0.038  61.987  14.872  1.00 36.65 ? 211 LEU A O     1 
ATOM   1595 C CB    . LEU A 1 212 ? 1.332   61.087  11.970  1.00 37.96 ? 211 LEU A CB    1 
ATOM   1596 C CG    . LEU A 1 212 ? 2.472   61.032  13.005  1.00 36.37 ? 211 LEU A CG    1 
ATOM   1597 C CD1   . LEU A 1 212 ? 2.318   59.862  14.024  1.00 31.16 ? 211 LEU A CD1   1 
ATOM   1598 C CD2   . LEU A 1 212 ? 3.750   60.872  12.259  1.00 38.37 ? 211 LEU A CD2   1 
ATOM   1599 N N     . ILE A 1 213 ? -1.172  60.496  13.532  1.00 36.18 ? 212 ILE A N     1 
ATOM   1600 C CA    . ILE A 1 213 ? -1.613  59.677  14.612  1.00 36.84 ? 212 ILE A CA    1 
ATOM   1601 C C     . ILE A 1 213 ? -1.365  58.210  14.177  1.00 38.78 ? 212 ILE A C     1 
ATOM   1602 O O     . ILE A 1 213 ? -1.626  57.804  13.021  1.00 38.44 ? 212 ILE A O     1 
ATOM   1603 C CB    . ILE A 1 213 ? -3.100  59.964  15.000  1.00 35.05 ? 212 ILE A CB    1 
ATOM   1604 C CG1   . ILE A 1 213 ? -3.552  58.973  16.043  1.00 34.12 ? 212 ILE A CG1   1 
ATOM   1605 C CG2   . ILE A 1 213 ? -4.032  59.833  13.795  1.00 35.03 ? 212 ILE A CG2   1 
ATOM   1606 C CD1   . ILE A 1 213 ? -4.921  59.326  16.741  1.00 36.08 ? 212 ILE A CD1   1 
ATOM   1607 N N     . LYS A 1 214 ? -0.852  57.425  15.106  1.00 39.94 ? 213 LYS A N     1 
ATOM   1608 C CA    . LYS A 1 214 ? -0.635  56.050  14.853  1.00 41.54 ? 213 LYS A CA    1 
ATOM   1609 C C     . LYS A 1 214 ? -1.636  55.386  15.802  1.00 41.75 ? 213 LYS A C     1 
ATOM   1610 O O     . LYS A 1 214 ? -1.561  55.610  17.047  1.00 39.93 ? 213 LYS A O     1 
ATOM   1611 C CB    . LYS A 1 214 ? 0.819   55.748  15.189  1.00 41.32 ? 213 LYS A CB    1 
ATOM   1612 C CG    . LYS A 1 214 ? 1.240   54.255  15.068  1.00 46.66 ? 213 LYS A CG    1 
ATOM   1613 C CD    . LYS A 1 214 ? 2.717   54.040  15.513  1.00 45.72 ? 213 LYS A CD    1 
ATOM   1614 C CE    . LYS A 1 214 ? 3.706   54.604  14.510  1.00 48.92 ? 213 LYS A CE    1 
ATOM   1615 N NZ    . LYS A 1 214 ? 4.257   53.418  13.795  1.00 51.86 ? 213 LYS A NZ    1 
ATOM   1616 N N     . VAL A 1 215 ? -2.612  54.672  15.192  1.00 41.64 ? 214 VAL A N     1 
ATOM   1617 C CA    . VAL A 1 215 ? -3.645  53.924  15.863  1.00 41.99 ? 214 VAL A CA    1 
ATOM   1618 C C     . VAL A 1 215 ? -3.084  52.512  15.983  1.00 43.70 ? 214 VAL A C     1 
ATOM   1619 O O     . VAL A 1 215 ? -2.717  51.908  14.964  1.00 43.30 ? 214 VAL A O     1 
ATOM   1620 C CB    . VAL A 1 215 ? -4.942  53.875  15.017  1.00 42.90 ? 214 VAL A CB    1 
ATOM   1621 C CG1   . VAL A 1 215 ? -6.060  53.148  15.765  1.00 40.63 ? 214 VAL A CG1   1 
ATOM   1622 C CG2   . VAL A 1 215 ? -5.425  55.279  14.654  1.00 43.08 ? 214 VAL A CG2   1 
ATOM   1623 N N     . ILE A 1 216 ? -3.003  52.004  17.225  1.00 45.12 ? 215 ILE A N     1 
ATOM   1624 C CA    . ILE A 1 216 ? -2.311  50.747  17.564  1.00 45.78 ? 215 ILE A CA    1 
ATOM   1625 C C     . ILE A 1 216 ? -3.294  49.804  18.233  1.00 47.27 ? 215 ILE A C     1 
ATOM   1626 O O     . ILE A 1 216 ? -4.118  50.204  19.066  1.00 47.14 ? 215 ILE A O     1 
ATOM   1627 C CB    . ILE A 1 216 ? -1.102  51.010  18.507  1.00 46.49 ? 215 ILE A CB    1 
ATOM   1628 C CG1   . ILE A 1 216 ? -0.070  51.937  17.811  1.00 47.97 ? 215 ILE A CG1   1 
ATOM   1629 C CG2   . ILE A 1 216 ? -0.459  49.685  18.991  1.00 45.12 ? 215 ILE A CG2   1 
ATOM   1630 C CD1   . ILE A 1 216 ? 1.088   52.521  18.659  1.00 45.72 ? 215 ILE A CD1   1 
ATOM   1631 N N     . ASP A 1 217 ? -3.268  48.543  17.820  1.00 48.83 ? 216 ASP A N     1 
ATOM   1632 C CA    . ASP A 1 217 ? -4.107  47.505  18.470  1.00 49.58 ? 216 ASP A CA    1 
ATOM   1633 C C     . ASP A 1 217 ? -5.608  47.865  18.608  1.00 49.17 ? 216 ASP A C     1 
ATOM   1634 O O     . ASP A 1 217 ? -6.221  47.803  19.683  1.00 49.93 ? 216 ASP A O     1 
ATOM   1635 C CB    . ASP A 1 217 ? -3.444  47.041  19.775  1.00 49.72 ? 216 ASP A CB    1 
ATOM   1636 C CG    . ASP A 1 217 ? -2.073  46.365  19.518  1.00 53.71 ? 216 ASP A CG    1 
ATOM   1637 O OD1   . ASP A 1 217 ? -1.879  45.804  18.399  1.00 57.80 ? 216 ASP A OD1   1 
ATOM   1638 O OD2   . ASP A 1 217 ? -1.177  46.386  20.406  1.00 54.82 ? 216 ASP A OD2   1 
ATOM   1639 N N     . VAL A 1 218 ? -6.182  48.212  17.470  1.00 48.39 ? 217 VAL A N     1 
ATOM   1640 C CA    . VAL A 1 218 ? -7.603  48.563  17.347  1.00 48.48 ? 217 VAL A CA    1 
ATOM   1641 C C     . VAL A 1 218 ? -8.033  49.736  18.297  1.00 48.68 ? 217 VAL A C     1 
ATOM   1642 O O     . VAL A 1 218 ? -9.162  49.837  18.733  1.00 47.16 ? 217 VAL A O     1 
ATOM   1643 C CB    . VAL A 1 218 ? -8.596  47.308  17.370  1.00 48.55 ? 217 VAL A CB    1 
ATOM   1644 C CG1   . VAL A 1 218 ? -9.709  47.482  16.369  1.00 43.80 ? 217 VAL A CG1   1 
ATOM   1645 C CG2   . VAL A 1 218 ? -7.878  45.983  17.056  1.00 49.52 ? 217 VAL A CG2   1 
ATOM   1646 N N     . GLY A 1 219 ? -7.111  50.656  18.551  1.00 49.79 ? 218 GLY A N     1 
ATOM   1647 C CA    . GLY A 1 219 ? -7.444  51.854  19.315  1.00 49.95 ? 218 GLY A CA    1 
ATOM   1648 C C     . GLY A 1 219 ? -7.218  51.642  20.791  1.00 50.61 ? 218 GLY A C     1 
ATOM   1649 O O     . GLY A 1 219 ? -7.781  52.336  21.599  1.00 50.65 ? 218 GLY A O     1 
ATOM   1650 N N     . ARG A 1 220 ? -6.434  50.638  21.142  1.00 51.49 ? 219 ARG A N     1 
ATOM   1651 C CA    . ARG A 1 220 ? -6.008  50.426  22.526  1.00 53.02 ? 219 ARG A CA    1 
ATOM   1652 C C     . ARG A 1 220 ? -4.980  51.532  22.902  1.00 51.74 ? 219 ARG A C     1 
ATOM   1653 O O     . ARG A 1 220 ? -4.795  51.859  24.071  1.00 53.15 ? 219 ARG A O     1 
ATOM   1654 C CB    . ARG A 1 220 ? -5.422  49.004  22.597  1.00 52.55 ? 219 ARG A CB    1 
ATOM   1655 C CG    . ARG A 1 220 ? -4.971  48.419  23.960  1.00 55.59 ? 219 ARG A CG    1 
ATOM   1656 C CD    . ARG A 1 220 ? -4.748  46.824  23.892  1.00 57.08 ? 219 ARG A CD    1 
ATOM   1657 N NE    . ARG A 1 220 ? -5.729  46.082  23.037  1.00 63.41 ? 219 ARG A NE    1 
ATOM   1658 C CZ    . ARG A 1 220 ? -7.066  46.047  23.224  1.00 65.06 ? 219 ARG A CZ    1 
ATOM   1659 N NH1   . ARG A 1 220 ? -7.641  46.723  24.225  1.00 64.60 ? 219 ARG A NH1   1 
ATOM   1660 N NH2   . ARG A 1 220 ? -7.858  45.372  22.380  1.00 63.82 ? 219 ARG A NH2   1 
ATOM   1661 N N     . ARG A 1 221 ? -4.318  52.103  21.893  1.00 50.35 ? 220 ARG A N     1 
ATOM   1662 C CA    . ARG A 1 221 ? -3.142  52.975  22.063  1.00 48.67 ? 220 ARG A CA    1 
ATOM   1663 C C     . ARG A 1 221 ? -2.921  53.920  20.888  1.00 46.32 ? 220 ARG A C     1 
ATOM   1664 O O     . ARG A 1 221 ? -3.096  53.527  19.726  1.00 45.55 ? 220 ARG A O     1 
ATOM   1665 C CB    . ARG A 1 221 ? -1.864  52.162  22.238  1.00 49.16 ? 220 ARG A CB    1 
ATOM   1666 C CG    . ARG A 1 221 ? -0.924  52.903  23.176  1.00 56.57 ? 220 ARG A CG    1 
ATOM   1667 C CD    . ARG A 1 221 ? 0.504   52.945  22.747  1.00 65.39 ? 220 ARG A CD    1 
ATOM   1668 N NE    . ARG A 1 221 ? 1.352   52.089  23.568  1.00 70.46 ? 220 ARG A NE    1 
ATOM   1669 C CZ    . ARG A 1 221 ? 1.370   50.754  23.538  1.00 74.66 ? 220 ARG A CZ    1 
ATOM   1670 N NH1   . ARG A 1 221 ? 0.551   50.063  22.742  1.00 75.60 ? 220 ARG A NH1   1 
ATOM   1671 N NH2   . ARG A 1 221 ? 2.221   50.103  24.330  1.00 76.76 ? 220 ARG A NH2   1 
ATOM   1672 N N     . PHE A 1 222 ? -2.494  55.144  21.179  1.00 44.07 ? 221 PHE A N     1 
ATOM   1673 C CA    . PHE A 1 222 ? -2.289  56.147  20.152  1.00 42.58 ? 221 PHE A CA    1 
ATOM   1674 C C     . PHE A 1 222 ? -0.977  56.858  20.350  1.00 43.43 ? 221 PHE A C     1 
ATOM   1675 O O     . PHE A 1 222 ? -0.513  57.137  21.451  1.00 44.29 ? 221 PHE A O     1 
ATOM   1676 C CB    . PHE A 1 222 ? -3.418  57.184  20.114  1.00 41.60 ? 221 PHE A CB    1 
ATOM   1677 C CG    . PHE A 1 222 ? -4.802  56.573  19.962  1.00 40.30 ? 221 PHE A CG    1 
ATOM   1678 C CD1   . PHE A 1 222 ? -5.520  56.128  21.097  1.00 38.18 ? 221 PHE A CD1   1 
ATOM   1679 C CD2   . PHE A 1 222 ? -5.379  56.432  18.704  1.00 35.05 ? 221 PHE A CD2   1 
ATOM   1680 C CE1   . PHE A 1 222 ? -6.836  55.533  20.986  1.00 41.26 ? 221 PHE A CE1   1 
ATOM   1681 C CE2   . PHE A 1 222 ? -6.688  55.868  18.555  1.00 41.82 ? 221 PHE A CE2   1 
ATOM   1682 C CZ    . PHE A 1 222 ? -7.436  55.408  19.710  1.00 40.61 ? 221 PHE A CZ    1 
ATOM   1683 N N     . LEU A 1 223 ? -0.351  57.169  19.249  1.00 43.81 ? 222 LEU A N     1 
ATOM   1684 C CA    . LEU A 1 223 ? 0.769   58.041  19.299  1.00 43.65 ? 222 LEU A CA    1 
ATOM   1685 C C     . LEU A 1 223 ? 0.356   59.223  18.396  1.00 42.28 ? 222 LEU A C     1 
ATOM   1686 O O     . LEU A 1 223 ? -0.017  59.033  17.248  1.00 40.75 ? 222 LEU A O     1 
ATOM   1687 C CB    . LEU A 1 223 ? 2.059   57.273  18.935  1.00 43.60 ? 222 LEU A CB    1 
ATOM   1688 C CG    . LEU A 1 223 ? 3.308   58.124  19.188  1.00 48.74 ? 222 LEU A CG    1 
ATOM   1689 C CD1   . LEU A 1 223 ? 4.676   57.313  19.225  1.00 52.30 ? 222 LEU A CD1   1 
ATOM   1690 C CD2   . LEU A 1 223 ? 3.375   59.248  18.080  1.00 50.57 ? 222 LEU A CD2   1 
ATOM   1691 N N     . VAL A 1 224 ? 0.307   60.417  18.985  1.00 42.05 ? 223 VAL A N     1 
ATOM   1692 C CA    . VAL A 1 224 ? -0.108  61.614  18.288  1.00 42.62 ? 223 VAL A CA    1 
ATOM   1693 C C     . VAL A 1 224 ? 1.060   62.601  18.200  1.00 43.92 ? 223 VAL A C     1 
ATOM   1694 O O     . VAL A 1 224 ? 1.771   62.849  19.168  1.00 43.64 ? 223 VAL A O     1 
ATOM   1695 C CB    . VAL A 1 224 ? -1.315  62.286  18.966  1.00 41.75 ? 223 VAL A CB    1 
ATOM   1696 C CG1   . VAL A 1 224 ? -1.787  63.513  18.200  1.00 39.69 ? 223 VAL A CG1   1 
ATOM   1697 C CG2   . VAL A 1 224 ? -2.439  61.345  19.052  1.00 40.82 ? 223 VAL A CG2   1 
ATOM   1698 N N     . ASN A 1 225 ? 1.256   63.171  17.032  1.00 44.60 ? 224 ASN A N     1 
ATOM   1699 C CA    . ASN A 1 225 ? 2.439   63.965  16.862  1.00 46.33 ? 224 ASN A CA    1 
ATOM   1700 C C     . ASN A 1 225 ? 2.120   65.206  16.044  1.00 46.72 ? 224 ASN A C     1 
ATOM   1701 O O     . ASN A 1 225 ? 1.530   65.112  14.987  1.00 46.19 ? 224 ASN A O     1 
ATOM   1702 C CB    . ASN A 1 225 ? 3.574   63.100  16.276  1.00 46.09 ? 224 ASN A CB    1 
ATOM   1703 C CG    . ASN A 1 225 ? 4.897   63.848  16.172  1.00 49.18 ? 224 ASN A CG    1 
ATOM   1704 O OD1   . ASN A 1 225 ? 5.371   64.122  15.072  1.00 52.59 ? 224 ASN A OD1   1 
ATOM   1705 N ND2   . ASN A 1 225 ? 5.474   64.230  17.314  1.00 53.26 ? 224 ASN A ND2   1 
ATOM   1706 N N     . ARG A 1 226 ? 2.472   66.369  16.596  1.00 48.51 ? 225 ARG A N     1 
ATOM   1707 C CA    . ARG A 1 226 ? 2.234   67.695  15.994  1.00 50.11 ? 225 ARG A CA    1 
ATOM   1708 C C     . ARG A 1 226 ? 0.866   67.971  15.438  1.00 50.39 ? 225 ARG A C     1 
ATOM   1709 O O     . ARG A 1 226 ? 0.800   68.279  14.244  1.00 50.96 ? 225 ARG A O     1 
ATOM   1710 C CB    . ARG A 1 226 ? 3.158   67.925  14.790  1.00 50.24 ? 225 ARG A CB    1 
ATOM   1711 C CG    . ARG A 1 226 ? 4.545   68.228  15.122  1.00 54.16 ? 225 ARG A CG    1 
ATOM   1712 C CD    . ARG A 1 226 ? 5.384   68.175  13.876  1.00 59.57 ? 225 ARG A CD    1 
ATOM   1713 N NE    . ARG A 1 226 ? 6.757   68.106  14.327  1.00 66.32 ? 225 ARG A NE    1 
ATOM   1714 C CZ    . ARG A 1 226 ? 7.516   69.169  14.576  1.00 68.72 ? 225 ARG A CZ    1 
ATOM   1715 N NH1   . ARG A 1 226 ? 7.025   70.390  14.346  1.00 69.05 ? 225 ARG A NH1   1 
ATOM   1716 N NH2   . ARG A 1 226 ? 8.759   68.996  15.043  1.00 68.14 ? 225 ARG A NH2   1 
ATOM   1717 N N     . VAL A 1 227 ? -0.209  67.921  16.217  1.00 50.54 ? 226 VAL A N     1 
ATOM   1718 C CA    . VAL A 1 227 ? -1.490  68.410  15.657  1.00 51.21 ? 226 VAL A CA    1 
ATOM   1719 C C     . VAL A 1 227 ? -1.309  69.855  15.237  1.00 51.25 ? 226 VAL A C     1 
ATOM   1720 O O     . VAL A 1 227 ? -0.750  70.614  15.969  1.00 50.90 ? 226 VAL A O     1 
ATOM   1721 C CB    . VAL A 1 227 ? -2.654  68.384  16.678  1.00 51.11 ? 226 VAL A CB    1 
ATOM   1722 C CG1   . VAL A 1 227 ? -3.954  68.583  15.959  1.00 50.39 ? 226 VAL A CG1   1 
ATOM   1723 C CG2   . VAL A 1 227 ? -2.688  67.056  17.425  1.00 53.66 ? 226 VAL A CG2   1 
ATOM   1724 N N     . GLN A 1 228 ? -1.797  70.271  14.086  1.00 52.72 ? 227 GLN A N     1 
ATOM   1725 C CA    . GLN A 1 228 ? -1.475  71.631  13.691  1.00 54.86 ? 227 GLN A CA    1 
ATOM   1726 C C     . GLN A 1 228 ? -2.686  72.521  13.471  1.00 54.29 ? 227 GLN A C     1 
ATOM   1727 O O     . GLN A 1 228 ? -2.545  73.671  13.058  1.00 55.00 ? 227 GLN A O     1 
ATOM   1728 C CB    . GLN A 1 228 ? -0.461  71.713  12.496  1.00 54.83 ? 227 GLN A CB    1 
ATOM   1729 C CG    . GLN A 1 228 ? -0.337  70.472  11.557  1.00 57.30 ? 227 GLN A CG    1 
ATOM   1730 C CD    . GLN A 1 228 ? -0.112  70.817  10.039  1.00 57.76 ? 227 GLN A CD    1 
ATOM   1731 O OE1   . GLN A 1 228 ? -0.092  71.997  9.673   1.00 63.96 ? 227 GLN A OE1   1 
ATOM   1732 N NE2   . GLN A 1 228 ? 0.018   69.787  9.172   1.00 54.59 ? 227 GLN A NE2   1 
ATOM   1733 N N     . ASP A 1 229 ? -3.878  72.015  13.737  1.00 53.96 ? 228 ASP A N     1 
ATOM   1734 C CA    . ASP A 1 229 ? -5.050  72.855  13.507  1.00 52.97 ? 228 ASP A CA    1 
ATOM   1735 C C     . ASP A 1 229 ? -6.379  72.291  14.027  1.00 52.52 ? 228 ASP A C     1 
ATOM   1736 O O     . ASP A 1 229 ? -6.449  71.158  14.520  1.00 51.73 ? 228 ASP A O     1 
ATOM   1737 C CB    . ASP A 1 229 ? -5.115  73.303  12.027  1.00 52.82 ? 228 ASP A CB    1 
ATOM   1738 C CG    . ASP A 1 229 ? -5.586  72.191  11.079  1.00 53.89 ? 228 ASP A CG    1 
ATOM   1739 O OD1   . ASP A 1 229 ? -5.713  71.016  11.551  1.00 52.14 ? 228 ASP A OD1   1 
ATOM   1740 O OD2   . ASP A 1 229 ? -5.836  72.512  9.872   1.00 50.61 ? 228 ASP A OD2   1 
ATOM   1741 N N     . HIS A 1 230 ? -7.420  73.114  13.915  1.00 52.65 ? 229 HIS A N     1 
ATOM   1742 C CA    . HIS A 1 230 ? -8.723  72.807  14.470  1.00 53.25 ? 229 HIS A CA    1 
ATOM   1743 C C     . HIS A 1 230 ? -9.172  71.434  13.931  1.00 52.94 ? 229 HIS A C     1 
ATOM   1744 O O     . HIS A 1 230 ? -9.442  70.487  14.706  1.00 53.00 ? 229 HIS A O     1 
ATOM   1745 C CB    . HIS A 1 230 ? -9.738  73.921  14.143  1.00 53.41 ? 229 HIS A CB    1 
ATOM   1746 C CG    . HIS A 1 230 ? -11.142 73.564  14.533  1.00 58.32 ? 229 HIS A CG    1 
ATOM   1747 N ND1   . HIS A 1 230 ? -11.564 73.516  15.853  1.00 60.39 ? 229 HIS A ND1   1 
ATOM   1748 C CD2   . HIS A 1 230 ? -12.212 73.178  13.786  1.00 60.21 ? 229 HIS A CD2   1 
ATOM   1749 C CE1   . HIS A 1 230 ? -12.839 73.156  15.896  1.00 59.09 ? 229 HIS A CE1   1 
ATOM   1750 N NE2   . HIS A 1 230 ? -13.251 72.931  14.659  1.00 58.72 ? 229 HIS A NE2   1 
ATOM   1751 N N     . ILE A 1 231 ? -9.178  71.308  12.600  1.00 51.49 ? 230 ILE A N     1 
ATOM   1752 C CA    . ILE A 1 231 ? -9.680  70.092  11.999  1.00 50.53 ? 230 ILE A CA    1 
ATOM   1753 C C     . ILE A 1 231 ? -8.860  68.843  12.283  1.00 48.45 ? 230 ILE A C     1 
ATOM   1754 O O     . ILE A 1 231 ? -9.432  67.782  12.461  1.00 48.73 ? 230 ILE A O     1 
ATOM   1755 C CB    . ILE A 1 231 ? -10.213 70.267  10.514  1.00 51.65 ? 230 ILE A CB    1 
ATOM   1756 C CG1   . ILE A 1 231 ? -11.341 69.265  10.265  1.00 53.76 ? 230 ILE A CG1   1 
ATOM   1757 C CG2   . ILE A 1 231 ? -9.107  70.185  9.436   1.00 51.21 ? 230 ILE A CG2   1 
ATOM   1758 C CD1   . ILE A 1 231 ? -12.538 69.473  11.242  1.00 57.26 ? 230 ILE A CD1   1 
ATOM   1759 N N     . GLN A 1 232 ? -7.558  68.971  12.463  1.00 46.77 ? 231 GLN A N     1 
ATOM   1760 C CA    . GLN A 1 232 ? -6.778  67.793  12.913  1.00 44.89 ? 231 GLN A CA    1 
ATOM   1761 C C     . GLN A 1 232 ? -7.101  67.348  14.277  1.00 44.47 ? 231 GLN A C     1 
ATOM   1762 O O     . GLN A 1 232 ? -7.102  66.143  14.548  1.00 45.43 ? 231 GLN A O     1 
ATOM   1763 C CB    . GLN A 1 232 ? -5.252  67.981  12.831  1.00 44.27 ? 231 GLN A CB    1 
ATOM   1764 C CG    . GLN A 1 232 ? -4.707  67.691  11.448  1.00 43.21 ? 231 GLN A CG    1 
ATOM   1765 C CD    . GLN A 1 232 ? -3.337  68.277  11.157  1.00 42.35 ? 231 GLN A CD    1 
ATOM   1766 O OE1   . GLN A 1 232 ? -2.356  68.035  11.886  1.00 41.04 ? 231 GLN A OE1   1 
ATOM   1767 N NE2   . GLN A 1 232 ? -3.245  68.973  10.039  1.00 35.11 ? 231 GLN A NE2   1 
ATOM   1768 N N     . SER A 1 233 ? -7.322  68.292  15.191  1.00 43.90 ? 232 SER A N     1 
ATOM   1769 C CA    . SER A 1 233 ? -7.511  67.848  16.582  1.00 42.90 ? 232 SER A CA    1 
ATOM   1770 C C     . SER A 1 233 ? -8.880  67.170  16.744  1.00 41.49 ? 232 SER A C     1 
ATOM   1771 O O     . SER A 1 233 ? -9.010  66.192  17.464  1.00 41.61 ? 232 SER A O     1 
ATOM   1772 C CB    . SER A 1 233 ? -7.310  68.985  17.580  1.00 43.97 ? 232 SER A CB    1 
ATOM   1773 O OG    . SER A 1 233 ? -8.335  69.958  17.433  1.00 43.47 ? 232 SER A OG    1 
ATOM   1774 N N     . ARG A 1 234 ? -9.873  67.681  16.034  1.00 40.41 ? 233 ARG A N     1 
ATOM   1775 C CA    . ARG A 1 234 ? -11.156 67.008  15.921  1.00 41.29 ? 233 ARG A CA    1 
ATOM   1776 C C     . ARG A 1 234 ? -11.014 65.531  15.460  1.00 40.37 ? 233 ARG A C     1 
ATOM   1777 O O     . ARG A 1 234 ? -11.467 64.631  16.181  1.00 40.21 ? 233 ARG A O     1 
ATOM   1778 C CB    . ARG A 1 234 ? -12.130 67.795  15.022  1.00 41.01 ? 233 ARG A CB    1 
ATOM   1779 C CG    . ARG A 1 234 ? -12.488 69.216  15.557  1.00 45.52 ? 233 ARG A CG    1 
ATOM   1780 C CD    . ARG A 1 234 ? -13.476 69.243  16.788  1.00 48.17 ? 233 ARG A CD    1 
ATOM   1781 N NE    . ARG A 1 234 ? -14.862 68.804  16.515  1.00 46.21 ? 233 ARG A NE    1 
ATOM   1782 C CZ    . ARG A 1 234 ? -15.769 69.555  15.875  1.00 47.20 ? 233 ARG A CZ    1 
ATOM   1783 N NH1   . ARG A 1 234 ? -15.406 70.763  15.446  1.00 44.71 ? 233 ARG A NH1   1 
ATOM   1784 N NH2   . ARG A 1 234 ? -17.042 69.118  15.659  1.00 44.86 ? 233 ARG A NH2   1 
ATOM   1785 N N     . ILE A 1 235 ? -10.331 65.296  14.324  1.00 39.06 ? 234 ILE A N     1 
ATOM   1786 C CA    . ILE A 1 235 ? -10.180 63.947  13.743  1.00 37.82 ? 234 ILE A CA    1 
ATOM   1787 C C     . ILE A 1 235 ? -9.616  63.039  14.826  1.00 37.96 ? 234 ILE A C     1 
ATOM   1788 O O     . ILE A 1 235 ? -10.144 61.949  15.066  1.00 39.35 ? 234 ILE A O     1 
ATOM   1789 C CB    . ILE A 1 235 ? -9.250  63.967  12.497  1.00 37.80 ? 234 ILE A CB    1 
ATOM   1790 C CG1   . ILE A 1 235 ? -9.950  64.503  11.286  1.00 34.79 ? 234 ILE A CG1   1 
ATOM   1791 C CG2   . ILE A 1 235 ? -8.691  62.628  12.193  1.00 38.48 ? 234 ILE A CG2   1 
ATOM   1792 C CD1   . ILE A 1 235 ? -9.022  65.353  10.377  1.00 33.87 ? 234 ILE A CD1   1 
ATOM   1793 N N     . VAL A 1 236 ? -8.614  63.512  15.558  1.00 36.91 ? 235 VAL A N     1 
ATOM   1794 C CA    . VAL A 1 236 ? -7.969  62.682  16.576  1.00 36.34 ? 235 VAL A CA    1 
ATOM   1795 C C     . VAL A 1 236 ? -8.936  62.364  17.686  1.00 36.50 ? 235 VAL A C     1 
ATOM   1796 O O     . VAL A 1 236 ? -9.071  61.196  18.138  1.00 37.12 ? 235 VAL A O     1 
ATOM   1797 C CB    . VAL A 1 236 ? -6.755  63.455  17.160  1.00 37.75 ? 235 VAL A CB    1 
ATOM   1798 C CG1   . VAL A 1 236 ? -6.092  62.721  18.368  1.00 36.45 ? 235 VAL A CG1   1 
ATOM   1799 C CG2   . VAL A 1 236 ? -5.764  63.837  16.013  1.00 37.32 ? 235 VAL A CG2   1 
ATOM   1800 N N     . TYR A 1 237 ? -9.636  63.394  18.135  1.00 35.57 ? 236 TYR A N     1 
ATOM   1801 C CA    . TYR A 1 237 ? -10.665 63.194  19.145  1.00 35.56 ? 236 TYR A CA    1 
ATOM   1802 C C     . TYR A 1 237 ? -11.669 62.094  18.704  1.00 34.78 ? 236 TYR A C     1 
ATOM   1803 O O     . TYR A 1 237 ? -11.958 61.134  19.438  1.00 33.19 ? 236 TYR A O     1 
ATOM   1804 C CB    . TYR A 1 237 ? -11.384 64.528  19.361  1.00 36.40 ? 236 TYR A CB    1 
ATOM   1805 C CG    . TYR A 1 237 ? -12.452 64.502  20.406  1.00 35.29 ? 236 TYR A CG    1 
ATOM   1806 C CD1   . TYR A 1 237 ? -12.270 63.826  21.602  1.00 34.28 ? 236 TYR A CD1   1 
ATOM   1807 C CD2   . TYR A 1 237 ? -13.630 65.199  20.216  1.00 38.45 ? 236 TYR A CD2   1 
ATOM   1808 C CE1   . TYR A 1 237 ? -13.236 63.826  22.580  1.00 33.50 ? 236 TYR A CE1   1 
ATOM   1809 C CE2   . TYR A 1 237 ? -14.605 65.239  21.212  1.00 35.99 ? 236 TYR A CE2   1 
ATOM   1810 C CZ    . TYR A 1 237 ? -14.399 64.535  22.357  1.00 35.76 ? 236 TYR A CZ    1 
ATOM   1811 O OH    . TYR A 1 237 ? -15.359 64.551  23.300  1.00 38.48 ? 236 TYR A OH    1 
ATOM   1812 N N     . TYR A 1 238 ? -12.181 62.264  17.497  1.00 33.93 ? 237 TYR A N     1 
ATOM   1813 C CA    . TYR A 1 238 ? -13.083 61.293  16.884  1.00 34.95 ? 237 TYR A CA    1 
ATOM   1814 C C     . TYR A 1 238 ? -12.455 59.899  16.843  1.00 36.86 ? 237 TYR A C     1 
ATOM   1815 O O     . TYR A 1 238 ? -13.023 58.925  17.397  1.00 37.87 ? 237 TYR A O     1 
ATOM   1816 C CB    . TYR A 1 238 ? -13.440 61.746  15.487  1.00 32.21 ? 237 TYR A CB    1 
ATOM   1817 C CG    . TYR A 1 238 ? -14.461 60.895  14.859  1.00 33.08 ? 237 TYR A CG    1 
ATOM   1818 C CD1   . TYR A 1 238 ? -15.835 61.054  15.173  1.00 32.99 ? 237 TYR A CD1   1 
ATOM   1819 C CD2   . TYR A 1 238 ? -14.101 59.944  13.885  1.00 31.34 ? 237 TYR A CD2   1 
ATOM   1820 C CE1   . TYR A 1 238 ? -16.822 60.274  14.562  1.00 31.05 ? 237 TYR A CE1   1 
ATOM   1821 C CE2   . TYR A 1 238 ? -15.074 59.158  13.242  1.00 30.53 ? 237 TYR A CE2   1 
ATOM   1822 C CZ    . TYR A 1 238 ? -16.433 59.309  13.592  1.00 33.24 ? 237 TYR A CZ    1 
ATOM   1823 O OH    . TYR A 1 238 ? -17.362 58.504  12.999  1.00 30.00 ? 237 TYR A OH    1 
ATOM   1824 N N     . LEU A 1 239 ? -11.270 59.785  16.229  1.00 37.02 ? 238 LEU A N     1 
ATOM   1825 C CA    . LEU A 1 239 ? -10.623 58.470  16.155  1.00 37.66 ? 238 LEU A CA    1 
ATOM   1826 C C     . LEU A 1 239 ? -10.430 57.780  17.487  1.00 37.93 ? 238 LEU A C     1 
ATOM   1827 O O     . LEU A 1 239 ? -10.420 56.569  17.572  1.00 38.51 ? 238 LEU A O     1 
ATOM   1828 C CB    . LEU A 1 239 ? -9.299  58.550  15.418  1.00 37.46 ? 238 LEU A CB    1 
ATOM   1829 C CG    . LEU A 1 239 ? -9.482  58.962  13.975  1.00 38.07 ? 238 LEU A CG    1 
ATOM   1830 C CD1   . LEU A 1 239 ? -8.110  59.000  13.389  1.00 42.78 ? 238 LEU A CD1   1 
ATOM   1831 C CD2   . LEU A 1 239 ? -10.376 57.968  13.241  1.00 42.42 ? 238 LEU A CD2   1 
ATOM   1832 N N     . MET A 1 240 ? -10.275 58.557  18.528  1.00 38.00 ? 239 MET A N     1 
ATOM   1833 C CA    . MET A 1 240 ? -10.082 57.974  19.833  1.00 40.67 ? 239 MET A CA    1 
ATOM   1834 C C     . MET A 1 240 ? -11.353 57.563  20.538  1.00 38.14 ? 239 MET A C     1 
ATOM   1835 O O     . MET A 1 240 ? -11.289 57.046  21.621  1.00 38.10 ? 239 MET A O     1 
ATOM   1836 C CB    . MET A 1 240 ? -9.315  58.962  20.699  1.00 40.17 ? 239 MET A CB    1 
ATOM   1837 C CG    . MET A 1 240 ? -8.058  59.575  19.955  1.00 45.25 ? 239 MET A CG    1 
ATOM   1838 S SD    . MET A 1 240 ? -6.780  60.198  21.151  1.00 50.70 ? 239 MET A SD    1 
ATOM   1839 C CE    . MET A 1 240 ? -7.796  60.344  22.655  1.00 47.16 ? 239 MET A CE    1 
ATOM   1840 N N     . ASN A 1 241 ? -12.518 57.831  19.949  1.00 37.81 ? 240 ASN A N     1 
ATOM   1841 C CA    . ASN A 1 241 ? -13.794 57.559  20.597  1.00 35.76 ? 240 ASN A CA    1 
ATOM   1842 C C     . ASN A 1 241 ? -14.631 56.481  19.895  1.00 35.51 ? 240 ASN A C     1 
ATOM   1843 O O     . ASN A 1 241 ? -15.578 55.970  20.478  1.00 35.17 ? 240 ASN A O     1 
ATOM   1844 C CB    . ASN A 1 241 ? -14.628 58.818  20.741  1.00 35.26 ? 240 ASN A CB    1 
ATOM   1845 C CG    . ASN A 1 241 ? -14.116 59.757  21.855  1.00 37.29 ? 240 ASN A CG    1 
ATOM   1846 O OD1   . ASN A 1 241 ? -14.105 59.435  23.063  1.00 36.34 ? 240 ASN A OD1   1 
ATOM   1847 N ND2   . ASN A 1 241 ? -13.681 60.926  21.438  1.00 39.22 ? 240 ASN A ND2   1 
ATOM   1848 N N     . ILE A 1 242 ? -14.293 56.176  18.643  1.00 34.49 ? 241 ILE A N     1 
ATOM   1849 C CA    . ILE A 1 242 ? -14.958 55.108  17.930  1.00 32.90 ? 241 ILE A CA    1 
ATOM   1850 C C     . ILE A 1 242 ? -14.339 53.737  18.322  1.00 34.67 ? 241 ILE A C     1 
ATOM   1851 O O     . ILE A 1 242 ? -13.220 53.618  18.790  1.00 34.09 ? 241 ILE A O     1 
ATOM   1852 C CB    . ILE A 1 242 ? -14.933 55.334  16.404  1.00 32.95 ? 241 ILE A CB    1 
ATOM   1853 C CG1   . ILE A 1 242 ? -13.510 55.249  15.849  1.00 30.30 ? 241 ILE A CG1   1 
ATOM   1854 C CG2   . ILE A 1 242 ? -15.646 56.679  16.039  1.00 28.20 ? 241 ILE A CG2   1 
ATOM   1855 C CD1   . ILE A 1 242 ? -13.432 55.514  14.336  1.00 29.53 ? 241 ILE A CD1   1 
ATOM   1856 N N     . HIS A 1 243 ? -15.093 52.688  18.156  1.00 35.53 ? 242 HIS A N     1 
ATOM   1857 C CA    . HIS A 1 243 ? -14.556 51.400  18.456  1.00 36.33 ? 242 HIS A CA    1 
ATOM   1858 C C     . HIS A 1 243 ? -15.228 50.514  17.451  1.00 36.73 ? 242 HIS A C     1 
ATOM   1859 O O     . HIS A 1 243 ? -16.044 50.951  16.621  1.00 37.49 ? 242 HIS A O     1 
ATOM   1860 C CB    . HIS A 1 243 ? -14.939 51.018  19.904  1.00 35.29 ? 242 HIS A CB    1 
ATOM   1861 C CG    . HIS A 1 243 ? -16.420 50.842  20.113  1.00 39.45 ? 242 HIS A CG    1 
ATOM   1862 N ND1   . HIS A 1 243 ? -17.229 51.825  20.661  1.00 38.46 ? 242 HIS A ND1   1 
ATOM   1863 C CD2   . HIS A 1 243 ? -17.241 49.795  19.825  1.00 36.44 ? 242 HIS A CD2   1 
ATOM   1864 C CE1   . HIS A 1 243 ? -18.472 51.374  20.718  1.00 37.01 ? 242 HIS A CE1   1 
ATOM   1865 N NE2   . HIS A 1 243 ? -18.496 50.137  20.248  1.00 34.63 ? 242 HIS A NE2   1 
ATOM   1866 N N     . VAL A 1 244 ? -14.944 49.245  17.546  1.00 37.95 ? 243 VAL A N     1 
ATOM   1867 C CA    . VAL A 1 244 ? -15.564 48.298  16.651  1.00 38.26 ? 243 VAL A CA    1 
ATOM   1868 C C     . VAL A 1 244 ? -16.280 47.183  17.393  1.00 38.92 ? 243 VAL A C     1 
ATOM   1869 O O     . VAL A 1 244 ? -16.576 46.206  16.782  1.00 40.36 ? 243 VAL A O     1 
ATOM   1870 C CB    . VAL A 1 244 ? -14.503 47.728  15.689  1.00 38.47 ? 243 VAL A CB    1 
ATOM   1871 C CG1   . VAL A 1 244 ? -13.896 48.896  14.887  1.00 38.66 ? 243 VAL A CG1   1 
ATOM   1872 C CG2   . VAL A 1 244 ? -13.382 46.907  16.461  1.00 33.16 ? 243 VAL A CG2   1 
ATOM   1873 N N     . GLN A 1 245 ? -16.551 47.312  18.682  1.00 39.70 ? 244 GLN A N     1 
ATOM   1874 C CA    . GLN A 1 245 ? -17.270 46.273  19.407  1.00 41.66 ? 244 GLN A CA    1 
ATOM   1875 C C     . GLN A 1 245 ? -18.684 46.103  18.869  1.00 41.63 ? 244 GLN A C     1 
ATOM   1876 O O     . GLN A 1 245 ? -19.335 47.054  18.511  1.00 41.03 ? 244 GLN A O     1 
ATOM   1877 C CB    . GLN A 1 245 ? -17.317 46.572  20.908  1.00 42.52 ? 244 GLN A CB    1 
ATOM   1878 C CG    . GLN A 1 245 ? -16.527 45.548  21.752  1.00 50.50 ? 244 GLN A CG    1 
ATOM   1879 C CD    . GLN A 1 245 ? -15.026 45.727  21.537  1.00 60.84 ? 244 GLN A CD    1 
ATOM   1880 O OE1   . GLN A 1 245 ? -14.566 46.866  21.360  1.00 68.15 ? 244 GLN A OE1   1 
ATOM   1881 N NE2   . GLN A 1 245 ? -14.264 44.627  21.490  1.00 60.60 ? 244 GLN A NE2   1 
ATOM   1882 N N     . PRO A 1 246 ? -19.195 44.873  18.858  1.00 42.60 ? 245 PRO A N     1 
ATOM   1883 C CA    . PRO A 1 246 ? -20.538 44.749  18.245  1.00 41.52 ? 245 PRO A CA    1 
ATOM   1884 C C     . PRO A 1 246 ? -21.572 45.396  19.173  1.00 38.73 ? 245 PRO A C     1 
ATOM   1885 O O     . PRO A 1 246 ? -21.448 45.257  20.382  1.00 38.06 ? 245 PRO A O     1 
ATOM   1886 C CB    . PRO A 1 246 ? -20.767 43.218  18.169  1.00 42.13 ? 245 PRO A CB    1 
ATOM   1887 C CG    . PRO A 1 246 ? -19.916 42.657  19.358  1.00 42.98 ? 245 PRO A CG    1 
ATOM   1888 C CD    . PRO A 1 246 ? -18.703 43.609  19.462  1.00 42.93 ? 245 PRO A CD    1 
ATOM   1889 N N     . ARG A 1 247 ? -22.550 46.115  18.620  1.00 36.23 ? 246 ARG A N     1 
ATOM   1890 C CA    . ARG A 1 247 ? -23.677 46.621  19.429  1.00 35.09 ? 246 ARG A CA    1 
ATOM   1891 C C     . ARG A 1 247 ? -24.824 47.104  18.571  1.00 33.65 ? 246 ARG A C     1 
ATOM   1892 O O     . ARG A 1 247 ? -24.777 46.980  17.370  1.00 34.06 ? 246 ARG A O     1 
ATOM   1893 C CB    . ARG A 1 247 ? -23.231 47.747  20.388  1.00 35.49 ? 246 ARG A CB    1 
ATOM   1894 C CG    . ARG A 1 247 ? -22.307 48.771  19.797  1.00 34.33 ? 246 ARG A CG    1 
ATOM   1895 C CD    . ARG A 1 247 ? -23.052 49.796  19.070  1.00 37.77 ? 246 ARG A CD    1 
ATOM   1896 N NE    . ARG A 1 247 ? -22.210 50.842  18.530  1.00 41.80 ? 246 ARG A NE    1 
ATOM   1897 C CZ    . ARG A 1 247 ? -22.183 52.098  18.954  1.00 40.44 ? 246 ARG A CZ    1 
ATOM   1898 N NH1   . ARG A 1 247 ? -22.934 52.475  19.958  1.00 39.22 ? 246 ARG A NH1   1 
ATOM   1899 N NH2   . ARG A 1 247 ? -21.387 52.973  18.351  1.00 40.90 ? 246 ARG A NH2   1 
ATOM   1900 N N     . THR A 1 248 ? -25.851 47.666  19.177  1.00 32.20 ? 247 THR A N     1 
ATOM   1901 C CA    . THR A 1 248 ? -26.988 48.095  18.410  1.00 31.84 ? 247 THR A CA    1 
ATOM   1902 C C     . THR A 1 248 ? -27.447 49.466  18.827  1.00 31.90 ? 247 THR A C     1 
ATOM   1903 O O     . THR A 1 248 ? -27.562 49.721  20.043  1.00 32.56 ? 247 THR A O     1 
ATOM   1904 C CB    . THR A 1 248 ? -28.164 47.135  18.695  1.00 32.21 ? 247 THR A CB    1 
ATOM   1905 O OG1   . THR A 1 248 ? -27.700 45.786  18.537  1.00 33.76 ? 247 THR A OG1   1 
ATOM   1906 C CG2   . THR A 1 248 ? -29.307 47.383  17.763  1.00 29.76 ? 247 THR A CG2   1 
ATOM   1907 N N     . ILE A 1 249 ? -27.755 50.337  17.847  1.00 30.24 ? 248 ILE A N     1 
ATOM   1908 C CA    . ILE A 1 249 ? -28.360 51.590  18.165  1.00 28.68 ? 248 ILE A CA    1 
ATOM   1909 C C     . ILE A 1 249 ? -29.811 51.567  17.757  1.00 28.17 ? 248 ILE A C     1 
ATOM   1910 O O     . ILE A 1 249 ? -30.108 51.315  16.606  1.00 28.57 ? 248 ILE A O     1 
ATOM   1911 C CB    . ILE A 1 249 ? -27.568 52.749  17.513  1.00 29.18 ? 248 ILE A CB    1 
ATOM   1912 C CG1   . ILE A 1 249 ? -26.096 52.686  17.995  1.00 30.93 ? 248 ILE A CG1   1 
ATOM   1913 C CG2   . ILE A 1 249 ? -28.262 54.164  17.807  1.00 25.32 ? 248 ILE A CG2   1 
ATOM   1914 C CD1   . ILE A 1 249 ? -25.085 53.655  17.365  1.00 29.63 ? 248 ILE A CD1   1 
ATOM   1915 N N     . TYR A 1 250 ? -30.722 51.884  18.675  1.00 27.33 ? 249 TYR A N     1 
ATOM   1916 C CA    . TYR A 1 250 ? -32.144 52.045  18.319  1.00 27.58 ? 249 TYR A CA    1 
ATOM   1917 C C     . TYR A 1 250 ? -32.553 53.521  18.265  1.00 27.24 ? 249 TYR A C     1 
ATOM   1918 O O     . TYR A 1 250 ? -32.194 54.257  19.143  1.00 28.12 ? 249 TYR A O     1 
ATOM   1919 C CB    . TYR A 1 250 ? -33.021 51.287  19.327  1.00 27.85 ? 249 TYR A CB    1 
ATOM   1920 C CG    . TYR A 1 250 ? -32.649 49.818  19.467  1.00 28.12 ? 249 TYR A CG    1 
ATOM   1921 C CD1   . TYR A 1 250 ? -31.659 49.411  20.345  1.00 30.05 ? 249 TYR A CD1   1 
ATOM   1922 C CD2   . TYR A 1 250 ? -33.290 48.835  18.701  1.00 30.84 ? 249 TYR A CD2   1 
ATOM   1923 C CE1   . TYR A 1 250 ? -31.295 48.040  20.490  1.00 33.20 ? 249 TYR A CE1   1 
ATOM   1924 C CE2   . TYR A 1 250 ? -32.978 47.454  18.847  1.00 32.59 ? 249 TYR A CE2   1 
ATOM   1925 C CZ    . TYR A 1 250 ? -31.981 47.067  19.731  1.00 33.78 ? 249 TYR A CZ    1 
ATOM   1926 O OH    . TYR A 1 250 ? -31.634 45.733  19.850  1.00 33.32 ? 249 TYR A OH    1 
ATOM   1927 N N     . LEU A 1 251 ? -33.313 53.959  17.277  1.00 26.48 ? 250 LEU A N     1 
ATOM   1928 C CA    . LEU A 1 251 ? -33.770 55.344  17.277  1.00 26.70 ? 250 LEU A CA    1 
ATOM   1929 C C     . LEU A 1 251 ? -35.264 55.313  17.087  1.00 28.12 ? 250 LEU A C     1 
ATOM   1930 O O     . LEU A 1 251 ? -35.769 54.562  16.191  1.00 29.49 ? 250 LEU A O     1 
ATOM   1931 C CB    . LEU A 1 251 ? -33.143 56.189  16.129  1.00 25.27 ? 250 LEU A CB    1 
ATOM   1932 C CG    . LEU A 1 251 ? -31.629 56.183  15.844  1.00 26.94 ? 250 LEU A CG    1 
ATOM   1933 C CD1   . LEU A 1 251 ? -31.190 57.011  14.579  1.00 21.77 ? 250 LEU A CD1   1 
ATOM   1934 C CD2   . LEU A 1 251 ? -30.867 56.709  17.088  1.00 26.80 ? 250 LEU A CD2   1 
ATOM   1935 N N     . CYS A 1 252 ? -36.000 56.116  17.860  1.00 26.71 ? 251 CYS A N     1 
ATOM   1936 C CA    . CYS A 1 252 ? -37.407 56.302  17.527  1.00 27.91 ? 251 CYS A CA    1 
ATOM   1937 C C     . CYS A 1 252 ? -37.863 57.621  18.086  1.00 28.22 ? 251 CYS A C     1 
ATOM   1938 O O     . CYS A 1 252 ? -37.088 58.281  18.826  1.00 29.19 ? 251 CYS A O     1 
ATOM   1939 C CB    . CYS A 1 252 ? -38.247 55.168  18.112  1.00 26.79 ? 251 CYS A CB    1 
ATOM   1940 S SG    . CYS A 1 252 ? -38.225 55.172  19.950  1.00 33.05 ? 251 CYS A SG    1 
ATOM   1941 N N     . ARG A 1 253 ? -39.099 58.008  17.741  1.00 27.80 ? 252 ARG A N     1 
ATOM   1942 C CA    . ARG A 1 253 ? -39.712 59.209  18.269  1.00 27.76 ? 252 ARG A CA    1 
ATOM   1943 C C     . ARG A 1 253 ? -40.484 58.947  19.553  1.00 29.33 ? 252 ARG A C     1 
ATOM   1944 O O     . ARG A 1 253 ? -40.879 57.823  19.856  1.00 31.32 ? 252 ARG A O     1 
ATOM   1945 C CB    . ARG A 1 253 ? -40.555 59.931  17.242  1.00 26.88 ? 252 ARG A CB    1 
ATOM   1946 C CG    . ARG A 1 253 ? -39.812 60.272  15.956  1.00 26.51 ? 252 ARG A CG    1 
ATOM   1947 C CD    . ARG A 1 253 ? -40.759 60.565  14.766  1.00 26.27 ? 252 ARG A CD    1 
ATOM   1948 N NE    . ARG A 1 253 ? -41.691 61.648  15.003  1.00 29.34 ? 252 ARG A NE    1 
ATOM   1949 C CZ    . ARG A 1 253 ? -42.541 62.137  14.096  1.00 30.54 ? 252 ARG A CZ    1 
ATOM   1950 N NH1   . ARG A 1 253 ? -43.371 63.105  14.458  1.00 20.15 ? 252 ARG A NH1   1 
ATOM   1951 N NH2   . ARG A 1 253 ? -42.611 61.636  12.840  1.00 28.24 ? 252 ARG A NH2   1 
ATOM   1952 N N     . HIS A 1 254 ? -40.619 59.959  20.380  1.00 29.67 ? 253 HIS A N     1 
ATOM   1953 C CA    . HIS A 1 254 ? -41.690 59.940  21.350  1.00 30.31 ? 253 HIS A CA    1 
ATOM   1954 C C     . HIS A 1 254 ? -43.006 59.278  20.821  1.00 29.96 ? 253 HIS A C     1 
ATOM   1955 O O     . HIS A 1 254 ? -43.375 59.531  19.686  1.00 29.55 ? 253 HIS A O     1 
ATOM   1956 C CB    . HIS A 1 254 ? -42.007 61.374  21.698  1.00 28.38 ? 253 HIS A CB    1 
ATOM   1957 C CG    . HIS A 1 254 ? -42.474 62.160  20.541  1.00 26.53 ? 253 HIS A CG    1 
ATOM   1958 N ND1   . HIS A 1 254 ? -43.813 62.294  20.229  1.00 24.77 ? 253 HIS A ND1   1 
ATOM   1959 C CD2   . HIS A 1 254 ? -41.795 62.913  19.643  1.00 27.35 ? 253 HIS A CD2   1 
ATOM   1960 C CE1   . HIS A 1 254 ? -43.938 63.091  19.181  1.00 22.68 ? 253 HIS A CE1   1 
ATOM   1961 N NE2   . HIS A 1 254 ? -42.728 63.454  18.786  1.00 24.82 ? 253 HIS A NE2   1 
ATOM   1962 N N     . GLY A 1 255 ? -43.718 58.496  21.645  1.00 29.57 ? 254 GLY A N     1 
ATOM   1963 C CA    . GLY A 1 255 ? -45.094 58.081  21.301  1.00 30.09 ? 254 GLY A CA    1 
ATOM   1964 C C     . GLY A 1 255 ? -45.880 59.284  20.816  1.00 30.95 ? 254 GLY A C     1 
ATOM   1965 O O     . GLY A 1 255 ? -45.617 60.377  21.242  1.00 32.06 ? 254 GLY A O     1 
ATOM   1966 N N     . GLU A 1 256 ? -46.807 59.111  19.882  1.00 32.63 ? 255 GLU A N     1 
ATOM   1967 C CA    . GLU A 1 256 ? -47.696 60.166  19.463  1.00 33.37 ? 255 GLU A CA    1 
ATOM   1968 C C     . GLU A 1 256 ? -48.136 61.125  20.570  1.00 32.87 ? 255 GLU A C     1 
ATOM   1969 O O     . GLU A 1 256 ? -48.477 60.687  21.686  1.00 32.26 ? 255 GLU A O     1 
ATOM   1970 C CB    . GLU A 1 256 ? -48.947 59.548  18.871  1.00 33.68 ? 255 GLU A CB    1 
ATOM   1971 C CG    . GLU A 1 256 ? -49.847 60.652  18.239  1.00 34.61 ? 255 GLU A CG    1 
ATOM   1972 C CD    . GLU A 1 256 ? -51.154 60.083  17.656  1.00 36.84 ? 255 GLU A CD    1 
ATOM   1973 O OE1   . GLU A 1 256 ? -51.979 59.597  18.454  1.00 36.40 ? 255 GLU A OE1   1 
ATOM   1974 O OE2   . GLU A 1 256 ? -51.369 60.181  16.414  1.00 42.51 ? 255 GLU A OE2   1 
ATOM   1975 N N     . ASN A 1 257 ? -48.098 62.426  20.290  1.00 32.92 ? 256 ASN A N     1 
ATOM   1976 C CA    . ASN A 1 257 ? -48.537 63.391  21.280  1.00 33.67 ? 256 ASN A CA    1 
ATOM   1977 C C     . ASN A 1 257 ? -49.730 64.198  20.845  1.00 34.83 ? 256 ASN A C     1 
ATOM   1978 O O     . ASN A 1 257 ? -50.186 64.131  19.705  1.00 35.59 ? 256 ASN A O     1 
ATOM   1979 C CB    . ASN A 1 257 ? -47.408 64.332  21.712  1.00 33.32 ? 256 ASN A CB    1 
ATOM   1980 C CG    . ASN A 1 257 ? -46.939 65.247  20.606  1.00 32.66 ? 256 ASN A CG    1 
ATOM   1981 O OD1   . ASN A 1 257 ? -47.738 65.828  19.828  1.00 32.51 ? 256 ASN A OD1   1 
ATOM   1982 N ND2   . ASN A 1 257 ? -45.618 65.402  20.524  1.00 29.69 ? 256 ASN A ND2   1 
ATOM   1983 N N     . GLU A 1 258 ? -50.191 65.043  21.737  1.00 36.10 ? 257 GLU A N     1 
ATOM   1984 C CA    . GLU A 1 258 ? -51.397 65.777  21.483  1.00 37.43 ? 257 GLU A CA    1 
ATOM   1985 C C     . GLU A 1 258 ? -51.327 66.777  20.359  1.00 37.10 ? 257 GLU A C     1 
ATOM   1986 O O     . GLU A 1 258 ? -52.261 66.840  19.573  1.00 37.10 ? 257 GLU A O     1 
ATOM   1987 C CB    . GLU A 1 258 ? -51.794 66.458  22.744  1.00 38.22 ? 257 GLU A CB    1 
ATOM   1988 C CG    . GLU A 1 258 ? -51.730 65.504  23.811  1.00 42.37 ? 257 GLU A CG    1 
ATOM   1989 C CD    . GLU A 1 258 ? -53.078 65.222  24.336  1.00 53.37 ? 257 GLU A CD    1 
ATOM   1990 O OE1   . GLU A 1 258 ? -53.800 64.403  23.633  1.00 54.94 ? 257 GLU A OE1   1 
ATOM   1991 O OE2   . GLU A 1 258 ? -53.364 65.836  25.447  1.00 52.86 ? 257 GLU A OE2   1 
ATOM   1992 N N     . HIS A 1 259 ? -50.235 67.547  20.266  1.00 37.45 ? 258 HIS A N     1 
ATOM   1993 C CA    . HIS A 1 259 ? -50.057 68.476  19.138  1.00 37.04 ? 258 HIS A CA    1 
ATOM   1994 C C     . HIS A 1 259 ? -49.933 67.679  17.817  1.00 36.61 ? 258 HIS A C     1 
ATOM   1995 O O     . HIS A 1 259 ? -50.337 68.157  16.706  1.00 35.23 ? 258 HIS A O     1 
ATOM   1996 C CB    . HIS A 1 259 ? -48.761 69.287  19.309  1.00 37.57 ? 258 HIS A CB    1 
ATOM   1997 C CG    . HIS A 1 259 ? -48.856 70.436  20.242  1.00 37.41 ? 258 HIS A CG    1 
ATOM   1998 N ND1   . HIS A 1 259 ? -49.811 70.531  21.223  1.00 39.49 ? 258 HIS A ND1   1 
ATOM   1999 C CD2   . HIS A 1 259 ? -48.085 71.537  20.360  1.00 40.19 ? 258 HIS A CD2   1 
ATOM   2000 C CE1   . HIS A 1 259 ? -49.628 71.637  21.912  1.00 38.52 ? 258 HIS A CE1   1 
ATOM   2001 N NE2   . HIS A 1 259 ? -48.578 72.260  21.418  1.00 39.99 ? 258 HIS A NE2   1 
ATOM   2002 N N     . ASN A 1 260 ? -49.322 66.501  17.905  1.00 35.48 ? 259 ASN A N     1 
ATOM   2003 C CA    . ASN A 1 260 ? -49.366 65.637  16.724  1.00 36.47 ? 259 ASN A CA    1 
ATOM   2004 C C     . ASN A 1 260 ? -50.828 65.567  16.224  1.00 37.23 ? 259 ASN A C     1 
ATOM   2005 O O     . ASN A 1 260 ? -51.093 65.810  15.025  1.00 36.38 ? 259 ASN A O     1 
ATOM   2006 C CB    . ASN A 1 260 ? -48.840 64.240  17.033  1.00 35.31 ? 259 ASN A CB    1 
ATOM   2007 C CG    . ASN A 1 260 ? -47.356 64.214  17.257  1.00 35.04 ? 259 ASN A CG    1 
ATOM   2008 O OD1   . ASN A 1 260 ? -46.820 63.442  18.104  1.00 35.64 ? 259 ASN A OD1   1 
ATOM   2009 N ND2   . ASN A 1 260 ? -46.666 65.041  16.507  1.00 27.14 ? 259 ASN A ND2   1 
ATOM   2010 N N     . LEU A 1 261 ? -51.766 65.265  17.155  1.00 38.06 ? 260 LEU A N     1 
ATOM   2011 C CA    . LEU A 1 261 ? -53.185 65.072  16.807  1.00 39.05 ? 260 LEU A CA    1 
ATOM   2012 C C     . LEU A 1 261 ? -53.820 66.306  16.221  1.00 39.77 ? 260 LEU A C     1 
ATOM   2013 O O     . LEU A 1 261 ? -54.637 66.226  15.317  1.00 40.61 ? 260 LEU A O     1 
ATOM   2014 C CB    . LEU A 1 261 ? -53.998 64.556  17.964  1.00 39.45 ? 260 LEU A CB    1 
ATOM   2015 C CG    . LEU A 1 261 ? -53.762 63.085  18.370  1.00 40.93 ? 260 LEU A CG    1 
ATOM   2016 C CD1   . LEU A 1 261 ? -54.409 62.873  19.743  1.00 41.73 ? 260 LEU A CD1   1 
ATOM   2017 C CD2   . LEU A 1 261 ? -54.239 61.950  17.386  1.00 36.99 ? 260 LEU A CD2   1 
ATOM   2018 N N     . GLN A 1 262 ? -53.387 67.466  16.664  1.00 40.34 ? 261 GLN A N     1 
ATOM   2019 C CA    . GLN A 1 262 ? -53.840 68.672  16.035  1.00 40.15 ? 261 GLN A CA    1 
ATOM   2020 C C     . GLN A 1 262 ? -52.950 69.209  14.970  1.00 39.65 ? 261 GLN A C     1 
ATOM   2021 O O     . GLN A 1 262 ? -53.158 70.352  14.593  1.00 41.06 ? 261 GLN A O     1 
ATOM   2022 C CB    . GLN A 1 262 ? -54.025 69.738  17.079  1.00 41.43 ? 261 GLN A CB    1 
ATOM   2023 C CG    . GLN A 1 262 ? -54.987 69.351  18.235  1.00 46.28 ? 261 GLN A CG    1 
ATOM   2024 C CD    . GLN A 1 262 ? -54.929 70.421  19.285  1.00 58.45 ? 261 GLN A CD    1 
ATOM   2025 O OE1   . GLN A 1 262 ? -54.355 70.207  20.373  1.00 64.95 ? 261 GLN A OE1   1 
ATOM   2026 N NE2   . GLN A 1 262 ? -55.417 71.634  18.942  1.00 59.69 ? 261 GLN A NE2   1 
ATOM   2027 N N     . GLY A 1 263 ? -51.981 68.447  14.440  1.00 38.22 ? 262 GLY A N     1 
ATOM   2028 C CA    . GLY A 1 263 ? -51.113 69.008  13.385  1.00 36.06 ? 262 GLY A CA    1 
ATOM   2029 C C     . GLY A 1 263 ? -50.352 70.261  13.885  1.00 37.10 ? 262 GLY A C     1 
ATOM   2030 O O     . GLY A 1 263 ? -49.912 71.142  13.095  1.00 37.66 ? 262 GLY A O     1 
ATOM   2031 N N     . ARG A 1 264 ? -50.169 70.366  15.200  1.00 35.37 ? 263 ARG A N     1 
ATOM   2032 C CA    . ARG A 1 264 ? -49.353 71.445  15.744  1.00 34.68 ? 263 ARG A CA    1 
ATOM   2033 C C     . ARG A 1 264 ? -47.877 71.104  15.865  1.00 32.96 ? 263 ARG A C     1 
ATOM   2034 O O     . ARG A 1 264 ? -47.560 70.011  16.438  1.00 32.25 ? 263 ARG A O     1 
ATOM   2035 C CB    . ARG A 1 264 ? -49.863 71.835  17.112  1.00 34.90 ? 263 ARG A CB    1 
ATOM   2036 C CG    . ARG A 1 264 ? -51.137 72.577  16.983  1.00 36.62 ? 263 ARG A CG    1 
ATOM   2037 C CD    . ARG A 1 264 ? -51.573 73.413  18.181  1.00 43.76 ? 263 ARG A CD    1 
ATOM   2038 N NE    . ARG A 1 264 ? -52.848 73.881  17.733  1.00 48.36 ? 263 ARG A NE    1 
ATOM   2039 C CZ    . ARG A 1 264 ? -53.042 75.004  17.063  1.00 49.90 ? 263 ARG A CZ    1 
ATOM   2040 N NH1   . ARG A 1 264 ? -52.025 75.888  16.843  1.00 41.74 ? 263 ARG A NH1   1 
ATOM   2041 N NH2   . ARG A 1 264 ? -54.286 75.226  16.625  1.00 49.24 ? 263 ARG A NH2   1 
ATOM   2042 N N     . ILE A 1 265 ? -47.000 72.027  15.400  1.00 30.52 ? 264 ILE A N     1 
ATOM   2043 C CA    . ILE A 1 265 ? -45.532 71.800  15.584  1.00 30.25 ? 264 ILE A CA    1 
ATOM   2044 C C     . ILE A 1 265 ? -45.024 72.238  16.964  1.00 30.77 ? 264 ILE A C     1 
ATOM   2045 O O     . ILE A 1 265 ? -45.649 73.065  17.605  1.00 32.11 ? 264 ILE A O     1 
ATOM   2046 C CB    . ILE A 1 265 ? -44.615 72.438  14.530  1.00 29.68 ? 264 ILE A CB    1 
ATOM   2047 C CG1   . ILE A 1 265 ? -44.555 73.942  14.694  1.00 26.34 ? 264 ILE A CG1   1 
ATOM   2048 C CG2   . ILE A 1 265 ? -44.955 72.005  13.096  1.00 25.43 ? 264 ILE A CG2   1 
ATOM   2049 C CD1   . ILE A 1 265 ? -43.716 74.544  13.586  1.00 25.06 ? 264 ILE A CD1   1 
ATOM   2050 N N     . GLY A 1 266 ? -43.917 71.650  17.418  1.00 30.83 ? 265 GLY A N     1 
ATOM   2051 C CA    . GLY A 1 266 ? -43.195 72.111  18.596  1.00 28.78 ? 265 GLY A CA    1 
ATOM   2052 C C     . GLY A 1 266 ? -43.994 71.993  19.901  1.00 29.96 ? 265 GLY A C     1 
ATOM   2053 O O     . GLY A 1 266 ? -44.831 71.059  20.099  1.00 29.32 ? 265 GLY A O     1 
ATOM   2054 N N     . GLY A 1 267 ? -43.771 72.944  20.813  1.00 28.49 ? 266 GLY A N     1 
ATOM   2055 C CA    . GLY A 1 267 ? -44.462 72.859  22.093  1.00 28.77 ? 266 GLY A CA    1 
ATOM   2056 C C     . GLY A 1 267 ? -43.878 71.719  22.930  1.00 29.51 ? 266 GLY A C     1 
ATOM   2057 O O     . GLY A 1 267 ? -42.848 71.118  22.585  1.00 28.24 ? 266 GLY A O     1 
ATOM   2058 N N     . ASP A 1 268 ? -44.534 71.451  24.049  1.00 30.40 ? 267 ASP A N     1 
ATOM   2059 C CA    . ASP A 1 268 ? -44.108 70.420  24.968  1.00 31.47 ? 267 ASP A CA    1 
ATOM   2060 C C     . ASP A 1 268 ? -45.357 69.618  25.414  1.00 31.41 ? 267 ASP A C     1 
ATOM   2061 O O     . ASP A 1 268 ? -45.583 69.434  26.603  1.00 31.03 ? 267 ASP A O     1 
ATOM   2062 C CB    . ASP A 1 268 ? -43.396 71.104  26.154  1.00 30.01 ? 267 ASP A CB    1 
ATOM   2063 C CG    . ASP A 1 268 ? -42.754 70.130  27.086  1.00 32.36 ? 267 ASP A CG    1 
ATOM   2064 O OD1   . ASP A 1 268 ? -42.567 68.891  26.782  1.00 32.65 ? 267 ASP A OD1   1 
ATOM   2065 O OD2   . ASP A 1 268 ? -42.447 70.619  28.188  1.00 38.46 ? 267 ASP A OD2   1 
ATOM   2066 N N     . SER A 1 269 ? -46.173 69.168  24.465  1.00 31.79 ? 268 SER A N     1 
ATOM   2067 C CA    . SER A 1 269 ? -47.363 68.408  24.847  1.00 32.27 ? 268 SER A CA    1 
ATOM   2068 C C     . SER A 1 269 ? -47.069 66.942  25.239  1.00 32.29 ? 268 SER A C     1 
ATOM   2069 O O     . SER A 1 269 ? -46.008 66.382  24.894  1.00 31.31 ? 268 SER A O     1 
ATOM   2070 C CB    . SER A 1 269 ? -48.438 68.521  23.755  1.00 31.31 ? 268 SER A CB    1 
ATOM   2071 O OG    . SER A 1 269 ? -48.011 67.825  22.611  1.00 34.06 ? 268 SER A OG    1 
ATOM   2072 N N     . GLY A 1 270 ? -48.018 66.306  25.961  1.00 33.52 ? 269 GLY A N     1 
ATOM   2073 C CA    . GLY A 1 270 ? -47.841 64.914  26.524  1.00 31.49 ? 269 GLY A CA    1 
ATOM   2074 C C     . GLY A 1 270 ? -48.332 63.890  25.518  1.00 33.29 ? 269 GLY A C     1 
ATOM   2075 O O     . GLY A 1 270 ? -48.732 64.242  24.398  1.00 32.10 ? 269 GLY A O     1 
ATOM   2076 N N     . LEU A 1 271 ? -48.276 62.608  25.875  1.00 34.57 ? 270 LEU A N     1 
ATOM   2077 C CA    . LEU A 1 271 ? -48.697 61.581  24.948  1.00 36.36 ? 270 LEU A CA    1 
ATOM   2078 C C     . LEU A 1 271 ? -50.214 61.501  24.838  1.00 38.22 ? 270 LEU A C     1 
ATOM   2079 O O     . LEU A 1 271 ? -50.889 61.598  25.857  1.00 40.08 ? 270 LEU A O     1 
ATOM   2080 C CB    . LEU A 1 271 ? -48.203 60.256  25.438  1.00 35.44 ? 270 LEU A CB    1 
ATOM   2081 C CG    . LEU A 1 271 ? -46.699 60.018  25.591  1.00 34.95 ? 270 LEU A CG    1 
ATOM   2082 C CD1   . LEU A 1 271 ? -46.506 58.781  26.369  1.00 28.77 ? 270 LEU A CD1   1 
ATOM   2083 C CD2   . LEU A 1 271 ? -45.977 59.949  24.237  1.00 30.52 ? 270 LEU A CD2   1 
ATOM   2084 N N     . SER A 1 272 ? -50.731 61.384  23.607  1.00 39.31 ? 271 SER A N     1 
ATOM   2085 C CA    . SER A 1 272 ? -52.091 60.846  23.271  1.00 39.67 ? 271 SER A CA    1 
ATOM   2086 C C     . SER A 1 272 ? -52.250 59.428  23.872  1.00 40.63 ? 271 SER A C     1 
ATOM   2087 O O     . SER A 1 272 ? -51.253 58.823  24.319  1.00 41.98 ? 271 SER A O     1 
ATOM   2088 C CB    . SER A 1 272 ? -52.212 60.693  21.756  1.00 39.41 ? 271 SER A CB    1 
ATOM   2089 O OG    . SER A 1 272 ? -51.513 59.480  21.327  1.00 39.15 ? 271 SER A OG    1 
ATOM   2090 N N     . SER A 1 273 ? -53.461 58.872  23.860  1.00 40.42 ? 272 SER A N     1 
ATOM   2091 C CA    . SER A 1 273 ? -53.611 57.499  24.354  1.00 40.60 ? 272 SER A CA    1 
ATOM   2092 C C     . SER A 1 273 ? -52.973 56.540  23.414  1.00 39.01 ? 272 SER A C     1 
ATOM   2093 O O     . SER A 1 273 ? -52.468 55.505  23.844  1.00 40.20 ? 272 SER A O     1 
ATOM   2094 C CB    . SER A 1 273 ? -55.069 57.084  24.621  1.00 41.88 ? 272 SER A CB    1 
ATOM   2095 O OG    . SER A 1 273 ? -55.961 57.661  23.689  1.00 44.59 ? 272 SER A OG    1 
ATOM   2096 N N     . ARG A 1 274 ? -52.890 56.878  22.149  1.00 37.22 ? 273 ARG A N     1 
ATOM   2097 C CA    . ARG A 1 274 ? -52.071 56.005  21.278  1.00 37.20 ? 273 ARG A CA    1 
ATOM   2098 C C     . ARG A 1 274 ? -50.525 56.057  21.548  1.00 37.27 ? 273 ARG A C     1 
ATOM   2099 O O     . ARG A 1 274 ? -49.836 54.987  21.567  1.00 35.34 ? 273 ARG A O     1 
ATOM   2100 C CB    . ARG A 1 274 ? -52.330 56.282  19.802  1.00 37.10 ? 273 ARG A CB    1 
ATOM   2101 C CG    . ARG A 1 274 ? -53.738 56.005  19.243  1.00 35.96 ? 273 ARG A CG    1 
ATOM   2102 C CD    . ARG A 1 274 ? -53.989 57.224  18.365  1.00 35.49 ? 273 ARG A CD    1 
ATOM   2103 N NE    . ARG A 1 274 ? -54.468 56.984  17.023  1.00 37.80 ? 273 ARG A NE    1 
ATOM   2104 C CZ    . ARG A 1 274 ? -54.346 57.824  15.995  1.00 39.39 ? 273 ARG A CZ    1 
ATOM   2105 N NH1   . ARG A 1 274 ? -53.692 58.948  16.083  1.00 31.97 ? 273 ARG A NH1   1 
ATOM   2106 N NH2   . ARG A 1 274 ? -54.893 57.508  14.834  1.00 44.51 ? 273 ARG A NH2   1 
ATOM   2107 N N     . GLY A 1 275 ? -50.002 57.300  21.720  1.00 37.31 ? 274 GLY A N     1 
ATOM   2108 C CA    . GLY A 1 275 ? -48.627 57.520  22.128  1.00 36.71 ? 274 GLY A CA    1 
ATOM   2109 C C     . GLY A 1 275 ? -48.348 56.626  23.321  1.00 36.62 ? 274 GLY A C     1 
ATOM   2110 O O     . GLY A 1 275 ? -47.329 55.916  23.332  1.00 35.85 ? 274 GLY A O     1 
ATOM   2111 N N     . LYS A 1 276 ? -49.292 56.545  24.271  1.00 37.09 ? 275 LYS A N     1 
ATOM   2112 C CA    . LYS A 1 276 ? -49.045 55.653  25.470  1.00 38.98 ? 275 LYS A CA    1 
ATOM   2113 C C     . LYS A 1 276 ? -49.056 54.188  25.127  1.00 37.98 ? 275 LYS A C     1 
ATOM   2114 O O     . LYS A 1 276 ? -48.298 53.393  25.731  1.00 37.26 ? 275 LYS A O     1 
ATOM   2115 C CB    . LYS A 1 276 ? -49.937 55.908  26.712  1.00 39.58 ? 275 LYS A CB    1 
ATOM   2116 C CG    . LYS A 1 276 ? -50.491 57.337  26.931  1.00 41.31 ? 275 LYS A CG    1 
ATOM   2117 C CD    . LYS A 1 276 ? -50.872 57.559  28.411  1.00 41.00 ? 275 LYS A CD    1 
ATOM   2118 C CE    . LYS A 1 276 ? -51.391 59.013  28.620  1.00 46.33 ? 275 LYS A CE    1 
ATOM   2119 N NZ    . LYS A 1 276 ? -52.178 59.170  29.900  1.00 49.52 ? 275 LYS A NZ    1 
ATOM   2120 N N     . LYS A 1 277 ? -49.885 53.826  24.141  1.00 38.28 ? 276 LYS A N     1 
ATOM   2121 C CA    . LYS A 1 277 ? -49.952 52.423  23.765  1.00 39.44 ? 276 LYS A CA    1 
ATOM   2122 C C     . LYS A 1 277 ? -48.636 52.092  23.074  1.00 38.51 ? 276 LYS A C     1 
ATOM   2123 O O     . LYS A 1 277 ? -48.058 51.043  23.317  1.00 39.00 ? 276 LYS A O     1 
ATOM   2124 C CB    . LYS A 1 277 ? -51.192 52.046  22.914  1.00 40.06 ? 276 LYS A CB    1 
ATOM   2125 C CG    . LYS A 1 277 ? -52.555 52.173  23.628  1.00 41.92 ? 276 LYS A CG    1 
ATOM   2126 C CD    . LYS A 1 277 ? -53.759 51.552  22.850  1.00 42.74 ? 276 LYS A CD    1 
ATOM   2127 C CE    . LYS A 1 277 ? -55.181 52.143  23.286  1.00 45.41 ? 276 LYS A CE    1 
ATOM   2128 N NZ    . LYS A 1 277 ? -55.754 53.208  22.301  1.00 48.16 ? 276 LYS A NZ    1 
ATOM   2129 N N     . PHE A 1 278 ? -48.118 53.009  22.248  1.00 38.27 ? 277 PHE A N     1 
ATOM   2130 C CA    . PHE A 1 278 ? -46.737 52.828  21.703  1.00 36.59 ? 277 PHE A CA    1 
ATOM   2131 C C     . PHE A 1 278 ? -45.689 52.610  22.797  1.00 35.68 ? 277 PHE A C     1 
ATOM   2132 O O     . PHE A 1 278 ? -44.808 51.730  22.682  1.00 35.25 ? 277 PHE A O     1 
ATOM   2133 C CB    . PHE A 1 278 ? -46.327 53.977  20.762  1.00 37.03 ? 277 PHE A CB    1 
ATOM   2134 C CG    . PHE A 1 278 ? -44.867 53.975  20.412  1.00 37.10 ? 277 PHE A CG    1 
ATOM   2135 C CD1   . PHE A 1 278 ? -44.359 53.027  19.511  1.00 33.98 ? 277 PHE A CD1   1 
ATOM   2136 C CD2   . PHE A 1 278 ? -43.985 54.893  21.020  1.00 35.19 ? 277 PHE A CD2   1 
ATOM   2137 C CE1   . PHE A 1 278 ? -43.010 52.972  19.195  1.00 33.24 ? 277 PHE A CE1   1 
ATOM   2138 C CE2   . PHE A 1 278 ? -42.631 54.858  20.711  1.00 36.41 ? 277 PHE A CE2   1 
ATOM   2139 C CZ    . PHE A 1 278 ? -42.125 53.905  19.789  1.00 36.16 ? 277 PHE A CZ    1 
ATOM   2140 N N     . ALA A 1 279 ? -45.807 53.368  23.880  1.00 34.03 ? 278 ALA A N     1 
ATOM   2141 C CA    . ALA A 1 279 ? -44.812 53.249  24.925  1.00 33.51 ? 278 ALA A CA    1 
ATOM   2142 C C     . ALA A 1 279 ? -44.730 51.872  25.461  1.00 33.05 ? 278 ALA A C     1 
ATOM   2143 O O     . ALA A 1 279 ? -43.640 51.281  25.485  1.00 36.03 ? 278 ALA A O     1 
ATOM   2144 C CB    . ALA A 1 279 ? -45.034 54.299  26.042  1.00 34.77 ? 278 ALA A CB    1 
ATOM   2145 N N     . SER A 1 280 ? -45.845 51.324  25.898  1.00 32.75 ? 279 SER A N     1 
ATOM   2146 C CA    . SER A 1 280 ? -45.945 49.831  26.219  1.00 32.21 ? 279 SER A CA    1 
ATOM   2147 C C     . SER A 1 280 ? -45.415 48.899  25.179  1.00 30.23 ? 279 SER A C     1 
ATOM   2148 O O     . SER A 1 280 ? -44.731 47.907  25.527  1.00 30.08 ? 279 SER A O     1 
ATOM   2149 C CB    . SER A 1 280 ? -47.393 49.384  26.374  1.00 32.10 ? 279 SER A CB    1 
ATOM   2150 O OG    . SER A 1 280 ? -48.023 50.194  27.322  1.00 36.28 ? 279 SER A OG    1 
ATOM   2151 N N     . ALA A 1 281 ? -45.773 49.145  23.926  1.00 27.71 ? 280 ALA A N     1 
ATOM   2152 C CA    . ALA A 1 281 ? -45.242 48.267  22.895  1.00 29.76 ? 280 ALA A CA    1 
ATOM   2153 C C     . ALA A 1 281 ? -43.696 48.391  22.862  1.00 31.61 ? 280 ALA A C     1 
ATOM   2154 O O     . ALA A 1 281 ? -42.947 47.361  22.644  1.00 32.60 ? 280 ALA A O     1 
ATOM   2155 C CB    . ALA A 1 281 ? -45.844 48.582  21.545  1.00 28.29 ? 280 ALA A CB    1 
ATOM   2156 N N     . LEU A 1 282 ? -43.195 49.629  23.088  1.00 30.70 ? 281 LEU A N     1 
ATOM   2157 C CA    . LEU A 1 282 ? -41.760 49.824  23.012  1.00 30.87 ? 281 LEU A CA    1 
ATOM   2158 C C     . LEU A 1 282 ? -41.163 49.041  24.163  1.00 32.03 ? 281 LEU A C     1 
ATOM   2159 O O     . LEU A 1 282 ? -40.079 48.460  24.057  1.00 31.07 ? 281 LEU A O     1 
ATOM   2160 C CB    . LEU A 1 282 ? -41.371 51.329  23.068  1.00 31.61 ? 281 LEU A CB    1 
ATOM   2161 C CG    . LEU A 1 282 ? -39.861 51.683  23.096  1.00 31.03 ? 281 LEU A CG    1 
ATOM   2162 C CD1   . LEU A 1 282 ? -39.152 51.135  21.810  1.00 30.17 ? 281 LEU A CD1   1 
ATOM   2163 C CD2   . LEU A 1 282 ? -39.558 53.218  23.315  1.00 28.66 ? 281 LEU A CD2   1 
ATOM   2164 N N     . SER A 1 283 ? -41.859 49.025  25.288  1.00 33.33 ? 282 SER A N     1 
ATOM   2165 C CA    . SER A 1 283 ? -41.370 48.181  26.378  1.00 35.99 ? 282 SER A CA    1 
ATOM   2166 C C     . SER A 1 283 ? -41.239 46.714  25.985  1.00 37.52 ? 282 SER A C     1 
ATOM   2167 O O     . SER A 1 283 ? -40.190 46.056  26.196  1.00 37.86 ? 282 SER A O     1 
ATOM   2168 C CB    . SER A 1 283 ? -42.268 48.311  27.595  1.00 35.89 ? 282 SER A CB    1 
ATOM   2169 O OG    . SER A 1 283 ? -41.661 47.581  28.620  1.00 38.90 ? 282 SER A OG    1 
ATOM   2170 N N     . LYS A 1 284 ? -42.318 46.198  25.390  1.00 39.63 ? 283 LYS A N     1 
ATOM   2171 C CA    . LYS A 1 284 ? -42.391 44.822  24.923  1.00 40.81 ? 283 LYS A CA    1 
ATOM   2172 C C     . LYS A 1 284 ? -41.266 44.615  23.913  1.00 39.65 ? 283 LYS A C     1 
ATOM   2173 O O     . LYS A 1 284 ? -40.399 43.735  24.093  1.00 40.09 ? 283 LYS A O     1 
ATOM   2174 C CB    . LYS A 1 284 ? -43.793 44.596  24.340  1.00 41.42 ? 283 LYS A CB    1 
ATOM   2175 C CG    . LYS A 1 284 ? -44.203 43.142  24.050  1.00 44.66 ? 283 LYS A CG    1 
ATOM   2176 C CD    . LYS A 1 284 ? -45.700 43.123  23.555  1.00 45.40 ? 283 LYS A CD    1 
ATOM   2177 C CE    . LYS A 1 284 ? -46.278 41.693  23.169  1.00 44.73 ? 283 LYS A CE    1 
ATOM   2178 N NZ    . LYS A 1 284 ? -45.443 41.309  22.004  1.00 46.43 ? 283 LYS A NZ    1 
ATOM   2179 N N     . PHE A 1 285 ? -41.206 45.465  22.888  1.00 38.68 ? 284 PHE A N     1 
ATOM   2180 C CA    . PHE A 1 285 ? -40.063 45.382  21.970  1.00 38.55 ? 284 PHE A CA    1 
ATOM   2181 C C     . PHE A 1 285 ? -38.677 45.370  22.666  1.00 40.39 ? 284 PHE A C     1 
ATOM   2182 O O     . PHE A 1 285 ? -37.794 44.531  22.326  1.00 41.62 ? 284 PHE A O     1 
ATOM   2183 C CB    . PHE A 1 285 ? -40.112 46.497  20.944  1.00 38.09 ? 284 PHE A CB    1 
ATOM   2184 C CG    . PHE A 1 285 ? -38.958 46.474  19.988  1.00 36.00 ? 284 PHE A CG    1 
ATOM   2185 C CD1   . PHE A 1 285 ? -39.011 45.709  18.821  1.00 35.58 ? 284 PHE A CD1   1 
ATOM   2186 C CD2   . PHE A 1 285 ? -37.795 47.176  20.264  1.00 33.45 ? 284 PHE A CD2   1 
ATOM   2187 C CE1   . PHE A 1 285 ? -37.903 45.621  17.952  1.00 35.05 ? 284 PHE A CE1   1 
ATOM   2188 C CE2   . PHE A 1 285 ? -36.695 47.110  19.382  1.00 35.65 ? 284 PHE A CE2   1 
ATOM   2189 C CZ    . PHE A 1 285 ? -36.762 46.342  18.219  1.00 35.71 ? 284 PHE A CZ    1 
ATOM   2190 N N     . VAL A 1 286 ? -38.451 46.276  23.623  1.00 39.32 ? 285 VAL A N     1 
ATOM   2191 C CA    . VAL A 1 286 ? -37.148 46.261  24.223  1.00 39.90 ? 285 VAL A CA    1 
ATOM   2192 C C     . VAL A 1 286 ? -36.869 44.974  24.877  1.00 40.80 ? 285 VAL A C     1 
ATOM   2193 O O     . VAL A 1 286 ? -35.788 44.506  24.706  1.00 41.87 ? 285 VAL A O     1 
ATOM   2194 C CB    . VAL A 1 286 ? -36.814 47.461  25.180  1.00 39.51 ? 285 VAL A CB    1 
ATOM   2195 C CG1   . VAL A 1 286 ? -35.457 47.240  25.889  1.00 36.18 ? 285 VAL A CG1   1 
ATOM   2196 C CG2   . VAL A 1 286 ? -36.753 48.721  24.364  1.00 38.89 ? 285 VAL A CG2   1 
ATOM   2197 N N     . GLU A 1 287 ? -37.808 44.429  25.651  1.00 43.22 ? 286 GLU A N     1 
ATOM   2198 C CA    . GLU A 1 287 ? -37.633 43.165  26.417  1.00 45.78 ? 286 GLU A CA    1 
ATOM   2199 C C     . GLU A 1 287 ? -37.221 41.998  25.495  1.00 46.05 ? 286 GLU A C     1 
ATOM   2200 O O     . GLU A 1 287 ? -36.240 41.268  25.755  1.00 44.02 ? 286 GLU A O     1 
ATOM   2201 C CB    . GLU A 1 287 ? -38.975 42.798  27.033  1.00 45.83 ? 286 GLU A CB    1 
ATOM   2202 C CG    . GLU A 1 287 ? -38.982 42.057  28.375  1.00 48.64 ? 286 GLU A CG    1 
ATOM   2203 C CD    . GLU A 1 287 ? -40.436 42.000  28.906  1.00 51.12 ? 286 GLU A CD    1 
ATOM   2204 O OE1   . GLU A 1 287 ? -40.946 40.891  29.114  1.00 59.01 ? 286 GLU A OE1   1 
ATOM   2205 O OE2   . GLU A 1 287 ? -41.116 43.058  29.056  1.00 55.94 ? 286 GLU A OE2   1 
ATOM   2206 N N     . GLU A 1 288 ? -37.977 41.856  24.405  1.00 46.60 ? 287 GLU A N     1 
ATOM   2207 C CA    . GLU A 1 288 ? -37.736 40.791  23.458  1.00 50.18 ? 287 GLU A CA    1 
ATOM   2208 C C     . GLU A 1 288 ? -36.401 40.960  22.699  1.00 49.60 ? 287 GLU A C     1 
ATOM   2209 O O     . GLU A 1 288 ? -35.942 40.030  22.068  1.00 50.54 ? 287 GLU A O     1 
ATOM   2210 C CB    . GLU A 1 288 ? -38.909 40.633  22.487  1.00 48.15 ? 287 GLU A CB    1 
ATOM   2211 C CG    . GLU A 1 288 ? -38.557 41.084  21.077  1.00 54.49 ? 287 GLU A CG    1 
ATOM   2212 C CD    . GLU A 1 288 ? -39.777 41.564  20.203  1.00 57.08 ? 287 GLU A CD    1 
ATOM   2213 O OE1   . GLU A 1 288 ? -39.473 41.830  18.977  1.00 62.15 ? 287 GLU A OE1   1 
ATOM   2214 O OE2   . GLU A 1 288 ? -40.981 41.664  20.717  1.00 58.75 ? 287 GLU A OE2   1 
ATOM   2215 N N     . GLN A 1 289 ? -35.757 42.118  22.756  1.00 50.20 ? 288 GLN A N     1 
ATOM   2216 C CA    . GLN A 1 289 ? -34.444 42.250  22.092  1.00 50.89 ? 288 GLN A CA    1 
ATOM   2217 C C     . GLN A 1 289 ? -33.309 41.556  22.865  1.00 51.78 ? 288 GLN A C     1 
ATOM   2218 O O     . GLN A 1 289 ? -32.270 41.279  22.307  1.00 50.72 ? 288 GLN A O     1 
ATOM   2219 C CB    . GLN A 1 289 ? -34.103 43.710  21.798  1.00 49.96 ? 288 GLN A CB    1 
ATOM   2220 C CG    . GLN A 1 289 ? -34.977 44.329  20.760  1.00 50.53 ? 288 GLN A CG    1 
ATOM   2221 C CD    . GLN A 1 289 ? -34.805 43.721  19.396  1.00 51.51 ? 288 GLN A CD    1 
ATOM   2222 O OE1   . GLN A 1 289 ? -33.733 43.781  18.787  1.00 51.76 ? 288 GLN A OE1   1 
ATOM   2223 N NE2   . GLN A 1 289 ? -35.880 43.149  18.887  1.00 56.77 ? 288 GLN A NE2   1 
ATOM   2224 N N     . ASN A 1 290 ? -33.550 41.296  24.152  1.00 54.27 ? 289 ASN A N     1 
ATOM   2225 C CA    . ASN A 1 290 ? -32.625 40.620  25.068  1.00 56.99 ? 289 ASN A CA    1 
ATOM   2226 C C     . ASN A 1 290 ? -31.241 41.202  25.180  1.00 57.11 ? 289 ASN A C     1 
ATOM   2227 O O     . ASN A 1 290 ? -30.235 40.483  25.091  1.00 57.47 ? 289 ASN A O     1 
ATOM   2228 C CB    . ASN A 1 290 ? -32.482 39.123  24.742  1.00 58.30 ? 289 ASN A CB    1 
ATOM   2229 C CG    . ASN A 1 290 ? -32.097 38.294  25.977  1.00 62.60 ? 289 ASN A CG    1 
ATOM   2230 O OD1   . ASN A 1 290 ? -31.669 37.153  25.848  1.00 67.13 ? 289 ASN A OD1   1 
ATOM   2231 N ND2   . ASN A 1 290 ? -32.270 38.874  27.187  1.00 68.04 ? 289 ASN A ND2   1 
ATOM   2232 N N     . LEU A 1 291 ? -31.183 42.500  25.382  1.00 57.59 ? 290 LEU A N     1 
ATOM   2233 C CA    . LEU A 1 291 ? -29.911 43.175  25.453  1.00 58.04 ? 290 LEU A CA    1 
ATOM   2234 C C     . LEU A 1 291 ? -29.403 43.117  26.873  1.00 58.83 ? 290 LEU A C     1 
ATOM   2235 O O     . LEU A 1 291 ? -30.112 43.505  27.786  1.00 59.04 ? 290 LEU A O     1 
ATOM   2236 C CB    . LEU A 1 291 ? -30.084 44.613  25.001  1.00 57.29 ? 290 LEU A CB    1 
ATOM   2237 C CG    . LEU A 1 291 ? -30.491 44.663  23.536  1.00 56.20 ? 290 LEU A CG    1 
ATOM   2238 C CD1   . LEU A 1 291 ? -31.015 46.022  23.284  1.00 57.33 ? 290 LEU A CD1   1 
ATOM   2239 C CD2   . LEU A 1 291 ? -29.339 44.333  22.596  1.00 53.82 ? 290 LEU A CD2   1 
ATOM   2240 N N     . LYS A 1 292 ? -28.178 42.618  27.057  1.00 59.76 ? 291 LYS A N     1 
ATOM   2241 C CA    . LYS A 1 292 ? -27.583 42.504  28.414  1.00 60.77 ? 291 LYS A CA    1 
ATOM   2242 C C     . LYS A 1 292 ? -27.562 43.863  29.180  1.00 59.53 ? 291 LYS A C     1 
ATOM   2243 O O     . LYS A 1 292 ? -27.886 43.870  30.384  1.00 60.05 ? 291 LYS A O     1 
ATOM   2244 C CB    . LYS A 1 292 ? -26.190 41.810  28.410  1.00 61.03 ? 291 LYS A CB    1 
ATOM   2245 C CG    . LYS A 1 292 ? -25.082 42.589  27.617  1.00 65.04 ? 291 LYS A CG    1 
ATOM   2246 C CD    . LYS A 1 292 ? -25.576 43.187  26.237  1.00 68.06 ? 291 LYS A CD    1 
ATOM   2247 C CE    . LYS A 1 292 ? -25.676 42.131  25.070  1.00 69.48 ? 291 LYS A CE    1 
ATOM   2248 N NZ    . LYS A 1 292 ? -26.183 42.708  23.773  1.00 65.23 ? 291 LYS A NZ    1 
ATOM   2249 N N     . ASP A 1 293 ? -27.191 44.970  28.489  1.00 56.91 ? 292 ASP A N     1 
ATOM   2250 C CA    . ASP A 1 293 ? -27.306 46.330  29.029  1.00 53.65 ? 292 ASP A CA    1 
ATOM   2251 C C     . ASP A 1 293 ? -27.890 47.126  27.956  1.00 51.56 ? 292 ASP A C     1 
ATOM   2252 O O     . ASP A 1 293 ? -27.905 46.658  26.809  1.00 53.59 ? 292 ASP A O     1 
ATOM   2253 C CB    . ASP A 1 293 ? -25.962 46.932  29.293  1.00 54.48 ? 292 ASP A CB    1 
ATOM   2254 C CG    . ASP A 1 293 ? -25.363 46.418  30.542  1.00 55.96 ? 292 ASP A CG    1 
ATOM   2255 O OD1   . ASP A 1 293 ? -25.925 46.737  31.592  1.00 56.35 ? 292 ASP A OD1   1 
ATOM   2256 O OD2   . ASP A 1 293 ? -24.364 45.665  30.473  1.00 58.17 ? 292 ASP A OD2   1 
ATOM   2257 N N     . LEU A 1 294 ? -28.355 48.330  28.283  1.00 46.42 ? 293 LEU A N     1 
ATOM   2258 C CA    . LEU A 1 294 ? -28.963 49.204  27.291  1.00 42.79 ? 293 LEU A CA    1 
ATOM   2259 C C     . LEU A 1 294 ? -29.036 50.591  27.883  1.00 41.22 ? 293 LEU A C     1 
ATOM   2260 O O     . LEU A 1 294 ? -29.674 50.763  28.902  1.00 39.74 ? 293 LEU A O     1 
ATOM   2261 C CB    . LEU A 1 294 ? -30.368 48.723  26.844  1.00 41.46 ? 293 LEU A CB    1 
ATOM   2262 C CG    . LEU A 1 294 ? -31.110 49.697  25.886  1.00 42.48 ? 293 LEU A CG    1 
ATOM   2263 C CD1   . LEU A 1 294 ? -30.511 49.751  24.502  1.00 37.72 ? 293 LEU A CD1   1 
ATOM   2264 C CD2   . LEU A 1 294 ? -32.592 49.496  25.772  1.00 40.79 ? 293 LEU A CD2   1 
ATOM   2265 N N     . ARG A 1 295 ? -28.391 51.586  27.276  1.00 39.11 ? 294 ARG A N     1 
ATOM   2266 C CA    . ARG A 1 295 ? -28.636 52.924  27.758  1.00 37.87 ? 294 ARG A CA    1 
ATOM   2267 C C     . ARG A 1 295 ? -29.840 53.460  27.056  1.00 35.53 ? 294 ARG A C     1 
ATOM   2268 O O     . ARG A 1 295 ? -30.056 53.140  25.909  1.00 37.25 ? 294 ARG A O     1 
ATOM   2269 C CB    . ARG A 1 295 ? -27.452 53.804  27.478  1.00 38.99 ? 294 ARG A CB    1 
ATOM   2270 C CG    . ARG A 1 295 ? -26.212 53.364  28.227  1.00 46.09 ? 294 ARG A CG    1 
ATOM   2271 C CD    . ARG A 1 295 ? -26.395 53.112  29.755  1.00 55.81 ? 294 ARG A CD    1 
ATOM   2272 N NE    . ARG A 1 295 ? -25.090 52.769  30.365  1.00 65.87 ? 294 ARG A NE    1 
ATOM   2273 C CZ    . ARG A 1 295 ? -23.991 53.567  30.377  1.00 69.96 ? 294 ARG A CZ    1 
ATOM   2274 N NH1   . ARG A 1 295 ? -24.007 54.803  29.834  1.00 69.01 ? 294 ARG A NH1   1 
ATOM   2275 N NH2   . ARG A 1 295 ? -22.851 53.135  30.947  1.00 69.03 ? 294 ARG A NH2   1 
ATOM   2276 N N     . VAL A 1 296 ? -30.625 54.276  27.733  1.00 33.44 ? 295 VAL A N     1 
ATOM   2277 C CA    . VAL A 1 296 ? -31.742 54.970  27.167  1.00 30.26 ? 295 VAL A CA    1 
ATOM   2278 C C     . VAL A 1 296 ? -31.526 56.471  27.309  1.00 30.99 ? 295 VAL A C     1 
ATOM   2279 O O     . VAL A 1 296 ? -31.272 56.986  28.423  1.00 30.61 ? 295 VAL A O     1 
ATOM   2280 C CB    . VAL A 1 296 ? -33.033 54.570  27.899  1.00 30.66 ? 295 VAL A CB    1 
ATOM   2281 C CG1   . VAL A 1 296 ? -34.297 55.239  27.244  1.00 24.18 ? 295 VAL A CG1   1 
ATOM   2282 C CG2   . VAL A 1 296 ? -33.186 53.013  27.914  1.00 30.17 ? 295 VAL A CG2   1 
ATOM   2283 N N     . TRP A 1 297 ? -31.661 57.197  26.197  1.00 30.38 ? 296 TRP A N     1 
ATOM   2284 C CA    . TRP A 1 297 ? -31.558 58.644  26.223  1.00 28.71 ? 296 TRP A CA    1 
ATOM   2285 C C     . TRP A 1 297 ? -32.865 59.271  25.753  1.00 28.85 ? 296 TRP A C     1 
ATOM   2286 O O     . TRP A 1 297 ? -33.510 58.754  24.865  1.00 27.65 ? 296 TRP A O     1 
ATOM   2287 C CB    . TRP A 1 297 ? -30.427 59.118  25.317  1.00 28.05 ? 296 TRP A CB    1 
ATOM   2288 C CG    . TRP A 1 297 ? -29.109 58.641  25.709  1.00 27.24 ? 296 TRP A CG    1 
ATOM   2289 C CD1   . TRP A 1 297 ? -28.789 57.968  26.850  1.00 27.65 ? 296 TRP A CD1   1 
ATOM   2290 C CD2   . TRP A 1 297 ? -27.890 58.783  24.975  1.00 27.40 ? 296 TRP A CD2   1 
ATOM   2291 N NE1   . TRP A 1 297 ? -27.455 57.610  26.846  1.00 27.33 ? 296 TRP A NE1   1 
ATOM   2292 C CE2   . TRP A 1 297 ? -26.867 58.117  25.725  1.00 25.20 ? 296 TRP A CE2   1 
ATOM   2293 C CE3   . TRP A 1 297 ? -27.563 59.358  23.724  1.00 26.16 ? 296 TRP A CE3   1 
ATOM   2294 C CZ2   . TRP A 1 297 ? -25.531 58.020  25.283  1.00 28.40 ? 296 TRP A CZ2   1 
ATOM   2295 C CZ3   . TRP A 1 297 ? -26.225 59.278  23.270  1.00 26.14 ? 296 TRP A CZ3   1 
ATOM   2296 C CH2   . TRP A 1 297 ? -25.228 58.587  24.038  1.00 29.18 ? 296 TRP A CH2   1 
ATOM   2297 N N     . THR A 1 298 ? -33.252 60.392  26.350  1.00 27.91 ? 297 THR A N     1 
ATOM   2298 C CA    . THR A 1 298 ? -34.382 61.095  25.850  1.00 27.70 ? 297 THR A CA    1 
ATOM   2299 C C     . THR A 1 298 ? -34.010 62.598  25.671  1.00 28.34 ? 297 THR A C     1 
ATOM   2300 O O     . THR A 1 298 ? -32.875 63.033  25.995  1.00 28.26 ? 297 THR A O     1 
ATOM   2301 C CB    . THR A 1 298 ? -35.506 61.068  26.868  1.00 27.84 ? 297 THR A CB    1 
ATOM   2302 O OG1   . THR A 1 298 ? -35.060 61.781  28.020  1.00 29.32 ? 297 THR A OG1   1 
ATOM   2303 C CG2   . THR A 1 298 ? -35.922 59.641  27.275  1.00 28.20 ? 297 THR A CG2   1 
ATOM   2304 N N     . SER A 1 299 ? -34.978 63.374  25.196  1.00 26.85 ? 298 SER A N     1 
ATOM   2305 C CA    . SER A 1 299 ? -34.851 64.793  25.226  1.00 28.70 ? 298 SER A CA    1 
ATOM   2306 C C     . SER A 1 299 ? -35.288 65.287  26.607  1.00 28.42 ? 298 SER A C     1 
ATOM   2307 O O     . SER A 1 299 ? -35.418 64.505  27.535  1.00 27.78 ? 298 SER A O     1 
ATOM   2308 C CB    . SER A 1 299 ? -35.712 65.453  24.113  1.00 28.34 ? 298 SER A CB    1 
ATOM   2309 O OG    . SER A 1 299 ? -37.105 65.351  24.382  1.00 27.78 ? 298 SER A OG    1 
ATOM   2310 N N     . GLN A 1 300 ? -35.513 66.586  26.725  1.00 28.84 ? 299 GLN A N     1 
ATOM   2311 C CA    . GLN A 1 300 ? -36.108 67.158  27.933  1.00 29.72 ? 299 GLN A CA    1 
ATOM   2312 C C     . GLN A 1 300 ? -37.562 67.524  27.669  1.00 29.79 ? 299 GLN A C     1 
ATOM   2313 O O     . GLN A 1 300 ? -38.211 68.152  28.514  1.00 30.62 ? 299 GLN A O     1 
ATOM   2314 C CB    . GLN A 1 300 ? -35.306 68.387  28.400  1.00 27.90 ? 299 GLN A CB    1 
ATOM   2315 C CG    . GLN A 1 300 ? -33.926 67.966  28.894  1.00 28.92 ? 299 GLN A CG    1 
ATOM   2316 C CD    . GLN A 1 300 ? -33.024 69.128  29.432  1.00 31.31 ? 299 GLN A CD    1 
ATOM   2317 O OE1   . GLN A 1 300 ? -33.259 70.314  29.192  1.00 31.03 ? 299 GLN A OE1   1 
ATOM   2318 N NE2   . GLN A 1 300 ? -31.994 68.756  30.122  1.00 30.59 ? 299 GLN A NE2   1 
ATOM   2319 N N     . LEU A 1 301 ? -38.082 67.133  26.511  1.00 29.66 ? 300 LEU A N     1 
ATOM   2320 C CA    . LEU A 1 301 ? -39.484 67.362  26.231  1.00 30.52 ? 300 LEU A CA    1 
ATOM   2321 C C     . LEU A 1 301 ? -40.304 66.244  26.804  1.00 31.63 ? 300 LEU A C     1 
ATOM   2322 O O     . LEU A 1 301 ? -39.819 65.090  26.836  1.00 33.72 ? 300 LEU A O     1 
ATOM   2323 C CB    . LEU A 1 301 ? -39.700 67.560  24.757  1.00 29.76 ? 300 LEU A CB    1 
ATOM   2324 C CG    . LEU A 1 301 ? -38.991 68.862  24.292  1.00 30.09 ? 300 LEU A CG    1 
ATOM   2325 C CD1   . LEU A 1 301 ? -39.154 69.019  22.794  1.00 28.44 ? 300 LEU A CD1   1 
ATOM   2326 C CD2   . LEU A 1 301 ? -39.497 70.194  25.045  1.00 21.78 ? 300 LEU A CD2   1 
ATOM   2327 N N     . LYS A 1 302 ? -41.489 66.566  27.349  1.00 31.51 ? 301 LYS A N     1 
ATOM   2328 C CA    . LYS A 1 302 ? -42.277 65.562  28.121  1.00 32.26 ? 301 LYS A CA    1 
ATOM   2329 C C     . LYS A 1 302 ? -42.558 64.224  27.428  1.00 31.66 ? 301 LYS A C     1 
ATOM   2330 O O     . LYS A 1 302 ? -42.526 63.129  28.045  1.00 30.70 ? 301 LYS A O     1 
ATOM   2331 C CB    . LYS A 1 302 ? -43.603 66.170  28.502  1.00 33.33 ? 301 LYS A CB    1 
ATOM   2332 C CG    . LYS A 1 302 ? -44.459 65.367  29.452  1.00 34.19 ? 301 LYS A CG    1 
ATOM   2333 C CD    . LYS A 1 302 ? -45.763 66.206  29.703  1.00 37.90 ? 301 LYS A CD    1 
ATOM   2334 C CE    . LYS A 1 302 ? -46.562 65.747  30.927  1.00 39.20 ? 301 LYS A CE    1 
ATOM   2335 N NZ    . LYS A 1 302 ? -47.862 66.493  30.880  1.00 42.08 ? 301 LYS A NZ    1 
ATOM   2336 N N     . SER A 1 303 ? -42.816 64.323  26.133  1.00 31.30 ? 302 SER A N     1 
ATOM   2337 C CA    . SER A 1 303 ? -43.325 63.181  25.395  1.00 31.64 ? 302 SER A CA    1 
ATOM   2338 C C     . SER A 1 303 ? -42.251 62.152  25.175  1.00 31.58 ? 302 SER A C     1 
ATOM   2339 O O     . SER A 1 303 ? -42.542 60.946  25.174  1.00 31.74 ? 302 SER A O     1 
ATOM   2340 C CB    . SER A 1 303 ? -44.008 63.607  24.100  1.00 31.41 ? 302 SER A CB    1 
ATOM   2341 O OG    . SER A 1 303 ? -43.034 63.976  23.169  1.00 33.13 ? 302 SER A OG    1 
ATOM   2342 N N     . THR A 1 304 ? -40.989 62.571  25.104  1.00 32.28 ? 303 THR A N     1 
ATOM   2343 C CA    . THR A 1 304 ? -39.938 61.527  25.059  1.00 32.50 ? 303 THR A CA    1 
ATOM   2344 C C     . THR A 1 304 ? -39.744 60.905  26.450  1.00 32.92 ? 303 THR A C     1 
ATOM   2345 O O     . THR A 1 304 ? -39.397 59.721  26.561  1.00 32.92 ? 303 THR A O     1 
ATOM   2346 C CB    . THR A 1 304 ? -38.569 61.991  24.520  1.00 32.59 ? 303 THR A CB    1 
ATOM   2347 O OG1   . THR A 1 304 ? -37.950 62.848  25.487  1.00 32.18 ? 303 THR A OG1   1 
ATOM   2348 C CG2   . THR A 1 304 ? -38.709 62.687  23.184  1.00 30.92 ? 303 THR A CG2   1 
ATOM   2349 N N     . ILE A 1 305 ? -39.944 61.692  27.512  1.00 31.98 ? 304 ILE A N     1 
ATOM   2350 C CA    . ILE A 1 305 ? -39.679 61.186  28.869  1.00 30.16 ? 304 ILE A CA    1 
ATOM   2351 C C     . ILE A 1 305 ? -40.798 60.246  29.259  1.00 30.58 ? 304 ILE A C     1 
ATOM   2352 O O     . ILE A 1 305 ? -40.542 59.159  29.790  1.00 31.33 ? 304 ILE A O     1 
ATOM   2353 C CB    . ILE A 1 305 ? -39.507 62.390  29.888  1.00 31.49 ? 304 ILE A CB    1 
ATOM   2354 C CG1   . ILE A 1 305 ? -38.263 63.240  29.513  1.00 32.49 ? 304 ILE A CG1   1 
ATOM   2355 C CG2   . ILE A 1 305 ? -39.400 61.964  31.346  1.00 27.02 ? 304 ILE A CG2   1 
ATOM   2356 C CD1   . ILE A 1 305 ? -38.350 64.680  30.012  1.00 30.97 ? 304 ILE A CD1   1 
ATOM   2357 N N     . GLN A 1 306 ? -42.056 60.650  29.029  1.00 29.56 ? 305 GLN A N     1 
ATOM   2358 C CA    . GLN A 1 306 ? -43.170 59.720  29.284  1.00 27.93 ? 305 GLN A CA    1 
ATOM   2359 C C     . GLN A 1 306 ? -42.987 58.403  28.565  1.00 27.27 ? 305 GLN A C     1 
ATOM   2360 O O     . GLN A 1 306 ? -43.304 57.363  29.144  1.00 26.62 ? 305 GLN A O     1 
ATOM   2361 C CB    . GLN A 1 306 ? -44.509 60.266  28.862  1.00 27.02 ? 305 GLN A CB    1 
ATOM   2362 C CG    . GLN A 1 306 ? -45.080 61.359  29.722  1.00 29.18 ? 305 GLN A CG    1 
ATOM   2363 C CD    . GLN A 1 306 ? -46.333 61.966  29.043  1.00 30.52 ? 305 GLN A CD    1 
ATOM   2364 O OE1   . GLN A 1 306 ? -46.246 62.705  28.075  1.00 33.23 ? 305 GLN A OE1   1 
ATOM   2365 N NE2   . GLN A 1 306 ? -47.481 61.590  29.522  1.00 29.13 ? 305 GLN A NE2   1 
ATOM   2366 N N     . THR A 1 307 ? -42.517 58.448  27.307  1.00 25.97 ? 306 THR A N     1 
ATOM   2367 C CA    . THR A 1 307 ? -42.247 57.246  26.562  1.00 25.13 ? 306 THR A CA    1 
ATOM   2368 C C     . THR A 1 307 ? -41.192 56.429  27.303  1.00 26.39 ? 306 THR A C     1 
ATOM   2369 O O     . THR A 1 307 ? -41.381 55.233  27.538  1.00 27.64 ? 306 THR A O     1 
ATOM   2370 C CB    . THR A 1 307 ? -41.803 57.616  25.144  1.00 26.27 ? 306 THR A CB    1 
ATOM   2371 O OG1   . THR A 1 307 ? -42.821 58.427  24.558  1.00 25.87 ? 306 THR A OG1   1 
ATOM   2372 C CG2   . THR A 1 307 ? -41.551 56.415  24.282  1.00 24.32 ? 306 THR A CG2   1 
ATOM   2373 N N     . ALA A 1 308 ? -40.093 57.039  27.738  1.00 27.22 ? 307 ALA A N     1 
ATOM   2374 C CA    . ALA A 1 308 ? -39.061 56.260  28.452  1.00 28.24 ? 307 ALA A CA    1 
ATOM   2375 C C     . ALA A 1 308 ? -39.559 55.651  29.765  1.00 29.60 ? 307 ALA A C     1 
ATOM   2376 O O     . ALA A 1 308 ? -39.036 54.622  30.237  1.00 29.59 ? 307 ALA A O     1 
ATOM   2377 C CB    . ALA A 1 308 ? -37.867 57.109  28.737  1.00 27.59 ? 307 ALA A CB    1 
ATOM   2378 N N     . GLU A 1 309 ? -40.519 56.320  30.396  1.00 30.28 ? 308 GLU A N     1 
ATOM   2379 C CA    . GLU A 1 309 ? -41.021 55.873  31.704  1.00 31.05 ? 308 GLU A CA    1 
ATOM   2380 C C     . GLU A 1 309 ? -41.679 54.487  31.505  1.00 32.15 ? 308 GLU A C     1 
ATOM   2381 O O     . GLU A 1 309 ? -41.461 53.566  32.287  1.00 31.78 ? 308 GLU A O     1 
ATOM   2382 C CB    . GLU A 1 309 ? -42.046 56.882  32.238  1.00 29.85 ? 308 GLU A CB    1 
ATOM   2383 C CG    . GLU A 1 309 ? -41.482 58.068  32.971  1.00 30.21 ? 308 GLU A CG    1 
ATOM   2384 C CD    . GLU A 1 309 ? -40.805 57.683  34.271  1.00 34.34 ? 308 GLU A CD    1 
ATOM   2385 O OE1   . GLU A 1 309 ? -41.386 56.855  35.008  1.00 41.41 ? 308 GLU A OE1   1 
ATOM   2386 O OE2   . GLU A 1 309 ? -39.689 58.159  34.583  1.00 34.79 ? 308 GLU A OE2   1 
ATOM   2387 N N     . ALA A 1 310 ? -42.441 54.337  30.419  1.00 33.42 ? 309 ALA A N     1 
ATOM   2388 C CA    . ALA A 1 310 ? -43.021 53.018  30.054  1.00 35.40 ? 309 ALA A CA    1 
ATOM   2389 C C     . ALA A 1 310 ? -42.003 51.875  30.106  1.00 36.76 ? 309 ALA A C     1 
ATOM   2390 O O     . ALA A 1 310 ? -42.397 50.757  30.270  1.00 38.29 ? 309 ALA A O     1 
ATOM   2391 C CB    . ALA A 1 310 ? -43.664 53.073  28.676  1.00 33.54 ? 309 ALA A CB    1 
ATOM   2392 N N     . LEU A 1 311 ? -40.697 52.131  29.961  1.00 38.26 ? 310 LEU A N     1 
ATOM   2393 C CA    . LEU A 1 311 ? -39.693 51.024  29.866  1.00 39.24 ? 310 LEU A CA    1 
ATOM   2394 C C     . LEU A 1 311 ? -39.184 50.463  31.186  1.00 39.94 ? 310 LEU A C     1 
ATOM   2395 O O     . LEU A 1 311 ? -38.590 49.372  31.217  1.00 39.28 ? 310 LEU A O     1 
ATOM   2396 C CB    . LEU A 1 311 ? -38.473 51.456  29.071  1.00 39.06 ? 310 LEU A CB    1 
ATOM   2397 C CG    . LEU A 1 311 ? -38.717 52.281  27.802  1.00 39.69 ? 310 LEU A CG    1 
ATOM   2398 C CD1   . LEU A 1 311 ? -37.403 52.627  27.190  1.00 38.00 ? 310 LEU A CD1   1 
ATOM   2399 C CD2   . LEU A 1 311 ? -39.618 51.560  26.786  1.00 37.77 ? 310 LEU A CD2   1 
ATOM   2400 N N     . ARG A 1 312 ? -39.415 51.224  32.258  1.00 41.00 ? 311 ARG A N     1 
ATOM   2401 C CA    . ARG A 1 312 ? -38.845 50.958  33.605  1.00 42.35 ? 311 ARG A CA    1 
ATOM   2402 C C     . ARG A 1 312 ? -37.335 50.699  33.589  1.00 41.94 ? 311 ARG A C     1 
ATOM   2403 O O     . ARG A 1 312 ? -36.866 49.679  34.096  1.00 42.93 ? 311 ARG A O     1 
ATOM   2404 C CB    . ARG A 1 312 ? -39.596 49.847  34.382  1.00 42.51 ? 311 ARG A CB    1 
ATOM   2405 C CG    . ARG A 1 312 ? -41.083 50.167  34.739  1.00 45.19 ? 311 ARG A CG    1 
ATOM   2406 C CD    . ARG A 1 312 ? -41.989 49.270  33.831  1.00 54.31 ? 311 ARG A CD    1 
ATOM   2407 N NE    . ARG A 1 312 ? -41.271 47.996  33.506  1.00 61.00 ? 311 ARG A NE    1 
ATOM   2408 C CZ    . ARG A 1 312 ? -41.522 47.147  32.487  1.00 59.61 ? 311 ARG A CZ    1 
ATOM   2409 N NH1   . ARG A 1 312 ? -42.520 47.342  31.619  1.00 57.40 ? 311 ARG A NH1   1 
ATOM   2410 N NH2   . ARG A 1 312 ? -40.752 46.073  32.350  1.00 57.54 ? 311 ARG A NH2   1 
ATOM   2411 N N     . LEU A 1 313 ? -36.591 51.591  32.946  1.00 40.56 ? 312 LEU A N     1 
ATOM   2412 C CA    . LEU A 1 313 ? -35.137 51.504  32.925  1.00 39.89 ? 312 LEU A CA    1 
ATOM   2413 C C     . LEU A 1 313 ? -34.537 52.881  33.238  1.00 38.62 ? 312 LEU A C     1 
ATOM   2414 O O     . LEU A 1 313 ? -35.136 53.939  32.904  1.00 37.96 ? 312 LEU A O     1 
ATOM   2415 C CB    . LEU A 1 313 ? -34.644 51.014  31.553  1.00 39.85 ? 312 LEU A CB    1 
ATOM   2416 C CG    . LEU A 1 313 ? -34.997 49.586  31.073  1.00 44.29 ? 312 LEU A CG    1 
ATOM   2417 C CD1   . LEU A 1 313 ? -34.727 49.426  29.570  1.00 42.71 ? 312 LEU A CD1   1 
ATOM   2418 C CD2   . LEU A 1 313 ? -34.327 48.391  31.889  1.00 43.12 ? 312 LEU A CD2   1 
ATOM   2419 N N     . PRO A 1 314 ? -33.329 52.894  33.813  1.00 37.11 ? 313 PRO A N     1 
ATOM   2420 C CA    . PRO A 1 314 ? -32.633 54.207  33.936  1.00 35.68 ? 313 PRO A CA    1 
ATOM   2421 C C     . PRO A 1 314 ? -32.549 54.897  32.538  1.00 34.06 ? 313 PRO A C     1 
ATOM   2422 O O     . PRO A 1 314 ? -32.283 54.230  31.524  1.00 34.04 ? 313 PRO A O     1 
ATOM   2423 C CB    . PRO A 1 314 ? -31.237 53.836  34.453  1.00 34.89 ? 313 PRO A CB    1 
ATOM   2424 C CG    . PRO A 1 314 ? -31.343 52.421  34.997  1.00 36.20 ? 313 PRO A CG    1 
ATOM   2425 C CD    . PRO A 1 314 ? -32.535 51.755  34.308  1.00 36.87 ? 313 PRO A CD    1 
ATOM   2426 N N     . TYR A 1 315 ? -32.872 56.178  32.465  1.00 31.91 ? 314 TYR A N     1 
ATOM   2427 C CA    . TYR A 1 315 ? -32.745 56.884  31.231  1.00 31.31 ? 314 TYR A CA    1 
ATOM   2428 C C     . TYR A 1 315 ? -32.125 58.236  31.527  1.00 32.79 ? 314 TYR A C     1 
ATOM   2429 O O     . TYR A 1 315 ? -32.283 58.786  32.612  1.00 32.87 ? 314 TYR A O     1 
ATOM   2430 C CB    . TYR A 1 315 ? -34.095 57.016  30.526  1.00 29.78 ? 314 TYR A CB    1 
ATOM   2431 C CG    . TYR A 1 315 ? -35.159 57.764  31.324  1.00 29.03 ? 314 TYR A CG    1 
ATOM   2432 C CD1   . TYR A 1 315 ? -35.285 59.188  31.222  1.00 27.38 ? 314 TYR A CD1   1 
ATOM   2433 C CD2   . TYR A 1 315 ? -36.077 57.071  32.122  1.00 25.72 ? 314 TYR A CD2   1 
ATOM   2434 C CE1   . TYR A 1 315 ? -36.291 59.906  31.911  1.00 24.54 ? 314 TYR A CE1   1 
ATOM   2435 C CE2   . TYR A 1 315 ? -37.075 57.761  32.845  1.00 29.13 ? 314 TYR A CE2   1 
ATOM   2436 C CZ    . TYR A 1 315 ? -37.133 59.195  32.740  1.00 30.42 ? 314 TYR A CZ    1 
ATOM   2437 O OH    . TYR A 1 315 ? -38.063 59.870  33.417  1.00 31.30 ? 314 TYR A OH    1 
ATOM   2438 N N     . GLU A 1 316 ? -31.491 58.836  30.547  1.00 33.67 ? 315 GLU A N     1 
ATOM   2439 C CA    . GLU A 1 316 ? -30.839 60.096  30.790  1.00 36.21 ? 315 GLU A CA    1 
ATOM   2440 C C     . GLU A 1 316 ? -31.340 61.159  29.809  1.00 33.08 ? 315 GLU A C     1 
ATOM   2441 O O     . GLU A 1 316 ? -31.459 60.872  28.620  1.00 34.84 ? 315 GLU A O     1 
ATOM   2442 C CB    . GLU A 1 316 ? -29.360 59.791  30.753  1.00 35.89 ? 315 GLU A CB    1 
ATOM   2443 C CG    . GLU A 1 316 ? -28.353 60.925  30.563  1.00 45.00 ? 315 GLU A CG    1 
ATOM   2444 C CD    . GLU A 1 316 ? -26.866 60.360  30.434  1.00 45.82 ? 315 GLU A CD    1 
ATOM   2445 O OE1   . GLU A 1 316 ? -26.693 59.089  30.521  1.00 52.67 ? 315 GLU A OE1   1 
ATOM   2446 O OE2   . GLU A 1 316 ? -25.924 61.202  30.243  1.00 58.10 ? 315 GLU A OE2   1 
ATOM   2447 N N     . GLN A 1 317 ? -31.724 62.342  30.312  1.00 30.72 ? 316 GLN A N     1 
ATOM   2448 C CA    . GLN A 1 317 ? -32.303 63.380  29.511  1.00 29.46 ? 316 GLN A CA    1 
ATOM   2449 C C     . GLN A 1 317 ? -31.175 64.245  28.963  1.00 30.05 ? 316 GLN A C     1 
ATOM   2450 O O     . GLN A 1 317 ? -30.240 64.526  29.698  1.00 27.81 ? 316 GLN A O     1 
ATOM   2451 C CB    . GLN A 1 317 ? -33.185 64.262  30.342  1.00 29.52 ? 316 GLN A CB    1 
ATOM   2452 C CG    . GLN A 1 317 ? -34.272 63.594  31.104  1.00 32.92 ? 316 GLN A CG    1 
ATOM   2453 C CD    . GLN A 1 317 ? -35.333 64.585  31.597  1.00 35.29 ? 316 GLN A CD    1 
ATOM   2454 O OE1   . GLN A 1 317 ? -36.108 64.275  32.503  1.00 39.95 ? 316 GLN A OE1   1 
ATOM   2455 N NE2   . GLN A 1 317 ? -35.372 65.755  31.012  1.00 32.75 ? 316 GLN A NE2   1 
ATOM   2456 N N     . TRP A 1 318 ? -31.259 64.674  27.685  1.00 29.46 ? 317 TRP A N     1 
ATOM   2457 C CA    . TRP A 1 318 ? -30.237 65.549  27.041  1.00 27.89 ? 317 TRP A CA    1 
ATOM   2458 C C     . TRP A 1 318 ? -30.988 66.671  26.465  1.00 26.94 ? 317 TRP A C     1 
ATOM   2459 O O     . TRP A 1 318 ? -31.815 66.465  25.630  1.00 29.19 ? 317 TRP A O     1 
ATOM   2460 C CB    . TRP A 1 318 ? -29.582 64.906  25.796  1.00 27.16 ? 317 TRP A CB    1 
ATOM   2461 C CG    . TRP A 1 318 ? -28.730 63.717  26.021  1.00 27.81 ? 317 TRP A CG    1 
ATOM   2462 C CD1   . TRP A 1 318 ? -29.125 62.491  26.526  1.00 29.31 ? 317 TRP A CD1   1 
ATOM   2463 C CD2   . TRP A 1 318 ? -27.334 63.588  25.703  1.00 25.28 ? 317 TRP A CD2   1 
ATOM   2464 N NE1   . TRP A 1 318 ? -28.025 61.618  26.561  1.00 28.85 ? 317 TRP A NE1   1 
ATOM   2465 C CE2   . TRP A 1 318 ? -26.922 62.289  26.089  1.00 27.44 ? 317 TRP A CE2   1 
ATOM   2466 C CE3   . TRP A 1 318 ? -26.376 64.470  25.185  1.00 28.91 ? 317 TRP A CE3   1 
ATOM   2467 C CZ2   . TRP A 1 318 ? -25.607 61.831  25.897  1.00 28.53 ? 317 TRP A CZ2   1 
ATOM   2468 C CZ3   . TRP A 1 318 ? -25.034 64.038  25.050  1.00 27.46 ? 317 TRP A CZ3   1 
ATOM   2469 C CH2   . TRP A 1 318 ? -24.676 62.738  25.404  1.00 27.60 ? 317 TRP A CH2   1 
ATOM   2470 N N     . LYS A 1 319 ? -30.669 67.880  26.816  1.00 27.71 ? 318 LYS A N     1 
ATOM   2471 C CA    . LYS A 1 319 ? -31.223 69.029  26.136  1.00 27.06 ? 318 LYS A CA    1 
ATOM   2472 C C     . LYS A 1 319 ? -30.977 69.049  24.628  1.00 26.71 ? 318 LYS A C     1 
ATOM   2473 O O     . LYS A 1 319 ? -31.839 69.523  23.841  1.00 27.72 ? 318 LYS A O     1 
ATOM   2474 C CB    . LYS A 1 319 ? -30.683 70.324  26.744  1.00 26.87 ? 318 LYS A CB    1 
ATOM   2475 C CG    . LYS A 1 319 ? -31.686 71.408  26.474  1.00 30.02 ? 318 LYS A CG    1 
ATOM   2476 C CD    . LYS A 1 319 ? -31.105 72.772  26.590  1.00 32.65 ? 318 LYS A CD    1 
ATOM   2477 C CE    . LYS A 1 319 ? -32.215 73.764  26.937  1.00 28.38 ? 318 LYS A CE    1 
ATOM   2478 N NZ    . LYS A 1 319 ? -32.182 74.788  25.909  1.00 25.30 ? 318 LYS A NZ    1 
ATOM   2479 N N     . ALA A 1 320 ? -29.788 68.603  24.223  1.00 25.97 ? 319 ALA A N     1 
ATOM   2480 C CA    . ALA A 1 320 ? -29.400 68.585  22.817  1.00 25.03 ? 319 ALA A CA    1 
ATOM   2481 C C     . ALA A 1 320 ? -30.371 67.785  21.950  1.00 25.56 ? 319 ALA A C     1 
ATOM   2482 O O     . ALA A 1 320 ? -30.409 67.974  20.726  1.00 25.10 ? 319 ALA A O     1 
ATOM   2483 C CB    . ALA A 1 320 ? -27.969 68.008  22.645  1.00 24.05 ? 319 ALA A CB    1 
ATOM   2484 N N     . LEU A 1 321 ? -31.096 66.847  22.552  1.00 24.94 ? 320 LEU A N     1 
ATOM   2485 C CA    . LEU A 1 321 ? -32.070 66.053  21.766  1.00 25.27 ? 320 LEU A CA    1 
ATOM   2486 C C     . LEU A 1 321 ? -33.436 66.706  21.648  1.00 25.63 ? 320 LEU A C     1 
ATOM   2487 O O     . LEU A 1 321 ? -34.298 66.212  20.947  1.00 26.69 ? 320 LEU A O     1 
ATOM   2488 C CB    . LEU A 1 321 ? -32.201 64.607  22.290  1.00 24.04 ? 320 LEU A CB    1 
ATOM   2489 C CG    . LEU A 1 321 ? -30.972 63.702  22.181  1.00 19.74 ? 320 LEU A CG    1 
ATOM   2490 C CD1   . LEU A 1 321 ? -31.263 62.548  23.175  1.00 16.75 ? 320 LEU A CD1   1 
ATOM   2491 C CD2   . LEU A 1 321 ? -30.749 63.164  20.773  1.00 15.90 ? 320 LEU A CD2   1 
ATOM   2492 N N     . ASN A 1 322 ? -33.666 67.799  22.341  1.00 25.83 ? 321 ASN A N     1 
ATOM   2493 C CA    . ASN A 1 322 ? -34.914 68.574  22.122  1.00 26.41 ? 321 ASN A CA    1 
ATOM   2494 C C     . ASN A 1 322 ? -35.223 68.856  20.633  1.00 26.36 ? 321 ASN A C     1 
ATOM   2495 O O     . ASN A 1 322 ? -34.315 69.121  19.890  1.00 26.69 ? 321 ASN A O     1 
ATOM   2496 C CB    . ASN A 1 322 ? -34.797 69.932  22.808  1.00 25.34 ? 321 ASN A CB    1 
ATOM   2497 C CG    . ASN A 1 322 ? -34.963 69.880  24.332  1.00 24.62 ? 321 ASN A CG    1 
ATOM   2498 O OD1   . ASN A 1 322 ? -34.951 70.946  24.960  1.00 27.75 ? 321 ASN A OD1   1 
ATOM   2499 N ND2   . ASN A 1 322 ? -35.077 68.689  24.936  1.00 19.29 ? 321 ASN A ND2   1 
ATOM   2500 N N     . GLU A 1 323 ? -36.491 68.847  20.214  1.00 26.44 ? 322 GLU A N     1 
ATOM   2501 C CA    . GLU A 1 323 ? -36.829 69.036  18.808  1.00 25.93 ? 322 GLU A CA    1 
ATOM   2502 C C     . GLU A 1 323 ? -36.371 70.371  18.282  1.00 25.98 ? 322 GLU A C     1 
ATOM   2503 O O     . GLU A 1 323 ? -36.141 71.278  19.034  1.00 27.20 ? 322 GLU A O     1 
ATOM   2504 C CB    . GLU A 1 323 ? -38.329 68.839  18.578  1.00 26.14 ? 322 GLU A CB    1 
ATOM   2505 C CG    . GLU A 1 323 ? -38.849 69.028  17.126  1.00 26.29 ? 322 GLU A CG    1 
ATOM   2506 C CD    . GLU A 1 323 ? -38.218 68.086  16.065  1.00 28.30 ? 322 GLU A CD    1 
ATOM   2507 O OE1   . GLU A 1 323 ? -37.002 67.826  16.131  1.00 29.44 ? 322 GLU A OE1   1 
ATOM   2508 O OE2   . GLU A 1 323 ? -38.926 67.646  15.121  1.00 31.61 ? 322 GLU A OE2   1 
ATOM   2509 N N     . ILE A 1 324 ? -36.189 70.477  16.976  1.00 26.45 ? 323 ILE A N     1 
ATOM   2510 C CA    . ILE A 1 324 ? -35.826 71.724  16.338  1.00 26.89 ? 323 ILE A CA    1 
ATOM   2511 C C     . ILE A 1 324 ? -36.671 72.841  16.899  1.00 28.24 ? 323 ILE A C     1 
ATOM   2512 O O     . ILE A 1 324 ? -37.864 72.655  17.214  1.00 29.92 ? 323 ILE A O     1 
ATOM   2513 C CB    . ILE A 1 324 ? -35.925 71.611  14.794  1.00 25.66 ? 323 ILE A CB    1 
ATOM   2514 C CG1   . ILE A 1 324 ? -35.397 72.891  14.121  1.00 26.34 ? 323 ILE A CG1   1 
ATOM   2515 C CG2   . ILE A 1 324 ? -37.358 71.336  14.363  1.00 25.71 ? 323 ILE A CG2   1 
ATOM   2516 C CD1   . ILE A 1 324 ? -35.192 72.755  12.586  1.00 25.22 ? 323 ILE A CD1   1 
ATOM   2517 N N     . ASP A 1 325 ? -36.105 74.014  17.077  1.00 29.08 ? 324 ASP A N     1 
ATOM   2518 C CA    . ASP A 1 325 ? -36.924 75.047  17.762  1.00 28.56 ? 324 ASP A CA    1 
ATOM   2519 C C     . ASP A 1 325 ? -37.554 75.903  16.694  1.00 28.90 ? 324 ASP A C     1 
ATOM   2520 O O     . ASP A 1 325 ? -36.862 76.617  15.960  1.00 29.43 ? 324 ASP A O     1 
ATOM   2521 C CB    . ASP A 1 325 ? -36.044 75.904  18.731  1.00 27.62 ? 324 ASP A CB    1 
ATOM   2522 C CG    . ASP A 1 325 ? -36.849 77.068  19.415  1.00 29.91 ? 324 ASP A CG    1 
ATOM   2523 O OD1   . ASP A 1 325 ? -37.814 77.661  18.844  1.00 27.72 ? 324 ASP A OD1   1 
ATOM   2524 O OD2   . ASP A 1 325 ? -36.510 77.404  20.560  1.00 33.59 ? 324 ASP A OD2   1 
ATOM   2525 N N     . ALA A 1 326 ? -38.852 75.897  16.596  1.00 30.60 ? 325 ALA A N     1 
ATOM   2526 C CA    . ALA A 1 326 ? -39.477 76.643  15.494  1.00 32.62 ? 325 ALA A CA    1 
ATOM   2527 C C     . ALA A 1 326 ? -39.660 78.170  15.724  1.00 34.32 ? 325 ALA A C     1 
ATOM   2528 O O     . ALA A 1 326 ? -40.475 78.799  15.020  1.00 36.00 ? 325 ALA A O     1 
ATOM   2529 C CB    . ALA A 1 326 ? -40.801 76.034  15.151  1.00 33.00 ? 325 ALA A CB    1 
ATOM   2530 N N     . GLY A 1 327 ? -38.892 78.755  16.652  1.00 34.26 ? 326 GLY A N     1 
ATOM   2531 C CA    . GLY A 1 327 ? -38.925 80.184  16.944  1.00 34.66 ? 326 GLY A CA    1 
ATOM   2532 C C     . GLY A 1 327 ? -40.307 80.740  17.218  1.00 34.49 ? 326 GLY A C     1 
ATOM   2533 O O     . GLY A 1 327 ? -40.990 80.231  18.063  1.00 35.19 ? 326 GLY A O     1 
ATOM   2534 N N     . VAL A 1 328 ? -40.725 81.769  16.492  1.00 35.01 ? 327 VAL A N     1 
ATOM   2535 C CA    . VAL A 1 328 ? -42.105 82.304  16.635  1.00 37.23 ? 327 VAL A CA    1 
ATOM   2536 C C     . VAL A 1 328 ? -43.239 81.429  16.050  1.00 37.39 ? 327 VAL A C     1 
ATOM   2537 O O     . VAL A 1 328 ? -44.396 81.816  16.147  1.00 37.88 ? 327 VAL A O     1 
ATOM   2538 C CB    . VAL A 1 328 ? -42.243 83.762  16.049  1.00 37.55 ? 327 VAL A CB    1 
ATOM   2539 C CG1   . VAL A 1 328 ? -41.240 84.752  16.724  1.00 35.97 ? 327 VAL A CG1   1 
ATOM   2540 C CG2   . VAL A 1 328 ? -41.992 83.727  14.506  1.00 38.28 ? 327 VAL A CG2   1 
ATOM   2541 N N     . CYS A 1 329 ? -42.913 80.280  15.451  1.00 37.28 ? 328 CYS A N     1 
ATOM   2542 C CA    . CYS A 1 329 ? -43.923 79.337  14.954  1.00 36.82 ? 328 CYS A CA    1 
ATOM   2543 C C     . CYS A 1 329 ? -44.193 78.188  15.902  1.00 36.80 ? 328 CYS A C     1 
ATOM   2544 O O     . CYS A 1 329 ? -44.992 77.285  15.596  1.00 36.97 ? 328 CYS A O     1 
ATOM   2545 C CB    . CYS A 1 329 ? -43.541 78.785  13.603  1.00 36.77 ? 328 CYS A CB    1 
ATOM   2546 S SG    . CYS A 1 329 ? -43.298 80.141  12.385  1.00 39.47 ? 328 CYS A SG    1 
ATOM   2547 N N     . GLU A 1 330 ? -43.545 78.194  17.055  1.00 36.01 ? 329 GLU A N     1 
ATOM   2548 C CA    . GLU A 1 330 ? -43.813 77.137  18.008  1.00 35.28 ? 329 GLU A CA    1 
ATOM   2549 C C     . GLU A 1 330 ? -45.322 77.069  18.225  1.00 37.18 ? 329 GLU A C     1 
ATOM   2550 O O     . GLU A 1 330 ? -46.006 78.106  18.401  1.00 37.09 ? 329 GLU A O     1 
ATOM   2551 C CB    . GLU A 1 330 ? -43.011 77.338  19.292  1.00 33.62 ? 329 GLU A CB    1 
ATOM   2552 C CG    . GLU A 1 330 ? -41.510 76.885  19.173  1.00 30.65 ? 329 GLU A CG    1 
ATOM   2553 C CD    . GLU A 1 330 ? -41.369 75.351  19.310  1.00 29.44 ? 329 GLU A CD    1 
ATOM   2554 O OE1   . GLU A 1 330 ? -41.930 74.744  20.287  1.00 24.49 ? 329 GLU A OE1   1 
ATOM   2555 O OE2   . GLU A 1 330 ? -40.742 74.729  18.411  1.00 29.09 ? 329 GLU A OE2   1 
ATOM   2556 N N     . GLU A 1 331 ? -45.857 75.854  18.158  1.00 38.35 ? 330 GLU A N     1 
ATOM   2557 C CA    . GLU A 1 331 ? -47.253 75.598  18.504  1.00 40.19 ? 330 GLU A CA    1 
ATOM   2558 C C     . GLU A 1 331 ? -48.263 76.034  17.447  1.00 40.29 ? 330 GLU A C     1 
ATOM   2559 O O     . GLU A 1 331 ? -49.434 75.975  17.720  1.00 41.71 ? 330 GLU A O     1 
ATOM   2560 C CB    . GLU A 1 331 ? -47.651 76.169  19.899  1.00 41.00 ? 330 GLU A CB    1 
ATOM   2561 C CG    . GLU A 1 331 ? -46.605 75.956  20.946  1.00 41.01 ? 330 GLU A CG    1 
ATOM   2562 C CD    . GLU A 1 331 ? -47.109 75.418  22.227  1.00 43.96 ? 330 GLU A CD    1 
ATOM   2563 O OE1   . GLU A 1 331 ? -46.466 75.669  23.246  1.00 44.73 ? 330 GLU A OE1   1 
ATOM   2564 O OE2   . GLU A 1 331 ? -48.080 74.654  22.257  1.00 49.38 ? 330 GLU A OE2   1 
ATOM   2565 N N     . LEU A 1 332 ? -47.825 76.430  16.254  1.00 39.76 ? 331 LEU A N     1 
ATOM   2566 C CA    . LEU A 1 332 ? -48.721 76.701  15.165  1.00 39.20 ? 331 LEU A CA    1 
ATOM   2567 C C     . LEU A 1 332 ? -48.885 75.474  14.340  1.00 39.35 ? 331 LEU A C     1 
ATOM   2568 O O     . LEU A 1 332 ? -48.009 74.582  14.398  1.00 39.43 ? 331 LEU A O     1 
ATOM   2569 C CB    . LEU A 1 332 ? -48.099 77.749  14.276  1.00 40.46 ? 331 LEU A CB    1 
ATOM   2570 C CG    . LEU A 1 332 ? -48.532 79.180  14.597  1.00 40.60 ? 331 LEU A CG    1 
ATOM   2571 C CD1   . LEU A 1 332 ? -48.914 79.392  16.041  1.00 40.64 ? 331 LEU A CD1   1 
ATOM   2572 C CD2   . LEU A 1 332 ? -47.447 80.094  14.189  1.00 38.52 ? 331 LEU A CD2   1 
ATOM   2573 N N     . THR A 1 333 ? -49.982 75.407  13.561  1.00 39.67 ? 332 THR A N     1 
ATOM   2574 C CA    . THR A 1 333 ? -50.152 74.358  12.502  1.00 40.10 ? 332 THR A CA    1 
ATOM   2575 C C     . THR A 1 333 ? -49.448 74.880  11.266  1.00 39.61 ? 332 THR A C     1 
ATOM   2576 O O     . THR A 1 333 ? -49.247 76.093  11.161  1.00 40.09 ? 332 THR A O     1 
ATOM   2577 C CB    . THR A 1 333 ? -51.642 74.081  12.120  1.00 40.16 ? 332 THR A CB    1 
ATOM   2578 O OG1   . THR A 1 333 ? -52.232 75.256  11.517  1.00 44.72 ? 332 THR A OG1   1 
ATOM   2579 C CG2   . THR A 1 333 ? -52.480 73.621  13.320  1.00 40.20 ? 332 THR A CG2   1 
ATOM   2580 N N     . TYR A 1 334 ? -49.064 74.002  10.348  1.00 40.31 ? 333 TYR A N     1 
ATOM   2581 C CA    . TYR A 1 334 ? -48.433 74.461  9.113   1.00 42.04 ? 333 TYR A CA    1 
ATOM   2582 C C     . TYR A 1 334 ? -49.355 75.393  8.328   1.00 44.46 ? 333 TYR A C     1 
ATOM   2583 O O     . TYR A 1 334 ? -48.879 76.338  7.678   1.00 45.33 ? 333 TYR A O     1 
ATOM   2584 C CB    . TYR A 1 334 ? -48.029 73.309  8.218   1.00 40.19 ? 333 TYR A CB    1 
ATOM   2585 C CG    . TYR A 1 334 ? -46.836 72.500  8.732   1.00 40.37 ? 333 TYR A CG    1 
ATOM   2586 C CD1   . TYR A 1 334 ? -45.497 72.950  8.548   1.00 35.70 ? 333 TYR A CD1   1 
ATOM   2587 C CD2   . TYR A 1 334 ? -47.042 71.274  9.397   1.00 38.09 ? 333 TYR A CD2   1 
ATOM   2588 C CE1   . TYR A 1 334 ? -44.427 72.199  9.024   1.00 36.63 ? 333 TYR A CE1   1 
ATOM   2589 C CE2   . TYR A 1 334 ? -45.965 70.505  9.874   1.00 35.96 ? 333 TYR A CE2   1 
ATOM   2590 C CZ    . TYR A 1 334 ? -44.676 70.958  9.682   1.00 37.12 ? 333 TYR A CZ    1 
ATOM   2591 O OH    . TYR A 1 334 ? -43.657 70.173  10.166  1.00 32.60 ? 333 TYR A OH    1 
ATOM   2592 N N     . GLU A 1 335 ? -50.664 75.139  8.398   1.00 46.38 ? 334 GLU A N     1 
ATOM   2593 C CA    . GLU A 1 335 ? -51.665 76.085  7.886   1.00 48.65 ? 334 GLU A CA    1 
ATOM   2594 C C     . GLU A 1 335 ? -51.510 77.420  8.549   1.00 48.12 ? 334 GLU A C     1 
ATOM   2595 O O     . GLU A 1 335 ? -51.408 78.431  7.853   1.00 47.56 ? 334 GLU A O     1 
ATOM   2596 C CB    . GLU A 1 335 ? -53.069 75.608  8.174   1.00 49.50 ? 334 GLU A CB    1 
ATOM   2597 C CG    . GLU A 1 335 ? -53.789 75.112  6.991   1.00 57.32 ? 334 GLU A CG    1 
ATOM   2598 C CD    . GLU A 1 335 ? -54.959 76.023  6.676   1.00 67.46 ? 334 GLU A CD    1 
ATOM   2599 O OE1   . GLU A 1 335 ? -56.018 75.832  7.339   1.00 68.68 ? 334 GLU A OE1   1 
ATOM   2600 O OE2   . GLU A 1 335 ? -54.807 76.936  5.803   1.00 72.48 ? 334 GLU A OE2   1 
ATOM   2601 N N     . GLU A 1 336 ? -51.507 77.437  9.888   1.00 47.57 ? 335 GLU A N     1 
ATOM   2602 C CA    . GLU A 1 336 ? -51.376 78.715  10.556  1.00 47.48 ? 335 GLU A CA    1 
ATOM   2603 C C     . GLU A 1 336 ? -50.066 79.369  10.109  1.00 47.68 ? 335 GLU A C     1 
ATOM   2604 O O     . GLU A 1 336 ? -50.026 80.595  9.944   1.00 48.53 ? 335 GLU A O     1 
ATOM   2605 C CB    . GLU A 1 336 ? -51.468 78.591  12.062  1.00 47.65 ? 335 GLU A CB    1 
ATOM   2606 C CG    . GLU A 1 336 ? -52.891 78.542  12.635  1.00 46.89 ? 335 GLU A CG    1 
ATOM   2607 C CD    . GLU A 1 336 ? -52.937 77.785  13.968  1.00 51.27 ? 335 GLU A CD    1 
ATOM   2608 O OE1   . GLU A 1 336 ? -51.870 77.383  14.481  1.00 54.74 ? 335 GLU A OE1   1 
ATOM   2609 O OE2   . GLU A 1 336 ? -54.032 77.544  14.521  1.00 52.77 ? 335 GLU A OE2   1 
ATOM   2610 N N     . ILE A 1 337 ? -49.019 78.571  9.830   1.00 46.82 ? 336 ILE A N     1 
ATOM   2611 C CA    . ILE A 1 337 ? -47.754 79.164  9.375   1.00 45.44 ? 336 ILE A CA    1 
ATOM   2612 C C     . ILE A 1 337 ? -47.916 79.797  7.985   1.00 46.49 ? 336 ILE A C     1 
ATOM   2613 O O     . ILE A 1 337 ? -47.529 80.951  7.789   1.00 46.01 ? 336 ILE A O     1 
ATOM   2614 C CB    . ILE A 1 337 ? -46.539 78.181  9.419   1.00 45.11 ? 336 ILE A CB    1 
ATOM   2615 C CG1   . ILE A 1 337 ? -46.292 77.656  10.830  1.00 45.39 ? 336 ILE A CG1   1 
ATOM   2616 C CG2   . ILE A 1 337 ? -45.278 78.885  8.976   1.00 41.65 ? 336 ILE A CG2   1 
ATOM   2617 C CD1   . ILE A 1 337 ? -45.502 76.345  10.873  1.00 44.16 ? 336 ILE A CD1   1 
ATOM   2618 N N     . ARG A 1 338 ? -48.467 79.033  7.033   1.00 47.82 ? 337 ARG A N     1 
ATOM   2619 C CA    . ARG A 1 338 ? -48.709 79.485  5.645   1.00 49.79 ? 337 ARG A CA    1 
ATOM   2620 C C     . ARG A 1 338 ? -49.439 80.817  5.647   1.00 49.28 ? 337 ARG A C     1 
ATOM   2621 O O     . ARG A 1 338 ? -49.066 81.713  4.911   1.00 49.72 ? 337 ARG A O     1 
ATOM   2622 C CB    . ARG A 1 338 ? -49.520 78.430  4.853   1.00 51.33 ? 337 ARG A CB    1 
ATOM   2623 C CG    . ARG A 1 338 ? -49.258 78.335  3.310   1.00 51.43 ? 337 ARG A CG    1 
ATOM   2624 C CD    . ARG A 1 338 ? -50.404 77.529  2.560   1.00 53.06 ? 337 ARG A CD    1 
ATOM   2625 N NE    . ARG A 1 338 ? -50.115 77.390  1.114   1.00 61.29 ? 337 ARG A NE    1 
ATOM   2626 C CZ    . ARG A 1 338 ? -49.510 76.333  0.504   1.00 68.10 ? 337 ARG A CZ    1 
ATOM   2627 N NH1   . ARG A 1 338 ? -49.275 76.365  -0.812  1.00 67.51 ? 337 ARG A NH1   1 
ATOM   2628 N NH2   . ARG A 1 338 ? -49.120 75.231  1.179   1.00 69.23 ? 337 ARG A NH2   1 
ATOM   2629 N N     . ASP A 1 339 ? -50.428 80.963  6.527   1.00 49.09 ? 338 ASP A N     1 
ATOM   2630 C CA    . ASP A 1 339 ? -51.298 82.141  6.541   1.00 49.65 ? 338 ASP A CA    1 
ATOM   2631 C C     . ASP A 1 339 ? -50.707 83.368  7.223   1.00 50.30 ? 338 ASP A C     1 
ATOM   2632 O O     . ASP A 1 339 ? -50.837 84.467  6.712   1.00 50.72 ? 338 ASP A O     1 
ATOM   2633 C CB    . ASP A 1 339 ? -52.679 81.827  7.137   1.00 49.51 ? 338 ASP A CB    1 
ATOM   2634 C CG    . ASP A 1 339 ? -53.494 80.861  6.263   1.00 51.49 ? 338 ASP A CG    1 
ATOM   2635 O OD1   . ASP A 1 339 ? -53.273 80.856  5.020   1.00 52.99 ? 338 ASP A OD1   1 
ATOM   2636 O OD2   . ASP A 1 339 ? -54.339 80.089  6.810   1.00 51.78 ? 338 ASP A OD2   1 
ATOM   2637 N N     . THR A 1 340 ? -50.076 83.188  8.378   1.00 50.39 ? 339 THR A N     1 
ATOM   2638 C CA    . THR A 1 340 ? -49.464 84.280  9.092   1.00 49.31 ? 339 THR A CA    1 
ATOM   2639 C C     . THR A 1 340 ? -48.095 84.598  8.520   1.00 49.80 ? 339 THR A C     1 
ATOM   2640 O O     . THR A 1 340 ? -47.693 85.763  8.482   1.00 49.70 ? 339 THR A O     1 
ATOM   2641 C CB    . THR A 1 340 ? -49.395 83.912  10.574  1.00 50.53 ? 339 THR A CB    1 
ATOM   2642 O OG1   . THR A 1 340 ? -50.630 83.277  10.930  1.00 50.32 ? 339 THR A OG1   1 
ATOM   2643 C CG2   . THR A 1 340 ? -49.206 85.132  11.471  1.00 48.27 ? 339 THR A CG2   1 
ATOM   2644 N N     . TYR A 1 341 ? -47.351 83.591  8.054   1.00 50.02 ? 340 TYR A N     1 
ATOM   2645 C CA    . TYR A 1 341 ? -45.992 83.874  7.519   1.00 49.28 ? 340 TYR A CA    1 
ATOM   2646 C C     . TYR A 1 341 ? -45.720 83.227  6.181   1.00 49.90 ? 340 TYR A C     1 
ATOM   2647 O O     . TYR A 1 341 ? -44.774 82.424  6.071   1.00 50.60 ? 340 TYR A O     1 
ATOM   2648 C CB    . TYR A 1 341 ? -44.854 83.462  8.479   1.00 48.01 ? 340 TYR A CB    1 
ATOM   2649 C CG    . TYR A 1 341 ? -45.020 83.817  9.925   1.00 46.30 ? 340 TYR A CG    1 
ATOM   2650 C CD1   . TYR A 1 341 ? -45.735 82.966  10.773  1.00 43.73 ? 340 TYR A CD1   1 
ATOM   2651 C CD2   . TYR A 1 341 ? -44.459 85.004  10.467  1.00 46.48 ? 340 TYR A CD2   1 
ATOM   2652 C CE1   . TYR A 1 341 ? -45.908 83.264  12.110  1.00 41.24 ? 340 TYR A CE1   1 
ATOM   2653 C CE2   . TYR A 1 341 ? -44.656 85.336  11.850  1.00 43.01 ? 340 TYR A CE2   1 
ATOM   2654 C CZ    . TYR A 1 341 ? -45.386 84.424  12.651  1.00 43.46 ? 340 TYR A CZ    1 
ATOM   2655 O OH    . TYR A 1 341 ? -45.629 84.630  14.004  1.00 46.57 ? 340 TYR A OH    1 
ATOM   2656 N N     . PRO A 1 342 ? -46.497 83.605  5.140   1.00 50.25 ? 341 PRO A N     1 
ATOM   2657 C CA    . PRO A 1 342 ? -46.386 82.906  3.826   1.00 49.16 ? 341 PRO A CA    1 
ATOM   2658 C C     . PRO A 1 342 ? -44.954 83.020  3.271   1.00 48.22 ? 341 PRO A C     1 
ATOM   2659 O O     . PRO A 1 342 ? -44.388 82.064  2.764   1.00 47.25 ? 341 PRO A O     1 
ATOM   2660 C CB    . PRO A 1 342 ? -47.401 83.672  2.925   1.00 49.50 ? 341 PRO A CB    1 
ATOM   2661 C CG    . PRO A 1 342 ? -47.613 85.042  3.631   1.00 48.41 ? 341 PRO A CG    1 
ATOM   2662 C CD    . PRO A 1 342 ? -47.499 84.706  5.115   1.00 50.32 ? 341 PRO A CD    1 
ATOM   2663 N N     . GLU A 1 343 ? -44.364 84.181  3.400   1.00 47.39 ? 342 GLU A N     1 
ATOM   2664 C CA    . GLU A 1 343 ? -43.013 84.350  2.936   1.00 49.28 ? 342 GLU A CA    1 
ATOM   2665 C C     . GLU A 1 343 ? -42.036 83.387  3.669   1.00 47.14 ? 342 GLU A C     1 
ATOM   2666 O O     . GLU A 1 343 ? -41.207 82.690  3.004   1.00 47.54 ? 342 GLU A O     1 
ATOM   2667 C CB    . GLU A 1 343 ? -42.654 85.822  3.053   1.00 47.91 ? 342 GLU A CB    1 
ATOM   2668 C CG    . GLU A 1 343 ? -41.248 86.163  2.826   1.00 53.18 ? 342 GLU A CG    1 
ATOM   2669 C CD    . GLU A 1 343 ? -41.018 87.703  2.709   1.00 56.75 ? 342 GLU A CD    1 
ATOM   2670 O OE1   . GLU A 1 343 ? -42.022 88.433  2.358   1.00 63.94 ? 342 GLU A OE1   1 
ATOM   2671 O OE2   . GLU A 1 343 ? -39.834 88.150  2.965   1.00 64.08 ? 342 GLU A OE2   1 
ATOM   2672 N N     . GLU A 1 344 ? -42.152 83.306  4.996   1.00 45.04 ? 343 GLU A N     1 
ATOM   2673 C CA    . GLU A 1 344 ? -41.348 82.355  5.762   1.00 44.48 ? 343 GLU A CA    1 
ATOM   2674 C C     . GLU A 1 344 ? -41.621 80.940  5.284   1.00 43.75 ? 343 GLU A C     1 
ATOM   2675 O O     . GLU A 1 344 ? -40.685 80.137  5.116   1.00 43.34 ? 343 GLU A O     1 
ATOM   2676 C CB    . GLU A 1 344 ? -41.602 82.418  7.286   1.00 44.06 ? 343 GLU A CB    1 
ATOM   2677 C CG    . GLU A 1 344 ? -41.029 83.679  7.944   1.00 43.20 ? 343 GLU A CG    1 
ATOM   2678 C CD    . GLU A 1 344 ? -39.553 83.887  7.686   1.00 43.47 ? 343 GLU A CD    1 
ATOM   2679 O OE1   . GLU A 1 344 ? -38.772 82.892  7.831   1.00 44.71 ? 343 GLU A OE1   1 
ATOM   2680 O OE2   . GLU A 1 344 ? -39.186 85.040  7.336   1.00 38.57 ? 343 GLU A OE2   1 
ATOM   2681 N N     . TYR A 1 345 ? -42.904 80.640  5.079   1.00 42.60 ? 344 TYR A N     1 
ATOM   2682 C CA    . TYR A 1 345 ? -43.329 79.277  4.709   1.00 41.88 ? 344 TYR A CA    1 
ATOM   2683 C C     . TYR A 1 345 ? -42.687 78.854  3.384   1.00 41.42 ? 344 TYR A C     1 
ATOM   2684 O O     . TYR A 1 345 ? -42.067 77.774  3.299   1.00 41.41 ? 344 TYR A O     1 
ATOM   2685 C CB    . TYR A 1 345 ? -44.852 79.196  4.649   1.00 41.34 ? 344 TYR A CB    1 
ATOM   2686 C CG    . TYR A 1 345 ? -45.404 77.833  4.342   1.00 40.36 ? 344 TYR A CG    1 
ATOM   2687 C CD1   . TYR A 1 345 ? -45.341 77.296  3.039   1.00 39.53 ? 344 TYR A CD1   1 
ATOM   2688 C CD2   . TYR A 1 345 ? -45.996 77.074  5.360   1.00 39.61 ? 344 TYR A CD2   1 
ATOM   2689 C CE1   . TYR A 1 345 ? -45.857 76.023  2.765   1.00 38.91 ? 344 TYR A CE1   1 
ATOM   2690 C CE2   . TYR A 1 345 ? -46.542 75.827  5.113   1.00 38.52 ? 344 TYR A CE2   1 
ATOM   2691 C CZ    . TYR A 1 345 ? -46.476 75.296  3.819   1.00 39.35 ? 344 TYR A CZ    1 
ATOM   2692 O OH    . TYR A 1 345 ? -47.014 74.041  3.601   1.00 35.87 ? 344 TYR A OH    1 
ATOM   2693 N N     . ALA A 1 346 ? -42.801 79.736  2.387   1.00 40.06 ? 345 ALA A N     1 
ATOM   2694 C CA    . ALA A 1 346 ? -42.100 79.592  1.116   1.00 39.64 ? 345 ALA A CA    1 
ATOM   2695 C C     . ALA A 1 346 ? -40.569 79.528  1.241   1.00 38.76 ? 345 ALA A C     1 
ATOM   2696 O O     . ALA A 1 346 ? -39.931 78.758  0.537   1.00 38.67 ? 345 ALA A O     1 
ATOM   2697 C CB    . ALA A 1 346 ? -42.546 80.712  0.093   1.00 39.39 ? 345 ALA A CB    1 
ATOM   2698 N N     . LEU A 1 347 ? -39.964 80.320  2.117   1.00 38.89 ? 346 LEU A N     1 
ATOM   2699 C CA    . LEU A 1 347 ? -38.487 80.293  2.206   1.00 39.30 ? 346 LEU A CA    1 
ATOM   2700 C C     . LEU A 1 347 ? -38.036 78.916  2.765   1.00 39.61 ? 346 LEU A C     1 
ATOM   2701 O O     . LEU A 1 347 ? -36.997 78.341  2.359   1.00 38.99 ? 346 LEU A O     1 
ATOM   2702 C CB    . LEU A 1 347 ? -37.972 81.452  3.059   1.00 39.79 ? 346 LEU A CB    1 
ATOM   2703 C CG    . LEU A 1 347 ? -38.031 82.921  2.523   1.00 42.57 ? 346 LEU A CG    1 
ATOM   2704 C CD1   . LEU A 1 347 ? -37.798 84.023  3.604   1.00 37.58 ? 346 LEU A CD1   1 
ATOM   2705 C CD2   . LEU A 1 347 ? -36.991 83.157  1.390   1.00 43.24 ? 346 LEU A CD2   1 
ATOM   2706 N N     . ARG A 1 348 ? -38.839 78.359  3.673   1.00 38.76 ? 347 ARG A N     1 
ATOM   2707 C CA    . ARG A 1 348 ? -38.441 77.118  4.287   1.00 38.77 ? 347 ARG A CA    1 
ATOM   2708 C C     . ARG A 1 348 ? -38.523 76.005  3.230   1.00 40.55 ? 347 ARG A C     1 
ATOM   2709 O O     . ARG A 1 348 ? -37.583 75.153  3.115   1.00 40.52 ? 347 ARG A O     1 
ATOM   2710 C CB    . ARG A 1 348 ? -39.295 76.809  5.522   1.00 37.37 ? 347 ARG A CB    1 
ATOM   2711 C CG    . ARG A 1 348 ? -38.781 75.617  6.282   1.00 36.01 ? 347 ARG A CG    1 
ATOM   2712 C CD    . ARG A 1 348 ? -39.462 75.433  7.608   1.00 30.46 ? 347 ARG A CD    1 
ATOM   2713 N NE    . ARG A 1 348 ? -38.635 74.601  8.437   1.00 29.71 ? 347 ARG A NE    1 
ATOM   2714 C CZ    . ARG A 1 348 ? -38.932 73.359  8.785   1.00 31.12 ? 347 ARG A CZ    1 
ATOM   2715 N NH1   . ARG A 1 348 ? -40.023 72.772  8.352   1.00 31.40 ? 347 ARG A NH1   1 
ATOM   2716 N NH2   . ARG A 1 348 ? -38.112 72.690  9.567   1.00 32.83 ? 347 ARG A NH2   1 
ATOM   2717 N N     . GLU A 1 349 ? -39.600 76.053  2.426   1.00 40.41 ? 348 GLU A N     1 
ATOM   2718 C CA    . GLU A 1 349 ? -39.730 75.124  1.307   1.00 41.18 ? 348 GLU A CA    1 
ATOM   2719 C C     . GLU A 1 349 ? -38.614 75.230  0.286   1.00 40.77 ? 348 GLU A C     1 
ATOM   2720 O O     . GLU A 1 349 ? -38.155 74.217  -0.207  1.00 39.31 ? 348 GLU A O     1 
ATOM   2721 C CB    . GLU A 1 349 ? -41.086 75.213  0.657   1.00 41.58 ? 348 GLU A CB    1 
ATOM   2722 C CG    . GLU A 1 349 ? -42.068 74.263  1.270   1.00 45.85 ? 348 GLU A CG    1 
ATOM   2723 C CD    . GLU A 1 349 ? -43.396 74.287  0.498   1.00 56.97 ? 348 GLU A CD    1 
ATOM   2724 O OE1   . GLU A 1 349 ? -43.847 75.387  0.092   1.00 58.41 ? 348 GLU A OE1   1 
ATOM   2725 O OE2   . GLU A 1 349 ? -44.006 73.202  0.294   1.00 63.31 ? 348 GLU A OE2   1 
ATOM   2726 N N     . GLN A 1 350 ? -38.104 76.438  0.049   1.00 41.54 ? 349 GLN A N     1 
ATOM   2727 C CA    . GLN A 1 350 ? -36.991 76.589  -0.901  1.00 43.03 ? 349 GLN A CA    1 
ATOM   2728 C C     . GLN A 1 350 ? -35.701 75.995  -0.458  1.00 42.80 ? 349 GLN A C     1 
ATOM   2729 O O     . GLN A 1 350 ? -34.938 75.523  -1.316  1.00 43.50 ? 349 GLN A O     1 
ATOM   2730 C CB    . GLN A 1 350 ? -36.783 78.022  -1.395  1.00 43.58 ? 349 GLN A CB    1 
ATOM   2731 C CG    . GLN A 1 350 ? -37.708 78.338  -2.654  1.00 51.52 ? 349 GLN A CG    1 
ATOM   2732 C CD    . GLN A 1 350 ? -38.730 79.507  -2.441  1.00 60.85 ? 349 GLN A CD    1 
ATOM   2733 O OE1   . GLN A 1 350 ? -38.340 80.643  -2.064  1.00 64.81 ? 349 GLN A OE1   1 
ATOM   2734 N NE2   . GLN A 1 350 ? -40.033 79.232  -2.692  1.00 63.06 ? 349 GLN A NE2   1 
ATOM   2735 N N     . ASP A 1 351 ? -35.448 75.983  0.867   1.00 42.20 ? 350 ASP A N     1 
ATOM   2736 C CA    . ASP A 1 351 ? -34.087 75.692  1.405   1.00 40.70 ? 350 ASP A CA    1 
ATOM   2737 C C     . ASP A 1 351 ? -34.179 75.128  2.841   1.00 39.61 ? 350 ASP A C     1 
ATOM   2738 O O     . ASP A 1 351 ? -33.847 75.785  3.841   1.00 38.62 ? 350 ASP A O     1 
ATOM   2739 C CB    . ASP A 1 351 ? -33.224 76.955  1.341   1.00 40.19 ? 350 ASP A CB    1 
ATOM   2740 C CG    . ASP A 1 351 ? -31.770 76.650  1.193   1.00 45.34 ? 350 ASP A CG    1 
ATOM   2741 O OD1   . ASP A 1 351 ? -31.396 75.450  1.363   1.00 49.89 ? 350 ASP A OD1   1 
ATOM   2742 O OD2   . ASP A 1 351 ? -30.973 77.605  0.915   1.00 48.80 ? 350 ASP A OD2   1 
ATOM   2743 N N     . LYS A 1 352 ? -34.677 73.904  2.937   1.00 38.17 ? 351 LYS A N     1 
ATOM   2744 C CA    . LYS A 1 352 ? -35.189 73.436  4.181   1.00 35.92 ? 351 LYS A CA    1 
ATOM   2745 C C     . LYS A 1 352 ? -34.039 73.069  5.110   1.00 34.99 ? 351 LYS A C     1 
ATOM   2746 O O     . LYS A 1 352 ? -34.232 73.046  6.315   1.00 36.27 ? 351 LYS A O     1 
ATOM   2747 C CB    . LYS A 1 352 ? -36.153 72.269  3.947   1.00 36.09 ? 351 LYS A CB    1 
ATOM   2748 C CG    . LYS A 1 352 ? -36.940 71.821  5.186   1.00 35.21 ? 351 LYS A CG    1 
ATOM   2749 C CD    . LYS A 1 352 ? -37.892 70.701  4.899   1.00 35.38 ? 351 LYS A CD    1 
ATOM   2750 C CE    . LYS A 1 352 ? -38.492 70.194  6.212   1.00 37.29 ? 351 LYS A CE    1 
ATOM   2751 N NZ    . LYS A 1 352 ? -38.969 68.796  6.206   1.00 33.73 ? 351 LYS A NZ    1 
ATOM   2752 N N     . TYR A 1 353 ? -32.851 72.809  4.596   1.00 32.38 ? 352 TYR A N     1 
ATOM   2753 C CA    . TYR A 1 353 ? -31.759 72.458  5.484   1.00 31.46 ? 352 TYR A CA    1 
ATOM   2754 C C     . TYR A 1 353 ? -31.237 73.711  6.202   1.00 32.13 ? 352 TYR A C     1 
ATOM   2755 O O     . TYR A 1 353 ? -31.072 73.692  7.429   1.00 32.61 ? 352 TYR A O     1 
ATOM   2756 C CB    . TYR A 1 353 ? -30.615 71.802  4.728   1.00 30.07 ? 352 TYR A CB    1 
ATOM   2757 C CG    . TYR A 1 353 ? -29.418 71.471  5.602   1.00 28.52 ? 352 TYR A CG    1 
ATOM   2758 C CD1   . TYR A 1 353 ? -29.382 70.328  6.407   1.00 21.06 ? 352 TYR A CD1   1 
ATOM   2759 C CD2   . TYR A 1 353 ? -28.270 72.318  5.592   1.00 34.43 ? 352 TYR A CD2   1 
ATOM   2760 C CE1   . TYR A 1 353 ? -28.248 70.041  7.227   1.00 26.42 ? 352 TYR A CE1   1 
ATOM   2761 C CE2   . TYR A 1 353 ? -27.131 72.048  6.365   1.00 25.18 ? 352 TYR A CE2   1 
ATOM   2762 C CZ    . TYR A 1 353 ? -27.118 70.912  7.140   1.00 28.16 ? 352 TYR A CZ    1 
ATOM   2763 O OH    . TYR A 1 353 ? -26.009 70.738  7.874   1.00 28.73 ? 352 TYR A OH    1 
ATOM   2764 N N     . TYR A 1 354 ? -31.051 74.796  5.442   1.00 32.25 ? 353 TYR A N     1 
ATOM   2765 C CA    . TYR A 1 354 ? -30.428 76.019  5.920   1.00 33.08 ? 353 TYR A CA    1 
ATOM   2766 C C     . TYR A 1 354 ? -31.395 77.040  6.487   1.00 33.75 ? 353 TYR A C     1 
ATOM   2767 O O     . TYR A 1 354 ? -31.015 77.885  7.287   1.00 35.06 ? 353 TYR A O     1 
ATOM   2768 C CB    . TYR A 1 354 ? -29.631 76.689  4.811   1.00 33.31 ? 353 TYR A CB    1 
ATOM   2769 C CG    . TYR A 1 354 ? -28.403 75.936  4.424   1.00 31.42 ? 353 TYR A CG    1 
ATOM   2770 C CD1   . TYR A 1 354 ? -27.313 75.898  5.255   1.00 32.00 ? 353 TYR A CD1   1 
ATOM   2771 C CD2   . TYR A 1 354 ? -28.361 75.203  3.228   1.00 33.00 ? 353 TYR A CD2   1 
ATOM   2772 C CE1   . TYR A 1 354 ? -26.132 75.193  4.878   1.00 34.62 ? 353 TYR A CE1   1 
ATOM   2773 C CE2   . TYR A 1 354 ? -27.213 74.481  2.833   1.00 30.71 ? 353 TYR A CE2   1 
ATOM   2774 C CZ    . TYR A 1 354 ? -26.112 74.481  3.660   1.00 34.78 ? 353 TYR A CZ    1 
ATOM   2775 O OH    . TYR A 1 354 ? -24.979 73.774  3.303   1.00 35.92 ? 353 TYR A OH    1 
ATOM   2776 N N     . TYR A 1 355 ? -32.631 76.988  6.053   1.00 32.65 ? 354 TYR A N     1 
ATOM   2777 C CA    . TYR A 1 355 ? -33.629 77.850  6.603   1.00 32.29 ? 354 TYR A CA    1 
ATOM   2778 C C     . TYR A 1 355 ? -33.682 77.865  8.144   1.00 33.51 ? 354 TYR A C     1 
ATOM   2779 O O     . TYR A 1 355 ? -33.793 76.846  8.830   1.00 33.90 ? 354 TYR A O     1 
ATOM   2780 C CB    . TYR A 1 355 ? -35.005 77.448  6.090   1.00 29.58 ? 354 TYR A CB    1 
ATOM   2781 C CG    . TYR A 1 355 ? -36.073 78.248  6.795   1.00 28.65 ? 354 TYR A CG    1 
ATOM   2782 C CD1   . TYR A 1 355 ? -36.441 79.532  6.348   1.00 26.84 ? 354 TYR A CD1   1 
ATOM   2783 C CD2   . TYR A 1 355 ? -36.728 77.738  7.910   1.00 26.40 ? 354 TYR A CD2   1 
ATOM   2784 C CE1   . TYR A 1 355 ? -37.491 80.246  7.012   1.00 26.92 ? 354 TYR A CE1   1 
ATOM   2785 C CE2   . TYR A 1 355 ? -37.744 78.445  8.583   1.00 24.45 ? 354 TYR A CE2   1 
ATOM   2786 C CZ    . TYR A 1 355 ? -38.114 79.715  8.128   1.00 27.01 ? 354 TYR A CZ    1 
ATOM   2787 O OH    . TYR A 1 355 ? -39.103 80.463  8.828   1.00 29.51 ? 354 TYR A OH    1 
ATOM   2788 N N     . ARG A 1 356 ? -33.709 79.045  8.706   1.00 34.34 ? 355 ARG A N     1 
ATOM   2789 C CA    . ARG A 1 356 ? -33.829 79.102  10.162  1.00 34.18 ? 355 ARG A CA    1 
ATOM   2790 C C     . ARG A 1 356 ? -35.134 79.814  10.419  1.00 33.36 ? 355 ARG A C     1 
ATOM   2791 O O     . ARG A 1 356 ? -35.467 80.758  9.714   1.00 33.19 ? 355 ARG A O     1 
ATOM   2792 C CB    . ARG A 1 356 ? -32.635 79.894  10.660  1.00 33.61 ? 355 ARG A CB    1 
ATOM   2793 C CG    . ARG A 1 356 ? -32.518 79.943  12.149  1.00 39.90 ? 355 ARG A CG    1 
ATOM   2794 C CD    . ARG A 1 356 ? -31.242 80.678  12.684  1.00 34.13 ? 355 ARG A CD    1 
ATOM   2795 N NE    . ARG A 1 356 ? -30.120 79.944  12.220  1.00 41.38 ? 355 ARG A NE    1 
ATOM   2796 C CZ    . ARG A 1 356 ? -28.885 80.302  12.449  1.00 45.58 ? 355 ARG A CZ    1 
ATOM   2797 N NH1   . ARG A 1 356 ? -28.692 81.402  13.153  1.00 51.65 ? 355 ARG A NH1   1 
ATOM   2798 N NH2   . ARG A 1 356 ? -27.875 79.583  11.978  1.00 43.46 ? 355 ARG A NH2   1 
ATOM   2799 N N     . TYR A 1 357 ? -35.913 79.322  11.365  1.00 32.92 ? 356 TYR A N     1 
ATOM   2800 C CA    . TYR A 1 357 ? -37.127 79.955  11.793  1.00 32.00 ? 356 TYR A CA    1 
ATOM   2801 C C     . TYR A 1 357 ? -36.844 81.261  12.567  1.00 32.36 ? 356 TYR A C     1 
ATOM   2802 O O     . TYR A 1 357 ? -35.836 81.394  13.282  1.00 32.88 ? 356 TYR A O     1 
ATOM   2803 C CB    . TYR A 1 357 ? -37.808 79.061  12.797  1.00 32.07 ? 356 TYR A CB    1 
ATOM   2804 C CG    . TYR A 1 357 ? -38.743 78.050  12.237  1.00 33.18 ? 356 TYR A CG    1 
ATOM   2805 C CD1   . TYR A 1 357 ? -40.000 78.423  11.736  1.00 34.63 ? 356 TYR A CD1   1 
ATOM   2806 C CD2   . TYR A 1 357 ? -38.406 76.685  12.251  1.00 31.75 ? 356 TYR A CD2   1 
ATOM   2807 C CE1   . TYR A 1 357 ? -40.895 77.461  11.224  1.00 31.28 ? 356 TYR A CE1   1 
ATOM   2808 C CE2   . TYR A 1 357 ? -39.263 75.736  11.736  1.00 32.32 ? 356 TYR A CE2   1 
ATOM   2809 C CZ    . TYR A 1 357 ? -40.516 76.124  11.221  1.00 31.08 ? 356 TYR A CZ    1 
ATOM   2810 O OH    . TYR A 1 357 ? -41.355 75.134  10.772  1.00 30.97 ? 356 TYR A OH    1 
ATOM   2811 N N     . PRO A 1 358 ? -37.785 82.204  12.523  1.00 32.18 ? 357 PRO A N     1 
ATOM   2812 C CA    . PRO A 1 358 ? -37.391 83.467  13.165  1.00 31.04 ? 357 PRO A CA    1 
ATOM   2813 C C     . PRO A 1 358 ? -37.315 83.295  14.685  1.00 29.98 ? 357 PRO A C     1 
ATOM   2814 O O     . PRO A 1 358 ? -38.292 82.904  15.323  1.00 29.55 ? 357 PRO A O     1 
ATOM   2815 C CB    . PRO A 1 358 ? -38.496 84.453  12.726  1.00 29.62 ? 357 PRO A CB    1 
ATOM   2816 C CG    . PRO A 1 358 ? -39.271 83.718  11.599  1.00 32.68 ? 357 PRO A CG    1 
ATOM   2817 C CD    . PRO A 1 358 ? -39.147 82.247  11.950  1.00 31.47 ? 357 PRO A CD    1 
ATOM   2818 N N     . THR A 1 359 ? -36.139 83.607  15.229  1.00 29.78 ? 358 THR A N     1 
ATOM   2819 C CA    . THR A 1 359 ? -35.764 83.407  16.648  1.00 29.88 ? 358 THR A CA    1 
ATOM   2820 C C     . THR A 1 359 ? -35.668 81.903  17.023  1.00 30.67 ? 358 THR A C     1 
ATOM   2821 O O     . THR A 1 359 ? -35.768 81.533  18.215  1.00 30.82 ? 358 THR A O     1 
ATOM   2822 C CB    . THR A 1 359 ? -36.712 84.147  17.692  1.00 29.72 ? 358 THR A CB    1 
ATOM   2823 O OG1   . THR A 1 359 ? -37.864 83.330  17.948  1.00 31.84 ? 358 THR A OG1   1 
ATOM   2824 C CG2   . THR A 1 359 ? -37.134 85.564  17.255  1.00 25.48 ? 358 THR A CG2   1 
ATOM   2825 N N     . GLY A 1 360 ? -35.506 81.052  16.004  1.00 30.39 ? 359 GLY A N     1 
ATOM   2826 C CA    . GLY A 1 360 ? -35.477 79.611  16.158  1.00 28.89 ? 359 GLY A CA    1 
ATOM   2827 C C     . GLY A 1 360 ? -34.317 79.039  15.381  1.00 29.28 ? 359 GLY A C     1 
ATOM   2828 O O     . GLY A 1 360 ? -33.253 79.697  15.210  1.00 27.87 ? 359 GLY A O     1 
ATOM   2829 N N     . GLU A 1 361 ? -34.491 77.794  14.919  1.00 29.34 ? 360 GLU A N     1 
ATOM   2830 C CA    . GLU A 1 361 ? -33.326 77.035  14.390  1.00 29.02 ? 360 GLU A CA    1 
ATOM   2831 C C     . GLU A 1 361 ? -33.535 76.496  12.948  1.00 29.37 ? 360 GLU A C     1 
ATOM   2832 O O     . GLU A 1 361 ? -34.667 76.418  12.431  1.00 29.33 ? 360 GLU A O     1 
ATOM   2833 C CB    . GLU A 1 361 ? -32.998 75.843  15.306  1.00 27.90 ? 360 GLU A CB    1 
ATOM   2834 C CG    . GLU A 1 361 ? -32.581 76.108  16.700  1.00 27.86 ? 360 GLU A CG    1 
ATOM   2835 C CD    . GLU A 1 361 ? -32.498 74.827  17.552  1.00 29.14 ? 360 GLU A CD    1 
ATOM   2836 O OE1   . GLU A 1 361 ? -31.415 74.486  18.010  1.00 30.09 ? 360 GLU A OE1   1 
ATOM   2837 O OE2   . GLU A 1 361 ? -33.526 74.147  17.775  1.00 28.95 ? 360 GLU A OE2   1 
ATOM   2838 N N     . SER A 1 362 ? -32.430 76.062  12.337  1.00 29.48 ? 361 SER A N     1 
ATOM   2839 C CA    . SER A 1 362 ? -32.409 75.336  11.085  1.00 27.41 ? 361 SER A CA    1 
ATOM   2840 C C     . SER A 1 362 ? -31.893 73.942  11.361  1.00 28.22 ? 361 SER A C     1 
ATOM   2841 O O     . SER A 1 362 ? -31.233 73.774  12.432  1.00 28.23 ? 361 SER A O     1 
ATOM   2842 C CB    . SER A 1 362 ? -31.347 76.004  10.249  1.00 27.94 ? 361 SER A CB    1 
ATOM   2843 O OG    . SER A 1 362 ? -30.087 75.806  10.903  1.00 27.17 ? 361 SER A OG    1 
ATOM   2844 N N     . TYR A 1 363 ? -32.056 72.997  10.387  1.00 27.43 ? 362 TYR A N     1 
ATOM   2845 C CA    . TYR A 1 363 ? -31.387 71.671  10.416  1.00 27.25 ? 362 TYR A CA    1 
ATOM   2846 C C     . TYR A 1 363 ? -29.902 71.829  10.585  1.00 27.30 ? 362 TYR A C     1 
ATOM   2847 O O     . TYR A 1 363 ? -29.236 71.020  11.268  1.00 28.45 ? 362 TYR A O     1 
ATOM   2848 C CB    . TYR A 1 363 ? -31.677 70.790  9.166   1.00 27.46 ? 362 TYR A CB    1 
ATOM   2849 C CG    . TYR A 1 363 ? -33.026 70.167  9.216   1.00 27.62 ? 362 TYR A CG    1 
ATOM   2850 C CD1   . TYR A 1 363 ? -34.180 70.942  8.959   1.00 27.85 ? 362 TYR A CD1   1 
ATOM   2851 C CD2   . TYR A 1 363 ? -33.181 68.832  9.618   1.00 25.46 ? 362 TYR A CD2   1 
ATOM   2852 C CE1   . TYR A 1 363 ? -35.445 70.386  9.051   1.00 30.62 ? 362 TYR A CE1   1 
ATOM   2853 C CE2   . TYR A 1 363 ? -34.444 68.257  9.731   1.00 27.89 ? 362 TYR A CE2   1 
ATOM   2854 C CZ    . TYR A 1 363 ? -35.575 69.026  9.445   1.00 30.19 ? 362 TYR A CZ    1 
ATOM   2855 O OH    . TYR A 1 363 ? -36.848 68.459  9.580   1.00 31.00 ? 362 TYR A OH    1 
ATOM   2856 N N     . GLN A 1 364 ? -29.355 72.878  10.017  1.00 26.90 ? 363 GLN A N     1 
ATOM   2857 C CA    . GLN A 1 364 ? -27.928 73.119  10.231  1.00 29.58 ? 363 GLN A CA    1 
ATOM   2858 C C     . GLN A 1 364 ? -27.550 73.269  11.726  1.00 29.57 ? 363 GLN A C     1 
ATOM   2859 O O     . GLN A 1 364 ? -26.473 72.747  12.214  1.00 29.58 ? 363 GLN A O     1 
ATOM   2860 C CB    . GLN A 1 364 ? -27.425 74.291  9.376   1.00 28.22 ? 363 GLN A CB    1 
ATOM   2861 C CG    . GLN A 1 364 ? -25.998 74.609  9.632   1.00 31.41 ? 363 GLN A CG    1 
ATOM   2862 C CD    . GLN A 1 364 ? -25.476 75.809  8.804   1.00 34.69 ? 363 GLN A CD    1 
ATOM   2863 O OE1   . GLN A 1 364 ? -24.308 75.801  8.359   1.00 42.32 ? 363 GLN A OE1   1 
ATOM   2864 N NE2   . GLN A 1 364 ? -26.346 76.793  8.529   1.00 35.95 ? 363 GLN A NE2   1 
ATOM   2865 N N     . ASP A 1 365 ? -28.432 73.951  12.468  1.00 29.44 ? 364 ASP A N     1 
ATOM   2866 C CA    . ASP A 1 365 ? -28.175 74.190  13.883  1.00 28.56 ? 364 ASP A CA    1 
ATOM   2867 C C     . ASP A 1 365 ? -28.273 72.907  14.625  1.00 28.03 ? 364 ASP A C     1 
ATOM   2868 O O     . ASP A 1 365 ? -27.484 72.711  15.586  1.00 29.19 ? 364 ASP A O     1 
ATOM   2869 C CB    . ASP A 1 365 ? -29.190 75.194  14.514  1.00 29.49 ? 364 ASP A CB    1 
ATOM   2870 C CG    . ASP A 1 365 ? -29.161 76.545  13.887  1.00 27.99 ? 364 ASP A CG    1 
ATOM   2871 O OD1   . ASP A 1 365 ? -28.082 76.902  13.440  1.00 27.50 ? 364 ASP A OD1   1 
ATOM   2872 O OD2   . ASP A 1 365 ? -30.232 77.216  13.801  1.00 33.01 ? 364 ASP A OD2   1 
ATOM   2873 N N     . LEU A 1 366 ? -29.286 72.083  14.281  1.00 27.21 ? 365 LEU A N     1 
ATOM   2874 C CA    . LEU A 1 366 ? -29.446 70.772  14.935  1.00 28.57 ? 365 LEU A CA    1 
ATOM   2875 C C     . LEU A 1 366 ? -28.200 69.907  14.834  1.00 28.06 ? 365 LEU A C     1 
ATOM   2876 O O     . LEU A 1 366 ? -27.829 69.216  15.830  1.00 27.25 ? 365 LEU A O     1 
ATOM   2877 C CB    . LEU A 1 366 ? -30.556 69.945  14.359  1.00 29.43 ? 365 LEU A CB    1 
ATOM   2878 C CG    . LEU A 1 366 ? -31.975 70.254  14.702  1.00 34.01 ? 365 LEU A CG    1 
ATOM   2879 C CD1   . LEU A 1 366 ? -32.812 69.264  13.872  1.00 31.44 ? 365 LEU A CD1   1 
ATOM   2880 C CD2   . LEU A 1 366 ? -32.164 70.071  16.213  1.00 36.22 ? 365 LEU A CD2   1 
ATOM   2881 N N     . VAL A 1 367 ? -27.550 69.959  13.665  1.00 29.15 ? 366 VAL A N     1 
ATOM   2882 C CA    . VAL A 1 367 ? -26.310 69.189  13.465  1.00 31.13 ? 366 VAL A CA    1 
ATOM   2883 C C     . VAL A 1 367 ? -25.307 69.553  14.529  1.00 32.33 ? 366 VAL A C     1 
ATOM   2884 O O     . VAL A 1 367 ? -24.754 68.698  15.239  1.00 34.05 ? 366 VAL A O     1 
ATOM   2885 C CB    . VAL A 1 367 ? -25.726 69.322  12.046  1.00 32.15 ? 366 VAL A CB    1 
ATOM   2886 C CG1   . VAL A 1 367 ? -24.279 68.730  11.986  1.00 31.35 ? 366 VAL A CG1   1 
ATOM   2887 C CG2   . VAL A 1 367 ? -26.676 68.641  11.051  1.00 29.60 ? 366 VAL A CG2   1 
ATOM   2888 N N     . GLN A 1 368 ? -25.162 70.835  14.725  1.00 32.49 ? 367 GLN A N     1 
ATOM   2889 C CA    . GLN A 1 368 ? -24.176 71.342  15.596  1.00 32.83 ? 367 GLN A CA    1 
ATOM   2890 C C     . GLN A 1 368 ? -24.531 71.066  17.066  1.00 32.84 ? 367 GLN A C     1 
ATOM   2891 O O     . GLN A 1 368 ? -23.623 70.781  17.842  1.00 33.80 ? 367 GLN A O     1 
ATOM   2892 C CB    . GLN A 1 368 ? -24.069 72.818  15.304  1.00 33.31 ? 367 GLN A CB    1 
ATOM   2893 C CG    . GLN A 1 368 ? -23.256 73.505  16.329  1.00 44.23 ? 367 GLN A CG    1 
ATOM   2894 C CD    . GLN A 1 368 ? -22.197 74.320  15.640  1.00 55.73 ? 367 GLN A CD    1 
ATOM   2895 O OE1   . GLN A 1 368 ? -21.042 73.875  15.450  1.00 58.70 ? 367 GLN A OE1   1 
ATOM   2896 N NE2   . GLN A 1 368 ? -22.596 75.511  15.196  1.00 57.30 ? 367 GLN A NE2   1 
ATOM   2897 N N     . ARG A 1 369 ? -25.798 71.164  17.496  1.00 30.48 ? 368 ARG A N     1 
ATOM   2898 C CA    . ARG A 1 369 ? -26.063 70.767  18.864  1.00 29.22 ? 368 ARG A CA    1 
ATOM   2899 C C     . ARG A 1 369 ? -25.922 69.225  18.965  1.00 28.34 ? 368 ARG A C     1 
ATOM   2900 O O     . ARG A 1 369 ? -25.798 68.690  20.052  1.00 26.90 ? 368 ARG A O     1 
ATOM   2901 C CB    . ARG A 1 369 ? -27.556 70.904  19.175  1.00 30.83 ? 368 ARG A CB    1 
ATOM   2902 C CG    . ARG A 1 369 ? -28.206 72.164  19.339  1.00 31.56 ? 368 ARG A CG    1 
ATOM   2903 C CD    . ARG A 1 369 ? -29.514 71.831  20.011  1.00 31.78 ? 368 ARG A CD    1 
ATOM   2904 N NE    . ARG A 1 369 ? -30.793 72.175  19.346  1.00 28.20 ? 368 ARG A NE    1 
ATOM   2905 C CZ    . ARG A 1 369 ? -31.879 71.405  19.415  1.00 23.78 ? 368 ARG A CZ    1 
ATOM   2906 N NH1   . ARG A 1 369 ? -31.853 70.238  20.048  1.00 21.02 ? 368 ARG A NH1   1 
ATOM   2907 N NH2   . ARG A 1 369 ? -33.001 71.803  18.896  1.00 26.99 ? 368 ARG A NH2   1 
ATOM   2908 N N     . LEU A 1 370 ? -26.146 68.486  17.875  1.00 27.33 ? 369 LEU A N     1 
ATOM   2909 C CA    . LEU A 1 370 ? -26.177 67.002  18.027  1.00 27.35 ? 369 LEU A CA    1 
ATOM   2910 C C     . LEU A 1 370 ? -24.795 66.376  17.978  1.00 28.30 ? 369 LEU A C     1 
ATOM   2911 O O     . LEU A 1 370 ? -24.605 65.221  18.381  1.00 29.55 ? 369 LEU A O     1 
ATOM   2912 C CB    . LEU A 1 370 ? -27.134 66.312  17.034  1.00 25.25 ? 369 LEU A CB    1 
ATOM   2913 C CG    . LEU A 1 370 ? -28.623 66.590  17.251  1.00 26.22 ? 369 LEU A CG    1 
ATOM   2914 C CD1   . LEU A 1 370 ? -29.500 66.311  16.015  1.00 19.15 ? 369 LEU A CD1   1 
ATOM   2915 C CD2   . LEU A 1 370 ? -29.131 65.810  18.546  1.00 23.02 ? 369 LEU A CD2   1 
ATOM   2916 N N     . GLU A 1 371 ? -23.791 67.112  17.535  1.00 29.46 ? 370 GLU A N     1 
ATOM   2917 C CA    . GLU A 1 371 ? -22.500 66.455  17.471  1.00 30.93 ? 370 GLU A CA    1 
ATOM   2918 C C     . GLU A 1 371 ? -22.075 65.834  18.788  1.00 29.01 ? 370 GLU A C     1 
ATOM   2919 O O     . GLU A 1 371 ? -21.556 64.755  18.763  1.00 31.17 ? 370 GLU A O     1 
ATOM   2920 C CB    . GLU A 1 371 ? -21.429 67.324  16.807  1.00 31.25 ? 370 GLU A CB    1 
ATOM   2921 C CG    . GLU A 1 371 ? -20.438 67.810  17.791  1.00 41.18 ? 370 GLU A CG    1 
ATOM   2922 C CD    . GLU A 1 371 ? -19.216 66.968  17.789  1.00 49.31 ? 370 GLU A CD    1 
ATOM   2923 O OE1   . GLU A 1 371 ? -18.869 66.516  16.678  1.00 53.16 ? 370 GLU A OE1   1 
ATOM   2924 O OE2   . GLU A 1 371 ? -18.616 66.766  18.883  1.00 55.10 ? 370 GLU A OE2   1 
ATOM   2925 N N     . PRO A 1 372 ? -22.247 66.505  19.950  1.00 28.27 ? 371 PRO A N     1 
ATOM   2926 C CA    . PRO A 1 372 ? -21.830 65.706  21.130  1.00 26.65 ? 371 PRO A CA    1 
ATOM   2927 C C     . PRO A 1 372 ? -22.677 64.457  21.408  1.00 27.78 ? 371 PRO A C     1 
ATOM   2928 O O     . PRO A 1 372 ? -22.182 63.478  22.037  1.00 26.60 ? 371 PRO A O     1 
ATOM   2929 C CB    . PRO A 1 372 ? -21.858 66.701  22.323  1.00 26.62 ? 371 PRO A CB    1 
ATOM   2930 C CG    . PRO A 1 372 ? -22.091 68.092  21.769  1.00 23.87 ? 371 PRO A CG    1 
ATOM   2931 C CD    . PRO A 1 372 ? -22.615 67.909  20.293  1.00 27.76 ? 371 PRO A CD    1 
ATOM   2932 N N     . VAL A 1 373 ? -23.922 64.441  20.918  1.00 27.72 ? 372 VAL A N     1 
ATOM   2933 C CA    . VAL A 1 373 ? -24.726 63.225  21.053  1.00 27.15 ? 372 VAL A CA    1 
ATOM   2934 C C     . VAL A 1 373 ? -24.130 62.119  20.199  1.00 27.91 ? 372 VAL A C     1 
ATOM   2935 O O     . VAL A 1 373 ? -23.955 61.005  20.691  1.00 28.26 ? 372 VAL A O     1 
ATOM   2936 C CB    . VAL A 1 373 ? -26.207 63.519  20.691  1.00 28.54 ? 372 VAL A CB    1 
ATOM   2937 C CG1   . VAL A 1 373 ? -27.083 62.247  20.602  1.00 23.74 ? 372 VAL A CG1   1 
ATOM   2938 C CG2   . VAL A 1 373 ? -26.737 64.501  21.660  1.00 24.81 ? 372 VAL A CG2   1 
ATOM   2939 N N     . ILE A 1 374 ? -23.774 62.440  18.952  1.00 27.44 ? 373 ILE A N     1 
ATOM   2940 C CA    . ILE A 1 374 ? -23.143 61.510  18.007  1.00 28.35 ? 373 ILE A CA    1 
ATOM   2941 C C     . ILE A 1 374 ? -21.821 60.988  18.592  1.00 30.50 ? 373 ILE A C     1 
ATOM   2942 O O     . ILE A 1 374 ? -21.516 59.795  18.570  1.00 29.21 ? 373 ILE A O     1 
ATOM   2943 C CB    . ILE A 1 374 ? -22.809 62.252  16.695  1.00 29.61 ? 373 ILE A CB    1 
ATOM   2944 C CG1   . ILE A 1 374 ? -24.058 62.461  15.814  1.00 27.62 ? 373 ILE A CG1   1 
ATOM   2945 C CG2   . ILE A 1 374 ? -21.774 61.575  15.942  1.00 27.38 ? 373 ILE A CG2   1 
ATOM   2946 C CD1   . ILE A 1 374 ? -24.944 61.266  15.836  1.00 33.35 ? 373 ILE A CD1   1 
ATOM   2947 N N     . MET A 1 375 ? -21.043 61.906  19.138  1.00 31.32 ? 374 MET A N     1 
ATOM   2948 C CA    . MET A 1 375 ? -19.768 61.543  19.684  1.00 33.02 ? 374 MET A CA    1 
ATOM   2949 C C     . MET A 1 375 ? -19.890 60.585  20.867  1.00 33.02 ? 374 MET A C     1 
ATOM   2950 O O     . MET A 1 375 ? -19.025 59.712  21.064  1.00 32.96 ? 374 MET A O     1 
ATOM   2951 C CB    . MET A 1 375 ? -18.997 62.819  20.068  1.00 33.57 ? 374 MET A CB    1 
ATOM   2952 C CG    . MET A 1 375 ? -17.537 62.571  20.201  1.00 36.46 ? 374 MET A CG    1 
ATOM   2953 S SD    . MET A 1 375 ? -16.660 62.230  18.616  1.00 40.21 ? 374 MET A SD    1 
ATOM   2954 C CE    . MET A 1 375 ? -15.961 63.834  18.216  1.00 46.43 ? 374 MET A CE    1 
ATOM   2955 N N     . GLU A 1 376 ? -20.939 60.737  21.675  1.00 32.23 ? 375 GLU A N     1 
ATOM   2956 C CA    . GLU A 1 376 ? -21.167 59.800  22.771  1.00 31.28 ? 375 GLU A CA    1 
ATOM   2957 C C     . GLU A 1 376 ? -21.806 58.489  22.214  1.00 32.13 ? 375 GLU A C     1 
ATOM   2958 O O     . GLU A 1 376 ? -21.550 57.394  22.700  1.00 32.03 ? 375 GLU A O     1 
ATOM   2959 C CB    . GLU A 1 376 ? -22.057 60.461  23.835  1.00 30.58 ? 375 GLU A CB    1 
ATOM   2960 C CG    . GLU A 1 376 ? -22.193 59.700  25.123  1.00 30.40 ? 375 GLU A CG    1 
ATOM   2961 C CD    . GLU A 1 376 ? -20.869 59.405  25.844  1.00 32.85 ? 375 GLU A CD    1 
ATOM   2962 O OE1   . GLU A 1 376 ? -19.923 60.164  25.788  1.00 38.77 ? 375 GLU A OE1   1 
ATOM   2963 O OE2   . GLU A 1 376 ? -20.756 58.409  26.534  1.00 39.41 ? 375 GLU A OE2   1 
ATOM   2964 N N     . LEU A 1 377 ? -22.611 58.589  21.157  1.00 32.19 ? 376 LEU A N     1 
ATOM   2965 C CA    . LEU A 1 377 ? -23.142 57.370  20.547  1.00 31.11 ? 376 LEU A CA    1 
ATOM   2966 C C     . LEU A 1 377 ? -21.955 56.501  20.120  1.00 31.59 ? 376 LEU A C     1 
ATOM   2967 O O     . LEU A 1 377 ? -21.993 55.266  20.292  1.00 33.62 ? 376 LEU A O     1 
ATOM   2968 C CB    . LEU A 1 377 ? -24.114 57.690  19.386  1.00 29.99 ? 376 LEU A CB    1 
ATOM   2969 C CG    . LEU A 1 377 ? -25.510 58.084  19.906  1.00 29.28 ? 376 LEU A CG    1 
ATOM   2970 C CD1   . LEU A 1 377 ? -26.429 58.515  18.845  1.00 25.23 ? 376 LEU A CD1   1 
ATOM   2971 C CD2   . LEU A 1 377 ? -26.162 56.894  20.661  1.00 31.27 ? 376 LEU A CD2   1 
ATOM   2972 N N     . GLU A 1 378 ? -20.894 57.128  19.624  1.00 30.20 ? 377 GLU A N     1 
ATOM   2973 C CA    . GLU A 1 378 ? -19.774 56.396  19.071  1.00 30.37 ? 377 GLU A CA    1 
ATOM   2974 C C     . GLU A 1 378 ? -19.063 55.652  20.189  1.00 31.08 ? 377 GLU A C     1 
ATOM   2975 O O     . GLU A 1 378 ? -18.540 54.595  19.937  1.00 31.35 ? 377 GLU A O     1 
ATOM   2976 C CB    . GLU A 1 378 ? -18.792 57.315  18.347  1.00 29.79 ? 377 GLU A CB    1 
ATOM   2977 C CG    . GLU A 1 378 ? -19.195 57.782  16.949  1.00 29.86 ? 377 GLU A CG    1 
ATOM   2978 C CD    . GLU A 1 378 ? -19.543 56.613  15.947  1.00 32.82 ? 377 GLU A CD    1 
ATOM   2979 O OE1   . GLU A 1 378 ? -19.073 55.454  16.179  1.00 27.77 ? 377 GLU A OE1   1 
ATOM   2980 O OE2   . GLU A 1 378 ? -20.275 56.880  14.938  1.00 26.32 ? 377 GLU A OE2   1 
ATOM   2981 N N     . ARG A 1 379 ? -19.095 56.176  21.420  1.00 31.13 ? 378 ARG A N     1 
ATOM   2982 C CA    . ARG A 1 379 ? -18.343 55.596  22.530  1.00 32.16 ? 378 ARG A CA    1 
ATOM   2983 C C     . ARG A 1 379 ? -19.127 54.454  23.143  1.00 33.15 ? 378 ARG A C     1 
ATOM   2984 O O     . ARG A 1 379 ? -18.565 53.585  23.836  1.00 31.87 ? 378 ARG A O     1 
ATOM   2985 C CB    . ARG A 1 379 ? -18.093 56.597  23.695  1.00 31.33 ? 378 ARG A CB    1 
ATOM   2986 C CG    . ARG A 1 379 ? -17.075 57.807  23.484  1.00 33.70 ? 378 ARG A CG    1 
ATOM   2987 C CD    . ARG A 1 379 ? -16.439 58.330  24.852  1.00 33.22 ? 378 ARG A CD    1 
ATOM   2988 N NE    . ARG A 1 379 ? -15.861 57.205  25.654  1.00 40.91 ? 378 ARG A NE    1 
ATOM   2989 C CZ    . ARG A 1 379 ? -14.646 56.627  25.465  1.00 43.69 ? 378 ARG A CZ    1 
ATOM   2990 N NH1   . ARG A 1 379 ? -13.784 57.061  24.512  1.00 41.03 ? 378 ARG A NH1   1 
ATOM   2991 N NH2   . ARG A 1 379 ? -14.286 55.571  26.217  1.00 40.60 ? 378 ARG A NH2   1 
ATOM   2992 N N     . GLN A 1 380 ? -20.454 54.497  22.980  1.00 33.92 ? 379 GLN A N     1 
ATOM   2993 C CA    . GLN A 1 380 ? -21.316 53.585  23.717  1.00 32.92 ? 379 GLN A CA    1 
ATOM   2994 C C     . GLN A 1 380 ? -21.433 52.229  23.020  1.00 33.45 ? 379 GLN A C     1 
ATOM   2995 O O     . GLN A 1 380 ? -20.849 51.994  21.949  1.00 33.02 ? 379 GLN A O     1 
ATOM   2996 C CB    . GLN A 1 380 ? -22.683 54.202  23.904  1.00 32.85 ? 379 GLN A CB    1 
ATOM   2997 C CG    . GLN A 1 380 ? -22.791 55.343  24.895  1.00 36.00 ? 379 GLN A CG    1 
ATOM   2998 C CD    . GLN A 1 380 ? -22.616 54.955  26.356  1.00 43.53 ? 379 GLN A CD    1 
ATOM   2999 O OE1   . GLN A 1 380 ? -21.753 55.500  27.019  1.00 47.25 ? 379 GLN A OE1   1 
ATOM   3000 N NE2   . GLN A 1 380 ? -23.462 54.049  26.883  1.00 48.06 ? 379 GLN A NE2   1 
ATOM   3001 N N     . GLU A 1 381 ? -22.198 51.344  23.647  1.00 34.43 ? 380 GLU A N     1 
ATOM   3002 C CA    . GLU A 1 381 ? -22.533 50.061  23.102  1.00 36.39 ? 380 GLU A CA    1 
ATOM   3003 C C     . GLU A 1 381 ? -24.035 50.054  22.766  1.00 35.17 ? 380 GLU A C     1 
ATOM   3004 O O     . GLU A 1 381 ? -24.407 50.605  21.794  1.00 35.63 ? 380 GLU A O     1 
ATOM   3005 C CB    . GLU A 1 381 ? -22.172 48.935  24.088  1.00 37.07 ? 380 GLU A CB    1 
ATOM   3006 C CG    . GLU A 1 381 ? -20.876 49.153  24.832  1.00 46.47 ? 380 GLU A CG    1 
ATOM   3007 C CD    . GLU A 1 381 ? -20.083 47.867  25.014  1.00 54.90 ? 380 GLU A CD    1 
ATOM   3008 O OE1   . GLU A 1 381 ? -20.764 46.816  25.175  1.00 59.73 ? 380 GLU A OE1   1 
ATOM   3009 O OE2   . GLU A 1 381 ? -18.811 47.907  24.984  1.00 55.20 ? 380 GLU A OE2   1 
ATOM   3010 N N     . ASN A 1 382 ? -24.898 49.429  23.555  1.00 34.26 ? 381 ASN A N     1 
ATOM   3011 C CA    . ASN A 1 382 ? -26.315 49.454  23.218  1.00 34.26 ? 381 ASN A CA    1 
ATOM   3012 C C     . ASN A 1 382 ? -26.969 50.725  23.670  1.00 32.64 ? 381 ASN A C     1 
ATOM   3013 O O     . ASN A 1 382 ? -26.915 51.030  24.861  1.00 33.60 ? 381 ASN A O     1 
ATOM   3014 C CB    . ASN A 1 382 ? -27.065 48.198  23.741  1.00 34.17 ? 381 ASN A CB    1 
ATOM   3015 C CG    . ASN A 1 382 ? -26.413 46.913  23.249  1.00 37.36 ? 381 ASN A CG    1 
ATOM   3016 O OD1   . ASN A 1 382 ? -25.927 46.858  22.090  1.00 39.88 ? 381 ASN A OD1   1 
ATOM   3017 N ND2   . ASN A 1 382 ? -26.331 45.900  24.128  1.00 33.46 ? 381 ASN A ND2   1 
ATOM   3018 N N     . VAL A 1 383 ? -27.616 51.441  22.746  1.00 30.64 ? 382 VAL A N     1 
ATOM   3019 C CA    . VAL A 1 383 ? -28.347 52.661  23.107  1.00 30.45 ? 382 VAL A CA    1 
ATOM   3020 C C     . VAL A 1 383 ? -29.680 52.739  22.380  1.00 30.41 ? 382 VAL A C     1 
ATOM   3021 O O     . VAL A 1 383 ? -29.755 52.529  21.161  1.00 30.92 ? 382 VAL A O     1 
ATOM   3022 C CB    . VAL A 1 383 ? -27.543 53.996  22.794  1.00 30.72 ? 382 VAL A CB    1 
ATOM   3023 C CG1   . VAL A 1 383 ? -28.294 55.194  23.402  1.00 30.77 ? 382 VAL A CG1   1 
ATOM   3024 C CG2   . VAL A 1 383 ? -26.169 53.954  23.397  1.00 29.46 ? 382 VAL A CG2   1 
ATOM   3025 N N     . LEU A 1 384 ? -30.724 53.068  23.128  1.00 29.71 ? 383 LEU A N     1 
ATOM   3026 C CA    . LEU A 1 384 ? -32.010 53.469  22.565  1.00 28.17 ? 383 LEU A CA    1 
ATOM   3027 C C     . LEU A 1 384 ? -32.143 54.981  22.723  1.00 28.25 ? 383 LEU A C     1 
ATOM   3028 O O     . LEU A 1 384 ? -32.044 55.475  23.842  1.00 28.88 ? 383 LEU A O     1 
ATOM   3029 C CB    . LEU A 1 384 ? -33.124 52.825  23.374  1.00 27.53 ? 383 LEU A CB    1 
ATOM   3030 C CG    . LEU A 1 384 ? -34.536 53.351  23.102  1.00 26.81 ? 383 LEU A CG    1 
ATOM   3031 C CD1   . LEU A 1 384 ? -34.901 53.284  21.622  1.00 22.46 ? 383 LEU A CD1   1 
ATOM   3032 C CD2   . LEU A 1 384 ? -35.505 52.619  23.913  1.00 22.32 ? 383 LEU A CD2   1 
ATOM   3033 N N     . VAL A 1 385 ? -32.400 55.712  21.637  1.00 27.11 ? 384 VAL A N     1 
ATOM   3034 C CA    . VAL A 1 385 ? -32.500 57.148  21.711  1.00 25.30 ? 384 VAL A CA    1 
ATOM   3035 C C     . VAL A 1 385 ? -33.922 57.443  21.330  1.00 26.15 ? 384 VAL A C     1 
ATOM   3036 O O     . VAL A 1 385 ? -34.294 57.143  20.205  1.00 27.61 ? 384 VAL A O     1 
ATOM   3037 C CB    . VAL A 1 385 ? -31.581 57.836  20.667  1.00 25.72 ? 384 VAL A CB    1 
ATOM   3038 C CG1   . VAL A 1 385 ? -31.758 59.368  20.696  1.00 19.02 ? 384 VAL A CG1   1 
ATOM   3039 C CG2   . VAL A 1 385 ? -30.156 57.508  20.986  1.00 23.89 ? 384 VAL A CG2   1 
ATOM   3040 N N     . ILE A 1 386 ? -34.712 58.020  22.232  1.00 23.99 ? 385 ILE A N     1 
ATOM   3041 C CA    . ILE A 1 386 ? -36.071 58.389  21.940  1.00 24.02 ? 385 ILE A CA    1 
ATOM   3042 C C     . ILE A 1 386 ? -36.195 59.908  21.710  1.00 24.42 ? 385 ILE A C     1 
ATOM   3043 O O     . ILE A 1 386 ? -35.952 60.698  22.617  1.00 23.39 ? 385 ILE A O     1 
ATOM   3044 C CB    . ILE A 1 386 ? -36.961 58.023  23.176  1.00 24.19 ? 385 ILE A CB    1 
ATOM   3045 C CG1   . ILE A 1 386 ? -36.897 56.528  23.478  1.00 25.10 ? 385 ILE A CG1   1 
ATOM   3046 C CG2   . ILE A 1 386 ? -38.360 58.512  23.030  1.00 20.40 ? 385 ILE A CG2   1 
ATOM   3047 C CD1   . ILE A 1 386 ? -37.215 56.159  24.975  1.00 25.34 ? 385 ILE A CD1   1 
ATOM   3048 N N     . CYS A 1 387 ? -36.652 60.343  20.543  1.00 25.24 ? 386 CYS A N     1 
ATOM   3049 C CA    . CYS A 1 387 ? -36.497 61.767  20.255  1.00 26.49 ? 386 CYS A CA    1 
ATOM   3050 C C     . CYS A 1 387 ? -37.625 62.340  19.411  1.00 26.90 ? 386 CYS A C     1 
ATOM   3051 O O     . CYS A 1 387 ? -38.782 62.153  19.787  1.00 26.27 ? 386 CYS A O     1 
ATOM   3052 C CB    . CYS A 1 387 ? -35.113 62.097  19.691  1.00 25.45 ? 386 CYS A CB    1 
ATOM   3053 S SG    . CYS A 1 387 ? -34.631 61.094  18.224  1.00 29.58 ? 386 CYS A SG    1 
ATOM   3054 N N     . HIS A 1 388 ? -37.297 63.081  18.349  1.00 26.73 ? 387 HIS A N     1 
ATOM   3055 C CA    . HIS A 1 388 ? -38.305 63.843  17.616  1.00 27.63 ? 387 HIS A CA    1 
ATOM   3056 C C     . HIS A 1 388 ? -37.974 63.877  16.131  1.00 29.15 ? 387 HIS A C     1 
ATOM   3057 O O     . HIS A 1 388 ? -36.849 63.595  15.721  1.00 30.56 ? 387 HIS A O     1 
ATOM   3058 C CB    . HIS A 1 388 ? -38.319 65.291  18.089  1.00 27.49 ? 387 HIS A CB    1 
ATOM   3059 C CG    . HIS A 1 388 ? -38.468 65.440  19.563  1.00 26.77 ? 387 HIS A CG    1 
ATOM   3060 N ND1   . HIS A 1 388 ? -39.687 65.638  20.162  1.00 30.93 ? 387 HIS A ND1   1 
ATOM   3061 C CD2   . HIS A 1 388 ? -37.557 65.453  20.562  1.00 25.65 ? 387 HIS A CD2   1 
ATOM   3062 C CE1   . HIS A 1 388 ? -39.528 65.765  21.469  1.00 27.46 ? 387 HIS A CE1   1 
ATOM   3063 N NE2   . HIS A 1 388 ? -38.250 65.612  21.740  1.00 25.57 ? 387 HIS A NE2   1 
ATOM   3064 N N     . GLN A 1 389 ? -38.929 64.287  15.314  1.00 29.57 ? 388 GLN A N     1 
ATOM   3065 C CA    . GLN A 1 389 ? -38.752 64.130  13.890  1.00 28.72 ? 388 GLN A CA    1 
ATOM   3066 C C     . GLN A 1 389 ? -37.474 64.692  13.295  1.00 28.40 ? 388 GLN A C     1 
ATOM   3067 O O     . GLN A 1 389 ? -36.716 63.969  12.650  1.00 28.06 ? 388 GLN A O     1 
ATOM   3068 C CB    . GLN A 1 389 ? -39.965 64.651  13.124  1.00 29.07 ? 388 GLN A CB    1 
ATOM   3069 C CG    . GLN A 1 389 ? -40.002 64.240  11.658  1.00 28.31 ? 388 GLN A CG    1 
ATOM   3070 C CD    . GLN A 1 389 ? -41.353 64.497  11.062  1.00 34.76 ? 388 GLN A CD    1 
ATOM   3071 O OE1   . GLN A 1 389 ? -41.997 63.558  10.589  1.00 34.44 ? 388 GLN A OE1   1 
ATOM   3072 N NE2   . GLN A 1 389 ? -41.841 65.767  11.140  1.00 32.09 ? 388 GLN A NE2   1 
ATOM   3073 N N     . ALA A 1 390 ? -37.268 65.998  13.447  1.00 28.20 ? 389 ALA A N     1 
ATOM   3074 C CA    . ALA A 1 390 ? -36.121 66.655  12.823  1.00 26.98 ? 389 ALA A CA    1 
ATOM   3075 C C     . ALA A 1 390 ? -34.829 66.127  13.409  1.00 27.50 ? 389 ALA A C     1 
ATOM   3076 O O     . ALA A 1 390 ? -33.865 65.816  12.683  1.00 28.01 ? 389 ALA A O     1 
ATOM   3077 C CB    . ALA A 1 390 ? -36.225 68.089  13.007  1.00 26.69 ? 389 ALA A CB    1 
ATOM   3078 N N     . VAL A 1 391 ? -34.815 65.968  14.724  1.00 26.80 ? 390 VAL A N     1 
ATOM   3079 C CA    . VAL A 1 391 ? -33.664 65.433  15.383  1.00 26.79 ? 390 VAL A CA    1 
ATOM   3080 C C     . VAL A 1 391 ? -33.285 64.042  14.838  1.00 28.08 ? 390 VAL A C     1 
ATOM   3081 O O     . VAL A 1 391 ? -32.136 63.762  14.442  1.00 27.09 ? 390 VAL A O     1 
ATOM   3082 C CB    . VAL A 1 391 ? -33.949 65.407  16.913  1.00 27.25 ? 390 VAL A CB    1 
ATOM   3083 C CG1   . VAL A 1 391 ? -32.988 64.448  17.633  1.00 25.27 ? 390 VAL A CG1   1 
ATOM   3084 C CG2   . VAL A 1 391 ? -33.833 66.846  17.453  1.00 23.18 ? 390 VAL A CG2   1 
ATOM   3085 N N     . LEU A 1 392 ? -34.293 63.170  14.802  1.00 29.04 ? 391 LEU A N     1 
ATOM   3086 C CA    . LEU A 1 392 ? -34.131 61.820  14.295  1.00 29.17 ? 391 LEU A CA    1 
ATOM   3087 C C     . LEU A 1 392 ? -33.561 61.837  12.819  1.00 28.58 ? 391 LEU A C     1 
ATOM   3088 O O     . LEU A 1 392 ? -32.528 61.193  12.530  1.00 28.67 ? 391 LEU A O     1 
ATOM   3089 C CB    . LEU A 1 392 ? -35.455 61.076  14.456  1.00 29.40 ? 391 LEU A CB    1 
ATOM   3090 C CG    . LEU A 1 392 ? -35.581 59.579  14.180  1.00 31.21 ? 391 LEU A CG    1 
ATOM   3091 C CD1   . LEU A 1 392 ? -34.201 58.946  14.047  1.00 33.71 ? 391 LEU A CD1   1 
ATOM   3092 C CD2   . LEU A 1 392 ? -36.454 58.839  15.232  1.00 28.65 ? 391 LEU A CD2   1 
ATOM   3093 N N     . ARG A 1 393 ? -34.176 62.610  11.935  1.00 26.71 ? 392 ARG A N     1 
ATOM   3094 C CA    . ARG A 1 393 ? -33.622 62.812  10.595  1.00 26.30 ? 392 ARG A CA    1 
ATOM   3095 C C     . ARG A 1 393 ? -32.119 63.130  10.688  1.00 27.28 ? 392 ARG A C     1 
ATOM   3096 O O     . ARG A 1 393 ? -31.274 62.481  10.000  1.00 26.00 ? 392 ARG A O     1 
ATOM   3097 C CB    . ARG A 1 393 ? -34.342 63.944  9.864   1.00 25.36 ? 392 ARG A CB    1 
ATOM   3098 C CG    . ARG A 1 393 ? -35.808 63.729  9.727   1.00 22.64 ? 392 ARG A CG    1 
ATOM   3099 C CD    . ARG A 1 393 ? -36.439 64.778  8.857   1.00 28.45 ? 392 ARG A CD    1 
ATOM   3100 N NE    . ARG A 1 393 ? -37.742 64.339  8.355   1.00 29.16 ? 392 ARG A NE    1 
ATOM   3101 C CZ    . ARG A 1 393 ? -38.812 65.114  8.260   1.00 34.36 ? 392 ARG A CZ    1 
ATOM   3102 N NH1   . ARG A 1 393 ? -38.793 66.388  8.651   1.00 37.21 ? 392 ARG A NH1   1 
ATOM   3103 N NH2   . ARG A 1 393 ? -39.929 64.605  7.790   1.00 38.32 ? 392 ARG A NH2   1 
ATOM   3104 N N     . CYS A 1 394 ? -31.757 64.068  11.584  1.00 27.18 ? 393 CYS A N     1 
ATOM   3105 C CA    A CYS A 1 394 ? -30.342 64.508  11.645  0.50 26.35 ? 393 CYS A CA    1 
ATOM   3106 C CA    B CYS A 1 394 ? -30.362 64.538  11.650  0.50 27.17 ? 393 CYS A CA    1 
ATOM   3107 C C     . CYS A 1 394 ? -29.395 63.420  12.069  1.00 26.82 ? 393 CYS A C     1 
ATOM   3108 O O     . CYS A 1 394 ? -28.303 63.293  11.531  1.00 27.77 ? 393 CYS A O     1 
ATOM   3109 C CB    A CYS A 1 394 ? -30.149 65.723  12.522  0.50 25.86 ? 393 CYS A CB    1 
ATOM   3110 C CB    B CYS A 1 394 ? -30.258 65.790  12.524  0.50 26.87 ? 393 CYS A CB    1 
ATOM   3111 S SG    A CYS A 1 394 ? -31.020 67.082  11.896  0.50 21.72 ? 393 CYS A SG    1 
ATOM   3112 S SG    B CYS A 1 394 ? -28.647 66.565  12.622  0.50 27.55 ? 393 CYS A SG    1 
ATOM   3113 N N     . LEU A 1 395 ? -29.805 62.620  13.025  1.00 27.65 ? 394 LEU A N     1 
ATOM   3114 C CA    . LEU A 1 395 ? -28.956 61.516  13.508  1.00 28.38 ? 394 LEU A CA    1 
ATOM   3115 C C     . LEU A 1 395 ? -28.912 60.433  12.411  1.00 30.40 ? 394 LEU A C     1 
ATOM   3116 O O     . LEU A 1 395 ? -27.831 59.851  12.160  1.00 30.45 ? 394 LEU A O     1 
ATOM   3117 C CB    . LEU A 1 395 ? -29.562 60.879  14.775  1.00 26.55 ? 394 LEU A CB    1 
ATOM   3118 C CG    . LEU A 1 395 ? -29.588 61.772  16.016  1.00 27.62 ? 394 LEU A CG    1 
ATOM   3119 C CD1   . LEU A 1 395 ? -30.368 61.176  17.169  1.00 20.02 ? 394 LEU A CD1   1 
ATOM   3120 C CD2   . LEU A 1 395 ? -28.158 62.168  16.445  1.00 24.28 ? 394 LEU A CD2   1 
ATOM   3121 N N     . LEU A 1 396 ? -30.082 60.137  11.793  1.00 29.53 ? 395 LEU A N     1 
ATOM   3122 C CA    . LEU A 1 396 ? -30.156 59.081  10.787  1.00 30.19 ? 395 LEU A CA    1 
ATOM   3123 C C     . LEU A 1 396 ? -29.240 59.469  9.624   1.00 30.08 ? 395 LEU A C     1 
ATOM   3124 O O     . LEU A 1 396 ? -28.440 58.659  9.191   1.00 30.44 ? 395 LEU A O     1 
ATOM   3125 C CB    . LEU A 1 396 ? -31.595 58.922  10.294  1.00 29.02 ? 395 LEU A CB    1 
ATOM   3126 C CG    . LEU A 1 396 ? -31.813 57.594  9.559   1.00 34.43 ? 395 LEU A CG    1 
ATOM   3127 C CD1   . LEU A 1 396 ? -31.668 56.386  10.506  1.00 30.70 ? 395 LEU A CD1   1 
ATOM   3128 C CD2   . LEU A 1 396 ? -33.182 57.516  8.813   1.00 34.26 ? 395 LEU A CD2   1 
ATOM   3129 N N     . ALA A 1 397 ? -29.332 60.722  9.142   1.00 30.10 ? 396 ALA A N     1 
ATOM   3130 C CA    . ALA A 1 397 ? -28.416 61.212  8.140   1.00 30.64 ? 396 ALA A CA    1 
ATOM   3131 C C     . ALA A 1 397 ? -26.982 60.944  8.523   1.00 30.66 ? 396 ALA A C     1 
ATOM   3132 O O     . ALA A 1 397 ? -26.167 60.541  7.661   1.00 31.58 ? 396 ALA A O     1 
ATOM   3133 C CB    . ALA A 1 397 ? -28.606 62.693  7.802   1.00 31.23 ? 396 ALA A CB    1 
ATOM   3134 N N     . TYR A 1 398 ? -26.638 61.091  9.790   1.00 28.95 ? 397 TYR A N     1 
ATOM   3135 C CA    . TYR A 1 398 ? -25.242 60.732  10.062  1.00 28.96 ? 397 TYR A CA    1 
ATOM   3136 C C     . TYR A 1 398 ? -24.940 59.207  9.918   1.00 29.26 ? 397 TYR A C     1 
ATOM   3137 O O     . TYR A 1 398 ? -23.895 58.820  9.359   1.00 29.03 ? 397 TYR A O     1 
ATOM   3138 C CB    . TYR A 1 398 ? -24.817 61.247  11.432  1.00 27.52 ? 397 TYR A CB    1 
ATOM   3139 C CG    . TYR A 1 398 ? -23.588 60.620  11.988  1.00 26.29 ? 397 TYR A CG    1 
ATOM   3140 C CD1   . TYR A 1 398 ? -22.299 61.118  11.639  1.00 23.22 ? 397 TYR A CD1   1 
ATOM   3141 C CD2   . TYR A 1 398 ? -23.674 59.570  12.905  1.00 24.66 ? 397 TYR A CD2   1 
ATOM   3142 C CE1   . TYR A 1 398 ? -21.123 60.591  12.218  1.00 22.46 ? 397 TYR A CE1   1 
ATOM   3143 C CE2   . TYR A 1 398 ? -22.498 59.030  13.462  1.00 23.97 ? 397 TYR A CE2   1 
ATOM   3144 C CZ    . TYR A 1 398 ? -21.233 59.537  13.106  1.00 24.02 ? 397 TYR A CZ    1 
ATOM   3145 O OH    . TYR A 1 398 ? -20.080 58.982  13.624  1.00 26.10 ? 397 TYR A OH    1 
ATOM   3146 N N     . PHE A 1 399 ? -25.806 58.354  10.468  1.00 29.06 ? 398 PHE A N     1 
ATOM   3147 C CA    . PHE A 1 399 ? -25.554 56.952  10.408  1.00 31.22 ? 398 PHE A CA    1 
ATOM   3148 C C     . PHE A 1 399 ? -25.653 56.394  8.965   1.00 32.80 ? 398 PHE A C     1 
ATOM   3149 O O     . PHE A 1 399 ? -24.827 55.574  8.543   1.00 33.16 ? 398 PHE A O     1 
ATOM   3150 C CB    . PHE A 1 399 ? -26.408 56.213  11.418  1.00 31.65 ? 398 PHE A CB    1 
ATOM   3151 C CG    . PHE A 1 399 ? -25.996 56.471  12.854  1.00 31.80 ? 398 PHE A CG    1 
ATOM   3152 C CD1   . PHE A 1 399 ? -24.860 55.867  13.384  1.00 31.07 ? 398 PHE A CD1   1 
ATOM   3153 C CD2   . PHE A 1 399 ? -26.752 57.314  13.677  1.00 31.23 ? 398 PHE A CD2   1 
ATOM   3154 C CE1   . PHE A 1 399 ? -24.490 56.090  14.716  1.00 31.10 ? 398 PHE A CE1   1 
ATOM   3155 C CE2   . PHE A 1 399 ? -26.392 57.533  15.035  1.00 28.05 ? 398 PHE A CE2   1 
ATOM   3156 C CZ    . PHE A 1 399 ? -25.266 56.915  15.533  1.00 30.00 ? 398 PHE A CZ    1 
ATOM   3157 N N     . LEU A 1 400 ? -26.601 56.897  8.181   1.00 33.19 ? 399 LEU A N     1 
ATOM   3158 C CA    . LEU A 1 400 ? -26.805 56.383  6.813   1.00 33.49 ? 399 LEU A CA    1 
ATOM   3159 C C     . LEU A 1 400 ? -26.130 57.238  5.754   1.00 34.78 ? 399 LEU A C     1 
ATOM   3160 O O     . LEU A 1 400 ? -26.496 57.178  4.556   1.00 35.51 ? 399 LEU A O     1 
ATOM   3161 C CB    . LEU A 1 400 ? -28.292 56.341  6.520   1.00 32.07 ? 399 LEU A CB    1 
ATOM   3162 C CG    . LEU A 1 400 ? -28.961 55.022  6.921   1.00 35.43 ? 399 LEU A CG    1 
ATOM   3163 C CD1   . LEU A 1 400 ? -28.229 54.172  8.046   1.00 29.68 ? 399 LEU A CD1   1 
ATOM   3164 C CD2   . LEU A 1 400 ? -30.462 55.248  7.174   1.00 29.30 ? 399 LEU A CD2   1 
ATOM   3165 N N     . ASP A 1 401 ? -25.214 58.106  6.182   1.00 35.25 ? 400 ASP A N     1 
ATOM   3166 C CA    . ASP A 1 401 ? -24.473 58.933  5.256   1.00 36.14 ? 400 ASP A CA    1 
ATOM   3167 C C     . ASP A 1 401 ? -25.379 59.748  4.289   1.00 37.14 ? 400 ASP A C     1 
ATOM   3168 O O     . ASP A 1 401 ? -25.110 59.838  3.114   1.00 37.96 ? 400 ASP A O     1 
ATOM   3169 C CB    . ASP A 1 401 ? -23.405 58.069  4.512   1.00 35.03 ? 400 ASP A CB    1 
ATOM   3170 C CG    . ASP A 1 401 ? -22.374 58.918  3.748   1.00 38.79 ? 400 ASP A CG    1 
ATOM   3171 O OD1   . ASP A 1 401 ? -22.198 60.151  3.988   1.00 42.07 ? 400 ASP A OD1   1 
ATOM   3172 O OD2   . ASP A 1 401 ? -21.745 58.379  2.843   1.00 42.99 ? 400 ASP A OD2   1 
ATOM   3173 N N     . LYS A 1 402 ? -26.433 60.379  4.777   1.00 37.27 ? 401 LYS A N     1 
ATOM   3174 C CA    . LYS A 1 402 ? -27.254 61.182  3.885   1.00 37.21 ? 401 LYS A CA    1 
ATOM   3175 C C     . LYS A 1 402 ? -26.807 62.645  3.765   1.00 37.83 ? 401 LYS A C     1 
ATOM   3176 O O     . LYS A 1 402 ? -26.424 63.255  4.712   1.00 38.65 ? 401 LYS A O     1 
ATOM   3177 C CB    . LYS A 1 402 ? -28.706 61.105  4.318   1.00 37.55 ? 401 LYS A CB    1 
ATOM   3178 C CG    . LYS A 1 402 ? -29.226 59.658  4.477   1.00 36.84 ? 401 LYS A CG    1 
ATOM   3179 C CD    . LYS A 1 402 ? -29.006 58.907  3.172   1.00 41.75 ? 401 LYS A CD    1 
ATOM   3180 C CE    . LYS A 1 402 ? -29.964 57.723  2.991   1.00 47.46 ? 401 LYS A CE    1 
ATOM   3181 N NZ    . LYS A 1 402 ? -29.406 56.606  2.135   1.00 49.93 ? 401 LYS A NZ    1 
ATOM   3182 N N     . SER A 1 403 ? -26.901 63.238  2.597   1.00 37.64 ? 402 SER A N     1 
ATOM   3183 C CA    . SER A 1 403 ? -26.429 64.581  2.444   1.00 37.94 ? 402 SER A CA    1 
ATOM   3184 C C     . SER A 1 403 ? -27.337 65.619  3.197   1.00 38.18 ? 402 SER A C     1 
ATOM   3185 O O     . SER A 1 403 ? -28.503 65.312  3.568   1.00 37.56 ? 402 SER A O     1 
ATOM   3186 C CB    . SER A 1 403 ? -26.429 64.910  0.943   1.00 36.89 ? 402 SER A CB    1 
ATOM   3187 O OG    . SER A 1 403 ? -27.791 65.028  0.531   1.00 37.59 ? 402 SER A OG    1 
ATOM   3188 N N     . ALA A 1 404 ? -26.818 66.850  3.341   1.00 37.45 ? 403 ALA A N     1 
ATOM   3189 C CA    . ALA A 1 404 ? -27.591 67.971  3.877   1.00 38.64 ? 403 ALA A CA    1 
ATOM   3190 C C     . ALA A 1 404 ? -28.892 68.154  3.124   1.00 39.53 ? 403 ALA A C     1 
ATOM   3191 O O     . ALA A 1 404 ? -29.918 68.483  3.676   1.00 40.01 ? 403 ALA A O     1 
ATOM   3192 C CB    . ALA A 1 404 ? -26.775 69.300  3.818   1.00 37.69 ? 403 ALA A CB    1 
ATOM   3193 N N     . GLU A 1 405 ? -28.837 67.923  1.842   1.00 41.14 ? 404 GLU A N     1 
ATOM   3194 C CA    . GLU A 1 405 ? -29.938 68.248  1.031   1.00 42.63 ? 404 GLU A CA    1 
ATOM   3195 C C     . GLU A 1 405 ? -31.035 67.197  1.218   1.00 41.38 ? 404 GLU A C     1 
ATOM   3196 O O     . GLU A 1 405 ? -32.211 67.554  1.230   1.00 40.69 ? 404 GLU A O     1 
ATOM   3197 C CB    . GLU A 1 405 ? -29.455 68.341  -0.417  1.00 44.00 ? 404 GLU A CB    1 
ATOM   3198 C CG    . GLU A 1 405 ? -30.351 69.180  -1.322  1.00 51.50 ? 404 GLU A CG    1 
ATOM   3199 C CD    . GLU A 1 405 ? -30.282 68.670  -2.788  1.00 64.13 ? 404 GLU A CD    1 
ATOM   3200 O OE1   . GLU A 1 405 ? -29.156 68.215  -3.190  1.00 68.71 ? 404 GLU A OE1   1 
ATOM   3201 O OE2   . GLU A 1 405 ? -31.331 68.698  -3.515  1.00 64.51 ? 404 GLU A OE2   1 
ATOM   3202 N N     . GLU A 1 406 ? -30.677 65.916  1.389   1.00 40.74 ? 405 GLU A N     1 
ATOM   3203 C CA    . GLU A 1 406 ? -31.744 64.907  1.620   1.00 41.24 ? 405 GLU A CA    1 
ATOM   3204 C C     . GLU A 1 406 ? -32.223 64.806  3.113   1.00 39.47 ? 405 GLU A C     1 
ATOM   3205 O O     . GLU A 1 406 ? -33.387 64.449  3.386   1.00 39.17 ? 405 GLU A O     1 
ATOM   3206 C CB    . GLU A 1 406 ? -31.485 63.555  0.897   1.00 40.11 ? 405 GLU A CB    1 
ATOM   3207 C CG    . GLU A 1 406 ? -30.221 62.877  1.340   1.00 46.30 ? 405 GLU A CG    1 
ATOM   3208 C CD    . GLU A 1 406 ? -29.649 61.800  0.365   1.00 46.21 ? 405 GLU A CD    1 
ATOM   3209 O OE1   . GLU A 1 406 ? -30.435 61.163  -0.370  1.00 52.39 ? 405 GLU A OE1   1 
ATOM   3210 O OE2   . GLU A 1 406 ? -28.402 61.570  0.379   1.00 48.67 ? 405 GLU A OE2   1 
ATOM   3211 N N     . MET A 1 407 ? -31.366 65.227  4.064   1.00 38.05 ? 406 MET A N     1 
ATOM   3212 C CA    . MET A 1 407 ? -31.671 65.083  5.504   1.00 35.38 ? 406 MET A CA    1 
ATOM   3213 C C     . MET A 1 407 ? -33.041 65.642  6.032   1.00 34.48 ? 406 MET A C     1 
ATOM   3214 O O     . MET A 1 407 ? -33.705 64.969  6.781   1.00 32.71 ? 406 MET A O     1 
ATOM   3215 C CB    . MET A 1 407 ? -30.505 65.575  6.332   1.00 36.54 ? 406 MET A CB    1 
ATOM   3216 C CG    . MET A 1 407 ? -30.850 65.861  7.793   1.00 36.05 ? 406 MET A CG    1 
ATOM   3217 S SD    . MET A 1 407 ? -29.490 66.753  8.573   1.00 35.44 ? 406 MET A SD    1 
ATOM   3218 C CE    . MET A 1 407 ? -28.019 65.945  7.867   1.00 31.04 ? 406 MET A CE    1 
ATOM   3219 N N     . PRO A 1 408 ? -33.461 66.863  5.617   1.00 33.04 ? 407 PRO A N     1 
ATOM   3220 C CA    . PRO A 1 408 ? -34.771 67.391  6.076   1.00 32.54 ? 407 PRO A CA    1 
ATOM   3221 C C     . PRO A 1 408 ? -35.994 66.588  5.571   1.00 32.10 ? 407 PRO A C     1 
ATOM   3222 O O     . PRO A 1 408 ? -37.139 66.860  5.982   1.00 31.72 ? 407 PRO A O     1 
ATOM   3223 C CB    . PRO A 1 408 ? -34.815 68.817  5.492   1.00 32.31 ? 407 PRO A CB    1 
ATOM   3224 C CG    . PRO A 1 408 ? -33.391 69.073  4.977   1.00 33.54 ? 407 PRO A CG    1 
ATOM   3225 C CD    . PRO A 1 408 ? -32.718 67.791  4.754   1.00 31.65 ? 407 PRO A CD    1 
ATOM   3226 N N     . TYR A 1 409 ? -35.757 65.644  4.657   1.00 31.26 ? 408 TYR A N     1 
ATOM   3227 C CA    . TYR A 1 409 ? -36.838 64.957  3.992   1.00 31.53 ? 408 TYR A CA    1 
ATOM   3228 C C     . TYR A 1 409 ? -36.799 63.483  4.331   1.00 31.95 ? 408 TYR A C     1 
ATOM   3229 O O     . TYR A 1 409 ? -37.629 62.753  3.846   1.00 33.40 ? 408 TYR A O     1 
ATOM   3230 C CB    . TYR A 1 409 ? -36.795 65.153  2.446   1.00 31.90 ? 408 TYR A CB    1 
ATOM   3231 C CG    . TYR A 1 409 ? -37.019 66.576  2.079   1.00 30.44 ? 408 TYR A CG    1 
ATOM   3232 C CD1   . TYR A 1 409 ? -38.258 67.177  2.249   1.00 32.47 ? 408 TYR A CD1   1 
ATOM   3233 C CD2   . TYR A 1 409 ? -35.975 67.357  1.699   1.00 32.69 ? 408 TYR A CD2   1 
ATOM   3234 C CE1   . TYR A 1 409 ? -38.459 68.535  1.969   1.00 32.85 ? 408 TYR A CE1   1 
ATOM   3235 C CE2   . TYR A 1 409 ? -36.158 68.711  1.406   1.00 32.55 ? 408 TYR A CE2   1 
ATOM   3236 C CZ    . TYR A 1 409 ? -37.385 69.277  1.523   1.00 32.53 ? 408 TYR A CZ    1 
ATOM   3237 O OH    . TYR A 1 409 ? -37.474 70.622  1.261   1.00 34.71 ? 408 TYR A OH    1 
ATOM   3238 N N     . LEU A 1 410 ? -35.847 63.015  5.125   1.00 31.37 ? 409 LEU A N     1 
ATOM   3239 C CA    . LEU A 1 410 ? -35.890 61.611  5.439   1.00 32.22 ? 409 LEU A CA    1 
ATOM   3240 C C     . LEU A 1 410 ? -37.194 61.232  6.148   1.00 34.17 ? 409 LEU A C     1 
ATOM   3241 O O     . LEU A 1 410 ? -37.754 62.028  6.901   1.00 36.78 ? 409 LEU A O     1 
ATOM   3242 C CB    . LEU A 1 410 ? -34.713 61.191  6.286   1.00 30.72 ? 409 LEU A CB    1 
ATOM   3243 C CG    . LEU A 1 410 ? -33.344 61.384  5.735   1.00 29.92 ? 409 LEU A CG    1 
ATOM   3244 C CD1   . LEU A 1 410 ? -32.330 61.061  6.896   1.00 22.34 ? 409 LEU A CD1   1 
ATOM   3245 C CD2   . LEU A 1 410 ? -33.117 60.542  4.432   1.00 25.01 ? 409 LEU A CD2   1 
ATOM   3246 N N     . LYS A 1 411 ? -37.663 60.005  5.940   1.00 35.56 ? 410 LYS A N     1 
ATOM   3247 C CA    . LYS A 1 411 ? -38.918 59.554  6.516   1.00 36.50 ? 410 LYS A CA    1 
ATOM   3248 C C     . LYS A 1 411 ? -38.618 58.956  7.837   1.00 34.90 ? 410 LYS A C     1 
ATOM   3249 O O     . LYS A 1 411 ? -37.811 58.035  7.910   1.00 34.04 ? 410 LYS A O     1 
ATOM   3250 C CB    . LYS A 1 411 ? -39.557 58.512  5.604   1.00 37.36 ? 410 LYS A CB    1 
ATOM   3251 C CG    . LYS A 1 411 ? -40.582 59.168  4.634   1.00 40.69 ? 410 LYS A CG    1 
ATOM   3252 C CD    . LYS A 1 411 ? -41.044 58.218  3.486   1.00 39.87 ? 410 LYS A CD    1 
ATOM   3253 C CE    . LYS A 1 411 ? -42.063 58.919  2.584   1.00 44.30 ? 410 LYS A CE    1 
ATOM   3254 N NZ    . LYS A 1 411 ? -42.572 57.859  1.631   1.00 53.48 ? 410 LYS A NZ    1 
ATOM   3255 N N     . CYS A 1 412 ? -39.252 59.477  8.882   1.00 34.31 ? 411 CYS A N     1 
ATOM   3256 C CA    . CYS A 1 412 ? -38.967 59.047  10.272  1.00 34.93 ? 411 CYS A CA    1 
ATOM   3257 C C     . CYS A 1 412 ? -40.331 58.991  10.950  1.00 35.74 ? 411 CYS A C     1 
ATOM   3258 O O     . CYS A 1 412 ? -40.718 59.914  11.659  1.00 35.98 ? 411 CYS A O     1 
ATOM   3259 C CB    . CYS A 1 412 ? -38.025 60.026  10.973  1.00 33.34 ? 411 CYS A CB    1 
ATOM   3260 S SG    . CYS A 1 412 ? -36.355 60.080  10.200  1.00 35.81 ? 411 CYS A SG    1 
ATOM   3261 N N     . PRO A 1 413 ? -41.118 57.937  10.646  1.00 36.58 ? 412 PRO A N     1 
ATOM   3262 C CA    . PRO A 1 413 ? -42.524 57.979  11.133  1.00 35.76 ? 412 PRO A CA    1 
ATOM   3263 C C     . PRO A 1 413 ? -42.628 57.704  12.612  1.00 34.69 ? 412 PRO A C     1 
ATOM   3264 O O     . PRO A 1 413 ? -41.725 57.143  13.225  1.00 33.91 ? 412 PRO A O     1 
ATOM   3265 C CB    . PRO A 1 413 ? -43.186 56.838  10.350  1.00 37.27 ? 412 PRO A CB    1 
ATOM   3266 C CG    . PRO A 1 413 ? -42.018 55.915  9.925   1.00 36.47 ? 412 PRO A CG    1 
ATOM   3267 C CD    . PRO A 1 413 ? -40.825 56.761  9.783   1.00 34.86 ? 412 PRO A CD    1 
ATOM   3268 N N     . LEU A 1 414 ? -43.750 58.094  13.180  1.00 34.87 ? 413 LEU A N     1 
ATOM   3269 C CA    . LEU A 1 414 ? -44.078 57.720  14.537  1.00 33.89 ? 413 LEU A CA    1 
ATOM   3270 C C     . LEU A 1 414 ? -44.161 56.227  14.742  1.00 34.94 ? 413 LEU A C     1 
ATOM   3271 O O     . LEU A 1 414 ? -44.469 55.464  13.830  1.00 36.40 ? 413 LEU A O     1 
ATOM   3272 C CB    . LEU A 1 414 ? -45.375 58.369  14.889  1.00 32.23 ? 413 LEU A CB    1 
ATOM   3273 C CG    . LEU A 1 414 ? -45.263 59.869  15.076  1.00 34.15 ? 413 LEU A CG    1 
ATOM   3274 C CD1   . LEU A 1 414 ? -46.595 60.431  14.928  1.00 35.42 ? 413 LEU A CD1   1 
ATOM   3275 C CD2   . LEU A 1 414 ? -44.712 60.236  16.532  1.00 36.55 ? 413 LEU A CD2   1 
ATOM   3276 N N     . HIS A 1 415 ? -43.886 55.794  15.954  1.00 35.29 ? 414 HIS A N     1 
ATOM   3277 C CA    . HIS A 1 415 ? -44.177 54.436  16.376  1.00 36.11 ? 414 HIS A CA    1 
ATOM   3278 C C     . HIS A 1 415 ? -43.307 53.376  15.699  1.00 36.17 ? 414 HIS A C     1 
ATOM   3279 O O     . HIS A 1 415 ? -43.615 52.153  15.725  1.00 36.90 ? 414 HIS A O     1 
ATOM   3280 C CB    . HIS A 1 415 ? -45.678 54.080  16.331  1.00 35.51 ? 414 HIS A CB    1 
ATOM   3281 C CG    . HIS A 1 415 ? -46.519 54.976  17.161  1.00 39.66 ? 414 HIS A CG    1 
ATOM   3282 N ND1   . HIS A 1 415 ? -45.981 55.907  18.030  1.00 44.41 ? 414 HIS A ND1   1 
ATOM   3283 C CD2   . HIS A 1 415 ? -47.864 55.114  17.248  1.00 40.51 ? 414 HIS A CD2   1 
ATOM   3284 C CE1   . HIS A 1 415 ? -46.966 56.582  18.607  1.00 42.71 ? 414 HIS A CE1   1 
ATOM   3285 N NE2   . HIS A 1 415 ? -48.116 56.113  18.157  1.00 37.81 ? 414 HIS A NE2   1 
ATOM   3286 N N     . THR A 1 416 ? -42.156 53.819  15.226  1.00 35.54 ? 415 THR A N     1 
ATOM   3287 C CA    . THR A 1 416 ? -41.278 52.971  14.460  1.00 34.13 ? 415 THR A CA    1 
ATOM   3288 C C     . THR A 1 416 ? -39.852 53.073  14.993  1.00 33.96 ? 415 THR A C     1 
ATOM   3289 O O     . THR A 1 416 ? -39.287 54.164  15.091  1.00 34.82 ? 415 THR A O     1 
ATOM   3290 C CB    . THR A 1 416 ? -41.436 53.437  12.995  1.00 34.40 ? 415 THR A CB    1 
ATOM   3291 O OG1   . THR A 1 416 ? -42.848 53.494  12.680  1.00 30.49 ? 415 THR A OG1   1 
ATOM   3292 C CG2   . THR A 1 416 ? -40.720 52.541  12.034  1.00 35.59 ? 415 THR A CG2   1 
ATOM   3293 N N     . VAL A 1 417 ? -39.263 51.942  15.351  1.00 33.57 ? 416 VAL A N     1 
ATOM   3294 C CA    . VAL A 1 417 ? -37.870 51.878  15.733  1.00 33.02 ? 416 VAL A CA    1 
ATOM   3295 C C     . VAL A 1 417 ? -36.980 51.711  14.495  1.00 35.20 ? 416 VAL A C     1 
ATOM   3296 O O     . VAL A 1 417 ? -37.291 50.897  13.648  1.00 37.43 ? 416 VAL A O     1 
ATOM   3297 C CB    . VAL A 1 417 ? -37.684 50.698  16.646  1.00 32.20 ? 416 VAL A CB    1 
ATOM   3298 C CG1   . VAL A 1 417 ? -36.213 50.502  17.115  1.00 31.45 ? 416 VAL A CG1   1 
ATOM   3299 C CG2   . VAL A 1 417 ? -38.571 50.825  17.796  1.00 28.86 ? 416 VAL A CG2   1 
ATOM   3300 N N     . LEU A 1 418 ? -35.904 52.482  14.359  1.00 35.68 ? 417 LEU A N     1 
ATOM   3301 C CA    . LEU A 1 418 ? -34.882 52.215  13.382  1.00 35.96 ? 417 LEU A CA    1 
ATOM   3302 C C     . LEU A 1 418 ? -33.805 51.539  14.166  1.00 36.61 ? 417 LEU A C     1 
ATOM   3303 O O     . LEU A 1 418 ? -33.323 52.085  15.207  1.00 38.13 ? 417 LEU A O     1 
ATOM   3304 C CB    . LEU A 1 418 ? -34.369 53.510  12.773  1.00 36.55 ? 417 LEU A CB    1 
ATOM   3305 C CG    . LEU A 1 418 ? -35.535 54.235  12.092  1.00 41.85 ? 417 LEU A CG    1 
ATOM   3306 C CD1   . LEU A 1 418 ? -35.145 55.569  11.415  1.00 40.86 ? 417 LEU A CD1   1 
ATOM   3307 C CD2   . LEU A 1 418 ? -36.293 53.260  11.056  1.00 44.14 ? 417 LEU A CD2   1 
ATOM   3308 N N     . LYS A 1 419 ? -33.454 50.327  13.751  1.00 35.77 ? 418 LYS A N     1 
ATOM   3309 C CA    . LYS A 1 419 ? -32.494 49.551  14.479  1.00 35.24 ? 418 LYS A CA    1 
ATOM   3310 C C     . LYS A 1 419 ? -31.256 49.523  13.580  1.00 36.89 ? 418 LYS A C     1 
ATOM   3311 O O     . LYS A 1 419 ? -31.351 49.110  12.412  1.00 38.39 ? 418 LYS A O     1 
ATOM   3312 C CB    . LYS A 1 419 ? -33.037 48.189  14.695  1.00 34.29 ? 418 LYS A CB    1 
ATOM   3313 C CG    . LYS A 1 419 ? -31.992 47.160  15.158  1.00 36.28 ? 418 LYS A CG    1 
ATOM   3314 C CD    . LYS A 1 419 ? -32.668 45.809  15.400  1.00 34.39 ? 418 LYS A CD    1 
ATOM   3315 C CE    . LYS A 1 419 ? -31.709 44.687  15.484  1.00 37.06 ? 418 LYS A CE    1 
ATOM   3316 N NZ    . LYS A 1 419 ? -32.272 43.437  16.211  1.00 40.95 ? 418 LYS A NZ    1 
ATOM   3317 N N     . LEU A 1 420 ? -30.126 50.013  14.095  1.00 36.38 ? 419 LEU A N     1 
ATOM   3318 C CA    . LEU A 1 420 ? -28.926 50.216  13.326  1.00 36.26 ? 419 LEU A CA    1 
ATOM   3319 C C     . LEU A 1 420 ? -27.868 49.262  13.827  1.00 37.14 ? 419 LEU A C     1 
ATOM   3320 O O     . LEU A 1 420 ? -27.585 49.282  15.002  1.00 36.69 ? 419 LEU A O     1 
ATOM   3321 C CB    . LEU A 1 420 ? -28.456 51.662  13.489  1.00 35.76 ? 419 LEU A CB    1 
ATOM   3322 C CG    . LEU A 1 420 ? -29.355 52.774  12.953  1.00 35.13 ? 419 LEU A CG    1 
ATOM   3323 C CD1   . LEU A 1 420 ? -28.766 54.006  13.384  1.00 34.58 ? 419 LEU A CD1   1 
ATOM   3324 C CD2   . LEU A 1 420 ? -29.461 52.783  11.414  1.00 36.46 ? 419 LEU A CD2   1 
ATOM   3325 N N     . THR A 1 421 ? -27.311 48.414  12.956  1.00 38.61 ? 420 THR A N     1 
ATOM   3326 C CA    . THR A 1 421 ? -26.257 47.462  13.344  1.00 41.13 ? 420 THR A CA    1 
ATOM   3327 C C     . THR A 1 421 ? -25.076 47.655  12.410  1.00 43.44 ? 420 THR A C     1 
ATOM   3328 O O     . THR A 1 421 ? -25.268 47.902  11.226  1.00 42.87 ? 420 THR A O     1 
ATOM   3329 C CB    . THR A 1 421 ? -26.750 46.016  13.186  1.00 41.01 ? 420 THR A CB    1 
ATOM   3330 O OG1   . THR A 1 421 ? -27.385 45.911  11.903  1.00 47.50 ? 420 THR A OG1   1 
ATOM   3331 C CG2   . THR A 1 421 ? -27.808 45.691  14.155  1.00 37.43 ? 420 THR A CG2   1 
ATOM   3332 N N     . PRO A 1 422 ? -23.836 47.616  12.939  1.00 47.38 ? 421 PRO A N     1 
ATOM   3333 C CA    . PRO A 1 422 ? -22.643 47.829  12.063  1.00 48.90 ? 421 PRO A CA    1 
ATOM   3334 C C     . PRO A 1 422 ? -22.409 46.667  11.174  1.00 51.15 ? 421 PRO A C     1 
ATOM   3335 O O     . PRO A 1 422 ? -22.349 45.554  11.643  1.00 53.46 ? 421 PRO A O     1 
ATOM   3336 C CB    . PRO A 1 422 ? -21.489 47.852  13.039  1.00 48.83 ? 421 PRO A CB    1 
ATOM   3337 C CG    . PRO A 1 422 ? -21.968 46.928  14.198  1.00 49.39 ? 421 PRO A CG    1 
ATOM   3338 C CD    . PRO A 1 422 ? -23.429 47.444  14.358  1.00 48.06 ? 421 PRO A CD    1 
ATOM   3339 N N     . VAL A 1 423 ? -22.299 46.899  9.886   1.00 52.88 ? 422 VAL A N     1 
ATOM   3340 C CA    . VAL A 1 423 ? -21.862 45.858  9.013   1.00 53.58 ? 422 VAL A CA    1 
ATOM   3341 C C     . VAL A 1 423 ? -20.876 46.430  7.994   1.00 53.07 ? 422 VAL A C     1 
ATOM   3342 O O     . VAL A 1 423 ? -21.146 47.495  7.394   1.00 52.70 ? 422 VAL A O     1 
ATOM   3343 C CB    . VAL A 1 423 ? -23.045 45.134  8.290   1.00 54.72 ? 422 VAL A CB    1 
ATOM   3344 C CG1   . VAL A 1 423 ? -23.776 46.072  7.223   1.00 54.17 ? 422 VAL A CG1   1 
ATOM   3345 C CG2   . VAL A 1 423 ? -22.517 43.845  7.604   1.00 55.37 ? 422 VAL A CG2   1 
ATOM   3346 N N     . ALA A 1 424 ? -19.785 45.676  7.770   1.00 52.20 ? 423 ALA A N     1 
ATOM   3347 C CA    . ALA A 1 424 ? -18.734 46.017  6.796   1.00 51.27 ? 423 ALA A CA    1 
ATOM   3348 C C     . ALA A 1 424 ? -18.302 47.440  7.078   1.00 50.25 ? 423 ALA A C     1 
ATOM   3349 O O     . ALA A 1 424 ? -17.820 47.695  8.161   1.00 51.21 ? 423 ALA A O     1 
ATOM   3350 C CB    . ALA A 1 424 ? -19.210 45.831  5.341   1.00 50.22 ? 423 ALA A CB    1 
ATOM   3351 N N     . TYR A 1 425 ? -18.555 48.356  6.147   1.00 49.52 ? 424 TYR A N     1 
ATOM   3352 C CA    . TYR A 1 425 ? -18.099 49.757  6.195   1.00 48.78 ? 424 TYR A CA    1 
ATOM   3353 C C     . TYR A 1 425 ? -19.091 50.837  6.700   1.00 49.14 ? 424 TYR A C     1 
ATOM   3354 O O     . TYR A 1 425 ? -18.710 52.002  6.790   1.00 50.50 ? 424 TYR A O     1 
ATOM   3355 C CB    . TYR A 1 425 ? -17.645 50.171  4.802   1.00 47.96 ? 424 TYR A CB    1 
ATOM   3356 C CG    . TYR A 1 425 ? -16.409 49.444  4.328   1.00 47.34 ? 424 TYR A CG    1 
ATOM   3357 C CD1   . TYR A 1 425 ? -15.260 49.462  5.082   1.00 44.63 ? 424 TYR A CD1   1 
ATOM   3358 C CD2   . TYR A 1 425 ? -16.390 48.765  3.126   1.00 46.18 ? 424 TYR A CD2   1 
ATOM   3359 C CE1   . TYR A 1 425 ? -14.126 48.847  4.666   1.00 45.82 ? 424 TYR A CE1   1 
ATOM   3360 C CE2   . TYR A 1 425 ? -15.248 48.131  2.691   1.00 46.91 ? 424 TYR A CE2   1 
ATOM   3361 C CZ    . TYR A 1 425 ? -14.104 48.174  3.486   1.00 47.19 ? 424 TYR A CZ    1 
ATOM   3362 O OH    . TYR A 1 425 ? -12.926 47.517  3.140   1.00 44.90 ? 424 TYR A OH    1 
ATOM   3363 N N     . GLY A 1 426 ? -20.334 50.473  7.032   1.00 48.02 ? 425 GLY A N     1 
ATOM   3364 C CA    . GLY A 1 426 ? -21.296 51.413  7.603   1.00 46.33 ? 425 GLY A CA    1 
ATOM   3365 C C     . GLY A 1 426 ? -22.307 50.750  8.521   1.00 45.85 ? 425 GLY A C     1 
ATOM   3366 O O     . GLY A 1 426 ? -21.964 49.961  9.406   1.00 44.53 ? 425 GLY A O     1 
ATOM   3367 N N     . CYS A 1 427 ? -23.570 51.037  8.275   1.00 46.20 ? 426 CYS A N     1 
ATOM   3368 C CA    . CYS A 1 427 ? -24.647 50.563  9.139   1.00 47.34 ? 426 CYS A CA    1 
ATOM   3369 C C     . CYS A 1 427 ? -25.740 49.966  8.339   1.00 46.60 ? 426 CYS A C     1 
ATOM   3370 O O     . CYS A 1 427 ? -26.190 50.588  7.385   1.00 46.79 ? 426 CYS A O     1 
ATOM   3371 C CB    . CYS A 1 427 ? -25.276 51.738  9.888   1.00 46.74 ? 426 CYS A CB    1 
ATOM   3372 S SG    . CYS A 1 427 ? -24.295 52.136  11.281  1.00 54.47 ? 426 CYS A SG    1 
ATOM   3373 N N     . ARG A 1 428 ? -26.180 48.782  8.736   1.00 45.91 ? 427 ARG A N     1 
ATOM   3374 C CA    . ARG A 1 428 ? -27.456 48.273  8.327   1.00 45.77 ? 427 ARG A CA    1 
ATOM   3375 C C     . ARG A 1 428 ? -28.573 48.988  9.126   1.00 45.37 ? 427 ARG A C     1 
ATOM   3376 O O     . ARG A 1 428 ? -28.484 49.095  10.359  1.00 44.90 ? 427 ARG A O     1 
ATOM   3377 C CB    . ARG A 1 428 ? -27.451 46.810  8.672   1.00 47.20 ? 427 ARG A CB    1 
ATOM   3378 C CG    . ARG A 1 428 ? -28.616 46.046  8.218   1.00 48.64 ? 427 ARG A CG    1 
ATOM   3379 C CD    . ARG A 1 428 ? -28.565 44.726  8.893   1.00 52.48 ? 427 ARG A CD    1 
ATOM   3380 N NE    . ARG A 1 428 ? -29.682 43.972  8.375   1.00 62.91 ? 427 ARG A NE    1 
ATOM   3381 C CZ    . ARG A 1 428 ? -30.334 43.021  9.039   1.00 68.57 ? 427 ARG A CZ    1 
ATOM   3382 N NH1   . ARG A 1 428 ? -29.964 42.698  10.277  1.00 71.10 ? 427 ARG A NH1   1 
ATOM   3383 N NH2   . ARG A 1 428 ? -31.365 42.397  8.461   1.00 69.24 ? 427 ARG A NH2   1 
ATOM   3384 N N     . VAL A 1 429 ? -29.590 49.489  8.421   1.00 43.95 ? 428 VAL A N     1 
ATOM   3385 C CA    . VAL A 1 429 ? -30.847 49.886  9.038   1.00 43.21 ? 428 VAL A CA    1 
ATOM   3386 C C     . VAL A 1 429 ? -31.981 48.818  8.905   1.00 43.07 ? 428 VAL A C     1 
ATOM   3387 O O     . VAL A 1 429 ? -32.233 48.323  7.811   1.00 43.91 ? 428 VAL A O     1 
ATOM   3388 C CB    . VAL A 1 429 ? -31.279 51.262  8.502   1.00 42.59 ? 428 VAL A CB    1 
ATOM   3389 C CG1   . VAL A 1 429 ? -31.594 51.230  7.016   1.00 43.76 ? 428 VAL A CG1   1 
ATOM   3390 C CG2   . VAL A 1 429 ? -32.444 51.815  9.265   1.00 43.63 ? 428 VAL A CG2   1 
ATOM   3391 N N     . GLU A 1 430 ? -32.634 48.422  9.999   1.00 42.13 ? 429 GLU A N     1 
ATOM   3392 C CA    . GLU A 1 430 ? -33.901 47.697  9.889   1.00 42.09 ? 429 GLU A CA    1 
ATOM   3393 C C     . GLU A 1 430 ? -34.944 48.559  10.566  1.00 40.22 ? 429 GLU A C     1 
ATOM   3394 O O     . GLU A 1 430 ? -34.701 49.128  11.636  1.00 40.11 ? 429 GLU A O     1 
ATOM   3395 C CB    . GLU A 1 430 ? -33.980 46.336  10.623  1.00 41.90 ? 429 GLU A CB    1 
ATOM   3396 C CG    . GLU A 1 430 ? -32.863 45.306  10.519  1.00 43.78 ? 429 GLU A CG    1 
ATOM   3397 C CD    . GLU A 1 430 ? -33.062 44.174  11.585  1.00 47.51 ? 429 GLU A CD    1 
ATOM   3398 O OE1   . GLU A 1 430 ? -34.227 43.539  11.707  1.00 44.30 ? 429 GLU A OE1   1 
ATOM   3399 O OE2   . GLU A 1 430 ? -32.012 43.991  12.317  1.00 53.26 ? 429 GLU A OE2   1 
ATOM   3400 N N     . SER A 1 431 ? -36.123 48.606  9.979   1.00 38.22 ? 430 SER A N     1 
ATOM   3401 C CA    . SER A 1 431 ? -37.193 49.388  10.505  1.00 37.14 ? 430 SER A CA    1 
ATOM   3402 C C     . SER A 1 431 ? -38.162 48.397  11.177  1.00 37.23 ? 430 SER A C     1 
ATOM   3403 O O     . SER A 1 431 ? -38.394 47.322  10.640  1.00 38.17 ? 430 SER A O     1 
ATOM   3404 C CB    . SER A 1 431 ? -37.845 50.113  9.354   1.00 35.82 ? 430 SER A CB    1 
ATOM   3405 O OG    . SER A 1 431 ? -39.005 50.797  9.780   1.00 38.13 ? 430 SER A OG    1 
ATOM   3406 N N     . ILE A 1 432 ? -38.676 48.724  12.357  1.00 35.60 ? 431 ILE A N     1 
ATOM   3407 C CA    . ILE A 1 432 ? -39.615 47.869  13.042  1.00 33.40 ? 431 ILE A CA    1 
ATOM   3408 C C     . ILE A 1 432 ? -40.749 48.725  13.594  1.00 34.40 ? 431 ILE A C     1 
ATOM   3409 O O     . ILE A 1 432 ? -40.560 49.492  14.529  1.00 34.36 ? 431 ILE A O     1 
ATOM   3410 C CB    . ILE A 1 432 ? -39.003 47.113  14.181  1.00 33.51 ? 431 ILE A CB    1 
ATOM   3411 C CG1   . ILE A 1 432 ? -37.775 46.260  13.757  1.00 32.83 ? 431 ILE A CG1   1 
ATOM   3412 C CG2   . ILE A 1 432 ? -40.065 46.283  14.831  1.00 29.65 ? 431 ILE A CG2   1 
ATOM   3413 C CD1   . ILE A 1 432 ? -36.434 46.704  14.346  1.00 32.33 ? 431 ILE A CD1   1 
ATOM   3414 N N     . TYR A 1 433 ? -41.925 48.614  12.987  1.00 34.63 ? 432 TYR A N     1 
ATOM   3415 C CA    . TYR A 1 433 ? -43.089 49.342  13.408  1.00 35.28 ? 432 TYR A CA    1 
ATOM   3416 C C     . TYR A 1 433 ? -43.836 48.532  14.491  1.00 35.96 ? 432 TYR A C     1 
ATOM   3417 O O     . TYR A 1 433 ? -43.956 47.297  14.424  1.00 35.08 ? 432 TYR A O     1 
ATOM   3418 C CB    . TYR A 1 433 ? -43.924 49.605  12.182  1.00 36.02 ? 432 TYR A CB    1 
ATOM   3419 C CG    . TYR A 1 433 ? -45.279 50.190  12.426  1.00 38.33 ? 432 TYR A CG    1 
ATOM   3420 C CD1   . TYR A 1 433 ? -45.415 51.453  12.993  1.00 39.01 ? 432 TYR A CD1   1 
ATOM   3421 C CD2   . TYR A 1 433 ? -46.454 49.490  12.036  1.00 37.86 ? 432 TYR A CD2   1 
ATOM   3422 C CE1   . TYR A 1 433 ? -46.680 52.021  13.189  1.00 39.91 ? 432 TYR A CE1   1 
ATOM   3423 C CE2   . TYR A 1 433 ? -47.712 50.031  12.221  1.00 37.26 ? 432 TYR A CE2   1 
ATOM   3424 C CZ    . TYR A 1 433 ? -47.824 51.294  12.799  1.00 40.33 ? 432 TYR A CZ    1 
ATOM   3425 O OH    . TYR A 1 433 ? -49.041 51.854  13.015  1.00 40.05 ? 432 TYR A OH    1 
ATOM   3426 N N     . LEU A 1 434 ? -44.302 49.223  15.520  1.00 36.81 ? 433 LEU A N     1 
ATOM   3427 C CA    . LEU A 1 434 ? -44.835 48.540  16.682  1.00 37.46 ? 433 LEU A CA    1 
ATOM   3428 C C     . LEU A 1 434 ? -46.355 48.534  16.673  1.00 38.14 ? 433 LEU A C     1 
ATOM   3429 O O     . LEU A 1 434 ? -47.014 48.249  17.650  1.00 38.51 ? 433 LEU A O     1 
ATOM   3430 C CB    . LEU A 1 434 ? -44.242 49.083  17.962  1.00 37.04 ? 433 LEU A CB    1 
ATOM   3431 C CG    . LEU A 1 434 ? -42.742 49.068  18.013  1.00 37.64 ? 433 LEU A CG    1 
ATOM   3432 C CD1   . LEU A 1 434 ? -42.341 49.512  19.429  1.00 36.67 ? 433 LEU A CD1   1 
ATOM   3433 C CD2   . LEU A 1 434 ? -42.204 47.641  17.730  1.00 39.09 ? 433 LEU A CD2   1 
ATOM   3434 N N     . ASN A 1 435 ? -46.905 48.803  15.512  1.00 39.72 ? 434 ASN A N     1 
ATOM   3435 C CA    . ASN A 1 435 ? -48.274 48.416  15.259  1.00 40.43 ? 434 ASN A CA    1 
ATOM   3436 C C     . ASN A 1 435 ? -49.241 49.121  16.141  1.00 39.79 ? 434 ASN A C     1 
ATOM   3437 O O     . ASN A 1 435 ? -50.064 48.481  16.773  1.00 40.74 ? 434 ASN A O     1 
ATOM   3438 C CB    . ASN A 1 435 ? -48.417 46.892  15.481  1.00 40.81 ? 434 ASN A CB    1 
ATOM   3439 C CG    . ASN A 1 435 ? -49.686 46.344  14.846  1.00 41.24 ? 434 ASN A CG    1 
ATOM   3440 O OD1   . ASN A 1 435 ? -50.048 46.682  13.704  1.00 36.91 ? 434 ASN A OD1   1 
ATOM   3441 N ND2   . ASN A 1 435 ? -50.385 45.535  15.606  1.00 38.50 ? 434 ASN A ND2   1 
ATOM   3442 N N     . VAL A 1 436 ? -49.110 50.435  16.234  1.00 39.10 ? 435 VAL A N     1 
ATOM   3443 C CA    . VAL A 1 436 ? -50.052 51.244  16.989  1.00 36.87 ? 435 VAL A CA    1 
ATOM   3444 C C     . VAL A 1 436 ? -50.200 52.396  16.068  1.00 38.59 ? 435 VAL A C     1 
ATOM   3445 O O     . VAL A 1 436 ? -49.197 52.908  15.576  1.00 39.71 ? 435 VAL A O     1 
ATOM   3446 C CB    . VAL A 1 436 ? -49.466 51.806  18.352  1.00 36.86 ? 435 VAL A CB    1 
ATOM   3447 C CG1   . VAL A 1 436 ? -50.409 52.930  18.897  1.00 33.01 ? 435 VAL A CG1   1 
ATOM   3448 C CG2   . VAL A 1 436 ? -49.255 50.726  19.391  1.00 28.08 ? 435 VAL A CG2   1 
ATOM   3449 N N     . GLU A 1 437 ? -51.431 52.795  15.796  1.00 39.32 ? 436 GLU A N     1 
ATOM   3450 C CA    . GLU A 1 437 ? -51.698 53.831  14.817  1.00 39.69 ? 436 GLU A CA    1 
ATOM   3451 C C     . GLU A 1 437 ? -51.245 55.181  15.360  1.00 38.87 ? 436 GLU A C     1 
ATOM   3452 O O     . GLU A 1 437 ? -51.166 55.363  16.577  1.00 38.54 ? 436 GLU A O     1 
ATOM   3453 C CB    . GLU A 1 437 ? -53.227 53.944  14.507  1.00 40.33 ? 436 GLU A CB    1 
ATOM   3454 C CG    . GLU A 1 437 ? -53.847 52.974  13.488  1.00 43.38 ? 436 GLU A CG    1 
ATOM   3455 C CD    . GLU A 1 437 ? -53.257 53.129  12.101  1.00 48.12 ? 436 GLU A CD    1 
ATOM   3456 O OE1   . GLU A 1 437 ? -52.645 54.169  11.831  1.00 49.91 ? 436 GLU A OE1   1 
ATOM   3457 O OE2   . GLU A 1 437 ? -53.353 52.195  11.280  1.00 50.70 ? 436 GLU A OE2   1 
ATOM   3458 N N     . SER A 1 438 ? -51.085 56.144  14.453  1.00 37.43 ? 437 SER A N     1 
ATOM   3459 C CA    . SER A 1 438 ? -50.845 57.504  14.847  1.00 36.14 ? 437 SER A CA    1 
ATOM   3460 C C     . SER A 1 438 ? -51.127 58.292  13.627  1.00 36.22 ? 437 SER A C     1 
ATOM   3461 O O     . SER A 1 438 ? -51.223 57.720  12.568  1.00 34.95 ? 437 SER A O     1 
ATOM   3462 C CB    . SER A 1 438 ? -49.351 57.673  15.132  1.00 36.05 ? 437 SER A CB    1 
ATOM   3463 O OG    . SER A 1 438 ? -48.628 57.568  13.914  1.00 31.55 ? 437 SER A OG    1 
ATOM   3464 N N     . VAL A 1 439 ? -51.180 59.613  13.753  1.00 36.76 ? 438 VAL A N     1 
ATOM   3465 C CA    . VAL A 1 439 ? -51.041 60.477  12.579  1.00 37.99 ? 438 VAL A CA    1 
ATOM   3466 C C     . VAL A 1 439 ? -49.666 60.277  11.904  1.00 39.02 ? 438 VAL A C     1 
ATOM   3467 O O     . VAL A 1 439 ? -48.742 59.585  12.406  1.00 38.08 ? 438 VAL A O     1 
ATOM   3468 C CB    . VAL A 1 439 ? -51.237 61.978  12.941  1.00 38.30 ? 438 VAL A CB    1 
ATOM   3469 C CG1   . VAL A 1 439 ? -52.671 62.250  13.526  1.00 36.33 ? 438 VAL A CG1   1 
ATOM   3470 C CG2   . VAL A 1 439 ? -50.205 62.353  13.994  1.00 36.72 ? 438 VAL A CG2   1 
ATOM   3471 N N     . CYS A 1 440 ? -49.544 60.901  10.754  1.00 41.00 ? 439 CYS A N     1 
ATOM   3472 C CA    . CYS A 1 440 ? -48.343 60.823  9.991   1.00 41.30 ? 439 CYS A CA    1 
ATOM   3473 C C     . CYS A 1 440 ? -47.910 62.293  9.765   1.00 40.90 ? 439 CYS A C     1 
ATOM   3474 O O     . CYS A 1 440 ? -48.704 63.118  9.328   1.00 40.29 ? 439 CYS A O     1 
ATOM   3475 C CB    . CYS A 1 440 ? -48.639 60.144  8.672   1.00 41.35 ? 439 CYS A CB    1 
ATOM   3476 S SG    . CYS A 1 440 ? -47.383 60.581  7.425   1.00 45.51 ? 439 CYS A SG    1 
ATOM   3477 N N     . THR A 1 441 ? -46.661 62.621  10.078  1.00 39.74 ? 440 THR A N     1 
ATOM   3478 C CA    . THR A 1 441 ? -46.261 64.043  10.137  1.00 38.44 ? 440 THR A CA    1 
ATOM   3479 C C     . THR A 1 441 ? -45.268 64.320  9.027   1.00 39.01 ? 440 THR A C     1 
ATOM   3480 O O     . THR A 1 441 ? -44.679 65.383  8.973   1.00 39.64 ? 440 THR A O     1 
ATOM   3481 C CB    . THR A 1 441 ? -45.649 64.388  11.537  1.00 38.12 ? 440 THR A CB    1 
ATOM   3482 O OG1   . THR A 1 441 ? -44.495 63.554  11.765  1.00 34.49 ? 440 THR A OG1   1 
ATOM   3483 C CG2   . THR A 1 441 ? -46.702 64.125  12.700  1.00 35.87 ? 440 THR A CG2   1 
ATOM   3484 N N     . HIS A 1 442 ? -45.080 63.346  8.144   1.00 39.24 ? 441 HIS A N     1 
ATOM   3485 C CA    . HIS A 1 442 ? -44.189 63.503  7.032   1.00 40.81 ? 441 HIS A CA    1 
ATOM   3486 C C     . HIS A 1 442 ? -44.691 64.458  5.979   1.00 42.11 ? 441 HIS A C     1 
ATOM   3487 O O     . HIS A 1 442 ? -45.814 64.401  5.613   1.00 42.45 ? 441 HIS A O     1 
ATOM   3488 C CB    . HIS A 1 442 ? -43.810 62.169  6.412   1.00 40.53 ? 441 HIS A CB    1 
ATOM   3489 C CG    . HIS A 1 442 ? -42.551 62.248  5.609   1.00 41.25 ? 441 HIS A CG    1 
ATOM   3490 N ND1   . HIS A 1 442 ? -42.546 62.431  4.246   1.00 44.20 ? 441 HIS A ND1   1 
ATOM   3491 C CD2   . HIS A 1 442 ? -41.254 62.232  5.985   1.00 42.88 ? 441 HIS A CD2   1 
ATOM   3492 C CE1   . HIS A 1 442 ? -41.299 62.509  3.809   1.00 43.56 ? 441 HIS A CE1   1 
ATOM   3493 N NE2   . HIS A 1 442 ? -40.495 62.364  4.842   1.00 44.76 ? 441 HIS A NE2   1 
ATOM   3494 N N     . ARG A 1 443 ? -43.844 65.347  5.494   1.00 45.52 ? 442 ARG A N     1 
ATOM   3495 C CA    . ARG A 1 443 ? -44.226 66.337  4.473   1.00 48.65 ? 442 ARG A CA    1 
ATOM   3496 C C     . ARG A 1 443 ? -43.189 66.361  3.376   1.00 51.24 ? 442 ARG A C     1 
ATOM   3497 O O     . ARG A 1 443 ? -42.096 66.807  3.630   1.00 51.79 ? 442 ARG A O     1 
ATOM   3498 C CB    . ARG A 1 443 ? -44.329 67.709  5.115   1.00 47.48 ? 442 ARG A CB    1 
ATOM   3499 C CG    . ARG A 1 443 ? -45.503 67.717  6.096   1.00 47.94 ? 442 ARG A CG    1 
ATOM   3500 C CD    . ARG A 1 443 ? -45.587 68.930  6.937   1.00 45.44 ? 442 ARG A CD    1 
ATOM   3501 N NE    . ARG A 1 443 ? -45.644 70.144  6.127   1.00 48.90 ? 442 ARG A NE    1 
ATOM   3502 C CZ    . ARG A 1 443 ? -46.775 70.786  5.821   1.00 46.49 ? 442 ARG A CZ    1 
ATOM   3503 N NH1   . ARG A 1 443 ? -47.937 70.326  6.244   1.00 42.48 ? 442 ARG A NH1   1 
ATOM   3504 N NH2   . ARG A 1 443 ? -46.741 71.897  5.097   1.00 44.05 ? 442 ARG A NH2   1 
ATOM   3505 N N     . GLU A 1 444 ? -43.505 65.859  2.182   1.00 55.18 ? 443 GLU A N     1 
ATOM   3506 C CA    . GLU A 1 444 ? -42.540 65.839  1.051   1.00 59.17 ? 443 GLU A CA    1 
ATOM   3507 C C     . GLU A 1 444 ? -42.233 67.232  0.548   1.00 61.46 ? 443 GLU A C     1 
ATOM   3508 O O     . GLU A 1 444 ? -42.961 68.152  0.850   1.00 60.50 ? 443 GLU A O     1 
ATOM   3509 C CB    . GLU A 1 444 ? -43.049 65.022  -0.136  1.00 59.23 ? 443 GLU A CB    1 
ATOM   3510 C CG    . GLU A 1 444 ? -43.681 63.685  0.198   1.00 63.36 ? 443 GLU A CG    1 
ATOM   3511 C CD    . GLU A 1 444 ? -42.657 62.564  0.387   1.00 70.23 ? 443 GLU A CD    1 
ATOM   3512 O OE1   . GLU A 1 444 ? -43.082 61.355  0.416   1.00 71.31 ? 443 GLU A OE1   1 
ATOM   3513 O OE2   . GLU A 1 444 ? -41.432 62.909  0.502   1.00 71.47 ? 443 GLU A OE2   1 
ATOM   3514 N N     . ARG A 1 445 ? -41.151 67.361  -0.222  1.00 66.02 ? 444 ARG A N     1 
ATOM   3515 C CA    . ARG A 1 445 ? -40.767 68.607  -0.955  1.00 71.26 ? 444 ARG A CA    1 
ATOM   3516 C C     . ARG A 1 445 ? -41.916 69.188  -1.800  1.00 73.60 ? 444 ARG A C     1 
ATOM   3517 O O     . ARG A 1 445 ? -42.733 68.420  -2.300  1.00 74.27 ? 444 ARG A O     1 
ATOM   3518 C CB    . ARG A 1 445 ? -39.584 68.295  -1.889  1.00 71.00 ? 444 ARG A CB    1 
ATOM   3519 C CG    . ARG A 1 445 ? -39.007 66.879  -1.686  1.00 72.03 ? 444 ARG A CG    1 
ATOM   3520 C CD    . ARG A 1 445 ? -37.956 66.512  -2.710  1.00 72.90 ? 444 ARG A CD    1 
ATOM   3521 N NE    . ARG A 1 445 ? -36.613 66.754  -2.186  1.00 74.73 ? 444 ARG A NE    1 
ATOM   3522 C CZ    . ARG A 1 445 ? -35.954 67.901  -2.313  1.00 74.17 ? 444 ARG A CZ    1 
ATOM   3523 N NH1   . ARG A 1 445 ? -36.516 68.912  -2.949  1.00 75.65 ? 444 ARG A NH1   1 
ATOM   3524 N NH2   . ARG A 1 445 ? -34.734 68.037  -1.802  1.00 74.21 ? 444 ARG A NH2   1 
ATOM   3525 N N     . SER A 1 446 ? -41.964 70.513  -1.989  1.00 77.15 ? 445 SER A N     1 
ATOM   3526 C CA    . SER A 1 446 ? -43.056 71.127  -2.811  1.00 80.84 ? 445 SER A CA    1 
ATOM   3527 C C     . SER A 1 446 ? -42.794 71.835  -4.180  1.00 82.77 ? 445 SER A C     1 
ATOM   3528 O O     . SER A 1 446 ? -42.419 73.042  -4.242  1.00 83.66 ? 445 SER A O     1 
ATOM   3529 C CB    . SER A 1 446 ? -44.038 71.951  -1.964  1.00 80.82 ? 445 SER A CB    1 
ATOM   3530 O OG    . SER A 1 446 ? -45.142 71.135  -1.614  1.00 81.30 ? 445 SER A OG    1 
ATOM   3531 N N     . GLU A 1 447 ? -43.089 71.067  -5.249  1.00 84.41 ? 446 GLU A N     1 
ATOM   3532 C CA    . GLU A 1 447 ? -43.081 71.487  -6.680  1.00 85.25 ? 446 GLU A CA    1 
ATOM   3533 C C     . GLU A 1 447 ? -42.173 72.672  -7.053  1.00 84.90 ? 446 GLU A C     1 
ATOM   3534 O O     . GLU A 1 447 ? -41.040 72.472  -7.513  1.00 84.32 ? 446 GLU A O     1 
ATOM   3535 C CB    . GLU A 1 447 ? -44.534 71.681  -7.209  1.00 86.12 ? 446 GLU A CB    1 
ATOM   3536 C CG    . GLU A 1 447 ? -45.556 70.499  -6.875  1.00 88.04 ? 446 GLU A CG    1 
ATOM   3537 C CD    . GLU A 1 447 ? -44.945 69.058  -6.899  1.00 90.77 ? 446 GLU A CD    1 
ATOM   3538 O OE1   . GLU A 1 447 ? -44.883 68.430  -7.982  1.00 90.82 ? 446 GLU A OE1   1 
ATOM   3539 O OE2   . GLU A 1 447 ? -44.554 68.536  -5.825  1.00 91.15 ? 446 GLU A OE2   1 
ATOM   3540 N N     . ASN A 1 454 ? -41.723 81.991  -12.803 1.00 75.36 ? 453 ASN A N     1 
ATOM   3541 C CA    . ASN A 1 454 ? -42.788 82.966  -12.468 1.00 76.23 ? 453 ASN A CA    1 
ATOM   3542 C C     . ASN A 1 454 ? -43.101 84.051  -13.551 1.00 76.30 ? 453 ASN A C     1 
ATOM   3543 O O     . ASN A 1 454 ? -42.470 85.125  -13.558 1.00 75.62 ? 453 ASN A O     1 
ATOM   3544 C CB    . ASN A 1 454 ? -42.522 83.621  -11.095 1.00 76.22 ? 453 ASN A CB    1 
ATOM   3545 C CG    . ASN A 1 454 ? -43.674 84.542  -10.630 1.00 76.78 ? 453 ASN A CG    1 
ATOM   3546 O OD1   . ASN A 1 454 ? -44.798 84.486  -11.139 1.00 77.58 ? 453 ASN A OD1   1 
ATOM   3547 N ND2   . ASN A 1 454 ? -43.376 85.404  -9.660  1.00 76.43 ? 453 ASN A ND2   1 
ATOM   3548 N N     . PRO A 1 455 ? -44.096 83.764  -14.447 1.00 76.35 ? 454 PRO A N     1 
ATOM   3549 C CA    . PRO A 1 455 ? -44.352 84.521  -15.701 1.00 75.74 ? 454 PRO A CA    1 
ATOM   3550 C C     . PRO A 1 455 ? -44.340 86.053  -15.634 1.00 74.43 ? 454 PRO A C     1 
ATOM   3551 O O     . PRO A 1 455 ? -43.931 86.711  -16.616 1.00 74.74 ? 454 PRO A O     1 
ATOM   3552 C CB    . PRO A 1 455 ? -45.724 83.974  -16.177 1.00 76.11 ? 454 PRO A CB    1 
ATOM   3553 C CG    . PRO A 1 455 ? -45.670 82.490  -15.738 1.00 76.42 ? 454 PRO A CG    1 
ATOM   3554 C CD    . PRO A 1 455 ? -45.027 82.608  -14.328 1.00 76.80 ? 454 PRO A CD    1 
ATOM   3555 N N     . LEU A 1 456 ? -44.764 86.620  -14.506 1.00 72.70 ? 455 LEU A N     1 
ATOM   3556 C CA    . LEU A 1 456 ? -45.018 88.074  -14.456 1.00 69.74 ? 455 LEU A CA    1 
ATOM   3557 C C     . LEU A 1 456 ? -43.742 88.955  -14.213 1.00 68.75 ? 455 LEU A C     1 
ATOM   3558 O O     . LEU A 1 456 ? -43.774 90.182  -14.436 1.00 67.05 ? 455 LEU A O     1 
ATOM   3559 C CB    . LEU A 1 456 ? -46.238 88.385  -13.548 1.00 69.88 ? 455 LEU A CB    1 
ATOM   3560 C CG    . LEU A 1 456 ? -47.649 88.508  -14.200 1.00 70.11 ? 455 LEU A CG    1 
ATOM   3561 C CD1   . LEU A 1 456 ? -48.045 87.484  -15.360 1.00 67.79 ? 455 LEU A CD1   1 
ATOM   3562 C CD2   . LEU A 1 456 ? -48.726 88.523  -13.083 1.00 69.94 ? 455 LEU A CD2   1 
ATOM   3563 N N     . MET A 1 457 ? -42.635 88.289  -13.813 1.00 67.41 ? 456 MET A N     1 
ATOM   3564 C CA    . MET A 1 457 ? -41.241 88.845  -13.707 1.00 66.30 ? 456 MET A CA    1 
ATOM   3565 C C     . MET A 1 457 ? -40.410 88.810  -15.025 1.00 65.98 ? 456 MET A C     1 
ATOM   3566 O O     . MET A 1 457 ? -39.173 89.003  -15.007 1.00 65.54 ? 456 MET A O     1 
ATOM   3567 C CB    . MET A 1 457 ? -40.482 88.085  -12.632 1.00 64.61 ? 456 MET A CB    1 
ATOM   3568 C CG    . MET A 1 457 ? -41.189 88.140  -11.309 1.00 62.16 ? 456 MET A CG    1 
ATOM   3569 S SD    . MET A 1 457 ? -40.985 89.767  -10.568 1.00 56.16 ? 456 MET A SD    1 
ATOM   3570 C CE    . MET A 1 457 ? -39.215 89.600  -10.034 1.00 46.39 ? 456 MET A CE    1 
ATOM   3571 N N     . ARG A 1 458 ? -41.105 88.541  -16.138 1.00 65.47 ? 457 ARG A N     1 
ATOM   3572 C CA    . ARG A 1 458 ? -40.551 88.464  -17.482 1.00 65.86 ? 457 ARG A CA    1 
ATOM   3573 C C     . ARG A 1 458 ? -41.495 89.141  -18.465 1.00 64.46 ? 457 ARG A C     1 
ATOM   3574 O O     . ARG A 1 458 ? -42.686 89.233  -18.245 1.00 63.90 ? 457 ARG A O     1 
ATOM   3575 C CB    . ARG A 1 458 ? -40.380 87.012  -17.913 1.00 65.36 ? 457 ARG A CB    1 
ATOM   3576 C CG    . ARG A 1 458 ? -39.305 86.220  -17.169 1.00 67.37 ? 457 ARG A CG    1 
ATOM   3577 C CD    . ARG A 1 458 ? -39.083 84.807  -17.828 1.00 69.10 ? 457 ARG A CD    1 
ATOM   3578 N NE    . ARG A 1 458 ? -40.339 84.220  -18.324 1.00 77.80 ? 457 ARG A NE    1 
ATOM   3579 C CZ    . ARG A 1 458 ? -41.228 83.571  -17.561 1.00 80.46 ? 457 ARG A CZ    1 
ATOM   3580 N NH1   . ARG A 1 458 ? -41.005 83.385  -16.252 1.00 80.10 ? 457 ARG A NH1   1 
ATOM   3581 N NH2   . ARG A 1 458 ? -42.346 83.101  -18.111 1.00 83.38 ? 457 ARG A NH2   1 
ATOM   3582 N N     . ARG A 1 459 ? -40.940 89.600  -19.571 1.00 64.20 ? 458 ARG A N     1 
ATOM   3583 C CA    . ARG A 1 459 ? -41.709 90.293  -20.596 1.00 63.10 ? 458 ARG A CA    1 
ATOM   3584 C C     . ARG A 1 459 ? -42.717 89.400  -21.300 1.00 63.86 ? 458 ARG A C     1 
ATOM   3585 O O     . ARG A 1 459 ? -43.799 89.865  -21.619 1.00 64.58 ? 458 ARG A O     1 
ATOM   3586 C CB    . ARG A 1 459 ? -40.778 90.957  -21.617 1.00 62.09 ? 458 ARG A CB    1 
ATOM   3587 C CG    . ARG A 1 459 ? -39.599 91.645  -20.989 1.00 56.65 ? 458 ARG A CG    1 
ATOM   3588 C CD    . ARG A 1 459 ? -39.560 93.073  -21.408 1.00 48.81 ? 458 ARG A CD    1 
ATOM   3589 N NE    . ARG A 1 459 ? -38.440 93.797  -20.810 1.00 42.81 ? 458 ARG A NE    1 
ATOM   3590 C CZ    . ARG A 1 459 ? -37.366 94.235  -21.481 1.00 38.89 ? 458 ARG A CZ    1 
ATOM   3591 N NH1   . ARG A 1 459 ? -37.204 94.061  -22.799 1.00 32.52 ? 458 ARG A NH1   1 
ATOM   3592 N NH2   . ARG A 1 459 ? -36.444 94.860  -20.812 1.00 36.80 ? 458 ARG A NH2   1 
ATOM   3593 N N     . ASN A 1 460 ? -42.366 88.139  -21.565 1.00 64.68 ? 459 ASN A N     1 
ATOM   3594 C CA    . ASN A 1 460 ? -43.311 87.176  -22.181 1.00 65.87 ? 459 ASN A CA    1 
ATOM   3595 C C     . ASN A 1 460 ? -43.324 85.869  -21.400 1.00 66.44 ? 459 ASN A C     1 
ATOM   3596 O O     . ASN A 1 460 ? -44.378 85.241  -21.286 1.00 67.80 ? 459 ASN A O     1 
ATOM   3597 C CB    . ASN A 1 460 ? -43.011 86.887  -23.681 1.00 65.74 ? 459 ASN A CB    1 
ATOM   3598 C CG    . ASN A 1 460 ? -43.492 88.013  -24.634 1.00 66.93 ? 459 ASN A CG    1 
ATOM   3599 O OD1   . ASN A 1 460 ? -42.688 88.711  -25.251 1.00 68.60 ? 459 ASN A OD1   1 
ATOM   3600 N ND2   . ASN A 1 460 ? -44.799 88.177  -24.750 1.00 68.75 ? 459 ASN A ND2   1 
HETATM 3601 P P1    . FDP B 2 .   ? -7.585  47.930  -1.070  1.00 41.51 ? 524 FDP A P1    1 
HETATM 3602 O O1P   . FDP B 2 .   ? -8.332  47.678  -2.379  1.00 41.26 ? 524 FDP A O1P   1 
HETATM 3603 O O2P   . FDP B 2 .   ? -7.723  46.774  -0.082  1.00 42.18 ? 524 FDP A O2P   1 
HETATM 3604 O O3P   . FDP B 2 .   ? -7.815  49.356  -0.628  1.00 43.17 ? 524 FDP A O3P   1 
HETATM 3605 O O1    . FDP B 2 .   ? -5.184  45.830  -0.707  1.00 42.35 ? 524 FDP A O1    1 
HETATM 3606 C C1    . FDP B 2 .   ? -4.159  46.593  -1.306  1.00 40.43 ? 524 FDP A C1    1 
HETATM 3607 C C2    . FDP B 2 .   ? -4.834  47.791  -1.948  1.00 38.26 ? 524 FDP A C2    1 
HETATM 3608 O O2    . FDP B 2 .   ? -5.965  48.191  -1.165  1.00 40.11 ? 524 FDP A O2    1 
HETATM 3609 C C3    . FDP B 2 .   ? -5.016  47.578  -3.439  1.00 37.75 ? 524 FDP A C3    1 
HETATM 3610 O O3    . FDP B 2 .   ? -6.286  47.173  -3.868  1.00 41.13 ? 524 FDP A O3    1 
HETATM 3611 C C4    . FDP B 2 .   ? -4.707  48.920  -4.039  1.00 37.14 ? 524 FDP A C4    1 
HETATM 3612 O O4    . FDP B 2 .   ? -4.408  48.710  -5.407  1.00 37.49 ? 524 FDP A O4    1 
HETATM 3613 C C5    . FDP B 2 .   ? -3.535  49.296  -3.188  1.00 36.82 ? 524 FDP A C5    1 
HETATM 3614 O O5    . FDP B 2 .   ? -3.908  48.878  -1.847  1.00 39.27 ? 524 FDP A O5    1 
HETATM 3615 C C6    . FDP B 2 .   ? -3.102  50.744  -3.145  1.00 32.05 ? 524 FDP A C6    1 
HETATM 3616 O O6    . FDP B 2 .   ? -2.086  50.707  -2.127  1.00 34.25 ? 524 FDP A O6    1 
HETATM 3617 P P2    . FDP B 2 .   ? -0.611  50.961  -2.672  1.00 39.21 ? 524 FDP A P2    1 
HETATM 3618 O O4P   . FDP B 2 .   ? -0.383  49.646  -3.442  1.00 42.39 ? 524 FDP A O4P   1 
HETATM 3619 O O5P   . FDP B 2 .   ? -0.646  52.145  -3.582  1.00 39.09 ? 524 FDP A O5P   1 
HETATM 3620 O O6P   . FDP B 2 .   ? 0.320   51.232  -1.465  1.00 38.27 ? 524 FDP A O6P   1 
HETATM 3621 P P     . PHS C 3 .   ? -42.259 64.554  17.554  1.00 28.64 ? 710 PHS A P     1 
HETATM 3622 O O1P   . PHS C 3 .   ? -43.526 64.943  16.852  1.00 28.68 ? 710 PHS A O1P   1 
HETATM 3623 O O2P   . PHS C 3 .   ? -41.764 65.732  18.310  1.00 27.42 ? 710 PHS A O2P   1 
HETATM 3624 O O3P   . PHS C 3 .   ? -41.230 63.887  16.701  1.00 33.33 ? 710 PHS A O3P   1 
HETATM 3625 P PB    . ADP D 4 .   ? -7.652  48.040  4.732   1.00 32.62 ? 700 ADP A PB    1 
HETATM 3626 O O1B   . ADP D 4 .   ? -6.554  48.359  5.785   1.00 25.40 ? 700 ADP A O1B   1 
HETATM 3627 O O2B   . ADP D 4 .   ? -8.323  49.199  4.022   1.00 31.33 ? 700 ADP A O2B   1 
HETATM 3628 O O3B   . ADP D 4 .   ? -7.320  46.896  3.746   1.00 32.06 ? 700 ADP A O3B   1 
HETATM 3629 P PA    . ADP D 4 .   ? -10.360 47.657  5.627   1.00 35.96 ? 700 ADP A PA    1 
HETATM 3630 O O1A   . ADP D 4 .   ? -10.793 48.935  6.275   1.00 38.35 ? 700 ADP A O1A   1 
HETATM 3631 O O2A   . ADP D 4 .   ? -10.979 47.361  4.283   1.00 36.51 ? 700 ADP A O2A   1 
HETATM 3632 O O3A   . ADP D 4 .   ? -8.779  47.437  5.715   1.00 33.00 ? 700 ADP A O3A   1 
HETATM 3633 O "O5'" . ADP D 4 .   ? -10.829 46.602  6.756   1.00 36.33 ? 700 ADP A "O5'" 1 
HETATM 3634 C "C5'" . ADP D 4 .   ? -12.107 46.727  7.422   1.00 36.06 ? 700 ADP A "C5'" 1 
HETATM 3635 C "C4'" . ADP D 4 .   ? -12.043 45.961  8.744   1.00 37.44 ? 700 ADP A "C4'" 1 
HETATM 3636 O "O4'" . ADP D 4 .   ? -11.050 46.549  9.610   1.00 36.86 ? 700 ADP A "O4'" 1 
HETATM 3637 C "C3'" . ADP D 4 .   ? -13.341 45.954  9.539   1.00 38.26 ? 700 ADP A "C3'" 1 
HETATM 3638 O "O3'" . ADP D 4 .   ? -13.584 44.580  9.795   1.00 39.91 ? 700 ADP A "O3'" 1 
HETATM 3639 C "C2'" . ADP D 4 .   ? -13.007 46.664  10.849  1.00 39.66 ? 700 ADP A "C2'" 1 
HETATM 3640 O "O2'" . ADP D 4 .   ? -13.477 45.965  11.994  1.00 42.82 ? 700 ADP A "O2'" 1 
HETATM 3641 C "C1'" . ADP D 4 .   ? -11.509 46.538  10.940  1.00 39.78 ? 700 ADP A "C1'" 1 
HETATM 3642 N N9    . ADP D 4 .   ? -10.904 47.653  11.667  1.00 42.86 ? 700 ADP A N9    1 
HETATM 3643 C C8    . ADP D 4 .   ? -11.452 48.881  11.911  1.00 42.42 ? 700 ADP A C8    1 
HETATM 3644 N N7    . ADP D 4 .   ? -10.552 49.636  12.628  1.00 39.99 ? 700 ADP A N7    1 
HETATM 3645 C C5    . ADP D 4 .   ? -9.442  48.896  12.843  1.00 36.59 ? 700 ADP A C5    1 
HETATM 3646 C C6    . ADP D 4 .   ? -8.158  49.094  13.525  1.00 40.93 ? 700 ADP A C6    1 
HETATM 3647 N N6    . ADP D 4 .   ? -7.895  50.268  14.120  1.00 42.18 ? 700 ADP A N6    1 
HETATM 3648 N N1    . ADP D 4 .   ? -7.258  48.075  13.549  1.00 43.33 ? 700 ADP A N1    1 
HETATM 3649 C C2    . ADP D 4 .   ? -7.553  46.887  12.939  1.00 41.62 ? 700 ADP A C2    1 
HETATM 3650 N N3    . ADP D 4 .   ? -8.726  46.647  12.307  1.00 37.95 ? 700 ADP A N3    1 
HETATM 3651 C C4    . ADP D 4 .   ? -9.671  47.595  12.222  1.00 38.60 ? 700 ADP A C4    1 
HETATM 3652 O O1    . F6P E 5 .   ? -44.359 67.418  13.584  1.00 37.51 ? 720 F6P A O1    1 
HETATM 3653 C C1    . F6P E 5 .   ? -43.650 67.230  14.792  1.00 34.76 ? 720 F6P A C1    1 
HETATM 3654 C C2    . F6P E 5 .   ? -42.265 67.853  14.637  1.00 34.60 ? 720 F6P A C2    1 
HETATM 3655 O O2    . F6P E 5 .   ? -41.321 67.096  15.497  1.00 32.85 ? 720 F6P A O2    1 
HETATM 3656 C C3    . F6P E 5 .   ? -42.385 69.348  14.956  1.00 33.10 ? 720 F6P A C3    1 
HETATM 3657 O O3    . F6P E 5 .   ? -42.258 69.591  16.334  1.00 33.49 ? 720 F6P A O3    1 
HETATM 3658 C C4    . F6P E 5 .   ? -41.242 69.950  14.151  1.00 32.56 ? 720 F6P A C4    1 
HETATM 3659 O O4    . F6P E 5 .   ? -41.389 71.310  13.862  1.00 26.57 ? 720 F6P A O4    1 
HETATM 3660 C C5    . F6P E 5 .   ? -41.461 69.160  12.898  1.00 30.82 ? 720 F6P A C5    1 
HETATM 3661 O O5    . F6P E 5 .   ? -41.794 67.843  13.298  1.00 30.29 ? 720 F6P A O5    1 
HETATM 3662 C C6    . F6P E 5 .   ? -40.248 69.214  12.009  1.00 30.83 ? 720 F6P A C6    1 
HETATM 3663 O O6    . F6P E 5 .   ? -40.558 68.568  10.797  1.00 29.38 ? 720 F6P A O6    1 
HETATM 3664 P P     . F6P E 5 .   ? -40.279 69.398  9.471   1.00 34.80 ? 720 F6P A P     1 
HETATM 3665 O O1P   . F6P E 5 .   ? -38.840 69.942  9.439   1.00 33.43 ? 720 F6P A O1P   1 
HETATM 3666 O O2P   . F6P E 5 .   ? -40.444 68.396  8.349   1.00 35.84 ? 720 F6P A O2P   1 
HETATM 3667 O O3P   . F6P E 5 .   ? -41.219 70.552  9.285   1.00 31.11 ? 720 F6P A O3P   1 
HETATM 3668 O O     . HOH F 6 .   ? -45.020 60.008  10.920  1.00 26.01 ? 520 HOH A O     1 
HETATM 3669 O O     . HOH F 6 .   ? 4.078   51.058  -6.007  1.00 34.61 ? 521 HOH A O     1 
HETATM 3670 O O     . HOH F 6 .   ? 4.286   46.777  -2.986  1.00 38.46 ? 522 HOH A O     1 
HETATM 3671 O O     . HOH F 6 .   ? 10.720  54.057  0.791   1.00 45.76 ? 523 HOH A O     1 
HETATM 3672 O O     . HOH F 6 .   ? -43.538 66.945  25.066  1.00 26.43 ? 525 HOH A O     1 
HETATM 3673 O O     . HOH F 6 .   ? -36.152 74.750  10.085  1.00 31.11 ? 526 HOH A O     1 
HETATM 3674 O O     . HOH F 6 .   ? -37.247 67.492  31.098  1.00 25.05 ? 527 HOH A O     1 
HETATM 3675 O O     . HOH F 6 .   ? -29.272 76.112  17.873  1.00 29.18 ? 528 HOH A O     1 
HETATM 3676 O O     . HOH F 6 .   ? -19.918 53.058  12.283  1.00 36.42 ? 529 HOH A O     1 
HETATM 3677 O O     . HOH F 6 .   ? 2.700   52.529  -1.081  1.00 42.38 ? 530 HOH A O     1 
HETATM 3678 O O     . HOH F 6 .   ? -38.770 47.676  29.006  1.00 28.34 ? 531 HOH A O     1 
HETATM 3679 O O     . HOH F 6 .   ? -45.584 69.012  21.711  1.00 30.04 ? 532 HOH A O     1 
HETATM 3680 O O     . HOH F 6 .   ? -46.340 67.649  15.435  1.00 32.00 ? 533 HOH A O     1 
HETATM 3681 O O     . HOH F 6 .   ? -5.279  69.760  8.486   1.00 28.51 ? 534 HOH A O     1 
HETATM 3682 O O     . HOH F 6 .   ? -12.031 56.126  -4.783  1.00 30.52 ? 535 HOH A O     1 
HETATM 3683 O O     . HOH F 6 .   ? -40.633 72.887  16.271  1.00 33.00 ? 536 HOH A O     1 
HETATM 3684 O O     . HOH F 6 .   ? -33.386 84.495  13.794  1.00 29.59 ? 537 HOH A O     1 
HETATM 3685 O O     . HOH F 6 .   ? -44.199 67.593  10.993  1.00 33.37 ? 538 HOH A O     1 
HETATM 3686 O O     . HOH F 6 .   ? 5.443   55.562  -5.025  1.00 43.09 ? 539 HOH A O     1 
HETATM 3687 O O     . HOH F 6 .   ? -29.377 83.230  4.074   1.00 34.27 ? 540 HOH A O     1 
HETATM 3688 O O     . HOH F 6 .   ? -41.125 61.502  8.773   1.00 27.35 ? 541 HOH A O     1 
HETATM 3689 O O     . HOH F 6 .   ? -17.833 53.569  17.594  1.00 31.97 ? 542 HOH A O     1 
HETATM 3690 O O     . HOH F 6 .   ? -42.156 66.313  7.806   1.00 28.23 ? 543 HOH A O     1 
HETATM 3691 O O     . HOH F 6 .   ? 7.517   58.378  6.240   1.00 42.50 ? 544 HOH A O     1 
HETATM 3692 O O     . HOH F 6 .   ? -42.709 57.205  18.073  1.00 29.92 ? 545 HOH A O     1 
HETATM 3693 O O     . HOH F 6 .   ? -41.093 40.399  22.355  1.00 52.52 ? 546 HOH A O     1 
HETATM 3694 O O     . HOH F 6 .   ? -0.232  46.175  11.228  1.00 37.04 ? 547 HOH A O     1 
HETATM 3695 O O     . HOH F 6 .   ? -42.180 68.366  18.288  1.00 27.92 ? 548 HOH A O     1 
HETATM 3696 O O     . HOH F 6 .   ? -53.377 51.232  17.005  1.00 34.70 ? 549 HOH A O     1 
HETATM 3697 O O     . HOH F 6 .   ? 3.457   44.992  -8.252  1.00 36.59 ? 550 HOH A O     1 
HETATM 3698 O O     . HOH F 6 .   ? -28.936 77.667  9.138   1.00 31.90 ? 551 HOH A O     1 
HETATM 3699 O O     . HOH F 6 .   ? -42.672 65.440  20.848  1.00 49.40 ? 552 HOH A O     1 
HETATM 3700 O O     . HOH F 6 .   ? -9.336  45.546  -3.196  1.00 66.51 ? 553 HOH A O     1 
HETATM 3701 O O     . HOH F 6 .   ? -4.418  39.972  -11.055 1.00 53.27 ? 554 HOH A O     1 
HETATM 3702 O O     . HOH F 6 .   ? -21.488 55.348  13.213  1.00 36.89 ? 555 HOH A O     1 
HETATM 3703 O O     . HOH F 6 .   ? -52.054 62.225  9.690   1.00 36.15 ? 556 HOH A O     1 
HETATM 3704 O O     . HOH F 6 .   ? -21.660 89.781  8.748   1.00 39.57 ? 557 HOH A O     1 
HETATM 3705 O O     . HOH F 6 .   ? -19.845 63.912  23.725  1.00 36.09 ? 558 HOH A O     1 
HETATM 3706 O O     . HOH F 6 .   ? -31.315 86.767  1.659   1.00 45.08 ? 559 HOH A O     1 
HETATM 3707 O O     . HOH F 6 .   ? -19.135 54.681  7.042   1.00 41.03 ? 560 HOH A O     1 
HETATM 3708 O O     . HOH F 6 .   ? -41.237 69.321  4.285   1.00 42.76 ? 561 HOH A O     1 
HETATM 3709 O O     . HOH F 6 .   ? -7.559  53.920  -13.017 1.00 45.98 ? 562 HOH A O     1 
HETATM 3710 O O     . HOH F 6 .   ? -10.997 70.739  18.250  1.00 42.46 ? 563 HOH A O     1 
HETATM 3711 O O     . HOH F 6 .   ? -6.428  51.314  -1.738  1.00 32.72 ? 564 HOH A O     1 
HETATM 3712 O O     . HOH F 6 .   ? -17.905 58.201  4.085   1.00 31.91 ? 565 HOH A O     1 
HETATM 3713 O O     . HOH F 6 .   ? -16.933 49.442  24.140  1.00 45.24 ? 566 HOH A O     1 
HETATM 3714 O O     . HOH F 6 .   ? -22.296 62.061  6.315   1.00 38.07 ? 567 HOH A O     1 
HETATM 3715 O O     . HOH F 6 .   ? -25.154 48.099  26.013  1.00 46.73 ? 568 HOH A O     1 
HETATM 3716 O O     . HOH F 6 .   ? -46.952 73.238  24.601  1.00 33.25 ? 569 HOH A O     1 
HETATM 3717 O O     . HOH F 6 .   ? -41.106 72.539  11.414  1.00 33.98 ? 570 HOH A O     1 
HETATM 3718 O O     . HOH F 6 .   ? -40.475 56.365  15.738  1.00 33.53 ? 571 HOH A O     1 
HETATM 3719 O O     . HOH F 6 .   ? -20.577 59.295  0.312   1.00 41.41 ? 572 HOH A O     1 
HETATM 3720 O O     . HOH F 6 .   ? -52.348 47.619  13.731  1.00 49.34 ? 573 HOH A O     1 
HETATM 3721 O O     . HOH F 6 .   ? -9.258  65.585  -11.953 1.00 55.76 ? 574 HOH A O     1 
HETATM 3722 O O     . HOH F 6 .   ? -36.258 58.590  3.671   1.00 36.94 ? 575 HOH A O     1 
HETATM 3723 O O     . HOH F 6 .   ? -27.324 57.144  0.943   1.00 46.17 ? 576 HOH A O     1 
HETATM 3724 O O     . HOH F 6 .   ? -37.816 61.211  1.470   1.00 46.94 ? 577 HOH A O     1 
HETATM 3725 O O     . HOH F 6 .   ? 4.669   64.564  -6.363  1.00 44.42 ? 578 HOH A O     1 
HETATM 3726 O O     . HOH F 6 .   ? -17.880 66.540  -1.103  1.00 41.60 ? 579 HOH A O     1 
HETATM 3727 O O     . HOH F 6 .   ? -16.117 52.617  14.752  1.00 42.09 ? 580 HOH A O     1 
HETATM 3728 O O     . HOH F 6 .   ? -23.426 60.268  29.333  1.00 45.65 ? 581 HOH A O     1 
HETATM 3729 O O     . HOH F 6 .   ? -24.269 43.346  16.764  1.00 47.61 ? 582 HOH A O     1 
HETATM 3730 O O     . HOH F 6 .   ? 2.283   65.976  8.051   1.00 41.79 ? 583 HOH A O     1 
HETATM 3731 O O     . HOH F 6 .   ? -50.346 67.842  26.769  1.00 48.75 ? 584 HOH A O     1 
HETATM 3732 O O     . HOH F 6 .   ? 1.690   38.902  16.542  1.00 73.06 ? 585 HOH A O     1 
HETATM 3733 O O     . HOH F 6 .   ? -19.473 51.622  16.282  1.00 34.26 ? 586 HOH A O     1 
HETATM 3734 O O     . HOH F 6 .   ? -45.734 71.834  -4.661  1.00 63.55 ? 587 HOH A O     1 
HETATM 3735 O O     . HOH F 6 .   ? -1.489  49.718  -5.635  1.00 40.40 ? 588 HOH A O     1 
HETATM 3736 O O     . HOH F 6 .   ? -23.692 53.882  6.333   1.00 47.41 ? 589 HOH A O     1 
HETATM 3737 O O     . HOH F 6 .   ? -10.453 52.297  14.335  1.00 44.46 ? 590 HOH A O     1 
HETATM 3738 O O     . HOH F 6 .   ? -23.446 62.382  1.799   1.00 52.98 ? 591 HOH A O     1 
HETATM 3739 O O     . HOH F 6 .   ? -18.886 52.452  9.809   1.00 42.00 ? 592 HOH A O     1 
HETATM 3740 O O     . HOH F 6 .   ? -31.368 84.125  2.495   1.00 40.76 ? 593 HOH A O     1 
HETATM 3741 O O     . HOH F 6 .   ? -39.753 64.894  -0.095  1.00 68.70 ? 594 HOH A O     1 
HETATM 3742 O O     . HOH F 6 .   ? 7.356   41.850  0.884   1.00 64.46 ? 595 HOH A O     1 
HETATM 3743 O O     . HOH F 6 .   ? -13.456 64.724  -7.146  1.00 47.87 ? 596 HOH A O     1 
HETATM 3744 O O     . HOH F 6 .   ? -0.533  39.804  12.504  1.00 66.46 ? 597 HOH A O     1 
HETATM 3745 O O     . HOH F 6 .   ? -22.795 45.267  16.205  1.00 78.06 ? 598 HOH A O     1 
HETATM 3746 O O     . HOH F 6 .   ? -27.101 74.877  17.380  1.00 37.30 ? 599 HOH A O     1 
HETATM 3747 O O     . HOH F 6 .   ? 6.771   71.275  -4.545  1.00 62.68 ? 600 HOH A O     1 
HETATM 3748 O O     . HOH F 6 .   ? -33.926 74.399  8.731   1.00 35.77 ? 601 HOH A O     1 
HETATM 3749 O O     . HOH F 6 .   ? -38.650 56.467  12.771  1.00 42.21 ? 602 HOH A O     1 
HETATM 3750 O O     . HOH F 6 .   ? 0.887   71.861  -8.557  1.00 59.81 ? 603 HOH A O     1 
HETATM 3751 O O     . HOH F 6 .   ? -4.752  50.197  0.810   1.00 52.08 ? 604 HOH A O     1 
HETATM 3752 O O     . HOH F 6 .   ? -10.209 49.056  -3.006  1.00 40.10 ? 605 HOH A O     1 
HETATM 3753 O O     . HOH F 6 .   ? -52.046 72.832  8.560   1.00 48.52 ? 606 HOH A O     1 
HETATM 3754 O O     . HOH F 6 .   ? 4.032   53.114  -6.608  1.00 40.95 ? 607 HOH A O     1 
HETATM 3755 O O     . HOH F 6 .   ? -49.877 62.713  28.371  1.00 42.56 ? 608 HOH A O     1 
HETATM 3756 O O     . HOH F 6 .   ? -37.042 86.082  6.256   1.00 37.50 ? 609 HOH A O     1 
HETATM 3757 O O     . HOH F 6 .   ? -19.987 48.491  10.138  1.00 53.36 ? 610 HOH A O     1 
HETATM 3758 O O     . HOH F 6 .   ? -23.543 50.458  13.172  1.00 57.18 ? 611 HOH A O     1 
HETATM 3759 O O     . HOH F 6 .   ? 5.197   48.114  1.739   1.00 39.10 ? 612 HOH A O     1 
HETATM 3760 O O     . HOH F 6 .   ? -23.107 48.838  5.800   1.00 55.21 ? 613 HOH A O     1 
HETATM 3761 O O     . HOH F 6 .   ? -35.602 71.575  27.795  1.00 40.08 ? 614 HOH A O     1 
HETATM 3762 O O     . HOH F 6 .   ? -9.309  80.072  4.214   1.00 64.49 ? 615 HOH A O     1 
HETATM 3763 O O     . HOH F 6 .   ? -12.046 73.826  -4.198  1.00 66.14 ? 616 HOH A O     1 
HETATM 3764 O O     . HOH F 6 .   ? -16.064 59.768  -0.334  1.00 40.99 ? 617 HOH A O     1 
HETATM 3765 O O     . HOH F 6 .   ? 0.320   68.225  -8.475  1.00 46.98 ? 618 HOH A O     1 
HETATM 3766 O O     . HOH F 6 .   ? -26.498 44.625  20.337  1.00 46.43 ? 619 HOH A O     1 
HETATM 3767 O O     . HOH F 6 .   ? -40.739 74.501  -9.020  1.00 58.33 ? 620 HOH A O     1 
HETATM 3768 O O     . HOH F 6 .   ? -19.727 60.400  3.493   1.00 45.31 ? 621 HOH A O     1 
HETATM 3769 O O     . HOH F 6 .   ? -29.796 85.573  14.103  1.00 32.04 ? 622 HOH A O     1 
HETATM 3770 O O     . HOH F 6 .   ? 9.200   67.293  -1.791  1.00 75.31 ? 623 HOH A O     1 
HETATM 3771 O O     . HOH F 6 .   ? -44.886 62.831  -1.538  1.00 63.36 ? 624 HOH A O     1 
HETATM 3772 O O     . HOH F 6 .   ? -29.865 46.687  11.915  1.00 57.36 ? 625 HOH A O     1 
HETATM 3773 O O     . HOH F 6 .   ? -20.570 68.317  3.523   1.00 48.95 ? 626 HOH A O     1 
HETATM 3774 O O     . HOH F 6 .   ? -16.429 46.116  9.759   1.00 63.44 ? 627 HOH A O     1 
HETATM 3775 O O     . HOH F 6 .   ? -9.060  73.623  11.055  1.00 53.47 ? 628 HOH A O     1 
HETATM 3776 O O     . HOH F 6 .   ? 2.271   46.140  16.982  1.00 55.36 ? 629 HOH A O     1 
HETATM 3777 O O     . HOH F 6 .   ? -28.304 97.860  -1.803  1.00 48.92 ? 630 HOH A O     1 
HETATM 3778 O O     . HOH F 6 .   ? 5.202   33.418  -11.757 1.00 39.90 ? 631 HOH A O     1 
HETATM 3779 O O     . HOH F 6 .   ? -28.787 44.253  16.036  1.00 58.34 ? 632 HOH A O     1 
HETATM 3780 O O     . HOH F 6 .   ? -5.023  47.917  2.402   1.00 41.69 ? 633 HOH A O     1 
HETATM 3781 O O     . HOH F 6 .   ? -20.478 48.046  4.537   1.00 59.21 ? 634 HOH A O     1 
HETATM 3782 O O     . HOH F 6 .   ? -40.960 69.588  -5.030  1.00 66.23 ? 635 HOH A O     1 
HETATM 3783 O O     . HOH F 6 .   ? -34.110 37.764  24.252  1.00 51.19 ? 636 HOH A O     1 
HETATM 3784 O O     . HOH F 6 .   ? -24.917 69.978  22.455  1.00 44.68 ? 637 HOH A O     1 
HETATM 3785 O O     . HOH F 6 .   ? -33.845 42.691  14.140  1.00 46.52 ? 638 HOH A O     1 
HETATM 3786 O O     . HOH F 6 .   ? -37.388 39.796  18.100  1.00 54.63 ? 639 HOH A O     1 
HETATM 3787 O O     . HOH F 6 .   ? -37.855 54.053  32.788  1.00 45.20 ? 640 HOH A O     1 
HETATM 3788 O O     . HOH F 6 .   ? 0.211   48.533  9.532   1.00 41.26 ? 641 HOH A O     1 
HETATM 3789 O O     . HOH F 6 .   ? -4.661  71.014  -12.594 1.00 64.87 ? 642 HOH A O     1 
HETATM 3790 O O     . HOH F 6 .   ? -44.822 87.051  4.147   1.00 78.71 ? 643 HOH A O     1 
HETATM 3791 O O     . HOH F 6 .   ? 13.214  57.778  12.522  1.00 71.85 ? 644 HOH A O     1 
HETATM 3792 O O     . HOH F 6 .   ? -16.960 62.472  -0.780  1.00 58.70 ? 645 HOH A O     1 
HETATM 3793 O O     . HOH F 6 .   ? -48.327 54.497  12.939  1.00 39.17 ? 646 HOH A O     1 
HETATM 3794 O O     . HOH F 6 .   ? -27.167 55.039  2.873   1.00 47.41 ? 647 HOH A O     1 
HETATM 3795 O O     . HOH F 6 .   ? -9.251  45.585  -13.273 1.00 60.31 ? 648 HOH A O     1 
HETATM 3796 O O     . HOH F 6 .   ? -24.835 68.067  7.911   1.00 33.31 ? 649 HOH A O     1 
HETATM 3797 O O     . HOH F 6 .   ? 9.805   46.365  -6.247  1.00 50.18 ? 650 HOH A O     1 
HETATM 3798 O O     . HOH F 6 .   ? -38.095 89.038  -20.009 1.00 56.87 ? 651 HOH A O     1 
HETATM 3799 O O     . HOH F 6 .   ? -42.251 70.675  6.643   1.00 33.60 ? 652 HOH A O     1 
HETATM 3800 O O     . HOH F 6 .   ? 6.808   57.732  -12.626 1.00 81.21 ? 653 HOH A O     1 
HETATM 3801 O O     . HOH F 6 .   ? 8.815   40.112  -5.879  1.00 51.57 ? 654 HOH A O     1 
HETATM 3802 O O     . HOH F 6 .   ? -31.758 72.866  1.749   1.00 50.82 ? 655 HOH A O     1 
HETATM 3803 O O     . HOH F 6 .   ? -39.654 72.534  19.176  1.00 29.28 ? 656 HOH A O     1 
HETATM 3804 O O     . HOH F 6 .   ? 7.787   49.153  -12.596 1.00 54.22 ? 657 HOH A O     1 
HETATM 3805 O O     . HOH F 6 .   ? -32.593 59.775  0.881   1.00 48.12 ? 658 HOH A O     1 
HETATM 3806 O O     . HOH F 6 .   ? 6.629   43.334  -15.852 1.00 37.95 ? 659 HOH A O     1 
HETATM 3807 O O     . HOH F 6 .   ? -50.030 73.173  14.764  1.00 73.69 ? 660 HOH A O     1 
HETATM 3808 O O     . HOH F 6 .   ? -42.794 59.536  8.739   1.00 50.82 ? 661 HOH A O     1 
HETATM 3809 O O     . HOH F 6 .   ? -39.141 53.087  8.693   1.00 46.44 ? 662 HOH A O     1 
HETATM 3810 O O     . HOH F 6 .   ? -53.751 54.507  25.901  1.00 58.64 ? 663 HOH A O     1 
HETATM 3811 O O     . HOH F 6 .   ? -28.277 57.116  30.804  1.00 62.41 ? 664 HOH A O     1 
HETATM 3812 O O     . HOH F 6 .   ? -23.999 72.678  10.927  1.00 50.86 ? 665 HOH A O     1 
HETATM 3813 O O     . HOH F 6 .   ? 8.768   44.461  -17.298 1.00 42.47 ? 666 HOH A O     1 
HETATM 3814 O O     . HOH F 6 .   ? -13.199 48.448  19.399  1.00 56.76 ? 667 HOH A O     1 
HETATM 3815 O O     . HOH F 6 .   ? 11.936  49.995  1.909   1.00 55.19 ? 668 HOH A O     1 
HETATM 3816 O O     . HOH F 6 .   ? -36.664 46.821  7.883   1.00 53.56 ? 669 HOH A O     1 
HETATM 3817 O O     . HOH F 6 .   ? -24.487 76.243  17.066  1.00 46.84 ? 670 HOH A O     1 
HETATM 3818 O O     . HOH F 6 .   ? -29.189 100.029 7.806   1.00 65.43 ? 671 HOH A O     1 
HETATM 3819 O O     . HOH F 6 .   ? -24.560 99.000  10.824  1.00 62.64 ? 672 HOH A O     1 
HETATM 3820 O O     . HOH F 6 .   ? 1.672   30.769  -4.351  1.00 51.73 ? 673 HOH A O     1 
HETATM 3821 O O     . HOH F 6 .   ? -54.744 66.363  21.064  1.00 52.45 ? 674 HOH A O     1 
HETATM 3822 O O     . HOH F 6 .   ? -39.712 62.019  1.665   1.00 55.86 ? 675 HOH A O     1 
HETATM 3823 O O     . HOH F 6 .   ? 9.804   64.529  9.245   1.00 53.11 ? 676 HOH A O     1 
HETATM 3824 O O     . HOH F 6 .   ? -32.869 82.372  14.933  1.00 53.47 ? 677 HOH A O     1 
HETATM 3825 O O     . HOH F 6 .   ? -35.725 72.355  0.421   1.00 38.47 ? 678 HOH A O     1 
HETATM 3826 O O     . HOH F 6 .   ? -12.750 45.438  0.806   1.00 35.63 ? 679 HOH A O     1 
HETATM 3827 O O     . HOH F 6 .   ? -13.920 66.271  16.604  1.00 70.86 ? 680 HOH A O     1 
HETATM 3828 O O     . HOH F 6 .   ? -54.274 58.521  20.626  1.00 66.98 ? 681 HOH A O     1 
HETATM 3829 O O     . HOH F 6 .   ? -17.562 42.242  -3.975  1.00 79.99 ? 682 HOH A O     1 
HETATM 3830 O O     . HOH F 6 .   ? -7.834  39.096  19.011  1.00 56.97 ? 683 HOH A O     1 
HETATM 3831 O O     . HOH F 6 .   ? -16.243 52.101  -1.922  1.00 60.71 ? 684 HOH A O     1 
HETATM 3832 O O     . HOH F 6 .   ? -28.221 71.697  23.920  1.00 39.86 ? 685 HOH A O     1 
HETATM 3833 O O     . HOH F 6 .   ? 4.818   51.620  -18.922 1.00 68.39 ? 686 HOH A O     1 
HETATM 3834 O O     . HOH F 6 .   ? -17.585 71.347  14.284  1.00 52.25 ? 687 HOH A O     1 
HETATM 3835 O O     . HOH F 6 .   ? -33.187 79.726  -0.468  1.00 59.12 ? 688 HOH A O     1 
HETATM 3836 O O     . HOH F 6 .   ? -18.895 45.312  14.731  1.00 63.99 ? 689 HOH A O     1 
HETATM 3837 O O     . HOH F 6 .   ? -18.885 95.772  -4.101  1.00 64.82 ? 690 HOH A O     1 
HETATM 3838 O O     . HOH F 6 .   ? 3.468   41.861  9.607   1.00 49.86 ? 691 HOH A O     1 
HETATM 3839 O O     . HOH F 6 .   ? -3.855  45.425  16.814  1.00 79.61 ? 692 HOH A O     1 
HETATM 3840 O O     . HOH F 6 .   ? 6.946   59.136  21.354  1.00 73.73 ? 693 HOH A O     1 
HETATM 3841 O O     . HOH F 6 .   ? -55.491 61.382  23.208  1.00 49.68 ? 694 HOH A O     1 
HETATM 3842 O O     . HOH F 6 .   ? 15.392  58.526  10.264  1.00 64.18 ? 695 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   PRO 2   1   ?   ?   ?   A . n 
A 1 3   LEU 3   2   ?   ?   ?   A . n 
A 1 4   GLU 4   3   3   GLU GLU A . n 
A 1 5   LEU 5   4   4   LEU LEU A . n 
A 1 6   THR 6   5   5   THR THR A . n 
A 1 7   GLN 7   6   6   GLN GLN A . n 
A 1 8   SER 8   7   7   SER SER A . n 
A 1 9   ARG 9   8   8   ARG ARG A . n 
A 1 10  VAL 10  9   9   VAL VAL A . n 
A 1 11  GLN 11  10  10  GLN GLN A . n 
A 1 12  LYS 12  11  11  LYS LYS A . n 
A 1 13  ILE 13  12  12  ILE ILE A . n 
A 1 14  TRP 14  13  13  TRP TRP A . n 
A 1 15  VAL 15  14  14  VAL VAL A . n 
A 1 16  PRO 16  15  15  PRO PRO A . n 
A 1 17  VAL 17  16  16  VAL VAL A . n 
A 1 18  ASP 18  17  17  ASP ASP A . n 
A 1 19  HIS 19  18  18  HIS HIS A . n 
A 1 20  ARG 20  19  19  ARG ARG A . n 
A 1 21  PRO 21  20  20  PRO PRO A . n 
A 1 22  SER 22  21  ?   ?   ?   A . n 
A 1 23  LEU 23  22  ?   ?   ?   A . n 
A 1 24  PRO 24  23  ?   ?   ?   A . n 
A 1 25  ARG 25  24  ?   ?   ?   A . n 
A 1 26  SER 26  25  ?   ?   ?   A . n 
A 1 27  CYS 27  26  ?   ?   ?   A . n 
A 1 28  GLY 28  27  ?   ?   ?   A . n 
A 1 29  PRO 29  28  ?   ?   ?   A . n 
A 1 30  LYS 30  29  ?   ?   ?   A . n 
A 1 31  LEU 31  30  ?   ?   ?   A . n 
A 1 32  THR 32  31  ?   ?   ?   A . n 
A 1 33  ASN 33  32  32  ASN ASN A . n 
A 1 34  SER 34  33  33  SER SER A . n 
A 1 35  PRO 35  34  34  PRO PRO A . n 
A 1 36  THR 36  35  35  THR THR A . n 
A 1 37  VAL 37  36  36  VAL VAL A . n 
A 1 38  ILE 38  37  37  ILE ILE A . n 
A 1 39  VAL 39  38  38  VAL VAL A . n 
A 1 40  MET 40  39  39  MET MET A . n 
A 1 41  VAL 41  40  40  VAL VAL A . n 
A 1 42  GLY 42  41  41  GLY GLY A . n 
A 1 43  LEU 43  42  42  LEU LEU A . n 
A 1 44  PRO 44  43  43  PRO PRO A . n 
A 1 45  ALA 45  44  44  ALA ALA A . n 
A 1 46  ARG 46  45  45  ARG ARG A . n 
A 1 47  GLY 47  46  46  GLY GLY A . n 
A 1 48  LYS 48  47  47  LYS LYS A . n 
A 1 49  THR 49  48  48  THR THR A . n 
A 1 50  TYR 50  49  49  TYR TYR A . n 
A 1 51  ILE 51  50  50  ILE ILE A . n 
A 1 52  SER 52  51  51  SER SER A . n 
A 1 53  LYS 53  52  52  LYS LYS A . n 
A 1 54  LYS 54  53  53  LYS LYS A . n 
A 1 55  LEU 55  54  54  LEU LEU A . n 
A 1 56  THR 56  55  55  THR THR A . n 
A 1 57  ARG 57  56  56  ARG ARG A . n 
A 1 58  TYR 58  57  57  TYR TYR A . n 
A 1 59  LEU 59  58  58  LEU LEU A . n 
A 1 60  ASN 60  59  59  ASN ASN A . n 
A 1 61  TRP 61  60  60  TRP TRP A . n 
A 1 62  ILE 62  61  61  ILE ILE A . n 
A 1 63  GLY 63  62  62  GLY GLY A . n 
A 1 64  VAL 64  63  63  VAL VAL A . n 
A 1 65  PRO 65  64  64  PRO PRO A . n 
A 1 66  THR 66  65  65  THR THR A . n 
A 1 67  LYS 67  66  66  LYS LYS A . n 
A 1 68  VAL 68  67  67  VAL VAL A . n 
A 1 69  PHE 69  68  68  PHE PHE A . n 
A 1 70  ASN 70  69  69  ASN ASN A . n 
A 1 71  VAL 71  70  70  VAL VAL A . n 
A 1 72  GLY 72  71  71  GLY GLY A . n 
A 1 73  GLU 73  72  72  GLU GLU A . n 
A 1 74  TYR 74  73  73  TYR TYR A . n 
A 1 75  ARG 75  74  74  ARG ARG A . n 
A 1 76  ARG 76  75  75  ARG ARG A . n 
A 1 77  GLU 77  76  76  GLU GLU A . n 
A 1 78  ALA 78  77  77  ALA ALA A . n 
A 1 79  VAL 79  78  78  VAL VAL A . n 
A 1 80  LYS 80  79  79  LYS LYS A . n 
A 1 81  GLN 81  80  80  GLN GLN A . n 
A 1 82  TYR 82  81  81  TYR TYR A . n 
A 1 83  SER 83  82  82  SER SER A . n 
A 1 84  SER 84  83  83  SER SER A . n 
A 1 85  TYR 85  84  84  TYR TYR A . n 
A 1 86  ASN 86  85  85  ASN ASN A . n 
A 1 87  PHE 87  86  86  PHE PHE A . n 
A 1 88  PHE 88  87  87  PHE PHE A . n 
A 1 89  ARG 89  88  88  ARG ARG A . n 
A 1 90  PRO 90  89  89  PRO PRO A . n 
A 1 91  ASP 91  90  90  ASP ASP A . n 
A 1 92  ASN 92  91  91  ASN ASN A . n 
A 1 93  GLU 93  92  92  GLU GLU A . n 
A 1 94  GLU 94  93  93  GLU GLU A . n 
A 1 95  ALA 95  94  94  ALA ALA A . n 
A 1 96  MET 96  95  95  MET MET A . n 
A 1 97  LYS 97  96  96  LYS LYS A . n 
A 1 98  VAL 98  97  97  VAL VAL A . n 
A 1 99  ARG 99  98  98  ARG ARG A . n 
A 1 100 LYS 100 99  99  LYS LYS A . n 
A 1 101 GLN 101 100 100 GLN GLN A . n 
A 1 102 CYS 102 101 101 CYS CYS A . n 
A 1 103 ALA 103 102 102 ALA ALA A . n 
A 1 104 LEU 104 103 103 LEU LEU A . n 
A 1 105 ALA 105 104 104 ALA ALA A . n 
A 1 106 ALA 106 105 105 ALA ALA A . n 
A 1 107 LEU 107 106 106 LEU LEU A . n 
A 1 108 ARG 108 107 107 ARG ARG A . n 
A 1 109 ASP 109 108 108 ASP ASP A . n 
A 1 110 VAL 110 109 109 VAL VAL A . n 
A 1 111 LYS 111 110 110 LYS LYS A . n 
A 1 112 SER 112 111 111 SER SER A . n 
A 1 113 TYR 113 112 112 TYR TYR A . n 
A 1 114 LEU 114 113 113 LEU LEU A . n 
A 1 115 ALA 115 114 114 ALA ALA A . n 
A 1 116 LYS 116 115 115 LYS LYS A . n 
A 1 117 GLU 117 116 116 GLU GLU A . n 
A 1 118 GLY 118 117 117 GLY GLY A . n 
A 1 119 GLY 119 118 118 GLY GLY A . n 
A 1 120 GLN 120 119 119 GLN GLN A . n 
A 1 121 ILE 121 120 120 ILE ILE A . n 
A 1 122 ALA 122 121 121 ALA ALA A . n 
A 1 123 VAL 123 122 122 VAL VAL A . n 
A 1 124 PHE 124 123 123 PHE PHE A . n 
A 1 125 ASP 125 124 124 ASP ASP A . n 
A 1 126 ALA 126 125 125 ALA ALA A . n 
A 1 127 THR 127 126 126 THR THR A . n 
A 1 128 ASN 128 127 127 ASN ASN A . n 
A 1 129 THR 129 128 128 THR THR A . n 
A 1 130 THR 130 129 129 THR THR A . n 
A 1 131 ARG 131 130 130 ARG ARG A . n 
A 1 132 GLU 132 131 131 GLU GLU A . n 
A 1 133 ARG 133 132 132 ARG ARG A . n 
A 1 134 ARG 134 133 133 ARG ARG A . n 
A 1 135 HIS 135 134 134 HIS HIS A . n 
A 1 136 MET 136 135 135 MET MET A . n 
A 1 137 ILE 137 136 136 ILE ILE A . n 
A 1 138 LEU 138 137 137 LEU LEU A . n 
A 1 139 HIS 139 138 138 HIS HIS A . n 
A 1 140 PHE 140 139 139 PHE PHE A . n 
A 1 141 ALA 141 140 140 ALA ALA A . n 
A 1 142 LYS 142 141 141 LYS LYS A . n 
A 1 143 GLU 143 142 142 GLU GLU A . n 
A 1 144 ASN 144 143 143 ASN ASN A . n 
A 1 145 ASP 145 144 144 ASP ASP A . n 
A 1 146 PHE 146 145 145 PHE PHE A . n 
A 1 147 LYS 147 146 146 LYS LYS A . n 
A 1 148 ALA 148 147 147 ALA ALA A . n 
A 1 149 PHE 149 148 148 PHE PHE A . n 
A 1 150 PHE 150 149 149 PHE PHE A . n 
A 1 151 ILE 151 150 150 ILE ILE A . n 
A 1 152 GLU 152 151 151 GLU GLU A . n 
A 1 153 SER 153 152 152 SER SER A . n 
A 1 154 VAL 154 153 153 VAL VAL A . n 
A 1 155 CYS 155 154 154 CYS CYS A . n 
A 1 156 ASP 156 155 155 ASP ASP A . n 
A 1 157 ASP 157 156 156 ASP ASP A . n 
A 1 158 PRO 158 157 157 PRO PRO A . n 
A 1 159 THR 159 158 158 THR THR A . n 
A 1 160 VAL 160 159 159 VAL VAL A . n 
A 1 161 VAL 161 160 160 VAL VAL A . n 
A 1 162 ALA 162 161 161 ALA ALA A . n 
A 1 163 SER 163 162 162 SER SER A . n 
A 1 164 ASN 164 163 163 ASN ASN A . n 
A 1 165 ILE 165 164 164 ILE ILE A . n 
A 1 166 MET 166 165 165 MET MET A . n 
A 1 167 GLU 167 166 166 GLU GLU A . n 
A 1 168 VAL 168 167 167 VAL VAL A . n 
A 1 169 LYS 169 168 168 LYS LYS A . n 
A 1 170 ILE 170 169 169 ILE ILE A . n 
A 1 171 SER 171 170 170 SER SER A . n 
A 1 172 SER 172 171 171 SER SER A . n 
A 1 173 PRO 173 172 172 PRO PRO A . n 
A 1 174 ASP 174 173 173 ASP ASP A . n 
A 1 175 TYR 175 174 174 TYR TYR A . n 
A 1 176 LYS 176 175 175 LYS LYS A . n 
A 1 177 ASP 177 176 176 ASP ASP A . n 
A 1 178 CYS 178 177 177 CYS CYS A . n 
A 1 179 ASN 179 178 178 ASN ASN A . n 
A 1 180 SER 180 179 179 SER SER A . n 
A 1 181 ALA 181 180 180 ALA ALA A . n 
A 1 182 GLU 182 181 181 GLU GLU A . n 
A 1 183 ALA 183 182 182 ALA ALA A . n 
A 1 184 MET 184 183 183 MET MET A . n 
A 1 185 ASP 185 184 184 ASP ASP A . n 
A 1 186 ASP 186 185 185 ASP ASP A . n 
A 1 187 PHE 187 186 186 PHE PHE A . n 
A 1 188 MET 188 187 187 MET MET A . n 
A 1 189 LYS 189 188 188 LYS LYS A . n 
A 1 190 ARG 190 189 189 ARG ARG A . n 
A 1 191 ILE 191 190 190 ILE ILE A . n 
A 1 192 SER 192 191 191 SER SER A . n 
A 1 193 CYS 193 192 192 CYS CYS A . n 
A 1 194 TYR 194 193 193 TYR TYR A . n 
A 1 195 GLU 195 194 194 GLU GLU A . n 
A 1 196 ALA 196 195 195 ALA ALA A . n 
A 1 197 SER 197 196 196 SER SER A . n 
A 1 198 TYR 198 197 197 TYR TYR A . n 
A 1 199 GLN 199 198 198 GLN GLN A . n 
A 1 200 PRO 200 199 199 PRO PRO A . n 
A 1 201 LEU 201 200 200 LEU LEU A . n 
A 1 202 ASP 202 201 201 ASP ASP A . n 
A 1 203 PRO 203 202 202 PRO PRO A . n 
A 1 204 ASP 204 203 203 ASP ASP A . n 
A 1 205 LYS 205 204 204 LYS LYS A . n 
A 1 206 CYS 206 205 205 CYS CYS A . n 
A 1 207 ASP 207 206 206 ASP ASP A . n 
A 1 208 ARG 208 207 207 ARG ARG A . n 
A 1 209 ASP 209 208 208 ASP ASP A . n 
A 1 210 LEU 210 209 209 LEU LEU A . n 
A 1 211 SER 211 210 210 SER SER A . n 
A 1 212 LEU 212 211 211 LEU LEU A . n 
A 1 213 ILE 213 212 212 ILE ILE A . n 
A 1 214 LYS 214 213 213 LYS LYS A . n 
A 1 215 VAL 215 214 214 VAL VAL A . n 
A 1 216 ILE 216 215 215 ILE ILE A . n 
A 1 217 ASP 217 216 216 ASP ASP A . n 
A 1 218 VAL 218 217 217 VAL VAL A . n 
A 1 219 GLY 219 218 218 GLY GLY A . n 
A 1 220 ARG 220 219 219 ARG ARG A . n 
A 1 221 ARG 221 220 220 ARG ARG A . n 
A 1 222 PHE 222 221 221 PHE PHE A . n 
A 1 223 LEU 223 222 222 LEU LEU A . n 
A 1 224 VAL 224 223 223 VAL VAL A . n 
A 1 225 ASN 225 224 224 ASN ASN A . n 
A 1 226 ARG 226 225 225 ARG ARG A . n 
A 1 227 VAL 227 226 226 VAL VAL A . n 
A 1 228 GLN 228 227 227 GLN GLN A . n 
A 1 229 ASP 229 228 228 ASP ASP A . n 
A 1 230 HIS 230 229 229 HIS HIS A . n 
A 1 231 ILE 231 230 230 ILE ILE A . n 
A 1 232 GLN 232 231 231 GLN GLN A . n 
A 1 233 SER 233 232 232 SER SER A . n 
A 1 234 ARG 234 233 233 ARG ARG A . n 
A 1 235 ILE 235 234 234 ILE ILE A . n 
A 1 236 VAL 236 235 235 VAL VAL A . n 
A 1 237 TYR 237 236 236 TYR TYR A . n 
A 1 238 TYR 238 237 237 TYR TYR A . n 
A 1 239 LEU 239 238 238 LEU LEU A . n 
A 1 240 MET 240 239 239 MET MET A . n 
A 1 241 ASN 241 240 240 ASN ASN A . n 
A 1 242 ILE 242 241 241 ILE ILE A . n 
A 1 243 HIS 243 242 242 HIS HIS A . n 
A 1 244 VAL 244 243 243 VAL VAL A . n 
A 1 245 GLN 245 244 244 GLN GLN A . n 
A 1 246 PRO 246 245 245 PRO PRO A . n 
A 1 247 ARG 247 246 246 ARG ARG A . n 
A 1 248 THR 248 247 247 THR THR A . n 
A 1 249 ILE 249 248 248 ILE ILE A . n 
A 1 250 TYR 250 249 249 TYR TYR A . n 
A 1 251 LEU 251 250 250 LEU LEU A . n 
A 1 252 CYS 252 251 251 CYS CYS A . n 
A 1 253 ARG 253 252 252 ARG ARG A . n 
A 1 254 HIS 254 253 253 HIS HIS A . n 
A 1 255 GLY 255 254 254 GLY GLY A . n 
A 1 256 GLU 256 255 255 GLU GLU A . n 
A 1 257 ASN 257 256 256 ASN ASN A . n 
A 1 258 GLU 258 257 257 GLU GLU A . n 
A 1 259 HIS 259 258 258 HIS HIS A . n 
A 1 260 ASN 260 259 259 ASN ASN A . n 
A 1 261 LEU 261 260 260 LEU LEU A . n 
A 1 262 GLN 262 261 261 GLN GLN A . n 
A 1 263 GLY 263 262 262 GLY GLY A . n 
A 1 264 ARG 264 263 263 ARG ARG A . n 
A 1 265 ILE 265 264 264 ILE ILE A . n 
A 1 266 GLY 266 265 265 GLY GLY A . n 
A 1 267 GLY 267 266 266 GLY GLY A . n 
A 1 268 ASP 268 267 267 ASP ASP A . n 
A 1 269 SER 269 268 268 SER SER A . n 
A 1 270 GLY 270 269 269 GLY GLY A . n 
A 1 271 LEU 271 270 270 LEU LEU A . n 
A 1 272 SER 272 271 271 SER SER A . n 
A 1 273 SER 273 272 272 SER SER A . n 
A 1 274 ARG 274 273 273 ARG ARG A . n 
A 1 275 GLY 275 274 274 GLY GLY A . n 
A 1 276 LYS 276 275 275 LYS LYS A . n 
A 1 277 LYS 277 276 276 LYS LYS A . n 
A 1 278 PHE 278 277 277 PHE PHE A . n 
A 1 279 ALA 279 278 278 ALA ALA A . n 
A 1 280 SER 280 279 279 SER SER A . n 
A 1 281 ALA 281 280 280 ALA ALA A . n 
A 1 282 LEU 282 281 281 LEU LEU A . n 
A 1 283 SER 283 282 282 SER SER A . n 
A 1 284 LYS 284 283 283 LYS LYS A . n 
A 1 285 PHE 285 284 284 PHE PHE A . n 
A 1 286 VAL 286 285 285 VAL VAL A . n 
A 1 287 GLU 287 286 286 GLU GLU A . n 
A 1 288 GLU 288 287 287 GLU GLU A . n 
A 1 289 GLN 289 288 288 GLN GLN A . n 
A 1 290 ASN 290 289 289 ASN ASN A . n 
A 1 291 LEU 291 290 290 LEU LEU A . n 
A 1 292 LYS 292 291 291 LYS LYS A . n 
A 1 293 ASP 293 292 292 ASP ASP A . n 
A 1 294 LEU 294 293 293 LEU LEU A . n 
A 1 295 ARG 295 294 294 ARG ARG A . n 
A 1 296 VAL 296 295 295 VAL VAL A . n 
A 1 297 TRP 297 296 296 TRP TRP A . n 
A 1 298 THR 298 297 297 THR THR A . n 
A 1 299 SER 299 298 298 SER SER A . n 
A 1 300 GLN 300 299 299 GLN GLN A . n 
A 1 301 LEU 301 300 300 LEU LEU A . n 
A 1 302 LYS 302 301 301 LYS LYS A . n 
A 1 303 SER 303 302 302 SER SER A . n 
A 1 304 THR 304 303 303 THR THR A . n 
A 1 305 ILE 305 304 304 ILE ILE A . n 
A 1 306 GLN 306 305 305 GLN GLN A . n 
A 1 307 THR 307 306 306 THR THR A . n 
A 1 308 ALA 308 307 307 ALA ALA A . n 
A 1 309 GLU 309 308 308 GLU GLU A . n 
A 1 310 ALA 310 309 309 ALA ALA A . n 
A 1 311 LEU 311 310 310 LEU LEU A . n 
A 1 312 ARG 312 311 311 ARG ARG A . n 
A 1 313 LEU 313 312 312 LEU LEU A . n 
A 1 314 PRO 314 313 313 PRO PRO A . n 
A 1 315 TYR 315 314 314 TYR TYR A . n 
A 1 316 GLU 316 315 315 GLU GLU A . n 
A 1 317 GLN 317 316 316 GLN GLN A . n 
A 1 318 TRP 318 317 317 TRP TRP A . n 
A 1 319 LYS 319 318 318 LYS LYS A . n 
A 1 320 ALA 320 319 319 ALA ALA A . n 
A 1 321 LEU 321 320 320 LEU LEU A . n 
A 1 322 ASN 322 321 321 ASN ASN A . n 
A 1 323 GLU 323 322 322 GLU GLU A . n 
A 1 324 ILE 324 323 323 ILE ILE A . n 
A 1 325 ASP 325 324 324 ASP ASP A . n 
A 1 326 ALA 326 325 325 ALA ALA A . n 
A 1 327 GLY 327 326 326 GLY GLY A . n 
A 1 328 VAL 328 327 327 VAL VAL A . n 
A 1 329 CYS 329 328 328 CYS CYS A . n 
A 1 330 GLU 330 329 329 GLU GLU A . n 
A 1 331 GLU 331 330 330 GLU GLU A . n 
A 1 332 LEU 332 331 331 LEU LEU A . n 
A 1 333 THR 333 332 332 THR THR A . n 
A 1 334 TYR 334 333 333 TYR TYR A . n 
A 1 335 GLU 335 334 334 GLU GLU A . n 
A 1 336 GLU 336 335 335 GLU GLU A . n 
A 1 337 ILE 337 336 336 ILE ILE A . n 
A 1 338 ARG 338 337 337 ARG ARG A . n 
A 1 339 ASP 339 338 338 ASP ASP A . n 
A 1 340 THR 340 339 339 THR THR A . n 
A 1 341 TYR 341 340 340 TYR TYR A . n 
A 1 342 PRO 342 341 341 PRO PRO A . n 
A 1 343 GLU 343 342 342 GLU GLU A . n 
A 1 344 GLU 344 343 343 GLU GLU A . n 
A 1 345 TYR 345 344 344 TYR TYR A . n 
A 1 346 ALA 346 345 345 ALA ALA A . n 
A 1 347 LEU 347 346 346 LEU LEU A . n 
A 1 348 ARG 348 347 347 ARG ARG A . n 
A 1 349 GLU 349 348 348 GLU GLU A . n 
A 1 350 GLN 350 349 349 GLN GLN A . n 
A 1 351 ASP 351 350 350 ASP ASP A . n 
A 1 352 LYS 352 351 351 LYS LYS A . n 
A 1 353 TYR 353 352 352 TYR TYR A . n 
A 1 354 TYR 354 353 353 TYR TYR A . n 
A 1 355 TYR 355 354 354 TYR TYR A . n 
A 1 356 ARG 356 355 355 ARG ARG A . n 
A 1 357 TYR 357 356 356 TYR TYR A . n 
A 1 358 PRO 358 357 357 PRO PRO A . n 
A 1 359 THR 359 358 358 THR THR A . n 
A 1 360 GLY 360 359 359 GLY GLY A . n 
A 1 361 GLU 361 360 360 GLU GLU A . n 
A 1 362 SER 362 361 361 SER SER A . n 
A 1 363 TYR 363 362 362 TYR TYR A . n 
A 1 364 GLN 364 363 363 GLN GLN A . n 
A 1 365 ASP 365 364 364 ASP ASP A . n 
A 1 366 LEU 366 365 365 LEU LEU A . n 
A 1 367 VAL 367 366 366 VAL VAL A . n 
A 1 368 GLN 368 367 367 GLN GLN A . n 
A 1 369 ARG 369 368 368 ARG ARG A . n 
A 1 370 LEU 370 369 369 LEU LEU A . n 
A 1 371 GLU 371 370 370 GLU GLU A . n 
A 1 372 PRO 372 371 371 PRO PRO A . n 
A 1 373 VAL 373 372 372 VAL VAL A . n 
A 1 374 ILE 374 373 373 ILE ILE A . n 
A 1 375 MET 375 374 374 MET MET A . n 
A 1 376 GLU 376 375 375 GLU GLU A . n 
A 1 377 LEU 377 376 376 LEU LEU A . n 
A 1 378 GLU 378 377 377 GLU GLU A . n 
A 1 379 ARG 379 378 378 ARG ARG A . n 
A 1 380 GLN 380 379 379 GLN GLN A . n 
A 1 381 GLU 381 380 380 GLU GLU A . n 
A 1 382 ASN 382 381 381 ASN ASN A . n 
A 1 383 VAL 383 382 382 VAL VAL A . n 
A 1 384 LEU 384 383 383 LEU LEU A . n 
A 1 385 VAL 385 384 384 VAL VAL A . n 
A 1 386 ILE 386 385 385 ILE ILE A . n 
A 1 387 CYS 387 386 386 CYS CYS A . n 
A 1 388 HIS 388 387 387 HIS HIS A . n 
A 1 389 GLN 389 388 388 GLN GLN A . n 
A 1 390 ALA 390 389 389 ALA ALA A . n 
A 1 391 VAL 391 390 390 VAL VAL A . n 
A 1 392 LEU 392 391 391 LEU LEU A . n 
A 1 393 ARG 393 392 392 ARG ARG A . n 
A 1 394 CYS 394 393 393 CYS CYS A . n 
A 1 395 LEU 395 394 394 LEU LEU A . n 
A 1 396 LEU 396 395 395 LEU LEU A . n 
A 1 397 ALA 397 396 396 ALA ALA A . n 
A 1 398 TYR 398 397 397 TYR TYR A . n 
A 1 399 PHE 399 398 398 PHE PHE A . n 
A 1 400 LEU 400 399 399 LEU LEU A . n 
A 1 401 ASP 401 400 400 ASP ASP A . n 
A 1 402 LYS 402 401 401 LYS LYS A . n 
A 1 403 SER 403 402 402 SER SER A . n 
A 1 404 ALA 404 403 403 ALA ALA A . n 
A 1 405 GLU 405 404 404 GLU GLU A . n 
A 1 406 GLU 406 405 405 GLU GLU A . n 
A 1 407 MET 407 406 406 MET MET A . n 
A 1 408 PRO 408 407 407 PRO PRO A . n 
A 1 409 TYR 409 408 408 TYR TYR A . n 
A 1 410 LEU 410 409 409 LEU LEU A . n 
A 1 411 LYS 411 410 410 LYS LYS A . n 
A 1 412 CYS 412 411 411 CYS CYS A . n 
A 1 413 PRO 413 412 412 PRO PRO A . n 
A 1 414 LEU 414 413 413 LEU LEU A . n 
A 1 415 HIS 415 414 414 HIS HIS A . n 
A 1 416 THR 416 415 415 THR THR A . n 
A 1 417 VAL 417 416 416 VAL VAL A . n 
A 1 418 LEU 418 417 417 LEU LEU A . n 
A 1 419 LYS 419 418 418 LYS LYS A . n 
A 1 420 LEU 420 419 419 LEU LEU A . n 
A 1 421 THR 421 420 420 THR THR A . n 
A 1 422 PRO 422 421 421 PRO PRO A . n 
A 1 423 VAL 423 422 422 VAL VAL A . n 
A 1 424 ALA 424 423 423 ALA ALA A . n 
A 1 425 TYR 425 424 424 TYR TYR A . n 
A 1 426 GLY 426 425 425 GLY GLY A . n 
A 1 427 CYS 427 426 426 CYS CYS A . n 
A 1 428 ARG 428 427 427 ARG ARG A . n 
A 1 429 VAL 429 428 428 VAL VAL A . n 
A 1 430 GLU 430 429 429 GLU GLU A . n 
A 1 431 SER 431 430 430 SER SER A . n 
A 1 432 ILE 432 431 431 ILE ILE A . n 
A 1 433 TYR 433 432 432 TYR TYR A . n 
A 1 434 LEU 434 433 433 LEU LEU A . n 
A 1 435 ASN 435 434 434 ASN ASN A . n 
A 1 436 VAL 436 435 435 VAL VAL A . n 
A 1 437 GLU 437 436 436 GLU GLU A . n 
A 1 438 SER 438 437 437 SER SER A . n 
A 1 439 VAL 439 438 438 VAL VAL A . n 
A 1 440 CYS 440 439 439 CYS CYS A . n 
A 1 441 THR 441 440 440 THR THR A . n 
A 1 442 HIS 442 441 441 HIS HIS A . n 
A 1 443 ARG 443 442 442 ARG ARG A . n 
A 1 444 GLU 444 443 443 GLU GLU A . n 
A 1 445 ARG 445 444 444 ARG ARG A . n 
A 1 446 SER 446 445 445 SER SER A . n 
A 1 447 GLU 447 446 446 GLU GLU A . n 
A 1 448 ASP 448 447 ?   ?   ?   A . n 
A 1 449 ALA 449 448 ?   ?   ?   A . n 
A 1 450 LYS 450 449 ?   ?   ?   A . n 
A 1 451 LYS 451 450 ?   ?   ?   A . n 
A 1 452 GLY 452 451 ?   ?   ?   A . n 
A 1 453 PRO 453 452 ?   ?   ?   A . n 
A 1 454 ASN 454 453 453 ASN ASN A . n 
A 1 455 PRO 455 454 454 PRO PRO A . n 
A 1 456 LEU 456 455 455 LEU LEU A . n 
A 1 457 MET 457 456 456 MET MET A . n 
A 1 458 ARG 458 457 457 ARG ARG A . n 
A 1 459 ARG 459 458 458 ARG ARG A . n 
A 1 460 ASN 460 459 459 ASN ASN A . n 
A 1 461 SER 461 460 ?   ?   ?   A . n 
A 1 462 VAL 462 461 ?   ?   ?   A . n 
A 1 463 THR 463 462 ?   ?   ?   A . n 
A 1 464 PRO 464 463 ?   ?   ?   A . n 
A 1 465 LEU 465 464 ?   ?   ?   A . n 
A 1 466 ALA 466 465 ?   ?   ?   A . n 
A 1 467 SER 467 466 ?   ?   ?   A . n 
A 1 468 PRO 468 467 ?   ?   ?   A . n 
A 1 469 GLU 469 468 ?   ?   ?   A . n 
A 1 470 PRO 470 469 ?   ?   ?   A . n 
A 1 471 THR 471 470 ?   ?   ?   A . n 
A 1 472 LYS 472 471 ?   ?   ?   A . n 
A 1 473 LYS 473 472 ?   ?   ?   A . n 
A 1 474 PRO 474 473 ?   ?   ?   A . n 
A 1 475 ARG 475 474 ?   ?   ?   A . n 
A 1 476 ILE 476 475 ?   ?   ?   A . n 
A 1 477 ASN 477 476 ?   ?   ?   A . n 
A 1 478 SER 478 477 ?   ?   ?   A . n 
A 1 479 PHE 479 478 ?   ?   ?   A . n 
A 1 480 GLU 480 479 ?   ?   ?   A . n 
A 1 481 GLU 481 480 ?   ?   ?   A . n 
A 1 482 HIS 482 481 ?   ?   ?   A . n 
A 1 483 VAL 483 482 ?   ?   ?   A . n 
A 1 484 ALA 484 483 ?   ?   ?   A . n 
A 1 485 SER 485 484 ?   ?   ?   A . n 
A 1 486 THR 486 485 ?   ?   ?   A . n 
A 1 487 SER 487 486 ?   ?   ?   A . n 
A 1 488 ALA 488 487 ?   ?   ?   A . n 
A 1 489 ALA 489 488 ?   ?   ?   A . n 
A 1 490 LEU 490 489 ?   ?   ?   A . n 
A 1 491 PRO 491 490 ?   ?   ?   A . n 
A 1 492 SER 492 491 ?   ?   ?   A . n 
A 1 493 CYS 493 492 ?   ?   ?   A . n 
A 1 494 LEU 494 493 ?   ?   ?   A . n 
A 1 495 PRO 495 494 ?   ?   ?   A . n 
A 1 496 PRO 496 495 ?   ?   ?   A . n 
A 1 497 GLU 497 496 ?   ?   ?   A . n 
A 1 498 VAL 498 497 ?   ?   ?   A . n 
A 1 499 PRO 499 498 ?   ?   ?   A . n 
A 1 500 THR 500 499 ?   ?   ?   A . n 
A 1 501 GLN 501 500 ?   ?   ?   A . n 
A 1 502 LEU 502 501 ?   ?   ?   A . n 
A 1 503 PRO 503 502 ?   ?   ?   A . n 
A 1 504 GLY 504 503 ?   ?   ?   A . n 
A 1 505 GLN 505 504 ?   ?   ?   A . n 
A 1 506 ASN 506 505 ?   ?   ?   A . n 
A 1 507 MET 507 506 ?   ?   ?   A . n 
A 1 508 LYS 508 507 ?   ?   ?   A . n 
A 1 509 GLY 509 508 ?   ?   ?   A . n 
A 1 510 SER 510 509 ?   ?   ?   A . n 
A 1 511 ARG 511 510 ?   ?   ?   A . n 
A 1 512 SER 512 511 ?   ?   ?   A . n 
A 1 513 SER 513 512 ?   ?   ?   A . n 
A 1 514 ALA 514 513 ?   ?   ?   A . n 
A 1 515 ASP 515 514 ?   ?   ?   A . n 
A 1 516 SER 516 515 ?   ?   ?   A . n 
A 1 517 SER 517 516 ?   ?   ?   A . n 
A 1 518 ARG 518 517 ?   ?   ?   A . n 
A 1 519 LYS 519 518 ?   ?   ?   A . n 
A 1 520 HIS 520 519 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FDP 1   524 524 FDP FDP A . 
C 3 PHS 1   710 710 PHS PHS A . 
D 4 ADP 1   700 700 ADP ADP A . 
E 5 F6P 1   720 720 F6P F6P A . 
F 6 HOH 1   520 1   HOH HOH A . 
F 6 HOH 2   521 2   HOH HOH A . 
F 6 HOH 3   522 3   HOH HOH A . 
F 6 HOH 4   523 4   HOH HOH A . 
F 6 HOH 5   525 5   HOH HOH A . 
F 6 HOH 6   526 6   HOH HOH A . 
F 6 HOH 7   527 7   HOH HOH A . 
F 6 HOH 8   528 8   HOH HOH A . 
F 6 HOH 9   529 9   HOH HOH A . 
F 6 HOH 10  530 10  HOH HOH A . 
F 6 HOH 11  531 11  HOH HOH A . 
F 6 HOH 12  532 12  HOH HOH A . 
F 6 HOH 13  533 13  HOH HOH A . 
F 6 HOH 14  534 14  HOH HOH A . 
F 6 HOH 15  535 15  HOH HOH A . 
F 6 HOH 16  536 16  HOH HOH A . 
F 6 HOH 17  537 17  HOH HOH A . 
F 6 HOH 18  538 18  HOH HOH A . 
F 6 HOH 19  539 19  HOH HOH A . 
F 6 HOH 20  540 20  HOH HOH A . 
F 6 HOH 21  541 21  HOH HOH A . 
F 6 HOH 22  542 22  HOH HOH A . 
F 6 HOH 23  543 23  HOH HOH A . 
F 6 HOH 24  544 24  HOH HOH A . 
F 6 HOH 25  545 25  HOH HOH A . 
F 6 HOH 26  546 26  HOH HOH A . 
F 6 HOH 27  547 27  HOH HOH A . 
F 6 HOH 28  548 28  HOH HOH A . 
F 6 HOH 29  549 29  HOH HOH A . 
F 6 HOH 30  550 30  HOH HOH A . 
F 6 HOH 31  551 31  HOH HOH A . 
F 6 HOH 32  552 32  HOH HOH A . 
F 6 HOH 33  553 33  HOH HOH A . 
F 6 HOH 34  554 34  HOH HOH A . 
F 6 HOH 35  555 35  HOH HOH A . 
F 6 HOH 36  556 36  HOH HOH A . 
F 6 HOH 37  557 37  HOH HOH A . 
F 6 HOH 38  558 38  HOH HOH A . 
F 6 HOH 39  559 39  HOH HOH A . 
F 6 HOH 40  560 40  HOH HOH A . 
F 6 HOH 41  561 41  HOH HOH A . 
F 6 HOH 42  562 42  HOH HOH A . 
F 6 HOH 43  563 43  HOH HOH A . 
F 6 HOH 44  564 44  HOH HOH A . 
F 6 HOH 45  565 45  HOH HOH A . 
F 6 HOH 46  566 46  HOH HOH A . 
F 6 HOH 47  567 47  HOH HOH A . 
F 6 HOH 48  568 48  HOH HOH A . 
F 6 HOH 49  569 49  HOH HOH A . 
F 6 HOH 50  570 50  HOH HOH A . 
F 6 HOH 51  571 51  HOH HOH A . 
F 6 HOH 52  572 52  HOH HOH A . 
F 6 HOH 53  573 53  HOH HOH A . 
F 6 HOH 54  574 54  HOH HOH A . 
F 6 HOH 55  575 55  HOH HOH A . 
F 6 HOH 56  576 56  HOH HOH A . 
F 6 HOH 57  577 57  HOH HOH A . 
F 6 HOH 58  578 58  HOH HOH A . 
F 6 HOH 59  579 59  HOH HOH A . 
F 6 HOH 60  580 60  HOH HOH A . 
F 6 HOH 61  581 61  HOH HOH A . 
F 6 HOH 62  582 62  HOH HOH A . 
F 6 HOH 63  583 63  HOH HOH A . 
F 6 HOH 64  584 64  HOH HOH A . 
F 6 HOH 65  585 65  HOH HOH A . 
F 6 HOH 66  586 66  HOH HOH A . 
F 6 HOH 67  587 67  HOH HOH A . 
F 6 HOH 68  588 68  HOH HOH A . 
F 6 HOH 69  589 69  HOH HOH A . 
F 6 HOH 70  590 70  HOH HOH A . 
F 6 HOH 71  591 71  HOH HOH A . 
F 6 HOH 72  592 72  HOH HOH A . 
F 6 HOH 73  593 73  HOH HOH A . 
F 6 HOH 74  594 74  HOH HOH A . 
F 6 HOH 75  595 75  HOH HOH A . 
F 6 HOH 76  596 76  HOH HOH A . 
F 6 HOH 77  597 77  HOH HOH A . 
F 6 HOH 78  598 78  HOH HOH A . 
F 6 HOH 79  599 79  HOH HOH A . 
F 6 HOH 80  600 80  HOH HOH A . 
F 6 HOH 81  601 81  HOH HOH A . 
F 6 HOH 82  602 82  HOH HOH A . 
F 6 HOH 83  603 83  HOH HOH A . 
F 6 HOH 84  604 84  HOH HOH A . 
F 6 HOH 85  605 85  HOH HOH A . 
F 6 HOH 86  606 86  HOH HOH A . 
F 6 HOH 87  607 87  HOH HOH A . 
F 6 HOH 88  608 88  HOH HOH A . 
F 6 HOH 89  609 89  HOH HOH A . 
F 6 HOH 90  610 90  HOH HOH A . 
F 6 HOH 91  611 91  HOH HOH A . 
F 6 HOH 92  612 92  HOH HOH A . 
F 6 HOH 93  613 93  HOH HOH A . 
F 6 HOH 94  614 94  HOH HOH A . 
F 6 HOH 95  615 95  HOH HOH A . 
F 6 HOH 96  616 96  HOH HOH A . 
F 6 HOH 97  617 97  HOH HOH A . 
F 6 HOH 98  618 98  HOH HOH A . 
F 6 HOH 99  619 99  HOH HOH A . 
F 6 HOH 100 620 100 HOH HOH A . 
F 6 HOH 101 621 101 HOH HOH A . 
F 6 HOH 102 622 102 HOH HOH A . 
F 6 HOH 103 623 103 HOH HOH A . 
F 6 HOH 104 624 104 HOH HOH A . 
F 6 HOH 105 625 105 HOH HOH A . 
F 6 HOH 106 626 106 HOH HOH A . 
F 6 HOH 107 627 107 HOH HOH A . 
F 6 HOH 108 628 108 HOH HOH A . 
F 6 HOH 109 629 109 HOH HOH A . 
F 6 HOH 110 630 110 HOH HOH A . 
F 6 HOH 111 631 111 HOH HOH A . 
F 6 HOH 112 632 112 HOH HOH A . 
F 6 HOH 113 633 113 HOH HOH A . 
F 6 HOH 114 634 114 HOH HOH A . 
F 6 HOH 115 635 115 HOH HOH A . 
F 6 HOH 116 636 116 HOH HOH A . 
F 6 HOH 117 637 117 HOH HOH A . 
F 6 HOH 118 638 118 HOH HOH A . 
F 6 HOH 119 639 119 HOH HOH A . 
F 6 HOH 120 640 120 HOH HOH A . 
F 6 HOH 121 641 121 HOH HOH A . 
F 6 HOH 122 642 122 HOH HOH A . 
F 6 HOH 123 643 123 HOH HOH A . 
F 6 HOH 124 644 124 HOH HOH A . 
F 6 HOH 125 645 125 HOH HOH A . 
F 6 HOH 126 646 126 HOH HOH A . 
F 6 HOH 127 647 127 HOH HOH A . 
F 6 HOH 128 648 128 HOH HOH A . 
F 6 HOH 129 649 129 HOH HOH A . 
F 6 HOH 130 650 130 HOH HOH A . 
F 6 HOH 131 651 131 HOH HOH A . 
F 6 HOH 132 652 132 HOH HOH A . 
F 6 HOH 133 653 133 HOH HOH A . 
F 6 HOH 134 654 134 HOH HOH A . 
F 6 HOH 135 655 135 HOH HOH A . 
F 6 HOH 136 656 136 HOH HOH A . 
F 6 HOH 137 657 137 HOH HOH A . 
F 6 HOH 138 658 138 HOH HOH A . 
F 6 HOH 139 659 139 HOH HOH A . 
F 6 HOH 140 660 140 HOH HOH A . 
F 6 HOH 141 661 141 HOH HOH A . 
F 6 HOH 142 662 142 HOH HOH A . 
F 6 HOH 143 663 143 HOH HOH A . 
F 6 HOH 144 664 144 HOH HOH A . 
F 6 HOH 145 665 145 HOH HOH A . 
F 6 HOH 146 666 146 HOH HOH A . 
F 6 HOH 147 667 147 HOH HOH A . 
F 6 HOH 148 668 148 HOH HOH A . 
F 6 HOH 149 669 149 HOH HOH A . 
F 6 HOH 150 670 150 HOH HOH A . 
F 6 HOH 151 671 151 HOH HOH A . 
F 6 HOH 152 672 152 HOH HOH A . 
F 6 HOH 153 673 153 HOH HOH A . 
F 6 HOH 154 674 154 HOH HOH A . 
F 6 HOH 155 675 155 HOH HOH A . 
F 6 HOH 156 676 156 HOH HOH A . 
F 6 HOH 157 677 157 HOH HOH A . 
F 6 HOH 158 678 158 HOH HOH A . 
F 6 HOH 159 679 159 HOH HOH A . 
F 6 HOH 160 680 160 HOH HOH A . 
F 6 HOH 161 681 161 HOH HOH A . 
F 6 HOH 162 682 162 HOH HOH A . 
F 6 HOH 163 683 163 HOH HOH A . 
F 6 HOH 164 684 164 HOH HOH A . 
F 6 HOH 165 685 165 HOH HOH A . 
F 6 HOH 166 686 166 HOH HOH A . 
F 6 HOH 167 687 167 HOH HOH A . 
F 6 HOH 168 688 168 HOH HOH A . 
F 6 HOH 169 689 169 HOH HOH A . 
F 6 HOH 170 690 170 HOH HOH A . 
F 6 HOH 171 691 171 HOH HOH A . 
F 6 HOH 172 692 172 HOH HOH A . 
F 6 HOH 173 693 173 HOH HOH A . 
F 6 HOH 174 694 174 HOH HOH A . 
F 6 HOH 175 695 175 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 51.0730000000 -0.8660254038 
-0.5000000000 0.0000000000 88.4610308950 0.0000000000 0.0000000000 -1.0000000000 43.2398333333 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-02-08 
2 'Structure model' 1 1 2012-03-21 
3 'Structure model' 1 2 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Data collection'      
3 3 'Structure model' 'Derived calculations' 
4 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' chem_comp                 
2 3 'Structure model' entity                    
3 3 'Structure model' pdbx_chem_comp_identifier 
4 3 'Structure model' pdbx_entity_nonpoly       
5 3 'Structure model' struct_site               
6 3 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_chem_comp.mon_nstd_flag'  
2 3 'Structure model' '_chem_comp.name'           
3 3 'Structure model' '_chem_comp.type'           
4 3 'Structure model' '_entity.pdbx_description'  
5 3 'Structure model' '_pdbx_entity_nonpoly.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
REFMAC   refinement        5.2.0019 ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
REFMAC   phasing           5.2.0019 ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NE2 A HIS 253 ? ? P A PHS 710 ? ? 1.72 
2 1 O   A HOH 577 ? ? O A HOH 675 ? ? 2.07 
3 1 OE2 A GLU 287 ? ? O A HOH 546 ? ? 2.07 
4 1 O   A SER 170 ? ? O A HOH 682 ? ? 2.08 
5 1 CA  A ARG 263 ? ? O A HOH 660 ? ? 2.10 
6 1 O   A HOH 521 ? ? O A HOH 607 ? ? 2.14 
7 1 C   A VAL 78  ? ? O A HOH 648 ? ? 2.17 
8 1 CB  A ASN 289 ? ? O A HOH 636 ? ? 2.18 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             429 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             429 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.332 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.080 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              263 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              263 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              263 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                116.33 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.97 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 4   ? ? 85.12   130.46  
2  1 VAL A 9   ? ? -92.65  -64.26  
3  1 LYS A 79  ? ? 57.17   -96.41  
4  1 ASN A 127 ? ? 37.67   41.02   
5  1 ASP A 155 ? ? -114.65 51.81   
6  1 ASP A 176 ? ? -105.25 60.46   
7  1 LYS A 204 ? ? -142.39 -70.51  
8  1 HIS A 253 ? ? -35.76  140.61  
9  1 GLU A 255 ? ? -35.50  134.53  
10 1 LEU A 293 ? ? -165.01 119.43  
11 1 ASP A 350 ? ? -154.71 70.20   
12 1 GLU A 380 ? ? -111.38 -103.28 
13 1 CYS A 386 ? ? -147.13 -131.49 
14 1 ALA A 423 ? ? 51.45   -114.32 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 0   ? A MET 1   
2  1 Y 1 A PRO 1   ? A PRO 2   
3  1 Y 1 A LEU 2   ? A LEU 3   
4  1 Y 1 A SER 21  ? A SER 22  
5  1 Y 1 A LEU 22  ? A LEU 23  
6  1 Y 1 A PRO 23  ? A PRO 24  
7  1 Y 1 A ARG 24  ? A ARG 25  
8  1 Y 1 A SER 25  ? A SER 26  
9  1 Y 1 A CYS 26  ? A CYS 27  
10 1 Y 1 A GLY 27  ? A GLY 28  
11 1 Y 1 A PRO 28  ? A PRO 29  
12 1 Y 1 A LYS 29  ? A LYS 30  
13 1 Y 1 A LEU 30  ? A LEU 31  
14 1 Y 1 A THR 31  ? A THR 32  
15 1 Y 1 A ASP 447 ? A ASP 448 
16 1 Y 1 A ALA 448 ? A ALA 449 
17 1 Y 1 A LYS 449 ? A LYS 450 
18 1 Y 1 A LYS 450 ? A LYS 451 
19 1 Y 1 A GLY 451 ? A GLY 452 
20 1 Y 1 A PRO 452 ? A PRO 453 
21 1 Y 1 A SER 460 ? A SER 461 
22 1 Y 1 A VAL 461 ? A VAL 462 
23 1 Y 1 A THR 462 ? A THR 463 
24 1 Y 1 A PRO 463 ? A PRO 464 
25 1 Y 1 A LEU 464 ? A LEU 465 
26 1 Y 1 A ALA 465 ? A ALA 466 
27 1 Y 1 A SER 466 ? A SER 467 
28 1 Y 1 A PRO 467 ? A PRO 468 
29 1 Y 1 A GLU 468 ? A GLU 469 
30 1 Y 1 A PRO 469 ? A PRO 470 
31 1 Y 1 A THR 470 ? A THR 471 
32 1 Y 1 A LYS 471 ? A LYS 472 
33 1 Y 1 A LYS 472 ? A LYS 473 
34 1 Y 1 A PRO 473 ? A PRO 474 
35 1 Y 1 A ARG 474 ? A ARG 475 
36 1 Y 1 A ILE 475 ? A ILE 476 
37 1 Y 1 A ASN 476 ? A ASN 477 
38 1 Y 1 A SER 477 ? A SER 478 
39 1 Y 1 A PHE 478 ? A PHE 479 
40 1 Y 1 A GLU 479 ? A GLU 480 
41 1 Y 1 A GLU 480 ? A GLU 481 
42 1 Y 1 A HIS 481 ? A HIS 482 
43 1 Y 1 A VAL 482 ? A VAL 483 
44 1 Y 1 A ALA 483 ? A ALA 484 
45 1 Y 1 A SER 484 ? A SER 485 
46 1 Y 1 A THR 485 ? A THR 486 
47 1 Y 1 A SER 486 ? A SER 487 
48 1 Y 1 A ALA 487 ? A ALA 488 
49 1 Y 1 A ALA 488 ? A ALA 489 
50 1 Y 1 A LEU 489 ? A LEU 490 
51 1 Y 1 A PRO 490 ? A PRO 491 
52 1 Y 1 A SER 491 ? A SER 492 
53 1 Y 1 A CYS 492 ? A CYS 493 
54 1 Y 1 A LEU 493 ? A LEU 494 
55 1 Y 1 A PRO 494 ? A PRO 495 
56 1 Y 1 A PRO 495 ? A PRO 496 
57 1 Y 1 A GLU 496 ? A GLU 497 
58 1 Y 1 A VAL 497 ? A VAL 498 
59 1 Y 1 A PRO 498 ? A PRO 499 
60 1 Y 1 A THR 499 ? A THR 500 
61 1 Y 1 A GLN 500 ? A GLN 501 
62 1 Y 1 A LEU 501 ? A LEU 502 
63 1 Y 1 A PRO 502 ? A PRO 503 
64 1 Y 1 A GLY 503 ? A GLY 504 
65 1 Y 1 A GLN 504 ? A GLN 505 
66 1 Y 1 A ASN 505 ? A ASN 506 
67 1 Y 1 A MET 506 ? A MET 507 
68 1 Y 1 A LYS 507 ? A LYS 508 
69 1 Y 1 A GLY 508 ? A GLY 509 
70 1 Y 1 A SER 509 ? A SER 510 
71 1 Y 1 A ARG 510 ? A ARG 511 
72 1 Y 1 A SER 511 ? A SER 512 
73 1 Y 1 A SER 512 ? A SER 513 
74 1 Y 1 A ALA 513 ? A ALA 514 
75 1 Y 1 A ASP 514 ? A ASP 515 
76 1 Y 1 A SER 515 ? A SER 516 
77 1 Y 1 A SER 516 ? A SER 517 
78 1 Y 1 A ARG 517 ? A ARG 518 
79 1 Y 1 A LYS 518 ? A LYS 519 
80 1 Y 1 A HIS 519 ? A HIS 520 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
F6P 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Fruf6PO3     
FDP 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Fruf2PO36PO3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2,6-di-O-phosphono-beta-D-fructofuranose FDP 
3 'PHOSPHONIC ACID'                        PHS 
4 "ADENOSINE-5'-DIPHOSPHATE"               ADP 
5 6-O-phosphono-beta-D-fructofuranose      F6P 
6 water                                    HOH 
#