data_3QUM
# 
_entry.id   3QUM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3QUM         
RCSB  RCSB064123   
WWPDB D_1000064123 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ZCH 'human prostate specific antigen (PSA) with activating Fab'                       unspecified 
PDB 2ZCK 'human prostate specific antigen (PSA) with activating Fab and acyl intermediate' unspecified 
PDB 2ZCL 'human prostate specific antigen (PSA) with activating Fab'                       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3QUM 
_pdbx_database_status.recvd_initial_deposition_date   2011-02-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stura, E.A.'  1 
'Muller, B.H.' 2 
'Michel, S.'   3 
'Ducancel, F.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of human prostate-specific antigen in a sandwich antibody complex.'       J.Mol.Biol. 414 530 544 2011 
JMOBAK UK 0022-2836 0070 ? 22037582 10.1016/j.jmb.2011.10.007 
1       'In Vitro Affinity Maturation of an Anti-PSA Antibody for Prostate Cancer Diagnostic Assay.' J.Mol.Biol. ?   ?   ?   2011 
JMOBAK UK 1089-8638 0070 ? 22019475 10.1016/j.jmb.2011.10.008 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Stura, E.A.'         1  ? 
primary 'Muller, B.H.'        2  ? 
primary 'Bossus, M.'          3  ? 
primary 'Michel, S.'          4  ? 
primary 'Jolivet-Reynaud, C.' 5  ? 
primary 'Ducancel, F.'        6  ? 
1       'Muller, B.H.'        7  ? 
1       'Savatier, A.'        8  ? 
1       
;L'hostis, G.
;
9  ? 
1       'Costa, N.'           10 ? 
1       'Bossus, M.'          11 ? 
1       'Michel, S.'          12 ? 
1       'Ott, C.'             13 ? 
1       'Becquart, L.'        14 ? 
1       'Ruffion, A.'         15 ? 
1       'Stura, E.A.'         16 ? 
1       'Ducancel, F.'        17 ? 
# 
_cell.entry_id           3QUM 
_cell.length_a           55.308 
_cell.length_b           226.883 
_cell.length_c           118.694 
_cell.angle_alpha        90.00 
_cell.angle_beta         96.51 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3QUM 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer  nat 'Prostate-specific antigen' 26122.025 2  3.4.21.77 ? ? ? 
2 polymer  nat 'Fab 5D3D11 Light Chain' 24271.965 2  ?         ? ? ? 
3 polymer  nat 'Fab 5D3D11 Heavy Chain' 23551.430 2  ?         ? ? ? 
4 polymer  nat 'Fab 5D5A5 Light Chain' 24189.725 2  ?         ? ? ? 
5 polymer  nat 'Fab 5D5A5 Heavy Chain' 23565.393 2  ?         ? ? ? 
6 branched man 
;N-acetyl-alpha-neuraminic acid-(2-3)-beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-alpha-D-mannopyranose-(1-3)-[N-acetyl-alpha-neuraminic acid-(2-3)-beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-2)-[N-acetyl-alpha-neuraminic acid-(2-3)-beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
3026.729  1  ?         ? ? ? 
7 branched man 'beta-D-galactopyranose-(1-3)-2-acetamido-2-deoxy-alpha-D-galactopyranose' 383.349   1  ?         ? ? ? 
8 branched man 
;N-acetyl-alpha-neuraminic acid-(2-3)-beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-alpha-D-mannopyranose-(1-3)-[N-acetyl-alpha-neuraminic acid-(2-3)-beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-2)-[N-acetyl-alpha-neuraminic acid-(2-3)-beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
3026.729  1  ?         ? ? ? 
9 water    nat water 18.015    91 ?         ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PSA, Gamma-seminoprotein, Seminin, Kallikrein-3, P-30 antigen, Semenogelase' 
7 'Thomsen-Friedenreich antigen'                                                
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMS
LLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVC
AQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
;
;IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMS
LLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVC
AQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
;
P,Q ? 
2 'polypeptide(L)' no no 
;DIVMTQTAPSVFVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTDFTLRI
SRVEAEDVGVYYCMQHLEYPVTFGAGTKVEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;DIVMTQTAPSVFVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTDFTLRI
SRVEAEDVGVYYCMQHLEYPVTFGAGTKVEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
L,M ? 
3 'polypeptide(L)' no no 
;QVQLQQSGPELVKPGASVKISCKVSGYAISSSWMNWVKQRPGQGLEWIGRIYPGDGDTKYNGKFKDKATLTVDKSSSTAY
MQLSSLTSVDSAVYFCARDGYRYYFDYWGQGTSVTVSSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRD
;
;QVQLQQSGPELVKPGASVKISCKVSGYAISSSWMNWVKQRPGQGLEWIGRIYPGDGDTKYNGKFKDKATLTVDKSSSTAY
MQLSSLTSVDSAVYFCARDGYRYYFDYWGQGTSVTVSSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRD
;
H,K ? 
4 'polypeptide(L)' no no 
;DIVLTQSPPSLAVSLGQRATISCRASESIDLYGFTFMHWYQQKPGQPPKILIYRASNLESGIPARFSGSGSRTDFTLTIN
PVEADDVATYYCQQTHEDPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQ
NGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;DIVLTQSPPSLAVSLGQRATISCRASESIDLYGFTFMHWYQQKPGQPPKILIYRASNLESGIPARFSGSGSRTDFTLTIN
PVEADDVATYYCQQTHEDPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQ
NGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
A,C ? 
5 'polypeptide(L)' no no 
;QVQLQQSGAELAKPGASVKMSCKTSGYSFSSYWMHWVKQRPGQGLEWIGYINPSTGYTENNQKFKDKVTLTADKSSNTAY
MQLNSLTSEDSAVYYCARSGRLYFDVWGAGTTVTVSSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWNS
GSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRDC
;
;QVQLQQSGAELAKPGASVKMSCKTSGYSFSSYWMHWVKQRPGQGLEWIGYINPSTGYTENNQKFKDKVTLTADKSSNTAY
MQLNSLTSEDSAVYYCARSGRLYFDVWGAGTTVTVSSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWNS
GSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRDC
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   VAL n 
1 3   GLY n 
1 4   GLY n 
1 5   TRP n 
1 6   GLU n 
1 7   CYS n 
1 8   GLU n 
1 9   LYS n 
1 10  HIS n 
1 11  SER n 
1 12  GLN n 
1 13  PRO n 
1 14  TRP n 
1 15  GLN n 
1 16  VAL n 
1 17  LEU n 
1 18  VAL n 
1 19  ALA n 
1 20  SER n 
1 21  ARG n 
1 22  GLY n 
1 23  ARG n 
1 24  ALA n 
1 25  VAL n 
1 26  CYS n 
1 27  GLY n 
1 28  GLY n 
1 29  VAL n 
1 30  LEU n 
1 31  VAL n 
1 32  HIS n 
1 33  PRO n 
1 34  GLN n 
1 35  TRP n 
1 36  VAL n 
1 37  LEU n 
1 38  THR n 
1 39  ALA n 
1 40  ALA n 
1 41  HIS n 
1 42  CYS n 
1 43  ILE n 
1 44  ARG n 
1 45  ASN n 
1 46  LYS n 
1 47  SER n 
1 48  VAL n 
1 49  ILE n 
1 50  LEU n 
1 51  LEU n 
1 52  GLY n 
1 53  ARG n 
1 54  HIS n 
1 55  SER n 
1 56  LEU n 
1 57  PHE n 
1 58  HIS n 
1 59  PRO n 
1 60  GLU n 
1 61  ASP n 
1 62  THR n 
1 63  GLY n 
1 64  GLN n 
1 65  VAL n 
1 66  PHE n 
1 67  GLN n 
1 68  VAL n 
1 69  SER n 
1 70  HIS n 
1 71  SER n 
1 72  PHE n 
1 73  PRO n 
1 74  HIS n 
1 75  PRO n 
1 76  LEU n 
1 77  TYR n 
1 78  ASP n 
1 79  MET n 
1 80  SER n 
1 81  LEU n 
1 82  LEU n 
1 83  LYS n 
1 84  ASN n 
1 85  ARG n 
1 86  PHE n 
1 87  LEU n 
1 88  ARG n 
1 89  PRO n 
1 90  GLY n 
1 91  ASP n 
1 92  ASP n 
1 93  SER n 
1 94  SER n 
1 95  HIS n 
1 96  ASP n 
1 97  LEU n 
1 98  MET n 
1 99  LEU n 
1 100 LEU n 
1 101 ARG n 
1 102 LEU n 
1 103 SER n 
1 104 GLU n 
1 105 PRO n 
1 106 ALA n 
1 107 GLU n 
1 108 LEU n 
1 109 THR n 
1 110 ASP n 
1 111 ALA n 
1 112 VAL n 
1 113 LYS n 
1 114 VAL n 
1 115 MET n 
1 116 ASP n 
1 117 LEU n 
1 118 PRO n 
1 119 THR n 
1 120 GLN n 
1 121 GLU n 
1 122 PRO n 
1 123 ALA n 
1 124 LEU n 
1 125 GLY n 
1 126 THR n 
1 127 THR n 
1 128 CYS n 
1 129 TYR n 
1 130 ALA n 
1 131 SER n 
1 132 GLY n 
1 133 TRP n 
1 134 GLY n 
1 135 SER n 
1 136 ILE n 
1 137 GLU n 
1 138 PRO n 
1 139 GLU n 
1 140 GLU n 
1 141 PHE n 
1 142 LEU n 
1 143 THR n 
1 144 PRO n 
1 145 LYS n 
1 146 LYS n 
1 147 LEU n 
1 148 GLN n 
1 149 CYS n 
1 150 VAL n 
1 151 ASP n 
1 152 LEU n 
1 153 HIS n 
1 154 VAL n 
1 155 ILE n 
1 156 SER n 
1 157 ASN n 
1 158 ASP n 
1 159 VAL n 
1 160 CYS n 
1 161 ALA n 
1 162 GLN n 
1 163 VAL n 
1 164 HIS n 
1 165 PRO n 
1 166 GLN n 
1 167 LYS n 
1 168 VAL n 
1 169 THR n 
1 170 LYS n 
1 171 PHE n 
1 172 MET n 
1 173 LEU n 
1 174 CYS n 
1 175 ALA n 
1 176 GLY n 
1 177 ARG n 
1 178 TRP n 
1 179 THR n 
1 180 GLY n 
1 181 GLY n 
1 182 LYS n 
1 183 SER n 
1 184 THR n 
1 185 CYS n 
1 186 SER n 
1 187 GLY n 
1 188 ASP n 
1 189 SER n 
1 190 GLY n 
1 191 GLY n 
1 192 PRO n 
1 193 LEU n 
1 194 VAL n 
1 195 CYS n 
1 196 ASN n 
1 197 GLY n 
1 198 VAL n 
1 199 LEU n 
1 200 GLN n 
1 201 GLY n 
1 202 ILE n 
1 203 THR n 
1 204 SER n 
1 205 TRP n 
1 206 GLY n 
1 207 SER n 
1 208 GLU n 
1 209 PRO n 
1 210 CYS n 
1 211 ALA n 
1 212 LEU n 
1 213 PRO n 
1 214 GLU n 
1 215 ARG n 
1 216 PRO n 
1 217 SER n 
1 218 LEU n 
1 219 TYR n 
1 220 THR n 
1 221 LYS n 
1 222 VAL n 
1 223 VAL n 
1 224 HIS n 
1 225 TYR n 
1 226 ARG n 
1 227 LYS n 
1 228 TRP n 
1 229 ILE n 
1 230 LYS n 
1 231 ASP n 
1 232 THR n 
1 233 ILE n 
1 234 VAL n 
1 235 ALA n 
1 236 ASN n 
1 237 PRO n 
2 1   ASP n 
2 2   ILE n 
2 3   VAL n 
2 4   MET n 
2 5   THR n 
2 6   GLN n 
2 7   THR n 
2 8   ALA n 
2 9   PRO n 
2 10  SER n 
2 11  VAL n 
2 12  PHE n 
2 13  VAL n 
2 14  THR n 
2 15  PRO n 
2 16  GLY n 
2 17  GLU n 
2 18  SER n 
2 19  VAL n 
2 20  SER n 
2 21  ILE n 
2 22  SER n 
2 23  CYS n 
2 24  ARG n 
2 25  SER n 
2 26  SER n 
2 27  LYS n 
2 28  SER n 
2 29  LEU n 
2 30  LEU n 
2 31  HIS n 
2 32  SER n 
2 33  ASN n 
2 34  GLY n 
2 35  ASN n 
2 36  THR n 
2 37  TYR n 
2 38  LEU n 
2 39  TYR n 
2 40  TRP n 
2 41  PHE n 
2 42  LEU n 
2 43  GLN n 
2 44  ARG n 
2 45  PRO n 
2 46  GLY n 
2 47  GLN n 
2 48  SER n 
2 49  PRO n 
2 50  GLN n 
2 51  LEU n 
2 52  LEU n 
2 53  ILE n 
2 54  TYR n 
2 55  ARG n 
2 56  MET n 
2 57  SER n 
2 58  ASN n 
2 59  LEU n 
2 60  ALA n 
2 61  SER n 
2 62  GLY n 
2 63  VAL n 
2 64  PRO n 
2 65  ASP n 
2 66  ARG n 
2 67  PHE n 
2 68  SER n 
2 69  GLY n 
2 70  SER n 
2 71  GLY n 
2 72  SER n 
2 73  GLY n 
2 74  THR n 
2 75  ASP n 
2 76  PHE n 
2 77  THR n 
2 78  LEU n 
2 79  ARG n 
2 80  ILE n 
2 81  SER n 
2 82  ARG n 
2 83  VAL n 
2 84  GLU n 
2 85  ALA n 
2 86  GLU n 
2 87  ASP n 
2 88  VAL n 
2 89  GLY n 
2 90  VAL n 
2 91  TYR n 
2 92  TYR n 
2 93  CYS n 
2 94  MET n 
2 95  GLN n 
2 96  HIS n 
2 97  LEU n 
2 98  GLU n 
2 99  TYR n 
2 100 PRO n 
2 101 VAL n 
2 102 THR n 
2 103 PHE n 
2 104 GLY n 
2 105 ALA n 
2 106 GLY n 
2 107 THR n 
2 108 LYS n 
2 109 VAL n 
2 110 GLU n 
2 111 ILE n 
2 112 LYS n 
2 113 ARG n 
2 114 ALA n 
2 115 ASP n 
2 116 ALA n 
2 117 ALA n 
2 118 PRO n 
2 119 THR n 
2 120 VAL n 
2 121 SER n 
2 122 ILE n 
2 123 PHE n 
2 124 PRO n 
2 125 PRO n 
2 126 SER n 
2 127 SER n 
2 128 GLU n 
2 129 GLN n 
2 130 LEU n 
2 131 THR n 
2 132 SER n 
2 133 GLY n 
2 134 GLY n 
2 135 ALA n 
2 136 SER n 
2 137 VAL n 
2 138 VAL n 
2 139 CYS n 
2 140 PHE n 
2 141 LEU n 
2 142 ASN n 
2 143 ASN n 
2 144 PHE n 
2 145 TYR n 
2 146 PRO n 
2 147 LYS n 
2 148 ASP n 
2 149 ILE n 
2 150 ASN n 
2 151 VAL n 
2 152 LYS n 
2 153 TRP n 
2 154 LYS n 
2 155 ILE n 
2 156 ASP n 
2 157 GLY n 
2 158 SER n 
2 159 GLU n 
2 160 ARG n 
2 161 GLN n 
2 162 ASN n 
2 163 GLY n 
2 164 VAL n 
2 165 LEU n 
2 166 ASN n 
2 167 SER n 
2 168 TRP n 
2 169 THR n 
2 170 ASP n 
2 171 GLN n 
2 172 ASP n 
2 173 SER n 
2 174 LYS n 
2 175 ASP n 
2 176 SER n 
2 177 THR n 
2 178 TYR n 
2 179 SER n 
2 180 MET n 
2 181 SER n 
2 182 SER n 
2 183 THR n 
2 184 LEU n 
2 185 THR n 
2 186 LEU n 
2 187 THR n 
2 188 LYS n 
2 189 ASP n 
2 190 GLU n 
2 191 TYR n 
2 192 GLU n 
2 193 ARG n 
2 194 HIS n 
2 195 ASN n 
2 196 SER n 
2 197 TYR n 
2 198 THR n 
2 199 CYS n 
2 200 GLU n 
2 201 ALA n 
2 202 THR n 
2 203 HIS n 
2 204 LYS n 
2 205 THR n 
2 206 SER n 
2 207 THR n 
2 208 SER n 
2 209 PRO n 
2 210 ILE n 
2 211 VAL n 
2 212 LYS n 
2 213 SER n 
2 214 PHE n 
2 215 ASN n 
2 216 ARG n 
2 217 ASN n 
2 218 GLU n 
2 219 CYS n 
3 1   GLN n 
3 2   VAL n 
3 3   GLN n 
3 4   LEU n 
3 5   GLN n 
3 6   GLN n 
3 7   SER n 
3 8   GLY n 
3 9   PRO n 
3 10  GLU n 
3 11  LEU n 
3 12  VAL n 
3 13  LYS n 
3 14  PRO n 
3 15  GLY n 
3 16  ALA n 
3 17  SER n 
3 18  VAL n 
3 19  LYS n 
3 20  ILE n 
3 21  SER n 
3 22  CYS n 
3 23  LYS n 
3 24  VAL n 
3 25  SER n 
3 26  GLY n 
3 27  TYR n 
3 28  ALA n 
3 29  ILE n 
3 30  SER n 
3 31  SER n 
3 32  SER n 
3 33  TRP n 
3 34  MET n 
3 35  ASN n 
3 36  TRP n 
3 37  VAL n 
3 38  LYS n 
3 39  GLN n 
3 40  ARG n 
3 41  PRO n 
3 42  GLY n 
3 43  GLN n 
3 44  GLY n 
3 45  LEU n 
3 46  GLU n 
3 47  TRP n 
3 48  ILE n 
3 49  GLY n 
3 50  ARG n 
3 51  ILE n 
3 52  TYR n 
3 53  PRO n 
3 54  GLY n 
3 55  ASP n 
3 56  GLY n 
3 57  ASP n 
3 58  THR n 
3 59  LYS n 
3 60  TYR n 
3 61  ASN n 
3 62  GLY n 
3 63  LYS n 
3 64  PHE n 
3 65  LYS n 
3 66  ASP n 
3 67  LYS n 
3 68  ALA n 
3 69  THR n 
3 70  LEU n 
3 71  THR n 
3 72  VAL n 
3 73  ASP n 
3 74  LYS n 
3 75  SER n 
3 76  SER n 
3 77  SER n 
3 78  THR n 
3 79  ALA n 
3 80  TYR n 
3 81  MET n 
3 82  GLN n 
3 83  LEU n 
3 84  SER n 
3 85  SER n 
3 86  LEU n 
3 87  THR n 
3 88  SER n 
3 89  VAL n 
3 90  ASP n 
3 91  SER n 
3 92  ALA n 
3 93  VAL n 
3 94  TYR n 
3 95  PHE n 
3 96  CYS n 
3 97  ALA n 
3 98  ARG n 
3 99  ASP n 
3 100 GLY n 
3 101 TYR n 
3 102 ARG n 
3 103 TYR n 
3 104 TYR n 
3 105 PHE n 
3 106 ASP n 
3 107 TYR n 
3 108 TRP n 
3 109 GLY n 
3 110 GLN n 
3 111 GLY n 
3 112 THR n 
3 113 SER n 
3 114 VAL n 
3 115 THR n 
3 116 VAL n 
3 117 SER n 
3 118 SER n 
3 119 ALA n 
3 120 LYS n 
3 121 THR n 
3 122 THR n 
3 123 ALA n 
3 124 PRO n 
3 125 PRO n 
3 126 VAL n 
3 127 TYR n 
3 128 PRO n 
3 129 LEU n 
3 130 ALA n 
3 131 PRO n 
3 132 VAL n 
3 133 CYS n 
3 134 GLY n 
3 135 ASP n 
3 136 THR n 
3 137 THR n 
3 138 GLY n 
3 139 SER n 
3 140 SER n 
3 141 VAL n 
3 142 THR n 
3 143 LEU n 
3 144 GLY n 
3 145 CYS n 
3 146 LEU n 
3 147 VAL n 
3 148 LYS n 
3 149 GLY n 
3 150 TYR n 
3 151 PHE n 
3 152 PRO n 
3 153 GLU n 
3 154 SER n 
3 155 VAL n 
3 156 THR n 
3 157 LEU n 
3 158 LEU n 
3 159 TRP n 
3 160 ASN n 
3 161 SER n 
3 162 GLY n 
3 163 SER n 
3 164 LEU n 
3 165 SER n 
3 166 SER n 
3 167 GLY n 
3 168 VAL n 
3 169 HIS n 
3 170 THR n 
3 171 PHE n 
3 172 PRO n 
3 173 ALA n 
3 174 VAL n 
3 175 LEU n 
3 176 GLN n 
3 177 SER n 
3 178 ASP n 
3 179 LEU n 
3 180 TYR n 
3 181 THR n 
3 182 LEU n 
3 183 SER n 
3 184 SER n 
3 185 SER n 
3 186 VAL n 
3 187 THR n 
3 188 VAL n 
3 189 THR n 
3 190 SER n 
3 191 SER n 
3 192 THR n 
3 193 TRP n 
3 194 PRO n 
3 195 SER n 
3 196 GLN n 
3 197 SER n 
3 198 ILE n 
3 199 THR n 
3 200 CYS n 
3 201 ASN n 
3 202 VAL n 
3 203 ALA n 
3 204 HIS n 
3 205 PRO n 
3 206 ALA n 
3 207 SER n 
3 208 SER n 
3 209 THR n 
3 210 LYS n 
3 211 VAL n 
3 212 ASP n 
3 213 LYS n 
3 214 LYS n 
3 215 ILE n 
3 216 VAL n 
3 217 PRO n 
3 218 ARG n 
3 219 ASP n 
4 1   ASP n 
4 2   ILE n 
4 3   VAL n 
4 4   LEU n 
4 5   THR n 
4 6   GLN n 
4 7   SER n 
4 8   PRO n 
4 9   PRO n 
4 10  SER n 
4 11  LEU n 
4 12  ALA n 
4 13  VAL n 
4 14  SER n 
4 15  LEU n 
4 16  GLY n 
4 17  GLN n 
4 18  ARG n 
4 19  ALA n 
4 20  THR n 
4 21  ILE n 
4 22  SER n 
4 23  CYS n 
4 24  ARG n 
4 25  ALA n 
4 26  SER n 
4 27  GLU n 
4 28  SER n 
4 29  ILE n 
4 30  ASP n 
4 31  LEU n 
4 32  TYR n 
4 33  GLY n 
4 34  PHE n 
4 35  THR n 
4 36  PHE n 
4 37  MET n 
4 38  HIS n 
4 39  TRP n 
4 40  TYR n 
4 41  GLN n 
4 42  GLN n 
4 43  LYS n 
4 44  PRO n 
4 45  GLY n 
4 46  GLN n 
4 47  PRO n 
4 48  PRO n 
4 49  LYS n 
4 50  ILE n 
4 51  LEU n 
4 52  ILE n 
4 53  TYR n 
4 54  ARG n 
4 55  ALA n 
4 56  SER n 
4 57  ASN n 
4 58  LEU n 
4 59  GLU n 
4 60  SER n 
4 61  GLY n 
4 62  ILE n 
4 63  PRO n 
4 64  ALA n 
4 65  ARG n 
4 66  PHE n 
4 67  SER n 
4 68  GLY n 
4 69  SER n 
4 70  GLY n 
4 71  SER n 
4 72  ARG n 
4 73  THR n 
4 74  ASP n 
4 75  PHE n 
4 76  THR n 
4 77  LEU n 
4 78  THR n 
4 79  ILE n 
4 80  ASN n 
4 81  PRO n 
4 82  VAL n 
4 83  GLU n 
4 84  ALA n 
4 85  ASP n 
4 86  ASP n 
4 87  VAL n 
4 88  ALA n 
4 89  THR n 
4 90  TYR n 
4 91  TYR n 
4 92  CYS n 
4 93  GLN n 
4 94  GLN n 
4 95  THR n 
4 96  HIS n 
4 97  GLU n 
4 98  ASP n 
4 99  PRO n 
4 100 TYR n 
4 101 THR n 
4 102 PHE n 
4 103 GLY n 
4 104 GLY n 
4 105 GLY n 
4 106 THR n 
4 107 LYS n 
4 108 LEU n 
4 109 GLU n 
4 110 ILE n 
4 111 LYS n 
4 112 ARG n 
4 113 ALA n 
4 114 ASP n 
4 115 ALA n 
4 116 ALA n 
4 117 PRO n 
4 118 THR n 
4 119 VAL n 
4 120 SER n 
4 121 ILE n 
4 122 PHE n 
4 123 PRO n 
4 124 PRO n 
4 125 SER n 
4 126 SER n 
4 127 GLU n 
4 128 GLN n 
4 129 LEU n 
4 130 THR n 
4 131 SER n 
4 132 GLY n 
4 133 GLY n 
4 134 ALA n 
4 135 SER n 
4 136 VAL n 
4 137 VAL n 
4 138 CYS n 
4 139 PHE n 
4 140 LEU n 
4 141 ASN n 
4 142 ASN n 
4 143 PHE n 
4 144 TYR n 
4 145 PRO n 
4 146 LYS n 
4 147 ASP n 
4 148 ILE n 
4 149 ASN n 
4 150 VAL n 
4 151 LYS n 
4 152 TRP n 
4 153 LYS n 
4 154 ILE n 
4 155 ASP n 
4 156 GLY n 
4 157 SER n 
4 158 GLU n 
4 159 ARG n 
4 160 GLN n 
4 161 ASN n 
4 162 GLY n 
4 163 VAL n 
4 164 LEU n 
4 165 ASN n 
4 166 SER n 
4 167 TRP n 
4 168 THR n 
4 169 ASP n 
4 170 GLN n 
4 171 ASP n 
4 172 SER n 
4 173 LYS n 
4 174 ASP n 
4 175 SER n 
4 176 THR n 
4 177 TYR n 
4 178 SER n 
4 179 MET n 
4 180 SER n 
4 181 SER n 
4 182 THR n 
4 183 LEU n 
4 184 THR n 
4 185 LEU n 
4 186 THR n 
4 187 LYS n 
4 188 ASP n 
4 189 GLU n 
4 190 TYR n 
4 191 GLU n 
4 192 ARG n 
4 193 HIS n 
4 194 ASN n 
4 195 SER n 
4 196 TYR n 
4 197 THR n 
4 198 CYS n 
4 199 GLU n 
4 200 ALA n 
4 201 THR n 
4 202 HIS n 
4 203 LYS n 
4 204 THR n 
4 205 SER n 
4 206 THR n 
4 207 SER n 
4 208 PRO n 
4 209 ILE n 
4 210 VAL n 
4 211 LYS n 
4 212 SER n 
4 213 PHE n 
4 214 ASN n 
4 215 ARG n 
4 216 ASN n 
4 217 GLU n 
4 218 CYS n 
5 1   GLN n 
5 2   VAL n 
5 3   GLN n 
5 4   LEU n 
5 5   GLN n 
5 6   GLN n 
5 7   SER n 
5 8   GLY n 
5 9   ALA n 
5 10  GLU n 
5 11  LEU n 
5 12  ALA n 
5 13  LYS n 
5 14  PRO n 
5 15  GLY n 
5 16  ALA n 
5 17  SER n 
5 18  VAL n 
5 19  LYS n 
5 20  MET n 
5 21  SER n 
5 22  CYS n 
5 23  LYS n 
5 24  THR n 
5 25  SER n 
5 26  GLY n 
5 27  TYR n 
5 28  SER n 
5 29  PHE n 
5 30  SER n 
5 31  SER n 
5 32  TYR n 
5 33  TRP n 
5 34  MET n 
5 35  HIS n 
5 36  TRP n 
5 37  VAL n 
5 38  LYS n 
5 39  GLN n 
5 40  ARG n 
5 41  PRO n 
5 42  GLY n 
5 43  GLN n 
5 44  GLY n 
5 45  LEU n 
5 46  GLU n 
5 47  TRP n 
5 48  ILE n 
5 49  GLY n 
5 50  TYR n 
5 51  ILE n 
5 52  ASN n 
5 53  PRO n 
5 54  SER n 
5 55  THR n 
5 56  GLY n 
5 57  TYR n 
5 58  THR n 
5 59  GLU n 
5 60  ASN n 
5 61  ASN n 
5 62  GLN n 
5 63  LYS n 
5 64  PHE n 
5 65  LYS n 
5 66  ASP n 
5 67  LYS n 
5 68  VAL n 
5 69  THR n 
5 70  LEU n 
5 71  THR n 
5 72  ALA n 
5 73  ASP n 
5 74  LYS n 
5 75  SER n 
5 76  SER n 
5 77  ASN n 
5 78  THR n 
5 79  ALA n 
5 80  TYR n 
5 81  MET n 
5 82  GLN n 
5 83  LEU n 
5 84  ASN n 
5 85  SER n 
5 86  LEU n 
5 87  THR n 
5 88  SER n 
5 89  GLU n 
5 90  ASP n 
5 91  SER n 
5 92  ALA n 
5 93  VAL n 
5 94  TYR n 
5 95  TYR n 
5 96  CYS n 
5 97  ALA n 
5 98  ARG n 
5 99  SER n 
5 100 GLY n 
5 101 ARG n 
5 102 LEU n 
5 103 TYR n 
5 104 PHE n 
5 105 ASP n 
5 106 VAL n 
5 107 TRP n 
5 108 GLY n 
5 109 ALA n 
5 110 GLY n 
5 111 THR n 
5 112 THR n 
5 113 VAL n 
5 114 THR n 
5 115 VAL n 
5 116 SER n 
5 117 SER n 
5 118 ALA n 
5 119 LYS n 
5 120 THR n 
5 121 THR n 
5 122 ALA n 
5 123 PRO n 
5 124 PRO n 
5 125 VAL n 
5 126 TYR n 
5 127 PRO n 
5 128 LEU n 
5 129 ALA n 
5 130 PRO n 
5 131 VAL n 
5 132 CYS n 
5 133 GLY n 
5 134 ASP n 
5 135 THR n 
5 136 THR n 
5 137 GLY n 
5 138 SER n 
5 139 SER n 
5 140 VAL n 
5 141 THR n 
5 142 LEU n 
5 143 GLY n 
5 144 CYS n 
5 145 LEU n 
5 146 VAL n 
5 147 LYS n 
5 148 GLY n 
5 149 TYR n 
5 150 PHE n 
5 151 PRO n 
5 152 GLU n 
5 153 SER n 
5 154 VAL n 
5 155 THR n 
5 156 LEU n 
5 157 LEU n 
5 158 TRP n 
5 159 ASN n 
5 160 SER n 
5 161 GLY n 
5 162 SER n 
5 163 LEU n 
5 164 SER n 
5 165 SER n 
5 166 GLY n 
5 167 VAL n 
5 168 HIS n 
5 169 THR n 
5 170 PHE n 
5 171 PRO n 
5 172 ALA n 
5 173 VAL n 
5 174 LEU n 
5 175 GLN n 
5 176 SER n 
5 177 ASP n 
5 178 LEU n 
5 179 TYR n 
5 180 THR n 
5 181 LEU n 
5 182 SER n 
5 183 SER n 
5 184 SER n 
5 185 VAL n 
5 186 THR n 
5 187 VAL n 
5 188 THR n 
5 189 SER n 
5 190 SER n 
5 191 THR n 
5 192 TRP n 
5 193 PRO n 
5 194 SER n 
5 195 GLN n 
5 196 SER n 
5 197 ILE n 
5 198 THR n 
5 199 CYS n 
5 200 ASN n 
5 201 VAL n 
5 202 ALA n 
5 203 HIS n 
5 204 PRO n 
5 205 ALA n 
5 206 SER n 
5 207 SER n 
5 208 THR n 
5 209 LYS n 
5 210 VAL n 
5 211 ASP n 
5 212 LYS n 
5 213 LYS n 
5 214 ILE n 
5 215 VAL n 
5 216 PRO n 
5 217 ARG n 
5 218 ASP n 
5 219 CYS n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? human 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ?     'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ?     'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ?     'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample ? ? ?     'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP KLK3_HUMAN P07288 1 
;IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMS
LLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVC
AQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
;
25 ? 
2 PDB 3QUM       3QUM   2 ? ?  ? 
3 PDB 3QUM       3QUM   3 ? ?  ? 
4 PDB 3QUM       3QUM   4 ? ?  ? 
5 PDB 3QUM       3QUM   5 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3QUM P 1 ? 237 ? P07288 25 ? 261 ? 16 246 
2  1 3QUM Q 1 ? 237 ? P07288 25 ? 261 ? 16 246 
3  2 3QUM L 1 ? 219 ? 3QUM   1  ? 214 ? 1  214 
4  2 3QUM M 1 ? 219 ? 3QUM   1  ? 214 ? 1  214 
5  3 3QUM H 1 ? 219 ? 3QUM   1  ? 214 ? 1  214 
6  3 3QUM K 1 ? 219 ? 3QUM   1  ? 214 ? 1  214 
7  4 3QUM A 1 ? 218 ? 3QUM   1  ? 214 ? 1  214 
8  4 3QUM C 1 ? 218 ? 3QUM   1  ? 214 ? 1  214 
9  5 3QUM B 1 ? 219 ? 3QUM   1  ? 216 ? 1  216 
10 5 3QUM D 1 ? 219 ? 3QUM   1  ? 216 ? 1  216 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A2G 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-galactopyranose ? 'C8 H15 N O6'    221.208 
ALA 'L-peptide linking'           y ALANINE                                     ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                    ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                  ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                             ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                                    ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                        ? 'C6 H12 O5'      164.156 
GAL 'D-saccharide, beta linking'  . beta-D-galactopyranose                      ? 'C6 H12 O6'      180.156 
GLN 'L-peptide linking'           y GLUTAMINE                                   ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                             ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                     ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                   ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                       ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                  ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                     ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                      ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                       ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                                  ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose    ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                               ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                     ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                      ? 'C3 H7 N O3'     105.093 
SIA 'D-saccharide, alpha linking' . 'N-acetyl-alpha-neuraminic acid'            ? 'C11 H19 N O9'   309.270 
THR 'L-peptide linking'           y THREONINE                                   ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                  ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                    ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                      ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3QUM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.04 
_exptl_crystal.density_percent_sol   59.54 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
;Protein solution: 20 ul 5D3D11 at 10.7 mg/ml and 10 ul PSA at 5 mg/ml + 31 ul 5D5A5 at 6.7mg/ml in PBS. against a precipitant of 10% PEG 4,000, 20% ethylene glycol, 100 mM Na,K phosphate. Drops consisted of 1 ul protein + precipitant equilibrated by vapor diffusion. Streak seeding and macro seeding were used, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-03-17 
_diffrn_detector.details                'Pt coated mirrors in a Kirkpatrick-Baez (KB) geometry' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'diffracting Si (111) monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.872600 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.872600 
# 
_reflns.entry_id                     3QUM 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             81.65 
_reflns.d_resolution_high            3.20 
_reflns.number_obs                   47573 
_reflns.number_all                   47764 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.145 
_reflns.pdbx_Rsym_value              0.145 
_reflns.pdbx_netI_over_sigmaI        8.4 
_reflns.B_iso_Wilson_estimate        83.924 
_reflns.pdbx_redundancy              2.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
3.20  3.37  98.8 0.791 0.590 1.7  2.4 ? 6864 ? ? ? ? 1  1 
3.37  3.58  99.3 0.503 0.370 2.8  2.4 ? 6549 ? ? ? ? 2  1 
3.58  3.82  99.6 0.387 0.273 3.8  2.4 ? 6152 ? ? ? ? 3  1 
3.82  4.13  99.9 0.198 0.155 6.2  2.5 ? 5780 ? ? ? ? 4  1 
4.13  4.53  99.9 0.097 0.084 10.3 2.5 ? 5294 ? ? ? ? 5  1 
4.53  5.06  99.9 0.073 0.067 12.8 2.6 ? 4833 ? ? ? ? 6  1 
5.06  5.84  99.9 0.069 0.060 13.5 2.6 ? 4200 ? ? ? ? 7  1 
5.84  7.16  99.8 0.065 0.061 14.7 2.6 ? 3587 ? ? ? ? 8  1 
7.16  10.12 99.6 0.068 0.078 18.6 2.6 ? 2774 ? ? ? ? 9  1 
10.12 81.65 99.0 0.071 0.057 20.4 2.5 ? 1540 ? ? ? ? 10 1 
# 
_refine.entry_id                                 3QUM 
_refine.ls_number_reflns_obs                     46916 
_refine.ls_number_reflns_all                     47764 
_refine.pdbx_ls_sigma_I                          -3 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             58.965 
_refine.ls_d_res_high                            3.200 
_refine.ls_percent_reflns_obs                    98.18 
_refine.ls_R_factor_obs                          0.2032 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1984 
_refine.ls_R_factor_R_free                       0.2937 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.05 
_refine.ls_number_reflns_R_free                  2367 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               73.269 
_refine.aniso_B[1][1]                            2.2654 
_refine.aniso_B[2][2]                            -2.5605 
_refine.aniso_B[3][3]                            0.2951 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -1.5974 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.304 
_refine.solvent_model_param_bsol                 68.872 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.83 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 2ZCH, using individual PSA and Fab as independent search models.' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.48 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        17078 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         437 
_refine_hist.number_atoms_solvent             91 
_refine_hist.number_atoms_total               17606 
_refine_hist.d_res_high                       3.200 
_refine_hist.d_res_low                        58.965 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.011  ? ? 17933 'X-RAY DIFFRACTION' ? 
f_angle_d          1.623  ? ? 24399 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 22.408 ? ? 6507  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.108  ? ? 2764  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.008  ? ? 3063  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 3.200  3.2654  2348 0.2998 87.00  0.4059 . . 122 . . . . 'X-RAY DIFFRACTION' 
. 3.2654 3.3364  2403 0.2769 92.00  0.3953 . . 136 . . . . 'X-RAY DIFFRACTION' 
. 3.3364 3.4140  2593 0.2512 96.00  0.3366 . . 131 . . . . 'X-RAY DIFFRACTION' 
. 3.4140 3.4994  2649 0.2318 99.00  0.3281 . . 133 . . . . 'X-RAY DIFFRACTION' 
. 3.4994 3.5940  2643 0.2440 100.00 0.3514 . . 154 . . . . 'X-RAY DIFFRACTION' 
. 3.5940 3.6997  2665 0.2745 99.00  0.3643 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 3.6997 3.8191  2616 0.2769 100.00 0.4068 . . 131 . . . . 'X-RAY DIFFRACTION' 
. 3.8191 3.9556  2711 0.2076 100.00 0.3061 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 3.9556 4.1139  2620 0.1826 100.00 0.2973 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 4.1139 4.3011  2642 0.1642 100.00 0.2470 . . 152 . . . . 'X-RAY DIFFRACTION' 
. 4.3011 4.5278  2657 0.1430 100.00 0.2633 . . 154 . . . . 'X-RAY DIFFRACTION' 
. 4.5278 4.8113  2662 0.1432 100.00 0.2335 . . 130 . . . . 'X-RAY DIFFRACTION' 
. 4.8113 5.1826  2664 0.1543 100.00 0.2802 . . 151 . . . . 'X-RAY DIFFRACTION' 
. 5.1826 5.7038  2698 0.1825 100.00 0.2572 . . 124 . . . . 'X-RAY DIFFRACTION' 
. 5.7038 6.5282  2649 0.2132 100.00 0.2926 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 6.5282 8.2213  2684 0.1914 100.00 0.3228 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 8.2213 58.9748 2645 0.1911 98.00  0.2366 . . 148 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3QUM 
_struct.title                     
'Crystal structure of human prostate specific antigen (PSA) in Fab sandwich with a high affinity and a PCa selective antibody' 
_struct.pdbx_descriptor           
;Prostate-specific antigen (E.C.3.4.21.77), Fab 5D3D11 Light Chain, Fab 5D3D11 Heavy Chain, Fab 5D5A5 Light Chain, Fab 5D5A5 Heavy Chain
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3QUM 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            
;kallikrein fold, Prostate-specific antigen, serine protease, negative regulation of angiogenesis, natural post-transductional modification, N-linked and O-linked glycosylation, IMMUNE SYSTEM
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 1 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 7 ? 
M N N 8 ? 
N N N 9 ? 
O N N 9 ? 
P N N 9 ? 
Q N N 9 ? 
R N N 9 ? 
S N N 9 ? 
T N N 9 ? 
U N N 9 ? 
V N N 9 ? 
W N N 9 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 39  ? ILE A 43  ? ALA P 55  ILE P 59  5 ? 5  
HELX_P HELX_P2  2  SER A 156 ? HIS A 164 ? SER P 164 HIS P 172 1 ? 9  
HELX_P HELX_P3  3  TYR A 225 ? ASN A 236 ? TYR P 234 ASN P 245 1 ? 12 
HELX_P HELX_P4  4  SER B 126 ? THR B 131 ? SER L 121 THR L 126 1 ? 6  
HELX_P HELX_P5  5  LYS B 188 ? ARG B 193 ? LYS L 183 ARG L 188 1 ? 6  
HELX_P HELX_P6  6  ALA C 28  ? SER C 32  ? ALA H 28  SER H 32  5 ? 5  
HELX_P HELX_P7  7  GLY C 62  ? LYS C 65  ? GLY H 61  LYS H 64  5 ? 4  
HELX_P HELX_P8  8  LYS C 74  ? SER C 76  ? LYS H 73  SER H 75  5 ? 3  
HELX_P HELX_P9  9  THR C 87  ? SER C 91  ? THR H 83  SER H 87  5 ? 5  
HELX_P HELX_P10 10 SER C 161 ? SER C 163 ? SER H 156 SER H 158 5 ? 3  
HELX_P HELX_P11 11 PRO C 205 ? SER C 208 ? PRO H 200 SER H 203 5 ? 4  
HELX_P HELX_P12 12 SER D 125 ? SER D 131 ? SER A 121 SER A 127 1 ? 7  
HELX_P HELX_P13 13 GLN E 62  ? LYS E 65  ? GLN B 61  LYS B 64  5 ? 4  
HELX_P HELX_P14 14 ASP F 78  ? LEU F 82  D ASP Q 95  LEU Q 95  5 ? 5  
HELX_P HELX_P15 15 ASN F 157 ? GLN F 162 ? ASN Q 165 GLN Q 170 1 ? 6  
HELX_P HELX_P16 16 TYR F 225 ? ASN F 236 ? TYR Q 234 ASN Q 245 1 ? 12 
HELX_P HELX_P17 17 GLU G 84  ? VAL G 88  ? GLU M 79  VAL M 83  5 ? 5  
HELX_P HELX_P18 18 SER G 126 ? SER G 132 ? SER M 121 SER M 127 1 ? 7  
HELX_P HELX_P19 19 LYS G 188 ? ARG G 193 ? LYS M 183 ARG M 188 1 ? 6  
HELX_P HELX_P20 20 THR H 87  ? SER H 91  ? THR K 83  SER K 87  5 ? 5  
HELX_P HELX_P21 21 SER H 161 ? SER H 163 ? SER K 156 SER K 158 5 ? 3  
HELX_P HELX_P22 22 THR H 189 ? TRP H 193 ? THR K 184 TRP K 188 5 ? 5  
HELX_P HELX_P23 23 SER I 125 ? SER I 131 ? SER C 121 SER C 127 1 ? 7  
HELX_P HELX_P24 24 LYS I 187 ? GLU I 191 ? LYS C 183 GLU C 187 1 ? 5  
HELX_P HELX_P25 25 THR J 87  ? SER J 91  ? THR D 83  SER D 87  5 ? 5  
HELX_P HELX_P26 26 SER J 160 ? SER J 162 ? SER D 157 SER D 159 5 ? 3  
HELX_P HELX_P27 27 PRO J 204 ? SER J 207 ? PRO D 201 SER D 204 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 7   SG  ? ? ? 1_555 A CYS 149 SG ? ? P CYS 22  P CYS 157 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf2  disulf ?    ? A CYS 26  SG  ? ? ? 1_555 A CYS 42  SG ? ? P CYS 42  P CYS 58  1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf3  disulf ?    ? A CYS 128 SG  ? ? ? 1_555 A CYS 195 SG ? ? P CYS 136 P CYS 201 1_555 ? ? ? ? ? ? ? 2.059 ? ?               
disulf4  disulf ?    ? A CYS 160 SG  ? ? ? 1_555 A CYS 174 SG ? ? P CYS 168 P CYS 182 1_555 ? ? ? ? ? ? ? 2.147 ? ?               
disulf5  disulf ?    ? A CYS 185 SG  ? ? ? 1_555 A CYS 210 SG ? ? P CYS 191 P CYS 220 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf6  disulf ?    ? B CYS 23  SG  ? ? ? 1_555 B CYS 93  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf7  disulf ?    ? B CYS 139 SG  ? ? ? 1_555 B CYS 199 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf8  disulf ?    ? B CYS 219 SG  ? ? ? 1_555 C CYS 133 SG ? ? L CYS 214 H CYS 128 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf9  disulf ?    ? C CYS 22  SG  ? ? ? 1_555 C CYS 96  SG ? ? H CYS 22  H CYS 92  1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf10 disulf ?    ? C CYS 145 SG  ? ? ? 1_555 C CYS 200 SG ? ? H CYS 140 H CYS 195 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf11 disulf ?    ? D CYS 23  SG  ? ? ? 1_555 D CYS 92  SG ? ? A CYS 23  A CYS 88  1_555 ? ? ? ? ? ? ? 2.055 ? ?               
disulf12 disulf ?    ? D CYS 138 SG  ? ? ? 1_555 D CYS 198 SG ? ? A CYS 134 A CYS 194 1_555 ? ? ? ? ? ? ? 2.061 ? ?               
disulf13 disulf ?    ? D CYS 218 SG  ? ? ? 1_555 E CYS 219 SG ? ? A CYS 214 B CYS 216 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf14 disulf ?    ? E CYS 22  SG  ? ? ? 1_555 E CYS 96  SG ? ? B CYS 22  B CYS 92  1_555 ? ? ? ? ? ? ? 2.060 ? ?               
disulf15 disulf ?    ? E CYS 144 SG  ? ? ? 1_555 E CYS 199 SG ? ? B CYS 141 B CYS 196 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf16 disulf ?    ? F CYS 7   SG  ? ? ? 1_555 F CYS 149 SG ? ? Q CYS 22  Q CYS 157 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf17 disulf ?    ? F CYS 26  SG  ? ? ? 1_555 F CYS 42  SG ? ? Q CYS 42  Q CYS 58  1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf18 disulf ?    ? F CYS 128 SG  ? ? ? 1_555 F CYS 195 SG ? ? Q CYS 136 Q CYS 201 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf19 disulf ?    ? F CYS 160 SG  ? ? ? 1_555 F CYS 174 SG ? ? Q CYS 168 Q CYS 182 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf20 disulf ?    ? F CYS 185 SG  ? ? ? 1_555 F CYS 210 SG ? ? Q CYS 191 Q CYS 220 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf21 disulf ?    ? G CYS 23  SG  ? ? ? 1_555 G CYS 93  SG ? ? M CYS 23  M CYS 88  1_555 ? ? ? ? ? ? ? 2.082 ? ?               
disulf22 disulf ?    ? G CYS 139 SG  ? ? ? 1_555 G CYS 199 SG ? ? M CYS 134 M CYS 194 1_555 ? ? ? ? ? ? ? 2.052 ? ?               
disulf23 disulf ?    ? G CYS 219 SG  ? ? ? 1_555 H CYS 133 SG ? ? M CYS 214 K CYS 128 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf24 disulf ?    ? H CYS 22  SG  ? ? ? 1_555 H CYS 96  SG ? ? K CYS 22  K CYS 92  1_555 ? ? ? ? ? ? ? 2.102 ? ?               
disulf25 disulf ?    ? H CYS 145 SG  ? ? ? 1_555 H CYS 200 SG ? ? K CYS 140 K CYS 195 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf26 disulf ?    ? I CYS 23  SG  ? ? ? 1_555 I CYS 92  SG ? ? C CYS 23  C CYS 88  1_555 ? ? ? ? ? ? ? 2.061 ? ?               
disulf27 disulf ?    ? I CYS 138 SG  ? ? ? 1_555 I CYS 198 SG ? ? C CYS 134 C CYS 194 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf28 disulf ?    ? I CYS 218 SG  ? ? ? 1_555 J CYS 219 SG ? ? C CYS 214 D CYS 216 1_555 ? ? ? ? ? ? ? 2.014 ? ?               
disulf29 disulf ?    ? J CYS 22  SG  ? ? ? 1_555 J CYS 96  SG ? ? D CYS 22  D CYS 92  1_555 ? ? ? ? ? ? ? 2.007 ? ?               
disulf30 disulf ?    ? J CYS 144 SG  ? ? ? 1_555 J CYS 199 SG ? ? D CYS 141 D CYS 196 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
covale1  covale one  ? A ASN 45  ND2 ? ? ? 1_555 K NAG .   C1 ? ? P ASN 61  E NAG 1   1_555 ? ? ? ? ? ? ? 1.415 ? N-Glycosylation 
covale2  covale one  ? A THR 119 OG1 ? ? ? 1_555 L A2G .   C1 ? ? P THR 125 F A2G 1   1_555 ? ? ? ? ? ? ? 1.341 ? O-Glycosylation 
covale3  covale one  ? F ASN 45  ND2 ? ? ? 1_555 M NAG .   C1 ? ? Q ASN 61  G NAG 1   1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
covale4  covale both ? K NAG .   O4  ? ? ? 1_555 K NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.432 ? ?               
covale5  covale both ? K NAG .   O6  ? ? ? 1_555 K FUC .   C1 ? ? E NAG 1   E FUC 15  1_555 ? ? ? ? ? ? ? 1.443 ? ?               
covale6  covale both ? K NAG .   O4  ? ? ? 1_555 K MAN .   C1 ? ? E NAG 2   E MAN 3   1_555 ? ? ? ? ? ? ? 1.456 ? ?               
covale7  covale both ? K MAN .   O3  ? ? ? 1_555 K MAN .   C1 ? ? E MAN 3   E MAN 4   1_555 ? ? ? ? ? ? ? 1.455 ? ?               
covale8  covale both ? K MAN .   O6  ? ? ? 1_555 K MAN .   C1 ? ? E MAN 3   E MAN 8   1_555 ? ? ? ? ? ? ? 1.466 ? ?               
covale9  covale both ? K MAN .   O4  ? ? ? 1_555 K NAG .   C1 ? ? E MAN 4   E NAG 5   1_555 ? ? ? ? ? ? ? 1.466 ? ?               
covale10 covale both ? K NAG .   O4  ? ? ? 1_555 K GAL .   C1 ? ? E NAG 5   E GAL 6   1_555 ? ? ? ? ? ? ? 1.457 ? ?               
covale11 covale both ? K GAL .   O3  ? ? ? 1_555 K SIA .   C2 ? ? E GAL 6   E SIA 7   1_555 ? ? ? ? ? ? ? 1.454 ? ?               
covale12 covale both ? K MAN .   O2  ? ? ? 1_555 K NAG .   C1 ? ? E MAN 8   E NAG 9   1_555 ? ? ? ? ? ? ? 1.469 ? ?               
covale13 covale both ? K MAN .   O6  ? ? ? 1_555 K NAG .   C1 ? ? E MAN 8   E NAG 12  1_555 ? ? ? ? ? ? ? 1.445 ? ?               
covale14 covale both ? K NAG .   O4  ? ? ? 1_555 K GAL .   C1 ? ? E NAG 9   E GAL 10  1_555 ? ? ? ? ? ? ? 1.436 ? ?               
covale15 covale both ? K GAL .   O3  ? ? ? 1_555 K SIA .   C2 ? ? E GAL 10  E SIA 11  1_555 ? ? ? ? ? ? ? 1.484 ? ?               
covale16 covale both ? K NAG .   O4  ? ? ? 1_555 K GAL .   C1 ? ? E NAG 12  E GAL 13  1_555 ? ? ? ? ? ? ? 1.444 ? ?               
covale17 covale both ? K GAL .   O3  ? ? ? 1_555 K SIA .   C2 ? ? E GAL 13  E SIA 14  1_555 ? ? ? ? ? ? ? 1.461 ? ?               
covale18 covale both ? L A2G .   O3  ? ? ? 1_555 L GAL .   C1 ? ? F A2G 1   F GAL 2   1_555 ? ? ? ? ? ? ? 1.449 ? ?               
covale19 covale both ? M NAG .   O4  ? ? ? 1_555 M NAG .   C1 ? ? G NAG 1   G NAG 2   1_555 ? ? ? ? ? ? ? 1.468 ? ?               
covale20 covale both ? M NAG .   O6  ? ? ? 1_555 M FUC .   C1 ? ? G NAG 1   G FUC 15  1_555 ? ? ? ? ? ? ? 1.451 ? ?               
covale21 covale both ? M NAG .   O4  ? ? ? 1_555 M MAN .   C1 ? ? G NAG 2   G MAN 3   1_555 ? ? ? ? ? ? ? 1.459 ? ?               
covale22 covale both ? M MAN .   O3  ? ? ? 1_555 M MAN .   C1 ? ? G MAN 3   G MAN 4   1_555 ? ? ? ? ? ? ? 1.470 ? ?               
covale23 covale both ? M MAN .   O6  ? ? ? 1_555 M MAN .   C1 ? ? G MAN 3   G MAN 8   1_555 ? ? ? ? ? ? ? 1.448 ? ?               
covale24 covale both ? M MAN .   O6  ? ? ? 1_555 M NAG .   C1 ? ? G MAN 4   G NAG 5   1_555 ? ? ? ? ? ? ? 1.447 ? ?               
covale25 covale both ? M NAG .   O4  ? ? ? 1_555 M GAL .   C1 ? ? G NAG 5   G GAL 6   1_555 ? ? ? ? ? ? ? 1.468 ? ?               
covale26 covale both ? M GAL .   O3  ? ? ? 1_555 M SIA .   C2 ? ? G GAL 6   G SIA 7   1_555 ? ? ? ? ? ? ? 1.452 ? ?               
covale27 covale both ? M MAN .   O2  ? ? ? 1_555 M NAG .   C1 ? ? G MAN 8   G NAG 9   1_555 ? ? ? ? ? ? ? 1.408 ? ?               
covale28 covale both ? M MAN .   O6  ? ? ? 1_555 M NAG .   C1 ? ? G MAN 8   G NAG 12  1_555 ? ? ? ? ? ? ? 1.450 ? ?               
covale29 covale both ? M NAG .   O4  ? ? ? 1_555 M GAL .   C1 ? ? G NAG 9   G GAL 10  1_555 ? ? ? ? ? ? ? 1.454 ? ?               
covale30 covale both ? M GAL .   O3  ? ? ? 1_555 M SIA .   C2 ? ? G GAL 10  G SIA 11  1_555 ? ? ? ? ? ? ? 1.458 ? ?               
covale31 covale both ? M NAG .   O4  ? ? ? 1_555 M GAL .   C1 ? ? G NAG 12  G GAL 13  1_555 ? ? ? ? ? ? ? 1.464 ? ?               
covale32 covale both ? M GAL .   O3  ? ? ? 1_555 M SIA .   C2 ? ? G GAL 13  G SIA 14  1_555 ? ? ? ? ? ? ? 1.467 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 156 B . ? ASP 151 L GLY 157 B ? GLY 152 L 1 -6.78 
2 PHE 151 C . ? PHE 146 H PRO 152 C ? PRO 147 H 1 7.20  
3 SER 7   D . ? SER 7   A PRO 8   D ? PRO 8   A 1 5.12  
4 PHE 151 H . ? PHE 146 K PRO 152 H ? PRO 147 K 1 -6.57 
5 TRP 193 H . ? TRP 188 K PRO 194 H ? PRO 189 K 1 24.22 
6 SER 7   I . ? SER 7   C PRO 8   I ? PRO 8   C 1 2.96  
7 ASN 80  I . ? ASN 76  C PRO 81  I ? PRO 77  C 1 0.04  
8 TYR 144 I . ? TYR 140 C PRO 145 I ? PRO 141 C 1 23.86 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 7 ? 
B  ? 7 ? 
C  ? 6 ? 
D  ? 4 ? 
E  ? 3 ? 
F  ? 4 ? 
G  ? 3 ? 
H  ? 4 ? 
I  ? 6 ? 
J  ? 4 ? 
K  ? 4 ? 
L  ? 4 ? 
M  ? 3 ? 
N  ? 5 ? 
O  ? 4 ? 
P  ? 3 ? 
Q  ? 2 ? 
R  ? 4 ? 
S  ? 3 ? 
T  ? 6 ? 
U  ? 4 ? 
V  ? 3 ? 
W  ? 3 ? 
X  ? 2 ? 
Y  ? 2 ? 
Z  ? 7 ? 
AA ? 6 ? 
AB ? 5 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 2 ? 
AF ? 4 ? 
AG ? 2 ? 
AH ? 3 ? 
AI ? 4 ? 
AJ ? 5 ? 
AK ? 4 ? 
AL ? 4 ? 
AM ? 4 ? 
AN ? 3 ? 
AO ? 4 ? 
AP ? 4 ? 
AQ ? 4 ? 
AR ? 4 ? 
AS ? 4 ? 
AT ? 4 ? 
AU ? 5 ? 
AV ? 5 ? 
AW ? 4 ? 
AX ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
A  5 6 ? anti-parallel 
A  6 7 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
B  6 7 ? anti-parallel 
C  1 2 ? parallel      
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
C  4 5 ? anti-parallel 
C  5 6 ? anti-parallel 
D  1 2 ? parallel      
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
I  1 2 ? parallel      
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
I  4 5 ? anti-parallel 
I  5 6 ? anti-parallel 
J  1 2 ? parallel      
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? parallel      
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
N  4 5 ? anti-parallel 
O  1 2 ? parallel      
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
T  1 2 ? parallel      
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
T  4 5 ? anti-parallel 
T  5 6 ? anti-parallel 
U  1 2 ? parallel      
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
Z  4 5 ? anti-parallel 
Z  5 6 ? anti-parallel 
Z  6 7 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AB 1 2 ? parallel      
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? parallel      
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AJ 4 5 ? anti-parallel 
AK 1 2 ? parallel      
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AU 4 5 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AV 4 5 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 GLN A 15  ? SER A 20  ? GLN P 30  SER P 35  
A  2 ARG A 23  ? HIS A 32  ? ARG P 38  HIS P 48  
A  3 TRP A 35  ? THR A 38  ? TRP P 51  THR P 54  
A  4 MET A 98  ? LEU A 102 ? MET P 104 LEU P 108 
A  5 GLN A 64  ? PRO A 73  ? GLN P 81  PRO P 90  
A  6 VAL A 48  ? LEU A 51  ? VAL P 64  LEU P 67  
A  7 GLN A 15  ? SER A 20  ? GLN P 30  SER P 35  
B  1 THR A 127 ? GLY A 132 ? THR P 135 GLY P 140 
B  2 GLN A 148 ? VAL A 154 ? GLN P 156 VAL P 162 
B  3 MET A 172 ? GLY A 176 ? MET P 180 GLY P 184 
B  4 SER A 217 ? LYS A 221 ? SER P 226 LYS P 230 
B  5 VAL A 198 ? THR A 203 ? VAL P 208 THR P 213 
B  6 PRO A 192 ? CYS A 195 ? PRO P 198 CYS P 201 
B  7 THR A 127 ? GLY A 132 ? THR P 135 GLY P 140 
C  1 SER B 10  ? VAL B 13  ? SER L 10  VAL L 13  
C  2 THR B 107 ? ILE B 111 ? THR L 102 ILE L 106 
C  3 GLY B 89  ? GLN B 95  ? GLY L 84  GLN L 90  
C  4 LEU B 38  ? GLN B 43  ? LEU L 33  GLN L 38  
C  5 GLN B 50  ? TYR B 54  ? GLN L 45  TYR L 49  
C  6 ASN B 58  ? LEU B 59  ? ASN L 53  LEU L 54  
D  1 SER B 10  ? VAL B 13  ? SER L 10  VAL L 13  
D  2 THR B 107 ? ILE B 111 ? THR L 102 ILE L 106 
D  3 GLY B 89  ? GLN B 95  ? GLY L 84  GLN L 90  
D  4 THR B 102 ? PHE B 103 ? THR L 97  PHE L 98  
E  1 VAL B 19  ? ARG B 24  ? VAL L 19  ARG L 24  
E  2 ASP B 75  ? ILE B 80  ? ASP L 70  ILE L 75  
E  3 PHE B 67  ? SER B 72  ? PHE L 62  SER L 67  
F  1 SER B 121 ? PHE B 123 ? SER L 116 PHE L 118 
F  2 GLY B 134 ? LEU B 141 ? GLY L 129 LEU L 136 
F  3 MET B 180 ? THR B 187 ? MET L 175 THR L 182 
F  4 VAL B 164 ? TRP B 168 ? VAL L 159 TRP L 163 
G  1 LYS B 152 ? LYS B 154 ? LYS L 147 LYS L 149 
G  2 TYR B 197 ? GLU B 200 ? TYR L 192 GLU L 195 
G  3 VAL B 211 ? PHE B 214 ? VAL L 206 PHE L 209 
H  1 GLN C 3   ? GLN C 6   ? GLN H 3   GLN H 6   
H  2 VAL C 18  ? SER C 25  ? VAL H 18  SER H 25  
H  3 THR C 78  ? LEU C 83  ? THR H 77  LEU H 82  
H  4 ALA C 68  ? ASP C 73  ? ALA H 67  ASP H 72  
I  1 GLU C 10  ? VAL C 12  ? GLU H 10  VAL H 12  
I  2 THR C 112 ? VAL C 116 ? THR H 107 VAL H 111 
I  3 ALA C 92  ? ARG C 98  ? ALA H 88  ARG H 94  
I  4 MET C 34  ? GLN C 39  ? MET H 34  GLN H 39  
I  5 GLU C 46  ? TYR C 52  ? GLU H 46  TYR H 52  
I  6 ASP C 57  ? TYR C 60  ? ASP H 56  TYR H 59  
J  1 GLU C 10  ? VAL C 12  ? GLU H 10  VAL H 12  
J  2 THR C 112 ? VAL C 116 ? THR H 107 VAL H 111 
J  3 ALA C 92  ? ARG C 98  ? ALA H 88  ARG H 94  
J  4 TYR C 107 ? TRP C 108 ? TYR H 102 TRP H 103 
K  1 VAL C 126 ? TYR C 127 ? VAL H 121 TYR H 122 
K  2 LEU C 146 ? TYR C 150 ? LEU H 141 TYR H 145 
K  3 TYR C 180 ? VAL C 188 ? TYR H 175 VAL H 183 
K  4 VAL C 141 ? LEU C 143 ? VAL H 136 LEU H 138 
L  1 VAL C 126 ? TYR C 127 ? VAL H 121 TYR H 122 
L  2 LEU C 146 ? TYR C 150 ? LEU H 141 TYR H 145 
L  3 TYR C 180 ? VAL C 188 ? TYR H 175 VAL H 183 
L  4 VAL C 168 ? THR C 170 ? VAL H 163 THR H 165 
M  1 THR C 156 ? TRP C 159 ? THR H 151 TRP H 154 
M  2 THR C 199 ? HIS C 204 ? THR H 194 HIS H 199 
M  3 THR C 209 ? LYS C 214 ? THR H 204 LYS H 209 
N  1 ALA D 12  ? SER D 14  ? ALA A 12  SER A 14  
N  2 THR D 106 ? LYS D 111 ? THR A 102 LYS A 107 
N  3 ALA D 88  ? GLN D 94  ? ALA A 84  GLN A 90  
N  4 MET D 37  ? GLN D 42  ? MET A 33  GLN A 38  
N  5 LYS D 49  ? TYR D 53  ? LYS A 45  TYR A 49  
O  1 ALA D 12  ? SER D 14  ? ALA A 12  SER A 14  
O  2 THR D 106 ? LYS D 111 ? THR A 102 LYS A 107 
O  3 ALA D 88  ? GLN D 94  ? ALA A 84  GLN A 90  
O  4 THR D 101 ? PHE D 102 ? THR A 97  PHE A 98  
P  1 ALA D 19  ? SER D 22  ? ALA A 19  SER A 22  
P  2 PHE D 75  ? ILE D 79  ? PHE A 71  ILE A 75  
P  3 PHE D 66  ? GLY D 70  ? PHE A 62  GLY A 66  
Q  1 ASP D 30  C LEU D 31  D ASP A 27  LEU A 27  
Q  2 PHE D 34  ? THR D 35  ? PHE A 30  THR A 31  
R  1 VAL D 119 ? PHE D 122 ? VAL A 115 PHE A 118 
R  2 ALA D 134 ? ASN D 141 ? ALA A 130 ASN A 137 
R  3 SER D 178 ? LEU D 185 ? SER A 174 LEU A 181 
R  4 VAL D 163 ? TRP D 167 ? VAL A 159 TRP A 163 
S  1 ASN D 149 ? ILE D 154 ? ASN A 145 ILE A 150 
S  2 SER D 195 ? HIS D 202 ? SER A 191 HIS A 198 
S  3 SER D 205 ? ASN D 214 ? SER A 201 ASN A 210 
T  1 GLU E 10  ? LEU E 11  ? GLU B 10  LEU B 11  
T  2 THR E 111 ? THR E 114 ? THR B 108 THR B 111 
T  3 VAL E 93  ? SER E 99  ? VAL B 89  SER B 95  
T  4 TRP E 33  ? GLN E 39  ? TRP B 33  GLN B 39  
T  5 GLU E 46  ? ILE E 51  ? GLU B 46  ILE B 51  
T  6 THR E 58  ? ASN E 60  ? THR B 57  ASN B 59  
U  1 GLU E 10  ? LEU E 11  ? GLU B 10  LEU B 11  
U  2 THR E 111 ? THR E 114 ? THR B 108 THR B 111 
U  3 VAL E 93  ? SER E 99  ? VAL B 89  SER B 95  
U  4 VAL E 106 ? TRP E 107 ? VAL B 103 TRP B 104 
V  1 LYS E 19  ? MET E 20  ? LYS B 19  MET B 20  
V  2 THR E 78  ? LEU E 83  ? THR B 77  LEU B 82  
V  3 VAL E 68  ? ASP E 73  ? VAL B 67  ASP B 72  
W  1 VAL E 125 ? LEU E 128 ? VAL B 122 LEU B 125 
W  2 GLY E 143 ? LYS E 147 ? GLY B 140 LYS B 144 
W  3 THR E 180 ? SER E 184 ? THR B 177 SER B 181 
X  1 SER E 139 ? VAL E 140 ? SER B 136 VAL B 137 
X  2 VAL E 187 ? THR E 188 ? VAL B 184 THR B 185 
Y  1 LEU E 157 ? TRP E 158 ? LEU B 154 TRP B 155 
Y  2 CYS E 199 ? ASN E 200 ? CYS B 196 ASN B 197 
Z  1 GLN F 15  ? SER F 20  ? GLN Q 30  SER Q 35  
Z  2 ARG F 23  ? LEU F 30  ? ARG Q 38  LEU Q 46  
Z  3 TRP F 35  ? THR F 38  ? TRP Q 51  THR Q 54  
Z  4 MET F 98  ? LEU F 102 ? MET Q 104 LEU Q 108 
Z  5 GLN F 64  ? PRO F 73  ? GLN Q 81  PRO Q 90  
Z  6 VAL F 48  ? LEU F 51  ? VAL Q 64  LEU Q 67  
Z  7 GLN F 15  ? SER F 20  ? GLN Q 30  SER Q 35  
AA 1 VAL F 198 ? ILE F 202 ? VAL Q 208 ILE Q 212 
AA 2 PRO F 192 ? CYS F 195 ? PRO Q 198 CYS Q 201 
AA 3 THR F 127 ? GLY F 132 ? THR Q 135 GLY Q 140 
AA 4 GLN F 148 ? ILE F 155 ? GLN Q 156 ILE Q 163 
AA 5 CYS F 174 ? ALA F 175 ? CYS Q 182 ALA Q 183 
AA 6 SER F 217 ? LEU F 218 ? SER Q 226 LEU Q 227 
AB 1 SER G 10  ? VAL G 13  ? SER M 10  VAL M 13  
AB 2 THR G 107 ? ILE G 111 ? THR M 102 ILE M 106 
AB 3 GLY G 89  ? GLN G 95  ? GLY M 84  GLN M 90  
AB 4 LEU G 38  ? GLN G 43  ? LEU M 33  GLN M 38  
AB 5 GLN G 50  ? LEU G 51  ? GLN M 45  LEU M 46  
AC 1 SER G 10  ? VAL G 13  ? SER M 10  VAL M 13  
AC 2 THR G 107 ? ILE G 111 ? THR M 102 ILE M 106 
AC 3 GLY G 89  ? GLN G 95  ? GLY M 84  GLN M 90  
AC 4 THR G 102 ? PHE G 103 ? THR M 97  PHE M 98  
AD 1 VAL G 19  ? ARG G 24  ? VAL M 19  ARG M 24  
AD 2 ASP G 75  ? ILE G 80  ? ASP M 70  ILE M 75  
AD 3 PHE G 67  ? SER G 70  ? PHE M 62  SER M 65  
AE 1 ILE G 53  ? TYR G 54  ? ILE M 48  TYR M 49  
AE 2 ASN G 58  ? LEU G 59  ? ASN M 53  LEU M 54  
AF 1 THR G 119 ? PHE G 123 ? THR M 114 PHE M 118 
AF 2 VAL G 138 ? PHE G 144 ? VAL M 133 PHE M 139 
AF 3 TYR G 178 ? SER G 182 ? TYR M 173 SER M 177 
AF 4 ASN G 166 ? TRP G 168 ? ASN M 161 TRP M 163 
AG 1 GLY G 134 ? SER G 136 ? GLY M 129 SER M 131 
AG 2 THR G 185 ? THR G 187 ? THR M 180 THR M 182 
AH 1 ILE G 149 ? LYS G 154 ? ILE M 144 LYS M 149 
AH 2 TYR G 197 ? HIS G 203 ? TYR M 192 HIS M 198 
AH 3 SER G 206 ? PHE G 214 ? SER M 201 PHE M 209 
AI 1 GLN H 3   ? GLN H 6   ? GLN K 3   GLN K 6   
AI 2 LYS H 19  ? SER H 25  ? LYS K 19  SER K 25  
AI 3 THR H 78  ? LEU H 83  ? THR K 77  LEU K 82  
AI 4 ALA H 68  ? ASP H 73  ? ALA K 67  ASP K 72  
AJ 1 GLU H 10  ? VAL H 12  ? GLU K 10  VAL K 12  
AJ 2 THR H 112 ? VAL H 116 ? THR K 107 VAL K 111 
AJ 3 ALA H 92  ? ARG H 98  ? ALA K 88  ARG K 94  
AJ 4 MET H 34  ? GLN H 39  ? MET K 34  GLN K 39  
AJ 5 GLU H 46  ? GLY H 49  ? GLU K 46  GLY K 49  
AK 1 GLU H 10  ? VAL H 12  ? GLU K 10  VAL K 12  
AK 2 THR H 112 ? VAL H 116 ? THR K 107 VAL K 111 
AK 3 ALA H 92  ? ARG H 98  ? ALA K 88  ARG K 94  
AK 4 TYR H 107 ? TRP H 108 ? TYR K 102 TRP K 103 
AL 1 VAL H 126 ? LEU H 129 ? VAL K 121 LEU K 124 
AL 2 VAL H 141 ? TYR H 150 ? VAL K 136 TYR K 145 
AL 3 TYR H 180 ? VAL H 188 ? TYR K 175 VAL K 183 
AL 4 HIS H 169 ? THR H 170 ? HIS K 164 THR K 165 
AM 1 VAL H 126 ? LEU H 129 ? VAL K 121 LEU K 124 
AM 2 VAL H 141 ? TYR H 150 ? VAL K 136 TYR K 145 
AM 3 TYR H 180 ? VAL H 188 ? TYR K 175 VAL K 183 
AM 4 VAL H 174 ? LEU H 175 ? VAL K 169 LEU K 170 
AN 1 THR H 156 ? TRP H 159 ? THR K 151 TRP K 154 
AN 2 THR H 199 ? HIS H 204 ? THR K 194 HIS K 199 
AN 3 THR H 209 ? LYS H 214 ? THR K 204 LYS K 209 
AO 1 THR I 5   ? SER I 7   ? THR C 5   SER C 7   
AO 2 ALA I 19  ? ARG I 24  ? ALA C 19  ARG C 24  
AO 3 ASP I 74  ? ILE I 79  ? ASP C 70  ILE C 75  
AO 4 PHE I 66  ? GLY I 70  ? PHE C 62  GLY C 66  
AP 1 LYS I 49  ? TYR I 53  ? LYS C 45  TYR C 49  
AP 2 MET I 37  ? GLN I 42  ? MET C 33  GLN C 38  
AP 3 ALA I 88  ? GLN I 94  ? ALA C 84  GLN C 90  
AP 4 THR I 101 ? PHE I 102 ? THR C 97  PHE C 98  
AQ 1 LYS I 49  ? TYR I 53  ? LYS C 45  TYR C 49  
AQ 2 MET I 37  ? GLN I 42  ? MET C 33  GLN C 38  
AQ 3 ALA I 88  ? GLN I 94  ? ALA C 84  GLN C 90  
AQ 4 THR I 106 ? LEU I 108 ? THR C 102 LEU C 104 
AR 1 THR I 118 ? PHE I 122 ? THR C 114 PHE C 118 
AR 2 GLY I 133 ? PHE I 143 ? GLY C 129 PHE C 139 
AR 3 TYR I 177 ? THR I 186 ? TYR C 173 THR C 182 
AR 4 VAL I 163 ? TRP I 167 ? VAL C 159 TRP C 163 
AS 1 SER I 157 ? ARG I 159 ? SER C 153 ARG C 155 
AS 2 VAL I 150 ? ILE I 154 ? VAL C 146 ILE C 150 
AS 3 SER I 195 ? ALA I 200 ? SER C 191 ALA C 196 
AS 4 ILE I 209 ? ASN I 214 ? ILE C 205 ASN C 210 
AT 1 GLN J 5   ? GLN J 6   ? GLN D 5   GLN D 6   
AT 2 VAL J 18  ? LYS J 23  ? VAL D 18  LYS D 23  
AT 3 THR J 78  ? LEU J 83  ? THR D 77  LEU D 82  
AT 4 THR J 69  ? ASP J 73  ? THR D 68  ASP D 72  
AU 1 THR J 58  ? ASN J 60  ? THR D 57  ASN D 59  
AU 2 GLU J 46  ? ILE J 51  ? GLU D 46  ILE D 51  
AU 3 TRP J 33  ? LYS J 38  ? TRP D 33  LYS D 38  
AU 4 ALA J 92  ? SER J 99  ? ALA D 88  SER D 95  
AU 5 VAL J 106 ? TRP J 107 ? VAL D 103 TRP D 104 
AV 1 THR J 58  ? ASN J 60  ? THR D 57  ASN D 59  
AV 2 GLU J 46  ? ILE J 51  ? GLU D 46  ILE D 51  
AV 3 TRP J 33  ? LYS J 38  ? TRP D 33  LYS D 38  
AV 4 ALA J 92  ? SER J 99  ? ALA D 88  SER D 95  
AV 5 THR J 111 ? VAL J 113 ? THR D 108 VAL D 110 
AW 1 VAL J 125 ? LEU J 128 ? VAL D 122 LEU D 125 
AW 2 SER J 139 ? LYS J 147 ? SER D 136 LYS D 144 
AW 3 LEU J 178 ? THR J 188 ? LEU D 175 THR D 185 
AW 4 VAL J 167 ? GLN J 175 ? VAL D 164 GLN D 172 
AX 1 LEU J 156 ? TRP J 158 ? LEU D 153 TRP D 155 
AX 2 CYS J 199 ? HIS J 203 ? CYS D 196 HIS D 200 
AX 3 THR J 208 ? LYS J 212 ? THR D 205 LYS D 209 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N VAL A 18  ? N VAL P 33  O CYS A 26  ? O CYS P 42  
A  2 3 N VAL A 29  ? N VAL P 45  O LEU A 37  ? O LEU P 53  
A  3 4 N VAL A 36  ? N VAL P 52  O LEU A 100 ? O LEU P 106 
A  4 5 O LEU A 99  ? O LEU P 105 N PHE A 72  ? N PHE P 89  
A  5 6 O PHE A 66  ? O PHE P 83  N ILE A 49  ? N ILE P 65  
A  6 7 O VAL A 48  ? O VAL P 64  N ALA A 19  ? N ALA P 34  
B  1 2 N CYS A 128 ? N CYS P 136 O LEU A 152 ? O LEU P 160 
B  2 3 N HIS A 153 ? N HIS P 161 O GLY A 176 ? O GLY P 184 
B  3 4 N LEU A 173 ? N LEU P 181 O TYR A 219 ? O TYR P 228 
B  4 5 O THR A 220 ? O THR P 229 N ILE A 202 ? N ILE P 212 
B  5 6 O GLY A 201 ? O GLY P 211 N LEU A 193 ? N LEU P 199 
B  6 7 O VAL A 194 ? O VAL P 200 N TYR A 129 ? N TYR P 137 
C  1 2 N VAL B 11  ? N VAL L 11  O LYS B 108 ? O LYS L 103 
C  2 3 O VAL B 109 ? O VAL L 104 N GLY B 89  ? N GLY L 84  
C  3 4 O TYR B 92  ? O TYR L 87  N PHE B 41  ? N PHE L 36  
C  4 5 N TRP B 40  ? N TRP L 35  O LEU B 52  ? O LEU L 47  
C  5 6 N TYR B 54  ? N TYR L 49  O ASN B 58  ? O ASN L 53  
D  1 2 N VAL B 11  ? N VAL L 11  O LYS B 108 ? O LYS L 103 
D  2 3 O VAL B 109 ? O VAL L 104 N GLY B 89  ? N GLY L 84  
D  3 4 N GLN B 95  ? N GLN L 90  O THR B 102 ? O THR L 97  
E  1 2 N ILE B 21  ? N ILE L 21  O LEU B 78  ? O LEU L 73  
E  2 3 O ARG B 79  ? O ARG L 74  N SER B 68  ? N SER L 63  
F  1 2 N SER B 121 ? N SER L 116 O PHE B 140 ? O PHE L 135 
F  2 3 N ALA B 135 ? N ALA L 130 O LEU B 186 ? O LEU L 181 
F  3 4 O THR B 183 ? O THR L 178 N LEU B 165 ? N LEU L 160 
G  1 2 N LYS B 152 ? N LYS L 147 O GLU B 200 ? O GLU L 195 
G  2 3 N CYS B 199 ? N CYS L 194 O LYS B 212 ? O LYS L 207 
H  1 2 N GLN C 3   ? N GLN H 3   O SER C 25  ? O SER H 25  
H  2 3 N ILE C 20  ? N ILE H 20  O MET C 81  ? O MET H 80  
H  3 4 O TYR C 80  ? O TYR H 79  N THR C 71  ? N THR H 70  
I  1 2 N GLU C 10  ? N GLU H 10  O THR C 115 ? O THR H 110 
I  2 3 O THR C 112 ? O THR H 107 N TYR C 94  ? N TYR H 90  
I  3 4 O ALA C 97  ? O ALA H 93  N ASN C 35  ? N ASN H 35  
I  4 5 N LYS C 38  ? N LYS H 38  O GLU C 46  ? O GLU H 46  
I  5 6 N TYR C 52  ? N TYR H 52  O ASP C 57  ? O ASP H 56  
J  1 2 N GLU C 10  ? N GLU H 10  O THR C 115 ? O THR H 110 
J  2 3 O THR C 112 ? O THR H 107 N TYR C 94  ? N TYR H 90  
J  3 4 N ARG C 98  ? N ARG H 94  O TYR C 107 ? O TYR H 102 
K  1 2 N TYR C 127 ? N TYR H 122 O LEU C 146 ? O LEU H 141 
K  2 3 N VAL C 147 ? N VAL H 142 O LEU C 182 ? O LEU H 177 
K  3 4 O VAL C 188 ? O VAL H 183 N VAL C 141 ? N VAL H 136 
L  1 2 N TYR C 127 ? N TYR H 122 O LEU C 146 ? O LEU H 141 
L  2 3 N VAL C 147 ? N VAL H 142 O LEU C 182 ? O LEU H 177 
L  3 4 O SER C 185 ? O SER H 180 N HIS C 169 ? N HIS H 164 
M  1 2 N THR C 156 ? N THR H 151 O ALA C 203 ? O ALA H 198 
M  2 3 N CYS C 200 ? N CYS H 195 O LYS C 213 ? O LYS H 208 
N  1 2 N VAL D 13  ? N VAL A 13  O GLU D 109 ? O GLU A 105 
N  2 3 O LEU D 108 ? O LEU A 104 N ALA D 88  ? N ALA A 84  
N  3 4 O TYR D 91  ? O TYR A 87  N TYR D 40  ? N TYR A 36  
N  4 5 N TRP D 39  ? N TRP A 35  O ILE D 52  ? O ILE A 48  
O  1 2 N VAL D 13  ? N VAL A 13  O GLU D 109 ? O GLU A 105 
O  2 3 O LEU D 108 ? O LEU A 104 N ALA D 88  ? N ALA A 84  
O  3 4 N GLN D 94  ? N GLN A 90  O THR D 101 ? O THR A 97  
P  1 2 N ALA D 19  ? N ALA A 19  O ILE D 79  ? O ILE A 75  
P  2 3 O THR D 76  ? O THR A 72  N SER D 69  ? N SER A 65  
Q  1 2 N LEU D 31  D N LEU A 27  O PHE D 34  ? O PHE A 30  
R  1 2 N PHE D 122 ? N PHE A 118 O VAL D 137 ? O VAL A 133 
R  2 3 N VAL D 136 ? N VAL A 132 O LEU D 183 ? O LEU A 179 
R  3 4 O THR D 182 ? O THR A 178 N LEU D 164 ? N LEU A 160 
S  1 2 N LYS D 153 ? N LYS A 149 O THR D 197 ? O THR A 193 
S  2 3 N TYR D 196 ? N TYR A 192 O PHE D 213 ? O PHE A 209 
T  1 2 N GLU E 10  ? N GLU B 10  O THR E 112 ? O THR B 109 
T  2 3 O THR E 111 ? O THR B 108 N TYR E 94  ? N TYR B 90  
T  3 4 O TYR E 95  ? O TYR B 91  N VAL E 37  ? N VAL B 37  
T  4 5 N LYS E 38  ? N LYS B 38  O GLU E 46  ? O GLU B 46  
T  5 6 N TYR E 50  ? N TYR B 50  O GLU E 59  ? O GLU B 58  
U  1 2 N GLU E 10  ? N GLU B 10  O THR E 112 ? O THR B 109 
U  2 3 O THR E 111 ? O THR B 108 N TYR E 94  ? N TYR B 90  
U  3 4 N ARG E 98  ? N ARG B 94  O VAL E 106 ? O VAL B 103 
V  1 2 N MET E 20  ? N MET B 20  O MET E 81  ? O MET B 80  
V  2 3 O THR E 78  ? O THR B 77  N ASP E 73  ? N ASP B 72  
W  1 2 N TYR E 126 ? N TYR B 123 O LEU E 145 ? O LEU B 142 
W  2 3 N VAL E 146 ? N VAL B 143 O LEU E 181 ? O LEU B 178 
X  1 2 N VAL E 140 ? N VAL B 137 O VAL E 187 ? O VAL B 184 
Y  1 2 N LEU E 157 ? N LEU B 154 O ASN E 200 ? O ASN B 197 
Z  1 2 N SER F 20  ? N SER Q 35  O ARG F 23  ? O ARG Q 38  
Z  2 3 N VAL F 29  ? N VAL Q 45  O LEU F 37  ? O LEU Q 53  
Z  3 4 N VAL F 36  ? N VAL Q 52  O LEU F 100 ? O LEU Q 106 
Z  4 5 O LEU F 99  ? O LEU Q 105 N PHE F 72  ? N PHE Q 89  
Z  5 6 O PHE F 66  ? O PHE Q 83  N ILE F 49  ? N ILE Q 65  
Z  6 7 O VAL F 48  ? O VAL Q 64  N ALA F 19  ? N ALA Q 34  
AA 1 2 O VAL F 198 ? O VAL Q 208 N CYS F 195 ? N CYS Q 201 
AA 2 3 O VAL F 194 ? O VAL Q 200 N TYR F 129 ? N TYR Q 137 
AA 3 4 N GLY F 132 ? N GLY Q 140 O GLN F 148 ? O GLN Q 156 
AA 4 5 N ILE F 155 ? N ILE Q 163 O CYS F 174 ? O CYS Q 182 
AA 5 6 N ALA F 175 ? N ALA Q 183 O SER F 217 ? O SER Q 226 
AB 1 2 N VAL G 11  ? N VAL M 11  O LYS G 108 ? O LYS M 103 
AB 2 3 O THR G 107 ? O THR M 102 N TYR G 91  ? N TYR M 86  
AB 3 4 O TYR G 92  ? O TYR M 87  N PHE G 41  ? N PHE M 36  
AB 4 5 N LEU G 42  ? N LEU M 37  O GLN G 50  ? O GLN M 45  
AC 1 2 N VAL G 11  ? N VAL M 11  O LYS G 108 ? O LYS M 103 
AC 2 3 O THR G 107 ? O THR M 102 N TYR G 91  ? N TYR M 86  
AC 3 4 N GLN G 95  ? N GLN M 90  O THR G 102 ? O THR M 97  
AD 1 2 N CYS G 23  ? N CYS M 23  O PHE G 76  ? O PHE M 71  
AD 2 3 O THR G 77  ? O THR M 72  N SER G 70  ? N SER M 65  
AE 1 2 N TYR G 54  ? N TYR M 49  O ASN G 58  ? O ASN M 53  
AF 1 2 N PHE G 123 ? N PHE M 118 O VAL G 138 ? O VAL M 133 
AF 2 3 N PHE G 144 ? N PHE M 139 O TYR G 178 ? O TYR M 173 
AF 3 4 O SER G 181 ? O SER M 176 N SER G 167 ? N SER M 162 
AG 1 2 N ALA G 135 ? N ALA M 130 O LEU G 186 ? O LEU M 181 
AH 1 2 N LYS G 154 ? N LYS M 149 O THR G 198 ? O THR M 193 
AH 2 3 N ALA G 201 ? N ALA M 196 O ILE G 210 ? O ILE M 205 
AI 1 2 N GLN H 5   ? N GLN K 5   O LYS H 23  ? O LYS K 23  
AI 2 3 N CYS H 22  ? N CYS K 22  O ALA H 79  ? O ALA K 78  
AI 3 4 O TYR H 80  ? O TYR K 79  N THR H 71  ? N THR K 70  
AJ 1 2 N VAL H 12  ? N VAL K 12  O THR H 115 ? O THR K 110 
AJ 2 3 O THR H 112 ? O THR K 107 N TYR H 94  ? N TYR K 90  
AJ 3 4 O PHE H 95  ? O PHE K 91  N VAL H 37  ? N VAL K 37  
AJ 4 5 N LYS H 38  ? N LYS K 38  O GLU H 46  ? O GLU K 46  
AK 1 2 N VAL H 12  ? N VAL K 12  O THR H 115 ? O THR K 110 
AK 2 3 O THR H 112 ? O THR K 107 N TYR H 94  ? N TYR K 90  
AK 3 4 N ARG H 98  ? N ARG K 94  O TYR H 107 ? O TYR K 102 
AL 1 2 N TYR H 127 ? N TYR K 122 O LEU H 146 ? O LEU K 141 
AL 2 3 N LEU H 143 ? N LEU K 138 O VAL H 186 ? O VAL K 181 
AL 3 4 O SER H 185 ? O SER K 180 N HIS H 169 ? N HIS K 164 
AM 1 2 N TYR H 127 ? N TYR K 122 O LEU H 146 ? O LEU K 141 
AM 2 3 N LEU H 143 ? N LEU K 138 O VAL H 186 ? O VAL K 181 
AM 3 4 O THR H 181 ? O THR K 176 N VAL H 174 ? N VAL K 169 
AN 1 2 N LEU H 158 ? N LEU K 153 O ASN H 201 ? O ASN K 196 
AN 2 3 N VAL H 202 ? N VAL K 197 O VAL H 211 ? O VAL K 206 
AO 1 2 N SER I 7   ? N SER C 7   O SER I 22  ? O SER C 22  
AO 2 3 N CYS I 23  ? N CYS C 23  O PHE I 75  ? O PHE C 71  
AO 3 4 O THR I 78  ? O THR C 74  N SER I 67  ? N SER C 63  
AP 1 2 O ILE I 52  ? O ILE C 48  N TRP I 39  ? N TRP C 35  
AP 2 3 N TYR I 40  ? N TYR C 36  O TYR I 91  ? O TYR C 87  
AP 3 4 N GLN I 94  ? N GLN C 90  O THR I 101 ? O THR C 97  
AQ 1 2 O ILE I 52  ? O ILE C 48  N TRP I 39  ? N TRP C 35  
AQ 2 3 N TYR I 40  ? N TYR C 36  O TYR I 91  ? O TYR C 87  
AQ 3 4 N ALA I 88  ? N ALA C 84  O LEU I 108 ? O LEU C 104 
AR 1 2 N SER I 120 ? N SER C 116 O PHE I 139 ? O PHE C 135 
AR 2 3 N ALA I 134 ? N ALA C 130 O LEU I 185 ? O LEU C 181 
AR 3 4 O SER I 180 ? O SER C 176 N SER I 166 ? N SER C 162 
AS 1 2 O SER I 157 ? O SER C 153 N ILE I 154 ? N ILE C 150 
AS 2 3 N LYS I 151 ? N LYS C 147 O GLU I 199 ? O GLU C 195 
AS 3 4 N ALA I 200 ? N ALA C 196 O ILE I 209 ? O ILE C 205 
AT 1 2 N GLN J 5   ? N GLN D 5   O LYS J 23  ? O LYS D 23  
AT 2 3 N CYS J 22  ? N CYS D 22  O ALA J 79  ? O ALA D 78  
AT 3 4 O TYR J 80  ? O TYR D 79  N THR J 71  ? N THR D 70  
AU 1 2 O GLU J 59  ? O GLU D 58  N TYR J 50  ? N TYR D 50  
AU 2 3 O GLU J 46  ? O GLU D 46  N LYS J 38  ? N LYS D 38  
AU 3 4 N HIS J 35  ? N HIS D 35  O ALA J 97  ? O ALA D 93  
AU 4 5 N ARG J 98  ? N ARG D 94  O VAL J 106 ? O VAL D 103 
AV 1 2 O GLU J 59  ? O GLU D 58  N TYR J 50  ? N TYR D 50  
AV 2 3 O GLU J 46  ? O GLU D 46  N LYS J 38  ? N LYS D 38  
AV 3 4 N HIS J 35  ? N HIS D 35  O ALA J 97  ? O ALA D 93  
AV 4 5 N ALA J 92  ? N ALA D 88  O VAL J 113 ? O VAL D 110 
AW 1 2 N TYR J 126 ? N TYR D 123 O LEU J 145 ? O LEU D 142 
AW 2 3 N VAL J 140 ? N VAL D 137 O VAL J 187 ? O VAL D 184 
AW 3 4 O SER J 184 ? O SER D 181 N HIS J 168 ? N HIS D 165 
AX 1 2 N LEU J 157 ? N LEU D 154 O ASN J 200 ? O ASN D 197 
AX 2 3 N HIS J 203 ? N HIS D 200 O THR J 208 ? O THR D 205 
# 
_database_PDB_matrix.entry_id          3QUM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3QUM 
_atom_sites.fract_transf_matrix[1][1]   0.018081 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002063 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004408 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008480 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ILE A 1 1   ? 1.388   17.487  47.425  1.00 108.34 ? 16  ILE P N   1 
ATOM   2     C CA  . ILE A 1 1   ? 1.742   17.110  46.059  1.00 115.09 ? 16  ILE P CA  1 
ATOM   3     C C   . ILE A 1 1   ? 0.660   16.236  45.402  1.00 118.70 ? 16  ILE P C   1 
ATOM   4     O O   . ILE A 1 1   ? 0.675   15.004  45.506  1.00 114.44 ? 16  ILE P O   1 
ATOM   5     C CB  . ILE A 1 1   ? 3.134   16.402  45.987  1.00 108.99 ? 16  ILE P CB  1 
ATOM   6     C CG1 . ILE A 1 1   ? 4.193   17.187  46.787  1.00 96.36  ? 16  ILE P CG1 1 
ATOM   7     C CG2 . ILE A 1 1   ? 3.563   16.210  44.531  1.00 105.05 ? 16  ILE P CG2 1 
ATOM   8     C CD1 . ILE A 1 1   ? 5.635   16.734  46.556  1.00 72.05  ? 16  ILE P CD1 1 
ATOM   9     N N   . VAL A 1 2   ? -0.288  16.902  44.745  1.00 125.18 ? 17  VAL P N   1 
ATOM   10    C CA  . VAL A 1 2   ? -1.337  16.242  43.966  1.00 129.54 ? 17  VAL P CA  1 
ATOM   11    C C   . VAL A 1 2   ? -0.758  15.820  42.619  1.00 126.19 ? 17  VAL P C   1 
ATOM   12    O O   . VAL A 1 2   ? -0.271  16.660  41.855  1.00 122.98 ? 17  VAL P O   1 
ATOM   13    C CB  . VAL A 1 2   ? -2.561  17.194  43.691  1.00 133.67 ? 17  VAL P CB  1 
ATOM   14    C CG1 . VAL A 1 2   ? -3.459  16.627  42.598  1.00 130.72 ? 17  VAL P CG1 1 
ATOM   15    C CG2 . VAL A 1 2   ? -3.366  17.472  44.965  1.00 130.71 ? 17  VAL P CG2 1 
ATOM   16    N N   . GLY A 1 3   ? -0.800  14.522  42.332  1.00 127.27 ? 18  GLY P N   1 
ATOM   17    C CA  . GLY A 1 3   ? -0.322  14.018  41.054  1.00 128.55 ? 18  GLY P CA  1 
ATOM   18    C C   . GLY A 1 3   ? 0.841   13.042  41.145  1.00 120.43 ? 18  GLY P C   1 
ATOM   19    O O   . GLY A 1 3   ? 1.280   12.678  42.242  1.00 113.08 ? 18  GLY P O   1 
ATOM   20    N N   . GLY A 1 4   ? 1.348   12.630  39.984  1.00 112.23 ? 19  GLY P N   1 
ATOM   21    C CA  . GLY A 1 4   ? 2.375   11.609  39.919  1.00 95.97  ? 19  GLY P CA  1 
ATOM   22    C C   . GLY A 1 4   ? 3.495   11.789  40.925  1.00 88.52  ? 19  GLY P C   1 
ATOM   23    O O   . GLY A 1 4   ? 3.784   12.925  41.350  1.00 79.14  ? 19  GLY P O   1 
ATOM   24    N N   . TRP A 1 5   ? 4.107   10.664  41.321  1.00 85.58  ? 20  TRP P N   1 
ATOM   25    C CA  . TRP A 1 5   ? 5.347   10.714  42.096  1.00 76.69  ? 20  TRP P CA  1 
ATOM   26    C C   . TRP A 1 5   ? 6.614   10.290  41.329  1.00 67.19  ? 20  TRP P C   1 
ATOM   27    O O   . TRP A 1 5   ? 6.677   9.221   40.733  1.00 63.27  ? 20  TRP P O   1 
ATOM   28    C CB  . TRP A 1 5   ? 5.254   10.063  43.481  1.00 74.67  ? 20  TRP P CB  1 
ATOM   29    C CG  . TRP A 1 5   ? 6.297   10.691  44.341  1.00 77.95  ? 20  TRP P CG  1 
ATOM   30    C CD1 . TRP A 1 5   ? 7.124   10.078  45.246  1.00 74.83  ? 20  TRP P CD1 1 
ATOM   31    C CD2 . TRP A 1 5   ? 6.687   12.078  44.316  1.00 79.18  ? 20  TRP P CD2 1 
ATOM   32    N NE1 . TRP A 1 5   ? 7.985   11.006  45.801  1.00 66.55  ? 20  TRP P NE1 1 
ATOM   33    C CE2 . TRP A 1 5   ? 7.734   12.236  45.248  1.00 73.55  ? 20  TRP P CE2 1 
ATOM   34    C CE3 . TRP A 1 5   ? 6.235   13.206  43.605  1.00 76.69  ? 20  TRP P CE3 1 
ATOM   35    C CZ2 . TRP A 1 5   ? 8.335   13.473  45.489  1.00 73.76  ? 20  TRP P CZ2 1 
ATOM   36    C CZ3 . TRP A 1 5   ? 6.837   14.430  43.841  1.00 75.58  ? 20  TRP P CZ3 1 
ATOM   37    C CH2 . TRP A 1 5   ? 7.876   14.554  44.774  1.00 73.65  ? 20  TRP P CH2 1 
ATOM   38    N N   . GLU A 1 6   ? 7.621   11.157  41.399  1.00 63.32  ? 21  GLU P N   1 
ATOM   39    C CA  . GLU A 1 6   ? 8.664   11.268  40.397  1.00 54.61  ? 21  GLU P CA  1 
ATOM   40    C C   . GLU A 1 6   ? 9.814   10.295  40.470  1.00 56.11  ? 21  GLU P C   1 
ATOM   41    O O   . GLU A 1 6   ? 9.903   9.468   41.373  1.00 59.55  ? 21  GLU P O   1 
ATOM   42    C CB  . GLU A 1 6   ? 9.280   12.642  40.490  1.00 53.36  ? 21  GLU P CB  1 
ATOM   43    C CG  . GLU A 1 6   ? 8.348   13.755  40.166  1.00 62.72  ? 21  GLU P CG  1 
ATOM   44    C CD  . GLU A 1 6   ? 9.046   15.094  40.245  1.00 66.41  ? 21  GLU P CD  1 
ATOM   45    O OE1 . GLU A 1 6   ? 10.244  15.148  39.876  1.00 60.86  ? 21  GLU P OE1 1 
ATOM   46    O OE2 . GLU A 1 6   ? 8.407   16.085  40.674  1.00 70.71  ? 21  GLU P OE2 1 
ATOM   47    N N   . CYS A 1 7   ? 10.702  10.435  39.487  1.00 51.58  ? 22  CYS P N   1 
ATOM   48    C CA  . CYS A 1 7   ? 11.985  9.756   39.445  1.00 48.01  ? 22  CYS P CA  1 
ATOM   49    C C   . CYS A 1 7   ? 13.039  10.712  39.920  1.00 49.56  ? 22  CYS P C   1 
ATOM   50    O O   . CYS A 1 7   ? 12.807  11.916  39.918  1.00 52.80  ? 22  CYS P O   1 
ATOM   51    C CB  . CYS A 1 7   ? 12.340  9.415   38.012  1.00 47.39  ? 22  CYS P CB  1 
ATOM   52    S SG  . CYS A 1 7   ? 11.363  8.119   37.336  1.00 55.63  ? 22  CYS P SG  1 
ATOM   53    N N   . GLU A 1 8   ? 14.207  10.194  40.299  1.00 46.96  ? 23  GLU P N   1 
ATOM   54    C CA  . GLU A 1 8   ? 15.361  11.072  40.543  1.00 49.69  ? 23  GLU P CA  1 
ATOM   55    C C   . GLU A 1 8   ? 15.951  11.604  39.223  1.00 49.34  ? 23  GLU P C   1 
ATOM   56    O O   . GLU A 1 8   ? 15.827  10.956  38.184  1.00 49.84  ? 23  GLU P O   1 
ATOM   57    C CB  . GLU A 1 8   ? 16.440  10.397  41.403  1.00 45.24  ? 23  GLU P CB  1 
ATOM   58    C CG  . GLU A 1 8   ? 16.725  11.113  42.730  1.00 40.60  ? 23  GLU P CG  1 
ATOM   59    C CD  . GLU A 1 8   ? 16.284  12.572  42.727  1.00 46.26  ? 23  GLU P CD  1 
ATOM   60    O OE1 . GLU A 1 8   ? 15.618  12.998  43.696  1.00 45.82  ? 23  GLU P OE1 1 
ATOM   61    O OE2 . GLU A 1 8   ? 16.588  13.298  41.755  1.00 48.43  ? 23  GLU P OE2 1 
ATOM   62    N N   . LYS A 1 9   ? 16.615  12.748  39.278  1.00 47.64  ? 24  LYS P N   1 
ATOM   63    C CA  . LYS A 1 9   ? 17.100  13.405  38.086  1.00 49.72  ? 24  LYS P CA  1 
ATOM   64    C C   . LYS A 1 9   ? 18.167  12.603  37.446  1.00 47.17  ? 24  LYS P C   1 
ATOM   65    O O   . LYS A 1 9   ? 19.185  12.353  38.014  1.00 46.52  ? 24  LYS P O   1 
ATOM   66    C CB  . LYS A 1 9   ? 17.633  14.790  38.403  1.00 56.22  ? 24  LYS P CB  1 
ATOM   67    C CG  . LYS A 1 9   ? 17.714  15.703  37.217  1.00 57.29  ? 24  LYS P CG  1 
ATOM   68    C CD  . LYS A 1 9   ? 17.855  17.148  37.611  1.00 58.85  ? 24  LYS P CD  1 
ATOM   69    C CE  . LYS A 1 9   ? 19.295  17.540  37.893  1.00 62.90  ? 24  LYS P CE  1 
ATOM   70    N NZ  . LYS A 1 9   ? 19.890  18.510  36.918  1.00 60.99  ? 24  LYS P NZ  1 
ATOM   71    N N   . HIS A 1 10  ? 17.908  12.227  36.222  1.00 48.20  ? 25  HIS P N   1 
ATOM   72    C CA  . HIS A 1 10  ? 18.791  11.381  35.416  1.00 46.45  ? 25  HIS P CA  1 
ATOM   73    C C   . HIS A 1 10  ? 19.063  10.002  35.975  1.00 43.55  ? 25  HIS P C   1 
ATOM   74    O O   . HIS A 1 10  ? 20.145  9.447   35.793  1.00 46.64  ? 25  HIS P O   1 
ATOM   75    C CB  . HIS A 1 10  ? 20.100  12.084  35.082  1.00 48.50  ? 25  HIS P CB  1 
ATOM   76    C CG  . HIS A 1 10  ? 19.904  13.411  34.438  1.00 51.19  ? 25  HIS P CG  1 
ATOM   77    N ND1 . HIS A 1 10  ? 19.222  13.561  33.254  1.00 57.99  ? 25  HIS P ND1 1 
ATOM   78    C CD2 . HIS A 1 10  ? 20.284  14.652  34.823  1.00 56.36  ? 25  HIS P CD2 1 
ATOM   79    C CE1 . HIS A 1 10  ? 19.190  14.843  32.930  1.00 65.04  ? 25  HIS P CE1 1 
ATOM   80    N NE2 . HIS A 1 10  ? 19.830  15.523  33.863  1.00 65.58  ? 25  HIS P NE2 1 
ATOM   81    N N   . SER A 1 11  ? 18.076  9.434   36.641  1.00 41.53  ? 26  SER P N   1 
ATOM   82    C CA  . SER A 1 11  ? 18.205  8.065   37.083  1.00 39.20  ? 26  SER P CA  1 
ATOM   83    C C   . SER A 1 11  ? 17.912  7.112   35.918  1.00 36.55  ? 26  SER P C   1 
ATOM   84    O O   . SER A 1 11  ? 18.234  5.926   35.990  1.00 35.17  ? 26  SER P O   1 
ATOM   85    C CB  . SER A 1 11  ? 17.284  7.812   38.275  1.00 36.22  ? 26  SER P CB  1 
ATOM   86    O OG  . SER A 1 11  ? 15.983  8.282   37.999  1.00 42.13  ? 26  SER P OG  1 
ATOM   87    N N   . GLN A 1 12  ? 17.330  7.639   34.837  1.00 35.77  ? 27  GLN P N   1 
ATOM   88    C CA  . GLN A 1 12  ? 16.905  6.794   33.712  1.00 35.73  ? 27  GLN P CA  1 
ATOM   89    C C   . GLN A 1 12  ? 17.445  7.175   32.324  1.00 34.11  ? 27  GLN P C   1 
ATOM   90    O O   . GLN A 1 12  ? 16.685  7.535   31.426  1.00 31.65  ? 27  GLN P O   1 
ATOM   91    C CB  . GLN A 1 12  ? 15.386  6.711   33.664  1.00 34.96  ? 27  GLN P CB  1 
ATOM   92    C CG  . GLN A 1 12  ? 14.745  7.036   34.958  1.00 30.68  ? 27  GLN P CG  1 
ATOM   93    C CD  . GLN A 1 12  ? 14.576  5.824   35.797  1.00 34.74  ? 27  GLN P CD  1 
ATOM   94    O OE1 . GLN A 1 12  ? 14.396  5.922   37.011  1.00 37.12  ? 27  GLN P OE1 1 
ATOM   95    N NE2 . GLN A 1 12  ? 14.626  4.653   35.165  1.00 30.19  ? 27  GLN P NE2 1 
ATOM   96    N N   . PRO A 1 13  ? 18.739  6.997   32.143  1.00 33.63  ? 28  PRO P N   1 
ATOM   97    C CA  . PRO A 1 13  ? 19.511  7.177   30.914  1.00 34.63  ? 28  PRO P CA  1 
ATOM   98    C C   . PRO A 1 13  ? 18.923  6.540   29.670  1.00 37.28  ? 28  PRO P C   1 
ATOM   99    O O   . PRO A 1 13  ? 18.929  7.232   28.652  1.00 38.27  ? 28  PRO P O   1 
ATOM   100   C CB  . PRO A 1 13  ? 20.848  6.494   31.236  1.00 35.25  ? 28  PRO P CB  1 
ATOM   101   C CG  . PRO A 1 13  ? 20.896  6.346   32.739  1.00 36.66  ? 28  PRO P CG  1 
ATOM   102   C CD  . PRO A 1 13  ? 19.603  6.834   33.322  1.00 33.56  ? 28  PRO P CD  1 
ATOM   103   N N   . TRP A 1 14  ? 18.400  5.311   29.694  1.00 30.55  ? 29  TRP P N   1 
ATOM   104   C CA  . TRP A 1 14  ? 17.815  4.702   28.515  1.00 28.33  ? 29  TRP P CA  1 
ATOM   105   C C   . TRP A 1 14  ? 16.528  5.363   28.065  1.00 33.21  ? 29  TRP P C   1 
ATOM   106   O O   . TRP A 1 14  ? 16.270  5.496   26.880  1.00 32.69  ? 29  TRP P O   1 
ATOM   107   C CB  . TRP A 1 14  ? 17.522  3.249   28.790  1.00 30.23  ? 29  TRP P CB  1 
ATOM   108   C CG  . TRP A 1 14  ? 16.998  2.947   30.167  1.00 32.54  ? 29  TRP P CG  1 
ATOM   109   C CD1 . TRP A 1 14  ? 15.695  2.771   30.524  1.00 32.56  ? 29  TRP P CD1 1 
ATOM   110   C CD2 . TRP A 1 14  ? 17.765  2.734   31.365  1.00 34.86  ? 29  TRP P CD2 1 
ATOM   111   N NE1 . TRP A 1 14  ? 15.598  2.483   31.867  1.00 34.64  ? 29  TRP P NE1 1 
ATOM   112   C CE2 . TRP A 1 14  ? 16.861  2.450   32.399  1.00 36.13  ? 29  TRP P CE2 1 
ATOM   113   C CE3 . TRP A 1 14  ? 19.124  2.770   31.666  1.00 33.34  ? 29  TRP P CE3 1 
ATOM   114   C CZ2 . TRP A 1 14  ? 17.279  2.206   33.693  1.00 32.76  ? 29  TRP P CZ2 1 
ATOM   115   C CZ3 . TRP A 1 14  ? 19.523  2.522   32.952  1.00 30.74  ? 29  TRP P CZ3 1 
ATOM   116   C CH2 . TRP A 1 14  ? 18.616  2.248   33.940  1.00 28.54  ? 29  TRP P CH2 1 
ATOM   117   N N   . GLN A 1 15  ? 15.706  5.759   29.021  1.00 35.75  ? 30  GLN P N   1 
ATOM   118   C CA  . GLN A 1 15  ? 14.376  6.258   28.738  1.00 30.58  ? 30  GLN P CA  1 
ATOM   119   C C   . GLN A 1 15  ? 14.464  7.359   27.699  1.00 32.05  ? 30  GLN P C   1 
ATOM   120   O O   . GLN A 1 15  ? 14.997  8.422   27.981  1.00 35.48  ? 30  GLN P O   1 
ATOM   121   C CB  . GLN A 1 15  ? 13.790  6.784   30.041  1.00 33.71  ? 30  GLN P CB  1 
ATOM   122   C CG  . GLN A 1 15  ? 12.348  7.235   29.965  1.00 44.71  ? 30  GLN P CG  1 
ATOM   123   C CD  . GLN A 1 15  ? 11.365  6.088   29.832  1.00 46.72  ? 30  GLN P CD  1 
ATOM   124   O OE1 . GLN A 1 15  ? 10.331  6.215   29.167  1.00 47.30  ? 30  GLN P OE1 1 
ATOM   125   N NE2 . GLN A 1 15  ? 11.686  4.956   30.459  1.00 41.14  ? 30  GLN P NE2 1 
ATOM   126   N N   . VAL A 1 16  ? 13.974  7.108   26.489  1.00 33.54  ? 31  VAL P N   1 
ATOM   127   C CA  . VAL A 1 16  ? 13.930  8.156   25.461  1.00 33.52  ? 31  VAL P CA  1 
ATOM   128   C C   . VAL A 1 16  ? 12.528  8.413   25.026  1.00 34.35  ? 31  VAL P C   1 
ATOM   129   O O   . VAL A 1 16  ? 11.609  7.743   25.477  1.00 39.59  ? 31  VAL P O   1 
ATOM   130   C CB  . VAL A 1 16  ? 14.627  7.779   24.175  1.00 33.70  ? 31  VAL P CB  1 
ATOM   131   C CG1 . VAL A 1 16  ? 15.977  7.172   24.466  1.00 34.22  ? 31  VAL P CG1 1 
ATOM   132   C CG2 . VAL A 1 16  ? 13.741  6.851   23.368  1.00 29.99  ? 31  VAL P CG2 1 
ATOM   133   N N   . LEU A 1 17  ? 12.386  9.354   24.100  1.00 35.24  ? 32  LEU P N   1 
ATOM   134   C CA  . LEU A 1 17  ? 11.085  9.842   23.648  1.00 35.09  ? 32  LEU P CA  1 
ATOM   135   C C   . LEU A 1 17  ? 11.005  9.968   22.137  1.00 37.29  ? 32  LEU P C   1 
ATOM   136   O O   . LEU A 1 17  ? 11.698  10.792  21.554  1.00 41.89  ? 32  LEU P O   1 
ATOM   137   C CB  . LEU A 1 17  ? 10.841  11.208  24.223  1.00 33.27  ? 32  LEU P CB  1 
ATOM   138   C CG  . LEU A 1 17  ? 9.617   11.865  23.672  1.00 32.64  ? 32  LEU P CG  1 
ATOM   139   C CD1 . LEU A 1 17  ? 8.456   11.288  24.409  1.00 36.84  ? 32  LEU P CD1 1 
ATOM   140   C CD2 . LEU A 1 17  ? 9.741   13.338  23.949  1.00 38.26  ? 32  LEU P CD2 1 
ATOM   141   N N   . VAL A 1 18  ? 10.162  9.150   21.514  1.00 36.85  ? 33  VAL P N   1 
ATOM   142   C CA  . VAL A 1 18  ? 9.958   9.167   20.075  1.00 35.99  ? 33  VAL P CA  1 
ATOM   143   C C   . VAL A 1 18  ? 9.004   10.290  19.778  1.00 36.47  ? 33  VAL P C   1 
ATOM   144   O O   . VAL A 1 18  ? 8.323   10.734  20.666  1.00 38.54  ? 33  VAL P O   1 
ATOM   145   C CB  . VAL A 1 18  ? 9.316   7.882   19.603  1.00 35.02  ? 33  VAL P CB  1 
ATOM   146   C CG1 . VAL A 1 18  ? 9.280   7.849   18.088  1.00 39.72  ? 33  VAL P CG1 1 
ATOM   147   C CG2 . VAL A 1 18  ? 10.066  6.696   20.156  1.00 34.96  ? 33  VAL P CG2 1 
ATOM   148   N N   . ALA A 1 19  ? 8.942   10.758  18.541  1.00 36.92  ? 34  ALA P N   1 
ATOM   149   C CA  . ALA A 1 19  ? 8.134   11.926  18.253  1.00 40.47  ? 34  ALA P CA  1 
ATOM   150   C C   . ALA A 1 19  ? 8.023   12.194  16.781  1.00 47.96  ? 34  ALA P C   1 
ATOM   151   O O   . ALA A 1 19  ? 8.964   11.989  16.025  1.00 46.56  ? 34  ALA P O   1 
ATOM   152   C CB  . ALA A 1 19  ? 8.724   13.122  18.901  1.00 40.56  ? 34  ALA P CB  1 
ATOM   153   N N   . SER A 1 20  ? 6.863   12.695  16.382  1.00 54.39  ? 35  SER P N   1 
ATOM   154   C CA  . SER A 1 20  ? 6.673   13.186  15.024  1.00 56.72  ? 35  SER P CA  1 
ATOM   155   C C   . SER A 1 20  ? 5.603   14.268  14.937  1.00 60.16  ? 35  SER P C   1 
ATOM   156   O O   . SER A 1 20  ? 4.767   14.415  15.826  1.00 60.58  ? 35  SER P O   1 
ATOM   157   C CB  . SER A 1 20  ? 6.392   12.046  14.042  1.00 55.86  ? 35  SER P CB  1 
ATOM   158   O OG  . SER A 1 20  ? 5.515   11.065  14.560  1.00 53.90  ? 35  SER P OG  1 
ATOM   159   N N   . ARG A 1 21  ? 5.646   15.027  13.852  1.00 65.52  ? 36  ARG P N   1 
ATOM   160   C CA  . ARG A 1 21  ? 4.754   16.164  13.679  1.00 70.36  ? 36  ARG P CA  1 
ATOM   161   C C   . ARG A 1 21  ? 4.708   17.022  14.928  1.00 71.68  ? 36  ARG P C   1 
ATOM   162   O O   . ARG A 1 21  ? 3.637   17.489  15.328  1.00 74.83  ? 36  ARG P O   1 
ATOM   163   C CB  . ARG A 1 21  ? 3.345   15.706  13.299  1.00 75.32  ? 36  ARG P CB  1 
ATOM   164   C CG  . ARG A 1 21  ? 3.133   15.622  11.806  1.00 73.57  ? 36  ARG P CG  1 
ATOM   165   C CD  . ARG A 1 21  ? 4.418   15.184  11.131  1.00 70.23  ? 36  ARG P CD  1 
ATOM   166   N NE  . ARG A 1 21  ? 4.237   13.953  10.374  1.00 68.12  ? 36  ARG P NE  1 
ATOM   167   C CZ  . ARG A 1 21  ? 4.206   13.898  9.049   1.00 63.35  ? 36  ARG P CZ  1 
ATOM   168   N NH1 . ARG A 1 21  ? 4.359   15.012  8.339   1.00 56.57  ? 36  ARG P NH1 1 
ATOM   169   N NH2 . ARG A 1 21  ? 4.033   12.726  8.441   1.00 66.59  ? 36  ARG P NH2 1 
ATOM   170   N N   . GLY A 1 22  ? 5.874   17.226  15.536  1.00 71.81  ? 37  GLY P N   1 
ATOM   171   C CA  . GLY A 1 22  ? 5.999   18.096  16.692  1.00 72.23  ? 37  GLY P CA  1 
ATOM   172   C C   . GLY A 1 22  ? 5.040   17.737  17.814  1.00 69.31  ? 37  GLY P C   1 
ATOM   173   O O   . GLY A 1 22  ? 4.488   18.629  18.462  1.00 71.99  ? 37  GLY P O   1 
ATOM   174   N N   . ARG A 1 23  ? 4.835   16.436  18.034  1.00 65.35  ? 38  ARG P N   1 
ATOM   175   C CA  . ARG A 1 23  ? 3.968   15.950  19.105  1.00 62.37  ? 38  ARG P CA  1 
ATOM   176   C C   . ARG A 1 23  ? 4.531   14.680  19.721  1.00 54.62  ? 38  ARG P C   1 
ATOM   177   O O   . ARG A 1 23  ? 5.194   13.883  19.060  1.00 50.35  ? 38  ARG P O   1 
ATOM   178   C CB  . ARG A 1 23  ? 2.528   15.717  18.599  1.00 67.57  ? 38  ARG P CB  1 
ATOM   179   C CG  . ARG A 1 23  ? 1.512   16.802  19.051  1.00 69.22  ? 38  ARG P CG  1 
ATOM   180   C CD  . ARG A 1 23  ? 0.846   17.556  17.888  1.00 66.09  ? 38  ARG P CD  1 
ATOM   181   N NE  . ARG A 1 23  ? 0.326   18.863  18.304  1.00 75.23  ? 38  ARG P NE  1 
ATOM   182   C CZ  . ARG A 1 23  ? 0.436   19.993  17.596  1.00 82.34  ? 38  ARG P CZ  1 
ATOM   183   N NH1 . ARG A 1 23  ? 1.054   19.992  16.410  1.00 79.79  ? 38  ARG P NH1 1 
ATOM   184   N NH2 . ARG A 1 23  ? -0.074  21.134  18.074  1.00 67.41  ? 38  ARG P NH2 1 
ATOM   185   N N   . ALA A 1 24  ? 4.270   14.502  21.005  1.00 55.67  ? 39  ALA P N   1 
ATOM   186   C CA  . ALA A 1 24  ? 4.659   13.275  21.682  1.00 56.33  ? 39  ALA P CA  1 
ATOM   187   C C   . ALA A 1 24  ? 3.980   12.086  21.028  1.00 49.87  ? 39  ALA P C   1 
ATOM   188   O O   . ALA A 1 24  ? 2.795   12.140  20.731  1.00 53.66  ? 39  ALA P O   1 
ATOM   189   C CB  . ALA A 1 24  ? 4.282   13.343  23.146  1.00 65.14  ? 39  ALA P CB  1 
ATOM   190   N N   . VAL A 1 25  ? 4.723   11.007  20.828  1.00 44.00  ? 41  VAL P N   1 
ATOM   191   C CA  . VAL A 1 25  ? 4.157   9.798   20.254  1.00 41.16  ? 41  VAL P CA  1 
ATOM   192   C C   . VAL A 1 25  ? 4.404   8.579   21.118  1.00 42.86  ? 41  VAL P C   1 
ATOM   193   O O   . VAL A 1 25  ? 3.523   7.740   21.262  1.00 45.57  ? 41  VAL P O   1 
ATOM   194   C CB  . VAL A 1 25  ? 4.678   9.546   18.837  1.00 43.03  ? 41  VAL P CB  1 
ATOM   195   C CG1 . VAL A 1 25  ? 4.759   8.061   18.520  1.00 38.63  ? 41  VAL P CG1 1 
ATOM   196   C CG2 . VAL A 1 25  ? 3.800   10.245  17.858  1.00 47.68  ? 41  VAL P CG2 1 
ATOM   197   N N   . CYS A 1 26  ? 5.581   8.476   21.717  1.00 39.18  ? 42  CYS P N   1 
ATOM   198   C CA  . CYS A 1 26  ? 5.876   7.269   22.463  1.00 47.00  ? 42  CYS P CA  1 
ATOM   199   C C   . CYS A 1 26  ? 7.156   7.386   23.241  1.00 41.14  ? 42  CYS P C   1 
ATOM   200   O O   . CYS A 1 26  ? 8.031   8.110   22.849  1.00 43.00  ? 42  CYS P O   1 
ATOM   201   C CB  . CYS A 1 26  ? 6.030   6.124   21.471  1.00 51.09  ? 42  CYS P CB  1 
ATOM   202   S SG  . CYS A 1 26  ? 4.888   4.741   21.686  1.00 66.02  ? 42  CYS P SG  1 
ATOM   203   N N   . GLY A 1 27  ? 7.281   6.644   24.327  1.00 41.74  ? 43  GLY P N   1 
ATOM   204   C CA  . GLY A 1 27  ? 8.554   6.545   25.007  1.00 39.79  ? 43  GLY P CA  1 
ATOM   205   C C   . GLY A 1 27  ? 9.168   5.215   24.659  1.00 40.88  ? 43  GLY P C   1 
ATOM   206   O O   . GLY A 1 27  ? 8.441   4.256   24.471  1.00 44.62  ? 43  GLY P O   1 
ATOM   207   N N   . GLY A 1 28  ? 10.492  5.144   24.579  1.00 37.53  ? 44  GLY P N   1 
ATOM   208   C CA  . GLY A 1 28  ? 11.154  3.940   24.101  1.00 34.06  ? 44  GLY P CA  1 
ATOM   209   C C   . GLY A 1 28  ? 12.384  3.637   24.910  1.00 31.81  ? 44  GLY P C   1 
ATOM   210   O O   . GLY A 1 28  ? 12.636  4.343   25.873  1.00 35.34  ? 44  GLY P O   1 
ATOM   211   N N   . VAL A 1 29  ? 13.144  2.609   24.536  1.00 29.08  ? 45  VAL P N   1 
ATOM   212   C CA  . VAL A 1 29  ? 14.309  2.200   25.332  1.00 30.32  ? 45  VAL P CA  1 
ATOM   213   C C   . VAL A 1 29  ? 15.582  1.993   24.500  1.00 31.84  ? 45  VAL P C   1 
ATOM   214   O O   . VAL A 1 29  ? 15.594  1.244   23.533  1.00 29.89  ? 45  VAL P O   1 
ATOM   215   C CB  . VAL A 1 29  ? 14.023  0.963   26.217  1.00 24.03  ? 45  VAL P CB  1 
ATOM   216   C CG1 . VAL A 1 29  ? 15.224  0.587   26.978  1.00 27.92  ? 45  VAL P CG1 1 
ATOM   217   C CG2 . VAL A 1 29  ? 12.971  1.276   27.180  1.00 24.84  ? 45  VAL P CG2 1 
ATOM   218   N N   . LEU A 1 30  ? 16.658  2.659   24.913  1.00 33.60  ? 46  LEU P N   1 
ATOM   219   C CA  . LEU A 1 30  ? 17.940  2.646   24.204  1.00 34.24  ? 46  LEU P CA  1 
ATOM   220   C C   . LEU A 1 30  ? 18.740  1.364   24.425  1.00 35.83  ? 46  LEU P C   1 
ATOM   221   O O   . LEU A 1 30  ? 19.363  1.208   25.464  1.00 34.49  ? 46  LEU P O   1 
ATOM   222   C CB  . LEU A 1 30  ? 18.768  3.822   24.689  1.00 30.80  ? 46  LEU P CB  1 
ATOM   223   C CG  . LEU A 1 30  ? 19.919  4.273   23.812  1.00 35.87  ? 46  LEU P CG  1 
ATOM   224   C CD1 . LEU A 1 30  ? 19.502  4.352   22.365  1.00 36.96  ? 46  LEU P CD1 1 
ATOM   225   C CD2 . LEU A 1 30  ? 20.404  5.616   24.304  1.00 35.04  ? 46  LEU P CD2 1 
ATOM   226   N N   . VAL A 1 31  ? 18.743  0.455   23.451  1.00 35.54  ? 47  VAL P N   1 
ATOM   227   C CA  . VAL A 1 31  ? 19.284  -0.884  23.688  1.00 37.67  ? 47  VAL P CA  1 
ATOM   228   C C   . VAL A 1 31  ? 20.669  -1.083  23.121  1.00 41.62  ? 47  VAL P C   1 
ATOM   229   O O   . VAL A 1 31  ? 21.210  -2.184  23.172  1.00 43.76  ? 47  VAL P O   1 
ATOM   230   C CB  . VAL A 1 31  ? 18.436  -1.963  23.026  1.00 33.02  ? 47  VAL P CB  1 
ATOM   231   C CG1 . VAL A 1 31  ? 17.084  -2.076  23.681  1.00 31.10  ? 47  VAL P CG1 1 
ATOM   232   C CG2 . VAL A 1 31  ? 18.296  -1.650  21.583  1.00 35.59  ? 47  VAL P CG2 1 
ATOM   233   N N   . HIS A 1 32  ? 21.240  -0.017  22.583  1.00 43.66  ? 48  HIS P N   1 
ATOM   234   C CA  . HIS A 1 32  ? 22.445  -0.095  21.765  1.00 42.89  ? 48  HIS P CA  1 
ATOM   235   C C   . HIS A 1 32  ? 22.642  1.348   21.269  1.00 49.74  ? 48  HIS P C   1 
ATOM   236   O O   . HIS A 1 32  ? 21.653  2.084   21.125  1.00 47.79  ? 48  HIS P O   1 
ATOM   237   C CB  . HIS A 1 32  ? 22.200  -1.058  20.618  1.00 38.16  ? 48  HIS P CB  1 
ATOM   238   C CG  . HIS A 1 32  ? 23.293  -1.093  19.605  1.00 45.09  ? 48  HIS P CG  1 
ATOM   239   N ND1 . HIS A 1 32  ? 23.540  -0.046  18.741  1.00 44.70  ? 48  HIS P ND1 1 
ATOM   240   C CD2 . HIS A 1 32  ? 24.183  -2.063  19.289  1.00 45.20  ? 48  HIS P CD2 1 
ATOM   241   C CE1 . HIS A 1 32  ? 24.548  -0.366  17.952  1.00 46.24  ? 48  HIS P CE1 1 
ATOM   242   N NE2 . HIS A 1 32  ? 24.950  -1.589  18.255  1.00 42.54  ? 48  HIS P NE2 1 
ATOM   243   N N   . PRO A 1 33  ? 23.901  1.799   21.060  1.00 48.38  ? 49  PRO P N   1 
ATOM   244   C CA  . PRO A 1 33  ? 23.895  3.249   20.861  1.00 42.06  ? 49  PRO P CA  1 
ATOM   245   C C   . PRO A 1 33  ? 23.099  3.688   19.629  1.00 49.93  ? 49  PRO P C   1 
ATOM   246   O O   . PRO A 1 33  ? 22.704  4.856   19.577  1.00 52.56  ? 49  PRO P O   1 
ATOM   247   C CB  . PRO A 1 33  ? 25.379  3.590   20.758  1.00 36.07  ? 49  PRO P CB  1 
ATOM   248   C CG  . PRO A 1 33  ? 26.042  2.544   21.578  1.00 35.32  ? 49  PRO P CG  1 
ATOM   249   C CD  . PRO A 1 33  ? 25.267  1.286   21.281  1.00 41.14  ? 49  PRO P CD  1 
ATOM   250   N N   . GLN A 1 34  ? 22.826  2.781   18.687  1.00 44.20  ? 50  GLN P N   1 
ATOM   251   C CA  . GLN A 1 34  ? 22.126  3.179   17.468  1.00 45.44  ? 50  GLN P CA  1 
ATOM   252   C C   . GLN A 1 34  ? 20.655  2.698   17.314  1.00 48.89  ? 50  GLN P C   1 
ATOM   253   O O   . GLN A 1 34  ? 19.973  3.042   16.336  1.00 46.05  ? 50  GLN P O   1 
ATOM   254   C CB  . GLN A 1 34  ? 22.951  2.769   16.255  1.00 48.83  ? 50  GLN P CB  1 
ATOM   255   C CG  . GLN A 1 34  ? 22.356  3.231   14.933  1.00 54.41  ? 50  GLN P CG  1 
ATOM   256   C CD  . GLN A 1 34  ? 23.379  3.861   14.027  1.00 51.59  ? 50  GLN P CD  1 
ATOM   257   O OE1 . GLN A 1 34  ? 23.246  5.022   13.625  1.00 47.47  ? 50  GLN P OE1 1 
ATOM   258   N NE2 . GLN A 1 34  ? 24.429  3.106   13.720  1.00 54.97  ? 50  GLN P NE2 1 
ATOM   259   N N   . TRP A 1 35  ? 20.158  1.937   18.288  1.00 47.55  ? 51  TRP P N   1 
ATOM   260   C CA  . TRP A 1 35  ? 18.843  1.308   18.188  1.00 38.90  ? 51  TRP P CA  1 
ATOM   261   C C   . TRP A 1 35  ? 17.954  1.593   19.367  1.00 41.55  ? 51  TRP P C   1 
ATOM   262   O O   . TRP A 1 35  ? 18.408  1.509   20.505  1.00 44.28  ? 51  TRP P O   1 
ATOM   263   C CB  . TRP A 1 35  ? 19.040  -0.177  18.168  1.00 37.90  ? 51  TRP P CB  1 
ATOM   264   C CG  . TRP A 1 35  ? 19.673  -0.636  16.952  1.00 45.07  ? 51  TRP P CG  1 
ATOM   265   C CD1 . TRP A 1 35  ? 20.987  -0.888  16.748  1.00 45.87  ? 51  TRP P CD1 1 
ATOM   266   C CD2 . TRP A 1 35  ? 19.013  -0.913  15.734  1.00 44.61  ? 51  TRP P CD2 1 
ATOM   267   N NE1 . TRP A 1 35  ? 21.185  -1.315  15.460  1.00 48.11  ? 51  TRP P NE1 1 
ATOM   268   C CE2 . TRP A 1 35  ? 19.979  -1.334  14.822  1.00 42.46  ? 51  TRP P CE2 1 
ATOM   269   C CE3 . TRP A 1 35  ? 17.690  -0.847  15.329  1.00 40.97  ? 51  TRP P CE3 1 
ATOM   270   C CZ2 . TRP A 1 35  ? 19.671  -1.683  13.554  1.00 44.48  ? 51  TRP P CZ2 1 
ATOM   271   C CZ3 . TRP A 1 35  ? 17.389  -1.195  14.078  1.00 42.19  ? 51  TRP P CZ3 1 
ATOM   272   C CH2 . TRP A 1 35  ? 18.368  -1.608  13.195  1.00 47.95  ? 51  TRP P CH2 1 
ATOM   273   N N   . VAL A 1 36  ? 16.682  1.880   19.112  1.00 35.65  ? 52  VAL P N   1 
ATOM   274   C CA  . VAL A 1 36  ? 15.743  2.056   20.198  1.00 30.90  ? 52  VAL P CA  1 
ATOM   275   C C   . VAL A 1 36  ? 14.687  0.988   20.089  1.00 32.19  ? 52  VAL P C   1 
ATOM   276   O O   . VAL A 1 36  ? 14.439  0.511   19.012  1.00 34.74  ? 52  VAL P O   1 
ATOM   277   C CB  . VAL A 1 36  ? 15.067  3.393   20.128  1.00 31.77  ? 52  VAL P CB  1 
ATOM   278   C CG1 . VAL A 1 36  ? 13.840  3.377   20.977  1.00 32.10  ? 52  VAL P CG1 1 
ATOM   279   C CG2 . VAL A 1 36  ? 16.000  4.467   20.596  1.00 35.14  ? 52  VAL P CG2 1 
ATOM   280   N N   . LEU A 1 37  ? 14.078  0.615   21.216  1.00 36.27  ? 53  LEU P N   1 
ATOM   281   C CA  . LEU A 1 37  ? 12.980  -0.361  21.314  1.00 30.10  ? 53  LEU P CA  1 
ATOM   282   C C   . LEU A 1 37  ? 11.724  0.367   21.749  1.00 31.10  ? 53  LEU P C   1 
ATOM   283   O O   . LEU A 1 37  ? 11.789  1.165   22.680  1.00 31.26  ? 53  LEU P O   1 
ATOM   284   C CB  . LEU A 1 37  ? 13.309  -1.365  22.408  1.00 27.24  ? 53  LEU P CB  1 
ATOM   285   C CG  . LEU A 1 37  ? 12.740  -2.762  22.301  1.00 28.88  ? 53  LEU P CG  1 
ATOM   286   C CD1 . LEU A 1 37  ? 13.094  -3.267  20.944  1.00 33.67  ? 53  LEU P CD1 1 
ATOM   287   C CD2 . LEU A 1 37  ? 13.315  -3.682  23.359  1.00 28.39  ? 53  LEU P CD2 1 
ATOM   288   N N   . THR A 1 38  ? 10.594  0.133   21.081  1.00 32.63  ? 54  THR P N   1 
ATOM   289   C CA  . THR A 1 38  ? 9.290   0.558   21.612  1.00 31.58  ? 54  THR P CA  1 
ATOM   290   C C   . THR A 1 38  ? 8.292   -0.474  21.252  1.00 31.78  ? 54  THR P C   1 
ATOM   291   O O   . THR A 1 38  ? 8.645   -1.612  21.002  1.00 33.09  ? 54  THR P O   1 
ATOM   292   C CB  . THR A 1 38  ? 8.748   1.836   20.990  1.00 36.92  ? 54  THR P CB  1 
ATOM   293   O OG1 . THR A 1 38  ? 9.571   2.240   19.886  1.00 39.17  ? 54  THR P OG1 1 
ATOM   294   C CG2 . THR A 1 38  ? 8.692   2.927   22.025  1.00 37.23  ? 54  THR P CG2 1 
ATOM   295   N N   . ALA A 1 39  ? 7.030   -0.075  21.204  1.00 38.72  ? 55  ALA P N   1 
ATOM   296   C CA  . ALA A 1 39  ? 5.976   -0.976  20.753  1.00 39.74  ? 55  ALA P CA  1 
ATOM   297   C C   . ALA A 1 39  ? 5.717   -0.696  19.275  1.00 40.74  ? 55  ALA P C   1 
ATOM   298   O O   . ALA A 1 39  ? 6.090   0.363   18.786  1.00 38.16  ? 55  ALA P O   1 
ATOM   299   C CB  . ALA A 1 39  ? 4.743   -0.776  21.571  1.00 37.33  ? 55  ALA P CB  1 
ATOM   300   N N   . ALA A 1 40  ? 5.114   -1.643  18.559  1.00 39.80  ? 56  ALA P N   1 
ATOM   301   C CA  . ALA A 1 40  ? 4.932   -1.471  17.124  1.00 38.53  ? 56  ALA P CA  1 
ATOM   302   C C   . ALA A 1 40  ? 3.856   -0.444  16.851  1.00 45.19  ? 56  ALA P C   1 
ATOM   303   O O   . ALA A 1 40  ? 3.988   0.345   15.933  1.00 48.74  ? 56  ALA P O   1 
ATOM   304   C CB  . ALA A 1 40  ? 4.602   -2.774  16.447  1.00 37.46  ? 56  ALA P CB  1 
ATOM   305   N N   . HIS A 1 41  ? 2.797   -0.422  17.652  1.00 43.90  ? 57  HIS P N   1 
ATOM   306   C CA  . HIS A 1 41  ? 1.744   0.568   17.437  1.00 44.84  ? 57  HIS P CA  1 
ATOM   307   C C   . HIS A 1 41  ? 2.214   2.035   17.581  1.00 49.51  ? 57  HIS P C   1 
ATOM   308   O O   . HIS A 1 41  ? 1.407   2.964   17.562  1.00 56.32  ? 57  HIS P O   1 
ATOM   309   C CB  . HIS A 1 41  ? 0.547   0.294   18.351  1.00 48.12  ? 57  HIS P CB  1 
ATOM   310   C CG  . HIS A 1 41  ? 0.816   0.561   19.800  1.00 52.58  ? 57  HIS P CG  1 
ATOM   311   N ND1 . HIS A 1 41  ? 1.236   -0.417  20.672  1.00 49.68  ? 57  HIS P ND1 1 
ATOM   312   C CD2 . HIS A 1 41  ? 0.721   1.700   20.527  1.00 55.62  ? 57  HIS P CD2 1 
ATOM   313   C CE1 . HIS A 1 41  ? 1.383   0.105   21.878  1.00 49.77  ? 57  HIS P CE1 1 
ATOM   314   N NE2 . HIS A 1 41  ? 1.088   1.390   21.813  1.00 51.72  ? 57  HIS P NE2 1 
ATOM   315   N N   . CYS A 1 42  ? 3.512   2.263   17.726  1.00 49.97  ? 58  CYS P N   1 
ATOM   316   C CA  . CYS A 1 42  ? 3.991   3.633   17.867  1.00 49.90  ? 58  CYS P CA  1 
ATOM   317   C C   . CYS A 1 42  ? 4.614   4.122   16.553  1.00 50.03  ? 58  CYS P C   1 
ATOM   318   O O   . CYS A 1 42  ? 5.343   5.107   16.544  1.00 56.51  ? 58  CYS P O   1 
ATOM   319   C CB  . CYS A 1 42  ? 5.014   3.759   19.015  1.00 54.12  ? 58  CYS P CB  1 
ATOM   320   S SG  . CYS A 1 42  ? 4.612   2.990   20.649  1.00 65.91  ? 58  CYS P SG  1 
ATOM   321   N N   . ILE A 1 43  ? 4.295   3.457   15.446  1.00 47.30  ? 59  ILE P N   1 
ATOM   322   C CA  . ILE A 1 43  ? 5.074   3.560   14.207  1.00 47.57  ? 59  ILE P CA  1 
ATOM   323   C C   . ILE A 1 43  ? 4.597   4.629   13.210  1.00 44.66  ? 59  ILE P C   1 
ATOM   324   O O   . ILE A 1 43  ? 3.460   4.649   12.810  1.00 44.14  ? 59  ILE P O   1 
ATOM   325   C CB  . ILE A 1 43  ? 5.185   2.159   13.564  1.00 42.31  ? 59  ILE P CB  1 
ATOM   326   C CG1 . ILE A 1 43  ? 5.586   2.205   12.110  1.00 43.19  ? 59  ILE P CG1 1 
ATOM   327   C CG2 . ILE A 1 43  ? 3.875   1.473   13.582  1.00 46.27  ? 59  ILE P CG2 1 
ATOM   328   C CD1 . ILE A 1 43  ? 5.668   0.804   11.537  1.00 42.81  ? 59  ILE P CD1 1 
ATOM   329   N N   . ARG A 1 44  ? 5.497   5.504   12.788  1.00 48.83  ? 60  ARG P N   1 
ATOM   330   C CA  . ARG A 1 44  ? 5.126   6.557   11.857  1.00 52.18  ? 60  ARG P CA  1 
ATOM   331   C C   . ARG A 1 44  ? 6.128   6.688   10.734  1.00 54.94  ? 60  ARG P C   1 
ATOM   332   O O   . ARG A 1 44  ? 7.255   6.241   10.860  1.00 51.56  ? 60  ARG P O   1 
ATOM   333   C CB  . ARG A 1 44  ? 4.999   7.889   12.577  1.00 55.06  ? 60  ARG P CB  1 
ATOM   334   C CG  . ARG A 1 44  ? 4.376   7.790   13.933  1.00 43.60  ? 60  ARG P CG  1 
ATOM   335   C CD  . ARG A 1 44  ? 2.879   7.896   13.849  1.00 50.03  ? 60  ARG P CD  1 
ATOM   336   N NE  . ARG A 1 44  ? 2.241   7.060   14.850  1.00 54.51  ? 60  ARG P NE  1 
ATOM   337   C CZ  . ARG A 1 44  ? 1.426   7.517   15.787  1.00 54.28  ? 60  ARG P CZ  1 
ATOM   338   N NH1 . ARG A 1 44  ? 0.893   6.685   16.665  1.00 53.35  ? 60  ARG P NH1 1 
ATOM   339   N NH2 . ARG A 1 44  ? 1.148   8.805   15.844  1.00 47.08  ? 60  ARG P NH2 1 
ATOM   340   N N   . ASN A 1 45  ? 5.704   7.275   9.623   1.00 55.56  ? 61  ASN P N   1 
ATOM   341   C CA  . ASN A 1 45  ? 6.604   7.519   8.512   1.00 59.98  ? 61  ASN P CA  1 
ATOM   342   C C   . ASN A 1 45  ? 7.708   8.478   8.888   1.00 63.49  ? 61  ASN P C   1 
ATOM   343   O O   . ASN A 1 45  ? 8.860   8.283   8.515   1.00 64.66  ? 61  ASN P O   1 
ATOM   344   C CB  . ASN A 1 45  ? 5.856   8.112   7.331   1.00 63.29  ? 61  ASN P CB  1 
ATOM   345   C CG  . ASN A 1 45  ? 4.728   7.252   6.867   1.00 66.04  ? 61  ASN P CG  1 
ATOM   346   O OD1 . ASN A 1 45  ? 4.833   6.033   6.813   1.00 61.24  ? 61  ASN P OD1 1 
ATOM   347   N ND2 . ASN A 1 45  ? 3.636   7.886   6.509   1.00 71.28  ? 61  ASN P ND2 1 
ATOM   348   N N   . LYS A 1 46  ? 7.352   9.534   9.610   1.00 56.57  ? 62  LYS P N   1 
ATOM   349   C CA  . LYS A 1 46  ? 8.345   10.502  10.041  1.00 55.40  ? 62  LYS P CA  1 
ATOM   350   C C   . LYS A 1 46  ? 8.317   10.762  11.532  1.00 56.55  ? 62  LYS P C   1 
ATOM   351   O O   . LYS A 1 46  ? 7.328   11.249  12.061  1.00 55.09  ? 62  LYS P O   1 
ATOM   352   C CB  . LYS A 1 46  ? 8.136   11.819  9.306   1.00 56.71  ? 62  LYS P CB  1 
ATOM   353   C CG  . LYS A 1 46  ? 9.169   12.873  9.620   1.00 51.98  ? 62  LYS P CG  1 
ATOM   354   C CD  . LYS A 1 46  ? 9.173   13.959  8.573   1.00 46.41  ? 62  LYS P CD  1 
ATOM   355   C CE  . LYS A 1 46  ? 8.199   15.045  8.930   1.00 48.66  ? 62  LYS P CE  1 
ATOM   356   N NZ  . LYS A 1 46  ? 8.412   16.247  8.107   1.00 54.89  ? 62  LYS P NZ  1 
ATOM   357   N N   . SER A 1 47  ? 9.435   10.496  12.192  1.00 53.29  ? 63  SER P N   1 
ATOM   358   C CA  . SER A 1 47  ? 9.610   10.835  13.591  1.00 47.68  ? 63  SER P CA  1 
ATOM   359   C C   . SER A 1 47  ? 11.088  10.978  13.886  1.00 45.64  ? 63  SER P C   1 
ATOM   360   O O   . SER A 1 47  ? 11.912  10.667  13.042  1.00 45.62  ? 63  SER P O   1 
ATOM   361   C CB  . SER A 1 47  ? 9.016   9.743   14.467  1.00 49.89  ? 63  SER P CB  1 
ATOM   362   O OG  . SER A 1 47  ? 9.367   8.464   13.973  1.00 55.78  ? 63  SER P OG  1 
ATOM   363   N N   . VAL A 1 48  ? 11.408  11.444  15.092  1.00 47.67  ? 64  VAL P N   1 
ATOM   364   C CA  . VAL A 1 48  ? 12.786  11.579  15.575  1.00 43.63  ? 64  VAL P CA  1 
ATOM   365   C C   . VAL A 1 48  ? 12.868  11.108  17.019  1.00 41.63  ? 64  VAL P C   1 
ATOM   366   O O   . VAL A 1 48  ? 11.854  10.939  17.679  1.00 40.02  ? 64  VAL P O   1 
ATOM   367   C CB  . VAL A 1 48  ? 13.256  13.034  15.549  1.00 41.80  ? 64  VAL P CB  1 
ATOM   368   C CG1 . VAL A 1 48  ? 13.508  13.480  14.127  1.00 45.36  ? 64  VAL P CG1 1 
ATOM   369   C CG2 . VAL A 1 48  ? 12.236  13.923  16.208  1.00 36.09  ? 64  VAL P CG2 1 
ATOM   370   N N   . ILE A 1 49  ? 14.079  10.890  17.508  1.00 43.70  ? 65  ILE P N   1 
ATOM   371   C CA  . ILE A 1 49  ? 14.275  10.402  18.871  1.00 42.32  ? 65  ILE P CA  1 
ATOM   372   C C   . ILE A 1 49  ? 14.856  11.509  19.758  1.00 46.64  ? 65  ILE P C   1 
ATOM   373   O O   . ILE A 1 49  ? 15.805  12.178  19.358  1.00 49.37  ? 65  ILE P O   1 
ATOM   374   C CB  . ILE A 1 49  ? 15.219  9.192   18.879  1.00 39.52  ? 65  ILE P CB  1 
ATOM   375   C CG1 . ILE A 1 49  ? 14.479  7.915   18.469  1.00 42.51  ? 65  ILE P CG1 1 
ATOM   376   C CG2 . ILE A 1 49  ? 15.734  8.967   20.245  1.00 40.39  ? 65  ILE P CG2 1 
ATOM   377   C CD1 . ILE A 1 49  ? 13.066  8.125   17.898  1.00 39.23  ? 65  ILE P CD1 1 
ATOM   378   N N   . LEU A 1 50  ? 14.291  11.732  20.943  1.00 41.62  ? 66  LEU P N   1 
ATOM   379   C CA  . LEU A 1 50  ? 14.845  12.749  21.846  1.00 42.99  ? 66  LEU P CA  1 
ATOM   380   C C   . LEU A 1 50  ? 15.519  12.045  22.986  1.00 43.07  ? 66  LEU P C   1 
ATOM   381   O O   . LEU A 1 50  ? 14.834  11.306  23.676  1.00 43.18  ? 66  LEU P O   1 
ATOM   382   C CB  . LEU A 1 50  ? 13.731  13.615  22.418  1.00 44.32  ? 66  LEU P CB  1 
ATOM   383   C CG  . LEU A 1 50  ? 13.213  14.708  21.485  1.00 51.68  ? 66  LEU P CG  1 
ATOM   384   C CD1 . LEU A 1 50  ? 13.074  14.153  20.075  1.00 51.45  ? 66  LEU P CD1 1 
ATOM   385   C CD2 . LEU A 1 50  ? 11.896  15.317  21.979  1.00 47.91  ? 66  LEU P CD2 1 
ATOM   386   N N   . LEU A 1 51  ? 16.830  12.230  23.191  1.00 42.58  ? 67  LEU P N   1 
ATOM   387   C CA  . LEU A 1 51  ? 17.522  11.500  24.284  1.00 49.56  ? 67  LEU P CA  1 
ATOM   388   C C   . LEU A 1 51  ? 18.023  12.388  25.425  1.00 55.68  ? 67  LEU P C   1 
ATOM   389   O O   . LEU A 1 51  ? 18.040  13.606  25.289  1.00 58.89  ? 67  LEU P O   1 
ATOM   390   C CB  . LEU A 1 51  ? 18.667  10.602  23.789  1.00 41.98  ? 67  LEU P CB  1 
ATOM   391   C CG  . LEU A 1 51  ? 18.355  9.508   22.772  1.00 41.05  ? 67  LEU P CG  1 
ATOM   392   C CD1 . LEU A 1 51  ? 18.468  10.089  21.384  1.00 46.45  ? 67  LEU P CD1 1 
ATOM   393   C CD2 . LEU A 1 51  ? 19.300  8.341   22.885  1.00 37.96  ? 67  LEU P CD2 1 
ATOM   394   N N   . GLY A 1 52  ? 18.415  11.776  26.546  1.00 55.38  ? 68  GLY P N   1 
ATOM   395   C CA  . GLY A 1 52  ? 19.022  12.504  27.656  1.00 56.40  ? 68  GLY P CA  1 
ATOM   396   C C   . GLY A 1 52  ? 18.152  13.489  28.426  1.00 61.75  ? 68  GLY P C   1 
ATOM   397   O O   . GLY A 1 52  ? 18.670  14.221  29.278  1.00 59.27  ? 68  GLY P O   1 
ATOM   398   N N   . ARG A 1 53  ? 16.845  13.507  28.131  1.00 63.50  ? 69  ARG P N   1 
ATOM   399   C CA  . ARG A 1 53  ? 15.872  14.372  28.829  1.00 63.08  ? 69  ARG P CA  1 
ATOM   400   C C   . ARG A 1 53  ? 15.224  13.759  30.091  1.00 64.61  ? 69  ARG P C   1 
ATOM   401   O O   . ARG A 1 53  ? 15.070  12.535  30.227  1.00 61.28  ? 69  ARG P O   1 
ATOM   402   C CB  . ARG A 1 53  ? 14.754  14.835  27.885  1.00 62.00  ? 69  ARG P CB  1 
ATOM   403   C CG  . ARG A 1 53  ? 15.138  15.888  26.828  1.00 65.97  ? 69  ARG P CG  1 
ATOM   404   C CD  . ARG A 1 53  ? 15.884  17.128  27.359  1.00 66.84  ? 69  ARG P CD  1 
ATOM   405   N NE  . ARG A 1 53  ? 15.089  18.009  28.216  1.00 71.91  ? 69  ARG P NE  1 
ATOM   406   C CZ  . ARG A 1 53  ? 14.249  18.933  27.769  1.00 69.44  ? 69  ARG P CZ  1 
ATOM   407   N NH1 . ARG A 1 53  ? 14.072  19.079  26.468  1.00 69.02  ? 69  ARG P NH1 1 
ATOM   408   N NH2 . ARG A 1 53  ? 13.581  19.696  28.623  1.00 71.76  ? 69  ARG P NH2 1 
ATOM   409   N N   . HIS A 1 54  ? 14.833  14.636  31.008  1.00 61.87  ? 70  HIS P N   1 
ATOM   410   C CA  . HIS A 1 54  ? 14.196  14.209  32.242  1.00 61.71  ? 70  HIS P CA  1 
ATOM   411   C C   . HIS A 1 54  ? 12.952  15.042  32.580  1.00 64.34  ? 70  HIS P C   1 
ATOM   412   O O   . HIS A 1 54  ? 12.006  14.537  33.185  1.00 63.15  ? 70  HIS P O   1 
ATOM   413   C CB  . HIS A 1 54  ? 15.197  14.213  33.392  1.00 61.10  ? 70  HIS P CB  1 
ATOM   414   C CG  . HIS A 1 54  ? 14.554  14.184  34.741  1.00 60.90  ? 70  HIS P CG  1 
ATOM   415   N ND1 . HIS A 1 54  ? 14.174  13.013  35.359  1.00 59.35  ? 70  HIS P ND1 1 
ATOM   416   C CD2 . HIS A 1 54  ? 14.217  15.186  35.587  1.00 61.29  ? 70  HIS P CD2 1 
ATOM   417   C CE1 . HIS A 1 54  ? 13.633  13.295  36.531  1.00 59.51  ? 70  HIS P CE1 1 
ATOM   418   N NE2 . HIS A 1 54  ? 13.644  14.606  36.692  1.00 58.68  ? 70  HIS P NE2 1 
ATOM   419   N N   . SER A 1 55  ? 12.953  16.315  32.194  1.00 65.08  ? 71  SER P N   1 
ATOM   420   C CA  . SER A 1 55  ? 11.719  17.097  32.182  1.00 69.99  ? 71  SER P CA  1 
ATOM   421   C C   . SER A 1 55  ? 11.526  17.763  30.810  1.00 75.87  ? 71  SER P C   1 
ATOM   422   O O   . SER A 1 55  ? 12.472  17.851  30.015  1.00 72.90  ? 71  SER P O   1 
ATOM   423   C CB  . SER A 1 55  ? 11.689  18.116  33.317  1.00 70.79  ? 71  SER P CB  1 
ATOM   424   O OG  . SER A 1 55  ? 12.637  19.138  33.111  1.00 80.17  ? 71  SER P OG  1 
ATOM   425   N N   . LEU A 1 56  ? 10.304  18.212  30.520  1.00 77.68  ? 72  LEU P N   1 
ATOM   426   C CA  . LEU A 1 56  ? 9.965   18.631  29.156  1.00 76.99  ? 72  LEU P CA  1 
ATOM   427   C C   . LEU A 1 56  ? 9.664   20.110  29.013  1.00 82.70  ? 72  LEU P C   1 
ATOM   428   O O   . LEU A 1 56  ? 9.270   20.585  27.949  1.00 85.26  ? 72  LEU P O   1 
ATOM   429   C CB  . LEU A 1 56  ? 8.819   17.797  28.605  1.00 76.70  ? 72  LEU P CB  1 
ATOM   430   C CG  . LEU A 1 56  ? 9.238   16.332  28.531  1.00 71.44  ? 72  LEU P CG  1 
ATOM   431   C CD1 . LEU A 1 56  ? 10.702  16.179  28.085  1.00 64.63  ? 72  LEU P CD1 1 
ATOM   432   C CD2 . LEU A 1 56  ? 9.031   15.733  29.889  1.00 71.00  ? 72  LEU P CD2 1 
ATOM   433   N N   . PHE A 1 57  ? 9.877   20.830  30.100  1.00 88.66  ? 73  PHE P N   1 
ATOM   434   C CA  . PHE A 1 57  ? 9.819   22.274  30.106  1.00 90.10  ? 73  PHE P CA  1 
ATOM   435   C C   . PHE A 1 57  ? 10.985  22.665  31.009  1.00 90.60  ? 73  PHE P C   1 
ATOM   436   O O   . PHE A 1 57  ? 11.726  21.795  31.479  1.00 88.09  ? 73  PHE P O   1 
ATOM   437   C CB  . PHE A 1 57  ? 8.446   22.729  30.628  1.00 93.98  ? 73  PHE P CB  1 
ATOM   438   C CG  . PHE A 1 57  ? 7.290   21.928  30.051  1.00 99.25  ? 73  PHE P CG  1 
ATOM   439   C CD1 . PHE A 1 57  ? 6.669   20.942  30.799  1.00 100.92 ? 73  PHE P CD1 1 
ATOM   440   C CD2 . PHE A 1 57  ? 6.859   22.129  28.742  1.00 101.67 ? 73  PHE P CD2 1 
ATOM   441   C CE1 . PHE A 1 57  ? 5.619   20.185  30.262  1.00 101.04 ? 73  PHE P CE1 1 
ATOM   442   C CE2 . PHE A 1 57  ? 5.812   21.374  28.200  1.00 95.89  ? 73  PHE P CE2 1 
ATOM   443   C CZ  . PHE A 1 57  ? 5.193   20.404  28.965  1.00 96.47  ? 73  PHE P CZ  1 
ATOM   444   N N   . HIS A 1 58  ? 11.183  23.945  31.266  1.00 91.65  ? 75  HIS P N   1 
ATOM   445   C CA  . HIS A 1 58  ? 12.347  24.288  32.063  1.00 94.71  ? 75  HIS P CA  1 
ATOM   446   C C   . HIS A 1 58  ? 13.538  23.506  31.493  1.00 94.40  ? 75  HIS P C   1 
ATOM   447   O O   . HIS A 1 58  ? 14.259  22.839  32.245  1.00 89.83  ? 75  HIS P O   1 
ATOM   448   C CB  . HIS A 1 58  ? 12.122  23.870  33.527  1.00 87.84  ? 75  HIS P CB  1 
ATOM   449   C CG  . HIS A 1 58  ? 10.841  24.395  34.116  1.00 95.38  ? 75  HIS P CG  1 
ATOM   450   N ND1 . HIS A 1 58  ? 10.643  24.502  35.477  1.00 89.96  ? 75  HIS P ND1 1 
ATOM   451   C CD2 . HIS A 1 58  ? 9.710   24.844  33.532  1.00 99.13  ? 75  HIS P CD2 1 
ATOM   452   C CE1 . HIS A 1 58  ? 9.430   24.998  35.705  1.00 95.39  ? 75  HIS P CE1 1 
ATOM   453   N NE2 . HIS A 1 58  ? 8.847   25.212  34.532  1.00 101.61 ? 75  HIS P NE2 1 
ATOM   454   N N   . PRO A 1 59  ? 13.727  23.579  30.159  1.00 93.56  ? 76  PRO P N   1 
ATOM   455   C CA  . PRO A 1 59  ? 14.639  22.749  29.359  1.00 85.24  ? 76  PRO P CA  1 
ATOM   456   C C   . PRO A 1 59  ? 16.038  22.546  29.949  1.00 84.02  ? 76  PRO P C   1 
ATOM   457   O O   . PRO A 1 59  ? 16.404  23.194  30.933  1.00 81.50  ? 76  PRO P O   1 
ATOM   458   C CB  . PRO A 1 59  ? 14.721  23.514  28.046  1.00 78.33  ? 76  PRO P CB  1 
ATOM   459   C CG  . PRO A 1 59  ? 13.401  24.173  27.940  1.00 78.67  ? 76  PRO P CG  1 
ATOM   460   C CD  . PRO A 1 59  ? 13.053  24.591  29.325  1.00 87.41  ? 76  PRO P CD  1 
ATOM   461   N N   . GLU A 1 60  ? 16.803  21.639  29.341  1.00 83.56  ? 77  GLU P N   1 
ATOM   462   C CA  . GLU A 1 60  ? 18.136  21.291  29.835  1.00 84.30  ? 77  GLU P CA  1 
ATOM   463   C C   . GLU A 1 60  ? 19.131  20.885  28.752  1.00 80.18  ? 77  GLU P C   1 
ATOM   464   O O   . GLU A 1 60  ? 18.772  20.310  27.725  1.00 76.61  ? 77  GLU P O   1 
ATOM   465   C CB  . GLU A 1 60  ? 18.073  20.188  30.895  1.00 88.36  ? 77  GLU P CB  1 
ATOM   466   C CG  . GLU A 1 60  ? 16.898  20.298  31.853  1.00 92.18  ? 77  GLU P CG  1 
ATOM   467   C CD  . GLU A 1 60  ? 16.246  18.952  32.126  1.00 92.66  ? 77  GLU P CD  1 
ATOM   468   O OE1 . GLU A 1 60  ? 16.771  17.918  31.637  1.00 82.78  ? 77  GLU P OE1 1 
ATOM   469   O OE2 . GLU A 1 60  ? 15.214  18.936  32.838  1.00 93.60  ? 77  GLU P OE2 1 
ATOM   470   N N   . ASP A 1 61  ? 20.398  21.151  29.051  1.00 84.39  ? 78  ASP P N   1 
ATOM   471   C CA  . ASP A 1 61  ? 21.499  21.098  28.098  1.00 84.17  ? 78  ASP P CA  1 
ATOM   472   C C   . ASP A 1 61  ? 21.948  19.702  27.696  1.00 79.03  ? 78  ASP P C   1 
ATOM   473   O O   . ASP A 1 61  ? 22.612  19.542  26.664  1.00 78.33  ? 78  ASP P O   1 
ATOM   474   C CB  . ASP A 1 61  ? 22.708  21.814  28.695  1.00 92.66  ? 78  ASP P CB  1 
ATOM   475   C CG  . ASP A 1 61  ? 23.429  20.968  29.743  1.00 99.96  ? 78  ASP P CG  1 
ATOM   476   O OD1 . ASP A 1 61  ? 22.745  20.325  30.594  1.00 90.58  ? 78  ASP P OD1 1 
ATOM   477   O OD2 . ASP A 1 61  ? 24.687  20.951  29.708  1.00 102.84 ? 78  ASP P OD2 1 
ATOM   478   N N   . THR A 1 62  ? 21.621  18.707  28.520  1.00 77.78  ? 79  THR P N   1 
ATOM   479   C CA  . THR A 1 62  ? 22.102  17.340  28.295  1.00 76.20  ? 79  THR P CA  1 
ATOM   480   C C   . THR A 1 62  ? 21.328  16.621  27.177  1.00 68.31  ? 79  THR P C   1 
ATOM   481   O O   . THR A 1 62  ? 21.653  15.491  26.800  1.00 61.40  ? 79  THR P O   1 
ATOM   482   C CB  . THR A 1 62  ? 22.093  16.499  29.603  1.00 75.72  ? 79  THR P CB  1 
ATOM   483   O OG1 . THR A 1 62  ? 20.745  16.201  29.985  1.00 72.63  ? 79  THR P OG1 1 
ATOM   484   C CG2 . THR A 1 62  ? 22.772  17.256  30.737  1.00 81.97  ? 79  THR P CG2 1 
ATOM   485   N N   . GLY A 1 63  ? 20.318  17.299  26.640  1.00 67.43  ? 80  GLY P N   1 
ATOM   486   C CA  . GLY A 1 63  ? 19.524  16.754  25.562  1.00 59.11  ? 80  GLY P CA  1 
ATOM   487   C C   . GLY A 1 63  ? 20.218  16.757  24.212  1.00 57.76  ? 80  GLY P C   1 
ATOM   488   O O   . GLY A 1 63  ? 21.073  17.598  23.922  1.00 57.25  ? 80  GLY P O   1 
ATOM   489   N N   . GLN A 1 64  ? 19.827  15.801  23.380  1.00 56.44  ? 81  GLN P N   1 
ATOM   490   C CA  . GLN A 1 64  ? 20.317  15.695  22.017  1.00 55.01  ? 81  GLN P CA  1 
ATOM   491   C C   . GLN A 1 64  ? 19.272  15.000  21.129  1.00 53.00  ? 81  GLN P C   1 
ATOM   492   O O   . GLN A 1 64  ? 18.428  14.234  21.636  1.00 47.93  ? 81  GLN P O   1 
ATOM   493   C CB  . GLN A 1 64  ? 21.635  14.934  22.007  1.00 48.26  ? 81  GLN P CB  1 
ATOM   494   C CG  . GLN A 1 64  ? 21.682  13.865  23.031  1.00 45.43  ? 81  GLN P CG  1 
ATOM   495   C CD  . GLN A 1 64  ? 22.969  13.087  22.971  1.00 51.57  ? 81  GLN P CD  1 
ATOM   496   O OE1 . GLN A 1 64  ? 23.392  12.652  21.898  1.00 51.06  ? 81  GLN P OE1 1 
ATOM   497   N NE2 . GLN A 1 64  ? 23.602  12.890  24.129  1.00 49.29  ? 81  GLN P NE2 1 
ATOM   498   N N   . VAL A 1 65  ? 19.348  15.269  19.816  1.00 48.96  ? 82  VAL P N   1 
ATOM   499   C CA  . VAL A 1 65  ? 18.392  14.751  18.826  1.00 46.06  ? 82  VAL P CA  1 
ATOM   500   C C   . VAL A 1 65  ? 18.972  13.805  17.732  1.00 47.54  ? 82  VAL P C   1 
ATOM   501   O O   . VAL A 1 65  ? 20.181  13.691  17.577  1.00 46.67  ? 82  VAL P O   1 
ATOM   502   C CB  . VAL A 1 65  ? 17.636  15.890  18.178  1.00 38.50  ? 82  VAL P CB  1 
ATOM   503   C CG1 . VAL A 1 65  ? 17.884  15.887  16.731  1.00 43.23  ? 82  VAL P CG1 1 
ATOM   504   C CG2 . VAL A 1 65  ? 16.179  15.745  18.447  1.00 40.96  ? 82  VAL P CG2 1 
ATOM   505   N N   . PHE A 1 66  ? 18.087  13.122  17.001  1.00 48.57  ? 83  PHE P N   1 
ATOM   506   C CA  . PHE A 1 66  ? 18.446  12.121  15.985  1.00 44.75  ? 83  PHE P CA  1 
ATOM   507   C C   . PHE A 1 66  ? 17.232  11.646  15.182  1.00 46.04  ? 83  PHE P C   1 
ATOM   508   O O   . PHE A 1 66  ? 16.326  11.008  15.730  1.00 45.43  ? 83  PHE P O   1 
ATOM   509   C CB  . PHE A 1 66  ? 18.989  10.884  16.653  1.00 43.85  ? 83  PHE P CB  1 
ATOM   510   C CG  . PHE A 1 66  ? 20.374  11.011  17.131  1.00 48.09  ? 83  PHE P CG  1 
ATOM   511   C CD1 . PHE A 1 66  ? 21.417  11.181  16.230  1.00 50.25  ? 83  PHE P CD1 1 
ATOM   512   C CD2 . PHE A 1 66  ? 20.654  10.903  18.480  1.00 45.25  ? 83  PHE P CD2 1 
ATOM   513   C CE1 . PHE A 1 66  ? 22.713  11.263  16.670  1.00 47.32  ? 83  PHE P CE1 1 
ATOM   514   C CE2 . PHE A 1 66  ? 21.945  10.989  18.929  1.00 46.45  ? 83  PHE P CE2 1 
ATOM   515   C CZ  . PHE A 1 66  ? 22.977  11.164  18.022  1.00 49.15  ? 83  PHE P CZ  1 
ATOM   516   N N   . GLN A 1 67  ? 17.222  11.911  13.884  1.00 43.52  ? 84  GLN P N   1 
ATOM   517   C CA  . GLN A 1 67  ? 16.157  11.409  13.029  1.00 43.68  ? 84  GLN P CA  1 
ATOM   518   C C   . GLN A 1 67  ? 16.166  9.884   12.995  1.00 46.71  ? 84  GLN P C   1 
ATOM   519   O O   . GLN A 1 67  ? 17.228  9.276   13.049  1.00 48.76  ? 84  GLN P O   1 
ATOM   520   C CB  . GLN A 1 67  ? 16.341  11.913  11.602  1.00 43.70  ? 84  GLN P CB  1 
ATOM   521   C CG  . GLN A 1 67  ? 16.424  13.402  11.445  1.00 45.26  ? 84  GLN P CG  1 
ATOM   522   C CD  . GLN A 1 67  ? 17.181  13.793  10.193  1.00 46.48  ? 84  GLN P CD  1 
ATOM   523   O OE1 . GLN A 1 67  ? 17.714  12.937  9.476   1.00 45.44  ? 84  GLN P OE1 1 
ATOM   524   N NE2 . GLN A 1 67  ? 17.243  15.093  9.926   1.00 48.59  ? 84  GLN P NE2 1 
ATOM   525   N N   . VAL A 1 68  ? 14.990  9.271   12.874  1.00 43.68  ? 85  VAL P N   1 
ATOM   526   C CA  . VAL A 1 68  ? 14.885  7.831   12.674  1.00 42.32  ? 85  VAL P CA  1 
ATOM   527   C C   . VAL A 1 68  ? 15.040  7.452   11.205  1.00 42.45  ? 85  VAL P C   1 
ATOM   528   O O   . VAL A 1 68  ? 14.235  7.867   10.378  1.00 39.00  ? 85  VAL P O   1 
ATOM   529   C CB  . VAL A 1 68  ? 13.499  7.332   13.063  1.00 46.05  ? 85  VAL P CB  1 
ATOM   530   C CG1 . VAL A 1 68  ? 13.533  5.834   13.338  1.00 47.18  ? 85  VAL P CG1 1 
ATOM   531   C CG2 . VAL A 1 68  ? 12.976  8.077   14.248  1.00 46.82  ? 85  VAL P CG2 1 
ATOM   532   N N   . SER A 1 69  ? 16.051  6.645   10.896  1.00 39.90  ? 86  SER P N   1 
ATOM   533   C CA  . SER A 1 69  ? 16.279  6.154   9.549   1.00 44.39  ? 86  SER P CA  1 
ATOM   534   C C   . SER A 1 69  ? 15.206  5.144   9.210   1.00 47.31  ? 86  SER P C   1 
ATOM   535   O O   . SER A 1 69  ? 14.319  5.384   8.390   1.00 46.34  ? 86  SER P O   1 
ATOM   536   C CB  . SER A 1 69  ? 17.661  5.472   9.466   1.00 50.44  ? 86  SER P CB  1 
ATOM   537   O OG  . SER A 1 69  ? 17.768  4.495   8.420   1.00 49.41  ? 86  SER P OG  1 
ATOM   538   N N   . HIS A 1 70  ? 15.299  3.996   9.856   1.00 47.84  ? 87  HIS P N   1 
ATOM   539   C CA  . HIS A 1 70  ? 14.465  2.885   9.477   1.00 50.38  ? 87  HIS P CA  1 
ATOM   540   C C   . HIS A 1 70  ? 13.833  2.176   10.653  1.00 52.53  ? 87  HIS P C   1 
ATOM   541   O O   . HIS A 1 70  ? 14.490  1.913   11.670  1.00 50.34  ? 87  HIS P O   1 
ATOM   542   C CB  . HIS A 1 70  ? 15.250  1.876   8.654   1.00 53.51  ? 87  HIS P CB  1 
ATOM   543   C CG  . HIS A 1 70  ? 14.370  0.993   7.830   1.00 56.82  ? 87  HIS P CG  1 
ATOM   544   N ND1 . HIS A 1 70  ? 14.566  -0.363  7.715   1.00 54.00  ? 87  HIS P ND1 1 
ATOM   545   C CD2 . HIS A 1 70  ? 13.259  1.278   7.108   1.00 58.50  ? 87  HIS P CD2 1 
ATOM   546   C CE1 . HIS A 1 70  ? 13.623  -0.874  6.941   1.00 56.62  ? 87  HIS P CE1 1 
ATOM   547   N NE2 . HIS A 1 70  ? 12.820  0.098   6.561   1.00 56.24  ? 87  HIS P NE2 1 
ATOM   548   N N   . SER A 1 71  ? 12.559  1.838   10.490  1.00 51.52  ? 88  SER P N   1 
ATOM   549   C CA  . SER A 1 71  ? 11.788  1.264   11.575  1.00 47.32  ? 88  SER P CA  1 
ATOM   550   C C   . SER A 1 71  ? 11.385  -0.180  11.251  1.00 47.53  ? 88  SER P C   1 
ATOM   551   O O   . SER A 1 71  ? 11.029  -0.480  10.107  1.00 47.73  ? 88  SER P O   1 
ATOM   552   C CB  . SER A 1 71  ? 10.584  2.165   11.857  1.00 40.16  ? 88  SER P CB  1 
ATOM   553   O OG  . SER A 1 71  ? 9.384   1.436   11.800  1.00 41.87  ? 88  SER P OG  1 
ATOM   554   N N   . PHE A 1 72  ? 11.458  -1.062  12.258  1.00 43.82  ? 89  PHE P N   1 
ATOM   555   C CA  . PHE A 1 72  ? 11.140  -2.497  12.110  1.00 39.88  ? 89  PHE P CA  1 
ATOM   556   C C   . PHE A 1 72  ? 10.100  -3.069  13.150  1.00 40.30  ? 89  PHE P C   1 
ATOM   557   O O   . PHE A 1 72  ? 10.487  -3.437  14.271  1.00 36.18  ? 89  PHE P O   1 
ATOM   558   C CB  . PHE A 1 72  ? 12.433  -3.324  12.216  1.00 40.09  ? 89  PHE P CB  1 
ATOM   559   C CG  . PHE A 1 72  ? 13.584  -2.846  11.324  1.00 50.29  ? 89  PHE P CG  1 
ATOM   560   C CD1 . PHE A 1 72  ? 14.159  -1.597  11.495  1.00 48.91  ? 89  PHE P CD1 1 
ATOM   561   C CD2 . PHE A 1 72  ? 14.136  -3.691  10.353  1.00 50.45  ? 89  PHE P CD2 1 
ATOM   562   C CE1 . PHE A 1 72  ? 15.214  -1.200  10.682  1.00 49.82  ? 89  PHE P CE1 1 
ATOM   563   C CE2 . PHE A 1 72  ? 15.188  -3.290  9.558   1.00 40.04  ? 89  PHE P CE2 1 
ATOM   564   C CZ  . PHE A 1 72  ? 15.725  -2.059  9.730   1.00 46.79  ? 89  PHE P CZ  1 
ATOM   565   N N   . PRO A 1 73  ? 8.792   -3.154  12.778  1.00 33.43  ? 90  PRO P N   1 
ATOM   566   C CA  . PRO A 1 73  ? 7.747   -3.836  13.554  1.00 30.78  ? 90  PRO P CA  1 
ATOM   567   C C   . PRO A 1 73  ? 8.027   -5.311  13.638  1.00 34.56  ? 90  PRO P C   1 
ATOM   568   O O   . PRO A 1 73  ? 8.787   -5.780  12.804  1.00 38.31  ? 90  PRO P O   1 
ATOM   569   C CB  . PRO A 1 73  ? 6.513   -3.653  12.694  1.00 33.79  ? 90  PRO P CB  1 
ATOM   570   C CG  . PRO A 1 73  ? 6.776   -2.434  11.912  1.00 38.04  ? 90  PRO P CG  1 
ATOM   571   C CD  . PRO A 1 73  ? 8.221   -2.378  11.668  1.00 34.34  ? 90  PRO P CD  1 
ATOM   572   N N   . HIS A 1 74  ? 7.448   -6.041  14.590  1.00 35.27  ? 91  HIS P N   1 
ATOM   573   C CA  . HIS A 1 74  ? 7.642   -7.493  14.605  1.00 32.43  ? 91  HIS P CA  1 
ATOM   574   C C   . HIS A 1 74  ? 6.700   -8.126  13.611  1.00 35.85  ? 91  HIS P C   1 
ATOM   575   O O   . HIS A 1 74  ? 5.518   -7.785  13.521  1.00 39.17  ? 91  HIS P O   1 
ATOM   576   C CB  . HIS A 1 74  ? 7.469   -8.101  15.984  1.00 29.76  ? 91  HIS P CB  1 
ATOM   577   C CG  . HIS A 1 74  ? 7.897   -9.529  16.069  1.00 33.41  ? 91  HIS P CG  1 
ATOM   578   N ND1 . HIS A 1 74  ? 7.252   -10.541 15.395  1.00 37.82  ? 91  HIS P ND1 1 
ATOM   579   C CD2 . HIS A 1 74  ? 8.897   -10.123 16.764  1.00 35.30  ? 91  HIS P CD2 1 
ATOM   580   C CE1 . HIS A 1 74  ? 7.839   -11.694 15.665  1.00 39.68  ? 91  HIS P CE1 1 
ATOM   581   N NE2 . HIS A 1 74  ? 8.845   -11.469 16.492  1.00 35.32  ? 91  HIS P NE2 1 
ATOM   582   N N   . PRO A 1 75  ? 7.246   -9.017  12.810  1.00 35.22  ? 92  PRO P N   1 
ATOM   583   C CA  . PRO A 1 75  ? 6.619   -9.745  11.717  1.00 39.11  ? 92  PRO P CA  1 
ATOM   584   C C   . PRO A 1 75  ? 5.217   -10.218 12.053  1.00 37.06  ? 92  PRO P C   1 
ATOM   585   O O   . PRO A 1 75  ? 4.289   -10.089 11.257  1.00 37.00  ? 92  PRO P O   1 
ATOM   586   C CB  . PRO A 1 75  ? 7.520   -10.975 11.584  1.00 45.42  ? 92  PRO P CB  1 
ATOM   587   C CG  . PRO A 1 75  ? 8.850   -10.514 12.020  1.00 43.79  ? 92  PRO P CG  1 
ATOM   588   C CD  . PRO A 1 75  ? 8.670   -9.337  12.941  1.00 37.79  ? 92  PRO P CD  1 
ATOM   589   N N   . LEU A 1 76  ? 5.075   -10.805 13.228  1.00 35.74  ? 93  LEU P N   1 
ATOM   590   C CA  . LEU A 1 76  ? 3.846   -11.493 13.536  1.00 38.91  ? 93  LEU P CA  1 
ATOM   591   C C   . LEU A 1 76  ? 2.746   -10.533 13.972  1.00 39.38  ? 93  LEU P C   1 
ATOM   592   O O   . LEU A 1 76  ? 1.572   -10.784 13.707  1.00 38.30  ? 93  LEU P O   1 
ATOM   593   C CB  . LEU A 1 76  ? 4.102   -12.618 14.538  1.00 40.69  ? 93  LEU P CB  1 
ATOM   594   C CG  . LEU A 1 76  ? 4.995   -13.691 13.907  1.00 40.94  ? 93  LEU P CG  1 
ATOM   595   C CD1 . LEU A 1 76  ? 4.911   -14.993 14.649  1.00 43.26  ? 93  LEU P CD1 1 
ATOM   596   C CD2 . LEU A 1 76  ? 4.574   -13.892 12.474  1.00 45.48  ? 93  LEU P CD2 1 
ATOM   597   N N   . TYR A 1 77  ? 3.146   -9.413  14.578  1.00 40.35  ? 94  TYR P N   1 
ATOM   598   C CA  . TYR A 1 77  ? 2.216   -8.393  15.061  1.00 40.74  ? 94  TYR P CA  1 
ATOM   599   C C   . TYR A 1 77  ? 1.129   -8.083  14.066  1.00 46.42  ? 94  TYR P C   1 
ATOM   600   O O   . TYR A 1 77  ? 1.356   -8.065  12.865  1.00 46.51  ? 94  TYR P O   1 
ATOM   601   C CB  . TYR A 1 77  ? 2.915   -7.083  15.381  1.00 39.01  ? 94  TYR P CB  1 
ATOM   602   C CG  . TYR A 1 77  ? 1.984   -6.075  16.003  1.00 39.04  ? 94  TYR P CG  1 
ATOM   603   C CD1 . TYR A 1 77  ? 1.330   -6.359  17.191  1.00 43.93  ? 94  TYR P CD1 1 
ATOM   604   C CD2 . TYR A 1 77  ? 1.753   -4.850  15.410  1.00 39.59  ? 94  TYR P CD2 1 
ATOM   605   C CE1 . TYR A 1 77  ? 0.476   -5.448  17.780  1.00 44.17  ? 94  TYR P CE1 1 
ATOM   606   C CE2 . TYR A 1 77  ? 0.902   -3.928  15.983  1.00 41.26  ? 94  TYR P CE2 1 
ATOM   607   C CZ  . TYR A 1 77  ? 0.264   -4.232  17.174  1.00 46.57  ? 94  TYR P CZ  1 
ATOM   608   O OH  . TYR A 1 77  ? -0.599  -3.332  17.771  1.00 50.40  ? 94  TYR P OH  1 
ATOM   609   N N   . ASP A 1 78  ? -0.052  -7.801  14.600  1.00 52.18  ? 95  ASP P N   1 
ATOM   610   C CA  . ASP A 1 78  ? -1.243  -7.562  13.816  1.00 49.27  ? 95  ASP P CA  1 
ATOM   611   C C   . ASP A 1 78  ? -1.498  -6.071  13.655  1.00 51.08  ? 95  ASP P C   1 
ATOM   612   O O   . ASP A 1 78  ? -2.181  -5.452  14.453  1.00 47.91  ? 95  ASP P O   1 
ATOM   613   C CB  . ASP A 1 78  ? -2.414  -8.228  14.515  1.00 57.55  ? 95  ASP P CB  1 
ATOM   614   C CG  . ASP A 1 78  ? -3.676  -8.205  13.680  1.00 65.87  ? 95  ASP P CG  1 
ATOM   615   O OD1 . ASP A 1 78  ? -3.713  -7.445  12.680  1.00 62.08  ? 95  ASP P OD1 1 
ATOM   616   O OD2 . ASP A 1 78  ? -4.629  -8.947  14.034  1.00 66.38  ? 95  ASP P OD2 1 
ATOM   617   N N   . MET A 1 79  A -0.950  -5.506  12.591  1.00 55.67  ? 95  MET P N   1 
ATOM   618   C CA  . MET A 1 79  A -0.980  -4.070  12.380  1.00 54.67  ? 95  MET P CA  1 
ATOM   619   C C   . MET A 1 79  A -2.329  -3.575  11.902  1.00 60.67  ? 95  MET P C   1 
ATOM   620   O O   . MET A 1 79  A -2.535  -2.375  11.784  1.00 62.38  ? 95  MET P O   1 
ATOM   621   C CB  . MET A 1 79  A 0.076   -3.670  11.359  1.00 48.37  ? 95  MET P CB  1 
ATOM   622   C CG  . MET A 1 79  A 0.541   -2.238  11.481  1.00 49.50  ? 95  MET P CG  1 
ATOM   623   S SD  . MET A 1 79  A 2.023   -2.057  12.495  1.00 57.95  ? 95  MET P SD  1 
ATOM   624   C CE  . MET A 1 79  A 2.721   -3.725  12.436  1.00 48.19  ? 95  MET P CE  1 
ATOM   625   N N   . SER A 1 80  B -3.245  -4.489  11.601  1.00 67.04  ? 95  SER P N   1 
ATOM   626   C CA  . SER A 1 80  B -4.583  -4.085  11.169  1.00 71.34  ? 95  SER P CA  1 
ATOM   627   C C   . SER A 1 80  B -5.468  -3.993  12.396  1.00 73.48  ? 95  SER P C   1 
ATOM   628   O O   . SER A 1 80  B -6.640  -4.370  12.382  1.00 78.44  ? 95  SER P O   1 
ATOM   629   C CB  . SER A 1 80  B -5.171  -5.068  10.157  1.00 72.00  ? 95  SER P CB  1 
ATOM   630   O OG  . SER A 1 80  B -5.840  -6.126  10.818  1.00 76.02  ? 95  SER P OG  1 
ATOM   631   N N   . LEU A 1 81  C -4.878  -3.490  13.467  1.00 73.24  ? 95  LEU P N   1 
ATOM   632   C CA  . LEU A 1 81  C -5.558  -3.405  14.737  1.00 77.32  ? 95  LEU P CA  1 
ATOM   633   C C   . LEU A 1 81  C -5.848  -1.949  15.052  1.00 85.03  ? 95  LEU P C   1 
ATOM   634   O O   . LEU A 1 81  C -6.233  -1.626  16.173  1.00 90.89  ? 95  LEU P O   1 
ATOM   635   C CB  . LEU A 1 81  C -4.702  -4.044  15.837  1.00 75.72  ? 95  LEU P CB  1 
ATOM   636   C CG  . LEU A 1 81  C -5.297  -5.262  16.550  1.00 73.61  ? 95  LEU P CG  1 
ATOM   637   C CD1 . LEU A 1 81  C -4.231  -6.147  17.188  1.00 63.63  ? 95  LEU P CD1 1 
ATOM   638   C CD2 . LEU A 1 81  C -6.305  -4.788  17.585  1.00 85.76  ? 95  LEU P CD2 1 
ATOM   639   N N   . LEU A 1 82  D -5.656  -1.073  14.066  1.00 84.22  ? 95  LEU P N   1 
ATOM   640   C CA  . LEU A 1 82  D -6.003  0.342   14.222  1.00 90.26  ? 95  LEU P CA  1 
ATOM   641   C C   . LEU A 1 82  D -7.261  0.633   13.401  1.00 99.07  ? 95  LEU P C   1 
ATOM   642   O O   . LEU A 1 82  D -7.206  0.726   12.172  1.00 102.85 ? 95  LEU P O   1 
ATOM   643   C CB  . LEU A 1 82  D -4.837  1.235   13.799  1.00 84.47  ? 95  LEU P CB  1 
ATOM   644   C CG  . LEU A 1 82  D -3.515  0.987   14.542  1.00 88.59  ? 95  LEU P CG  1 
ATOM   645   C CD1 . LEU A 1 82  D -3.771  0.574   15.991  1.00 88.35  ? 95  LEU P CD1 1 
ATOM   646   C CD2 . LEU A 1 82  D -2.611  -0.031  13.856  1.00 77.91  ? 95  LEU P CD2 1 
ATOM   647   N N   . LYS A 1 83  E -8.399  0.765   14.076  1.00 98.66  ? 95  LYS P N   1 
ATOM   648   C CA  . LYS A 1 83  E -9.668  0.623   13.381  1.00 105.53 ? 95  LYS P CA  1 
ATOM   649   C C   . LYS A 1 83  E -10.742 1.637   13.750  1.00 114.41 ? 95  LYS P C   1 
ATOM   650   O O   . LYS A 1 83  E -10.588 2.414   14.691  1.00 111.19 ? 95  LYS P O   1 
ATOM   651   C CB  . LYS A 1 83  E -10.206 -0.801  13.584  1.00 111.87 ? 95  LYS P CB  1 
ATOM   652   C CG  . LYS A 1 83  E -9.673  -1.507  14.840  1.00 109.12 ? 95  LYS P CG  1 
ATOM   653   C CD  . LYS A 1 83  E -10.343 -2.875  15.101  1.00 110.59 ? 95  LYS P CD  1 
ATOM   654   C CE  . LYS A 1 83  E -10.147 -3.894  13.961  1.00 108.25 ? 95  LYS P CE  1 
ATOM   655   N NZ  . LYS A 1 83  E -11.123 -3.760  12.823  1.00 110.91 ? 95  LYS P NZ  1 
ATOM   656   N N   . ASN A 1 84  F -11.825 1.617   12.973  1.00 120.65 ? 95  ASN P N   1 
ATOM   657   C CA  . ASN A 1 84  F -13.047 2.361   13.275  1.00 128.64 ? 95  ASN P CA  1 
ATOM   658   C C   . ASN A 1 84  F -13.832 1.628   14.367  1.00 130.19 ? 95  ASN P C   1 
ATOM   659   O O   . ASN A 1 84  F -14.115 2.183   15.435  1.00 130.31 ? 95  ASN P O   1 
ATOM   660   C CB  . ASN A 1 84  F -13.912 2.497   12.016  1.00 129.46 ? 95  ASN P CB  1 
ATOM   661   C CG  . ASN A 1 84  F -13.800 3.871   11.364  1.00 131.33 ? 95  ASN P CG  1 
ATOM   662   O OD1 . ASN A 1 84  F -13.608 4.889   12.041  1.00 129.12 ? 95  ASN P OD1 1 
ATOM   663   N ND2 . ASN A 1 84  F -13.940 3.906   10.041  1.00 128.03 ? 95  ASN P ND2 1 
ATOM   664   N N   . ARG A 1 85  G -14.194 0.381   14.072  1.00 125.79 ? 95  ARG P N   1 
ATOM   665   C CA  . ARG A 1 85  G -14.625 -0.569  15.087  1.00 122.63 ? 95  ARG P CA  1 
ATOM   666   C C   . ARG A 1 85  G -13.451 -0.721  16.075  1.00 127.20 ? 95  ARG P C   1 
ATOM   667   O O   . ARG A 1 85  G -12.309 -0.870  15.642  1.00 126.44 ? 95  ARG P O   1 
ATOM   668   C CB  . ARG A 1 85  G -15.012 -1.901  14.416  1.00 118.88 ? 95  ARG P CB  1 
ATOM   669   C CG  . ARG A 1 85  G -15.972 -1.812  13.201  1.00 109.41 ? 95  ARG P CG  1 
ATOM   670   C CD  . ARG A 1 85  G -15.539 -0.830  12.088  1.00 112.45 ? 95  ARG P CD  1 
ATOM   671   N NE  . ARG A 1 85  G -16.035 -1.167  10.749  1.00 122.99 ? 95  ARG P NE  1 
ATOM   672   C CZ  . ARG A 1 85  G -16.007 -0.337  9.701   1.00 125.32 ? 95  ARG P CZ  1 
ATOM   673   N NH1 . ARG A 1 85  G -15.505 0.886   9.824   1.00 122.20 ? 95  ARG P NH1 1 
ATOM   674   N NH2 . ARG A 1 85  G -16.484 -0.728  8.521   1.00 114.99 ? 95  ARG P NH2 1 
ATOM   675   N N   . PHE A 1 86  H -13.699 -0.651  17.386  1.00 128.63 ? 95  PHE P N   1 
ATOM   676   C CA  . PHE A 1 86  H -12.575 -0.535  18.344  1.00 125.12 ? 95  PHE P CA  1 
ATOM   677   C C   . PHE A 1 86  H -12.450 -1.607  19.473  1.00 123.07 ? 95  PHE P C   1 
ATOM   678   O O   . PHE A 1 86  H -13.400 -1.858  20.226  1.00 124.81 ? 95  PHE P O   1 
ATOM   679   C CB  . PHE A 1 86  H -12.504 0.898   18.918  1.00 119.80 ? 95  PHE P CB  1 
ATOM   680   C CG  . PHE A 1 86  H -11.272 1.676   18.492  1.00 123.89 ? 95  PHE P CG  1 
ATOM   681   C CD1 . PHE A 1 86  H -10.553 1.316   17.356  1.00 117.66 ? 95  PHE P CD1 1 
ATOM   682   C CD2 . PHE A 1 86  H -10.835 2.770   19.231  1.00 122.73 ? 95  PHE P CD2 1 
ATOM   683   C CE1 . PHE A 1 86  H -9.425  2.027   16.978  1.00 108.33 ? 95  PHE P CE1 1 
ATOM   684   C CE2 . PHE A 1 86  H -9.707  3.486   18.850  1.00 108.40 ? 95  PHE P CE2 1 
ATOM   685   C CZ  . PHE A 1 86  H -9.008  3.114   17.724  1.00 104.39 ? 95  PHE P CZ  1 
ATOM   686   N N   . LEU A 1 87  I -11.258 -2.216  19.558  1.00 118.24 ? 95  LEU P N   1 
ATOM   687   C CA  . LEU A 1 87  I -10.849 -3.208  20.586  1.00 106.56 ? 95  LEU P CA  1 
ATOM   688   C C   . LEU A 1 87  I -11.855 -4.292  21.002  1.00 103.47 ? 95  LEU P C   1 
ATOM   689   O O   . LEU A 1 87  I -12.202 -4.407  22.179  1.00 98.15  ? 95  LEU P O   1 
ATOM   690   C CB  . LEU A 1 87  I -10.270 -2.523  21.836  1.00 101.52 ? 95  LEU P CB  1 
ATOM   691   C CG  . LEU A 1 87  I -8.865  -1.919  21.737  1.00 97.48  ? 95  LEU P CG  1 
ATOM   692   C CD1 . LEU A 1 87  I -8.888  -0.657  20.901  1.00 104.64 ? 95  LEU P CD1 1 
ATOM   693   C CD2 . LEU A 1 87  I -8.309  -1.613  23.114  1.00 94.98  ? 95  LEU P CD2 1 
ATOM   694   N N   . ARG A 1 88  J -12.287 -5.108  20.043  1.00 107.64 ? 95  ARG P N   1 
ATOM   695   C CA  . ARG A 1 88  J -13.209 -6.203  20.339  1.00 101.99 ? 95  ARG P CA  1 
ATOM   696   C C   . ARG A 1 88  J -12.537 -7.227  21.258  1.00 87.55  ? 95  ARG P C   1 
ATOM   697   O O   . ARG A 1 88  J -11.323 -7.404  21.224  1.00 81.81  ? 95  ARG P O   1 
ATOM   698   C CB  . ARG A 1 88  J -13.733 -6.869  19.047  1.00 101.81 ? 95  ARG P CB  1 
ATOM   699   C CG  . ARG A 1 88  J -14.079 -5.898  17.902  1.00 107.00 ? 95  ARG P CG  1 
ATOM   700   C CD  . ARG A 1 88  J -14.973 -4.733  18.368  1.00 120.91 ? 95  ARG P CD  1 
ATOM   701   N NE  . ARG A 1 88  J -16.391 -5.091  18.478  1.00 132.24 ? 95  ARG P NE  1 
ATOM   702   C CZ  . ARG A 1 88  J -17.315 -4.344  19.088  1.00 128.05 ? 95  ARG P CZ  1 
ATOM   703   N NH1 . ARG A 1 88  J -17.162 -3.992  20.363  1.00 123.11 ? 95  ARG P NH1 1 
ATOM   704   N NH2 . ARG A 1 88  J -18.400 -3.955  18.422  1.00 123.18 ? 95  ARG P NH2 1 
ATOM   705   N N   . PRO A 1 89  K -13.337 -7.890  22.095  1.00 87.59  ? 95  PRO P N   1 
ATOM   706   C CA  . PRO A 1 89  K -12.959 -8.951  23.034  1.00 87.67  ? 95  PRO P CA  1 
ATOM   707   C C   . PRO A 1 89  K -12.106 -10.078 22.442  1.00 93.85  ? 95  PRO P C   1 
ATOM   708   O O   . PRO A 1 89  K -11.363 -10.719 23.199  1.00 92.84  ? 95  PRO P O   1 
ATOM   709   C CB  . PRO A 1 89  K -14.311 -9.527  23.451  1.00 84.59  ? 95  PRO P CB  1 
ATOM   710   C CG  . PRO A 1 89  K -15.223 -8.390  23.378  1.00 89.85  ? 95  PRO P CG  1 
ATOM   711   C CD  . PRO A 1 89  K -14.747 -7.504  22.254  1.00 95.13  ? 95  PRO P CD  1 
ATOM   712   N N   . GLY A 1 90  ? -12.221 -10.339 21.141  1.00 91.60  ? 96  GLY P N   1 
ATOM   713   C CA  . GLY A 1 90  ? -11.523 -11.467 20.549  1.00 82.09  ? 96  GLY P CA  1 
ATOM   714   C C   . GLY A 1 90  ? -10.130 -11.099 20.093  1.00 81.74  ? 96  GLY P C   1 
ATOM   715   O O   . GLY A 1 90  ? -9.241  -11.956 20.021  1.00 83.15  ? 96  GLY P O   1 
ATOM   716   N N   . ASP A 1 91  ? -9.943  -9.813  19.804  1.00 83.15  ? 97  ASP P N   1 
ATOM   717   C CA  . ASP A 1 91  ? -8.713  -9.295  19.198  1.00 81.44  ? 97  ASP P CA  1 
ATOM   718   C C   . ASP A 1 91  ? -7.417  -9.688  19.902  1.00 71.11  ? 97  ASP P C   1 
ATOM   719   O O   . ASP A 1 91  ? -7.285  -9.569  21.116  1.00 65.95  ? 97  ASP P O   1 
ATOM   720   C CB  . ASP A 1 91  ? -8.803  -7.780  19.081  1.00 80.21  ? 97  ASP P CB  1 
ATOM   721   C CG  . ASP A 1 91  ? -9.974  -7.348  18.238  1.00 89.82  ? 97  ASP P CG  1 
ATOM   722   O OD1 . ASP A 1 91  ? -10.824 -8.219  17.937  1.00 91.47  ? 97  ASP P OD1 1 
ATOM   723   O OD2 . ASP A 1 91  ? -10.048 -6.153  17.870  1.00 96.17  ? 97  ASP P OD2 1 
ATOM   724   N N   . ASP A 1 92  ? -6.457  -10.155 19.117  1.00 68.69  ? 98  ASP P N   1 
ATOM   725   C CA  . ASP A 1 92  ? -5.170  -10.575 19.656  1.00 65.03  ? 98  ASP P CA  1 
ATOM   726   C C   . ASP A 1 92  ? -4.021  -9.688  19.194  1.00 60.11  ? 98  ASP P C   1 
ATOM   727   O O   . ASP A 1 92  ? -3.433  -9.899  18.131  1.00 61.21  ? 98  ASP P O   1 
ATOM   728   C CB  . ASP A 1 92  ? -4.862  -12.027 19.281  1.00 63.44  ? 98  ASP P CB  1 
ATOM   729   C CG  . ASP A 1 92  ? -3.513  -12.480 19.799  1.00 56.85  ? 98  ASP P CG  1 
ATOM   730   O OD1 . ASP A 1 92  ? -2.787  -11.622 20.362  1.00 51.05  ? 98  ASP P OD1 1 
ATOM   731   O OD2 . ASP A 1 92  ? -3.187  -13.686 19.654  1.00 59.14  ? 98  ASP P OD2 1 
ATOM   732   N N   . SER A 1 93  ? -3.690  -8.694  19.996  1.00 56.33  ? 99  SER P N   1 
ATOM   733   C CA  . SER A 1 93  ? -2.493  -7.943  19.717  1.00 56.95  ? 99  SER P CA  1 
ATOM   734   C C   . SER A 1 93  ? -1.432  -8.630  20.522  1.00 49.19  ? 99  SER P C   1 
ATOM   735   O O   . SER A 1 93  ? -1.485  -8.634  21.735  1.00 46.86  ? 99  SER P O   1 
ATOM   736   C CB  . SER A 1 93  ? -2.637  -6.503  20.185  1.00 59.40  ? 99  SER P CB  1 
ATOM   737   O OG  . SER A 1 93  ? -2.757  -6.469  21.592  1.00 62.12  ? 99  SER P OG  1 
ATOM   738   N N   . SER A 1 94  ? -0.470  -9.239  19.862  1.00 47.63  ? 100 SER P N   1 
ATOM   739   C CA  . SER A 1 94  ? 0.514   -9.916  20.643  1.00 44.49  ? 100 SER P CA  1 
ATOM   740   C C   . SER A 1 94  ? 1.902   -9.370  20.500  1.00 46.78  ? 100 SER P C   1 
ATOM   741   O O   . SER A 1 94  ? 2.399   -8.747  21.436  1.00 53.77  ? 100 SER P O   1 
ATOM   742   C CB  . SER A 1 94  ? 0.453   -11.418 20.476  1.00 42.77  ? 100 SER P CB  1 
ATOM   743   O OG  . SER A 1 94  ? -0.302  -11.950 21.542  1.00 39.68  ? 100 SER P OG  1 
ATOM   744   N N   . HIS A 1 95  ? 2.547   -9.570  19.365  1.00 41.02  ? 101 HIS P N   1 
ATOM   745   C CA  . HIS A 1 95  ? 3.985   -9.287  19.341  1.00 41.14  ? 101 HIS P CA  1 
ATOM   746   C C   . HIS A 1 95  ? 4.311   -7.802  19.134  1.00 38.62  ? 101 HIS P C   1 
ATOM   747   O O   . HIS A 1 95  ? 5.004   -7.400  18.219  1.00 35.88  ? 101 HIS P O   1 
ATOM   748   C CB  . HIS A 1 95  ? 4.616   -10.227 18.361  1.00 38.77  ? 101 HIS P CB  1 
ATOM   749   C CG  . HIS A 1 95  ? 3.978   -11.574 18.409  1.00 43.95  ? 101 HIS P CG  1 
ATOM   750   N ND1 . HIS A 1 95  ? 3.942   -12.326 19.561  1.00 43.40  ? 101 HIS P ND1 1 
ATOM   751   C CD2 . HIS A 1 95  ? 3.289   -12.272 17.476  1.00 42.58  ? 101 HIS P CD2 1 
ATOM   752   C CE1 . HIS A 1 95  ? 3.301   -13.457 19.322  1.00 43.68  ? 101 HIS P CE1 1 
ATOM   753   N NE2 . HIS A 1 95  ? 2.891   -13.446 18.067  1.00 44.40  ? 101 HIS P NE2 1 
ATOM   754   N N   . ASP A 1 96  ? 3.788   -7.003  20.045  1.00 37.35  ? 102 ASP P N   1 
ATOM   755   C CA  . ASP A 1 96  ? 3.724   -5.583  19.890  1.00 35.05  ? 102 ASP P CA  1 
ATOM   756   C C   . ASP A 1 96  ? 5.062   -5.063  20.265  1.00 34.34  ? 102 ASP P C   1 
ATOM   757   O O   . ASP A 1 96  ? 5.291   -4.742  21.413  1.00 38.07  ? 102 ASP P O   1 
ATOM   758   C CB  . ASP A 1 96  ? 2.672   -5.044  20.853  1.00 41.28  ? 102 ASP P CB  1 
ATOM   759   C CG  . ASP A 1 96  ? 2.386   -3.577  20.635  1.00 46.74  ? 102 ASP P CG  1 
ATOM   760   O OD1 . ASP A 1 96  ? 3.026   -2.973  19.738  1.00 45.40  ? 102 ASP P OD1 1 
ATOM   761   O OD2 . ASP A 1 96  ? 1.530   -3.025  21.365  1.00 47.00  ? 102 ASP P OD2 1 
ATOM   762   N N   . LEU A 1 97  ? 5.952   -4.968  19.292  1.00 36.48  ? 103 LEU P N   1 
ATOM   763   C CA  . LEU A 1 97  ? 7.375   -4.754  19.561  1.00 32.49  ? 103 LEU P CA  1 
ATOM   764   C C   . LEU A 1 97  ? 8.065   -4.149  18.354  1.00 31.54  ? 103 LEU P C   1 
ATOM   765   O O   . LEU A 1 97  ? 8.042   -4.726  17.281  1.00 32.68  ? 103 LEU P O   1 
ATOM   766   C CB  . LEU A 1 97  ? 8.017   -6.103  19.834  1.00 29.33  ? 103 LEU P CB  1 
ATOM   767   C CG  . LEU A 1 97  ? 9.366   -6.032  20.501  1.00 30.43  ? 103 LEU P CG  1 
ATOM   768   C CD1 . LEU A 1 97  ? 9.119   -5.322  21.793  1.00 29.98  ? 103 LEU P CD1 1 
ATOM   769   C CD2 . LEU A 1 97  ? 9.996   -7.420  20.713  1.00 29.31  ? 103 LEU P CD2 1 
ATOM   770   N N   . MET A 1 98  ? 8.701   -3.001  18.501  1.00 33.76  ? 104 MET P N   1 
ATOM   771   C CA  . MET A 1 98  ? 9.380   -2.409  17.347  1.00 34.10  ? 104 MET P CA  1 
ATOM   772   C C   . MET A 1 98  ? 10.851  -2.018  17.588  1.00 35.28  ? 104 MET P C   1 
ATOM   773   O O   . MET A 1 98  ? 11.182  -1.523  18.664  1.00 33.14  ? 104 MET P O   1 
ATOM   774   C CB  . MET A 1 98  ? 8.591   -1.217  16.853  1.00 30.59  ? 104 MET P CB  1 
ATOM   775   C CG  . MET A 1 98  ? 9.282   -0.493  15.772  1.00 31.97  ? 104 MET P CG  1 
ATOM   776   S SD  . MET A 1 98  ? 8.111   0.526   14.892  1.00 43.85  ? 104 MET P SD  1 
ATOM   777   C CE  . MET A 1 98  ? 7.464   1.590   16.162  1.00 42.16  ? 104 MET P CE  1 
ATOM   778   N N   . LEU A 1 99  ? 11.723  -2.261  16.596  1.00 36.49  ? 105 LEU P N   1 
ATOM   779   C CA  . LEU A 1 99  ? 13.110  -1.749  16.586  1.00 31.43  ? 105 LEU P CA  1 
ATOM   780   C C   . LEU A 1 99  ? 13.209  -0.498  15.722  1.00 31.40  ? 105 LEU P C   1 
ATOM   781   O O   . LEU A 1 99  ? 12.743  -0.493  14.592  1.00 34.29  ? 105 LEU P O   1 
ATOM   782   C CB  . LEU A 1 99  ? 14.084  -2.777  16.033  1.00 29.43  ? 105 LEU P CB  1 
ATOM   783   C CG  . LEU A 1 99  ? 15.044  -3.590  16.896  1.00 27.07  ? 105 LEU P CG  1 
ATOM   784   C CD1 . LEU A 1 99  ? 15.485  -2.807  18.058  1.00 30.47  ? 105 LEU P CD1 1 
ATOM   785   C CD2 . LEU A 1 99  ? 14.423  -4.843  17.370  1.00 29.50  ? 105 LEU P CD2 1 
ATOM   786   N N   . LEU A 1 100 ? 13.817  0.554   16.270  1.00 32.08  ? 106 LEU P N   1 
ATOM   787   C CA  . LEU A 1 100 ? 14.058  1.838   15.588  1.00 34.38  ? 106 LEU P CA  1 
ATOM   788   C C   . LEU A 1 100 ? 15.556  2.077   15.365  1.00 38.95  ? 106 LEU P C   1 
ATOM   789   O O   . LEU A 1 100 ? 16.323  2.015   16.332  1.00 40.92  ? 106 LEU P O   1 
ATOM   790   C CB  . LEU A 1 100 ? 13.534  2.967   16.456  1.00 28.12  ? 106 LEU P CB  1 
ATOM   791   C CG  . LEU A 1 100 ? 12.159  3.456   16.059  1.00 27.37  ? 106 LEU P CG  1 
ATOM   792   C CD1 . LEU A 1 100 ? 11.297  2.281   15.824  1.00 32.06  ? 106 LEU P CD1 1 
ATOM   793   C CD2 . LEU A 1 100 ? 11.587  4.311   17.123  1.00 27.39  ? 106 LEU P CD2 1 
ATOM   794   N N   . ARG A 1 101 ? 15.988  2.348   14.127  1.00 37.24  ? 107 ARG P N   1 
ATOM   795   C CA  . ARG A 1 101 ? 17.430  2.524   13.858  1.00 44.19  ? 107 ARG P CA  1 
ATOM   796   C C   . ARG A 1 101 ? 17.801  3.992   13.699  1.00 45.46  ? 107 ARG P C   1 
ATOM   797   O O   . ARG A 1 101 ? 17.402  4.615   12.722  1.00 50.56  ? 107 ARG P O   1 
ATOM   798   C CB  . ARG A 1 101 ? 17.865  1.758   12.605  1.00 42.24  ? 107 ARG P CB  1 
ATOM   799   C CG  . ARG A 1 101 ? 19.379  1.535   12.479  1.00 46.37  ? 107 ARG P CG  1 
ATOM   800   C CD  . ARG A 1 101 ? 20.056  2.383   11.370  1.00 49.21  ? 107 ARG P CD  1 
ATOM   801   N NE  . ARG A 1 101 ? 19.315  2.370   10.110  1.00 52.89  ? 107 ARG P NE  1 
ATOM   802   C CZ  . ARG A 1 101 ? 18.976  1.264   9.448   1.00 55.92  ? 107 ARG P CZ  1 
ATOM   803   N NH1 . ARG A 1 101 ? 18.287  1.349   8.307   1.00 50.87  ? 107 ARG P NH1 1 
ATOM   804   N NH2 . ARG A 1 101 ? 19.322  0.072   9.927   1.00 47.98  ? 107 ARG P NH2 1 
ATOM   805   N N   . LEU A 1 102 ? 18.558  4.556   14.633  1.00 37.30  ? 108 LEU P N   1 
ATOM   806   C CA  . LEU A 1 102 ? 18.807  5.988   14.566  1.00 42.47  ? 108 LEU P CA  1 
ATOM   807   C C   . LEU A 1 102 ? 19.757  6.307   13.429  1.00 47.61  ? 108 LEU P C   1 
ATOM   808   O O   . LEU A 1 102 ? 20.531  5.446   13.019  1.00 54.91  ? 108 LEU P O   1 
ATOM   809   C CB  . LEU A 1 102 ? 19.394  6.510   15.877  1.00 50.34  ? 108 LEU P CB  1 
ATOM   810   C CG  . LEU A 1 102 ? 18.551  6.409   17.151  1.00 49.00  ? 108 LEU P CG  1 
ATOM   811   C CD1 . LEU A 1 102 ? 17.080  6.486   16.799  1.00 49.24  ? 108 LEU P CD1 1 
ATOM   812   C CD2 . LEU A 1 102 ? 18.853  5.119   17.893  1.00 45.87  ? 108 LEU P CD2 1 
ATOM   813   N N   . SER A 1 103 ? 19.713  7.533   12.917  1.00 45.32  ? 109 SER P N   1 
ATOM   814   C CA  . SER A 1 103 ? 20.589  7.914   11.813  1.00 46.57  ? 109 SER P CA  1 
ATOM   815   C C   . SER A 1 103 ? 22.044  7.640   12.140  1.00 48.98  ? 109 SER P C   1 
ATOM   816   O O   . SER A 1 103 ? 22.695  6.865   11.461  1.00 55.81  ? 109 SER P O   1 
ATOM   817   C CB  . SER A 1 103 ? 20.422  9.385   11.485  1.00 48.80  ? 109 SER P CB  1 
ATOM   818   O OG  . SER A 1 103 ? 20.989  10.177  12.500  1.00 45.79  ? 109 SER P OG  1 
ATOM   819   N N   . GLU A 1 104 ? 22.549  8.283   13.186  1.00 49.96  ? 110 GLU P N   1 
ATOM   820   C CA  . GLU A 1 104 ? 23.929  8.106   13.648  1.00 52.35  ? 110 GLU P CA  1 
ATOM   821   C C   . GLU A 1 104 ? 23.944  7.588   15.097  1.00 52.43  ? 110 GLU P C   1 
ATOM   822   O O   . GLU A 1 104 ? 23.013  7.869   15.844  1.00 55.53  ? 110 GLU P O   1 
ATOM   823   C CB  . GLU A 1 104 ? 24.661  9.460   13.614  1.00 60.02  ? 110 GLU P CB  1 
ATOM   824   C CG  . GLU A 1 104 ? 24.629  10.243  12.286  1.00 64.10  ? 110 GLU P CG  1 
ATOM   825   C CD  . GLU A 1 104 ? 25.193  11.676  12.432  1.00 72.57  ? 110 GLU P CD  1 
ATOM   826   O OE1 . GLU A 1 104 ? 25.594  12.293  11.408  1.00 79.49  ? 110 GLU P OE1 1 
ATOM   827   O OE2 . GLU A 1 104 ? 25.226  12.187  13.577  1.00 67.20  ? 110 GLU P OE2 1 
ATOM   828   N N   . PRO A 1 105 ? 24.997  6.855   15.516  1.00 51.00  ? 111 PRO P N   1 
ATOM   829   C CA  . PRO A 1 105 ? 25.033  6.468   16.933  1.00 48.72  ? 111 PRO P CA  1 
ATOM   830   C C   . PRO A 1 105 ? 25.070  7.669   17.839  1.00 49.61  ? 111 PRO P C   1 
ATOM   831   O O   . PRO A 1 105 ? 25.737  8.627   17.457  1.00 52.14  ? 111 PRO P O   1 
ATOM   832   C CB  . PRO A 1 105 ? 26.345  5.716   17.044  1.00 46.93  ? 111 PRO P CB  1 
ATOM   833   C CG  . PRO A 1 105 ? 26.486  5.079   15.725  1.00 53.73  ? 111 PRO P CG  1 
ATOM   834   C CD  . PRO A 1 105 ? 26.038  6.154   14.752  1.00 54.59  ? 111 PRO P CD  1 
ATOM   835   N N   . ALA A 1 106 ? 24.383  7.615   18.990  1.00 48.39  ? 112 ALA P N   1 
ATOM   836   C CA  . ALA A 1 106 ? 24.318  8.738   19.936  1.00 49.74  ? 112 ALA P CA  1 
ATOM   837   C C   . ALA A 1 106 ? 25.519  8.721   20.862  1.00 48.55  ? 112 ALA P C   1 
ATOM   838   O O   . ALA A 1 106 ? 26.146  7.681   21.058  1.00 46.16  ? 112 ALA P O   1 
ATOM   839   C CB  . ALA A 1 106 ? 23.043  8.696   20.737  1.00 44.24  ? 112 ALA P CB  1 
ATOM   840   N N   . GLU A 1 107 ? 25.883  9.862   21.423  1.00 45.59  ? 113 GLU P N   1 
ATOM   841   C CA  . GLU A 1 107 ? 27.030  9.800   22.304  1.00 50.40  ? 113 GLU P CA  1 
ATOM   842   C C   . GLU A 1 107 ? 26.577  9.547   23.721  1.00 51.03  ? 113 GLU P C   1 
ATOM   843   O O   . GLU A 1 107 ? 25.746  10.276  24.250  1.00 50.57  ? 113 GLU P O   1 
ATOM   844   C CB  . GLU A 1 107 ? 27.923  11.034  22.219  1.00 52.05  ? 113 GLU P CB  1 
ATOM   845   C CG  . GLU A 1 107 ? 29.037  11.011  23.270  1.00 60.97  ? 113 GLU P CG  1 
ATOM   846   C CD  . GLU A 1 107 ? 30.348  11.683  22.836  1.00 73.72  ? 113 GLU P CD  1 
ATOM   847   O OE1 . GLU A 1 107 ? 30.381  12.375  21.786  1.00 69.78  ? 113 GLU P OE1 1 
ATOM   848   O OE2 . GLU A 1 107 ? 31.356  11.502  23.565  1.00 75.40  ? 113 GLU P OE2 1 
ATOM   849   N N   . LEU A 1 108 ? 27.113  8.486   24.312  1.00 47.36  ? 114 LEU P N   1 
ATOM   850   C CA  . LEU A 1 108 ? 26.823  8.152   25.686  1.00 44.30  ? 114 LEU P CA  1 
ATOM   851   C C   . LEU A 1 108 ? 27.495  9.154   26.608  1.00 45.91  ? 114 LEU P C   1 
ATOM   852   O O   . LEU A 1 108 ? 28.648  9.524   26.415  1.00 48.04  ? 114 LEU P O   1 
ATOM   853   C CB  . LEU A 1 108 ? 27.303  6.740   26.015  1.00 46.82  ? 114 LEU P CB  1 
ATOM   854   C CG  . LEU A 1 108 ? 26.770  5.567   25.196  1.00 42.16  ? 114 LEU P CG  1 
ATOM   855   C CD1 . LEU A 1 108 ? 27.386  5.613   23.834  1.00 45.90  ? 114 LEU P CD1 1 
ATOM   856   C CD2 . LEU A 1 108 ? 27.102  4.252   25.885  1.00 46.45  ? 114 LEU P CD2 1 
ATOM   857   N N   . THR A 1 109 ? 26.750  9.582   27.616  1.00 44.96  ? 115 THR P N   1 
ATOM   858   C CA  . THR A 1 109 ? 27.177  10.605  28.547  1.00 44.97  ? 115 THR P CA  1 
ATOM   859   C C   . THR A 1 109 ? 26.451  10.303  29.822  1.00 45.85  ? 115 THR P C   1 
ATOM   860   O O   . THR A 1 109 ? 25.734  9.325   29.891  1.00 48.13  ? 115 THR P O   1 
ATOM   861   C CB  . THR A 1 109 ? 26.718  11.966  28.094  1.00 47.05  ? 115 THR P CB  1 
ATOM   862   O OG1 . THR A 1 109 ? 25.285  12.025  28.149  1.00 50.41  ? 115 THR P OG1 1 
ATOM   863   C CG2 . THR A 1 109 ? 27.169  12.205  26.681  1.00 46.35  ? 115 THR P CG2 1 
ATOM   864   N N   . ASP A 1 110 ? 26.595  11.133  30.838  1.00 47.71  ? 116 ASP P N   1 
ATOM   865   C CA  . ASP A 1 110 ? 26.070  10.707  32.118  1.00 51.01  ? 116 ASP P CA  1 
ATOM   866   C C   . ASP A 1 110 ? 24.570  10.531  32.043  1.00 49.85  ? 116 ASP P C   1 
ATOM   867   O O   . ASP A 1 110 ? 23.999  9.713   32.764  1.00 51.70  ? 116 ASP P O   1 
ATOM   868   C CB  . ASP A 1 110 ? 26.478  11.641  33.261  1.00 59.08  ? 116 ASP P CB  1 
ATOM   869   C CG  . ASP A 1 110 ? 26.373  13.103  32.889  1.00 63.03  ? 116 ASP P CG  1 
ATOM   870   O OD1 . ASP A 1 110 ? 27.136  13.528  31.986  1.00 67.18  ? 116 ASP P OD1 1 
ATOM   871   O OD2 . ASP A 1 110 ? 25.545  13.821  33.510  1.00 63.73  ? 116 ASP P OD2 1 
ATOM   872   N N   . ALA A 1 111 ? 23.924  11.271  31.157  1.00 44.34  ? 117 ALA P N   1 
ATOM   873   C CA  . ALA A 1 111 ? 22.476  11.242  31.158  1.00 48.25  ? 117 ALA P CA  1 
ATOM   874   C C   . ALA A 1 111 ? 21.896  10.523  29.959  1.00 46.82  ? 117 ALA P C   1 
ATOM   875   O O   . ALA A 1 111 ? 20.767  10.802  29.555  1.00 52.89  ? 117 ALA P O   1 
ATOM   876   C CB  . ALA A 1 111 ? 21.904  12.649  31.273  1.00 53.98  ? 117 ALA P CB  1 
ATOM   877   N N   . VAL A 1 112 ? 22.659  9.597   29.398  1.00 40.16  ? 118 VAL P N   1 
ATOM   878   C CA  . VAL A 1 112 ? 22.161  8.756   28.320  1.00 41.97  ? 118 VAL P CA  1 
ATOM   879   C C   . VAL A 1 112 ? 23.105  7.551   28.129  1.00 40.64  ? 118 VAL P C   1 
ATOM   880   O O   . VAL A 1 112 ? 24.077  7.610   27.406  1.00 44.30  ? 118 VAL P O   1 
ATOM   881   C CB  . VAL A 1 112 ? 21.794  9.594   26.996  1.00 38.53  ? 118 VAL P CB  1 
ATOM   882   C CG1 . VAL A 1 112 ? 22.661  10.820  26.835  1.00 38.65  ? 118 VAL P CG1 1 
ATOM   883   C CG2 . VAL A 1 112 ? 21.822  8.762   25.743  1.00 35.25  ? 118 VAL P CG2 1 
ATOM   884   N N   . LYS A 1 113 ? 22.839  6.470   28.841  1.00 35.44  ? 119 LYS P N   1 
ATOM   885   C CA  . LYS A 1 113 ? 23.527  5.211   28.602  1.00 36.62  ? 119 LYS P CA  1 
ATOM   886   C C   . LYS A 1 113 ? 22.531  4.185   27.990  1.00 43.29  ? 119 LYS P C   1 
ATOM   887   O O   . LYS A 1 113 ? 21.515  4.578   27.373  1.00 41.70  ? 119 LYS P O   1 
ATOM   888   C CB  . LYS A 1 113 ? 24.115  4.690   29.909  1.00 41.34  ? 119 LYS P CB  1 
ATOM   889   C CG  . LYS A 1 113 ? 24.805  5.759   30.762  1.00 43.82  ? 119 LYS P CG  1 
ATOM   890   C CD  . LYS A 1 113 ? 25.681  5.140   31.841  1.00 37.47  ? 119 LYS P CD  1 
ATOM   891   C CE  . LYS A 1 113 ? 26.789  6.083   32.325  1.00 43.53  ? 119 LYS P CE  1 
ATOM   892   N NZ  . LYS A 1 113 ? 27.659  6.652   31.239  1.00 45.41  ? 119 LYS P NZ  1 
ATOM   893   N N   . VAL A 1 114 ? 22.814  2.886   28.144  1.00 37.38  ? 120 VAL P N   1 
ATOM   894   C CA  . VAL A 1 114 ? 21.947  1.850   27.575  1.00 34.36  ? 120 VAL P CA  1 
ATOM   895   C C   . VAL A 1 114 ? 21.558  0.738   28.561  1.00 35.88  ? 120 VAL P C   1 
ATOM   896   O O   . VAL A 1 114 ? 22.284  0.434   29.506  1.00 39.68  ? 120 VAL P O   1 
ATOM   897   C CB  . VAL A 1 114 ? 22.530  1.237   26.275  1.00 34.19  ? 120 VAL P CB  1 
ATOM   898   C CG1 . VAL A 1 114 ? 23.635  2.084   25.752  1.00 33.33  ? 120 VAL P CG1 1 
ATOM   899   C CG2 . VAL A 1 114 ? 23.011  -0.176  26.517  1.00 34.62  ? 120 VAL P CG2 1 
ATOM   900   N N   . MET A 1 115 ? 20.391  0.149   28.323  1.00 34.34  ? 121 MET P N   1 
ATOM   901   C CA  . MET A 1 115 ? 19.816  -0.880  29.171  1.00 35.12  ? 121 MET P CA  1 
ATOM   902   C C   . MET A 1 115 ? 20.097  -2.212  28.482  1.00 39.45  ? 121 MET P C   1 
ATOM   903   O O   . MET A 1 115 ? 20.580  -2.211  27.361  1.00 45.12  ? 121 MET P O   1 
ATOM   904   C CB  . MET A 1 115 ? 18.322  -0.624  29.292  1.00 34.19  ? 121 MET P CB  1 
ATOM   905   C CG  . MET A 1 115 ? 17.529  -1.829  29.678  1.00 38.83  ? 121 MET P CG  1 
ATOM   906   S SD  . MET A 1 115 ? 17.928  -2.372  31.347  1.00 48.85  ? 121 MET P SD  1 
ATOM   907   C CE  . MET A 1 115 ? 17.282  -0.958  32.243  1.00 37.44  ? 121 MET P CE  1 
ATOM   908   N N   . ASP A 1 116 ? 19.869  -3.350  29.099  1.00 34.77  ? 122 ASP P N   1 
ATOM   909   C CA  . ASP A 1 116 ? 20.198  -4.550  28.374  1.00 38.08  ? 122 ASP P CA  1 
ATOM   910   C C   . ASP A 1 116 ? 19.309  -5.754  28.573  1.00 40.03  ? 122 ASP P C   1 
ATOM   911   O O   . ASP A 1 116 ? 18.692  -5.931  29.592  1.00 39.01  ? 122 ASP P O   1 
ATOM   912   C CB  . ASP A 1 116 ? 21.680  -4.903  28.473  1.00 45.01  ? 122 ASP P CB  1 
ATOM   913   C CG  . ASP A 1 116 ? 22.222  -4.850  29.867  1.00 47.81  ? 122 ASP P CG  1 
ATOM   914   O OD1 . ASP A 1 116 ? 21.906  -3.928  30.607  1.00 49.78  ? 122 ASP P OD1 1 
ATOM   915   O OD2 . ASP A 1 116 ? 23.022  -5.719  30.226  1.00 48.90  ? 122 ASP P OD2 1 
ATOM   916   N N   . LEU A 1 117 ? 19.281  -6.583  27.550  1.00 41.10  ? 123 LEU P N   1 
ATOM   917   C CA  . LEU A 1 117 ? 18.287  -7.607  27.363  1.00 42.69  ? 123 LEU P CA  1 
ATOM   918   C C   . LEU A 1 117 ? 18.332  -8.695  28.392  1.00 41.39  ? 123 LEU P C   1 
ATOM   919   O O   . LEU A 1 117 ? 19.386  -9.086  28.812  1.00 43.60  ? 123 LEU P O   1 
ATOM   920   C CB  . LEU A 1 117 ? 18.446  -8.193  25.974  1.00 42.92  ? 123 LEU P CB  1 
ATOM   921   C CG  . LEU A 1 117 ? 17.703  -7.401  24.917  1.00 37.99  ? 123 LEU P CG  1 
ATOM   922   C CD1 . LEU A 1 117 ? 17.758  -6.009  25.317  1.00 32.79  ? 123 LEU P CD1 1 
ATOM   923   C CD2 . LEU A 1 117 ? 18.307  -7.541  23.589  1.00 30.90  ? 123 LEU P CD2 1 
ATOM   924   N N   . PRO A 1 118 ? 17.172  -9.208  28.761  1.00 37.61  ? 124 PRO P N   1 
ATOM   925   C CA  . PRO A 1 118 ? 17.043  -10.070 29.911  1.00 41.71  ? 124 PRO P CA  1 
ATOM   926   C C   . PRO A 1 118 ? 17.137  -11.492 29.501  1.00 42.47  ? 124 PRO P C   1 
ATOM   927   O O   . PRO A 1 118 ? 16.859  -11.754 28.373  1.00 42.65  ? 124 PRO P O   1 
ATOM   928   C CB  . PRO A 1 118 ? 15.627  -9.776  30.382  1.00 43.56  ? 124 PRO P CB  1 
ATOM   929   C CG  . PRO A 1 118 ? 15.089  -8.751  29.489  1.00 42.34  ? 124 PRO P CG  1 
ATOM   930   C CD  . PRO A 1 118 ? 15.849  -8.865  28.256  1.00 39.39  ? 124 PRO P CD  1 
ATOM   931   N N   . THR A 1 119 ? 17.554  -12.438 30.272  1.00 43.36  ? 125 THR P N   1 
ATOM   932   C CA  . THR A 1 119 ? 17.713  -13.807 29.826  1.00 44.43  ? 125 THR P CA  1 
ATOM   933   C C   . THR A 1 119 ? 16.791  -14.723 30.587  1.00 44.21  ? 125 THR P C   1 
ATOM   934   O O   . THR A 1 119 ? 16.445  -15.767 30.099  1.00 44.73  ? 125 THR P O   1 
ATOM   935   C CB  . THR A 1 119 ? 19.064  -14.342 30.196  1.00 44.64  ? 125 THR P CB  1 
ATOM   936   O OG1 . THR A 1 119 ? 19.456  -13.720 31.427  1.00 48.18  ? 125 THR P OG1 1 
ATOM   937   C CG2 . THR A 1 119 ? 20.151  -14.119 29.144  1.00 44.59  ? 125 THR P CG2 1 
ATOM   938   N N   . GLN A 1 120 ? 16.417  -14.436 31.840  1.00 44.26  ? 128 GLN P N   1 
ATOM   939   C CA  . GLN A 1 120 ? 15.366  -15.160 32.533  1.00 45.49  ? 128 GLN P CA  1 
ATOM   940   C C   . GLN A 1 120 ? 14.162  -14.229 32.667  1.00 45.14  ? 128 GLN P C   1 
ATOM   941   O O   . GLN A 1 120 ? 14.292  -13.005 32.553  1.00 42.81  ? 128 GLN P O   1 
ATOM   942   C CB  . GLN A 1 120 ? 15.880  -15.522 33.914  1.00 50.81  ? 128 GLN P CB  1 
ATOM   943   C CG  . GLN A 1 120 ? 15.292  -16.747 34.587  1.00 52.97  ? 128 GLN P CG  1 
ATOM   944   C CD  . GLN A 1 120 ? 16.170  -17.167 35.772  1.00 59.75  ? 128 GLN P CD  1 
ATOM   945   O OE1 . GLN A 1 120 ? 16.863  -18.193 35.717  1.00 61.56  ? 128 GLN P OE1 1 
ATOM   946   N NE2 . GLN A 1 120 ? 16.180  -16.343 36.830  1.00 54.22  ? 128 GLN P NE2 1 
ATOM   947   N N   . GLU A 1 121 ? 12.987  -14.796 32.901  1.00 40.48  ? 129 GLU P N   1 
ATOM   948   C CA  . GLU A 1 121 ? 11.810  -13.959 33.034  1.00 40.61  ? 129 GLU P CA  1 
ATOM   949   C C   . GLU A 1 121 ? 11.606  -13.712 34.508  1.00 43.78  ? 129 GLU P C   1 
ATOM   950   O O   . GLU A 1 121 ? 12.339  -14.284 35.321  1.00 42.93  ? 129 GLU P O   1 
ATOM   951   C CB  . GLU A 1 121 ? 10.573  -14.579 32.355  1.00 45.37  ? 129 GLU P CB  1 
ATOM   952   C CG  . GLU A 1 121 ? 9.600   -15.355 33.280  1.00 51.71  ? 129 GLU P CG  1 
ATOM   953   C CD  . GLU A 1 121 ? 8.422   -16.044 32.524  1.00 60.02  ? 129 GLU P CD  1 
ATOM   954   O OE1 . GLU A 1 121 ? 7.547   -15.317 31.974  1.00 54.36  ? 129 GLU P OE1 1 
ATOM   955   O OE2 . GLU A 1 121 ? 8.370   -17.312 32.499  1.00 58.59  ? 129 GLU P OE2 1 
ATOM   956   N N   . PRO A 1 122 ? 10.640  -12.830 34.858  1.00 44.80  ? 130 PRO P N   1 
ATOM   957   C CA  . PRO A 1 122 ? 10.363  -12.418 36.245  1.00 38.35  ? 130 PRO P CA  1 
ATOM   958   C C   . PRO A 1 122 ? 9.411   -13.388 36.898  1.00 37.65  ? 130 PRO P C   1 
ATOM   959   O O   . PRO A 1 122 ? 8.537   -13.870 36.203  1.00 47.15  ? 130 PRO P O   1 
ATOM   960   C CB  . PRO A 1 122 ? 9.607   -11.096 36.068  1.00 35.48  ? 130 PRO P CB  1 
ATOM   961   C CG  . PRO A 1 122 ? 9.518   -10.845 34.594  1.00 35.66  ? 130 PRO P CG  1 
ATOM   962   C CD  . PRO A 1 122 ? 9.733   -12.148 33.921  1.00 37.32  ? 130 PRO P CD  1 
ATOM   963   N N   . ALA A 1 123 ? 9.516   -13.656 38.188  1.00 36.03  ? 131 ALA P N   1 
ATOM   964   C CA  . ALA A 1 123 ? 8.580   -14.599 38.794  1.00 36.88  ? 131 ALA P CA  1 
ATOM   965   C C   . ALA A 1 123 ? 7.525   -13.900 39.614  1.00 34.57  ? 131 ALA P C   1 
ATOM   966   O O   . ALA A 1 123 ? 7.751   -12.814 40.093  1.00 36.44  ? 131 ALA P O   1 
ATOM   967   C CB  . ALA A 1 123 ? 9.316   -15.593 39.641  1.00 46.43  ? 131 ALA P CB  1 
ATOM   968   N N   . LEU A 1 124 ? 6.375   -14.537 39.799  1.00 37.88  ? 132 LEU P N   1 
ATOM   969   C CA  . LEU A 1 124 ? 5.213   -13.857 40.383  1.00 38.57  ? 132 LEU P CA  1 
ATOM   970   C C   . LEU A 1 124 ? 5.473   -13.331 41.769  1.00 36.19  ? 132 LEU P C   1 
ATOM   971   O O   . LEU A 1 124 ? 5.846   -14.083 42.662  1.00 40.60  ? 132 LEU P O   1 
ATOM   972   C CB  . LEU A 1 124 ? 3.971   -14.762 40.374  1.00 39.06  ? 132 LEU P CB  1 
ATOM   973   C CG  . LEU A 1 124 ? 3.497   -15.114 38.958  1.00 35.68  ? 132 LEU P CG  1 
ATOM   974   C CD1 . LEU A 1 124 ? 3.410   -16.615 38.730  1.00 33.72  ? 132 LEU P CD1 1 
ATOM   975   C CD2 . LEU A 1 124 ? 2.194   -14.443 38.691  1.00 32.84  ? 132 LEU P CD2 1 
ATOM   976   N N   . GLY A 1 125 ? 5.259   -12.035 41.940  1.00 33.46  ? 133 GLY P N   1 
ATOM   977   C CA  . GLY A 1 125 ? 5.524   -11.383 43.202  1.00 35.10  ? 133 GLY P CA  1 
ATOM   978   C C   . GLY A 1 125 ? 6.792   -10.578 43.069  1.00 41.11  ? 133 GLY P C   1 
ATOM   979   O O   . GLY A 1 125 ? 7.352   -10.095 44.042  1.00 47.95  ? 133 GLY P O   1 
ATOM   980   N N   . THR A 1 126 ? 7.267   -10.440 41.839  1.00 42.99  ? 134 THR P N   1 
ATOM   981   C CA  . THR A 1 126 ? 8.487   -9.687  41.593  1.00 40.00  ? 134 THR P CA  1 
ATOM   982   C C   . THR A 1 126 ? 8.122   -8.222  41.533  1.00 39.66  ? 134 THR P C   1 
ATOM   983   O O   . THR A 1 126 ? 7.242   -7.828  40.775  1.00 40.42  ? 134 THR P O   1 
ATOM   984   C CB  . THR A 1 126 ? 9.232   -10.177 40.317  1.00 36.84  ? 134 THR P CB  1 
ATOM   985   O OG1 . THR A 1 126 ? 9.693   -11.516 40.531  1.00 40.35  ? 134 THR P OG1 1 
ATOM   986   C CG2 . THR A 1 126 ? 10.441  -9.315  40.009  1.00 39.61  ? 134 THR P CG2 1 
ATOM   987   N N   . THR A 1 127 ? 8.776   -7.432  42.373  1.00 38.49  ? 135 THR P N   1 
ATOM   988   C CA  . THR A 1 127 ? 8.532   -5.996  42.449  1.00 43.21  ? 135 THR P CA  1 
ATOM   989   C C   . THR A 1 127 ? 9.145   -5.226  41.271  1.00 42.11  ? 135 THR P C   1 
ATOM   990   O O   . THR A 1 127 ? 10.244  -5.529  40.823  1.00 42.83  ? 135 THR P O   1 
ATOM   991   C CB  . THR A 1 127 ? 9.106   -5.450  43.758  1.00 48.83  ? 135 THR P CB  1 
ATOM   992   O OG1 . THR A 1 127 ? 10.085  -6.384  44.250  1.00 49.15  ? 135 THR P OG1 1 
ATOM   993   C CG2 . THR A 1 127 ? 7.983   -5.242  44.795  1.00 45.59  ? 135 THR P CG2 1 
ATOM   994   N N   . CYS A 1 128 ? 8.430   -4.216  40.791  1.00 40.39  ? 136 CYS P N   1 
ATOM   995   C CA  . CYS A 1 128 ? 8.771   -3.545  39.544  1.00 38.39  ? 136 CYS P CA  1 
ATOM   996   C C   . CYS A 1 128 ? 8.494   -2.076  39.661  1.00 38.83  ? 136 CYS P C   1 
ATOM   997   O O   . CYS A 1 128 ? 8.170   -1.593  40.737  1.00 44.58  ? 136 CYS P O   1 
ATOM   998   C CB  . CYS A 1 128 ? 7.904   -4.063  38.406  1.00 38.13  ? 136 CYS P CB  1 
ATOM   999   S SG  . CYS A 1 128 ? 8.306   -5.708  37.871  1.00 50.61  ? 136 CYS P SG  1 
ATOM   1000  N N   . TYR A 1 129 ? 8.609   -1.384  38.534  1.00 32.78  ? 137 TYR P N   1 
ATOM   1001  C CA  . TYR A 1 129 ? 8.244   0.012   38.409  1.00 33.57  ? 137 TYR P CA  1 
ATOM   1002  C C   . TYR A 1 129 ? 8.423   0.325   36.966  1.00 35.53  ? 137 TYR P C   1 
ATOM   1003  O O   . TYR A 1 129 ? 9.155   -0.379  36.275  1.00 36.12  ? 137 TYR P O   1 
ATOM   1004  C CB  . TYR A 1 129 ? 9.138   0.939   39.236  1.00 37.85  ? 137 TYR P CB  1 
ATOM   1005  C CG  . TYR A 1 129 ? 10.492  1.227   38.647  1.00 36.48  ? 137 TYR P CG  1 
ATOM   1006  C CD1 . TYR A 1 129 ? 10.700  2.338   37.848  1.00 36.85  ? 137 TYR P CD1 1 
ATOM   1007  C CD2 . TYR A 1 129 ? 11.568  0.391   38.903  1.00 38.78  ? 137 TYR P CD2 1 
ATOM   1008  C CE1 . TYR A 1 129 ? 11.940  2.600   37.296  1.00 39.21  ? 137 TYR P CE1 1 
ATOM   1009  C CE2 . TYR A 1 129 ? 12.824  0.647   38.373  1.00 41.11  ? 137 TYR P CE2 1 
ATOM   1010  C CZ  . TYR A 1 129 ? 13.006  1.754   37.569  1.00 42.42  ? 137 TYR P CZ  1 
ATOM   1011  O OH  . TYR A 1 129 ? 14.253  2.004   37.029  1.00 38.88  ? 137 TYR P OH  1 
ATOM   1012  N N   . ALA A 1 130 ? 7.776   1.396   36.521  1.00 33.80  ? 138 ALA P N   1 
ATOM   1013  C CA  . ALA A 1 130 ? 7.735   1.743   35.116  1.00 32.79  ? 138 ALA P CA  1 
ATOM   1014  C C   . ALA A 1 130 ? 7.584   3.237   34.912  1.00 37.41  ? 138 ALA P C   1 
ATOM   1015  O O   . ALA A 1 130 ? 6.782   3.864   35.590  1.00 39.81  ? 138 ALA P O   1 
ATOM   1016  C CB  . ALA A 1 130 ? 6.608   1.036   34.477  1.00 31.35  ? 138 ALA P CB  1 
ATOM   1017  N N   . SER A 1 131 ? 8.329   3.788   33.946  1.00 43.17  ? 139 SER P N   1 
ATOM   1018  C CA  . SER A 1 131 ? 8.436   5.247   33.728  1.00 47.35  ? 139 SER P CA  1 
ATOM   1019  C C   . SER A 1 131 ? 7.704   5.841   32.495  1.00 53.98  ? 139 SER P C   1 
ATOM   1020  O O   . SER A 1 131 ? 7.355   5.138   31.535  1.00 55.37  ? 139 SER P O   1 
ATOM   1021  C CB  . SER A 1 131 ? 9.911   5.657   33.703  1.00 47.84  ? 139 SER P CB  1 
ATOM   1022  O OG  . SER A 1 131 ? 10.655  4.782   32.871  1.00 46.99  ? 139 SER P OG  1 
ATOM   1023  N N   . GLY A 1 132 ? 7.483   7.152   32.539  1.00 55.17  ? 140 GLY P N   1 
ATOM   1024  C CA  . GLY A 1 132 ? 6.762   7.852   31.489  1.00 68.66  ? 140 GLY P CA  1 
ATOM   1025  C C   . GLY A 1 132 ? 6.525   9.322   31.817  1.00 69.92  ? 140 GLY P C   1 
ATOM   1026  O O   . GLY A 1 132 ? 6.707   9.740   32.965  1.00 64.86  ? 140 GLY P O   1 
ATOM   1027  N N   . TRP A 1 133 ? 6.114   10.119  30.832  1.00 69.70  ? 141 TRP P N   1 
ATOM   1028  C CA  . TRP A 1 133 ? 6.109   11.549  31.079  1.00 66.58  ? 141 TRP P CA  1 
ATOM   1029  C C   . TRP A 1 133 ? 4.818   12.090  31.595  1.00 79.38  ? 141 TRP P C   1 
ATOM   1030  O O   . TRP A 1 133 ? 4.790   12.890  32.529  1.00 85.41  ? 141 TRP P O   1 
ATOM   1031  C CB  . TRP A 1 133 ? 6.647   12.359  29.901  1.00 62.81  ? 141 TRP P CB  1 
ATOM   1032  C CG  . TRP A 1 133 ? 8.108   12.421  30.039  1.00 60.49  ? 141 TRP P CG  1 
ATOM   1033  C CD1 . TRP A 1 133 ? 8.820   13.157  30.946  1.00 59.68  ? 141 TRP P CD1 1 
ATOM   1034  C CD2 . TRP A 1 133 ? 9.054   11.635  29.335  1.00 57.02  ? 141 TRP P CD2 1 
ATOM   1035  N NE1 . TRP A 1 133 ? 10.155  12.902  30.823  1.00 50.13  ? 141 TRP P NE1 1 
ATOM   1036  C CE2 . TRP A 1 133 ? 10.327  11.966  29.836  1.00 54.84  ? 141 TRP P CE2 1 
ATOM   1037  C CE3 . TRP A 1 133 ? 8.954   10.690  28.312  1.00 52.48  ? 141 TRP P CE3 1 
ATOM   1038  C CZ2 . TRP A 1 133 ? 11.493  11.390  29.336  1.00 55.15  ? 141 TRP P CZ2 1 
ATOM   1039  C CZ3 . TRP A 1 133 ? 10.106  10.116  27.827  1.00 48.83  ? 141 TRP P CZ3 1 
ATOM   1040  C CH2 . TRP A 1 133 ? 11.359  10.467  28.335  1.00 48.57  ? 141 TRP P CH2 1 
ATOM   1041  N N   . GLY A 1 134 ? 3.732   11.657  31.009  1.00 86.43  ? 142 GLY P N   1 
ATOM   1042  C CA  . GLY A 1 134 ? 2.497   12.241  31.426  1.00 100.49 ? 142 GLY P CA  1 
ATOM   1043  C C   . GLY A 1 134 ? 1.392   11.496  30.778  1.00 111.22 ? 142 GLY P C   1 
ATOM   1044  O O   . GLY A 1 134 ? 1.587   10.813  29.769  1.00 106.36 ? 142 GLY P O   1 
ATOM   1045  N N   . SER A 1 135 ? 0.233   11.631  31.401  1.00 121.67 ? 143 SER P N   1 
ATOM   1046  C CA  . SER A 1 135 ? -1.014  11.179  30.846  1.00 129.10 ? 143 SER P CA  1 
ATOM   1047  C C   . SER A 1 135 ? -0.859  10.929  29.342  1.00 131.11 ? 143 SER P C   1 
ATOM   1048  O O   . SER A 1 135 ? -0.372  11.798  28.603  1.00 128.11 ? 143 SER P O   1 
ATOM   1049  C CB  . SER A 1 135 ? -2.078  12.240  31.132  1.00 134.11 ? 143 SER P CB  1 
ATOM   1050  O OG  . SER A 1 135 ? -1.672  13.076  32.217  1.00 130.35 ? 143 SER P OG  1 
ATOM   1051  N N   . ILE A 1 136 ? -1.227  9.722   28.907  1.00 131.50 ? 144 ILE P N   1 
ATOM   1052  C CA  . ILE A 1 136 ? -1.287  9.390   27.486  1.00 127.34 ? 144 ILE P CA  1 
ATOM   1053  C C   . ILE A 1 136 ? -2.772  9.282   27.090  1.00 128.72 ? 144 ILE P C   1 
ATOM   1054  O O   . ILE A 1 136 ? -3.121  8.595   26.128  1.00 124.09 ? 144 ILE P O   1 
ATOM   1055  C CB  . ILE A 1 136 ? -0.470  8.094   27.159  1.00 106.65 ? 144 ILE P CB  1 
ATOM   1056  C CG1 . ILE A 1 136 ? 0.083   8.111   25.722  1.00 99.00  ? 144 ILE P CG1 1 
ATOM   1057  C CG2 . ILE A 1 136 ? -1.281  6.846   27.476  1.00 107.29 ? 144 ILE P CG2 1 
ATOM   1058  C CD1 . ILE A 1 136 ? 0.995   9.294   25.414  1.00 90.60  ? 144 ILE P CD1 1 
ATOM   1059  N N   . GLU A 1 137 ? -3.621  10.001  27.842  1.00 138.62 ? 145 GLU P N   1 
ATOM   1060  C CA  . GLU A 1 137 ? -5.093  10.023  27.679  1.00 141.96 ? 145 GLU P CA  1 
ATOM   1061  C C   . GLU A 1 137 ? -5.792  11.409  27.503  1.00 146.11 ? 145 GLU P C   1 
ATOM   1062  O O   . GLU A 1 137 ? -7.020  11.449  27.391  1.00 145.84 ? 145 GLU P O   1 
ATOM   1063  C CB  . GLU A 1 137 ? -5.777  9.274   28.848  1.00 136.33 ? 145 GLU P CB  1 
ATOM   1064  C CG  . GLU A 1 137 ? -6.396  7.910   28.497  1.00 135.78 ? 145 GLU P CG  1 
ATOM   1065  C CD  . GLU A 1 137 ? -6.851  7.114   29.728  1.00 139.04 ? 145 GLU P CD  1 
ATOM   1066  O OE1 . GLU A 1 137 ? -7.200  7.739   30.754  1.00 140.12 ? 145 GLU P OE1 1 
ATOM   1067  O OE2 . GLU A 1 137 ? -6.859  5.861   29.667  1.00 133.63 ? 145 GLU P OE2 1 
ATOM   1068  N N   . PRO A 1 138 ? -5.039  12.541  27.509  1.00 148.95 ? 146 PRO P N   1 
ATOM   1069  C CA  . PRO A 1 138 ? -5.714  13.830  27.286  1.00 152.11 ? 146 PRO P CA  1 
ATOM   1070  C C   . PRO A 1 138 ? -5.166  14.667  26.118  1.00 153.03 ? 146 PRO P C   1 
ATOM   1071  O O   . PRO A 1 138 ? -4.213  14.273  25.443  1.00 153.44 ? 146 PRO P O   1 
ATOM   1072  C CB  . PRO A 1 138 ? -5.419  14.588  28.588  1.00 150.17 ? 146 PRO P CB  1 
ATOM   1073  C CG  . PRO A 1 138 ? -4.160  13.906  29.169  1.00 148.77 ? 146 PRO P CG  1 
ATOM   1074  C CD  . PRO A 1 138 ? -3.776  12.775  28.222  1.00 147.45 ? 146 PRO P CD  1 
ATOM   1075  N N   . GLU A 1 139 ? -5.770  15.836  25.911  1.00 153.30 ? 147 GLU P N   1 
ATOM   1076  C CA  . GLU A 1 139 ? -5.346  16.778  24.878  1.00 154.07 ? 147 GLU P CA  1 
ATOM   1077  C C   . GLU A 1 139 ? -3.900  17.214  25.125  1.00 152.87 ? 147 GLU P C   1 
ATOM   1078  O O   . GLU A 1 139 ? -3.048  17.145  24.236  1.00 151.48 ? 147 GLU P O   1 
ATOM   1079  C CB  . GLU A 1 139 ? -6.291  17.980  24.880  1.00 155.89 ? 147 GLU P CB  1 
ATOM   1080  C CG  . GLU A 1 139 ? -7.716  17.609  25.298  1.00 156.79 ? 147 GLU P CG  1 
ATOM   1081  C CD  . GLU A 1 139 ? -8.707  18.748  25.145  1.00 157.42 ? 147 GLU P CD  1 
ATOM   1082  O OE1 . GLU A 1 139 ? -8.707  19.669  25.992  1.00 155.43 ? 147 GLU P OE1 1 
ATOM   1083  O OE2 . GLU A 1 139 ? -9.497  18.710  24.178  1.00 156.74 ? 147 GLU P OE2 1 
ATOM   1084  N N   . GLU A 1 140 ? -3.640  17.673  26.345  1.00 154.64 ? 148 GLU P N   1 
ATOM   1085  C CA  . GLU A 1 140 ? -2.278  17.825  26.848  1.00 153.50 ? 148 GLU P CA  1 
ATOM   1086  C C   . GLU A 1 140 ? -2.214  17.158  28.227  1.00 155.21 ? 148 GLU P C   1 
ATOM   1087  O O   . GLU A 1 140 ? -3.033  17.457  29.107  1.00 152.37 ? 148 GLU P O   1 
ATOM   1088  C CB  . GLU A 1 140 ? -1.862  19.302  26.927  1.00 149.64 ? 148 GLU P CB  1 
ATOM   1089  C CG  . GLU A 1 140 ? -2.363  20.053  28.170  1.00 146.01 ? 148 GLU P CG  1 
ATOM   1090  C CD  . GLU A 1 140 ? -1.996  21.526  28.146  1.00 139.28 ? 148 GLU P CD  1 
ATOM   1091  O OE1 . GLU A 1 140 ? -2.010  22.172  29.219  1.00 129.98 ? 148 GLU P OE1 1 
ATOM   1092  O OE2 . GLU A 1 140 ? -1.694  22.034  27.045  1.00 139.44 ? 148 GLU P OE2 1 
ATOM   1093  N N   . PHE A 1 141 ? -1.260  16.238  28.396  1.00 151.00 ? 149 PHE P N   1 
ATOM   1094  C CA  . PHE A 1 141 ? -1.088  15.483  29.647  1.00 142.22 ? 149 PHE P CA  1 
ATOM   1095  C C   . PHE A 1 141 ? -1.332  16.347  30.878  1.00 143.77 ? 149 PHE P C   1 
ATOM   1096  O O   . PHE A 1 141 ? -2.225  16.086  31.697  1.00 142.73 ? 149 PHE P O   1 
ATOM   1097  C CB  . PHE A 1 141 ? 0.329   14.890  29.766  1.00 129.62 ? 149 PHE P CB  1 
ATOM   1098  C CG  . PHE A 1 141 ? 1.172   15.017  28.525  1.00 125.13 ? 149 PHE P CG  1 
ATOM   1099  C CD1 . PHE A 1 141 ? 1.903   13.933  28.067  1.00 118.87 ? 149 PHE P CD1 1 
ATOM   1100  C CD2 . PHE A 1 141 ? 1.255   16.213  27.829  1.00 129.30 ? 149 PHE P CD2 1 
ATOM   1101  C CE1 . PHE A 1 141 ? 2.689   14.037  26.937  1.00 114.56 ? 149 PHE P CE1 1 
ATOM   1102  C CE2 . PHE A 1 141 ? 2.028   16.320  26.692  1.00 122.45 ? 149 PHE P CE2 1 
ATOM   1103  C CZ  . PHE A 1 141 ? 2.751   15.231  26.249  1.00 110.70 ? 149 PHE P CZ  1 
ATOM   1104  N N   . LEU A 1 142 ? -0.500  17.380  30.970  0.00 140.20 ? 150 LEU P N   1 
ATOM   1105  C CA  . LEU A 1 142 ? -0.513  18.345  32.054  0.51 136.69 ? 150 LEU P CA  1 
ATOM   1106  C C   . LEU A 1 142 ? 0.632   19.327  31.831  0.91 131.56 ? 150 LEU P C   1 
ATOM   1107  O O   . LEU A 1 142 ? 1.492   19.113  30.976  1.00 125.34 ? 150 LEU P O   1 
ATOM   1108  C CB  . LEU A 1 142 ? -0.353  17.661  33.398  1.00 137.24 ? 150 LEU P CB  1 
ATOM   1109  C CG  . LEU A 1 142 ? -0.744  18.594  34.540  1.00 139.82 ? 150 LEU P CG  1 
ATOM   1110  C CD1 . LEU A 1 142 ? -2.228  18.929  34.449  1.00 141.36 ? 150 LEU P CD1 1 
ATOM   1111  C CD2 . LEU A 1 142 ? -0.386  17.982  35.885  1.00 142.11 ? 150 LEU P CD2 1 
ATOM   1112  N N   . THR A 1 143 ? 0.646   20.406  32.605  0.41 128.95 ? 151 THR P N   1 
ATOM   1113  C CA  . THR A 1 143 ? 1.662   21.434  32.429  1.00 123.10 ? 151 THR P CA  1 
ATOM   1114  C C   . THR A 1 143 ? 3.002   21.121  33.118  0.00 119.82 ? 151 THR P C   1 
ATOM   1115  O O   . THR A 1 143 ? 3.992   21.777  32.837  0.60 115.61 ? 151 THR P O   1 
ATOM   1116  C CB  . THR A 1 143 ? 1.180   22.772  32.950  1.00 122.99 ? 151 THR P CB  1 
ATOM   1117  O OG1 . THR A 1 143 ? 2.283   23.476  33.518  0.82 125.96 ? 151 THR P OG1 1 
ATOM   1118  C CG2 . THR A 1 143 ? 0.168   22.547  34.046  1.00 123.92 ? 151 THR P CG2 1 
ATOM   1119  N N   . PRO A 1 144 ? 3.029   20.132  34.012  0.00 119.67 ? 152 PRO P N   1 
ATOM   1120  C CA  . PRO A 1 144 ? 4.261   19.734  34.729  0.71 113.69 ? 152 PRO P CA  1 
ATOM   1121  C C   . PRO A 1 144 ? 5.084   18.761  33.877  0.00 105.39 ? 152 PRO P C   1 
ATOM   1122  O O   . PRO A 1 144 ? 4.568   18.104  32.976  0.77 110.01 ? 152 PRO P O   1 
ATOM   1123  C CB  . PRO A 1 144 ? 3.741   19.073  36.016  1.00 116.98 ? 152 PRO P CB  1 
ATOM   1124  C CG  . PRO A 1 144 ? 2.263   19.405  36.091  0.73 121.95 ? 152 PRO P CG  1 
ATOM   1125  C CD  . PRO A 1 144 ? 1.806   19.680  34.701  0.65 123.42 ? 152 PRO P CD  1 
ATOM   1126  N N   . LYS A 1 145 ? 6.379   18.687  34.138  1.00 93.93  ? 153 LYS P N   1 
ATOM   1127  C CA  . LYS A 1 145 ? 7.264   18.076  33.198  1.00 85.30  ? 153 LYS P CA  1 
ATOM   1128  C C   . LYS A 1 145 ? 7.572   16.617  33.420  0.03 78.36  ? 153 LYS P C   1 
ATOM   1129  O O   . LYS A 1 145 ? 7.293   15.792  32.578  0.73 73.92  ? 153 LYS P O   1 
ATOM   1130  C CB  . LYS A 1 145 ? 8.554   18.884  33.177  0.33 85.11  ? 153 LYS P CB  1 
ATOM   1131  C CG  . LYS A 1 145 ? 8.340   20.273  33.666  1.00 85.06  ? 153 LYS P CG  1 
ATOM   1132  C CD  . LYS A 1 145 ? 9.503   20.704  34.478  0.91 80.50  ? 153 LYS P CD  1 
ATOM   1133  C CE  . LYS A 1 145 ? 9.087   21.179  35.821  1.00 79.79  ? 153 LYS P CE  1 
ATOM   1134  N NZ  . LYS A 1 145 ? 8.041   22.228  35.840  0.53 90.28  ? 153 LYS P NZ  1 
ATOM   1135  N N   . LYS A 1 146 ? 8.121   16.304  34.583  1.00 74.24  ? 154 LYS P N   1 
ATOM   1136  C CA  . LYS A 1 146 ? 9.061   15.221  34.798  1.00 71.05  ? 154 LYS P CA  1 
ATOM   1137  C C   . LYS A 1 146 ? 8.637   13.749  34.792  1.00 62.00  ? 154 LYS P C   1 
ATOM   1138  O O   . LYS A 1 146 ? 7.505   13.409  34.946  1.00 54.64  ? 154 LYS P O   1 
ATOM   1139  C CB  . LYS A 1 146 ? 9.846   15.543  36.059  1.00 70.24  ? 154 LYS P CB  1 
ATOM   1140  C CG  . LYS A 1 146 ? 9.846   17.013  36.382  1.00 70.29  ? 154 LYS P CG  1 
ATOM   1141  C CD  . LYS A 1 146 ? 9.973   17.270  37.872  1.00 70.43  ? 154 LYS P CD  1 
ATOM   1142  C CE  . LYS A 1 146 ? 8.898   18.214  38.377  1.00 65.41  ? 154 LYS P CE  1 
ATOM   1143  N NZ  . LYS A 1 146 ? 9.307   19.635  38.403  1.00 58.14  ? 154 LYS P NZ  1 
ATOM   1144  N N   . LEU A 1 147 ? 9.610   12.875  34.640  1.00 58.15  ? 155 LEU P N   1 
ATOM   1145  C CA  . LEU A 1 147 ? 9.367   11.448  34.493  1.00 53.93  ? 155 LEU P CA  1 
ATOM   1146  C C   . LEU A 1 147 ? 8.652   11.030  35.727  1.00 54.15  ? 155 LEU P C   1 
ATOM   1147  O O   . LEU A 1 147 ? 8.661   11.758  36.701  1.00 58.14  ? 155 LEU P O   1 
ATOM   1148  C CB  . LEU A 1 147 ? 10.672  10.655  34.403  1.00 54.49  ? 155 LEU P CB  1 
ATOM   1149  C CG  . LEU A 1 147 ? 11.289  10.241  33.064  1.00 52.31  ? 155 LEU P CG  1 
ATOM   1150  C CD1 . LEU A 1 147 ? 12.460  9.308   33.296  1.00 41.86  ? 155 LEU P CD1 1 
ATOM   1151  C CD2 . LEU A 1 147 ? 10.270  9.562   32.183  1.00 53.70  ? 155 LEU P CD2 1 
ATOM   1152  N N   . GLN A 1 148 ? 8.065   9.840   35.691  1.00 54.82  ? 156 GLN P N   1 
ATOM   1153  C CA  . GLN A 1 148 ? 7.221   9.329   36.763  1.00 51.32  ? 156 GLN P CA  1 
ATOM   1154  C C   . GLN A 1 148 ? 7.530   7.875   36.969  1.00 48.41  ? 156 GLN P C   1 
ATOM   1155  O O   . GLN A 1 148 ? 7.523   7.112   36.025  1.00 49.41  ? 156 GLN P O   1 
ATOM   1156  C CB  . GLN A 1 148 ? 5.760   9.421   36.341  1.00 53.18  ? 156 GLN P CB  1 
ATOM   1157  C CG  . GLN A 1 148 ? 5.282   10.828  36.103  1.00 64.54  ? 156 GLN P CG  1 
ATOM   1158  C CD  . GLN A 1 148 ? 5.168   11.592  37.398  1.00 70.68  ? 156 GLN P CD  1 
ATOM   1159  O OE1 . GLN A 1 148 ? 4.575   11.088  38.352  1.00 75.93  ? 156 GLN P OE1 1 
ATOM   1160  N NE2 . GLN A 1 148 ? 5.743   12.805  37.452  1.00 63.17  ? 156 GLN P NE2 1 
ATOM   1161  N N   . CYS A 1 149 ? 7.777   7.455   38.193  1.00 45.13  ? 157 CYS P N   1 
ATOM   1162  C CA  . CYS A 1 149 ? 7.978   6.036   38.401  1.00 41.56  ? 157 CYS P CA  1 
ATOM   1163  C C   . CYS A 1 149 ? 6.950   5.488   39.349  1.00 44.51  ? 157 CYS P C   1 
ATOM   1164  O O   . CYS A 1 149 ? 6.880   5.931   40.484  1.00 51.52  ? 157 CYS P O   1 
ATOM   1165  C CB  . CYS A 1 149 ? 9.375   5.774   38.930  1.00 43.71  ? 157 CYS P CB  1 
ATOM   1166  S SG  . CYS A 1 149 ? 10.642  6.264   37.746  1.00 52.84  ? 157 CYS P SG  1 
ATOM   1167  N N   . VAL A 1 150 ? 6.140   4.533   38.898  1.00 40.18  ? 158 VAL P N   1 
ATOM   1168  C CA  . VAL A 1 150 ? 5.091   4.008   39.759  1.00 43.68  ? 158 VAL P CA  1 
ATOM   1169  C C   . VAL A 1 150 ? 5.318   2.542   40.135  1.00 43.92  ? 158 VAL P C   1 
ATOM   1170  O O   . VAL A 1 150 ? 5.531   1.718   39.272  1.00 39.93  ? 158 VAL P O   1 
ATOM   1171  C CB  . VAL A 1 150 ? 3.740   4.233   39.135  1.00 40.21  ? 158 VAL P CB  1 
ATOM   1172  C CG1 . VAL A 1 150 ? 3.641   5.677   38.693  1.00 47.58  ? 158 VAL P CG1 1 
ATOM   1173  C CG2 . VAL A 1 150 ? 3.566   3.340   37.971  1.00 45.31  ? 158 VAL P CG2 1 
ATOM   1174  N N   . ASP A 1 151 ? 5.312   2.232   41.433  1.00 49.94  ? 159 ASP P N   1 
ATOM   1175  C CA  . ASP A 1 151 ? 5.658   0.896   41.918  1.00 44.24  ? 159 ASP P CA  1 
ATOM   1176  C C   . ASP A 1 151 ? 4.605   -0.083  41.481  1.00 51.61  ? 159 ASP P C   1 
ATOM   1177  O O   . ASP A 1 151 ? 3.414   0.208   41.583  1.00 61.68  ? 159 ASP P O   1 
ATOM   1178  C CB  . ASP A 1 151 ? 5.713   0.863   43.440  1.00 52.78  ? 159 ASP P CB  1 
ATOM   1179  C CG  . ASP A 1 151 ? 6.981   1.451   43.984  1.00 57.46  ? 159 ASP P CG  1 
ATOM   1180  O OD1 . ASP A 1 151 ? 7.090   1.681   45.216  1.00 64.67  ? 159 ASP P OD1 1 
ATOM   1181  O OD2 . ASP A 1 151 ? 7.879   1.687   43.163  1.00 54.04  ? 159 ASP P OD2 1 
ATOM   1182  N N   . LEU A 1 152 ? 4.974   -1.274  41.048  1.00 45.34  ? 160 LEU P N   1 
ATOM   1183  C CA  . LEU A 1 152 ? 4.006   -2.300  40.743  1.00 42.79  ? 160 LEU P CA  1 
ATOM   1184  C C   . LEU A 1 152 ? 4.667   -3.568  41.111  1.00 44.33  ? 160 LEU P C   1 
ATOM   1185  O O   . LEU A 1 152 ? 5.816   -3.546  41.395  1.00 45.99  ? 160 LEU P O   1 
ATOM   1186  C CB  . LEU A 1 152 ? 3.732   -2.339  39.258  1.00 42.89  ? 160 LEU P CB  1 
ATOM   1187  C CG  . LEU A 1 152 ? 3.279   -1.108  38.510  1.00 43.08  ? 160 LEU P CG  1 
ATOM   1188  C CD1 . LEU A 1 152 ? 3.983   -1.007  37.255  1.00 31.14  ? 160 LEU P CD1 1 
ATOM   1189  C CD2 . LEU A 1 152 ? 1.867   -1.267  38.210  1.00 52.58  ? 160 LEU P CD2 1 
ATOM   1190  N N   . HIS A 1 153 ? 3.956   -4.678  41.107  1.00 46.17  ? 161 HIS P N   1 
ATOM   1191  C CA  . HIS A 1 153 ? 4.577   -5.979  41.018  1.00 44.18  ? 161 HIS P CA  1 
ATOM   1192  C C   . HIS A 1 153 ? 3.848   -6.904  40.091  1.00 42.26  ? 161 HIS P C   1 
ATOM   1193  O O   . HIS A 1 153 ? 2.722   -6.691  39.758  1.00 43.08  ? 161 HIS P O   1 
ATOM   1194  C CB  . HIS A 1 153 ? 4.787   -6.694  42.338  1.00 48.09  ? 161 HIS P CB  1 
ATOM   1195  C CG  . HIS A 1 153 ? 3.794   -6.382  43.392  1.00 59.05  ? 161 HIS P CG  1 
ATOM   1196  N ND1 . HIS A 1 153 ? 3.798   -5.193  44.074  1.00 61.69  ? 161 HIS P ND1 1 
ATOM   1197  C CD2 . HIS A 1 153 ? 2.723   -7.069  43.834  1.00 63.18  ? 161 HIS P CD2 1 
ATOM   1198  C CE1 . HIS A 1 153 ? 2.788   -5.172  44.920  1.00 68.12  ? 161 HIS P CE1 1 
ATOM   1199  N NE2 . HIS A 1 153 ? 2.118   -6.299  44.791  1.00 73.70  ? 161 HIS P NE2 1 
ATOM   1200  N N   . VAL A 1 154 ? 4.530   -7.949  39.694  1.00 40.41  ? 162 VAL P N   1 
ATOM   1201  C CA  . VAL A 1 154 ? 4.052   -8.849  38.694  1.00 36.11  ? 162 VAL P CA  1 
ATOM   1202  C C   . VAL A 1 154 ? 3.103   -9.855  39.243  1.00 36.98  ? 162 VAL P C   1 
ATOM   1203  O O   . VAL A 1 154 ? 3.482   -10.623 40.077  1.00 38.61  ? 162 VAL P O   1 
ATOM   1204  C CB  . VAL A 1 154 ? 5.205   -9.632  38.164  1.00 33.98  ? 162 VAL P CB  1 
ATOM   1205  C CG1 . VAL A 1 154 ? 4.723   -10.735 37.391  1.00 34.41  ? 162 VAL P CG1 1 
ATOM   1206  C CG2 . VAL A 1 154 ? 6.037   -8.810  37.317  1.00 37.40  ? 162 VAL P CG2 1 
ATOM   1207  N N   . ILE A 1 155 ? 1.869   -9.872  38.767  1.00 37.45  ? 163 ILE P N   1 
ATOM   1208  C CA  . ILE A 1 155 ? 0.878   -10.825 39.261  1.00 36.37  ? 163 ILE P CA  1 
ATOM   1209  C C   . ILE A 1 155 ? 0.595   -11.744 38.124  1.00 35.27  ? 163 ILE P C   1 
ATOM   1210  O O   . ILE A 1 155 ? 1.324   -11.698 37.136  1.00 38.66  ? 163 ILE P O   1 
ATOM   1211  C CB  . ILE A 1 155 ? -0.401  -10.132 39.621  1.00 34.07  ? 163 ILE P CB  1 
ATOM   1212  C CG1 . ILE A 1 155 ? -0.944  -9.403  38.395  1.00 35.60  ? 163 ILE P CG1 1 
ATOM   1213  C CG2 . ILE A 1 155 ? -0.134  -9.146  40.719  1.00 36.35  ? 163 ILE P CG2 1 
ATOM   1214  C CD1 . ILE A 1 155 ? -1.340  -7.958  38.668  1.00 36.17  ? 163 ILE P CD1 1 
ATOM   1215  N N   . SER A 1 156 ? -0.451  -12.564 38.245  1.00 33.10  ? 164 SER P N   1 
ATOM   1216  C CA  . SER A 1 156 ? -0.780  -13.566 37.209  1.00 36.52  ? 164 SER P CA  1 
ATOM   1217  C C   . SER A 1 156 ? -1.428  -13.027 35.952  1.00 36.05  ? 164 SER P C   1 
ATOM   1218  O O   . SER A 1 156 ? -1.982  -11.929 35.924  1.00 37.50  ? 164 SER P O   1 
ATOM   1219  C CB  . SER A 1 156 ? -1.648  -14.707 37.750  1.00 42.61  ? 164 SER P CB  1 
ATOM   1220  O OG  . SER A 1 156 ? -2.374  -15.332 36.696  1.00 38.45  ? 164 SER P OG  1 
ATOM   1221  N N   . ASN A 1 157 ? -1.341  -13.823 34.902  1.00 35.71  ? 165 ASN P N   1 
ATOM   1222  C CA  . ASN A 1 157 ? -1.860  -13.410 33.614  1.00 44.17  ? 165 ASN P CA  1 
ATOM   1223  C C   . ASN A 1 157 ? -3.382  -13.350 33.571  1.00 45.68  ? 165 ASN P C   1 
ATOM   1224  O O   . ASN A 1 157 ? -3.947  -12.713 32.679  1.00 45.82  ? 165 ASN P O   1 
ATOM   1225  C CB  . ASN A 1 157 ? -1.340  -14.326 32.507  1.00 47.69  ? 165 ASN P CB  1 
ATOM   1226  C CG  . ASN A 1 157 ? -0.508  -13.587 31.478  1.00 44.24  ? 165 ASN P CG  1 
ATOM   1227  O OD1 . ASN A 1 157 ? -0.329  -12.365 31.556  1.00 39.79  ? 165 ASN P OD1 1 
ATOM   1228  N ND2 . ASN A 1 157 ? 0.006   -14.328 30.505  1.00 41.29  ? 165 ASN P ND2 1 
ATOM   1229  N N   . ASP A 1 158 ? -4.036  -14.005 34.536  1.00 47.59  ? 166 ASP P N   1 
ATOM   1230  C CA  . ASP A 1 158 ? -5.510  -14.037 34.622  1.00 47.94  ? 166 ASP P CA  1 
ATOM   1231  C C   . ASP A 1 158 ? -6.091  -12.817 35.339  1.00 45.86  ? 166 ASP P C   1 
ATOM   1232  O O   . ASP A 1 158 ? -7.251  -12.455 35.159  1.00 40.84  ? 166 ASP P O   1 
ATOM   1233  C CB  . ASP A 1 158 ? -5.966  -15.318 35.301  1.00 46.74  ? 166 ASP P CB  1 
ATOM   1234  C CG  . ASP A 1 158 ? -5.411  -16.548 34.619  1.00 57.59  ? 166 ASP P CG  1 
ATOM   1235  O OD1 . ASP A 1 158 ? -4.744  -17.376 35.297  1.00 55.58  ? 166 ASP P OD1 1 
ATOM   1236  O OD2 . ASP A 1 158 ? -5.629  -16.664 33.384  1.00 64.00  ? 166 ASP P OD2 1 
ATOM   1237  N N   . VAL A 1 159 ? -5.276  -12.178 36.163  1.00 44.43  ? 167 VAL P N   1 
ATOM   1238  C CA  . VAL A 1 159 ? -5.747  -10.981 36.796  1.00 42.27  ? 167 VAL P CA  1 
ATOM   1239  C C   . VAL A 1 159 ? -6.134  -10.016 35.702  1.00 43.71  ? 167 VAL P C   1 
ATOM   1240  O O   . VAL A 1 159 ? -7.194  -9.434  35.791  1.00 48.46  ? 167 VAL P O   1 
ATOM   1241  C CB  . VAL A 1 159 ? -4.736  -10.377 37.785  1.00 40.13  ? 167 VAL P CB  1 
ATOM   1242  C CG1 . VAL A 1 159 ? -5.287  -9.108  38.427  1.00 35.00  ? 167 VAL P CG1 1 
ATOM   1243  C CG2 . VAL A 1 159 ? -4.423  -11.389 38.852  1.00 34.88  ? 167 VAL P CG2 1 
ATOM   1244  N N   . CYS A 1 160 ? -5.345  -9.820  34.667  1.00 47.49  ? 168 CYS P N   1 
ATOM   1245  C CA  . CYS A 1 160 ? -5.809  -8.861  33.687  1.00 54.63  ? 168 CYS P CA  1 
ATOM   1246  C C   . CYS A 1 160 ? -6.650  -9.374  32.567  1.00 52.18  ? 168 CYS P C   1 
ATOM   1247  O O   . CYS A 1 160 ? -7.320  -8.637  31.873  1.00 48.12  ? 168 CYS P O   1 
ATOM   1248  C CB  . CYS A 1 160 ? -4.741  -7.908  33.175  1.00 54.94  ? 168 CYS P CB  1 
ATOM   1249  S SG  . CYS A 1 160 ? -3.142  -8.500  32.986  1.00 75.95  ? 168 CYS P SG  1 
ATOM   1250  N N   . ALA A 1 161 ? -6.626  -10.666 32.412  1.00 47.76  ? 169 ALA P N   1 
ATOM   1251  C CA  . ALA A 1 161 ? -7.664  -11.328 31.637  1.00 45.63  ? 169 ALA P CA  1 
ATOM   1252  C C   . ALA A 1 161 ? -9.026  -10.718 31.961  1.00 48.32  ? 169 ALA P C   1 
ATOM   1253  O O   . ALA A 1 161 ? -9.759  -10.322 31.064  1.00 54.91  ? 169 ALA P O   1 
ATOM   1254  C CB  . ALA A 1 161 ? -7.668  -12.819 31.937  1.00 44.70  ? 169 ALA P CB  1 
ATOM   1255  N N   . GLN A 1 162 ? -9.317  -10.626 33.259  1.00 51.37  ? 170 GLN P N   1 
ATOM   1256  C CA  . GLN A 1 162 ? -10.577 -10.157 33.841  1.00 48.06  ? 170 GLN P CA  1 
ATOM   1257  C C   . GLN A 1 162 ? -10.898 -8.646  33.724  1.00 52.25  ? 170 GLN P C   1 
ATOM   1258  O O   . GLN A 1 162 ? -12.061 -8.250  33.735  1.00 61.70  ? 170 GLN P O   1 
ATOM   1259  C CB  . GLN A 1 162 ? -10.602 -10.590 35.306  1.00 45.35  ? 170 GLN P CB  1 
ATOM   1260  C CG  . GLN A 1 162 ? -10.558 -12.113 35.470  1.00 44.65  ? 170 GLN P CG  1 
ATOM   1261  C CD  . GLN A 1 162 ? -10.895 -12.534 36.893  1.00 43.64  ? 170 GLN P CD  1 
ATOM   1262  O OE1 . GLN A 1 162 ? -10.928 -11.700 37.804  1.00 45.37  ? 170 GLN P OE1 1 
ATOM   1263  N NE2 . GLN A 1 162 ? -11.145 -13.828 37.094  1.00 37.72  ? 170 GLN P NE2 1 
ATOM   1264  N N   . VAL A 1 163 ? -9.883  -7.806  33.601  1.00 51.38  ? 171 VAL P N   1 
ATOM   1265  C CA  . VAL A 1 163 ? -10.097 -6.368  33.584  1.00 54.04  ? 171 VAL P CA  1 
ATOM   1266  C C   . VAL A 1 163 ? -9.879  -5.769  32.188  1.00 54.19  ? 171 VAL P C   1 
ATOM   1267  O O   . VAL A 1 163 ? -10.219 -4.614  31.914  1.00 51.80  ? 171 VAL P O   1 
ATOM   1268  C CB  . VAL A 1 163 ? -9.227  -5.695  34.678  1.00 57.73  ? 171 VAL P CB  1 
ATOM   1269  C CG1 . VAL A 1 163 ? -8.307  -4.617  34.092  1.00 57.39  ? 171 VAL P CG1 1 
ATOM   1270  C CG2 . VAL A 1 163 ? -10.119 -5.166  35.833  1.00 57.05  ? 171 VAL P CG2 1 
ATOM   1271  N N   . HIS A 1 164 ? -9.326  -6.588  31.302  1.00 58.98  ? 172 HIS P N   1 
ATOM   1272  C CA  . HIS A 1 164 ? -9.059  -6.173  29.929  1.00 61.48  ? 172 HIS P CA  1 
ATOM   1273  C C   . HIS A 1 164 ? -9.883  -7.020  28.946  1.00 62.09  ? 172 HIS P C   1 
ATOM   1274  O O   . HIS A 1 164 ? -9.839  -8.256  29.001  1.00 57.51  ? 172 HIS P O   1 
ATOM   1275  C CB  . HIS A 1 164 ? -7.548  -6.226  29.633  1.00 58.95  ? 172 HIS P CB  1 
ATOM   1276  C CG  . HIS A 1 164 ? -6.739  -5.274  30.464  1.00 60.06  ? 172 HIS P CG  1 
ATOM   1277  N ND1 . HIS A 1 164 ? -6.867  -3.902  30.367  1.00 63.73  ? 172 HIS P ND1 1 
ATOM   1278  C CD2 . HIS A 1 164 ? -5.799  -5.497  31.414  1.00 59.79  ? 172 HIS P CD2 1 
ATOM   1279  C CE1 . HIS A 1 164 ? -6.041  -3.322  31.219  1.00 61.78  ? 172 HIS P CE1 1 
ATOM   1280  N NE2 . HIS A 1 164 ? -5.380  -4.267  31.866  1.00 61.55  ? 172 HIS P NE2 1 
ATOM   1281  N N   . PRO A 1 165 ? -10.654 -6.353  28.055  1.00 67.53  ? 173 PRO P N   1 
ATOM   1282  C CA  . PRO A 1 165 ? -11.635 -7.043  27.223  1.00 68.43  ? 173 PRO P CA  1 
ATOM   1283  C C   . PRO A 1 165 ? -10.948 -7.464  25.944  1.00 71.38  ? 173 PRO P C   1 
ATOM   1284  O O   . PRO A 1 165 ? -11.296 -6.983  24.871  1.00 78.93  ? 173 PRO P O   1 
ATOM   1285  C CB  . PRO A 1 165 ? -12.659 -5.941  26.915  1.00 66.69  ? 173 PRO P CB  1 
ATOM   1286  C CG  . PRO A 1 165 ? -12.029 -4.628  27.356  1.00 63.75  ? 173 PRO P CG  1 
ATOM   1287  C CD  . PRO A 1 165 ? -10.591 -4.931  27.686  1.00 68.98  ? 173 PRO P CD  1 
ATOM   1288  N N   . GLN A 1 166 ? -9.985  -8.367  26.063  1.00 71.09  ? 174 GLN P N   1 
ATOM   1289  C CA  . GLN A 1 166 ? -9.031  -8.590  25.000  1.00 61.57  ? 174 GLN P CA  1 
ATOM   1290  C C   . GLN A 1 166 ? -8.276  -9.883  25.236  1.00 54.89  ? 174 GLN P C   1 
ATOM   1291  O O   . GLN A 1 166 ? -8.147  -10.339 26.369  1.00 57.09  ? 174 GLN P O   1 
ATOM   1292  C CB  . GLN A 1 166 ? -8.081  -7.409  24.967  1.00 56.54  ? 174 GLN P CB  1 
ATOM   1293  C CG  . GLN A 1 166 ? -6.783  -7.703  24.310  1.00 63.75  ? 174 GLN P CG  1 
ATOM   1294  C CD  . GLN A 1 166 ? -5.691  -6.798  24.831  1.00 70.80  ? 174 GLN P CD  1 
ATOM   1295  O OE1 . GLN A 1 166 ? -5.939  -5.944  25.695  1.00 72.50  ? 174 GLN P OE1 1 
ATOM   1296  N NE2 . GLN A 1 166 ? -4.472  -6.979  24.321  1.00 61.98  ? 174 GLN P NE2 1 
ATOM   1297  N N   . LYS A 1 167 ? -7.804  -10.496 24.161  1.00 57.57  ? 175 LYS P N   1 
ATOM   1298  C CA  . LYS A 1 167 ? -7.107  -11.772 24.269  1.00 55.42  ? 175 LYS P CA  1 
ATOM   1299  C C   . LYS A 1 167 ? -5.767  -11.501 24.913  1.00 51.08  ? 175 LYS P C   1 
ATOM   1300  O O   . LYS A 1 167 ? -5.028  -10.635 24.455  1.00 50.45  ? 175 LYS P O   1 
ATOM   1301  C CB  . LYS A 1 167 ? -6.918  -12.402 22.887  1.00 56.06  ? 175 LYS P CB  1 
ATOM   1302  C CG  . LYS A 1 167 ? -6.744  -13.910 22.881  1.00 52.08  ? 175 LYS P CG  1 
ATOM   1303  C CD  . LYS A 1 167 ? -6.757  -14.434 21.443  1.00 58.32  ? 175 LYS P CD  1 
ATOM   1304  C CE  . LYS A 1 167 ? -6.457  -15.931 21.360  1.00 62.29  ? 175 LYS P CE  1 
ATOM   1305  N NZ  . LYS A 1 167 ? -5.139  -16.316 21.971  1.00 65.37  ? 175 LYS P NZ  1 
ATOM   1306  N N   . VAL A 1 168 ? -5.483  -12.218 25.998  1.00 48.66  ? 176 VAL P N   1 
ATOM   1307  C CA  . VAL A 1 168 ? -4.221  -12.109 26.720  1.00 43.49  ? 176 VAL P CA  1 
ATOM   1308  C C   . VAL A 1 168 ? -3.457  -13.414 26.625  1.00 46.52  ? 176 VAL P C   1 
ATOM   1309  O O   . VAL A 1 168 ? -3.743  -14.365 27.351  1.00 46.84  ? 176 VAL P O   1 
ATOM   1310  C CB  . VAL A 1 168 ? -4.419  -11.830 28.201  1.00 43.76  ? 176 VAL P CB  1 
ATOM   1311  C CG1 . VAL A 1 168 ? -3.070  -11.760 28.858  1.00 43.52  ? 176 VAL P CG1 1 
ATOM   1312  C CG2 . VAL A 1 168 ? -5.204  -10.549 28.419  1.00 40.26  ? 176 VAL P CG2 1 
ATOM   1313  N N   . THR A 1 169 ? -2.475  -13.447 25.736  1.00 46.01  ? 177 THR P N   1 
ATOM   1314  C CA  . THR A 1 169 ? -1.796  -14.675 25.357  1.00 40.90  ? 177 THR P CA  1 
ATOM   1315  C C   . THR A 1 169 ? -0.554  -14.814 26.213  1.00 43.82  ? 177 THR P C   1 
ATOM   1316  O O   . THR A 1 169 ? -0.338  -13.965 27.068  1.00 47.29  ? 177 THR P O   1 
ATOM   1317  C CB  . THR A 1 169 ? -1.418  -14.581 23.886  1.00 47.28  ? 177 THR P CB  1 
ATOM   1318  O OG1 . THR A 1 169 ? -0.255  -13.754 23.735  1.00 49.66  ? 177 THR P OG1 1 
ATOM   1319  C CG2 . THR A 1 169 ? -2.588  -13.982 23.084  1.00 44.98  ? 177 THR P CG2 1 
ATOM   1320  N N   . LYS A 1 170 ? 0.275   -15.842 26.014  1.00 43.54  ? 178 LYS P N   1 
ATOM   1321  C CA  . LYS A 1 170 ? 1.482   -15.938 26.845  1.00 44.83  ? 178 LYS P CA  1 
ATOM   1322  C C   . LYS A 1 170 ? 2.737   -15.269 26.307  1.00 47.59  ? 178 LYS P C   1 
ATOM   1323  O O   . LYS A 1 170 ? 3.836   -15.771 26.476  1.00 53.45  ? 178 LYS P O   1 
ATOM   1324  C CB  . LYS A 1 170 ? 1.815   -17.355 27.288  1.00 46.29  ? 178 LYS P CB  1 
ATOM   1325  C CG  . LYS A 1 170 ? 2.331   -17.382 28.771  1.00 56.90  ? 178 LYS P CG  1 
ATOM   1326  C CD  . LYS A 1 170 ? 2.858   -15.986 29.276  1.00 56.60  ? 178 LYS P CD  1 
ATOM   1327  C CE  . LYS A 1 170 ? 3.000   -15.863 30.838  1.00 54.48  ? 178 LYS P CE  1 
ATOM   1328  N NZ  . LYS A 1 170 ? 3.526   -14.542 31.401  1.00 33.08  ? 178 LYS P NZ  1 
ATOM   1329  N N   . PHE A 1 171 ? 2.568   -14.130 25.665  1.00 48.46  ? 179 PHE P N   1 
ATOM   1330  C CA  . PHE A 1 171 ? 3.681   -13.260 25.357  1.00 44.91  ? 179 PHE P CA  1 
ATOM   1331  C C   . PHE A 1 171 ? 3.331   -11.935 25.986  1.00 43.89  ? 179 PHE P C   1 
ATOM   1332  O O   . PHE A 1 171 ? 3.586   -10.871 25.403  1.00 45.77  ? 179 PHE P O   1 
ATOM   1333  C CB  . PHE A 1 171 ? 3.793   -13.031 23.867  1.00 46.37  ? 179 PHE P CB  1 
ATOM   1334  C CG  . PHE A 1 171 ? 3.759   -14.269 23.059  1.00 49.73  ? 179 PHE P CG  1 
ATOM   1335  C CD1 . PHE A 1 171 ? 2.707   -14.511 22.199  1.00 47.70  ? 179 PHE P CD1 1 
ATOM   1336  C CD2 . PHE A 1 171 ? 4.791   -15.181 23.129  1.00 52.32  ? 179 PHE P CD2 1 
ATOM   1337  C CE1 . PHE A 1 171 ? 2.688   -15.633 21.418  1.00 48.91  ? 179 PHE P CE1 1 
ATOM   1338  C CE2 . PHE A 1 171 ? 4.770   -16.323 22.346  1.00 54.95  ? 179 PHE P CE2 1 
ATOM   1339  C CZ  . PHE A 1 171 ? 3.721   -16.546 21.485  1.00 49.44  ? 179 PHE P CZ  1 
ATOM   1340  N N   . MET A 1 172 ? 2.687   -11.997 27.145  1.00 39.31  ? 180 MET P N   1 
ATOM   1341  C CA  . MET A 1 172 ? 2.297   -10.785 27.837  1.00 37.70  ? 180 MET P CA  1 
ATOM   1342  C C   . MET A 1 172 ? 2.532   -10.980 29.322  1.00 37.80  ? 180 MET P C   1 
ATOM   1343  O O   . MET A 1 172 ? 2.199   -12.024 29.876  1.00 39.97  ? 180 MET P O   1 
ATOM   1344  C CB  . MET A 1 172 ? 0.832   -10.470 27.560  1.00 40.44  ? 180 MET P CB  1 
ATOM   1345  C CG  . MET A 1 172 ? 0.372   -10.819 26.154  1.00 40.74  ? 180 MET P CG  1 
ATOM   1346  S SD  . MET A 1 172 ? -0.704  -9.546  25.485  1.00 43.32  ? 180 MET P SD  1 
ATOM   1347  C CE  . MET A 1 172 ? -2.247  -10.407 25.452  1.00 46.49  ? 180 MET P CE  1 
ATOM   1348  N N   . LEU A 1 173 ? 3.150   -9.999  29.960  1.00 33.01  ? 181 LEU P N   1 
ATOM   1349  C CA  . LEU A 1 173 ? 3.316   -10.045 31.391  1.00 34.19  ? 181 LEU P CA  1 
ATOM   1350  C C   . LEU A 1 173 ? 2.257   -9.124  31.875  1.00 40.56  ? 181 LEU P C   1 
ATOM   1351  O O   . LEU A 1 173 ? 2.031   -8.086  31.252  1.00 39.58  ? 181 LEU P O   1 
ATOM   1352  C CB  . LEU A 1 173 ? 4.622   -9.410  31.815  1.00 34.55  ? 181 LEU P CB  1 
ATOM   1353  C CG  . LEU A 1 173 ? 5.992   -10.017 31.656  1.00 32.51  ? 181 LEU P CG  1 
ATOM   1354  C CD1 . LEU A 1 173 ? 6.947   -8.865  31.678  1.00 31.68  ? 181 LEU P CD1 1 
ATOM   1355  C CD2 . LEU A 1 173 ? 6.239   -10.911 32.818  1.00 34.93  ? 181 LEU P CD2 1 
ATOM   1356  N N   . CYS A 1 174 ? 1.599   -9.389  32.997  1.00 41.57  ? 182 CYS P N   1 
ATOM   1357  C CA  . CYS A 1 174 ? 0.708   -8.392  33.598  1.00 43.72  ? 182 CYS P CA  1 
ATOM   1358  C C   . CYS A 1 174 ? 1.130   -8.070  35.008  1.00 45.39  ? 182 CYS P C   1 
ATOM   1359  O O   . CYS A 1 174 ? 1.353   -8.949  35.788  1.00 43.50  ? 182 CYS P O   1 
ATOM   1360  C CB  . CYS A 1 174 ? -0.741  -8.874  33.588  1.00 50.82  ? 182 CYS P CB  1 
ATOM   1361  S SG  . CYS A 1 174 ? -1.907  -8.088  34.693  1.00 66.54  ? 182 CYS P SG  1 
ATOM   1362  N N   . ALA A 1 175 ? 1.254   -6.794  35.320  1.00 39.95  ? 183 ALA P N   1 
ATOM   1363  C CA  . ALA A 1 175 ? 1.688   -6.302  36.608  1.00 42.16  ? 183 ALA P CA  1 
ATOM   1364  C C   . ALA A 1 175 ? 0.747   -5.223  36.978  1.00 44.21  ? 183 ALA P C   1 
ATOM   1365  O O   . ALA A 1 175 ? 0.449   -4.367  36.160  1.00 41.56  ? 183 ALA P O   1 
ATOM   1366  C CB  . ALA A 1 175 ? 3.089   -5.758  36.539  1.00 43.79  ? 183 ALA P CB  1 
ATOM   1367  N N   . GLY A 1 176 ? 0.285   -5.273  38.220  1.00 48.19  ? 184 GLY P N   1 
ATOM   1368  C CA  . GLY A 1 176 ? -0.734  -4.366  38.693  1.00 53.98  ? 184 GLY P CA  1 
ATOM   1369  C C   . GLY A 1 176 ? -0.335  -3.674  39.969  1.00 55.31  ? 184 GLY P C   1 
ATOM   1370  O O   . GLY A 1 176 ? 0.798   -3.806  40.421  1.00 51.13  ? 184 GLY P O   1 
ATOM   1371  N N   . ARG A 1 177 ? -1.299  -2.951  40.537  1.00 66.02  ? 185 ARG P N   1 
ATOM   1372  C CA  . ARG A 1 177 ? -1.137  -2.155  41.748  1.00 66.85  ? 185 ARG P CA  1 
ATOM   1373  C C   . ARG A 1 177 ? -0.697  -0.772  41.297  1.00 77.50  ? 185 ARG P C   1 
ATOM   1374  O O   . ARG A 1 177 ? 0.232   -0.634  40.514  1.00 76.10  ? 185 ARG P O   1 
ATOM   1375  C CB  . ARG A 1 177 ? -0.137  -2.798  42.706  1.00 61.09  ? 185 ARG P CB  1 
ATOM   1376  C CG  . ARG A 1 177 ? -0.286  -2.414  44.153  1.00 71.91  ? 185 ARG P CG  1 
ATOM   1377  C CD  . ARG A 1 177 ? 0.898   -2.953  44.971  1.00 82.58  ? 185 ARG P CD  1 
ATOM   1378  N NE  . ARG A 1 177 ? 1.768   -1.898  45.523  1.00 93.94  ? 185 ARG P NE  1 
ATOM   1379  C CZ  . ARG A 1 177 ? 3.109   -1.938  45.579  1.00 80.69  ? 185 ARG P CZ  1 
ATOM   1380  N NH1 . ARG A 1 177 ? 3.776   -0.916  46.110  1.00 73.89  ? 185 ARG P NH1 1 
ATOM   1381  N NH2 . ARG A 1 177 ? 3.795   -2.983  45.110  1.00 66.09  ? 185 ARG P NH2 1 
ATOM   1382  N N   . TRP A 1 178 ? -1.409  0.251   41.747  1.00 91.91  ? 186 TRP P N   1 
ATOM   1383  C CA  . TRP A 1 178 ? -1.094  1.643   41.412  1.00 98.32  ? 186 TRP P CA  1 
ATOM   1384  C C   . TRP A 1 178 ? -1.028  2.409   42.725  1.00 101.12 ? 186 TRP P C   1 
ATOM   1385  O O   . TRP A 1 178 ? -1.223  3.631   42.767  1.00 101.63 ? 186 TRP P O   1 
ATOM   1386  C CB  . TRP A 1 178 ? -2.200  2.238   40.556  1.00 102.49 ? 186 TRP P CB  1 
ATOM   1387  C CG  . TRP A 1 178 ? -1.760  3.056   39.412  1.00 104.47 ? 186 TRP P CG  1 
ATOM   1388  C CD1 . TRP A 1 178 ? -1.778  4.418   39.320  1.00 109.78 ? 186 TRP P CD1 1 
ATOM   1389  C CD2 . TRP A 1 178 ? -1.274  2.574   38.162  1.00 104.54 ? 186 TRP P CD2 1 
ATOM   1390  N NE1 . TRP A 1 178 ? -1.317  4.817   38.084  1.00 111.24 ? 186 TRP P NE1 1 
ATOM   1391  C CE2 . TRP A 1 178 ? -0.996  3.692   37.346  1.00 106.37 ? 186 TRP P CE2 1 
ATOM   1392  C CE3 . TRP A 1 178 ? -1.032  1.295   37.634  1.00 97.76  ? 186 TRP P CE3 1 
ATOM   1393  C CZ2 . TRP A 1 178 ? -0.490  3.581   36.053  1.00 101.91 ? 186 TRP P CZ2 1 
ATOM   1394  C CZ3 . TRP A 1 178 ? -0.532  1.181   36.345  1.00 87.54  ? 186 TRP P CZ3 1 
ATOM   1395  C CH2 . TRP A 1 178 ? -0.266  2.314   35.572  1.00 95.72  ? 186 TRP P CH2 1 
ATOM   1396  N N   . THR A 1 179 A -0.820  1.657   43.804  1.00 99.66  ? 186 THR P N   1 
ATOM   1397  C CA  . THR A 1 179 A -0.468  2.226   45.097  1.00 97.70  ? 186 THR P CA  1 
ATOM   1398  C C   . THR A 1 179 A 1.068   2.227   45.155  1.00 95.99  ? 186 THR P C   1 
ATOM   1399  O O   . THR A 1 179 A 1.686   1.492   45.931  1.00 97.08  ? 186 THR P O   1 
ATOM   1400  C CB  . THR A 1 179 A -1.182  1.500   46.308  1.00 95.02  ? 186 THR P CB  1 
ATOM   1401  O OG1 . THR A 1 179 A -0.456  1.732   47.522  1.00 97.99  ? 186 THR P OG1 1 
ATOM   1402  C CG2 . THR A 1 179 A -1.378  -0.028  46.079  1.00 82.18  ? 186 THR P CG2 1 
ATOM   1403  N N   . GLY A 1 180 B 1.662   3.057   44.290  1.00 92.77  ? 186 GLY P N   1 
ATOM   1404  C CA  . GLY A 1 180 B 3.105   3.113   44.088  1.00 86.11  ? 186 GLY P CA  1 
ATOM   1405  C C   . GLY A 1 180 B 3.735   4.504   44.171  1.00 89.24  ? 186 GLY P C   1 
ATOM   1406  O O   . GLY A 1 180 B 4.518   4.773   45.086  1.00 93.37  ? 186 GLY P O   1 
ATOM   1407  N N   . GLY A 1 181 ? 3.414   5.380   43.215  1.00 90.71  ? 187 GLY P N   1 
ATOM   1408  C CA  . GLY A 1 181 ? 3.897   6.761   43.214  1.00 93.82  ? 187 GLY P CA  1 
ATOM   1409  C C   . GLY A 1 181 ? 2.795   7.777   43.510  1.00 104.81 ? 187 GLY P C   1 
ATOM   1410  O O   . GLY A 1 181 ? 2.886   8.564   44.467  1.00 103.86 ? 187 GLY P O   1 
ATOM   1411  N N   . LYS A 1 182 ? 1.772   7.777   42.655  1.00 103.36 ? 188 LYS P N   1 
ATOM   1412  C CA  . LYS A 1 182 ? 0.457   8.363   42.955  1.00 117.25 ? 188 LYS P CA  1 
ATOM   1413  C C   . LYS A 1 182 ? -0.577  7.725   42.009  1.00 122.90 ? 188 LYS P C   1 
ATOM   1414  O O   . LYS A 1 182 ? -0.201  7.189   40.961  1.00 118.98 ? 188 LYS P O   1 
ATOM   1415  C CB  . LYS A 1 182 ? 0.464   9.900   42.834  1.00 114.74 ? 188 LYS P CB  1 
ATOM   1416  C CG  . LYS A 1 182 ? -0.844  10.619  43.265  1.00 114.88 ? 188 LYS P CG  1 
ATOM   1417  C CD  . LYS A 1 182 ? -1.297  10.236  44.684  1.00 112.64 ? 188 LYS P CD  1 
ATOM   1418  C CE  . LYS A 1 182 ? -2.216  11.287  45.308  1.00 99.83  ? 188 LYS P CE  1 
ATOM   1419  N NZ  . LYS A 1 182 ? -3.418  11.568  44.482  1.00 98.23  ? 188 LYS P NZ  1 
ATOM   1420  N N   . SER A 1 183 ? -1.860  7.761   42.384  1.00 125.61 ? 189 SER P N   1 
ATOM   1421  C CA  . SER A 1 183 ? -2.944  7.230   41.541  1.00 120.74 ? 189 SER P CA  1 
ATOM   1422  C C   . SER A 1 183 ? -3.169  8.072   40.273  1.00 121.97 ? 189 SER P C   1 
ATOM   1423  O O   . SER A 1 183 ? -4.308  8.404   39.925  1.00 116.78 ? 189 SER P O   1 
ATOM   1424  C CB  . SER A 1 183 ? -4.243  7.105   42.347  1.00 115.18 ? 189 SER P CB  1 
ATOM   1425  O OG  . SER A 1 183 ? -4.074  6.202   43.430  1.00 107.27 ? 189 SER P OG  1 
ATOM   1426  N N   . THR A 1 184 ? -2.065  8.405   39.599  1.00 127.42 ? 190 THR P N   1 
ATOM   1427  C CA  . THR A 1 184 ? -2.074  9.197   38.366  1.00 127.03 ? 190 THR P CA  1 
ATOM   1428  C C   . THR A 1 184 ? -1.329  8.498   37.225  1.00 123.26 ? 190 THR P C   1 
ATOM   1429  O O   . THR A 1 184 ? -0.522  7.582   37.437  1.00 110.93 ? 190 THR P O   1 
ATOM   1430  C CB  . THR A 1 184 ? -1.425  10.606  38.546  1.00 125.05 ? 190 THR P CB  1 
ATOM   1431  O OG1 . THR A 1 184 ? 0.008   10.485  38.582  1.00 122.79 ? 190 THR P OG1 1 
ATOM   1432  C CG2 . THR A 1 184 ? -1.933  11.299  39.809  1.00 121.04 ? 190 THR P CG2 1 
ATOM   1433  N N   . CYS A 1 185 ? -1.603  8.973   36.013  1.00 127.44 ? 191 CYS P N   1 
ATOM   1434  C CA  . CYS A 1 185 ? -1.006  8.442   34.795  1.00 124.09 ? 191 CYS P CA  1 
ATOM   1435  C C   . CYS A 1 185 ? 0.520   8.435   34.870  1.00 118.67 ? 191 CYS P C   1 
ATOM   1436  O O   . CYS A 1 185 ? 1.146   9.501   34.964  1.00 116.77 ? 191 CYS P O   1 
ATOM   1437  C CB  . CYS A 1 185 ? -1.468  9.272   33.589  1.00 123.84 ? 191 CYS P CB  1 
ATOM   1438  S SG  . CYS A 1 185 ? -1.669  8.338   32.041  1.00 130.28 ? 191 CYS P SG  1 
ATOM   1439  N N   . SER A 1 186 ? 1.104   7.231   34.837  1.00 113.21 ? 192 SER P N   1 
ATOM   1440  C CA  . SER A 1 186 ? 2.559   7.058   34.716  1.00 107.14 ? 192 SER P CA  1 
ATOM   1441  C C   . SER A 1 186 ? 3.103   7.897   33.553  1.00 104.94 ? 192 SER P C   1 
ATOM   1442  O O   . SER A 1 186 ? 3.998   8.741   33.734  1.00 95.24  ? 192 SER P O   1 
ATOM   1443  C CB  . SER A 1 186 ? 2.937   5.582   34.475  1.00 96.90  ? 192 SER P CB  1 
ATOM   1444  O OG  . SER A 1 186 ? 2.524   4.723   35.524  1.00 90.41  ? 192 SER P OG  1 
ATOM   1445  N N   . GLY A 1 187 ? 2.548   7.651   32.363  1.00 106.08 ? 193 GLY P N   1 
ATOM   1446  C CA  . GLY A 1 187 ? 2.996   8.282   31.134  1.00 96.97  ? 193 GLY P CA  1 
ATOM   1447  C C   . GLY A 1 187 ? 2.774   7.361   29.946  1.00 95.92  ? 193 GLY P C   1 
ATOM   1448  O O   . GLY A 1 187 ? 2.192   6.277   30.085  1.00 96.52  ? 193 GLY P O   1 
ATOM   1449  N N   . ASP A 1 188 ? 3.288   7.782   28.793  1.00 93.27  ? 194 ASP P N   1 
ATOM   1450  C CA  . ASP A 1 188 ? 2.928   7.227   27.484  1.00 91.43  ? 194 ASP P CA  1 
ATOM   1451  C C   . ASP A 1 188 ? 3.176   5.729   27.248  1.00 78.97  ? 194 ASP P C   1 
ATOM   1452  O O   . ASP A 1 188 ? 3.515   4.978   28.160  1.00 64.09  ? 194 ASP P O   1 
ATOM   1453  C CB  . ASP A 1 188 ? 3.631   8.047   26.407  1.00 88.85  ? 194 ASP P CB  1 
ATOM   1454  C CG  . ASP A 1 188 ? 4.309   9.263   26.980  1.00 92.11  ? 194 ASP P CG  1 
ATOM   1455  O OD1 . ASP A 1 188 ? 3.959   10.389  26.547  1.00 100.39 ? 194 ASP P OD1 1 
ATOM   1456  O OD2 . ASP A 1 188 ? 5.166   9.080   27.886  1.00 79.68  ? 194 ASP P OD2 1 
ATOM   1457  N N   . SER A 1 189 ? 2.986   5.320   25.994  1.00 80.23  ? 195 SER P N   1 
ATOM   1458  C CA  . SER A 1 189 ? 3.134   3.927   25.572  1.00 71.45  ? 195 SER P CA  1 
ATOM   1459  C C   . SER A 1 189 ? 4.581   3.565   25.187  1.00 62.45  ? 195 SER P C   1 
ATOM   1460  O O   . SER A 1 189 ? 5.421   4.440   24.941  1.00 54.72  ? 195 SER P O   1 
ATOM   1461  C CB  . SER A 1 189 ? 2.176   3.618   24.408  1.00 65.35  ? 195 SER P CB  1 
ATOM   1462  O OG  . SER A 1 189 ? 0.833   3.913   24.754  1.00 75.27  ? 195 SER P OG  1 
ATOM   1463  N N   . GLY A 1 190 ? 4.854   2.264   25.131  1.00 55.85  ? 196 GLY P N   1 
ATOM   1464  C CA  . GLY A 1 190 ? 6.184   1.789   24.839  1.00 47.38  ? 196 GLY P CA  1 
ATOM   1465  C C   . GLY A 1 190 ? 7.082   2.132   26.004  1.00 48.64  ? 196 GLY P C   1 
ATOM   1466  O O   . GLY A 1 190 ? 8.297   1.967   25.914  1.00 50.25  ? 196 GLY P O   1 
ATOM   1467  N N   . GLY A 1 191 ? 6.490   2.615   27.097  1.00 49.44  ? 197 GLY P N   1 
ATOM   1468  C CA  . GLY A 1 191 ? 7.234   2.895   28.319  1.00 46.70  ? 197 GLY P CA  1 
ATOM   1469  C C   . GLY A 1 191 ? 7.775   1.597   28.891  1.00 40.70  ? 197 GLY P C   1 
ATOM   1470  O O   . GLY A 1 191 ? 7.111   0.578   28.802  1.00 40.53  ? 197 GLY P O   1 
ATOM   1471  N N   . PRO A 1 192 ? 8.984   1.618   29.463  1.00 36.71  ? 198 PRO P N   1 
ATOM   1472  C CA  . PRO A 1 192 ? 9.593   0.369   29.899  1.00 34.97  ? 198 PRO P CA  1 
ATOM   1473  C C   . PRO A 1 192 ? 9.074   -0.013  31.268  1.00 34.36  ? 198 PRO P C   1 
ATOM   1474  O O   . PRO A 1 192 ? 8.750   0.885   32.041  1.00 34.38  ? 198 PRO P O   1 
ATOM   1475  C CB  . PRO A 1 192 ? 11.084  0.736   30.033  1.00 35.36  ? 198 PRO P CB  1 
ATOM   1476  C CG  . PRO A 1 192 ? 11.200  2.180   29.663  1.00 37.92  ? 198 PRO P CG  1 
ATOM   1477  C CD  . PRO A 1 192 ? 9.833   2.760   29.808  1.00 42.51  ? 198 PRO P CD  1 
ATOM   1478  N N   . LEU A 1 193 ? 9.014   -1.316  31.547  1.00 31.98  ? 199 LEU P N   1 
ATOM   1479  C CA  . LEU A 1 193 ? 8.754   -1.850  32.881  1.00 32.10  ? 199 LEU P CA  1 
ATOM   1480  C C   . LEU A 1 193 ? 10.011  -2.590  33.325  1.00 30.16  ? 199 LEU P C   1 
ATOM   1481  O O   . LEU A 1 193 ? 10.373  -3.616  32.758  1.00 29.90  ? 199 LEU P O   1 
ATOM   1482  C CB  . LEU A 1 193 ? 7.531   -2.794  32.865  1.00 32.70  ? 199 LEU P CB  1 
ATOM   1483  C CG  . LEU A 1 193 ? 7.438   -3.969  33.856  1.00 30.62  ? 199 LEU P CG  1 
ATOM   1484  C CD1 . LEU A 1 193 ? 6.512   -3.624  34.937  1.00 30.02  ? 199 LEU P CD1 1 
ATOM   1485  C CD2 . LEU A 1 193 ? 6.987   -5.256  33.196  1.00 28.75  ? 199 LEU P CD2 1 
ATOM   1486  N N   . VAL A 1 194 ? 10.685  -2.057  34.332  1.00 28.95  ? 200 VAL P N   1 
ATOM   1487  C CA  . VAL A 1 194 ? 11.938  -2.641  34.800  1.00 32.90  ? 200 VAL P CA  1 
ATOM   1488  C C   . VAL A 1 194 ? 11.794  -3.401  36.129  1.00 36.78  ? 200 VAL P C   1 
ATOM   1489  O O   . VAL A 1 194 ? 11.271  -2.858  37.096  1.00 38.08  ? 200 VAL P O   1 
ATOM   1490  C CB  . VAL A 1 194 ? 12.977  -1.550  34.976  1.00 30.95  ? 200 VAL P CB  1 
ATOM   1491  C CG1 . VAL A 1 194 ? 13.811  -1.434  33.754  1.00 31.04  ? 200 VAL P CG1 1 
ATOM   1492  C CG2 . VAL A 1 194 ? 12.284  -0.255  35.225  1.00 33.80  ? 200 VAL P CG2 1 
ATOM   1493  N N   . CYS A 1 195 ? 12.271  -4.644  36.183  1.00 36.64  ? 201 CYS P N   1 
ATOM   1494  C CA  . CYS A 1 195 ? 12.134  -5.467  37.383  1.00 34.82  ? 201 CYS P CA  1 
ATOM   1495  C C   . CYS A 1 195 ? 13.476  -5.800  37.999  1.00 35.18  ? 201 CYS P C   1 
ATOM   1496  O O   . CYS A 1 195 ? 14.306  -6.484  37.397  1.00 33.95  ? 201 CYS P O   1 
ATOM   1497  C CB  . CYS A 1 195 ? 11.406  -6.766  37.061  1.00 39.14  ? 201 CYS P CB  1 
ATOM   1498  S SG  . CYS A 1 195 ? 9.674   -6.570  36.597  1.00 54.27  ? 201 CYS P SG  1 
ATOM   1499  N N   . ASN A 1 196 ? 13.681  -5.307  39.213  1.00 36.62  ? 202 ASN P N   1 
ATOM   1500  C CA  . ASN A 1 196 ? 14.884  -5.611  39.976  1.00 35.72  ? 202 ASN P CA  1 
ATOM   1501  C C   . ASN A 1 196 ? 16.130  -5.295  39.208  1.00 34.75  ? 202 ASN P C   1 
ATOM   1502  O O   . ASN A 1 196 ? 17.158  -5.938  39.412  1.00 35.59  ? 202 ASN P O   1 
ATOM   1503  C CB  . ASN A 1 196 ? 14.930  -7.080  40.377  1.00 34.71  ? 202 ASN P CB  1 
ATOM   1504  C CG  . ASN A 1 196 ? 13.879  -7.428  41.384  1.00 40.59  ? 202 ASN P CG  1 
ATOM   1505  O OD1 . ASN A 1 196 ? 13.382  -6.549  42.105  1.00 43.67  ? 202 ASN P OD1 1 
ATOM   1506  N ND2 . ASN A 1 196 ? 13.506  -8.710  41.437  1.00 43.27  ? 202 ASN P ND2 1 
ATOM   1507  N N   . GLY A 1 197 ? 16.029  -4.321  38.313  1.00 30.91  ? 203 GLY P N   1 
ATOM   1508  C CA  . GLY A 1 197 ? 17.188  -3.838  37.599  1.00 30.22  ? 203 GLY P CA  1 
ATOM   1509  C C   . GLY A 1 197 ? 17.121  -4.214  36.151  1.00 29.96  ? 203 GLY P C   1 
ATOM   1510  O O   . GLY A 1 197 ? 17.376  -3.392  35.300  1.00 31.86  ? 203 GLY P O   1 
ATOM   1511  N N   . VAL A 1 198 ? 16.779  -5.459  35.869  1.00 28.85  ? 208 VAL P N   1 
ATOM   1512  C CA  . VAL A 1 198 ? 16.624  -5.901  34.502  1.00 29.34  ? 208 VAL P CA  1 
ATOM   1513  C C   . VAL A 1 198 ? 15.471  -5.146  33.850  1.00 31.09  ? 208 VAL P C   1 
ATOM   1514  O O   . VAL A 1 198 ? 14.531  -4.753  34.528  1.00 30.67  ? 208 VAL P O   1 
ATOM   1515  C CB  . VAL A 1 198 ? 16.272  -7.383  34.464  1.00 30.62  ? 208 VAL P CB  1 
ATOM   1516  C CG1 . VAL A 1 198 ? 16.544  -7.953  33.096  1.00 31.75  ? 208 VAL P CG1 1 
ATOM   1517  C CG2 . VAL A 1 198 ? 17.035  -8.130  35.515  1.00 30.80  ? 208 VAL P CG2 1 
ATOM   1518  N N   . LEU A 1 199 ? 15.552  -4.914  32.548  1.00 28.84  ? 209 LEU P N   1 
ATOM   1519  C CA  . LEU A 1 199 ? 14.397  -4.498  31.792  1.00 26.15  ? 209 LEU P CA  1 
ATOM   1520  C C   . LEU A 1 199 ? 13.634  -5.771  31.579  1.00 30.63  ? 209 LEU P C   1 
ATOM   1521  O O   . LEU A 1 199 ? 14.228  -6.845  31.495  1.00 32.23  ? 209 LEU P O   1 
ATOM   1522  C CB  . LEU A 1 199 ? 14.810  -3.967  30.444  1.00 27.27  ? 209 LEU P CB  1 
ATOM   1523  C CG  . LEU A 1 199 ? 13.667  -3.922  29.439  1.00 30.82  ? 209 LEU P CG  1 
ATOM   1524  C CD1 . LEU A 1 199 ? 12.670  -2.842  29.802  1.00 28.38  ? 209 LEU P CD1 1 
ATOM   1525  C CD2 . LEU A 1 199 ? 14.179  -3.733  28.016  1.00 29.72  ? 209 LEU P CD2 1 
ATOM   1526  N N   . GLN A 1 200 ? 12.315  -5.686  31.488  1.00 32.47  ? 210 GLN P N   1 
ATOM   1527  C CA  . GLN A 1 200 ? 11.531  -6.912  31.415  1.00 31.07  ? 210 GLN P CA  1 
ATOM   1528  C C   . GLN A 1 200 ? 10.306  -6.830  30.513  1.00 32.61  ? 210 GLN P C   1 
ATOM   1529  O O   . GLN A 1 200 ? 9.744   -7.862  30.134  1.00 33.64  ? 210 GLN P O   1 
ATOM   1530  C CB  . GLN A 1 200 ? 11.118  -7.357  32.801  1.00 30.82  ? 210 GLN P CB  1 
ATOM   1531  C CG  . GLN A 1 200 ? 10.943  -8.818  32.854  1.00 32.28  ? 210 GLN P CG  1 
ATOM   1532  C CD  . GLN A 1 200 ? 12.180  -9.504  33.295  1.00 36.20  ? 210 GLN P CD  1 
ATOM   1533  O OE1 . GLN A 1 200 ? 12.717  -10.358 32.592  1.00 39.23  ? 210 GLN P OE1 1 
ATOM   1534  N NE2 . GLN A 1 200 ? 12.658  -9.137  34.471  1.00 34.20  ? 210 GLN P NE2 1 
ATOM   1535  N N   . GLY A 1 201 ? 9.894   -5.611  30.170  1.00 32.45  ? 211 GLY P N   1 
ATOM   1536  C CA  . GLY A 1 201 ? 8.790   -5.429  29.243  1.00 30.81  ? 211 GLY P CA  1 
ATOM   1537  C C   . GLY A 1 201 ? 8.504   -4.035  28.703  1.00 30.22  ? 211 GLY P C   1 
ATOM   1538  O O   . GLY A 1 201 ? 8.736   -3.012  29.343  1.00 28.79  ? 211 GLY P O   1 
ATOM   1539  N N   . ILE A 1 202 ? 7.977   -4.013  27.491  1.00 28.74  ? 212 ILE P N   1 
ATOM   1540  C CA  . ILE A 1 202 ? 7.462   -2.806  26.895  1.00 30.58  ? 212 ILE P CA  1 
ATOM   1541  C C   . ILE A 1 202 ? 5.943   -2.775  27.005  1.00 35.13  ? 212 ILE P C   1 
ATOM   1542  O O   . ILE A 1 202 ? 5.288   -3.820  26.948  1.00 34.67  ? 212 ILE P O   1 
ATOM   1543  C CB  . ILE A 1 202 ? 7.848   -2.750  25.437  1.00 29.27  ? 212 ILE P CB  1 
ATOM   1544  C CG1 . ILE A 1 202 ? 9.171   -2.022  25.301  1.00 30.40  ? 212 ILE P CG1 1 
ATOM   1545  C CG2 . ILE A 1 202 ? 6.784   -2.058  24.639  1.00 32.26  ? 212 ILE P CG2 1 
ATOM   1546  C CD1 . ILE A 1 202 ? 10.272  -2.945  24.864  1.00 32.46  ? 212 ILE P CD1 1 
ATOM   1547  N N   . THR A 1 203 ? 5.391   -1.574  27.164  1.00 36.99  ? 213 THR P N   1 
ATOM   1548  C CA  . THR A 1 203 ? 3.951   -1.376  27.311  1.00 40.86  ? 213 THR P CA  1 
ATOM   1549  C C   . THR A 1 203 ? 3.162   -1.620  26.038  1.00 38.75  ? 213 THR P C   1 
ATOM   1550  O O   . THR A 1 203 ? 3.322   -0.929  25.064  1.00 40.60  ? 213 THR P O   1 
ATOM   1551  C CB  . THR A 1 203 ? 3.633   0.052   27.747  1.00 49.16  ? 213 THR P CB  1 
ATOM   1552  O OG1 . THR A 1 203 ? 4.230   0.304   29.029  1.00 47.59  ? 213 THR P OG1 1 
ATOM   1553  C CG2 . THR A 1 203 ? 2.113   0.251   27.818  1.00 52.57  ? 213 THR P CG2 1 
ATOM   1554  N N   . SER A 1 204 ? 2.271   -2.583  26.066  1.00 40.13  ? 214 SER P N   1 
ATOM   1555  C CA  . SER A 1 204 ? 1.559   -2.941  24.868  1.00 48.55  ? 214 SER P CA  1 
ATOM   1556  C C   . SER A 1 204 ? 0.318   -2.089  24.673  1.00 55.98  ? 214 SER P C   1 
ATOM   1557  O O   . SER A 1 204 ? 0.056   -1.156  25.441  1.00 54.25  ? 214 SER P O   1 
ATOM   1558  C CB  . SER A 1 204 ? 1.139   -4.417  24.924  1.00 56.09  ? 214 SER P CB  1 
ATOM   1559  O OG  . SER A 1 204 ? -0.178  -4.547  25.482  1.00 58.54  ? 214 SER P OG  1 
ATOM   1560  N N   . TRP A 1 205 ? -0.446  -2.496  23.653  1.00 63.38  ? 215 TRP P N   1 
ATOM   1561  C CA  . TRP A 1 205 ? -1.633  -1.826  23.114  1.00 65.67  ? 215 TRP P CA  1 
ATOM   1562  C C   . TRP A 1 205 ? -2.902  -2.011  23.961  1.00 72.84  ? 215 TRP P C   1 
ATOM   1563  O O   . TRP A 1 205 ? -3.280  -3.141  24.315  1.00 65.35  ? 215 TRP P O   1 
ATOM   1564  C CB  . TRP A 1 205 ? -1.882  -2.322  21.675  1.00 58.18  ? 215 TRP P CB  1 
ATOM   1565  C CG  . TRP A 1 205 ? -2.827  -1.482  20.878  1.00 66.72  ? 215 TRP P CG  1 
ATOM   1566  C CD1 . TRP A 1 205 ? -3.739  -1.914  19.945  1.00 76.69  ? 215 TRP P CD1 1 
ATOM   1567  C CD2 . TRP A 1 205 ? -2.968  -0.055  20.945  1.00 73.00  ? 215 TRP P CD2 1 
ATOM   1568  N NE1 . TRP A 1 205 ? -4.443  -0.837  19.434  1.00 77.57  ? 215 TRP P NE1 1 
ATOM   1569  C CE2 . TRP A 1 205 ? -3.986  0.311   20.028  1.00 73.74  ? 215 TRP P CE2 1 
ATOM   1570  C CE3 . TRP A 1 205 ? -2.336  0.950   21.695  1.00 70.36  ? 215 TRP P CE3 1 
ATOM   1571  C CZ2 . TRP A 1 205 ? -4.378  1.628   19.843  1.00 76.16  ? 215 TRP P CZ2 1 
ATOM   1572  C CZ3 . TRP A 1 205 ? -2.725  2.257   21.510  1.00 73.70  ? 215 TRP P CZ3 1 
ATOM   1573  C CH2 . TRP A 1 205 ? -3.740  2.586   20.590  1.00 85.82  ? 215 TRP P CH2 1 
ATOM   1574  N N   . GLY A 1 206 ? -3.549  -0.883  24.268  1.00 76.64  ? 216 GLY P N   1 
ATOM   1575  C CA  . GLY A 1 206 ? -4.783  -0.861  25.035  1.00 80.62  ? 216 GLY P CA  1 
ATOM   1576  C C   . GLY A 1 206 ? -4.552  -0.515  26.498  1.00 87.41  ? 216 GLY P C   1 
ATOM   1577  O O   . GLY A 1 206 ? -5.190  0.391   27.054  1.00 89.22  ? 216 GLY P O   1 
ATOM   1578  N N   . SER A 1 207 ? -3.659  -1.230  27.140  1.00 83.60  ? 217 SER P N   1 
ATOM   1579  C CA  . SER A 1 207 ? -3.434  -0.963  28.526  1.00 80.10  ? 217 SER P CA  1 
ATOM   1580  C C   . SER A 1 207 ? -2.532  0.225   28.656  1.00 89.15  ? 217 SER P C   1 
ATOM   1581  O O   . SER A 1 207 ? -1.350  0.121   28.424  1.00 91.92  ? 217 SER P O   1 
ATOM   1582  C CB  . SER A 1 207 ? -2.795  -2.146  29.183  1.00 66.64  ? 217 SER P CB  1 
ATOM   1583  O OG  . SER A 1 207 ? -1.605  -1.718  29.780  1.00 62.91  ? 217 SER P OG  1 
ATOM   1584  N N   . GLU A 1 208 ? -3.103  1.354   29.060  1.00 96.21  ? 218 GLU P N   1 
ATOM   1585  C CA  . GLU A 1 208 ? -2.347  2.541   29.426  1.00 101.98 ? 218 GLU P CA  1 
ATOM   1586  C C   . GLU A 1 208 ? -2.710  2.881   30.856  1.00 107.84 ? 218 GLU P C   1 
ATOM   1587  O O   . GLU A 1 208 ? -3.635  2.312   31.407  1.00 108.97 ? 218 GLU P O   1 
ATOM   1588  C CB  . GLU A 1 208 ? -2.644  3.708   28.493  1.00 104.83 ? 218 GLU P CB  1 
ATOM   1589  C CG  . GLU A 1 208 ? -4.054  3.737   27.937  1.00 109.74 ? 218 GLU P CG  1 
ATOM   1590  C CD  . GLU A 1 208 ? -4.097  4.144   26.492  1.00 108.27 ? 218 GLU P CD  1 
ATOM   1591  O OE1 . GLU A 1 208 ? -5.157  4.580   26.028  1.00 108.17 ? 218 GLU P OE1 1 
ATOM   1592  O OE2 . GLU A 1 208 ? -3.068  4.026   25.818  1.00 102.03 ? 218 GLU P OE2 1 
ATOM   1593  N N   . PRO A 1 209 ? -1.967  3.804   31.453  1.00 109.49 ? 219 PRO P N   1 
ATOM   1594  C CA  . PRO A 1 209 ? -1.894  3.940   32.912  1.00 110.57 ? 219 PRO P CA  1 
ATOM   1595  C C   . PRO A 1 209 ? -2.748  4.984   33.668  1.00 116.99 ? 219 PRO P C   1 
ATOM   1596  O O   . PRO A 1 209 ? -2.663  4.998   34.891  1.00 115.43 ? 219 PRO P O   1 
ATOM   1597  C CB  . PRO A 1 209 ? -0.412  4.244   33.131  1.00 109.15 ? 219 PRO P CB  1 
ATOM   1598  C CG  . PRO A 1 209 ? 0.274   3.641   31.963  1.00 99.74  ? 219 PRO P CG  1 
ATOM   1599  C CD  . PRO A 1 209 ? -0.632  3.854   30.829  1.00 98.39  ? 219 PRO P CD  1 
ATOM   1600  N N   . CYS A 1 210 ? -3.533  5.825   33.004  1.00 120.36 ? 220 CYS P N   1 
ATOM   1601  C CA  . CYS A 1 210 ? -4.320  6.902   33.722  1.00 119.15 ? 220 CYS P CA  1 
ATOM   1602  C C   . CYS A 1 210 ? -5.280  6.531   34.651  1.00 120.57 ? 220 CYS P C   1 
ATOM   1603  O O   . CYS A 1 210 ? -6.463  6.647   34.435  1.00 121.82 ? 220 CYS P O   1 
ATOM   1604  C CB  . CYS A 1 210 ? -4.797  7.974   32.742  1.00 121.13 ? 220 CYS P CB  1 
ATOM   1605  S SG  . CYS A 1 210 ? -3.534  9.122   32.334  1.00 132.38 ? 220 CYS P SG  1 
ATOM   1606  N N   . ALA A 1 211 ? -4.770  6.271   35.816  1.00 118.39 ? 221 ALA P N   1 
ATOM   1607  C CA  . ALA A 1 211 ? -5.599  6.337   36.955  1.00 121.21 ? 221 ALA P CA  1 
ATOM   1608  C C   . ALA A 1 211 ? -6.271  5.003   36.972  1.00 118.09 ? 221 ALA P C   1 
ATOM   1609  O O   . ALA A 1 211 ? -7.406  4.855   36.536  1.00 111.51 ? 221 ALA P O   1 
ATOM   1610  C CB  . ALA A 1 211 ? -6.623  7.384   36.699  1.00 115.37 ? 221 ALA P CB  1 
ATOM   1611  N N   . LEU A 1 212 ? -5.519  3.990   37.330  1.00 117.51 ? 222 LEU P N   1 
ATOM   1612  C CA  . LEU A 1 212 ? -6.090  2.659   37.367  1.00 106.82 ? 222 LEU P CA  1 
ATOM   1613  C C   . LEU A 1 212 ? -5.406  1.756   38.374  1.00 100.99 ? 222 LEU P C   1 
ATOM   1614  O O   . LEU A 1 212 ? -4.952  0.672   38.072  1.00 95.78  ? 222 LEU P O   1 
ATOM   1615  C CB  . LEU A 1 212 ? -6.159  2.069   35.966  1.00 107.58 ? 222 LEU P CB  1 
ATOM   1616  C CG  . LEU A 1 212 ? -6.911  3.097   35.111  1.00 108.88 ? 222 LEU P CG  1 
ATOM   1617  C CD1 . LEU A 1 212 ? -6.675  2.885   33.654  1.00 108.04 ? 222 LEU P CD1 1 
ATOM   1618  C CD2 . LEU A 1 212 ? -8.387  3.098   35.408  1.00 99.47  ? 222 LEU P CD2 1 
ATOM   1619  N N   . PRO A 1 213 ? -5.362  2.261   39.590  1.00 109.51 ? 223 PRO P N   1 
ATOM   1620  C CA  . PRO A 1 213 ? -5.104  1.483   40.818  1.00 111.01 ? 223 PRO P CA  1 
ATOM   1621  C C   . PRO A 1 213 ? -6.122  0.362   40.866  1.00 103.08 ? 223 PRO P C   1 
ATOM   1622  O O   . PRO A 1 213 ? -5.941  -0.719  41.439  1.00 95.42  ? 223 PRO P O   1 
ATOM   1623  C CB  . PRO A 1 213 ? -5.363  2.497   41.953  1.00 113.07 ? 223 PRO P CB  1 
ATOM   1624  C CG  . PRO A 1 213 ? -5.211  3.852   41.302  1.00 117.60 ? 223 PRO P CG  1 
ATOM   1625  C CD  . PRO A 1 213 ? -5.709  3.664   39.888  1.00 115.87 ? 223 PRO P CD  1 
ATOM   1626  N N   . GLU A 1 214 A -7.235  0.683   40.227  1.00 100.36 ? 223 GLU P N   1 
ATOM   1627  C CA  . GLU A 1 214 A -8.203  -0.282  39.788  1.00 100.65 ? 223 GLU P CA  1 
ATOM   1628  C C   . GLU A 1 214 A -7.504  -1.253  38.807  1.00 103.81 ? 223 GLU P C   1 
ATOM   1629  O O   . GLU A 1 214 A -7.345  -2.446  39.111  1.00 101.53 ? 223 GLU P O   1 
ATOM   1630  C CB  . GLU A 1 214 A -9.373  0.480   39.140  1.00 98.21  ? 223 GLU P CB  1 
ATOM   1631  C CG  . GLU A 1 214 A -9.916  1.616   40.036  1.00 91.93  ? 223 GLU P CG  1 
ATOM   1632  C CD  . GLU A 1 214 A -10.314 2.886   39.278  1.00 89.25  ? 223 GLU P CD  1 
ATOM   1633  O OE1 . GLU A 1 214 A -10.344 3.960   39.924  1.00 79.04  ? 223 GLU P OE1 1 
ATOM   1634  O OE2 . GLU A 1 214 A -10.594 2.818   38.054  1.00 93.28  ? 223 GLU P OE2 1 
ATOM   1635  N N   . ARG A 1 215 ? -7.035  -0.734  37.667  1.00 94.34  ? 224 ARG P N   1 
ATOM   1636  C CA  . ARG A 1 215 ? -6.568  -1.593  36.573  1.00 82.27  ? 224 ARG P CA  1 
ATOM   1637  C C   . ARG A 1 215 ? -5.070  -1.907  36.495  1.00 76.70  ? 224 ARG P C   1 
ATOM   1638  O O   . ARG A 1 215 ? -4.237  -1.032  36.250  1.00 76.27  ? 224 ARG P O   1 
ATOM   1639  C CB  . ARG A 1 215 ? -7.024  -1.043  35.219  1.00 87.36  ? 224 ARG P CB  1 
ATOM   1640  C CG  . ARG A 1 215 ? -8.435  -1.390  34.832  1.00 87.59  ? 224 ARG P CG  1 
ATOM   1641  C CD  . ARG A 1 215 ? -9.446  -0.461  35.486  1.00 97.73  ? 224 ARG P CD  1 
ATOM   1642  N NE  . ARG A 1 215 ? -10.803 -0.775  35.043  1.00 101.13 ? 224 ARG P NE  1 
ATOM   1643  C CZ  . ARG A 1 215 ? -11.428 -0.165  34.039  1.00 99.73  ? 224 ARG P CZ  1 
ATOM   1644  N NH1 . ARG A 1 215 ? -10.825 0.813   33.373  1.00 98.51  ? 224 ARG P NH1 1 
ATOM   1645  N NH2 . ARG A 1 215 ? -12.661 -0.530  33.709  1.00 98.97  ? 224 ARG P NH2 1 
ATOM   1646  N N   . PRO A 1 216 ? -4.732  -3.182  36.672  1.00 68.64  ? 225 PRO P N   1 
ATOM   1647  C CA  . PRO A 1 216 ? -3.426  -3.715  36.284  1.00 56.46  ? 225 PRO P CA  1 
ATOM   1648  C C   . PRO A 1 216 ? -3.136  -3.384  34.832  1.00 49.18  ? 225 PRO P C   1 
ATOM   1649  O O   . PRO A 1 216 ? -4.072  -3.342  34.070  1.00 51.15  ? 225 PRO P O   1 
ATOM   1650  C CB  . PRO A 1 216 ? -3.633  -5.226  36.380  1.00 53.26  ? 225 PRO P CB  1 
ATOM   1651  C CG  . PRO A 1 216 ? -5.105  -5.436  36.666  1.00 59.17  ? 225 PRO P CG  1 
ATOM   1652  C CD  . PRO A 1 216 ? -5.581  -4.197  37.309  1.00 63.17  ? 225 PRO P CD  1 
ATOM   1653  N N   . SER A 1 217 ? -1.876  -3.188  34.449  1.00 51.40  ? 226 SER P N   1 
ATOM   1654  C CA  . SER A 1 217 ? -1.519  -3.031  33.034  1.00 46.90  ? 226 SER P CA  1 
ATOM   1655  C C   . SER A 1 217 ? -0.854  -4.255  32.486  1.00 42.92  ? 226 SER P C   1 
ATOM   1656  O O   . SER A 1 217 ? -0.205  -4.986  33.230  1.00 42.58  ? 226 SER P O   1 
ATOM   1657  C CB  . SER A 1 217 ? -0.553  -1.886  32.848  1.00 44.41  ? 226 SER P CB  1 
ATOM   1658  O OG  . SER A 1 217 ? -0.906  -0.830  33.713  1.00 64.91  ? 226 SER P OG  1 
ATOM   1659  N N   . LEU A 1 218 ? -1.001  -4.479  31.184  1.00 43.17  ? 227 LEU P N   1 
ATOM   1660  C CA  . LEU A 1 218 ? -0.244  -5.548  30.542  1.00 42.65  ? 227 LEU P CA  1 
ATOM   1661  C C   . LEU A 1 218 ? 0.865   -5.058  29.620  1.00 37.42  ? 227 LEU P C   1 
ATOM   1662  O O   . LEU A 1 218 ? 0.718   -4.057  28.926  1.00 36.81  ? 227 LEU P O   1 
ATOM   1663  C CB  . LEU A 1 218 ? -1.124  -6.622  29.880  1.00 45.77  ? 227 LEU P CB  1 
ATOM   1664  C CG  . LEU A 1 218 ? -2.418  -6.403  29.112  1.00 45.32  ? 227 LEU P CG  1 
ATOM   1665  C CD1 . LEU A 1 218 ? -2.239  -5.411  28.013  1.00 51.50  ? 227 LEU P CD1 1 
ATOM   1666  C CD2 . LEU A 1 218 ? -2.811  -7.728  28.536  1.00 42.32  ? 227 LEU P CD2 1 
ATOM   1667  N N   . TYR A 1 219 ? 1.987   -5.780  29.683  1.00 37.65  ? 228 TYR P N   1 
ATOM   1668  C CA  . TYR A 1 219 ? 3.237   -5.462  28.989  1.00 37.62  ? 228 TYR P CA  1 
ATOM   1669  C C   . TYR A 1 219 ? 3.697   -6.647  28.139  1.00 35.29  ? 228 TYR P C   1 
ATOM   1670  O O   . TYR A 1 219 ? 3.342   -7.792  28.425  1.00 36.90  ? 228 TYR P O   1 
ATOM   1671  C CB  . TYR A 1 219 ? 4.338   -5.115  29.999  1.00 32.48  ? 228 TYR P CB  1 
ATOM   1672  C CG  . TYR A 1 219 ? 4.005   -3.988  30.947  1.00 31.52  ? 228 TYR P CG  1 
ATOM   1673  C CD1 . TYR A 1 219 ? 3.382   -4.239  32.164  1.00 31.59  ? 228 TYR P CD1 1 
ATOM   1674  C CD2 . TYR A 1 219 ? 4.329   -2.687  30.638  1.00 31.70  ? 228 TYR P CD2 1 
ATOM   1675  C CE1 . TYR A 1 219 ? 3.085   -3.236  33.030  1.00 29.09  ? 228 TYR P CE1 1 
ATOM   1676  C CE2 . TYR A 1 219 ? 4.037   -1.674  31.494  1.00 34.43  ? 228 TYR P CE2 1 
ATOM   1677  C CZ  . TYR A 1 219 ? 3.405   -1.955  32.689  1.00 33.55  ? 228 TYR P CZ  1 
ATOM   1678  O OH  . TYR A 1 219 ? 3.092   -0.932  33.545  1.00 34.65  ? 228 TYR P OH  1 
ATOM   1679  N N   . THR A 1 220 ? 4.488   -6.376  27.107  1.00 30.41  ? 229 THR P N   1 
ATOM   1680  C CA  . THR A 1 220 ? 4.997   -7.441  26.255  1.00 31.68  ? 229 THR P CA  1 
ATOM   1681  C C   . THR A 1 220 ? 6.201   -8.132  26.884  1.00 33.33  ? 229 THR P C   1 
ATOM   1682  O O   . THR A 1 220 ? 7.237   -7.521  27.086  1.00 36.55  ? 229 THR P O   1 
ATOM   1683  C CB  . THR A 1 220 ? 5.383   -6.891  24.885  1.00 34.73  ? 229 THR P CB  1 
ATOM   1684  O OG1 . THR A 1 220 ? 4.190   -6.661  24.117  1.00 40.35  ? 229 THR P OG1 1 
ATOM   1685  C CG2 . THR A 1 220 ? 6.301   -7.854  24.167  1.00 31.75  ? 229 THR P CG2 1 
ATOM   1686  N N   . LYS A 1 221 ? 6.084   -9.408  27.208  1.00 32.95  ? 230 LYS P N   1 
ATOM   1687  C CA  . LYS A 1 221 ? 7.192   -10.102 27.869  1.00 34.77  ? 230 LYS P CA  1 
ATOM   1688  C C   . LYS A 1 221 ? 8.454   -10.157 26.953  1.00 37.33  ? 230 LYS P C   1 
ATOM   1689  O O   . LYS A 1 221 ? 8.505   -10.951 26.024  1.00 37.73  ? 230 LYS P O   1 
ATOM   1690  C CB  . LYS A 1 221 ? 6.706   -11.489 28.355  1.00 32.49  ? 230 LYS P CB  1 
ATOM   1691  C CG  . LYS A 1 221 ? 7.743   -12.416 28.942  1.00 36.16  ? 230 LYS P CG  1 
ATOM   1692  C CD  . LYS A 1 221 ? 7.156   -13.506 29.837  1.00 29.71  ? 230 LYS P CD  1 
ATOM   1693  C CE  . LYS A 1 221 ? 6.340   -14.563 29.114  1.00 39.76  ? 230 LYS P CE  1 
ATOM   1694  N NZ  . LYS A 1 221 ? 7.038   -15.435 28.099  1.00 50.79  ? 230 LYS P NZ  1 
ATOM   1695  N N   . VAL A 1 222 ? 9.454   -9.303  27.199  1.00 35.23  ? 231 VAL P N   1 
ATOM   1696  C CA  . VAL A 1 222 ? 10.634  -9.203  26.306  1.00 35.05  ? 231 VAL P CA  1 
ATOM   1697  C C   . VAL A 1 222 ? 11.548  -10.440 26.188  1.00 39.62  ? 231 VAL P C   1 
ATOM   1698  O O   . VAL A 1 222 ? 11.957  -10.817 25.085  1.00 35.01  ? 231 VAL P O   1 
ATOM   1699  C CB  . VAL A 1 222 ? 11.589  -8.066  26.729  1.00 31.57  ? 231 VAL P CB  1 
ATOM   1700  C CG1 . VAL A 1 222 ? 12.872  -8.133  25.914  1.00 31.56  ? 231 VAL P CG1 1 
ATOM   1701  C CG2 . VAL A 1 222 ? 10.931  -6.730  26.594  1.00 30.56  ? 231 VAL P CG2 1 
ATOM   1702  N N   . VAL A 1 223 ? 11.902  -11.040 27.326  1.00 39.75  ? 232 VAL P N   1 
ATOM   1703  C CA  . VAL A 1 223 ? 12.965  -12.039 27.365  1.00 38.26  ? 232 VAL P CA  1 
ATOM   1704  C C   . VAL A 1 223 ? 12.682  -13.101 26.330  1.00 42.55  ? 232 VAL P C   1 
ATOM   1705  O O   . VAL A 1 223 ? 13.574  -13.861 25.920  1.00 42.43  ? 232 VAL P O   1 
ATOM   1706  C CB  . VAL A 1 223 ? 13.011  -12.725 28.698  1.00 36.72  ? 232 VAL P CB  1 
ATOM   1707  C CG1 . VAL A 1 223 ? 11.662  -13.359 28.952  1.00 40.08  ? 232 VAL P CG1 1 
ATOM   1708  C CG2 . VAL A 1 223 ? 14.106  -13.757 28.716  1.00 32.15  ? 232 VAL P CG2 1 
ATOM   1709  N N   . HIS A 1 224 ? 11.421  -13.138 25.915  1.00 42.25  ? 233 HIS P N   1 
ATOM   1710  C CA  . HIS A 1 224 ? 10.926  -14.117 24.963  1.00 47.66  ? 233 HIS P CA  1 
ATOM   1711  C C   . HIS A 1 224 ? 11.312  -13.706 23.527  1.00 46.50  ? 233 HIS P C   1 
ATOM   1712  O O   . HIS A 1 224 ? 11.328  -14.528 22.615  1.00 50.27  ? 233 HIS P O   1 
ATOM   1713  C CB  . HIS A 1 224 ? 9.404   -14.269 25.147  1.00 52.04  ? 233 HIS P CB  1 
ATOM   1714  C CG  . HIS A 1 224 ? 8.775   -15.369 24.338  1.00 58.48  ? 233 HIS P CG  1 
ATOM   1715  N ND1 . HIS A 1 224 ? 9.115   -15.625 23.026  1.00 56.53  ? 233 HIS P ND1 1 
ATOM   1716  C CD2 . HIS A 1 224 ? 7.785   -16.241 24.648  1.00 62.72  ? 233 HIS P CD2 1 
ATOM   1717  C CE1 . HIS A 1 224 ? 8.388   -16.631 22.570  1.00 55.73  ? 233 HIS P CE1 1 
ATOM   1718  N NE2 . HIS A 1 224 ? 7.571   -17.021 23.532  1.00 65.47  ? 233 HIS P NE2 1 
ATOM   1719  N N   . TYR A 1 225 ? 11.662  -12.444 23.322  1.00 41.76  ? 234 TYR P N   1 
ATOM   1720  C CA  . TYR A 1 225 ? 12.014  -12.017 21.971  1.00 42.61  ? 234 TYR P CA  1 
ATOM   1721  C C   . TYR A 1 225 ? 13.491  -11.699 21.842  1.00 39.93  ? 234 TYR P C   1 
ATOM   1722  O O   . TYR A 1 225 ? 13.873  -11.042 20.887  1.00 33.93  ? 234 TYR P O   1 
ATOM   1723  C CB  . TYR A 1 225 ? 11.193  -10.791 21.529  1.00 41.43  ? 234 TYR P CB  1 
ATOM   1724  C CG  . TYR A 1 225 ? 9.688   -10.968 21.593  1.00 38.02  ? 234 TYR P CG  1 
ATOM   1725  C CD1 . TYR A 1 225 ? 8.947   -11.113 20.455  1.00 35.86  ? 234 TYR P CD1 1 
ATOM   1726  C CD2 . TYR A 1 225 ? 9.024   -10.981 22.804  1.00 41.39  ? 234 TYR P CD2 1 
ATOM   1727  C CE1 . TYR A 1 225 ? 7.589   -11.277 20.515  1.00 42.23  ? 234 TYR P CE1 1 
ATOM   1728  C CE2 . TYR A 1 225 ? 7.670   -11.144 22.880  1.00 40.64  ? 234 TYR P CE2 1 
ATOM   1729  C CZ  . TYR A 1 225 ? 6.946   -11.288 21.734  1.00 44.31  ? 234 TYR P CZ  1 
ATOM   1730  O OH  . TYR A 1 225 ? 5.568   -11.440 21.797  1.00 46.26  ? 234 TYR P OH  1 
ATOM   1731  N N   . ARG A 1 226 ? 14.318  -12.110 22.773  1.00 42.52  ? 235 ARG P N   1 
ATOM   1732  C CA  . ARG A 1 226 ? 15.720  -11.751 22.756  1.00 37.68  ? 235 ARG P CA  1 
ATOM   1733  C C   . ARG A 1 226 ? 16.370  -12.063 21.462  1.00 36.23  ? 235 ARG P C   1 
ATOM   1734  O O   . ARG A 1 226 ? 16.876  -11.210 20.806  1.00 36.28  ? 235 ARG P O   1 
ATOM   1735  C CB  . ARG A 1 226 ? 16.447  -12.521 23.815  1.00 35.95  ? 235 ARG P CB  1 
ATOM   1736  C CG  . ARG A 1 226 ? 17.596  -11.806 24.385  1.00 40.98  ? 235 ARG P CG  1 
ATOM   1737  C CD  . ARG A 1 226 ? 18.515  -12.795 25.028  1.00 49.68  ? 235 ARG P CD  1 
ATOM   1738  N NE  . ARG A 1 226 ? 19.139  -12.277 26.219  1.00 51.57  ? 235 ARG P NE  1 
ATOM   1739  C CZ  . ARG A 1 226 ? 20.434  -12.272 26.415  1.00 50.46  ? 235 ARG P CZ  1 
ATOM   1740  N NH1 . ARG A 1 226 ? 20.923  -11.770 27.524  1.00 50.21  ? 235 ARG P NH1 1 
ATOM   1741  N NH2 . ARG A 1 226 ? 21.228  -12.769 25.496  1.00 49.33  ? 235 ARG P NH2 1 
ATOM   1742  N N   . LYS A 1 227 ? 16.394  -13.317 21.096  1.00 37.30  ? 236 LYS P N   1 
ATOM   1743  C CA  . LYS A 1 227 ? 16.994  -13.706 19.821  1.00 40.77  ? 236 LYS P CA  1 
ATOM   1744  C C   . LYS A 1 227 ? 16.518  -12.887 18.611  1.00 40.67  ? 236 LYS P C   1 
ATOM   1745  O O   . LYS A 1 227 ? 17.309  -12.604 17.723  1.00 39.78  ? 236 LYS P O   1 
ATOM   1746  C CB  . LYS A 1 227 ? 16.794  -15.208 19.549  1.00 46.26  ? 236 LYS P CB  1 
ATOM   1747  C CG  . LYS A 1 227 ? 17.698  -15.766 18.448  1.00 50.85  ? 236 LYS P CG  1 
ATOM   1748  C CD  . LYS A 1 227 ? 19.012  -14.967 18.390  1.00 56.43  ? 236 LYS P CD  1 
ATOM   1749  C CE  . LYS A 1 227 ? 20.214  -15.747 17.841  1.00 56.86  ? 236 LYS P CE  1 
ATOM   1750  N NZ  . LYS A 1 227 ? 21.477  -15.157 18.400  1.00 62.56  ? 236 LYS P NZ  1 
ATOM   1751  N N   . TRP A 1 228 ? 15.234  -12.529 18.549  1.00 40.27  ? 237 TRP P N   1 
ATOM   1752  C CA  . TRP A 1 228 ? 14.751  -11.747 17.406  1.00 35.37  ? 237 TRP P CA  1 
ATOM   1753  C C   . TRP A 1 228 ? 15.480  -10.418 17.315  1.00 36.26  ? 237 TRP P C   1 
ATOM   1754  O O   . TRP A 1 228 ? 15.981  -10.071 16.267  1.00 37.46  ? 237 TRP P O   1 
ATOM   1755  C CB  . TRP A 1 228 ? 13.247  -11.508 17.460  1.00 33.38  ? 237 TRP P CB  1 
ATOM   1756  C CG  . TRP A 1 228 ? 12.733  -10.631 16.330  1.00 34.67  ? 237 TRP P CG  1 
ATOM   1757  C CD1 . TRP A 1 228 ? 12.546  -10.999 15.033  1.00 36.90  ? 237 TRP P CD1 1 
ATOM   1758  C CD2 . TRP A 1 228 ? 12.330  -9.254  16.409  1.00 31.42  ? 237 TRP P CD2 1 
ATOM   1759  N NE1 . TRP A 1 228 ? 12.064  -9.941  14.301  1.00 33.98  ? 237 TRP P NE1 1 
ATOM   1760  C CE2 . TRP A 1 228 ? 11.919  -8.863  15.133  1.00 31.63  ? 237 TRP P CE2 1 
ATOM   1761  C CE3 . TRP A 1 228 ? 12.271  -8.324  17.438  1.00 28.67  ? 237 TRP P CE3 1 
ATOM   1762  C CZ2 . TRP A 1 228 ? 11.459  -7.589  14.869  1.00 31.24  ? 237 TRP P CZ2 1 
ATOM   1763  C CZ3 . TRP A 1 228 ? 11.820  -7.074  17.168  1.00 27.85  ? 237 TRP P CZ3 1 
ATOM   1764  C CH2 . TRP A 1 228 ? 11.427  -6.709  15.901  1.00 28.11  ? 237 TRP P CH2 1 
ATOM   1765  N N   . ILE A 1 229 ? 15.533  -9.697  18.433  1.00 37.09  ? 238 ILE P N   1 
ATOM   1766  C CA  . ILE A 1 229 ? 16.259  -8.444  18.559  1.00 33.95  ? 238 ILE P CA  1 
ATOM   1767  C C   . ILE A 1 229 ? 17.740  -8.677  18.265  1.00 42.35  ? 238 ILE P C   1 
ATOM   1768  O O   . ILE A 1 229 ? 18.326  -8.024  17.387  1.00 43.10  ? 238 ILE P O   1 
ATOM   1769  C CB  . ILE A 1 229 ? 16.189  -7.882  19.994  1.00 32.28  ? 238 ILE P CB  1 
ATOM   1770  C CG1 . ILE A 1 229 ? 14.766  -7.831  20.522  1.00 35.78  ? 238 ILE P CG1 1 
ATOM   1771  C CG2 . ILE A 1 229 ? 16.736  -6.513  20.028  1.00 34.13  ? 238 ILE P CG2 1 
ATOM   1772  C CD1 . ILE A 1 229 ? 14.675  -7.336  21.928  1.00 32.35  ? 238 ILE P CD1 1 
ATOM   1773  N N   . LYS A 1 230 ? 18.365  -9.592  19.004  1.00 39.80  ? 239 LYS P N   1 
ATOM   1774  C CA  . LYS A 1 230 ? 19.796  -9.760  18.844  1.00 37.61  ? 239 LYS P CA  1 
ATOM   1775  C C   . LYS A 1 230 ? 20.066  -9.796  17.344  1.00 44.24  ? 239 LYS P C   1 
ATOM   1776  O O   . LYS A 1 230 ? 20.976  -9.145  16.863  1.00 48.71  ? 239 LYS P O   1 
ATOM   1777  C CB  . LYS A 1 230 ? 20.317  -11.032 19.527  1.00 41.34  ? 239 LYS P CB  1 
ATOM   1778  C CG  . LYS A 1 230 ? 20.437  -10.995 21.059  1.00 39.19  ? 239 LYS P CG  1 
ATOM   1779  C CD  . LYS A 1 230 ? 21.237  -9.821  21.558  1.00 38.18  ? 239 LYS P CD  1 
ATOM   1780  C CE  . LYS A 1 230 ? 21.689  -10.049 22.996  1.00 47.06  ? 239 LYS P CE  1 
ATOM   1781  N NZ  . LYS A 1 230 ? 22.085  -8.774  23.685  1.00 48.34  ? 239 LYS P NZ  1 
ATOM   1782  N N   . ASP A 1 231 ? 19.229  -10.510 16.595  1.00 42.86  ? 240 ASP P N   1 
ATOM   1783  C CA  . ASP A 1 231 ? 19.521  -10.796 15.202  1.00 38.95  ? 240 ASP P CA  1 
ATOM   1784  C C   . ASP A 1 231 ? 19.031  -9.714  14.286  1.00 41.57  ? 240 ASP P C   1 
ATOM   1785  O O   . ASP A 1 231 ? 19.789  -9.231  13.453  1.00 44.10  ? 240 ASP P O   1 
ATOM   1786  C CB  . ASP A 1 231 ? 18.928  -12.136 14.802  1.00 42.23  ? 240 ASP P CB  1 
ATOM   1787  C CG  . ASP A 1 231 ? 19.723  -13.299 15.364  1.00 54.96  ? 240 ASP P CG  1 
ATOM   1788  O OD1 . ASP A 1 231 ? 20.839  -13.032 15.884  1.00 57.80  ? 240 ASP P OD1 1 
ATOM   1789  O OD2 . ASP A 1 231 ? 19.256  -14.465 15.296  1.00 54.32  ? 240 ASP P OD2 1 
ATOM   1790  N N   . THR A 1 232 ? 17.761  -9.338  14.420  1.00 41.34  ? 241 THR P N   1 
ATOM   1791  C CA  . THR A 1 232 ? 17.201  -8.290  13.565  1.00 40.95  ? 241 THR P CA  1 
ATOM   1792  C C   . THR A 1 232 ? 18.137  -7.097  13.621  1.00 40.51  ? 241 THR P C   1 
ATOM   1793  O O   . THR A 1 232 ? 18.344  -6.423  12.613  1.00 43.11  ? 241 THR P O   1 
ATOM   1794  C CB  . THR A 1 232 ? 15.706  -7.923  13.887  1.00 36.65  ? 241 THR P CB  1 
ATOM   1795  O OG1 . THR A 1 232 ? 15.392  -6.626  13.371  1.00 35.26  ? 241 THR P OG1 1 
ATOM   1796  C CG2 . THR A 1 232 ? 15.439  -7.886  15.358  1.00 36.91  ? 241 THR P CG2 1 
ATOM   1797  N N   . ILE A 1 233 ? 18.737  -6.887  14.793  1.00 39.64  ? 242 ILE P N   1 
ATOM   1798  C CA  . ILE A 1 233 ? 19.744  -5.837  15.006  1.00 47.65  ? 242 ILE P CA  1 
ATOM   1799  C C   . ILE A 1 233 ? 21.029  -6.021  14.173  1.00 47.35  ? 242 ILE P C   1 
ATOM   1800  O O   . ILE A 1 233 ? 21.515  -5.070  13.552  1.00 50.40  ? 242 ILE P O   1 
ATOM   1801  C CB  . ILE A 1 233 ? 20.128  -5.709  16.513  1.00 45.30  ? 242 ILE P CB  1 
ATOM   1802  C CG1 . ILE A 1 233 ? 19.711  -4.358  17.075  1.00 42.32  ? 242 ILE P CG1 1 
ATOM   1803  C CG2 . ILE A 1 233 ? 21.622  -5.825  16.708  1.00 46.52  ? 242 ILE P CG2 1 
ATOM   1804  C CD1 . ILE A 1 233 ? 19.871  -4.309  18.541  1.00 37.02  ? 242 ILE P CD1 1 
ATOM   1805  N N   . VAL A 1 234 ? 21.560  -7.242  14.179  1.00 44.25  ? 243 VAL P N   1 
ATOM   1806  C CA  . VAL A 1 234 ? 22.808  -7.597  13.519  1.00 45.04  ? 243 VAL P CA  1 
ATOM   1807  C C   . VAL A 1 234 ? 22.720  -7.482  12.002  1.00 50.35  ? 243 VAL P C   1 
ATOM   1808  O O   . VAL A 1 234 ? 23.674  -7.102  11.313  1.00 46.78  ? 243 VAL P O   1 
ATOM   1809  C CB  . VAL A 1 234 ? 23.138  -9.044  13.869  1.00 46.77  ? 243 VAL P CB  1 
ATOM   1810  C CG1 . VAL A 1 234 ? 24.070  -9.658  12.846  1.00 51.01  ? 243 VAL P CG1 1 
ATOM   1811  C CG2 . VAL A 1 234 ? 23.710  -9.122  15.269  1.00 50.88  ? 243 VAL P CG2 1 
ATOM   1812  N N   . ALA A 1 235 ? 21.550  -7.810  11.484  1.00 53.30  ? 244 ALA P N   1 
ATOM   1813  C CA  . ALA A 1 235 ? 21.391  -7.944  10.054  1.00 55.40  ? 244 ALA P CA  1 
ATOM   1814  C C   . ALA A 1 235 ? 21.059  -6.619  9.381   1.00 54.25  ? 244 ALA P C   1 
ATOM   1815  O O   . ALA A 1 235 ? 21.051  -6.519  8.154   1.00 58.43  ? 244 ALA P O   1 
ATOM   1816  C CB  . ALA A 1 235 ? 20.334  -8.999  9.741   1.00 53.66  ? 244 ALA P CB  1 
ATOM   1817  N N   . ASN A 1 236 ? 20.795  -5.584  10.159  1.00 51.13  ? 245 ASN P N   1 
ATOM   1818  C CA  . ASN A 1 236 ? 20.508  -4.316  9.506   1.00 58.04  ? 245 ASN P CA  1 
ATOM   1819  C C   . ASN A 1 236 ? 21.393  -3.113  9.873   1.00 66.43  ? 245 ASN P C   1 
ATOM   1820  O O   . ASN A 1 236 ? 20.869  -2.023  10.154  1.00 64.08  ? 245 ASN P O   1 
ATOM   1821  C CB  . ASN A 1 236 ? 19.020  -3.987  9.598   1.00 52.46  ? 245 ASN P CB  1 
ATOM   1822  C CG  . ASN A 1 236 ? 18.179  -4.930  8.767   1.00 55.66  ? 245 ASN P CG  1 
ATOM   1823  O OD1 . ASN A 1 236 ? 17.978  -4.715  7.560   1.00 50.07  ? 245 ASN P OD1 1 
ATOM   1824  N ND2 . ASN A 1 236 ? 17.689  -5.995  9.405   1.00 53.03  ? 245 ASN P ND2 1 
ATOM   1825  N N   . PRO A 1 237 ? 22.736  -3.296  9.807   1.00 65.87  ? 246 PRO P N   1 
ATOM   1826  C CA  . PRO A 1 237 ? 23.706  -2.274  10.217  1.00 64.01  ? 246 PRO P CA  1 
ATOM   1827  C C   . PRO A 1 237 ? 23.425  -0.886  9.613   1.00 76.31  ? 246 PRO P C   1 
ATOM   1828  O O   . PRO A 1 237 ? 23.558  0.140   10.305  1.00 72.03  ? 246 PRO P O   1 
ATOM   1829  C CB  . PRO A 1 237 ? 25.032  -2.831  9.692   1.00 59.49  ? 246 PRO P CB  1 
ATOM   1830  C CG  . PRO A 1 237 ? 24.826  -4.282  9.626   1.00 60.19  ? 246 PRO P CG  1 
ATOM   1831  C CD  . PRO A 1 237 ? 23.412  -4.459  9.200   1.00 61.12  ? 246 PRO P CD  1 
ATOM   1832  O OXT . PRO A 1 237 ? 23.047  -0.756  8.432   1.00 81.17  ? 246 PRO P OXT 1 
ATOM   1833  N N   . ASP B 2 1   ? 30.797  24.828  45.244  1.00 60.72  ? 1   ASP L N   1 
ATOM   1834  C CA  . ASP B 2 1   ? 30.990  23.939  46.392  1.00 60.63  ? 1   ASP L CA  1 
ATOM   1835  C C   . ASP B 2 1   ? 30.105  24.380  47.558  1.00 53.18  ? 1   ASP L C   1 
ATOM   1836  O O   . ASP B 2 1   ? 30.594  24.851  48.582  1.00 51.40  ? 1   ASP L O   1 
ATOM   1837  C CB  . ASP B 2 1   ? 32.471  23.872  46.801  1.00 56.62  ? 1   ASP L CB  1 
ATOM   1838  C CG  . ASP B 2 1   ? 33.274  22.871  45.955  1.00 63.66  ? 1   ASP L CG  1 
ATOM   1839  O OD1 . ASP B 2 1   ? 33.709  21.833  46.523  1.00 62.28  ? 1   ASP L OD1 1 
ATOM   1840  O OD2 . ASP B 2 1   ? 33.466  23.117  44.728  1.00 63.00  ? 1   ASP L OD2 1 
ATOM   1841  N N   . ILE B 2 2   ? 28.796  24.230  47.369  1.00 51.44  ? 2   ILE L N   1 
ATOM   1842  C CA  . ILE B 2 2   ? 27.789  24.688  48.320  1.00 47.95  ? 2   ILE L CA  1 
ATOM   1843  C C   . ILE B 2 2   ? 28.169  24.230  49.713  1.00 49.39  ? 2   ILE L C   1 
ATOM   1844  O O   . ILE B 2 2   ? 28.223  23.031  49.970  1.00 50.52  ? 2   ILE L O   1 
ATOM   1845  C CB  . ILE B 2 2   ? 26.395  24.103  47.981  1.00 43.07  ? 2   ILE L CB  1 
ATOM   1846  C CG1 . ILE B 2 2   ? 25.786  24.772  46.743  1.00 43.36  ? 2   ILE L CG1 1 
ATOM   1847  C CG2 . ILE B 2 2   ? 25.445  24.246  49.167  1.00 43.80  ? 2   ILE L CG2 1 
ATOM   1848  C CD1 . ILE B 2 2   ? 26.667  24.810  45.533  1.00 44.40  ? 2   ILE L CD1 1 
ATOM   1849  N N   . VAL B 2 3   ? 28.441  25.160  50.623  1.00 48.10  ? 3   VAL L N   1 
ATOM   1850  C CA  . VAL B 2 3   ? 28.749  24.730  51.981  1.00 48.92  ? 3   VAL L CA  1 
ATOM   1851  C C   . VAL B 2 3   ? 27.518  24.701  52.869  1.00 50.14  ? 3   VAL L C   1 
ATOM   1852  O O   . VAL B 2 3   ? 26.726  25.653  52.921  1.00 48.10  ? 3   VAL L O   1 
ATOM   1853  C CB  . VAL B 2 3   ? 29.908  25.515  52.649  1.00 46.52  ? 3   VAL L CB  1 
ATOM   1854  C CG1 . VAL B 2 3   ? 30.274  26.739  51.847  1.00 44.91  ? 3   VAL L CG1 1 
ATOM   1855  C CG2 . VAL B 2 3   ? 29.559  25.859  54.103  1.00 44.94  ? 3   VAL L CG2 1 
ATOM   1856  N N   . MET B 2 4   ? 27.371  23.581  53.559  1.00 46.90  ? 4   MET L N   1 
ATOM   1857  C CA  . MET B 2 4   ? 26.239  23.373  54.425  1.00 51.48  ? 4   MET L CA  1 
ATOM   1858  C C   . MET B 2 4   ? 26.616  23.716  55.845  1.00 55.19  ? 4   MET L C   1 
ATOM   1859  O O   . MET B 2 4   ? 27.794  23.648  56.192  1.00 57.85  ? 4   MET L O   1 
ATOM   1860  C CB  . MET B 2 4   ? 25.819  21.926  54.323  1.00 54.06  ? 4   MET L CB  1 
ATOM   1861  C CG  . MET B 2 4   ? 25.486  21.546  52.888  1.00 54.29  ? 4   MET L CG  1 
ATOM   1862  S SD  . MET B 2 4   ? 24.129  22.533  52.207  1.00 68.77  ? 4   MET L SD  1 
ATOM   1863  C CE  . MET B 2 4   ? 22.873  22.276  53.466  1.00 47.64  ? 4   MET L CE  1 
ATOM   1864  N N   . THR B 2 5   ? 25.631  24.099  56.660  1.00 55.10  ? 5   THR L N   1 
ATOM   1865  C CA  . THR B 2 5   ? 25.919  24.548  58.020  1.00 58.43  ? 5   THR L CA  1 
ATOM   1866  C C   . THR B 2 5   ? 24.887  24.135  59.036  1.00 59.24  ? 5   THR L C   1 
ATOM   1867  O O   . THR B 2 5   ? 23.717  24.501  58.920  1.00 60.17  ? 5   THR L O   1 
ATOM   1868  C CB  . THR B 2 5   ? 26.007  26.081  58.131  1.00 55.44  ? 5   THR L CB  1 
ATOM   1869  O OG1 . THR B 2 5   ? 26.735  26.611  57.023  1.00 61.96  ? 5   THR L OG1 1 
ATOM   1870  C CG2 . THR B 2 5   ? 26.723  26.458  59.412  1.00 56.22  ? 5   THR L CG2 1 
ATOM   1871  N N   . GLN B 2 6   ? 25.328  23.405  60.054  1.00 57.79  ? 6   GLN L N   1 
ATOM   1872  C CA  . GLN B 2 6   ? 24.477  23.149  61.210  1.00 62.37  ? 6   GLN L CA  1 
ATOM   1873  C C   . GLN B 2 6   ? 25.100  23.826  62.411  1.00 67.63  ? 6   GLN L C   1 
ATOM   1874  O O   . GLN B 2 6   ? 25.929  23.255  63.115  1.00 69.11  ? 6   GLN L O   1 
ATOM   1875  C CB  . GLN B 2 6   ? 24.273  21.660  61.432  1.00 57.61  ? 6   GLN L CB  1 
ATOM   1876  C CG  . GLN B 2 6   ? 23.674  21.029  60.210  1.00 57.77  ? 6   GLN L CG  1 
ATOM   1877  C CD  . GLN B 2 6   ? 23.785  19.531  60.181  1.00 57.04  ? 6   GLN L CD  1 
ATOM   1878  O OE1 . GLN B 2 6   ? 23.264  18.841  61.059  1.00 61.41  ? 6   GLN L OE1 1 
ATOM   1879  N NE2 . GLN B 2 6   ? 24.436  19.008  59.149  1.00 49.82  ? 6   GLN L NE2 1 
ATOM   1880  N N   . THR B 2 7   ? 24.672  25.069  62.606  1.00 70.54  ? 7   THR L N   1 
ATOM   1881  C CA  . THR B 2 7   ? 25.231  26.006  63.566  1.00 64.16  ? 7   THR L CA  1 
ATOM   1882  C C   . THR B 2 7   ? 25.359  25.398  64.961  1.00 71.47  ? 7   THR L C   1 
ATOM   1883  O O   . THR B 2 7   ? 26.209  25.823  65.753  1.00 77.69  ? 7   THR L O   1 
ATOM   1884  C CB  . THR B 2 7   ? 24.345  27.281  63.643  1.00 67.01  ? 7   THR L CB  1 
ATOM   1885  O OG1 . THR B 2 7   ? 23.349  27.122  64.662  1.00 73.67  ? 7   THR L OG1 1 
ATOM   1886  C CG2 . THR B 2 7   ? 23.620  27.533  62.315  1.00 70.67  ? 7   THR L CG2 1 
ATOM   1887  N N   . ALA B 2 8   ? 24.531  24.394  65.256  1.00 68.60  ? 8   ALA L N   1 
ATOM   1888  C CA  . ALA B 2 8   ? 24.357  23.932  66.630  1.00 66.35  ? 8   ALA L CA  1 
ATOM   1889  C C   . ALA B 2 8   ? 24.729  22.474  66.880  1.00 67.56  ? 8   ALA L C   1 
ATOM   1890  O O   . ALA B 2 8   ? 23.868  21.600  66.824  1.00 69.56  ? 8   ALA L O   1 
ATOM   1891  C CB  . ALA B 2 8   ? 22.925  24.197  67.091  1.00 68.48  ? 8   ALA L CB  1 
ATOM   1892  N N   . PRO B 2 9   ? 26.009  22.217  67.198  1.00 64.21  ? 9   PRO L N   1 
ATOM   1893  C CA  . PRO B 2 9   ? 26.521  20.900  67.576  1.00 60.63  ? 9   PRO L CA  1 
ATOM   1894  C C   . PRO B 2 9   ? 25.513  19.981  68.260  1.00 60.85  ? 9   PRO L C   1 
ATOM   1895  O O   . PRO B 2 9   ? 25.399  18.830  67.853  1.00 59.97  ? 9   PRO L O   1 
ATOM   1896  C CB  . PRO B 2 9   ? 27.664  21.254  68.519  1.00 67.35  ? 9   PRO L CB  1 
ATOM   1897  C CG  . PRO B 2 9   ? 28.247  22.490  67.893  1.00 70.20  ? 9   PRO L CG  1 
ATOM   1898  C CD  . PRO B 2 9   ? 27.091  23.218  67.200  1.00 65.63  ? 9   PRO L CD  1 
ATOM   1899  N N   . SER B 2 10  ? 24.785  20.445  69.266  1.00 64.53  ? 10  SER L N   1 
ATOM   1900  C CA  . SER B 2 10  ? 23.819  19.535  69.895  1.00 71.94  ? 10  SER L CA  1 
ATOM   1901  C C   . SER B 2 10  ? 22.438  20.107  70.228  1.00 68.72  ? 10  SER L C   1 
ATOM   1902  O O   . SER B 2 10  ? 22.164  21.299  70.040  1.00 63.49  ? 10  SER L O   1 
ATOM   1903  C CB  . SER B 2 10  ? 24.416  18.842  71.135  1.00 71.11  ? 10  SER L CB  1 
ATOM   1904  O OG  . SER B 2 10  ? 23.467  17.975  71.749  1.00 67.59  ? 10  SER L OG  1 
ATOM   1905  N N   . VAL B 2 11  ? 21.581  19.211  70.709  1.00 63.42  ? 11  VAL L N   1 
ATOM   1906  C CA  . VAL B 2 11  ? 20.249  19.551  71.171  1.00 72.56  ? 11  VAL L CA  1 
ATOM   1907  C C   . VAL B 2 11  ? 19.726  18.355  71.984  1.00 79.83  ? 11  VAL L C   1 
ATOM   1908  O O   . VAL B 2 11  ? 20.016  17.205  71.624  1.00 77.86  ? 11  VAL L O   1 
ATOM   1909  C CB  . VAL B 2 11  ? 19.308  19.836  69.986  1.00 67.03  ? 11  VAL L CB  1 
ATOM   1910  C CG1 . VAL B 2 11  ? 19.081  18.561  69.185  1.00 66.28  ? 11  VAL L CG1 1 
ATOM   1911  C CG2 . VAL B 2 11  ? 17.989  20.424  70.473  1.00 61.08  ? 11  VAL L CG2 1 
ATOM   1912  N N   . PHE B 2 12  ? 18.990  18.625  73.076  1.00 80.30  ? 12  PHE L N   1 
ATOM   1913  C CA  . PHE B 2 12  ? 18.479  17.583  73.985  1.00 76.44  ? 12  PHE L CA  1 
ATOM   1914  C C   . PHE B 2 12  ? 16.971  17.672  74.083  1.00 69.40  ? 12  PHE L C   1 
ATOM   1915  O O   . PHE B 2 12  ? 16.412  18.725  73.818  1.00 69.52  ? 12  PHE L O   1 
ATOM   1916  C CB  . PHE B 2 12  ? 19.035  17.748  75.402  1.00 81.58  ? 12  PHE L CB  1 
ATOM   1917  C CG  . PHE B 2 12  ? 20.530  17.815  75.480  1.00 75.68  ? 12  PHE L CG  1 
ATOM   1918  C CD1 . PHE B 2 12  ? 21.208  18.965  75.100  1.00 72.67  ? 12  PHE L CD1 1 
ATOM   1919  C CD2 . PHE B 2 12  ? 21.251  16.743  75.972  1.00 76.95  ? 12  PHE L CD2 1 
ATOM   1920  C CE1 . PHE B 2 12  ? 22.578  19.034  75.181  1.00 76.00  ? 12  PHE L CE1 1 
ATOM   1921  C CE2 . PHE B 2 12  ? 22.623  16.808  76.058  1.00 82.14  ? 12  PHE L CE2 1 
ATOM   1922  C CZ  . PHE B 2 12  ? 23.290  17.960  75.659  1.00 79.84  ? 12  PHE L CZ  1 
ATOM   1923  N N   . VAL B 2 13  ? 16.327  16.591  74.521  1.00 68.64  ? 13  VAL L N   1 
ATOM   1924  C CA  . VAL B 2 13  ? 14.869  16.487  74.473  1.00 69.63  ? 13  VAL L CA  1 
ATOM   1925  C C   . VAL B 2 13  ? 14.267  15.511  75.486  1.00 73.03  ? 13  VAL L C   1 
ATOM   1926  O O   . VAL B 2 13  ? 14.879  14.517  75.849  1.00 76.35  ? 13  VAL L O   1 
ATOM   1927  C CB  . VAL B 2 13  ? 14.392  16.055  73.062  1.00 69.34  ? 13  VAL L CB  1 
ATOM   1928  C CG1 . VAL B 2 13  ? 12.995  15.453  73.112  1.00 68.19  ? 13  VAL L CG1 1 
ATOM   1929  C CG2 . VAL B 2 13  ? 14.432  17.226  72.095  1.00 74.09  ? 13  VAL L CG2 1 
ATOM   1930  N N   . THR B 2 14  ? 13.046  15.802  75.918  1.00 72.77  ? 14  THR L N   1 
ATOM   1931  C CA  . THR B 2 14  ? 12.289  14.935  76.808  1.00 72.17  ? 14  THR L CA  1 
ATOM   1932  C C   . THR B 2 14  ? 11.488  13.922  75.973  1.00 71.39  ? 14  THR L C   1 
ATOM   1933  O O   . THR B 2 14  ? 10.800  14.320  75.031  1.00 69.88  ? 14  THR L O   1 
ATOM   1934  C CB  . THR B 2 14  ? 11.322  15.800  77.668  1.00 73.16  ? 14  THR L CB  1 
ATOM   1935  O OG1 . THR B 2 14  ? 11.975  17.020  78.061  1.00 69.16  ? 14  THR L OG1 1 
ATOM   1936  C CG2 . THR B 2 14  ? 10.822  15.040  78.899  1.00 66.70  ? 14  THR L CG2 1 
ATOM   1937  N N   . PRO B 2 15  ? 11.581  12.611  76.298  1.00 68.76  ? 15  PRO L N   1 
ATOM   1938  C CA  . PRO B 2 15  ? 10.803  11.611  75.551  1.00 64.87  ? 15  PRO L CA  1 
ATOM   1939  C C   . PRO B 2 15  ? 9.350   12.028  75.360  1.00 68.18  ? 15  PRO L C   1 
ATOM   1940  O O   . PRO B 2 15  ? 8.857   12.870  76.104  1.00 70.38  ? 15  PRO L O   1 
ATOM   1941  C CB  . PRO B 2 15  ? 10.887  10.375  76.439  1.00 61.10  ? 15  PRO L CB  1 
ATOM   1942  C CG  . PRO B 2 15  ? 12.222  10.495  77.086  1.00 66.01  ? 15  PRO L CG  1 
ATOM   1943  C CD  . PRO B 2 15  ? 12.444  11.978  77.313  1.00 70.26  ? 15  PRO L CD  1 
ATOM   1944  N N   . GLY B 2 16  ? 8.685   11.455  74.360  1.00 70.25  ? 16  GLY L N   1 
ATOM   1945  C CA  . GLY B 2 16  ? 7.301   11.786  74.045  1.00 69.41  ? 16  GLY L CA  1 
ATOM   1946  C C   . GLY B 2 16  ? 7.067   13.197  73.540  1.00 66.49  ? 16  GLY L C   1 
ATOM   1947  O O   . GLY B 2 16  ? 5.987   13.505  73.037  1.00 60.04  ? 16  GLY L O   1 
ATOM   1948  N N   . GLU B 2 17  ? 8.093   14.038  73.684  1.00 72.08  ? 17  GLU L N   1 
ATOM   1949  C CA  . GLU B 2 17  ? 8.076   15.460  73.310  1.00 74.64  ? 17  GLU L CA  1 
ATOM   1950  C C   . GLU B 2 17  ? 8.450   15.691  71.829  1.00 74.95  ? 17  GLU L C   1 
ATOM   1951  O O   . GLU B 2 17  ? 8.513   14.742  71.045  1.00 73.07  ? 17  GLU L O   1 
ATOM   1952  C CB  . GLU B 2 17  ? 9.034   16.245  74.227  1.00 74.37  ? 17  GLU L CB  1 
ATOM   1953  C CG  . GLU B 2 17  ? 8.479   17.553  74.819  1.00 81.85  ? 17  GLU L CG  1 
ATOM   1954  C CD  . GLU B 2 17  ? 8.195   17.475  76.334  1.00 86.53  ? 17  GLU L CD  1 
ATOM   1955  O OE1 . GLU B 2 17  ? 8.513   18.454  77.056  1.00 87.45  ? 17  GLU L OE1 1 
ATOM   1956  O OE2 . GLU B 2 17  ? 7.652   16.443  76.803  1.00 84.78  ? 17  GLU L OE2 1 
ATOM   1957  N N   . SER B 2 18  ? 8.709   16.946  71.457  1.00 75.33  ? 18  SER L N   1 
ATOM   1958  C CA  . SER B 2 18  ? 8.983   17.299  70.060  1.00 71.55  ? 18  SER L CA  1 
ATOM   1959  C C   . SER B 2 18  ? 10.405  17.786  69.879  1.00 65.98  ? 18  SER L C   1 
ATOM   1960  O O   . SER B 2 18  ? 11.176  17.840  70.829  1.00 67.25  ? 18  SER L O   1 
ATOM   1961  C CB  . SER B 2 18  ? 8.020   18.387  69.580  1.00 74.50  ? 18  SER L CB  1 
ATOM   1962  O OG  . SER B 2 18  ? 6.685   18.088  69.957  1.00 82.90  ? 18  SER L OG  1 
ATOM   1963  N N   . VAL B 2 19  ? 10.751  18.147  68.652  1.00 65.48  ? 19  VAL L N   1 
ATOM   1964  C CA  . VAL B 2 19  ? 12.091  18.651  68.368  1.00 67.75  ? 19  VAL L CA  1 
ATOM   1965  C C   . VAL B 2 19  ? 12.218  19.279  66.976  1.00 68.53  ? 19  VAL L C   1 
ATOM   1966  O O   . VAL B 2 19  ? 11.378  19.068  66.091  1.00 65.46  ? 19  VAL L O   1 
ATOM   1967  C CB  . VAL B 2 19  ? 13.147  17.541  68.491  1.00 66.12  ? 19  VAL L CB  1 
ATOM   1968  C CG1 . VAL B 2 19  ? 13.218  16.749  67.193  1.00 62.69  ? 19  VAL L CG1 1 
ATOM   1969  C CG2 . VAL B 2 19  ? 14.497  18.142  68.838  1.00 58.80  ? 19  VAL L CG2 1 
ATOM   1970  N N   . SER B 2 20  ? 13.288  20.046  66.793  1.00 64.09  ? 20  SER L N   1 
ATOM   1971  C CA  . SER B 2 20  ? 13.535  20.731  65.536  1.00 59.70  ? 20  SER L CA  1 
ATOM   1972  C C   . SER B 2 20  ? 15.045  20.870  65.312  1.00 57.24  ? 20  SER L C   1 
ATOM   1973  O O   . SER B 2 20  ? 15.757  21.354  66.187  1.00 52.84  ? 20  SER L O   1 
ATOM   1974  C CB  . SER B 2 20  ? 12.825  22.091  65.549  1.00 59.72  ? 20  SER L CB  1 
ATOM   1975  O OG  . SER B 2 20  ? 13.258  22.951  64.508  1.00 65.03  ? 20  SER L OG  1 
ATOM   1976  N N   . ILE B 2 21  ? 15.521  20.410  64.152  1.00 56.60  ? 21  ILE L N   1 
ATOM   1977  C CA  . ILE B 2 21  ? 16.928  20.527  63.760  1.00 57.32  ? 21  ILE L CA  1 
ATOM   1978  C C   . ILE B 2 21  ? 17.000  21.464  62.568  1.00 59.28  ? 21  ILE L C   1 
ATOM   1979  O O   . ILE B 2 21  ? 16.076  21.454  61.758  1.00 61.01  ? 21  ILE L O   1 
ATOM   1980  C CB  . ILE B 2 21  ? 17.502  19.173  63.329  1.00 47.75  ? 21  ILE L CB  1 
ATOM   1981  C CG1 . ILE B 2 21  ? 17.455  18.198  64.484  1.00 48.38  ? 21  ILE L CG1 1 
ATOM   1982  C CG2 . ILE B 2 21  ? 18.924  19.312  62.877  1.00 52.09  ? 21  ILE L CG2 1 
ATOM   1983  C CD1 . ILE B 2 21  ? 16.227  17.377  64.482  1.00 54.82  ? 21  ILE L CD1 1 
ATOM   1984  N N   . SER B 2 22  ? 18.067  22.263  62.440  1.00 55.21  ? 22  SER L N   1 
ATOM   1985  C CA  . SER B 2 22  ? 18.168  23.162  61.286  1.00 55.02  ? 22  SER L CA  1 
ATOM   1986  C C   . SER B 2 22  ? 19.478  23.132  60.507  1.00 58.09  ? 22  SER L C   1 
ATOM   1987  O O   . SER B 2 22  ? 20.567  23.068  61.076  1.00 62.49  ? 22  SER L O   1 
ATOM   1988  C CB  . SER B 2 22  ? 17.853  24.604  61.673  1.00 56.24  ? 22  SER L CB  1 
ATOM   1989  O OG  . SER B 2 22  ? 19.045  25.310  61.960  1.00 63.32  ? 22  SER L OG  1 
ATOM   1990  N N   . CYS B 2 23  ? 19.334  23.223  59.190  1.00 59.32  ? 23  CYS L N   1 
ATOM   1991  C CA  . CYS B 2 23  ? 20.440  23.332  58.260  1.00 51.27  ? 23  CYS L CA  1 
ATOM   1992  C C   . CYS B 2 23  ? 20.463  24.739  57.718  1.00 57.36  ? 23  CYS L C   1 
ATOM   1993  O O   . CYS B 2 23  ? 19.536  25.504  57.956  1.00 63.02  ? 23  CYS L O   1 
ATOM   1994  C CB  . CYS B 2 23  ? 20.195  22.396  57.101  1.00 52.26  ? 23  CYS L CB  1 
ATOM   1995  S SG  . CYS B 2 23  ? 21.675  21.565  56.490  1.00 80.14  ? 23  CYS L SG  1 
ATOM   1996  N N   . ARG B 2 24  ? 21.512  25.082  56.975  1.00 62.86  ? 24  ARG L N   1 
ATOM   1997  C CA  . ARG B 2 24  ? 21.619  26.402  56.327  1.00 60.40  ? 24  ARG L CA  1 
ATOM   1998  C C   . ARG B 2 24  ? 22.550  26.381  55.112  1.00 54.53  ? 24  ARG L C   1 
ATOM   1999  O O   . ARG B 2 24  ? 23.757  26.183  55.222  1.00 53.75  ? 24  ARG L O   1 
ATOM   2000  C CB  . ARG B 2 24  ? 22.067  27.467  57.325  1.00 65.38  ? 24  ARG L CB  1 
ATOM   2001  C CG  . ARG B 2 24  ? 21.954  28.872  56.810  1.00 66.94  ? 24  ARG L CG  1 
ATOM   2002  C CD  . ARG B 2 24  ? 21.187  29.729  57.789  1.00 74.90  ? 24  ARG L CD  1 
ATOM   2003  N NE  . ARG B 2 24  ? 19.810  29.947  57.351  1.00 77.77  ? 24  ARG L NE  1 
ATOM   2004  C CZ  . ARG B 2 24  ? 19.401  31.023  56.674  1.00 81.19  ? 24  ARG L CZ  1 
ATOM   2005  N NH1 . ARG B 2 24  ? 20.278  31.979  56.367  1.00 88.33  ? 24  ARG L NH1 1 
ATOM   2006  N NH2 . ARG B 2 24  ? 18.122  31.151  56.307  1.00 69.17  ? 24  ARG L NH2 1 
ATOM   2007  N N   . SER B 2 25  ? 21.971  26.583  53.944  1.00 51.62  ? 25  SER L N   1 
ATOM   2008  C CA  . SER B 2 25  ? 22.710  26.446  52.712  1.00 48.79  ? 25  SER L CA  1 
ATOM   2009  C C   . SER B 2 25  ? 23.362  27.749  52.367  1.00 48.86  ? 25  SER L C   1 
ATOM   2010  O O   . SER B 2 25  ? 22.766  28.798  52.535  1.00 51.42  ? 25  SER L O   1 
ATOM   2011  C CB  . SER B 2 25  ? 21.737  26.132  51.606  1.00 49.61  ? 25  SER L CB  1 
ATOM   2012  O OG  . SER B 2 25  ? 20.638  27.009  51.737  1.00 50.31  ? 25  SER L OG  1 
ATOM   2013  N N   . SER B 2 26  ? 24.585  27.679  51.868  1.00 49.72  ? 26  SER L N   1 
ATOM   2014  C CA  . SER B 2 26  ? 25.270  28.852  51.362  1.00 46.40  ? 26  SER L CA  1 
ATOM   2015  C C   . SER B 2 26  ? 24.530  29.461  50.203  1.00 45.13  ? 26  SER L C   1 
ATOM   2016  O O   . SER B 2 26  ? 24.974  30.460  49.657  1.00 44.61  ? 26  SER L O   1 
ATOM   2017  C CB  . SER B 2 26  ? 26.637  28.457  50.832  1.00 47.26  ? 26  SER L CB  1 
ATOM   2018  O OG  . SER B 2 26  ? 26.842  28.995  49.530  1.00 45.99  ? 26  SER L OG  1 
ATOM   2019  N N   . LYS B 2 27  ? 23.426  28.844  49.796  1.00 46.14  ? 27  LYS L N   1 
ATOM   2020  C CA  . LYS B 2 27  ? 22.856  29.150  48.482  1.00 48.53  ? 27  LYS L CA  1 
ATOM   2021  C C   . LYS B 2 27  ? 21.383  28.738  48.319  1.00 51.26  ? 27  LYS L C   1 
ATOM   2022  O O   . LYS B 2 27  ? 20.879  27.915  49.076  1.00 50.84  ? 27  LYS L O   1 
ATOM   2023  C CB  . LYS B 2 27  ? 23.737  28.512  47.391  1.00 45.68  ? 27  LYS L CB  1 
ATOM   2024  C CG  . LYS B 2 27  ? 23.021  28.096  46.131  1.00 44.33  ? 27  LYS L CG  1 
ATOM   2025  C CD  . LYS B 2 27  ? 24.018  27.739  45.069  1.00 47.01  ? 27  LYS L CD  1 
ATOM   2026  C CE  . LYS B 2 27  ? 24.317  28.931  44.169  1.00 54.28  ? 27  LYS L CE  1 
ATOM   2027  N NZ  . LYS B 2 27  ? 25.127  28.536  42.971  1.00 56.08  ? 27  LYS L NZ  1 
ATOM   2028  N N   . SER B 2 28  A 20.688  29.336  47.356  1.00 47.94  ? 27  SER L N   1 
ATOM   2029  C CA  . SER B 2 28  A 19.380  28.846  47.004  1.00 44.77  ? 27  SER L CA  1 
ATOM   2030  C C   . SER B 2 28  A 19.531  27.477  46.390  1.00 47.42  ? 27  SER L C   1 
ATOM   2031  O O   . SER B 2 28  A 20.281  27.319  45.415  1.00 44.01  ? 27  SER L O   1 
ATOM   2032  C CB  . SER B 2 28  A 18.716  29.752  45.983  1.00 54.72  ? 27  SER L CB  1 
ATOM   2033  O OG  . SER B 2 28  A 17.439  29.213  45.611  1.00 60.51  ? 27  SER L OG  1 
ATOM   2034  N N   . LEU B 2 29  B 18.801  26.502  46.951  1.00 49.47  ? 27  LEU L N   1 
ATOM   2035  C CA  . LEU B 2 29  B 18.866  25.088  46.528  1.00 45.42  ? 27  LEU L CA  1 
ATOM   2036  C C   . LEU B 2 29  B 17.759  24.637  45.552  1.00 48.10  ? 27  LEU L C   1 
ATOM   2037  O O   . LEU B 2 29  B 17.773  23.494  45.092  1.00 46.97  ? 27  LEU L O   1 
ATOM   2038  C CB  . LEU B 2 29  B 18.948  24.142  47.745  1.00 38.57  ? 27  LEU L CB  1 
ATOM   2039  C CG  . LEU B 2 29  B 20.373  24.059  48.334  1.00 41.38  ? 27  LEU L CG  1 
ATOM   2040  C CD1 . LEU B 2 29  B 20.484  23.398  49.694  1.00 38.77  ? 27  LEU L CD1 1 
ATOM   2041  C CD2 . LEU B 2 29  B 21.331  23.383  47.366  1.00 41.40  ? 27  LEU L CD2 1 
ATOM   2042  N N   . LEU B 2 30  C 16.818  25.538  45.245  1.00 50.47  ? 27  LEU L N   1 
ATOM   2043  C CA  . LEU B 2 30  C 15.741  25.312  44.273  1.00 45.63  ? 27  LEU L CA  1 
ATOM   2044  C C   . LEU B 2 30  C 16.319  25.244  42.864  1.00 44.38  ? 27  LEU L C   1 
ATOM   2045  O O   . LEU B 2 30  C 17.275  25.937  42.558  1.00 41.30  ? 27  LEU L O   1 
ATOM   2046  C CB  . LEU B 2 30  C 14.737  26.464  44.378  1.00 45.86  ? 27  LEU L CB  1 
ATOM   2047  C CG  . LEU B 2 30  C 13.284  26.493  43.887  1.00 40.45  ? 27  LEU L CG  1 
ATOM   2048  C CD1 . LEU B 2 30  C 13.197  26.718  42.395  1.00 47.56  ? 27  LEU L CD1 1 
ATOM   2049  C CD2 . LEU B 2 30  C 12.543  25.258  44.300  1.00 45.15  ? 27  LEU L CD2 1 
ATOM   2050  N N   . HIS B 2 31  D 15.726  24.413  42.013  1.00 49.49  ? 27  HIS L N   1 
ATOM   2051  C CA  . HIS B 2 31  D 16.242  24.120  40.661  1.00 57.46  ? 27  HIS L CA  1 
ATOM   2052  C C   . HIS B 2 31  D 15.397  24.804  39.587  1.00 56.17  ? 27  HIS L C   1 
ATOM   2053  O O   . HIS B 2 31  D 14.372  25.409  39.887  1.00 54.38  ? 27  HIS L O   1 
ATOM   2054  C CB  . HIS B 2 31  D 16.197  22.597  40.438  1.00 59.13  ? 27  HIS L CB  1 
ATOM   2055  C CG  . HIS B 2 31  D 16.982  22.111  39.257  1.00 62.11  ? 27  HIS L CG  1 
ATOM   2056  N ND1 . HIS B 2 31  D 16.402  21.838  38.034  1.00 61.37  ? 27  HIS L ND1 1 
ATOM   2057  C CD2 . HIS B 2 31  D 18.298  21.807  39.125  1.00 61.90  ? 27  HIS L CD2 1 
ATOM   2058  C CE1 . HIS B 2 31  D 17.328  21.402  37.198  1.00 62.54  ? 27  HIS L CE1 1 
ATOM   2059  N NE2 . HIS B 2 31  D 18.485  21.374  37.833  1.00 63.07  ? 27  HIS L NE2 1 
ATOM   2060  N N   . SER B 2 32  E 15.801  24.705  38.330  1.00 53.32  ? 27  SER L N   1 
ATOM   2061  C CA  . SER B 2 32  E 14.881  25.117  37.286  1.00 55.95  ? 27  SER L CA  1 
ATOM   2062  C C   . SER B 2 32  E 13.614  24.283  37.410  1.00 59.93  ? 27  SER L C   1 
ATOM   2063  O O   . SER B 2 32  E 12.516  24.810  37.349  1.00 63.88  ? 27  SER L O   1 
ATOM   2064  C CB  . SER B 2 32  E 15.488  24.912  35.905  1.00 58.44  ? 27  SER L CB  1 
ATOM   2065  O OG  . SER B 2 32  E 16.853  25.276  35.914  1.00 57.23  ? 27  SER L OG  1 
ATOM   2066  N N   . ASN B 2 33  ? 13.765  22.977  37.610  1.00 59.64  ? 28  ASN L N   1 
ATOM   2067  C CA  . ASN B 2 33  ? 12.608  22.089  37.531  1.00 61.45  ? 28  ASN L CA  1 
ATOM   2068  C C   . ASN B 2 33  ? 11.712  22.027  38.752  1.00 57.76  ? 28  ASN L C   1 
ATOM   2069  O O   . ASN B 2 33  ? 10.808  21.197  38.801  1.00 56.79  ? 28  ASN L O   1 
ATOM   2070  C CB  . ASN B 2 33  ? 12.986  20.673  37.074  1.00 64.77  ? 28  ASN L CB  1 
ATOM   2071  C CG  . ASN B 2 33  ? 13.892  19.950  38.048  1.00 61.71  ? 28  ASN L CG  1 
ATOM   2072  O OD1 . ASN B 2 33  ? 13.563  19.763  39.219  1.00 57.93  ? 28  ASN L OD1 1 
ATOM   2073  N ND2 . ASN B 2 33  ? 15.035  19.502  37.547  1.00 66.28  ? 28  ASN L ND2 1 
ATOM   2074  N N   . GLY B 2 34  ? 11.954  22.901  39.723  1.00 55.15  ? 29  GLY L N   1 
ATOM   2075  C CA  . GLY B 2 34  ? 11.052  23.044  40.853  1.00 51.58  ? 29  GLY L CA  1 
ATOM   2076  C C   . GLY B 2 34  ? 11.371  22.231  42.092  1.00 49.60  ? 29  GLY L C   1 
ATOM   2077  O O   . GLY B 2 34  ? 10.959  22.601  43.180  1.00 51.69  ? 29  GLY L O   1 
ATOM   2078  N N   . ASN B 2 35  ? 12.087  21.124  41.934  1.00 47.46  ? 30  ASN L N   1 
ATOM   2079  C CA  . ASN B 2 35  ? 12.467  20.286  43.060  1.00 45.79  ? 30  ASN L CA  1 
ATOM   2080  C C   . ASN B 2 35  ? 13.653  20.846  43.813  1.00 48.73  ? 30  ASN L C   1 
ATOM   2081  O O   . ASN B 2 35  ? 14.750  20.842  43.274  1.00 53.69  ? 30  ASN L O   1 
ATOM   2082  C CB  . ASN B 2 35  ? 12.873  18.910  42.557  1.00 47.30  ? 30  ASN L CB  1 
ATOM   2083  C CG  . ASN B 2 35  ? 11.697  18.055  42.206  1.00 54.35  ? 30  ASN L CG  1 
ATOM   2084  O OD1 . ASN B 2 35  ? 11.255  17.211  43.000  1.00 55.92  ? 30  ASN L OD1 1 
ATOM   2085  N ND2 . ASN B 2 35  ? 11.166  18.264  41.010  1.00 55.84  ? 30  ASN L ND2 1 
ATOM   2086  N N   . THR B 2 36  ? 13.469  21.295  45.055  1.00 45.11  ? 31  THR L N   1 
ATOM   2087  C CA  . THR B 2 36  ? 14.609  21.778  45.854  1.00 44.68  ? 31  THR L CA  1 
ATOM   2088  C C   . THR B 2 36  ? 15.451  20.618  46.457  1.00 40.44  ? 31  THR L C   1 
ATOM   2089  O O   . THR B 2 36  ? 14.952  19.861  47.282  1.00 38.76  ? 31  THR L O   1 
ATOM   2090  C CB  . THR B 2 36  ? 14.188  22.896  46.898  1.00 45.27  ? 31  THR L CB  1 
ATOM   2091  O OG1 . THR B 2 36  ? 14.833  22.680  48.151  1.00 41.91  ? 31  THR L OG1 1 
ATOM   2092  C CG2 . THR B 2 36  ? 12.689  22.926  47.125  1.00 47.69  ? 31  THR L CG2 1 
ATOM   2093  N N   . TYR B 2 37  ? 16.723  20.503  46.038  1.00 37.55  ? 32  TYR L N   1 
ATOM   2094  C CA  . TYR B 2 37  ? 17.560  19.291  46.238  1.00 39.02  ? 32  TYR L CA  1 
ATOM   2095  C C   . TYR B 2 37  ? 18.326  19.070  47.578  1.00 38.06  ? 32  TYR L C   1 
ATOM   2096  O O   . TYR B 2 37  ? 19.537  18.907  47.604  1.00 34.65  ? 32  TYR L O   1 
ATOM   2097  C CB  . TYR B 2 37  ? 18.489  19.078  45.023  1.00 38.43  ? 32  TYR L CB  1 
ATOM   2098  C CG  . TYR B 2 37  ? 17.741  18.539  43.824  1.00 41.19  ? 32  TYR L CG  1 
ATOM   2099  C CD1 . TYR B 2 37  ? 17.295  19.382  42.826  1.00 45.10  ? 32  TYR L CD1 1 
ATOM   2100  C CD2 . TYR B 2 37  ? 17.429  17.191  43.722  1.00 42.72  ? 32  TYR L CD2 1 
ATOM   2101  C CE1 . TYR B 2 37  ? 16.575  18.905  41.748  1.00 49.23  ? 32  TYR L CE1 1 
ATOM   2102  C CE2 . TYR B 2 37  ? 16.706  16.700  42.643  1.00 44.31  ? 32  TYR L CE2 1 
ATOM   2103  C CZ  . TYR B 2 37  ? 16.285  17.567  41.660  1.00 49.81  ? 32  TYR L CZ  1 
ATOM   2104  O OH  . TYR B 2 37  ? 15.574  17.113  40.577  1.00 51.63  ? 32  TYR L OH  1 
ATOM   2105  N N   . LEU B 2 38  ? 17.582  18.991  48.674  1.00 41.76  ? 33  LEU L N   1 
ATOM   2106  C CA  . LEU B 2 38  ? 18.126  18.820  50.023  1.00 39.52  ? 33  LEU L CA  1 
ATOM   2107  C C   . LEU B 2 38  ? 17.711  17.457  50.577  1.00 41.30  ? 33  LEU L C   1 
ATOM   2108  O O   . LEU B 2 38  ? 16.540  17.104  50.524  1.00 40.62  ? 33  LEU L O   1 
ATOM   2109  C CB  . LEU B 2 38  ? 17.528  19.906  50.909  1.00 41.52  ? 33  LEU L CB  1 
ATOM   2110  C CG  . LEU B 2 38  ? 17.759  20.148  52.408  1.00 46.12  ? 33  LEU L CG  1 
ATOM   2111  C CD1 . LEU B 2 38  ? 17.539  18.893  53.264  1.00 44.91  ? 33  LEU L CD1 1 
ATOM   2112  C CD2 . LEU B 2 38  ? 19.130  20.780  52.654  1.00 44.91  ? 33  LEU L CD2 1 
ATOM   2113  N N   . TYR B 2 39  ? 18.660  16.696  51.111  1.00 37.28  ? 34  TYR L N   1 
ATOM   2114  C CA  . TYR B 2 39  ? 18.350  15.377  51.639  1.00 37.10  ? 34  TYR L CA  1 
ATOM   2115  C C   . TYR B 2 39  ? 18.759  15.327  53.104  1.00 40.01  ? 34  TYR L C   1 
ATOM   2116  O O   . TYR B 2 39  ? 19.763  15.930  53.464  1.00 39.43  ? 34  TYR L O   1 
ATOM   2117  C CB  . TYR B 2 39  ? 19.035  14.268  50.802  1.00 39.02  ? 34  TYR L CB  1 
ATOM   2118  C CG  . TYR B 2 39  ? 18.537  14.198  49.361  1.00 39.23  ? 34  TYR L CG  1 
ATOM   2119  C CD1 . TYR B 2 39  ? 17.512  13.335  48.988  1.00 40.34  ? 34  TYR L CD1 1 
ATOM   2120  C CD2 . TYR B 2 39  ? 19.075  15.016  48.381  1.00 41.80  ? 34  TYR L CD2 1 
ATOM   2121  C CE1 . TYR B 2 39  ? 17.035  13.302  47.683  1.00 38.44  ? 34  TYR L CE1 1 
ATOM   2122  C CE2 . TYR B 2 39  ? 18.605  14.979  47.081  1.00 42.78  ? 34  TYR L CE2 1 
ATOM   2123  C CZ  . TYR B 2 39  ? 17.590  14.130  46.740  1.00 39.66  ? 34  TYR L CZ  1 
ATOM   2124  O OH  . TYR B 2 39  ? 17.156  14.137  45.441  1.00 37.39  ? 34  TYR L OH  1 
ATOM   2125  N N   . TRP B 2 40  ? 17.963  14.631  53.931  1.00 40.56  ? 35  TRP L N   1 
ATOM   2126  C CA  . TRP B 2 40  ? 18.185  14.476  55.386  1.00 41.11  ? 35  TRP L CA  1 
ATOM   2127  C C   . TRP B 2 40  ? 18.438  13.016  55.819  1.00 43.39  ? 35  TRP L C   1 
ATOM   2128  O O   . TRP B 2 40  ? 17.584  12.141  55.590  1.00 39.81  ? 35  TRP L O   1 
ATOM   2129  C CB  . TRP B 2 40  ? 16.947  14.909  56.175  1.00 42.32  ? 35  TRP L CB  1 
ATOM   2130  C CG  . TRP B 2 40  ? 16.685  16.369  56.403  1.00 41.98  ? 35  TRP L CG  1 
ATOM   2131  C CD1 . TRP B 2 40  ? 15.597  17.061  55.995  1.00 47.47  ? 35  TRP L CD1 1 
ATOM   2132  C CD2 . TRP B 2 40  ? 17.476  17.281  57.155  1.00 41.21  ? 35  TRP L CD2 1 
ATOM   2133  N NE1 . TRP B 2 40  ? 15.671  18.361  56.411  1.00 49.45  ? 35  TRP L NE1 1 
ATOM   2134  C CE2 . TRP B 2 40  ? 16.819  18.518  57.132  1.00 47.09  ? 35  TRP L CE2 1 
ATOM   2135  C CE3 . TRP B 2 40  ? 18.682  17.178  57.831  1.00 46.22  ? 35  TRP L CE3 1 
ATOM   2136  C CZ2 . TRP B 2 40  ? 17.325  19.639  57.756  1.00 55.70  ? 35  TRP L CZ2 1 
ATOM   2137  C CZ3 . TRP B 2 40  ? 19.187  18.290  58.452  1.00 52.93  ? 35  TRP L CZ3 1 
ATOM   2138  C CH2 . TRP B 2 40  ? 18.511  19.508  58.412  1.00 60.09  ? 35  TRP L CH2 1 
ATOM   2139  N N   . PHE B 2 41  ? 19.566  12.770  56.499  1.00 43.19  ? 36  PHE L N   1 
ATOM   2140  C CA  . PHE B 2 41  ? 19.961  11.418  56.941  1.00 42.27  ? 36  PHE L CA  1 
ATOM   2141  C C   . PHE B 2 41  ? 20.009  11.259  58.462  1.00 45.85  ? 36  PHE L C   1 
ATOM   2142  O O   . PHE B 2 41  ? 20.028  12.250  59.188  1.00 46.29  ? 36  PHE L O   1 
ATOM   2143  C CB  . PHE B 2 41  ? 21.344  11.071  56.421  1.00 37.12  ? 36  PHE L CB  1 
ATOM   2144  C CG  . PHE B 2 41  ? 21.439  11.006  54.950  1.00 34.91  ? 36  PHE L CG  1 
ATOM   2145  C CD1 . PHE B 2 41  ? 21.946  12.061  54.237  1.00 35.26  ? 36  PHE L CD1 1 
ATOM   2146  C CD2 . PHE B 2 41  ? 21.044  9.884   54.281  1.00 37.15  ? 36  PHE L CD2 1 
ATOM   2147  C CE1 . PHE B 2 41  ? 22.047  12.004  52.904  1.00 36.01  ? 36  PHE L CE1 1 
ATOM   2148  C CE2 . PHE B 2 41  ? 21.143  9.824   52.929  1.00 37.72  ? 36  PHE L CE2 1 
ATOM   2149  C CZ  . PHE B 2 41  ? 21.648  10.887  52.243  1.00 38.42  ? 36  PHE L CZ  1 
ATOM   2150  N N   . LEU B 2 42  ? 20.052  10.008  58.930  1.00 43.41  ? 37  LEU L N   1 
ATOM   2151  C CA  . LEU B 2 42  ? 20.148  9.701   60.354  1.00 39.74  ? 37  LEU L CA  1 
ATOM   2152  C C   . LEU B 2 42  ? 21.072  8.533   60.598  1.00 39.92  ? 37  LEU L C   1 
ATOM   2153  O O   . LEU B 2 42  ? 20.836  7.434   60.115  1.00 43.07  ? 37  LEU L O   1 
ATOM   2154  C CB  . LEU B 2 42  ? 18.781  9.337   60.925  1.00 45.59  ? 37  LEU L CB  1 
ATOM   2155  C CG  . LEU B 2 42  ? 18.926  8.735   62.332  1.00 50.36  ? 37  LEU L CG  1 
ATOM   2156  C CD1 . LEU B 2 42  ? 19.070  9.856   63.352  1.00 49.24  ? 37  LEU L CD1 1 
ATOM   2157  C CD2 . LEU B 2 42  ? 17.796  7.781   62.727  1.00 45.11  ? 37  LEU L CD2 1 
ATOM   2158  N N   . GLN B 2 43  ? 22.111  8.753   61.385  1.00 42.19  ? 38  GLN L N   1 
ATOM   2159  C CA  . GLN B 2 43  ? 23.065  7.686   61.685  1.00 45.22  ? 38  GLN L CA  1 
ATOM   2160  C C   . GLN B 2 43  ? 23.029  7.399   63.168  1.00 48.90  ? 38  GLN L C   1 
ATOM   2161  O O   . GLN B 2 43  ? 23.611  8.146   63.950  1.00 45.83  ? 38  GLN L O   1 
ATOM   2162  C CB  . GLN B 2 43  ? 24.483  8.105   61.281  1.00 40.51  ? 38  GLN L CB  1 
ATOM   2163  C CG  . GLN B 2 43  ? 25.582  7.115   61.576  1.00 38.49  ? 38  GLN L CG  1 
ATOM   2164  C CD  . GLN B 2 43  ? 26.952  7.671   61.215  1.00 40.08  ? 38  GLN L CD  1 
ATOM   2165  O OE1 . GLN B 2 43  ? 27.909  6.921   61.024  1.00 41.16  ? 38  GLN L OE1 1 
ATOM   2166  N NE2 . GLN B 2 43  ? 27.047  8.989   61.114  1.00 35.12  ? 38  GLN L NE2 1 
ATOM   2167  N N   . ARG B 2 44  ? 22.327  6.337   63.564  1.00 51.56  ? 39  ARG L N   1 
ATOM   2168  C CA  . ARG B 2 44  ? 22.327  5.924   64.956  1.00 49.55  ? 39  ARG L CA  1 
ATOM   2169  C C   . ARG B 2 44  ? 23.775  5.722   65.415  1.00 57.04  ? 39  ARG L C   1 
ATOM   2170  O O   . ARG B 2 44  ? 24.722  6.001   64.673  1.00 54.86  ? 39  ARG L O   1 
ATOM   2171  C CB  . ARG B 2 44  ? 21.512  4.654   65.121  1.00 48.69  ? 39  ARG L CB  1 
ATOM   2172  C CG  . ARG B 2 44  ? 20.131  4.774   64.545  1.00 52.17  ? 39  ARG L CG  1 
ATOM   2173  C CD  . ARG B 2 44  ? 19.194  3.687   65.053  1.00 55.79  ? 39  ARG L CD  1 
ATOM   2174  N NE  . ARG B 2 44  ? 18.298  3.217   63.999  1.00 57.40  ? 39  ARG L NE  1 
ATOM   2175  C CZ  . ARG B 2 44  ? 17.277  3.919   63.511  1.00 60.36  ? 39  ARG L CZ  1 
ATOM   2176  N NH1 . ARG B 2 44  ? 16.511  3.413   62.555  1.00 64.80  ? 39  ARG L NH1 1 
ATOM   2177  N NH2 . ARG B 2 44  ? 17.018  5.134   63.968  1.00 61.79  ? 39  ARG L NH2 1 
ATOM   2178  N N   . PRO B 2 45  ? 23.970  5.258   66.650  1.00 60.97  ? 40  PRO L N   1 
ATOM   2179  C CA  . PRO B 2 45  ? 25.364  4.992   67.008  1.00 60.01  ? 40  PRO L CA  1 
ATOM   2180  C C   . PRO B 2 45  ? 25.743  3.603   66.520  1.00 64.30  ? 40  PRO L C   1 
ATOM   2181  O O   . PRO B 2 45  ? 24.984  2.650   66.779  1.00 62.84  ? 40  PRO L O   1 
ATOM   2182  C CB  . PRO B 2 45  ? 25.342  5.011   68.536  1.00 58.19  ? 40  PRO L CB  1 
ATOM   2183  C CG  . PRO B 2 45  ? 23.974  5.548   68.907  1.00 62.76  ? 40  PRO L CG  1 
ATOM   2184  C CD  . PRO B 2 45  ? 23.075  5.144   67.805  1.00 58.56  ? 40  PRO L CD  1 
ATOM   2185  N N   . GLY B 2 46  ? 26.868  3.495   65.809  1.00 60.81  ? 41  GLY L N   1 
ATOM   2186  C CA  . GLY B 2 46  ? 27.392  2.201   65.397  1.00 58.32  ? 41  GLY L CA  1 
ATOM   2187  C C   . GLY B 2 46  ? 26.535  1.516   64.359  1.00 57.80  ? 41  GLY L C   1 
ATOM   2188  O O   . GLY B 2 46  ? 26.221  0.321   64.461  1.00 54.35  ? 41  GLY L O   1 
ATOM   2189  N N   . GLN B 2 47  ? 26.142  2.309   63.368  1.00 59.04  ? 42  GLN L N   1 
ATOM   2190  C CA  . GLN B 2 47  ? 25.419  1.849   62.194  1.00 52.33  ? 42  GLN L CA  1 
ATOM   2191  C C   . GLN B 2 47  ? 25.735  2.900   61.166  1.00 49.34  ? 42  GLN L C   1 
ATOM   2192  O O   . GLN B 2 47  ? 26.490  3.827   61.464  1.00 49.30  ? 42  GLN L O   1 
ATOM   2193  C CB  . GLN B 2 47  ? 23.934  1.842   62.471  1.00 50.59  ? 42  GLN L CB  1 
ATOM   2194  C CG  . GLN B 2 47  ? 23.591  1.191   63.775  1.00 54.71  ? 42  GLN L CG  1 
ATOM   2195  C CD  . GLN B 2 47  ? 22.706  -0.016  63.587  1.00 60.34  ? 42  GLN L CD  1 
ATOM   2196  O OE1 . GLN B 2 47  ? 23.133  -1.166  63.796  1.00 54.50  ? 42  GLN L OE1 1 
ATOM   2197  N NE2 . GLN B 2 47  ? 21.451  0.236   63.191  1.00 57.29  ? 42  GLN L NE2 1 
ATOM   2198  N N   . SER B 2 48  ? 25.160  2.794   59.975  1.00 44.92  ? 43  SER L N   1 
ATOM   2199  C CA  . SER B 2 48  ? 25.413  3.802   58.948  1.00 38.75  ? 43  SER L CA  1 
ATOM   2200  C C   . SER B 2 48  ? 24.191  4.636   58.682  1.00 37.77  ? 43  SER L C   1 
ATOM   2201  O O   . SER B 2 48  ? 23.087  4.272   59.053  1.00 40.57  ? 43  SER L O   1 
ATOM   2202  C CB  . SER B 2 48  ? 25.775  3.118   57.678  1.00 35.40  ? 43  SER L CB  1 
ATOM   2203  O OG  . SER B 2 48  ? 24.935  2.001   57.616  1.00 45.21  ? 43  SER L OG  1 
ATOM   2204  N N   . PRO B 2 49  ? 24.380  5.759   58.009  1.00 35.74  ? 44  PRO L N   1 
ATOM   2205  C CA  . PRO B 2 49  ? 23.230  6.624   57.786  1.00 37.06  ? 44  PRO L CA  1 
ATOM   2206  C C   . PRO B 2 49  ? 22.076  5.903   57.073  1.00 38.73  ? 44  PRO L C   1 
ATOM   2207  O O   . PRO B 2 49  ? 22.308  5.072   56.208  1.00 36.65  ? 44  PRO L O   1 
ATOM   2208  C CB  . PRO B 2 49  ? 23.803  7.710   56.882  1.00 36.43  ? 44  PRO L CB  1 
ATOM   2209  C CG  . PRO B 2 49  ? 25.269  7.682   57.101  1.00 33.59  ? 44  PRO L CG  1 
ATOM   2210  C CD  . PRO B 2 49  ? 25.606  6.274   57.377  1.00 36.13  ? 44  PRO L CD  1 
ATOM   2211  N N   . GLN B 2 50  ? 20.841  6.205   57.455  1.00 39.60  ? 45  GLN L N   1 
ATOM   2212  C CA  . GLN B 2 50  ? 19.685  5.831   56.659  1.00 38.07  ? 45  GLN L CA  1 
ATOM   2213  C C   . GLN B 2 50  ? 19.183  7.133   56.103  1.00 40.59  ? 45  GLN L C   1 
ATOM   2214  O O   . GLN B 2 50  ? 19.337  8.170   56.751  1.00 40.79  ? 45  GLN L O   1 
ATOM   2215  C CB  . GLN B 2 50  ? 18.565  5.256   57.517  1.00 48.07  ? 45  GLN L CB  1 
ATOM   2216  C CG  . GLN B 2 50  ? 18.924  4.110   58.455  1.00 58.59  ? 45  GLN L CG  1 
ATOM   2217  C CD  . GLN B 2 50  ? 17.917  3.989   59.617  1.00 63.75  ? 45  GLN L CD  1 
ATOM   2218  O OE1 . GLN B 2 50  ? 18.306  3.768   60.776  1.00 57.41  ? 45  GLN L OE1 1 
ATOM   2219  N NE2 . GLN B 2 50  ? 16.621  4.165   59.307  1.00 60.98  ? 45  GLN L NE2 1 
ATOM   2220  N N   . LEU B 2 51  ? 18.584  7.114   54.918  1.00 38.30  ? 46  LEU L N   1 
ATOM   2221  C CA  . LEU B 2 51  ? 17.971  8.343   54.422  1.00 37.01  ? 46  LEU L CA  1 
ATOM   2222  C C   . LEU B 2 51  ? 16.554  8.527   54.994  1.00 40.06  ? 46  LEU L C   1 
ATOM   2223  O O   . LEU B 2 51  ? 15.738  7.606   55.004  1.00 35.48  ? 46  LEU L O   1 
ATOM   2224  C CB  . LEU B 2 51  ? 17.997  8.416   52.900  1.00 31.29  ? 46  LEU L CB  1 
ATOM   2225  C CG  . LEU B 2 51  ? 16.904  9.260   52.260  1.00 34.37  ? 46  LEU L CG  1 
ATOM   2226  C CD1 . LEU B 2 51  ? 17.244  10.720  52.241  1.00 36.33  ? 46  LEU L CD1 1 
ATOM   2227  C CD2 . LEU B 2 51  ? 16.736  8.780   50.882  1.00 34.43  ? 46  LEU L CD2 1 
ATOM   2228  N N   . LEU B 2 52  ? 16.288  9.721   55.511  1.00 42.08  ? 47  LEU L N   1 
ATOM   2229  C CA  . LEU B 2 52  ? 14.992  10.030  56.105  1.00 41.13  ? 47  LEU L CA  1 
ATOM   2230  C C   . LEU B 2 52  ? 14.092  10.783  55.133  1.00 39.50  ? 47  LEU L C   1 
ATOM   2231  O O   . LEU B 2 52  ? 13.122  10.230  54.619  1.00 43.69  ? 47  LEU L O   1 
ATOM   2232  C CB  . LEU B 2 52  ? 15.187  10.827  57.392  1.00 41.77  ? 47  LEU L CB  1 
ATOM   2233  C CG  . LEU B 2 52  ? 15.688  9.997   58.574  1.00 43.44  ? 47  LEU L CG  1 
ATOM   2234  C CD1 . LEU B 2 52  ? 16.188  10.869  59.693  1.00 43.85  ? 47  LEU L CD1 1 
ATOM   2235  C CD2 . LEU B 2 52  ? 14.580  9.093   59.068  1.00 47.60  ? 47  LEU L CD2 1 
ATOM   2236  N N   . ILE B 2 53  ? 14.421  12.041  54.872  1.00 35.52  ? 48  ILE L N   1 
ATOM   2237  C CA  . ILE B 2 53  ? 13.653  12.848  53.929  1.00 39.80  ? 48  ILE L CA  1 
ATOM   2238  C C   . ILE B 2 53  ? 14.381  13.022  52.579  1.00 41.16  ? 48  ILE L C   1 
ATOM   2239  O O   . ILE B 2 53  ? 15.584  13.249  52.562  1.00 38.94  ? 48  ILE L O   1 
ATOM   2240  C CB  . ILE B 2 53  ? 13.349  14.242  54.514  1.00 40.98  ? 48  ILE L CB  1 
ATOM   2241  C CG1 . ILE B 2 53  ? 12.251  14.174  55.578  1.00 41.15  ? 48  ILE L CG1 1 
ATOM   2242  C CG2 . ILE B 2 53  ? 12.922  15.189  53.410  1.00 42.20  ? 48  ILE L CG2 1 
ATOM   2243  C CD1 . ILE B 2 53  ? 11.879  12.780  55.995  1.00 41.93  ? 48  ILE L CD1 1 
ATOM   2244  N N   . TYR B 2 54  ? 13.661  12.906  51.461  1.00 38.54  ? 49  TYR L N   1 
ATOM   2245  C CA  . TYR B 2 54  ? 14.230  13.282  50.174  1.00 38.11  ? 49  TYR L CA  1 
ATOM   2246  C C   . TYR B 2 54  ? 13.628  14.545  49.562  1.00 41.14  ? 49  TYR L C   1 
ATOM   2247  O O   . TYR B 2 54  ? 12.447  14.816  49.738  1.00 43.17  ? 49  TYR L O   1 
ATOM   2248  C CB  . TYR B 2 54  ? 14.188  12.133  49.172  1.00 38.91  ? 49  TYR L CB  1 
ATOM   2249  C CG  . TYR B 2 54  ? 12.830  11.626  48.707  1.00 41.07  ? 49  TYR L CG  1 
ATOM   2250  C CD1 . TYR B 2 54  ? 12.246  12.078  47.521  1.00 39.99  ? 49  TYR L CD1 1 
ATOM   2251  C CD2 . TYR B 2 54  ? 12.169  10.632  49.418  1.00 41.64  ? 49  TYR L CD2 1 
ATOM   2252  C CE1 . TYR B 2 54  ? 11.024  11.570  47.089  1.00 42.67  ? 49  TYR L CE1 1 
ATOM   2253  C CE2 . TYR B 2 54  ? 10.960  10.119  48.989  1.00 41.86  ? 49  TYR L CE2 1 
ATOM   2254  C CZ  . TYR B 2 54  ? 10.391  10.588  47.840  1.00 44.30  ? 49  TYR L CZ  1 
ATOM   2255  O OH  . TYR B 2 54  ? 9.187   10.038  47.480  1.00 42.64  ? 49  TYR L OH  1 
ATOM   2256  N N   . ARG B 2 55  ? 14.457  15.329  48.871  1.00 40.54  ? 50  ARG L N   1 
ATOM   2257  C CA  . ARG B 2 55  ? 14.000  16.528  48.168  1.00 40.55  ? 50  ARG L CA  1 
ATOM   2258  C C   . ARG B 2 55  ? 13.198  17.497  49.041  1.00 43.06  ? 50  ARG L C   1 
ATOM   2259  O O   . ARG B 2 55  ? 12.079  17.926  48.714  1.00 40.58  ? 50  ARG L O   1 
ATOM   2260  C CB  . ARG B 2 55  ? 13.217  16.134  46.926  1.00 45.97  ? 50  ARG L CB  1 
ATOM   2261  C CG  . ARG B 2 55  ? 14.036  16.272  45.675  1.00 48.42  ? 50  ARG L CG  1 
ATOM   2262  C CD  . ARG B 2 55  ? 13.890  15.090  44.767  1.00 44.15  ? 50  ARG L CD  1 
ATOM   2263  N NE  . ARG B 2 55  ? 12.506  14.886  44.406  1.00 46.07  ? 50  ARG L NE  1 
ATOM   2264  C CZ  . ARG B 2 55  ? 12.063  13.773  43.852  1.00 52.92  ? 50  ARG L CZ  1 
ATOM   2265  N NH1 . ARG B 2 55  ? 10.772  13.657  43.557  1.00 61.99  ? 50  ARG L NH1 1 
ATOM   2266  N NH2 . ARG B 2 55  ? 12.913  12.784  43.598  1.00 43.22  ? 50  ARG L NH2 1 
ATOM   2267  N N   . MET B 2 56  ? 13.811  17.812  50.171  1.00 46.25  ? 51  MET L N   1 
ATOM   2268  C CA  . MET B 2 56  ? 13.359  18.835  51.102  1.00 42.98  ? 51  MET L CA  1 
ATOM   2269  C C   . MET B 2 56  ? 12.095  18.531  51.916  1.00 42.85  ? 51  MET L C   1 
ATOM   2270  O O   . MET B 2 56  ? 11.988  18.931  53.068  1.00 42.57  ? 51  MET L O   1 
ATOM   2271  C CB  . MET B 2 56  ? 13.245  20.182  50.408  1.00 39.36  ? 51  MET L CB  1 
ATOM   2272  C CG  . MET B 2 56  ? 13.143  21.279  51.409  1.00 42.24  ? 51  MET L CG  1 
ATOM   2273  S SD  . MET B 2 56  ? 12.656  22.841  50.697  1.00 58.78  ? 51  MET L SD  1 
ATOM   2274  C CE  . MET B 2 56  ? 11.223  23.212  51.704  1.00 53.23  ? 51  MET L CE  1 
ATOM   2275  N N   . SER B 2 57  ? 11.139  17.828  51.337  1.00 44.16  ? 52  SER L N   1 
ATOM   2276  C CA  . SER B 2 57  ? 9.842   17.750  51.987  1.00 46.77  ? 52  SER L CA  1 
ATOM   2277  C C   . SER B 2 57  ? 9.254   16.375  51.924  1.00 43.11  ? 52  SER L C   1 
ATOM   2278  O O   . SER B 2 57  ? 8.251   16.117  52.571  1.00 40.58  ? 52  SER L O   1 
ATOM   2279  C CB  . SER B 2 57  ? 8.857   18.737  51.341  1.00 48.43  ? 52  SER L CB  1 
ATOM   2280  O OG  . SER B 2 57  ? 8.359   18.251  50.099  1.00 49.30  ? 52  SER L OG  1 
ATOM   2281  N N   . ASN B 2 58  ? 9.877   15.509  51.129  1.00 43.64  ? 53  ASN L N   1 
ATOM   2282  C CA  . ASN B 2 58  ? 9.315   14.201  50.805  1.00 43.55  ? 53  ASN L CA  1 
ATOM   2283  C C   . ASN B 2 58  ? 9.893   13.097  51.675  1.00 44.59  ? 53  ASN L C   1 
ATOM   2284  O O   . ASN B 2 58  ? 11.093  13.054  51.941  1.00 41.82  ? 53  ASN L O   1 
ATOM   2285  C CB  . ASN B 2 58  ? 9.466   13.893  49.315  1.00 42.47  ? 53  ASN L CB  1 
ATOM   2286  C CG  . ASN B 2 58  ? 8.750   14.901  48.443  1.00 46.45  ? 53  ASN L CG  1 
ATOM   2287  O OD1 . ASN B 2 58  ? 7.571   14.742  48.141  1.00 56.31  ? 53  ASN L OD1 1 
ATOM   2288  N ND2 . ASN B 2 58  ? 9.450   15.951  48.050  1.00 43.59  ? 53  ASN L ND2 1 
ATOM   2289  N N   . LEU B 2 59  ? 9.018   12.206  52.121  1.00 46.39  ? 54  LEU L N   1 
ATOM   2290  C CA  . LEU B 2 59  ? 9.338   11.301  53.208  1.00 42.75  ? 54  LEU L CA  1 
ATOM   2291  C C   . LEU B 2 59  ? 9.582   9.889   52.685  1.00 42.19  ? 54  LEU L C   1 
ATOM   2292  O O   . LEU B 2 59  ? 8.702   9.272   52.095  1.00 42.72  ? 54  LEU L O   1 
ATOM   2293  C CB  . LEU B 2 59  ? 8.196   11.339  54.213  1.00 40.64  ? 54  LEU L CB  1 
ATOM   2294  C CG  . LEU B 2 59  ? 8.386   10.506  55.462  1.00 43.94  ? 54  LEU L CG  1 
ATOM   2295  C CD1 . LEU B 2 59  ? 8.213   11.389  56.661  1.00 41.02  ? 54  LEU L CD1 1 
ATOM   2296  C CD2 . LEU B 2 59  ? 7.397   9.341   55.461  1.00 44.30  ? 54  LEU L CD2 1 
ATOM   2297  N N   . ALA B 2 60  ? 10.796  9.390   52.872  1.00 45.15  ? 55  ALA L N   1 
ATOM   2298  C CA  . ALA B 2 60  ? 11.179  8.122   52.266  1.00 46.68  ? 55  ALA L CA  1 
ATOM   2299  C C   . ALA B 2 60  ? 10.457  6.998   52.993  1.00 51.84  ? 55  ALA L C   1 
ATOM   2300  O O   . ALA B 2 60  ? 10.041  7.173   54.142  1.00 51.10  ? 55  ALA L O   1 
ATOM   2301  C CB  . ALA B 2 60  ? 12.698  7.931   52.308  1.00 39.21  ? 55  ALA L CB  1 
ATOM   2302  N N   . SER B 2 61  ? 10.312  5.851   52.325  1.00 53.76  ? 56  SER L N   1 
ATOM   2303  C CA  . SER B 2 61  ? 9.572   4.695   52.860  1.00 53.16  ? 56  SER L CA  1 
ATOM   2304  C C   . SER B 2 61  ? 10.136  4.099   54.161  1.00 54.43  ? 56  SER L C   1 
ATOM   2305  O O   . SER B 2 61  ? 11.170  4.525   54.677  1.00 50.54  ? 56  SER L O   1 
ATOM   2306  C CB  . SER B 2 61  ? 9.444   3.603   51.790  1.00 48.76  ? 56  SER L CB  1 
ATOM   2307  O OG  . SER B 2 61  ? 10.721  3.256   51.283  1.00 48.67  ? 56  SER L OG  1 
ATOM   2308  N N   . GLY B 2 62  ? 9.454   3.089   54.682  1.00 59.89  ? 57  GLY L N   1 
ATOM   2309  C CA  . GLY B 2 62  ? 9.795   2.568   55.989  1.00 56.36  ? 57  GLY L CA  1 
ATOM   2310  C C   . GLY B 2 62  ? 9.606   3.665   57.020  1.00 59.05  ? 57  GLY L C   1 
ATOM   2311  O O   . GLY B 2 62  ? 8.884   3.479   57.997  1.00 62.06  ? 57  GLY L O   1 
ATOM   2312  N N   . VAL B 2 63  ? 10.233  4.817   56.784  1.00 57.67  ? 58  VAL L N   1 
ATOM   2313  C CA  . VAL B 2 63  ? 10.250  5.922   57.741  1.00 55.24  ? 58  VAL L CA  1 
ATOM   2314  C C   . VAL B 2 63  ? 8.854   6.358   58.120  1.00 50.70  ? 58  VAL L C   1 
ATOM   2315  O O   . VAL B 2 63  ? 8.021   6.602   57.251  1.00 47.87  ? 58  VAL L O   1 
ATOM   2316  C CB  . VAL B 2 63  ? 10.992  7.147   57.179  1.00 54.76  ? 58  VAL L CB  1 
ATOM   2317  C CG1 . VAL B 2 63  ? 10.822  8.331   58.094  1.00 53.94  ? 58  VAL L CG1 1 
ATOM   2318  C CG2 . VAL B 2 63  ? 12.449  6.845   56.992  1.00 50.74  ? 58  VAL L CG2 1 
ATOM   2319  N N   . PRO B 2 64  ? 8.612   6.483   59.430  1.00 54.70  ? 59  PRO L N   1 
ATOM   2320  C CA  . PRO B 2 64  ? 7.308   6.713   60.058  1.00 61.39  ? 59  PRO L CA  1 
ATOM   2321  C C   . PRO B 2 64  ? 7.035   8.210   60.181  1.00 61.10  ? 59  PRO L C   1 
ATOM   2322  O O   . PRO B 2 64  ? 7.958   8.975   60.475  1.00 61.18  ? 59  PRO L O   1 
ATOM   2323  C CB  . PRO B 2 64  ? 7.484   6.090   61.451  1.00 63.35  ? 59  PRO L CB  1 
ATOM   2324  C CG  . PRO B 2 64  ? 9.028   5.950   61.646  1.00 63.92  ? 59  PRO L CG  1 
ATOM   2325  C CD  . PRO B 2 64  ? 9.689   6.524   60.429  1.00 56.97  ? 59  PRO L CD  1 
ATOM   2326  N N   . ASP B 2 65  ? 5.779   8.611   59.988  1.00 60.95  ? 60  ASP L N   1 
ATOM   2327  C CA  . ASP B 2 65  ? 5.426   10.020  59.761  1.00 61.14  ? 60  ASP L CA  1 
ATOM   2328  C C   . ASP B 2 65  ? 5.807   11.015  60.849  1.00 58.93  ? 60  ASP L C   1 
ATOM   2329  O O   . ASP B 2 65  ? 5.809   12.221  60.607  1.00 59.98  ? 60  ASP L O   1 
ATOM   2330  C CB  . ASP B 2 65  ? 3.937   10.158  59.448  1.00 63.64  ? 60  ASP L CB  1 
ATOM   2331  C CG  . ASP B 2 65  ? 3.069   9.681   60.580  1.00 67.04  ? 60  ASP L CG  1 
ATOM   2332  O OD1 . ASP B 2 65  ? 3.622   9.378   61.671  1.00 65.83  ? 60  ASP L OD1 1 
ATOM   2333  O OD2 . ASP B 2 65  ? 1.840   9.607   60.373  1.00 67.65  ? 60  ASP L OD2 1 
ATOM   2334  N N   . ARG B 2 66  ? 6.099   10.529  62.047  1.00 59.23  ? 61  ARG L N   1 
ATOM   2335  C CA  . ARG B 2 66  ? 6.587   11.421  63.089  1.00 63.45  ? 61  ARG L CA  1 
ATOM   2336  C C   . ARG B 2 66  ? 7.620   12.407  62.514  1.00 58.92  ? 61  ARG L C   1 
ATOM   2337  O O   . ARG B 2 66  ? 7.772   13.520  63.019  1.00 56.30  ? 61  ARG L O   1 
ATOM   2338  C CB  . ARG B 2 66  ? 7.200   10.628  64.250  1.00 69.44  ? 61  ARG L CB  1 
ATOM   2339  C CG  . ARG B 2 66  ? 6.460   9.344   64.637  1.00 71.52  ? 61  ARG L CG  1 
ATOM   2340  C CD  . ARG B 2 66  ? 6.993   8.798   65.964  1.00 76.19  ? 61  ARG L CD  1 
ATOM   2341  N NE  . ARG B 2 66  ? 8.397   8.382   65.932  1.00 64.55  ? 61  ARG L NE  1 
ATOM   2342  C CZ  . ARG B 2 66  ? 8.778   7.113   65.977  1.00 65.82  ? 61  ARG L CZ  1 
ATOM   2343  N NH1 . ARG B 2 66  ? 10.063  6.803   65.953  1.00 65.37  ? 61  ARG L NH1 1 
ATOM   2344  N NH2 . ARG B 2 66  ? 7.861   6.154   66.047  1.00 66.92  ? 61  ARG L NH2 1 
ATOM   2345  N N   . PHE B 2 67  ? 8.314   11.983  61.455  1.00 54.38  ? 62  PHE L N   1 
ATOM   2346  C CA  . PHE B 2 67  ? 9.309   12.800  60.759  1.00 51.10  ? 62  PHE L CA  1 
ATOM   2347  C C   . PHE B 2 67  ? 8.724   13.637  59.622  1.00 53.27  ? 62  PHE L C   1 
ATOM   2348  O O   . PHE B 2 67  ? 7.680   13.285  59.064  1.00 59.99  ? 62  PHE L O   1 
ATOM   2349  C CB  . PHE B 2 67  ? 10.352  11.903  60.134  1.00 49.89  ? 62  PHE L CB  1 
ATOM   2350  C CG  . PHE B 2 67  ? 11.209  11.205  61.105  1.00 46.48  ? 62  PHE L CG  1 
ATOM   2351  C CD1 . PHE B 2 67  ? 12.408  11.767  61.502  1.00 48.48  ? 62  PHE L CD1 1 
ATOM   2352  C CD2 . PHE B 2 67  ? 10.849  9.969   61.586  1.00 49.37  ? 62  PHE L CD2 1 
ATOM   2353  C CE1 . PHE B 2 67  ? 13.229  11.125  62.393  1.00 53.47  ? 62  PHE L CE1 1 
ATOM   2354  C CE2 . PHE B 2 67  ? 11.662  9.309   62.473  1.00 60.00  ? 62  PHE L CE2 1 
ATOM   2355  C CZ  . PHE B 2 67  ? 12.860  9.891   62.885  1.00 58.25  ? 62  PHE L CZ  1 
ATOM   2356  N N   . SER B 2 68  ? 9.422   14.715  59.258  1.00 47.48  ? 63  SER L N   1 
ATOM   2357  C CA  . SER B 2 68  ? 9.006   15.605  58.179  1.00 46.14  ? 63  SER L CA  1 
ATOM   2358  C C   . SER B 2 68  ? 9.961   16.777  58.139  1.00 51.89  ? 63  SER L C   1 
ATOM   2359  O O   . SER B 2 68  ? 10.465  17.200  59.177  1.00 56.33  ? 63  SER L O   1 
ATOM   2360  C CB  . SER B 2 68  ? 7.624   16.150  58.466  1.00 49.72  ? 63  SER L CB  1 
ATOM   2361  O OG  . SER B 2 68  ? 7.666   16.962  59.628  1.00 44.86  ? 63  SER L OG  1 
ATOM   2362  N N   . GLY B 2 69  ? 10.205  17.325  56.959  1.00 46.59  ? 64  GLY L N   1 
ATOM   2363  C CA  . GLY B 2 69  ? 11.050  18.496  56.877  1.00 46.44  ? 64  GLY L CA  1 
ATOM   2364  C C   . GLY B 2 69  ? 10.442  19.570  56.006  1.00 53.35  ? 64  GLY L C   1 
ATOM   2365  O O   . GLY B 2 69  ? 9.301   19.454  55.558  1.00 57.04  ? 64  GLY L O   1 
ATOM   2366  N N   . SER B 2 70  ? 11.215  20.624  55.772  1.00 53.84  ? 65  SER L N   1 
ATOM   2367  C CA  . SER B 2 70  ? 10.811  21.734  54.921  1.00 51.64  ? 65  SER L CA  1 
ATOM   2368  C C   . SER B 2 70  ? 11.820  22.855  55.040  1.00 54.15  ? 65  SER L C   1 
ATOM   2369  O O   . SER B 2 70  ? 12.836  22.723  55.730  1.00 56.37  ? 65  SER L O   1 
ATOM   2370  C CB  . SER B 2 70  ? 9.425   22.253  55.281  1.00 52.78  ? 65  SER L CB  1 
ATOM   2371  O OG  . SER B 2 70  ? 8.507   21.959  54.227  1.00 57.22  ? 65  SER L OG  1 
ATOM   2372  N N   . GLY B 2 71  ? 11.538  23.957  54.357  1.00 50.67  ? 66  GLY L N   1 
ATOM   2373  C CA  . GLY B 2 71  ? 12.429  25.098  54.332  1.00 50.81  ? 66  GLY L CA  1 
ATOM   2374  C C   . GLY B 2 71  ? 12.073  25.954  53.138  1.00 54.43  ? 66  GLY L C   1 
ATOM   2375  O O   . GLY B 2 71  ? 10.969  25.832  52.598  1.00 53.12  ? 66  GLY L O   1 
ATOM   2376  N N   . SER B 2 72  ? 12.994  26.830  52.740  1.00 54.63  ? 67  SER L N   1 
ATOM   2377  C CA  . SER B 2 72  ? 12.892  27.559  51.478  1.00 50.16  ? 67  SER L CA  1 
ATOM   2378  C C   . SER B 2 72  ? 14.129  28.420  51.299  1.00 49.96  ? 67  SER L C   1 
ATOM   2379  O O   . SER B 2 72  ? 14.879  28.629  52.242  1.00 47.23  ? 67  SER L O   1 
ATOM   2380  C CB  . SER B 2 72  ? 11.630  28.422  51.432  1.00 50.73  ? 67  SER L CB  1 
ATOM   2381  O OG  . SER B 2 72  ? 11.752  29.575  52.248  1.00 52.39  ? 67  SER L OG  1 
ATOM   2382  N N   . GLY B 2 73  ? 14.342  28.914  50.086  1.00 55.98  ? 68  GLY L N   1 
ATOM   2383  C CA  . GLY B 2 73  ? 15.438  29.831  49.832  1.00 51.53  ? 68  GLY L CA  1 
ATOM   2384  C C   . GLY B 2 73  ? 16.761  29.267  50.281  1.00 49.04  ? 68  GLY L C   1 
ATOM   2385  O O   . GLY B 2 73  ? 17.461  28.677  49.470  1.00 51.23  ? 68  GLY L O   1 
ATOM   2386  N N   . THR B 2 74  ? 17.116  29.451  51.556  1.00 54.05  ? 69  THR L N   1 
ATOM   2387  C CA  . THR B 2 74  ? 18.374  28.888  52.099  1.00 56.65  ? 69  THR L CA  1 
ATOM   2388  C C   . THR B 2 74  ? 18.328  28.382  53.558  1.00 55.43  ? 69  THR L C   1 
ATOM   2389  O O   . THR B 2 74  ? 19.373  28.047  54.123  1.00 56.38  ? 69  THR L O   1 
ATOM   2390  C CB  . THR B 2 74  ? 19.619  29.836  51.920  1.00 51.97  ? 69  THR L CB  1 
ATOM   2391  O OG1 . THR B 2 74  ? 19.645  30.805  52.963  1.00 56.77  ? 69  THR L OG1 1 
ATOM   2392  C CG2 . THR B 2 74  ? 19.609  30.546  50.582  1.00 48.05  ? 69  THR L CG2 1 
ATOM   2393  N N   . ASP B 2 75  ? 17.130  28.315  54.146  1.00 54.72  ? 70  ASP L N   1 
ATOM   2394  C CA  . ASP B 2 75  ? 16.946  27.725  55.477  1.00 55.30  ? 70  ASP L CA  1 
ATOM   2395  C C   . ASP B 2 75  ? 15.923  26.561  55.513  1.00 51.28  ? 70  ASP L C   1 
ATOM   2396  O O   . ASP B 2 75  ? 14.790  26.693  55.047  1.00 49.17  ? 70  ASP L O   1 
ATOM   2397  C CB  . ASP B 2 75  ? 16.573  28.815  56.497  1.00 61.96  ? 70  ASP L CB  1 
ATOM   2398  C CG  . ASP B 2 75  ? 17.084  28.511  57.928  1.00 71.91  ? 70  ASP L CG  1 
ATOM   2399  O OD1 . ASP B 2 75  ? 17.817  27.508  58.117  1.00 67.57  ? 70  ASP L OD1 1 
ATOM   2400  O OD2 . ASP B 2 75  ? 16.753  29.284  58.870  1.00 74.62  ? 70  ASP L OD2 1 
ATOM   2401  N N   . PHE B 2 76  ? 16.334  25.434  56.097  1.00 52.70  ? 71  PHE L N   1 
ATOM   2402  C CA  . PHE B 2 76  ? 15.496  24.240  56.218  1.00 50.79  ? 71  PHE L CA  1 
ATOM   2403  C C   . PHE B 2 76  ? 15.540  23.645  57.623  1.00 52.58  ? 71  PHE L C   1 
ATOM   2404  O O   . PHE B 2 76  ? 16.300  24.082  58.492  1.00 52.33  ? 71  PHE L O   1 
ATOM   2405  C CB  . PHE B 2 76  ? 15.952  23.186  55.226  1.00 47.96  ? 71  PHE L CB  1 
ATOM   2406  C CG  . PHE B 2 76  ? 16.641  23.759  54.058  1.00 46.61  ? 71  PHE L CG  1 
ATOM   2407  C CD1 . PHE B 2 76  ? 17.907  24.282  54.188  1.00 49.28  ? 71  PHE L CD1 1 
ATOM   2408  C CD2 . PHE B 2 76  ? 16.015  23.822  52.838  1.00 45.35  ? 71  PHE L CD2 1 
ATOM   2409  C CE1 . PHE B 2 76  ? 18.536  24.850  53.115  1.00 49.35  ? 71  PHE L CE1 1 
ATOM   2410  C CE2 . PHE B 2 76  ? 16.645  24.377  51.755  1.00 44.89  ? 71  PHE L CE2 1 
ATOM   2411  C CZ  . PHE B 2 76  ? 17.904  24.892  51.893  1.00 46.80  ? 71  PHE L CZ  1 
ATOM   2412  N N   . THR B 2 77  ? 14.724  22.620  57.827  1.00 52.18  ? 72  THR L N   1 
ATOM   2413  C CA  . THR B 2 77  ? 14.472  22.120  59.160  1.00 52.70  ? 72  THR L CA  1 
ATOM   2414  C C   . THR B 2 77  ? 13.782  20.785  59.184  1.00 54.03  ? 72  THR L C   1 
ATOM   2415  O O   . THR B 2 77  ? 12.725  20.613  58.588  1.00 55.60  ? 72  THR L O   1 
ATOM   2416  C CB  . THR B 2 77  ? 13.520  23.037  59.871  1.00 53.06  ? 72  THR L CB  1 
ATOM   2417  O OG1 . THR B 2 77  ? 13.915  24.395  59.634  1.00 63.07  ? 72  THR L OG1 1 
ATOM   2418  C CG2 . THR B 2 77  ? 13.517  22.726  61.355  1.00 54.21  ? 72  THR L CG2 1 
ATOM   2419  N N   . LEU B 2 78  ? 14.355  19.840  59.907  1.00 53.84  ? 73  LEU L N   1 
ATOM   2420  C CA  . LEU B 2 78  ? 13.664  18.587  60.116  1.00 54.46  ? 73  LEU L CA  1 
ATOM   2421  C C   . LEU B 2 78  ? 12.963  18.595  61.473  1.00 56.97  ? 73  LEU L C   1 
ATOM   2422  O O   . LEU B 2 78  ? 13.554  18.988  62.477  1.00 58.04  ? 73  LEU L O   1 
ATOM   2423  C CB  . LEU B 2 78  ? 14.639  17.434  60.052  1.00 51.87  ? 73  LEU L CB  1 
ATOM   2424  C CG  . LEU B 2 78  ? 13.840  16.141  60.064  1.00 53.07  ? 73  LEU L CG  1 
ATOM   2425  C CD1 . LEU B 2 78  ? 13.650  15.665  58.627  1.00 52.37  ? 73  LEU L CD1 1 
ATOM   2426  C CD2 . LEU B 2 78  ? 14.535  15.094  60.904  1.00 53.68  ? 73  LEU L CD2 1 
ATOM   2427  N N   . ARG B 2 79  ? 11.703  18.179  61.510  1.00 53.57  ? 74  ARG L N   1 
ATOM   2428  C CA  . ARG B 2 79  ? 10.967  18.179  62.767  1.00 56.36  ? 74  ARG L CA  1 
ATOM   2429  C C   . ARG B 2 79  ? 10.434  16.790  63.076  1.00 58.39  ? 74  ARG L C   1 
ATOM   2430  O O   . ARG B 2 79  ? 9.876   16.130  62.204  1.00 55.60  ? 74  ARG L O   1 
ATOM   2431  C CB  . ARG B 2 79  ? 9.820   19.214  62.764  1.00 64.46  ? 74  ARG L CB  1 
ATOM   2432  C CG  . ARG B 2 79  ? 10.245  20.699  62.921  1.00 70.26  ? 74  ARG L CG  1 
ATOM   2433  C CD  . ARG B 2 79  ? 9.045   21.687  62.991  1.00 71.05  ? 74  ARG L CD  1 
ATOM   2434  N NE  . ARG B 2 79  ? 9.465   23.095  63.109  1.00 76.30  ? 74  ARG L NE  1 
ATOM   2435  C CZ  . ARG B 2 79  ? 9.362   23.838  64.217  1.00 85.42  ? 74  ARG L CZ  1 
ATOM   2436  N NH1 . ARG B 2 79  ? 9.780   25.097  64.218  1.00 83.96  ? 74  ARG L NH1 1 
ATOM   2437  N NH2 . ARG B 2 79  ? 8.843   23.332  65.332  1.00 93.76  ? 74  ARG L NH2 1 
ATOM   2438  N N   . ILE B 2 80  ? 10.617  16.369  64.328  1.00 63.92  ? 75  ILE L N   1 
ATOM   2439  C CA  . ILE B 2 80  ? 10.166  15.072  64.841  1.00 61.84  ? 75  ILE L CA  1 
ATOM   2440  C C   . ILE B 2 80  ? 9.025   15.223  65.852  1.00 64.32  ? 75  ILE L C   1 
ATOM   2441  O O   . ILE B 2 80  ? 9.190   15.880  66.880  1.00 69.37  ? 75  ILE L O   1 
ATOM   2442  C CB  . ILE B 2 80  ? 11.313  14.379  65.582  1.00 62.33  ? 75  ILE L CB  1 
ATOM   2443  C CG1 . ILE B 2 80  ? 12.349  13.867  64.591  1.00 52.88  ? 75  ILE L CG1 1 
ATOM   2444  C CG2 . ILE B 2 80  ? 10.774  13.265  66.497  1.00 67.24  ? 75  ILE L CG2 1 
ATOM   2445  C CD1 . ILE B 2 80  ? 13.578  13.366  65.240  1.00 52.59  ? 75  ILE L CD1 1 
ATOM   2446  N N   . SER B 2 81  ? 7.880   14.602  65.595  1.00 63.01  ? 76  SER L N   1 
ATOM   2447  C CA  . SER B 2 81  ? 6.725   14.823  66.471  1.00 71.43  ? 76  SER L CA  1 
ATOM   2448  C C   . SER B 2 81  ? 6.898   14.345  67.937  1.00 73.24  ? 76  SER L C   1 
ATOM   2449  O O   . SER B 2 81  ? 6.554   15.075  68.866  1.00 71.33  ? 76  SER L O   1 
ATOM   2450  C CB  . SER B 2 81  ? 5.395   14.343  65.829  1.00 73.14  ? 76  SER L CB  1 
ATOM   2451  O OG  . SER B 2 81  ? 5.330   12.934  65.648  1.00 73.72  ? 76  SER L OG  1 
ATOM   2452  N N   . ARG B 2 82  ? 7.437   13.148  68.159  1.00 71.44  ? 77  ARG L N   1 
ATOM   2453  C CA  . ARG B 2 82  ? 7.602   12.678  69.537  1.00 70.84  ? 77  ARG L CA  1 
ATOM   2454  C C   . ARG B 2 82  ? 8.751   11.688  69.719  1.00 69.14  ? 77  ARG L C   1 
ATOM   2455  O O   . ARG B 2 82  ? 8.564   10.476  69.594  1.00 70.11  ? 77  ARG L O   1 
ATOM   2456  C CB  . ARG B 2 82  ? 6.295   12.082  70.066  1.00 70.73  ? 77  ARG L CB  1 
ATOM   2457  C CG  . ARG B 2 82  ? 5.981   10.698  69.530  1.00 70.56  ? 77  ARG L CG  1 
ATOM   2458  C CD  . ARG B 2 82  ? 4.620   10.226  69.971  1.00 72.52  ? 77  ARG L CD  1 
ATOM   2459  N NE  . ARG B 2 82  ? 3.668   10.296  68.870  1.00 77.44  ? 77  ARG L NE  1 
ATOM   2460  C CZ  . ARG B 2 82  ? 3.175   11.428  68.370  1.00 81.75  ? 77  ARG L CZ  1 
ATOM   2461  N NH1 . ARG B 2 82  ? 3.538   12.604  68.872  1.00 77.17  ? 77  ARG L NH1 1 
ATOM   2462  N NH2 . ARG B 2 82  ? 2.315   11.383  67.358  1.00 82.33  ? 77  ARG L NH2 1 
ATOM   2463  N N   . VAL B 2 83  ? 9.934   12.204  70.043  1.00 67.70  ? 78  VAL L N   1 
ATOM   2464  C CA  . VAL B 2 83  ? 11.136  11.368  70.105  1.00 67.25  ? 78  VAL L CA  1 
ATOM   2465  C C   . VAL B 2 83  ? 10.933  10.049  70.833  1.00 68.99  ? 78  VAL L C   1 
ATOM   2466  O O   . VAL B 2 83  ? 10.466  10.012  71.964  1.00 71.20  ? 78  VAL L O   1 
ATOM   2467  C CB  . VAL B 2 83  ? 12.321  12.078  70.762  1.00 59.21  ? 78  VAL L CB  1 
ATOM   2468  C CG1 . VAL B 2 83  ? 12.903  13.103  69.832  1.00 62.38  ? 78  VAL L CG1 1 
ATOM   2469  C CG2 . VAL B 2 83  ? 11.887  12.713  72.047  1.00 67.43  ? 78  VAL L CG2 1 
ATOM   2470  N N   . GLU B 2 84  ? 11.297  8.968   70.157  1.00 71.27  ? 79  GLU L N   1 
ATOM   2471  C CA  . GLU B 2 84  ? 11.350  7.650   70.755  1.00 70.82  ? 79  GLU L CA  1 
ATOM   2472  C C   . GLU B 2 84  ? 12.786  7.469   71.259  1.00 72.14  ? 79  GLU L C   1 
ATOM   2473  O O   . GLU B 2 84  ? 13.487  8.451   71.499  1.00 71.19  ? 79  GLU L O   1 
ATOM   2474  C CB  . GLU B 2 84  ? 10.993  6.601   69.704  1.00 73.37  ? 79  GLU L CB  1 
ATOM   2475  C CG  . GLU B 2 84  ? 10.439  5.295   70.253  1.00 81.22  ? 79  GLU L CG  1 
ATOM   2476  C CD  . GLU B 2 84  ? 8.917   5.304   70.424  1.00 94.08  ? 79  GLU L CD  1 
ATOM   2477  O OE1 . GLU B 2 84  ? 8.177   5.345   69.402  1.00 89.67  ? 79  GLU L OE1 1 
ATOM   2478  O OE2 . GLU B 2 84  ? 8.465   5.251   71.593  1.00 100.99 ? 79  GLU L OE2 1 
ATOM   2479  N N   . ALA B 2 85  ? 13.239  6.234   71.432  1.00 72.55  ? 80  ALA L N   1 
ATOM   2480  C CA  . ALA B 2 85  ? 14.621  6.031   71.837  1.00 68.57  ? 80  ALA L CA  1 
ATOM   2481  C C   . ALA B 2 85  ? 15.398  5.509   70.646  1.00 68.49  ? 80  ALA L C   1 
ATOM   2482  O O   . ALA B 2 85  ? 16.630  5.522   70.643  1.00 65.80  ? 80  ALA L O   1 
ATOM   2483  C CB  . ALA B 2 85  ? 14.699  5.080   72.993  1.00 71.15  ? 80  ALA L CB  1 
ATOM   2484  N N   . GLU B 2 86  ? 14.650  5.046   69.646  1.00 66.85  ? 81  GLU L N   1 
ATOM   2485  C CA  . GLU B 2 86  ? 15.192  4.621   68.362  1.00 66.86  ? 81  GLU L CA  1 
ATOM   2486  C C   . GLU B 2 86  ? 15.508  5.836   67.499  1.00 71.42  ? 81  GLU L C   1 
ATOM   2487  O O   . GLU B 2 86  ? 16.299  5.747   66.562  1.00 74.75  ? 81  GLU L O   1 
ATOM   2488  C CB  . GLU B 2 86  ? 14.211  3.703   67.623  1.00 69.76  ? 81  GLU L CB  1 
ATOM   2489  C CG  . GLU B 2 86  ? 13.778  2.469   68.432  1.00 90.25  ? 81  GLU L CG  1 
ATOM   2490  C CD  . GLU B 2 86  ? 12.445  2.642   69.209  1.00 93.94  ? 81  GLU L CD  1 
ATOM   2491  O OE1 . GLU B 2 86  ? 11.378  2.773   68.548  1.00 95.02  ? 81  GLU L OE1 1 
ATOM   2492  O OE2 . GLU B 2 86  ? 12.464  2.614   70.474  1.00 79.48  ? 81  GLU L OE2 1 
ATOM   2493  N N   . ASP B 2 87  ? 14.900  6.974   67.822  1.00 71.18  ? 82  ASP L N   1 
ATOM   2494  C CA  . ASP B 2 87  ? 15.097  8.197   67.041  1.00 66.56  ? 82  ASP L CA  1 
ATOM   2495  C C   . ASP B 2 87  ? 16.378  8.897   67.456  1.00 61.14  ? 82  ASP L C   1 
ATOM   2496  O O   . ASP B 2 87  ? 16.560  10.082  67.188  1.00 59.07  ? 82  ASP L O   1 
ATOM   2497  C CB  . ASP B 2 87  ? 13.907  9.153   67.204  1.00 63.72  ? 82  ASP L CB  1 
ATOM   2498  C CG  . ASP B 2 87  ? 12.644  8.649   66.509  1.00 72.79  ? 82  ASP L CG  1 
ATOM   2499  O OD1 . ASP B 2 87  ? 11.622  9.378   66.522  1.00 73.80  ? 82  ASP L OD1 1 
ATOM   2500  O OD2 . ASP B 2 87  ? 12.665  7.524   65.947  1.00 78.62  ? 82  ASP L OD2 1 
ATOM   2501  N N   . VAL B 2 88  ? 17.275  8.156   68.093  1.00 58.92  ? 83  VAL L N   1 
ATOM   2502  C CA  . VAL B 2 88  ? 18.372  8.779   68.804  1.00 60.12  ? 83  VAL L CA  1 
ATOM   2503  C C   . VAL B 2 88  ? 19.681  8.527   68.132  1.00 55.84  ? 83  VAL L C   1 
ATOM   2504  O O   . VAL B 2 88  ? 20.057  7.378   67.945  1.00 58.71  ? 83  VAL L O   1 
ATOM   2505  C CB  . VAL B 2 88  ? 18.479  8.219   70.203  1.00 62.30  ? 83  VAL L CB  1 
ATOM   2506  C CG1 . VAL B 2 88  ? 19.838  8.572   70.791  1.00 60.37  ? 83  VAL L CG1 1 
ATOM   2507  C CG2 . VAL B 2 88  ? 17.331  8.740   71.053  1.00 62.49  ? 83  VAL L CG2 1 
ATOM   2508  N N   . GLY B 2 89  ? 20.379  9.603   67.790  1.00 50.06  ? 84  GLY L N   1 
ATOM   2509  C CA  . GLY B 2 89  ? 21.659  9.485   67.129  1.00 50.41  ? 84  GLY L CA  1 
ATOM   2510  C C   . GLY B 2 89  ? 22.126  10.777  66.499  1.00 48.22  ? 84  GLY L C   1 
ATOM   2511  O O   . GLY B 2 89  ? 21.921  11.852  67.040  1.00 54.27  ? 84  GLY L O   1 
ATOM   2512  N N   . VAL B 2 90  ? 22.780  10.684  65.354  1.00 45.59  ? 85  VAL L N   1 
ATOM   2513  C CA  . VAL B 2 90  ? 23.240  11.893  64.688  1.00 47.80  ? 85  VAL L CA  1 
ATOM   2514  C C   . VAL B 2 90  ? 22.366  12.177  63.461  1.00 48.41  ? 85  VAL L C   1 
ATOM   2515  O O   . VAL B 2 90  ? 21.872  11.242  62.812  1.00 46.60  ? 85  VAL L O   1 
ATOM   2516  C CB  . VAL B 2 90  ? 24.749  11.826  64.365  1.00 40.70  ? 85  VAL L CB  1 
ATOM   2517  C CG1 . VAL B 2 90  ? 25.127  12.886  63.404  1.00 43.47  ? 85  VAL L CG1 1 
ATOM   2518  C CG2 . VAL B 2 90  ? 25.538  12.000  65.615  1.00 37.04  ? 85  VAL L CG2 1 
ATOM   2519  N N   . TYR B 2 91  ? 22.146  13.466  63.185  1.00 47.95  ? 86  TYR L N   1 
ATOM   2520  C CA  . TYR B 2 91  ? 21.290  13.915  62.082  1.00 46.20  ? 86  TYR L CA  1 
ATOM   2521  C C   . TYR B 2 91  ? 22.038  14.817  61.094  1.00 47.19  ? 86  TYR L C   1 
ATOM   2522  O O   . TYR B 2 91  ? 22.314  15.988  61.393  1.00 48.27  ? 86  TYR L O   1 
ATOM   2523  C CB  . TYR B 2 91  ? 20.070  14.664  62.620  1.00 43.93  ? 86  TYR L CB  1 
ATOM   2524  C CG  . TYR B 2 91  ? 18.995  13.796  63.214  1.00 44.09  ? 86  TYR L CG  1 
ATOM   2525  C CD1 . TYR B 2 91  ? 19.029  13.408  64.544  1.00 49.58  ? 86  TYR L CD1 1 
ATOM   2526  C CD2 . TYR B 2 91  ? 17.936  13.386  62.453  1.00 44.48  ? 86  TYR L CD2 1 
ATOM   2527  C CE1 . TYR B 2 91  ? 18.024  12.618  65.084  1.00 48.61  ? 86  TYR L CE1 1 
ATOM   2528  C CE2 . TYR B 2 91  ? 16.939  12.603  62.978  1.00 46.03  ? 86  TYR L CE2 1 
ATOM   2529  C CZ  . TYR B 2 91  ? 16.981  12.223  64.279  1.00 46.22  ? 86  TYR L CZ  1 
ATOM   2530  O OH  . TYR B 2 91  ? 15.958  11.439  64.743  1.00 49.36  ? 86  TYR L OH  1 
ATOM   2531  N N   . TYR B 2 92  ? 22.348  14.267  59.917  1.00 46.58  ? 87  TYR L N   1 
ATOM   2532  C CA  . TYR B 2 92  ? 23.047  14.990  58.852  1.00 43.32  ? 87  TYR L CA  1 
ATOM   2533  C C   . TYR B 2 92  ? 22.139  15.397  57.673  1.00 42.29  ? 87  TYR L C   1 
ATOM   2534  O O   . TYR B 2 92  ? 21.177  14.707  57.321  1.00 41.12  ? 87  TYR L O   1 
ATOM   2535  C CB  . TYR B 2 92  ? 24.134  14.121  58.270  1.00 38.05  ? 87  TYR L CB  1 
ATOM   2536  C CG  . TYR B 2 92  ? 25.183  13.589  59.203  1.00 40.30  ? 87  TYR L CG  1 
ATOM   2537  C CD1 . TYR B 2 92  ? 26.335  14.305  59.446  1.00 44.61  ? 87  TYR L CD1 1 
ATOM   2538  C CD2 . TYR B 2 92  ? 25.071  12.328  59.763  1.00 39.55  ? 87  TYR L CD2 1 
ATOM   2539  C CE1 . TYR B 2 92  ? 27.345  13.800  60.247  1.00 47.89  ? 87  TYR L CE1 1 
ATOM   2540  C CE2 . TYR B 2 92  ? 26.069  11.809  60.575  1.00 39.81  ? 87  TYR L CE2 1 
ATOM   2541  C CZ  . TYR B 2 92  ? 27.209  12.555  60.812  1.00 46.16  ? 87  TYR L CZ  1 
ATOM   2542  O OH  . TYR B 2 92  ? 28.229  12.083  61.608  1.00 49.77  ? 87  TYR L OH  1 
ATOM   2543  N N   . CYS B 2 93  ? 22.490  16.504  57.034  1.00 41.94  ? 88  CYS L N   1 
ATOM   2544  C CA  . CYS B 2 93  ? 21.805  16.977  55.835  1.00 41.95  ? 88  CYS L CA  1 
ATOM   2545  C C   . CYS B 2 93  ? 22.762  17.092  54.638  1.00 40.28  ? 88  CYS L C   1 
ATOM   2546  O O   . CYS B 2 93  ? 23.927  17.463  54.777  1.00 40.09  ? 88  CYS L O   1 
ATOM   2547  C CB  . CYS B 2 93  ? 21.188  18.347  56.099  1.00 46.02  ? 88  CYS L CB  1 
ATOM   2548  S SG  . CYS B 2 93  ? 22.423  19.671  56.273  1.00 58.29  ? 88  CYS L SG  1 
ATOM   2549  N N   . MET B 2 94  ? 22.275  16.801  53.446  1.00 37.48  ? 89  MET L N   1 
ATOM   2550  C CA  . MET B 2 94  ? 23.148  16.915  52.304  1.00 38.10  ? 89  MET L CA  1 
ATOM   2551  C C   . MET B 2 94  ? 22.510  17.758  51.214  1.00 39.93  ? 89  MET L C   1 
ATOM   2552  O O   . MET B 2 94  ? 21.277  17.845  51.135  1.00 38.37  ? 89  MET L O   1 
ATOM   2553  C CB  . MET B 2 94  ? 23.406  15.554  51.723  1.00 36.04  ? 89  MET L CB  1 
ATOM   2554  C CG  . MET B 2 94  ? 22.475  15.328  50.575  1.00 38.88  ? 89  MET L CG  1 
ATOM   2555  S SD  . MET B 2 94  ? 22.947  13.925  49.618  1.00 48.81  ? 89  MET L SD  1 
ATOM   2556  C CE  . MET B 2 94  ? 23.956  13.138  50.863  1.00 43.31  ? 89  MET L CE  1 
ATOM   2557  N N   . GLN B 2 95  ? 23.363  18.364  50.381  1.00 39.85  ? 90  GLN L N   1 
ATOM   2558  C CA  . GLN B 2 95  ? 22.960  19.057  49.158  1.00 37.50  ? 90  GLN L CA  1 
ATOM   2559  C C   . GLN B 2 95  ? 23.239  18.188  47.941  1.00 37.17  ? 90  GLN L C   1 
ATOM   2560  O O   . GLN B 2 95  ? 24.118  17.342  47.984  1.00 36.91  ? 90  GLN L O   1 
ATOM   2561  C CB  . GLN B 2 95  ? 23.748  20.339  49.000  1.00 37.78  ? 90  GLN L CB  1 
ATOM   2562  C CG  . GLN B 2 95  ? 23.817  20.802  47.549  1.00 42.45  ? 90  GLN L CG  1 
ATOM   2563  C CD  . GLN B 2 95  ? 25.059  20.317  46.805  1.00 41.26  ? 90  GLN L CD  1 
ATOM   2564  O OE1 . GLN B 2 95  ? 26.023  19.852  47.412  1.00 40.05  ? 90  GLN L OE1 1 
ATOM   2565  N NE2 . GLN B 2 95  ? 25.041  20.448  45.485  1.00 37.49  ? 90  GLN L NE2 1 
ATOM   2566  N N   . HIS B 2 96  ? 22.497  18.388  46.857  1.00 36.78  ? 91  HIS L N   1 
ATOM   2567  C CA  . HIS B 2 96  ? 22.786  17.680  45.625  1.00 34.84  ? 91  HIS L CA  1 
ATOM   2568  C C   . HIS B 2 96  ? 22.396  18.485  44.428  1.00 36.88  ? 91  HIS L C   1 
ATOM   2569  O O   . HIS B 2 96  ? 22.224  17.916  43.381  1.00 42.78  ? 91  HIS L O   1 
ATOM   2570  C CB  . HIS B 2 96  ? 22.031  16.369  45.558  1.00 36.41  ? 91  HIS L CB  1 
ATOM   2571  C CG  . HIS B 2 96  ? 22.652  15.343  44.654  1.00 40.54  ? 91  HIS L CG  1 
ATOM   2572  N ND1 . HIS B 2 96  ? 23.055  14.100  45.104  1.00 43.08  ? 91  HIS L ND1 1 
ATOM   2573  C CD2 . HIS B 2 96  ? 22.918  15.361  43.327  1.00 42.44  ? 91  HIS L CD2 1 
ATOM   2574  C CE1 . HIS B 2 96  ? 23.548  13.400  44.099  1.00 39.67  ? 91  HIS L CE1 1 
ATOM   2575  N NE2 . HIS B 2 96  ? 23.483  14.145  43.009  1.00 48.21  ? 91  HIS L NE2 1 
ATOM   2576  N N   . LEU B 2 97  ? 22.232  19.794  44.578  1.00 37.34  ? 92  LEU L N   1 
ATOM   2577  C CA  . LEU B 2 97  ? 22.067  20.691  43.437  1.00 36.60  ? 92  LEU L CA  1 
ATOM   2578  C C   . LEU B 2 97  ? 23.338  20.647  42.582  1.00 41.58  ? 92  LEU L C   1 
ATOM   2579  O O   . LEU B 2 97  ? 23.342  20.180  41.432  1.00 37.98  ? 92  LEU L O   1 
ATOM   2580  C CB  . LEU B 2 97  ? 21.884  22.124  43.933  1.00 37.90  ? 92  LEU L CB  1 
ATOM   2581  C CG  . LEU B 2 97  ? 20.794  23.084  43.445  1.00 38.72  ? 92  LEU L CG  1 
ATOM   2582  C CD1 . LEU B 2 97  ? 21.282  24.521  43.548  1.00 36.57  ? 92  LEU L CD1 1 
ATOM   2583  C CD2 . LEU B 2 97  ? 20.320  22.788  42.035  1.00 40.48  ? 92  LEU L CD2 1 
ATOM   2584  N N   . GLU B 2 98  ? 24.420  21.149  43.177  1.00 45.77  ? 93  GLU L N   1 
ATOM   2585  C CA  . GLU B 2 98  ? 25.721  21.312  42.507  1.00 53.84  ? 93  GLU L CA  1 
ATOM   2586  C C   . GLU B 2 98  ? 26.637  20.106  42.783  1.00 50.88  ? 93  GLU L C   1 
ATOM   2587  O O   . GLU B 2 98  ? 26.234  19.207  43.520  1.00 48.87  ? 93  GLU L O   1 
ATOM   2588  C CB  . GLU B 2 98  ? 26.389  22.643  42.910  1.00 52.58  ? 93  GLU L CB  1 
ATOM   2589  C CG  . GLU B 2 98  ? 25.532  23.897  42.663  1.00 53.69  ? 93  GLU L CG  1 
ATOM   2590  C CD  . GLU B 2 98  ? 26.317  25.049  42.033  1.00 69.13  ? 93  GLU L CD  1 
ATOM   2591  O OE1 . GLU B 2 98  ? 27.011  24.826  41.001  1.00 82.08  ? 93  GLU L OE1 1 
ATOM   2592  O OE2 . GLU B 2 98  ? 26.225  26.179  42.570  1.00 59.66  ? 93  GLU L OE2 1 
ATOM   2593  N N   . TYR B 2 99  ? 27.793  20.041  42.151  1.00 46.35  ? 94  TYR L N   1 
ATOM   2594  C CA  . TYR B 2 99  ? 28.401  18.751  42.025  1.00 47.11  ? 94  TYR L CA  1 
ATOM   2595  C C   . TYR B 2 99  ? 29.690  18.374  42.664  1.00 51.45  ? 94  TYR L C   1 
ATOM   2596  O O   . TYR B 2 99  ? 30.496  17.735  42.050  1.00 53.56  ? 94  TYR L O   1 
ATOM   2597  C CB  . TYR B 2 99  ? 28.435  18.320  40.589  1.00 53.05  ? 94  TYR L CB  1 
ATOM   2598  C CG  . TYR B 2 99  ? 27.992  16.904  40.436  1.00 52.56  ? 94  TYR L CG  1 
ATOM   2599  C CD1 . TYR B 2 99  ? 27.311  16.497  39.338  1.00 61.97  ? 94  TYR L CD1 1 
ATOM   2600  C CD2 . TYR B 2 99  ? 28.233  15.987  41.404  1.00 48.59  ? 94  TYR L CD2 1 
ATOM   2601  C CE1 . TYR B 2 99  ? 26.912  15.234  39.206  1.00 63.51  ? 94  TYR L CE1 1 
ATOM   2602  C CE2 . TYR B 2 99  ? 27.821  14.725  41.276  1.00 53.48  ? 94  TYR L CE2 1 
ATOM   2603  C CZ  . TYR B 2 99  ? 27.160  14.360  40.174  1.00 62.76  ? 94  TYR L CZ  1 
ATOM   2604  O OH  . TYR B 2 99  ? 26.748  13.079  40.011  1.00 62.32  ? 94  TYR L OH  1 
ATOM   2605  N N   . PRO B 2 100 ? 29.842  18.711  43.926  1.00 56.39  ? 95  PRO L N   1 
ATOM   2606  C CA  . PRO B 2 100 ? 30.662  17.956  44.847  1.00 52.38  ? 95  PRO L CA  1 
ATOM   2607  C C   . PRO B 2 100 ? 29.718  17.804  45.978  1.00 46.91  ? 95  PRO L C   1 
ATOM   2608  O O   . PRO B 2 100 ? 29.621  18.663  46.777  1.00 49.12  ? 95  PRO L O   1 
ATOM   2609  C CB  . PRO B 2 100 ? 31.747  18.933  45.232  1.00 43.84  ? 95  PRO L CB  1 
ATOM   2610  C CG  . PRO B 2 100 ? 31.509  20.123  44.452  1.00 55.69  ? 95  PRO L CG  1 
ATOM   2611  C CD  . PRO B 2 100 ? 30.103  20.138  44.071  1.00 56.85  ? 95  PRO L CD  1 
ATOM   2612  N N   . VAL B 2 101 ? 28.945  16.757  46.003  1.00 42.50  ? 96  VAL L N   1 
ATOM   2613  C CA  . VAL B 2 101 ? 27.835  16.742  46.917  1.00 44.26  ? 96  VAL L CA  1 
ATOM   2614  C C   . VAL B 2 101 ? 28.469  16.998  48.280  1.00 41.41  ? 96  VAL L C   1 
ATOM   2615  O O   . VAL B 2 101 ? 29.597  16.582  48.517  1.00 40.94  ? 96  VAL L O   1 
ATOM   2616  C CB  . VAL B 2 101 ? 26.937  15.452  46.775  1.00 46.78  ? 96  VAL L CB  1 
ATOM   2617  C CG1 . VAL B 2 101 ? 27.041  14.900  45.371  1.00 44.18  ? 96  VAL L CG1 1 
ATOM   2618  C CG2 . VAL B 2 101 ? 27.261  14.372  47.812  1.00 44.30  ? 96  VAL L CG2 1 
ATOM   2619  N N   . THR B 2 102 ? 27.782  17.737  49.143  1.00 38.70  ? 97  THR L N   1 
ATOM   2620  C CA  . THR B 2 102 ? 28.376  18.175  50.399  1.00 40.86  ? 97  THR L CA  1 
ATOM   2621  C C   . THR B 2 102 ? 27.447  17.989  51.603  1.00 40.36  ? 97  THR L C   1 
ATOM   2622  O O   . THR B 2 102 ? 26.250  18.277  51.538  1.00 39.72  ? 97  THR L O   1 
ATOM   2623  C CB  . THR B 2 102 ? 28.812  19.640  50.311  1.00 40.48  ? 97  THR L CB  1 
ATOM   2624  O OG1 . THR B 2 102 ? 27.855  20.362  49.534  1.00 45.05  ? 97  THR L OG1 1 
ATOM   2625  C CG2 . THR B 2 102 ? 30.142  19.750  49.635  1.00 39.38  ? 97  THR L CG2 1 
ATOM   2626  N N   . PHE B 2 103 ? 28.017  17.521  52.706  1.00 35.45  ? 98  PHE L N   1 
ATOM   2627  C CA  . PHE B 2 103 ? 27.235  17.180  53.874  1.00 37.96  ? 98  PHE L CA  1 
ATOM   2628  C C   . PHE B 2 103 ? 27.296  18.260  54.962  1.00 40.68  ? 98  PHE L C   1 
ATOM   2629  O O   . PHE B 2 103 ? 28.208  19.070  55.001  1.00 45.05  ? 98  PHE L O   1 
ATOM   2630  C CB  . PHE B 2 103 ? 27.725  15.841  54.429  1.00 40.44  ? 98  PHE L CB  1 
ATOM   2631  C CG  . PHE B 2 103 ? 27.306  14.633  53.616  1.00 41.43  ? 98  PHE L CG  1 
ATOM   2632  C CD1 . PHE B 2 103 ? 28.029  14.232  52.519  1.00 39.37  ? 98  PHE L CD1 1 
ATOM   2633  C CD2 . PHE B 2 103 ? 26.203  13.880  53.979  1.00 43.37  ? 98  PHE L CD2 1 
ATOM   2634  C CE1 . PHE B 2 103 ? 27.657  13.136  51.788  1.00 35.20  ? 98  PHE L CE1 1 
ATOM   2635  C CE2 . PHE B 2 103 ? 25.835  12.776  53.238  1.00 41.49  ? 98  PHE L CE2 1 
ATOM   2636  C CZ  . PHE B 2 103 ? 26.578  12.411  52.148  1.00 38.03  ? 98  PHE L CZ  1 
ATOM   2637  N N   . GLY B 2 104 ? 26.321  18.273  55.852  1.00 38.99  ? 99  GLY L N   1 
ATOM   2638  C CA  . GLY B 2 104 ? 26.378  19.180  56.975  1.00 46.66  ? 99  GLY L CA  1 
ATOM   2639  C C   . GLY B 2 104 ? 27.080  18.536  58.159  1.00 51.99  ? 99  GLY L C   1 
ATOM   2640  O O   . GLY B 2 104 ? 27.059  17.321  58.304  1.00 50.36  ? 99  GLY L O   1 
ATOM   2641  N N   . ALA B 2 105 ? 27.673  19.357  59.025  1.00 56.38  ? 100 ALA L N   1 
ATOM   2642  C CA  . ALA B 2 105 ? 28.523  18.878  60.115  1.00 49.28  ? 100 ALA L CA  1 
ATOM   2643  C C   . ALA B 2 105 ? 27.832  17.921  61.079  1.00 49.68  ? 100 ALA L C   1 
ATOM   2644  O O   . ALA B 2 105 ? 28.497  17.126  61.766  1.00 51.68  ? 100 ALA L O   1 
ATOM   2645  C CB  . ALA B 2 105 ? 29.105  20.047  60.864  1.00 54.33  ? 100 ALA L CB  1 
ATOM   2646  N N   . GLY B 2 106 ? 26.506  18.003  61.139  1.00 48.59  ? 101 GLY L N   1 
ATOM   2647  C CA  . GLY B 2 106 ? 25.730  17.091  61.968  1.00 54.10  ? 101 GLY L CA  1 
ATOM   2648  C C   . GLY B 2 106 ? 25.263  17.636  63.310  1.00 54.59  ? 101 GLY L C   1 
ATOM   2649  O O   . GLY B 2 106 ? 25.843  18.564  63.881  1.00 56.95  ? 101 GLY L O   1 
ATOM   2650  N N   . THR B 2 107 ? 24.199  17.046  63.824  1.00 48.06  ? 102 THR L N   1 
ATOM   2651  C CA  . THR B 2 107 ? 23.572  17.577  65.016  1.00 55.69  ? 102 THR L CA  1 
ATOM   2652  C C   . THR B 2 107 ? 23.337  16.447  66.006  1.00 61.12  ? 102 THR L C   1 
ATOM   2653  O O   . THR B 2 107 ? 22.558  15.524  65.734  1.00 59.63  ? 102 THR L O   1 
ATOM   2654  C CB  . THR B 2 107 ? 22.230  18.257  64.665  1.00 57.25  ? 102 THR L CB  1 
ATOM   2655  O OG1 . THR B 2 107 ? 22.474  19.455  63.919  1.00 59.83  ? 102 THR L OG1 1 
ATOM   2656  C CG2 . THR B 2 107 ? 21.460  18.608  65.914  1.00 59.94  ? 102 THR L CG2 1 
ATOM   2657  N N   . LYS B 2 108 ? 24.012  16.504  67.150  1.00 58.71  ? 103 LYS L N   1 
ATOM   2658  C CA  . LYS B 2 108 ? 23.943  15.400  68.105  1.00 59.16  ? 103 LYS L CA  1 
ATOM   2659  C C   . LYS B 2 108 ? 22.659  15.486  68.952  1.00 67.10  ? 103 LYS L C   1 
ATOM   2660  O O   . LYS B 2 108 ? 22.393  16.492  69.627  1.00 71.80  ? 103 LYS L O   1 
ATOM   2661  C CB  . LYS B 2 108 ? 25.219  15.355  68.966  1.00 67.77  ? 103 LYS L CB  1 
ATOM   2662  C CG  . LYS B 2 108 ? 26.364  16.323  68.508  1.00 72.10  ? 103 LYS L CG  1 
ATOM   2663  C CD  . LYS B 2 108 ? 27.344  15.718  67.464  1.00 64.92  ? 103 LYS L CD  1 
ATOM   2664  C CE  . LYS B 2 108 ? 27.530  16.623  66.222  1.00 55.80  ? 103 LYS L CE  1 
ATOM   2665  N NZ  . LYS B 2 108 ? 28.419  17.797  66.453  1.00 54.57  ? 103 LYS L NZ  1 
ATOM   2666  N N   . VAL B 2 109 ? 21.841  14.445  68.892  1.00 61.97  ? 104 VAL L N   1 
ATOM   2667  C CA  . VAL B 2 109 ? 20.541  14.492  69.537  1.00 59.70  ? 104 VAL L CA  1 
ATOM   2668  C C   . VAL B 2 109 ? 20.510  13.456  70.611  1.00 66.70  ? 104 VAL L C   1 
ATOM   2669  O O   . VAL B 2 109 ? 20.627  12.273  70.321  1.00 69.65  ? 104 VAL L O   1 
ATOM   2670  C CB  . VAL B 2 109 ? 19.421  14.156  68.554  1.00 58.18  ? 104 VAL L CB  1 
ATOM   2671  C CG1 . VAL B 2 109 ? 18.196  13.647  69.305  1.00 56.79  ? 104 VAL L CG1 1 
ATOM   2672  C CG2 . VAL B 2 109 ? 19.095  15.363  67.690  1.00 58.56  ? 104 VAL L CG2 1 
ATOM   2673  N N   . GLU B 2 110 ? 20.350  13.883  71.857  1.00 75.29  ? 105 GLU L N   1 
ATOM   2674  C CA  . GLU B 2 110 ? 20.325  12.927  72.967  1.00 82.13  ? 105 GLU L CA  1 
ATOM   2675  C C   . GLU B 2 110 ? 19.233  13.202  74.018  1.00 80.13  ? 105 GLU L C   1 
ATOM   2676  O O   . GLU B 2 110 ? 18.893  14.357  74.304  1.00 78.13  ? 105 GLU L O   1 
ATOM   2677  C CB  . GLU B 2 110 ? 21.715  12.812  73.615  1.00 82.82  ? 105 GLU L CB  1 
ATOM   2678  C CG  . GLU B 2 110 ? 22.697  13.910  73.176  1.00 84.70  ? 105 GLU L CG  1 
ATOM   2679  C CD  . GLU B 2 110 ? 23.985  13.918  73.998  1.00 92.85  ? 105 GLU L CD  1 
ATOM   2680  O OE1 . GLU B 2 110 ? 24.162  13.008  74.842  1.00 90.38  ? 105 GLU L OE1 1 
ATOM   2681  O OE2 . GLU B 2 110 ? 24.818  14.835  73.799  1.00 88.59  ? 105 GLU L OE2 1 
ATOM   2682  N N   . ILE B 2 111 ? 18.713  12.118  74.594  1.00 77.80  ? 106 ILE L N   1 
ATOM   2683  C CA  . ILE B 2 111 ? 17.584  12.149  75.532  1.00 81.41  ? 106 ILE L CA  1 
ATOM   2684  C C   . ILE B 2 111 ? 17.815  12.925  76.874  1.00 86.51  ? 106 ILE L C   1 
ATOM   2685  O O   . ILE B 2 111 ? 18.929  13.388  77.156  1.00 84.91  ? 106 ILE L O   1 
ATOM   2686  C CB  . ILE B 2 111 ? 17.058  10.697  75.729  1.00 81.05  ? 106 ILE L CB  1 
ATOM   2687  C CG1 . ILE B 2 111 ? 16.251  10.270  74.498  1.00 68.12  ? 106 ILE L CG1 1 
ATOM   2688  C CG2 . ILE B 2 111 ? 16.241  10.534  77.008  1.00 85.01  ? 106 ILE L CG2 1 
ATOM   2689  C CD1 . ILE B 2 111 ? 15.583  8.924   74.641  1.00 65.92  ? 106 ILE L CD1 1 
ATOM   2690  N N   . LYS B 2 112 ? 16.743  13.100  77.660  1.00 90.66  ? 107 LYS L N   1 
ATOM   2691  C CA  . LYS B 2 112 ? 16.771  13.859  78.929  1.00 92.58  ? 107 LYS L CA  1 
ATOM   2692  C C   . LYS B 2 112 ? 16.090  13.168  80.127  1.00 95.88  ? 107 LYS L C   1 
ATOM   2693  O O   . LYS B 2 112 ? 15.198  12.322  79.972  1.00 95.53  ? 107 LYS L O   1 
ATOM   2694  C CB  . LYS B 2 112 ? 16.143  15.248  78.768  1.00 84.92  ? 107 LYS L CB  1 
ATOM   2695  C CG  . LYS B 2 112 ? 16.964  16.254  77.978  1.00 83.46  ? 107 LYS L CG  1 
ATOM   2696  C CD  . LYS B 2 112 ? 16.488  17.685  78.276  1.00 79.90  ? 107 LYS L CD  1 
ATOM   2697  C CE  . LYS B 2 112 ? 15.026  17.873  77.891  1.00 77.28  ? 107 LYS L CE  1 
ATOM   2698  N NZ  . LYS B 2 112 ? 14.526  19.239  78.179  1.00 67.40  ? 107 LYS L NZ  1 
ATOM   2699  N N   . ARG B 2 113 ? 16.518  13.568  81.321  1.00 98.08  ? 108 ARG L N   1 
ATOM   2700  C CA  . ARG B 2 113 ? 15.985  13.062  82.581  1.00 104.06 ? 108 ARG L CA  1 
ATOM   2701  C C   . ARG B 2 113 ? 16.561  13.887  83.743  1.00 103.64 ? 108 ARG L C   1 
ATOM   2702  O O   . ARG B 2 113 ? 17.427  14.744  83.538  1.00 95.86  ? 108 ARG L O   1 
ATOM   2703  C CB  . ARG B 2 113 ? 16.282  11.569  82.750  1.00 98.84  ? 108 ARG L CB  1 
ATOM   2704  C CG  . ARG B 2 113 ? 15.363  10.864  83.748  1.00 105.72 ? 108 ARG L CG  1 
ATOM   2705  C CD  . ARG B 2 113 ? 15.840  9.449   84.008  1.00 111.30 ? 108 ARG L CD  1 
ATOM   2706  N NE  . ARG B 2 113 ? 17.298  9.387   83.941  1.00 111.74 ? 108 ARG L NE  1 
ATOM   2707  C CZ  . ARG B 2 113 ? 18.114  9.631   84.964  1.00 105.00 ? 108 ARG L CZ  1 
ATOM   2708  N NH1 . ARG B 2 113 ? 17.622  9.948   86.157  1.00 102.40 ? 108 ARG L NH1 1 
ATOM   2709  N NH2 . ARG B 2 113 ? 19.428  9.553   84.792  1.00 96.79  ? 108 ARG L NH2 1 
ATOM   2710  N N   . ALA B 2 114 ? 16.061  13.650  84.953  1.00 102.31 ? 109 ALA L N   1 
ATOM   2711  C CA  . ALA B 2 114 ? 16.508  14.406  86.119  1.00 98.41  ? 109 ALA L CA  1 
ATOM   2712  C C   . ALA B 2 114 ? 17.785  13.794  86.676  1.00 97.90  ? 109 ALA L C   1 
ATOM   2713  O O   . ALA B 2 114 ? 17.947  12.572  86.650  1.00 99.38  ? 109 ALA L O   1 
ATOM   2714  C CB  . ALA B 2 114 ? 15.423  14.443  87.179  1.00 105.03 ? 109 ALA L CB  1 
ATOM   2715  N N   . ASP B 2 115 ? 18.672  14.650  87.185  1.00 94.81  ? 110 ASP L N   1 
ATOM   2716  C CA  . ASP B 2 115 ? 20.051  14.277  87.525  1.00 93.45  ? 110 ASP L CA  1 
ATOM   2717  C C   . ASP B 2 115 ? 20.170  12.937  88.261  1.00 94.12  ? 110 ASP L C   1 
ATOM   2718  O O   . ASP B 2 115 ? 19.176  12.388  88.737  1.00 94.13  ? 110 ASP L O   1 
ATOM   2719  C CB  . ASP B 2 115 ? 20.722  15.393  88.335  1.00 96.01  ? 110 ASP L CB  1 
ATOM   2720  C CG  . ASP B 2 115 ? 20.516  16.773  87.718  1.00 100.58 ? 110 ASP L CG  1 
ATOM   2721  O OD1 . ASP B 2 115 ? 19.778  16.875  86.714  1.00 104.78 ? 110 ASP L OD1 1 
ATOM   2722  O OD2 . ASP B 2 115 ? 21.084  17.759  88.238  1.00 97.81  ? 110 ASP L OD2 1 
ATOM   2723  N N   . ALA B 2 116 ? 21.387  12.405  88.342  1.00 90.69  ? 111 ALA L N   1 
ATOM   2724  C CA  . ALA B 2 116 ? 21.607  11.127  89.019  1.00 87.59  ? 111 ALA L CA  1 
ATOM   2725  C C   . ALA B 2 116 ? 23.002  11.021  89.608  1.00 87.87  ? 111 ALA L C   1 
ATOM   2726  O O   . ALA B 2 116 ? 23.835  11.905  89.406  1.00 88.67  ? 111 ALA L O   1 
ATOM   2727  C CB  . ALA B 2 116 ? 21.343  9.967   88.084  1.00 91.02  ? 111 ALA L CB  1 
ATOM   2728  N N   . ALA B 2 117 ? 23.250  9.924   90.320  1.00 83.74  ? 112 ALA L N   1 
ATOM   2729  C CA  . ALA B 2 117 ? 24.470  9.777   91.110  1.00 83.27  ? 112 ALA L CA  1 
ATOM   2730  C C   . ALA B 2 117 ? 25.505  8.800   90.521  1.00 86.03  ? 112 ALA L C   1 
ATOM   2731  O O   . ALA B 2 117 ? 25.173  7.649   90.201  1.00 85.41  ? 112 ALA L O   1 
ATOM   2732  C CB  . ALA B 2 117 ? 24.112  9.372   92.532  1.00 81.11  ? 112 ALA L CB  1 
ATOM   2733  N N   . PRO B 2 118 ? 26.766  9.262   90.379  1.00 79.16  ? 113 PRO L N   1 
ATOM   2734  C CA  . PRO B 2 118 ? 27.917  8.435   89.997  1.00 80.01  ? 113 PRO L CA  1 
ATOM   2735  C C   . PRO B 2 118 ? 28.205  7.347   91.030  1.00 86.41  ? 113 PRO L C   1 
ATOM   2736  O O   . PRO B 2 118 ? 28.532  7.666   92.170  1.00 95.34  ? 113 PRO L O   1 
ATOM   2737  C CB  . PRO B 2 118 ? 29.087  9.430   89.990  1.00 73.34  ? 113 PRO L CB  1 
ATOM   2738  C CG  . PRO B 2 118 ? 28.482  10.739  89.830  1.00 77.82  ? 113 PRO L CG  1 
ATOM   2739  C CD  . PRO B 2 118 ? 27.129  10.684  90.477  1.00 81.39  ? 113 PRO L CD  1 
ATOM   2740  N N   . THR B 2 119 ? 28.101  6.084   90.641  1.00 80.39  ? 114 THR L N   1 
ATOM   2741  C CA  . THR B 2 119 ? 28.434  4.984   91.530  1.00 77.44  ? 114 THR L CA  1 
ATOM   2742  C C   . THR B 2 119 ? 29.925  4.649   91.426  1.00 84.85  ? 114 THR L C   1 
ATOM   2743  O O   . THR B 2 119 ? 30.285  3.684   90.749  1.00 91.51  ? 114 THR L O   1 
ATOM   2744  C CB  . THR B 2 119 ? 27.629  3.756   91.112  1.00 81.10  ? 114 THR L CB  1 
ATOM   2745  O OG1 . THR B 2 119 ? 26.279  4.153   90.835  1.00 85.31  ? 114 THR L OG1 1 
ATOM   2746  C CG2 . THR B 2 119 ? 27.652  2.687   92.189  1.00 82.33  ? 114 THR L CG2 1 
ATOM   2747  N N   . VAL B 2 120 ? 30.794  5.422   92.085  1.00 85.00  ? 115 VAL L N   1 
ATOM   2748  C CA  . VAL B 2 120 ? 32.254  5.276   91.877  1.00 90.43  ? 115 VAL L CA  1 
ATOM   2749  C C   . VAL B 2 120 ? 32.878  3.998   92.444  1.00 87.59  ? 115 VAL L C   1 
ATOM   2750  O O   . VAL B 2 120 ? 32.474  3.507   93.497  1.00 89.36  ? 115 VAL L O   1 
ATOM   2751  C CB  . VAL B 2 120 ? 33.089  6.508   92.366  1.00 87.76  ? 115 VAL L CB  1 
ATOM   2752  C CG1 . VAL B 2 120 ? 34.593  6.246   92.224  1.00 77.74  ? 115 VAL L CG1 1 
ATOM   2753  C CG2 . VAL B 2 120 ? 32.706  7.763   91.598  1.00 86.09  ? 115 VAL L CG2 1 
ATOM   2754  N N   . SER B 2 121 ? 33.862  3.473   91.716  1.00 88.43  ? 116 SER L N   1 
ATOM   2755  C CA  . SER B 2 121 ? 34.652  2.329   92.151  1.00 89.23  ? 116 SER L CA  1 
ATOM   2756  C C   . SER B 2 121 ? 36.127  2.587   91.833  1.00 93.42  ? 116 SER L C   1 
ATOM   2757  O O   . SER B 2 121 ? 36.456  3.205   90.810  1.00 90.15  ? 116 SER L O   1 
ATOM   2758  C CB  . SER B 2 121 ? 34.178  1.048   91.458  1.00 85.15  ? 116 SER L CB  1 
ATOM   2759  O OG  . SER B 2 121 ? 32.764  0.972   91.412  1.00 83.31  ? 116 SER L OG  1 
ATOM   2760  N N   . ILE B 2 122 ? 37.014  2.140   92.720  1.00 92.20  ? 117 ILE L N   1 
ATOM   2761  C CA  . ILE B 2 122 ? 38.441  2.199   92.436  1.00 91.87  ? 117 ILE L CA  1 
ATOM   2762  C C   . ILE B 2 122 ? 39.039  0.821   92.682  1.00 96.68  ? 117 ILE L C   1 
ATOM   2763  O O   . ILE B 2 122 ? 38.583  0.080   93.565  1.00 92.38  ? 117 ILE L O   1 
ATOM   2764  C CB  . ILE B 2 122 ? 39.168  3.274   93.252  1.00 87.62  ? 117 ILE L CB  1 
ATOM   2765  C CG1 . ILE B 2 122 ? 40.193  4.003   92.382  1.00 91.45  ? 117 ILE L CG1 1 
ATOM   2766  C CG2 . ILE B 2 122 ? 39.844  2.659   94.438  1.00 94.13  ? 117 ILE L CG2 1 
ATOM   2767  C CD1 . ILE B 2 122 ? 41.016  5.033   93.129  1.00 92.32  ? 117 ILE L CD1 1 
ATOM   2768  N N   . PHE B 2 123 ? 40.006  0.454   91.849  1.00 100.43 ? 118 PHE L N   1 
ATOM   2769  C CA  . PHE B 2 123 ? 40.541  -0.890  91.825  1.00 98.39  ? 118 PHE L CA  1 
ATOM   2770  C C   . PHE B 2 123 ? 42.043  -0.900  91.811  1.00 95.32  ? 118 PHE L C   1 
ATOM   2771  O O   . PHE B 2 123 ? 42.673  0.060   91.416  1.00 88.00  ? 118 PHE L O   1 
ATOM   2772  C CB  . PHE B 2 123 ? 40.027  -1.623  90.616  1.00 95.58  ? 118 PHE L CB  1 
ATOM   2773  C CG  . PHE B 2 123 ? 38.560  -1.817  90.622  1.00 96.31  ? 118 PHE L CG  1 
ATOM   2774  C CD1 . PHE B 2 123 ? 37.726  -0.747  90.587  1.00 94.92  ? 118 PHE L CD1 1 
ATOM   2775  C CD2 . PHE B 2 123 ? 38.016  -3.070  90.660  1.00 105.33 ? 118 PHE L CD2 1 
ATOM   2776  C CE1 . PHE B 2 123 ? 36.377  -0.922  90.584  1.00 98.12  ? 118 PHE L CE1 1 
ATOM   2777  C CE2 . PHE B 2 123 ? 36.665  -3.246  90.654  1.00 108.56 ? 118 PHE L CE2 1 
ATOM   2778  C CZ  . PHE B 2 123 ? 35.846  -2.175  90.616  1.00 100.14 ? 118 PHE L CZ  1 
ATOM   2779  N N   . PRO B 2 124 ? 42.603  -2.016  92.246  1.00 102.08 ? 119 PRO L N   1 
ATOM   2780  C CA  . PRO B 2 124 ? 44.012  -2.112  92.611  1.00 101.32 ? 119 PRO L CA  1 
ATOM   2781  C C   . PRO B 2 124 ? 44.841  -2.978  91.680  1.00 97.28  ? 119 PRO L C   1 
ATOM   2782  O O   . PRO B 2 124 ? 44.497  -4.106  91.375  1.00 92.13  ? 119 PRO L O   1 
ATOM   2783  C CB  . PRO B 2 124 ? 43.951  -2.743  93.994  1.00 102.36 ? 119 PRO L CB  1 
ATOM   2784  C CG  . PRO B 2 124 ? 42.713  -3.499  93.997  1.00 105.27 ? 119 PRO L CG  1 
ATOM   2785  C CD  . PRO B 2 124 ? 41.744  -2.690  93.223  1.00 105.60 ? 119 PRO L CD  1 
ATOM   2786  N N   . PRO B 2 125 ? 45.957  -2.421  91.253  1.00 92.01  ? 120 PRO L N   1 
ATOM   2787  C CA  . PRO B 2 125 ? 46.787  -3.028  90.237  1.00 94.63  ? 120 PRO L CA  1 
ATOM   2788  C C   . PRO B 2 125 ? 46.796  -4.512  90.335  1.00 94.91  ? 120 PRO L C   1 
ATOM   2789  O O   . PRO B 2 125 ? 47.445  -5.076  91.182  1.00 93.84  ? 120 PRO L O   1 
ATOM   2790  C CB  . PRO B 2 125 ? 48.156  -2.476  90.555  1.00 92.02  ? 120 PRO L CB  1 
ATOM   2791  C CG  . PRO B 2 125 ? 47.873  -1.175  91.094  1.00 90.36  ? 120 PRO L CG  1 
ATOM   2792  C CD  . PRO B 2 125 ? 46.680  -1.356  91.945  1.00 92.53  ? 120 PRO L CD  1 
ATOM   2793  N N   . SER B 2 126 ? 46.083  -5.154  89.432  1.00 99.71  ? 121 SER L N   1 
ATOM   2794  C CA  . SER B 2 126 ? 46.070  -6.614  89.435  1.00 100.57 ? 121 SER L CA  1 
ATOM   2795  C C   . SER B 2 126 ? 47.483  -7.158  89.624  1.00 101.63 ? 121 SER L C   1 
ATOM   2796  O O   . SER B 2 126 ? 48.475  -6.515  89.260  1.00 102.82 ? 121 SER L O   1 
ATOM   2797  C CB  . SER B 2 126 ? 45.448  -7.167  88.143  1.00 93.46  ? 121 SER L CB  1 
ATOM   2798  O OG  . SER B 2 126 ? 45.474  -8.587  88.119  1.00 88.59  ? 121 SER L OG  1 
ATOM   2799  N N   . SER B 2 127 ? 47.557  -8.343  90.215  1.00 98.00  ? 122 SER L N   1 
ATOM   2800  C CA  . SER B 2 127 ? 48.821  -9.001  90.491  1.00 98.44  ? 122 SER L CA  1 
ATOM   2801  C C   . SER B 2 127 ? 49.708  -9.043  89.251  1.00 101.56 ? 122 SER L C   1 
ATOM   2802  O O   . SER B 2 127 ? 50.872  -8.617  89.271  1.00 96.10  ? 122 SER L O   1 
ATOM   2803  C CB  . SER B 2 127 ? 48.523  -10.424 90.961  1.00 96.16  ? 122 SER L CB  1 
ATOM   2804  O OG  . SER B 2 127 ? 47.321  -10.900 90.371  1.00 89.94  ? 122 SER L OG  1 
ATOM   2805  N N   . GLU B 2 128 ? 49.118  -9.548  88.172  1.00 99.96  ? 123 GLU L N   1 
ATOM   2806  C CA  . GLU B 2 128 ? 49.829  -9.919  86.960  1.00 98.18  ? 123 GLU L CA  1 
ATOM   2807  C C   . GLU B 2 128 ? 50.628  -8.782  86.377  1.00 99.63  ? 123 GLU L C   1 
ATOM   2808  O O   . GLU B 2 128 ? 51.750  -8.976  85.915  1.00 103.68 ? 123 GLU L O   1 
ATOM   2809  C CB  . GLU B 2 128 ? 48.823  -10.397 85.927  1.00 98.05  ? 123 GLU L CB  1 
ATOM   2810  C CG  . GLU B 2 128 ? 47.616  -11.053 86.558  1.00 94.88  ? 123 GLU L CG  1 
ATOM   2811  C CD  . GLU B 2 128 ? 47.027  -12.117 85.668  1.00 101.67 ? 123 GLU L CD  1 
ATOM   2812  O OE1 . GLU B 2 128 ? 46.222  -12.936 86.168  1.00 100.70 ? 123 GLU L OE1 1 
ATOM   2813  O OE2 . GLU B 2 128 ? 47.379  -12.136 84.464  1.00 105.52 ? 123 GLU L OE2 1 
ATOM   2814  N N   . GLN B 2 129 ? 50.026  -7.601  86.382  1.00 97.83  ? 124 GLN L N   1 
ATOM   2815  C CA  . GLN B 2 129 ? 50.633  -6.406  85.812  1.00 103.48 ? 124 GLN L CA  1 
ATOM   2816  C C   . GLN B 2 129 ? 51.920  -6.045  86.565  1.00 107.65 ? 124 GLN L C   1 
ATOM   2817  O O   . GLN B 2 129 ? 52.881  -5.504  85.996  1.00 103.25 ? 124 GLN L O   1 
ATOM   2818  C CB  . GLN B 2 129 ? 49.623  -5.262  85.880  1.00 97.39  ? 124 GLN L CB  1 
ATOM   2819  C CG  . GLN B 2 129 ? 49.891  -4.101  84.960  1.00 89.54  ? 124 GLN L CG  1 
ATOM   2820  C CD  . GLN B 2 129 ? 48.855  -3.029  85.141  1.00 92.71  ? 124 GLN L CD  1 
ATOM   2821  O OE1 . GLN B 2 129 ? 47.787  -3.276  85.708  1.00 92.14  ? 124 GLN L OE1 1 
ATOM   2822  N NE2 . GLN B 2 129 ? 49.156  -1.828  84.670  1.00 94.92  ? 124 GLN L NE2 1 
ATOM   2823  N N   . LEU B 2 130 ? 51.933  -6.363  87.852  1.00 104.85 ? 125 LEU L N   1 
ATOM   2824  C CA  . LEU B 2 130 ? 53.096  -6.108  88.683  1.00 108.48 ? 125 LEU L CA  1 
ATOM   2825  C C   . LEU B 2 130 ? 54.213  -7.100  88.320  1.00 112.14 ? 125 LEU L C   1 
ATOM   2826  O O   . LEU B 2 130 ? 55.406  -6.803  88.479  1.00 110.95 ? 125 LEU L O   1 
ATOM   2827  C CB  . LEU B 2 130 ? 52.690  -6.205  90.156  1.00 112.05 ? 125 LEU L CB  1 
ATOM   2828  C CG  . LEU B 2 130 ? 51.400  -5.425  90.480  1.00 107.73 ? 125 LEU L CG  1 
ATOM   2829  C CD1 . LEU B 2 130 ? 50.565  -6.108  91.572  1.00 105.78 ? 125 LEU L CD1 1 
ATOM   2830  C CD2 . LEU B 2 130 ? 51.688  -3.962  90.834  1.00 98.10  ? 125 LEU L CD2 1 
ATOM   2831  N N   . THR B 2 131 ? 53.806  -8.265  87.808  1.00 110.58 ? 126 THR L N   1 
ATOM   2832  C CA  . THR B 2 131 ? 54.722  -9.308  87.345  1.00 102.83 ? 126 THR L CA  1 
ATOM   2833  C C   . THR B 2 131 ? 55.338  -8.942  86.007  1.00 101.81 ? 126 THR L C   1 
ATOM   2834  O O   . THR B 2 131 ? 56.108  -9.709  85.441  1.00 100.00 ? 126 THR L O   1 
ATOM   2835  C CB  . THR B 2 131 ? 53.988  -10.643 87.152  1.00 94.46  ? 126 THR L CB  1 
ATOM   2836  O OG1 . THR B 2 131 ? 53.283  -10.988 88.350  1.00 84.82  ? 126 THR L OG1 1 
ATOM   2837  C CG2 . THR B 2 131 ? 54.970  -11.744 86.799  1.00 95.64  ? 126 THR L CG2 1 
ATOM   2838  N N   . SER B 2 132 ? 54.995  -7.767  85.496  1.00 107.43 ? 127 SER L N   1 
ATOM   2839  C CA  . SER B 2 132 ? 55.394  -7.403  84.140  1.00 115.46 ? 127 SER L CA  1 
ATOM   2840  C C   . SER B 2 132 ? 56.106  -6.040  84.009  1.00 114.29 ? 127 SER L C   1 
ATOM   2841  O O   . SER B 2 132 ? 56.550  -5.667  82.915  1.00 110.44 ? 127 SER L O   1 
ATOM   2842  C CB  . SER B 2 132 ? 54.200  -7.527  83.174  1.00 115.47 ? 127 SER L CB  1 
ATOM   2843  O OG  . SER B 2 132 ? 53.012  -6.964  83.714  1.00 109.24 ? 127 SER L OG  1 
ATOM   2844  N N   . GLY B 2 133 ? 56.220  -5.308  85.117  1.00 109.34 ? 128 GLY L N   1 
ATOM   2845  C CA  . GLY B 2 133 ? 57.076  -4.130  85.155  1.00 107.19 ? 128 GLY L CA  1 
ATOM   2846  C C   . GLY B 2 133 ? 56.403  -2.776  85.259  1.00 99.94  ? 128 GLY L C   1 
ATOM   2847  O O   . GLY B 2 133 ? 56.974  -1.757  84.865  1.00 93.35  ? 128 GLY L O   1 
ATOM   2848  N N   . GLY B 2 134 ? 55.193  -2.766  85.803  1.00 99.50  ? 129 GLY L N   1 
ATOM   2849  C CA  . GLY B 2 134 ? 54.421  -1.548  85.944  1.00 98.29  ? 129 GLY L CA  1 
ATOM   2850  C C   . GLY B 2 134 ? 52.991  -1.908  86.281  1.00 97.62  ? 129 GLY L C   1 
ATOM   2851  O O   . GLY B 2 134 ? 52.587  -3.050  86.082  1.00 97.83  ? 129 GLY L O   1 
ATOM   2852  N N   . ALA B 2 135 ? 52.227  -0.948  86.797  1.00 94.59  ? 130 ALA L N   1 
ATOM   2853  C CA  . ALA B 2 135 ? 50.828  -1.198  87.133  1.00 94.50  ? 130 ALA L CA  1 
ATOM   2854  C C   . ALA B 2 135 ? 49.969  0.060   87.102  1.00 93.37  ? 130 ALA L C   1 
ATOM   2855  O O   . ALA B 2 135 ? 50.452  1.166   87.340  1.00 91.39  ? 130 ALA L O   1 
ATOM   2856  C CB  . ALA B 2 135 ? 50.719  -1.877  88.475  1.00 98.09  ? 130 ALA L CB  1 
ATOM   2857  N N   . SER B 2 136 ? 48.685  -0.129  86.816  1.00 91.75  ? 131 SER L N   1 
ATOM   2858  C CA  . SER B 2 136 ? 47.768  0.988   86.640  1.00 94.25  ? 131 SER L CA  1 
ATOM   2859  C C   . SER B 2 136 ? 46.461  0.859   87.441  1.00 95.86  ? 131 SER L C   1 
ATOM   2860  O O   . SER B 2 136 ? 45.861  -0.222  87.530  1.00 89.04  ? 131 SER L O   1 
ATOM   2861  C CB  . SER B 2 136 ? 47.476  1.221   85.148  1.00 93.71  ? 131 SER L CB  1 
ATOM   2862  O OG  . SER B 2 136 ? 47.013  0.050   84.498  1.00 92.03  ? 131 SER L OG  1 
ATOM   2863  N N   . VAL B 2 137 ? 46.038  1.988   88.015  1.00 97.00  ? 132 VAL L N   1 
ATOM   2864  C CA  . VAL B 2 137 ? 44.805  2.088   88.793  1.00 94.37  ? 132 VAL L CA  1 
ATOM   2865  C C   . VAL B 2 137 ? 43.666  2.571   87.918  1.00 94.59  ? 132 VAL L C   1 
ATOM   2866  O O   . VAL B 2 137 ? 43.865  3.447   87.081  1.00 95.02  ? 132 VAL L O   1 
ATOM   2867  C CB  . VAL B 2 137 ? 44.923  3.139   89.910  1.00 92.96  ? 132 VAL L CB  1 
ATOM   2868  C CG1 . VAL B 2 137 ? 44.301  2.619   91.197  1.00 92.20  ? 132 VAL L CG1 1 
ATOM   2869  C CG2 . VAL B 2 137 ? 46.367  3.561   90.113  1.00 94.71  ? 132 VAL L CG2 1 
ATOM   2870  N N   . VAL B 2 138 ? 42.468  2.039   88.144  1.00 92.89  ? 133 VAL L N   1 
ATOM   2871  C CA  . VAL B 2 138 ? 41.294  2.424   87.371  1.00 86.99  ? 133 VAL L CA  1 
ATOM   2872  C C   . VAL B 2 138 ? 40.218  3.037   88.257  1.00 90.50  ? 133 VAL L C   1 
ATOM   2873  O O   . VAL B 2 138 ? 39.960  2.551   89.355  1.00 94.56  ? 133 VAL L O   1 
ATOM   2874  C CB  . VAL B 2 138 ? 40.686  1.208   86.652  1.00 92.17  ? 133 VAL L CB  1 
ATOM   2875  C CG1 . VAL B 2 138 ? 41.757  0.474   85.852  1.00 92.63  ? 133 VAL L CG1 1 
ATOM   2876  C CG2 . VAL B 2 138 ? 40.021  0.267   87.653  1.00 90.28  ? 133 VAL L CG2 1 
ATOM   2877  N N   . CYS B 2 139 ? 39.587  4.106   87.785  1.00 89.88  ? 134 CYS L N   1 
ATOM   2878  C CA  . CYS B 2 139 ? 38.427  4.656   88.480  1.00 95.71  ? 134 CYS L CA  1 
ATOM   2879  C C   . CYS B 2 139 ? 37.180  4.439   87.630  1.00 95.72  ? 134 CYS L C   1 
ATOM   2880  O O   . CYS B 2 139 ? 37.232  4.612   86.404  1.00 90.66  ? 134 CYS L O   1 
ATOM   2881  C CB  . CYS B 2 139 ? 38.609  6.151   88.772  1.00 100.94 ? 134 CYS L CB  1 
ATOM   2882  S SG  . CYS B 2 139 ? 38.471  6.627   90.536  1.00 105.70 ? 134 CYS L SG  1 
ATOM   2883  N N   . PHE B 2 140 ? 36.069  4.078   88.284  1.00 92.27  ? 135 PHE L N   1 
ATOM   2884  C CA  . PHE B 2 140 ? 34.810  3.752   87.601  1.00 83.89  ? 135 PHE L CA  1 
ATOM   2885  C C   . PHE B 2 140 ? 33.579  4.594   87.977  1.00 87.47  ? 135 PHE L C   1 
ATOM   2886  O O   . PHE B 2 140 ? 32.875  4.269   88.928  1.00 90.82  ? 135 PHE L O   1 
ATOM   2887  C CB  . PHE B 2 140 ? 34.469  2.287   87.824  1.00 80.27  ? 135 PHE L CB  1 
ATOM   2888  C CG  . PHE B 2 140 ? 35.064  1.374   86.812  1.00 82.37  ? 135 PHE L CG  1 
ATOM   2889  C CD1 . PHE B 2 140 ? 36.439  1.232   86.713  1.00 88.17  ? 135 PHE L CD1 1 
ATOM   2890  C CD2 . PHE B 2 140 ? 34.253  0.648   85.962  1.00 79.35  ? 135 PHE L CD2 1 
ATOM   2891  C CE1 . PHE B 2 140 ? 36.998  0.383   85.777  1.00 85.87  ? 135 PHE L CE1 1 
ATOM   2892  C CE2 . PHE B 2 140 ? 34.804  -0.194  85.024  1.00 82.45  ? 135 PHE L CE2 1 
ATOM   2893  C CZ  . PHE B 2 140 ? 36.176  -0.334  84.934  1.00 85.51  ? 135 PHE L CZ  1 
ATOM   2894  N N   . LEU B 2 141 ? 33.261  5.636   87.224  1.00 86.71  ? 136 LEU L N   1 
ATOM   2895  C CA  . LEU B 2 141 ? 31.999  6.345   87.417  1.00 83.79  ? 136 LEU L CA  1 
ATOM   2896  C C   . LEU B 2 141 ? 30.989  5.612   86.578  1.00 82.16  ? 136 LEU L C   1 
ATOM   2897  O O   . LEU B 2 141 ? 31.354  5.056   85.572  1.00 84.52  ? 136 LEU L O   1 
ATOM   2898  C CB  . LEU B 2 141 ? 32.120  7.777   86.947  1.00 80.74  ? 136 LEU L CB  1 
ATOM   2899  C CG  . LEU B 2 141 ? 33.364  8.483   87.457  1.00 81.05  ? 136 LEU L CG  1 
ATOM   2900  C CD1 . LEU B 2 141 ? 34.506  7.549   87.476  1.00 85.96  ? 136 LEU L CD1 1 
ATOM   2901  C CD2 . LEU B 2 141 ? 33.707  9.669   86.627  1.00 77.37  ? 136 LEU L CD2 1 
ATOM   2902  N N   . ASN B 2 142 ? 29.726  5.571   86.965  1.00 79.86  ? 137 ASN L N   1 
ATOM   2903  C CA  . ASN B 2 142 ? 28.851  4.653   86.254  1.00 86.33  ? 137 ASN L CA  1 
ATOM   2904  C C   . ASN B 2 142 ? 27.411  4.983   85.873  1.00 87.84  ? 137 ASN L C   1 
ATOM   2905  O O   . ASN B 2 142 ? 26.815  4.231   85.144  1.00 92.92  ? 137 ASN L O   1 
ATOM   2906  C CB  . ASN B 2 142 ? 28.907  3.271   86.894  1.00 85.19  ? 137 ASN L CB  1 
ATOM   2907  C CG  . ASN B 2 142 ? 30.035  2.444   86.363  1.00 85.94  ? 137 ASN L CG  1 
ATOM   2908  O OD1 . ASN B 2 142 ? 31.164  2.895   86.327  1.00 80.45  ? 137 ASN L OD1 1 
ATOM   2909  N ND2 . ASN B 2 142 ? 29.740  1.227   85.946  1.00 75.43  ? 137 ASN L ND2 1 
ATOM   2910  N N   . ASN B 2 143 ? 26.849  6.085   86.311  1.00 86.06  ? 138 ASN L N   1 
ATOM   2911  C CA  . ASN B 2 143 ? 25.580  6.504   85.754  1.00 87.54  ? 138 ASN L CA  1 
ATOM   2912  C C   . ASN B 2 143 ? 25.276  7.882   86.269  1.00 88.11  ? 138 ASN L C   1 
ATOM   2913  O O   . ASN B 2 143 ? 25.095  8.043   87.457  1.00 97.63  ? 138 ASN L O   1 
ATOM   2914  C CB  . ASN B 2 143 ? 24.430  5.558   86.120  1.00 83.77  ? 138 ASN L CB  1 
ATOM   2915  C CG  . ASN B 2 143 ? 24.590  4.154   85.558  1.00 84.95  ? 138 ASN L CG  1 
ATOM   2916  O OD1 . ASN B 2 143 ? 25.026  3.272   86.271  1.00 83.37  ? 138 ASN L OD1 1 
ATOM   2917  N ND2 . ASN B 2 143 ? 24.236  3.939   84.292  1.00 86.34  ? 138 ASN L ND2 1 
ATOM   2918  N N   . PHE B 2 144 ? 25.212  8.873   85.388  1.00 80.19  ? 139 PHE L N   1 
ATOM   2919  C CA  . PHE B 2 144 ? 24.922  10.216  85.837  1.00 85.69  ? 139 PHE L CA  1 
ATOM   2920  C C   . PHE B 2 144 ? 24.345  11.178  84.821  1.00 88.80  ? 139 PHE L C   1 
ATOM   2921  O O   . PHE B 2 144 ? 25.068  11.813  84.091  1.00 86.97  ? 139 PHE L O   1 
ATOM   2922  C CB  . PHE B 2 144 ? 26.166  10.816  86.435  1.00 86.84  ? 139 PHE L CB  1 
ATOM   2923  C CG  . PHE B 2 144 ? 27.378  10.638  85.609  1.00 83.15  ? 139 PHE L CG  1 
ATOM   2924  C CD1 . PHE B 2 144 ? 28.074  11.724  85.166  1.00 83.36  ? 139 PHE L CD1 1 
ATOM   2925  C CD2 . PHE B 2 144 ? 27.846  9.397   85.312  1.00 83.48  ? 139 PHE L CD2 1 
ATOM   2926  C CE1 . PHE B 2 144 ? 29.196  11.576  84.430  1.00 81.83  ? 139 PHE L CE1 1 
ATOM   2927  C CE2 . PHE B 2 144 ? 28.978  9.255   84.573  1.00 84.43  ? 139 PHE L CE2 1 
ATOM   2928  C CZ  . PHE B 2 144 ? 29.644  10.348  84.132  1.00 79.59  ? 139 PHE L CZ  1 
ATOM   2929  N N   . TYR B 2 145 ? 23.032  11.324  84.828  1.00 92.22  ? 140 TYR L N   1 
ATOM   2930  C CA  . TYR B 2 145 ? 22.337  12.115  83.798  1.00 97.57  ? 140 TYR L CA  1 
ATOM   2931  C C   . TYR B 2 145 ? 22.926  13.493  83.452  1.00 99.62  ? 140 TYR L C   1 
ATOM   2932  O O   . TYR B 2 145 ? 22.898  13.905  82.285  1.00 102.08 ? 140 TYR L O   1 
ATOM   2933  C CB  . TYR B 2 145 ? 20.843  12.290  84.084  1.00 97.23  ? 140 TYR L CB  1 
ATOM   2934  C CG  . TYR B 2 145 ? 20.235  13.294  83.125  1.00 101.86 ? 140 TYR L CG  1 
ATOM   2935  C CD1 . TYR B 2 145 ? 19.498  12.877  82.034  1.00 101.07 ? 140 TYR L CD1 1 
ATOM   2936  C CD2 . TYR B 2 145 ? 20.450  14.666  83.284  1.00 102.90 ? 140 TYR L CD2 1 
ATOM   2937  C CE1 . TYR B 2 145 ? 18.980  13.790  81.144  1.00 100.19 ? 140 TYR L CE1 1 
ATOM   2938  C CE2 . TYR B 2 145 ? 19.928  15.581  82.393  1.00 103.19 ? 140 TYR L CE2 1 
ATOM   2939  C CZ  . TYR B 2 145 ? 19.186  15.134  81.329  1.00 98.70  ? 140 TYR L CZ  1 
ATOM   2940  O OH  . TYR B 2 145 ? 18.651  16.028  80.439  1.00 97.08  ? 140 TYR L OH  1 
ATOM   2941  N N   . PRO B 2 146 ? 23.387  14.246  84.458  1.00 94.69  ? 141 PRO L N   1 
ATOM   2942  C CA  . PRO B 2 146 ? 24.125  15.443  84.045  1.00 97.51  ? 141 PRO L CA  1 
ATOM   2943  C C   . PRO B 2 146 ? 25.410  14.982  83.367  1.00 101.02 ? 141 PRO L C   1 
ATOM   2944  O O   . PRO B 2 146 ? 26.309  14.445  84.023  1.00 97.88  ? 141 PRO L O   1 
ATOM   2945  C CB  . PRO B 2 146 ? 24.414  16.150  85.363  1.00 100.47 ? 141 PRO L CB  1 
ATOM   2946  C CG  . PRO B 2 146 ? 23.339  15.654  86.290  1.00 102.53 ? 141 PRO L CG  1 
ATOM   2947  C CD  . PRO B 2 146 ? 23.113  14.226  85.902  1.00 97.56  ? 141 PRO L CD  1 
ATOM   2948  N N   . LYS B 2 147 ? 25.475  15.179  82.053  1.00 101.33 ? 142 LYS L N   1 
ATOM   2949  C CA  . LYS B 2 147 ? 26.435  14.477  81.206  1.00 95.63  ? 142 LYS L CA  1 
ATOM   2950  C C   . LYS B 2 147 ? 27.897  14.737  81.547  1.00 95.33  ? 142 LYS L C   1 
ATOM   2951  O O   . LYS B 2 147 ? 28.770  13.991  81.120  1.00 94.44  ? 142 LYS L O   1 
ATOM   2952  C CB  . LYS B 2 147 ? 26.163  14.773  79.720  1.00 98.89  ? 142 LYS L CB  1 
ATOM   2953  C CG  . LYS B 2 147 ? 27.223  14.225  78.742  1.00 102.67 ? 142 LYS L CG  1 
ATOM   2954  C CD  . LYS B 2 147 ? 27.009  14.714  77.300  1.00 97.30  ? 142 LYS L CD  1 
ATOM   2955  C CE  . LYS B 2 147 ? 28.239  14.476  76.426  1.00 90.78  ? 142 LYS L CE  1 
ATOM   2956  N NZ  . LYS B 2 147 ? 28.637  13.037  76.340  1.00 90.30  ? 142 LYS L NZ  1 
ATOM   2957  N N   . ASP B 2 148 ? 28.184  15.772  82.322  1.00 98.26  ? 143 ASP L N   1 
ATOM   2958  C CA  . ASP B 2 148 ? 29.588  16.087  82.551  1.00 103.98 ? 143 ASP L CA  1 
ATOM   2959  C C   . ASP B 2 148 ? 30.077  16.020  84.006  1.00 101.04 ? 143 ASP L C   1 
ATOM   2960  O O   . ASP B 2 148 ? 29.372  16.419  84.940  1.00 94.39  ? 143 ASP L O   1 
ATOM   2961  C CB  . ASP B 2 148 ? 29.949  17.434  81.926  1.00 102.76 ? 143 ASP L CB  1 
ATOM   2962  C CG  . ASP B 2 148 ? 31.445  17.623  81.799  1.00 109.97 ? 143 ASP L CG  1 
ATOM   2963  O OD1 . ASP B 2 148 ? 32.157  16.610  81.597  1.00 111.20 ? 143 ASP L OD1 1 
ATOM   2964  O OD2 . ASP B 2 148 ? 31.908  18.779  81.904  1.00 113.65 ? 143 ASP L OD2 1 
ATOM   2965  N N   . ILE B 2 149 ? 31.293  15.503  84.175  1.00 98.37  ? 144 ILE L N   1 
ATOM   2966  C CA  . ILE B 2 149 ? 31.976  15.530  85.462  1.00 105.92 ? 144 ILE L CA  1 
ATOM   2967  C C   . ILE B 2 149 ? 33.490  15.743  85.288  1.00 110.54 ? 144 ILE L C   1 
ATOM   2968  O O   . ILE B 2 149 ? 34.001  15.710  84.162  1.00 101.73 ? 144 ILE L O   1 
ATOM   2969  C CB  . ILE B 2 149 ? 31.693  14.254  86.322  1.00 103.29 ? 144 ILE L CB  1 
ATOM   2970  C CG1 . ILE B 2 149 ? 32.459  13.041  85.797  1.00 100.58 ? 144 ILE L CG1 1 
ATOM   2971  C CG2 . ILE B 2 149 ? 30.206  13.977  86.435  1.00 99.74  ? 144 ILE L CG2 1 
ATOM   2972  C CD1 . ILE B 2 149 ? 33.790  12.852  86.486  1.00 103.02 ? 144 ILE L CD1 1 
ATOM   2973  N N   . ASN B 2 150 ? 34.188  15.959  86.409  1.00 112.16 ? 145 ASN L N   1 
ATOM   2974  C CA  . ASN B 2 150 ? 35.634  16.196  86.419  1.00 105.10 ? 145 ASN L CA  1 
ATOM   2975  C C   . ASN B 2 150 ? 36.381  15.386  87.496  1.00 106.13 ? 145 ASN L C   1 
ATOM   2976  O O   . ASN B 2 150 ? 35.868  15.185  88.594  1.00 106.52 ? 145 ASN L O   1 
ATOM   2977  C CB  . ASN B 2 150 ? 35.910  17.686  86.594  1.00 106.41 ? 145 ASN L CB  1 
ATOM   2978  C CG  . ASN B 2 150 ? 37.115  18.144  85.810  1.00 117.25 ? 145 ASN L CG  1 
ATOM   2979  O OD1 . ASN B 2 150 ? 37.609  17.425  84.941  1.00 114.68 ? 145 ASN L OD1 1 
ATOM   2980  N ND2 . ASN B 2 150 ? 37.598  19.350  86.107  1.00 124.30 ? 145 ASN L ND2 1 
ATOM   2981  N N   . VAL B 2 151 ? 37.593  14.930  87.178  1.00 104.61 ? 146 VAL L N   1 
ATOM   2982  C CA  . VAL B 2 151 ? 38.345  14.032  88.058  1.00 98.82  ? 146 VAL L CA  1 
ATOM   2983  C C   . VAL B 2 151 ? 39.841  14.327  88.086  1.00 98.46  ? 146 VAL L C   1 
ATOM   2984  O O   . VAL B 2 151 ? 40.447  14.572  87.053  1.00 97.35  ? 146 VAL L O   1 
ATOM   2985  C CB  . VAL B 2 151 ? 38.163  12.563  87.645  1.00 99.83  ? 146 VAL L CB  1 
ATOM   2986  C CG1 . VAL B 2 151 ? 39.387  11.738  88.029  1.00 102.76 ? 146 VAL L CG1 1 
ATOM   2987  C CG2 . VAL B 2 151 ? 36.895  11.984  88.263  1.00 102.13 ? 146 VAL L CG2 1 
ATOM   2988  N N   . LYS B 2 152 ? 40.432  14.284  89.277  1.00 103.72 ? 147 LYS L N   1 
ATOM   2989  C CA  . LYS B 2 152 ? 41.862  14.541  89.446  1.00 99.01  ? 147 LYS L CA  1 
ATOM   2990  C C   . LYS B 2 152 ? 42.582  13.419  90.187  1.00 97.37  ? 147 LYS L C   1 
ATOM   2991  O O   . LYS B 2 152 ? 41.962  12.595  90.861  1.00 97.76  ? 147 LYS L O   1 
ATOM   2992  C CB  . LYS B 2 152 ? 42.105  15.879  90.154  1.00 99.77  ? 147 LYS L CB  1 
ATOM   2993  C CG  . LYS B 2 152 ? 40.987  16.337  91.099  1.00 107.33 ? 147 LYS L CG  1 
ATOM   2994  C CD  . LYS B 2 152 ? 39.707  16.712  90.332  1.00 110.50 ? 147 LYS L CD  1 
ATOM   2995  C CE  . LYS B 2 152 ? 38.810  17.680  91.098  1.00 109.88 ? 147 LYS L CE  1 
ATOM   2996  N NZ  . LYS B 2 152 ? 38.849  19.057  90.513  1.00 104.42 ? 147 LYS L NZ  1 
ATOM   2997  N N   . TRP B 2 153 ? 43.899  13.386  90.041  1.00 98.81  ? 148 TRP L N   1 
ATOM   2998  C CA  . TRP B 2 153 ? 44.718  12.420  90.756  1.00 102.42 ? 148 TRP L CA  1 
ATOM   2999  C C   . TRP B 2 153 ? 45.788  13.111  91.609  1.00 108.03 ? 148 TRP L C   1 
ATOM   3000  O O   . TRP B 2 153 ? 46.648  13.833  91.088  1.00 105.18 ? 148 TRP L O   1 
ATOM   3001  C CB  . TRP B 2 153 ? 45.393  11.436  89.791  1.00 104.96 ? 148 TRP L CB  1 
ATOM   3002  C CG  . TRP B 2 153 ? 44.469  10.504  89.049  1.00 102.59 ? 148 TRP L CG  1 
ATOM   3003  C CD1 . TRP B 2 153 ? 43.903  10.722  87.829  1.00 102.84 ? 148 TRP L CD1 1 
ATOM   3004  C CD2 . TRP B 2 153 ? 44.036  9.197   89.463  1.00 101.42 ? 148 TRP L CD2 1 
ATOM   3005  N NE1 . TRP B 2 153 ? 43.135  9.645   87.463  1.00 102.32 ? 148 TRP L NE1 1 
ATOM   3006  C CE2 . TRP B 2 153 ? 43.196  8.695   88.449  1.00 99.20  ? 148 TRP L CE2 1 
ATOM   3007  C CE3 . TRP B 2 153 ? 44.265  8.410   90.595  1.00 100.54 ? 148 TRP L CE3 1 
ATOM   3008  C CZ2 . TRP B 2 153 ? 42.584  7.443   88.533  1.00 93.85  ? 148 TRP L CZ2 1 
ATOM   3009  C CZ3 . TRP B 2 153 ? 43.656  7.163   90.674  1.00 100.30 ? 148 TRP L CZ3 1 
ATOM   3010  C CH2 . TRP B 2 153 ? 42.824  6.696   89.650  1.00 97.09  ? 148 TRP L CH2 1 
ATOM   3011  N N   . LYS B 2 154 ? 45.714  12.877  92.921  1.00 113.16 ? 149 LYS L N   1 
ATOM   3012  C CA  . LYS B 2 154 ? 46.743  13.283  93.877  1.00 109.08 ? 149 LYS L CA  1 
ATOM   3013  C C   . LYS B 2 154 ? 47.326  12.020  94.503  1.00 108.32 ? 149 LYS L C   1 
ATOM   3014  O O   . LYS B 2 154 ? 46.599  11.265  95.153  1.00 111.34 ? 149 LYS L O   1 
ATOM   3015  C CB  . LYS B 2 154 ? 46.131  14.154  94.975  1.00 102.78 ? 149 LYS L CB  1 
ATOM   3016  C CG  . LYS B 2 154 ? 45.443  15.397  94.461  1.00 105.18 ? 149 LYS L CG  1 
ATOM   3017  C CD  . LYS B 2 154 ? 44.302  15.791  95.362  1.00 107.38 ? 149 LYS L CD  1 
ATOM   3018  C CE  . LYS B 2 154 ? 43.331  14.634  95.515  1.00 113.77 ? 149 LYS L CE  1 
ATOM   3019  N NZ  . LYS B 2 154 ? 42.150  15.000  96.342  1.00 117.35 ? 149 LYS L NZ  1 
ATOM   3020  N N   . ILE B 2 155 ? 48.619  11.767  94.299  1.00 104.57 ? 150 ILE L N   1 
ATOM   3021  C CA  . ILE B 2 155 ? 49.245  10.589  94.908  1.00 110.29 ? 150 ILE L CA  1 
ATOM   3022  C C   . ILE B 2 155 ? 49.160  10.656  96.445  1.00 114.36 ? 150 ILE L C   1 
ATOM   3023  O O   . ILE B 2 155 ? 48.649  9.737   97.093  1.00 112.24 ? 150 ILE L O   1 
ATOM   3024  C CB  . ILE B 2 155 ? 50.699  10.356  94.420  1.00 107.43 ? 150 ILE L CB  1 
ATOM   3025  C CG1 . ILE B 2 155 ? 51.431  11.686  94.246  1.00 110.18 ? 150 ILE L CG1 1 
ATOM   3026  C CG2 . ILE B 2 155 ? 50.709  9.554   93.117  1.00 98.57  ? 150 ILE L CG2 1 
ATOM   3027  C CD1 . ILE B 2 155 ? 52.878  11.546  93.788  1.00 114.37 ? 150 ILE L CD1 1 
ATOM   3028  N N   . ASP B 2 156 ? 49.657  11.747  97.021  1.00 116.95 ? 151 ASP L N   1 
ATOM   3029  C CA  . ASP B 2 156 ? 49.301  12.107  98.390  1.00 111.96 ? 151 ASP L CA  1 
ATOM   3030  C C   . ASP B 2 156 ? 48.363  13.325  98.336  1.00 107.61 ? 151 ASP L C   1 
ATOM   3031  O O   . ASP B 2 156 ? 47.218  13.234  98.788  1.00 104.53 ? 151 ASP L O   1 
ATOM   3032  C CB  . ASP B 2 156 ? 50.545  12.354  99.258  1.00 108.91 ? 151 ASP L CB  1 
ATOM   3033  C CG  . ASP B 2 156 ? 51.601  11.262  99.105  1.00 109.09 ? 151 ASP L CG  1 
ATOM   3034  O OD1 . ASP B 2 156 ? 51.254  10.104  98.776  1.00 107.32 ? 151 ASP L OD1 1 
ATOM   3035  O OD2 . ASP B 2 156 ? 52.790  11.572  99.324  1.00 106.26 ? 151 ASP L OD2 1 
ATOM   3036  N N   . GLY B 2 157 ? 48.832  14.442  97.758  1.00 108.18 ? 152 GLY L N   1 
ATOM   3037  C CA  . GLY B 2 157 ? 50.220  14.578  97.323  1.00 108.41 ? 152 GLY L CA  1 
ATOM   3038  C C   . GLY B 2 157 ? 50.681  15.298  96.050  1.00 108.95 ? 152 GLY L C   1 
ATOM   3039  O O   . GLY B 2 157 ? 51.737  15.939  96.076  1.00 102.08 ? 152 GLY L O   1 
ATOM   3040  N N   . SER B 2 158 ? 49.945  15.189  94.940  1.00 114.20 ? 153 SER L N   1 
ATOM   3041  C CA  . SER B 2 158 ? 50.482  15.650  93.639  1.00 122.94 ? 153 SER L CA  1 
ATOM   3042  C C   . SER B 2 158 ? 49.477  15.972  92.508  1.00 121.89 ? 153 SER L C   1 
ATOM   3043  O O   . SER B 2 158 ? 48.260  15.903  92.685  1.00 119.66 ? 153 SER L O   1 
ATOM   3044  C CB  . SER B 2 158 ? 51.538  14.642  93.121  1.00 130.76 ? 153 SER L CB  1 
ATOM   3045  O OG  . SER B 2 158 ? 52.118  15.013  91.867  1.00 126.12 ? 153 SER L OG  1 
ATOM   3046  N N   . GLU B 2 159 ? 50.022  16.320  91.342  1.00 127.01 ? 154 GLU L N   1 
ATOM   3047  C CA  . GLU B 2 159 ? 49.234  16.624  90.154  1.00 125.26 ? 154 GLU L CA  1 
ATOM   3048  C C   . GLU B 2 159 ? 48.812  15.360  89.416  1.00 124.66 ? 154 GLU L C   1 
ATOM   3049  O O   . GLU B 2 159 ? 49.126  14.237  89.816  1.00 116.43 ? 154 GLU L O   1 
ATOM   3050  C CB  . GLU B 2 159 ? 50.055  17.474  89.175  1.00 129.10 ? 154 GLU L CB  1 
ATOM   3051  C CG  . GLU B 2 159 ? 50.709  18.708  89.763  1.00 136.60 ? 154 GLU L CG  1 
ATOM   3052  C CD  . GLU B 2 159 ? 51.967  19.107  89.009  1.00 137.84 ? 154 GLU L CD  1 
ATOM   3053  O OE1 . GLU B 2 159 ? 52.603  18.211  88.412  1.00 135.81 ? 154 GLU L OE1 1 
ATOM   3054  O OE2 . GLU B 2 159 ? 52.320  20.308  89.019  1.00 131.45 ? 154 GLU L OE2 1 
ATOM   3055  N N   . ARG B 2 160 ? 48.107  15.581  88.315  1.00 128.82 ? 155 ARG L N   1 
ATOM   3056  C CA  . ARG B 2 160 ? 47.782  14.556  87.337  1.00 124.74 ? 155 ARG L CA  1 
ATOM   3057  C C   . ARG B 2 160 ? 48.713  14.751  86.145  1.00 126.49 ? 155 ARG L C   1 
ATOM   3058  O O   . ARG B 2 160 ? 48.837  15.867  85.644  1.00 127.21 ? 155 ARG L O   1 
ATOM   3059  C CB  . ARG B 2 160 ? 46.338  14.760  86.876  1.00 126.20 ? 155 ARG L CB  1 
ATOM   3060  C CG  . ARG B 2 160 ? 46.056  14.323  85.445  1.00 128.53 ? 155 ARG L CG  1 
ATOM   3061  C CD  . ARG B 2 160 ? 45.079  15.260  84.731  1.00 122.68 ? 155 ARG L CD  1 
ATOM   3062  N NE  . ARG B 2 160 ? 44.578  14.664  83.494  1.00 128.03 ? 155 ARG L NE  1 
ATOM   3063  C CZ  . ARG B 2 160 ? 45.349  14.302  82.470  1.00 130.24 ? 155 ARG L CZ  1 
ATOM   3064  N NH1 . ARG B 2 160 ? 44.808  13.761  81.383  1.00 128.78 ? 155 ARG L NH1 1 
ATOM   3065  N NH2 . ARG B 2 160 ? 46.664  14.475  82.533  1.00 126.78 ? 155 ARG L NH2 1 
ATOM   3066  N N   . GLN B 2 161 ? 49.369  13.685  85.688  1.00 125.07 ? 156 GLN L N   1 
ATOM   3067  C CA  . GLN B 2 161 ? 50.193  13.774  84.474  1.00 132.48 ? 156 GLN L CA  1 
ATOM   3068  C C   . GLN B 2 161 ? 49.987  12.640  83.448  1.00 134.22 ? 156 GLN L C   1 
ATOM   3069  O O   . GLN B 2 161 ? 49.144  11.764  83.647  1.00 132.26 ? 156 GLN L O   1 
ATOM   3070  C CB  . GLN B 2 161 ? 51.678  13.959  84.816  1.00 133.45 ? 156 GLN L CB  1 
ATOM   3071  C CG  . GLN B 2 161 ? 52.012  15.353  85.370  1.00 138.30 ? 156 GLN L CG  1 
ATOM   3072  C CD  . GLN B 2 161 ? 51.321  16.495  84.606  1.00 138.00 ? 156 GLN L CD  1 
ATOM   3073  O OE1 . GLN B 2 161 ? 50.739  17.401  85.213  1.00 134.01 ? 156 GLN L OE1 1 
ATOM   3074  N NE2 . GLN B 2 161 ? 51.388  16.452  83.276  1.00 132.62 ? 156 GLN L NE2 1 
ATOM   3075  N N   . ASN B 2 162 ? 50.771  12.673  82.364  1.00 135.18 ? 157 ASN L N   1 
ATOM   3076  C CA  . ASN B 2 162 ? 50.564  11.831  81.166  1.00 131.88 ? 157 ASN L CA  1 
ATOM   3077  C C   . ASN B 2 162 ? 49.914  10.467  81.409  1.00 131.52 ? 157 ASN L C   1 
ATOM   3078  O O   . ASN B 2 162 ? 49.042  10.048  80.641  1.00 129.32 ? 157 ASN L O   1 
ATOM   3079  C CB  . ASN B 2 162 ? 51.881  11.657  80.377  1.00 129.34 ? 157 ASN L CB  1 
ATOM   3080  C CG  . ASN B 2 162 ? 51.679  11.017  78.999  1.00 120.17 ? 157 ASN L CG  1 
ATOM   3081  O OD1 . ASN B 2 162 ? 50.552  10.859  78.523  1.00 113.51 ? 157 ASN L OD1 1 
ATOM   3082  N ND2 . ASN B 2 162 ? 52.785  10.655  78.352  1.00 120.63 ? 157 ASN L ND2 1 
ATOM   3083  N N   . GLY B 2 163 ? 50.340  9.789   82.478  1.00 131.99 ? 158 GLY L N   1 
ATOM   3084  C CA  . GLY B 2 163 ? 49.896  8.439   82.800  1.00 120.69 ? 158 GLY L CA  1 
ATOM   3085  C C   . GLY B 2 163 ? 48.405  8.160   82.732  1.00 113.19 ? 158 GLY L C   1 
ATOM   3086  O O   . GLY B 2 163 ? 48.001  7.034   82.432  1.00 104.28 ? 158 GLY L O   1 
ATOM   3087  N N   . VAL B 2 164 ? 47.588  9.179   83.002  1.00 118.93 ? 159 VAL L N   1 
ATOM   3088  C CA  . VAL B 2 164 ? 46.130  9.018   83.016  1.00 114.92 ? 159 VAL L CA  1 
ATOM   3089  C C   . VAL B 2 164 ? 45.440  9.231   81.649  1.00 111.96 ? 159 VAL L C   1 
ATOM   3090  O O   . VAL B 2 164 ? 45.730  10.189  80.920  1.00 112.08 ? 159 VAL L O   1 
ATOM   3091  C CB  . VAL B 2 164 ? 45.468  9.891   84.105  1.00 109.39 ? 159 VAL L CB  1 
ATOM   3092  C CG1 . VAL B 2 164 ? 46.303  9.855   85.372  1.00 106.82 ? 159 VAL L CG1 1 
ATOM   3093  C CG2 . VAL B 2 164 ? 45.302  11.313  83.622  1.00 113.34 ? 159 VAL L CG2 1 
ATOM   3094  N N   . LEU B 2 165 ? 44.535  8.311   81.318  1.00 100.59 ? 160 LEU L N   1 
ATOM   3095  C CA  . LEU B 2 165 ? 43.797  8.342   80.069  1.00 92.97  ? 160 LEU L CA  1 
ATOM   3096  C C   . LEU B 2 165 ? 42.315  8.206   80.379  1.00 88.71  ? 160 LEU L C   1 
ATOM   3097  O O   . LEU B 2 165 ? 41.926  7.398   81.220  1.00 90.13  ? 160 LEU L O   1 
ATOM   3098  C CB  . LEU B 2 165 ? 44.259  7.200   79.160  1.00 96.27  ? 160 LEU L CB  1 
ATOM   3099  C CG  . LEU B 2 165 ? 45.603  7.358   78.425  1.00 103.25 ? 160 LEU L CG  1 
ATOM   3100  C CD1 . LEU B 2 165 ? 46.783  7.523   79.373  1.00 106.82 ? 160 LEU L CD1 1 
ATOM   3101  C CD2 . LEU B 2 165 ? 45.857  6.191   77.477  1.00 95.80  ? 160 LEU L CD2 1 
ATOM   3102  N N   . ASN B 2 166 ? 41.481  8.991   79.707  1.00 85.51  ? 161 ASN L N   1 
ATOM   3103  C CA  . ASN B 2 166 ? 40.037  8.977   79.991  1.00 87.86  ? 161 ASN L CA  1 
ATOM   3104  C C   . ASN B 2 166 ? 39.135  8.466   78.846  1.00 81.44  ? 161 ASN L C   1 
ATOM   3105  O O   . ASN B 2 166 ? 39.492  8.551   77.668  1.00 82.78  ? 161 ASN L O   1 
ATOM   3106  C CB  . ASN B 2 166 ? 39.568  10.364  80.456  1.00 84.65  ? 161 ASN L CB  1 
ATOM   3107  C CG  . ASN B 2 166 ? 40.196  10.780  81.768  1.00 82.60  ? 161 ASN L CG  1 
ATOM   3108  O OD1 . ASN B 2 166 ? 40.697  9.940   82.512  1.00 86.76  ? 161 ASN L OD1 1 
ATOM   3109  N ND2 . ASN B 2 166 ? 40.170  12.080  82.061  1.00 78.25  ? 161 ASN L ND2 1 
ATOM   3110  N N   . SER B 2 167 ? 37.965  7.943   79.197  1.00 73.52  ? 162 SER L N   1 
ATOM   3111  C CA  . SER B 2 167 ? 37.047  7.436   78.190  1.00 76.76  ? 162 SER L CA  1 
ATOM   3112  C C   . SER B 2 167 ? 35.622  7.342   78.715  1.00 75.17  ? 162 SER L C   1 
ATOM   3113  O O   . SER B 2 167 ? 35.393  6.785   79.789  1.00 73.46  ? 162 SER L O   1 
ATOM   3114  C CB  . SER B 2 167 ? 37.508  6.069   77.695  1.00 79.64  ? 162 SER L CB  1 
ATOM   3115  O OG  . SER B 2 167 ? 36.649  5.594   76.672  1.00 79.23  ? 162 SER L OG  1 
ATOM   3116  N N   . TRP B 2 168 ? 34.671  7.864   77.944  1.00 67.70  ? 163 TRP L N   1 
ATOM   3117  C CA  . TRP B 2 168 ? 33.294  7.950   78.391  1.00 71.12  ? 163 TRP L CA  1 
ATOM   3118  C C   . TRP B 2 168 ? 32.395  7.195   77.443  1.00 67.95  ? 163 TRP L C   1 
ATOM   3119  O O   . TRP B 2 168 ? 32.687  7.117   76.257  1.00 67.15  ? 163 TRP L O   1 
ATOM   3120  C CB  . TRP B 2 168 ? 32.847  9.400   78.437  1.00 74.36  ? 163 TRP L CB  1 
ATOM   3121  C CG  . TRP B 2 168 ? 33.925  10.373  78.823  1.00 77.86  ? 163 TRP L CG  1 
ATOM   3122  C CD1 . TRP B 2 168 ? 33.908  11.232  79.889  1.00 77.64  ? 163 TRP L CD1 1 
ATOM   3123  C CD2 . TRP B 2 168 ? 35.172  10.609  78.137  1.00 80.66  ? 163 TRP L CD2 1 
ATOM   3124  N NE1 . TRP B 2 168 ? 35.067  11.984  79.912  1.00 78.08  ? 163 TRP L NE1 1 
ATOM   3125  C CE2 . TRP B 2 168 ? 35.856  11.622  78.850  1.00 81.26  ? 163 TRP L CE2 1 
ATOM   3126  C CE3 . TRP B 2 168 ? 35.774  10.065  76.990  1.00 77.69  ? 163 TRP L CE3 1 
ATOM   3127  C CZ2 . TRP B 2 168 ? 37.110  12.097  78.458  1.00 80.25  ? 163 TRP L CZ2 1 
ATOM   3128  C CZ3 . TRP B 2 168 ? 37.020  10.536  76.606  1.00 79.33  ? 163 TRP L CZ3 1 
ATOM   3129  C CH2 . TRP B 2 168 ? 37.671  11.546  77.336  1.00 80.70  ? 163 TRP L CH2 1 
ATOM   3130  N N   . THR B 2 169 ? 31.301  6.639   77.955  1.00 67.44  ? 164 THR L N   1 
ATOM   3131  C CA  . THR B 2 169 ? 30.423  5.847   77.102  1.00 74.29  ? 164 THR L CA  1 
ATOM   3132  C C   . THR B 2 169 ? 29.360  6.728   76.508  1.00 77.33  ? 164 THR L C   1 
ATOM   3133  O O   . THR B 2 169 ? 29.260  7.900   76.851  1.00 81.74  ? 164 THR L O   1 
ATOM   3134  C CB  . THR B 2 169 ? 29.736  4.648   77.825  1.00 76.13  ? 164 THR L CB  1 
ATOM   3135  O OG1 . THR B 2 169 ? 28.695  5.106   78.703  1.00 71.46  ? 164 THR L OG1 1 
ATOM   3136  C CG2 . THR B 2 169 ? 30.752  3.823   78.589  1.00 73.98  ? 164 THR L CG2 1 
ATOM   3137  N N   . ASP B 2 170 ? 28.572  6.151   75.610  1.00 76.78  ? 165 ASP L N   1 
ATOM   3138  C CA  . ASP B 2 170 ? 27.488  6.863   74.954  1.00 77.89  ? 165 ASP L CA  1 
ATOM   3139  C C   . ASP B 2 170 ? 26.197  6.742   75.768  1.00 75.36  ? 165 ASP L C   1 
ATOM   3140  O O   . ASP B 2 170 ? 26.069  5.842   76.591  1.00 73.49  ? 165 ASP L O   1 
ATOM   3141  C CB  . ASP B 2 170 ? 27.305  6.365   73.504  1.00 90.91  ? 165 ASP L CB  1 
ATOM   3142  C CG  . ASP B 2 170 ? 27.827  4.916   73.269  1.00 91.65  ? 165 ASP L CG  1 
ATOM   3143  O OD1 . ASP B 2 170 ? 27.728  4.448   72.105  1.00 83.15  ? 165 ASP L OD1 1 
ATOM   3144  O OD2 . ASP B 2 170 ? 28.334  4.250   74.212  1.00 86.57  ? 165 ASP L OD2 1 
ATOM   3145  N N   . GLN B 2 171 ? 25.248  7.650   75.549  1.00 79.39  ? 166 GLN L N   1 
ATOM   3146  C CA  . GLN B 2 171 ? 24.052  7.705   76.393  1.00 82.15  ? 166 GLN L CA  1 
ATOM   3147  C C   . GLN B 2 171 ? 23.389  6.342   76.426  1.00 81.70  ? 166 GLN L C   1 
ATOM   3148  O O   . GLN B 2 171 ? 22.950  5.853   75.395  1.00 84.79  ? 166 GLN L O   1 
ATOM   3149  C CB  . GLN B 2 171 ? 23.057  8.768   75.907  1.00 79.79  ? 166 GLN L CB  1 
ATOM   3150  C CG  . GLN B 2 171 ? 22.092  9.244   76.996  1.00 83.99  ? 166 GLN L CG  1 
ATOM   3151  C CD  . GLN B 2 171 ? 20.846  9.945   76.458  1.00 87.82  ? 166 GLN L CD  1 
ATOM   3152  O OE1 . GLN B 2 171 ? 20.589  11.108  76.773  1.00 86.50  ? 166 GLN L OE1 1 
ATOM   3153  N NE2 . GLN B 2 171 ? 20.059  9.233   75.654  1.00 87.85  ? 166 GLN L NE2 1 
ATOM   3154  N N   . ASP B 2 172 ? 23.321  5.729   77.605  1.00 81.59  ? 167 ASP L N   1 
ATOM   3155  C CA  . ASP B 2 172 ? 22.838  4.356   77.714  1.00 87.17  ? 167 ASP L CA  1 
ATOM   3156  C C   . ASP B 2 172 ? 21.570  4.096   76.888  1.00 91.58  ? 167 ASP L C   1 
ATOM   3157  O O   . ASP B 2 172 ? 20.990  5.005   76.297  1.00 92.02  ? 167 ASP L O   1 
ATOM   3158  C CB  . ASP B 2 172 ? 22.646  3.949   79.178  1.00 90.00  ? 167 ASP L CB  1 
ATOM   3159  C CG  . ASP B 2 172 ? 23.231  2.565   79.490  1.00 98.02  ? 167 ASP L CG  1 
ATOM   3160  O OD1 . ASP B 2 172 ? 24.383  2.270   79.086  1.00 90.94  ? 167 ASP L OD1 1 
ATOM   3161  O OD2 . ASP B 2 172 ? 22.531  1.770   80.154  1.00 102.84 ? 167 ASP L OD2 1 
ATOM   3162  N N   . SER B 2 173 ? 21.155  2.840   76.834  1.00 93.07  ? 168 SER L N   1 
ATOM   3163  C CA  . SER B 2 173 ? 20.023  2.460   76.015  1.00 91.10  ? 168 SER L CA  1 
ATOM   3164  C C   . SER B 2 173 ? 18.762  2.473   76.868  1.00 92.31  ? 168 SER L C   1 
ATOM   3165  O O   . SER B 2 173 ? 17.688  2.851   76.402  1.00 95.86  ? 168 SER L O   1 
ATOM   3166  C CB  . SER B 2 173 ? 20.278  1.079   75.422  1.00 90.90  ? 168 SER L CB  1 
ATOM   3167  O OG  . SER B 2 173 ? 21.664  0.925   75.140  1.00 83.76  ? 168 SER L OG  1 
ATOM   3168  N N   . LYS B 2 174 ? 18.898  2.076   78.127  1.00 87.92  ? 169 LYS L N   1 
ATOM   3169  C CA  . LYS B 2 174 ? 17.769  2.121   79.042  1.00 91.19  ? 169 LYS L CA  1 
ATOM   3170  C C   . LYS B 2 174 ? 17.899  3.290   80.027  1.00 94.91  ? 169 LYS L C   1 
ATOM   3171  O O   . LYS B 2 174 ? 17.062  4.195   80.052  1.00 89.28  ? 169 LYS L O   1 
ATOM   3172  C CB  . LYS B 2 174 ? 17.621  0.785   79.768  1.00 90.24  ? 169 LYS L CB  1 
ATOM   3173  C CG  . LYS B 2 174 ? 17.361  -0.398  78.830  1.00 90.80  ? 169 LYS L CG  1 
ATOM   3174  C CD  . LYS B 2 174 ? 16.784  -1.610  79.581  1.00 94.62  ? 169 LYS L CD  1 
ATOM   3175  C CE  . LYS B 2 174 ? 17.611  -1.975  80.821  1.00 84.19  ? 169 LYS L CE  1 
ATOM   3176  N NZ  . LYS B 2 174 ? 16.989  -3.079  81.599  1.00 65.14  ? 169 LYS L NZ  1 
ATOM   3177  N N   . ASP B 2 175 ? 18.971  3.271   80.815  1.00 101.62 ? 170 ASP L N   1 
ATOM   3178  C CA  . ASP B 2 175 ? 19.278  4.323   81.795  1.00 96.38  ? 170 ASP L CA  1 
ATOM   3179  C C   . ASP B 2 175 ? 19.166  5.734   81.270  1.00 91.76  ? 170 ASP L C   1 
ATOM   3180  O O   . ASP B 2 175 ? 18.747  6.638   81.986  1.00 91.56  ? 170 ASP L O   1 
ATOM   3181  C CB  . ASP B 2 175 ? 20.713  4.174   82.284  1.00 92.43  ? 170 ASP L CB  1 
ATOM   3182  C CG  . ASP B 2 175 ? 20.980  2.832   82.888  1.00 102.11 ? 170 ASP L CG  1 
ATOM   3183  O OD1 . ASP B 2 175 ? 19.994  2.117   83.176  1.00 110.10 ? 170 ASP L OD1 1 
ATOM   3184  O OD2 . ASP B 2 175 ? 22.172  2.496   83.074  1.00 102.87 ? 170 ASP L OD2 1 
ATOM   3185  N N   . SER B 2 176 ? 19.599  5.931   80.035  1.00 88.23  ? 171 SER L N   1 
ATOM   3186  C CA  . SER B 2 176 ? 19.756  7.275   79.534  1.00 87.92  ? 171 SER L CA  1 
ATOM   3187  C C   . SER B 2 176 ? 20.609  8.015   80.545  1.00 86.38  ? 171 SER L C   1 
ATOM   3188  O O   . SER B 2 176 ? 20.493  9.225   80.711  1.00 88.39  ? 171 SER L O   1 
ATOM   3189  C CB  . SER B 2 176 ? 18.400  7.955   79.364  1.00 92.25  ? 171 SER L CB  1 
ATOM   3190  O OG  . SER B 2 176 ? 17.618  7.288   78.384  1.00 93.96  ? 171 SER L OG  1 
ATOM   3191  N N   . THR B 2 177 ? 21.452  7.255   81.236  1.00 85.75  ? 172 THR L N   1 
ATOM   3192  C CA  . THR B 2 177 ? 22.482  7.809   82.099  1.00 85.52  ? 172 THR L CA  1 
ATOM   3193  C C   . THR B 2 177 ? 23.786  7.815   81.328  1.00 80.33  ? 172 THR L C   1 
ATOM   3194  O O   . THR B 2 177 ? 23.778  7.828   80.111  1.00 81.71  ? 172 THR L O   1 
ATOM   3195  C CB  . THR B 2 177 ? 22.669  6.944   83.331  1.00 88.50  ? 172 THR L CB  1 
ATOM   3196  O OG1 . THR B 2 177 ? 23.267  5.701   82.948  1.00 88.17  ? 172 THR L OG1 1 
ATOM   3197  C CG2 . THR B 2 177 ? 21.327  6.681   83.964  1.00 91.43  ? 172 THR L CG2 1 
ATOM   3198  N N   . TYR B 2 178 ? 24.911  7.790   82.024  1.00 80.30  ? 173 TYR L N   1 
ATOM   3199  C CA  . TYR B 2 178 ? 26.195  7.770   81.333  1.00 80.98  ? 173 TYR L CA  1 
ATOM   3200  C C   . TYR B 2 178 ? 27.179  6.780   81.960  1.00 82.95  ? 173 TYR L C   1 
ATOM   3201  O O   . TYR B 2 178 ? 26.789  5.646   82.245  1.00 82.81  ? 173 TYR L O   1 
ATOM   3202  C CB  . TYR B 2 178 ? 26.778  9.179   81.220  1.00 78.30  ? 173 TYR L CB  1 
ATOM   3203  C CG  . TYR B 2 178 ? 26.078  10.027  80.179  1.00 85.58  ? 173 TYR L CG  1 
ATOM   3204  C CD1 . TYR B 2 178 ? 26.725  10.392  79.010  1.00 86.68  ? 173 TYR L CD1 1 
ATOM   3205  C CD2 . TYR B 2 178 ? 24.761  10.446  80.352  1.00 88.99  ? 173 TYR L CD2 1 
ATOM   3206  C CE1 . TYR B 2 178 ? 26.092  11.160  78.048  1.00 83.63  ? 173 TYR L CE1 1 
ATOM   3207  C CE2 . TYR B 2 178 ? 24.117  11.213  79.388  1.00 83.91  ? 173 TYR L CE2 1 
ATOM   3208  C CZ  . TYR B 2 178 ? 24.796  11.564  78.242  1.00 82.07  ? 173 TYR L CZ  1 
ATOM   3209  O OH  . TYR B 2 178 ? 24.196  12.323  77.274  1.00 86.39  ? 173 TYR L OH  1 
ATOM   3210  N N   . SER B 2 179 ? 28.432  7.209   82.164  1.00 81.18  ? 174 SER L N   1 
ATOM   3211  C CA  . SER B 2 179 ? 29.530  6.337   82.631  1.00 80.18  ? 174 SER L CA  1 
ATOM   3212  C C   . SER B 2 179 ? 30.898  6.797   82.079  1.00 78.33  ? 174 SER L C   1 
ATOM   3213  O O   . SER B 2 179 ? 30.959  7.418   81.009  1.00 75.73  ? 174 SER L O   1 
ATOM   3214  C CB  . SER B 2 179 ? 29.270  4.875   82.231  1.00 81.43  ? 174 SER L CB  1 
ATOM   3215  O OG  . SER B 2 179 ? 30.136  3.968   82.885  1.00 75.95  ? 174 SER L OG  1 
ATOM   3216  N N   . MET B 2 180 ? 31.982  6.478   82.793  1.00 73.72  ? 175 MET L N   1 
ATOM   3217  C CA  . MET B 2 180 ? 33.321  6.934   82.414  1.00 74.83  ? 175 MET L CA  1 
ATOM   3218  C C   . MET B 2 180 ? 34.439  6.011   82.901  1.00 75.77  ? 175 MET L C   1 
ATOM   3219  O O   . MET B 2 180 ? 34.229  5.210   83.783  1.00 79.21  ? 175 MET L O   1 
ATOM   3220  C CB  . MET B 2 180 ? 33.574  8.339   82.970  1.00 77.43  ? 175 MET L CB  1 
ATOM   3221  C CG  . MET B 2 180 ? 34.947  8.898   82.592  1.00 79.09  ? 175 MET L CG  1 
ATOM   3222  S SD  . MET B 2 180 ? 35.550  10.257  83.617  1.00 85.75  ? 175 MET L SD  1 
ATOM   3223  C CE  . MET B 2 180 ? 37.293  10.237  83.209  1.00 80.08  ? 175 MET L CE  1 
ATOM   3224  N N   . SER B 2 181 ? 35.632  6.130   82.333  1.00 74.82  ? 176 SER L N   1 
ATOM   3225  C CA  . SER B 2 181 ? 36.799  5.466   82.899  1.00 75.26  ? 176 SER L CA  1 
ATOM   3226  C C   . SER B 2 181 ? 38.014  6.368   82.830  1.00 81.65  ? 176 SER L C   1 
ATOM   3227  O O   . SER B 2 181 ? 38.196  7.103   81.864  1.00 81.29  ? 176 SER L O   1 
ATOM   3228  C CB  . SER B 2 181 ? 37.134  4.186   82.152  1.00 81.88  ? 176 SER L CB  1 
ATOM   3229  O OG  . SER B 2 181 ? 38.449  4.286   81.608  1.00 86.15  ? 176 SER L OG  1 
ATOM   3230  N N   . SER B 2 182 ? 38.862  6.275   83.848  1.00 89.15  ? 177 SER L N   1 
ATOM   3231  C CA  . SER B 2 182 ? 40.033  7.135   83.981  1.00 88.45  ? 177 SER L CA  1 
ATOM   3232  C C   . SER B 2 182 ? 41.176  6.308   84.547  1.00 85.05  ? 177 SER L C   1 
ATOM   3233  O O   . SER B 2 182 ? 41.109  5.884   85.694  1.00 86.85  ? 177 SER L O   1 
ATOM   3234  C CB  . SER B 2 182 ? 39.710  8.292   84.934  1.00 88.76  ? 177 SER L CB  1 
ATOM   3235  O OG  . SER B 2 182 ? 40.818  9.156   85.103  1.00 88.92  ? 177 SER L OG  1 
ATOM   3236  N N   . THR B 2 183 ? 42.214  6.067   83.749  1.00 87.81  ? 178 THR L N   1 
ATOM   3237  C CA  . THR B 2 183 ? 43.301  5.179   84.174  1.00 90.50  ? 178 THR L CA  1 
ATOM   3238  C C   . THR B 2 183 ? 44.613  5.884   84.486  1.00 98.82  ? 178 THR L C   1 
ATOM   3239  O O   . THR B 2 183 ? 45.218  6.504   83.614  1.00 99.17  ? 178 THR L O   1 
ATOM   3240  C CB  . THR B 2 183 ? 43.593  4.057   83.151  1.00 88.25  ? 178 THR L CB  1 
ATOM   3241  O OG1 . THR B 2 183 ? 42.919  2.858   83.552  1.00 82.90  ? 178 THR L OG1 1 
ATOM   3242  C CG2 . THR B 2 183 ? 45.096  3.770   83.084  1.00 90.28  ? 178 THR L CG2 1 
ATOM   3243  N N   . LEU B 2 184 ? 45.047  5.756   85.738  1.00 101.05 ? 179 LEU L N   1 
ATOM   3244  C CA  . LEU B 2 184 ? 46.344  6.240   86.180  1.00 100.60 ? 179 LEU L CA  1 
ATOM   3245  C C   . LEU B 2 184 ? 47.345  5.100   86.140  1.00 100.33 ? 179 LEU L C   1 
ATOM   3246  O O   . LEU B 2 184 ? 47.374  4.252   87.028  1.00 99.10  ? 179 LEU L O   1 
ATOM   3247  C CB  . LEU B 2 184 ? 46.248  6.794   87.599  1.00 103.16 ? 179 LEU L CB  1 
ATOM   3248  C CG  . LEU B 2 184 ? 47.566  7.221   88.246  1.00 102.59 ? 179 LEU L CG  1 
ATOM   3249  C CD1 . LEU B 2 184 ? 48.513  7.879   87.236  1.00 106.60 ? 179 LEU L CD1 1 
ATOM   3250  C CD2 . LEU B 2 184 ? 47.277  8.146   89.404  1.00 94.89  ? 179 LEU L CD2 1 
ATOM   3251  N N   . THR B 2 185 ? 48.163  5.093   85.097  1.00 104.53 ? 180 THR L N   1 
ATOM   3252  C CA  . THR B 2 185 ? 49.124  4.028   84.871  1.00 103.38 ? 180 THR L CA  1 
ATOM   3253  C C   . THR B 2 185 ? 50.535  4.532   85.212  1.00 105.21 ? 180 THR L C   1 
ATOM   3254  O O   . THR B 2 185 ? 50.872  5.683   84.929  1.00 106.12 ? 180 THR L O   1 
ATOM   3255  C CB  . THR B 2 185 ? 48.992  3.469   83.406  1.00 102.27 ? 180 THR L CB  1 
ATOM   3256  O OG1 . THR B 2 185 ? 49.919  2.401   83.191  1.00 100.89 ? 180 THR L OG1 1 
ATOM   3257  C CG2 . THR B 2 185 ? 49.217  4.554   82.364  1.00 104.32 ? 180 THR L CG2 1 
ATOM   3258  N N   . LEU B 2 186 ? 51.340  3.683   85.851  1.00 105.92 ? 181 LEU L N   1 
ATOM   3259  C CA  . LEU B 2 186 ? 52.695  4.057   86.266  1.00 103.82 ? 181 LEU L CA  1 
ATOM   3260  C C   . LEU B 2 186 ? 53.559  2.812   86.486  1.00 102.63 ? 181 LEU L C   1 
ATOM   3261  O O   . LEU B 2 186 ? 53.047  1.773   86.906  1.00 105.74 ? 181 LEU L O   1 
ATOM   3262  C CB  . LEU B 2 186 ? 52.628  4.892   87.544  1.00 99.14  ? 181 LEU L CB  1 
ATOM   3263  C CG  . LEU B 2 186 ? 53.709  5.957   87.684  1.00 103.60 ? 181 LEU L CG  1 
ATOM   3264  C CD1 . LEU B 2 186 ? 53.336  6.970   88.752  1.00 103.98 ? 181 LEU L CD1 1 
ATOM   3265  C CD2 . LEU B 2 186 ? 55.053  5.322   87.978  1.00 107.78 ? 181 LEU L CD2 1 
ATOM   3266  N N   . THR B 2 187 ? 54.858  2.912   86.209  1.00 97.96  ? 182 THR L N   1 
ATOM   3267  C CA  . THR B 2 187 ? 55.775  1.776   86.374  1.00 101.62 ? 182 THR L CA  1 
ATOM   3268  C C   . THR B 2 187 ? 55.755  1.166   87.786  1.00 101.92 ? 182 THR L C   1 
ATOM   3269  O O   . THR B 2 187 ? 55.162  1.737   88.692  1.00 105.99 ? 182 THR L O   1 
ATOM   3270  C CB  . THR B 2 187 ? 57.203  2.171   85.998  1.00 103.10 ? 182 THR L CB  1 
ATOM   3271  O OG1 . THR B 2 187 ? 58.129  1.447   86.812  1.00 106.87 ? 182 THR L OG1 1 
ATOM   3272  C CG2 . THR B 2 187 ? 57.400  3.646   86.224  1.00 105.56 ? 182 THR L CG2 1 
ATOM   3273  N N   . LYS B 2 188 ? 56.400  0.013   87.970  1.00 101.79 ? 183 LYS L N   1 
ATOM   3274  C CA  . LYS B 2 188 ? 56.305  -0.743  89.235  1.00 108.20 ? 183 LYS L CA  1 
ATOM   3275  C C   . LYS B 2 188 ? 56.915  -0.069  90.463  1.00 112.44 ? 183 LYS L C   1 
ATOM   3276  O O   . LYS B 2 188 ? 56.220  0.166   91.456  1.00 111.27 ? 183 LYS L O   1 
ATOM   3277  C CB  . LYS B 2 188 ? 56.885  -2.163  89.107  1.00 107.06 ? 183 LYS L CB  1 
ATOM   3278  C CG  . LYS B 2 188 ? 58.398  -2.240  88.926  1.00 102.81 ? 183 LYS L CG  1 
ATOM   3279  C CD  . LYS B 2 188 ? 58.803  -1.568  87.633  1.00 103.21 ? 183 LYS L CD  1 
ATOM   3280  C CE  . LYS B 2 188 ? 60.047  -2.176  87.044  1.00 99.60  ? 183 LYS L CE  1 
ATOM   3281  N NZ  . LYS B 2 188 ? 60.079  -1.916  85.583  1.00 97.11  ? 183 LYS L NZ  1 
ATOM   3282  N N   . ASP B 2 189 ? 58.212  0.222   90.399  1.00 110.25 ? 184 ASP L N   1 
ATOM   3283  C CA  . ASP B 2 189 ? 58.931  0.754   91.552  1.00 110.64 ? 184 ASP L CA  1 
ATOM   3284  C C   . ASP B 2 189 ? 58.452  2.140   91.987  1.00 109.28 ? 184 ASP L C   1 
ATOM   3285  O O   . ASP B 2 189 ? 58.495  2.459   93.174  1.00 111.17 ? 184 ASP L O   1 
ATOM   3286  C CB  . ASP B 2 189 ? 60.444  0.746   91.307  1.00 113.92 ? 184 ASP L CB  1 
ATOM   3287  C CG  . ASP B 2 189 ? 60.820  1.328   89.961  1.00 113.02 ? 184 ASP L CG  1 
ATOM   3288  O OD1 . ASP B 2 189 ? 61.871  0.920   89.418  1.00 109.65 ? 184 ASP L OD1 1 
ATOM   3289  O OD2 . ASP B 2 189 ? 60.065  2.185   89.447  1.00 110.19 ? 184 ASP L OD2 1 
ATOM   3290  N N   . GLU B 2 190 ? 58.000  2.956   91.036  1.00 109.40 ? 185 GLU L N   1 
ATOM   3291  C CA  . GLU B 2 190 ? 57.393  4.246   91.366  1.00 111.46 ? 185 GLU L CA  1 
ATOM   3292  C C   . GLU B 2 190 ? 55.937  4.053   91.781  1.00 104.72 ? 185 GLU L C   1 
ATOM   3293  O O   . GLU B 2 190 ? 55.342  4.908   92.436  1.00 100.72 ? 185 GLU L O   1 
ATOM   3294  C CB  . GLU B 2 190 ? 57.482  5.210   90.189  1.00 110.18 ? 185 GLU L CB  1 
ATOM   3295  C CG  . GLU B 2 190 ? 58.870  5.331   89.620  1.00 117.61 ? 185 GLU L CG  1 
ATOM   3296  C CD  . GLU B 2 190 ? 58.850  5.680   88.149  1.00 125.49 ? 185 GLU L CD  1 
ATOM   3297  O OE1 . GLU B 2 190 ? 59.812  5.309   87.432  1.00 123.87 ? 185 GLU L OE1 1 
ATOM   3298  O OE2 . GLU B 2 190 ? 57.860  6.314   87.712  1.00 122.24 ? 185 GLU L OE2 1 
ATOM   3299  N N   . TYR B 2 191 ? 55.362  2.924   91.395  1.00 103.34 ? 186 TYR L N   1 
ATOM   3300  C CA  . TYR B 2 191 ? 54.066  2.564   91.926  1.00 106.30 ? 186 TYR L CA  1 
ATOM   3301  C C   . TYR B 2 191 ? 54.276  2.173   93.365  1.00 107.71 ? 186 TYR L C   1 
ATOM   3302  O O   . TYR B 2 191 ? 53.518  2.579   94.245  1.00 110.67 ? 186 TYR L O   1 
ATOM   3303  C CB  . TYR B 2 191 ? 53.449  1.380   91.190  1.00 106.77 ? 186 TYR L CB  1 
ATOM   3304  C CG  . TYR B 2 191 ? 52.440  0.654   92.053  1.00 103.38 ? 186 TYR L CG  1 
ATOM   3305  C CD1 . TYR B 2 191 ? 51.361  1.330   92.607  1.00 95.08  ? 186 TYR L CD1 1 
ATOM   3306  C CD2 . TYR B 2 191 ? 52.574  -0.695  92.330  1.00 105.72 ? 186 TYR L CD2 1 
ATOM   3307  C CE1 . TYR B 2 191 ? 50.447  0.684   93.401  1.00 91.27  ? 186 TYR L CE1 1 
ATOM   3308  C CE2 . TYR B 2 191 ? 51.655  -1.349  93.128  1.00 100.78 ? 186 TYR L CE2 1 
ATOM   3309  C CZ  . TYR B 2 191 ? 50.596  -0.653  93.657  1.00 92.95  ? 186 TYR L CZ  1 
ATOM   3310  O OH  . TYR B 2 191 ? 49.680  -1.306  94.448  1.00 95.11  ? 186 TYR L OH  1 
ATOM   3311  N N   . GLU B 2 192 ? 55.311  1.369   93.594  1.00 106.78 ? 187 GLU L N   1 
ATOM   3312  C CA  . GLU B 2 192 ? 55.644  0.881   94.934  1.00 111.21 ? 187 GLU L CA  1 
ATOM   3313  C C   . GLU B 2 192 ? 55.903  2.012   95.948  1.00 111.50 ? 187 GLU L C   1 
ATOM   3314  O O   . GLU B 2 192 ? 55.317  2.036   97.036  1.00 106.42 ? 187 GLU L O   1 
ATOM   3315  C CB  . GLU B 2 192 ? 56.846  -0.072  94.873  1.00 109.62 ? 187 GLU L CB  1 
ATOM   3316  C CG  . GLU B 2 192 ? 56.602  -1.327  94.044  1.00 112.91 ? 187 GLU L CG  1 
ATOM   3317  C CD  . GLU B 2 192 ? 57.298  -2.558  94.602  1.00 110.21 ? 187 GLU L CD  1 
ATOM   3318  O OE1 . GLU B 2 192 ? 56.584  -3.534  94.924  1.00 99.77  ? 187 GLU L OE1 1 
ATOM   3319  O OE2 . GLU B 2 192 ? 58.548  -2.549  94.713  1.00 111.21 ? 187 GLU L OE2 1 
ATOM   3320  N N   . ARG B 2 193 ? 56.766  2.954   95.573  1.00 108.03 ? 188 ARG L N   1 
ATOM   3321  C CA  . ARG B 2 193 ? 57.176  4.025   96.472  1.00 97.68  ? 188 ARG L CA  1 
ATOM   3322  C C   . ARG B 2 193 ? 56.056  4.992   96.872  1.00 103.17 ? 188 ARG L C   1 
ATOM   3323  O O   . ARG B 2 193 ? 56.265  6.205   96.896  1.00 101.10 ? 188 ARG L O   1 
ATOM   3324  C CB  . ARG B 2 193 ? 58.351  4.796   95.883  1.00 92.70  ? 188 ARG L CB  1 
ATOM   3325  C CG  . ARG B 2 193 ? 57.955  5.996   95.078  1.00 99.35  ? 188 ARG L CG  1 
ATOM   3326  C CD  . ARG B 2 193 ? 59.163  6.838   94.790  1.00 108.90 ? 188 ARG L CD  1 
ATOM   3327  N NE  . ARG B 2 193 ? 60.141  6.077   94.023  1.00 111.78 ? 188 ARG L NE  1 
ATOM   3328  C CZ  . ARG B 2 193 ? 60.988  6.615   93.154  1.00 113.47 ? 188 ARG L CZ  1 
ATOM   3329  N NH1 . ARG B 2 193 ? 60.981  7.925   92.939  1.00 112.69 ? 188 ARG L NH1 1 
ATOM   3330  N NH2 . ARG B 2 193 ? 61.839  5.842   92.497  1.00 114.87 ? 188 ARG L NH2 1 
ATOM   3331  N N   . HIS B 2 194 ? 54.882  4.451   97.201  1.00 103.97 ? 189 HIS L N   1 
ATOM   3332  C CA  . HIS B 2 194 ? 53.816  5.217   97.853  1.00 102.92 ? 189 HIS L CA  1 
ATOM   3333  C C   . HIS B 2 194 ? 52.757  4.328   98.483  1.00 104.82 ? 189 HIS L C   1 
ATOM   3334  O O   . HIS B 2 194 ? 52.762  3.111   98.309  1.00 102.83 ? 189 HIS L O   1 
ATOM   3335  C CB  . HIS B 2 194 ? 53.150  6.199   96.898  1.00 104.43 ? 189 HIS L CB  1 
ATOM   3336  C CG  . HIS B 2 194 ? 53.963  7.425   96.630  1.00 104.07 ? 189 HIS L CG  1 
ATOM   3337  N ND1 . HIS B 2 194 ? 54.095  8.444   97.546  1.00 102.42 ? 189 HIS L ND1 1 
ATOM   3338  C CD2 . HIS B 2 194 ? 54.682  7.794   95.543  1.00 101.00 ? 189 HIS L CD2 1 
ATOM   3339  C CE1 . HIS B 2 194 ? 54.867  9.390   97.037  1.00 101.50 ? 189 HIS L CE1 1 
ATOM   3340  N NE2 . HIS B 2 194 ? 55.236  9.019   95.824  1.00 101.34 ? 189 HIS L NE2 1 
ATOM   3341  N N   . ASN B 2 195 ? 51.838  4.966   99.197  1.00 107.96 ? 190 ASN L N   1 
ATOM   3342  C CA  . ASN B 2 195 ? 50.884  4.270   100.049 1.00 115.19 ? 190 ASN L CA  1 
ATOM   3343  C C   . ASN B 2 195 ? 49.465  4.683   99.742  1.00 118.04 ? 190 ASN L C   1 
ATOM   3344  O O   . ASN B 2 195 ? 48.585  3.841   99.623  1.00 119.69 ? 190 ASN L O   1 
ATOM   3345  C CB  . ASN B 2 195 ? 51.169  4.597   101.514 1.00 123.82 ? 190 ASN L CB  1 
ATOM   3346  C CG  . ASN B 2 195 ? 51.213  6.104   101.779 1.00 124.90 ? 190 ASN L CG  1 
ATOM   3347  O OD1 . ASN B 2 195 ? 51.244  6.915   100.842 1.00 123.47 ? 190 ASN L OD1 1 
ATOM   3348  N ND2 . ASN B 2 195 ? 51.227  6.481   103.057 1.00 114.04 ? 190 ASN L ND2 1 
ATOM   3349  N N   . SER B 2 196 ? 49.251  5.992   99.638  1.00 118.73 ? 191 SER L N   1 
ATOM   3350  C CA  . SER B 2 196 ? 47.949  6.556   99.299  1.00 117.18 ? 191 SER L CA  1 
ATOM   3351  C C   . SER B 2 196 ? 47.798  6.776   97.797  1.00 112.11 ? 191 SER L C   1 
ATOM   3352  O O   . SER B 2 196 ? 48.746  7.153   97.115  1.00 111.84 ? 191 SER L O   1 
ATOM   3353  C CB  . SER B 2 196 ? 47.745  7.896   100.006 1.00 117.25 ? 191 SER L CB  1 
ATOM   3354  O OG  . SER B 2 196 ? 46.848  8.717   99.271  1.00 110.76 ? 191 SER L OG  1 
ATOM   3355  N N   . TYR B 2 197 ? 46.596  6.545   97.289  1.00 110.59 ? 192 TYR L N   1 
ATOM   3356  C CA  . TYR B 2 197 ? 46.273  6.862   95.909  1.00 106.45 ? 192 TYR L CA  1 
ATOM   3357  C C   . TYR B 2 197 ? 44.838  7.356   95.887  1.00 109.46 ? 192 TYR L C   1 
ATOM   3358  O O   . TYR B 2 197 ? 43.933  6.623   96.281  1.00 107.56 ? 192 TYR L O   1 
ATOM   3359  C CB  . TYR B 2 197 ? 46.444  5.631   95.024  1.00 96.32  ? 192 TYR L CB  1 
ATOM   3360  C CG  . TYR B 2 197 ? 47.885  5.317   94.729  1.00 96.31  ? 192 TYR L CG  1 
ATOM   3361  C CD1 . TYR B 2 197 ? 48.719  6.288   94.213  1.00 100.87 ? 192 TYR L CD1 1 
ATOM   3362  C CD2 . TYR B 2 197 ? 48.415  4.052   94.957  1.00 99.28  ? 192 TYR L CD2 1 
ATOM   3363  C CE1 . TYR B 2 197 ? 50.044  6.023   93.932  1.00 102.04 ? 192 TYR L CE1 1 
ATOM   3364  C CE2 . TYR B 2 197 ? 49.745  3.773   94.678  1.00 96.77  ? 192 TYR L CE2 1 
ATOM   3365  C CZ  . TYR B 2 197 ? 50.555  4.768   94.163  1.00 98.80  ? 192 TYR L CZ  1 
ATOM   3366  O OH  . TYR B 2 197 ? 51.882  4.527   93.873  1.00 98.62  ? 192 TYR L OH  1 
ATOM   3367  N N   . THR B 2 198 ? 44.629  8.590   95.429  1.00 105.88 ? 193 THR L N   1 
ATOM   3368  C CA  . THR B 2 198 ? 43.328  9.236   95.577  1.00 105.32 ? 193 THR L CA  1 
ATOM   3369  C C   . THR B 2 198 ? 42.673  9.722   94.275  1.00 104.22 ? 193 THR L C   1 
ATOM   3370  O O   . THR B 2 198 ? 43.309  10.395  93.458  1.00 100.23 ? 193 THR L O   1 
ATOM   3371  C CB  . THR B 2 198 ? 43.433  10.402  96.559  1.00 112.52 ? 193 THR L CB  1 
ATOM   3372  O OG1 . THR B 2 198 ? 44.020  9.939   97.785  1.00 112.24 ? 193 THR L OG1 1 
ATOM   3373  C CG2 . THR B 2 198 ? 42.060  10.989  96.828  1.00 109.63 ? 193 THR L CG2 1 
ATOM   3374  N N   . CYS B 2 199 ? 41.386  9.392   94.121  1.00 105.10 ? 194 CYS L N   1 
ATOM   3375  C CA  . CYS B 2 199 ? 40.604  9.659   92.902  1.00 110.03 ? 194 CYS L CA  1 
ATOM   3376  C C   . CYS B 2 199 ? 39.431  10.630  93.151  1.00 105.54 ? 194 CYS L C   1 
ATOM   3377  O O   . CYS B 2 199 ? 38.413  10.260  93.749  1.00 102.40 ? 194 CYS L O   1 
ATOM   3378  C CB  . CYS B 2 199 ? 40.079  8.327   92.331  1.00 111.17 ? 194 CYS L CB  1 
ATOM   3379  S SG  . CYS B 2 199 ? 39.679  8.274   90.540  1.00 113.77 ? 194 CYS L SG  1 
ATOM   3380  N N   . GLU B 2 200 ? 39.563  11.860  92.662  1.00 100.58 ? 195 GLU L N   1 
ATOM   3381  C CA  . GLU B 2 200 ? 38.620  12.919  93.018  1.00 109.87 ? 195 GLU L CA  1 
ATOM   3382  C C   . GLU B 2 200 ? 37.581  13.228  91.936  1.00 110.73 ? 195 GLU L C   1 
ATOM   3383  O O   . GLU B 2 200 ? 37.928  13.595  90.813  1.00 107.46 ? 195 GLU L O   1 
ATOM   3384  C CB  . GLU B 2 200 ? 39.386  14.191  93.399  1.00 113.52 ? 195 GLU L CB  1 
ATOM   3385  C CG  . GLU B 2 200 ? 38.616  15.163  94.285  1.00 114.94 ? 195 GLU L CG  1 
ATOM   3386  C CD  . GLU B 2 200 ? 39.540  16.064  95.092  1.00 121.27 ? 195 GLU L CD  1 
ATOM   3387  O OE1 . GLU B 2 200 ? 39.248  16.298  96.287  1.00 124.05 ? 195 GLU L OE1 1 
ATOM   3388  O OE2 . GLU B 2 200 ? 40.563  16.526  94.535  1.00 117.91 ? 195 GLU L OE2 1 
ATOM   3389  N N   . ALA B 2 201 ? 36.306  13.094  92.295  1.00 110.44 ? 196 ALA L N   1 
ATOM   3390  C CA  . ALA B 2 201 ? 35.198  13.345  91.377  1.00 106.19 ? 196 ALA L CA  1 
ATOM   3391  C C   . ALA B 2 201 ? 34.671  14.776  91.466  1.00 111.24 ? 196 ALA L C   1 
ATOM   3392  O O   . ALA B 2 201 ? 35.233  15.619  92.166  1.00 114.05 ? 196 ALA L O   1 
ATOM   3393  C CB  . ALA B 2 201 ? 34.077  12.363  91.632  1.00 100.65 ? 196 ALA L CB  1 
ATOM   3394  N N   . THR B 2 202 ? 33.585  15.035  90.743  1.00 110.96 ? 197 THR L N   1 
ATOM   3395  C CA  . THR B 2 202 ? 32.956  16.354  90.692  1.00 110.18 ? 197 THR L CA  1 
ATOM   3396  C C   . THR B 2 202 ? 31.652  16.260  89.910  1.00 106.55 ? 197 THR L C   1 
ATOM   3397  O O   . THR B 2 202 ? 31.645  15.827  88.766  1.00 106.00 ? 197 THR L O   1 
ATOM   3398  C CB  . THR B 2 202 ? 33.874  17.403  90.027  1.00 107.60 ? 197 THR L CB  1 
ATOM   3399  O OG1 . THR B 2 202 ? 34.763  17.950  91.011  1.00 102.65 ? 197 THR L OG1 1 
ATOM   3400  C CG2 . THR B 2 202 ? 33.047  18.529  89.397  1.00 104.79 ? 197 THR L CG2 1 
ATOM   3401  N N   . HIS B 2 203 ? 30.547  16.652  90.529  1.00 106.59 ? 198 HIS L N   1 
ATOM   3402  C CA  . HIS B 2 203 ? 29.255  16.562  89.868  1.00 105.12 ? 198 HIS L CA  1 
ATOM   3403  C C   . HIS B 2 203 ? 28.438  17.799  90.166  1.00 111.85 ? 198 HIS L C   1 
ATOM   3404  O O   . HIS B 2 203 ? 28.969  18.832  90.570  1.00 115.91 ? 198 HIS L O   1 
ATOM   3405  C CB  . HIS B 2 203 ? 28.499  15.331  90.373  1.00 106.46 ? 198 HIS L CB  1 
ATOM   3406  C CG  . HIS B 2 203 ? 27.494  14.800  89.383  1.00 102.03 ? 198 HIS L CG  1 
ATOM   3407  N ND1 . HIS B 2 203 ? 27.678  14.849  88.040  1.00 93.01  ? 198 HIS L ND1 1 
ATOM   3408  C CD2 . HIS B 2 203 ? 26.301  14.174  89.599  1.00 98.31  ? 198 HIS L CD2 1 
ATOM   3409  C CE1 . HIS B 2 203 ? 26.638  14.289  87.422  1.00 90.03  ? 198 HIS L CE1 1 
ATOM   3410  N NE2 . HIS B 2 203 ? 25.800  13.875  88.354  1.00 93.69  ? 198 HIS L NE2 1 
ATOM   3411  N N   . LYS B 2 204 ? 27.136  17.687  89.945  1.00 113.04 ? 199 LYS L N   1 
ATOM   3412  C CA  . LYS B 2 204 ? 26.194  18.611  90.537  1.00 108.95 ? 199 LYS L CA  1 
ATOM   3413  C C   . LYS B 2 204 ? 24.938  17.875  90.952  1.00 104.66 ? 199 LYS L C   1 
ATOM   3414  O O   . LYS B 2 204 ? 23.830  18.367  90.798  1.00 103.22 ? 199 LYS L O   1 
ATOM   3415  C CB  . LYS B 2 204 ? 25.874  19.796  89.634  1.00 110.12 ? 199 LYS L CB  1 
ATOM   3416  C CG  . LYS B 2 204 ? 25.333  20.966  90.442  1.00 112.15 ? 199 LYS L CG  1 
ATOM   3417  C CD  . LYS B 2 204 ? 26.068  21.067  91.784  1.00 106.27 ? 199 LYS L CD  1 
ATOM   3418  C CE  . LYS B 2 204 ? 25.418  22.088  92.698  1.00 102.76 ? 199 LYS L CE  1 
ATOM   3419  N NZ  . LYS B 2 204 ? 25.283  23.403  92.021  1.00 96.45  ? 199 LYS L NZ  1 
ATOM   3420  N N   . THR B 2 205 ? 25.122  16.663  91.448  1.00 102.57 ? 200 THR L N   1 
ATOM   3421  C CA  . THR B 2 205 ? 24.176  16.140  92.405  1.00 112.56 ? 200 THR L CA  1 
ATOM   3422  C C   . THR B 2 205 ? 24.993  16.120  93.680  1.00 122.18 ? 200 THR L C   1 
ATOM   3423  O O   . THR B 2 205 ? 24.566  15.601  94.714  1.00 126.25 ? 200 THR L O   1 
ATOM   3424  C CB  . THR B 2 205 ? 23.645  14.758  92.035  1.00 109.43 ? 200 THR L CB  1 
ATOM   3425  O OG1 . THR B 2 205 ? 23.141  14.802  90.698  1.00 108.91 ? 200 THR L OG1 1 
ATOM   3426  C CG2 . THR B 2 205 ? 22.504  14.353  92.979  1.00 97.29  ? 200 THR L CG2 1 
ATOM   3427  N N   . SER B 2 206 ? 26.184  16.714  93.579  1.00 121.88 ? 201 SER L N   1 
ATOM   3428  C CA  . SER B 2 206 ? 27.087  16.882  94.716  1.00 128.63 ? 201 SER L CA  1 
ATOM   3429  C C   . SER B 2 206 ? 27.565  18.337  94.838  1.00 128.61 ? 201 SER L C   1 
ATOM   3430  O O   . SER B 2 206 ? 27.800  19.015  93.833  1.00 121.94 ? 201 SER L O   1 
ATOM   3431  C CB  . SER B 2 206 ? 28.287  15.929  94.601  1.00 128.60 ? 201 SER L CB  1 
ATOM   3432  O OG  . SER B 2 206 ? 28.858  15.648  95.871  1.00 129.11 ? 201 SER L OG  1 
ATOM   3433  N N   . THR B 2 207 ? 27.693  18.805  96.079  1.00 133.07 ? 202 THR L N   1 
ATOM   3434  C CA  . THR B 2 207 ? 28.205  20.142  96.366  1.00 132.54 ? 202 THR L CA  1 
ATOM   3435  C C   . THR B 2 207 ? 29.691  20.062  96.716  1.00 136.67 ? 202 THR L C   1 
ATOM   3436  O O   . THR B 2 207 ? 30.463  20.976  96.404  1.00 134.35 ? 202 THR L O   1 
ATOM   3437  C CB  . THR B 2 207 ? 27.443  20.804  97.539  1.00 135.74 ? 202 THR L CB  1 
ATOM   3438  O OG1 . THR B 2 207 ? 27.762  22.199  97.607  1.00 136.50 ? 202 THR L OG1 1 
ATOM   3439  C CG2 . THR B 2 207 ? 27.813  20.145  98.861  1.00 138.61 ? 202 THR L CG2 1 
ATOM   3440  N N   . SER B 2 208 ? 30.081  18.962  97.362  1.00 138.10 ? 203 SER L N   1 
ATOM   3441  C CA  . SER B 2 208 ? 31.475  18.730  97.744  1.00 133.62 ? 203 SER L CA  1 
ATOM   3442  C C   . SER B 2 208 ? 32.065  17.529  97.007  1.00 123.80 ? 203 SER L C   1 
ATOM   3443  O O   . SER B 2 208 ? 31.463  16.453  96.974  1.00 121.86 ? 203 SER L O   1 
ATOM   3444  C CB  . SER B 2 208 ? 31.618  18.557  99.264  1.00 131.90 ? 203 SER L CB  1 
ATOM   3445  O OG  . SER B 2 208 ? 31.012  17.356  99.716  1.00 134.02 ? 203 SER L OG  1 
ATOM   3446  N N   . PRO B 2 209 ? 33.252  17.725  96.413  1.00 118.29 ? 204 PRO L N   1 
ATOM   3447  C CA  . PRO B 2 209 ? 34.003  16.784  95.578  1.00 121.83 ? 204 PRO L CA  1 
ATOM   3448  C C   . PRO B 2 209 ? 33.994  15.358  96.126  1.00 124.69 ? 204 PRO L C   1 
ATOM   3449  O O   . PRO B 2 209 ? 34.329  15.149  97.293  1.00 123.95 ? 204 PRO L O   1 
ATOM   3450  C CB  . PRO B 2 209 ? 35.437  17.333  95.625  1.00 121.65 ? 204 PRO L CB  1 
ATOM   3451  C CG  . PRO B 2 209 ? 35.366  18.666  96.324  1.00 121.66 ? 204 PRO L CG  1 
ATOM   3452  C CD  . PRO B 2 209 ? 33.938  19.019  96.531  1.00 123.00 ? 204 PRO L CD  1 
ATOM   3453  N N   . ILE B 2 210 ? 33.624  14.391  95.289  1.00 124.18 ? 205 ILE L N   1 
ATOM   3454  C CA  . ILE B 2 210 ? 33.677  12.986  95.683  1.00 120.03 ? 205 ILE L CA  1 
ATOM   3455  C C   . ILE B 2 210 ? 35.090  12.425  95.514  1.00 116.08 ? 205 ILE L C   1 
ATOM   3456  O O   . ILE B 2 210 ? 35.761  12.653  94.508  1.00 109.80 ? 205 ILE L O   1 
ATOM   3457  C CB  . ILE B 2 210 ? 32.648  12.121  94.922  1.00 113.29 ? 205 ILE L CB  1 
ATOM   3458  C CG1 . ILE B 2 210 ? 31.269  12.252  95.568  1.00 112.48 ? 205 ILE L CG1 1 
ATOM   3459  C CG2 . ILE B 2 210 ? 33.065  10.656  94.931  1.00 103.81 ? 205 ILE L CG2 1 
ATOM   3460  C CD1 . ILE B 2 210 ? 30.777  13.663  95.692  1.00 113.41 ? 205 ILE L CD1 1 
ATOM   3461  N N   . VAL B 2 211 ? 35.536  11.697  96.526  1.00 115.74 ? 206 VAL L N   1 
ATOM   3462  C CA  . VAL B 2 211 ? 36.882  11.167  96.539  1.00 111.11 ? 206 VAL L CA  1 
ATOM   3463  C C   . VAL B 2 211 ? 36.841  9.699   96.958  1.00 108.57 ? 206 VAL L C   1 
ATOM   3464  O O   . VAL B 2 211 ? 36.128  9.326   97.901  1.00 102.59 ? 206 VAL L O   1 
ATOM   3465  C CB  . VAL B 2 211 ? 37.781  11.996  97.488  1.00 108.98 ? 206 VAL L CB  1 
ATOM   3466  C CG1 . VAL B 2 211 ? 39.127  11.338  97.673  1.00 104.24 ? 206 VAL L CG1 1 
ATOM   3467  C CG2 . VAL B 2 211 ? 37.938  13.413  96.961  1.00 107.10 ? 206 VAL L CG2 1 
ATOM   3468  N N   . LYS B 2 212 ? 37.574  8.868   96.219  1.00 107.54 ? 207 LYS L N   1 
ATOM   3469  C CA  . LYS B 2 212 ? 37.796  7.477   96.602  1.00 102.74 ? 207 LYS L CA  1 
ATOM   3470  C C   . LYS B 2 212 ? 39.257  7.098   96.368  1.00 100.61 ? 207 LYS L C   1 
ATOM   3471  O O   . LYS B 2 212 ? 39.786  7.235   95.269  1.00 103.40 ? 207 LYS L O   1 
ATOM   3472  C CB  . LYS B 2 212 ? 36.847  6.538   95.863  1.00 94.48  ? 207 LYS L CB  1 
ATOM   3473  C CG  . LYS B 2 212 ? 35.376  6.862   96.080  1.00 95.76  ? 207 LYS L CG  1 
ATOM   3474  C CD  . LYS B 2 212 ? 34.914  6.618   97.505  1.00 87.64  ? 207 LYS L CD  1 
ATOM   3475  C CE  . LYS B 2 212 ? 34.606  5.153   97.720  1.00 85.41  ? 207 LYS L CE  1 
ATOM   3476  N NZ  . LYS B 2 212 ? 33.557  4.646   96.792  1.00 77.03  ? 207 LYS L NZ  1 
ATOM   3477  N N   . SER B 2 213 ? 39.905  6.633   97.425  1.00 102.07 ? 208 SER L N   1 
ATOM   3478  C CA  . SER B 2 213 ? 41.339  6.408   97.405  1.00 109.57 ? 208 SER L CA  1 
ATOM   3479  C C   . SER B 2 213 ? 41.680  5.103   98.108  1.00 112.27 ? 208 SER L C   1 
ATOM   3480  O O   . SER B 2 213 ? 40.779  4.379   98.532  1.00 110.27 ? 208 SER L O   1 
ATOM   3481  C CB  . SER B 2 213 ? 42.059  7.581   98.080  1.00 112.27 ? 208 SER L CB  1 
ATOM   3482  O OG  . SER B 2 213 ? 41.443  7.946   99.305  1.00 110.71 ? 208 SER L OG  1 
ATOM   3483  N N   . PHE B 2 214 ? 42.973  4.796   98.216  1.00 114.20 ? 209 PHE L N   1 
ATOM   3484  C CA  . PHE B 2 214 ? 43.422  3.635   98.996  1.00 122.01 ? 209 PHE L CA  1 
ATOM   3485  C C   . PHE B 2 214 ? 44.890  3.730   99.421  1.00 121.26 ? 209 PHE L C   1 
ATOM   3486  O O   . PHE B 2 214 ? 45.718  4.285   98.701  1.00 118.03 ? 209 PHE L O   1 
ATOM   3487  C CB  . PHE B 2 214 ? 43.138  2.307   98.266  1.00 117.45 ? 209 PHE L CB  1 
ATOM   3488  C CG  . PHE B 2 214 ? 44.146  1.954   97.203  1.00 114.73 ? 209 PHE L CG  1 
ATOM   3489  C CD1 . PHE B 2 214 ? 44.880  0.776   97.290  1.00 117.02 ? 209 PHE L CD1 1 
ATOM   3490  C CD2 . PHE B 2 214 ? 44.351  2.786   96.113  1.00 109.29 ? 209 PHE L CD2 1 
ATOM   3491  C CE1 . PHE B 2 214 ? 45.810  0.431   96.311  1.00 111.48 ? 209 PHE L CE1 1 
ATOM   3492  C CE2 . PHE B 2 214 ? 45.276  2.449   95.134  1.00 112.04 ? 209 PHE L CE2 1 
ATOM   3493  C CZ  . PHE B 2 214 ? 46.010  1.266   95.236  1.00 108.61 ? 209 PHE L CZ  1 
ATOM   3494  N N   . ASN B 2 215 ? 45.196  3.207   100.606 1.00 125.32 ? 210 ASN L N   1 
ATOM   3495  C CA  . ASN B 2 215 ? 46.576  3.121   101.073 1.00 124.16 ? 210 ASN L CA  1 
ATOM   3496  C C   . ASN B 2 215 ? 47.093  1.704   100.891 1.00 124.55 ? 210 ASN L C   1 
ATOM   3497  O O   . ASN B 2 215 ? 46.312  0.790   100.628 1.00 126.48 ? 210 ASN L O   1 
ATOM   3498  C CB  . ASN B 2 215 ? 46.706  3.554   102.534 1.00 124.97 ? 210 ASN L CB  1 
ATOM   3499  C CG  . ASN B 2 215 ? 46.238  4.976   102.766 1.00 122.72 ? 210 ASN L CG  1 
ATOM   3500  O OD1 . ASN B 2 215 ? 46.836  5.712   103.548 1.00 122.38 ? 210 ASN L OD1 1 
ATOM   3501  N ND2 . ASN B 2 215 ? 45.162  5.369   102.092 1.00 120.20 ? 210 ASN L ND2 1 
ATOM   3502  N N   . ARG B 2 216 ? 48.399  1.510   101.035 1.00 122.70 ? 211 ARG L N   1 
ATOM   3503  C CA  . ARG B 2 216 ? 48.962  0.197   100.742 1.00 131.44 ? 211 ARG L CA  1 
ATOM   3504  C C   . ARG B 2 216 ? 49.023  -0.791  101.915 1.00 139.66 ? 211 ARG L C   1 
ATOM   3505  O O   . ARG B 2 216 ? 49.911  -0.735  102.775 1.00 129.98 ? 211 ARG L O   1 
ATOM   3506  C CB  . ARG B 2 216 ? 50.284  0.318   100.000 1.00 119.80 ? 211 ARG L CB  1 
ATOM   3507  C CG  . ARG B 2 216 ? 50.070  0.691   98.555  1.00 109.25 ? 211 ARG L CG  1 
ATOM   3508  C CD  . ARG B 2 216 ? 51.222  0.222   97.749  1.00 107.22 ? 211 ARG L CD  1 
ATOM   3509  N NE  . ARG B 2 216 ? 52.453  0.662   98.375  1.00 110.19 ? 211 ARG L NE  1 
ATOM   3510  C CZ  . ARG B 2 216 ? 53.644  0.148   98.115  1.00 109.78 ? 211 ARG L CZ  1 
ATOM   3511  N NH1 . ARG B 2 216 ? 54.712  0.614   98.745  1.00 109.98 ? 211 ARG L NH1 1 
ATOM   3512  N NH2 . ARG B 2 216 ? 53.760  -0.835  97.232  1.00 106.56 ? 211 ARG L NH2 1 
ATOM   3513  N N   . ASN B 2 217 ? 48.060  -1.714  101.887 1.00 147.01 ? 212 ASN L N   1 
ATOM   3514  C CA  . ASN B 2 217 ? 47.765  -2.643  102.972 1.00 150.24 ? 212 ASN L CA  1 
ATOM   3515  C C   . ASN B 2 217 ? 48.021  -4.111  102.598 1.00 152.44 ? 212 ASN L C   1 
ATOM   3516  O O   . ASN B 2 217 ? 47.877  -4.493  101.434 1.00 151.54 ? 212 ASN L O   1 
ATOM   3517  C CB  . ASN B 2 217 ? 46.299  -2.461  103.401 1.00 152.73 ? 212 ASN L CB  1 
ATOM   3518  C CG  . ASN B 2 217 ? 45.349  -2.309  102.208 1.00 149.47 ? 212 ASN L CG  1 
ATOM   3519  O OD1 . ASN B 2 217 ? 44.675  -1.284  102.058 1.00 141.88 ? 212 ASN L OD1 1 
ATOM   3520  N ND2 . ASN B 2 217 ? 45.301  -3.328  101.354 1.00 150.18 ? 212 ASN L ND2 1 
ATOM   3521  N N   . GLU B 2 218 ? 48.387  -4.922  103.595 1.00 154.88 ? 213 GLU L N   1 
ATOM   3522  C CA  . GLU B 2 218 ? 48.657  -6.355  103.409 1.00 152.53 ? 213 GLU L CA  1 
ATOM   3523  C C   . GLU B 2 218 ? 47.432  -7.119  102.897 1.00 158.98 ? 213 GLU L C   1 
ATOM   3524  O O   . GLU B 2 218 ? 47.515  -7.864  101.912 1.00 157.73 ? 213 GLU L O   1 
ATOM   3525  C CB  . GLU B 2 218 ? 49.142  -6.997  104.722 1.00 148.18 ? 213 GLU L CB  1 
ATOM   3526  C CG  . GLU B 2 218 ? 48.063  -7.116  105.811 1.00 145.14 ? 213 GLU L CG  1 
ATOM   3527  C CD  . GLU B 2 218 ? 48.300  -8.274  106.768 1.00 135.11 ? 213 GLU L CD  1 
ATOM   3528  O OE1 . GLU B 2 218 ? 49.460  -8.722  106.883 1.00 133.90 ? 213 GLU L OE1 1 
ATOM   3529  O OE2 . GLU B 2 218 ? 47.327  -8.737  107.402 1.00 127.43 ? 213 GLU L OE2 1 
ATOM   3530  N N   . CYS B 2 219 ? 46.312  -6.933  103.596 1.00 159.14 ? 214 CYS L N   1 
ATOM   3531  C CA  . CYS B 2 219 ? 45.020  -7.548  103.285 1.00 157.56 ? 214 CYS L CA  1 
ATOM   3532  C C   . CYS B 2 219 ? 44.205  -7.627  104.576 1.00 152.25 ? 214 CYS L C   1 
ATOM   3533  O O   . CYS B 2 219 ? 44.691  -7.262  105.653 1.00 142.39 ? 214 CYS L O   1 
ATOM   3534  C CB  . CYS B 2 219 ? 45.178  -8.941  102.656 1.00 157.05 ? 214 CYS L CB  1 
ATOM   3535  S SG  . CYS B 2 219 ? 43.845  -9.393  101.511 1.00 161.60 ? 214 CYS L SG  1 
ATOM   3536  O OXT . CYS B 2 219 ? 43.048  -8.048  104.574 1.00 156.59 ? 214 CYS L OXT 1 
ATOM   3537  N N   . GLN C 3 1   ? 15.170  -8.610  48.435  1.00 49.29  ? 1   GLN H N   1 
ATOM   3538  C CA  . GLN C 3 1   ? 15.666  -7.621  49.389  1.00 49.89  ? 1   GLN H CA  1 
ATOM   3539  C C   . GLN C 3 1   ? 17.118  -7.183  49.157  1.00 47.26  ? 1   GLN H C   1 
ATOM   3540  O O   . GLN C 3 1   ? 18.048  -7.946  49.384  1.00 50.89  ? 1   GLN H O   1 
ATOM   3541  C CB  . GLN C 3 1   ? 15.512  -8.152  50.802  1.00 54.33  ? 1   GLN H CB  1 
ATOM   3542  C CG  . GLN C 3 1   ? 15.454  -9.669  50.909  1.00 61.05  ? 1   GLN H CG  1 
ATOM   3543  C CD  . GLN C 3 1   ? 15.368  -10.143 52.378  1.00 83.67  ? 1   GLN H CD  1 
ATOM   3544  O OE1 . GLN C 3 1   ? 14.439  -10.873 52.769  1.00 87.13  ? 1   GLN H OE1 1 
ATOM   3545  N NE2 . GLN C 3 1   ? 16.340  -9.715  53.196  1.00 76.91  ? 1   GLN H NE2 1 
ATOM   3546  N N   . VAL C 3 2   ? 17.301  -5.948  48.705  1.00 43.13  ? 2   VAL H N   1 
ATOM   3547  C CA  . VAL C 3 2   ? 18.624  -5.394  48.390  1.00 42.81  ? 2   VAL H CA  1 
ATOM   3548  C C   . VAL C 3 2   ? 19.604  -5.421  49.553  1.00 42.58  ? 2   VAL H C   1 
ATOM   3549  O O   . VAL C 3 2   ? 19.288  -4.913  50.610  1.00 48.24  ? 2   VAL H O   1 
ATOM   3550  C CB  . VAL C 3 2   ? 18.496  -3.909  48.041  1.00 40.73  ? 2   VAL H CB  1 
ATOM   3551  C CG1 . VAL C 3 2   ? 19.841  -3.232  48.112  1.00 34.33  ? 2   VAL H CG1 1 
ATOM   3552  C CG2 . VAL C 3 2   ? 17.867  -3.744  46.695  1.00 42.46  ? 2   VAL H CG2 1 
ATOM   3553  N N   . GLN C 3 3   ? 20.800  -5.969  49.375  1.00 40.94  ? 3   GLN H N   1 
ATOM   3554  C CA  . GLN C 3 3   ? 21.781  -5.944  50.457  1.00 42.92  ? 3   GLN H CA  1 
ATOM   3555  C C   . GLN C 3 3   ? 23.136  -5.486  49.941  1.00 42.44  ? 3   GLN H C   1 
ATOM   3556  O O   . GLN C 3 3   ? 23.506  -5.853  48.829  1.00 43.15  ? 3   GLN H O   1 
ATOM   3557  C CB  . GLN C 3 3   ? 21.877  -7.322  51.111  1.00 43.27  ? 3   GLN H CB  1 
ATOM   3558  C CG  . GLN C 3 3   ? 20.533  -7.813  51.678  1.00 53.03  ? 3   GLN H CG  1 
ATOM   3559  C CD  . GLN C 3 3   ? 20.592  -9.191  52.363  1.00 66.52  ? 3   GLN H CD  1 
ATOM   3560  O OE1 . GLN C 3 3   ? 19.620  -9.965  52.309  1.00 64.18  ? 3   GLN H OE1 1 
ATOM   3561  N NE2 . GLN C 3 3   ? 21.729  -9.498  53.011  1.00 68.23  ? 3   GLN H NE2 1 
ATOM   3562  N N   . LEU C 3 4   ? 23.862  -4.679  50.721  1.00 37.37  ? 4   LEU H N   1 
ATOM   3563  C CA  . LEU C 3 4   ? 25.209  -4.200  50.328  1.00 37.62  ? 4   LEU H CA  1 
ATOM   3564  C C   . LEU C 3 4   ? 26.273  -4.565  51.352  1.00 40.57  ? 4   LEU H C   1 
ATOM   3565  O O   . LEU C 3 4   ? 26.427  -3.863  52.362  1.00 45.33  ? 4   LEU H O   1 
ATOM   3566  C CB  . LEU C 3 4   ? 25.247  -2.674  50.172  1.00 36.22  ? 4   LEU H CB  1 
ATOM   3567  C CG  . LEU C 3 4   ? 24.399  -2.004  49.106  1.00 31.28  ? 4   LEU H CG  1 
ATOM   3568  C CD1 . LEU C 3 4   ? 24.570  -0.530  49.165  1.00 28.91  ? 4   LEU H CD1 1 
ATOM   3569  C CD2 . LEU C 3 4   ? 24.849  -2.517  47.805  1.00 34.37  ? 4   LEU H CD2 1 
ATOM   3570  N N   . GLN C 3 5   ? 27.025  -5.633  51.094  1.00 41.54  ? 5   GLN H N   1 
ATOM   3571  C CA  . GLN C 3 5   ? 27.992  -6.154  52.082  1.00 45.82  ? 5   GLN H CA  1 
ATOM   3572  C C   . GLN C 3 5   ? 29.424  -5.861  51.690  1.00 42.99  ? 5   GLN H C   1 
ATOM   3573  O O   . GLN C 3 5   ? 29.933  -6.432  50.741  1.00 41.87  ? 5   GLN H O   1 
ATOM   3574  C CB  . GLN C 3 5   ? 27.834  -7.670  52.277  1.00 48.32  ? 5   GLN H CB  1 
ATOM   3575  C CG  . GLN C 3 5   ? 28.920  -8.326  53.126  1.00 49.17  ? 5   GLN H CG  1 
ATOM   3576  C CD  . GLN C 3 5   ? 28.465  -8.606  54.556  1.00 62.14  ? 5   GLN H CD  1 
ATOM   3577  O OE1 . GLN C 3 5   ? 27.307  -8.348  54.900  1.00 73.26  ? 5   GLN H OE1 1 
ATOM   3578  N NE2 . GLN C 3 5   ? 29.374  -9.134  55.400  1.00 54.91  ? 5   GLN H NE2 1 
ATOM   3579  N N   . GLN C 3 6   ? 30.070  -4.974  52.430  1.00 40.70  ? 6   GLN H N   1 
ATOM   3580  C CA  . GLN C 3 6   ? 31.436  -4.619  52.142  1.00 37.87  ? 6   GLN H CA  1 
ATOM   3581  C C   . GLN C 3 6   ? 32.333  -5.590  52.880  1.00 36.54  ? 6   GLN H C   1 
ATOM   3582  O O   . GLN C 3 6   ? 31.855  -6.490  53.551  1.00 33.01  ? 6   GLN H O   1 
ATOM   3583  C CB  . GLN C 3 6   ? 31.723  -3.188  52.577  1.00 41.10  ? 6   GLN H CB  1 
ATOM   3584  C CG  . GLN C 3 6   ? 30.576  -2.202  52.356  1.00 40.12  ? 6   GLN H CG  1 
ATOM   3585  C CD  . GLN C 3 6   ? 30.885  -0.842  52.947  1.00 38.99  ? 6   GLN H CD  1 
ATOM   3586  O OE1 . GLN C 3 6   ? 32.047  -0.474  53.088  1.00 39.23  ? 6   GLN H OE1 1 
ATOM   3587  N NE2 . GLN C 3 6   ? 29.857  -0.097  53.305  1.00 37.17  ? 6   GLN H NE2 1 
ATOM   3588  N N   . SER C 3 7   ? 33.639  -5.402  52.736  1.00 38.01  ? 7   SER H N   1 
ATOM   3589  C CA  . SER C 3 7   ? 34.621  -6.361  53.227  1.00 35.63  ? 7   SER H CA  1 
ATOM   3590  C C   . SER C 3 7   ? 35.151  -6.001  54.612  1.00 36.71  ? 7   SER H C   1 
ATOM   3591  O O   . SER C 3 7   ? 34.744  -4.994  55.208  1.00 37.24  ? 7   SER H O   1 
ATOM   3592  C CB  . SER C 3 7   ? 35.769  -6.571  52.205  1.00 34.86  ? 7   SER H CB  1 
ATOM   3593  O OG  . SER C 3 7   ? 36.730  -5.514  52.174  1.00 40.68  ? 7   SER H OG  1 
ATOM   3594  N N   . GLY C 3 8   ? 36.049  -6.837  55.128  1.00 34.70  ? 8   GLY H N   1 
ATOM   3595  C CA  . GLY C 3 8   ? 36.564  -6.656  56.472  1.00 34.93  ? 8   GLY H CA  1 
ATOM   3596  C C   . GLY C 3 8   ? 37.446  -5.441  56.674  1.00 36.87  ? 8   GLY H C   1 
ATOM   3597  O O   . GLY C 3 8   ? 37.782  -4.746  55.704  1.00 39.48  ? 8   GLY H O   1 
ATOM   3598  N N   . PRO C 3 9   ? 37.819  -5.181  57.939  1.00 33.49  ? 9   PRO H N   1 
ATOM   3599  C CA  . PRO C 3 9   ? 38.770  -4.170  58.413  1.00 36.50  ? 9   PRO H CA  1 
ATOM   3600  C C   . PRO C 3 9   ? 40.150  -4.371  57.841  1.00 36.67  ? 9   PRO H C   1 
ATOM   3601  O O   . PRO C 3 9   ? 40.506  -5.511  57.587  1.00 35.02  ? 9   PRO H O   1 
ATOM   3602  C CB  . PRO C 3 9   ? 38.826  -4.436  59.907  1.00 35.29  ? 9   PRO H CB  1 
ATOM   3603  C CG  . PRO C 3 9   ? 37.522  -4.953  60.216  1.00 40.00  ? 9   PRO H CG  1 
ATOM   3604  C CD  . PRO C 3 9   ? 37.138  -5.829  59.059  1.00 32.58  ? 9   PRO H CD  1 
ATOM   3605  N N   . GLU C 3 10  ? 40.904  -3.289  57.649  1.00 41.27  ? 10  GLU H N   1 
ATOM   3606  C CA  . GLU C 3 10  ? 42.308  -3.387  57.232  1.00 42.67  ? 10  GLU H CA  1 
ATOM   3607  C C   . GLU C 3 10  ? 43.333  -2.439  57.904  1.00 43.06  ? 10  GLU H C   1 
ATOM   3608  O O   . GLU C 3 10  ? 43.088  -1.251  58.132  1.00 39.80  ? 10  GLU H O   1 
ATOM   3609  C CB  . GLU C 3 10  ? 42.425  -3.340  55.713  1.00 36.81  ? 10  GLU H CB  1 
ATOM   3610  C CG  . GLU C 3 10  ? 42.710  -4.723  55.131  1.00 46.75  ? 10  GLU H CG  1 
ATOM   3611  C CD  . GLU C 3 10  ? 42.513  -4.798  53.611  1.00 56.80  ? 10  GLU H CD  1 
ATOM   3612  O OE1 . GLU C 3 10  ? 41.588  -4.119  53.097  1.00 62.46  ? 10  GLU H OE1 1 
ATOM   3613  O OE2 . GLU C 3 10  ? 43.274  -5.539  52.933  1.00 50.01  ? 10  GLU H OE2 1 
ATOM   3614  N N   . LEU C 3 11  ? 44.486  -3.001  58.244  1.00 44.14  ? 11  LEU H N   1 
ATOM   3615  C CA  . LEU C 3 11  ? 45.639  -2.186  58.621  1.00 46.61  ? 11  LEU H CA  1 
ATOM   3616  C C   . LEU C 3 11  ? 46.715  -2.232  57.523  1.00 43.99  ? 11  LEU H C   1 
ATOM   3617  O O   . LEU C 3 11  ? 47.157  -3.301  57.102  1.00 38.27  ? 11  LEU H O   1 
ATOM   3618  C CB  . LEU C 3 11  ? 46.197  -2.595  59.987  1.00 41.20  ? 11  LEU H CB  1 
ATOM   3619  C CG  . LEU C 3 11  ? 47.714  -2.620  60.111  1.00 45.81  ? 11  LEU H CG  1 
ATOM   3620  C CD1 . LEU C 3 11  ? 48.159  -2.096  61.472  1.00 47.91  ? 11  LEU H CD1 1 
ATOM   3621  C CD2 . LEU C 3 11  ? 48.236  -4.042  59.824  1.00 42.85  ? 11  LEU H CD2 1 
ATOM   3622  N N   . VAL C 3 12  ? 47.094  -1.061  57.034  1.00 42.08  ? 12  VAL H N   1 
ATOM   3623  C CA  . VAL C 3 12  ? 48.069  -0.987  55.976  1.00 43.33  ? 12  VAL H CA  1 
ATOM   3624  C C   . VAL C 3 12  ? 49.148  -0.017  56.396  1.00 49.31  ? 12  VAL H C   1 
ATOM   3625  O O   . VAL C 3 12  ? 48.888  0.942   57.116  1.00 48.86  ? 12  VAL H O   1 
ATOM   3626  C CB  . VAL C 3 12  ? 47.460  -0.469  54.686  1.00 43.99  ? 12  VAL H CB  1 
ATOM   3627  C CG1 . VAL C 3 12  ? 48.461  -0.613  53.574  1.00 48.78  ? 12  VAL H CG1 1 
ATOM   3628  C CG2 . VAL C 3 12  ? 46.213  -1.219  54.351  1.00 40.10  ? 12  VAL H CG2 1 
ATOM   3629  N N   . LYS C 3 13  ? 50.369  -0.264  55.945  1.00 51.45  ? 13  LYS H N   1 
ATOM   3630  C CA  . LYS C 3 13  ? 51.486  0.637   56.237  1.00 55.27  ? 13  LYS H CA  1 
ATOM   3631  C C   . LYS C 3 13  ? 51.443  1.851   55.306  1.00 55.99  ? 13  LYS H C   1 
ATOM   3632  O O   . LYS C 3 13  ? 50.822  1.804   54.233  1.00 56.98  ? 13  LYS H O   1 
ATOM   3633  C CB  . LYS C 3 13  ? 52.842  -0.106  56.165  1.00 57.79  ? 13  LYS H CB  1 
ATOM   3634  C CG  . LYS C 3 13  ? 53.083  -1.002  54.916  1.00 61.04  ? 13  LYS H CG  1 
ATOM   3635  C CD  . LYS C 3 13  ? 51.828  -1.776  54.397  1.00 62.58  ? 13  LYS H CD  1 
ATOM   3636  C CE  . LYS C 3 13  ? 51.439  -3.014  55.241  1.00 61.02  ? 13  LYS H CE  1 
ATOM   3637  N NZ  . LYS C 3 13  ? 50.255  -3.744  54.659  1.00 44.99  ? 13  LYS H NZ  1 
ATOM   3638  N N   . PRO C 3 14  ? 52.081  2.950   55.714  1.00 50.40  ? 14  PRO H N   1 
ATOM   3639  C CA  . PRO C 3 14  ? 52.009  4.157   54.883  1.00 45.25  ? 14  PRO H CA  1 
ATOM   3640  C C   . PRO C 3 14  ? 52.746  4.000   53.547  1.00 48.30  ? 14  PRO H C   1 
ATOM   3641  O O   . PRO C 3 14  ? 53.741  3.284   53.469  1.00 50.42  ? 14  PRO H O   1 
ATOM   3642  C CB  . PRO C 3 14  ? 52.680  5.195   55.753  1.00 44.80  ? 14  PRO H CB  1 
ATOM   3643  C CG  . PRO C 3 14  ? 52.539  4.648   57.165  1.00 47.38  ? 14  PRO H CG  1 
ATOM   3644  C CD  . PRO C 3 14  ? 52.719  3.192   57.014  1.00 47.21  ? 14  PRO H CD  1 
ATOM   3645  N N   . GLY C 3 15  ? 52.243  4.637   52.497  1.00 49.03  ? 15  GLY H N   1 
ATOM   3646  C CA  . GLY C 3 15  ? 52.900  4.592   51.205  1.00 46.28  ? 15  GLY H CA  1 
ATOM   3647  C C   . GLY C 3 15  ? 52.354  3.490   50.326  1.00 51.94  ? 15  GLY H C   1 
ATOM   3648  O O   . GLY C 3 15  ? 52.567  3.472   49.105  1.00 56.81  ? 15  GLY H O   1 
ATOM   3649  N N   . ALA C 3 16  ? 51.641  2.558   50.942  1.00 51.49  ? 16  ALA H N   1 
ATOM   3650  C CA  . ALA C 3 16  ? 50.974  1.520   50.170  1.00 53.89  ? 16  ALA H CA  1 
ATOM   3651  C C   . ALA C 3 16  ? 49.553  1.938   49.796  1.00 49.46  ? 16  ALA H C   1 
ATOM   3652  O O   . ALA C 3 16  ? 49.220  3.130   49.837  1.00 46.69  ? 16  ALA H O   1 
ATOM   3653  C CB  . ALA C 3 16  ? 50.959  0.220   50.933  1.00 56.16  ? 16  ALA H CB  1 
ATOM   3654  N N   . SER C 3 17  ? 48.738  0.949   49.418  1.00 48.17  ? 17  SER H N   1 
ATOM   3655  C CA  . SER C 3 17  ? 47.328  1.144   49.054  1.00 43.52  ? 17  SER H CA  1 
ATOM   3656  C C   . SER C 3 17  ? 46.490  -0.002  49.582  1.00 38.85  ? 17  SER H C   1 
ATOM   3657  O O   . SER C 3 17  ? 47.027  -1.056  49.907  1.00 40.02  ? 17  SER H O   1 
ATOM   3658  C CB  . SER C 3 17  ? 47.165  1.198   47.528  1.00 45.04  ? 17  SER H CB  1 
ATOM   3659  O OG  . SER C 3 17  ? 47.944  0.197   46.884  1.00 44.85  ? 17  SER H OG  1 
ATOM   3660  N N   . VAL C 3 18  ? 45.179  0.200   49.676  1.00 38.78  ? 18  VAL H N   1 
ATOM   3661  C CA  . VAL C 3 18  ? 44.257  -0.920  49.856  1.00 36.33  ? 18  VAL H CA  1 
ATOM   3662  C C   . VAL C 3 18  ? 43.276  -0.905  48.733  1.00 33.25  ? 18  VAL H C   1 
ATOM   3663  O O   . VAL C 3 18  ? 43.220  0.071   48.001  1.00 33.07  ? 18  VAL H O   1 
ATOM   3664  C CB  . VAL C 3 18  ? 43.454  -0.895  51.179  1.00 39.30  ? 18  VAL H CB  1 
ATOM   3665  C CG1 . VAL C 3 18  ? 43.981  -1.964  52.150  1.00 40.10  ? 18  VAL H CG1 1 
ATOM   3666  C CG2 . VAL C 3 18  ? 43.391  0.510   51.794  1.00 36.33  ? 18  VAL H CG2 1 
ATOM   3667  N N   . LYS C 3 19  ? 42.528  -2.004  48.598  1.00 36.55  ? 19  LYS H N   1 
ATOM   3668  C CA  . LYS C 3 19  ? 41.387  -2.102  47.671  1.00 36.54  ? 19  LYS H CA  1 
ATOM   3669  C C   . LYS C 3 19  ? 40.173  -2.644  48.404  1.00 31.27  ? 19  LYS H C   1 
ATOM   3670  O O   . LYS C 3 19  ? 40.170  -3.779  48.851  1.00 29.94  ? 19  LYS H O   1 
ATOM   3671  C CB  . LYS C 3 19  ? 41.703  -2.997  46.472  1.00 36.14  ? 19  LYS H CB  1 
ATOM   3672  C CG  . LYS C 3 19  ? 41.205  -2.482  45.128  1.00 34.63  ? 19  LYS H CG  1 
ATOM   3673  C CD  . LYS C 3 19  ? 41.388  -3.560  44.088  1.00 33.19  ? 19  LYS H CD  1 
ATOM   3674  C CE  . LYS C 3 19  ? 41.040  -3.102  42.709  1.00 30.19  ? 19  LYS H CE  1 
ATOM   3675  N NZ  . LYS C 3 19  ? 40.985  -4.345  41.908  1.00 38.37  ? 19  LYS H NZ  1 
ATOM   3676  N N   . ILE C 3 20  ? 39.149  -1.805  48.501  1.00 28.82  ? 20  ILE H N   1 
ATOM   3677  C CA  . ILE C 3 20  ? 37.963  -2.055  49.298  1.00 28.74  ? 20  ILE H CA  1 
ATOM   3678  C C   . ILE C 3 20  ? 36.779  -2.522  48.443  1.00 27.52  ? 20  ILE H C   1 
ATOM   3679  O O   . ILE C 3 20  ? 36.370  -1.827  47.542  1.00 30.64  ? 20  ILE H O   1 
ATOM   3680  C CB  . ILE C 3 20  ? 37.590  -0.747  50.030  1.00 30.78  ? 20  ILE H CB  1 
ATOM   3681  C CG1 . ILE C 3 20  ? 38.637  -0.405  51.099  1.00 32.94  ? 20  ILE H CG1 1 
ATOM   3682  C CG2 . ILE C 3 20  ? 36.210  -0.811  50.632  1.00 35.40  ? 20  ILE H CG2 1 
ATOM   3683  C CD1 . ILE C 3 20  ? 39.122  -1.595  51.893  1.00 35.77  ? 20  ILE H CD1 1 
ATOM   3684  N N   . SER C 3 21  ? 36.224  -3.690  48.728  1.00 24.17  ? 21  SER H N   1 
ATOM   3685  C CA  . SER C 3 21  ? 35.069  -4.214  47.989  1.00 28.31  ? 21  SER H CA  1 
ATOM   3686  C C   . SER C 3 21  ? 33.648  -3.796  48.465  1.00 35.73  ? 21  SER H C   1 
ATOM   3687  O O   . SER C 3 21  ? 33.423  -3.379  49.608  1.00 36.15  ? 21  SER H O   1 
ATOM   3688  C CB  . SER C 3 21  ? 35.075  -5.729  48.086  1.00 30.33  ? 21  SER H CB  1 
ATOM   3689  O OG  . SER C 3 21  ? 34.164  -6.152  49.114  1.00 30.87  ? 21  SER H OG  1 
ATOM   3690  N N   . CYS C 3 22  ? 32.678  -3.984  47.579  1.00 33.34  ? 22  CYS H N   1 
ATOM   3691  C CA  . CYS C 3 22  ? 31.277  -3.959  47.945  1.00 30.49  ? 22  CYS H CA  1 
ATOM   3692  C C   . CYS C 3 22  ? 30.514  -4.965  47.089  1.00 31.16  ? 22  CYS H C   1 
ATOM   3693  O O   . CYS C 3 22  ? 30.270  -4.720  45.921  1.00 30.38  ? 22  CYS H O   1 
ATOM   3694  C CB  . CYS C 3 22  ? 30.710  -2.582  47.708  1.00 30.78  ? 22  CYS H CB  1 
ATOM   3695  S SG  . CYS C 3 22  ? 29.208  -2.261  48.634  1.00 54.26  ? 22  CYS H SG  1 
ATOM   3696  N N   . LYS C 3 23  ? 30.156  -6.110  47.657  1.00 33.48  ? 23  LYS H N   1 
ATOM   3697  C CA  . LYS C 3 23  ? 29.343  -7.083  46.941  1.00 31.36  ? 23  LYS H CA  1 
ATOM   3698  C C   . LYS C 3 23  ? 27.871  -6.837  47.146  1.00 33.85  ? 23  LYS H C   1 
ATOM   3699  O O   . LYS C 3 23  ? 27.353  -6.990  48.253  1.00 34.44  ? 23  LYS H O   1 
ATOM   3700  C CB  . LYS C 3 23  ? 29.638  -8.497  47.400  1.00 32.18  ? 23  LYS H CB  1 
ATOM   3701  C CG  . LYS C 3 23  ? 28.572  -9.476  46.956  1.00 33.04  ? 23  LYS H CG  1 
ATOM   3702  C CD  . LYS C 3 23  ? 29.130  -10.828 46.566  1.00 32.47  ? 23  LYS H CD  1 
ATOM   3703  C CE  . LYS C 3 23  ? 29.043  -11.024 45.062  1.00 35.14  ? 23  LYS H CE  1 
ATOM   3704  N NZ  . LYS C 3 23  ? 29.602  -12.364 44.704  1.00 50.13  ? 23  LYS H NZ  1 
ATOM   3705  N N   . VAL C 3 24  ? 27.200  -6.492  46.057  1.00 32.07  ? 24  VAL H N   1 
ATOM   3706  C CA  . VAL C 3 24  ? 25.783  -6.194  46.065  1.00 32.57  ? 24  VAL H CA  1 
ATOM   3707  C C   . VAL C 3 24  ? 24.924  -7.443  45.871  1.00 33.44  ? 24  VAL H C   1 
ATOM   3708  O O   . VAL C 3 24  ? 25.304  -8.368  45.151  1.00 31.98  ? 24  VAL H O   1 
ATOM   3709  C CB  . VAL C 3 24  ? 25.478  -5.294  44.912  1.00 32.50  ? 24  VAL H CB  1 
ATOM   3710  C CG1 . VAL C 3 24  ? 24.860  -6.113  43.809  1.00 34.19  ? 24  VAL H CG1 1 
ATOM   3711  C CG2 . VAL C 3 24  ? 24.555  -4.197  45.339  1.00 32.73  ? 24  VAL H CG2 1 
ATOM   3712  N N   . SER C 3 25  ? 23.754  -7.469  46.497  1.00 35.29  ? 25  SER H N   1 
ATOM   3713  C CA  . SER C 3 25  ? 22.859  -8.616  46.323  1.00 42.59  ? 25  SER H CA  1 
ATOM   3714  C C   . SER C 3 25  ? 21.370  -8.220  46.263  1.00 43.46  ? 25  SER H C   1 
ATOM   3715  O O   . SER C 3 25  ? 20.955  -7.250  46.902  1.00 41.86  ? 25  SER H O   1 
ATOM   3716  C CB  . SER C 3 25  ? 23.120  -9.691  47.401  1.00 42.93  ? 25  SER H CB  1 
ATOM   3717  O OG  . SER C 3 25  ? 22.283  -9.522  48.539  1.00 48.29  ? 25  SER H OG  1 
ATOM   3718  N N   . GLY C 3 26  ? 20.581  -8.963  45.482  1.00 42.64  ? 26  GLY H N   1 
ATOM   3719  C CA  . GLY C 3 26  ? 19.136  -8.768  45.449  1.00 45.41  ? 26  GLY H CA  1 
ATOM   3720  C C   . GLY C 3 26  ? 18.591  -7.825  44.377  1.00 44.00  ? 26  GLY H C   1 
ATOM   3721  O O   . GLY C 3 26  ? 17.493  -7.262  44.526  1.00 42.97  ? 26  GLY H O   1 
ATOM   3722  N N   . TYR C 3 27  ? 19.357  -7.658  43.298  1.00 39.15  ? 27  TYR H N   1 
ATOM   3723  C CA  . TYR C 3 27  ? 19.004  -6.739  42.226  1.00 33.79  ? 27  TYR H CA  1 
ATOM   3724  C C   . TYR C 3 27  ? 20.120  -6.668  41.202  1.00 36.00  ? 27  TYR H C   1 
ATOM   3725  O O   . TYR C 3 27  ? 21.284  -6.740  41.554  1.00 38.34  ? 27  TYR H O   1 
ATOM   3726  C CB  . TYR C 3 27  ? 18.737  -5.356  42.795  1.00 33.47  ? 27  TYR H CB  1 
ATOM   3727  C CG  . TYR C 3 27  ? 19.952  -4.450  42.973  1.00 34.87  ? 27  TYR H CG  1 
ATOM   3728  C CD1 . TYR C 3 27  ? 20.373  -3.647  41.941  1.00 36.48  ? 27  TYR H CD1 1 
ATOM   3729  C CD2 . TYR C 3 27  ? 20.627  -4.345  44.183  1.00 33.34  ? 27  TYR H CD2 1 
ATOM   3730  C CE1 . TYR C 3 27  ? 21.442  -2.780  42.082  1.00 39.15  ? 27  TYR H CE1 1 
ATOM   3731  C CE2 . TYR C 3 27  ? 21.702  -3.471  44.332  1.00 34.16  ? 27  TYR H CE2 1 
ATOM   3732  C CZ  . TYR C 3 27  ? 22.114  -2.688  43.261  1.00 37.44  ? 27  TYR H CZ  1 
ATOM   3733  O OH  . TYR C 3 27  ? 23.186  -1.795  43.296  1.00 30.80  ? 27  TYR H OH  1 
ATOM   3734  N N   . ALA C 3 28  ? 19.761  -6.544  39.929  1.00 36.10  ? 28  ALA H N   1 
ATOM   3735  C CA  . ALA C 3 28  ? 20.737  -6.394  38.853  1.00 30.28  ? 28  ALA H CA  1 
ATOM   3736  C C   . ALA C 3 28  ? 21.546  -5.141  39.053  1.00 27.33  ? 28  ALA H C   1 
ATOM   3737  O O   . ALA C 3 28  ? 20.972  -4.089  39.200  1.00 26.69  ? 28  ALA H O   1 
ATOM   3738  C CB  . ALA C 3 28  ? 20.018  -6.321  37.526  1.00 30.36  ? 28  ALA H CB  1 
ATOM   3739  N N   . ILE C 3 29  ? 22.873  -5.254  39.009  1.00 30.68  ? 29  ILE H N   1 
ATOM   3740  C CA  . ILE C 3 29  ? 23.769  -4.144  39.359  1.00 30.23  ? 29  ILE H CA  1 
ATOM   3741  C C   . ILE C 3 29  ? 24.137  -3.124  38.286  1.00 28.26  ? 29  ILE H C   1 
ATOM   3742  O O   . ILE C 3 29  ? 24.593  -2.045  38.610  1.00 32.37  ? 29  ILE H O   1 
ATOM   3743  C CB  . ILE C 3 29  ? 25.107  -4.617  39.901  1.00 29.09  ? 29  ILE H CB  1 
ATOM   3744  C CG1 . ILE C 3 29  ? 25.734  -3.519  40.763  1.00 29.47  ? 29  ILE H CG1 1 
ATOM   3745  C CG2 . ILE C 3 29  ? 26.034  -4.914  38.754  1.00 32.26  ? 29  ILE H CG2 1 
ATOM   3746  C CD1 . ILE C 3 29  ? 27.231  -3.711  41.063  1.00 32.46  ? 29  ILE H CD1 1 
ATOM   3747  N N   . SER C 3 30  ? 23.970  -3.408  37.019  1.00 23.62  ? 30  SER H N   1 
ATOM   3748  C CA  . SER C 3 30  ? 24.503  -2.437  36.101  1.00 25.17  ? 30  SER H CA  1 
ATOM   3749  C C   . SER C 3 30  ? 23.682  -1.197  35.928  1.00 27.79  ? 30  SER H C   1 
ATOM   3750  O O   . SER C 3 30  ? 24.106  -0.313  35.213  1.00 30.04  ? 30  SER H O   1 
ATOM   3751  C CB  . SER C 3 30  ? 24.747  -3.067  34.763  1.00 30.30  ? 30  SER H CB  1 
ATOM   3752  O OG  . SER C 3 30  ? 25.066  -4.424  34.984  1.00 42.88  ? 30  SER H OG  1 
ATOM   3753  N N   . SER C 3 31  ? 22.531  -1.101  36.589  1.00 32.42  ? 31  SER H N   1 
ATOM   3754  C CA  . SER C 3 31  ? 21.535  -0.041  36.278  1.00 33.29  ? 31  SER H CA  1 
ATOM   3755  C C   . SER C 3 31  ? 21.425  1.107   37.259  1.00 33.97  ? 31  SER H C   1 
ATOM   3756  O O   . SER C 3 31  ? 20.792  2.122   36.944  1.00 32.75  ? 31  SER H O   1 
ATOM   3757  C CB  . SER C 3 31  ? 20.131  -0.610  36.125  1.00 29.94  ? 31  SER H CB  1 
ATOM   3758  O OG  . SER C 3 31  ? 20.120  -1.620  35.147  1.00 35.87  ? 31  SER H OG  1 
ATOM   3759  N N   . SER C 3 32  ? 22.019  0.960   38.441  1.00 33.56  ? 32  SER H N   1 
ATOM   3760  C CA  . SER C 3 32  ? 22.021  2.064   39.401  1.00 34.50  ? 32  SER H CA  1 
ATOM   3761  C C   . SER C 3 32  ? 23.434  2.563   39.706  1.00 31.45  ? 32  SER H C   1 
ATOM   3762  O O   . SER C 3 32  ? 24.344  1.766   39.912  1.00 31.02  ? 32  SER H O   1 
ATOM   3763  C CB  . SER C 3 32  ? 21.301  1.641   40.683  1.00 37.85  ? 32  SER H CB  1 
ATOM   3764  O OG  . SER C 3 32  ? 20.485  0.505   40.427  1.00 41.87  ? 32  SER H OG  1 
ATOM   3765  N N   . TRP C 3 33  ? 23.604  3.881   39.716  1.00 30.07  ? 33  TRP H N   1 
ATOM   3766  C CA  . TRP C 3 33  ? 24.872  4.493   40.079  1.00 33.79  ? 33  TRP H CA  1 
ATOM   3767  C C   . TRP C 3 33  ? 25.224  4.082   41.518  1.00 32.38  ? 33  TRP H C   1 
ATOM   3768  O O   . TRP C 3 33  ? 24.345  3.915   42.340  1.00 32.94  ? 33  TRP H O   1 
ATOM   3769  C CB  . TRP C 3 33  ? 24.797  6.037   39.977  1.00 35.19  ? 33  TRP H CB  1 
ATOM   3770  C CG  . TRP C 3 33  ? 24.794  6.664   38.587  1.00 34.86  ? 33  TRP H CG  1 
ATOM   3771  C CD1 . TRP C 3 33  ? 23.736  6.773   37.748  1.00 38.68  ? 33  TRP H CD1 1 
ATOM   3772  C CD2 . TRP C 3 33  ? 25.886  7.312   37.924  1.00 37.57  ? 33  TRP H CD2 1 
ATOM   3773  N NE1 . TRP C 3 33  ? 24.098  7.416   36.586  1.00 35.73  ? 33  TRP H NE1 1 
ATOM   3774  C CE2 . TRP C 3 33  ? 25.414  7.761   36.676  1.00 38.42  ? 33  TRP H CE2 1 
ATOM   3775  C CE3 . TRP C 3 33  ? 27.219  7.538   38.251  1.00 37.84  ? 33  TRP H CE3 1 
ATOM   3776  C CZ2 . TRP C 3 33  ? 26.225  8.428   35.767  1.00 40.15  ? 33  TRP H CZ2 1 
ATOM   3777  C CZ3 . TRP C 3 33  ? 28.018  8.200   37.336  1.00 41.22  ? 33  TRP H CZ3 1 
ATOM   3778  C CH2 . TRP C 3 33  ? 27.517  8.637   36.114  1.00 38.66  ? 33  TRP H CH2 1 
ATOM   3779  N N   . MET C 3 34  ? 26.508  3.953   41.832  1.00 31.07  ? 34  MET H N   1 
ATOM   3780  C CA  . MET C 3 34  ? 26.947  3.627   43.184  1.00 30.34  ? 34  MET H CA  1 
ATOM   3781  C C   . MET C 3 34  ? 27.918  4.669   43.739  1.00 31.99  ? 34  MET H C   1 
ATOM   3782  O O   . MET C 3 34  ? 28.948  4.890   43.127  1.00 38.40  ? 34  MET H O   1 
ATOM   3783  C CB  . MET C 3 34  ? 27.680  2.307   43.125  1.00 28.69  ? 34  MET H CB  1 
ATOM   3784  C CG  . MET C 3 34  ? 28.139  1.831   44.455  1.00 33.35  ? 34  MET H CG  1 
ATOM   3785  S SD  . MET C 3 34  ? 26.782  1.202   45.468  1.00 51.71  ? 34  MET H SD  1 
ATOM   3786  C CE  . MET C 3 34  ? 26.932  -0.581  45.300  1.00 28.85  ? 34  MET H CE  1 
ATOM   3787  N N   . ASN C 3 35  ? 27.643  5.307   44.878  1.00 31.15  ? 35  ASN H N   1 
ATOM   3788  C CA  . ASN C 3 35  ? 28.677  6.176   45.457  1.00 29.11  ? 35  ASN H CA  1 
ATOM   3789  C C   . ASN C 3 35  ? 29.447  5.574   46.594  1.00 27.48  ? 35  ASN H C   1 
ATOM   3790  O O   . ASN C 3 35  ? 29.094  4.533   47.101  1.00 30.01  ? 35  ASN H O   1 
ATOM   3791  C CB  . ASN C 3 35  ? 28.206  7.554   45.931  1.00 33.45  ? 35  ASN H CB  1 
ATOM   3792  C CG  . ASN C 3 35  ? 26.834  7.943   45.440  1.00 40.94  ? 35  ASN H CG  1 
ATOM   3793  O OD1 . ASN C 3 35  ? 25.826  7.369   45.858  1.00 39.63  ? 35  ASN H OD1 1 
ATOM   3794  N ND2 . ASN C 3 35  ? 26.780  8.992   44.611  1.00 39.15  ? 35  ASN H ND2 1 
ATOM   3795  N N   . TRP C 3 36  ? 30.512  6.280   46.973  1.00 29.59  ? 36  TRP H N   1 
ATOM   3796  C CA  . TRP C 3 36  ? 31.398  5.971   48.121  1.00 29.82  ? 36  TRP H CA  1 
ATOM   3797  C C   . TRP C 3 36  ? 31.631  7.202   48.965  1.00 28.88  ? 36  TRP H C   1 
ATOM   3798  O O   . TRP C 3 36  ? 31.884  8.265   48.421  1.00 32.59  ? 36  TRP H O   1 
ATOM   3799  C CB  . TRP C 3 36  ? 32.784  5.588   47.643  1.00 27.13  ? 36  TRP H CB  1 
ATOM   3800  C CG  . TRP C 3 36  ? 32.848  4.378   46.839  1.00 26.21  ? 36  TRP H CG  1 
ATOM   3801  C CD1 . TRP C 3 36  ? 32.745  4.276   45.491  1.00 23.79  ? 36  TRP H CD1 1 
ATOM   3802  C CD2 . TRP C 3 36  ? 33.055  3.066   47.336  1.00 25.39  ? 36  TRP H CD2 1 
ATOM   3803  N NE1 . TRP C 3 36  ? 32.881  2.971   45.120  1.00 26.62  ? 36  TRP H NE1 1 
ATOM   3804  C CE2 . TRP C 3 36  ? 33.065  2.208   46.241  1.00 23.87  ? 36  TRP H CE2 1 
ATOM   3805  C CE3 . TRP C 3 36  ? 33.229  2.536   48.616  1.00 27.40  ? 36  TRP H CE3 1 
ATOM   3806  C CZ2 . TRP C 3 36  ? 33.250  0.862   46.372  1.00 25.22  ? 36  TRP H CZ2 1 
ATOM   3807  C CZ3 . TRP C 3 36  ? 33.411  1.204   48.752  1.00 28.04  ? 36  TRP H CZ3 1 
ATOM   3808  C CH2 . TRP C 3 36  ? 33.425  0.373   47.634  1.00 29.73  ? 36  TRP H CH2 1 
ATOM   3809  N N   . VAL C 3 37  ? 31.600  7.081   50.283  1.00 28.02  ? 37  VAL H N   1 
ATOM   3810  C CA  . VAL C 3 37  ? 31.795  8.266   51.128  1.00 32.17  ? 37  VAL H CA  1 
ATOM   3811  C C   . VAL C 3 37  ? 32.672  7.984   52.338  1.00 34.40  ? 37  VAL H C   1 
ATOM   3812  O O   . VAL C 3 37  ? 32.776  6.845   52.774  1.00 36.59  ? 37  VAL H O   1 
ATOM   3813  C CB  . VAL C 3 37  ? 30.462  8.815   51.609  1.00 33.37  ? 37  VAL H CB  1 
ATOM   3814  C CG1 . VAL C 3 37  ? 29.386  7.797   51.364  1.00 32.66  ? 37  VAL H CG1 1 
ATOM   3815  C CG2 . VAL C 3 37  ? 30.529  9.150   53.081  1.00 35.75  ? 37  VAL H CG2 1 
ATOM   3816  N N   . LYS C 3 38  ? 33.289  9.021   52.888  1.00 34.73  ? 38  LYS H N   1 
ATOM   3817  C CA  . LYS C 3 38  ? 34.307  8.844   53.921  1.00 38.42  ? 38  LYS H CA  1 
ATOM   3818  C C   . LYS C 3 38  ? 33.889  9.407   55.276  1.00 40.00  ? 38  LYS H C   1 
ATOM   3819  O O   . LYS C 3 38  ? 33.301  10.478  55.356  1.00 42.60  ? 38  LYS H O   1 
ATOM   3820  C CB  . LYS C 3 38  ? 35.626  9.472   53.456  1.00 39.25  ? 38  LYS H CB  1 
ATOM   3821  C CG  . LYS C 3 38  ? 36.544  9.930   54.553  1.00 40.11  ? 38  LYS H CG  1 
ATOM   3822  C CD  . LYS C 3 38  ? 37.956  9.887   54.049  1.00 41.34  ? 38  LYS H CD  1 
ATOM   3823  C CE  . LYS C 3 38  ? 38.857  10.811  54.827  1.00 43.44  ? 38  LYS H CE  1 
ATOM   3824  N NZ  . LYS C 3 38  ? 40.092  11.125  54.047  1.00 47.26  ? 38  LYS H NZ  1 
ATOM   3825  N N   . GLN C 3 39  ? 34.176  8.675   56.344  1.00 40.73  ? 39  GLN H N   1 
ATOM   3826  C CA  . GLN C 3 39  ? 33.910  9.201   57.665  1.00 43.58  ? 39  GLN H CA  1 
ATOM   3827  C C   . GLN C 3 39  ? 35.123  9.070   58.553  1.00 50.59  ? 39  GLN H C   1 
ATOM   3828  O O   . GLN C 3 39  ? 35.328  8.042   59.205  1.00 51.61  ? 39  GLN H O   1 
ATOM   3829  C CB  . GLN C 3 39  ? 32.719  8.515   58.302  1.00 41.06  ? 39  GLN H CB  1 
ATOM   3830  C CG  . GLN C 3 39  ? 32.243  9.214   59.540  1.00 43.58  ? 39  GLN H CG  1 
ATOM   3831  C CD  . GLN C 3 39  ? 30.883  8.726   59.985  1.00 46.15  ? 39  GLN H CD  1 
ATOM   3832  O OE1 . GLN C 3 39  ? 30.617  7.520   59.998  1.00 44.24  ? 39  GLN H OE1 1 
ATOM   3833  N NE2 . GLN C 3 39  ? 30.009  9.661   60.358  1.00 46.16  ? 39  GLN H NE2 1 
ATOM   3834  N N   . ARG C 3 40  ? 35.933  10.127  58.536  1.00 53.93  ? 40  ARG H N   1 
ATOM   3835  C CA  . ARG C 3 40  ? 37.047  10.326  59.464  1.00 61.22  ? 40  ARG H CA  1 
ATOM   3836  C C   . ARG C 3 40  ? 36.446  10.319  60.865  1.00 67.01  ? 40  ARG H C   1 
ATOM   3837  O O   . ARG C 3 40  ? 35.408  10.959  61.086  1.00 74.33  ? 40  ARG H O   1 
ATOM   3838  C CB  . ARG C 3 40  ? 37.681  11.692  59.173  1.00 66.19  ? 40  ARG H CB  1 
ATOM   3839  C CG  . ARG C 3 40  ? 39.153  11.847  59.483  1.00 59.70  ? 40  ARG H CG  1 
ATOM   3840  C CD  . ARG C 3 40  ? 40.010  11.458  58.315  1.00 54.34  ? 40  ARG H CD  1 
ATOM   3841  N NE  . ARG C 3 40  ? 41.422  11.373  58.681  1.00 69.09  ? 40  ARG H NE  1 
ATOM   3842  C CZ  . ARG C 3 40  ? 41.927  10.587  59.643  1.00 72.10  ? 40  ARG H CZ  1 
ATOM   3843  N NH1 . ARG C 3 40  ? 41.137  9.803   60.378  1.00 68.64  ? 40  ARG H NH1 1 
ATOM   3844  N NH2 . ARG C 3 40  ? 43.236  10.591  59.887  1.00 64.24  ? 40  ARG H NH2 1 
ATOM   3845  N N   . PRO C 3 41  ? 37.083  9.628   61.785  1.00 66.15  ? 41  PRO H N   1 
ATOM   3846  C CA  . PRO C 3 41  ? 36.532  9.368   63.106  1.00 69.99  ? 41  PRO H CA  1 
ATOM   3847  C C   . PRO C 3 41  ? 35.697  10.469  63.698  1.00 69.84  ? 41  PRO H C   1 
ATOM   3848  O O   . PRO C 3 41  ? 36.147  11.573  63.929  1.00 68.99  ? 41  PRO H O   1 
ATOM   3849  C CB  . PRO C 3 41  ? 37.778  9.138   63.929  1.00 72.71  ? 41  PRO H CB  1 
ATOM   3850  C CG  . PRO C 3 41  ? 38.689  8.506   62.978  1.00 72.64  ? 41  PRO H CG  1 
ATOM   3851  C CD  . PRO C 3 41  ? 38.510  9.310   61.749  1.00 64.63  ? 41  PRO H CD  1 
ATOM   3852  N N   . GLY C 3 42  ? 34.450  10.129  63.949  1.00 69.79  ? 42  GLY H N   1 
ATOM   3853  C CA  . GLY C 3 42  ? 33.510  11.051  64.528  1.00 80.42  ? 42  GLY H CA  1 
ATOM   3854  C C   . GLY C 3 42  ? 33.095  12.213  63.664  1.00 83.02  ? 42  GLY H C   1 
ATOM   3855  O O   . GLY C 3 42  ? 31.918  12.480  63.540  1.00 80.50  ? 42  GLY H O   1 
ATOM   3856  N N   . GLN C 3 43  ? 34.051  12.915  63.072  1.00 79.31  ? 43  GLN H N   1 
ATOM   3857  C CA  . GLN C 3 43  ? 33.774  14.250  62.571  1.00 82.53  ? 43  GLN H CA  1 
ATOM   3858  C C   . GLN C 3 43  ? 32.671  14.490  61.536  1.00 83.34  ? 43  GLN H C   1 
ATOM   3859  O O   . GLN C 3 43  ? 31.875  15.381  61.744  1.00 83.15  ? 43  GLN H O   1 
ATOM   3860  C CB  . GLN C 3 43  ? 35.048  15.071  62.322  1.00 77.02  ? 43  GLN H CB  1 
ATOM   3861  C CG  . GLN C 3 43  ? 35.963  14.617  61.237  1.00 79.90  ? 43  GLN H CG  1 
ATOM   3862  C CD  . GLN C 3 43  ? 36.940  15.693  60.848  1.00 86.15  ? 43  GLN H CD  1 
ATOM   3863  O OE1 . GLN C 3 43  ? 36.850  16.815  61.308  1.00 87.30  ? 43  GLN H OE1 1 
ATOM   3864  N NE2 . GLN C 3 43  ? 37.871  15.358  59.990  1.00 77.95  ? 43  GLN H NE2 1 
ATOM   3865  N N   . GLY C 3 44  ? 32.582  13.736  60.446  1.00 74.28  ? 44  GLY H N   1 
ATOM   3866  C CA  . GLY C 3 44  ? 31.494  13.978  59.504  1.00 62.70  ? 44  GLY H CA  1 
ATOM   3867  C C   . GLY C 3 44  ? 31.522  13.203  58.215  1.00 56.29  ? 44  GLY H C   1 
ATOM   3868  O O   . GLY C 3 44  ? 32.468  12.512  57.974  1.00 59.16  ? 44  GLY H O   1 
ATOM   3869  N N   . LEU C 3 45  ? 30.497  13.297  57.381  1.00 46.97  ? 45  LEU H N   1 
ATOM   3870  C CA  . LEU C 3 45  ? 30.575  12.588  56.098  1.00 41.80  ? 45  LEU H CA  1 
ATOM   3871  C C   . LEU C 3 45  ? 31.239  13.445  55.022  1.00 40.85  ? 45  LEU H C   1 
ATOM   3872  O O   . LEU C 3 45  ? 31.142  14.659  55.072  1.00 43.37  ? 45  LEU H O   1 
ATOM   3873  C CB  . LEU C 3 45  ? 29.180  12.201  55.601  1.00 46.43  ? 45  LEU H CB  1 
ATOM   3874  C CG  . LEU C 3 45  ? 28.197  11.212  56.254  1.00 42.29  ? 45  LEU H CG  1 
ATOM   3875  C CD1 . LEU C 3 45  ? 28.891  10.131  57.071  1.00 38.78  ? 45  LEU H CD1 1 
ATOM   3876  C CD2 . LEU C 3 45  ? 27.146  11.959  57.048  1.00 34.37  ? 45  LEU H CD2 1 
ATOM   3877  N N   . GLU C 3 46  ? 31.880  12.813  54.040  1.00 40.19  ? 46  GLU H N   1 
ATOM   3878  C CA  . GLU C 3 46  ? 32.580  13.506  52.949  1.00 37.26  ? 46  GLU H CA  1 
ATOM   3879  C C   . GLU C 3 46  ? 32.518  12.649  51.679  1.00 37.36  ? 46  GLU H C   1 
ATOM   3880  O O   . GLU C 3 46  ? 32.661  11.436  51.751  1.00 38.49  ? 46  GLU H O   1 
ATOM   3881  C CB  . GLU C 3 46  ? 34.035  13.751  53.345  1.00 39.58  ? 46  GLU H CB  1 
ATOM   3882  C CG  . GLU C 3 46  ? 34.651  14.972  52.699  1.00 46.32  ? 46  GLU H CG  1 
ATOM   3883  C CD  . GLU C 3 46  ? 36.162  15.107  52.930  1.00 56.89  ? 46  GLU H CD  1 
ATOM   3884  O OE1 . GLU C 3 46  ? 36.728  16.107  52.421  1.00 58.32  ? 46  GLU H OE1 1 
ATOM   3885  O OE2 . GLU C 3 46  ? 36.779  14.237  53.604  1.00 55.29  ? 46  GLU H OE2 1 
ATOM   3886  N N   . TRP C 3 47  ? 32.313  13.254  50.513  1.00 37.60  ? 47  TRP H N   1 
ATOM   3887  C CA  . TRP C 3 47  ? 31.928  12.467  49.315  1.00 41.12  ? 47  TRP H CA  1 
ATOM   3888  C C   . TRP C 3 47  ? 33.045  12.183  48.287  1.00 35.73  ? 47  TRP H C   1 
ATOM   3889  O O   . TRP C 3 47  ? 33.622  13.096  47.737  1.00 36.33  ? 47  TRP H O   1 
ATOM   3890  C CB  . TRP C 3 47  ? 30.710  13.132  48.635  1.00 39.80  ? 47  TRP H CB  1 
ATOM   3891  C CG  . TRP C 3 47  ? 30.200  12.433  47.418  1.00 36.88  ? 47  TRP H CG  1 
ATOM   3892  C CD1 . TRP C 3 47  ? 29.460  11.308  47.380  1.00 36.76  ? 47  TRP H CD1 1 
ATOM   3893  C CD2 . TRP C 3 47  ? 30.383  12.837  46.069  1.00 38.41  ? 47  TRP H CD2 1 
ATOM   3894  N NE1 . TRP C 3 47  ? 29.166  10.966  46.085  1.00 34.73  ? 47  TRP H NE1 1 
ATOM   3895  C CE2 . TRP C 3 47  ? 29.733  11.893  45.260  1.00 39.16  ? 47  TRP H CE2 1 
ATOM   3896  C CE3 . TRP C 3 47  ? 31.051  13.897  45.463  1.00 41.51  ? 47  TRP H CE3 1 
ATOM   3897  C CZ2 . TRP C 3 47  ? 29.733  11.975  43.880  1.00 41.70  ? 47  TRP H CZ2 1 
ATOM   3898  C CZ3 . TRP C 3 47  ? 31.048  13.980  44.096  1.00 42.49  ? 47  TRP H CZ3 1 
ATOM   3899  C CH2 . TRP C 3 47  ? 30.389  13.029  43.317  1.00 41.67  ? 47  TRP H CH2 1 
ATOM   3900  N N   . ILE C 3 48  ? 33.338  10.924  48.007  1.00 33.21  ? 48  ILE H N   1 
ATOM   3901  C CA  . ILE C 3 48  ? 34.510  10.642  47.182  1.00 36.56  ? 48  ILE H CA  1 
ATOM   3902  C C   . ILE C 3 48  ? 34.232  10.607  45.697  1.00 38.14  ? 48  ILE H C   1 
ATOM   3903  O O   . ILE C 3 48  ? 35.138  10.827  44.918  1.00 41.81  ? 48  ILE H O   1 
ATOM   3904  C CB  . ILE C 3 48  ? 35.180  9.299   47.495  1.00 33.38  ? 48  ILE H CB  1 
ATOM   3905  C CG1 . ILE C 3 48  ? 35.772  9.271   48.899  1.00 34.02  ? 48  ILE H CG1 1 
ATOM   3906  C CG2 . ILE C 3 48  ? 36.245  9.023   46.482  1.00 29.01  ? 48  ILE H CG2 1 
ATOM   3907  C CD1 . ILE C 3 48  ? 35.968  7.845   49.440  1.00 33.25  ? 48  ILE H CD1 1 
ATOM   3908  N N   . GLY C 3 49  ? 33.008  10.288  45.293  1.00 38.44  ? 49  GLY H N   1 
ATOM   3909  C CA  . GLY C 3 49  ? 32.690  10.189  43.874  1.00 36.80  ? 49  GLY H CA  1 
ATOM   3910  C C   . GLY C 3 49  ? 31.774  9.034   43.543  1.00 36.14  ? 49  GLY H C   1 
ATOM   3911  O O   . GLY C 3 49  ? 31.467  8.217   44.397  1.00 35.97  ? 49  GLY H O   1 
ATOM   3912  N N   . ARG C 3 50  ? 31.332  8.952   42.298  1.00 36.74  ? 50  ARG H N   1 
ATOM   3913  C CA  . ARG C 3 50  ? 30.319  7.965   41.950  1.00 35.93  ? 50  ARG H CA  1 
ATOM   3914  C C   . ARG C 3 50  ? 30.629  7.247   40.651  1.00 36.48  ? 50  ARG H C   1 
ATOM   3915  O O   . ARG C 3 50  ? 31.349  7.770   39.812  1.00 38.90  ? 50  ARG H O   1 
ATOM   3916  C CB  . ARG C 3 50  ? 28.951  8.643   41.860  1.00 37.43  ? 50  ARG H CB  1 
ATOM   3917  C CG  . ARG C 3 50  ? 28.813  9.643   40.728  1.00 36.27  ? 50  ARG H CG  1 
ATOM   3918  C CD  . ARG C 3 50  ? 27.573  10.514  40.895  1.00 41.85  ? 50  ARG H CD  1 
ATOM   3919  N NE  . ARG C 3 50  ? 26.550  10.305  39.862  1.00 48.49  ? 50  ARG H NE  1 
ATOM   3920  C CZ  . ARG C 3 50  ? 25.299  9.897   40.111  1.00 48.23  ? 50  ARG H CZ  1 
ATOM   3921  N NH1 . ARG C 3 50  ? 24.916  9.651   41.361  1.00 45.77  ? 50  ARG H NH1 1 
ATOM   3922  N NH2 . ARG C 3 50  ? 24.424  9.732   39.119  1.00 44.67  ? 50  ARG H NH2 1 
ATOM   3923  N N   . ILE C 3 51  ? 30.061  6.060   40.477  1.00 34.24  ? 51  ILE H N   1 
ATOM   3924  C CA  . ILE C 3 51  ? 30.296  5.257   39.276  1.00 35.90  ? 51  ILE H CA  1 
ATOM   3925  C C   . ILE C 3 51  ? 29.039  4.545   38.706  1.00 38.73  ? 51  ILE H C   1 
ATOM   3926  O O   . ILE C 3 51  ? 28.269  3.897   39.430  1.00 32.32  ? 51  ILE H O   1 
ATOM   3927  C CB  . ILE C 3 51  ? 31.380  4.200   39.544  1.00 34.22  ? 51  ILE H CB  1 
ATOM   3928  C CG1 . ILE C 3 51  ? 31.739  3.444   38.265  1.00 34.54  ? 51  ILE H CG1 1 
ATOM   3929  C CG2 . ILE C 3 51  ? 30.929  3.233   40.637  1.00 29.79  ? 51  ILE H CG2 1 
ATOM   3930  C CD1 . ILE C 3 51  ? 32.769  2.360   38.499  1.00 35.43  ? 51  ILE H CD1 1 
ATOM   3931  N N   . TYR C 3 52  ? 28.842  4.659   37.393  1.00 42.33  ? 52  TYR H N   1 
ATOM   3932  C CA  . TYR C 3 52  ? 27.819  3.852   36.714  1.00 39.09  ? 52  TYR H CA  1 
ATOM   3933  C C   . TYR C 3 52  ? 28.412  2.518   36.299  1.00 35.30  ? 52  TYR H C   1 
ATOM   3934  O O   . TYR C 3 52  ? 29.208  2.464   35.378  1.00 38.50  ? 52  TYR H O   1 
ATOM   3935  C CB  . TYR C 3 52  ? 27.220  4.563   35.484  1.00 36.99  ? 52  TYR H CB  1 
ATOM   3936  C CG  . TYR C 3 52  ? 26.001  3.831   34.935  1.00 39.68  ? 52  TYR H CG  1 
ATOM   3937  C CD1 . TYR C 3 52  ? 24.799  3.838   35.636  1.00 37.11  ? 52  TYR H CD1 1 
ATOM   3938  C CD2 . TYR C 3 52  ? 26.050  3.117   33.728  1.00 40.83  ? 52  TYR H CD2 1 
ATOM   3939  C CE1 . TYR C 3 52  ? 23.668  3.168   35.156  1.00 36.82  ? 52  TYR H CE1 1 
ATOM   3940  C CE2 . TYR C 3 52  ? 24.909  2.441   33.236  1.00 41.49  ? 52  TYR H CE2 1 
ATOM   3941  C CZ  . TYR C 3 52  ? 23.720  2.473   33.968  1.00 38.22  ? 52  TYR H CZ  1 
ATOM   3942  O OH  . TYR C 3 52  ? 22.582  1.814   33.538  1.00 31.96  ? 52  TYR H OH  1 
ATOM   3943  N N   . PRO C 3 53  A 28.039  1.444   36.992  1.00 32.43  ? 52  PRO H N   1 
ATOM   3944  C CA  . PRO C 3 53  A 28.529  0.073   36.768  1.00 33.09  ? 52  PRO H CA  1 
ATOM   3945  C C   . PRO C 3 53  A 28.255  -0.531  35.390  1.00 33.71  ? 52  PRO H C   1 
ATOM   3946  O O   . PRO C 3 53  A 28.789  -1.576  35.100  1.00 36.02  ? 52  PRO H O   1 
ATOM   3947  C CB  . PRO C 3 53  A 27.800  -0.738  37.833  1.00 29.76  ? 52  PRO H CB  1 
ATOM   3948  C CG  . PRO C 3 53  A 27.470  0.243   38.872  1.00 33.04  ? 52  PRO H CG  1 
ATOM   3949  C CD  . PRO C 3 53  A 27.279  1.571   38.237  1.00 30.79  ? 52  PRO H CD  1 
ATOM   3950  N N   . GLY C 3 54  ? 27.441  0.099   34.560  1.00 35.61  ? 53  GLY H N   1 
ATOM   3951  C CA  . GLY C 3 54  ? 27.166  -0.440  33.242  1.00 37.55  ? 53  GLY H CA  1 
ATOM   3952  C C   . GLY C 3 54  ? 28.409  -0.429  32.388  1.00 39.13  ? 53  GLY H C   1 
ATOM   3953  O O   . GLY C 3 54  ? 28.901  -1.463  31.958  1.00 38.89  ? 53  GLY H O   1 
ATOM   3954  N N   . ASP C 3 55  ? 28.935  0.770   32.196  1.00 40.07  ? 54  ASP H N   1 
ATOM   3955  C CA  . ASP C 3 55  ? 30.067  1.022   31.321  1.00 44.98  ? 54  ASP H CA  1 
ATOM   3956  C C   . ASP C 3 55  ? 31.311  1.560   32.040  1.00 48.27  ? 54  ASP H C   1 
ATOM   3957  O O   . ASP C 3 55  ? 32.225  2.096   31.387  1.00 48.46  ? 54  ASP H O   1 
ATOM   3958  C CB  . ASP C 3 55  ? 29.651  2.070   30.303  1.00 52.03  ? 54  ASP H CB  1 
ATOM   3959  C CG  . ASP C 3 55  ? 29.110  3.336   30.966  1.00 53.77  ? 54  ASP H CG  1 
ATOM   3960  O OD1 . ASP C 3 55  ? 28.591  4.223   30.236  1.00 59.46  ? 54  ASP H OD1 1 
ATOM   3961  O OD2 . ASP C 3 55  ? 29.201  3.434   32.216  1.00 47.05  ? 54  ASP H OD2 1 
ATOM   3962  N N   . GLY C 3 56  ? 31.338  1.454   33.365  1.00 42.10  ? 55  GLY H N   1 
ATOM   3963  C CA  . GLY C 3 56  ? 32.475  1.918   34.147  1.00 44.76  ? 55  GLY H CA  1 
ATOM   3964  C C   . GLY C 3 56  ? 32.733  3.419   34.277  1.00 44.95  ? 55  GLY H C   1 
ATOM   3965  O O   . GLY C 3 56  ? 33.892  3.815   34.498  1.00 45.55  ? 55  GLY H O   1 
ATOM   3966  N N   . ASP C 3 57  ? 31.666  4.230   34.195  1.00 41.94  ? 56  ASP H N   1 
ATOM   3967  C CA  . ASP C 3 57  ? 31.724  5.712   34.176  1.00 38.72  ? 56  ASP H CA  1 
ATOM   3968  C C   . ASP C 3 57  ? 31.725  6.378   35.562  1.00 37.33  ? 56  ASP H C   1 
ATOM   3969  O O   . ASP C 3 57  ? 31.022  5.962   36.491  1.00 34.32  ? 56  ASP H O   1 
ATOM   3970  C CB  . ASP C 3 57  ? 30.584  6.269   33.307  1.00 41.49  ? 56  ASP H CB  1 
ATOM   3971  C CG  . ASP C 3 57  ? 30.732  7.749   32.996  1.00 41.57  ? 56  ASP H CG  1 
ATOM   3972  O OD1 . ASP C 3 57  ? 31.483  8.436   33.707  1.00 40.94  ? 56  ASP H OD1 1 
ATOM   3973  O OD2 . ASP C 3 57  ? 30.079  8.233   32.041  1.00 44.07  ? 56  ASP H OD2 1 
ATOM   3974  N N   . THR C 3 58  ? 32.521  7.437   35.671  1.00 40.74  ? 57  THR H N   1 
ATOM   3975  C CA  . THR C 3 58  ? 32.915  8.018   36.955  1.00 39.41  ? 57  THR H CA  1 
ATOM   3976  C C   . THR C 3 58  ? 32.934  9.548   36.955  1.00 40.80  ? 57  THR H C   1 
ATOM   3977  O O   . THR C 3 58  ? 33.118  10.185  35.902  1.00 36.62  ? 57  THR H O   1 
ATOM   3978  C CB  . THR C 3 58  ? 34.337  7.605   37.293  1.00 34.45  ? 57  THR H CB  1 
ATOM   3979  O OG1 . THR C 3 58  ? 35.216  8.211   36.344  1.00 39.14  ? 57  THR H OG1 1 
ATOM   3980  C CG2 . THR C 3 58  ? 34.492  6.108   37.212  1.00 33.92  ? 57  THR H CG2 1 
ATOM   3981  N N   . LYS C 3 59  ? 32.757  10.118  38.156  1.00 41.54  ? 58  LYS H N   1 
ATOM   3982  C CA  . LYS C 3 59  ? 32.824  11.569  38.409  1.00 42.59  ? 58  LYS H CA  1 
ATOM   3983  C C   . LYS C 3 59  ? 33.251  11.805  39.847  1.00 38.79  ? 58  LYS H C   1 
ATOM   3984  O O   . LYS C 3 59  ? 32.468  11.618  40.748  1.00 40.43  ? 58  LYS H O   1 
ATOM   3985  C CB  . LYS C 3 59  ? 31.466  12.205  38.137  1.00 41.16  ? 58  LYS H CB  1 
ATOM   3986  C CG  . LYS C 3 59  ? 30.654  11.345  37.124  1.00 48.16  ? 58  LYS H CG  1 
ATOM   3987  C CD  . LYS C 3 59  ? 29.915  12.132  36.035  1.00 56.80  ? 58  LYS H CD  1 
ATOM   3988  C CE  . LYS C 3 59  ? 30.254  11.634  34.632  1.00 51.09  ? 58  LYS H CE  1 
ATOM   3989  N NZ  . LYS C 3 59  ? 30.871  12.749  33.848  1.00 55.04  ? 58  LYS H NZ  1 
ATOM   3990  N N   . TYR C 3 60  ? 34.508  12.189  40.060  1.00 41.41  ? 59  TYR H N   1 
ATOM   3991  C CA  . TYR C 3 60  ? 35.085  12.244  41.410  1.00 39.44  ? 59  TYR H CA  1 
ATOM   3992  C C   . TYR C 3 60  ? 34.986  13.627  42.078  1.00 40.16  ? 59  TYR H C   1 
ATOM   3993  O O   . TYR C 3 60  ? 34.675  14.635  41.453  1.00 39.57  ? 59  TYR H O   1 
ATOM   3994  C CB  . TYR C 3 60  ? 36.569  11.804  41.414  1.00 36.80  ? 59  TYR H CB  1 
ATOM   3995  C CG  . TYR C 3 60  ? 36.872  10.402  40.890  1.00 40.30  ? 59  TYR H CG  1 
ATOM   3996  C CD1 . TYR C 3 60  ? 37.303  9.382   41.741  1.00 36.58  ? 59  TYR H CD1 1 
ATOM   3997  C CD2 . TYR C 3 60  ? 36.758  10.105  39.538  1.00 39.56  ? 59  TYR H CD2 1 
ATOM   3998  C CE1 . TYR C 3 60  ? 37.599  8.103   41.254  1.00 32.16  ? 59  TYR H CE1 1 
ATOM   3999  C CE2 . TYR C 3 60  ? 37.042  8.831   39.050  1.00 35.80  ? 59  TYR H CE2 1 
ATOM   4000  C CZ  . TYR C 3 60  ? 37.461  7.840   39.907  1.00 36.35  ? 59  TYR H CZ  1 
ATOM   4001  O OH  . TYR C 3 60  ? 37.737  6.593   39.389  1.00 37.67  ? 59  TYR H OH  1 
ATOM   4002  N N   . ASN C 3 61  ? 35.269  13.660  43.370  1.00 42.28  ? 60  ASN H N   1 
ATOM   4003  C CA  . ASN C 3 61  ? 35.476  14.909  44.064  1.00 41.01  ? 60  ASN H CA  1 
ATOM   4004  C C   . ASN C 3 61  ? 36.911  15.377  43.859  1.00 43.60  ? 60  ASN H C   1 
ATOM   4005  O O   . ASN C 3 61  ? 37.858  14.585  43.928  1.00 43.06  ? 60  ASN H O   1 
ATOM   4006  C CB  . ASN C 3 61  ? 35.230  14.712  45.545  1.00 42.62  ? 60  ASN H CB  1 
ATOM   4007  C CG  . ASN C 3 61  ? 35.291  16.008  46.312  1.00 44.46  ? 60  ASN H CG  1 
ATOM   4008  O OD1 . ASN C 3 61  ? 34.932  16.071  47.494  1.00 42.78  ? 60  ASN H OD1 1 
ATOM   4009  N ND2 . ASN C 3 61  ? 35.738  17.059  45.644  1.00 43.06  ? 60  ASN H ND2 1 
ATOM   4010  N N   . GLY C 3 62  ? 37.068  16.668  43.607  1.00 40.77  ? 61  GLY H N   1 
ATOM   4011  C CA  . GLY C 3 62  ? 38.383  17.241  43.417  1.00 44.99  ? 61  GLY H CA  1 
ATOM   4012  C C   . GLY C 3 62  ? 39.311  16.879  44.552  1.00 44.67  ? 61  GLY H C   1 
ATOM   4013  O O   . GLY C 3 62  ? 40.372  16.320  44.330  1.00 47.59  ? 61  GLY H O   1 
ATOM   4014  N N   . LYS C 3 63  ? 38.906  17.198  45.772  1.00 40.18  ? 62  LYS H N   1 
ATOM   4015  C CA  . LYS C 3 63  ? 39.665  16.812  46.940  1.00 40.12  ? 62  LYS H CA  1 
ATOM   4016  C C   . LYS C 3 63  ? 40.226  15.412  46.840  1.00 45.43  ? 62  LYS H C   1 
ATOM   4017  O O   . LYS C 3 63  ? 41.193  15.098  47.531  1.00 53.05  ? 62  LYS H O   1 
ATOM   4018  C CB  . LYS C 3 63  ? 38.792  16.852  48.186  1.00 45.85  ? 62  LYS H CB  1 
ATOM   4019  C CG  . LYS C 3 63  ? 38.395  18.219  48.676  1.00 47.14  ? 62  LYS H CG  1 
ATOM   4020  C CD  . LYS C 3 63  ? 37.998  18.111  50.145  1.00 50.64  ? 62  LYS H CD  1 
ATOM   4021  C CE  . LYS C 3 63  ? 39.047  17.320  50.947  1.00 54.84  ? 62  LYS H CE  1 
ATOM   4022  N NZ  . LYS C 3 63  ? 39.019  17.584  52.431  1.00 53.72  ? 62  LYS H NZ  1 
ATOM   4023  N N   . PHE C 3 64  ? 39.608  14.559  46.022  1.00 43.53  ? 63  PHE H N   1 
ATOM   4024  C CA  . PHE C 3 64  ? 39.979  13.144  45.964  1.00 41.54  ? 63  PHE H CA  1 
ATOM   4025  C C   . PHE C 3 64  ? 40.385  12.662  44.586  1.00 43.02  ? 63  PHE H C   1 
ATOM   4026  O O   . PHE C 3 64  ? 40.369  11.452  44.354  1.00 42.97  ? 63  PHE H O   1 
ATOM   4027  C CB  . PHE C 3 64  ? 38.809  12.264  46.404  1.00 41.97  ? 63  PHE H CB  1 
ATOM   4028  C CG  . PHE C 3 64  ? 38.515  12.326  47.859  1.00 40.40  ? 63  PHE H CG  1 
ATOM   4029  C CD1 . PHE C 3 64  ? 37.663  13.284  48.363  1.00 40.81  ? 63  PHE H CD1 1 
ATOM   4030  C CD2 . PHE C 3 64  ? 39.088  11.424  48.726  1.00 38.02  ? 63  PHE H CD2 1 
ATOM   4031  C CE1 . PHE C 3 64  ? 37.396  13.350  49.717  1.00 42.19  ? 63  PHE H CE1 1 
ATOM   4032  C CE2 . PHE C 3 64  ? 38.817  11.481  50.074  1.00 39.93  ? 63  PHE H CE2 1 
ATOM   4033  C CZ  . PHE C 3 64  ? 37.972  12.450  50.572  1.00 40.70  ? 63  PHE H CZ  1 
ATOM   4034  N N   . LYS C 3 65  ? 40.733  13.574  43.676  1.00 43.82  ? 64  LYS H N   1 
ATOM   4035  C CA  . LYS C 3 65  ? 41.005  13.204  42.282  1.00 43.80  ? 64  LYS H CA  1 
ATOM   4036  C C   . LYS C 3 65  ? 42.109  12.187  42.160  1.00 42.62  ? 64  LYS H C   1 
ATOM   4037  O O   . LYS C 3 65  ? 42.023  11.269  41.359  1.00 40.66  ? 64  LYS H O   1 
ATOM   4038  C CB  . LYS C 3 65  ? 41.376  14.419  41.436  1.00 47.88  ? 64  LYS H CB  1 
ATOM   4039  C CG  . LYS C 3 65  ? 40.984  14.271  39.952  1.00 56.36  ? 64  LYS H CG  1 
ATOM   4040  C CD  . LYS C 3 65  ? 41.032  12.800  39.466  1.00 56.04  ? 64  LYS H CD  1 
ATOM   4041  C CE  . LYS C 3 65  ? 39.782  12.377  38.675  1.00 56.83  ? 64  LYS H CE  1 
ATOM   4042  N NZ  . LYS C 3 65  ? 39.500  13.245  37.461  1.00 61.54  ? 64  LYS H NZ  1 
ATOM   4043  N N   . ASP C 3 66  ? 43.141  12.363  42.973  1.00 46.90  ? 65  ASP H N   1 
ATOM   4044  C CA  . ASP C 3 66  ? 44.373  11.590  42.858  1.00 47.25  ? 65  ASP H CA  1 
ATOM   4045  C C   . ASP C 3 66  ? 44.426  10.374  43.789  1.00 41.58  ? 65  ASP H C   1 
ATOM   4046  O O   . ASP C 3 66  ? 45.033  9.359   43.473  1.00 42.22  ? 65  ASP H O   1 
ATOM   4047  C CB  . ASP C 3 66  ? 45.570  12.509  43.128  1.00 55.99  ? 65  ASP H CB  1 
ATOM   4048  C CG  . ASP C 3 66  ? 45.502  13.836  42.331  1.00 67.56  ? 65  ASP H CG  1 
ATOM   4049  O OD1 . ASP C 3 66  ? 45.193  13.808  41.102  1.00 64.75  ? 65  ASP H OD1 1 
ATOM   4050  O OD2 . ASP C 3 66  ? 45.778  14.909  42.938  1.00 68.90  ? 65  ASP H OD2 1 
ATOM   4051  N N   . LYS C 3 67  ? 43.804  10.488  44.950  1.00 40.32  ? 66  LYS H N   1 
ATOM   4052  C CA  . LYS C 3 67  ? 43.742  9.379   45.891  1.00 37.80  ? 66  LYS H CA  1 
ATOM   4053  C C   . LYS C 3 67  ? 42.852  8.176   45.450  1.00 42.70  ? 66  LYS H C   1 
ATOM   4054  O O   . LYS C 3 67  ? 43.196  7.008   45.680  1.00 40.03  ? 66  LYS H O   1 
ATOM   4055  C CB  . LYS C 3 67  ? 43.304  9.913   47.254  1.00 34.25  ? 66  LYS H CB  1 
ATOM   4056  C CG  . LYS C 3 67  ? 43.475  8.950   48.389  1.00 35.93  ? 66  LYS H CG  1 
ATOM   4057  C CD  . LYS C 3 67  ? 44.954  8.758   48.773  1.00 41.78  ? 66  LYS H CD  1 
ATOM   4058  C CE  . LYS C 3 67  ? 45.501  9.913   49.644  1.00 48.77  ? 66  LYS H CE  1 
ATOM   4059  N NZ  . LYS C 3 67  ? 46.910  9.695   50.140  1.00 45.97  ? 66  LYS H NZ  1 
ATOM   4060  N N   . ALA C 3 68  ? 41.707  8.422   44.820  1.00 40.93  ? 67  ALA H N   1 
ATOM   4061  C CA  . ALA C 3 68  ? 40.792  7.294   44.650  1.00 39.24  ? 67  ALA H CA  1 
ATOM   4062  C C   . ALA C 3 68  ? 40.452  6.814   43.224  1.00 40.86  ? 67  ALA H C   1 
ATOM   4063  O O   . ALA C 3 68  ? 40.588  7.535   42.224  1.00 37.35  ? 67  ALA H O   1 
ATOM   4064  C CB  . ALA C 3 68  ? 39.530  7.479   45.504  1.00 32.65  ? 67  ALA H CB  1 
ATOM   4065  N N   . THR C 3 69  ? 39.999  5.565   43.166  1.00 41.16  ? 68  THR H N   1 
ATOM   4066  C CA  . THR C 3 69  ? 39.724  4.880   41.906  1.00 38.78  ? 68  THR H CA  1 
ATOM   4067  C C   . THR C 3 69  ? 38.589  3.865   42.043  1.00 35.15  ? 68  THR H C   1 
ATOM   4068  O O   . THR C 3 69  ? 38.734  2.778   42.610  1.00 31.26  ? 68  THR H O   1 
ATOM   4069  C CB  . THR C 3 69  ? 41.002  4.228   41.357  1.00 37.24  ? 68  THR H CB  1 
ATOM   4070  O OG1 . THR C 3 69  ? 41.820  5.260   40.818  1.00 42.15  ? 68  THR H OG1 1 
ATOM   4071  C CG2 . THR C 3 69  ? 40.700  3.238   40.272  1.00 35.68  ? 68  THR H CG2 1 
ATOM   4072  N N   . LEU C 3 70  ? 37.442  4.250   41.516  1.00 33.75  ? 69  LEU H N   1 
ATOM   4073  C CA  . LEU C 3 70  ? 36.280  3.390   41.549  1.00 36.90  ? 69  LEU H CA  1 
ATOM   4074  C C   . LEU C 3 70  ? 36.401  2.508   40.324  1.00 32.81  ? 69  LEU H C   1 
ATOM   4075  O O   . LEU C 3 70  ? 36.872  2.968   39.304  1.00 34.40  ? 69  LEU H O   1 
ATOM   4076  C CB  . LEU C 3 70  ? 35.001  4.245   41.528  1.00 33.27  ? 69  LEU H CB  1 
ATOM   4077  C CG  . LEU C 3 70  ? 35.129  5.468   42.452  1.00 29.80  ? 69  LEU H CG  1 
ATOM   4078  C CD1 . LEU C 3 70  ? 33.939  6.395   42.340  1.00 28.64  ? 69  LEU H CD1 1 
ATOM   4079  C CD2 . LEU C 3 70  ? 35.377  5.048   43.885  1.00 24.94  ? 69  LEU H CD2 1 
ATOM   4080  N N   . THR C 3 71  ? 36.055  1.234   40.447  1.00 30.82  ? 70  THR H N   1 
ATOM   4081  C CA  . THR C 3 71  ? 35.998  0.333   39.307  1.00 31.30  ? 70  THR H CA  1 
ATOM   4082  C C   . THR C 3 71  ? 34.933  -0.670  39.622  1.00 34.01  ? 70  THR H C   1 
ATOM   4083  O O   . THR C 3 71  ? 34.524  -0.749  40.781  1.00 38.24  ? 70  THR H O   1 
ATOM   4084  C CB  . THR C 3 71  ? 37.310  -0.416  39.119  1.00 31.18  ? 70  THR H CB  1 
ATOM   4085  O OG1 . THR C 3 71  ? 37.742  -0.963  40.374  1.00 28.60  ? 70  THR H OG1 1 
ATOM   4086  C CG2 . THR C 3 71  ? 38.348  0.526   38.594  1.00 30.20  ? 70  THR H CG2 1 
ATOM   4087  N N   . VAL C 3 72  ? 34.468  -1.440  38.639  1.00 31.07  ? 71  VAL H N   1 
ATOM   4088  C CA  . VAL C 3 72  ? 33.486  -2.478  38.972  1.00 35.20  ? 71  VAL H CA  1 
ATOM   4089  C C   . VAL C 3 72  ? 33.728  -3.762  38.263  1.00 35.40  ? 71  VAL H C   1 
ATOM   4090  O O   . VAL C 3 72  ? 34.511  -3.826  37.323  1.00 37.64  ? 71  VAL H O   1 
ATOM   4091  C CB  . VAL C 3 72  ? 31.993  -2.099  38.649  1.00 36.37  ? 71  VAL H CB  1 
ATOM   4092  C CG1 . VAL C 3 72  ? 31.465  -1.015  39.593  1.00 30.81  ? 71  VAL H CG1 1 
ATOM   4093  C CG2 . VAL C 3 72  ? 31.804  -1.720  37.170  1.00 32.62  ? 71  VAL H CG2 1 
ATOM   4094  N N   . ASP C 3 73  ? 32.920  -4.745  38.621  1.00 38.74  ? 72  ASP H N   1 
ATOM   4095  C CA  . ASP C 3 73  ? 32.832  -6.003  37.905  1.00 46.23  ? 72  ASP H CA  1 
ATOM   4096  C C   . ASP C 3 73  ? 31.422  -6.548  37.723  1.00 46.27  ? 72  ASP H C   1 
ATOM   4097  O O   . ASP C 3 73  ? 31.035  -7.463  38.396  1.00 44.60  ? 72  ASP H O   1 
ATOM   4098  C CB  . ASP C 3 73  ? 33.622  -7.051  38.635  1.00 43.57  ? 72  ASP H CB  1 
ATOM   4099  C CG  . ASP C 3 73  ? 33.605  -8.350  37.934  1.00 52.73  ? 72  ASP H CG  1 
ATOM   4100  O OD1 . ASP C 3 73  ? 33.656  -8.364  36.702  1.00 54.45  ? 72  ASP H OD1 1 
ATOM   4101  O OD2 . ASP C 3 73  ? 33.547  -9.365  38.616  1.00 48.54  ? 72  ASP H OD2 1 
ATOM   4102  N N   . LYS C 3 74  ? 30.667  -6.037  36.774  1.00 45.53  ? 73  LYS H N   1 
ATOM   4103  C CA  . LYS C 3 74  ? 29.306  -6.481  36.613  1.00 43.93  ? 73  LYS H CA  1 
ATOM   4104  C C   . LYS C 3 74  ? 29.168  -7.905  37.004  1.00 43.87  ? 73  LYS H C   1 
ATOM   4105  O O   . LYS C 3 74  ? 28.543  -8.255  37.966  1.00 43.26  ? 73  LYS H O   1 
ATOM   4106  C CB  . LYS C 3 74  ? 28.898  -6.422  35.161  1.00 42.10  ? 73  LYS H CB  1 
ATOM   4107  C CG  . LYS C 3 74  ? 29.141  -5.139  34.469  1.00 44.84  ? 73  LYS H CG  1 
ATOM   4108  C CD  . LYS C 3 74  ? 28.717  -5.235  33.035  1.00 43.02  ? 73  LYS H CD  1 
ATOM   4109  C CE  . LYS C 3 74  ? 29.887  -5.276  32.111  1.00 45.33  ? 73  LYS H CE  1 
ATOM   4110  N NZ  . LYS C 3 74  ? 29.499  -5.687  30.759  1.00 47.46  ? 73  LYS H NZ  1 
ATOM   4111  N N   . SER C 3 75  ? 29.748  -8.739  36.188  1.00 40.08  ? 74  SER H N   1 
ATOM   4112  C CA  . SER C 3 75  ? 29.479  -10.142 36.194  1.00 40.11  ? 74  SER H CA  1 
ATOM   4113  C C   . SER C 3 75  ? 29.514  -10.829 37.521  1.00 39.56  ? 74  SER H C   1 
ATOM   4114  O O   . SER C 3 75  ? 29.339  -12.012 37.589  1.00 41.02  ? 74  SER H O   1 
ATOM   4115  C CB  . SER C 3 75  ? 30.434  -10.828 35.266  1.00 41.30  ? 74  SER H CB  1 
ATOM   4116  O OG  . SER C 3 75  ? 30.878  -11.980 35.886  1.00 45.27  ? 74  SER H OG  1 
ATOM   4117  N N   . SER C 3 76  ? 29.735  -10.113 38.594  1.00 39.05  ? 75  SER H N   1 
ATOM   4118  C CA  . SER C 3 76  ? 29.781  -10.786 39.868  1.00 43.90  ? 75  SER H CA  1 
ATOM   4119  C C   . SER C 3 76  ? 29.413  -9.838  40.941  1.00 38.35  ? 75  SER H C   1 
ATOM   4120  O O   . SER C 3 76  ? 29.763  -9.987  42.081  1.00 34.60  ? 75  SER H O   1 
ATOM   4121  C CB  . SER C 3 76  ? 31.138  -11.396 40.128  1.00 46.10  ? 75  SER H CB  1 
ATOM   4122  O OG  . SER C 3 76  ? 32.117  -10.408 40.248  1.00 42.11  ? 75  SER H OG  1 
ATOM   4123  N N   . SER C 3 77  ? 28.677  -8.844  40.538  1.00 37.31  ? 76  SER H N   1 
ATOM   4124  C CA  . SER C 3 77  ? 27.986  -7.980  41.465  1.00 37.16  ? 76  SER H CA  1 
ATOM   4125  C C   . SER C 3 77  ? 28.909  -7.392  42.518  1.00 35.56  ? 76  SER H C   1 
ATOM   4126  O O   . SER C 3 77  ? 28.497  -7.213  43.658  1.00 37.17  ? 76  SER H O   1 
ATOM   4127  C CB  . SER C 3 77  ? 26.860  -8.757  42.162  1.00 39.84  ? 76  SER H CB  1 
ATOM   4128  O OG  . SER C 3 77  ? 25.705  -8.868  41.353  1.00 37.60  ? 76  SER H OG  1 
ATOM   4129  N N   . THR C 3 78  ? 30.153  -7.092  42.169  1.00 36.14  ? 77  THR H N   1 
ATOM   4130  C CA  . THR C 3 78  ? 31.055  -6.486  43.156  1.00 34.18  ? 77  THR H CA  1 
ATOM   4131  C C   . THR C 3 78  ? 31.554  -5.148  42.646  1.00 30.86  ? 77  THR H C   1 
ATOM   4132  O O   . THR C 3 78  ? 31.571  -4.901  41.459  1.00 33.80  ? 77  THR H O   1 
ATOM   4133  C CB  . THR C 3 78  ? 32.257  -7.390  43.532  1.00 35.16  ? 77  THR H CB  1 
ATOM   4134  O OG1 . THR C 3 78  ? 33.053  -7.607  42.369  1.00 43.12  ? 77  THR H OG1 1 
ATOM   4135  C CG2 . THR C 3 78  ? 31.817  -8.770  44.080  1.00 33.98  ? 77  THR H CG2 1 
ATOM   4136  N N   . ALA C 3 79  ? 31.946  -4.284  43.563  1.00 30.64  ? 78  ALA H N   1 
ATOM   4137  C CA  . ALA C 3 79  ? 32.361  -2.925  43.244  1.00 30.50  ? 78  ALA H CA  1 
ATOM   4138  C C   . ALA C 3 79  ? 33.604  -2.598  44.089  1.00 33.22  ? 78  ALA H C   1 
ATOM   4139  O O   . ALA C 3 79  ? 33.728  -3.080  45.234  1.00 31.04  ? 78  ALA H O   1 
ATOM   4140  C CB  . ALA C 3 79  ? 31.242  -1.968  43.547  1.00 27.18  ? 78  ALA H CB  1 
ATOM   4141  N N   . TYR C 3 80  ? 34.533  -1.808  43.543  1.00 32.52  ? 79  TYR H N   1 
ATOM   4142  C CA  . TYR C 3 80  ? 35.831  -1.636  44.197  1.00 28.40  ? 79  TYR H CA  1 
ATOM   4143  C C   . TYR C 3 80  ? 36.173  -0.192  44.362  1.00 30.40  ? 79  TYR H C   1 
ATOM   4144  O O   . TYR C 3 80  ? 35.781  0.624   43.533  1.00 32.99  ? 79  TYR H O   1 
ATOM   4145  C CB  . TYR C 3 80  ? 36.928  -2.303  43.392  1.00 24.83  ? 79  TYR H CB  1 
ATOM   4146  C CG  . TYR C 3 80  ? 36.774  -3.784  43.305  1.00 27.11  ? 79  TYR H CG  1 
ATOM   4147  C CD1 . TYR C 3 80  ? 37.334  -4.604  44.259  1.00 26.37  ? 79  TYR H CD1 1 
ATOM   4148  C CD2 . TYR C 3 80  ? 36.063  -4.377  42.265  1.00 30.83  ? 79  TYR H CD2 1 
ATOM   4149  C CE1 . TYR C 3 80  ? 37.190  -5.974  44.191  1.00 27.26  ? 79  TYR H CE1 1 
ATOM   4150  C CE2 . TYR C 3 80  ? 35.928  -5.754  42.190  1.00 29.00  ? 79  TYR H CE2 1 
ATOM   4151  C CZ  . TYR C 3 80  ? 36.487  -6.533  43.167  1.00 28.97  ? 79  TYR H CZ  1 
ATOM   4152  O OH  . TYR C 3 80  ? 36.368  -7.889  43.122  1.00 38.46  ? 79  TYR H OH  1 
ATOM   4153  N N   . MET C 3 81  ? 36.891  0.121   45.438  1.00 27.94  ? 80  MET H N   1 
ATOM   4154  C CA  . MET C 3 81  ? 37.498  1.432   45.595  1.00 31.57  ? 80  MET H CA  1 
ATOM   4155  C C   . MET C 3 81  ? 38.937  1.273   46.006  1.00 33.45  ? 80  MET H C   1 
ATOM   4156  O O   . MET C 3 81  ? 39.231  0.572   46.955  1.00 32.22  ? 80  MET H O   1 
ATOM   4157  C CB  . MET C 3 81  ? 36.795  2.265   46.644  1.00 28.31  ? 80  MET H CB  1 
ATOM   4158  C CG  . MET C 3 81  ? 36.986  3.730   46.434  1.00 30.90  ? 80  MET H CG  1 
ATOM   4159  S SD  . MET C 3 81  ? 37.265  4.672   47.937  1.00 41.27  ? 80  MET H SD  1 
ATOM   4160  C CE  . MET C 3 81  ? 36.361  3.748   49.190  1.00 32.79  ? 80  MET H CE  1 
ATOM   4161  N N   . GLN C 3 82  ? 39.826  1.935   45.283  1.00 34.35  ? 81  GLN H N   1 
ATOM   4162  C CA  . GLN C 3 82  ? 41.224  1.853   45.584  1.00 36.65  ? 81  GLN H CA  1 
ATOM   4163  C C   . GLN C 3 82  ? 41.802  3.194   46.005  1.00 40.82  ? 81  GLN H C   1 
ATOM   4164  O O   . GLN C 3 82  ? 41.674  4.191   45.289  1.00 43.00  ? 81  GLN H O   1 
ATOM   4165  C CB  . GLN C 3 82  ? 41.993  1.317   44.391  1.00 38.33  ? 81  GLN H CB  1 
ATOM   4166  C CG  . GLN C 3 82  ? 43.293  0.655   44.815  1.00 45.51  ? 81  GLN H CG  1 
ATOM   4167  C CD  . GLN C 3 82  ? 44.290  0.579   43.697  1.00 56.83  ? 81  GLN H CD  1 
ATOM   4168  O OE1 . GLN C 3 82  ? 45.037  -0.396  43.572  1.00 64.87  ? 81  GLN H OE1 1 
ATOM   4169  N NE2 . GLN C 3 82  ? 44.301  1.607   42.856  1.00 63.21  ? 81  GLN H NE2 1 
ATOM   4170  N N   . LEU C 3 83  ? 42.457  3.213   47.164  1.00 37.44  ? 82  LEU H N   1 
ATOM   4171  C CA  . LEU C 3 83  ? 43.143  4.408   47.632  1.00 36.64  ? 82  LEU H CA  1 
ATOM   4172  C C   . LEU C 3 83  ? 44.689  4.289   47.528  1.00 42.34  ? 82  LEU H C   1 
ATOM   4173  O O   . LEU C 3 83  ? 45.330  3.620   48.330  1.00 44.02  ? 82  LEU H O   1 
ATOM   4174  C CB  . LEU C 3 83  ? 42.688  4.703   49.054  1.00 35.19  ? 82  LEU H CB  1 
ATOM   4175  C CG  . LEU C 3 83  ? 41.173  4.518   49.217  1.00 38.02  ? 82  LEU H CG  1 
ATOM   4176  C CD1 . LEU C 3 83  ? 40.851  3.352   50.101  1.00 39.43  ? 82  LEU H CD1 1 
ATOM   4177  C CD2 . LEU C 3 83  ? 40.506  5.748   49.775  1.00 34.75  ? 82  LEU H CD2 1 
ATOM   4178  N N   . SER C 3 84  A 45.275  4.938   46.524  1.00 44.10  ? 82  SER H N   1 
ATOM   4179  C CA  . SER C 3 84  A 46.714  4.896   46.264  1.00 40.20  ? 82  SER H CA  1 
ATOM   4180  C C   . SER C 3 84  A 47.477  5.692   47.295  1.00 43.28  ? 82  SER H C   1 
ATOM   4181  O O   . SER C 3 84  A 46.875  6.398   48.097  1.00 43.96  ? 82  SER H O   1 
ATOM   4182  C CB  . SER C 3 84  A 47.005  5.508   44.895  1.00 46.79  ? 82  SER H CB  1 
ATOM   4183  O OG  . SER C 3 84  A 46.468  4.724   43.842  1.00 55.22  ? 82  SER H OG  1 
ATOM   4184  N N   . SER C 3 85  B 48.804  5.576   47.271  1.00 44.31  ? 82  SER H N   1 
ATOM   4185  C CA  . SER C 3 85  B 49.683  6.441   48.064  1.00 44.83  ? 82  SER H CA  1 
ATOM   4186  C C   . SER C 3 85  B 49.192  6.773   49.474  1.00 44.23  ? 82  SER H C   1 
ATOM   4187  O O   . SER C 3 85  B 48.981  7.950   49.785  1.00 42.34  ? 82  SER H O   1 
ATOM   4188  C CB  . SER C 3 85  B 49.912  7.758   47.317  1.00 43.95  ? 82  SER H CB  1 
ATOM   4189  O OG  . SER C 3 85  B 49.494  7.658   45.960  1.00 55.34  ? 82  SER H OG  1 
ATOM   4190  N N   . LEU C 3 86  C 49.047  5.763   50.333  1.00 41.73  ? 82  LEU H N   1 
ATOM   4191  C CA  . LEU C 3 86  C 48.347  5.960   51.609  1.00 45.92  ? 82  LEU H CA  1 
ATOM   4192  C C   . LEU C 3 86  C 49.039  6.902   52.606  1.00 48.36  ? 82  LEU H C   1 
ATOM   4193  O O   . LEU C 3 86  C 50.247  6.885   52.740  1.00 51.87  ? 82  LEU H O   1 
ATOM   4194  C CB  . LEU C 3 86  C 47.984  4.621   52.272  1.00 46.84  ? 82  LEU H CB  1 
ATOM   4195  C CG  . LEU C 3 86  C 46.721  3.919   51.744  1.00 43.93  ? 82  LEU H CG  1 
ATOM   4196  C CD1 . LEU C 3 86  C 46.350  2.741   52.615  1.00 41.00  ? 82  LEU H CD1 1 
ATOM   4197  C CD2 . LEU C 3 86  C 45.558  4.887   51.661  1.00 43.88  ? 82  LEU H CD2 1 
ATOM   4198  N N   . THR C 3 87  ? 48.240  7.703   53.312  1.00 51.21  ? 83  THR H N   1 
ATOM   4199  C CA  . THR C 3 87  ? 48.709  8.732   54.246  1.00 47.10  ? 83  THR H CA  1 
ATOM   4200  C C   . THR C 3 87  ? 47.951  8.662   55.564  1.00 45.03  ? 83  THR H C   1 
ATOM   4201  O O   . THR C 3 87  ? 47.000  7.921   55.677  1.00 48.24  ? 83  THR H O   1 
ATOM   4202  C CB  . THR C 3 87  ? 48.490  10.113  53.641  1.00 52.10  ? 83  THR H CB  1 
ATOM   4203  O OG1 . THR C 3 87  ? 49.684  10.521  52.956  1.00 58.94  ? 83  THR H OG1 1 
ATOM   4204  C CG2 . THR C 3 87  ? 48.106  11.135  54.710  1.00 45.75  ? 83  THR H CG2 1 
ATOM   4205  N N   . SER C 3 88  ? 48.356  9.420   56.572  1.00 46.12  ? 84  SER H N   1 
ATOM   4206  C CA  . SER C 3 88  ? 47.742  9.254   57.893  1.00 49.07  ? 84  SER H CA  1 
ATOM   4207  C C   . SER C 3 88  ? 46.340  9.840   58.023  1.00 51.76  ? 84  SER H C   1 
ATOM   4208  O O   . SER C 3 88  ? 45.528  9.385   58.832  1.00 52.66  ? 84  SER H O   1 
ATOM   4209  C CB  . SER C 3 88  ? 48.650  9.802   58.988  1.00 48.07  ? 84  SER H CB  1 
ATOM   4210  O OG  . SER C 3 88  ? 49.536  8.795   59.444  1.00 47.54  ? 84  SER H OG  1 
ATOM   4211  N N   . VAL C 3 89  ? 46.046  10.849  57.222  1.00 52.39  ? 85  VAL H N   1 
ATOM   4212  C CA  . VAL C 3 89  ? 44.708  11.396  57.228  1.00 50.92  ? 85  VAL H CA  1 
ATOM   4213  C C   . VAL C 3 89  ? 43.741  10.483  56.464  1.00 50.84  ? 85  VAL H C   1 
ATOM   4214  O O   . VAL C 3 89  ? 42.546  10.726  56.428  1.00 53.30  ? 85  VAL H O   1 
ATOM   4215  C CB  . VAL C 3 89  ? 44.688  12.796  56.638  1.00 50.48  ? 85  VAL H CB  1 
ATOM   4216  C CG1 . VAL C 3 89  ? 44.734  12.726  55.135  1.00 47.91  ? 85  VAL H CG1 1 
ATOM   4217  C CG2 . VAL C 3 89  ? 43.448  13.521  57.105  1.00 59.74  ? 85  VAL H CG2 1 
ATOM   4218  N N   . ASP C 3 90  ? 44.271  9.423   55.867  1.00 49.42  ? 86  ASP H N   1 
ATOM   4219  C CA  . ASP C 3 90  ? 43.470  8.466   55.106  1.00 48.63  ? 86  ASP H CA  1 
ATOM   4220  C C   . ASP C 3 90  ? 42.766  7.435   55.980  1.00 48.14  ? 86  ASP H C   1 
ATOM   4221  O O   . ASP C 3 90  ? 42.087  6.549   55.482  1.00 44.96  ? 86  ASP H O   1 
ATOM   4222  C CB  . ASP C 3 90  ? 44.357  7.708   54.116  1.00 48.15  ? 86  ASP H CB  1 
ATOM   4223  C CG  . ASP C 3 90  ? 44.929  8.597   53.043  1.00 51.60  ? 86  ASP H CG  1 
ATOM   4224  O OD1 . ASP C 3 90  ? 44.469  9.759   52.920  1.00 57.06  ? 86  ASP H OD1 1 
ATOM   4225  O OD2 . ASP C 3 90  ? 45.828  8.123   52.310  1.00 48.24  ? 86  ASP H OD2 1 
ATOM   4226  N N   . SER C 3 91  ? 42.948  7.527   57.286  1.00 53.91  ? 87  SER H N   1 
ATOM   4227  C CA  . SER C 3 91  ? 42.460  6.477   58.171  1.00 53.47  ? 87  SER H CA  1 
ATOM   4228  C C   . SER C 3 91  ? 40.999  6.739   58.527  1.00 53.54  ? 87  SER H C   1 
ATOM   4229  O O   . SER C 3 91  ? 40.695  7.690   59.245  1.00 57.27  ? 87  SER H O   1 
ATOM   4230  C CB  . SER C 3 91  ? 43.330  6.410   59.435  1.00 53.97  ? 87  SER H CB  1 
ATOM   4231  O OG  . SER C 3 91  ? 44.671  6.037   59.136  1.00 48.50  ? 87  SER H OG  1 
ATOM   4232  N N   . ALA C 3 92  ? 40.086  5.918   58.024  1.00 45.25  ? 88  ALA H N   1 
ATOM   4233  C CA  . ALA C 3 92  ? 38.688  6.150   58.336  1.00 43.77  ? 88  ALA H CA  1 
ATOM   4234  C C   . ALA C 3 92  ? 37.799  4.957   58.058  1.00 45.47  ? 88  ALA H C   1 
ATOM   4235  O O   . ALA C 3 92  ? 38.278  3.854   57.782  1.00 43.88  ? 88  ALA H O   1 
ATOM   4236  C CB  . ALA C 3 92  ? 38.200  7.328   57.588  1.00 46.58  ? 88  ALA H CB  1 
ATOM   4237  N N   . VAL C 3 93  ? 36.494  5.186   58.148  1.00 43.01  ? 89  VAL H N   1 
ATOM   4238  C CA  . VAL C 3 93  ? 35.520  4.176   57.785  1.00 40.11  ? 89  VAL H CA  1 
ATOM   4239  C C   . VAL C 3 93  ? 34.977  4.603   56.468  1.00 36.92  ? 89  VAL H C   1 
ATOM   4240  O O   . VAL C 3 93  ? 34.739  5.787   56.273  1.00 37.03  ? 89  VAL H O   1 
ATOM   4241  C CB  . VAL C 3 93  ? 34.373  4.171   58.755  1.00 43.56  ? 89  VAL H CB  1 
ATOM   4242  C CG1 . VAL C 3 93  ? 33.394  3.015   58.442  1.00 37.63  ? 89  VAL H CG1 1 
ATOM   4243  C CG2 . VAL C 3 93  ? 34.924  4.117   60.167  1.00 45.51  ? 89  VAL H CG2 1 
ATOM   4244  N N   . TYR C 3 94  ? 34.783  3.643   55.572  1.00 35.33  ? 90  TYR H N   1 
ATOM   4245  C CA  . TYR C 3 94  ? 34.357  3.925   54.211  1.00 33.87  ? 90  TYR H CA  1 
ATOM   4246  C C   . TYR C 3 94  ? 33.072  3.238   53.865  1.00 31.08  ? 90  TYR H C   1 
ATOM   4247  O O   . TYR C 3 94  ? 32.966  2.034   54.010  1.00 32.61  ? 90  TYR H O   1 
ATOM   4248  C CB  . TYR C 3 94  ? 35.425  3.457   53.251  1.00 34.68  ? 90  TYR H CB  1 
ATOM   4249  C CG  . TYR C 3 94  ? 36.651  4.276   53.364  1.00 34.34  ? 90  TYR H CG  1 
ATOM   4250  C CD1 . TYR C 3 94  ? 37.443  4.211   54.484  1.00 34.66  ? 90  TYR H CD1 1 
ATOM   4251  C CD2 . TYR C 3 94  ? 37.011  5.126   52.355  1.00 37.83  ? 90  TYR H CD2 1 
ATOM   4252  C CE1 . TYR C 3 94  ? 38.567  4.970   54.589  1.00 37.99  ? 90  TYR H CE1 1 
ATOM   4253  C CE2 . TYR C 3 94  ? 38.137  5.878   52.446  1.00 41.98  ? 90  TYR H CE2 1 
ATOM   4254  C CZ  . TYR C 3 94  ? 38.913  5.806   53.563  1.00 39.99  ? 90  TYR H CZ  1 
ATOM   4255  O OH  . TYR C 3 94  ? 40.036  6.599   53.636  1.00 42.98  ? 90  TYR H OH  1 
ATOM   4256  N N   . PHE C 3 95  ? 32.104  4.007   53.386  1.00 30.17  ? 91  PHE H N   1 
ATOM   4257  C CA  . PHE C 3 95  ? 30.784  3.481   53.047  1.00 32.48  ? 91  PHE H CA  1 
ATOM   4258  C C   . PHE C 3 95  ? 30.581  3.449   51.557  1.00 30.63  ? 91  PHE H C   1 
ATOM   4259  O O   . PHE C 3 95  ? 30.940  4.397   50.868  1.00 30.80  ? 91  PHE H O   1 
ATOM   4260  C CB  . PHE C 3 95  ? 29.689  4.371   53.645  1.00 31.69  ? 91  PHE H CB  1 
ATOM   4261  C CG  . PHE C 3 95  ? 29.698  4.422   55.142  1.00 33.29  ? 91  PHE H CG  1 
ATOM   4262  C CD1 . PHE C 3 95  ? 29.208  3.372   55.885  1.00 35.04  ? 91  PHE H CD1 1 
ATOM   4263  C CD2 . PHE C 3 95  ? 30.198  5.511   55.805  1.00 34.14  ? 91  PHE H CD2 1 
ATOM   4264  C CE1 . PHE C 3 95  ? 29.217  3.413   57.237  1.00 32.90  ? 91  PHE H CE1 1 
ATOM   4265  C CE2 . PHE C 3 95  ? 30.199  5.546   57.173  1.00 33.94  ? 91  PHE H CE2 1 
ATOM   4266  C CZ  . PHE C 3 95  ? 29.705  4.497   57.878  1.00 33.81  ? 91  PHE H CZ  1 
ATOM   4267  N N   . CYS C 3 96  ? 30.001  2.376   51.044  1.00 28.74  ? 92  CYS H N   1 
ATOM   4268  C CA  . CYS C 3 96  ? 29.432  2.481   49.713  1.00 31.63  ? 92  CYS H CA  1 
ATOM   4269  C C   . CYS C 3 96  ? 27.925  2.553   49.851  1.00 33.06  ? 92  CYS H C   1 
ATOM   4270  O O   . CYS C 3 96  ? 27.353  1.938   50.749  1.00 34.32  ? 92  CYS H O   1 
ATOM   4271  C CB  . CYS C 3 96  ? 29.892  1.384   48.748  1.00 31.12  ? 92  CYS H CB  1 
ATOM   4272  S SG  . CYS C 3 96  ? 29.153  -0.236  48.955  1.00 45.95  ? 92  CYS H SG  1 
ATOM   4273  N N   . ALA C 3 97  ? 27.308  3.325   48.962  1.00 31.89  ? 93  ALA H N   1 
ATOM   4274  C CA  . ALA C 3 97  ? 25.908  3.665   49.032  1.00 30.27  ? 93  ALA H CA  1 
ATOM   4275  C C   . ALA C 3 97  ? 25.372  3.788   47.603  1.00 34.39  ? 93  ALA H C   1 
ATOM   4276  O O   . ALA C 3 97  ? 26.022  4.366   46.738  1.00 35.72  ? 93  ALA H O   1 
ATOM   4277  C CB  . ALA C 3 97  ? 25.770  4.961   49.756  1.00 30.44  ? 93  ALA H CB  1 
ATOM   4278  N N   . ARG C 3 98  ? 24.189  3.246   47.349  1.00 35.02  ? 94  ARG H N   1 
ATOM   4279  C CA  . ARG C 3 98  ? 23.629  3.231   46.001  1.00 34.18  ? 94  ARG H CA  1 
ATOM   4280  C C   . ARG C 3 98  ? 22.559  4.314   45.801  1.00 35.68  ? 94  ARG H C   1 
ATOM   4281  O O   . ARG C 3 98  ? 21.874  4.682   46.752  1.00 35.48  ? 94  ARG H O   1 
ATOM   4282  C CB  . ARG C 3 98  ? 23.022  1.850   45.770  1.00 34.97  ? 94  ARG H CB  1 
ATOM   4283  C CG  . ARG C 3 98  ? 22.376  1.651   44.435  1.00 37.91  ? 94  ARG H CG  1 
ATOM   4284  C CD  . ARG C 3 98  ? 20.881  1.454   44.568  1.00 39.50  ? 94  ARG H CD  1 
ATOM   4285  N NE  . ARG C 3 98  ? 20.499  0.055   44.386  1.00 45.42  ? 94  ARG H NE  1 
ATOM   4286  C CZ  . ARG C 3 98  ? 19.262  -0.411  44.538  1.00 43.57  ? 94  ARG H CZ  1 
ATOM   4287  N NH1 . ARG C 3 98  ? 19.019  -1.700  44.348  1.00 36.53  ? 94  ARG H NH1 1 
ATOM   4288  N NH2 . ARG C 3 98  ? 18.273  0.413   44.887  1.00 42.92  ? 94  ARG H NH2 1 
ATOM   4289  N N   . ASP C 3 99  ? 22.420  4.827   44.577  1.00 34.60  ? 95  ASP H N   1 
ATOM   4290  C CA  . ASP C 3 99  ? 21.264  5.668   44.190  1.00 34.90  ? 95  ASP H CA  1 
ATOM   4291  C C   . ASP C 3 99  ? 20.139  4.839   43.543  1.00 33.89  ? 95  ASP H C   1 
ATOM   4292  O O   . ASP C 3 99  ? 20.383  3.966   42.722  1.00 34.48  ? 95  ASP H O   1 
ATOM   4293  C CB  . ASP C 3 99  ? 21.678  6.786   43.214  1.00 39.20  ? 95  ASP H CB  1 
ATOM   4294  C CG  . ASP C 3 99  ? 22.886  7.606   43.713  1.00 42.27  ? 95  ASP H CG  1 
ATOM   4295  O OD1 . ASP C 3 99  ? 23.203  7.497   44.915  1.00 42.79  ? 95  ASP H OD1 1 
ATOM   4296  O OD2 . ASP C 3 99  ? 23.520  8.348   42.913  1.00 37.91  ? 95  ASP H OD2 1 
ATOM   4297  N N   . GLY C 3 100 ? 18.898  5.114   43.911  1.00 35.79  ? 96  GLY H N   1 
ATOM   4298  C CA  . GLY C 3 100 ? 17.769  4.354   43.385  1.00 39.92  ? 96  GLY H CA  1 
ATOM   4299  C C   . GLY C 3 100 ? 16.959  5.096   42.333  1.00 38.83  ? 96  GLY H C   1 
ATOM   4300  O O   . GLY C 3 100 ? 17.457  6.044   41.743  1.00 42.16  ? 96  GLY H O   1 
ATOM   4301  N N   . TYR C 3 101 ? 15.720  4.687   42.082  1.00 35.14  ? 97  TYR H N   1 
ATOM   4302  C CA  . TYR C 3 101 ? 14.931  5.418   41.101  1.00 36.45  ? 97  TYR H CA  1 
ATOM   4303  C C   . TYR C 3 101 ? 14.119  6.516   41.714  1.00 37.03  ? 97  TYR H C   1 
ATOM   4304  O O   . TYR C 3 101 ? 13.641  7.392   41.011  1.00 38.93  ? 97  TYR H O   1 
ATOM   4305  C CB  . TYR C 3 101 ? 14.009  4.513   40.312  1.00 39.63  ? 97  TYR H CB  1 
ATOM   4306  C CG  . TYR C 3 101 ? 12.999  3.790   41.148  1.00 41.17  ? 97  TYR H CG  1 
ATOM   4307  C CD1 . TYR C 3 101 ? 13.337  2.627   41.792  1.00 41.56  ? 97  TYR H CD1 1 
ATOM   4308  C CD2 . TYR C 3 101 ? 11.699  4.249   41.268  1.00 41.77  ? 97  TYR H CD2 1 
ATOM   4309  C CE1 . TYR C 3 101 ? 12.420  1.947   42.550  1.00 43.17  ? 97  TYR H CE1 1 
ATOM   4310  C CE2 . TYR C 3 101 ? 10.773  3.567   42.028  1.00 42.81  ? 97  TYR H CE2 1 
ATOM   4311  C CZ  . TYR C 3 101 ? 11.151  2.420   42.668  1.00 39.65  ? 97  TYR H CZ  1 
ATOM   4312  O OH  . TYR C 3 101 ? 10.284  1.718   43.439  1.00 37.71  ? 97  TYR H OH  1 
ATOM   4313  N N   . ARG C 3 102 ? 13.955  6.495   43.026  1.00 37.05  ? 98  ARG H N   1 
ATOM   4314  C CA  . ARG C 3 102 ? 13.139  7.542   43.621  1.00 38.25  ? 98  ARG H CA  1 
ATOM   4315  C C   . ARG C 3 102 ? 13.874  8.655   44.371  1.00 37.39  ? 98  ARG H C   1 
ATOM   4316  O O   . ARG C 3 102 ? 13.374  9.775   44.441  1.00 37.91  ? 98  ARG H O   1 
ATOM   4317  C CB  . ARG C 3 102 ? 12.031  6.964   44.473  1.00 36.01  ? 98  ARG H CB  1 
ATOM   4318  C CG  . ARG C 3 102 ? 11.093  8.020   44.917  1.00 39.63  ? 98  ARG H CG  1 
ATOM   4319  C CD  . ARG C 3 102 ? 9.744   7.474   45.083  1.00 42.04  ? 98  ARG H CD  1 
ATOM   4320  N NE  . ARG C 3 102 ? 9.132   7.197   43.799  1.00 43.85  ? 98  ARG H NE  1 
ATOM   4321  C CZ  . ARG C 3 102 ? 8.408   6.111   43.568  1.00 53.17  ? 98  ARG H CZ  1 
ATOM   4322  N NH1 . ARG C 3 102 ? 7.277   6.209   42.901  1.00 52.04  ? 98  ARG H NH1 1 
ATOM   4323  N NH2 . ARG C 3 102 ? 8.822   4.922   44.008  1.00 53.05  ? 98  ARG H NH2 1 
ATOM   4324  N N   . TYR C 3 103 ? 15.045  8.346   44.929  1.00 37.40  ? 99  TYR H N   1 
ATOM   4325  C CA  . TYR C 3 103 ? 15.908  9.332   45.571  1.00 33.16  ? 99  TYR H CA  1 
ATOM   4326  C C   . TYR C 3 103 ? 17.308  8.758   45.635  1.00 30.01  ? 99  TYR H C   1 
ATOM   4327  O O   . TYR C 3 103 ? 17.467  7.560   45.568  1.00 29.54  ? 99  TYR H O   1 
ATOM   4328  C CB  . TYR C 3 103 ? 15.381  9.684   46.955  1.00 36.24  ? 99  TYR H CB  1 
ATOM   4329  C CG  . TYR C 3 103 ? 14.780  8.512   47.668  1.00 31.32  ? 99  TYR H CG  1 
ATOM   4330  C CD1 . TYR C 3 103 ? 15.558  7.667   48.420  1.00 33.09  ? 99  TYR H CD1 1 
ATOM   4331  C CD2 . TYR C 3 103 ? 13.434  8.237   47.584  1.00 34.99  ? 99  TYR H CD2 1 
ATOM   4332  C CE1 . TYR C 3 103 ? 15.023  6.589   49.078  1.00 33.06  ? 99  TYR H CE1 1 
ATOM   4333  C CE2 . TYR C 3 103 ? 12.884  7.152   48.242  1.00 35.09  ? 99  TYR H CE2 1 
ATOM   4334  C CZ  . TYR C 3 103 ? 13.693  6.328   48.983  1.00 35.55  ? 99  TYR H CZ  1 
ATOM   4335  O OH  . TYR C 3 103 ? 13.196  5.233   49.656  1.00 44.29  ? 99  TYR H OH  1 
ATOM   4336  N N   . TYR C 3 104 ? 18.321  9.608   45.734  1.00 30.56  ? 100 TYR H N   1 
ATOM   4337  C CA  . TYR C 3 104 ? 19.700  9.146   45.861  1.00 30.94  ? 100 TYR H CA  1 
ATOM   4338  C C   . TYR C 3 104 ? 20.018  8.591   47.246  1.00 34.59  ? 100 TYR H C   1 
ATOM   4339  O O   . TYR C 3 104 ? 19.261  8.767   48.191  1.00 34.52  ? 100 TYR H O   1 
ATOM   4340  C CB  . TYR C 3 104 ? 20.673  10.287  45.689  1.00 33.88  ? 100 TYR H CB  1 
ATOM   4341  C CG  . TYR C 3 104 ? 20.570  11.108  44.461  1.00 36.37  ? 100 TYR H CG  1 
ATOM   4342  C CD1 . TYR C 3 104 ? 19.913  12.331  44.481  1.00 34.54  ? 100 TYR H CD1 1 
ATOM   4343  C CD2 . TYR C 3 104 ? 21.207  10.704  43.294  1.00 40.22  ? 100 TYR H CD2 1 
ATOM   4344  C CE1 . TYR C 3 104 ? 19.845  13.117  43.350  1.00 38.13  ? 100 TYR H CE1 1 
ATOM   4345  C CE2 . TYR C 3 104 ? 21.148  11.470  42.149  1.00 44.35  ? 100 TYR H CE2 1 
ATOM   4346  C CZ  . TYR C 3 104 ? 20.464  12.683  42.173  1.00 44.23  ? 100 TYR H CZ  1 
ATOM   4347  O OH  . TYR C 3 104 ? 20.419  13.432  41.004  1.00 41.48  ? 100 TYR H OH  1 
ATOM   4348  N N   . PHE C 3 105 A 21.194  7.990   47.382  1.00 36.16  ? 100 PHE H N   1 
ATOM   4349  C CA  . PHE C 3 105 A 21.648  7.427   48.661  1.00 37.89  ? 100 PHE H CA  1 
ATOM   4350  C C   . PHE C 3 105 A 20.619  6.499   49.367  1.00 40.27  ? 100 PHE H C   1 
ATOM   4351  O O   . PHE C 3 105 A 20.634  6.322   50.587  1.00 39.06  ? 100 PHE H O   1 
ATOM   4352  C CB  . PHE C 3 105 A 22.199  8.535   49.559  1.00 32.03  ? 100 PHE H CB  1 
ATOM   4353  C CG  . PHE C 3 105 A 23.478  9.108   49.052  1.00 33.15  ? 100 PHE H CG  1 
ATOM   4354  C CD1 . PHE C 3 105 A 24.678  8.474   49.276  1.00 39.35  ? 100 PHE H CD1 1 
ATOM   4355  C CD2 . PHE C 3 105 A 23.490  10.258  48.318  1.00 33.52  ? 100 PHE H CD2 1 
ATOM   4356  C CE1 . PHE C 3 105 A 25.871  9.005   48.778  1.00 33.64  ? 100 PHE H CE1 1 
ATOM   4357  C CE2 . PHE C 3 105 A 24.678  10.784  47.831  1.00 34.40  ? 100 PHE H CE2 1 
ATOM   4358  C CZ  . PHE C 3 105 A 25.854  10.153  48.057  1.00 29.68  ? 100 PHE H CZ  1 
ATOM   4359  N N   . ASP C 3 106 ? 19.773  5.868   48.557  1.00 35.97  ? 101 ASP H N   1 
ATOM   4360  C CA  . ASP C 3 106 ? 18.714  4.996   49.027  1.00 33.66  ? 101 ASP H CA  1 
ATOM   4361  C C   . ASP C 3 106 ? 19.139  3.843   49.946  1.00 39.22  ? 101 ASP H C   1 
ATOM   4362  O O   . ASP C 3 106 ? 18.432  3.577   50.901  1.00 47.23  ? 101 ASP H O   1 
ATOM   4363  C CB  . ASP C 3 106 ? 17.893  4.469   47.841  1.00 39.10  ? 101 ASP H CB  1 
ATOM   4364  C CG  . ASP C 3 106 ? 18.666  3.468   46.968  1.00 43.29  ? 101 ASP H CG  1 
ATOM   4365  O OD1 . ASP C 3 106 ? 19.842  3.171   47.290  1.00 43.55  ? 101 ASP H OD1 1 
ATOM   4366  O OD2 . ASP C 3 106 ? 18.093  2.967   45.964  1.00 39.92  ? 101 ASP H OD2 1 
ATOM   4367  N N   . TYR C 3 107 ? 20.254  3.152   49.670  1.00 38.97  ? 102 TYR H N   1 
ATOM   4368  C CA  . TYR C 3 107 ? 20.737  2.036   50.521  1.00 36.97  ? 102 TYR H CA  1 
ATOM   4369  C C   . TYR C 3 107 ? 22.242  2.094   50.784  1.00 36.06  ? 102 TYR H C   1 
ATOM   4370  O O   . TYR C 3 107 ? 23.015  2.419   49.884  1.00 37.55  ? 102 TYR H O   1 
ATOM   4371  C CB  . TYR C 3 107 ? 20.525  0.706   49.849  1.00 32.11  ? 102 TYR H CB  1 
ATOM   4372  C CG  . TYR C 3 107 ? 19.126  0.231   49.656  1.00 36.93  ? 102 TYR H CG  1 
ATOM   4373  C CD1 . TYR C 3 107 ? 18.480  -0.470  50.658  1.00 41.42  ? 102 TYR H CD1 1 
ATOM   4374  C CD2 . TYR C 3 107 ? 18.475  0.393   48.434  1.00 40.91  ? 102 TYR H CD2 1 
ATOM   4375  C CE1 . TYR C 3 107 ? 17.193  -0.962  50.477  1.00 49.99  ? 102 TYR H CE1 1 
ATOM   4376  C CE2 . TYR C 3 107 ? 17.185  -0.092  48.230  1.00 44.57  ? 102 TYR H CE2 1 
ATOM   4377  C CZ  . TYR C 3 107 ? 16.542  -0.772  49.259  1.00 51.46  ? 102 TYR H CZ  1 
ATOM   4378  O OH  . TYR C 3 107 ? 15.257  -1.267  49.095  1.00 50.34  ? 102 TYR H OH  1 
ATOM   4379  N N   . TRP C 3 108 ? 22.661  1.706   51.983  1.00 30.59  ? 103 TRP H N   1 
ATOM   4380  C CA  . TRP C 3 108 ? 24.062  1.772   52.376  1.00 28.56  ? 103 TRP H CA  1 
ATOM   4381  C C   . TRP C 3 108 ? 24.580  0.419   52.805  1.00 35.77  ? 103 TRP H C   1 
ATOM   4382  O O   . TRP C 3 108 ? 23.806  -0.428  53.272  1.00 40.20  ? 103 TRP H O   1 
ATOM   4383  C CB  . TRP C 3 108 ? 24.212  2.691   53.567  1.00 30.97  ? 103 TRP H CB  1 
ATOM   4384  C CG  . TRP C 3 108 ? 23.850  4.110   53.301  1.00 36.86  ? 103 TRP H CG  1 
ATOM   4385  C CD1 . TRP C 3 108 ? 22.619  4.623   52.951  1.00 36.36  ? 103 TRP H CD1 1 
ATOM   4386  C CD2 . TRP C 3 108 ? 24.738  5.219   53.381  1.00 36.67  ? 103 TRP H CD2 1 
ATOM   4387  N NE1 . TRP C 3 108 ? 22.710  5.991   52.800  1.00 34.64  ? 103 TRP H NE1 1 
ATOM   4388  C CE2 . TRP C 3 108 ? 24.001  6.374   53.056  1.00 33.92  ? 103 TRP H CE2 1 
ATOM   4389  C CE3 . TRP C 3 108 ? 26.090  5.344   53.692  1.00 33.14  ? 103 TRP H CE3 1 
ATOM   4390  C CZ2 . TRP C 3 108 ? 24.578  7.620   53.026  1.00 35.36  ? 103 TRP H CZ2 1 
ATOM   4391  C CZ3 . TRP C 3 108 ? 26.647  6.572   53.676  1.00 33.29  ? 103 TRP H CZ3 1 
ATOM   4392  C CH2 . TRP C 3 108 ? 25.900  7.701   53.346  1.00 35.36  ? 103 TRP H CH2 1 
ATOM   4393  N N   . GLY C 3 109 ? 25.889  0.219   52.676  1.00 32.32  ? 104 GLY H N   1 
ATOM   4394  C CA  . GLY C 3 109 ? 26.527  -0.945  53.264  1.00 37.11  ? 104 GLY H CA  1 
ATOM   4395  C C   . GLY C 3 109 ? 26.999  -0.679  54.695  1.00 41.66  ? 104 GLY H C   1 
ATOM   4396  O O   . GLY C 3 109 ? 26.981  0.460   55.151  1.00 37.60  ? 104 GLY H O   1 
ATOM   4397  N N   . GLN C 3 110 ? 27.445  -1.720  55.400  1.00 47.25  ? 105 GLN H N   1 
ATOM   4398  C CA  . GLN C 3 110 ? 27.854  -1.597  56.818  1.00 44.90  ? 105 GLN H CA  1 
ATOM   4399  C C   . GLN C 3 110 ? 29.160  -0.865  57.111  1.00 42.90  ? 105 GLN H C   1 
ATOM   4400  O O   . GLN C 3 110 ? 29.542  -0.744  58.266  1.00 46.81  ? 105 GLN H O   1 
ATOM   4401  C CB  . GLN C 3 110 ? 27.924  -2.966  57.524  1.00 41.53  ? 105 GLN H CB  1 
ATOM   4402  C CG  . GLN C 3 110 ? 27.845  -4.216  56.631  1.00 54.68  ? 105 GLN H CG  1 
ATOM   4403  C CD  . GLN C 3 110 ? 29.126  -4.524  55.862  1.00 49.09  ? 105 GLN H CD  1 
ATOM   4404  O OE1 . GLN C 3 110 ? 29.845  -5.467  56.185  1.00 47.86  ? 105 GLN H OE1 1 
ATOM   4405  N NE2 . GLN C 3 110 ? 29.396  -3.745  54.827  1.00 44.77  ? 105 GLN H NE2 1 
ATOM   4406  N N   . GLY C 3 111 ? 29.869  -0.408  56.092  1.00 39.86  ? 106 GLY H N   1 
ATOM   4407  C CA  . GLY C 3 111 ? 31.108  0.307   56.346  1.00 39.66  ? 106 GLY H CA  1 
ATOM   4408  C C   . GLY C 3 111 ? 32.375  -0.521  56.540  1.00 39.83  ? 106 GLY H C   1 
ATOM   4409  O O   . GLY C 3 111 ? 32.408  -1.477  57.319  1.00 38.01  ? 106 GLY H O   1 
ATOM   4410  N N   . THR C 3 112 ? 33.425  -0.113  55.823  1.00 38.14  ? 107 THR H N   1 
ATOM   4411  C CA  . THR C 3 112 ? 34.751  -0.739  55.843  1.00 38.27  ? 107 THR H CA  1 
ATOM   4412  C C   . THR C 3 112 ? 35.725  0.153   56.594  1.00 36.68  ? 107 THR H C   1 
ATOM   4413  O O   . THR C 3 112 ? 35.664  1.373   56.461  1.00 37.25  ? 107 THR H O   1 
ATOM   4414  C CB  . THR C 3 112 ? 35.296  -0.921  54.394  1.00 44.31  ? 107 THR H CB  1 
ATOM   4415  O OG1 . THR C 3 112 ? 34.860  -2.176  53.848  1.00 44.48  ? 107 THR H OG1 1 
ATOM   4416  C CG2 . THR C 3 112 ? 36.824  -0.862  54.364  1.00 41.25  ? 107 THR H CG2 1 
ATOM   4417  N N   . SER C 3 113 ? 36.642  -0.431  57.361  1.00 37.31  ? 108 SER H N   1 
ATOM   4418  C CA  . SER C 3 113 ? 37.541  0.406   58.157  1.00 42.99  ? 108 SER H CA  1 
ATOM   4419  C C   . SER C 3 113 ? 39.066  0.204   58.031  1.00 38.50  ? 108 SER H C   1 
ATOM   4420  O O   . SER C 3 113 ? 39.599  -0.790  58.513  1.00 33.41  ? 108 SER H O   1 
ATOM   4421  C CB  . SER C 3 113 ? 37.130  0.351   59.621  1.00 46.94  ? 108 SER H CB  1 
ATOM   4422  O OG  . SER C 3 113 ? 37.547  1.552   60.280  1.00 58.91  ? 108 SER H OG  1 
ATOM   4423  N N   . VAL C 3 114 ? 39.746  1.185   57.417  1.00 38.52  ? 109 VAL H N   1 
ATOM   4424  C CA  . VAL C 3 114 ? 41.212  1.154   57.197  1.00 42.64  ? 109 VAL H CA  1 
ATOM   4425  C C   . VAL C 3 114 ? 42.042  1.916   58.256  1.00 44.30  ? 109 VAL H C   1 
ATOM   4426  O O   . VAL C 3 114 ? 41.825  3.115   58.501  1.00 42.81  ? 109 VAL H O   1 
ATOM   4427  C CB  . VAL C 3 114 ? 41.647  1.545   55.703  1.00 36.44  ? 109 VAL H CB  1 
ATOM   4428  C CG1 . VAL C 3 114 ? 41.907  3.015   55.519  1.00 34.07  ? 109 VAL H CG1 1 
ATOM   4429  C CG2 . VAL C 3 114 ? 42.875  0.796   55.306  1.00 38.06  ? 109 VAL H CG2 1 
ATOM   4430  N N   . THR C 3 115 ? 42.977  1.198   58.888  1.00 41.35  ? 110 THR H N   1 
ATOM   4431  C CA  . THR C 3 115 ? 43.903  1.790   59.859  1.00 42.28  ? 110 THR H CA  1 
ATOM   4432  C C   . THR C 3 115 ? 45.344  1.778   59.296  1.00 47.87  ? 110 THR H C   1 
ATOM   4433  O O   . THR C 3 115 ? 45.920  0.701   59.089  1.00 48.63  ? 110 THR H O   1 
ATOM   4434  C CB  . THR C 3 115 ? 43.833  1.058   61.223  1.00 41.81  ? 110 THR H CB  1 
ATOM   4435  O OG1 . THR C 3 115 ? 42.491  1.092   61.730  1.00 44.19  ? 110 THR H OG1 1 
ATOM   4436  C CG2 . THR C 3 115 ? 44.750  1.705   62.237  1.00 42.90  ? 110 THR H CG2 1 
ATOM   4437  N N   . VAL C 3 116 ? 45.914  2.971   59.060  1.00 44.99  ? 111 VAL H N   1 
ATOM   4438  C CA  . VAL C 3 116 ? 47.173  3.148   58.313  1.00 43.08  ? 111 VAL H CA  1 
ATOM   4439  C C   . VAL C 3 116 ? 48.410  3.513   59.147  1.00 46.02  ? 111 VAL H C   1 
ATOM   4440  O O   . VAL C 3 116 ? 48.449  4.594   59.711  1.00 49.65  ? 111 VAL H O   1 
ATOM   4441  C CB  . VAL C 3 116 ? 47.002  4.266   57.283  1.00 43.82  ? 111 VAL H CB  1 
ATOM   4442  C CG1 . VAL C 3 116 ? 48.331  4.616   56.612  1.00 47.20  ? 111 VAL H CG1 1 
ATOM   4443  C CG2 . VAL C 3 116 ? 46.004  3.857   56.259  1.00 47.50  ? 111 VAL H CG2 1 
ATOM   4444  N N   . SER C 3 117 ? 49.424  2.641   59.193  1.00 48.64  ? 112 SER H N   1 
ATOM   4445  C CA  . SER C 3 117 ? 50.666  2.901   59.955  1.00 51.05  ? 112 SER H CA  1 
ATOM   4446  C C   . SER C 3 117 ? 51.658  1.736   60.016  1.00 54.19  ? 112 SER H C   1 
ATOM   4447  O O   . SER C 3 117 ? 51.348  0.581   59.682  1.00 52.32  ? 112 SER H O   1 
ATOM   4448  C CB  . SER C 3 117 ? 50.366  3.345   61.392  1.00 50.77  ? 112 SER H CB  1 
ATOM   4449  O OG  . SER C 3 117 ? 50.006  2.237   62.210  1.00 53.72  ? 112 SER H OG  1 
ATOM   4450  N N   . SER C 3 118 ? 52.858  2.048   60.483  1.00 55.08  ? 113 SER H N   1 
ATOM   4451  C CA  . SER C 3 118 ? 53.915  1.052   60.551  1.00 59.23  ? 113 SER H CA  1 
ATOM   4452  C C   . SER C 3 118 ? 53.977  0.487   61.940  1.00 58.07  ? 113 SER H C   1 
ATOM   4453  O O   . SER C 3 118 ? 54.974  -0.139  62.309  1.00 59.95  ? 113 SER H O   1 
ATOM   4454  C CB  . SER C 3 118 ? 55.248  1.678   60.192  1.00 56.46  ? 113 SER H CB  1 
ATOM   4455  O OG  . SER C 3 118 ? 55.007  2.870   59.466  1.00 58.61  ? 113 SER H OG  1 
ATOM   4456  N N   . ALA C 3 119 ? 52.921  0.746   62.712  1.00 51.14  ? 114 ALA H N   1 
ATOM   4457  C CA  . ALA C 3 119 ? 52.713  0.069   63.976  1.00 49.81  ? 114 ALA H CA  1 
ATOM   4458  C C   . ALA C 3 119 ? 52.483  -1.399  63.663  1.00 52.33  ? 114 ALA H C   1 
ATOM   4459  O O   . ALA C 3 119 ? 51.976  -1.739  62.590  1.00 55.99  ? 114 ALA H O   1 
ATOM   4460  C CB  . ALA C 3 119 ? 51.536  0.645   64.678  1.00 55.40  ? 114 ALA H CB  1 
ATOM   4461  N N   . LYS C 3 120 ? 52.865  -2.272  64.583  1.00 48.05  ? 115 LYS H N   1 
ATOM   4462  C CA  . LYS C 3 120 ? 52.925  -3.699  64.284  1.00 52.13  ? 115 LYS H CA  1 
ATOM   4463  C C   . LYS C 3 120 ? 51.872  -4.434  65.085  1.00 54.51  ? 115 LYS H C   1 
ATOM   4464  O O   . LYS C 3 120 ? 51.541  -4.022  66.190  1.00 60.23  ? 115 LYS H O   1 
ATOM   4465  C CB  . LYS C 3 120 ? 54.318  -4.243  64.636  1.00 57.07  ? 115 LYS H CB  1 
ATOM   4466  C CG  . LYS C 3 120 ? 54.932  -5.260  63.651  1.00 57.34  ? 115 LYS H CG  1 
ATOM   4467  C CD  . LYS C 3 120 ? 55.502  -4.619  62.375  1.00 55.00  ? 115 LYS H CD  1 
ATOM   4468  C CE  . LYS C 3 120 ? 56.731  -3.754  62.657  1.00 57.63  ? 115 LYS H CE  1 
ATOM   4469  N NZ  . LYS C 3 120 ? 56.394  -2.395  63.212  1.00 54.42  ? 115 LYS H NZ  1 
ATOM   4470  N N   . THR C 3 121 ? 51.342  -5.521  64.538  1.00 54.35  ? 116 THR H N   1 
ATOM   4471  C CA  . THR C 3 121 ? 50.269  -6.247  65.211  1.00 56.93  ? 116 THR H CA  1 
ATOM   4472  C C   . THR C 3 121 ? 50.811  -6.793  66.527  1.00 57.60  ? 116 THR H C   1 
ATOM   4473  O O   . THR C 3 121 ? 51.978  -7.156  66.591  1.00 58.67  ? 116 THR H O   1 
ATOM   4474  C CB  . THR C 3 121 ? 49.746  -7.369  64.323  1.00 53.05  ? 116 THR H CB  1 
ATOM   4475  O OG1 . THR C 3 121 ? 49.820  -6.938  62.962  1.00 54.93  ? 116 THR H OG1 1 
ATOM   4476  C CG2 . THR C 3 121 ? 48.313  -7.692  64.652  1.00 49.60  ? 116 THR H CG2 1 
ATOM   4477  N N   . THR C 3 122 ? 49.978  -6.824  67.572  1.00 56.31  ? 117 THR H N   1 
ATOM   4478  C CA  . THR C 3 122 ? 50.406  -7.254  68.915  1.00 53.56  ? 117 THR H CA  1 
ATOM   4479  C C   . THR C 3 122 ? 49.295  -7.837  69.808  1.00 58.36  ? 117 THR H C   1 
ATOM   4480  O O   . THR C 3 122 ? 48.257  -7.195  70.035  1.00 59.95  ? 117 THR H O   1 
ATOM   4481  C CB  . THR C 3 122 ? 51.019  -6.095  69.669  1.00 51.50  ? 117 THR H CB  1 
ATOM   4482  O OG1 . THR C 3 122 ? 50.927  -4.919  68.859  1.00 52.49  ? 117 THR H OG1 1 
ATOM   4483  C CG2 . THR C 3 122 ? 52.462  -6.392  69.980  1.00 60.02  ? 117 THR H CG2 1 
ATOM   4484  N N   . ALA C 3 123 ? 49.513  -9.039  70.336  1.00 49.57  ? 118 ALA H N   1 
ATOM   4485  C CA  . ALA C 3 123 ? 48.501  -9.659  71.159  1.00 42.93  ? 118 ALA H CA  1 
ATOM   4486  C C   . ALA C 3 123 ? 48.129  -8.668  72.264  1.00 55.05  ? 118 ALA H C   1 
ATOM   4487  O O   . ALA C 3 123 ? 48.871  -7.728  72.508  1.00 59.82  ? 118 ALA H O   1 
ATOM   4488  C CB  . ALA C 3 123 ? 49.034  -10.905 71.726  1.00 38.09  ? 118 ALA H CB  1 
ATOM   4489  N N   . PRO C 3 124 ? 46.958  -8.840  72.910  1.00 61.04  ? 119 PRO H N   1 
ATOM   4490  C CA  . PRO C 3 124 ? 46.628  -8.071  74.113  1.00 57.41  ? 119 PRO H CA  1 
ATOM   4491  C C   . PRO C 3 124 ? 46.751  -8.918  75.361  1.00 60.62  ? 119 PRO H C   1 
ATOM   4492  O O   . PRO C 3 124 ? 46.224  -10.038 75.373  1.00 60.07  ? 119 PRO H O   1 
ATOM   4493  C CB  . PRO C 3 124 ? 45.140  -7.764  73.929  1.00 60.85  ? 119 PRO H CB  1 
ATOM   4494  C CG  . PRO C 3 124 ? 44.648  -8.685  72.814  1.00 56.69  ? 119 PRO H CG  1 
ATOM   4495  C CD  . PRO C 3 124 ? 45.784  -9.587  72.436  1.00 60.54  ? 119 PRO H CD  1 
ATOM   4496  N N   . PRO C 3 125 ? 47.456  -8.411  76.388  1.00 72.44  ? 120 PRO H N   1 
ATOM   4497  C CA  . PRO C 3 125 ? 47.396  -8.958  77.764  1.00 77.12  ? 120 PRO H CA  1 
ATOM   4498  C C   . PRO C 3 125 ? 46.187  -8.436  78.569  1.00 68.09  ? 120 PRO H C   1 
ATOM   4499  O O   . PRO C 3 125 ? 46.039  -7.227  78.710  1.00 68.68  ? 120 PRO H O   1 
ATOM   4500  C CB  . PRO C 3 125 ? 48.714  -8.466  78.409  1.00 75.96  ? 120 PRO H CB  1 
ATOM   4501  C CG  . PRO C 3 125 ? 49.608  -8.054  77.240  1.00 79.38  ? 120 PRO H CG  1 
ATOM   4502  C CD  . PRO C 3 125 ? 48.651  -7.569  76.172  1.00 73.71  ? 120 PRO H CD  1 
ATOM   4503  N N   . VAL C 3 126 ? 45.332  -9.319  79.077  1.00 64.53  ? 121 VAL H N   1 
ATOM   4504  C CA  . VAL C 3 126 ? 44.209  -8.865  79.895  1.00 68.40  ? 121 VAL H CA  1 
ATOM   4505  C C   . VAL C 3 126 ? 44.423  -9.161  81.373  1.00 75.23  ? 121 VAL H C   1 
ATOM   4506  O O   . VAL C 3 126 ? 44.666  -10.304 81.766  1.00 81.42  ? 121 VAL H O   1 
ATOM   4507  C CB  . VAL C 3 126 ? 42.844  -9.437  79.422  1.00 66.83  ? 121 VAL H CB  1 
ATOM   4508  C CG1 . VAL C 3 126 ? 43.050  -10.672 78.604  1.00 64.68  ? 121 VAL H CG1 1 
ATOM   4509  C CG2 . VAL C 3 126 ? 41.916  -9.713  80.608  1.00 62.08  ? 121 VAL H CG2 1 
ATOM   4510  N N   . TYR C 3 127 ? 44.330  -8.114  82.184  1.00 74.40  ? 122 TYR H N   1 
ATOM   4511  C CA  . TYR C 3 127 ? 44.461  -8.221  83.628  1.00 76.24  ? 122 TYR H CA  1 
ATOM   4512  C C   . TYR C 3 127 ? 43.100  -7.998  84.313  1.00 74.87  ? 122 TYR H C   1 
ATOM   4513  O O   . TYR C 3 127 ? 42.407  -7.038  83.986  1.00 74.08  ? 122 TYR H O   1 
ATOM   4514  C CB  . TYR C 3 127 ? 45.428  -7.152  84.115  1.00 82.99  ? 122 TYR H CB  1 
ATOM   4515  C CG  . TYR C 3 127 ? 46.768  -7.085  83.415  1.00 79.89  ? 122 TYR H CG  1 
ATOM   4516  C CD1 . TYR C 3 127 ? 47.624  -8.178  83.393  1.00 87.71  ? 122 TYR H CD1 1 
ATOM   4517  C CD2 . TYR C 3 127 ? 47.203  -5.905  82.838  1.00 78.21  ? 122 TYR H CD2 1 
ATOM   4518  C CE1 . TYR C 3 127 ? 48.864  -8.103  82.779  1.00 90.00  ? 122 TYR H CE1 1 
ATOM   4519  C CE2 . TYR C 3 127 ? 48.437  -5.818  82.225  1.00 85.82  ? 122 TYR H CE2 1 
ATOM   4520  C CZ  . TYR C 3 127 ? 49.265  -6.917  82.197  1.00 88.22  ? 122 TYR H CZ  1 
ATOM   4521  O OH  . TYR C 3 127 ? 50.496  -6.823  81.585  1.00 87.36  ? 122 TYR H OH  1 
ATOM   4522  N N   . PRO C 3 128 ? 42.731  -8.852  85.293  1.00 78.21  ? 123 PRO H N   1 
ATOM   4523  C CA  . PRO C 3 128 ? 41.394  -8.859  85.905  1.00 79.57  ? 123 PRO H CA  1 
ATOM   4524  C C   . PRO C 3 128 ? 41.289  -7.964  87.136  1.00 84.36  ? 123 PRO H C   1 
ATOM   4525  O O   . PRO C 3 128 ? 42.270  -7.812  87.860  1.00 88.01  ? 123 PRO H O   1 
ATOM   4526  C CB  . PRO C 3 128 ? 41.224  -10.316 86.350  1.00 78.25  ? 123 PRO H CB  1 
ATOM   4527  C CG  . PRO C 3 128 ? 42.612  -10.944 86.260  1.00 85.35  ? 123 PRO H CG  1 
ATOM   4528  C CD  . PRO C 3 128 ? 43.591  -9.841  85.952  1.00 85.24  ? 123 PRO H CD  1 
ATOM   4529  N N   . LEU C 3 129 ? 40.105  -7.405  87.380  1.00 87.88  ? 124 LEU H N   1 
ATOM   4530  C CA  . LEU C 3 129 ? 39.892  -6.466  88.489  1.00 94.39  ? 124 LEU H CA  1 
ATOM   4531  C C   . LEU C 3 129 ? 38.755  -6.863  89.459  1.00 104.18 ? 124 LEU H C   1 
ATOM   4532  O O   . LEU C 3 129 ? 37.622  -7.104  89.034  1.00 99.50  ? 124 LEU H O   1 
ATOM   4533  C CB  . LEU C 3 129 ? 39.659  -5.054  87.943  1.00 84.26  ? 124 LEU H CB  1 
ATOM   4534  C CG  . LEU C 3 129 ? 40.885  -4.152  87.744  1.00 86.47  ? 124 LEU H CG  1 
ATOM   4535  C CD1 . LEU C 3 129 ? 42.125  -4.911  87.253  1.00 82.49  ? 124 LEU H CD1 1 
ATOM   4536  C CD2 . LEU C 3 129 ? 40.557  -2.962  86.830  1.00 80.07  ? 124 LEU H CD2 1 
ATOM   4537  N N   . ALA C 3 130 ? 39.082  -6.933  90.755  1.00 113.78 ? 125 ALA H N   1 
ATOM   4538  C CA  . ALA C 3 130 ? 38.122  -7.239  91.830  1.00 121.91 ? 125 ALA H CA  1 
ATOM   4539  C C   . ALA C 3 130 ? 38.561  -6.579  93.142  1.00 131.04 ? 125 ALA H C   1 
ATOM   4540  O O   . ALA C 3 130 ? 39.763  -6.504  93.429  1.00 130.30 ? 125 ALA H O   1 
ATOM   4541  C CB  . ALA C 3 130 ? 37.963  -8.747  92.013  1.00 122.52 ? 125 ALA H CB  1 
ATOM   4542  N N   . PRO C 3 131 ? 37.591  -6.088  93.940  1.00 133.60 ? 126 PRO H N   1 
ATOM   4543  C CA  . PRO C 3 131 ? 37.966  -5.219  95.054  1.00 138.95 ? 126 PRO H CA  1 
ATOM   4544  C C   . PRO C 3 131 ? 37.641  -5.804  96.416  1.00 154.14 ? 126 PRO H C   1 
ATOM   4545  O O   . PRO C 3 131 ? 37.774  -5.076  97.398  1.00 159.38 ? 126 PRO H O   1 
ATOM   4546  C CB  . PRO C 3 131 ? 37.047  -4.010  94.843  1.00 131.30 ? 126 PRO H CB  1 
ATOM   4547  C CG  . PRO C 3 131 ? 35.825  -4.574  94.024  1.00 129.02 ? 126 PRO H CG  1 
ATOM   4548  C CD  . PRO C 3 131 ? 36.138  -6.036  93.719  1.00 126.99 ? 126 PRO H CD  1 
ATOM   4549  N N   . VAL C 3 132 ? 37.219  -7.066  96.484  1.00 156.90 ? 127 VAL H N   1 
ATOM   4550  C CA  . VAL C 3 132 ? 36.608  -7.582  97.716  1.00 162.55 ? 127 VAL H CA  1 
ATOM   4551  C C   . VAL C 3 132 ? 37.572  -7.765  98.903  1.00 168.53 ? 127 VAL H C   1 
ATOM   4552  O O   . VAL C 3 132 ? 37.122  -7.954  100.034 1.00 169.09 ? 127 VAL H O   1 
ATOM   4553  C CB  . VAL C 3 132 ? 35.775  -8.866  97.477  1.00 154.71 ? 127 VAL H CB  1 
ATOM   4554  C CG1 . VAL C 3 132 ? 36.673  -10.074 97.351  1.00 150.23 ? 127 VAL H CG1 1 
ATOM   4555  C CG2 . VAL C 3 132 ? 34.780  -9.060  98.608  1.00 153.76 ? 127 VAL H CG2 1 
ATOM   4556  N N   . CYS C 3 133 ? 38.883  -7.695  98.646  1.00 172.81 ? 128 CYS H N   1 
ATOM   4557  C CA  . CYS C 3 133 ? 39.909  -7.818  99.696  1.00 174.91 ? 128 CYS H CA  1 
ATOM   4558  C C   . CYS C 3 133 ? 39.711  -6.729  100.751 1.00 172.47 ? 128 CYS H C   1 
ATOM   4559  O O   . CYS C 3 133 ? 39.767  -6.991  101.954 1.00 168.88 ? 128 CYS H O   1 
ATOM   4560  C CB  . CYS C 3 133 ? 41.326  -7.748  99.098  1.00 170.77 ? 128 CYS H CB  1 
ATOM   4561  S SG  . CYS C 3 133 ? 42.659  -8.428  100.153 1.00 157.45 ? 128 CYS H SG  1 
ATOM   4562  N N   . GLY C 3 134 ? 39.476  -5.507  100.286 1.00 171.14 ? 129 GLY H N   1 
ATOM   4563  C CA  . GLY C 3 134 ? 39.011  -4.446  101.154 1.00 168.11 ? 129 GLY H CA  1 
ATOM   4564  C C   . GLY C 3 134 ? 37.526  -4.633  101.400 1.00 170.53 ? 129 GLY H C   1 
ATOM   4565  O O   . GLY C 3 134 ? 36.756  -4.922  100.479 1.00 169.04 ? 129 GLY H O   1 
ATOM   4566  N N   . ASP C 3 135 ? 37.129  -4.473  102.656 1.00 174.27 ? 130 ASP H N   1 
ATOM   4567  C CA  . ASP C 3 135 ? 35.747  -4.675  103.086 1.00 175.75 ? 130 ASP H CA  1 
ATOM   4568  C C   . ASP C 3 135 ? 34.720  -3.972  102.164 1.00 171.88 ? 130 ASP H C   1 
ATOM   4569  O O   . ASP C 3 135 ? 34.856  -2.784  101.866 1.00 171.80 ? 130 ASP H O   1 
ATOM   4570  C CB  . ASP C 3 135 ? 35.596  -4.214  104.548 1.00 175.78 ? 130 ASP H CB  1 
ATOM   4571  C CG  . ASP C 3 135 ? 36.775  -4.648  105.431 1.00 170.10 ? 130 ASP H CG  1 
ATOM   4572  O OD1 . ASP C 3 135 ? 36.892  -4.152  106.575 1.00 163.08 ? 130 ASP H OD1 1 
ATOM   4573  O OD2 . ASP C 3 135 ? 37.588  -5.484  104.980 1.00 170.23 ? 130 ASP H OD2 1 
ATOM   4574  N N   . THR C 3 136 ? 33.698  -4.707  101.720 1.00 165.02 ? 131 THR H N   1 
ATOM   4575  C CA  . THR C 3 136 ? 32.713  -4.167  100.774 1.00 165.32 ? 131 THR H CA  1 
ATOM   4576  C C   . THR C 3 136 ? 31.253  -4.447  101.174 1.00 162.85 ? 131 THR H C   1 
ATOM   4577  O O   . THR C 3 136 ? 30.984  -5.396  101.908 1.00 160.28 ? 131 THR H O   1 
ATOM   4578  C CB  . THR C 3 136 ? 32.979  -4.680  99.339  1.00 163.48 ? 131 THR H CB  1 
ATOM   4579  O OG1 . THR C 3 136 ? 33.626  -5.957  99.402  1.00 155.49 ? 131 THR H OG1 1 
ATOM   4580  C CG2 . THR C 3 136 ? 33.879  -3.712  98.584  1.00 158.19 ? 131 THR H CG2 1 
ATOM   4581  N N   . THR C 3 137 ? 30.326  -3.612  100.689 1.00 164.89 ? 132 THR H N   1 
ATOM   4582  C CA  . THR C 3 137 ? 28.890  -3.716  101.011 1.00 160.92 ? 132 THR H CA  1 
ATOM   4583  C C   . THR C 3 137 ? 27.991  -3.127  99.901  1.00 159.45 ? 132 THR H C   1 
ATOM   4584  O O   . THR C 3 137 ? 28.484  -2.493  98.964  1.00 158.97 ? 132 THR H O   1 
ATOM   4585  C CB  . THR C 3 137 ? 28.560  -3.065  102.393 1.00 154.21 ? 132 THR H CB  1 
ATOM   4586  O OG1 . THR C 3 137 ? 28.169  -4.078  103.327 1.00 146.96 ? 132 THR H OG1 1 
ATOM   4587  C CG2 . THR C 3 137 ? 27.440  -2.036  102.281 1.00 150.46 ? 132 THR H CG2 1 
ATOM   4588  N N   . GLY C 3 138 ? 26.680  -3.348  100.007 1.00 155.82 ? 133 GLY H N   1 
ATOM   4589  C CA  . GLY C 3 138 ? 25.728  -2.883  99.009  1.00 149.57 ? 133 GLY H CA  1 
ATOM   4590  C C   . GLY C 3 138 ? 25.320  -4.034  98.109  1.00 147.54 ? 133 GLY H C   1 
ATOM   4591  O O   . GLY C 3 138 ? 26.178  -4.641  97.470  1.00 148.04 ? 133 GLY H O   1 
ATOM   4592  N N   . SER C 3 139 ? 24.023  -4.338  98.050  1.00 146.09 ? 134 SER H N   1 
ATOM   4593  C CA  . SER C 3 139 ? 23.545  -5.570  97.398  1.00 144.48 ? 134 SER H CA  1 
ATOM   4594  C C   . SER C 3 139 ? 23.926  -5.714  95.926  1.00 140.87 ? 134 SER H C   1 
ATOM   4595  O O   . SER C 3 139 ? 23.508  -6.663  95.261  1.00 140.76 ? 134 SER H O   1 
ATOM   4596  C CB  . SER C 3 139 ? 22.027  -5.728  97.544  1.00 143.62 ? 134 SER H CB  1 
ATOM   4597  O OG  . SER C 3 139 ? 21.575  -6.907  96.891  1.00 134.21 ? 134 SER H OG  1 
ATOM   4598  N N   . SER C 3 140 ? 24.707  -4.769  95.418  1.00 137.18 ? 135 SER H N   1 
ATOM   4599  C CA  . SER C 3 140 ? 25.172  -4.826  94.043  1.00 129.47 ? 135 SER H CA  1 
ATOM   4600  C C   . SER C 3 140 ? 26.655  -4.475  93.989  1.00 127.10 ? 135 SER H C   1 
ATOM   4601  O O   . SER C 3 140 ? 27.041  -3.337  94.246  1.00 127.18 ? 135 SER H O   1 
ATOM   4602  C CB  . SER C 3 140 ? 24.348  -3.876  93.178  1.00 125.00 ? 135 SER H CB  1 
ATOM   4603  O OG  . SER C 3 140 ? 23.911  -2.761  93.938  1.00 123.92 ? 135 SER H OG  1 
ATOM   4604  N N   . VAL C 3 141 ? 27.487  -5.461  93.673  1.00 123.26 ? 136 VAL H N   1 
ATOM   4605  C CA  . VAL C 3 141 ? 28.928  -5.242  93.617  1.00 120.67 ? 136 VAL H CA  1 
ATOM   4606  C C   . VAL C 3 141 ? 29.431  -5.152  92.185  1.00 114.92 ? 136 VAL H C   1 
ATOM   4607  O O   . VAL C 3 141 ? 28.983  -5.891  91.299  1.00 109.71 ? 136 VAL H O   1 
ATOM   4608  C CB  . VAL C 3 141 ? 29.708  -6.353  94.311  1.00 123.16 ? 136 VAL H CB  1 
ATOM   4609  C CG1 . VAL C 3 141 ? 29.536  -7.660  93.548  1.00 122.72 ? 136 VAL H CG1 1 
ATOM   4610  C CG2 . VAL C 3 141 ? 31.182  -5.975  94.398  1.00 119.42 ? 136 VAL H CG2 1 
ATOM   4611  N N   . THR C 3 142 ? 30.396  -4.261  91.983  1.00 111.58 ? 137 THR H N   1 
ATOM   4612  C CA  . THR C 3 142 ? 30.843  -3.888  90.653  1.00 106.48 ? 137 THR H CA  1 
ATOM   4613  C C   . THR C 3 142 ? 32.348  -4.129  90.466  1.00 111.54 ? 137 THR H C   1 
ATOM   4614  O O   . THR C 3 142 ? 33.172  -3.720  91.301  1.00 108.95 ? 137 THR H O   1 
ATOM   4615  C CB  . THR C 3 142 ? 30.459  -2.423  90.363  1.00 101.36 ? 137 THR H CB  1 
ATOM   4616  O OG1 . THR C 3 142 ? 31.487  -1.786  89.599  1.00 103.03 ? 137 THR H OG1 1 
ATOM   4617  C CG2 . THR C 3 142 ? 30.269  -1.661  91.668  1.00 103.87 ? 137 THR H CG2 1 
ATOM   4618  N N   . LEU C 3 143 ? 32.686  -4.811  89.366  1.00 109.70 ? 138 LEU H N   1 
ATOM   4619  C CA  . LEU C 3 143 ? 34.063  -5.222  89.069  1.00 106.69 ? 138 LEU H CA  1 
ATOM   4620  C C   . LEU C 3 143 ? 34.248  -5.661  87.606  1.00 93.82  ? 138 LEU H C   1 
ATOM   4621  O O   . LEU C 3 143 ? 33.268  -5.982  86.934  1.00 87.46  ? 138 LEU H O   1 
ATOM   4622  C CB  . LEU C 3 143 ? 34.510  -6.338  90.035  1.00 116.55 ? 138 LEU H CB  1 
ATOM   4623  C CG  . LEU C 3 143 ? 33.583  -7.499  90.454  1.00 115.48 ? 138 LEU H CG  1 
ATOM   4624  C CD1 . LEU C 3 143 ? 34.360  -8.575  91.218  1.00 118.77 ? 138 LEU H CD1 1 
ATOM   4625  C CD2 . LEU C 3 143 ? 32.406  -7.024  91.298  1.00 119.75 ? 138 LEU H CD2 1 
ATOM   4626  N N   . GLY C 3 144 ? 35.501  -5.665  87.125  1.00 95.54  ? 139 GLY H N   1 
ATOM   4627  C CA  . GLY C 3 144 ? 35.821  -6.137  85.776  1.00 92.37  ? 139 GLY H CA  1 
ATOM   4628  C C   . GLY C 3 144 ? 37.213  -5.958  85.139  1.00 85.08  ? 139 GLY H C   1 
ATOM   4629  O O   . GLY C 3 144 ? 38.140  -5.403  85.741  1.00 78.07  ? 139 GLY H O   1 
ATOM   4630  N N   . CYS C 3 145 ? 37.301  -6.404  83.877  1.00 78.20  ? 140 CYS H N   1 
ATOM   4631  C CA  . CYS C 3 145 ? 38.525  -6.580  83.062  1.00 75.27  ? 140 CYS H CA  1 
ATOM   4632  C C   . CYS C 3 145 ? 39.297  -5.334  82.573  1.00 68.59  ? 140 CYS H C   1 
ATOM   4633  O O   . CYS C 3 145 ? 38.687  -4.364  82.147  1.00 73.38  ? 140 CYS H O   1 
ATOM   4634  C CB  . CYS C 3 145 ? 38.133  -7.379  81.808  1.00 78.51  ? 140 CYS H CB  1 
ATOM   4635  S SG  . CYS C 3 145 ? 38.916  -9.006  81.624  1.00 89.60  ? 140 CYS H SG  1 
ATOM   4636  N N   . LEU C 3 146 ? 40.633  -5.386  82.576  1.00 64.69  ? 141 LEU H N   1 
ATOM   4637  C CA  . LEU C 3 146 ? 41.457  -4.362  81.899  1.00 64.74  ? 141 LEU H CA  1 
ATOM   4638  C C   . LEU C 3 146 ? 42.251  -4.937  80.711  1.00 69.16  ? 141 LEU H C   1 
ATOM   4639  O O   . LEU C 3 146 ? 43.224  -5.656  80.914  1.00 73.18  ? 141 LEU H O   1 
ATOM   4640  C CB  . LEU C 3 146 ? 42.430  -3.674  82.871  1.00 62.12  ? 141 LEU H CB  1 
ATOM   4641  C CG  . LEU C 3 146 ? 43.424  -2.655  82.276  1.00 63.56  ? 141 LEU H CG  1 
ATOM   4642  C CD1 . LEU C 3 146 ? 42.682  -1.580  81.515  1.00 66.67  ? 141 LEU H CD1 1 
ATOM   4643  C CD2 . LEU C 3 146 ? 44.356  -2.007  83.311  1.00 68.44  ? 141 LEU H CD2 1 
ATOM   4644  N N   . VAL C 3 147 ? 41.849  -4.626  79.478  1.00 63.34  ? 142 VAL H N   1 
ATOM   4645  C CA  . VAL C 3 147 ? 42.580  -5.094  78.308  1.00 56.37  ? 142 VAL H CA  1 
ATOM   4646  C C   . VAL C 3 147 ? 43.563  -4.033  77.905  1.00 55.74  ? 142 VAL H C   1 
ATOM   4647  O O   . VAL C 3 147 ? 43.183  -2.898  77.703  1.00 59.72  ? 142 VAL H O   1 
ATOM   4648  C CB  . VAL C 3 147 ? 41.653  -5.341  77.145  1.00 52.99  ? 142 VAL H CB  1 
ATOM   4649  C CG1 . VAL C 3 147 ? 42.425  -5.939  75.998  1.00 53.54  ? 142 VAL H CG1 1 
ATOM   4650  C CG2 . VAL C 3 147 ? 40.566  -6.278  77.578  1.00 60.95  ? 142 VAL H CG2 1 
ATOM   4651  N N   . LYS C 3 148 ? 44.829  -4.382  77.776  1.00 54.14  ? 143 LYS H N   1 
ATOM   4652  C CA  . LYS C 3 148 ? 45.823  -3.346  77.594  1.00 56.17  ? 143 LYS H CA  1 
ATOM   4653  C C   . LYS C 3 148 ? 46.910  -3.761  76.634  1.00 58.75  ? 143 LYS H C   1 
ATOM   4654  O O   . LYS C 3 148 ? 47.360  -4.895  76.679  1.00 62.94  ? 143 LYS H O   1 
ATOM   4655  C CB  . LYS C 3 148 ? 46.437  -3.020  78.945  1.00 65.29  ? 143 LYS H CB  1 
ATOM   4656  C CG  . LYS C 3 148 ? 47.486  -1.932  78.932  1.00 73.74  ? 143 LYS H CG  1 
ATOM   4657  C CD  . LYS C 3 148 ? 47.708  -1.391  80.351  1.00 78.76  ? 143 LYS H CD  1 
ATOM   4658  C CE  . LYS C 3 148 ? 48.816  -0.353  80.361  1.00 88.92  ? 143 LYS H CE  1 
ATOM   4659  N NZ  . LYS C 3 148 ? 48.969  0.269   79.012  1.00 86.70  ? 143 LYS H NZ  1 
ATOM   4660  N N   . GLY C 3 149 ? 47.317  -2.837  75.763  1.00 62.07  ? 144 GLY H N   1 
ATOM   4661  C CA  . GLY C 3 149 ? 48.476  -3.006  74.890  1.00 60.66  ? 144 GLY H CA  1 
ATOM   4662  C C   . GLY C 3 149 ? 48.351  -3.787  73.582  1.00 57.05  ? 144 GLY H C   1 
ATOM   4663  O O   . GLY C 3 149 ? 49.224  -4.604  73.278  1.00 53.63  ? 144 GLY H O   1 
ATOM   4664  N N   . TYR C 3 150 ? 47.305  -3.521  72.795  1.00 58.67  ? 145 TYR H N   1 
ATOM   4665  C CA  . TYR C 3 150 ? 47.044  -4.281  71.564  1.00 55.66  ? 145 TYR H CA  1 
ATOM   4666  C C   . TYR C 3 150 ? 46.998  -3.423  70.313  1.00 51.91  ? 145 TYR H C   1 
ATOM   4667  O O   . TYR C 3 150 ? 46.819  -2.220  70.392  1.00 49.84  ? 145 TYR H O   1 
ATOM   4668  C CB  . TYR C 3 150 ? 45.727  -5.055  71.677  1.00 60.22  ? 145 TYR H CB  1 
ATOM   4669  C CG  . TYR C 3 150 ? 44.486  -4.192  71.869  1.00 57.40  ? 145 TYR H CG  1 
ATOM   4670  C CD1 . TYR C 3 150 ? 43.990  -3.920  73.128  1.00 57.56  ? 145 TYR H CD1 1 
ATOM   4671  C CD2 . TYR C 3 150 ? 43.804  -3.675  70.786  1.00 57.79  ? 145 TYR H CD2 1 
ATOM   4672  C CE1 . TYR C 3 150 ? 42.861  -3.145  73.293  1.00 60.18  ? 145 TYR H CE1 1 
ATOM   4673  C CE2 . TYR C 3 150 ? 42.679  -2.902  70.951  1.00 57.82  ? 145 TYR H CE2 1 
ATOM   4674  C CZ  . TYR C 3 150 ? 42.215  -2.640  72.200  1.00 58.55  ? 145 TYR H CZ  1 
ATOM   4675  O OH  . TYR C 3 150 ? 41.094  -1.871  72.355  1.00 60.16  ? 145 TYR H OH  1 
ATOM   4676  N N   . PHE C 3 151 ? 47.146  -4.063  69.158  1.00 53.75  ? 146 PHE H N   1 
ATOM   4677  C CA  . PHE C 3 151 ? 47.053  -3.384  67.861  1.00 59.22  ? 146 PHE H CA  1 
ATOM   4678  C C   . PHE C 3 151 ? 46.950  -4.400  66.725  1.00 62.99  ? 146 PHE H C   1 
ATOM   4679  O O   . PHE C 3 151 ? 47.671  -5.405  66.745  1.00 62.06  ? 146 PHE H O   1 
ATOM   4680  C CB  . PHE C 3 151 ? 48.288  -2.527  67.635  1.00 58.11  ? 146 PHE H CB  1 
ATOM   4681  C CG  . PHE C 3 151 ? 48.061  -1.363  66.716  1.00 56.31  ? 146 PHE H CG  1 
ATOM   4682  C CD1 . PHE C 3 151 ? 47.194  -0.338  67.078  1.00 55.54  ? 146 PHE H CD1 1 
ATOM   4683  C CD2 . PHE C 3 151 ? 48.733  -1.279  65.511  1.00 53.64  ? 146 PHE H CD2 1 
ATOM   4684  C CE1 . PHE C 3 151 ? 46.994  0.748   66.254  1.00 55.11  ? 146 PHE H CE1 1 
ATOM   4685  C CE2 . PHE C 3 151 ? 48.537  -0.200  64.677  1.00 55.94  ? 146 PHE H CE2 1 
ATOM   4686  C CZ  . PHE C 3 151 ? 47.666  0.819   65.049  1.00 59.49  ? 146 PHE H CZ  1 
ATOM   4687  N N   . PRO C 3 152 ? 46.115  -4.114  65.698  1.00 60.70  ? 147 PRO H N   1 
ATOM   4688  C CA  . PRO C 3 152 ? 45.426  -2.840  65.532  1.00 51.79  ? 147 PRO H CA  1 
ATOM   4689  C C   . PRO C 3 152 ? 44.168  -2.861  66.300  1.00 52.59  ? 147 PRO H C   1 
ATOM   4690  O O   . PRO C 3 152 ? 44.121  -3.452  67.350  1.00 47.50  ? 147 PRO H O   1 
ATOM   4691  C CB  . PRO C 3 152 ? 45.056  -2.819  64.049  1.00 50.42  ? 147 PRO H CB  1 
ATOM   4692  C CG  . PRO C 3 152 ? 45.719  -4.025  63.429  1.00 55.54  ? 147 PRO H CG  1 
ATOM   4693  C CD  . PRO C 3 152 ? 45.868  -4.999  64.548  1.00 61.06  ? 147 PRO H CD  1 
ATOM   4694  N N   . GLU C 3 153 ? 43.132  -2.298  65.704  1.00 61.88  ? 148 GLU H N   1 
ATOM   4695  C CA  . GLU C 3 153 ? 42.059  -1.715  66.472  1.00 59.74  ? 148 GLU H CA  1 
ATOM   4696  C C   . GLU C 3 153 ? 40.972  -2.633  66.972  1.00 66.81  ? 148 GLU H C   1 
ATOM   4697  O O   . GLU C 3 153 ? 40.662  -2.633  68.171  1.00 74.88  ? 148 GLU H O   1 
ATOM   4698  C CB  . GLU C 3 153 ? 41.418  -0.569  65.710  1.00 63.79  ? 148 GLU H CB  1 
ATOM   4699  C CG  . GLU C 3 153 ? 40.160  -0.055  66.403  1.00 72.81  ? 148 GLU H CG  1 
ATOM   4700  C CD  . GLU C 3 153 ? 40.376  0.175   67.895  1.00 72.96  ? 148 GLU H CD  1 
ATOM   4701  O OE1 . GLU C 3 153 ? 39.427  -0.007  68.705  1.00 73.47  ? 148 GLU H OE1 1 
ATOM   4702  O OE2 . GLU C 3 153 ? 41.517  0.534   68.254  1.00 70.32  ? 148 GLU H OE2 1 
ATOM   4703  N N   . SER C 3 154 ? 40.353  -3.386  66.078  1.00 62.64  ? 149 SER H N   1 
ATOM   4704  C CA  . SER C 3 154 ? 39.112  -4.058  66.465  1.00 67.07  ? 149 SER H CA  1 
ATOM   4705  C C   . SER C 3 154 ? 39.267  -5.183  67.527  1.00 64.93  ? 149 SER H C   1 
ATOM   4706  O O   . SER C 3 154 ? 39.817  -6.235  67.213  1.00 71.94  ? 149 SER H O   1 
ATOM   4707  C CB  . SER C 3 154 ? 38.424  -4.573  65.207  1.00 63.00  ? 149 SER H CB  1 
ATOM   4708  O OG  . SER C 3 154 ? 37.554  -5.637  65.513  1.00 68.02  ? 149 SER H OG  1 
ATOM   4709  N N   . VAL C 3 155 ? 38.803  -4.962  68.768  1.00 59.35  ? 150 VAL H N   1 
ATOM   4710  C CA  . VAL C 3 155 ? 38.785  -6.015  69.832  1.00 64.75  ? 150 VAL H CA  1 
ATOM   4711  C C   . VAL C 3 155 ? 37.401  -6.151  70.494  1.00 66.82  ? 150 VAL H C   1 
ATOM   4712  O O   . VAL C 3 155 ? 36.575  -5.246  70.404  1.00 72.16  ? 150 VAL H O   1 
ATOM   4713  C CB  . VAL C 3 155 ? 39.900  -5.846  70.934  1.00 62.31  ? 150 VAL H CB  1 
ATOM   4714  C CG1 . VAL C 3 155 ? 39.695  -4.595  71.777  1.00 59.73  ? 150 VAL H CG1 1 
ATOM   4715  C CG2 . VAL C 3 155 ? 39.941  -7.046  71.839  1.00 56.68  ? 150 VAL H CG2 1 
ATOM   4716  N N   . THR C 3 156 ? 37.117  -7.273  71.143  1.00 62.23  ? 151 THR H N   1 
ATOM   4717  C CA  . THR C 3 156 ? 35.754  -7.467  71.636  1.00 66.08  ? 151 THR H CA  1 
ATOM   4718  C C   . THR C 3 156 ? 35.673  -8.279  72.916  1.00 71.46  ? 151 THR H C   1 
ATOM   4719  O O   . THR C 3 156 ? 36.336  -9.305  73.045  1.00 71.92  ? 151 THR H O   1 
ATOM   4720  C CB  . THR C 3 156 ? 34.828  -8.121  70.573  1.00 66.30  ? 151 THR H CB  1 
ATOM   4721  O OG1 . THR C 3 156 ? 35.010  -9.548  70.562  1.00 61.66  ? 151 THR H OG1 1 
ATOM   4722  C CG2 . THR C 3 156 ? 35.071  -7.523  69.181  1.00 57.57  ? 151 THR H CG2 1 
ATOM   4723  N N   . LEU C 3 157 ? 34.822  -7.829  73.839  1.00 76.07  ? 152 LEU H N   1 
ATOM   4724  C CA  . LEU C 3 157 ? 34.716  -8.437  75.168  1.00 78.01  ? 152 LEU H CA  1 
ATOM   4725  C C   . LEU C 3 157 ? 33.291  -8.721  75.684  1.00 77.50  ? 152 LEU H C   1 
ATOM   4726  O O   . LEU C 3 157 ? 32.572  -7.804  76.084  1.00 75.69  ? 152 LEU H O   1 
ATOM   4727  C CB  . LEU C 3 157 ? 35.461  -7.583  76.194  1.00 76.27  ? 152 LEU H CB  1 
ATOM   4728  C CG  . LEU C 3 157 ? 35.145  -8.004  77.638  1.00 90.13  ? 152 LEU H CG  1 
ATOM   4729  C CD1 . LEU C 3 157 ? 35.014  -9.535  77.795  1.00 85.36  ? 152 LEU H CD1 1 
ATOM   4730  C CD2 . LEU C 3 157 ? 36.170  -7.434  78.640  1.00 94.86  ? 152 LEU H CD2 1 
ATOM   4731  N N   . LEU C 3 158 ? 32.922  -10.001 75.710  1.00 78.02  ? 153 LEU H N   1 
ATOM   4732  C CA  . LEU C 3 158 ? 31.650  -10.442 76.273  1.00 79.02  ? 153 LEU H CA  1 
ATOM   4733  C C   . LEU C 3 158 ? 31.836  -11.271 77.558  1.00 87.32  ? 153 LEU H C   1 
ATOM   4734  O O   . LEU C 3 158 ? 32.846  -11.967 77.724  1.00 85.92  ? 153 LEU H O   1 
ATOM   4735  C CB  . LEU C 3 158 ? 30.817  -11.204 75.231  1.00 76.60  ? 153 LEU H CB  1 
ATOM   4736  C CG  . LEU C 3 158 ? 31.436  -12.303 74.352  1.00 84.78  ? 153 LEU H CG  1 
ATOM   4737  C CD1 . LEU C 3 158 ? 32.244  -13.306 75.158  1.00 88.51  ? 153 LEU H CD1 1 
ATOM   4738  C CD2 . LEU C 3 158 ? 30.380  -13.034 73.506  1.00 87.23  ? 153 LEU H CD2 1 
ATOM   4739  N N   . TRP C 3 159 ? 30.848  -11.194 78.454  1.00 92.15  ? 154 TRP H N   1 
ATOM   4740  C CA  . TRP C 3 159 ? 30.926  -11.816 79.785  1.00 93.46  ? 154 TRP H CA  1 
ATOM   4741  C C   . TRP C 3 159 ? 30.271  -13.196 79.912  1.00 98.41  ? 154 TRP H C   1 
ATOM   4742  O O   . TRP C 3 159 ? 29.124  -13.406 79.492  1.00 96.81  ? 154 TRP H O   1 
ATOM   4743  C CB  . TRP C 3 159 ? 30.319  -10.896 80.834  1.00 87.53  ? 154 TRP H CB  1 
ATOM   4744  C CG  . TRP C 3 159 ? 31.103  -9.667  81.099  1.00 83.49  ? 154 TRP H CG  1 
ATOM   4745  C CD1 . TRP C 3 159 ? 30.887  -8.432  80.571  1.00 82.78  ? 154 TRP H CD1 1 
ATOM   4746  C CD2 . TRP C 3 159 ? 32.222  -9.537  81.986  1.00 84.24  ? 154 TRP H CD2 1 
ATOM   4747  N NE1 . TRP C 3 159 ? 31.810  -7.538  81.065  1.00 82.14  ? 154 TRP H NE1 1 
ATOM   4748  C CE2 . TRP C 3 159 ? 32.639  -8.194  81.937  1.00 83.81  ? 154 TRP H CE2 1 
ATOM   4749  C CE3 . TRP C 3 159 ? 32.914  -10.427 82.812  1.00 88.67  ? 154 TRP H CE3 1 
ATOM   4750  C CZ2 . TRP C 3 159 ? 33.717  -7.720  82.685  1.00 85.07  ? 154 TRP H CZ2 1 
ATOM   4751  C CZ3 . TRP C 3 159 ? 33.984  -9.953  83.552  1.00 84.48  ? 154 TRP H CZ3 1 
ATOM   4752  C CH2 . TRP C 3 159 ? 34.374  -8.614  83.484  1.00 84.27  ? 154 TRP H CH2 1 
ATOM   4753  N N   . ASN C 3 160 ? 30.998  -14.119 80.538  1.00 99.57  ? 155 ASN H N   1 
ATOM   4754  C CA  . ASN C 3 160 ? 30.573  -15.509 80.601  1.00 103.39 ? 155 ASN H CA  1 
ATOM   4755  C C   . ASN C 3 160 ? 29.888  -15.846 79.298  1.00 101.94 ? 155 ASN H C   1 
ATOM   4756  O O   . ASN C 3 160 ? 28.707  -16.182 79.263  1.00 101.77 ? 155 ASN H O   1 
ATOM   4757  C CB  . ASN C 3 160 ? 29.637  -15.753 81.782  1.00 108.78 ? 155 ASN H CB  1 
ATOM   4758  C CG  . ASN C 3 160 ? 30.266  -15.379 83.111  1.00 109.62 ? 155 ASN H CG  1 
ATOM   4759  O OD1 . ASN C 3 160 ? 31.466  -15.119 83.187  1.00 107.30 ? 155 ASN H OD1 1 
ATOM   4760  N ND2 . ASN C 3 160 ? 29.455  -15.348 84.165  1.00 110.47 ? 155 ASN H ND2 1 
ATOM   4761  N N   . SER C 3 161 ? 30.637  -15.684 78.217  1.00 99.08  ? 156 SER H N   1 
ATOM   4762  C CA  . SER C 3 161 ? 30.197  -16.101 76.901  1.00 102.36 ? 156 SER H CA  1 
ATOM   4763  C C   . SER C 3 161 ? 28.855  -15.507 76.460  1.00 100.68 ? 156 SER H C   1 
ATOM   4764  O O   . SER C 3 161 ? 28.144  -16.108 75.657  1.00 104.12 ? 156 SER H O   1 
ATOM   4765  C CB  . SER C 3 161 ? 30.154  -17.623 76.859  1.00 105.96 ? 156 SER H CB  1 
ATOM   4766  O OG  . SER C 3 161 ? 31.329  -18.145 77.450  1.00 97.38  ? 156 SER H OG  1 
ATOM   4767  N N   . GLY C 3 162 ? 28.518  -14.328 76.974  1.00 95.64  ? 157 GLY H N   1 
ATOM   4768  C CA  . GLY C 3 162 ? 27.335  -13.615 76.519  1.00 102.25 ? 157 GLY H CA  1 
ATOM   4769  C C   . GLY C 3 162 ? 26.074  -13.990 77.276  1.00 110.34 ? 157 GLY H C   1 
ATOM   4770  O O   . GLY C 3 162 ? 24.966  -13.984 76.720  1.00 107.72 ? 157 GLY H O   1 
ATOM   4771  N N   . SER C 3 163 ? 26.250  -14.307 78.555  1.00 109.48 ? 158 SER H N   1 
ATOM   4772  C CA  . SER C 3 163 ? 25.162  -14.765 79.408  1.00 105.79 ? 158 SER H CA  1 
ATOM   4773  C C   . SER C 3 163 ? 24.446  -13.596 80.067  1.00 103.38 ? 158 SER H C   1 
ATOM   4774  O O   . SER C 3 163 ? 23.229  -13.609 80.233  1.00 103.26 ? 158 SER H O   1 
ATOM   4775  C CB  . SER C 3 163 ? 25.731  -15.686 80.479  1.00 105.50 ? 158 SER H CB  1 
ATOM   4776  O OG  . SER C 3 163 ? 27.034  -15.256 80.829  1.00 103.75 ? 158 SER H OG  1 
ATOM   4777  N N   . LEU C 3 164 ? 25.210  -12.584 80.450  1.00 103.14 ? 159 LEU H N   1 
ATOM   4778  C CA  . LEU C 3 164 ? 24.638  -11.441 81.144  1.00 104.19 ? 159 LEU H CA  1 
ATOM   4779  C C   . LEU C 3 164 ? 24.860  -10.137 80.376  1.00 103.48 ? 159 LEU H C   1 
ATOM   4780  O O   . LEU C 3 164 ? 25.633  -9.269  80.793  1.00 98.44  ? 159 LEU H O   1 
ATOM   4781  C CB  . LEU C 3 164 ? 25.151  -11.355 82.596  1.00 104.81 ? 159 LEU H CB  1 
ATOM   4782  C CG  . LEU C 3 164 ? 26.645  -11.339 82.970  1.00 99.23  ? 159 LEU H CG  1 
ATOM   4783  C CD1 . LEU C 3 164 ? 26.794  -11.149 84.474  1.00 91.65  ? 159 LEU H CD1 1 
ATOM   4784  C CD2 . LEU C 3 164 ? 27.384  -12.595 82.525  1.00 98.38  ? 159 LEU H CD2 1 
ATOM   4785  N N   . SER C 3 165 ? 24.186  -10.014 79.237  1.00 106.05 ? 160 SER H N   1 
ATOM   4786  C CA  . SER C 3 165 ? 24.202  -8.757  78.504  1.00 107.22 ? 160 SER H CA  1 
ATOM   4787  C C   . SER C 3 165 ? 23.869  -7.654  79.498  1.00 100.24 ? 160 SER H C   1 
ATOM   4788  O O   . SER C 3 165 ? 24.637  -6.708  79.692  1.00 94.05  ? 160 SER H O   1 
ATOM   4789  C CB  . SER C 3 165 ? 23.194  -8.784  77.342  1.00 108.28 ? 160 SER H CB  1 
ATOM   4790  O OG  . SER C 3 165 ? 21.903  -9.183  77.776  1.00 101.62 ? 160 SER H OG  1 
ATOM   4791  N N   . SER C 3 166 ? 22.725  -7.818  80.151  1.00 100.98 ? 161 SER H N   1 
ATOM   4792  C CA  . SER C 3 166 ? 22.262  -6.900  81.183  1.00 102.26 ? 161 SER H CA  1 
ATOM   4793  C C   . SER C 3 166 ? 23.297  -6.651  82.285  1.00 99.27  ? 161 SER H C   1 
ATOM   4794  O O   . SER C 3 166 ? 23.667  -7.573  83.020  1.00 98.13  ? 161 SER H O   1 
ATOM   4795  C CB  . SER C 3 166 ? 20.970  -7.442  81.802  1.00 101.19 ? 161 SER H CB  1 
ATOM   4796  O OG  . SER C 3 166 ? 21.054  -8.850  81.975  1.00 102.21 ? 161 SER H OG  1 
ATOM   4797  N N   . GLY C 3 167 ? 23.765  -5.409  82.390  1.00 89.03  ? 162 GLY H N   1 
ATOM   4798  C CA  . GLY C 3 167 ? 24.539  -4.995  83.544  1.00 84.85  ? 162 GLY H CA  1 
ATOM   4799  C C   . GLY C 3 167 ? 26.000  -4.685  83.309  1.00 85.92  ? 162 GLY H C   1 
ATOM   4800  O O   . GLY C 3 167 ? 26.809  -4.805  84.230  1.00 84.72  ? 162 GLY H O   1 
ATOM   4801  N N   . VAL C 3 168 ? 26.347  -4.265  82.094  1.00 85.52  ? 163 VAL H N   1 
ATOM   4802  C CA  . VAL C 3 168 ? 27.756  -4.033  81.765  1.00 85.35  ? 163 VAL H CA  1 
ATOM   4803  C C   . VAL C 3 168 ? 28.028  -2.867  80.796  1.00 81.67  ? 163 VAL H C   1 
ATOM   4804  O O   . VAL C 3 168 ? 27.230  -2.592  79.900  1.00 85.16  ? 163 VAL H O   1 
ATOM   4805  C CB  . VAL C 3 168 ? 28.437  -5.345  81.259  1.00 89.21  ? 163 VAL H CB  1 
ATOM   4806  C CG1 . VAL C 3 168 ? 27.485  -6.152  80.359  1.00 90.29  ? 163 VAL H CG1 1 
ATOM   4807  C CG2 . VAL C 3 168 ? 29.777  -5.052  80.565  1.00 80.08  ? 163 VAL H CG2 1 
ATOM   4808  N N   . HIS C 3 169 ? 29.163  -2.193  80.998  1.00 79.72  ? 164 HIS H N   1 
ATOM   4809  C CA  . HIS C 3 169 ? 29.626  -1.101  80.139  1.00 77.76  ? 164 HIS H CA  1 
ATOM   4810  C C   . HIS C 3 169 ? 31.059  -1.375  79.647  1.00 73.90  ? 164 HIS H C   1 
ATOM   4811  O O   . HIS C 3 169 ? 31.914  -1.745  80.447  1.00 73.15  ? 164 HIS H O   1 
ATOM   4812  C CB  . HIS C 3 169 ? 29.645  0.218   80.925  1.00 79.85  ? 164 HIS H CB  1 
ATOM   4813  C CG  . HIS C 3 169 ? 28.329  0.603   81.538  1.00 88.43  ? 164 HIS H CG  1 
ATOM   4814  N ND1 . HIS C 3 169 ? 28.241  1.353   82.693  1.00 87.07  ? 164 HIS H ND1 1 
ATOM   4815  C CD2 . HIS C 3 169 ? 27.052  0.360   81.150  1.00 95.69  ? 164 HIS H CD2 1 
ATOM   4816  C CE1 . HIS C 3 169 ? 26.967  1.551   82.992  1.00 90.90  ? 164 HIS H CE1 1 
ATOM   4817  N NE2 . HIS C 3 169 ? 26.224  0.958   82.073  1.00 90.84  ? 164 HIS H NE2 1 
ATOM   4818  N N   . THR C 3 170 ? 31.334  -1.187  78.354  1.00 68.54  ? 165 THR H N   1 
ATOM   4819  C CA  . THR C 3 170 ? 32.718  -1.226  77.851  1.00 64.15  ? 165 THR H CA  1 
ATOM   4820  C C   . THR C 3 170 ? 33.079  0.119   77.239  1.00 67.56  ? 165 THR H C   1 
ATOM   4821  O O   . THR C 3 170 ? 32.306  0.673   76.472  1.00 71.11  ? 165 THR H O   1 
ATOM   4822  C CB  . THR C 3 170 ? 32.933  -2.287  76.757  1.00 59.64  ? 165 THR H CB  1 
ATOM   4823  O OG1 . THR C 3 170 ? 32.290  -3.510  77.119  1.00 69.18  ? 165 THR H OG1 1 
ATOM   4824  C CG2 . THR C 3 170 ? 34.416  -2.553  76.543  1.00 55.69  ? 165 THR H CG2 1 
ATOM   4825  N N   . PHE C 3 171 ? 34.251  0.652   77.548  1.00 66.44  ? 166 PHE H N   1 
ATOM   4826  C CA  . PHE C 3 171 ? 34.548  2.005   77.097  1.00 66.48  ? 166 PHE H CA  1 
ATOM   4827  C C   . PHE C 3 171 ? 35.311  2.071   75.777  1.00 69.71  ? 166 PHE H C   1 
ATOM   4828  O O   . PHE C 3 171 ? 36.233  1.288   75.522  1.00 68.99  ? 166 PHE H O   1 
ATOM   4829  C CB  . PHE C 3 171 ? 35.271  2.801   78.192  1.00 68.42  ? 166 PHE H CB  1 
ATOM   4830  C CG  . PHE C 3 171 ? 34.691  2.592   79.557  1.00 73.61  ? 166 PHE H CG  1 
ATOM   4831  C CD1 . PHE C 3 171 ? 33.461  3.133   79.893  1.00 75.21  ? 166 PHE H CD1 1 
ATOM   4832  C CD2 . PHE C 3 171 ? 35.357  1.829   80.499  1.00 76.44  ? 166 PHE H CD2 1 
ATOM   4833  C CE1 . PHE C 3 171 ? 32.909  2.926   81.145  1.00 74.03  ? 166 PHE H CE1 1 
ATOM   4834  C CE2 . PHE C 3 171 ? 34.808  1.620   81.761  1.00 79.66  ? 166 PHE H CE2 1 
ATOM   4835  C CZ  . PHE C 3 171 ? 33.583  2.167   82.078  1.00 76.47  ? 166 PHE H CZ  1 
ATOM   4836  N N   . PRO C 3 172 ? 34.901  3.006   74.921  1.00 68.03  ? 167 PRO H N   1 
ATOM   4837  C CA  . PRO C 3 172 ? 35.669  3.445   73.761  1.00 66.12  ? 167 PRO H CA  1 
ATOM   4838  C C   . PRO C 3 172 ? 37.158  3.322   74.033  1.00 62.83  ? 167 PRO H C   1 
ATOM   4839  O O   . PRO C 3 172 ? 37.637  3.928   74.975  1.00 68.56  ? 167 PRO H O   1 
ATOM   4840  C CB  . PRO C 3 172 ? 35.292  4.914   73.679  1.00 67.60  ? 167 PRO H CB  1 
ATOM   4841  C CG  . PRO C 3 172 ? 33.840  4.943   74.171  1.00 66.92  ? 167 PRO H CG  1 
ATOM   4842  C CD  . PRO C 3 172 ? 33.633  3.739   75.051  1.00 66.19  ? 167 PRO H CD  1 
ATOM   4843  N N   . ALA C 3 173 ? 37.883  2.557   73.232  1.00 62.76  ? 168 ALA H N   1 
ATOM   4844  C CA  . ALA C 3 173 ? 39.308  2.396   73.474  1.00 66.52  ? 168 ALA H CA  1 
ATOM   4845  C C   . ALA C 3 173 ? 40.076  3.703   73.233  1.00 70.34  ? 168 ALA H C   1 
ATOM   4846  O O   . ALA C 3 173 ? 39.716  4.504   72.365  1.00 69.88  ? 168 ALA H O   1 
ATOM   4847  C CB  . ALA C 3 173 ? 39.872  1.267   72.645  1.00 63.51  ? 168 ALA H CB  1 
ATOM   4848  N N   . VAL C 3 174 ? 41.114  3.908   74.042  1.00 68.71  ? 169 VAL H N   1 
ATOM   4849  C CA  . VAL C 3 174 ? 41.987  5.073   73.973  1.00 71.09  ? 169 VAL H CA  1 
ATOM   4850  C C   . VAL C 3 174 ? 43.376  4.540   73.708  1.00 71.36  ? 169 VAL H C   1 
ATOM   4851  O O   . VAL C 3 174 ? 43.707  3.425   74.105  1.00 69.01  ? 169 VAL H O   1 
ATOM   4852  C CB  . VAL C 3 174 ? 42.030  5.838   75.307  1.00 75.57  ? 169 VAL H CB  1 
ATOM   4853  C CG1 . VAL C 3 174 ? 42.963  7.042   75.196  1.00 72.65  ? 169 VAL H CG1 1 
ATOM   4854  C CG2 . VAL C 3 174 ? 40.623  6.243   75.748  1.00 71.24  ? 169 VAL H CG2 1 
ATOM   4855  N N   . LEU C 3 175 ? 44.212  5.332   73.062  1.00 75.03  ? 170 LEU H N   1 
ATOM   4856  C CA  . LEU C 3 175 ? 45.380  4.735   72.451  1.00 76.52  ? 170 LEU H CA  1 
ATOM   4857  C C   . LEU C 3 175 ? 46.674  5.488   72.613  1.00 79.66  ? 170 LEU H C   1 
ATOM   4858  O O   . LEU C 3 175 ? 47.556  5.345   71.786  1.00 84.47  ? 170 LEU H O   1 
ATOM   4859  C CB  . LEU C 3 175 ? 45.120  4.557   70.961  1.00 72.91  ? 170 LEU H CB  1 
ATOM   4860  C CG  . LEU C 3 175 ? 45.201  5.809   70.090  1.00 69.87  ? 170 LEU H CG  1 
ATOM   4861  C CD1 . LEU C 3 175 ? 45.045  7.096   70.895  1.00 71.50  ? 170 LEU H CD1 1 
ATOM   4862  C CD2 . LEU C 3 175 ? 46.509  5.799   69.307  1.00 72.18  ? 170 LEU H CD2 1 
ATOM   4863  N N   . GLN C 3 176 ? 46.814  6.277   73.662  1.00 81.49  ? 171 GLN H N   1 
ATOM   4864  C CA  . GLN C 3 176 ? 47.968  7.172   73.716  1.00 92.45  ? 171 GLN H CA  1 
ATOM   4865  C C   . GLN C 3 176 ? 49.324  6.597   73.234  1.00 93.75  ? 171 GLN H C   1 
ATOM   4866  O O   . GLN C 3 176 ? 49.929  7.132   72.288  1.00 97.59  ? 171 GLN H O   1 
ATOM   4867  C CB  . GLN C 3 176 ? 48.087  7.873   75.081  1.00 100.55 ? 171 GLN H CB  1 
ATOM   4868  C CG  . GLN C 3 176 ? 47.223  9.130   75.184  1.00 103.11 ? 171 GLN H CG  1 
ATOM   4869  C CD  . GLN C 3 176 ? 47.242  9.960   73.902  1.00 102.23 ? 171 GLN H CD  1 
ATOM   4870  O OE1 . GLN C 3 176 ? 46.805  9.506   72.836  1.00 91.53  ? 171 GLN H OE1 1 
ATOM   4871  N NE2 . GLN C 3 176 ? 47.747  11.183  74.003  1.00 109.14 ? 171 GLN H NE2 1 
ATOM   4872  N N   . SER C 3 177 ? 49.797  5.518   73.847  1.00 81.17  ? 172 SER H N   1 
ATOM   4873  C CA  . SER C 3 177 ? 51.193  5.134   73.653  1.00 84.55  ? 172 SER H CA  1 
ATOM   4874  C C   . SER C 3 177 ? 51.599  4.679   72.229  1.00 84.21  ? 172 SER H C   1 
ATOM   4875  O O   . SER C 3 177 ? 52.788  4.674   71.896  1.00 83.29  ? 172 SER H O   1 
ATOM   4876  C CB  . SER C 3 177 ? 51.597  4.094   74.700  1.00 94.44  ? 172 SER H CB  1 
ATOM   4877  O OG  . SER C 3 177 ? 53.010  3.944   74.771  1.00 98.78  ? 172 SER H OG  1 
ATOM   4878  N N   . ASP C 3 178 ? 50.611  4.339   71.400  1.00 81.57  ? 173 ASP H N   1 
ATOM   4879  C CA  . ASP C 3 178 ? 50.812  3.663   70.109  1.00 75.55  ? 173 ASP H CA  1 
ATOM   4880  C C   . ASP C 3 178 ? 50.337  2.210   70.261  1.00 65.27  ? 173 ASP H C   1 
ATOM   4881  O O   . ASP C 3 178 ? 50.507  1.373   69.386  1.00 57.50  ? 173 ASP H O   1 
ATOM   4882  C CB  . ASP C 3 178 ? 52.270  3.766   69.632  1.00 82.83  ? 173 ASP H CB  1 
ATOM   4883  C CG  . ASP C 3 178 ? 52.523  3.057   68.297  1.00 85.18  ? 173 ASP H CG  1 
ATOM   4884  O OD1 . ASP C 3 178 ? 52.682  3.760   67.270  1.00 81.70  ? 173 ASP H OD1 1 
ATOM   4885  O OD2 . ASP C 3 178 ? 52.595  1.802   68.280  1.00 80.59  ? 173 ASP H OD2 1 
ATOM   4886  N N   . LEU C 3 179 ? 49.732  1.934   71.407  1.00 66.50  ? 174 LEU H N   1 
ATOM   4887  C CA  . LEU C 3 179 ? 48.959  0.724   71.611  1.00 60.55  ? 174 LEU H CA  1 
ATOM   4888  C C   . LEU C 3 179 ? 47.589  1.135   72.108  1.00 60.33  ? 174 LEU H C   1 
ATOM   4889  O O   . LEU C 3 179 ? 47.412  2.247   72.585  1.00 67.83  ? 174 LEU H O   1 
ATOM   4890  C CB  . LEU C 3 179 ? 49.640  -0.190  72.628  1.00 61.37  ? 174 LEU H CB  1 
ATOM   4891  C CG  . LEU C 3 179 ? 50.865  -0.903  72.052  1.00 60.37  ? 174 LEU H CG  1 
ATOM   4892  C CD1 . LEU C 3 179 ? 51.156  -2.212  72.767  1.00 56.32  ? 174 LEU H CD1 1 
ATOM   4893  C CD2 . LEU C 3 179 ? 50.648  -1.173  70.572  1.00 60.70  ? 174 LEU H CD2 1 
ATOM   4894  N N   . TYR C 3 180 ? 46.611  0.251   72.000  1.00 61.47  ? 175 TYR H N   1 
ATOM   4895  C CA  . TYR C 3 180 ? 45.263  0.579   72.458  1.00 63.87  ? 175 TYR H CA  1 
ATOM   4896  C C   . TYR C 3 180 ? 44.993  -0.027  73.824  1.00 60.62  ? 175 TYR H C   1 
ATOM   4897  O O   . TYR C 3 180 ? 45.385  -1.157  74.083  1.00 60.07  ? 175 TYR H O   1 
ATOM   4898  C CB  . TYR C 3 180 ? 44.210  0.087   71.458  1.00 62.86  ? 175 TYR H CB  1 
ATOM   4899  C CG  . TYR C 3 180 ? 44.003  0.996   70.260  1.00 61.26  ? 175 TYR H CG  1 
ATOM   4900  C CD1 . TYR C 3 180 ? 43.071  2.006   70.298  1.00 63.86  ? 175 TYR H CD1 1 
ATOM   4901  C CD2 . TYR C 3 180 ? 44.733  0.830   69.091  1.00 63.25  ? 175 TYR H CD2 1 
ATOM   4902  C CE1 . TYR C 3 180 ? 42.863  2.828   69.213  1.00 67.47  ? 175 TYR H CE1 1 
ATOM   4903  C CE2 . TYR C 3 180 ? 44.540  1.651   68.000  1.00 63.83  ? 175 TYR H CE2 1 
ATOM   4904  C CZ  . TYR C 3 180 ? 43.600  2.647   68.067  1.00 68.22  ? 175 TYR H CZ  1 
ATOM   4905  O OH  . TYR C 3 180 ? 43.393  3.477   66.988  1.00 76.50  ? 175 TYR H OH  1 
ATOM   4906  N N   . THR C 3 181 ? 44.318  0.732   74.685  1.00 66.15  ? 176 THR H N   1 
ATOM   4907  C CA  . THR C 3 181 ? 43.925  0.288   76.033  1.00 68.42  ? 176 THR H CA  1 
ATOM   4908  C C   . THR C 3 181 ? 42.400  0.366   76.223  1.00 59.25  ? 176 THR H C   1 
ATOM   4909  O O   . THR C 3 181 ? 41.747  1.214   75.644  1.00 65.56  ? 176 THR H O   1 
ATOM   4910  C CB  . THR C 3 181 ? 44.643  1.133   77.116  1.00 75.03  ? 176 THR H CB  1 
ATOM   4911  O OG1 . THR C 3 181 ? 46.035  0.759   77.192  1.00 69.62  ? 176 THR H OG1 1 
ATOM   4912  C CG2 . THR C 3 181 ? 43.958  0.974   78.487  1.00 70.38  ? 176 THR H CG2 1 
ATOM   4913  N N   . LEU C 3 182 ? 41.825  -0.518  77.018  1.00 53.95  ? 177 LEU H N   1 
ATOM   4914  C CA  . LEU C 3 182 ? 40.366  -0.587  77.084  1.00 64.21  ? 177 LEU H CA  1 
ATOM   4915  C C   . LEU C 3 182 ? 39.858  -1.441  78.247  1.00 67.69  ? 177 LEU H C   1 
ATOM   4916  O O   . LEU C 3 182 ? 40.391  -2.519  78.524  1.00 67.36  ? 177 LEU H O   1 
ATOM   4917  C CB  . LEU C 3 182 ? 39.790  -1.127  75.758  1.00 67.22  ? 177 LEU H CB  1 
ATOM   4918  C CG  . LEU C 3 182 ? 38.787  -2.306  75.792  1.00 60.72  ? 177 LEU H CG  1 
ATOM   4919  C CD1 . LEU C 3 182 ? 37.401  -1.875  75.368  1.00 59.17  ? 177 LEU H CD1 1 
ATOM   4920  C CD2 . LEU C 3 182 ? 39.247  -3.475  74.933  1.00 55.85  ? 177 LEU H CD2 1 
ATOM   4921  N N   . SER C 3 183 ? 38.805  -0.975  78.907  1.00 67.11  ? 178 SER H N   1 
ATOM   4922  C CA  . SER C 3 183 ? 38.277  -1.675  80.068  1.00 67.64  ? 178 SER H CA  1 
ATOM   4923  C C   . SER C 3 183 ? 36.759  -1.692  80.080  1.00 64.18  ? 178 SER H C   1 
ATOM   4924  O O   . SER C 3 183 ? 36.116  -0.745  79.645  1.00 66.44  ? 178 SER H O   1 
ATOM   4925  C CB  . SER C 3 183 ? 38.750  -0.964  81.321  1.00 72.96  ? 178 SER H CB  1 
ATOM   4926  O OG  . SER C 3 183 ? 38.160  0.325   81.373  1.00 77.62  ? 178 SER H OG  1 
ATOM   4927  N N   . SER C 3 184 ? 36.180  -2.769  80.577  1.00 58.11  ? 179 SER H N   1 
ATOM   4928  C CA  . SER C 3 184 ? 34.749  -2.785  80.767  1.00 65.97  ? 179 SER H CA  1 
ATOM   4929  C C   . SER C 3 184 ? 34.567  -3.354  82.138  1.00 74.53  ? 179 SER H C   1 
ATOM   4930  O O   . SER C 3 184 ? 35.474  -4.004  82.635  1.00 76.25  ? 179 SER H O   1 
ATOM   4931  C CB  . SER C 3 184 ? 34.043  -3.649  79.714  1.00 65.38  ? 179 SER H CB  1 
ATOM   4932  O OG  . SER C 3 184 ? 33.939  -5.015  80.073  1.00 62.21  ? 179 SER H OG  1 
ATOM   4933  N N   . SER C 3 185 ? 33.423  -3.096  82.767  1.00 74.84  ? 180 SER H N   1 
ATOM   4934  C CA  . SER C 3 185 ? 33.107  -3.757  84.022  1.00 73.88  ? 180 SER H CA  1 
ATOM   4935  C C   . SER C 3 185 ? 31.645  -4.088  84.103  1.00 76.00  ? 180 SER H C   1 
ATOM   4936  O O   . SER C 3 185 ? 30.806  -3.371  83.587  1.00 76.04  ? 180 SER H O   1 
ATOM   4937  C CB  . SER C 3 185 ? 33.491  -2.894  85.210  1.00 84.72  ? 180 SER H CB  1 
ATOM   4938  O OG  . SER C 3 185 ? 32.691  -1.729  85.251  1.00 92.77  ? 180 SER H OG  1 
ATOM   4939  N N   . VAL C 3 186 ? 31.349  -5.188  84.774  1.00 86.28  ? 181 VAL H N   1 
ATOM   4940  C CA  . VAL C 3 186 ? 29.978  -5.620  84.963  1.00 88.74  ? 181 VAL H CA  1 
ATOM   4941  C C   . VAL C 3 186 ? 29.592  -5.473  86.430  1.00 96.28  ? 181 VAL H C   1 
ATOM   4942  O O   . VAL C 3 186 ? 30.424  -5.644  87.333  1.00 96.61  ? 181 VAL H O   1 
ATOM   4943  C CB  . VAL C 3 186 ? 29.800  -7.086  84.548  1.00 83.73  ? 181 VAL H CB  1 
ATOM   4944  C CG1 . VAL C 3 186 ? 30.643  -7.993  85.437  1.00 79.82  ? 181 VAL H CG1 1 
ATOM   4945  C CG2 . VAL C 3 186 ? 28.343  -7.476  84.612  1.00 86.55  ? 181 VAL H CG2 1 
ATOM   4946  N N   . THR C 3 187 ? 28.324  -5.149  86.658  1.00 98.30  ? 182 THR H N   1 
ATOM   4947  C CA  . THR C 3 187 ? 27.788  -5.058  88.005  1.00 99.48  ? 182 THR H CA  1 
ATOM   4948  C C   . THR C 3 187 ? 26.797  -6.189  88.282  1.00 101.74 ? 182 THR H C   1 
ATOM   4949  O O   . THR C 3 187 ? 25.928  -6.492  87.453  1.00 94.80  ? 182 THR H O   1 
ATOM   4950  C CB  . THR C 3 187 ? 27.119  -3.692  88.241  1.00 97.20  ? 182 THR H CB  1 
ATOM   4951  O OG1 . THR C 3 187 ? 28.119  -2.725  88.581  1.00 95.11  ? 182 THR H OG1 1 
ATOM   4952  C CG2 . THR C 3 187 ? 26.128  -3.779  89.373  1.00 107.75 ? 182 THR H CG2 1 
ATOM   4953  N N   . VAL C 3 188 ? 26.955  -6.826  89.442  1.00 109.22 ? 183 VAL H N   1 
ATOM   4954  C CA  . VAL C 3 188 ? 25.996  -7.822  89.918  1.00 116.18 ? 183 VAL H CA  1 
ATOM   4955  C C   . VAL C 3 188 ? 25.859  -7.807  91.432  1.00 122.37 ? 183 VAL H C   1 
ATOM   4956  O O   . VAL C 3 188 ? 26.713  -7.281  92.147  1.00 120.08 ? 183 VAL H O   1 
ATOM   4957  C CB  . VAL C 3 188 ? 26.379  -9.249  89.517  1.00 111.54 ? 183 VAL H CB  1 
ATOM   4958  C CG1 . VAL C 3 188 ? 26.238  -9.436  88.017  1.00 110.93 ? 183 VAL H CG1 1 
ATOM   4959  C CG2 . VAL C 3 188 ? 27.787  -9.565  89.997  1.00 109.40 ? 183 VAL H CG2 1 
ATOM   4960  N N   . THR C 3 189 ? 24.779  -8.417  91.903  1.00 125.99 ? 184 THR H N   1 
ATOM   4961  C CA  . THR C 3 189 ? 24.468  -8.490  93.322  1.00 130.96 ? 184 THR H CA  1 
ATOM   4962  C C   . THR C 3 189 ? 25.638  -8.948  94.200  1.00 129.96 ? 184 THR H C   1 
ATOM   4963  O O   . THR C 3 189 ? 26.227  -10.000 93.962  1.00 129.14 ? 184 THR H O   1 
ATOM   4964  C CB  . THR C 3 189 ? 23.269  -9.427  93.549  1.00 136.10 ? 184 THR H CB  1 
ATOM   4965  O OG1 . THR C 3 189 ? 23.543  -10.298 94.651  1.00 140.01 ? 184 THR H OG1 1 
ATOM   4966  C CG2 . THR C 3 189 ? 23.020  -10.266 92.304  1.00 130.85 ? 184 THR H CG2 1 
ATOM   4967  N N   . SER C 3 190 ? 25.959  -8.156  95.225  1.00 134.75 ? 185 SER H N   1 
ATOM   4968  C CA  . SER C 3 190 ? 26.991  -8.517  96.209  1.00 139.70 ? 185 SER H CA  1 
ATOM   4969  C C   . SER C 3 190 ? 26.517  -9.682  97.063  1.00 138.24 ? 185 SER H C   1 
ATOM   4970  O O   . SER C 3 190 ? 27.164  -10.071 98.040  1.00 131.73 ? 185 SER H O   1 
ATOM   4971  C CB  . SER C 3 190 ? 27.319  -7.324  97.116  1.00 135.00 ? 185 SER H CB  1 
ATOM   4972  O OG  . SER C 3 190 ? 28.199  -7.688  98.168  1.00 125.76 ? 185 SER H OG  1 
ATOM   4973  N N   . SER C 3 191 ? 25.379  -10.235 96.666  1.00 138.67 ? 186 SER H N   1 
ATOM   4974  C CA  . SER C 3 191 ? 24.656  -11.202 97.466  1.00 140.57 ? 186 SER H CA  1 
ATOM   4975  C C   . SER C 3 191 ? 24.710  -12.591 96.832  1.00 135.86 ? 186 SER H C   1 
ATOM   4976  O O   . SER C 3 191 ? 24.467  -13.599 97.497  1.00 132.41 ? 186 SER H O   1 
ATOM   4977  C CB  . SER C 3 191 ? 23.202  -10.743 97.603  1.00 144.87 ? 186 SER H CB  1 
ATOM   4978  O OG  . SER C 3 191 ? 23.092  -9.335  97.429  1.00 141.16 ? 186 SER H OG  1 
ATOM   4979  N N   . THR C 3 192 ? 25.027  -12.641 95.542  1.00 138.74 ? 187 THR H N   1 
ATOM   4980  C CA  . THR C 3 192 ? 25.056  -13.915 94.826  1.00 143.29 ? 187 THR H CA  1 
ATOM   4981  C C   . THR C 3 192 ? 26.327  -14.134 93.979  1.00 146.87 ? 187 THR H C   1 
ATOM   4982  O O   . THR C 3 192 ? 26.435  -15.148 93.280  1.00 145.33 ? 187 THR H O   1 
ATOM   4983  C CB  . THR C 3 192 ? 23.780  -14.112 93.952  1.00 135.97 ? 187 THR H CB  1 
ATOM   4984  O OG1 . THR C 3 192 ? 23.862  -13.301 92.775  1.00 131.26 ? 187 THR H OG1 1 
ATOM   4985  C CG2 . THR C 3 192 ? 22.522  -13.742 94.729  1.00 133.91 ? 187 THR H CG2 1 
ATOM   4986  N N   . TRP C 3 193 ? 27.289  -13.206 94.045  1.00 144.39 ? 188 TRP H N   1 
ATOM   4987  C CA  . TRP C 3 193 ? 28.536  -13.369 93.276  1.00 140.85 ? 188 TRP H CA  1 
ATOM   4988  C C   . TRP C 3 193 ? 29.545  -14.370 93.834  1.00 141.21 ? 188 TRP H C   1 
ATOM   4989  O O   . TRP C 3 193 ? 29.640  -15.477 93.307  1.00 144.80 ? 188 TRP H O   1 
ATOM   4990  C CB  . TRP C 3 193 ? 29.269  -12.051 92.994  1.00 139.69 ? 188 TRP H CB  1 
ATOM   4991  C CG  . TRP C 3 193 ? 30.708  -12.313 92.525  1.00 135.97 ? 188 TRP H CG  1 
ATOM   4992  C CD1 . TRP C 3 193 ? 31.098  -13.149 91.515  1.00 133.13 ? 188 TRP H CD1 1 
ATOM   4993  C CD2 . TRP C 3 193 ? 31.919  -11.753 93.061  1.00 131.45 ? 188 TRP H CD2 1 
ATOM   4994  N NE1 . TRP C 3 193 ? 32.467  -13.138 91.385  1.00 126.10 ? 188 TRP H NE1 1 
ATOM   4995  C CE2 . TRP C 3 193 ? 32.993  -12.286 92.319  1.00 127.64 ? 188 TRP H CE2 1 
ATOM   4996  C CE3 . TRP C 3 193 ? 32.198  -10.847 94.087  1.00 134.33 ? 188 TRP H CE3 1 
ATOM   4997  C CZ2 . TRP C 3 193 ? 34.321  -11.942 92.573  1.00 126.42 ? 188 TRP H CZ2 1 
ATOM   4998  C CZ3 . TRP C 3 193 ? 33.522  -10.508 94.334  1.00 134.04 ? 188 TRP H CZ3 1 
ATOM   4999  C CH2 . TRP C 3 193 ? 34.563  -11.055 93.582  1.00 126.05 ? 188 TRP H CH2 1 
ATOM   5000  N N   . PRO C 3 194 ? 30.318  -13.975 94.874  1.00 138.33 ? 189 PRO H N   1 
ATOM   5001  C CA  . PRO C 3 194 ? 31.490  -14.770 95.270  1.00 139.16 ? 189 PRO H CA  1 
ATOM   5002  C C   . PRO C 3 194 ? 31.246  -16.287 95.222  1.00 143.05 ? 189 PRO H C   1 
ATOM   5003  O O   . PRO C 3 194 ? 32.200  -17.061 95.123  1.00 141.83 ? 189 PRO H O   1 
ATOM   5004  C CB  . PRO C 3 194 ? 31.793  -14.265 96.686  1.00 135.89 ? 189 PRO H CB  1 
ATOM   5005  C CG  . PRO C 3 194 ? 31.339  -12.826 96.656  1.00 134.00 ? 189 PRO H CG  1 
ATOM   5006  C CD  . PRO C 3 194 ? 30.089  -12.844 95.799  1.00 137.28 ? 189 PRO H CD  1 
ATOM   5007  N N   . SER C 3 195 ? 29.978  -16.689 95.283  1.00 144.81 ? 190 SER H N   1 
ATOM   5008  C CA  . SER C 3 195 ? 29.551  -18.037 94.909  1.00 147.12 ? 190 SER H CA  1 
ATOM   5009  C C   . SER C 3 195 ? 29.890  -18.372 93.448  1.00 147.97 ? 190 SER H C   1 
ATOM   5010  O O   . SER C 3 195 ? 29.094  -18.124 92.536  1.00 147.60 ? 190 SER H O   1 
ATOM   5011  C CB  . SER C 3 195 ? 28.042  -18.188 95.118  1.00 150.14 ? 190 SER H CB  1 
ATOM   5012  O OG  . SER C 3 195 ? 27.523  -19.240 94.320  1.00 147.44 ? 190 SER H OG  1 
ATOM   5013  N N   . GLN C 3 196 ? 31.084  -18.919 93.241  1.00 148.86 ? 191 GLN H N   1 
ATOM   5014  C CA  . GLN C 3 196 ? 31.510  -19.514 91.961  1.00 149.23 ? 191 GLN H CA  1 
ATOM   5015  C C   . GLN C 3 196 ? 31.650  -18.624 90.707  1.00 142.63 ? 191 GLN H C   1 
ATOM   5016  O O   . GLN C 3 196 ? 31.882  -17.414 90.799  1.00 137.85 ? 191 GLN H O   1 
ATOM   5017  C CB  . GLN C 3 196 ? 30.722  -20.798 91.641  1.00 149.30 ? 191 GLN H CB  1 
ATOM   5018  C CG  . GLN C 3 196 ? 31.613  -22.041 91.471  1.00 142.52 ? 191 GLN H CG  1 
ATOM   5019  C CD  . GLN C 3 196 ? 32.583  -22.247 92.637  1.00 142.11 ? 191 GLN H CD  1 
ATOM   5020  O OE1 . GLN C 3 196 ? 32.173  -22.558 93.756  1.00 140.03 ? 191 GLN H OE1 1 
ATOM   5021  N NE2 . GLN C 3 196 ? 33.877  -22.078 92.372  1.00 136.79 ? 191 GLN H NE2 1 
ATOM   5022  N N   . SER C 3 197 ? 31.492  -19.260 89.545  1.00 141.42 ? 192 SER H N   1 
ATOM   5023  C CA  . SER C 3 197 ? 32.140  -18.833 88.296  1.00 133.22 ? 192 SER H CA  1 
ATOM   5024  C C   . SER C 3 197 ? 31.613  -17.593 87.577  1.00 125.37 ? 192 SER H C   1 
ATOM   5025  O O   . SER C 3 197 ? 30.435  -17.514 87.219  1.00 121.35 ? 192 SER H O   1 
ATOM   5026  C CB  . SER C 3 197 ? 32.198  -20.003 87.306  1.00 129.55 ? 192 SER H CB  1 
ATOM   5027  O OG  . SER C 3 197 ? 33.494  -20.576 87.271  1.00 125.30 ? 192 SER H OG  1 
ATOM   5028  N N   . ILE C 3 198 ? 32.526  -16.644 87.363  1.00 118.68 ? 193 ILE H N   1 
ATOM   5029  C CA  . ILE C 3 198 ? 32.321  -15.504 86.472  1.00 112.32 ? 193 ILE H CA  1 
ATOM   5030  C C   . ILE C 3 198 ? 33.641  -15.196 85.744  1.00 114.46 ? 193 ILE H C   1 
ATOM   5031  O O   . ILE C 3 198 ? 34.711  -15.209 86.362  1.00 119.30 ? 193 ILE H O   1 
ATOM   5032  C CB  . ILE C 3 198 ? 31.858  -14.260 87.234  1.00 112.31 ? 193 ILE H CB  1 
ATOM   5033  C CG1 . ILE C 3 198 ? 30.544  -14.529 87.971  1.00 121.14 ? 193 ILE H CG1 1 
ATOM   5034  C CG2 . ILE C 3 198 ? 31.680  -13.108 86.282  1.00 105.04 ? 193 ILE H CG2 1 
ATOM   5035  C CD1 . ILE C 3 198 ? 30.696  -15.267 89.289  1.00 126.94 ? 193 ILE H CD1 1 
ATOM   5036  N N   . THR C 3 199 ? 33.567  -14.922 84.440  1.00 109.07 ? 194 THR H N   1 
ATOM   5037  C CA  . THR C 3 199 ? 34.757  -14.796 83.594  1.00 102.14 ? 194 THR H CA  1 
ATOM   5038  C C   . THR C 3 199 ? 34.514  -13.831 82.427  1.00 95.30  ? 194 THR H C   1 
ATOM   5039  O O   . THR C 3 199 ? 33.404  -13.752 81.903  1.00 94.49  ? 194 THR H O   1 
ATOM   5040  C CB  . THR C 3 199 ? 35.160  -16.182 83.022  1.00 100.13 ? 194 THR H CB  1 
ATOM   5041  O OG1 . THR C 3 199 ? 35.144  -17.160 84.066  1.00 100.50 ? 194 THR H OG1 1 
ATOM   5042  C CG2 . THR C 3 199 ? 36.545  -16.150 82.388  1.00 98.45  ? 194 THR H CG2 1 
ATOM   5043  N N   . CYS C 3 200 ? 35.548  -13.101 82.017  1.00 91.45  ? 195 CYS H N   1 
ATOM   5044  C CA  . CYS C 3 200 ? 35.446  -12.245 80.832  1.00 91.12  ? 195 CYS H CA  1 
ATOM   5045  C C   . CYS C 3 200 ? 36.172  -12.815 79.606  1.00 89.70  ? 195 CYS H C   1 
ATOM   5046  O O   . CYS C 3 200 ? 37.218  -13.459 79.729  1.00 87.19  ? 195 CYS H O   1 
ATOM   5047  C CB  . CYS C 3 200 ? 35.949  -10.829 81.126  1.00 89.60  ? 195 CYS H CB  1 
ATOM   5048  S SG  . CYS C 3 200 ? 37.747  -10.630 81.216  1.00 91.51  ? 195 CYS H SG  1 
ATOM   5049  N N   . ASN C 3 201 ? 35.619  -12.548 78.425  1.00 86.38  ? 196 ASN H N   1 
ATOM   5050  C CA  . ASN C 3 201 ? 36.140  -13.112 77.187  1.00 83.20  ? 196 ASN H CA  1 
ATOM   5051  C C   . ASN C 3 201 ? 36.538  -12.096 76.130  1.00 78.61  ? 196 ASN H C   1 
ATOM   5052  O O   . ASN C 3 201 ? 35.691  -11.618 75.378  1.00 76.39  ? 196 ASN H O   1 
ATOM   5053  C CB  . ASN C 3 201 ? 35.097  -14.034 76.580  1.00 84.52  ? 196 ASN H CB  1 
ATOM   5054  C CG  . ASN C 3 201 ? 34.499  -14.950 77.590  1.00 86.46  ? 196 ASN H CG  1 
ATOM   5055  O OD1 . ASN C 3 201 ? 35.213  -15.516 78.412  1.00 87.75  ? 196 ASN H OD1 1 
ATOM   5056  N ND2 . ASN C 3 201 ? 33.181  -15.101 77.552  1.00 88.20  ? 196 ASN H ND2 1 
ATOM   5057  N N   . VAL C 3 202 ? 37.829  -11.805 76.041  1.00 74.27  ? 197 VAL H N   1 
ATOM   5058  C CA  . VAL C 3 202 ? 38.342  -10.952 74.974  1.00 71.70  ? 197 VAL H CA  1 
ATOM   5059  C C   . VAL C 3 202 ? 38.634  -11.695 73.650  1.00 73.02  ? 197 VAL H C   1 
ATOM   5060  O O   . VAL C 3 202 ? 39.115  -12.829 73.646  1.00 75.11  ? 197 VAL H O   1 
ATOM   5061  C CB  . VAL C 3 202 ? 39.591  -10.218 75.437  1.00 65.64  ? 197 VAL H CB  1 
ATOM   5062  C CG1 . VAL C 3 202 ? 39.202  -9.060  76.326  1.00 66.88  ? 197 VAL H CG1 1 
ATOM   5063  C CG2 . VAL C 3 202 ? 40.487  -11.172 76.182  1.00 69.76  ? 197 VAL H CG2 1 
ATOM   5064  N N   . ALA C 3 203 ? 38.319  -11.044 72.532  1.00 70.65  ? 198 ALA H N   1 
ATOM   5065  C CA  . ALA C 3 203 ? 38.602  -11.564 71.193  1.00 66.09  ? 198 ALA H CA  1 
ATOM   5066  C C   . ALA C 3 203 ? 39.486  -10.569 70.482  1.00 64.37  ? 198 ALA H C   1 
ATOM   5067  O O   . ALA C 3 203 ? 39.179  -9.381  70.469  1.00 66.66  ? 198 ALA H O   1 
ATOM   5068  C CB  . ALA C 3 203 ? 37.316  -11.728 70.404  1.00 65.33  ? 198 ALA H CB  1 
ATOM   5069  N N   . HIS C 3 204 ? 40.580  -11.033 69.892  1.00 61.61  ? 199 HIS H N   1 
ATOM   5070  C CA  . HIS C 3 204 ? 41.400  -10.148 69.070  1.00 62.66  ? 199 HIS H CA  1 
ATOM   5071  C C   . HIS C 3 204 ? 41.716  -10.830 67.759  1.00 59.79  ? 199 HIS H C   1 
ATOM   5072  O O   . HIS C 3 204 ? 42.731  -11.506 67.632  1.00 60.65  ? 199 HIS H O   1 
ATOM   5073  C CB  . HIS C 3 204 ? 42.684  -9.740  69.788  1.00 60.15  ? 199 HIS H CB  1 
ATOM   5074  C CG  . HIS C 3 204 ? 43.412  -8.608  69.131  1.00 57.83  ? 199 HIS H CG  1 
ATOM   5075  N ND1 . HIS C 3 204 ? 44.774  -8.615  68.924  1.00 62.44  ? 199 HIS H ND1 1 
ATOM   5076  C CD2 . HIS C 3 204 ? 42.967  -7.428  68.637  1.00 59.95  ? 199 HIS H CD2 1 
ATOM   5077  C CE1 . HIS C 3 204 ? 45.140  -7.492  68.332  1.00 59.22  ? 199 HIS H CE1 1 
ATOM   5078  N NE2 . HIS C 3 204 ? 44.063  -6.753  68.146  1.00 62.57  ? 199 HIS H NE2 1 
ATOM   5079  N N   . PRO C 3 205 ? 40.851  -10.636 66.764  1.00 57.64  ? 200 PRO H N   1 
ATOM   5080  C CA  . PRO C 3 205 ? 40.956  -11.439 65.552  1.00 60.73  ? 200 PRO H CA  1 
ATOM   5081  C C   . PRO C 3 205 ? 42.284  -11.171 64.850  1.00 56.21  ? 200 PRO H C   1 
ATOM   5082  O O   . PRO C 3 205 ? 42.864  -12.064 64.240  1.00 54.37  ? 200 PRO H O   1 
ATOM   5083  C CB  . PRO C 3 205 ? 39.785  -10.925 64.701  1.00 61.93  ? 200 PRO H CB  1 
ATOM   5084  C CG  . PRO C 3 205 ? 38.948  -10.076 65.633  1.00 55.76  ? 200 PRO H CG  1 
ATOM   5085  C CD  . PRO C 3 205 ? 39.925  -9.513  66.583  1.00 55.62  ? 200 PRO H CD  1 
ATOM   5086  N N   . ALA C 3 206 ? 42.761  -9.941  64.953  1.00 54.15  ? 201 ALA H N   1 
ATOM   5087  C CA  . ALA C 3 206 ? 43.991  -9.545  64.294  1.00 53.80  ? 201 ALA H CA  1 
ATOM   5088  C C   . ALA C 3 206 ? 45.171  -10.460 64.599  1.00 56.07  ? 201 ALA H C   1 
ATOM   5089  O O   . ALA C 3 206 ? 46.081  -10.588 63.766  1.00 55.04  ? 201 ALA H O   1 
ATOM   5090  C CB  . ALA C 3 206 ? 44.335  -8.131  64.683  1.00 57.83  ? 201 ALA H CB  1 
ATOM   5091  N N   . SER C 3 207 ? 45.168  -11.063 65.793  1.00 54.19  ? 202 SER H N   1 
ATOM   5092  C CA  . SER C 3 207 ? 46.310  -11.843 66.275  1.00 52.27  ? 202 SER H CA  1 
ATOM   5093  C C   . SER C 3 207 ? 45.906  -13.233 66.621  1.00 50.64  ? 202 SER H C   1 
ATOM   5094  O O   . SER C 3 207 ? 46.660  -13.958 67.251  1.00 51.55  ? 202 SER H O   1 
ATOM   5095  C CB  . SER C 3 207 ? 46.930  -11.230 67.525  1.00 52.77  ? 202 SER H CB  1 
ATOM   5096  O OG  . SER C 3 207 ? 46.375  -9.970  67.801  1.00 56.05  ? 202 SER H OG  1 
ATOM   5097  N N   . SER C 3 208 ? 44.704  -13.603 66.227  1.00 54.55  ? 203 SER H N   1 
ATOM   5098  C CA  . SER C 3 208 ? 44.216  -14.936 66.531  1.00 61.14  ? 203 SER H CA  1 
ATOM   5099  C C   . SER C 3 208 ? 44.270  -15.180 68.043  1.00 62.20  ? 203 SER H C   1 
ATOM   5100  O O   . SER C 3 208 ? 44.616  -16.268 68.501  1.00 66.73  ? 203 SER H O   1 
ATOM   5101  C CB  . SER C 3 208 ? 45.020  -15.995 65.758  1.00 61.69  ? 203 SER H CB  1 
ATOM   5102  O OG  . SER C 3 208 ? 46.267  -15.491 65.300  1.00 58.33  ? 203 SER H OG  1 
ATOM   5103  N N   . THR C 3 209 ? 43.916  -14.152 68.809  1.00 65.20  ? 204 THR H N   1 
ATOM   5104  C CA  . THR C 3 209 ? 43.953  -14.204 70.271  1.00 66.82  ? 204 THR H CA  1 
ATOM   5105  C C   . THR C 3 209 ? 42.557  -14.400 70.848  1.00 65.45  ? 204 THR H C   1 
ATOM   5106  O O   . THR C 3 209 ? 41.626  -13.698 70.471  1.00 69.76  ? 204 THR H O   1 
ATOM   5107  C CB  . THR C 3 209 ? 44.525  -12.898 70.861  1.00 66.01  ? 204 THR H CB  1 
ATOM   5108  O OG1 . THR C 3 209 ? 45.474  -12.318 69.949  1.00 62.25  ? 204 THR H OG1 1 
ATOM   5109  C CG2 . THR C 3 209 ? 45.188  -13.167 72.220  1.00 68.68  ? 204 THR H CG2 1 
ATOM   5110  N N   . LYS C 3 210 ? 42.412  -15.329 71.779  1.00 64.35  ? 205 LYS H N   1 
ATOM   5111  C CA  . LYS C 3 210 ? 41.094  -15.666 72.285  1.00 72.76  ? 205 LYS H CA  1 
ATOM   5112  C C   . LYS C 3 210 ? 41.246  -16.213 73.704  1.00 78.36  ? 205 LYS H C   1 
ATOM   5113  O O   . LYS C 3 210 ? 41.405  -17.420 73.895  1.00 86.17  ? 205 LYS H O   1 
ATOM   5114  C CB  . LYS C 3 210 ? 40.427  -16.676 71.323  1.00 72.12  ? 205 LYS H CB  1 
ATOM   5115  C CG  . LYS C 3 210 ? 39.153  -17.398 71.811  1.00 78.47  ? 205 LYS H CG  1 
ATOM   5116  C CD  . LYS C 3 210 ? 37.837  -16.754 71.310  1.00 88.65  ? 205 LYS H CD  1 
ATOM   5117  C CE  . LYS C 3 210 ? 36.978  -16.177 72.482  1.00 95.12  ? 205 LYS H CE  1 
ATOM   5118  N NZ  . LYS C 3 210 ? 35.682  -15.488 72.088  1.00 78.16  ? 205 LYS H NZ  1 
ATOM   5119  N N   . VAL C 3 211 ? 41.228  -15.330 74.702  1.00 73.47  ? 206 VAL H N   1 
ATOM   5120  C CA  . VAL C 3 211 ? 41.389  -15.780 76.086  1.00 78.84  ? 206 VAL H CA  1 
ATOM   5121  C C   . VAL C 3 211 ? 40.320  -15.263 77.042  1.00 85.36  ? 206 VAL H C   1 
ATOM   5122  O O   . VAL C 3 211 ? 39.621  -14.291 76.737  1.00 83.56  ? 206 VAL H O   1 
ATOM   5123  C CB  . VAL C 3 211 ? 42.760  -15.426 76.656  1.00 72.19  ? 206 VAL H CB  1 
ATOM   5124  C CG1 . VAL C 3 211 ? 43.716  -15.129 75.529  1.00 69.76  ? 206 VAL H CG1 1 
ATOM   5125  C CG2 . VAL C 3 211 ? 42.636  -14.250 77.603  1.00 67.14  ? 206 VAL H CG2 1 
ATOM   5126  N N   . ASP C 3 212 ? 40.218  -15.930 78.199  1.00 87.47  ? 207 ASP H N   1 
ATOM   5127  C CA  . ASP C 3 212 ? 39.180  -15.680 79.197  1.00 87.87  ? 207 ASP H CA  1 
ATOM   5128  C C   . ASP C 3 212 ? 39.816  -15.544 80.570  1.00 90.66  ? 207 ASP H C   1 
ATOM   5129  O O   . ASP C 3 212 ? 40.552  -16.426 81.013  1.00 91.67  ? 207 ASP H O   1 
ATOM   5130  C CB  . ASP C 3 212 ? 38.160  -16.825 79.220  1.00 84.85  ? 207 ASP H CB  1 
ATOM   5131  C CG  . ASP C 3 212 ? 37.834  -17.349 77.829  1.00 87.35  ? 207 ASP H CG  1 
ATOM   5132  O OD1 . ASP C 3 212 ? 38.203  -18.508 77.527  1.00 84.33  ? 207 ASP H OD1 1 
ATOM   5133  O OD2 . ASP C 3 212 ? 37.215  -16.604 77.033  1.00 85.45  ? 207 ASP H OD2 1 
ATOM   5134  N N   . LYS C 3 213 ? 39.544  -14.427 81.236  1.00 93.47  ? 208 LYS H N   1 
ATOM   5135  C CA  . LYS C 3 213 ? 40.051  -14.203 82.583  1.00 90.91  ? 208 LYS H CA  1 
ATOM   5136  C C   . LYS C 3 213 ? 38.875  -14.224 83.526  1.00 97.62  ? 208 LYS H C   1 
ATOM   5137  O O   . LYS C 3 213 ? 37.768  -13.847 83.153  1.00 96.65  ? 208 LYS H O   1 
ATOM   5138  C CB  . LYS C 3 213 ? 40.774  -12.867 82.692  1.00 82.29  ? 208 LYS H CB  1 
ATOM   5139  C CG  . LYS C 3 213 ? 41.980  -12.933 83.566  1.00 77.92  ? 208 LYS H CG  1 
ATOM   5140  C CD  . LYS C 3 213 ? 42.904  -14.017 83.066  1.00 82.15  ? 208 LYS H CD  1 
ATOM   5141  C CE  . LYS C 3 213 ? 43.998  -14.291 84.067  1.00 87.96  ? 208 LYS H CE  1 
ATOM   5142  N NZ  . LYS C 3 213 ? 43.423  -14.549 85.416  1.00 92.08  ? 208 LYS H NZ  1 
ATOM   5143  N N   . LYS C 3 214 ? 39.118  -14.652 84.756  1.00 106.90 ? 209 LYS H N   1 
ATOM   5144  C CA  . LYS C 3 214 ? 38.031  -14.925 85.683  1.00 108.83 ? 209 LYS H CA  1 
ATOM   5145  C C   . LYS C 3 214 ? 38.301  -14.322 87.066  1.00 114.04 ? 209 LYS H C   1 
ATOM   5146  O O   . LYS C 3 214 ? 39.405  -13.843 87.339  1.00 108.10 ? 209 LYS H O   1 
ATOM   5147  C CB  . LYS C 3 214 ? 37.789  -16.440 85.756  1.00 107.61 ? 209 LYS H CB  1 
ATOM   5148  C CG  . LYS C 3 214 ? 39.049  -17.306 85.504  1.00 109.95 ? 209 LYS H CG  1 
ATOM   5149  C CD  . LYS C 3 214 ? 39.447  -17.414 84.015  1.00 103.85 ? 209 LYS H CD  1 
ATOM   5150  C CE  . LYS C 3 214 ? 39.049  -18.758 83.381  1.00 100.16 ? 209 LYS H CE  1 
ATOM   5151  N NZ  . LYS C 3 214 ? 39.995  -19.882 83.685  1.00 89.89  ? 209 LYS H NZ  1 
ATOM   5152  N N   . ILE C 3 215 ? 37.285  -14.347 87.924  1.00 118.47 ? 210 ILE H N   1 
ATOM   5153  C CA  . ILE C 3 215 ? 37.353  -13.750 89.264  1.00 127.40 ? 210 ILE H CA  1 
ATOM   5154  C C   . ILE C 3 215 ? 38.482  -14.265 90.178  1.00 131.31 ? 210 ILE H C   1 
ATOM   5155  O O   . ILE C 3 215 ? 38.920  -15.415 90.066  1.00 127.94 ? 210 ILE H O   1 
ATOM   5156  C CB  . ILE C 3 215 ? 35.985  -13.880 90.009  1.00 122.97 ? 210 ILE H CB  1 
ATOM   5157  C CG1 . ILE C 3 215 ? 36.184  -14.061 91.523  1.00 129.17 ? 210 ILE H CG1 1 
ATOM   5158  C CG2 . ILE C 3 215 ? 35.180  -15.040 89.452  1.00 123.00 ? 210 ILE H CG2 1 
ATOM   5159  C CD1 . ILE C 3 215 ? 36.375  -15.503 91.991  1.00 127.73 ? 210 ILE H CD1 1 
ATOM   5160  N N   . VAL C 3 216 ? 38.932  -13.390 91.081  1.00 131.81 ? 211 VAL H N   1 
ATOM   5161  C CA  . VAL C 3 216 ? 39.833  -13.753 92.180  1.00 132.66 ? 211 VAL H CA  1 
ATOM   5162  C C   . VAL C 3 216 ? 40.092  -12.544 93.106  1.00 133.80 ? 211 VAL H C   1 
ATOM   5163  O O   . VAL C 3 216 ? 40.591  -11.509 92.653  1.00 126.72 ? 211 VAL H O   1 
ATOM   5164  C CB  . VAL C 3 216 ? 41.163  -14.368 91.660  1.00 133.72 ? 211 VAL H CB  1 
ATOM   5165  C CG1 . VAL C 3 216 ? 42.360  -13.526 92.080  1.00 137.97 ? 211 VAL H CG1 1 
ATOM   5166  C CG2 . VAL C 3 216 ? 41.321  -15.819 92.132  1.00 121.25 ? 211 VAL H CG2 1 
ATOM   5167  N N   . PRO C 3 217 ? 39.705  -12.667 94.397  1.00 140.49 ? 212 PRO H N   1 
ATOM   5168  C CA  . PRO C 3 217 ? 39.865  -11.687 95.488  1.00 140.40 ? 212 PRO H CA  1 
ATOM   5169  C C   . PRO C 3 217 ? 41.221  -11.718 96.201  1.00 136.11 ? 212 PRO H C   1 
ATOM   5170  O O   . PRO C 3 217 ? 41.837  -12.769 96.370  1.00 134.55 ? 212 PRO H O   1 
ATOM   5171  C CB  . PRO C 3 217 ? 38.778  -12.103 96.488  1.00 136.00 ? 212 PRO H CB  1 
ATOM   5172  C CG  . PRO C 3 217 ? 37.847  -12.983 95.722  1.00 135.48 ? 212 PRO H CG  1 
ATOM   5173  C CD  . PRO C 3 217 ? 38.731  -13.706 94.767  1.00 137.79 ? 212 PRO H CD  1 
ATOM   5174  N N   . ASP D 4 1   ? 2.019   26.573  7.150   1.00 77.24  ? 1   ASP A N   1 
ATOM   5175  C CA  . ASP D 4 1   ? 3.218   27.181  6.566   1.00 89.73  ? 1   ASP A CA  1 
ATOM   5176  C C   . ASP D 4 1   ? 3.489   28.572  7.159   1.00 90.26  ? 1   ASP A C   1 
ATOM   5177  O O   . ASP D 4 1   ? 3.413   29.591  6.459   1.00 89.38  ? 1   ASP A O   1 
ATOM   5178  C CB  . ASP D 4 1   ? 3.124   27.252  5.027   1.00 90.22  ? 1   ASP A CB  1 
ATOM   5179  C CG  . ASP D 4 1   ? 2.989   25.873  4.374   1.00 86.24  ? 1   ASP A CG  1 
ATOM   5180  O OD1 . ASP D 4 1   ? 1.946   25.217  4.584   1.00 89.60  ? 1   ASP A OD1 1 
ATOM   5181  O OD2 . ASP D 4 1   ? 3.915   25.444  3.646   1.00 80.00  ? 1   ASP A OD2 1 
ATOM   5182  N N   . ILE D 4 2   ? 3.829   28.596  8.448   1.00 91.47  ? 2   ILE A N   1 
ATOM   5183  C CA  . ILE D 4 2   ? 3.947   29.844  9.213   1.00 90.83  ? 2   ILE A CA  1 
ATOM   5184  C C   . ILE D 4 2   ? 5.408   30.299  9.372   1.00 80.81  ? 2   ILE A C   1 
ATOM   5185  O O   . ILE D 4 2   ? 6.168   29.793  10.202  1.00 70.39  ? 2   ILE A O   1 
ATOM   5186  C CB  . ILE D 4 2   ? 3.182   29.746  10.558  1.00 94.52  ? 2   ILE A CB  1 
ATOM   5187  C CG1 . ILE D 4 2   ? 1.931   28.871  10.360  1.00 93.19  ? 2   ILE A CG1 1 
ATOM   5188  C CG2 . ILE D 4 2   ? 2.805   31.136  11.063  1.00 89.02  ? 2   ILE A CG2 1 
ATOM   5189  C CD1 . ILE D 4 2   ? 1.225   28.428  11.626  1.00 91.04  ? 2   ILE A CD1 1 
ATOM   5190  N N   . VAL D 4 3   ? 5.753   31.287  8.553   1.00 80.87  ? 3   VAL A N   1 
ATOM   5191  C CA  . VAL D 4 3   ? 7.130   31.620  8.228   1.00 79.56  ? 3   VAL A CA  1 
ATOM   5192  C C   . VAL D 4 3   ? 7.587   32.954  8.814   1.00 77.04  ? 3   VAL A C   1 
ATOM   5193  O O   . VAL D 4 3   ? 6.786   33.870  9.024   1.00 71.32  ? 3   VAL A O   1 
ATOM   5194  C CB  . VAL D 4 3   ? 7.356   31.577  6.682   1.00 83.94  ? 3   VAL A CB  1 
ATOM   5195  C CG1 . VAL D 4 3   ? 6.125   32.104  5.929   1.00 76.93  ? 3   VAL A CG1 1 
ATOM   5196  C CG2 . VAL D 4 3   ? 8.648   32.309  6.274   1.00 78.48  ? 3   VAL A CG2 1 
ATOM   5197  N N   . LEU D 4 4   ? 8.900   33.043  9.021   1.00 78.14  ? 4   LEU A N   1 
ATOM   5198  C CA  . LEU D 4 4   ? 9.528   33.951  9.979   1.00 77.55  ? 4   LEU A CA  1 
ATOM   5199  C C   . LEU D 4 4   ? 10.366  35.087  9.362   1.00 76.47  ? 4   LEU A C   1 
ATOM   5200  O O   . LEU D 4 4   ? 11.097  34.888  8.384   1.00 72.50  ? 4   LEU A O   1 
ATOM   5201  C CB  . LEU D 4 4   ? 10.393  33.106  10.922  1.00 78.08  ? 4   LEU A CB  1 
ATOM   5202  C CG  . LEU D 4 4   ? 11.161  31.981  10.204  1.00 71.85  ? 4   LEU A CG  1 
ATOM   5203  C CD1 . LEU D 4 4   ? 12.384  32.537  9.505   1.00 67.33  ? 4   LEU A CD1 1 
ATOM   5204  C CD2 . LEU D 4 4   ? 11.564  30.840  11.140  1.00 66.63  ? 4   LEU A CD2 1 
ATOM   5205  N N   . THR D 4 5   ? 10.275  36.276  9.956   1.00 78.48  ? 5   THR A N   1 
ATOM   5206  C CA  . THR D 4 5   ? 10.899  37.467  9.373   1.00 76.70  ? 5   THR A CA  1 
ATOM   5207  C C   . THR D 4 5   ? 12.281  37.801  9.964   1.00 71.25  ? 5   THR A C   1 
ATOM   5208  O O   . THR D 4 5   ? 12.675  37.248  10.984  1.00 72.91  ? 5   THR A O   1 
ATOM   5209  C CB  . THR D 4 5   ? 9.960   38.696  9.447   1.00 72.05  ? 5   THR A CB  1 
ATOM   5210  O OG1 . THR D 4 5   ? 10.583  39.707  10.236  1.00 76.93  ? 5   THR A OG1 1 
ATOM   5211  C CG2 . THR D 4 5   ? 8.616   38.327  10.065  1.00 68.77  ? 5   THR A CG2 1 
ATOM   5212  N N   . GLN D 4 6   ? 13.004  38.713  9.320   1.00 68.02  ? 6   GLN A N   1 
ATOM   5213  C CA  . GLN D 4 6   ? 14.423  38.891  9.584   1.00 66.65  ? 6   GLN A CA  1 
ATOM   5214  C C   . GLN D 4 6   ? 14.770  40.352  9.488   1.00 74.13  ? 6   GLN A C   1 
ATOM   5215  O O   . GLN D 4 6   ? 14.339  41.017  8.546   1.00 77.68  ? 6   GLN A O   1 
ATOM   5216  C CB  . GLN D 4 6   ? 15.211  38.149  8.513   1.00 66.26  ? 6   GLN A CB  1 
ATOM   5217  C CG  . GLN D 4 6   ? 16.554  37.636  8.938   1.00 65.94  ? 6   GLN A CG  1 
ATOM   5218  C CD  . GLN D 4 6   ? 17.182  36.739  7.888   1.00 67.14  ? 6   GLN A CD  1 
ATOM   5219  O OE1 . GLN D 4 6   ? 18.033  37.174  7.127   1.00 71.23  ? 6   GLN A OE1 1 
ATOM   5220  N NE2 . GLN D 4 6   ? 16.771  35.482  7.849   1.00 65.37  ? 6   GLN A NE2 1 
ATOM   5221  N N   . SER D 4 7   ? 15.555  40.860  10.442  1.00 77.25  ? 7   SER A N   1 
ATOM   5222  C CA  . SER D 4 7   ? 16.011  42.264  10.398  1.00 78.86  ? 7   SER A CA  1 
ATOM   5223  C C   . SER D 4 7   ? 17.470  42.471  10.850  1.00 79.54  ? 7   SER A C   1 
ATOM   5224  O O   . SER D 4 7   ? 17.929  41.819  11.802  1.00 77.72  ? 7   SER A O   1 
ATOM   5225  C CB  . SER D 4 7   ? 15.072  43.180  11.193  1.00 74.06  ? 7   SER A CB  1 
ATOM   5226  O OG  . SER D 4 7   ? 15.512  44.527  11.135  1.00 75.24  ? 7   SER A OG  1 
ATOM   5227  N N   . PRO D 4 8   ? 18.193  43.404  10.187  1.00 78.05  ? 8   PRO A N   1 
ATOM   5228  C CA  . PRO D 4 8   ? 17.721  44.325  9.145   1.00 76.62  ? 8   PRO A CA  1 
ATOM   5229  C C   . PRO D 4 8   ? 18.082  43.809  7.758   1.00 82.49  ? 8   PRO A C   1 
ATOM   5230  O O   . PRO D 4 8   ? 19.125  43.174  7.622   1.00 83.48  ? 8   PRO A O   1 
ATOM   5231  C CB  . PRO D 4 8   ? 18.555  45.566  9.411   1.00 70.75  ? 8   PRO A CB  1 
ATOM   5232  C CG  . PRO D 4 8   ? 19.901  44.987  9.920   1.00 75.39  ? 8   PRO A CG  1 
ATOM   5233  C CD  . PRO D 4 8   ? 19.643  43.565  10.398  1.00 73.92  ? 8   PRO A CD  1 
ATOM   5234  N N   . PRO D 4 9   ? 17.250  44.085  6.738   1.00 80.88  ? 9   PRO A N   1 
ATOM   5235  C CA  . PRO D 4 9   ? 17.561  43.573  5.400   1.00 76.10  ? 9   PRO A CA  1 
ATOM   5236  C C   . PRO D 4 9   ? 19.008  43.829  4.990   1.00 77.03  ? 9   PRO A C   1 
ATOM   5237  O O   . PRO D 4 9   ? 19.672  42.903  4.535   1.00 77.72  ? 9   PRO A O   1 
ATOM   5238  C CB  . PRO D 4 9   ? 16.595  44.347  4.507   1.00 76.76  ? 9   PRO A CB  1 
ATOM   5239  C CG  . PRO D 4 9   ? 15.400  44.554  5.379   1.00 78.25  ? 9   PRO A CG  1 
ATOM   5240  C CD  . PRO D 4 9   ? 15.975  44.824  6.755   1.00 82.35  ? 9   PRO A CD  1 
ATOM   5241  N N   . SER D 4 10  ? 19.494  45.055  5.150   1.00 77.22  ? 10  SER A N   1 
ATOM   5242  C CA  . SER D 4 10  ? 20.892  45.352  4.846   1.00 78.80  ? 10  SER A CA  1 
ATOM   5243  C C   . SER D 4 10  ? 21.736  45.303  6.111   1.00 78.08  ? 10  SER A C   1 
ATOM   5244  O O   . SER D 4 10  ? 21.210  45.201  7.216   1.00 77.04  ? 10  SER A O   1 
ATOM   5245  C CB  . SER D 4 10  ? 21.030  46.744  4.207   1.00 83.23  ? 10  SER A CB  1 
ATOM   5246  O OG  . SER D 4 10  ? 20.471  46.809  2.903   1.00 85.41  ? 10  SER A OG  1 
ATOM   5247  N N   . LEU D 4 11  ? 23.049  45.384  5.946   1.00 77.34  ? 11  LEU A N   1 
ATOM   5248  C CA  . LEU D 4 11  ? 23.920  45.652  7.079   1.00 75.51  ? 11  LEU A CA  1 
ATOM   5249  C C   . LEU D 4 11  ? 25.337  46.007  6.654   1.00 79.99  ? 11  LEU A C   1 
ATOM   5250  O O   . LEU D 4 11  ? 25.910  45.358  5.785   1.00 78.83  ? 11  LEU A O   1 
ATOM   5251  C CB  . LEU D 4 11  ? 23.952  44.469  8.033   1.00 79.98  ? 11  LEU A CB  1 
ATOM   5252  C CG  . LEU D 4 11  ? 24.449  44.841  9.434   1.00 85.51  ? 11  LEU A CG  1 
ATOM   5253  C CD1 . LEU D 4 11  ? 23.546  45.922  10.042  1.00 85.87  ? 11  LEU A CD1 1 
ATOM   5254  C CD2 . LEU D 4 11  ? 24.543  43.614  10.344  1.00 78.93  ? 11  LEU A CD2 1 
ATOM   5255  N N   . ALA D 4 12  ? 25.895  47.039  7.287   1.00 83.81  ? 12  ALA A N   1 
ATOM   5256  C CA  . ALA D 4 12  ? 27.259  47.497  7.017   1.00 78.17  ? 12  ALA A CA  1 
ATOM   5257  C C   . ALA D 4 12  ? 28.063  47.614  8.313   1.00 80.95  ? 12  ALA A C   1 
ATOM   5258  O O   . ALA D 4 12  ? 27.602  48.203  9.293   1.00 83.22  ? 12  ALA A O   1 
ATOM   5259  C CB  . ALA D 4 12  ? 27.222  48.836  6.303   1.00 77.49  ? 12  ALA A CB  1 
ATOM   5260  N N   . VAL D 4 13  ? 29.261  47.047  8.332   1.00 77.57  ? 13  VAL A N   1 
ATOM   5261  C CA  . VAL D 4 13  ? 30.118  47.197  9.498   1.00 78.18  ? 13  VAL A CA  1 
ATOM   5262  C C   . VAL D 4 13  ? 31.574  47.263  9.054   1.00 77.88  ? 13  VAL A C   1 
ATOM   5263  O O   . VAL D 4 13  ? 31.970  46.575  8.126   1.00 77.81  ? 13  VAL A O   1 
ATOM   5264  C CB  . VAL D 4 13  ? 29.903  46.058  10.547  1.00 78.07  ? 13  VAL A CB  1 
ATOM   5265  C CG1 . VAL D 4 13  ? 28.428  45.724  10.702  1.00 73.65  ? 13  VAL A CG1 1 
ATOM   5266  C CG2 . VAL D 4 13  ? 30.692  44.810  10.187  1.00 77.29  ? 13  VAL A CG2 1 
ATOM   5267  N N   . SER D 4 14  ? 32.367  48.110  9.696   1.00 78.97  ? 14  SER A N   1 
ATOM   5268  C CA  . SER D 4 14  ? 33.793  48.136  9.417   1.00 77.89  ? 14  SER A CA  1 
ATOM   5269  C C   . SER D 4 14  ? 34.409  46.820  9.836   1.00 79.73  ? 14  SER A C   1 
ATOM   5270  O O   . SER D 4 14  ? 33.764  46.007  10.494  1.00 79.81  ? 14  SER A O   1 
ATOM   5271  C CB  . SER D 4 14  ? 34.483  49.289  10.142  1.00 84.92  ? 14  SER A CB  1 
ATOM   5272  O OG  . SER D 4 14  ? 35.885  49.274  9.916   1.00 84.43  ? 14  SER A OG  1 
ATOM   5273  N N   . LEU D 4 15  ? 35.724  46.640  9.530   1.00 82.46  ? 15  LEU A N   1 
ATOM   5274  C CA  . LEU D 4 15  ? 36.575  45.432  9.745   1.00 77.28  ? 15  LEU A CA  1 
ATOM   5275  C C   . LEU D 4 15  ? 36.390  44.960  11.141  1.00 78.06  ? 15  LEU A C   1 
ATOM   5276  O O   . LEU D 4 15  ? 36.257  43.799  11.412  1.00 85.60  ? 15  LEU A O   1 
ATOM   5277  C CB  . LEU D 4 15  ? 38.037  45.586  9.395   1.00 81.95  ? 15  LEU A CB  1 
ATOM   5278  C CG  . LEU D 4 15  ? 38.839  46.206  10.516  1.00 83.50  ? 15  LEU A CG  1 
ATOM   5279  C CD1 . LEU D 4 15  ? 39.959  45.334  10.983  1.00 84.93  ? 15  LEU A CD1 1 
ATOM   5280  C CD2 . LEU D 4 15  ? 39.315  47.612  10.188  1.00 78.88  ? 15  LEU A CD2 1 
ATOM   5281  N N   . GLY D 4 16  ? 36.427  45.872  12.073  1.00 83.39  ? 16  GLY A N   1 
ATOM   5282  C CA  . GLY D 4 16  ? 36.611  45.502  13.461  1.00 84.05  ? 16  GLY A CA  1 
ATOM   5283  C C   . GLY D 4 16  ? 35.327  45.068  14.111  1.00 78.84  ? 16  GLY A C   1 
ATOM   5284  O O   . GLY D 4 16  ? 35.196  43.931  14.561  1.00 75.60  ? 16  GLY A O   1 
ATOM   5285  N N   . GLN D 4 17  ? 34.375  45.992  14.122  1.00 80.69  ? 17  GLN A N   1 
ATOM   5286  C CA  . GLN D 4 17  ? 33.151  45.896  14.913  1.00 87.04  ? 17  GLN A CA  1 
ATOM   5287  C C   . GLN D 4 17  ? 32.540  44.495  15.086  1.00 81.77  ? 17  GLN A C   1 
ATOM   5288  O O   . GLN D 4 17  ? 32.963  43.520  14.462  1.00 76.28  ? 17  GLN A O   1 
ATOM   5289  C CB  . GLN D 4 17  ? 32.099  46.845  14.322  1.00 88.18  ? 17  GLN A CB  1 
ATOM   5290  C CG  . GLN D 4 17  ? 32.678  48.145  13.754  1.00 89.95  ? 17  GLN A CG  1 
ATOM   5291  C CD  . GLN D 4 17  ? 31.621  49.027  13.077  1.00 96.57  ? 17  GLN A CD  1 
ATOM   5292  O OE1 . GLN D 4 17  ? 31.850  49.562  11.989  1.00 89.71  ? 17  GLN A OE1 1 
ATOM   5293  N NE2 . GLN D 4 17  ? 30.461  49.179  13.721  1.00 104.13 ? 17  GLN A NE2 1 
ATOM   5294  N N   . ARG D 4 18  ? 31.540  44.411  15.958  1.00 84.10  ? 18  ARG A N   1 
ATOM   5295  C CA  . ARG D 4 18  ? 30.652  43.254  15.975  1.00 83.77  ? 18  ARG A CA  1 
ATOM   5296  C C   . ARG D 4 18  ? 29.478  43.479  14.993  1.00 83.29  ? 18  ARG A C   1 
ATOM   5297  O O   . ARG D 4 18  ? 29.093  44.616  14.680  1.00 81.41  ? 18  ARG A O   1 
ATOM   5298  C CB  . ARG D 4 18  ? 30.157  42.940  17.396  1.00 78.34  ? 18  ARG A CB  1 
ATOM   5299  C CG  . ARG D 4 18  ? 28.784  43.502  17.716  1.00 76.69  ? 18  ARG A CG  1 
ATOM   5300  C CD  . ARG D 4 18  ? 28.524  43.533  19.211  1.00 87.00  ? 18  ARG A CD  1 
ATOM   5301  N NE  . ARG D 4 18  ? 28.538  42.198  19.812  1.00 99.75  ? 18  ARG A NE  1 
ATOM   5302  C CZ  . ARG D 4 18  ? 29.385  41.801  20.763  1.00 99.09  ? 18  ARG A CZ  1 
ATOM   5303  N NH1 . ARG D 4 18  ? 30.301  42.636  21.242  1.00 93.48  ? 18  ARG A NH1 1 
ATOM   5304  N NH2 . ARG D 4 18  ? 29.310  40.564  21.248  1.00 91.47  ? 18  ARG A NH2 1 
ATOM   5305  N N   . ALA D 4 19  ? 28.929  42.386  14.490  1.00 79.14  ? 19  ALA A N   1 
ATOM   5306  C CA  . ALA D 4 19  ? 27.861  42.462  13.522  1.00 74.32  ? 19  ALA A CA  1 
ATOM   5307  C C   . ALA D 4 19  ? 26.694  41.684  14.088  1.00 73.58  ? 19  ALA A C   1 
ATOM   5308  O O   . ALA D 4 19  ? 26.892  40.566  14.555  1.00 74.88  ? 19  ALA A O   1 
ATOM   5309  C CB  . ALA D 4 19  ? 28.323  41.839  12.238  1.00 78.90  ? 19  ALA A CB  1 
ATOM   5310  N N   . THR D 4 20  ? 25.487  42.253  14.069  1.00 67.35  ? 20  THR A N   1 
ATOM   5311  C CA  . THR D 4 20  ? 24.316  41.504  14.537  1.00 68.48  ? 20  THR A CA  1 
ATOM   5312  C C   . THR D 4 20  ? 23.117  41.513  13.586  1.00 72.17  ? 20  THR A C   1 
ATOM   5313  O O   . THR D 4 20  ? 22.878  42.499  12.886  1.00 76.53  ? 20  THR A O   1 
ATOM   5314  C CB  . THR D 4 20  ? 23.843  41.961  15.928  1.00 72.09  ? 20  THR A CB  1 
ATOM   5315  O OG1 . THR D 4 20  ? 24.807  41.579  16.916  1.00 80.97  ? 20  THR A OG1 1 
ATOM   5316  C CG2 . THR D 4 20  ? 22.520  41.308  16.279  1.00 68.19  ? 20  THR A CG2 1 
ATOM   5317  N N   . ILE D 4 21  ? 22.380  40.398  13.584  1.00 68.64  ? 21  ILE A N   1 
ATOM   5318  C CA  . ILE D 4 21  ? 21.155  40.185  12.809  1.00 67.14  ? 21  ILE A CA  1 
ATOM   5319  C C   . ILE D 4 21  ? 20.155  39.565  13.766  1.00 71.12  ? 21  ILE A C   1 
ATOM   5320  O O   . ILE D 4 21  ? 20.567  38.869  14.686  1.00 74.61  ? 21  ILE A O   1 
ATOM   5321  C CB  . ILE D 4 21  ? 21.383  39.115  11.720  1.00 66.49  ? 21  ILE A CB  1 
ATOM   5322  C CG1 . ILE D 4 21  ? 22.399  39.581  10.678  1.00 66.22  ? 21  ILE A CG1 1 
ATOM   5323  C CG2 . ILE D 4 21  ? 20.066  38.692  11.074  1.00 69.92  ? 21  ILE A CG2 1 
ATOM   5324  C CD1 . ILE D 4 21  ? 23.827  39.329  11.064  1.00 62.25  ? 21  ILE A CD1 1 
ATOM   5325  N N   . SER D 4 22  ? 18.855  39.761  13.574  1.00 69.15  ? 22  SER A N   1 
ATOM   5326  C CA  . SER D 4 22  ? 17.910  39.006  14.405  1.00 69.41  ? 22  SER A CA  1 
ATOM   5327  C C   . SER D 4 22  ? 16.686  38.506  13.644  1.00 72.86  ? 22  SER A C   1 
ATOM   5328  O O   . SER D 4 22  ? 16.172  39.195  12.760  1.00 74.96  ? 22  SER A O   1 
ATOM   5329  C CB  . SER D 4 22  ? 17.500  39.804  15.637  1.00 69.66  ? 22  SER A CB  1 
ATOM   5330  O OG  . SER D 4 22  ? 16.999  41.063  15.249  1.00 83.20  ? 22  SER A OG  1 
ATOM   5331  N N   . CYS D 4 23  ? 16.222  37.309  14.007  1.00 72.90  ? 23  CYS A N   1 
ATOM   5332  C CA  . CYS D 4 23  ? 15.186  36.602  13.261  1.00 67.79  ? 23  CYS A CA  1 
ATOM   5333  C C   . CYS D 4 23  ? 13.970  36.296  14.095  1.00 64.85  ? 23  CYS A C   1 
ATOM   5334  O O   . CYS D 4 23  ? 13.864  35.211  14.636  1.00 70.10  ? 23  CYS A O   1 
ATOM   5335  C CB  . CYS D 4 23  ? 15.739  35.277  12.748  1.00 73.73  ? 23  CYS A CB  1 
ATOM   5336  S SG  . CYS D 4 23  ? 14.676  34.397  11.561  1.00 88.65  ? 23  CYS A SG  1 
ATOM   5337  N N   . ARG D 4 24  ? 13.045  37.244  14.171  1.00 66.99  ? 24  ARG A N   1 
ATOM   5338  C CA  . ARG D 4 24  ? 11.794  37.088  14.924  1.00 73.08  ? 24  ARG A CA  1 
ATOM   5339  C C   . ARG D 4 24  ? 10.824  36.047  14.324  1.00 78.05  ? 24  ARG A C   1 
ATOM   5340  O O   . ARG D 4 24  ? 10.544  36.051  13.123  1.00 79.03  ? 24  ARG A O   1 
ATOM   5341  C CB  . ARG D 4 24  ? 11.106  38.445  15.026  1.00 77.57  ? 24  ARG A CB  1 
ATOM   5342  C CG  . ARG D 4 24  ? 9.893   38.508  15.927  1.00 83.38  ? 24  ARG A CG  1 
ATOM   5343  C CD  . ARG D 4 24  ? 9.446   39.958  16.038  1.00 87.71  ? 24  ARG A CD  1 
ATOM   5344  N NE  . ARG D 4 24  ? 8.395   40.157  17.026  1.00 88.75  ? 24  ARG A NE  1 
ATOM   5345  C CZ  . ARG D 4 24  ? 7.802   41.324  17.241  1.00 87.49  ? 24  ARG A CZ  1 
ATOM   5346  N NH1 . ARG D 4 24  ? 6.848   41.428  18.151  1.00 87.42  ? 24  ARG A NH1 1 
ATOM   5347  N NH2 . ARG D 4 24  ? 8.159   42.389  16.534  1.00 88.51  ? 24  ARG A NH2 1 
ATOM   5348  N N   . ALA D 4 25  ? 10.295  35.170  15.171  1.00 76.74  ? 25  ALA A N   1 
ATOM   5349  C CA  . ALA D 4 25  ? 9.555   34.007  14.697  1.00 76.06  ? 25  ALA A CA  1 
ATOM   5350  C C   . ALA D 4 25  ? 8.064   34.264  14.581  1.00 81.02  ? 25  ALA A C   1 
ATOM   5351  O O   . ALA D 4 25  ? 7.549   35.210  15.171  1.00 83.96  ? 25  ALA A O   1 
ATOM   5352  C CB  . ALA D 4 25  ? 9.807   32.835  15.599  1.00 80.54  ? 25  ALA A CB  1 
ATOM   5353  N N   . SER D 4 26  ? 7.388   33.388  13.833  1.00 87.23  ? 26  SER A N   1 
ATOM   5354  C CA  . SER D 4 26  ? 5.950   33.482  13.508  1.00 89.85  ? 26  SER A CA  1 
ATOM   5355  C C   . SER D 4 26  ? 5.053   32.816  14.563  1.00 88.79  ? 26  SER A C   1 
ATOM   5356  O O   . SER D 4 26  ? 3.829   32.992  14.565  1.00 80.14  ? 26  SER A O   1 
ATOM   5357  C CB  . SER D 4 26  ? 5.686   32.840  12.135  1.00 88.78  ? 26  SER A CB  1 
ATOM   5358  O OG  . SER D 4 26  ? 6.645   33.278  11.182  1.00 83.61  ? 26  SER A OG  1 
ATOM   5359  N N   . GLU D 4 27  ? 5.697   32.035  15.431  1.00 88.76  ? 27  GLU A N   1 
ATOM   5360  C CA  . GLU D 4 27  ? 5.109   31.410  16.619  1.00 87.37  ? 27  GLU A CA  1 
ATOM   5361  C C   . GLU D 4 27  ? 6.193   30.488  17.158  1.00 86.12  ? 27  GLU A C   1 
ATOM   5362  O O   . GLU D 4 27  ? 7.315   30.521  16.660  1.00 84.14  ? 27  GLU A O   1 
ATOM   5363  C CB  . GLU D 4 27  ? 3.813   30.657  16.323  1.00 86.53  ? 27  GLU A CB  1 
ATOM   5364  C CG  . GLU D 4 27  ? 3.982   29.271  15.775  1.00 87.52  ? 27  GLU A CG  1 
ATOM   5365  C CD  . GLU D 4 27  ? 2.715   28.462  15.923  1.00 97.50  ? 27  GLU A CD  1 
ATOM   5366  O OE1 . GLU D 4 27  ? 2.402   28.067  17.067  1.00 91.77  ? 27  GLU A OE1 1 
ATOM   5367  O OE2 . GLU D 4 27  ? 2.035   28.220  14.900  1.00 107.43 ? 27  GLU A OE2 1 
ATOM   5368  N N   . SER D 4 28  A 5.895   29.675  18.166  1.00 88.33  ? 27  SER A N   1 
ATOM   5369  C CA  . SER D 4 28  A 6.985   28.973  18.850  1.00 87.95  ? 27  SER A CA  1 
ATOM   5370  C C   . SER D 4 28  A 7.472   27.706  18.158  1.00 81.58  ? 27  SER A C   1 
ATOM   5371  O O   . SER D 4 28  A 6.715   27.010  17.476  1.00 76.02  ? 27  SER A O   1 
ATOM   5372  C CB  . SER D 4 28  A 6.668   28.687  20.320  1.00 89.30  ? 27  SER A CB  1 
ATOM   5373  O OG  . SER D 4 28  A 7.825   28.186  20.974  1.00 83.90  ? 27  SER A OG  1 
ATOM   5374  N N   . ILE D 4 29  B 8.754   27.423  18.361  1.00 80.78  ? 27  ILE A N   1 
ATOM   5375  C CA  . ILE D 4 29  B 9.419   26.321  17.687  1.00 81.41  ? 27  ILE A CA  1 
ATOM   5376  C C   . ILE D 4 29  B 10.088  25.391  18.734  1.00 77.85  ? 27  ILE A C   1 
ATOM   5377  O O   . ILE D 4 29  B 10.530  24.273  18.438  1.00 71.73  ? 27  ILE A O   1 
ATOM   5378  C CB  . ILE D 4 29  B 10.373  26.864  16.583  1.00 74.85  ? 27  ILE A CB  1 
ATOM   5379  C CG1 . ILE D 4 29  B 11.819  26.502  16.878  1.00 77.67  ? 27  ILE A CG1 1 
ATOM   5380  C CG2 . ILE D 4 29  B 10.214  28.370  16.414  1.00 68.41  ? 27  ILE A CG2 1 
ATOM   5381  C CD1 . ILE D 4 29  B 12.138  25.091  16.516  1.00 75.88  ? 27  ILE A CD1 1 
ATOM   5382  N N   . ASP D 4 30  C 10.123  25.861  19.974  1.00 77.98  ? 27  ASP A N   1 
ATOM   5383  C CA  . ASP D 4 30  C 10.443  25.009  21.110  1.00 73.86  ? 27  ASP A CA  1 
ATOM   5384  C C   . ASP D 4 30  C 9.556   23.768  21.061  1.00 69.79  ? 27  ASP A C   1 
ATOM   5385  O O   . ASP D 4 30  C 8.337   23.858  21.005  1.00 74.17  ? 27  ASP A O   1 
ATOM   5386  C CB  . ASP D 4 30  C 10.230  25.801  22.416  1.00 80.95  ? 27  ASP A CB  1 
ATOM   5387  C CG  . ASP D 4 30  C 10.498  24.981  23.680  1.00 79.41  ? 27  ASP A CG  1 
ATOM   5388  O OD1 . ASP D 4 30  C 10.610  23.741  23.580  1.00 77.07  ? 27  ASP A OD1 1 
ATOM   5389  O OD2 . ASP D 4 30  C 10.576  25.590  24.779  1.00 77.41  ? 27  ASP A OD2 1 
ATOM   5390  N N   . LEU D 4 31  D 10.178  22.604  21.045  1.00 69.66  ? 27  LEU A N   1 
ATOM   5391  C CA  . LEU D 4 31  D 9.456   21.357  21.190  1.00 72.21  ? 27  LEU A CA  1 
ATOM   5392  C C   . LEU D 4 31  D 9.949   20.664  22.456  1.00 67.03  ? 27  LEU A C   1 
ATOM   5393  O O   . LEU D 4 31  D 10.864  19.852  22.393  1.00 65.55  ? 27  LEU A O   1 
ATOM   5394  C CB  . LEU D 4 31  D 9.693   20.457  19.966  1.00 72.23  ? 27  LEU A CB  1 
ATOM   5395  C CG  . LEU D 4 31  D 9.214   18.992  20.033  1.00 71.42  ? 27  LEU A CG  1 
ATOM   5396  C CD1 . LEU D 4 31  D 7.704   18.876  19.901  1.00 70.33  ? 27  LEU A CD1 1 
ATOM   5397  C CD2 . LEU D 4 31  D 9.891   18.138  18.977  1.00 69.70  ? 27  LEU A CD2 1 
ATOM   5398  N N   . TYR D 4 32  ? 9.360   20.982  23.604  1.00 65.93  ? 28  TYR A N   1 
ATOM   5399  C CA  . TYR D 4 32  ? 9.822   20.396  24.862  1.00 69.06  ? 28  TYR A CA  1 
ATOM   5400  C C   . TYR D 4 32  ? 11.283  20.679  25.109  1.00 66.58  ? 28  TYR A C   1 
ATOM   5401  O O   . TYR D 4 32  ? 12.050  19.742  25.322  1.00 60.02  ? 28  TYR A O   1 
ATOM   5402  C CB  . TYR D 4 32  ? 9.721   18.874  24.857  1.00 67.53  ? 28  TYR A CB  1 
ATOM   5403  C CG  . TYR D 4 32  ? 8.395   18.286  24.460  1.00 71.69  ? 28  TYR A CG  1 
ATOM   5404  C CD1 . TYR D 4 32  ? 8.340   17.233  23.559  1.00 67.36  ? 28  TYR A CD1 1 
ATOM   5405  C CD2 . TYR D 4 32  ? 7.205   18.760  24.999  1.00 73.46  ? 28  TYR A CD2 1 
ATOM   5406  C CE1 . TYR D 4 32  ? 7.154   16.681  23.200  1.00 65.20  ? 28  TYR A CE1 1 
ATOM   5407  C CE2 . TYR D 4 32  ? 6.008   18.210  24.645  1.00 69.97  ? 28  TYR A CE2 1 
ATOM   5408  C CZ  . TYR D 4 32  ? 5.988   17.171  23.744  1.00 71.02  ? 28  TYR A CZ  1 
ATOM   5409  O OH  . TYR D 4 32  ? 4.790   16.611  23.376  1.00 81.88  ? 28  TYR A OH  1 
ATOM   5410  N N   . GLY D 4 33  ? 11.675  21.946  25.058  1.00 66.51  ? 29  GLY A N   1 
ATOM   5411  C CA  . GLY D 4 33  ? 13.031  22.339  25.395  1.00 73.05  ? 29  GLY A CA  1 
ATOM   5412  C C   . GLY D 4 33  ? 14.085  22.246  24.300  1.00 71.36  ? 29  GLY A C   1 
ATOM   5413  O O   . GLY D 4 33  ? 15.250  22.618  24.487  1.00 73.85  ? 29  GLY A O   1 
ATOM   5414  N N   . PHE D 4 34  ? 13.695  21.723  23.153  1.00 65.64  ? 30  PHE A N   1 
ATOM   5415  C CA  . PHE D 4 34  ? 14.558  21.800  22.006  1.00 62.45  ? 30  PHE A CA  1 
ATOM   5416  C C   . PHE D 4 34  ? 14.003  22.891  21.128  1.00 66.25  ? 30  PHE A C   1 
ATOM   5417  O O   . PHE D 4 34  ? 12.799  23.061  21.033  1.00 72.59  ? 30  PHE A O   1 
ATOM   5418  C CB  . PHE D 4 34  ? 14.522  20.501  21.253  1.00 62.38  ? 30  PHE A CB  1 
ATOM   5419  C CG  . PHE D 4 34  ? 15.120  19.347  21.992  1.00 61.00  ? 30  PHE A CG  1 
ATOM   5420  C CD1 . PHE D 4 34  ? 14.380  18.635  22.903  1.00 60.90  ? 30  PHE A CD1 1 
ATOM   5421  C CD2 . PHE D 4 34  ? 16.414  18.937  21.722  1.00 61.61  ? 30  PHE A CD2 1 
ATOM   5422  C CE1 . PHE D 4 34  ? 14.928  17.556  23.545  1.00 62.24  ? 30  PHE A CE1 1 
ATOM   5423  C CE2 . PHE D 4 34  ? 16.962  17.858  22.360  1.00 55.10  ? 30  PHE A CE2 1 
ATOM   5424  C CZ  . PHE D 4 34  ? 16.222  17.168  23.272  1.00 57.44  ? 30  PHE A CZ  1 
ATOM   5425  N N   . THR D 4 35  ? 14.863  23.659  20.491  1.00 67.46  ? 31  THR A N   1 
ATOM   5426  C CA  . THR D 4 35  ? 14.354  24.705  19.618  1.00 70.25  ? 31  THR A CA  1 
ATOM   5427  C C   . THR D 4 35  ? 15.179  24.688  18.351  1.00 70.39  ? 31  THR A C   1 
ATOM   5428  O O   . THR D 4 35  ? 16.359  25.051  18.333  1.00 70.51  ? 31  THR A O   1 
ATOM   5429  C CB  . THR D 4 35  ? 14.368  26.115  20.263  1.00 72.36  ? 31  THR A CB  1 
ATOM   5430  O OG1 . THR D 4 35  ? 15.719  26.531  20.461  1.00 79.60  ? 31  THR A OG1 1 
ATOM   5431  C CG2 . THR D 4 35  ? 13.635  26.146  21.616  1.00 71.40  ? 31  THR A CG2 1 
ATOM   5432  N N   . PHE D 4 36  ? 14.539  24.235  17.291  1.00 68.81  ? 32  PHE A N   1 
ATOM   5433  C CA  . PHE D 4 36  ? 15.202  24.024  16.022  1.00 67.31  ? 32  PHE A CA  1 
ATOM   5434  C C   . PHE D 4 36  ? 15.341  25.316  15.197  1.00 67.39  ? 32  PHE A C   1 
ATOM   5435  O O   . PHE D 4 36  ? 14.715  25.467  14.148  1.00 63.09  ? 32  PHE A O   1 
ATOM   5436  C CB  . PHE D 4 36  ? 14.445  22.952  15.237  1.00 62.21  ? 32  PHE A CB  1 
ATOM   5437  C CG  . PHE D 4 36  ? 14.206  21.673  16.014  1.00 63.55  ? 32  PHE A CG  1 
ATOM   5438  C CD1 . PHE D 4 36  ? 13.260  21.624  17.022  1.00 61.95  ? 32  PHE A CD1 1 
ATOM   5439  C CD2 . PHE D 4 36  ? 14.912  20.509  15.708  1.00 60.80  ? 32  PHE A CD2 1 
ATOM   5440  C CE1 . PHE D 4 36  ? 13.037  20.446  17.715  1.00 62.29  ? 32  PHE A CE1 1 
ATOM   5441  C CE2 . PHE D 4 36  ? 14.692  19.337  16.401  1.00 51.33  ? 32  PHE A CE2 1 
ATOM   5442  C CZ  . PHE D 4 36  ? 13.756  19.304  17.402  1.00 52.21  ? 32  PHE A CZ  1 
ATOM   5443  N N   . MET D 4 37  ? 16.164  26.244  15.677  1.00 69.46  ? 33  MET A N   1 
ATOM   5444  C CA  . MET D 4 37  ? 16.567  27.390  14.875  1.00 62.70  ? 33  MET A CA  1 
ATOM   5445  C C   . MET D 4 37  ? 17.844  27.006  14.184  1.00 62.12  ? 33  MET A C   1 
ATOM   5446  O O   . MET D 4 37  ? 18.643  26.265  14.736  1.00 63.46  ? 33  MET A O   1 
ATOM   5447  C CB  . MET D 4 37  ? 16.853  28.591  15.766  1.00 67.35  ? 33  MET A CB  1 
ATOM   5448  C CG  . MET D 4 37  ? 17.167  29.869  15.016  1.00 65.82  ? 33  MET A CG  1 
ATOM   5449  S SD  . MET D 4 37  ? 16.032  30.176  13.637  1.00 78.15  ? 33  MET A SD  1 
ATOM   5450  C CE  . MET D 4 37  ? 14.411  30.103  14.422  1.00 66.90  ? 33  MET A CE  1 
ATOM   5451  N N   . HIS D 4 38  ? 18.071  27.513  12.989  1.00 57.54  ? 34  HIS A N   1 
ATOM   5452  C CA  . HIS D 4 38  ? 19.358  27.267  12.388  1.00 57.83  ? 34  HIS A CA  1 
ATOM   5453  C C   . HIS D 4 38  ? 19.800  28.407  11.468  1.00 60.01  ? 34  HIS A C   1 
ATOM   5454  O O   . HIS D 4 38  ? 19.011  28.918  10.658  1.00 54.54  ? 34  HIS A O   1 
ATOM   5455  C CB  . HIS D 4 38  ? 19.341  25.924  11.671  1.00 59.54  ? 34  HIS A CB  1 
ATOM   5456  C CG  . HIS D 4 38  ? 18.719  24.816  12.469  1.00 60.65  ? 34  HIS A CG  1 
ATOM   5457  N ND1 . HIS D 4 38  ? 17.500  24.259  12.145  1.00 60.50  ? 34  HIS A ND1 1 
ATOM   5458  C CD2 . HIS D 4 38  ? 19.151  24.154  13.566  1.00 61.96  ? 34  HIS A CD2 1 
ATOM   5459  C CE1 . HIS D 4 38  ? 17.211  23.300  13.007  1.00 59.23  ? 34  HIS A CE1 1 
ATOM   5460  N NE2 . HIS D 4 38  ? 18.196  23.221  13.883  1.00 61.43  ? 34  HIS A NE2 1 
ATOM   5461  N N   . TRP D 4 39  ? 21.066  28.809  11.611  1.00 60.55  ? 35  TRP A N   1 
ATOM   5462  C CA  . TRP D 4 39  ? 21.630  29.898  10.809  1.00 60.35  ? 35  TRP A CA  1 
ATOM   5463  C C   . TRP D 4 39  ? 22.611  29.395  9.727   1.00 59.75  ? 35  TRP A C   1 
ATOM   5464  O O   . TRP D 4 39  ? 23.589  28.712  10.055  1.00 57.93  ? 35  TRP A O   1 
ATOM   5465  C CB  . TRP D 4 39  ? 22.321  30.918  11.720  1.00 61.93  ? 35  TRP A CB  1 
ATOM   5466  C CG  . TRP D 4 39  ? 21.407  31.609  12.684  1.00 59.56  ? 35  TRP A CG  1 
ATOM   5467  C CD1 . TRP D 4 39  ? 21.110  31.218  13.948  1.00 63.33  ? 35  TRP A CD1 1 
ATOM   5468  C CD2 . TRP D 4 39  ? 20.679  32.818  12.456  1.00 57.19  ? 35  TRP A CD2 1 
ATOM   5469  N NE1 . TRP D 4 39  ? 20.229  32.103  14.523  1.00 65.85  ? 35  TRP A NE1 1 
ATOM   5470  C CE2 . TRP D 4 39  ? 19.955  33.097  13.623  1.00 60.96  ? 35  TRP A CE2 1 
ATOM   5471  C CE3 . TRP D 4 39  ? 20.560  33.682  11.371  1.00 61.09  ? 35  TRP A CE3 1 
ATOM   5472  C CZ2 . TRP D 4 39  ? 19.128  34.201  13.736  1.00 67.38  ? 35  TRP A CZ2 1 
ATOM   5473  C CZ3 . TRP D 4 39  ? 19.738  34.776  11.481  1.00 61.59  ? 35  TRP A CZ3 1 
ATOM   5474  C CH2 . TRP D 4 39  ? 19.034  35.029  12.653  1.00 68.15  ? 35  TRP A CH2 1 
ATOM   5475  N N   . TYR D 4 40  ? 22.336  29.747  8.458   1.00 58.27  ? 36  TYR A N   1 
ATOM   5476  C CA  . TYR D 4 40  ? 23.097  29.303  7.276   1.00 53.22  ? 36  TYR A CA  1 
ATOM   5477  C C   . TYR D 4 40  ? 23.746  30.478  6.561   1.00 54.91  ? 36  TYR A C   1 
ATOM   5478  O O   . TYR D 4 40  ? 23.102  31.514  6.383   1.00 54.01  ? 36  TYR A O   1 
ATOM   5479  C CB  . TYR D 4 40  ? 22.172  28.630  6.248   1.00 54.41  ? 36  TYR A CB  1 
ATOM   5480  C CG  . TYR D 4 40  ? 21.448  27.380  6.704   1.00 53.20  ? 36  TYR A CG  1 
ATOM   5481  C CD1 . TYR D 4 40  ? 22.106  26.161  6.777   1.00 51.52  ? 36  TYR A CD1 1 
ATOM   5482  C CD2 . TYR D 4 40  ? 20.098  27.420  7.035   1.00 50.62  ? 36  TYR A CD2 1 
ATOM   5483  C CE1 . TYR D 4 40  ? 21.444  25.032  7.191   1.00 52.63  ? 36  TYR A CE1 1 
ATOM   5484  C CE2 . TYR D 4 40  ? 19.433  26.308  7.447   1.00 45.86  ? 36  TYR A CE2 1 
ATOM   5485  C CZ  . TYR D 4 40  ? 20.102  25.116  7.526   1.00 51.28  ? 36  TYR A CZ  1 
ATOM   5486  O OH  . TYR D 4 40  ? 19.424  23.991  7.937   1.00 55.42  ? 36  TYR A OH  1 
ATOM   5487  N N   . GLN D 4 41  ? 24.994  30.308  6.109   1.00 59.19  ? 37  GLN A N   1 
ATOM   5488  C CA  . GLN D 4 41  ? 25.705  31.363  5.353   1.00 61.83  ? 37  GLN A CA  1 
ATOM   5489  C C   . GLN D 4 41  ? 25.810  31.121  3.849   1.00 64.27  ? 37  GLN A C   1 
ATOM   5490  O O   . GLN D 4 41  ? 26.424  30.143  3.411   1.00 69.15  ? 37  GLN A O   1 
ATOM   5491  C CB  . GLN D 4 41  ? 27.132  31.571  5.862   1.00 58.03  ? 37  GLN A CB  1 
ATOM   5492  C CG  . GLN D 4 41  ? 28.044  32.154  4.776   1.00 56.33  ? 37  GLN A CG  1 
ATOM   5493  C CD  . GLN D 4 41  ? 29.434  32.463  5.256   1.00 54.53  ? 37  GLN A CD  1 
ATOM   5494  O OE1 . GLN D 4 41  ? 30.343  31.647  5.108   1.00 53.60  ? 37  GLN A OE1 1 
ATOM   5495  N NE2 . GLN D 4 41  ? 29.615  33.649  5.836   1.00 53.91  ? 37  GLN A NE2 1 
ATOM   5496  N N   . GLN D 4 42  ? 25.258  32.031  3.056   1.00 59.45  ? 38  GLN A N   1 
ATOM   5497  C CA  . GLN D 4 42  ? 25.395  31.925  1.610   1.00 65.44  ? 38  GLN A CA  1 
ATOM   5498  C C   . GLN D 4 42  ? 26.331  32.989  1.035   1.00 69.32  ? 38  GLN A C   1 
ATOM   5499  O O   . GLN D 4 42  ? 26.010  34.181  1.036   1.00 70.21  ? 38  GLN A O   1 
ATOM   5500  C CB  . GLN D 4 42  ? 24.015  31.979  0.930   1.00 75.63  ? 38  GLN A CB  1 
ATOM   5501  C CG  . GLN D 4 42  ? 24.051  32.283  -0.582  1.00 78.75  ? 38  GLN A CG  1 
ATOM   5502  C CD  . GLN D 4 42  ? 22.923  31.614  -1.354  1.00 72.89  ? 38  GLN A CD  1 
ATOM   5503  O OE1 . GLN D 4 42  ? 23.152  30.638  -2.089  1.00 62.20  ? 38  GLN A OE1 1 
ATOM   5504  N NE2 . GLN D 4 42  ? 21.697  32.135  -1.191  1.00 66.13  ? 38  GLN A NE2 1 
ATOM   5505  N N   . LYS D 4 43  ? 27.487  32.550  0.546   1.00 69.23  ? 39  LYS A N   1 
ATOM   5506  C CA  . LYS D 4 43  ? 28.400  33.434  -0.166  1.00 71.11  ? 39  LYS A CA  1 
ATOM   5507  C C   . LYS D 4 43  ? 27.727  33.995  -1.451  1.00 78.80  ? 39  LYS A C   1 
ATOM   5508  O O   . LYS D 4 43  ? 26.556  34.378  -1.398  1.00 78.73  ? 39  LYS A O   1 
ATOM   5509  C CB  . LYS D 4 43  ? 29.709  32.698  -0.416  1.00 75.81  ? 39  LYS A CB  1 
ATOM   5510  C CG  . LYS D 4 43  ? 30.445  32.348  0.866   1.00 70.03  ? 39  LYS A CG  1 
ATOM   5511  C CD  . LYS D 4 43  ? 30.905  33.612  1.582   1.00 70.49  ? 39  LYS A CD  1 
ATOM   5512  C CE  . LYS D 4 43  ? 31.718  34.530  0.661   1.00 77.32  ? 39  LYS A CE  1 
ATOM   5513  N NZ  . LYS D 4 43  ? 32.406  35.637  1.393   1.00 73.41  ? 39  LYS A NZ  1 
ATOM   5514  N N   . PRO D 4 44  ? 28.444  34.093  -2.594  1.00 80.67  ? 40  PRO A N   1 
ATOM   5515  C CA  . PRO D 4 44  ? 27.667  34.577  -3.745  1.00 78.47  ? 40  PRO A CA  1 
ATOM   5516  C C   . PRO D 4 44  ? 27.534  33.525  -4.851  1.00 81.45  ? 40  PRO A C   1 
ATOM   5517  O O   . PRO D 4 44  ? 26.439  33.318  -5.402  1.00 76.77  ? 40  PRO A O   1 
ATOM   5518  C CB  . PRO D 4 44  ? 28.513  35.749  -4.258  1.00 75.27  ? 40  PRO A CB  1 
ATOM   5519  C CG  . PRO D 4 44  ? 29.796  35.749  -3.386  1.00 79.57  ? 40  PRO A CG  1 
ATOM   5520  C CD  . PRO D 4 44  ? 29.868  34.387  -2.799  1.00 82.60  ? 40  PRO A CD  1 
ATOM   5521  N N   . GLY D 4 45  ? 28.654  32.880  -5.175  1.00 78.87  ? 41  GLY A N   1 
ATOM   5522  C CA  . GLY D 4 45  ? 28.678  31.790  -6.136  1.00 77.23  ? 41  GLY A CA  1 
ATOM   5523  C C   . GLY D 4 45  ? 28.667  30.443  -5.436  1.00 78.04  ? 41  GLY A C   1 
ATOM   5524  O O   . GLY D 4 45  ? 29.201  29.445  -5.933  1.00 72.18  ? 41  GLY A O   1 
ATOM   5525  N N   . GLN D 4 46  ? 28.026  30.418  -4.272  1.00 81.68  ? 42  GLN A N   1 
ATOM   5526  C CA  . GLN D 4 46  ? 28.043  29.245  -3.412  1.00 76.92  ? 42  GLN A CA  1 
ATOM   5527  C C   . GLN D 4 46  ? 26.651  28.715  -3.025  1.00 71.18  ? 42  GLN A C   1 
ATOM   5528  O O   . GLN D 4 46  ? 25.647  29.442  -3.080  1.00 69.02  ? 42  GLN A O   1 
ATOM   5529  C CB  . GLN D 4 46  ? 28.828  29.578  -2.139  1.00 80.67  ? 42  GLN A CB  1 
ATOM   5530  C CG  . GLN D 4 46  ? 30.194  30.213  -2.383  1.00 85.16  ? 42  GLN A CG  1 
ATOM   5531  C CD  . GLN D 4 46  ? 31.308  29.190  -2.541  1.00 91.14  ? 42  GLN A CD  1 
ATOM   5532  O OE1 . GLN D 4 46  ? 31.250  28.084  -1.986  1.00 87.14  ? 42  GLN A OE1 1 
ATOM   5533  N NE2 . GLN D 4 46  ? 32.342  29.564  -3.290  1.00 96.52  ? 42  GLN A NE2 1 
ATOM   5534  N N   . PRO D 4 47  ? 26.602  27.436  -2.619  1.00 68.62  ? 43  PRO A N   1 
ATOM   5535  C CA  . PRO D 4 47  ? 25.463  26.806  -1.945  1.00 65.31  ? 43  PRO A CA  1 
ATOM   5536  C C   . PRO D 4 47  ? 25.570  27.093  -0.455  1.00 66.74  ? 43  PRO A C   1 
ATOM   5537  O O   . PRO D 4 47  ? 26.672  26.979  0.071   1.00 71.43  ? 43  PRO A O   1 
ATOM   5538  C CB  . PRO D 4 47  ? 25.727  25.321  -2.172  1.00 64.32  ? 43  PRO A CB  1 
ATOM   5539  C CG  . PRO D 4 47  ? 27.207  25.210  -2.144  1.00 61.02  ? 43  PRO A CG  1 
ATOM   5540  C CD  . PRO D 4 47  ? 27.711  26.482  -2.815  1.00 69.05  ? 43  PRO A CD  1 
ATOM   5541  N N   . PRO D 4 48  ? 24.461  27.437  0.221   1.00 63.33  ? 44  PRO A N   1 
ATOM   5542  C CA  . PRO D 4 48  ? 24.506  27.806  1.639   1.00 60.45  ? 44  PRO A CA  1 
ATOM   5543  C C   . PRO D 4 48  ? 25.414  26.895  2.460   1.00 62.43  ? 44  PRO A C   1 
ATOM   5544  O O   . PRO D 4 48  ? 25.667  25.754  2.060   1.00 61.69  ? 44  PRO A O   1 
ATOM   5545  C CB  . PRO D 4 48  ? 23.060  27.618  2.085   1.00 58.21  ? 44  PRO A CB  1 
ATOM   5546  C CG  . PRO D 4 48  ? 22.264  27.877  0.886   1.00 59.19  ? 44  PRO A CG  1 
ATOM   5547  C CD  . PRO D 4 48  ? 23.078  27.365  -0.274  1.00 65.71  ? 44  PRO A CD  1 
ATOM   5548  N N   . LYS D 4 49  ? 25.906  27.401  3.590   1.00 63.09  ? 45  LYS A N   1 
ATOM   5549  C CA  . LYS D 4 49  ? 26.693  26.594  4.520   1.00 62.79  ? 45  LYS A CA  1 
ATOM   5550  C C   . LYS D 4 49  ? 26.071  26.664  5.921   1.00 58.12  ? 45  LYS A C   1 
ATOM   5551  O O   . LYS D 4 49  ? 25.288  27.577  6.207   1.00 53.23  ? 45  LYS A O   1 
ATOM   5552  C CB  . LYS D 4 49  ? 28.158  27.040  4.522   1.00 59.19  ? 45  LYS A CB  1 
ATOM   5553  C CG  . LYS D 4 49  ? 29.052  26.175  5.394   1.00 57.12  ? 45  LYS A CG  1 
ATOM   5554  C CD  . LYS D 4 49  ? 30.522  26.438  5.115   1.00 69.39  ? 45  LYS A CD  1 
ATOM   5555  C CE  . LYS D 4 49  ? 31.081  25.606  3.930   1.00 82.78  ? 45  LYS A CE  1 
ATOM   5556  N NZ  . LYS D 4 49  ? 30.684  26.043  2.545   1.00 71.35  ? 45  LYS A NZ  1 
ATOM   5557  N N   . ILE D 4 50  ? 26.396  25.700  6.783   1.00 54.93  ? 46  ILE A N   1 
ATOM   5558  C CA  . ILE D 4 50  ? 25.807  25.675  8.121   1.00 56.53  ? 46  ILE A CA  1 
ATOM   5559  C C   . ILE D 4 50  ? 26.717  26.266  9.185   1.00 56.96  ? 46  ILE A C   1 
ATOM   5560  O O   . ILE D 4 50  ? 27.913  26.007  9.193   1.00 59.32  ? 46  ILE A O   1 
ATOM   5561  C CB  . ILE D 4 50  ? 25.436  24.264  8.558   1.00 56.33  ? 46  ILE A CB  1 
ATOM   5562  C CG1 . ILE D 4 50  ? 24.819  24.300  9.969   1.00 54.72  ? 46  ILE A CG1 1 
ATOM   5563  C CG2 . ILE D 4 50  ? 26.661  23.362  8.465   1.00 52.02  ? 46  ILE A CG2 1 
ATOM   5564  C CD1 . ILE D 4 50  ? 23.470  25.025  10.077  1.00 49.09  ? 46  ILE A CD1 1 
ATOM   5565  N N   . LEU D 4 51  ? 26.120  27.046  10.084  1.00 59.39  ? 47  LEU A N   1 
ATOM   5566  C CA  . LEU D 4 51  ? 26.815  27.730  11.170  1.00 60.95  ? 47  LEU A CA  1 
ATOM   5567  C C   . LEU D 4 51  ? 26.388  27.251  12.542  1.00 66.47  ? 47  LEU A C   1 
ATOM   5568  O O   . LEU D 4 51  ? 27.162  26.670  13.307  1.00 71.31  ? 47  LEU A O   1 
ATOM   5569  C CB  . LEU D 4 51  ? 26.451  29.198  11.134  1.00 57.72  ? 47  LEU A CB  1 
ATOM   5570  C CG  . LEU D 4 51  ? 26.891  29.973  9.912   1.00 60.75  ? 47  LEU A CG  1 
ATOM   5571  C CD1 . LEU D 4 51  ? 26.654  31.446  10.169  1.00 61.13  ? 47  LEU A CD1 1 
ATOM   5572  C CD2 . LEU D 4 51  ? 28.358  29.690  9.628   1.00 64.68  ? 47  LEU A CD2 1 
ATOM   5573  N N   . ILE D 4 52  ? 25.131  27.550  12.842  1.00 66.68  ? 48  ILE A N   1 
ATOM   5574  C CA  . ILE D 4 52  ? 24.554  27.332  14.155  1.00 72.52  ? 48  ILE A CA  1 
ATOM   5575  C C   . ILE D 4 52  ? 23.176  26.645  14.061  1.00 74.83  ? 48  ILE A C   1 
ATOM   5576  O O   . ILE D 4 52  ? 22.325  27.031  13.234  1.00 67.21  ? 48  ILE A O   1 
ATOM   5577  C CB  . ILE D 4 52  ? 24.461  28.678  14.913  1.00 72.80  ? 48  ILE A CB  1 
ATOM   5578  C CG1 . ILE D 4 52  ? 25.870  29.170  15.256  1.00 74.81  ? 48  ILE A CG1 1 
ATOM   5579  C CG2 . ILE D 4 52  ? 23.579  28.566  16.153  1.00 75.48  ? 48  ILE A CG2 1 
ATOM   5580  C CD1 . ILE D 4 52  ? 25.907  30.545  15.907  1.00 77.58  ? 48  ILE A CD1 1 
ATOM   5581  N N   . TYR D 4 53  ? 22.988  25.617  14.899  1.00 75.29  ? 49  TYR A N   1 
ATOM   5582  C CA  . TYR D 4 53  ? 21.737  24.873  14.992  1.00 66.34  ? 49  TYR A CA  1 
ATOM   5583  C C   . TYR D 4 53  ? 21.189  24.867  16.402  1.00 73.91  ? 49  TYR A C   1 
ATOM   5584  O O   . TYR D 4 53  ? 21.913  24.576  17.356  1.00 78.38  ? 49  TYR A O   1 
ATOM   5585  C CB  . TYR D 4 53  ? 21.930  23.437  14.542  1.00 62.24  ? 49  TYR A CB  1 
ATOM   5586  C CG  . TYR D 4 53  ? 23.135  22.772  15.130  1.00 64.87  ? 49  TYR A CG  1 
ATOM   5587  C CD1 . TYR D 4 53  ? 24.269  22.554  14.368  1.00 69.12  ? 49  TYR A CD1 1 
ATOM   5588  C CD2 . TYR D 4 53  ? 23.139  22.344  16.441  1.00 74.93  ? 49  TYR A CD2 1 
ATOM   5589  C CE1 . TYR D 4 53  ? 25.379  21.934  14.898  1.00 77.47  ? 49  TYR A CE1 1 
ATOM   5590  C CE2 . TYR D 4 53  ? 24.245  21.718  16.988  1.00 83.41  ? 49  TYR A CE2 1 
ATOM   5591  C CZ  . TYR D 4 53  ? 25.366  21.515  16.216  1.00 85.60  ? 49  TYR A CZ  1 
ATOM   5592  O OH  . TYR D 4 53  ? 26.474  20.895  16.774  1.00 91.32  ? 49  TYR A OH  1 
ATOM   5593  N N   . ARG D 4 54  ? 19.894  25.162  16.515  1.00 77.69  ? 50  ARG A N   1 
ATOM   5594  C CA  . ARG D 4 54  ? 19.194  25.304  17.799  1.00 77.20  ? 50  ARG A CA  1 
ATOM   5595  C C   . ARG D 4 54  ? 19.689  26.526  18.582  1.00 80.59  ? 50  ARG A C   1 
ATOM   5596  O O   . ARG D 4 54  ? 19.443  26.651  19.777  1.00 84.40  ? 50  ARG A O   1 
ATOM   5597  C CB  . ARG D 4 54  ? 19.267  24.007  18.632  1.00 75.31  ? 50  ARG A CB  1 
ATOM   5598  C CG  . ARG D 4 54  ? 18.464  22.849  18.035  1.00 69.61  ? 50  ARG A CG  1 
ATOM   5599  C CD  . ARG D 4 54  ? 18.592  21.551  18.831  1.00 70.28  ? 50  ARG A CD  1 
ATOM   5600  N NE  . ARG D 4 54  ? 19.792  20.772  18.508  1.00 75.64  ? 50  ARG A NE  1 
ATOM   5601  C CZ  . ARG D 4 54  ? 20.035  20.202  17.324  1.00 72.42  ? 50  ARG A CZ  1 
ATOM   5602  N NH1 . ARG D 4 54  ? 21.152  19.493  17.128  1.00 69.22  ? 50  ARG A NH1 1 
ATOM   5603  N NH2 . ARG D 4 54  ? 19.169  20.342  16.327  1.00 60.41  ? 50  ARG A NH2 1 
ATOM   5604  N N   . ALA D 4 55  ? 20.391  27.417  17.881  1.00 83.49  ? 51  ALA A N   1 
ATOM   5605  C CA  . ALA D 4 55  ? 20.889  28.687  18.425  1.00 83.28  ? 51  ALA A CA  1 
ATOM   5606  C C   . ALA D 4 55  ? 22.032  28.542  19.439  1.00 85.92  ? 51  ALA A C   1 
ATOM   5607  O O   . ALA D 4 55  ? 22.892  29.411  19.545  1.00 79.17  ? 51  ALA A O   1 
ATOM   5608  C CB  . ALA D 4 55  ? 19.742  29.509  19.003  1.00 74.42  ? 51  ALA A CB  1 
ATOM   5609  N N   . SER D 4 56  ? 22.050  27.434  20.169  1.00 93.84  ? 52  SER A N   1 
ATOM   5610  C CA  . SER D 4 56  ? 23.029  27.236  21.243  1.00 103.56 ? 52  SER A CA  1 
ATOM   5611  C C   . SER D 4 56  ? 24.429  26.865  20.737  1.00 105.97 ? 52  SER A C   1 
ATOM   5612  O O   . SER D 4 56  ? 25.438  27.122  21.407  1.00 105.51 ? 52  SER A O   1 
ATOM   5613  C CB  . SER D 4 56  ? 22.529  26.162  22.227  1.00 108.33 ? 52  SER A CB  1 
ATOM   5614  O OG  . SER D 4 56  ? 23.473  25.891  23.258  1.00 114.30 ? 52  SER A OG  1 
ATOM   5615  N N   . ASN D 4 57  ? 24.497  26.256  19.561  1.00 99.37  ? 53  ASN A N   1 
ATOM   5616  C CA  . ASN D 4 57  ? 25.747  25.641  19.151  1.00 99.28  ? 53  ASN A CA  1 
ATOM   5617  C C   . ASN D 4 57  ? 26.227  26.084  17.783  1.00 97.26  ? 53  ASN A C   1 
ATOM   5618  O O   . ASN D 4 57  ? 25.591  26.906  17.128  1.00 93.44  ? 53  ASN A O   1 
ATOM   5619  C CB  . ASN D 4 57  ? 25.594  24.126  19.187  1.00 97.74  ? 53  ASN A CB  1 
ATOM   5620  C CG  . ASN D 4 57  ? 24.761  23.668  20.355  1.00 101.40 ? 53  ASN A CG  1 
ATOM   5621  O OD1 . ASN D 4 57  ? 25.281  23.440  21.451  1.00 110.65 ? 53  ASN A OD1 1 
ATOM   5622  N ND2 . ASN D 4 57  ? 23.453  23.558  20.141  1.00 93.88  ? 53  ASN A ND2 1 
ATOM   5623  N N   . LEU D 4 58  ? 27.360  25.528  17.367  1.00 97.38  ? 54  LEU A N   1 
ATOM   5624  C CA  . LEU D 4 58  ? 27.940  25.786  16.054  1.00 91.23  ? 54  LEU A CA  1 
ATOM   5625  C C   . LEU D 4 58  ? 28.525  24.470  15.538  1.00 89.54  ? 54  LEU A C   1 
ATOM   5626  O O   . LEU D 4 58  ? 29.049  23.681  16.328  1.00 94.16  ? 54  LEU A O   1 
ATOM   5627  C CB  . LEU D 4 58  ? 28.996  26.908  16.129  1.00 90.03  ? 54  LEU A CB  1 
ATOM   5628  C CG  . LEU D 4 58  ? 29.938  27.164  17.330  1.00 93.00  ? 54  LEU A CG  1 
ATOM   5629  C CD1 . LEU D 4 58  ? 29.517  26.469  18.637  1.00 90.81  ? 54  LEU A CD1 1 
ATOM   5630  C CD2 . LEU D 4 58  ? 31.400  26.834  16.993  1.00 92.76  ? 54  LEU A CD2 1 
ATOM   5631  N N   . GLU D 4 59  ? 28.468  24.201  14.239  1.00 84.81  ? 55  GLU A N   1 
ATOM   5632  C CA  . GLU D 4 59  ? 28.997  22.923  13.766  1.00 92.70  ? 55  GLU A CA  1 
ATOM   5633  C C   . GLU D 4 59  ? 30.510  22.926  13.705  1.00 98.01  ? 55  GLU A C   1 
ATOM   5634  O O   . GLU D 4 59  ? 31.126  23.947  13.493  1.00 95.86  ? 55  GLU A O   1 
ATOM   5635  C CB  . GLU D 4 59  ? 28.382  22.460  12.442  1.00 84.18  ? 55  GLU A CB  1 
ATOM   5636  C CG  . GLU D 4 59  ? 27.795  21.044  12.493  1.00 79.22  ? 55  GLU A CG  1 
ATOM   5637  C CD  . GLU D 4 59  ? 28.347  20.084  11.440  1.00 84.56  ? 55  GLU A CD  1 
ATOM   5638  O OE1 . GLU D 4 59  ? 28.556  20.481  10.288  1.00 78.91  ? 55  GLU A OE1 1 
ATOM   5639  O OE2 . GLU D 4 59  ? 28.559  18.903  11.751  1.00 89.00  ? 55  GLU A OE2 1 
ATOM   5640  N N   . SER D 4 60  ? 31.094  21.754  13.889  1.00 97.75  ? 56  SER A N   1 
ATOM   5641  C CA  . SER D 4 60  ? 32.502  21.613  14.279  1.00 102.33 ? 56  SER A CA  1 
ATOM   5642  C C   . SER D 4 60  ? 33.553  22.487  13.559  1.00 104.64 ? 56  SER A C   1 
ATOM   5643  O O   . SER D 4 60  ? 34.583  22.844  14.157  1.00 107.18 ? 56  SER A O   1 
ATOM   5644  C CB  . SER D 4 60  ? 32.907  20.134  14.241  1.00 106.13 ? 56  SER A CB  1 
ATOM   5645  O OG  . SER D 4 60  ? 32.214  19.398  15.240  1.00 99.44  ? 56  SER A OG  1 
ATOM   5646  N N   . GLY D 4 61  ? 33.299  22.836  12.300  1.00 98.65  ? 57  GLY A N   1 
ATOM   5647  C CA  . GLY D 4 61  ? 34.286  23.550  11.504  1.00 98.00  ? 57  GLY A CA  1 
ATOM   5648  C C   . GLY D 4 61  ? 34.104  25.055  11.398  1.00 94.25  ? 57  GLY A C   1 
ATOM   5649  O O   . GLY D 4 61  ? 34.840  25.723  10.671  1.00 90.74  ? 57  GLY A O   1 
ATOM   5650  N N   . ILE D 4 62  ? 33.118  25.587  12.115  1.00 93.69  ? 58  ILE A N   1 
ATOM   5651  C CA  . ILE D 4 62  ? 32.873  27.029  12.176  1.00 97.47  ? 58  ILE A CA  1 
ATOM   5652  C C   . ILE D 4 62  ? 33.872  27.678  13.150  1.00 102.05 ? 58  ILE A C   1 
ATOM   5653  O O   . ILE D 4 62  ? 34.320  27.022  14.100  1.00 105.85 ? 58  ILE A O   1 
ATOM   5654  C CB  . ILE D 4 62  ? 31.407  27.335  12.630  1.00 92.98  ? 58  ILE A CB  1 
ATOM   5655  C CG1 . ILE D 4 62  ? 30.394  26.868  11.589  1.00 88.31  ? 58  ILE A CG1 1 
ATOM   5656  C CG2 . ILE D 4 62  ? 31.183  28.820  12.854  1.00 87.90  ? 58  ILE A CG2 1 
ATOM   5657  C CD1 . ILE D 4 62  ? 30.280  25.374  11.449  1.00 94.01  ? 58  ILE A CD1 1 
ATOM   5658  N N   . PRO D 4 63  ? 34.244  28.958  12.906  1.00 97.74  ? 59  PRO A N   1 
ATOM   5659  C CA  . PRO D 4 63  ? 35.093  29.757  13.812  1.00 94.74  ? 59  PRO A CA  1 
ATOM   5660  C C   . PRO D 4 63  ? 34.371  30.345  15.038  1.00 94.58  ? 59  PRO A C   1 
ATOM   5661  O O   . PRO D 4 63  ? 33.197  30.742  14.960  1.00 92.60  ? 59  PRO A O   1 
ATOM   5662  C CB  . PRO D 4 63  ? 35.586  30.904  12.918  1.00 91.06  ? 59  PRO A CB  1 
ATOM   5663  C CG  . PRO D 4 63  ? 35.330  30.461  11.528  1.00 93.37  ? 59  PRO A CG  1 
ATOM   5664  C CD  . PRO D 4 63  ? 34.106  29.606  11.593  1.00 90.13  ? 59  PRO A CD  1 
ATOM   5665  N N   . ALA D 4 64  ? 35.097  30.418  16.154  1.00 94.73  ? 60  ALA A N   1 
ATOM   5666  C CA  . ALA D 4 64  ? 34.575  30.953  17.414  1.00 92.69  ? 60  ALA A CA  1 
ATOM   5667  C C   . ALA D 4 64  ? 33.867  32.315  17.296  1.00 88.65  ? 60  ALA A C   1 
ATOM   5668  O O   . ALA D 4 64  ? 33.248  32.778  18.260  1.00 82.58  ? 60  ALA A O   1 
ATOM   5669  C CB  . ALA D 4 64  ? 35.693  31.014  18.470  1.00 94.44  ? 60  ALA A CB  1 
ATOM   5670  N N   . ARG D 4 65  ? 33.952  32.946  16.124  1.00 90.07  ? 61  ARG A N   1 
ATOM   5671  C CA  . ARG D 4 65  ? 33.344  34.262  15.906  1.00 88.78  ? 61  ARG A CA  1 
ATOM   5672  C C   . ARG D 4 65  ? 31.824  34.220  15.994  1.00 86.02  ? 61  ARG A C   1 
ATOM   5673  O O   . ARG D 4 65  ? 31.176  35.268  16.031  1.00 84.62  ? 61  ARG A O   1 
ATOM   5674  C CB  . ARG D 4 65  ? 33.751  34.848  14.543  1.00 83.28  ? 61  ARG A CB  1 
ATOM   5675  C CG  . ARG D 4 65  ? 35.213  35.256  14.416  1.00 85.61  ? 61  ARG A CG  1 
ATOM   5676  C CD  . ARG D 4 65  ? 35.994  34.353  13.468  1.00 84.38  ? 61  ARG A CD  1 
ATOM   5677  N NE  . ARG D 4 65  ? 35.345  34.214  12.166  1.00 86.81  ? 61  ARG A NE  1 
ATOM   5678  C CZ  . ARG D 4 65  ? 35.298  35.165  11.234  1.00 86.17  ? 61  ARG A CZ  1 
ATOM   5679  N NH1 . ARG D 4 65  ? 34.689  34.929  10.074  1.00 79.28  ? 61  ARG A NH1 1 
ATOM   5680  N NH2 . ARG D 4 65  ? 35.856  36.351  11.456  1.00 81.30  ? 61  ARG A NH2 1 
ATOM   5681  N N   . PHE D 4 66  ? 31.258  33.018  16.041  1.00 80.12  ? 62  PHE A N   1 
ATOM   5682  C CA  . PHE D 4 66  ? 29.822  32.864  15.835  1.00 77.63  ? 62  PHE A CA  1 
ATOM   5683  C C   . PHE D 4 66  ? 28.955  32.568  17.085  1.00 81.36  ? 62  PHE A C   1 
ATOM   5684  O O   . PHE D 4 66  ? 28.939  31.460  17.627  1.00 80.49  ? 62  PHE A O   1 
ATOM   5685  C CB  . PHE D 4 66  ? 29.587  31.867  14.698  1.00 81.51  ? 62  PHE A CB  1 
ATOM   5686  C CG  . PHE D 4 66  ? 30.046  32.374  13.356  1.00 78.73  ? 62  PHE A CG  1 
ATOM   5687  C CD1 . PHE D 4 66  ? 31.385  32.336  13.008  1.00 83.06  ? 62  PHE A CD1 1 
ATOM   5688  C CD2 . PHE D 4 66  ? 29.140  32.912  12.449  1.00 70.90  ? 62  PHE A CD2 1 
ATOM   5689  C CE1 . PHE D 4 66  ? 31.811  32.822  11.770  1.00 84.06  ? 62  PHE A CE1 1 
ATOM   5690  C CE2 . PHE D 4 66  ? 29.565  33.398  11.225  1.00 69.71  ? 62  PHE A CE2 1 
ATOM   5691  C CZ  . PHE D 4 66  ? 30.899  33.352  10.884  1.00 75.20  ? 62  PHE A CZ  1 
ATOM   5692  N N   . SER D 4 67  ? 28.222  33.587  17.518  1.00 80.97  ? 63  SER A N   1 
ATOM   5693  C CA  . SER D 4 67  ? 27.421  33.499  18.724  1.00 78.75  ? 63  SER A CA  1 
ATOM   5694  C C   . SER D 4 67  ? 25.970  33.222  18.382  1.00 76.91  ? 63  SER A C   1 
ATOM   5695  O O   . SER D 4 67  ? 25.243  34.099  17.906  1.00 71.73  ? 63  SER A O   1 
ATOM   5696  C CB  . SER D 4 67  ? 27.538  34.798  19.544  1.00 81.01  ? 63  SER A CB  1 
ATOM   5697  O OG  . SER D 4 67  ? 26.284  35.462  19.673  1.00 81.99  ? 63  SER A OG  1 
ATOM   5698  N N   . GLY D 4 68  ? 25.545  31.993  18.624  1.00 79.22  ? 64  GLY A N   1 
ATOM   5699  C CA  . GLY D 4 68  ? 24.132  31.682  18.525  1.00 83.51  ? 64  GLY A CA  1 
ATOM   5700  C C   . GLY D 4 68  ? 23.394  32.025  19.806  1.00 76.76  ? 64  GLY A C   1 
ATOM   5701  O O   . GLY D 4 68  ? 23.633  31.419  20.852  1.00 75.68  ? 64  GLY A O   1 
ATOM   5702  N N   . SER D 4 69  ? 22.503  33.004  19.733  1.00 73.19  ? 65  SER A N   1 
ATOM   5703  C CA  . SER D 4 69  ? 21.680  33.337  20.885  1.00 73.19  ? 65  SER A CA  1 
ATOM   5704  C C   . SER D 4 69  ? 20.204  33.413  20.511  1.00 71.69  ? 65  SER A C   1 
ATOM   5705  O O   . SER D 4 69  ? 19.820  34.039  19.521  1.00 70.71  ? 65  SER A O   1 
ATOM   5706  C CB  . SER D 4 69  ? 22.177  34.611  21.566  1.00 79.74  ? 65  SER A CB  1 
ATOM   5707  O OG  . SER D 4 69  ? 23.293  34.310  22.400  1.00 90.75  ? 65  SER A OG  1 
ATOM   5708  N N   . GLY D 4 70  ? 19.380  32.738  21.297  1.00 68.62  ? 66  GLY A N   1 
ATOM   5709  C CA  . GLY D 4 70  ? 18.002  32.543  20.917  1.00 68.90  ? 66  GLY A CA  1 
ATOM   5710  C C   . GLY D 4 70  ? 17.134  32.131  22.072  1.00 71.21  ? 66  GLY A C   1 
ATOM   5711  O O   . GLY D 4 70  ? 17.531  31.340  22.923  1.00 68.28  ? 66  GLY A O   1 
ATOM   5712  N N   . SER D 4 71  ? 15.921  32.667  22.066  1.00 79.72  ? 67  SER A N   1 
ATOM   5713  C CA  . SER D 4 71  ? 15.002  32.589  23.201  1.00 86.32  ? 67  SER A CA  1 
ATOM   5714  C C   . SER D 4 71  ? 13.817  31.635  22.992  1.00 78.79  ? 67  SER A C   1 
ATOM   5715  O O   . SER D 4 71  ? 13.985  30.416  22.931  1.00 80.83  ? 67  SER A O   1 
ATOM   5716  C CB  . SER D 4 71  ? 14.482  33.998  23.523  1.00 89.34  ? 67  SER A CB  1 
ATOM   5717  O OG  . SER D 4 71  ? 13.541  33.973  24.578  1.00 91.81  ? 67  SER A OG  1 
ATOM   5718  N N   . ARG D 4 72  ? 12.619  32.200  22.902  1.00 77.42  ? 68  ARG A N   1 
ATOM   5719  C CA  . ARG D 4 72  ? 11.406  31.415  22.714  1.00 84.25  ? 68  ARG A CA  1 
ATOM   5720  C C   . ARG D 4 72  ? 10.962  31.571  21.264  1.00 82.54  ? 68  ARG A C   1 
ATOM   5721  O O   . ARG D 4 72  ? 10.523  30.617  20.608  1.00 78.41  ? 68  ARG A O   1 
ATOM   5722  C CB  . ARG D 4 72  ? 10.310  31.922  23.670  1.00 84.70  ? 68  ARG A CB  1 
ATOM   5723  C CG  . ARG D 4 72  ? 8.984   31.152  23.632  1.00 89.94  ? 68  ARG A CG  1 
ATOM   5724  C CD  . ARG D 4 72  ? 8.978   29.895  24.524  1.00 97.95  ? 68  ARG A CD  1 
ATOM   5725  N NE  . ARG D 4 72  ? 8.757   30.187  25.946  1.00 102.61 ? 68  ARG A NE  1 
ATOM   5726  C CZ  . ARG D 4 72  ? 8.544   29.259  26.879  1.00 95.58  ? 68  ARG A CZ  1 
ATOM   5727  N NH1 . ARG D 4 72  ? 8.360   29.614  28.148  1.00 92.73  ? 68  ARG A NH1 1 
ATOM   5728  N NH2 . ARG D 4 72  ? 8.517   27.974  26.545  1.00 92.50  ? 68  ARG A NH2 1 
ATOM   5729  N N   . THR D 4 73  ? 11.123  32.792  20.769  1.00 80.91  ? 69  THR A N   1 
ATOM   5730  C CA  . THR D 4 73  ? 10.535  33.207  19.513  1.00 75.70  ? 69  THR A CA  1 
ATOM   5731  C C   . THR D 4 73  ? 11.405  34.281  18.879  1.00 76.40  ? 69  THR A C   1 
ATOM   5732  O O   . THR D 4 73  ? 11.173  34.690  17.748  1.00 75.54  ? 69  THR A O   1 
ATOM   5733  C CB  . THR D 4 73  ? 9.096   33.708  19.745  1.00 70.67  ? 69  THR A CB  1 
ATOM   5734  O OG1 . THR D 4 73  ? 8.177   32.660  19.432  1.00 64.05  ? 69  THR A OG1 1 
ATOM   5735  C CG2 . THR D 4 73  ? 8.781   34.911  18.900  1.00 72.39  ? 69  THR A CG2 1 
ATOM   5736  N N   . ASP D 4 74  ? 12.426  34.722  19.608  1.00 78.70  ? 70  ASP A N   1 
ATOM   5737  C CA  . ASP D 4 74  ? 13.405  35.667  19.065  1.00 81.05  ? 70  ASP A CA  1 
ATOM   5738  C C   . ASP D 4 74  ? 14.814  35.048  19.059  1.00 79.40  ? 70  ASP A C   1 
ATOM   5739  O O   . ASP D 4 74  ? 15.167  34.293  19.970  1.00 77.54  ? 70  ASP A O   1 
ATOM   5740  C CB  . ASP D 4 74  ? 13.387  36.985  19.852  1.00 87.72  ? 70  ASP A CB  1 
ATOM   5741  C CG  . ASP D 4 74  ? 12.012  37.656  19.847  1.00 92.21  ? 70  ASP A CG  1 
ATOM   5742  O OD1 . ASP D 4 74  ? 11.954  38.908  19.761  1.00 91.54  ? 70  ASP A OD1 1 
ATOM   5743  O OD2 . ASP D 4 74  ? 10.989  36.929  19.927  1.00 92.32  ? 70  ASP A OD2 1 
ATOM   5744  N N   . PHE D 4 75  ? 15.609  35.342  18.030  1.00 73.48  ? 71  PHE A N   1 
ATOM   5745  C CA  . PHE D 4 75  ? 16.953  34.761  17.918  1.00 73.45  ? 71  PHE A CA  1 
ATOM   5746  C C   . PHE D 4 75  ? 17.871  35.720  17.193  1.00 75.60  ? 71  PHE A C   1 
ATOM   5747  O O   . PHE D 4 75  ? 17.415  36.522  16.377  1.00 77.59  ? 71  PHE A O   1 
ATOM   5748  C CB  . PHE D 4 75  ? 16.916  33.433  17.165  1.00 67.53  ? 71  PHE A CB  1 
ATOM   5749  C CG  . PHE D 4 75  ? 15.821  32.522  17.616  1.00 69.17  ? 71  PHE A CG  1 
ATOM   5750  C CD1 . PHE D 4 75  ? 14.509  32.760  17.245  1.00 72.85  ? 71  PHE A CD1 1 
ATOM   5751  C CD2 . PHE D 4 75  ? 16.095  31.434  18.410  1.00 70.53  ? 71  PHE A CD2 1 
ATOM   5752  C CE1 . PHE D 4 75  ? 13.497  31.934  17.663  1.00 72.49  ? 71  PHE A CE1 1 
ATOM   5753  C CE2 . PHE D 4 75  ? 15.091  30.604  18.830  1.00 69.08  ? 71  PHE A CE2 1 
ATOM   5754  C CZ  . PHE D 4 75  ? 13.790  30.854  18.456  1.00 74.20  ? 71  PHE A CZ  1 
ATOM   5755  N N   . THR D 4 76  ? 19.162  35.657  17.489  1.00 69.45  ? 72  THR A N   1 
ATOM   5756  C CA  . THR D 4 76  ? 20.094  36.560  16.832  1.00 69.34  ? 72  THR A CA  1 
ATOM   5757  C C   . THR D 4 76  ? 21.392  35.856  16.509  1.00 68.70  ? 72  THR A C   1 
ATOM   5758  O O   . THR D 4 76  ? 21.866  35.020  17.277  1.00 73.74  ? 72  THR A O   1 
ATOM   5759  C CB  . THR D 4 76  ? 20.406  37.846  17.669  1.00 71.24  ? 72  THR A CB  1 
ATOM   5760  O OG1 . THR D 4 76  ? 21.380  37.556  18.684  1.00 72.40  ? 72  THR A OG1 1 
ATOM   5761  C CG2 . THR D 4 76  ? 19.135  38.462  18.286  1.00 70.59  ? 72  THR A CG2 1 
ATOM   5762  N N   . LEU D 4 77  ? 21.960  36.203  15.364  1.00 60.45  ? 73  LEU A N   1 
ATOM   5763  C CA  . LEU D 4 77  ? 23.254  35.699  14.979  1.00 61.26  ? 73  LEU A CA  1 
ATOM   5764  C C   . LEU D 4 77  ? 24.242  36.825  15.171  1.00 65.96  ? 73  LEU A C   1 
ATOM   5765  O O   . LEU D 4 77  ? 23.996  37.942  14.732  1.00 66.44  ? 73  LEU A O   1 
ATOM   5766  C CB  . LEU D 4 77  ? 23.224  35.256  13.529  1.00 60.96  ? 73  LEU A CB  1 
ATOM   5767  C CG  . LEU D 4 77  ? 24.533  34.874  12.869  1.00 56.09  ? 73  LEU A CG  1 
ATOM   5768  C CD1 . LEU D 4 77  ? 25.060  33.605  13.458  1.00 56.38  ? 73  LEU A CD1 1 
ATOM   5769  C CD2 . LEU D 4 77  ? 24.247  34.688  11.409  1.00 55.56  ? 73  LEU A CD2 1 
ATOM   5770  N N   . THR D 4 78  ? 25.344  36.532  15.859  1.00 72.50  ? 74  THR A N   1 
ATOM   5771  C CA  . THR D 4 78  ? 26.357  37.534  16.207  1.00 72.84  ? 74  THR A CA  1 
ATOM   5772  C C   . THR D 4 78  ? 27.723  37.084  15.713  1.00 74.22  ? 74  THR A C   1 
ATOM   5773  O O   . THR D 4 78  ? 28.136  35.948  15.960  1.00 72.80  ? 74  THR A O   1 
ATOM   5774  C CB  . THR D 4 78  ? 26.428  37.777  17.740  1.00 70.93  ? 74  THR A CB  1 
ATOM   5775  O OG1 . THR D 4 78  ? 25.583  38.874  18.099  1.00 74.10  ? 74  THR A OG1 1 
ATOM   5776  C CG2 . THR D 4 78  ? 27.834  38.099  18.173  1.00 73.23  ? 74  THR A CG2 1 
ATOM   5777  N N   . ILE D 4 79  ? 28.413  37.970  14.998  1.00 72.34  ? 75  ILE A N   1 
ATOM   5778  C CA  . ILE D 4 79  ? 29.769  37.696  14.572  1.00 71.43  ? 75  ILE A CA  1 
ATOM   5779  C C   . ILE D 4 79  ? 30.664  38.559  15.445  1.00 77.73  ? 75  ILE A C   1 
ATOM   5780  O O   . ILE D 4 79  ? 30.791  39.756  15.200  1.00 78.96  ? 75  ILE A O   1 
ATOM   5781  C CB  . ILE D 4 79  ? 29.969  38.020  13.085  1.00 71.37  ? 75  ILE A CB  1 
ATOM   5782  C CG1 . ILE D 4 79  ? 28.667  37.811  12.306  1.00 69.13  ? 75  ILE A CG1 1 
ATOM   5783  C CG2 . ILE D 4 79  ? 31.075  37.142  12.479  1.00 70.83  ? 75  ILE A CG2 1 
ATOM   5784  C CD1 . ILE D 4 79  ? 28.676  36.575  11.373  1.00 61.43  ? 75  ILE A CD1 1 
ATOM   5785  N N   . ASN D 4 80  ? 31.264  37.950  16.473  1.00 81.69  ? 76  ASN A N   1 
ATOM   5786  C CA  . ASN D 4 80  ? 31.886  38.705  17.573  1.00 86.51  ? 76  ASN A CA  1 
ATOM   5787  C C   . ASN D 4 80  ? 33.014  39.636  17.133  1.00 84.82  ? 76  ASN A C   1 
ATOM   5788  O O   . ASN D 4 80  ? 33.000  40.818  17.504  1.00 83.70  ? 76  ASN A O   1 
ATOM   5789  C CB  . ASN D 4 80  ? 32.312  37.788  18.744  1.00 91.61  ? 76  ASN A CB  1 
ATOM   5790  C CG  . ASN D 4 80  ? 31.172  37.522  19.745  1.00 92.39  ? 76  ASN A CG  1 
ATOM   5791  O OD1 . ASN D 4 80  ? 30.527  38.451  20.240  1.00 93.68  ? 76  ASN A OD1 1 
ATOM   5792  N ND2 . ASN D 4 80  ? 30.938  36.247  20.053  1.00 88.12  ? 76  ASN A ND2 1 
ATOM   5793  N N   . PRO D 4 81  ? 33.992  39.099  16.365  1.00 79.72  ? 77  PRO A N   1 
ATOM   5794  C CA  . PRO D 4 81  ? 35.006  39.820  15.579  1.00 77.94  ? 77  PRO A CA  1 
ATOM   5795  C C   . PRO D 4 81  ? 34.677  39.640  14.100  1.00 79.03  ? 77  PRO A C   1 
ATOM   5796  O O   . PRO D 4 81  ? 34.150  38.577  13.793  1.00 87.77  ? 77  PRO A O   1 
ATOM   5797  C CB  . PRO D 4 81  ? 36.287  39.042  15.887  1.00 77.16  ? 77  PRO A CB  1 
ATOM   5798  C CG  . PRO D 4 81  ? 35.822  37.761  16.666  1.00 77.73  ? 77  PRO A CG  1 
ATOM   5799  C CD  . PRO D 4 81  ? 34.350  37.679  16.480  1.00 73.48  ? 77  PRO A CD  1 
ATOM   5800  N N   . VAL D 4 82  ? 34.954  40.604  13.215  1.00 79.53  ? 78  VAL A N   1 
ATOM   5801  C CA  . VAL D 4 82  ? 34.656  40.448  11.764  1.00 76.10  ? 78  VAL A CA  1 
ATOM   5802  C C   . VAL D 4 82  ? 35.923  40.298  10.884  1.00 71.53  ? 78  VAL A C   1 
ATOM   5803  O O   . VAL D 4 82  ? 36.983  40.861  11.165  1.00 71.52  ? 78  VAL A O   1 
ATOM   5804  C CB  . VAL D 4 82  ? 33.718  41.594  11.197  1.00 70.57  ? 78  VAL A CB  1 
ATOM   5805  C CG1 . VAL D 4 82  ? 33.551  41.502  9.697   1.00 62.24  ? 78  VAL A CG1 1 
ATOM   5806  C CG2 . VAL D 4 82  ? 32.353  41.582  11.862  1.00 72.61  ? 78  VAL A CG2 1 
ATOM   5807  N N   . GLU D 4 83  ? 35.816  39.509  9.827   1.00 74.31  ? 79  GLU A N   1 
ATOM   5808  C CA  . GLU D 4 83  ? 36.855  39.498  8.803   1.00 77.55  ? 79  GLU A CA  1 
ATOM   5809  C C   . GLU D 4 83  ? 36.256  39.844  7.423   1.00 78.49  ? 79  GLU A C   1 
ATOM   5810  O O   . GLU D 4 83  ? 35.122  40.321  7.332   1.00 74.76  ? 79  GLU A O   1 
ATOM   5811  C CB  . GLU D 4 83  ? 37.659  38.181  8.805   1.00 80.10  ? 79  GLU A CB  1 
ATOM   5812  C CG  . GLU D 4 83  ? 37.404  37.236  7.609   1.00 82.95  ? 79  GLU A CG  1 
ATOM   5813  C CD  . GLU D 4 83  ? 38.642  36.424  7.189   1.00 89.51  ? 79  GLU A CD  1 
ATOM   5814  O OE1 . GLU D 4 83  ? 39.666  37.042  6.812   1.00 90.13  ? 79  GLU A OE1 1 
ATOM   5815  O OE2 . GLU D 4 83  ? 38.583  35.168  7.209   1.00 89.62  ? 79  GLU A OE2 1 
ATOM   5816  N N   . ALA D 4 84  ? 37.024  39.634  6.359   1.00 80.42  ? 80  ALA A N   1 
ATOM   5817  C CA  . ALA D 4 84  ? 36.603  40.035  5.022   1.00 81.89  ? 80  ALA A CA  1 
ATOM   5818  C C   . ALA D 4 84  ? 35.917  38.893  4.280   1.00 78.43  ? 80  ALA A C   1 
ATOM   5819  O O   . ALA D 4 84  ? 34.884  39.070  3.627   1.00 72.23  ? 80  ALA A O   1 
ATOM   5820  C CB  . ALA D 4 84  ? 37.810  40.530  4.231   1.00 80.21  ? 80  ALA A CB  1 
ATOM   5821  N N   . ASP D 4 85  ? 36.511  37.714  4.411   1.00 81.50  ? 81  ASP A N   1 
ATOM   5822  C CA  . ASP D 4 85  ? 36.173  36.551  3.600   1.00 83.21  ? 81  ASP A CA  1 
ATOM   5823  C C   . ASP D 4 85  ? 34.792  36.003  3.957   1.00 79.39  ? 81  ASP A C   1 
ATOM   5824  O O   . ASP D 4 85  ? 34.403  34.918  3.512   1.00 74.60  ? 81  ASP A O   1 
ATOM   5825  C CB  . ASP D 4 85  ? 37.255  35.465  3.769   1.00 93.32  ? 81  ASP A CB  1 
ATOM   5826  C CG  . ASP D 4 85  ? 38.699  36.005  3.572   1.00 96.56  ? 81  ASP A CG  1 
ATOM   5827  O OD1 . ASP D 4 85  ? 39.106  37.006  4.229   1.00 89.58  ? 81  ASP A OD1 1 
ATOM   5828  O OD2 . ASP D 4 85  ? 39.440  35.397  2.765   1.00 101.96 ? 81  ASP A OD2 1 
ATOM   5829  N N   . ASP D 4 86  ? 34.059  36.765  4.769   1.00 80.14  ? 82  ASP A N   1 
ATOM   5830  C CA  . ASP D 4 86  ? 32.696  36.400  5.169   1.00 78.11  ? 82  ASP A CA  1 
ATOM   5831  C C   . ASP D 4 86  ? 31.700  37.513  4.857   1.00 73.75  ? 82  ASP A C   1 
ATOM   5832  O O   . ASP D 4 86  ? 30.757  37.772  5.615   1.00 69.15  ? 82  ASP A O   1 
ATOM   5833  C CB  . ASP D 4 86  ? 32.612  35.948  6.644   1.00 79.44  ? 82  ASP A CB  1 
ATOM   5834  C CG  . ASP D 4 86  ? 32.944  37.059  7.628   1.00 79.78  ? 82  ASP A CG  1 
ATOM   5835  O OD1 . ASP D 4 86  ? 33.135  38.204  7.173   1.00 82.46  ? 82  ASP A OD1 1 
ATOM   5836  O OD2 . ASP D 4 86  ? 33.013  36.786  8.853   1.00 76.82  ? 82  ASP A OD2 1 
ATOM   5837  N N   . VAL D 4 87  ? 31.946  38.170  3.728   1.00 78.84  ? 83  VAL A N   1 
ATOM   5838  C CA  . VAL D 4 87  ? 30.969  39.043  3.091   1.00 78.17  ? 83  VAL A CA  1 
ATOM   5839  C C   . VAL D 4 87  ? 29.934  38.141  2.446   1.00 69.16  ? 83  VAL A C   1 
ATOM   5840  O O   . VAL D 4 87  ? 30.278  37.295  1.630   1.00 73.79  ? 83  VAL A O   1 
ATOM   5841  C CB  . VAL D 4 87  ? 31.626  39.889  1.989   1.00 73.26  ? 83  VAL A CB  1 
ATOM   5842  C CG1 . VAL D 4 87  ? 32.530  39.016  1.117   1.00 68.71  ? 83  VAL A CG1 1 
ATOM   5843  C CG2 . VAL D 4 87  ? 30.558  40.587  1.165   1.00 70.32  ? 83  VAL A CG2 1 
ATOM   5844  N N   . ALA D 4 88  ? 28.673  38.288  2.808   1.00 62.99  ? 84  ALA A N   1 
ATOM   5845  C CA  . ALA D 4 88  ? 27.701  37.327  2.325   1.00 64.40  ? 84  ALA A CA  1 
ATOM   5846  C C   . ALA D 4 88  ? 26.282  37.655  2.740   1.00 70.04  ? 84  ALA A C   1 
ATOM   5847  O O   . ALA D 4 88  ? 26.018  38.714  3.316   1.00 77.39  ? 84  ALA A O   1 
ATOM   5848  C CB  . ALA D 4 88  ? 28.067  35.949  2.800   1.00 66.22  ? 84  ALA A CB  1 
ATOM   5849  N N   . THR D 4 89  ? 25.366  36.745  2.433   1.00 64.43  ? 85  THR A N   1 
ATOM   5850  C CA  . THR D 4 89  ? 23.975  36.930  2.801   1.00 63.67  ? 85  THR A CA  1 
ATOM   5851  C C   . THR D 4 89  ? 23.580  35.785  3.712   1.00 67.19  ? 85  THR A C   1 
ATOM   5852  O O   . THR D 4 89  ? 23.862  34.623  3.411   1.00 69.65  ? 85  THR A O   1 
ATOM   5853  C CB  . THR D 4 89  ? 23.059  37.029  1.570   1.00 64.41  ? 85  THR A CB  1 
ATOM   5854  O OG1 . THR D 4 89  ? 21.696  36.927  1.989   1.00 64.34  ? 85  THR A OG1 1 
ATOM   5855  C CG2 . THR D 4 89  ? 23.376  35.929  0.566   1.00 64.23  ? 85  THR A CG2 1 
ATOM   5856  N N   . TYR D 4 90  ? 22.940  36.120  4.833   1.00 71.50  ? 86  TYR A N   1 
ATOM   5857  C CA  . TYR D 4 90  ? 22.763  35.184  5.957   1.00 64.22  ? 86  TYR A CA  1 
ATOM   5858  C C   . TYR D 4 90  ? 21.301  34.757  6.202   1.00 59.68  ? 86  TYR A C   1 
ATOM   5859  O O   . TYR D 4 90  ? 20.423  35.599  6.358   1.00 58.46  ? 86  TYR A O   1 
ATOM   5860  C CB  . TYR D 4 90  ? 23.385  35.793  7.229   1.00 55.20  ? 86  TYR A CB  1 
ATOM   5861  C CG  . TYR D 4 90  ? 24.902  35.946  7.183   1.00 57.78  ? 86  TYR A CG  1 
ATOM   5862  C CD1 . TYR D 4 90  ? 25.498  37.129  6.762   1.00 60.44  ? 86  TYR A CD1 1 
ATOM   5863  C CD2 . TYR D 4 90  ? 25.741  34.899  7.569   1.00 57.02  ? 86  TYR A CD2 1 
ATOM   5864  C CE1 . TYR D 4 90  ? 26.893  37.259  6.725   1.00 62.10  ? 86  TYR A CE1 1 
ATOM   5865  C CE2 . TYR D 4 90  ? 27.122  35.021  7.535   1.00 52.13  ? 86  TYR A CE2 1 
ATOM   5866  C CZ  . TYR D 4 90  ? 27.695  36.198  7.114   1.00 60.56  ? 86  TYR A CZ  1 
ATOM   5867  O OH  . TYR D 4 90  ? 29.070  36.310  7.079   1.00 63.77  ? 86  TYR A OH  1 
ATOM   5868  N N   . TYR D 4 91  ? 21.050  33.448  6.243   1.00 59.92  ? 87  TYR A N   1 
ATOM   5869  C CA  . TYR D 4 91  ? 19.674  32.926  6.404   1.00 67.25  ? 87  TYR A CA  1 
ATOM   5870  C C   . TYR D 4 91  ? 19.357  32.155  7.719   1.00 63.76  ? 87  TYR A C   1 
ATOM   5871  O O   . TYR D 4 91  ? 20.130  31.294  8.174   1.00 57.51  ? 87  TYR A O   1 
ATOM   5872  C CB  . TYR D 4 91  ? 19.261  32.053  5.193   1.00 66.70  ? 87  TYR A CB  1 
ATOM   5873  C CG  . TYR D 4 91  ? 19.186  32.769  3.848   1.00 65.75  ? 87  TYR A CG  1 
ATOM   5874  C CD1 . TYR D 4 91  ? 20.305  32.872  3.026   1.00 63.69  ? 87  TYR A CD1 1 
ATOM   5875  C CD2 . TYR D 4 91  ? 17.989  33.317  3.396   1.00 65.05  ? 87  TYR A CD2 1 
ATOM   5876  C CE1 . TYR D 4 91  ? 20.229  33.513  1.799   1.00 71.42  ? 87  TYR A CE1 1 
ATOM   5877  C CE2 . TYR D 4 91  ? 17.908  33.970  2.179   1.00 65.59  ? 87  TYR A CE2 1 
ATOM   5878  C CZ  . TYR D 4 91  ? 19.023  34.063  1.382   1.00 70.35  ? 87  TYR A CZ  1 
ATOM   5879  O OH  . TYR D 4 91  ? 18.935  34.705  0.166   1.00 73.26  ? 87  TYR A OH  1 
ATOM   5880  N N   . CYS D 4 92  ? 18.198  32.452  8.305   1.00 62.61  ? 88  CYS A N   1 
ATOM   5881  C CA  . CYS D 4 92  ? 17.727  31.705  9.468   1.00 62.68  ? 88  CYS A CA  1 
ATOM   5882  C C   . CYS D 4 92  ? 16.706  30.652  9.029   1.00 57.50  ? 88  CYS A C   1 
ATOM   5883  O O   . CYS D 4 92  ? 16.101  30.801  7.974   1.00 57.21  ? 88  CYS A O   1 
ATOM   5884  C CB  . CYS D 4 92  ? 17.128  32.661  10.490  1.00 63.89  ? 88  CYS A CB  1 
ATOM   5885  S SG  . CYS D 4 92  ? 15.511  33.268  10.060  1.00 76.08  ? 88  CYS A SG  1 
ATOM   5886  N N   . GLN D 4 93  ? 16.532  29.581  9.806   1.00 55.81  ? 89  GLN A N   1 
ATOM   5887  C CA  . GLN D 4 93  ? 15.620  28.490  9.397   1.00 56.87  ? 89  GLN A CA  1 
ATOM   5888  C C   . GLN D 4 93  ? 14.992  27.644  10.507  1.00 53.23  ? 89  GLN A C   1 
ATOM   5889  O O   . GLN D 4 93  ? 15.674  27.179  11.423  1.00 51.34  ? 89  GLN A O   1 
ATOM   5890  C CB  . GLN D 4 93  ? 16.273  27.550  8.374   1.00 53.25  ? 89  GLN A CB  1 
ATOM   5891  C CG  . GLN D 4 93  ? 15.449  26.296  8.070   1.00 49.63  ? 89  GLN A CG  1 
ATOM   5892  C CD  . GLN D 4 93  ? 16.288  25.040  8.120   1.00 48.40  ? 89  GLN A CD  1 
ATOM   5893  O OE1 . GLN D 4 93  ? 16.335  24.252  7.173   1.00 42.36  ? 89  GLN A OE1 1 
ATOM   5894  N NE2 . GLN D 4 93  ? 16.971  24.855  9.231   1.00 50.85  ? 89  GLN A NE2 1 
ATOM   5895  N N   . GLN D 4 94  ? 13.686  27.423  10.373  1.00 52.93  ? 90  GLN A N   1 
ATOM   5896  C CA  . GLN D 4 94  ? 12.909  26.679  11.349  1.00 50.66  ? 90  GLN A CA  1 
ATOM   5897  C C   . GLN D 4 94  ? 12.710  25.242  10.899  1.00 48.84  ? 90  GLN A C   1 
ATOM   5898  O O   . GLN D 4 94  ? 12.643  24.973  9.708   1.00 50.34  ? 90  GLN A O   1 
ATOM   5899  C CB  . GLN D 4 94  ? 11.570  27.370  11.582  1.00 51.12  ? 90  GLN A CB  1 
ATOM   5900  C CG  . GLN D 4 94  ? 10.558  27.142  10.505  1.00 50.39  ? 90  GLN A CG  1 
ATOM   5901  C CD  . GLN D 4 94  ? 9.833   25.840  10.681  1.00 51.88  ? 90  GLN A CD  1 
ATOM   5902  O OE1 . GLN D 4 94  ? 9.133   25.381  9.787   1.00 59.24  ? 90  GLN A OE1 1 
ATOM   5903  N NE2 . GLN D 4 94  ? 10.000  25.230  11.835  1.00 51.70  ? 90  GLN A NE2 1 
ATOM   5904  N N   . THR D 4 95  ? 12.639  24.329  11.864  1.00 52.41  ? 91  THR A N   1 
ATOM   5905  C CA  . THR D 4 95  ? 12.560  22.881  11.613  1.00 57.50  ? 91  THR A CA  1 
ATOM   5906  C C   . THR D 4 95  ? 11.626  22.233  12.659  1.00 58.32  ? 91  THR A C   1 
ATOM   5907  O O   . THR D 4 95  ? 11.799  21.093  13.101  1.00 57.10  ? 91  THR A O   1 
ATOM   5908  C CB  . THR D 4 95  ? 14.006  22.205  11.529  1.00 58.57  ? 91  THR A CB  1 
ATOM   5909  O OG1 . THR D 4 95  ? 14.406  22.058  10.162  1.00 50.84  ? 91  THR A OG1 1 
ATOM   5910  C CG2 . THR D 4 95  ? 14.056  20.829  12.159  1.00 55.48  ? 91  THR A CG2 1 
ATOM   5911  N N   . HIS D 4 96  ? 10.608  22.982  13.047  1.00 59.12  ? 92  HIS A N   1 
ATOM   5912  C CA  . HIS D 4 96  ? 9.663   22.466  14.009  1.00 61.73  ? 92  HIS A CA  1 
ATOM   5913  C C   . HIS D 4 96  ? 8.279   22.209  13.407  1.00 70.32  ? 92  HIS A C   1 
ATOM   5914  O O   . HIS D 4 96  ? 7.535   21.397  13.951  1.00 78.47  ? 92  HIS A O   1 
ATOM   5915  C CB  . HIS D 4 96  ? 9.583   23.371  15.238  1.00 65.80  ? 92  HIS A CB  1 
ATOM   5916  C CG  . HIS D 4 96  ? 8.503   22.989  16.194  1.00 68.96  ? 92  HIS A CG  1 
ATOM   5917  N ND1 . HIS D 4 96  ? 7.575   23.892  16.667  1.00 67.78  ? 92  HIS A ND1 1 
ATOM   5918  C CD2 . HIS D 4 96  ? 8.189   21.797  16.754  1.00 73.31  ? 92  HIS A CD2 1 
ATOM   5919  C CE1 . HIS D 4 96  ? 6.742   23.273  17.483  1.00 77.72  ? 92  HIS A CE1 1 
ATOM   5920  N NE2 . HIS D 4 96  ? 7.091   22.001  17.553  1.00 77.84  ? 92  HIS A NE2 1 
ATOM   5921  N N   . GLU D 4 97  ? 7.924   22.876  12.303  1.00 66.41  ? 93  GLU A N   1 
ATOM   5922  C CA  . GLU D 4 97  ? 6.636   22.596  11.640  1.00 68.71  ? 93  GLU A CA  1 
ATOM   5923  C C   . GLU D 4 97  ? 6.779   22.326  10.136  1.00 69.30  ? 93  GLU A C   1 
ATOM   5924  O O   . GLU D 4 97  ? 7.107   23.216  9.356   1.00 66.10  ? 93  GLU A O   1 
ATOM   5925  C CB  . GLU D 4 97  ? 5.603   23.685  11.932  1.00 66.95  ? 93  GLU A CB  1 
ATOM   5926  C CG  . GLU D 4 97  ? 4.203   23.134  12.219  1.00 76.60  ? 93  GLU A CG  1 
ATOM   5927  C CD  . GLU D 4 97  ? 4.154   22.144  13.401  1.00 84.25  ? 93  GLU A CD  1 
ATOM   5928  O OE1 . GLU D 4 97  ? 3.713   22.529  14.521  1.00 80.63  ? 93  GLU A OE1 1 
ATOM   5929  O OE2 . GLU D 4 97  ? 4.546   20.971  13.199  1.00 78.36  ? 93  GLU A OE2 1 
ATOM   5930  N N   . ASP D 4 98  ? 6.488   21.089  9.747   1.00 72.84  ? 94  ASP A N   1 
ATOM   5931  C CA  . ASP D 4 98  ? 7.049   20.484  8.528   1.00 73.90  ? 94  ASP A CA  1 
ATOM   5932  C C   . ASP D 4 98  ? 6.926   21.219  7.191   1.00 74.99  ? 94  ASP A C   1 
ATOM   5933  O O   . ASP D 4 98  ? 7.662   20.884  6.256   1.00 74.45  ? 94  ASP A O   1 
ATOM   5934  C CB  . ASP D 4 98  ? 6.615   19.022  8.375   1.00 72.20  ? 94  ASP A CB  1 
ATOM   5935  C CG  . ASP D 4 98  ? 5.162   18.822  8.708   1.00 80.82  ? 94  ASP A CG  1 
ATOM   5936  O OD1 . ASP D 4 98  ? 4.824   18.930  9.909   1.00 85.03  ? 94  ASP A OD1 1 
ATOM   5937  O OD2 . ASP D 4 98  ? 4.359   18.571  7.778   1.00 88.56  ? 94  ASP A OD2 1 
ATOM   5938  N N   . PRO D 4 99  ? 6.008   22.195  7.074   1.00 71.30  ? 95  PRO A N   1 
ATOM   5939  C CA  . PRO D 4 99  ? 6.185   23.036  5.878   1.00 70.09  ? 95  PRO A CA  1 
ATOM   5940  C C   . PRO D 4 99  ? 7.384   23.981  6.092   1.00 73.67  ? 95  PRO A C   1 
ATOM   5941  O O   . PRO D 4 99  ? 7.208   25.209  6.035   1.00 74.74  ? 95  PRO A O   1 
ATOM   5942  C CB  . PRO D 4 99  ? 4.885   23.834  5.808   1.00 72.18  ? 95  PRO A CB  1 
ATOM   5943  C CG  . PRO D 4 99  ? 3.921   23.119  6.749   1.00 74.63  ? 95  PRO A CG  1 
ATOM   5944  C CD  . PRO D 4 99  ? 4.755   22.476  7.795   1.00 64.06  ? 95  PRO A CD  1 
ATOM   5945  N N   . TYR D 4 100 ? 8.567   23.396  6.345   1.00 68.02  ? 96  TYR A N   1 
ATOM   5946  C CA  . TYR D 4 100 ? 9.784   24.100  6.759   1.00 58.35  ? 96  TYR A CA  1 
ATOM   5947  C C   . TYR D 4 100 ? 9.874   25.462  6.110   1.00 62.87  ? 96  TYR A C   1 
ATOM   5948  O O   . TYR D 4 100 ? 9.457   25.621  4.965   1.00 71.11  ? 96  TYR A O   1 
ATOM   5949  C CB  . TYR D 4 100 ? 11.016  23.313  6.326   1.00 55.70  ? 96  TYR A CB  1 
ATOM   5950  C CG  . TYR D 4 100 ? 11.253  22.029  7.054   1.00 54.29  ? 96  TYR A CG  1 
ATOM   5951  C CD1 . TYR D 4 100 ? 10.221  21.368  7.680   1.00 60.10  ? 96  TYR A CD1 1 
ATOM   5952  C CD2 . TYR D 4 100 ? 12.518  21.464  7.098   1.00 52.06  ? 96  TYR A CD2 1 
ATOM   5953  C CE1 . TYR D 4 100 ? 10.434  20.178  8.354   1.00 63.80  ? 96  TYR A CE1 1 
ATOM   5954  C CE2 . TYR D 4 100 ? 12.756  20.274  7.767   1.00 52.99  ? 96  TYR A CE2 1 
ATOM   5955  C CZ  . TYR D 4 100 ? 11.706  19.630  8.399   1.00 61.04  ? 96  TYR A CZ  1 
ATOM   5956  O OH  . TYR D 4 100 ? 11.917  18.437  9.073   1.00 49.79  ? 96  TYR A OH  1 
ATOM   5957  N N   . THR D 4 101 ? 10.448  26.439  6.806   1.00 59.75  ? 97  THR A N   1 
ATOM   5958  C CA  . THR D 4 101 ? 10.714  27.742  6.177   1.00 65.24  ? 97  THR A CA  1 
ATOM   5959  C C   . THR D 4 101 ? 12.091  28.369  6.511   1.00 60.93  ? 97  THR A C   1 
ATOM   5960  O O   . THR D 4 101 ? 12.700  28.055  7.530   1.00 58.26  ? 97  THR A O   1 
ATOM   5961  C CB  . THR D 4 101 ? 9.572   28.756  6.449   1.00 65.52  ? 97  THR A CB  1 
ATOM   5962  O OG1 . THR D 4 101 ? 9.191   28.685  7.823   1.00 65.25  ? 97  THR A OG1 1 
ATOM   5963  C CG2 . THR D 4 101 ? 8.350   28.438  5.592   1.00 72.09  ? 97  THR A CG2 1 
ATOM   5964  N N   . PHE D 4 102 ? 12.585  29.226  5.623   1.00 57.80  ? 98  PHE A N   1 
ATOM   5965  C CA  . PHE D 4 102 ? 13.728  30.081  5.924   1.00 56.02  ? 98  PHE A CA  1 
ATOM   5966  C C   . PHE D 4 102 ? 13.227  31.511  6.079   1.00 63.42  ? 98  PHE A C   1 
ATOM   5967  O O   . PHE D 4 102 ? 12.056  31.787  5.816   1.00 74.79  ? 98  PHE A O   1 
ATOM   5968  C CB  . PHE D 4 102 ? 14.728  30.056  4.791   1.00 58.56  ? 98  PHE A CB  1 
ATOM   5969  C CG  . PHE D 4 102 ? 15.342  28.713  4.534   1.00 56.58  ? 98  PHE A CG  1 
ATOM   5970  C CD1 . PHE D 4 102 ? 16.619  28.415  4.990   1.00 54.49  ? 98  PHE A CD1 1 
ATOM   5971  C CD2 . PHE D 4 102 ? 14.670  27.764  3.796   1.00 52.18  ? 98  PHE A CD2 1 
ATOM   5972  C CE1 . PHE D 4 102 ? 17.201  27.188  4.721   1.00 47.89  ? 98  PHE A CE1 1 
ATOM   5973  C CE2 . PHE D 4 102 ? 15.251  26.539  3.534   1.00 49.78  ? 98  PHE A CE2 1 
ATOM   5974  C CZ  . PHE D 4 102 ? 16.515  26.255  3.990   1.00 45.78  ? 98  PHE A CZ  1 
ATOM   5975  N N   . GLY D 4 103 ? 14.102  32.427  6.486   1.00 61.31  ? 99  GLY A N   1 
ATOM   5976  C CA  . GLY D 4 103 ? 13.694  33.802  6.740   1.00 64.14  ? 99  GLY A CA  1 
ATOM   5977  C C   . GLY D 4 103 ? 13.910  34.677  5.523   1.00 71.45  ? 99  GLY A C   1 
ATOM   5978  O O   . GLY D 4 103 ? 14.206  34.163  4.443   1.00 75.60  ? 99  GLY A O   1 
ATOM   5979  N N   . GLY D 4 104 ? 13.758  35.990  5.683   1.00 72.07  ? 100 GLY A N   1 
ATOM   5980  C CA  . GLY D 4 104 ? 14.042  36.920  4.602   1.00 67.36  ? 100 GLY A CA  1 
ATOM   5981  C C   . GLY D 4 104 ? 15.453  36.768  4.059   1.00 66.04  ? 100 GLY A C   1 
ATOM   5982  O O   . GLY D 4 104 ? 15.714  36.059  3.089   1.00 61.71  ? 100 GLY A O   1 
ATOM   5983  N N   . GLY D 4 105 ? 16.391  37.446  4.689   1.00 68.06  ? 101 GLY A N   1 
ATOM   5984  C CA  . GLY D 4 105 ? 17.744  37.422  4.181   1.00 72.09  ? 101 GLY A CA  1 
ATOM   5985  C C   . GLY D 4 105 ? 18.420  38.756  4.402   1.00 73.07  ? 101 GLY A C   1 
ATOM   5986  O O   . GLY D 4 105 ? 17.886  39.796  4.012   1.00 72.31  ? 101 GLY A O   1 
ATOM   5987  N N   . THR D 4 106 ? 19.589  38.719  5.039   1.00 72.58  ? 102 THR A N   1 
ATOM   5988  C CA  . THR D 4 106 ? 20.373  39.920  5.303   1.00 75.79  ? 102 THR A CA  1 
ATOM   5989  C C   . THR D 4 106 ? 21.679  39.906  4.492   1.00 76.36  ? 102 THR A C   1 
ATOM   5990  O O   . THR D 4 106 ? 22.472  38.962  4.591   1.00 72.20  ? 102 THR A O   1 
ATOM   5991  C CB  . THR D 4 106 ? 20.694  40.066  6.812   1.00 72.09  ? 102 THR A CB  1 
ATOM   5992  O OG1 . THR D 4 106 ? 19.509  39.845  7.585   1.00 68.67  ? 102 THR A OG1 1 
ATOM   5993  C CG2 . THR D 4 106 ? 21.228  41.454  7.111   1.00 75.73  ? 102 THR A CG2 1 
ATOM   5994  N N   . LYS D 4 107 ? 21.895  40.936  3.673   1.00 75.32  ? 103 LYS A N   1 
ATOM   5995  C CA  . LYS D 4 107 ? 23.164  41.054  2.977   1.00 73.74  ? 103 LYS A CA  1 
ATOM   5996  C C   . LYS D 4 107 ? 24.081  41.760  3.925   1.00 70.02  ? 103 LYS A C   1 
ATOM   5997  O O   . LYS D 4 107 ? 23.721  42.802  4.472   1.00 70.86  ? 103 LYS A O   1 
ATOM   5998  C CB  . LYS D 4 107 ? 23.036  41.849  1.678   1.00 79.61  ? 103 LYS A CB  1 
ATOM   5999  C CG  . LYS D 4 107 ? 24.332  41.908  0.855   1.00 83.41  ? 103 LYS A CG  1 
ATOM   6000  C CD  . LYS D 4 107 ? 24.046  42.117  -0.640  1.00 89.98  ? 103 LYS A CD  1 
ATOM   6001  C CE  . LYS D 4 107 ? 23.161  43.345  -0.887  1.00 92.33  ? 103 LYS A CE  1 
ATOM   6002  N NZ  . LYS D 4 107 ? 22.321  43.209  -2.112  1.00 79.70  ? 103 LYS A NZ  1 
ATOM   6003  N N   . LEU D 4 108 ? 25.244  41.170  4.156   1.00 66.70  ? 104 LEU A N   1 
ATOM   6004  C CA  . LEU D 4 108 ? 26.264  41.829  4.959   1.00 76.45  ? 104 LEU A CA  1 
ATOM   6005  C C   . LEU D 4 108 ? 27.295  42.514  4.066   1.00 80.63  ? 104 LEU A C   1 
ATOM   6006  O O   . LEU D 4 108 ? 28.016  41.853  3.308   1.00 80.33  ? 104 LEU A O   1 
ATOM   6007  C CB  . LEU D 4 108 ? 26.958  40.855  5.917   1.00 73.99  ? 104 LEU A CB  1 
ATOM   6008  C CG  . LEU D 4 108 ? 27.855  41.518  6.972   1.00 72.60  ? 104 LEU A CG  1 
ATOM   6009  C CD1 . LEU D 4 108 ? 27.041  42.448  7.856   1.00 70.74  ? 104 LEU A CD1 1 
ATOM   6010  C CD2 . LEU D 4 108 ? 28.569  40.475  7.820   1.00 74.44  ? 104 LEU A CD2 1 
ATOM   6011  N N   . GLU D 4 109 ? 27.346  43.841  4.151   1.00 80.00  ? 105 GLU A N   1 
ATOM   6012  C CA  . GLU D 4 109 ? 28.332  44.619  3.422   1.00 79.15  ? 105 GLU A CA  1 
ATOM   6013  C C   . GLU D 4 109 ? 29.413  45.074  4.408   1.00 80.69  ? 105 GLU A C   1 
ATOM   6014  O O   . GLU D 4 109 ? 29.143  45.280  5.597   1.00 77.80  ? 105 GLU A O   1 
ATOM   6015  C CB  . GLU D 4 109 ? 27.670  45.805  2.699   1.00 82.14  ? 105 GLU A CB  1 
ATOM   6016  C CG  . GLU D 4 109 ? 26.126  45.847  2.792   1.00 84.41  ? 105 GLU A CG  1 
ATOM   6017  C CD  . GLU D 4 109 ? 25.441  46.536  1.591   1.00 99.63  ? 105 GLU A CD  1 
ATOM   6018  O OE1 . GLU D 4 109 ? 25.984  46.459  0.462   1.00 103.56 ? 105 GLU A OE1 1 
ATOM   6019  O OE2 . GLU D 4 109 ? 24.348  47.136  1.770   1.00 93.87  ? 105 GLU A OE2 1 
ATOM   6020  N N   . ILE D 4 110 ? 30.641  45.201  3.915   1.00 79.23  ? 106 ILE A N   1 
ATOM   6021  C CA  . ILE D 4 110 ? 31.773  45.600  4.747   1.00 78.54  ? 106 ILE A CA  1 
ATOM   6022  C C   . ILE D 4 110 ? 32.049  47.123  4.665   1.00 84.01  ? 106 ILE A C   1 
ATOM   6023  O O   . ILE D 4 110 ? 31.528  47.818  3.781   1.00 83.68  ? 106 ILE A O   1 
ATOM   6024  C CB  . ILE D 4 110 ? 33.023  44.759  4.401   1.00 68.60  ? 106 ILE A CB  1 
ATOM   6025  C CG1 . ILE D 4 110 ? 33.329  43.781  5.523   1.00 68.45  ? 106 ILE A CG1 1 
ATOM   6026  C CG2 . ILE D 4 110 ? 34.224  45.625  4.183   1.00 74.68  ? 106 ILE A CG2 1 
ATOM   6027  C CD1 . ILE D 4 110 ? 34.728  43.246  5.476   1.00 68.98  ? 106 ILE A CD1 1 
ATOM   6028  N N   . LYS D 4 111 ? 32.834  47.643  5.608   1.00 81.02  ? 107 LYS A N   1 
ATOM   6029  C CA  . LYS D 4 111 ? 33.224  49.051  5.594   1.00 81.71  ? 107 LYS A CA  1 
ATOM   6030  C C   . LYS D 4 111 ? 34.718  49.172  5.336   1.00 79.11  ? 107 LYS A C   1 
ATOM   6031  O O   . LYS D 4 111 ? 35.516  48.380  5.840   1.00 76.68  ? 107 LYS A O   1 
ATOM   6032  C CB  . LYS D 4 111 ? 32.893  49.721  6.929   1.00 88.21  ? 107 LYS A CB  1 
ATOM   6033  C CG  . LYS D 4 111 ? 31.645  50.591  6.957   1.00 87.95  ? 107 LYS A CG  1 
ATOM   6034  C CD  . LYS D 4 111 ? 31.467  51.210  8.353   1.00 86.30  ? 107 LYS A CD  1 
ATOM   6035  C CE  . LYS D 4 111 ? 30.252  52.115  8.400   1.00 83.70  ? 107 LYS A CE  1 
ATOM   6036  N NZ  . LYS D 4 111 ? 29.473  51.987  7.134   1.00 82.33  ? 107 LYS A NZ  1 
ATOM   6037  N N   . ARG D 4 112 ? 35.101  50.180  4.569   1.00 79.19  ? 108 ARG A N   1 
ATOM   6038  C CA  . ARG D 4 112 ? 36.504  50.338  4.239   1.00 82.22  ? 108 ARG A CA  1 
ATOM   6039  C C   . ARG D 4 112 ? 36.876  51.769  3.846   1.00 82.86  ? 108 ARG A C   1 
ATOM   6040  O O   . ARG D 4 112 ? 36.008  52.631  3.670   1.00 75.85  ? 108 ARG A O   1 
ATOM   6041  C CB  . ARG D 4 112 ? 36.903  49.351  3.139   1.00 77.76  ? 108 ARG A CB  1 
ATOM   6042  C CG  . ARG D 4 112 ? 36.469  49.758  1.757   1.00 78.89  ? 108 ARG A CG  1 
ATOM   6043  C CD  . ARG D 4 112 ? 37.656  50.130  0.905   1.00 77.09  ? 108 ARG A CD  1 
ATOM   6044  N NE  . ARG D 4 112 ? 38.538  48.992  0.683   1.00 75.68  ? 108 ARG A NE  1 
ATOM   6045  C CZ  . ARG D 4 112 ? 39.782  49.098  0.228   1.00 81.11  ? 108 ARG A CZ  1 
ATOM   6046  N NH1 . ARG D 4 112 ? 40.293  50.294  -0.045  1.00 78.80  ? 108 ARG A NH1 1 
ATOM   6047  N NH2 . ARG D 4 112 ? 40.520  48.011  0.048   1.00 82.86  ? 108 ARG A NH2 1 
ATOM   6048  N N   . ALA D 4 113 ? 38.186  51.992  3.728   1.00 86.70  ? 109 ALA A N   1 
ATOM   6049  C CA  . ALA D 4 113 ? 38.769  53.283  3.364   1.00 83.78  ? 109 ALA A CA  1 
ATOM   6050  C C   . ALA D 4 113 ? 38.406  53.649  1.935   1.00 83.02  ? 109 ALA A C   1 
ATOM   6051  O O   . ALA D 4 113 ? 38.816  52.956  1.003   1.00 85.61  ? 109 ALA A O   1 
ATOM   6052  C CB  . ALA D 4 113 ? 40.292  53.226  3.520   1.00 84.21  ? 109 ALA A CB  1 
ATOM   6053  N N   . ASP D 4 114 ? 37.642  54.730  1.764   1.00 85.67  ? 110 ASP A N   1 
ATOM   6054  C CA  . ASP D 4 114 ? 37.162  55.142  0.440   1.00 80.69  ? 110 ASP A CA  1 
ATOM   6055  C C   . ASP D 4 114 ? 38.257  54.889  -0.605  1.00 78.19  ? 110 ASP A C   1 
ATOM   6056  O O   . ASP D 4 114 ? 39.450  54.967  -0.294  1.00 78.22  ? 110 ASP A O   1 
ATOM   6057  C CB  . ASP D 4 114 ? 36.714  56.613  0.444   1.00 83.95  ? 110 ASP A CB  1 
ATOM   6058  C CG  . ASP D 4 114 ? 35.529  56.886  1.396   1.00 90.78  ? 110 ASP A CG  1 
ATOM   6059  O OD1 . ASP D 4 114 ? 35.128  55.975  2.159   1.00 89.92  ? 110 ASP A OD1 1 
ATOM   6060  O OD2 . ASP D 4 114 ? 34.998  58.025  1.383   1.00 91.05  ? 110 ASP A OD2 1 
ATOM   6061  N N   . ALA D 4 115 ? 37.868  54.552  -1.831  1.00 75.89  ? 111 ALA A N   1 
ATOM   6062  C CA  . ALA D 4 115 ? 38.869  54.138  -2.818  1.00 75.80  ? 111 ALA A CA  1 
ATOM   6063  C C   . ALA D 4 115 ? 38.601  54.652  -4.226  1.00 74.17  ? 111 ALA A C   1 
ATOM   6064  O O   . ALA D 4 115 ? 37.473  54.619  -4.711  1.00 73.11  ? 111 ALA A O   1 
ATOM   6065  C CB  . ALA D 4 115 ? 39.029  52.628  -2.822  1.00 70.11  ? 111 ALA A CB  1 
ATOM   6066  N N   . ALA D 4 116 ? 39.664  55.123  -4.870  1.00 73.00  ? 112 ALA A N   1 
ATOM   6067  C CA  . ALA D 4 116 ? 39.581  55.734  -6.187  1.00 70.06  ? 112 ALA A CA  1 
ATOM   6068  C C   . ALA D 4 116 ? 39.428  54.691  -7.288  1.00 62.60  ? 112 ALA A C   1 
ATOM   6069  O O   . ALA D 4 116 ? 40.247  53.786  -7.393  1.00 64.96  ? 112 ALA A O   1 
ATOM   6070  C CB  . ALA D 4 116 ? 40.831  56.576  -6.429  1.00 74.52  ? 112 ALA A CB  1 
ATOM   6071  N N   . PRO D 4 117 ? 38.390  54.829  -8.125  1.00 60.24  ? 113 PRO A N   1 
ATOM   6072  C CA  . PRO D 4 117 ? 38.158  53.929  -9.261  1.00 63.26  ? 113 PRO A CA  1 
ATOM   6073  C C   . PRO D 4 117 ? 39.410  53.691  -10.069 1.00 60.16  ? 113 PRO A C   1 
ATOM   6074  O O   . PRO D 4 117 ? 40.493  54.104  -9.678  1.00 65.34  ? 113 PRO A O   1 
ATOM   6075  C CB  . PRO D 4 117 ? 37.156  54.698  -10.113 1.00 58.14  ? 113 PRO A CB  1 
ATOM   6076  C CG  . PRO D 4 117 ? 36.395  55.511  -9.132  1.00 58.18  ? 113 PRO A CG  1 
ATOM   6077  C CD  . PRO D 4 117 ? 37.336  55.848  -8.004  1.00 60.34  ? 113 PRO A CD  1 
ATOM   6078  N N   . THR D 4 118 ? 39.265  53.010  -11.191 1.00 59.39  ? 114 THR A N   1 
ATOM   6079  C CA  . THR D 4 118 ? 40.384  52.831  -12.102 1.00 66.34  ? 114 THR A CA  1 
ATOM   6080  C C   . THR D 4 118 ? 39.798  52.642  -13.484 1.00 72.03  ? 114 THR A C   1 
ATOM   6081  O O   . THR D 4 118 ? 39.015  51.721  -13.716 1.00 72.44  ? 114 THR A O   1 
ATOM   6082  C CB  . THR D 4 118 ? 41.307  51.651  -11.703 1.00 63.09  ? 114 THR A CB  1 
ATOM   6083  O OG1 . THR D 4 118 ? 42.365  52.139  -10.870 1.00 66.82  ? 114 THR A OG1 1 
ATOM   6084  C CG2 . THR D 4 118 ? 41.920  50.982  -12.936 1.00 61.75  ? 114 THR A CG2 1 
ATOM   6085  N N   . VAL D 4 119 ? 40.160  53.526  -14.405 1.00 74.41  ? 115 VAL A N   1 
ATOM   6086  C CA  . VAL D 4 119 ? 39.456  53.554  -15.675 1.00 72.52  ? 115 VAL A CA  1 
ATOM   6087  C C   . VAL D 4 119 ? 40.298  53.233  -16.924 1.00 71.01  ? 115 VAL A C   1 
ATOM   6088  O O   . VAL D 4 119 ? 41.417  53.720  -17.104 1.00 68.79  ? 115 VAL A O   1 
ATOM   6089  C CB  . VAL D 4 119 ? 38.635  54.843  -15.805 1.00 69.80  ? 115 VAL A CB  1 
ATOM   6090  C CG1 . VAL D 4 119 ? 37.686  54.739  -16.970 1.00 70.67  ? 115 VAL A CG1 1 
ATOM   6091  C CG2 . VAL D 4 119 ? 37.860  55.089  -14.510 1.00 59.95  ? 115 VAL A CG2 1 
ATOM   6092  N N   . SER D 4 120 ? 39.711  52.385  -17.764 1.00 74.10  ? 116 SER A N   1 
ATOM   6093  C CA  . SER D 4 120 ? 40.323  51.861  -18.968 1.00 76.36  ? 116 SER A CA  1 
ATOM   6094  C C   . SER D 4 120 ? 39.187  51.728  -19.966 1.00 76.24  ? 116 SER A C   1 
ATOM   6095  O O   . SER D 4 120 ? 38.119  51.238  -19.613 1.00 74.23  ? 116 SER A O   1 
ATOM   6096  C CB  . SER D 4 120 ? 40.910  50.492  -18.665 1.00 79.42  ? 116 SER A CB  1 
ATOM   6097  O OG  . SER D 4 120 ? 40.461  50.031  -17.393 1.00 79.71  ? 116 SER A OG  1 
ATOM   6098  N N   . ILE D 4 121 ? 39.401  52.187  -21.197 1.00 81.36  ? 117 ILE A N   1 
ATOM   6099  C CA  . ILE D 4 121 ? 38.338  52.216  -22.210 1.00 81.88  ? 117 ILE A CA  1 
ATOM   6100  C C   . ILE D 4 121 ? 38.824  51.520  -23.462 1.00 81.00  ? 117 ILE A C   1 
ATOM   6101  O O   . ILE D 4 121 ? 39.939  51.778  -23.915 1.00 77.99  ? 117 ILE A O   1 
ATOM   6102  C CB  . ILE D 4 121 ? 37.947  53.654  -22.592 1.00 78.96  ? 117 ILE A CB  1 
ATOM   6103  C CG1 . ILE D 4 121 ? 36.436  53.826  -22.587 1.00 77.38  ? 117 ILE A CG1 1 
ATOM   6104  C CG2 . ILE D 4 121 ? 38.472  54.014  -23.969 1.00 77.51  ? 117 ILE A CG2 1 
ATOM   6105  C CD1 . ILE D 4 121 ? 36.000  55.168  -23.135 1.00 81.18  ? 117 ILE A CD1 1 
ATOM   6106  N N   . PHE D 4 122 ? 37.996  50.647  -24.028 1.00 80.36  ? 118 PHE A N   1 
ATOM   6107  C CA  . PHE D 4 122 ? 38.462  49.783  -25.108 1.00 84.87  ? 118 PHE A CA  1 
ATOM   6108  C C   . PHE D 4 122 ? 37.742  49.961  -26.458 1.00 87.47  ? 118 PHE A C   1 
ATOM   6109  O O   . PHE D 4 122 ? 36.508  50.071  -26.516 1.00 83.23  ? 118 PHE A O   1 
ATOM   6110  C CB  . PHE D 4 122 ? 38.439  48.315  -24.665 1.00 86.85  ? 118 PHE A CB  1 
ATOM   6111  C CG  . PHE D 4 122 ? 39.614  47.909  -23.804 1.00 86.12  ? 118 PHE A CG  1 
ATOM   6112  C CD1 . PHE D 4 122 ? 39.416  47.406  -22.532 1.00 85.80  ? 118 PHE A CD1 1 
ATOM   6113  C CD2 . PHE D 4 122 ? 40.911  48.019  -24.271 1.00 90.53  ? 118 PHE A CD2 1 
ATOM   6114  C CE1 . PHE D 4 122 ? 40.488  47.020  -21.741 1.00 85.21  ? 118 PHE A CE1 1 
ATOM   6115  C CE2 . PHE D 4 122 ? 41.985  47.637  -23.477 1.00 91.82  ? 118 PHE A CE2 1 
ATOM   6116  C CZ  . PHE D 4 122 ? 41.770  47.137  -22.216 1.00 85.90  ? 118 PHE A CZ  1 
ATOM   6117  N N   . PRO D 4 123 ? 38.525  49.980  -27.555 1.00 91.10  ? 119 PRO A N   1 
ATOM   6118  C CA  . PRO D 4 123 ? 37.958  50.215  -28.877 1.00 87.04  ? 119 PRO A CA  1 
ATOM   6119  C C   . PRO D 4 123 ? 37.618  48.885  -29.497 1.00 88.87  ? 119 PRO A C   1 
ATOM   6120  O O   . PRO D 4 123 ? 38.314  47.900  -29.256 1.00 86.42  ? 119 PRO A O   1 
ATOM   6121  C CB  . PRO D 4 123 ? 39.122  50.849  -29.655 1.00 85.82  ? 119 PRO A CB  1 
ATOM   6122  C CG  . PRO D 4 123 ? 40.359  50.720  -28.756 1.00 93.64  ? 119 PRO A CG  1 
ATOM   6123  C CD  . PRO D 4 123 ? 39.980  49.782  -27.638 1.00 92.85  ? 119 PRO A CD  1 
ATOM   6124  N N   . PRO D 4 124 ? 36.549  48.857  -30.293 1.00 92.04  ? 120 PRO A N   1 
ATOM   6125  C CA  . PRO D 4 124 ? 36.080  47.677  -31.022 1.00 94.49  ? 120 PRO A CA  1 
ATOM   6126  C C   . PRO D 4 124 ? 37.192  46.919  -31.743 1.00 96.96  ? 120 PRO A C   1 
ATOM   6127  O O   . PRO D 4 124 ? 38.045  47.502  -32.423 1.00 95.79  ? 120 PRO A O   1 
ATOM   6128  C CB  . PRO D 4 124 ? 35.092  48.271  -32.020 1.00 92.08  ? 120 PRO A CB  1 
ATOM   6129  C CG  . PRO D 4 124 ? 34.522  49.440  -31.285 1.00 88.94  ? 120 PRO A CG  1 
ATOM   6130  C CD  . PRO D 4 124 ? 35.657  50.012  -30.486 1.00 89.85  ? 120 PRO A CD  1 
ATOM   6131  N N   . SER D 4 125 ? 37.170  45.603  -31.569 1.00 99.62  ? 121 SER A N   1 
ATOM   6132  C CA  . SER D 4 125 ? 38.133  44.725  -32.201 1.00 101.27 ? 121 SER A CA  1 
ATOM   6133  C C   . SER D 4 125 ? 37.931  44.757  -33.706 1.00 103.64 ? 121 SER A C   1 
ATOM   6134  O O   . SER D 4 125 ? 36.935  45.295  -34.198 1.00 101.97 ? 121 SER A O   1 
ATOM   6135  C CB  . SER D 4 125 ? 37.972  43.306  -31.662 1.00 98.14  ? 121 SER A CB  1 
ATOM   6136  O OG  . SER D 4 125 ? 36.673  43.129  -31.125 1.00 93.84  ? 121 SER A OG  1 
ATOM   6137  N N   . SER D 4 126 ? 38.886  44.189  -34.434 1.00 107.38 ? 122 SER A N   1 
ATOM   6138  C CA  . SER D 4 126 ? 38.816  44.142  -35.890 1.00 109.19 ? 122 SER A CA  1 
ATOM   6139  C C   . SER D 4 126 ? 37.802  43.076  -36.339 1.00 106.09 ? 122 SER A C   1 
ATOM   6140  O O   . SER D 4 126 ? 37.132  43.215  -37.365 1.00 101.12 ? 122 SER A O   1 
ATOM   6141  C CB  . SER D 4 126 ? 40.209  43.856  -36.458 1.00 107.10 ? 122 SER A CB  1 
ATOM   6142  O OG  . SER D 4 126 ? 41.203  44.548  -35.705 1.00 110.08 ? 122 SER A OG  1 
ATOM   6143  N N   . GLU D 4 127 ? 37.678  42.022  -35.541 1.00 103.38 ? 123 GLU A N   1 
ATOM   6144  C CA  . GLU D 4 127 ? 36.778  40.926  -35.854 1.00 97.89  ? 123 GLU A CA  1 
ATOM   6145  C C   . GLU D 4 127 ? 35.347  41.403  -35.836 1.00 95.07  ? 123 GLU A C   1 
ATOM   6146  O O   . GLU D 4 127 ? 34.573  41.111  -36.737 1.00 101.13 ? 123 GLU A O   1 
ATOM   6147  C CB  . GLU D 4 127 ? 36.952  39.777  -34.860 1.00 98.80  ? 123 GLU A CB  1 
ATOM   6148  C CG  . GLU D 4 127 ? 37.897  40.067  -33.703 1.00 106.36 ? 123 GLU A CG  1 
ATOM   6149  C CD  . GLU D 4 127 ? 39.371  40.144  -34.117 1.00 114.13 ? 123 GLU A CD  1 
ATOM   6150  O OE1 . GLU D 4 127 ? 39.671  40.616  -35.241 1.00 109.73 ? 123 GLU A OE1 1 
ATOM   6151  O OE2 . GLU D 4 127 ? 40.237  39.742  -33.301 1.00 116.12 ? 123 GLU A OE2 1 
ATOM   6152  N N   . GLN D 4 128 ? 34.995  42.143  -34.799 1.00 94.12  ? 124 GLN A N   1 
ATOM   6153  C CA  . GLN D 4 128 ? 33.631  42.619  -34.645 1.00 96.64  ? 124 GLN A CA  1 
ATOM   6154  C C   . GLN D 4 128 ? 33.257  43.530  -35.801 1.00 96.05  ? 124 GLN A C   1 
ATOM   6155  O O   . GLN D 4 128 ? 32.131  43.498  -36.303 1.00 91.55  ? 124 GLN A O   1 
ATOM   6156  C CB  . GLN D 4 128 ? 33.504  43.376  -33.329 1.00 97.24  ? 124 GLN A CB  1 
ATOM   6157  C CG  . GLN D 4 128 ? 32.090  43.602  -32.848 1.00 93.50  ? 124 GLN A CG  1 
ATOM   6158  C CD  . GLN D 4 128 ? 32.079  44.458  -31.611 1.00 93.36  ? 124 GLN A CD  1 
ATOM   6159  O OE1 . GLN D 4 128 ? 33.091  44.564  -30.916 1.00 95.07  ? 124 GLN A OE1 1 
ATOM   6160  N NE2 . GLN D 4 128 ? 30.949  45.088  -31.330 1.00 93.05  ? 124 GLN A NE2 1 
ATOM   6161  N N   . LEU D 4 129 ? 34.230  44.333  -36.220 1.00 99.92  ? 125 LEU A N   1 
ATOM   6162  C CA  . LEU D 4 129 ? 34.044  45.326  -37.275 1.00 100.86 ? 125 LEU A CA  1 
ATOM   6163  C C   . LEU D 4 129 ? 34.068  44.718  -38.680 1.00 98.58  ? 125 LEU A C   1 
ATOM   6164  O O   . LEU D 4 129 ? 33.582  45.322  -39.637 1.00 91.30  ? 125 LEU A O   1 
ATOM   6165  C CB  . LEU D 4 129 ? 35.114  46.407  -37.154 1.00 101.72 ? 125 LEU A CB  1 
ATOM   6166  C CG  . LEU D 4 129 ? 35.063  47.230  -35.870 1.00 96.88  ? 125 LEU A CG  1 
ATOM   6167  C CD1 . LEU D 4 129 ? 36.338  48.045  -35.724 1.00 100.08 ? 125 LEU A CD1 1 
ATOM   6168  C CD2 . LEU D 4 129 ? 33.828  48.120  -35.867 1.00 91.74  ? 125 LEU A CD2 1 
ATOM   6169  N N   . THR D 4 130 ? 34.655  43.531  -38.799 1.00 100.33 ? 126 THR A N   1 
ATOM   6170  C CA  . THR D 4 130 ? 34.573  42.758  -40.028 1.00 97.31  ? 126 THR A CA  1 
ATOM   6171  C C   . THR D 4 130 ? 33.123  42.304  -40.197 1.00 96.12  ? 126 THR A C   1 
ATOM   6172  O O   . THR D 4 130 ? 32.526  42.458  -41.267 1.00 95.34  ? 126 THR A O   1 
ATOM   6173  C CB  . THR D 4 130 ? 35.507  41.524  -39.978 1.00 96.99  ? 126 THR A CB  1 
ATOM   6174  O OG1 . THR D 4 130 ? 36.817  41.916  -39.541 1.00 91.61  ? 126 THR A OG1 1 
ATOM   6175  C CG2 . THR D 4 130 ? 35.602  40.866  -41.346 1.00 100.23 ? 126 THR A CG2 1 
ATOM   6176  N N   . SER D 4 131 ? 32.559  41.777  -39.111 1.00 95.47  ? 127 SER A N   1 
ATOM   6177  C CA  . SER D 4 131 ? 31.205  41.230  -39.108 1.00 97.88  ? 127 SER A CA  1 
ATOM   6178  C C   . SER D 4 131 ? 30.137  42.316  -38.986 1.00 96.70  ? 127 SER A C   1 
ATOM   6179  O O   . SER D 4 131 ? 28.973  42.034  -38.698 1.00 98.54  ? 127 SER A O   1 
ATOM   6180  C CB  . SER D 4 131 ? 31.046  40.200  -37.984 1.00 100.16 ? 127 SER A CB  1 
ATOM   6181  O OG  . SER D 4 131 ? 32.037  39.189  -38.066 1.00 100.48 ? 127 SER A OG  1 
ATOM   6182  N N   . GLY D 4 132 ? 30.537  43.559  -39.210 1.00 94.66  ? 128 GLY A N   1 
ATOM   6183  C CA  . GLY D 4 132 ? 29.588  44.650  -39.281 1.00 95.54  ? 128 GLY A CA  1 
ATOM   6184  C C   . GLY D 4 132 ? 28.969  44.981  -37.945 1.00 93.35  ? 128 GLY A C   1 
ATOM   6185  O O   . GLY D 4 132 ? 27.791  45.330  -37.872 1.00 90.84  ? 128 GLY A O   1 
ATOM   6186  N N   . GLY D 4 133 ? 29.770  44.877  -36.889 1.00 96.70  ? 129 GLY A N   1 
ATOM   6187  C CA  . GLY D 4 133 ? 29.325  45.227  -35.547 1.00 101.64 ? 129 GLY A CA  1 
ATOM   6188  C C   . GLY D 4 133 ? 30.308  46.082  -34.747 1.00 102.29 ? 129 GLY A C   1 
ATOM   6189  O O   . GLY D 4 133 ? 31.525  45.827  -34.761 1.00 98.11  ? 129 GLY A O   1 
ATOM   6190  N N   . ALA D 4 134 ? 29.781  47.090  -34.041 1.00 98.99  ? 130 ALA A N   1 
ATOM   6191  C CA  . ALA D 4 134 ? 30.617  48.036  -33.291 1.00 96.76  ? 130 ALA A CA  1 
ATOM   6192  C C   . ALA D 4 134 ? 30.050  48.433  -31.917 1.00 97.74  ? 130 ALA A C   1 
ATOM   6193  O O   . ALA D 4 134 ? 29.038  49.145  -31.831 1.00 93.69  ? 130 ALA A O   1 
ATOM   6194  C CB  . ALA D 4 134 ? 30.884  49.283  -34.131 1.00 95.99  ? 130 ALA A CB  1 
ATOM   6195  N N   . SER D 4 135 ? 30.718  47.981  -30.851 1.00 94.81  ? 131 SER A N   1 
ATOM   6196  C CA  . SER D 4 135 ? 30.337  48.336  -29.480 1.00 87.94  ? 131 SER A CA  1 
ATOM   6197  C C   . SER D 4 135 ? 31.551  48.508  -28.565 1.00 81.84  ? 131 SER A C   1 
ATOM   6198  O O   . SER D 4 135 ? 32.473  47.695  -28.571 1.00 76.30  ? 131 SER A O   1 
ATOM   6199  C CB  . SER D 4 135 ? 29.340  47.329  -28.897 1.00 89.67  ? 131 SER A CB  1 
ATOM   6200  O OG  . SER D 4 135 ? 29.826  46.002  -28.992 1.00 88.19  ? 131 SER A OG  1 
ATOM   6201  N N   . VAL D 4 136 ? 31.539  49.583  -27.785 1.00 81.40  ? 132 VAL A N   1 
ATOM   6202  C CA  . VAL D 4 136 ? 32.701  49.976  -27.005 1.00 82.57  ? 132 VAL A CA  1 
ATOM   6203  C C   . VAL D 4 136 ? 32.539  49.632  -25.534 1.00 83.14  ? 132 VAL A C   1 
ATOM   6204  O O   . VAL D 4 136 ? 31.509  49.919  -24.933 1.00 83.60  ? 132 VAL A O   1 
ATOM   6205  C CB  . VAL D 4 136 ? 32.966  51.487  -27.127 1.00 80.53  ? 132 VAL A CB  1 
ATOM   6206  C CG1 . VAL D 4 136 ? 33.808  51.966  -25.974 1.00 83.12  ? 132 VAL A CG1 1 
ATOM   6207  C CG2 . VAL D 4 136 ? 33.658  51.802  -28.429 1.00 82.49  ? 132 VAL A CG2 1 
ATOM   6208  N N   . VAL D 4 137 ? 33.578  49.039  -24.957 1.00 78.18  ? 133 VAL A N   1 
ATOM   6209  C CA  . VAL D 4 137 ? 33.559  48.642  -23.554 1.00 79.74  ? 133 VAL A CA  1 
ATOM   6210  C C   . VAL D 4 137 ? 34.530  49.436  -22.663 1.00 87.54  ? 133 VAL A C   1 
ATOM   6211  O O   . VAL D 4 137 ? 35.713  49.602  -22.990 1.00 86.73  ? 133 VAL A O   1 
ATOM   6212  C CB  . VAL D 4 137 ? 33.836  47.136  -23.412 1.00 84.41  ? 133 VAL A CB  1 
ATOM   6213  C CG1 . VAL D 4 137 ? 34.885  46.868  -22.341 1.00 84.77  ? 133 VAL A CG1 1 
ATOM   6214  C CG2 . VAL D 4 137 ? 32.540  46.392  -23.115 1.00 91.30  ? 133 VAL A CG2 1 
ATOM   6215  N N   . CYS D 4 138 ? 34.015  49.915  -21.531 1.00 85.42  ? 134 CYS A N   1 
ATOM   6216  C CA  . CYS D 4 138 ? 34.787  50.712  -20.579 1.00 78.32  ? 134 CYS A CA  1 
ATOM   6217  C C   . CYS D 4 138 ? 34.722  50.071  -19.196 1.00 79.53  ? 134 CYS A C   1 
ATOM   6218  O O   . CYS D 4 138 ? 33.640  49.731  -18.728 1.00 84.41  ? 134 CYS A O   1 
ATOM   6219  C CB  . CYS D 4 138 ? 34.217  52.128  -20.539 1.00 78.78  ? 134 CYS A CB  1 
ATOM   6220  S SG  . CYS D 4 138 ? 34.734  53.190  -19.173 1.00 77.04  ? 134 CYS A SG  1 
ATOM   6221  N N   . PHE D 4 139 ? 35.872  49.911  -18.545 1.00 79.46  ? 135 PHE A N   1 
ATOM   6222  C CA  . PHE D 4 139 ? 35.959  49.190  -17.270 1.00 75.30  ? 135 PHE A CA  1 
ATOM   6223  C C   . PHE D 4 139 ? 36.153  50.106  -16.058 1.00 67.94  ? 135 PHE A C   1 
ATOM   6224  O O   . PHE D 4 139 ? 36.958  51.019  -16.096 1.00 67.73  ? 135 PHE A O   1 
ATOM   6225  C CB  . PHE D 4 139 ? 37.121  48.191  -17.313 1.00 78.52  ? 135 PHE A CB  1 
ATOM   6226  C CG  . PHE D 4 139 ? 36.786  46.863  -17.966 1.00 79.89  ? 135 PHE A CG  1 
ATOM   6227  C CD1 . PHE D 4 139 ? 35.582  46.223  -17.710 1.00 82.76  ? 135 PHE A CD1 1 
ATOM   6228  C CD2 . PHE D 4 139 ? 37.704  46.231  -18.793 1.00 79.64  ? 135 PHE A CD2 1 
ATOM   6229  C CE1 . PHE D 4 139 ? 35.287  44.996  -18.293 1.00 84.66  ? 135 PHE A CE1 1 
ATOM   6230  C CE2 . PHE D 4 139 ? 37.415  45.011  -19.378 1.00 83.51  ? 135 PHE A CE2 1 
ATOM   6231  C CZ  . PHE D 4 139 ? 36.205  44.394  -19.131 1.00 84.50  ? 135 PHE A CZ  1 
ATOM   6232  N N   . LEU D 4 140 ? 35.423  49.850  -14.979 1.00 68.36  ? 136 LEU A N   1 
ATOM   6233  C CA  . LEU D 4 140 ? 35.625  50.576  -13.715 1.00 70.87  ? 136 LEU A CA  1 
ATOM   6234  C C   . LEU D 4 140 ? 35.955  49.640  -12.517 1.00 72.48  ? 136 LEU A C   1 
ATOM   6235  O O   . LEU D 4 140 ? 35.062  48.995  -11.963 1.00 73.24  ? 136 LEU A O   1 
ATOM   6236  C CB  . LEU D 4 140 ? 34.401  51.442  -13.394 1.00 62.75  ? 136 LEU A CB  1 
ATOM   6237  C CG  . LEU D 4 140 ? 34.263  52.744  -14.179 1.00 61.89  ? 136 LEU A CG  1 
ATOM   6238  C CD1 . LEU D 4 140 ? 34.289  52.474  -15.658 1.00 70.74  ? 136 LEU A CD1 1 
ATOM   6239  C CD2 . LEU D 4 140 ? 32.999  53.487  -13.818 1.00 59.94  ? 136 LEU A CD2 1 
ATOM   6240  N N   . ASN D 4 141 ? 37.222  49.572  -12.104 1.00 67.11  ? 137 ASN A N   1 
ATOM   6241  C CA  . ASN D 4 141 ? 37.628  48.566  -11.115 1.00 66.45  ? 137 ASN A CA  1 
ATOM   6242  C C   . ASN D 4 141 ? 38.202  49.038  -9.767  1.00 70.87  ? 137 ASN A C   1 
ATOM   6243  O O   . ASN D 4 141 ? 39.125  49.853  -9.725  1.00 68.53  ? 137 ASN A O   1 
ATOM   6244  C CB  . ASN D 4 141 ? 38.582  47.552  -11.742 1.00 67.30  ? 137 ASN A CB  1 
ATOM   6245  C CG  . ASN D 4 141 ? 37.979  46.848  -12.939 1.00 71.36  ? 137 ASN A CG  1 
ATOM   6246  O OD1 . ASN D 4 141 ? 37.062  47.360  -13.580 1.00 65.38  ? 137 ASN A OD1 1 
ATOM   6247  N ND2 . ASN D 4 141 ? 38.502  45.665  -13.253 1.00 74.95  ? 137 ASN A ND2 1 
ATOM   6248  N N   . ASN D 4 142 ? 37.620  48.498  -8.687  1.00 73.80  ? 138 ASN A N   1 
ATOM   6249  C CA  . ASN D 4 142 ? 38.118  48.579  -7.309  1.00 67.32  ? 138 ASN A CA  1 
ATOM   6250  C C   . ASN D 4 142 ? 37.873  49.899  -6.600  1.00 67.06  ? 138 ASN A C   1 
ATOM   6251  O O   . ASN D 4 142 ? 38.817  50.568  -6.227  1.00 73.64  ? 138 ASN A O   1 
ATOM   6252  C CB  . ASN D 4 142 ? 39.607  48.239  -7.263  1.00 68.52  ? 138 ASN A CB  1 
ATOM   6253  C CG  . ASN D 4 142 ? 39.940  46.994  -8.058  1.00 74.86  ? 138 ASN A CG  1 
ATOM   6254  O OD1 . ASN D 4 142 ? 40.466  47.070  -9.173  1.00 80.57  ? 138 ASN A OD1 1 
ATOM   6255  N ND2 . ASN D 4 142 ? 39.628  45.835  -7.493  1.00 76.77  ? 138 ASN A ND2 1 
ATOM   6256  N N   . PHE D 4 143 ? 36.616  50.264  -6.395  1.00 66.99  ? 139 PHE A N   1 
ATOM   6257  C CA  . PHE D 4 143 ? 36.271  51.527  -5.763  1.00 68.28  ? 139 PHE A CA  1 
ATOM   6258  C C   . PHE D 4 143 ? 35.268  51.392  -4.648  1.00 67.08  ? 139 PHE A C   1 
ATOM   6259  O O   . PHE D 4 143 ? 34.161  51.044  -4.905  1.00 69.86  ? 139 PHE A O   1 
ATOM   6260  C CB  . PHE D 4 143 ? 35.625  52.386  -6.794  1.00 68.19  ? 139 PHE A CB  1 
ATOM   6261  C CG  . PHE D 4 143 ? 34.623  51.672  -7.602  1.00 63.43  ? 139 PHE A CG  1 
ATOM   6262  C CD1 . PHE D 4 143 ? 33.308  51.748  -7.295  1.00 62.08  ? 139 PHE A CD1 1 
ATOM   6263  C CD2 . PHE D 4 143 ? 34.995  50.942  -8.680  1.00 65.35  ? 139 PHE A CD2 1 
ATOM   6264  C CE1 . PHE D 4 143 ? 32.395  51.119  -8.046  1.00 64.76  ? 139 PHE A CE1 1 
ATOM   6265  C CE2 . PHE D 4 143 ? 34.076  50.303  -9.424  1.00 66.23  ? 139 PHE A CE2 1 
ATOM   6266  C CZ  . PHE D 4 143 ? 32.777  50.387  -9.097  1.00 66.38  ? 139 PHE A CZ  1 
ATOM   6267  N N   . TYR D 4 144 ? 35.624  51.727  -3.420  1.00 68.79  ? 140 TYR A N   1 
ATOM   6268  C CA  . TYR D 4 144 ? 34.830  51.313  -2.272  1.00 75.01  ? 140 TYR A CA  1 
ATOM   6269  C C   . TYR D 4 144 ? 33.434  51.833  -2.047  1.00 72.97  ? 140 TYR A C   1 
ATOM   6270  O O   . TYR D 4 144 ? 32.706  51.262  -1.260  1.00 82.27  ? 140 TYR A O   1 
ATOM   6271  C CB  . TYR D 4 144 ? 35.539  51.478  -0.939  1.00 77.48  ? 140 TYR A CB  1 
ATOM   6272  C CG  . TYR D 4 144 ? 34.526  51.262  0.133   1.00 73.81  ? 140 TYR A CG  1 
ATOM   6273  C CD1 . TYR D 4 144 ? 33.929  50.052  0.265   1.00 75.42  ? 140 TYR A CD1 1 
ATOM   6274  C CD2 . TYR D 4 144 ? 34.066  52.284  0.906   1.00 78.15  ? 140 TYR A CD2 1 
ATOM   6275  C CE1 . TYR D 4 144 ? 32.975  49.839  1.179   1.00 81.28  ? 140 TYR A CE1 1 
ATOM   6276  C CE2 . TYR D 4 144 ? 33.101  52.075  1.839   1.00 82.36  ? 140 TYR A CE2 1 
ATOM   6277  C CZ  . TYR D 4 144 ? 32.555  50.844  1.969   1.00 82.19  ? 140 TYR A CZ  1 
ATOM   6278  O OH  . TYR D 4 144 ? 31.577  50.590  2.899   1.00 82.46  ? 140 TYR A OH  1 
ATOM   6279  N N   . PRO D 4 145 ? 33.038  52.927  -2.660  1.00 66.83  ? 141 PRO A N   1 
ATOM   6280  C CA  . PRO D 4 145 ? 31.657  53.325  -2.431  1.00 73.76  ? 141 PRO A CA  1 
ATOM   6281  C C   . PRO D 4 145 ? 30.715  52.945  -3.565  1.00 78.50  ? 141 PRO A C   1 
ATOM   6282  O O   . PRO D 4 145 ? 30.605  53.610  -4.570  1.00 75.55  ? 141 PRO A O   1 
ATOM   6283  C CB  . PRO D 4 145 ? 31.764  54.818  -2.240  1.00 72.12  ? 141 PRO A CB  1 
ATOM   6284  C CG  . PRO D 4 145 ? 33.068  54.997  -1.685  1.00 79.76  ? 141 PRO A CG  1 
ATOM   6285  C CD  . PRO D 4 145 ? 33.952  54.039  -2.366  1.00 74.83  ? 141 PRO A CD  1 
ATOM   6286  N N   . LYS D 4 146 ? 30.006  51.850  -3.371  1.00 87.32  ? 142 LYS A N   1 
ATOM   6287  C CA  . LYS D 4 146 ? 29.099  51.353  -4.382  1.00 81.48  ? 142 LYS A CA  1 
ATOM   6288  C C   . LYS D 4 146 ? 28.442  52.455  -5.189  1.00 80.19  ? 142 LYS A C   1 
ATOM   6289  O O   . LYS D 4 146 ? 28.132  52.278  -6.350  1.00 82.59  ? 142 LYS A O   1 
ATOM   6290  C CB  . LYS D 4 146 ? 28.038  50.444  -3.762  1.00 84.00  ? 142 LYS A CB  1 
ATOM   6291  C CG  . LYS D 4 146 ? 27.674  50.763  -2.330  1.00 91.72  ? 142 LYS A CG  1 
ATOM   6292  C CD  . LYS D 4 146 ? 28.723  50.305  -1.337  1.00 85.70  ? 142 LYS A CD  1 
ATOM   6293  C CE  . LYS D 4 146 ? 28.562  51.034  -0.025  1.00 82.97  ? 142 LYS A CE  1 
ATOM   6294  N NZ  . LYS D 4 146 ? 28.491  50.103  1.112   1.00 78.02  ? 142 LYS A NZ  1 
ATOM   6295  N N   . ASP D 4 147 ? 28.205  53.596  -4.584  1.00 76.85  ? 143 ASP A N   1 
ATOM   6296  C CA  . ASP D 4 147 ? 27.552  54.637  -5.329  1.00 78.24  ? 143 ASP A CA  1 
ATOM   6297  C C   . ASP D 4 147 ? 28.435  54.934  -6.501  1.00 74.91  ? 143 ASP A C   1 
ATOM   6298  O O   . ASP D 4 147 ? 29.588  54.597  -6.477  1.00 75.66  ? 143 ASP A O   1 
ATOM   6299  C CB  . ASP D 4 147 ? 27.372  55.866  -4.472  1.00 84.10  ? 143 ASP A CB  1 
ATOM   6300  C CG  . ASP D 4 147 ? 26.232  55.733  -3.532  1.00 98.34  ? 143 ASP A CG  1 
ATOM   6301  O OD1 . ASP D 4 147 ? 25.910  54.593  -3.180  1.00 94.76  ? 143 ASP A OD1 1 
ATOM   6302  O OD2 . ASP D 4 147 ? 25.660  56.762  -3.150  1.00 107.90 ? 143 ASP A OD2 1 
ATOM   6303  N N   . ILE D 4 148 ? 27.895  55.569  -7.527  1.00 75.97  ? 144 ILE A N   1 
ATOM   6304  C CA  . ILE D 4 148 ? 28.649  55.815  -8.732  1.00 73.41  ? 144 ILE A CA  1 
ATOM   6305  C C   . ILE D 4 148 ? 27.757  55.777  -9.956  1.00 78.44  ? 144 ILE A C   1 
ATOM   6306  O O   . ILE D 4 148 ? 26.989  54.859  -10.134 1.00 84.67  ? 144 ILE A O   1 
ATOM   6307  C CB  . ILE D 4 148 ? 29.666  54.740  -8.891  1.00 69.85  ? 144 ILE A CB  1 
ATOM   6308  C CG1 . ILE D 4 148 ? 30.012  54.557  -10.346 1.00 62.11  ? 144 ILE A CG1 1 
ATOM   6309  C CG2 . ILE D 4 148 ? 29.098  53.463  -8.412  1.00 69.72  ? 144 ILE A CG2 1 
ATOM   6310  C CD1 . ILE D 4 148 ? 30.930  53.439  -10.535 1.00 53.72  ? 144 ILE A CD1 1 
ATOM   6311  N N   . ASN D 4 149 ? 27.861  56.772  -10.814 1.00 75.48  ? 145 ASN A N   1 
ATOM   6312  C CA  . ASN D 4 149 ? 27.080  56.758  -12.043 1.00 81.15  ? 145 ASN A CA  1 
ATOM   6313  C C   . ASN D 4 149 ? 27.925  57.064  -13.283 1.00 79.37  ? 145 ASN A C   1 
ATOM   6314  O O   . ASN D 4 149 ? 29.004  57.640  -13.189 1.00 77.57  ? 145 ASN A O   1 
ATOM   6315  C CB  . ASN D 4 149 ? 25.900  57.705  -11.927 1.00 76.16  ? 145 ASN A CB  1 
ATOM   6316  C CG  . ASN D 4 149 ? 26.333  59.094  -11.589 1.00 80.75  ? 145 ASN A CG  1 
ATOM   6317  O OD1 . ASN D 4 149 ? 26.460  59.945  -12.474 1.00 87.44  ? 145 ASN A OD1 1 
ATOM   6318  N ND2 . ASN D 4 149 ? 26.603  59.335  -10.307 1.00 75.43  ? 145 ASN A ND2 1 
ATOM   6319  N N   . VAL D 4 150 ? 27.428  56.659  -14.443 1.00 78.52  ? 146 VAL A N   1 
ATOM   6320  C CA  . VAL D 4 150 ? 28.186  56.765  -15.668 1.00 72.54  ? 146 VAL A CA  1 
ATOM   6321  C C   . VAL D 4 150 ? 27.316  57.299  -16.785 1.00 79.73  ? 146 VAL A C   1 
ATOM   6322  O O   . VAL D 4 150 ? 26.180  56.851  -16.967 1.00 84.67  ? 146 VAL A O   1 
ATOM   6323  C CB  . VAL D 4 150 ? 28.717  55.396  -16.063 1.00 62.40  ? 146 VAL A CB  1 
ATOM   6324  C CG1 . VAL D 4 150 ? 29.650  55.495  -17.255 1.00 64.74  ? 146 VAL A CG1 1 
ATOM   6325  C CG2 . VAL D 4 150 ? 29.420  54.793  -14.889 1.00 62.90  ? 146 VAL A CG2 1 
ATOM   6326  N N   . LYS D 4 151 ? 27.844  58.276  -17.517 1.00 78.94  ? 147 LYS A N   1 
ATOM   6327  C CA  . LYS D 4 151 ? 27.263  58.679  -18.791 1.00 82.98  ? 147 LYS A CA  1 
ATOM   6328  C C   . LYS D 4 151 ? 28.333  58.497  -19.847 1.00 78.71  ? 147 LYS A C   1 
ATOM   6329  O O   . LYS D 4 151 ? 29.519  58.556  -19.536 1.00 77.92  ? 147 LYS A O   1 
ATOM   6330  C CB  . LYS D 4 151 ? 26.786  60.139  -18.765 1.00 86.75  ? 147 LYS A CB  1 
ATOM   6331  C CG  . LYS D 4 151 ? 25.328  60.331  -18.315 1.00 90.87  ? 147 LYS A CG  1 
ATOM   6332  C CD  . LYS D 4 151 ? 25.156  59.960  -16.844 1.00 92.86  ? 147 LYS A CD  1 
ATOM   6333  C CE  . LYS D 4 151 ? 24.017  58.972  -16.627 1.00 91.62  ? 147 LYS A CE  1 
ATOM   6334  N NZ  . LYS D 4 151 ? 24.140  58.304  -15.293 1.00 88.07  ? 147 LYS A NZ  1 
ATOM   6335  N N   . TRP D 4 152 ? 27.925  58.240  -21.084 1.00 80.18  ? 148 TRP A N   1 
ATOM   6336  C CA  . TRP D 4 152 ? 28.851  58.342  -22.201 1.00 81.46  ? 148 TRP A CA  1 
ATOM   6337  C C   . TRP D 4 152 ? 28.623  59.650  -22.951 1.00 90.40  ? 148 TRP A C   1 
ATOM   6338  O O   . TRP D 4 152 ? 27.516  60.174  -22.981 1.00 92.14  ? 148 TRP A O   1 
ATOM   6339  C CB  . TRP D 4 152 ? 28.674  57.198  -23.181 1.00 73.70  ? 148 TRP A CB  1 
ATOM   6340  C CG  . TRP D 4 152 ? 29.001  55.881  -22.659 1.00 75.69  ? 148 TRP A CG  1 
ATOM   6341  C CD1 . TRP D 4 152 ? 28.337  55.213  -21.684 1.00 79.88  ? 148 TRP A CD1 1 
ATOM   6342  C CD2 . TRP D 4 152 ? 30.040  55.004  -23.116 1.00 79.42  ? 148 TRP A CD2 1 
ATOM   6343  N NE1 . TRP D 4 152 ? 28.906  53.978  -21.487 1.00 83.49  ? 148 TRP A NE1 1 
ATOM   6344  C CE2 . TRP D 4 152 ? 29.956  53.827  -22.355 1.00 83.26  ? 148 TRP A CE2 1 
ATOM   6345  C CE3 . TRP D 4 152 ? 31.036  55.102  -24.089 1.00 78.48  ? 148 TRP A CE3 1 
ATOM   6346  C CZ2 . TRP D 4 152 ? 30.836  52.752  -22.533 1.00 83.47  ? 148 TRP A CZ2 1 
ATOM   6347  C CZ3 . TRP D 4 152 ? 31.909  54.031  -24.264 1.00 76.89  ? 148 TRP A CZ3 1 
ATOM   6348  C CH2 . TRP D 4 152 ? 31.800  52.876  -23.492 1.00 77.84  ? 148 TRP A CH2 1 
ATOM   6349  N N   . LYS D 4 153 ? 29.683  60.165  -23.558 1.00 91.10  ? 149 LYS A N   1 
ATOM   6350  C CA  . LYS D 4 153 ? 29.580  61.297  -24.453 1.00 92.13  ? 149 LYS A CA  1 
ATOM   6351  C C   . LYS D 4 153 ? 30.343  60.933  -25.731 1.00 92.50  ? 149 LYS A C   1 
ATOM   6352  O O   . LYS D 4 153 ? 31.451  60.403  -25.679 1.00 84.74  ? 149 LYS A O   1 
ATOM   6353  C CB  . LYS D 4 153 ? 30.159  62.548  -23.788 1.00 94.98  ? 149 LYS A CB  1 
ATOM   6354  C CG  . LYS D 4 153 ? 29.788  63.860  -24.461 1.00 100.48 ? 149 LYS A CG  1 
ATOM   6355  C CD  . LYS D 4 153 ? 30.989  64.808  -24.548 1.00 100.37 ? 149 LYS A CD  1 
ATOM   6356  C CE  . LYS D 4 153 ? 32.072  64.246  -25.468 1.00 100.10 ? 149 LYS A CE  1 
ATOM   6357  N NZ  . LYS D 4 153 ? 33.199  65.194  -25.688 1.00 104.02 ? 149 LYS A NZ  1 
ATOM   6358  N N   . ILE D 4 154 ? 29.718  61.186  -26.875 1.00 99.29  ? 150 ILE A N   1 
ATOM   6359  C CA  . ILE D 4 154 ? 30.340  60.970  -28.180 1.00 101.71 ? 150 ILE A CA  1 
ATOM   6360  C C   . ILE D 4 154 ? 30.313  62.267  -28.997 1.00 100.95 ? 150 ILE A C   1 
ATOM   6361  O O   . ILE D 4 154 ? 29.243  62.762  -29.339 1.00 105.04 ? 150 ILE A O   1 
ATOM   6362  C CB  . ILE D 4 154 ? 29.622  59.847  -28.964 1.00 98.92  ? 150 ILE A CB  1 
ATOM   6363  C CG1 . ILE D 4 154 ? 29.889  59.976  -30.461 1.00 99.28  ? 150 ILE A CG1 1 
ATOM   6364  C CG2 . ILE D 4 154 ? 28.122  59.905  -28.730 1.00 105.06 ? 150 ILE A CG2 1 
ATOM   6365  C CD1 . ILE D 4 154 ? 31.350  60.083  -30.816 1.00 100.92 ? 150 ILE A CD1 1 
ATOM   6366  N N   . ASP D 4 155 ? 31.489  62.810  -29.306 1.00 98.55  ? 151 ASP A N   1 
ATOM   6367  C CA  . ASP D 4 155 ? 31.590  64.090  -30.012 1.00 102.47 ? 151 ASP A CA  1 
ATOM   6368  C C   . ASP D 4 155 ? 30.751  65.205  -29.349 1.00 103.08 ? 151 ASP A C   1 
ATOM   6369  O O   . ASP D 4 155 ? 29.989  65.910  -30.021 1.00 101.98 ? 151 ASP A O   1 
ATOM   6370  C CB  . ASP D 4 155 ? 31.220  63.936  -31.501 1.00 105.62 ? 151 ASP A CB  1 
ATOM   6371  C CG  . ASP D 4 155 ? 32.292  63.195  -32.313 1.00 103.56 ? 151 ASP A CG  1 
ATOM   6372  O OD1 . ASP D 4 155 ? 33.132  62.497  -31.707 1.00 101.40 ? 151 ASP A OD1 1 
ATOM   6373  O OD2 . ASP D 4 155 ? 32.287  63.312  -33.561 1.00 98.62  ? 151 ASP A OD2 1 
ATOM   6374  N N   . GLY D 4 156 ? 30.910  65.364  -28.036 1.00 99.05  ? 152 GLY A N   1 
ATOM   6375  C CA  . GLY D 4 156 ? 30.168  66.357  -27.284 1.00 94.38  ? 152 GLY A CA  1 
ATOM   6376  C C   . GLY D 4 156 ? 28.820  65.825  -26.831 1.00 99.66  ? 152 GLY A C   1 
ATOM   6377  O O   . GLY D 4 156 ? 28.378  66.086  -25.717 1.00 99.84  ? 152 GLY A O   1 
ATOM   6378  N N   . SER D 4 157 ? 28.166  65.064  -27.701 1.00 102.32 ? 153 SER A N   1 
ATOM   6379  C CA  . SER D 4 157 ? 26.822  64.552  -27.427 1.00 110.98 ? 153 SER A CA  1 
ATOM   6380  C C   . SER D 4 157 ? 26.818  63.260  -26.597 1.00 111.29 ? 153 SER A C   1 
ATOM   6381  O O   . SER D 4 157 ? 27.433  62.258  -26.970 1.00 106.19 ? 153 SER A O   1 
ATOM   6382  C CB  . SER D 4 157 ? 26.047  64.347  -28.744 1.00 108.42 ? 153 SER A CB  1 
ATOM   6383  O OG  . SER D 4 157 ? 24.813  63.665  -28.542 1.00 101.08 ? 153 SER A OG  1 
ATOM   6384  N N   . GLU D 4 158 ? 26.111  63.284  -25.472 1.00 110.74 ? 154 GLU A N   1 
ATOM   6385  C CA  . GLU D 4 158 ? 25.998  62.096  -24.638 1.00 107.67 ? 154 GLU A CA  1 
ATOM   6386  C C   . GLU D 4 158 ? 24.613  61.455  -24.749 1.00 108.72 ? 154 GLU A C   1 
ATOM   6387  O O   . GLU D 4 158 ? 23.626  61.971  -24.210 1.00 103.86 ? 154 GLU A O   1 
ATOM   6388  C CB  . GLU D 4 158 ? 26.344  62.420  -23.177 1.00 109.09 ? 154 GLU A CB  1 
ATOM   6389  C CG  . GLU D 4 158 ? 25.166  62.771  -22.275 1.00 106.69 ? 154 GLU A CG  1 
ATOM   6390  C CD  . GLU D 4 158 ? 24.672  64.186  -22.490 1.00 110.05 ? 154 GLU A CD  1 
ATOM   6391  O OE1 . GLU D 4 158 ? 24.959  64.779  -23.557 1.00 106.55 ? 154 GLU A OE1 1 
ATOM   6392  O OE2 . GLU D 4 158 ? 24.001  64.708  -21.579 1.00 111.86 ? 154 GLU A OE2 1 
ATOM   6393  N N   . ARG D 4 159 ? 24.534  60.338  -25.467 1.00 109.59 ? 155 ARG A N   1 
ATOM   6394  C CA  . ARG D 4 159 ? 23.287  59.586  -25.494 1.00 108.87 ? 155 ARG A CA  1 
ATOM   6395  C C   . ARG D 4 159 ? 23.414  58.282  -24.736 1.00 98.18  ? 155 ARG A C   1 
ATOM   6396  O O   . ARG D 4 159 ? 24.514  57.755  -24.573 1.00 89.01  ? 155 ARG A O   1 
ATOM   6397  C CB  . ARG D 4 159 ? 22.769  59.366  -26.914 1.00 114.27 ? 155 ARG A CB  1 
ATOM   6398  C CG  . ARG D 4 159 ? 21.415  60.023  -27.125 1.00 113.30 ? 155 ARG A CG  1 
ATOM   6399  C CD  . ARG D 4 159 ? 20.801  59.659  -28.456 1.00 115.41 ? 155 ARG A CD  1 
ATOM   6400  N NE  . ARG D 4 159 ? 19.344  59.667  -28.361 1.00 126.92 ? 155 ARG A NE  1 
ATOM   6401  C CZ  . ARG D 4 159 ? 18.613  58.613  -28.003 1.00 123.58 ? 155 ARG A CZ  1 
ATOM   6402  N NH1 . ARG D 4 159 ? 17.292  58.704  -27.939 1.00 119.65 ? 155 ARG A NH1 1 
ATOM   6403  N NH2 . ARG D 4 159 ? 19.198  57.464  -27.713 1.00 115.33 ? 155 ARG A NH2 1 
ATOM   6404  N N   . GLN D 4 160 ? 22.275  57.774  -24.275 1.00 99.38  ? 156 GLN A N   1 
ATOM   6405  C CA  . GLN D 4 160 ? 22.265  56.734  -23.254 1.00 101.61 ? 156 GLN A CA  1 
ATOM   6406  C C   . GLN D 4 160 ? 21.615  55.415  -23.665 1.00 99.29  ? 156 GLN A C   1 
ATOM   6407  O O   . GLN D 4 160 ? 21.653  54.448  -22.908 1.00 95.88  ? 156 GLN A O   1 
ATOM   6408  C CB  . GLN D 4 160 ? 21.608  57.255  -21.972 1.00 99.55  ? 156 GLN A CB  1 
ATOM   6409  C CG  . GLN D 4 160 ? 20.213  57.800  -22.177 1.00 101.59 ? 156 GLN A CG  1 
ATOM   6410  C CD  . GLN D 4 160 ? 20.204  59.278  -22.509 1.00 100.99 ? 156 GLN A CD  1 
ATOM   6411  O OE1 . GLN D 4 160 ? 19.931  60.111  -21.644 1.00 90.97  ? 156 GLN A OE1 1 
ATOM   6412  N NE2 . GLN D 4 160 ? 20.498  59.615  -23.766 1.00 102.64 ? 156 GLN A NE2 1 
ATOM   6413  N N   . ASN D 4 161 ? 21.035  55.361  -24.857 1.00 101.91 ? 157 ASN A N   1 
ATOM   6414  C CA  . ASN D 4 161 ? 20.373  54.133  -25.296 1.00 103.14 ? 157 ASN A CA  1 
ATOM   6415  C C   . ASN D 4 161 ? 21.238  52.851  -25.299 1.00 99.47  ? 157 ASN A C   1 
ATOM   6416  O O   . ASN D 4 161 ? 21.107  52.009  -24.405 1.00 100.08 ? 157 ASN A O   1 
ATOM   6417  C CB  . ASN D 4 161 ? 19.609  54.327  -26.621 1.00 102.75 ? 157 ASN A CB  1 
ATOM   6418  C CG  . ASN D 4 161 ? 20.395  55.109  -27.656 1.00 105.70 ? 157 ASN A CG  1 
ATOM   6419  O OD1 . ASN D 4 161 ? 20.317  54.814  -28.843 1.00 107.79 ? 157 ASN A OD1 1 
ATOM   6420  N ND2 . ASN D 4 161 ? 21.136  56.122  -27.217 1.00 106.50 ? 157 ASN A ND2 1 
ATOM   6421  N N   . GLY D 4 162 ? 22.117  52.710  -26.283 1.00 94.77  ? 158 GLY A N   1 
ATOM   6422  C CA  . GLY D 4 162 ? 22.829  51.460  -26.490 1.00 95.73  ? 158 GLY A CA  1 
ATOM   6423  C C   . GLY D 4 162 ? 23.651  50.870  -25.348 1.00 94.65  ? 158 GLY A C   1 
ATOM   6424  O O   . GLY D 4 162 ? 24.237  49.803  -25.522 1.00 92.77  ? 158 GLY A O   1 
ATOM   6425  N N   . VAL D 4 163 ? 23.704  51.525  -24.187 1.00 95.15  ? 159 VAL A N   1 
ATOM   6426  C CA  . VAL D 4 163 ? 24.587  51.056  -23.103 1.00 89.27  ? 159 VAL A CA  1 
ATOM   6427  C C   . VAL D 4 163 ? 24.038  49.966  -22.201 1.00 88.17  ? 159 VAL A C   1 
ATOM   6428  O O   . VAL D 4 163 ? 22.934  50.072  -21.663 1.00 91.96  ? 159 VAL A O   1 
ATOM   6429  C CB  . VAL D 4 163 ? 25.050  52.178  -22.151 1.00 89.64  ? 159 VAL A CB  1 
ATOM   6430  C CG1 . VAL D 4 163 ? 25.988  53.127  -22.858 1.00 88.02  ? 159 VAL A CG1 1 
ATOM   6431  C CG2 . VAL D 4 163 ? 23.849  52.895  -21.528 1.00 95.12  ? 159 VAL A CG2 1 
ATOM   6432  N N   . LEU D 4 164 ? 24.855  48.936  -22.020 1.00 86.12  ? 160 LEU A N   1 
ATOM   6433  C CA  . LEU D 4 164 ? 24.601  47.872  -21.062 1.00 83.77  ? 160 LEU A CA  1 
ATOM   6434  C C   . LEU D 4 164 ? 25.675  47.898  -19.968 1.00 83.57  ? 160 LEU A C   1 
ATOM   6435  O O   . LEU D 4 164 ? 26.836  48.217  -20.217 1.00 83.05  ? 160 LEU A O   1 
ATOM   6436  C CB  . LEU D 4 164 ? 24.585  46.512  -21.769 1.00 89.90  ? 160 LEU A CB  1 
ATOM   6437  C CG  . LEU D 4 164 ? 23.464  46.327  -22.801 1.00 95.57  ? 160 LEU A CG  1 
ATOM   6438  C CD1 . LEU D 4 164 ? 23.674  45.085  -23.672 1.00 98.01  ? 160 LEU A CD1 1 
ATOM   6439  C CD2 . LEU D 4 164 ? 22.104  46.287  -22.104 1.00 94.83  ? 160 LEU A CD2 1 
ATOM   6440  N N   . ASN D 4 165 ? 25.284  47.578  -18.744 1.00 83.81  ? 161 ASN A N   1 
ATOM   6441  C CA  . ASN D 4 165 ? 26.230  47.611  -17.642 1.00 79.63  ? 161 ASN A CA  1 
ATOM   6442  C C   . ASN D 4 165 ? 25.932  46.605  -16.538 1.00 75.45  ? 161 ASN A C   1 
ATOM   6443  O O   . ASN D 4 165 ? 24.776  46.327  -16.224 1.00 75.94  ? 161 ASN A O   1 
ATOM   6444  C CB  . ASN D 4 165 ? 26.380  49.031  -17.068 1.00 77.70  ? 161 ASN A CB  1 
ATOM   6445  C CG  . ASN D 4 165 ? 25.087  49.827  -17.091 1.00 75.00  ? 161 ASN A CG  1 
ATOM   6446  O OD1 . ASN D 4 165 ? 25.104  51.032  -17.338 1.00 73.93  ? 161 ASN A OD1 1 
ATOM   6447  N ND2 . ASN D 4 165 ? 23.962  49.163  -16.836 1.00 74.22  ? 161 ASN A ND2 1 
ATOM   6448  N N   . SER D 4 166 ? 26.993  46.056  -15.963 1.00 72.58  ? 162 SER A N   1 
ATOM   6449  C CA  . SER D 4 166 ? 26.862  45.144  -14.846 1.00 72.13  ? 162 SER A CA  1 
ATOM   6450  C C   . SER D 4 166 ? 27.623  45.658  -13.621 1.00 77.54  ? 162 SER A C   1 
ATOM   6451  O O   . SER D 4 166 ? 28.020  46.828  -13.567 1.00 76.18  ? 162 SER A O   1 
ATOM   6452  C CB  . SER D 4 166 ? 27.352  43.746  -15.229 1.00 74.97  ? 162 SER A CB  1 
ATOM   6453  O OG  . SER D 4 166 ? 28.764  43.666  -15.180 1.00 74.88  ? 162 SER A OG  1 
ATOM   6454  N N   . TRP D 4 167 ? 27.811  44.759  -12.651 1.00 79.04  ? 163 TRP A N   1 
ATOM   6455  C CA  . TRP D 4 167 ? 28.433  45.033  -11.357 1.00 71.55  ? 163 TRP A CA  1 
ATOM   6456  C C   . TRP D 4 167 ? 28.857  43.703  -10.725 1.00 72.19  ? 163 TRP A C   1 
ATOM   6457  O O   . TRP D 4 167 ? 28.068  42.762  -10.720 1.00 76.23  ? 163 TRP A O   1 
ATOM   6458  C CB  . TRP D 4 167 ? 27.412  45.688  -10.440 1.00 65.70  ? 163 TRP A CB  1 
ATOM   6459  C CG  . TRP D 4 167 ? 27.010  47.065  -10.830 1.00 69.67  ? 163 TRP A CG  1 
ATOM   6460  C CD1 . TRP D 4 167 ? 27.645  48.214  -10.488 1.00 74.72  ? 163 TRP A CD1 1 
ATOM   6461  C CD2 . TRP D 4 167 ? 25.866  47.455  -11.608 1.00 73.33  ? 163 TRP A CD2 1 
ATOM   6462  N NE1 . TRP D 4 167 ? 26.982  49.296  -11.006 1.00 77.27  ? 163 TRP A NE1 1 
ATOM   6463  C CE2 . TRP D 4 167 ? 25.885  48.858  -11.698 1.00 76.01  ? 163 TRP A CE2 1 
ATOM   6464  C CE3 . TRP D 4 167 ? 24.836  46.758  -12.243 1.00 75.83  ? 163 TRP A CE3 1 
ATOM   6465  C CZ2 . TRP D 4 167 ? 24.909  49.580  -12.392 1.00 74.57  ? 163 TRP A CZ2 1 
ATOM   6466  C CZ3 . TRP D 4 167 ? 23.867  47.480  -12.934 1.00 72.00  ? 163 TRP A CZ3 1 
ATOM   6467  C CH2 . TRP D 4 167 ? 23.911  48.873  -12.998 1.00 68.89  ? 163 TRP A CH2 1 
ATOM   6468  N N   . THR D 4 168 ? 30.078  43.605  -10.199 1.00 65.98  ? 164 THR A N   1 
ATOM   6469  C CA  . THR D 4 168 ? 30.458  42.409  -9.450  1.00 67.69  ? 164 THR A CA  1 
ATOM   6470  C C   . THR D 4 168 ? 29.867  42.514  -8.053  1.00 75.48  ? 164 THR A C   1 
ATOM   6471  O O   . THR D 4 168 ? 29.307  43.546  -7.699  1.00 79.82  ? 164 THR A O   1 
ATOM   6472  C CB  . THR D 4 168 ? 31.972  42.279  -9.284  1.00 71.22  ? 164 THR A CB  1 
ATOM   6473  O OG1 . THR D 4 168 ? 32.480  43.481  -8.703  1.00 72.85  ? 164 THR A OG1 1 
ATOM   6474  C CG2 . THR D 4 168 ? 32.661  42.017  -10.611 1.00 73.25  ? 164 THR A CG2 1 
ATOM   6475  N N   . ASP D 4 169 ? 29.985  41.454  -7.258  1.00 77.40  ? 165 ASP A N   1 
ATOM   6476  C CA  . ASP D 4 169 ? 29.676  41.535  -5.824  1.00 79.76  ? 165 ASP A CA  1 
ATOM   6477  C C   . ASP D 4 169 ? 30.950  41.980  -5.095  1.00 86.56  ? 165 ASP A C   1 
ATOM   6478  O O   . ASP D 4 169 ? 32.051  41.849  -5.645  1.00 91.28  ? 165 ASP A O   1 
ATOM   6479  C CB  . ASP D 4 169 ? 29.218  40.178  -5.279  1.00 84.65  ? 165 ASP A CB  1 
ATOM   6480  C CG  . ASP D 4 169 ? 27.845  39.751  -5.805  1.00 96.29  ? 165 ASP A CG  1 
ATOM   6481  O OD1 . ASP D 4 169 ? 26.826  40.364  -5.395  1.00 101.47 ? 165 ASP A OD1 1 
ATOM   6482  O OD2 . ASP D 4 169 ? 27.783  38.785  -6.610  1.00 91.48  ? 165 ASP A OD2 1 
ATOM   6483  N N   . GLN D 4 170 ? 30.824  42.499  -3.872  1.00 83.97  ? 166 GLN A N   1 
ATOM   6484  C CA  . GLN D 4 170 ? 32.000  42.928  -3.103  1.00 74.63  ? 166 GLN A CA  1 
ATOM   6485  C C   . GLN D 4 170 ? 33.124  41.896  -3.196  1.00 63.49  ? 166 GLN A C   1 
ATOM   6486  O O   . GLN D 4 170 ? 32.889  40.710  -3.069  1.00 59.41  ? 166 GLN A O   1 
ATOM   6487  C CB  . GLN D 4 170 ? 31.617  43.146  -1.639  1.00 74.11  ? 166 GLN A CB  1 
ATOM   6488  C CG  . GLN D 4 170 ? 31.877  44.550  -1.114  1.00 80.03  ? 166 GLN A CG  1 
ATOM   6489  C CD  . GLN D 4 170 ? 31.575  44.688  0.379   1.00 81.85  ? 166 GLN A CD  1 
ATOM   6490  O OE1 . GLN D 4 170 ? 31.616  43.708  1.124   1.00 81.32  ? 166 GLN A OE1 1 
ATOM   6491  N NE2 . GLN D 4 170 ? 31.269  45.909  0.816   1.00 80.44  ? 166 GLN A NE2 1 
ATOM   6492  N N   . ASP D 4 171 ? 34.348  42.339  -3.434  1.00 67.64  ? 167 ASP A N   1 
ATOM   6493  C CA  . ASP D 4 171 ? 35.479  41.409  -3.443  1.00 75.36  ? 167 ASP A CA  1 
ATOM   6494  C C   . ASP D 4 171 ? 35.571  40.691  -2.087  1.00 72.64  ? 167 ASP A C   1 
ATOM   6495  O O   . ASP D 4 171 ? 35.065  41.188  -1.088  1.00 72.17  ? 167 ASP A O   1 
ATOM   6496  C CB  . ASP D 4 171 ? 36.791  42.149  -3.774  1.00 74.88  ? 167 ASP A CB  1 
ATOM   6497  C CG  . ASP D 4 171 ? 37.932  41.206  -4.175  1.00 75.89  ? 167 ASP A CG  1 
ATOM   6498  O OD1 . ASP D 4 171 ? 39.112  41.580  -3.993  1.00 78.45  ? 167 ASP A OD1 1 
ATOM   6499  O OD2 . ASP D 4 171 ? 37.661  40.093  -4.673  1.00 74.99  ? 167 ASP A OD2 1 
ATOM   6500  N N   . SER D 4 172 ? 36.208  39.528  -2.042  1.00 71.92  ? 168 SER A N   1 
ATOM   6501  C CA  . SER D 4 172 ? 36.331  38.821  -0.774  1.00 75.45  ? 168 SER A CA  1 
ATOM   6502  C C   . SER D 4 172 ? 37.657  39.056  -0.050  1.00 79.81  ? 168 SER A C   1 
ATOM   6503  O O   . SER D 4 172 ? 37.850  38.606  1.073   1.00 80.82  ? 168 SER A O   1 
ATOM   6504  C CB  . SER D 4 172 ? 36.067  37.332  -0.964  1.00 83.91  ? 168 SER A CB  1 
ATOM   6505  O OG  . SER D 4 172 ? 34.689  37.105  -1.217  1.00 88.83  ? 168 SER A OG  1 
ATOM   6506  N N   . LYS D 4 173 ? 38.562  39.786  -0.685  1.00 83.23  ? 169 LYS A N   1 
ATOM   6507  C CA  . LYS D 4 173 ? 39.869  40.049  -0.099  1.00 82.58  ? 169 LYS A CA  1 
ATOM   6508  C C   . LYS D 4 173 ? 40.199  41.554  -0.037  1.00 84.51  ? 169 LYS A C   1 
ATOM   6509  O O   . LYS D 4 173 ? 40.769  42.045  0.945   1.00 82.91  ? 169 LYS A O   1 
ATOM   6510  C CB  . LYS D 4 173 ? 40.925  39.258  -0.871  1.00 82.88  ? 169 LYS A CB  1 
ATOM   6511  C CG  . LYS D 4 173 ? 40.715  37.746  -0.776  1.00 84.57  ? 169 LYS A CG  1 
ATOM   6512  C CD  . LYS D 4 173 ? 41.204  36.998  -2.010  1.00 86.16  ? 169 LYS A CD  1 
ATOM   6513  C CE  . LYS D 4 173 ? 42.690  37.218  -2.279  1.00 85.46  ? 169 LYS A CE  1 
ATOM   6514  N NZ  . LYS D 4 173 ? 43.546  36.917  -1.098  1.00 81.82  ? 169 LYS A NZ  1 
ATOM   6515  N N   . ASP D 4 174 ? 39.815  42.286  -1.078  1.00 83.03  ? 170 ASP A N   1 
ATOM   6516  C CA  . ASP D 4 174 ? 40.034  43.730  -1.132  1.00 84.06  ? 170 ASP A CA  1 
ATOM   6517  C C   . ASP D 4 174 ? 38.848  44.553  -0.621  1.00 80.11  ? 170 ASP A C   1 
ATOM   6518  O O   . ASP D 4 174 ? 38.981  45.744  -0.349  1.00 80.96  ? 170 ASP A O   1 
ATOM   6519  C CB  . ASP D 4 174 ? 40.352  44.161  -2.567  1.00 86.53  ? 170 ASP A CB  1 
ATOM   6520  C CG  . ASP D 4 174 ? 41.809  43.936  -2.945  1.00 95.74  ? 170 ASP A CG  1 
ATOM   6521  O OD1 . ASP D 4 174 ? 42.110  44.006  -4.163  1.00 95.13  ? 170 ASP A OD1 1 
ATOM   6522  O OD2 . ASP D 4 174 ? 42.646  43.696  -2.033  1.00 98.16  ? 170 ASP A OD2 1 
ATOM   6523  N N   . SER D 4 175 ? 37.687  43.922  -0.518  1.00 79.92  ? 171 SER A N   1 
ATOM   6524  C CA  . SER D 4 175 ? 36.454  44.620  -0.153  1.00 78.74  ? 171 SER A CA  1 
ATOM   6525  C C   . SER D 4 175 ? 36.002  45.648  -1.215  1.00 76.66  ? 171 SER A C   1 
ATOM   6526  O O   . SER D 4 175 ? 35.142  46.493  -0.948  1.00 76.15  ? 171 SER A O   1 
ATOM   6527  C CB  . SER D 4 175 ? 36.597  45.269  1.230   1.00 73.75  ? 171 SER A CB  1 
ATOM   6528  O OG  . SER D 4 175 ? 36.973  44.312  2.210   1.00 65.70  ? 171 SER A OG  1 
ATOM   6529  N N   . THR D 4 176 ? 36.543  45.532  -2.428  1.00 74.66  ? 172 THR A N   1 
ATOM   6530  C CA  . THR D 4 176 ? 36.353  46.540  -3.474  1.00 75.62  ? 172 THR A CA  1 
ATOM   6531  C C   . THR D 4 176 ? 35.413  46.129  -4.611  1.00 78.24  ? 172 THR A C   1 
ATOM   6532  O O   . THR D 4 176 ? 35.576  45.063  -5.210  1.00 84.07  ? 172 THR A O   1 
ATOM   6533  C CB  . THR D 4 176 ? 37.693  46.873  -4.113  1.00 72.04  ? 172 THR A CB  1 
ATOM   6534  O OG1 . THR D 4 176 ? 38.010  45.873  -5.084  1.00 75.85  ? 172 THR A OG1 1 
ATOM   6535  C CG2 . THR D 4 176 ? 38.762  46.876  -3.060  1.00 76.12  ? 172 THR A CG2 1 
ATOM   6536  N N   . TYR D 4 177 ? 34.451  46.985  -4.936  1.00 72.72  ? 173 TYR A N   1 
ATOM   6537  C CA  . TYR D 4 177 ? 33.525  46.681  -6.021  1.00 71.29  ? 173 TYR A CA  1 
ATOM   6538  C C   . TYR D 4 177 ? 34.228  46.768  -7.369  1.00 69.27  ? 173 TYR A C   1 
ATOM   6539  O O   . TYR D 4 177 ? 35.454  46.848  -7.426  1.00 65.48  ? 173 TYR A O   1 
ATOM   6540  C CB  . TYR D 4 177 ? 32.311  47.609  -5.979  1.00 70.92  ? 173 TYR A CB  1 
ATOM   6541  C CG  . TYR D 4 177 ? 31.455  47.454  -4.735  1.00 78.75  ? 173 TYR A CG  1 
ATOM   6542  C CD1 . TYR D 4 177 ? 31.993  47.625  -3.462  1.00 80.26  ? 173 TYR A CD1 1 
ATOM   6543  C CD2 . TYR D 4 177 ? 30.104  47.148  -4.834  1.00 81.00  ? 173 TYR A CD2 1 
ATOM   6544  C CE1 . TYR D 4 177 ? 31.209  47.496  -2.326  1.00 82.67  ? 173 TYR A CE1 1 
ATOM   6545  C CE2 . TYR D 4 177 ? 29.315  47.007  -3.703  1.00 80.90  ? 173 TYR A CE2 1 
ATOM   6546  C CZ  . TYR D 4 177 ? 29.869  47.182  -2.454  1.00 84.12  ? 173 TYR A CZ  1 
ATOM   6547  O OH  . TYR D 4 177 ? 29.076  47.042  -1.332  1.00 84.28  ? 173 TYR A OH  1 
ATOM   6548  N N   . SER D 4 178 ? 33.435  46.729  -8.440  1.00 73.53  ? 174 SER A N   1 
ATOM   6549  C CA  . SER D 4 178 ? 33.900  46.839  -9.832  1.00 71.77  ? 174 SER A CA  1 
ATOM   6550  C C   . SER D 4 178 ? 32.688  46.976  -10.723 1.00 68.86  ? 174 SER A C   1 
ATOM   6551  O O   . SER D 4 178 ? 31.567  46.975  -10.237 1.00 72.25  ? 174 SER A O   1 
ATOM   6552  C CB  . SER D 4 178 ? 34.687  45.608  -10.273 1.00 74.19  ? 174 SER A CB  1 
ATOM   6553  O OG  . SER D 4 178 ? 35.995  45.613  -9.733  1.00 75.48  ? 174 SER A OG  1 
ATOM   6554  N N   . MET D 4 179 ? 32.893  47.061  -12.028 1.00 67.65  ? 175 MET A N   1 
ATOM   6555  C CA  . MET D 4 179 ? 31.762  47.342  -12.904 1.00 76.27  ? 175 MET A CA  1 
ATOM   6556  C C   . MET D 4 179 ? 32.089  47.480  -14.389 1.00 80.02  ? 175 MET A C   1 
ATOM   6557  O O   . MET D 4 179 ? 33.154  47.972  -14.758 1.00 81.33  ? 175 MET A O   1 
ATOM   6558  C CB  . MET D 4 179 ? 31.072  48.623  -12.451 1.00 69.85  ? 175 MET A CB  1 
ATOM   6559  C CG  . MET D 4 179 ? 30.481  49.377  -13.597 1.00 70.73  ? 175 MET A CG  1 
ATOM   6560  S SD  . MET D 4 179 ? 29.173  50.435  -13.028 1.00 87.50  ? 175 MET A SD  1 
ATOM   6561  C CE  . MET D 4 179 ? 28.139  50.428  -14.493 1.00 82.73  ? 175 MET A CE  1 
ATOM   6562  N N   . SER D 4 180 ? 31.152  47.087  -15.243 1.00 78.25  ? 176 SER A N   1 
ATOM   6563  C CA  . SER D 4 180 ? 31.390  47.188  -16.670 1.00 79.90  ? 176 SER A CA  1 
ATOM   6564  C C   . SER D 4 180 ? 30.353  48.033  -17.388 1.00 81.79  ? 176 SER A C   1 
ATOM   6565  O O   . SER D 4 180 ? 29.174  47.969  -17.065 1.00 85.07  ? 176 SER A O   1 
ATOM   6566  C CB  . SER D 4 180 ? 31.439  45.799  -17.295 1.00 84.54  ? 176 SER A CB  1 
ATOM   6567  O OG  . SER D 4 180 ? 31.837  45.885  -18.657 1.00 93.59  ? 176 SER A OG  1 
ATOM   6568  N N   . SER D 4 181 ? 30.800  48.824  -18.363 1.00 84.59  ? 177 SER A N   1 
ATOM   6569  C CA  . SER D 4 181 ? 29.880  49.547  -19.241 1.00 84.18  ? 177 SER A CA  1 
ATOM   6570  C C   . SER D 4 181 ? 30.146  49.346  -20.727 1.00 85.80  ? 177 SER A C   1 
ATOM   6571  O O   . SER D 4 181 ? 31.288  49.414  -21.197 1.00 83.33  ? 177 SER A O   1 
ATOM   6572  C CB  . SER D 4 181 ? 29.863  51.036  -18.951 1.00 80.23  ? 177 SER A CB  1 
ATOM   6573  O OG  . SER D 4 181 ? 28.886  51.651  -19.772 1.00 83.30  ? 177 SER A OG  1 
ATOM   6574  N N   . THR D 4 182 ? 29.050  49.156  -21.456 1.00 85.63  ? 178 THR A N   1 
ATOM   6575  C CA  . THR D 4 182 ? 29.073  48.722  -22.845 1.00 82.34  ? 178 THR A CA  1 
ATOM   6576  C C   . THR D 4 182 ? 28.281  49.674  -23.752 1.00 85.60  ? 178 THR A C   1 
ATOM   6577  O O   . THR D 4 182 ? 27.082  49.880  -23.555 1.00 87.69  ? 178 THR A O   1 
ATOM   6578  C CB  . THR D 4 182 ? 28.498  47.282  -22.951 1.00 83.22  ? 178 THR A CB  1 
ATOM   6579  O OG1 . THR D 4 182 ? 29.561  46.342  -23.173 1.00 78.04  ? 178 THR A OG1 1 
ATOM   6580  C CG2 . THR D 4 182 ? 27.437  47.171  -24.062 1.00 82.72  ? 178 THR A CG2 1 
ATOM   6581  N N   . LEU D 4 183 ? 28.956  50.263  -24.740 1.00 87.67  ? 179 LEU A N   1 
ATOM   6582  C CA  . LEU D 4 183 ? 28.271  51.077  -25.747 1.00 85.91  ? 179 LEU A CA  1 
ATOM   6583  C C   . LEU D 4 183 ? 28.121  50.350  -27.082 1.00 84.67  ? 179 LEU A C   1 
ATOM   6584  O O   . LEU D 4 183 ? 29.104  50.031  -27.739 1.00 79.10  ? 179 LEU A O   1 
ATOM   6585  C CB  . LEU D 4 183 ? 28.984  52.396  -25.980 1.00 78.83  ? 179 LEU A CB  1 
ATOM   6586  C CG  . LEU D 4 183 ? 28.238  53.146  -27.084 1.00 80.43  ? 179 LEU A CG  1 
ATOM   6587  C CD1 . LEU D 4 183 ? 27.063  53.964  -26.532 1.00 78.29  ? 179 LEU A CD1 1 
ATOM   6588  C CD2 . LEU D 4 183 ? 29.185  54.019  -27.883 1.00 78.14  ? 179 LEU A CD2 1 
ATOM   6589  N N   . THR D 4 184 ? 26.874  50.127  -27.483 1.00 87.48  ? 180 THR A N   1 
ATOM   6590  C CA  . THR D 4 184 ? 26.542  49.291  -28.636 1.00 92.26  ? 180 THR A CA  1 
ATOM   6591  C C   . THR D 4 184 ? 26.026  50.107  -29.823 1.00 96.96  ? 180 THR A C   1 
ATOM   6592  O O   . THR D 4 184 ? 25.035  50.842  -29.692 1.00 98.10  ? 180 THR A O   1 
ATOM   6593  C CB  . THR D 4 184 ? 25.422  48.308  -28.260 1.00 100.71 ? 180 THR A CB  1 
ATOM   6594  O OG1 . THR D 4 184 ? 24.186  49.026  -28.090 1.00 104.30 ? 180 THR A OG1 1 
ATOM   6595  C CG2 . THR D 4 184 ? 25.762  47.578  -26.956 1.00 98.47  ? 180 THR A CG2 1 
ATOM   6596  N N   . LEU D 4 185 ? 26.665  49.967  -30.984 1.00 93.03  ? 181 LEU A N   1 
ATOM   6597  C CA  . LEU D 4 185 ? 26.234  50.715  -32.163 1.00 91.51  ? 181 LEU A CA  1 
ATOM   6598  C C   . LEU D 4 185 ? 26.510  49.997  -33.487 1.00 96.54  ? 181 LEU A C   1 
ATOM   6599  O O   . LEU D 4 185 ? 27.272  49.027  -33.530 1.00 96.70  ? 181 LEU A O   1 
ATOM   6600  C CB  . LEU D 4 185 ? 26.881  52.106  -32.175 1.00 90.82  ? 181 LEU A CB  1 
ATOM   6601  C CG  . LEU D 4 185 ? 26.603  53.086  -31.027 1.00 82.68  ? 181 LEU A CG  1 
ATOM   6602  C CD1 . LEU D 4 185 ? 27.666  54.166  -31.034 1.00 73.67  ? 181 LEU A CD1 1 
ATOM   6603  C CD2 . LEU D 4 185 ? 25.180  53.685  -31.054 1.00 74.42  ? 181 LEU A CD2 1 
ATOM   6604  N N   . THR D 4 186 ? 25.877  50.491  -34.555 1.00 101.01 ? 182 THR A N   1 
ATOM   6605  C CA  . THR D 4 186 ? 26.108  50.049  -35.942 1.00 101.28 ? 182 THR A CA  1 
ATOM   6606  C C   . THR D 4 186 ? 27.574  50.157  -36.355 1.00 98.46  ? 182 THR A C   1 
ATOM   6607  O O   . THR D 4 186 ? 28.419  50.549  -35.559 1.00 101.97 ? 182 THR A O   1 
ATOM   6608  C CB  . THR D 4 186 ? 25.296  50.933  -36.912 1.00 100.26 ? 182 THR A CB  1 
ATOM   6609  O OG1 . THR D 4 186 ? 23.969  51.112  -36.398 1.00 98.50  ? 182 THR A OG1 1 
ATOM   6610  C CG2 . THR D 4 186 ? 25.239  50.321  -38.307 1.00 102.73 ? 182 THR A CG2 1 
ATOM   6611  N N   . LYS D 4 187 ? 27.889  49.812  -37.597 1.00 99.81  ? 183 LYS A N   1 
ATOM   6612  C CA  . LYS D 4 187 ? 29.189  50.194  -38.127 1.00 103.12 ? 183 LYS A CA  1 
ATOM   6613  C C   . LYS D 4 187 ? 29.087  51.604  -38.748 1.00 105.96 ? 183 LYS A C   1 
ATOM   6614  O O   . LYS D 4 187 ? 29.906  52.477  -38.462 1.00 102.32 ? 183 LYS A O   1 
ATOM   6615  C CB  . LYS D 4 187 ? 29.740  49.146  -39.106 1.00 97.94  ? 183 LYS A CB  1 
ATOM   6616  C CG  . LYS D 4 187 ? 31.264  49.211  -39.314 1.00 102.82 ? 183 LYS A CG  1 
ATOM   6617  C CD  . LYS D 4 187 ? 31.667  50.377  -40.244 1.00 113.90 ? 183 LYS A CD  1 
ATOM   6618  C CE  . LYS D 4 187 ? 33.182  50.482  -40.482 1.00 99.31  ? 183 LYS A CE  1 
ATOM   6619  N NZ  . LYS D 4 187 ? 33.531  51.749  -41.191 1.00 96.19  ? 183 LYS A NZ  1 
ATOM   6620  N N   . ASP D 4 188 ? 28.062  51.848  -39.559 1.00 108.57 ? 184 ASP A N   1 
ATOM   6621  C CA  . ASP D 4 188 ? 27.921  53.158  -40.197 1.00 108.04 ? 184 ASP A CA  1 
ATOM   6622  C C   . ASP D 4 188 ? 27.642  54.271  -39.193 1.00 104.77 ? 184 ASP A C   1 
ATOM   6623  O O   . ASP D 4 188 ? 27.506  55.445  -39.566 1.00 103.48 ? 184 ASP A O   1 
ATOM   6624  C CB  . ASP D 4 188 ? 26.829  53.129  -41.262 1.00 114.39 ? 184 ASP A CB  1 
ATOM   6625  C CG  . ASP D 4 188 ? 27.202  52.268  -42.452 1.00 121.33 ? 184 ASP A CG  1 
ATOM   6626  O OD1 . ASP D 4 188 ? 27.213  51.022  -42.309 1.00 117.24 ? 184 ASP A OD1 1 
ATOM   6627  O OD2 . ASP D 4 188 ? 27.482  52.842  -43.528 1.00 125.11 ? 184 ASP A OD2 1 
ATOM   6628  N N   . GLU D 4 189 ? 27.561  53.894  -37.921 1.00 101.49 ? 185 GLU A N   1 
ATOM   6629  C CA  . GLU D 4 189 ? 27.339  54.858  -36.849 1.00 102.48 ? 185 GLU A CA  1 
ATOM   6630  C C   . GLU D 4 189 ? 28.645  55.166  -36.153 1.00 97.38  ? 185 GLU A C   1 
ATOM   6631  O O   . GLU D 4 189 ? 28.854  56.258  -35.635 1.00 97.22  ? 185 GLU A O   1 
ATOM   6632  C CB  . GLU D 4 189 ? 26.342  54.316  -35.825 1.00 100.38 ? 185 GLU A CB  1 
ATOM   6633  C CG  . GLU D 4 189 ? 25.961  55.325  -34.758 1.00 89.56  ? 185 GLU A CG  1 
ATOM   6634  C CD  . GLU D 4 189 ? 25.505  56.636  -35.363 1.00 94.85  ? 185 GLU A CD  1 
ATOM   6635  O OE1 . GLU D 4 189 ? 25.970  57.703  -34.911 1.00 98.02  ? 185 GLU A OE1 1 
ATOM   6636  O OE2 . GLU D 4 189 ? 24.692  56.601  -36.309 1.00 94.66  ? 185 GLU A OE2 1 
ATOM   6637  N N   . TYR D 4 190 ? 29.521  54.178  -36.142 1.00 96.50  ? 186 TYR A N   1 
ATOM   6638  C CA  . TYR D 4 190 ? 30.815  54.302  -35.502 1.00 95.70  ? 186 TYR A CA  1 
ATOM   6639  C C   . TYR D 4 190 ? 31.791  54.914  -36.513 1.00 98.29  ? 186 TYR A C   1 
ATOM   6640  O O   . TYR D 4 190 ? 32.597  55.781  -36.174 1.00 99.30  ? 186 TYR A O   1 
ATOM   6641  C CB  . TYR D 4 190 ? 31.236  52.916  -35.010 1.00 90.18  ? 186 TYR A CB  1 
ATOM   6642  C CG  . TYR D 4 190 ? 32.611  52.774  -34.403 1.00 83.81  ? 186 TYR A CG  1 
ATOM   6643  C CD1 . TYR D 4 190 ? 32.927  53.353  -33.184 1.00 81.08  ? 186 TYR A CD1 1 
ATOM   6644  C CD2 . TYR D 4 190 ? 33.577  51.997  -35.026 1.00 80.87  ? 186 TYR A CD2 1 
ATOM   6645  C CE1 . TYR D 4 190 ? 34.183  53.191  -32.627 1.00 79.01  ? 186 TYR A CE1 1 
ATOM   6646  C CE2 . TYR D 4 190 ? 34.828  51.828  -34.476 1.00 79.68  ? 186 TYR A CE2 1 
ATOM   6647  C CZ  . TYR D 4 190 ? 35.124  52.422  -33.279 1.00 78.37  ? 186 TYR A CZ  1 
ATOM   6648  O OH  . TYR D 4 190 ? 36.374  52.240  -32.750 1.00 80.10  ? 186 TYR A OH  1 
ATOM   6649  N N   . GLU D 4 191 ? 31.687  54.492  -37.768 1.00 99.69  ? 187 GLU A N   1 
ATOM   6650  C CA  . GLU D 4 191 ? 32.442  55.123  -38.841 1.00 102.53 ? 187 GLU A CA  1 
ATOM   6651  C C   . GLU D 4 191 ? 32.035  56.605  -38.981 1.00 103.63 ? 187 GLU A C   1 
ATOM   6652  O O   . GLU D 4 191 ? 32.703  57.386  -39.658 1.00 106.23 ? 187 GLU A O   1 
ATOM   6653  C CB  . GLU D 4 191 ? 32.246  54.345  -40.156 1.00 104.58 ? 187 GLU A CB  1 
ATOM   6654  C CG  . GLU D 4 191 ? 32.621  55.104  -41.437 1.00 111.44 ? 187 GLU A CG  1 
ATOM   6655  C CD  . GLU D 4 191 ? 31.402  55.623  -42.211 1.00 111.30 ? 187 GLU A CD  1 
ATOM   6656  O OE1 . GLU D 4 191 ? 30.346  54.945  -42.205 1.00 108.30 ? 187 GLU A OE1 1 
ATOM   6657  O OE2 . GLU D 4 191 ? 31.506  56.707  -42.834 1.00 107.82 ? 187 GLU A OE2 1 
ATOM   6658  N N   . ARG D 4 192 ? 30.948  56.996  -38.324 1.00 100.78 ? 188 ARG A N   1 
ATOM   6659  C CA  . ARG D 4 192 ? 30.452  58.363  -38.439 1.00 99.51  ? 188 ARG A CA  1 
ATOM   6660  C C   . ARG D 4 192 ? 31.346  59.423  -37.762 1.00 103.74 ? 188 ARG A C   1 
ATOM   6661  O O   . ARG D 4 192 ? 31.687  60.431  -38.387 1.00 110.74 ? 188 ARG A O   1 
ATOM   6662  C CB  . ARG D 4 192 ? 28.997  58.461  -37.967 1.00 99.86  ? 188 ARG A CB  1 
ATOM   6663  C CG  . ARG D 4 192 ? 28.531  59.888  -37.701 1.00 101.76 ? 188 ARG A CG  1 
ATOM   6664  C CD  . ARG D 4 192 ? 27.166  60.184  -38.336 1.00 107.59 ? 188 ARG A CD  1 
ATOM   6665  N NE  . ARG D 4 192 ? 26.061  59.445  -37.725 1.00 103.02 ? 188 ARG A NE  1 
ATOM   6666  C CZ  . ARG D 4 192 ? 24.802  59.503  -38.149 1.00 96.31  ? 188 ARG A CZ  1 
ATOM   6667  N NH1 . ARG D 4 192 ? 23.862  58.798  -37.537 1.00 95.75  ? 188 ARG A NH1 1 
ATOM   6668  N NH2 . ARG D 4 192 ? 24.484  60.263  -39.187 1.00 96.23  ? 188 ARG A NH2 1 
ATOM   6669  N N   . HIS D 4 193 ? 31.727  59.214  -36.502 1.00 101.90 ? 189 HIS A N   1 
ATOM   6670  C CA  . HIS D 4 193 ? 32.649  60.143  -35.834 1.00 101.22 ? 189 HIS A CA  1 
ATOM   6671  C C   . HIS D 4 193 ? 33.793  59.436  -35.130 1.00 99.58  ? 189 HIS A C   1 
ATOM   6672  O O   . HIS D 4 193 ? 34.151  58.319  -35.499 1.00 99.65  ? 189 HIS A O   1 
ATOM   6673  C CB  . HIS D 4 193 ? 31.926  61.057  -34.854 1.00 96.64  ? 189 HIS A CB  1 
ATOM   6674  C CG  . HIS D 4 193 ? 30.577  60.558  -34.445 1.00 98.20  ? 189 HIS A CG  1 
ATOM   6675  N ND1 . HIS D 4 193 ? 29.474  61.368  -34.414 1.00 104.03 ? 189 HIS A ND1 1 
ATOM   6676  C CD2 . HIS D 4 193 ? 30.168  59.325  -34.069 1.00 99.00  ? 189 HIS A CD2 1 
ATOM   6677  C CE1 . HIS D 4 193 ? 28.420  60.657  -34.021 1.00 105.16 ? 189 HIS A CE1 1 
ATOM   6678  N NE2 . HIS D 4 193 ? 28.822  59.418  -33.809 1.00 104.65 ? 189 HIS A NE2 1 
ATOM   6679  N N   . ASN D 4 194 ? 34.361  60.082  -34.112 1.00 99.17  ? 190 ASN A N   1 
ATOM   6680  C CA  . ASN D 4 194 ? 35.597  59.575  -33.510 1.00 101.30 ? 190 ASN A CA  1 
ATOM   6681  C C   . ASN D 4 194 ? 35.852  59.855  -32.018 1.00 99.32  ? 190 ASN A C   1 
ATOM   6682  O O   . ASN D 4 194 ? 36.479  59.048  -31.341 1.00 97.28  ? 190 ASN A O   1 
ATOM   6683  C CB  . ASN D 4 194 ? 36.787  60.091  -34.299 1.00 102.10 ? 190 ASN A CB  1 
ATOM   6684  C CG  . ASN D 4 194 ? 37.022  61.549  -34.064 1.00 102.51 ? 190 ASN A CG  1 
ATOM   6685  O OD1 . ASN D 4 194 ? 36.086  62.351  -34.098 1.00 98.99  ? 190 ASN A OD1 1 
ATOM   6686  N ND2 . ASN D 4 194 ? 38.268  61.910  -33.794 1.00 106.15 ? 190 ASN A ND2 1 
ATOM   6687  N N   . SER D 4 195 ? 35.404  60.994  -31.505 1.00 99.47  ? 191 SER A N   1 
ATOM   6688  C CA  . SER D 4 195 ? 35.665  61.315  -30.103 1.00 97.84  ? 191 SER A CA  1 
ATOM   6689  C C   . SER D 4 195 ? 34.630  60.705  -29.170 1.00 97.40  ? 191 SER A C   1 
ATOM   6690  O O   . SER D 4 195 ? 33.552  61.262  -28.965 1.00 97.20  ? 191 SER A O   1 
ATOM   6691  C CB  . SER D 4 195 ? 35.738  62.824  -29.879 1.00 101.94 ? 191 SER A CB  1 
ATOM   6692  O OG  . SER D 4 195 ? 35.670  63.130  -28.496 1.00 96.55  ? 191 SER A OG  1 
ATOM   6693  N N   . TYR D 4 196 ? 34.987  59.560  -28.597 1.00 97.99  ? 192 TYR A N   1 
ATOM   6694  C CA  . TYR D 4 196 ? 34.130  58.825  -27.676 1.00 91.32  ? 192 TYR A CA  1 
ATOM   6695  C C   . TYR D 4 196 ? 34.666  58.879  -26.246 1.00 89.17  ? 192 TYR A C   1 
ATOM   6696  O O   . TYR D 4 196 ? 35.745  58.354  -25.979 1.00 90.20  ? 192 TYR A O   1 
ATOM   6697  C CB  . TYR D 4 196 ? 34.117  57.355  -28.070 1.00 91.79  ? 192 TYR A CB  1 
ATOM   6698  C CG  . TYR D 4 196 ? 33.460  57.003  -29.381 1.00 92.38  ? 192 TYR A CG  1 
ATOM   6699  C CD1 . TYR D 4 196 ? 32.098  57.183  -29.571 1.00 91.33  ? 192 TYR A CD1 1 
ATOM   6700  C CD2 . TYR D 4 196 ? 34.193  56.425  -30.406 1.00 93.03  ? 192 TYR A CD2 1 
ATOM   6701  C CE1 . TYR D 4 196 ? 31.492  56.832  -30.760 1.00 90.30  ? 192 TYR A CE1 1 
ATOM   6702  C CE2 . TYR D 4 196 ? 33.597  56.066  -31.596 1.00 92.81  ? 192 TYR A CE2 1 
ATOM   6703  C CZ  . TYR D 4 196 ? 32.245  56.273  -31.768 1.00 92.20  ? 192 TYR A CZ  1 
ATOM   6704  O OH  . TYR D 4 196 ? 31.637  55.926  -32.951 1.00 93.89  ? 192 TYR A OH  1 
ATOM   6705  N N   . THR D 4 197 ? 33.917  59.465  -25.317 1.00 86.71  ? 193 THR A N   1 
ATOM   6706  C CA  . THR D 4 197 ? 34.357  59.485  -23.923 1.00 80.36  ? 193 THR A CA  1 
ATOM   6707  C C   . THR D 4 197 ? 33.450  58.682  -22.987 1.00 82.32  ? 193 THR A C   1 
ATOM   6708  O O   . THR D 4 197 ? 32.273  58.498  -23.264 1.00 81.71  ? 193 THR A O   1 
ATOM   6709  C CB  . THR D 4 197 ? 34.428  60.908  -23.369 1.00 81.64  ? 193 THR A CB  1 
ATOM   6710  O OG1 . THR D 4 197 ? 33.100  61.361  -23.084 1.00 89.91  ? 193 THR A OG1 1 
ATOM   6711  C CG2 . THR D 4 197 ? 35.092  61.850  -24.353 1.00 84.90  ? 193 THR A CG2 1 
ATOM   6712  N N   . CYS D 4 198 ? 34.021  58.250  -21.858 1.00 90.09  ? 194 CYS A N   1 
ATOM   6713  C CA  . CYS D 4 198 ? 33.366  57.461  -20.797 1.00 83.33  ? 194 CYS A CA  1 
ATOM   6714  C C   . CYS D 4 198 ? 33.397  58.271  -19.476 1.00 76.65  ? 194 CYS A C   1 
ATOM   6715  O O   . CYS D 4 198 ? 34.440  58.430  -18.851 1.00 74.82  ? 194 CYS A O   1 
ATOM   6716  C CB  . CYS D 4 198 ? 34.124  56.130  -20.665 1.00 77.29  ? 194 CYS A CB  1 
ATOM   6717  S SG  . CYS D 4 198 ? 33.628  54.912  -19.420 1.00 86.16  ? 194 CYS A SG  1 
ATOM   6718  N N   . GLU D 4 199 ? 32.257  58.802  -19.062 1.00 76.79  ? 195 GLU A N   1 
ATOM   6719  C CA  . GLU D 4 199 ? 32.239  59.824  -18.017 1.00 75.56  ? 195 GLU A CA  1 
ATOM   6720  C C   . GLU D 4 199 ? 31.705  59.267  -16.688 1.00 72.76  ? 195 GLU A C   1 
ATOM   6721  O O   . GLU D 4 199 ? 30.593  58.748  -16.630 1.00 73.87  ? 195 GLU A O   1 
ATOM   6722  C CB  . GLU D 4 199 ? 31.410  61.025  -18.501 1.00 76.23  ? 195 GLU A CB  1 
ATOM   6723  C CG  . GLU D 4 199 ? 31.515  62.303  -17.666 1.00 74.69  ? 195 GLU A CG  1 
ATOM   6724  C CD  . GLU D 4 199 ? 30.748  63.482  -18.287 1.00 79.82  ? 195 GLU A CD  1 
ATOM   6725  O OE1 . GLU D 4 199 ? 31.091  64.653  -18.002 1.00 72.46  ? 195 GLU A OE1 1 
ATOM   6726  O OE2 . GLU D 4 199 ? 29.802  63.241  -19.068 1.00 87.26  ? 195 GLU A OE2 1 
ATOM   6727  N N   . ALA D 4 200 ? 32.503  59.396  -15.627 1.00 70.21  ? 196 ALA A N   1 
ATOM   6728  C CA  . ALA D 4 200 ? 32.229  58.768  -14.324 1.00 65.52  ? 196 ALA A CA  1 
ATOM   6729  C C   . ALA D 4 200 ? 32.106  59.761  -13.171 1.00 67.05  ? 196 ALA A C   1 
ATOM   6730  O O   . ALA D 4 200 ? 32.669  60.841  -13.209 1.00 73.91  ? 196 ALA A O   1 
ATOM   6731  C CB  . ALA D 4 200 ? 33.306  57.753  -13.996 1.00 58.84  ? 196 ALA A CB  1 
ATOM   6732  N N   . THR D 4 201 ? 31.391  59.379  -12.127 1.00 62.96  ? 197 THR A N   1 
ATOM   6733  C CA  . THR D 4 201 ? 31.106  60.299  -11.046 1.00 66.70  ? 197 THR A CA  1 
ATOM   6734  C C   . THR D 4 201 ? 31.213  59.590  -9.708  1.00 74.37  ? 197 THR A C   1 
ATOM   6735  O O   . THR D 4 201 ? 30.645  58.515  -9.531  1.00 75.14  ? 197 THR A O   1 
ATOM   6736  C CB  . THR D 4 201 ? 29.699  60.870  -11.203 1.00 69.28  ? 197 THR A CB  1 
ATOM   6737  O OG1 . THR D 4 201 ? 29.688  61.819  -12.273 1.00 63.16  ? 197 THR A OG1 1 
ATOM   6738  C CG2 . THR D 4 201 ? 29.249  61.546  -9.921  1.00 76.34  ? 197 THR A CG2 1 
ATOM   6739  N N   . HIS D 4 202 ? 31.922  60.196  -8.756  1.00 79.73  ? 198 HIS A N   1 
ATOM   6740  C CA  . HIS D 4 202 ? 32.331  59.468  -7.548  1.00 80.25  ? 198 HIS A CA  1 
ATOM   6741  C C   . HIS D 4 202 ? 32.840  60.319  -6.378  1.00 78.78  ? 198 HIS A C   1 
ATOM   6742  O O   . HIS D 4 202 ? 33.461  61.363  -6.551  1.00 79.48  ? 198 HIS A O   1 
ATOM   6743  C CB  . HIS D 4 202 ? 33.416  58.451  -7.922  1.00 78.10  ? 198 HIS A CB  1 
ATOM   6744  C CG  . HIS D 4 202 ? 33.438  57.227  -7.060  1.00 76.74  ? 198 HIS A CG  1 
ATOM   6745  N ND1 . HIS D 4 202 ? 32.626  56.139  -7.295  1.00 70.05  ? 198 HIS A ND1 1 
ATOM   6746  C CD2 . HIS D 4 202 ? 34.194  56.910  -5.983  1.00 75.90  ? 198 HIS A CD2 1 
ATOM   6747  C CE1 . HIS D 4 202 ? 32.878  55.205  -6.395  1.00 68.77  ? 198 HIS A CE1 1 
ATOM   6748  N NE2 . HIS D 4 202 ? 33.824  55.648  -5.588  1.00 72.41  ? 198 HIS A NE2 1 
ATOM   6749  N N   . LYS D 4 203 ? 32.587  59.822  -5.178  1.00 79.00  ? 199 LYS A N   1 
ATOM   6750  C CA  . LYS D 4 203 ? 33.034  60.458  -3.963  1.00 79.03  ? 199 LYS A CA  1 
ATOM   6751  C C   . LYS D 4 203 ? 34.531  60.806  -4.030  1.00 82.51  ? 199 LYS A C   1 
ATOM   6752  O O   . LYS D 4 203 ? 34.957  61.851  -3.526  1.00 82.38  ? 199 LYS A O   1 
ATOM   6753  C CB  . LYS D 4 203 ? 32.751  59.510  -2.793  1.00 86.28  ? 199 LYS A CB  1 
ATOM   6754  C CG  . LYS D 4 203 ? 32.225  60.187  -1.535  1.00 89.81  ? 199 LYS A CG  1 
ATOM   6755  C CD  . LYS D 4 203 ? 32.024  59.168  -0.424  1.00 84.33  ? 199 LYS A CD  1 
ATOM   6756  C CE  . LYS D 4 203 ? 32.086  59.841  0.935   1.00 92.30  ? 199 LYS A CE  1 
ATOM   6757  N NZ  . LYS D 4 203 ? 31.235  61.061  0.994   1.00 90.16  ? 199 LYS A NZ  1 
ATOM   6758  N N   . THR D 4 204 ? 35.325  59.938  -4.663  1.00 84.26  ? 200 THR A N   1 
ATOM   6759  C CA  . THR D 4 204 ? 36.796  60.062  -4.629  1.00 82.11  ? 200 THR A CA  1 
ATOM   6760  C C   . THR D 4 204 ? 37.386  61.252  -5.382  1.00 77.83  ? 200 THR A C   1 
ATOM   6761  O O   . THR D 4 204 ? 38.543  61.603  -5.158  1.00 79.41  ? 200 THR A O   1 
ATOM   6762  C CB  . THR D 4 204 ? 37.551  58.770  -5.110  1.00 76.73  ? 200 THR A CB  1 
ATOM   6763  O OG1 . THR D 4 204 ? 36.761  58.050  -6.062  1.00 72.49  ? 200 THR A OG1 1 
ATOM   6764  C CG2 . THR D 4 204 ? 37.878  57.858  -3.942  1.00 74.43  ? 200 THR A CG2 1 
ATOM   6765  N N   . SER D 4 205 ? 36.616  61.854  -6.283  1.00 74.36  ? 201 SER A N   1 
ATOM   6766  C CA  . SER D 4 205 ? 37.116  62.995  -7.044  1.00 76.30  ? 201 SER A CA  1 
ATOM   6767  C C   . SER D 4 205 ? 36.025  64.037  -7.309  1.00 78.05  ? 201 SER A C   1 
ATOM   6768  O O   . SER D 4 205 ? 34.907  63.694  -7.690  1.00 82.42  ? 201 SER A O   1 
ATOM   6769  C CB  . SER D 4 205 ? 37.772  62.536  -8.361  1.00 72.58  ? 201 SER A CB  1 
ATOM   6770  O OG  . SER D 4 205 ? 38.643  63.531  -8.901  1.00 67.14  ? 201 SER A OG  1 
ATOM   6771  N N   . THR D 4 206 ? 36.352  65.307  -7.094  1.00 74.06  ? 202 THR A N   1 
ATOM   6772  C CA  . THR D 4 206 ? 35.472  66.389  -7.483  1.00 69.36  ? 202 THR A CA  1 
ATOM   6773  C C   . THR D 4 206 ? 35.361  66.447  -9.003  1.00 70.51  ? 202 THR A C   1 
ATOM   6774  O O   . THR D 4 206 ? 34.276  66.684  -9.523  1.00 75.59  ? 202 THR A O   1 
ATOM   6775  C CB  . THR D 4 206 ? 35.999  67.708  -6.978  1.00 76.36  ? 202 THR A CB  1 
ATOM   6776  O OG1 . THR D 4 206 ? 37.397  67.788  -7.279  1.00 76.74  ? 202 THR A OG1 1 
ATOM   6777  C CG2 . THR D 4 206 ? 35.808  67.798  -5.477  1.00 81.21  ? 202 THR A CG2 1 
ATOM   6778  N N   . SER D 4 207 ? 36.476  66.225  -9.710  1.00 65.79  ? 203 SER A N   1 
ATOM   6779  C CA  . SER D 4 207 ? 36.488  66.167  -11.183 1.00 64.66  ? 203 SER A CA  1 
ATOM   6780  C C   . SER D 4 207 ? 35.954  64.833  -11.682 1.00 61.08  ? 203 SER A C   1 
ATOM   6781  O O   . SER D 4 207 ? 36.171  63.817  -11.043 1.00 63.29  ? 203 SER A O   1 
ATOM   6782  C CB  . SER D 4 207 ? 37.909  66.350  -11.734 1.00 65.41  ? 203 SER A CB  1 
ATOM   6783  O OG  . SER D 4 207 ? 38.429  67.641  -11.479 1.00 67.34  ? 203 SER A OG  1 
ATOM   6784  N N   . PRO D 4 208 ? 35.253  64.829  -12.826 1.00 58.60  ? 204 PRO A N   1 
ATOM   6785  C CA  . PRO D 4 208 ? 34.798  63.571  -13.418 1.00 57.69  ? 204 PRO A CA  1 
ATOM   6786  C C   . PRO D 4 208 ? 35.977  62.730  -13.842 1.00 65.06  ? 204 PRO A C   1 
ATOM   6787  O O   . PRO D 4 208 ? 36.823  63.182  -14.622 1.00 73.92  ? 204 PRO A O   1 
ATOM   6788  C CB  . PRO D 4 208 ? 34.047  64.014  -14.668 1.00 57.50  ? 204 PRO A CB  1 
ATOM   6789  C CG  . PRO D 4 208 ? 33.663  65.373  -14.414 1.00 63.78  ? 204 PRO A CG  1 
ATOM   6790  C CD  . PRO D 4 208 ? 34.724  65.987  -13.555 1.00 64.66  ? 204 PRO A CD  1 
ATOM   6791  N N   . ILE D 4 209 ? 36.028  61.512  -13.322 1.00 64.10  ? 205 ILE A N   1 
ATOM   6792  C CA  . ILE D 4 209 ? 37.025  60.544  -13.718 1.00 67.34  ? 205 ILE A CA  1 
ATOM   6793  C C   . ILE D 4 209 ? 36.717  60.190  -15.169 1.00 68.69  ? 205 ILE A C   1 
ATOM   6794  O O   . ILE D 4 209 ? 35.602  59.783  -15.481 1.00 64.11  ? 205 ILE A O   1 
ATOM   6795  C CB  . ILE D 4 209 ? 36.952  59.300  -12.805 1.00 67.96  ? 205 ILE A CB  1 
ATOM   6796  C CG1 . ILE D 4 209 ? 36.788  59.719  -11.351 1.00 60.91  ? 205 ILE A CG1 1 
ATOM   6797  C CG2 . ILE D 4 209 ? 38.218  58.461  -12.903 1.00 71.32  ? 205 ILE A CG2 1 
ATOM   6798  C CD1 . ILE D 4 209 ? 38.028  60.293  -10.782 1.00 60.11  ? 205 ILE A CD1 1 
ATOM   6799  N N   . VAL D 4 210 ? 37.687  60.373  -16.062 1.00 70.91  ? 206 VAL A N   1 
ATOM   6800  C CA  . VAL D 4 210 ? 37.405  60.205  -17.482 1.00 69.82  ? 206 VAL A CA  1 
ATOM   6801  C C   . VAL D 4 210 ? 38.499  59.548  -18.324 1.00 69.45  ? 206 VAL A C   1 
ATOM   6802  O O   . VAL D 4 210 ? 39.652  59.953  -18.302 1.00 71.40  ? 206 VAL A O   1 
ATOM   6803  C CB  . VAL D 4 210 ? 37.063  61.545  -18.134 1.00 70.81  ? 206 VAL A CB  1 
ATOM   6804  C CG1 . VAL D 4 210 ? 36.967  61.369  -19.637 1.00 73.86  ? 206 VAL A CG1 1 
ATOM   6805  C CG2 . VAL D 4 210 ? 35.769  62.105  -17.561 1.00 68.95  ? 206 VAL A CG2 1 
ATOM   6806  N N   . LYS D 4 211 ? 38.121  58.525  -19.074 1.00 70.59  ? 207 LYS A N   1 
ATOM   6807  C CA  . LYS D 4 211 ? 38.971  58.033  -20.147 1.00 76.84  ? 207 LYS A CA  1 
ATOM   6808  C C   . LYS D 4 211 ? 38.292  58.401  -21.453 1.00 80.41  ? 207 LYS A C   1 
ATOM   6809  O O   . LYS D 4 211 ? 37.198  58.965  -21.439 1.00 76.16  ? 207 LYS A O   1 
ATOM   6810  C CB  . LYS D 4 211 ? 39.212  56.530  -20.049 1.00 73.68  ? 207 LYS A CB  1 
ATOM   6811  C CG  . LYS D 4 211 ? 40.138  56.150  -18.918 1.00 70.49  ? 207 LYS A CG  1 
ATOM   6812  C CD  . LYS D 4 211 ? 41.551  56.556  -19.212 1.00 67.28  ? 207 LYS A CD  1 
ATOM   6813  C CE  . LYS D 4 211 ? 42.477  56.105  -18.111 1.00 67.51  ? 207 LYS A CE  1 
ATOM   6814  N NZ  . LYS D 4 211 ? 43.809  55.758  -18.669 1.00 68.95  ? 207 LYS A NZ  1 
ATOM   6815  N N   . SER D 4 212 ? 38.939  58.090  -22.573 1.00 84.08  ? 208 SER A N   1 
ATOM   6816  C CA  . SER D 4 212 ? 38.533  58.655  -23.855 1.00 86.55  ? 208 SER A CA  1 
ATOM   6817  C C   . SER D 4 212 ? 39.439  58.178  -24.990 1.00 91.73  ? 208 SER A C   1 
ATOM   6818  O O   . SER D 4 212 ? 40.556  57.711  -24.744 1.00 94.78  ? 208 SER A O   1 
ATOM   6819  C CB  . SER D 4 212 ? 38.575  60.187  -23.764 1.00 84.73  ? 208 SER A CB  1 
ATOM   6820  O OG  . SER D 4 212 ? 38.186  60.810  -24.976 1.00 87.39  ? 208 SER A OG  1 
ATOM   6821  N N   . PHE D 4 213 ? 38.952  58.300  -26.226 1.00 93.50  ? 209 PHE A N   1 
ATOM   6822  C CA  . PHE D 4 213 ? 39.764  58.025  -27.419 1.00 98.65  ? 209 PHE A CA  1 
ATOM   6823  C C   . PHE D 4 213 ? 39.085  58.566  -28.698 1.00 103.20 ? 209 PHE A C   1 
ATOM   6824  O O   . PHE D 4 213 ? 37.858  58.722  -28.730 1.00 103.72 ? 209 PHE A O   1 
ATOM   6825  C CB  . PHE D 4 213 ? 40.017  56.527  -27.547 1.00 95.34  ? 209 PHE A CB  1 
ATOM   6826  C CG  . PHE D 4 213 ? 38.951  55.808  -28.303 1.00 96.11  ? 209 PHE A CG  1 
ATOM   6827  C CD1 . PHE D 4 213 ? 39.281  54.886  -29.285 1.00 96.10  ? 209 PHE A CD1 1 
ATOM   6828  C CD2 . PHE D 4 213 ? 37.613  56.076  -28.051 1.00 91.61  ? 209 PHE A CD2 1 
ATOM   6829  C CE1 . PHE D 4 213 ? 38.295  54.230  -29.992 1.00 97.96  ? 209 PHE A CE1 1 
ATOM   6830  C CE2 . PHE D 4 213 ? 36.625  55.434  -28.758 1.00 92.54  ? 209 PHE A CE2 1 
ATOM   6831  C CZ  . PHE D 4 213 ? 36.961  54.505  -29.729 1.00 96.09  ? 209 PHE A CZ  1 
ATOM   6832  N N   . ASN D 4 214 ? 39.867  58.849  -29.743 1.00 98.14  ? 210 ASN A N   1 
ATOM   6833  C CA  . ASN D 4 214 ? 39.306  59.414  -30.970 1.00 99.57  ? 210 ASN A CA  1 
ATOM   6834  C C   . ASN D 4 214 ? 39.586  58.518  -32.157 1.00 101.78 ? 210 ASN A C   1 
ATOM   6835  O O   . ASN D 4 214 ? 40.731  58.153  -32.376 1.00 106.07 ? 210 ASN A O   1 
ATOM   6836  C CB  . ASN D 4 214 ? 39.894  60.793  -31.238 1.00 104.85 ? 210 ASN A CB  1 
ATOM   6837  C CG  . ASN D 4 214 ? 40.439  61.455  -29.987 1.00 101.50 ? 210 ASN A CG  1 
ATOM   6838  O OD1 . ASN D 4 214 ? 41.379  60.962  -29.361 1.00 94.28  ? 210 ASN A OD1 1 
ATOM   6839  N ND2 . ASN D 4 214 ? 39.858  62.592  -29.627 1.00 97.56  ? 210 ASN A ND2 1 
ATOM   6840  N N   . ARG D 4 215 ? 38.558  58.171  -32.930 1.00 100.50 ? 211 ARG A N   1 
ATOM   6841  C CA  . ARG D 4 215 ? 38.732  57.182  -33.996 1.00 103.61 ? 211 ARG A CA  1 
ATOM   6842  C C   . ARG D 4 215 ? 39.658  57.685  -35.086 1.00 112.14 ? 211 ARG A C   1 
ATOM   6843  O O   . ARG D 4 215 ? 40.491  56.931  -35.605 1.00 114.71 ? 211 ARG A O   1 
ATOM   6844  C CB  . ARG D 4 215 ? 37.405  56.761  -34.625 1.00 101.77 ? 211 ARG A CB  1 
ATOM   6845  C CG  . ARG D 4 215 ? 37.569  55.619  -35.632 1.00 100.75 ? 211 ARG A CG  1 
ATOM   6846  C CD  . ARG D 4 215 ? 36.285  55.334  -36.374 1.00 95.91  ? 211 ARG A CD  1 
ATOM   6847  N NE  . ARG D 4 215 ? 35.869  56.478  -37.170 1.00 97.63  ? 211 ARG A NE  1 
ATOM   6848  C CZ  . ARG D 4 215 ? 35.767  56.469  -38.494 1.00 102.43 ? 211 ARG A CZ  1 
ATOM   6849  N NH1 . ARG D 4 215 ? 35.384  57.566  -39.133 1.00 108.30 ? 211 ARG A NH1 1 
ATOM   6850  N NH2 . ARG D 4 215 ? 36.041  55.367  -39.180 1.00 105.09 ? 211 ARG A NH2 1 
ATOM   6851  N N   . ASN D 4 216 ? 39.489  58.953  -35.447 1.00 112.08 ? 212 ASN A N   1 
ATOM   6852  C CA  . ASN D 4 216 ? 40.385  59.597  -36.392 1.00 111.86 ? 212 ASN A CA  1 
ATOM   6853  C C   . ASN D 4 216 ? 41.659  59.987  -35.657 1.00 115.03 ? 212 ASN A C   1 
ATOM   6854  O O   . ASN D 4 216 ? 42.005  61.166  -35.548 1.00 110.63 ? 212 ASN A O   1 
ATOM   6855  C CB  . ASN D 4 216 ? 39.711  60.805  -37.036 1.00 110.97 ? 212 ASN A CB  1 
ATOM   6856  C CG  . ASN D 4 216 ? 38.390  60.451  -37.699 1.00 110.02 ? 212 ASN A CG  1 
ATOM   6857  O OD1 . ASN D 4 216 ? 37.591  59.687  -37.156 1.00 105.34 ? 212 ASN A OD1 1 
ATOM   6858  N ND2 . ASN D 4 216 ? 38.155  61.011  -38.883 1.00 114.86 ? 212 ASN A ND2 1 
ATOM   6859  N N   . GLU D 4 217 ? 42.324  58.959  -35.130 1.00 123.13 ? 213 GLU A N   1 
ATOM   6860  C CA  . GLU D 4 217 ? 43.574  59.071  -34.376 1.00 126.13 ? 213 GLU A CA  1 
ATOM   6861  C C   . GLU D 4 217 ? 44.306  57.724  -34.394 1.00 130.05 ? 213 GLU A C   1 
ATOM   6862  O O   . GLU D 4 217 ? 45.478  57.655  -34.029 1.00 131.68 ? 213 GLU A O   1 
ATOM   6863  C CB  . GLU D 4 217 ? 43.325  59.511  -32.922 1.00 118.20 ? 213 GLU A CB  1 
ATOM   6864  C CG  . GLU D 4 217 ? 42.977  60.989  -32.749 1.00 117.33 ? 213 GLU A CG  1 
ATOM   6865  C CD  . GLU D 4 217 ? 44.090  61.784  -32.089 1.00 116.12 ? 213 GLU A CD  1 
ATOM   6866  O OE1 . GLU D 4 217 ? 44.186  63.000  -32.365 1.00 115.24 ? 213 GLU A OE1 1 
ATOM   6867  O OE2 . GLU D 4 217 ? 44.862  61.195  -31.299 1.00 113.71 ? 213 GLU A OE2 1 
ATOM   6868  N N   . CYS D 4 218 ? 43.594  56.671  -34.811 1.00 132.97 ? 214 CYS A N   1 
ATOM   6869  C CA  . CYS D 4 218 ? 44.121  55.293  -34.931 1.00 144.01 ? 214 CYS A CA  1 
ATOM   6870  C C   . CYS D 4 218 ? 44.151  54.493  -33.608 1.00 142.01 ? 214 CYS A C   1 
ATOM   6871  O O   . CYS D 4 218 ? 43.141  53.916  -33.191 1.00 130.24 ? 214 CYS A O   1 
ATOM   6872  C CB  . CYS D 4 218 ? 45.494  55.274  -35.635 1.00 146.10 ? 214 CYS A CB  1 
ATOM   6873  S SG  . CYS D 4 218 ? 46.302  53.638  -35.783 1.00 146.46 ? 214 CYS A SG  1 
ATOM   6874  O OXT . CYS D 4 218 ? 45.179  54.390  -32.927 1.00 146.55 ? 214 CYS A OXT 1 
ATOM   6875  N N   . GLN E 5 1   ? 35.642  11.511  2.613   1.00 100.19 ? 1   GLN B N   1 
ATOM   6876  C CA  . GLN E 5 1   ? 35.191  12.900  2.647   1.00 94.36  ? 1   GLN B CA  1 
ATOM   6877  C C   . GLN E 5 1   ? 33.838  13.004  1.964   1.00 84.80  ? 1   GLN B C   1 
ATOM   6878  O O   . GLN E 5 1   ? 33.723  12.743  0.771   1.00 88.98  ? 1   GLN B O   1 
ATOM   6879  C CB  . GLN E 5 1   ? 36.200  13.804  1.944   1.00 94.15  ? 1   GLN B CB  1 
ATOM   6880  C CG  . GLN E 5 1   ? 36.634  13.256  0.599   1.00 105.44 ? 1   GLN B CG  1 
ATOM   6881  C CD  . GLN E 5 1   ? 37.362  14.282  -0.246  1.00 118.19 ? 1   GLN B CD  1 
ATOM   6882  O OE1 . GLN E 5 1   ? 36.740  15.144  -0.878  1.00 117.90 ? 1   GLN B OE1 1 
ATOM   6883  N NE2 . GLN E 5 1   ? 38.690  14.192  -0.270  1.00 123.77 ? 1   GLN B NE2 1 
ATOM   6884  N N   . VAL E 5 2   ? 32.808  13.378  2.711   1.00 78.87  ? 2   VAL B N   1 
ATOM   6885  C CA  . VAL E 5 2   ? 31.463  13.337  2.153   1.00 75.90  ? 2   VAL B CA  1 
ATOM   6886  C C   . VAL E 5 2   ? 31.272  14.399  1.086   1.00 72.19  ? 2   VAL B C   1 
ATOM   6887  O O   . VAL E 5 2   ? 31.528  15.574  1.323   1.00 71.04  ? 2   VAL B O   1 
ATOM   6888  C CB  . VAL E 5 2   ? 30.373  13.439  3.249   1.00 67.35  ? 2   VAL B CB  1 
ATOM   6889  C CG1 . VAL E 5 2   ? 31.021  13.461  4.612   1.00 66.61  ? 2   VAL B CG1 1 
ATOM   6890  C CG2 . VAL E 5 2   ? 29.468  14.647  3.026   1.00 54.40  ? 2   VAL B CG2 1 
ATOM   6891  N N   . GLN E 5 3   ? 30.861  13.969  -0.103  1.00 70.01  ? 3   GLN B N   1 
ATOM   6892  C CA  . GLN E 5 3   ? 30.442  14.902  -1.137  1.00 69.16  ? 3   GLN B CA  1 
ATOM   6893  C C   . GLN E 5 3   ? 29.090  14.494  -1.695  1.00 66.52  ? 3   GLN B C   1 
ATOM   6894  O O   . GLN E 5 3   ? 28.718  13.324  -1.703  1.00 65.42  ? 3   GLN B O   1 
ATOM   6895  C CB  . GLN E 5 3   ? 31.451  14.993  -2.294  1.00 80.25  ? 3   GLN B CB  1 
ATOM   6896  C CG  . GLN E 5 3   ? 32.932  14.832  -1.932  1.00 89.68  ? 3   GLN B CG  1 
ATOM   6897  C CD  . GLN E 5 3   ? 33.574  13.618  -2.616  1.00 98.22  ? 3   GLN B CD  1 
ATOM   6898  O OE1 . GLN E 5 3   ? 34.565  13.070  -2.129  1.00 102.02 ? 3   GLN B OE1 1 
ATOM   6899  N NE2 . GLN E 5 3   ? 32.995  13.188  -3.742  1.00 104.19 ? 3   GLN B NE2 1 
ATOM   6900  N N   . LEU E 5 4   ? 28.347  15.491  -2.137  1.00 66.81  ? 4   LEU B N   1 
ATOM   6901  C CA  . LEU E 5 4   ? 27.224  15.272  -3.028  1.00 69.41  ? 4   LEU B CA  1 
ATOM   6902  C C   . LEU E 5 4   ? 27.774  15.601  -4.422  1.00 75.29  ? 4   LEU B C   1 
ATOM   6903  O O   . LEU E 5 4   ? 28.888  16.121  -4.537  1.00 75.94  ? 4   LEU B O   1 
ATOM   6904  C CB  . LEU E 5 4   ? 26.032  16.159  -2.631  1.00 64.23  ? 4   LEU B CB  1 
ATOM   6905  C CG  . LEU E 5 4   ? 25.127  15.584  -1.520  1.00 60.00  ? 4   LEU B CG  1 
ATOM   6906  C CD1 . LEU E 5 4   ? 25.947  14.811  -0.499  1.00 57.09  ? 4   LEU B CD1 1 
ATOM   6907  C CD2 . LEU E 5 4   ? 24.217  16.620  -0.821  1.00 51.74  ? 4   LEU B CD2 1 
ATOM   6908  N N   . GLN E 5 5   ? 27.045  15.276  -5.483  1.00 75.27  ? 5   GLN B N   1 
ATOM   6909  C CA  . GLN E 5 5   ? 27.563  15.570  -6.810  1.00 72.67  ? 5   GLN B CA  1 
ATOM   6910  C C   . GLN E 5 5   ? 26.456  15.952  -7.754  1.00 70.45  ? 5   GLN B C   1 
ATOM   6911  O O   . GLN E 5 5   ? 26.259  15.321  -8.783  1.00 75.25  ? 5   GLN B O   1 
ATOM   6912  C CB  . GLN E 5 5   ? 28.369  14.390  -7.364  1.00 77.13  ? 5   GLN B CB  1 
ATOM   6913  C CG  . GLN E 5 5   ? 29.173  14.711  -8.628  1.00 80.96  ? 5   GLN B CG  1 
ATOM   6914  C CD  . GLN E 5 5   ? 29.965  16.021  -8.528  1.00 85.63  ? 5   GLN B CD  1 
ATOM   6915  O OE1 . GLN E 5 5   ? 29.443  17.057  -8.095  1.00 79.96  ? 5   GLN B OE1 1 
ATOM   6916  N NE2 . GLN E 5 5   ? 31.230  15.978  -8.946  1.00 84.96  ? 5   GLN B NE2 1 
ATOM   6917  N N   . GLN E 5 6   ? 25.733  17.003  -7.409  1.00 70.04  ? 6   GLN B N   1 
ATOM   6918  C CA  . GLN E 5 6   ? 24.621  17.410  -8.246  1.00 74.30  ? 6   GLN B CA  1 
ATOM   6919  C C   . GLN E 5 6   ? 25.008  17.488  -9.725  1.00 79.99  ? 6   GLN B C   1 
ATOM   6920  O O   . GLN E 5 6   ? 26.112  17.911  -10.085 1.00 77.48  ? 6   GLN B O   1 
ATOM   6921  C CB  . GLN E 5 6   ? 23.981  18.710  -7.753  1.00 68.04  ? 6   GLN B CB  1 
ATOM   6922  C CG  . GLN E 5 6   ? 23.225  18.531  -6.451  1.00 65.09  ? 6   GLN B CG  1 
ATOM   6923  C CD  . GLN E 5 6   ? 22.227  19.630  -6.190  1.00 64.18  ? 6   GLN B CD  1 
ATOM   6924  O OE1 . GLN E 5 6   ? 21.536  20.098  -7.099  1.00 63.14  ? 6   GLN B OE1 1 
ATOM   6925  N NE2 . GLN E 5 6   ? 22.129  20.036  -4.932  1.00 62.55  ? 6   GLN B NE2 1 
ATOM   6926  N N   . SER E 5 7   ? 24.074  17.036  -10.557 1.00 78.25  ? 7   SER B N   1 
ATOM   6927  C CA  . SER E 5 7   ? 24.203  16.988  -12.002 1.00 74.60  ? 7   SER B CA  1 
ATOM   6928  C C   . SER E 5 7   ? 24.336  18.385  -12.601 1.00 75.18  ? 7   SER B C   1 
ATOM   6929  O O   . SER E 5 7   ? 24.032  19.378  -11.945 1.00 78.89  ? 7   SER B O   1 
ATOM   6930  C CB  . SER E 5 7   ? 22.934  16.358  -12.544 1.00 75.08  ? 7   SER B CB  1 
ATOM   6931  O OG  . SER E 5 7   ? 21.816  17.109  -12.094 1.00 71.65  ? 7   SER B OG  1 
ATOM   6932  N N   . GLY E 5 8   ? 24.763  18.453  -13.859 1.00 72.45  ? 8   GLY B N   1 
ATOM   6933  C CA  . GLY E 5 8   ? 24.916  19.719  -14.561 1.00 73.98  ? 8   GLY B CA  1 
ATOM   6934  C C   . GLY E 5 8   ? 23.588  20.363  -14.905 1.00 75.29  ? 8   GLY B C   1 
ATOM   6935  O O   . GLY E 5 8   ? 22.542  19.717  -14.795 1.00 75.97  ? 8   GLY B O   1 
ATOM   6936  N N   . ALA E 5 9   ? 23.630  21.624  -15.339 1.00 73.15  ? 9   ALA B N   1 
ATOM   6937  C CA  . ALA E 5 9   ? 22.412  22.426  -15.520 1.00 75.43  ? 9   ALA B CA  1 
ATOM   6938  C C   . ALA E 5 9   ? 21.607  22.055  -16.759 1.00 79.37  ? 9   ALA B C   1 
ATOM   6939  O O   . ALA E 5 9   ? 22.144  21.496  -17.716 1.00 83.47  ? 9   ALA B O   1 
ATOM   6940  C CB  . ALA E 5 9   ? 22.739  23.904  -15.532 1.00 77.14  ? 9   ALA B CB  1 
ATOM   6941  N N   . GLU E 5 10  ? 20.318  22.383  -16.744 1.00 79.34  ? 10  GLU B N   1 
ATOM   6942  C CA  . GLU E 5 10  ? 19.418  21.896  -17.785 1.00 80.65  ? 10  GLU B CA  1 
ATOM   6943  C C   . GLU E 5 10  ? 18.495  22.946  -18.414 1.00 84.59  ? 10  GLU B C   1 
ATOM   6944  O O   . GLU E 5 10  ? 17.768  23.673  -17.717 1.00 79.13  ? 10  GLU B O   1 
ATOM   6945  C CB  . GLU E 5 10  ? 18.592  20.713  -17.269 1.00 83.65  ? 10  GLU B CB  1 
ATOM   6946  C CG  . GLU E 5 10  ? 18.584  19.499  -18.203 1.00 86.62  ? 10  GLU B CG  1 
ATOM   6947  C CD  . GLU E 5 10  ? 19.270  18.290  -17.592 1.00 93.82  ? 10  GLU B CD  1 
ATOM   6948  O OE1 . GLU E 5 10  ? 18.733  17.755  -16.593 1.00 95.54  ? 10  GLU B OE1 1 
ATOM   6949  O OE2 . GLU E 5 10  ? 20.343  17.880  -18.101 1.00 92.64  ? 10  GLU B OE2 1 
ATOM   6950  N N   . LEU E 5 11  ? 18.546  23.000  -19.747 1.00 89.93  ? 11  LEU B N   1 
ATOM   6951  C CA  . LEU E 5 11  ? 17.657  23.830  -20.551 1.00 87.20  ? 11  LEU B CA  1 
ATOM   6952  C C   . LEU E 5 11  ? 16.422  23.021  -20.896 1.00 87.55  ? 11  LEU B C   1 
ATOM   6953  O O   . LEU E 5 11  ? 16.516  21.816  -21.130 1.00 87.62  ? 11  LEU B O   1 
ATOM   6954  C CB  . LEU E 5 11  ? 18.347  24.271  -21.838 1.00 79.50  ? 11  LEU B CB  1 
ATOM   6955  C CG  . LEU E 5 11  ? 17.417  24.940  -22.858 1.00 89.48  ? 11  LEU B CG  1 
ATOM   6956  C CD1 . LEU E 5 11  ? 16.649  26.124  -22.245 1.00 90.08  ? 11  LEU B CD1 1 
ATOM   6957  C CD2 . LEU E 5 11  ? 18.179  25.358  -24.119 1.00 90.41  ? 11  LEU B CD2 1 
ATOM   6958  N N   . ALA E 5 12  ? 15.270  23.681  -20.937 1.00 84.60  ? 12  ALA B N   1 
ATOM   6959  C CA  . ALA E 5 12  ? 14.015  22.972  -21.092 1.00 83.21  ? 12  ALA B CA  1 
ATOM   6960  C C   . ALA E 5 12  ? 12.939  23.861  -21.663 1.00 85.54  ? 12  ALA B C   1 
ATOM   6961  O O   . ALA E 5 12  ? 12.828  25.016  -21.285 1.00 85.61  ? 12  ALA B O   1 
ATOM   6962  C CB  . ALA E 5 12  ? 13.567  22.441  -19.749 1.00 87.21  ? 12  ALA B CB  1 
ATOM   6963  N N   . LYS E 5 13  ? 12.126  23.301  -22.550 1.00 85.70  ? 13  LYS B N   1 
ATOM   6964  C CA  . LYS E 5 13  ? 10.986  24.010  -23.129 1.00 85.33  ? 13  LYS B CA  1 
ATOM   6965  C C   . LYS E 5 13  ? 9.714   23.851  -22.269 1.00 83.03  ? 13  LYS B C   1 
ATOM   6966  O O   . LYS E 5 13  ? 9.495   22.777  -21.694 1.00 76.77  ? 13  LYS B O   1 
ATOM   6967  C CB  . LYS E 5 13  ? 10.756  23.518  -24.564 1.00 84.77  ? 13  LYS B CB  1 
ATOM   6968  C CG  . LYS E 5 13  ? 11.056  22.027  -24.779 1.00 87.81  ? 13  LYS B CG  1 
ATOM   6969  C CD  . LYS E 5 13  ? 12.556  21.723  -24.876 1.00 91.81  ? 13  LYS B CD  1 
ATOM   6970  C CE  . LYS E 5 13  ? 13.132  22.061  -26.255 1.00 94.98  ? 13  LYS B CE  1 
ATOM   6971  N NZ  . LYS E 5 13  ? 14.546  21.584  -26.406 1.00 88.57  ? 13  LYS B NZ  1 
ATOM   6972  N N   . PRO E 5 14  ? 8.876   24.918  -22.187 1.00 82.02  ? 14  PRO B N   1 
ATOM   6973  C CA  . PRO E 5 14  ? 7.684   25.031  -21.313 1.00 83.03  ? 14  PRO B CA  1 
ATOM   6974  C C   . PRO E 5 14  ? 6.697   23.853  -21.380 1.00 83.97  ? 14  PRO B C   1 
ATOM   6975  O O   . PRO E 5 14  ? 6.865   22.949  -22.209 1.00 85.16  ? 14  PRO B O   1 
ATOM   6976  C CB  . PRO E 5 14  ? 7.009   26.319  -21.790 1.00 69.80  ? 14  PRO B CB  1 
ATOM   6977  C CG  . PRO E 5 14  ? 8.114   27.115  -22.361 1.00 77.50  ? 14  PRO B CG  1 
ATOM   6978  C CD  . PRO E 5 14  ? 9.075   26.141  -22.983 1.00 78.17  ? 14  PRO B CD  1 
ATOM   6979  N N   . GLY E 5 15  ? 5.691   23.865  -20.503 1.00 77.82  ? 15  GLY B N   1 
ATOM   6980  C CA  . GLY E 5 15  ? 4.772   22.749  -20.383 1.00 75.78  ? 15  GLY B CA  1 
ATOM   6981  C C   . GLY E 5 15  ? 5.480   21.410  -20.498 1.00 83.03  ? 15  GLY B C   1 
ATOM   6982  O O   . GLY E 5 15  ? 4.846   20.392  -20.786 1.00 85.50  ? 15  GLY B O   1 
ATOM   6983  N N   . ALA E 5 16  ? 6.798   21.412  -20.284 1.00 86.28  ? 16  ALA B N   1 
ATOM   6984  C CA  . ALA E 5 16  ? 7.624   20.204  -20.393 1.00 84.58  ? 16  ALA B CA  1 
ATOM   6985  C C   . ALA E 5 16  ? 8.190   19.769  -19.039 1.00 87.36  ? 16  ALA B C   1 
ATOM   6986  O O   . ALA E 5 16  ? 7.624   20.091  -17.988 1.00 85.29  ? 16  ALA B O   1 
ATOM   6987  C CB  . ALA E 5 16  ? 8.743   20.390  -21.409 1.00 73.03  ? 16  ALA B CB  1 
ATOM   6988  N N   . SER E 5 17  ? 9.309   19.049  -19.059 1.00 84.36  ? 17  SER B N   1 
ATOM   6989  C CA  . SER E 5 17  ? 9.739   18.341  -17.858 1.00 82.51  ? 17  SER B CA  1 
ATOM   6990  C C   . SER E 5 17  ? 11.196  17.960  -17.801 1.00 78.16  ? 17  SER B C   1 
ATOM   6991  O O   . SER E 5 17  ? 11.735  17.396  -18.741 1.00 80.72  ? 17  SER B O   1 
ATOM   6992  C CB  . SER E 5 17  ? 8.918   17.062  -17.684 1.00 88.09  ? 17  SER B CB  1 
ATOM   6993  O OG  . SER E 5 17  ? 9.696   16.039  -17.084 1.00 79.92  ? 17  SER B OG  1 
ATOM   6994  N N   . VAL E 5 18  ? 11.810  18.219  -16.654 1.00 81.02  ? 18  VAL B N   1 
ATOM   6995  C CA  . VAL E 5 18  ? 13.171  17.767  -16.392 1.00 80.10  ? 18  VAL B CA  1 
ATOM   6996  C C   . VAL E 5 18  ? 13.262  16.851  -15.152 1.00 78.77  ? 18  VAL B C   1 
ATOM   6997  O O   . VAL E 5 18  ? 12.499  16.986  -14.196 1.00 75.06  ? 18  VAL B O   1 
ATOM   6998  C CB  . VAL E 5 18  ? 14.124  18.961  -16.206 1.00 74.37  ? 18  VAL B CB  1 
ATOM   6999  C CG1 . VAL E 5 18  ? 15.466  18.666  -16.853 1.00 76.98  ? 18  VAL B CG1 1 
ATOM   7000  C CG2 . VAL E 5 18  ? 13.512  20.211  -16.788 1.00 76.29  ? 18  VAL B CG2 1 
ATOM   7001  N N   . LYS E 5 19  ? 14.203  15.915  -15.182 1.00 78.14  ? 19  LYS B N   1 
ATOM   7002  C CA  . LYS E 5 19  ? 14.505  15.075  -14.031 1.00 69.34  ? 19  LYS B CA  1 
ATOM   7003  C C   . LYS E 5 19  ? 16.006  15.188  -13.792 1.00 68.93  ? 19  LYS B C   1 
ATOM   7004  O O   . LYS E 5 19  ? 16.810  14.852  -14.668 1.00 67.55  ? 19  LYS B O   1 
ATOM   7005  C CB  . LYS E 5 19  ? 14.083  13.626  -14.306 1.00 73.47  ? 19  LYS B CB  1 
ATOM   7006  C CG  . LYS E 5 19  ? 14.614  12.569  -13.329 1.00 69.73  ? 19  LYS B CG  1 
ATOM   7007  C CD  . LYS E 5 19  ? 14.555  11.159  -13.963 1.00 62.96  ? 19  LYS B CD  1 
ATOM   7008  C CE  . LYS E 5 19  ? 15.218  10.082  -13.102 1.00 55.21  ? 19  LYS B CE  1 
ATOM   7009  N NZ  . LYS E 5 19  ? 15.495  8.827   -13.861 1.00 50.64  ? 19  LYS B NZ  1 
ATOM   7010  N N   . MET E 5 20  ? 16.373  15.692  -12.614 1.00 73.58  ? 20  MET B N   1 
ATOM   7011  C CA  . MET E 5 20  ? 17.777  15.964  -12.264 1.00 71.61  ? 20  MET B CA  1 
ATOM   7012  C C   . MET E 5 20  ? 18.335  15.164  -11.078 1.00 59.67  ? 20  MET B C   1 
ATOM   7013  O O   . MET E 5 20  ? 17.616  14.758  -10.180 1.00 58.50  ? 20  MET B O   1 
ATOM   7014  C CB  . MET E 5 20  ? 17.975  17.449  -12.023 1.00 62.39  ? 20  MET B CB  1 
ATOM   7015  C CG  . MET E 5 20  ? 16.776  18.108  -11.473 1.00 58.77  ? 20  MET B CG  1 
ATOM   7016  S SD  . MET E 5 20  ? 17.353  19.403  -10.415 1.00 73.27  ? 20  MET B SD  1 
ATOM   7017  C CE  . MET E 5 20  ? 15.841  20.353  -10.222 1.00 70.33  ? 20  MET B CE  1 
ATOM   7018  N N   . SER E 5 21  ? 19.639  14.956  -11.095 1.00 58.28  ? 21  SER B N   1 
ATOM   7019  C CA  . SER E 5 21  ? 20.252  13.965  -10.239 1.00 64.43  ? 21  SER B CA  1 
ATOM   7020  C C   . SER E 5 21  ? 21.000  14.541  -9.022  1.00 71.67  ? 21  SER B C   1 
ATOM   7021  O O   . SER E 5 21  ? 21.225  15.755  -8.944  1.00 72.09  ? 21  SER B O   1 
ATOM   7022  C CB  . SER E 5 21  ? 21.199  13.113  -11.076 1.00 61.66  ? 21  SER B CB  1 
ATOM   7023  O OG  . SER E 5 21  ? 22.411  12.910  -10.368 1.00 69.84  ? 21  SER B OG  1 
ATOM   7024  N N   . CYS E 5 22  ? 21.354  13.648  -8.086  1.00 70.80  ? 22  CYS B N   1 
ATOM   7025  C CA  . CYS E 5 22  ? 22.211  13.926  -6.925  1.00 70.74  ? 22  CYS B CA  1 
ATOM   7026  C C   . CYS E 5 22  ? 22.892  12.632  -6.465  1.00 67.48  ? 22  CYS B C   1 
ATOM   7027  O O   . CYS E 5 22  ? 22.273  11.770  -5.827  1.00 58.52  ? 22  CYS B O   1 
ATOM   7028  C CB  . CYS E 5 22  ? 21.408  14.524  -5.767  1.00 70.31  ? 22  CYS B CB  1 
ATOM   7029  S SG  . CYS E 5 22  ? 22.418  15.248  -4.418  1.00 79.86  ? 22  CYS B SG  1 
ATOM   7030  N N   . LYS E 5 23  ? 24.171  12.502  -6.795  1.00 70.29  ? 23  LYS B N   1 
ATOM   7031  C CA  . LYS E 5 23  ? 24.892  11.259  -6.558  1.00 70.47  ? 23  LYS B CA  1 
ATOM   7032  C C   . LYS E 5 23  ? 25.887  11.355  -5.375  1.00 77.51  ? 23  LYS B C   1 
ATOM   7033  O O   . LYS E 5 23  ? 26.814  12.174  -5.400  1.00 77.94  ? 23  LYS B O   1 
ATOM   7034  C CB  . LYS E 5 23  ? 25.578  10.816  -7.850  1.00 66.08  ? 23  LYS B CB  1 
ATOM   7035  C CG  . LYS E 5 23  ? 25.960  9.355   -7.874  1.00 77.63  ? 23  LYS B CG  1 
ATOM   7036  C CD  . LYS E 5 23  ? 27.057  9.039   -6.861  1.00 84.53  ? 23  LYS B CD  1 
ATOM   7037  C CE  . LYS E 5 23  ? 27.574  7.616   -6.998  1.00 85.75  ? 23  LYS B CE  1 
ATOM   7038  N NZ  . LYS E 5 23  ? 28.690  7.508   -7.973  1.00 91.10  ? 23  LYS B NZ  1 
ATOM   7039  N N   . THR E 5 24  ? 25.686  10.493  -4.368  1.00 74.41  ? 24  THR B N   1 
ATOM   7040  C CA  . THR E 5 24  ? 26.386  10.516  -3.071  1.00 67.14  ? 24  THR B CA  1 
ATOM   7041  C C   . THR E 5 24  ? 27.741  9.828   -3.039  1.00 71.80  ? 24  THR B C   1 
ATOM   7042  O O   . THR E 5 24  ? 27.965  8.846   -3.745  1.00 74.56  ? 24  THR B O   1 
ATOM   7043  C CB  . THR E 5 24  ? 25.554  9.791   -2.005  1.00 68.18  ? 24  THR B CB  1 
ATOM   7044  O OG1 . THR E 5 24  ? 24.502  10.646  -1.544  1.00 63.90  ? 24  THR B OG1 1 
ATOM   7045  C CG2 . THR E 5 24  ? 26.433  9.359   -0.825  1.00 68.41  ? 24  THR B CG2 1 
ATOM   7046  N N   . SER E 5 25  ? 28.633  10.328  -2.187  1.00 71.96  ? 25  SER B N   1 
ATOM   7047  C CA  . SER E 5 25  ? 29.939  9.708   -1.984  1.00 73.91  ? 25  SER B CA  1 
ATOM   7048  C C   . SER E 5 25  ? 30.313  9.833   -0.532  1.00 73.66  ? 25  SER B C   1 
ATOM   7049  O O   . SER E 5 25  ? 29.998  10.832  0.104   1.00 73.44  ? 25  SER B O   1 
ATOM   7050  C CB  . SER E 5 25  ? 31.031  10.428  -2.784  1.00 80.70  ? 25  SER B CB  1 
ATOM   7051  O OG  . SER E 5 25  ? 30.700  10.573  -4.155  1.00 89.72  ? 25  SER B OG  1 
ATOM   7052  N N   . GLY E 5 26  ? 30.999  8.821   -0.014  1.00 75.33  ? 26  GLY B N   1 
ATOM   7053  C CA  . GLY E 5 26  ? 31.684  8.923   1.267   1.00 81.49  ? 26  GLY B CA  1 
ATOM   7054  C C   . GLY E 5 26  ? 30.862  8.943   2.551   1.00 79.35  ? 26  GLY B C   1 
ATOM   7055  O O   . GLY E 5 26  ? 31.260  9.562   3.548   1.00 78.61  ? 26  GLY B O   1 
ATOM   7056  N N   . TYR E 5 27  ? 29.726  8.256   2.540   1.00 75.38  ? 27  TYR B N   1 
ATOM   7057  C CA  . TYR E 5 27  ? 28.899  8.146   3.724   1.00 65.38  ? 27  TYR B CA  1 
ATOM   7058  C C   . TYR E 5 27  ? 27.705  7.266   3.424   1.00 66.26  ? 27  TYR B C   1 
ATOM   7059  O O   . TYR E 5 27  ? 27.081  7.386   2.367   1.00 67.76  ? 27  TYR B O   1 
ATOM   7060  C CB  . TYR E 5 27  ? 28.450  9.528   4.205   1.00 68.72  ? 27  TYR B CB  1 
ATOM   7061  C CG  . TYR E 5 27  ? 27.327  10.162  3.406   1.00 69.22  ? 27  TYR B CG  1 
ATOM   7062  C CD1 . TYR E 5 27  ? 26.002  10.016  3.802   1.00 71.08  ? 27  TYR B CD1 1 
ATOM   7063  C CD2 . TYR E 5 27  ? 27.584  10.928  2.272   1.00 70.99  ? 27  TYR B CD2 1 
ATOM   7064  C CE1 . TYR E 5 27  ? 24.957  10.602  3.086   1.00 68.83  ? 27  TYR B CE1 1 
ATOM   7065  C CE2 . TYR E 5 27  ? 26.540  11.525  1.549   1.00 68.23  ? 27  TYR B CE2 1 
ATOM   7066  C CZ  . TYR E 5 27  ? 25.229  11.354  1.966   1.00 65.19  ? 27  TYR B CZ  1 
ATOM   7067  O OH  . TYR E 5 27  ? 24.175  11.919  1.285   1.00 58.77  ? 27  TYR B OH  1 
ATOM   7068  N N   . SER E 5 28  ? 27.408  6.374   4.363   1.00 70.70  ? 28  SER B N   1 
ATOM   7069  C CA  . SER E 5 28  ? 26.262  5.463   4.281   1.00 70.37  ? 28  SER B CA  1 
ATOM   7070  C C   . SER E 5 28  ? 24.963  6.133   3.804   1.00 66.66  ? 28  SER B C   1 
ATOM   7071  O O   . SER E 5 28  ? 24.480  7.102   4.393   1.00 69.40  ? 28  SER B O   1 
ATOM   7072  C CB  . SER E 5 28  ? 26.036  4.784   5.632   1.00 65.90  ? 28  SER B CB  1 
ATOM   7073  O OG  . SER E 5 28  ? 24.956  3.875   5.550   1.00 71.86  ? 28  SER B OG  1 
ATOM   7074  N N   . PHE E 5 29  ? 24.382  5.587   2.749   1.00 64.84  ? 29  PHE B N   1 
ATOM   7075  C CA  . PHE E 5 29  ? 23.358  6.303   2.007   1.00 63.75  ? 29  PHE B CA  1 
ATOM   7076  C C   . PHE E 5 29  ? 21.977  6.366   2.673   1.00 61.02  ? 29  PHE B C   1 
ATOM   7077  O O   . PHE E 5 29  ? 21.365  7.432   2.722   1.00 56.98  ? 29  PHE B O   1 
ATOM   7078  C CB  . PHE E 5 29  ? 23.273  5.764   0.569   1.00 63.37  ? 29  PHE B CB  1 
ATOM   7079  C CG  . PHE E 5 29  ? 22.118  6.300   -0.201  1.00 60.65  ? 29  PHE B CG  1 
ATOM   7080  C CD1 . PHE E 5 29  ? 21.993  7.662   -0.423  1.00 61.89  ? 29  PHE B CD1 1 
ATOM   7081  C CD2 . PHE E 5 29  ? 21.149  5.450   -0.691  1.00 60.89  ? 29  PHE B CD2 1 
ATOM   7082  C CE1 . PHE E 5 29  ? 20.920  8.168   -1.110  1.00 59.02  ? 29  PHE B CE1 1 
ATOM   7083  C CE2 . PHE E 5 29  ? 20.079  5.944   -1.385  1.00 61.26  ? 29  PHE B CE2 1 
ATOM   7084  C CZ  . PHE E 5 29  ? 19.960  7.310   -1.595  1.00 60.49  ? 29  PHE B CZ  1 
ATOM   7085  N N   . SER E 5 30  ? 21.504  5.238   3.196   1.00 60.30  ? 30  SER B N   1 
ATOM   7086  C CA  . SER E 5 30  ? 20.126  5.111   3.680   1.00 58.92  ? 30  SER B CA  1 
ATOM   7087  C C   . SER E 5 30  ? 19.871  5.739   5.032   1.00 62.29  ? 30  SER B C   1 
ATOM   7088  O O   . SER E 5 30  ? 18.717  5.901   5.450   1.00 59.66  ? 30  SER B O   1 
ATOM   7089  C CB  . SER E 5 30  ? 19.782  3.645   3.799   1.00 59.55  ? 30  SER B CB  1 
ATOM   7090  O OG  . SER E 5 30  ? 20.286  2.977   2.667   1.00 74.39  ? 30  SER B OG  1 
ATOM   7091  N N   . SER E 5 31  ? 20.951  6.082   5.720   1.00 61.54  ? 31  SER B N   1 
ATOM   7092  C CA  . SER E 5 31  ? 20.856  6.553   7.089   1.00 56.15  ? 31  SER B CA  1 
ATOM   7093  C C   . SER E 5 31  ? 20.361  7.986   7.237   1.00 54.93  ? 31  SER B C   1 
ATOM   7094  O O   . SER E 5 31  ? 19.756  8.322   8.254   1.00 56.45  ? 31  SER B O   1 
ATOM   7095  C CB  . SER E 5 31  ? 22.196  6.367   7.752   1.00 52.42  ? 31  SER B CB  1 
ATOM   7096  O OG  . SER E 5 31  ? 22.760  5.177   7.240   1.00 57.67  ? 31  SER B OG  1 
ATOM   7097  N N   . TYR E 5 32  ? 20.595  8.823   6.229   1.00 52.27  ? 32  TYR B N   1 
ATOM   7098  C CA  . TYR E 5 32  ? 20.181  10.225  6.303   1.00 51.67  ? 32  TYR B CA  1 
ATOM   7099  C C   . TYR E 5 32  ? 18.951  10.506  5.422   1.00 51.17  ? 32  TYR B C   1 
ATOM   7100  O O   . TYR E 5 32  ? 18.733  9.854   4.411   1.00 50.37  ? 32  TYR B O   1 
ATOM   7101  C CB  . TYR E 5 32  ? 21.364  11.176  5.996   1.00 52.60  ? 32  TYR B CB  1 
ATOM   7102  C CG  . TYR E 5 32  ? 22.632  10.854  6.783   1.00 57.33  ? 32  TYR B CG  1 
ATOM   7103  C CD1 . TYR E 5 32  ? 23.460  9.801   6.394   1.00 56.60  ? 32  TYR B CD1 1 
ATOM   7104  C CD2 . TYR E 5 32  ? 22.992  11.592  7.927   1.00 54.68  ? 32  TYR B CD2 1 
ATOM   7105  C CE1 . TYR E 5 32  ? 24.608  9.484   7.121   1.00 63.21  ? 32  TYR B CE1 1 
ATOM   7106  C CE2 . TYR E 5 32  ? 24.137  11.280  8.662   1.00 54.01  ? 32  TYR B CE2 1 
ATOM   7107  C CZ  . TYR E 5 32  ? 24.945  10.221  8.255   1.00 63.51  ? 32  TYR B CZ  1 
ATOM   7108  O OH  . TYR E 5 32  ? 26.094  9.875   8.955   1.00 62.10  ? 32  TYR B OH  1 
ATOM   7109  N N   . TRP E 5 33  ? 18.117  11.442  5.855   1.00 52.32  ? 33  TRP B N   1 
ATOM   7110  C CA  . TRP E 5 33  ? 17.020  11.927  5.045   1.00 47.08  ? 33  TRP B CA  1 
ATOM   7111  C C   . TRP E 5 33  ? 17.702  12.660  3.880   1.00 51.10  ? 33  TRP B C   1 
ATOM   7112  O O   . TRP E 5 33  ? 18.890  12.925  3.962   1.00 53.13  ? 33  TRP B O   1 
ATOM   7113  C CB  . TRP E 5 33  ? 16.203  12.960  5.828   1.00 46.87  ? 33  TRP B CB  1 
ATOM   7114  C CG  . TRP E 5 33  ? 15.327  12.583  7.037   1.00 44.43  ? 33  TRP B CG  1 
ATOM   7115  C CD1 . TRP E 5 33  ? 15.115  13.364  8.137   1.00 50.24  ? 33  TRP B CD1 1 
ATOM   7116  C CD2 . TRP E 5 33  ? 14.505  11.440  7.220   1.00 44.45  ? 33  TRP B CD2 1 
ATOM   7117  N NE1 . TRP E 5 33  ? 14.242  12.775  8.999   1.00 42.66  ? 33  TRP B NE1 1 
ATOM   7118  C CE2 . TRP E 5 33  ? 13.849  11.588  8.462   1.00 45.31  ? 33  TRP B CE2 1 
ATOM   7119  C CE3 . TRP E 5 33  ? 14.251  10.302  6.463   1.00 57.39  ? 33  TRP B CE3 1 
ATOM   7120  C CZ2 . TRP E 5 33  ? 12.970  10.632  8.970   1.00 58.28  ? 33  TRP B CZ2 1 
ATOM   7121  C CZ3 . TRP E 5 33  ? 13.352  9.348   6.965   1.00 64.02  ? 33  TRP B CZ3 1 
ATOM   7122  C CH2 . TRP E 5 33  ? 12.728  9.520   8.210   1.00 62.40  ? 33  TRP B CH2 1 
ATOM   7123  N N   . MET E 5 34  ? 16.968  13.013  2.817   1.00 59.23  ? 34  MET B N   1 
ATOM   7124  C CA  . MET E 5 34  ? 17.471  13.930  1.761   1.00 51.36  ? 34  MET B CA  1 
ATOM   7125  C C   . MET E 5 34  ? 16.451  14.976  1.291   1.00 49.15  ? 34  MET B C   1 
ATOM   7126  O O   . MET E 5 34  ? 15.279  14.673  1.070   1.00 49.01  ? 34  MET B O   1 
ATOM   7127  C CB  . MET E 5 34  ? 17.949  13.157  0.549   1.00 44.65  ? 34  MET B CB  1 
ATOM   7128  C CG  . MET E 5 34  ? 19.130  13.791  -0.120  1.00 51.56  ? 34  MET B CG  1 
ATOM   7129  S SD  . MET E 5 34  ? 20.555  12.688  0.043   1.00 70.45  ? 34  MET B SD  1 
ATOM   7130  C CE  . MET E 5 34  ? 21.539  13.222  -1.359  1.00 69.56  ? 34  MET B CE  1 
ATOM   7131  N N   . HIS E 5 35  ? 16.910  16.204  1.113   1.00 47.64  ? 35  HIS B N   1 
ATOM   7132  C CA  . HIS E 5 35  ? 16.018  17.320  0.816   1.00 51.15  ? 35  HIS B CA  1 
ATOM   7133  C C   . HIS E 5 35  ? 16.360  18.018  -0.509  1.00 59.02  ? 35  HIS B C   1 
ATOM   7134  O O   . HIS E 5 35  ? 17.496  17.916  -1.002  1.00 57.50  ? 35  HIS B O   1 
ATOM   7135  C CB  . HIS E 5 35  ? 16.094  18.376  1.922   1.00 53.19  ? 35  HIS B CB  1 
ATOM   7136  C CG  . HIS E 5 35  ? 15.794  17.864  3.301   1.00 54.16  ? 35  HIS B CG  1 
ATOM   7137  N ND1 . HIS E 5 35  ? 16.462  16.796  3.864   1.00 50.02  ? 35  HIS B ND1 1 
ATOM   7138  C CD2 . HIS E 5 35  ? 14.938  18.319  4.247   1.00 50.53  ? 35  HIS B CD2 1 
ATOM   7139  C CE1 . HIS E 5 35  ? 16.011  16.599  5.091   1.00 50.01  ? 35  HIS B CE1 1 
ATOM   7140  N NE2 . HIS E 5 35  ? 15.088  17.510  5.347   1.00 52.75  ? 35  HIS B NE2 1 
ATOM   7141  N N   . TRP E 5 36  ? 15.365  18.712  -1.082  1.00 61.20  ? 36  TRP B N   1 
ATOM   7142  C CA  . TRP E 5 36  ? 15.575  19.612  -2.223  1.00 59.94  ? 36  TRP B CA  1 
ATOM   7143  C C   . TRP E 5 36  ? 14.921  20.935  -1.898  1.00 59.39  ? 36  TRP B C   1 
ATOM   7144  O O   . TRP E 5 36  ? 13.918  20.978  -1.177  1.00 57.65  ? 36  TRP B O   1 
ATOM   7145  C CB  . TRP E 5 36  ? 15.033  19.055  -3.553  1.00 58.29  ? 36  TRP B CB  1 
ATOM   7146  C CG  . TRP E 5 36  ? 15.661  17.767  -3.974  1.00 52.44  ? 36  TRP B CG  1 
ATOM   7147  C CD1 . TRP E 5 36  ? 15.364  16.537  -3.491  1.00 53.03  ? 36  TRP B CD1 1 
ATOM   7148  C CD2 . TRP E 5 36  ? 16.685  17.576  -4.955  1.00 51.58  ? 36  TRP B CD2 1 
ATOM   7149  N NE1 . TRP E 5 36  ? 16.135  15.589  -4.098  1.00 57.03  ? 36  TRP B NE1 1 
ATOM   7150  C CE2 . TRP E 5 36  ? 16.964  16.203  -4.999  1.00 58.24  ? 36  TRP B CE2 1 
ATOM   7151  C CE3 . TRP E 5 36  ? 17.400  18.428  -5.790  1.00 60.18  ? 36  TRP B CE3 1 
ATOM   7152  C CZ2 . TRP E 5 36  ? 17.928  15.656  -5.862  1.00 59.22  ? 36  TRP B CZ2 1 
ATOM   7153  C CZ3 . TRP E 5 36  ? 18.360  17.883  -6.641  1.00 62.79  ? 36  TRP B CZ3 1 
ATOM   7154  C CH2 . TRP E 5 36  ? 18.611  16.512  -6.669  1.00 58.01  ? 36  TRP B CH2 1 
ATOM   7155  N N   . VAL E 5 37  ? 15.499  22.000  -2.450  1.00 59.99  ? 37  VAL B N   1 
ATOM   7156  C CA  . VAL E 5 37  ? 15.207  23.363  -2.032  1.00 61.41  ? 37  VAL B CA  1 
ATOM   7157  C C   . VAL E 5 37  ? 15.567  24.362  -3.144  1.00 62.29  ? 37  VAL B C   1 
ATOM   7158  O O   . VAL E 5 37  ? 16.667  24.322  -3.709  1.00 57.11  ? 37  VAL B O   1 
ATOM   7159  C CB  . VAL E 5 37  ? 15.958  23.685  -0.717  1.00 55.53  ? 37  VAL B CB  1 
ATOM   7160  C CG1 . VAL E 5 37  ? 17.377  23.207  -0.800  1.00 50.13  ? 37  VAL B CG1 1 
ATOM   7161  C CG2 . VAL E 5 37  ? 15.912  25.158  -0.403  1.00 57.04  ? 37  VAL B CG2 1 
ATOM   7162  N N   . LYS E 5 38  ? 14.626  25.259  -3.434  1.00 61.34  ? 38  LYS B N   1 
ATOM   7163  C CA  . LYS E 5 38  ? 14.659  26.087  -4.635  1.00 61.74  ? 38  LYS B CA  1 
ATOM   7164  C C   . LYS E 5 38  ? 14.908  27.555  -4.369  1.00 66.94  ? 38  LYS B C   1 
ATOM   7165  O O   . LYS E 5 38  ? 14.442  28.087  -3.369  1.00 68.68  ? 38  LYS B O   1 
ATOM   7166  C CB  . LYS E 5 38  ? 13.327  25.949  -5.364  1.00 65.54  ? 38  LYS B CB  1 
ATOM   7167  C CG  . LYS E 5 38  ? 12.962  27.123  -6.232  1.00 68.07  ? 38  LYS B CG  1 
ATOM   7168  C CD  . LYS E 5 38  ? 11.765  26.790  -7.102  1.00 68.50  ? 38  LYS B CD  1 
ATOM   7169  C CE  . LYS E 5 38  ? 11.287  28.031  -7.829  1.00 73.04  ? 38  LYS B CE  1 
ATOM   7170  N NZ  . LYS E 5 38  ? 10.113  27.764  -8.696  1.00 76.44  ? 38  LYS B NZ  1 
ATOM   7171  N N   . GLN E 5 39  ? 15.622  28.215  -5.281  1.00 74.76  ? 39  GLN B N   1 
ATOM   7172  C CA  . GLN E 5 39  ? 15.889  29.658  -5.162  1.00 79.82  ? 39  GLN B CA  1 
ATOM   7173  C C   . GLN E 5 39  ? 15.695  30.445  -6.466  1.00 83.97  ? 39  GLN B C   1 
ATOM   7174  O O   . GLN E 5 39  ? 16.411  30.209  -7.450  1.00 82.89  ? 39  GLN B O   1 
ATOM   7175  C CB  . GLN E 5 39  ? 17.302  29.916  -4.629  1.00 74.48  ? 39  GLN B CB  1 
ATOM   7176  C CG  . GLN E 5 39  ? 17.587  31.390  -4.360  1.00 78.26  ? 39  GLN B CG  1 
ATOM   7177  C CD  . GLN E 5 39  ? 18.816  31.610  -3.491  1.00 80.01  ? 39  GLN B CD  1 
ATOM   7178  O OE1 . GLN E 5 39  ? 19.836  30.916  -3.638  1.00 70.34  ? 39  GLN B OE1 1 
ATOM   7179  N NE2 . GLN E 5 39  ? 18.728  32.584  -2.576  1.00 77.94  ? 39  GLN B NE2 1 
ATOM   7180  N N   . ARG E 5 40  ? 14.744  31.385  -6.451  1.00 82.98  ? 40  ARG B N   1 
ATOM   7181  C CA  . ARG E 5 40  ? 14.446  32.244  -7.602  1.00 86.99  ? 40  ARG B CA  1 
ATOM   7182  C C   . ARG E 5 40  ? 15.403  33.432  -7.698  1.00 94.63  ? 40  ARG B C   1 
ATOM   7183  O O   . ARG E 5 40  ? 15.229  34.428  -6.978  1.00 96.84  ? 40  ARG B O   1 
ATOM   7184  C CB  . ARG E 5 40  ? 13.020  32.778  -7.507  1.00 91.15  ? 40  ARG B CB  1 
ATOM   7185  C CG  . ARG E 5 40  ? 11.946  31.778  -7.805  1.00 84.67  ? 40  ARG B CG  1 
ATOM   7186  C CD  . ARG E 5 40  ? 11.010  32.390  -8.792  1.00 86.49  ? 40  ARG B CD  1 
ATOM   7187  N NE  . ARG E 5 40  ? 11.716  32.671  -10.037 1.00 96.80  ? 40  ARG B NE  1 
ATOM   7188  C CZ  . ARG E 5 40  ? 11.320  33.571  -10.931 1.00 102.71 ? 40  ARG B CZ  1 
ATOM   7189  N NH1 . ARG E 5 40  ? 10.221  34.287  -10.707 1.00 100.66 ? 40  ARG B NH1 1 
ATOM   7190  N NH2 . ARG E 5 40  ? 12.024  33.761  -12.045 1.00 96.09  ? 40  ARG B NH2 1 
ATOM   7191  N N   . PRO E 5 41  ? 16.383  33.349  -8.622  1.00 96.22  ? 41  PRO B N   1 
ATOM   7192  C CA  . PRO E 5 41  ? 17.500  34.286  -8.748  1.00 93.31  ? 41  PRO B CA  1 
ATOM   7193  C C   . PRO E 5 41  ? 17.366  35.519  -7.866  1.00 95.29  ? 41  PRO B C   1 
ATOM   7194  O O   . PRO E 5 41  ? 16.536  36.390  -8.118  1.00 91.50  ? 41  PRO B O   1 
ATOM   7195  C CB  . PRO E 5 41  ? 17.446  34.652  -10.227 1.00 91.40  ? 41  PRO B CB  1 
ATOM   7196  C CG  . PRO E 5 41  ? 17.060  33.322  -10.886 1.00 89.06  ? 41  PRO B CG  1 
ATOM   7197  C CD  . PRO E 5 41  ? 16.249  32.538  -9.846  1.00 94.90  ? 41  PRO B CD  1 
ATOM   7198  N N   . GLY E 5 42  ? 18.168  35.546  -6.806  1.00 99.70  ? 42  GLY B N   1 
ATOM   7199  C CA  . GLY E 5 42  ? 18.310  36.708  -5.953  1.00 100.31 ? 42  GLY B CA  1 
ATOM   7200  C C   . GLY E 5 42  ? 17.104  37.186  -5.167  1.00 103.83 ? 42  GLY B C   1 
ATOM   7201  O O   . GLY E 5 42  ? 16.916  38.397  -5.034  1.00 108.78 ? 42  GLY B O   1 
ATOM   7202  N N   . GLN E 5 43  ? 16.295  36.275  -4.627  1.00 101.01 ? 43  GLN B N   1 
ATOM   7203  C CA  . GLN E 5 43  ? 15.225  36.720  -3.726  1.00 105.18 ? 43  GLN B CA  1 
ATOM   7204  C C   . GLN E 5 43  ? 14.624  35.685  -2.766  1.00 105.83 ? 43  GLN B C   1 
ATOM   7205  O O   . GLN E 5 43  ? 13.407  35.672  -2.553  1.00 106.23 ? 43  GLN B O   1 
ATOM   7206  C CB  . GLN E 5 43  ? 14.108  37.423  -4.498  1.00 101.44 ? 43  GLN B CB  1 
ATOM   7207  C CG  . GLN E 5 43  ? 13.408  36.552  -5.505  1.00 101.09 ? 43  GLN B CG  1 
ATOM   7208  C CD  . GLN E 5 43  ? 12.275  37.286  -6.182  1.00 107.03 ? 43  GLN B CD  1 
ATOM   7209  O OE1 . GLN E 5 43  ? 11.118  37.171  -5.778  1.00 109.16 ? 43  GLN B OE1 1 
ATOM   7210  N NE2 . GLN E 5 43  ? 12.603  38.064  -7.212  1.00 106.99 ? 43  GLN B NE2 1 
ATOM   7211  N N   . GLY E 5 44  ? 15.467  34.844  -2.168  1.00 98.88  ? 44  GLY B N   1 
ATOM   7212  C CA  . GLY E 5 44  ? 15.012  33.990  -1.080  1.00 86.14  ? 44  GLY B CA  1 
ATOM   7213  C C   . GLY E 5 44  ? 15.306  32.513  -1.230  1.00 79.40  ? 44  GLY B C   1 
ATOM   7214  O O   . GLY E 5 44  ? 15.985  32.094  -2.163  1.00 83.26  ? 44  GLY B O   1 
ATOM   7215  N N   . LEU E 5 45  ? 14.780  31.720  -0.305  1.00 72.49  ? 45  LEU B N   1 
ATOM   7216  C CA  . LEU E 5 45  ? 14.980  30.280  -0.330  1.00 69.87  ? 45  LEU B CA  1 
ATOM   7217  C C   . LEU E 5 45  ? 13.692  29.539  0.020   1.00 71.63  ? 45  LEU B C   1 
ATOM   7218  O O   . LEU E 5 45  ? 12.961  29.962  0.921   1.00 72.75  ? 45  LEU B O   1 
ATOM   7219  C CB  . LEU E 5 45  ? 16.062  29.911  0.671   1.00 69.15  ? 45  LEU B CB  1 
ATOM   7220  C CG  . LEU E 5 45  ? 17.467  29.673  0.139   1.00 68.36  ? 45  LEU B CG  1 
ATOM   7221  C CD1 . LEU E 5 45  ? 18.441  29.347  1.272   1.00 63.42  ? 45  LEU B CD1 1 
ATOM   7222  C CD2 . LEU E 5 45  ? 17.404  28.541  -0.834  1.00 68.42  ? 45  LEU B CD2 1 
ATOM   7223  N N   . GLU E 5 46  ? 13.421  28.429  -0.677  1.00 72.14  ? 46  GLU B N   1 
ATOM   7224  C CA  . GLU E 5 46  ? 12.207  27.632  -0.429  1.00 69.04  ? 46  GLU B CA  1 
ATOM   7225  C C   . GLU E 5 46  ? 12.394  26.097  -0.378  1.00 64.09  ? 46  GLU B C   1 
ATOM   7226  O O   . GLU E 5 46  ? 13.083  25.499  -1.210  1.00 61.12  ? 46  GLU B O   1 
ATOM   7227  C CB  . GLU E 5 46  ? 11.096  28.016  -1.410  1.00 70.65  ? 46  GLU B CB  1 
ATOM   7228  C CG  . GLU E 5 46  ? 9.743   28.197  -0.722  1.00 80.80  ? 46  GLU B CG  1 
ATOM   7229  C CD  . GLU E 5 46  ? 8.695   28.862  -1.612  1.00 93.07  ? 46  GLU B CD  1 
ATOM   7230  O OE1 . GLU E 5 46  ? 8.131   29.895  -1.176  1.00 92.82  ? 46  GLU B OE1 1 
ATOM   7231  O OE2 . GLU E 5 46  ? 8.436   28.359  -2.736  1.00 91.69  ? 46  GLU B OE2 1 
ATOM   7232  N N   . TRP E 5 47  ? 11.764  25.466  0.608   1.00 62.20  ? 47  TRP B N   1 
ATOM   7233  C CA  . TRP E 5 47  ? 11.926  24.034  0.805   1.00 60.52  ? 47  TRP B CA  1 
ATOM   7234  C C   . TRP E 5 47  ? 10.897  23.272  -0.006  1.00 62.36  ? 47  TRP B C   1 
ATOM   7235  O O   . TRP E 5 47  ? 9.686   23.410  0.211   1.00 59.63  ? 47  TRP B O   1 
ATOM   7236  C CB  . TRP E 5 47  ? 11.814  23.677  2.289   1.00 62.15  ? 47  TRP B CB  1 
ATOM   7237  C CG  . TRP E 5 47  ? 11.922  22.182  2.611   1.00 64.07  ? 47  TRP B CG  1 
ATOM   7238  C CD1 . TRP E 5 47  ? 13.058  21.417  2.653   1.00 58.43  ? 47  TRP B CD1 1 
ATOM   7239  C CD2 . TRP E 5 47  ? 10.842  21.306  2.967   1.00 61.86  ? 47  TRP B CD2 1 
ATOM   7240  N NE1 . TRP E 5 47  ? 12.742  20.117  2.998   1.00 54.32  ? 47  TRP B NE1 1 
ATOM   7241  C CE2 . TRP E 5 47  ? 11.389  20.031  3.191   1.00 56.27  ? 47  TRP B CE2 1 
ATOM   7242  C CE3 . TRP E 5 47  ? 9.463   21.480  3.108   1.00 60.29  ? 47  TRP B CE3 1 
ATOM   7243  C CZ2 . TRP E 5 47  ? 10.608  18.949  3.544   1.00 58.70  ? 47  TRP B CZ2 1 
ATOM   7244  C CZ3 . TRP E 5 47  ? 8.699   20.405  3.455   1.00 58.31  ? 47  TRP B CZ3 1 
ATOM   7245  C CH2 . TRP E 5 47  ? 9.267   19.156  3.673   1.00 57.75  ? 47  TRP B CH2 1 
ATOM   7246  N N   . ILE E 5 48  ? 11.393  22.480  -0.952  1.00 64.03  ? 48  ILE B N   1 
ATOM   7247  C CA  . ILE E 5 48  ? 10.531  21.638  -1.780  1.00 68.32  ? 48  ILE B CA  1 
ATOM   7248  C C   . ILE E 5 48  ? 9.960   20.505  -0.938  1.00 62.74  ? 48  ILE B C   1 
ATOM   7249  O O   . ILE E 5 48  ? 8.875   20.626  -0.366  1.00 64.62  ? 48  ILE B O   1 
ATOM   7250  C CB  . ILE E 5 48  ? 11.285  21.014  -3.005  1.00 65.52  ? 48  ILE B CB  1 
ATOM   7251  C CG1 . ILE E 5 48  ? 11.851  22.085  -3.927  1.00 62.05  ? 48  ILE B CG1 1 
ATOM   7252  C CG2 . ILE E 5 48  ? 10.373  20.115  -3.831  1.00 61.73  ? 48  ILE B CG2 1 
ATOM   7253  C CD1 . ILE E 5 48  ? 12.546  21.491  -5.135  1.00 59.81  ? 48  ILE B CD1 1 
ATOM   7254  N N   . GLY E 5 49  ? 10.702  19.408  -0.866  1.00 58.14  ? 49  GLY B N   1 
ATOM   7255  C CA  . GLY E 5 49  ? 10.210  18.206  -0.230  1.00 58.78  ? 49  GLY B CA  1 
ATOM   7256  C C   . GLY E 5 49  ? 11.367  17.420  0.318   1.00 53.35  ? 49  GLY B C   1 
ATOM   7257  O O   . GLY E 5 49  ? 12.424  17.982  0.567   1.00 56.07  ? 49  GLY B O   1 
ATOM   7258  N N   . TYR E 5 50  ? 11.172  16.125  0.506   1.00 46.86  ? 50  TYR B N   1 
ATOM   7259  C CA  . TYR E 5 50  ? 12.255  15.272  0.967   1.00 52.20  ? 50  TYR B CA  1 
ATOM   7260  C C   . TYR E 5 50  ? 11.880  13.814  0.821   1.00 55.55  ? 50  TYR B C   1 
ATOM   7261  O O   . TYR E 5 50  ? 10.701  13.459  0.787   1.00 56.78  ? 50  TYR B O   1 
ATOM   7262  C CB  . TYR E 5 50  ? 12.594  15.543  2.430   1.00 55.86  ? 50  TYR B CB  1 
ATOM   7263  C CG  . TYR E 5 50  ? 11.997  14.536  3.401   1.00 56.55  ? 50  TYR B CG  1 
ATOM   7264  C CD1 . TYR E 5 50  ? 10.773  14.787  4.039   1.00 54.50  ? 50  TYR B CD1 1 
ATOM   7265  C CD2 . TYR E 5 50  ? 12.654  13.341  3.680   1.00 51.65  ? 50  TYR B CD2 1 
ATOM   7266  C CE1 . TYR E 5 50  ? 10.226  13.881  4.916   1.00 52.09  ? 50  TYR B CE1 1 
ATOM   7267  C CE2 . TYR E 5 50  ? 12.107  12.423  4.554   1.00 55.28  ? 50  TYR B CE2 1 
ATOM   7268  C CZ  . TYR E 5 50  ? 10.896  12.699  5.173   1.00 56.30  ? 50  TYR B CZ  1 
ATOM   7269  O OH  . TYR E 5 50  ? 10.369  11.780  6.053   1.00 57.64  ? 50  TYR B OH  1 
ATOM   7270  N N   . ILE E 5 51  ? 12.882  12.957  0.760   1.00 50.40  ? 51  ILE B N   1 
ATOM   7271  C CA  . ILE E 5 51  ? 12.592  11.563  0.541   1.00 51.90  ? 51  ILE B CA  1 
ATOM   7272  C C   . ILE E 5 51  ? 13.534  10.731  1.410   1.00 58.12  ? 51  ILE B C   1 
ATOM   7273  O O   . ILE E 5 51  ? 14.701  11.102  1.583   1.00 57.29  ? 51  ILE B O   1 
ATOM   7274  C CB  . ILE E 5 51  ? 12.773  11.236  -0.920  1.00 47.63  ? 51  ILE B CB  1 
ATOM   7275  C CG1 . ILE E 5 51  ? 12.363  9.799   -1.188  1.00 53.49  ? 51  ILE B CG1 1 
ATOM   7276  C CG2 . ILE E 5 51  ? 14.222  11.448  -1.310  1.00 49.16  ? 51  ILE B CG2 1 
ATOM   7277  C CD1 . ILE E 5 51  ? 13.538  8.884   -1.528  1.00 57.22  ? 51  ILE B CD1 1 
ATOM   7278  N N   . ASN E 5 52  ? 13.031  9.634   1.984   1.00 53.49  ? 52  ASN B N   1 
ATOM   7279  C CA  . ASN E 5 52  ? 13.886  8.741   2.752   1.00 51.02  ? 52  ASN B CA  1 
ATOM   7280  C C   . ASN E 5 52  ? 14.333  7.479   2.019   1.00 53.79  ? 52  ASN B C   1 
ATOM   7281  O O   . ASN E 5 52  ? 13.546  6.568   1.798   1.00 53.57  ? 52  ASN B O   1 
ATOM   7282  C CB  . ASN E 5 52  ? 13.245  8.351   4.072   1.00 50.36  ? 52  ASN B CB  1 
ATOM   7283  C CG  . ASN E 5 52  ? 14.105  7.360   4.848   1.00 53.53  ? 52  ASN B CG  1 
ATOM   7284  O OD1 . ASN E 5 52  ? 13.671  6.760   5.830   1.00 52.60  ? 52  ASN B OD1 1 
ATOM   7285  N ND2 . ASN E 5 52  ? 15.338  7.182   4.396   1.00 53.34  ? 52  ASN B ND2 1 
ATOM   7286  N N   . PRO E 5 53  A 15.620  7.416   1.668   1.00 53.47  ? 52  PRO B N   1 
ATOM   7287  C CA  . PRO E 5 53  A 16.242  6.242   1.054   1.00 54.12  ? 52  PRO B CA  1 
ATOM   7288  C C   . PRO E 5 53  A 15.829  4.895   1.661   1.00 57.33  ? 52  PRO B C   1 
ATOM   7289  O O   . PRO E 5 53  A 15.346  4.078   0.901   1.00 58.22  ? 52  PRO B O   1 
ATOM   7290  C CB  . PRO E 5 53  A 17.728  6.496   1.282   1.00 54.34  ? 52  PRO B CB  1 
ATOM   7291  C CG  . PRO E 5 53  A 17.837  7.967   1.205   1.00 54.72  ? 52  PRO B CG  1 
ATOM   7292  C CD  . PRO E 5 53  A 16.578  8.524   1.813   1.00 52.34  ? 52  PRO B CD  1 
ATOM   7293  N N   . SER E 5 54  ? 16.004  4.671   2.965   1.00 57.33  ? 53  SER B N   1 
ATOM   7294  C CA  . SER E 5 54  ? 15.828  3.332   3.570   1.00 59.56  ? 53  SER B CA  1 
ATOM   7295  C C   . SER E 5 54  ? 14.363  2.845   3.692   1.00 61.30  ? 53  SER B C   1 
ATOM   7296  O O   . SER E 5 54  ? 14.076  1.665   3.941   1.00 56.85  ? 53  SER B O   1 
ATOM   7297  C CB  . SER E 5 54  ? 16.510  3.292   4.945   1.00 61.57  ? 53  SER B CB  1 
ATOM   7298  O OG  . SER E 5 54  ? 16.633  1.956   5.434   1.00 71.68  ? 53  SER B OG  1 
ATOM   7299  N N   . THR E 5 55  ? 13.442  3.774   3.503   1.00 61.56  ? 54  THR B N   1 
ATOM   7300  C CA  . THR E 5 55  ? 12.025  3.516   3.642   1.00 55.98  ? 54  THR B CA  1 
ATOM   7301  C C   . THR E 5 55  ? 11.363  3.855   2.319   1.00 56.16  ? 54  THR B C   1 
ATOM   7302  O O   . THR E 5 55  ? 10.706  3.030   1.707   1.00 54.87  ? 54  THR B O   1 
ATOM   7303  C CB  . THR E 5 55  ? 11.451  4.389   4.768   1.00 52.95  ? 54  THR B CB  1 
ATOM   7304  O OG1 . THR E 5 55  ? 11.242  3.579   5.928   1.00 55.78  ? 54  THR B OG1 1 
ATOM   7305  C CG2 . THR E 5 55  ? 10.143  5.072   4.349   1.00 48.64  ? 54  THR B CG2 1 
ATOM   7306  N N   . GLY E 5 56  ? 11.560  5.078   1.862   1.00 55.53  ? 55  GLY B N   1 
ATOM   7307  C CA  . GLY E 5 56  ? 11.053  5.459   0.568   1.00 55.18  ? 55  GLY B CA  1 
ATOM   7308  C C   . GLY E 5 56  ? 9.988   6.506   0.740   1.00 57.28  ? 55  GLY B C   1 
ATOM   7309  O O   . GLY E 5 56  ? 9.402   6.982   -0.240  1.00 59.27  ? 55  GLY B O   1 
ATOM   7310  N N   . TYR E 5 57  ? 9.730   6.874   1.990   1.00 53.43  ? 56  TYR B N   1 
ATOM   7311  C CA  . TYR E 5 57  ? 8.680   7.839   2.232   1.00 52.61  ? 56  TYR B CA  1 
ATOM   7312  C C   . TYR E 5 57  ? 9.138   9.133   1.661   1.00 52.36  ? 56  TYR B C   1 
ATOM   7313  O O   . TYR E 5 57  ? 10.337  9.362   1.551   1.00 53.90  ? 56  TYR B O   1 
ATOM   7314  C CB  . TYR E 5 57  ? 8.400   8.009   3.705   1.00 52.39  ? 56  TYR B CB  1 
ATOM   7315  C CG  . TYR E 5 57  ? 7.220   8.892   3.948   1.00 52.25  ? 56  TYR B CG  1 
ATOM   7316  C CD1 . TYR E 5 57  ? 5.948   8.483   3.609   1.00 58.06  ? 56  TYR B CD1 1 
ATOM   7317  C CD2 . TYR E 5 57  ? 7.374   10.129  4.519   1.00 56.58  ? 56  TYR B CD2 1 
ATOM   7318  C CE1 . TYR E 5 57  ? 4.858   9.291   3.832   1.00 66.49  ? 56  TYR B CE1 1 
ATOM   7319  C CE2 . TYR E 5 57  ? 6.293   10.947  4.753   1.00 63.53  ? 56  TYR B CE2 1 
ATOM   7320  C CZ  . TYR E 5 57  ? 5.038   10.526  4.408   1.00 67.51  ? 56  TYR B CZ  1 
ATOM   7321  O OH  . TYR E 5 57  ? 3.973   11.359  4.651   1.00 70.86  ? 56  TYR B OH  1 
ATOM   7322  N N   . THR E 5 58  ? 8.191   9.972   1.267   1.00 54.51  ? 57  THR B N   1 
ATOM   7323  C CA  . THR E 5 58  ? 8.538   11.293  0.744   1.00 58.41  ? 57  THR B CA  1 
ATOM   7324  C C   . THR E 5 58  ? 7.352   12.257  0.705   1.00 59.92  ? 57  THR B C   1 
ATOM   7325  O O   . THR E 5 58  ? 6.305   11.925  0.156   1.00 64.74  ? 57  THR B O   1 
ATOM   7326  C CB  . THR E 5 58  ? 9.160   11.206  -0.671  1.00 58.42  ? 57  THR B CB  1 
ATOM   7327  O OG1 . THR E 5 58  ? 8.408   12.024  -1.578  1.00 58.51  ? 57  THR B OG1 1 
ATOM   7328  C CG2 . THR E 5 58  ? 9.160   9.772   -1.179  1.00 59.85  ? 57  THR B CG2 1 
ATOM   7329  N N   . GLU E 5 59  ? 7.519   13.452  1.268   1.00 57.62  ? 58  GLU B N   1 
ATOM   7330  C CA  . GLU E 5 59  ? 6.452   14.454  1.219   1.00 61.46  ? 58  GLU B CA  1 
ATOM   7331  C C   . GLU E 5 59  ? 6.885   15.811  0.635   1.00 61.20  ? 58  GLU B C   1 
ATOM   7332  O O   . GLU E 5 59  ? 8.078   16.053  0.434   1.00 62.37  ? 58  GLU B O   1 
ATOM   7333  C CB  . GLU E 5 59  ? 5.819   14.620  2.596   1.00 63.89  ? 58  GLU B CB  1 
ATOM   7334  C CG  . GLU E 5 59  ? 6.815   14.596  3.749   1.00 65.80  ? 58  GLU B CG  1 
ATOM   7335  C CD  . GLU E 5 59  ? 6.142   14.793  5.104   1.00 61.69  ? 58  GLU B CD  1 
ATOM   7336  O OE1 . GLU E 5 59  ? 5.978   13.775  5.827   1.00 53.56  ? 58  GLU B OE1 1 
ATOM   7337  O OE2 . GLU E 5 59  ? 5.783   15.959  5.432   1.00 57.04  ? 58  GLU B OE2 1 
ATOM   7338  N N   . ASN E 5 60  ? 5.909   16.679  0.361   1.00 55.67  ? 59  ASN B N   1 
ATOM   7339  C CA  . ASN E 5 60  ? 6.151   17.925  -0.365  1.00 57.19  ? 59  ASN B CA  1 
ATOM   7340  C C   . ASN E 5 60  ? 5.442   19.122  0.233   1.00 59.31  ? 59  ASN B C   1 
ATOM   7341  O O   . ASN E 5 60  ? 4.388   18.986  0.833   1.00 62.13  ? 59  ASN B O   1 
ATOM   7342  C CB  . ASN E 5 60  ? 5.700   17.777  -1.816  1.00 61.48  ? 59  ASN B CB  1 
ATOM   7343  C CG  . ASN E 5 60  ? 6.330   16.578  -2.501  1.00 68.28  ? 59  ASN B CG  1 
ATOM   7344  O OD1 . ASN E 5 60  ? 6.344   15.474  -1.954  1.00 68.88  ? 59  ASN B OD1 1 
ATOM   7345  N ND2 . ASN E 5 60  ? 6.859   16.787  -3.703  1.00 69.63  ? 59  ASN B ND2 1 
ATOM   7346  N N   . ASN E 5 61  ? 6.017   20.303  0.054   1.00 63.10  ? 60  ASN B N   1 
ATOM   7347  C CA  . ASN E 5 61  ? 5.348   21.537  0.439   1.00 66.08  ? 60  ASN B CA  1 
ATOM   7348  C C   . ASN E 5 61  ? 4.007   21.699  -0.313  1.00 74.15  ? 60  ASN B C   1 
ATOM   7349  O O   . ASN E 5 61  ? 3.947   21.506  -1.531  1.00 76.05  ? 60  ASN B O   1 
ATOM   7350  C CB  . ASN E 5 61  ? 6.283   22.716  0.183   1.00 61.38  ? 60  ASN B CB  1 
ATOM   7351  C CG  . ASN E 5 61  ? 5.749   24.012  0.740   1.00 70.26  ? 60  ASN B CG  1 
ATOM   7352  O OD1 . ASN E 5 61  ? 6.484   24.996  0.852   1.00 72.35  ? 60  ASN B OD1 1 
ATOM   7353  N ND2 . ASN E 5 61  ? 4.464   24.027  1.102   1.00 69.97  ? 60  ASN B ND2 1 
ATOM   7354  N N   . GLN E 5 62  ? 2.930   22.032  0.400   1.00 73.68  ? 61  GLN B N   1 
ATOM   7355  C CA  . GLN E 5 62  ? 1.616   22.073  -0.239  1.00 74.88  ? 61  GLN B CA  1 
ATOM   7356  C C   . GLN E 5 62  ? 1.736   22.801  -1.551  1.00 74.66  ? 61  GLN B C   1 
ATOM   7357  O O   . GLN E 5 62  ? 1.091   22.436  -2.527  1.00 77.52  ? 61  GLN B O   1 
ATOM   7358  C CB  . GLN E 5 62  ? 0.539   22.726  0.643   1.00 76.89  ? 61  GLN B CB  1 
ATOM   7359  C CG  . GLN E 5 62  ? -0.014  21.841  1.764   1.00 76.62  ? 61  GLN B CG  1 
ATOM   7360  C CD  . GLN E 5 62  ? -0.503  20.473  1.291   1.00 74.48  ? 61  GLN B CD  1 
ATOM   7361  O OE1 . GLN E 5 62  ? -1.611  20.053  1.626   1.00 70.84  ? 61  GLN B OE1 1 
ATOM   7362  N NE2 . GLN E 5 62  ? 0.329   19.765  0.530   1.00 75.82  ? 61  GLN B NE2 1 
ATOM   7363  N N   . LYS E 5 63  ? 2.584   23.821  -1.562  1.00 72.80  ? 62  LYS B N   1 
ATOM   7364  C CA  . LYS E 5 63  ? 2.861   24.587  -2.767  1.00 75.96  ? 62  LYS B CA  1 
ATOM   7365  C C   . LYS E 5 63  ? 3.146   23.683  -3.976  1.00 82.13  ? 62  LYS B C   1 
ATOM   7366  O O   . LYS E 5 63  ? 2.425   23.724  -4.979  1.00 87.39  ? 62  LYS B O   1 
ATOM   7367  C CB  . LYS E 5 63  ? 4.046   25.522  -2.534  1.00 75.25  ? 62  LYS B CB  1 
ATOM   7368  C CG  . LYS E 5 63  ? 4.074   26.180  -1.167  1.00 75.54  ? 62  LYS B CG  1 
ATOM   7369  C CD  . LYS E 5 63  ? 3.159   27.388  -1.086  1.00 78.49  ? 62  LYS B CD  1 
ATOM   7370  C CE  . LYS E 5 63  ? 2.647   27.581  0.342   1.00 83.40  ? 62  LYS B CE  1 
ATOM   7371  N NZ  . LYS E 5 63  ? 1.833   26.402  0.800   1.00 80.65  ? 62  LYS B NZ  1 
ATOM   7372  N N   . PHE E 5 64  ? 4.198   22.875  -3.889  1.00 76.33  ? 63  PHE B N   1 
ATOM   7373  C CA  . PHE E 5 64  ? 4.535   21.968  -4.977  1.00 78.92  ? 63  PHE B CA  1 
ATOM   7374  C C   . PHE E 5 64  ? 3.685   20.726  -4.878  1.00 81.99  ? 63  PHE B C   1 
ATOM   7375  O O   . PHE E 5 64  ? 4.210   19.648  -4.620  1.00 81.75  ? 63  PHE B O   1 
ATOM   7376  C CB  . PHE E 5 64  ? 5.990   21.529  -4.875  1.00 77.40  ? 63  PHE B CB  1 
ATOM   7377  C CG  . PHE E 5 64  ? 6.926   22.620  -4.486  1.00 71.76  ? 63  PHE B CG  1 
ATOM   7378  C CD1 . PHE E 5 64  ? 6.941   23.103  -3.198  1.00 71.33  ? 63  PHE B CD1 1 
ATOM   7379  C CD2 . PHE E 5 64  ? 7.805   23.149  -5.404  1.00 65.21  ? 63  PHE B CD2 1 
ATOM   7380  C CE1 . PHE E 5 64  ? 7.807   24.108  -2.839  1.00 74.74  ? 63  PHE B CE1 1 
ATOM   7381  C CE2 . PHE E 5 64  ? 8.668   24.151  -5.049  1.00 69.82  ? 63  PHE B CE2 1 
ATOM   7382  C CZ  . PHE E 5 64  ? 8.672   24.634  -3.765  1.00 72.24  ? 63  PHE B CZ  1 
ATOM   7383  N N   . LYS E 5 65  ? 2.395   20.856  -5.093  1.00 89.13  ? 64  LYS B N   1 
ATOM   7384  C CA  . LYS E 5 65  ? 1.507   19.724  -4.904  1.00 97.66  ? 64  LYS B CA  1 
ATOM   7385  C C   . LYS E 5 65  ? 1.652   18.673  -5.989  1.00 101.52 ? 64  LYS B C   1 
ATOM   7386  O O   . LYS E 5 65  ? 1.702   17.491  -5.707  1.00 99.58  ? 64  LYS B O   1 
ATOM   7387  C CB  . LYS E 5 65  ? 0.054   20.193  -4.797  1.00 101.44 ? 64  LYS B CB  1 
ATOM   7388  C CG  . LYS E 5 65  ? -0.830  19.304  -3.963  1.00 101.08 ? 64  LYS B CG  1 
ATOM   7389  C CD  . LYS E 5 65  ? -2.291  19.629  -4.174  1.00 106.54 ? 64  LYS B CD  1 
ATOM   7390  C CE  . LYS E 5 65  ? -2.527  20.312  -5.503  1.00 102.98 ? 64  LYS B CE  1 
ATOM   7391  N NZ  . LYS E 5 65  ? -3.701  19.749  -6.207  1.00 97.05  ? 64  LYS B NZ  1 
ATOM   7392  N N   . ASP E 5 66  ? 1.714   19.102  -7.233  1.00 97.20  ? 65  ASP B N   1 
ATOM   7393  C CA  . ASP E 5 66  ? 1.769   18.162  -8.352  1.00 92.40  ? 65  ASP B CA  1 
ATOM   7394  C C   . ASP E 5 66  ? 3.030   18.366  -9.210  1.00 87.62  ? 65  ASP B C   1 
ATOM   7395  O O   . ASP E 5 66  ? 3.300   17.596  -10.136 1.00 85.78  ? 65  ASP B O   1 
ATOM   7396  C CB  . ASP E 5 66  ? 0.484   18.275  -9.191  1.00 99.92  ? 65  ASP B CB  1 
ATOM   7397  C CG  . ASP E 5 66  ? -0.790  18.368  -8.323  1.00 102.15 ? 65  ASP B CG  1 
ATOM   7398  O OD1 . ASP E 5 66  ? -0.927  17.577  -7.365  1.00 101.15 ? 65  ASP B OD1 1 
ATOM   7399  O OD2 . ASP E 5 66  ? -1.663  19.225  -8.602  1.00 105.14 ? 65  ASP B OD2 1 
ATOM   7400  N N   . LYS E 5 67  ? 3.806   19.390  -8.854  1.00 87.22  ? 66  LYS B N   1 
ATOM   7401  C CA  . LYS E 5 67  ? 4.968   19.852  -9.622  1.00 83.73  ? 66  LYS B CA  1 
ATOM   7402  C C   . LYS E 5 67  ? 6.281   19.041  -9.489  1.00 83.85  ? 66  LYS B C   1 
ATOM   7403  O O   . LYS E 5 67  ? 7.238   19.287  -10.235 1.00 78.73  ? 66  LYS B O   1 
ATOM   7404  C CB  . LYS E 5 67  ? 5.248   21.321  -9.273  1.00 75.60  ? 66  LYS B CB  1 
ATOM   7405  C CG  . LYS E 5 67  ? 4.652   22.349  -10.231 1.00 83.95  ? 66  LYS B CG  1 
ATOM   7406  C CD  . LYS E 5 67  ? 3.141   22.199  -10.412 1.00 87.82  ? 66  LYS B CD  1 
ATOM   7407  C CE  . LYS E 5 67  ? 2.607   23.209  -11.433 1.00 80.34  ? 66  LYS B CE  1 
ATOM   7408  N NZ  . LYS E 5 67  ? 1.175   22.986  -11.795 1.00 73.27  ? 66  LYS B NZ  1 
ATOM   7409  N N   . VAL E 5 68  ? 6.339   18.093  -8.551  1.00 82.96  ? 67  VAL B N   1 
ATOM   7410  C CA  . VAL E 5 68  ? 7.599   17.393  -8.248  1.00 76.83  ? 67  VAL B CA  1 
ATOM   7411  C C   . VAL E 5 68  ? 7.453   15.879  -8.062  1.00 73.19  ? 67  VAL B C   1 
ATOM   7412  O O   . VAL E 5 68  ? 6.377   15.384  -7.731  1.00 76.88  ? 67  VAL B O   1 
ATOM   7413  C CB  . VAL E 5 68  ? 8.258   17.954  -6.961  1.00 75.89  ? 67  VAL B CB  1 
ATOM   7414  C CG1 . VAL E 5 68  ? 9.747   18.233  -7.185  1.00 69.68  ? 67  VAL B CG1 1 
ATOM   7415  C CG2 . VAL E 5 68  ? 7.525   19.202  -6.477  1.00 73.17  ? 67  VAL B CG2 1 
ATOM   7416  N N   . THR E 5 69  ? 8.547   15.151  -8.263  1.00 65.36  ? 68  THR B N   1 
ATOM   7417  C CA  . THR E 5 69  ? 8.562   13.704  -8.080  1.00 62.80  ? 68  THR B CA  1 
ATOM   7418  C C   . THR E 5 69  ? 9.922   13.294  -7.546  1.00 62.22  ? 68  THR B C   1 
ATOM   7419  O O   . THR E 5 69  ? 10.878  13.106  -8.301  1.00 61.66  ? 68  THR B O   1 
ATOM   7420  C CB  . THR E 5 69  ? 8.223   12.934  -9.391  1.00 67.32  ? 68  THR B CB  1 
ATOM   7421  O OG1 . THR E 5 69  ? 6.802   12.756  -9.486  1.00 70.63  ? 68  THR B OG1 1 
ATOM   7422  C CG2 . THR E 5 69  ? 8.921   11.553  -9.453  1.00 62.42  ? 68  THR B CG2 1 
ATOM   7423  N N   . LEU E 5 70  ? 10.005  13.182  -6.229  1.00 57.86  ? 69  LEU B N   1 
ATOM   7424  C CA  . LEU E 5 70  ? 11.232  12.771  -5.582  1.00 55.03  ? 69  LEU B CA  1 
ATOM   7425  C C   . LEU E 5 70  ? 11.306  11.252  -5.549  1.00 58.07  ? 69  LEU B C   1 
ATOM   7426  O O   . LEU E 5 70  ? 10.271  10.596  -5.512  1.00 66.19  ? 69  LEU B O   1 
ATOM   7427  C CB  . LEU E 5 70  ? 11.272  13.362  -4.189  1.00 51.44  ? 69  LEU B CB  1 
ATOM   7428  C CG  . LEU E 5 70  ? 11.413  14.878  -4.294  1.00 53.75  ? 69  LEU B CG  1 
ATOM   7429  C CD1 . LEU E 5 70  ? 10.469  15.605  -3.354  1.00 58.35  ? 69  LEU B CD1 1 
ATOM   7430  C CD2 . LEU E 5 70  ? 12.838  15.263  -4.016  1.00 52.84  ? 69  LEU B CD2 1 
ATOM   7431  N N   . THR E 5 71  ? 12.520  10.699  -5.577  1.00 56.72  ? 70  THR B N   1 
ATOM   7432  C CA  . THR E 5 71  ? 12.736  9.248   -5.658  1.00 59.37  ? 70  THR B CA  1 
ATOM   7433  C C   . THR E 5 71  ? 14.179  8.905   -5.309  1.00 60.84  ? 70  THR B C   1 
ATOM   7434  O O   . THR E 5 71  ? 14.975  9.815   -5.087  1.00 61.98  ? 70  THR B O   1 
ATOM   7435  C CB  . THR E 5 71  ? 12.462  8.756   -7.067  1.00 57.98  ? 70  THR B CB  1 
ATOM   7436  O OG1 . THR E 5 71  ? 12.671  9.842   -7.984  1.00 53.90  ? 70  THR B OG1 1 
ATOM   7437  C CG2 . THR E 5 71  ? 11.030  8.278   -7.165  1.00 61.71  ? 70  THR B CG2 1 
ATOM   7438  N N   . ALA E 5 72  ? 14.536  7.621   -5.274  1.00 56.29  ? 71  ALA B N   1 
ATOM   7439  C CA  . ALA E 5 72  ? 15.940  7.283   -5.032  1.00 58.79  ? 71  ALA B CA  1 
ATOM   7440  C C   . ALA E 5 72  ? 16.402  5.893   -5.478  1.00 63.13  ? 71  ALA B C   1 
ATOM   7441  O O   . ALA E 5 72  ? 15.594  5.020   -5.737  1.00 65.13  ? 71  ALA B O   1 
ATOM   7442  C CB  . ALA E 5 72  ? 16.275  7.501   -3.590  1.00 59.04  ? 71  ALA B CB  1 
ATOM   7443  N N   . ASP E 5 73  ? 17.713  5.693   -5.564  1.00 65.77  ? 72  ASP B N   1 
ATOM   7444  C CA  . ASP E 5 73  ? 18.255  4.379   -5.902  1.00 69.82  ? 72  ASP B CA  1 
ATOM   7445  C C   . ASP E 5 73  ? 19.346  3.938   -4.924  1.00 73.76  ? 72  ASP B C   1 
ATOM   7446  O O   . ASP E 5 73  ? 20.460  4.461   -4.947  1.00 73.76  ? 72  ASP B O   1 
ATOM   7447  C CB  . ASP E 5 73  ? 18.790  4.356   -7.338  1.00 70.95  ? 72  ASP B CB  1 
ATOM   7448  C CG  . ASP E 5 73  ? 19.350  2.978   -7.746  1.00 81.10  ? 72  ASP B CG  1 
ATOM   7449  O OD1 . ASP E 5 73  ? 19.784  2.195   -6.862  1.00 75.57  ? 72  ASP B OD1 1 
ATOM   7450  O OD2 . ASP E 5 73  ? 19.356  2.680   -8.966  1.00 82.28  ? 72  ASP B OD2 1 
ATOM   7451  N N   . LYS E 5 74  ? 19.022  2.955   -4.087  1.00 80.01  ? 73  LYS B N   1 
ATOM   7452  C CA  . LYS E 5 74  ? 19.925  2.472   -3.035  1.00 79.23  ? 73  LYS B CA  1 
ATOM   7453  C C   . LYS E 5 74  ? 21.240  1.897   -3.568  1.00 76.40  ? 73  LYS B C   1 
ATOM   7454  O O   . LYS E 5 74  ? 22.280  2.002   -2.915  1.00 75.59  ? 73  LYS B O   1 
ATOM   7455  C CB  . LYS E 5 74  ? 19.228  1.391   -2.198  1.00 77.07  ? 73  LYS B CB  1 
ATOM   7456  C CG  . LYS E 5 74  ? 18.394  1.863   -1.011  1.00 69.76  ? 73  LYS B CG  1 
ATOM   7457  C CD  . LYS E 5 74  ? 17.699  0.642   -0.407  1.00 72.96  ? 73  LYS B CD  1 
ATOM   7458  C CE  . LYS E 5 74  ? 16.651  0.988   0.639   1.00 70.80  ? 73  LYS B CE  1 
ATOM   7459  N NZ  . LYS E 5 74  ? 15.589  -0.066  0.653   1.00 66.95  ? 73  LYS B NZ  1 
ATOM   7460  N N   . SER E 5 75  ? 21.190  1.265   -4.738  1.00 81.43  ? 74  SER B N   1 
ATOM   7461  C CA  . SER E 5 75  ? 22.347  0.522   -5.244  1.00 79.98  ? 74  SER B CA  1 
ATOM   7462  C C   . SER E 5 75  ? 23.440  1.422   -5.814  1.00 77.94  ? 74  SER B C   1 
ATOM   7463  O O   . SER E 5 75  ? 24.631  1.096   -5.733  1.00 81.43  ? 74  SER B O   1 
ATOM   7464  C CB  . SER E 5 75  ? 21.926  -0.519  -6.282  1.00 73.29  ? 74  SER B CB  1 
ATOM   7465  O OG  . SER E 5 75  ? 23.032  -1.335  -6.626  1.00 71.70  ? 74  SER B OG  1 
ATOM   7466  N N   . SER E 5 76  ? 23.030  2.550   -6.383  1.00 70.25  ? 75  SER B N   1 
ATOM   7467  C CA  . SER E 5 76  ? 23.969  3.483   -6.977  1.00 71.06  ? 75  SER B CA  1 
ATOM   7468  C C   . SER E 5 76  ? 24.141  4.728   -6.118  1.00 74.78  ? 75  SER B C   1 
ATOM   7469  O O   . SER E 5 76  ? 24.721  5.726   -6.567  1.00 73.11  ? 75  SER B O   1 
ATOM   7470  C CB  . SER E 5 76  ? 23.484  3.879   -8.363  1.00 73.36  ? 75  SER B CB  1 
ATOM   7471  O OG  . SER E 5 76  ? 22.129  4.274   -8.318  1.00 66.91  ? 75  SER B OG  1 
ATOM   7472  N N   . ASN E 5 77  ? 23.627  4.662   -4.889  1.00 72.98  ? 76  ASN B N   1 
ATOM   7473  C CA  . ASN E 5 77  ? 23.716  5.761   -3.923  1.00 69.33  ? 76  ASN B CA  1 
ATOM   7474  C C   . ASN E 5 77  ? 23.251  7.129   -4.447  1.00 66.96  ? 76  ASN B C   1 
ATOM   7475  O O   . ASN E 5 77  ? 23.963  8.113   -4.287  1.00 70.99  ? 76  ASN B O   1 
ATOM   7476  C CB  . ASN E 5 77  ? 25.153  5.902   -3.389  1.00 71.55  ? 76  ASN B CB  1 
ATOM   7477  C CG  . ASN E 5 77  ? 25.660  4.643   -2.706  1.00 72.85  ? 76  ASN B CG  1 
ATOM   7478  O OD1 . ASN E 5 77  ? 24.880  3.848   -2.175  1.00 69.62  ? 76  ASN B OD1 1 
ATOM   7479  N ND2 . ASN E 5 77  ? 26.983  4.464   -2.706  1.00 72.50  ? 76  ASN B ND2 1 
ATOM   7480  N N   . THR E 5 78  ? 22.069  7.215   -5.051  1.00 65.04  ? 77  THR B N   1 
ATOM   7481  C CA  . THR E 5 78  ? 21.630  8.505   -5.596  1.00 66.76  ? 77  THR B CA  1 
ATOM   7482  C C   . THR E 5 78  ? 20.203  8.965   -5.267  1.00 64.92  ? 77  THR B C   1 
ATOM   7483  O O   . THR E 5 78  ? 19.426  8.271   -4.589  1.00 60.23  ? 77  THR B O   1 
ATOM   7484  C CB  . THR E 5 78  ? 21.805  8.562   -7.123  1.00 69.53  ? 77  THR B CB  1 
ATOM   7485  O OG1 . THR E 5 78  ? 20.564  8.954   -7.730  1.00 59.66  ? 77  THR B OG1 1 
ATOM   7486  C CG2 . THR E 5 78  ? 22.255  7.202   -7.669  1.00 66.08  ? 77  THR B CG2 1 
ATOM   7487  N N   . ALA E 5 79  ? 19.865  10.149  -5.770  1.00 60.76  ? 78  ALA B N   1 
ATOM   7488  C CA  . ALA E 5 79  ? 18.560  10.720  -5.500  1.00 60.29  ? 78  ALA B CA  1 
ATOM   7489  C C   . ALA E 5 79  ? 18.129  11.701  -6.569  1.00 59.00  ? 78  ALA B C   1 
ATOM   7490  O O   . ALA E 5 79  ? 18.729  12.759  -6.753  1.00 58.23  ? 78  ALA B O   1 
ATOM   7491  C CB  . ALA E 5 79  ? 18.543  11.374  -4.136  1.00 62.59  ? 78  ALA B CB  1 
ATOM   7492  N N   . TYR E 5 80  ? 17.058  11.337  -7.254  1.00 59.26  ? 79  TYR B N   1 
ATOM   7493  C CA  . TYR E 5 80  ? 16.571  12.092  -8.388  1.00 58.22  ? 79  TYR B CA  1 
ATOM   7494  C C   . TYR E 5 80  ? 15.391  12.982  -7.992  1.00 57.03  ? 79  TYR B C   1 
ATOM   7495  O O   . TYR E 5 80  ? 14.597  12.620  -7.126  1.00 54.59  ? 79  TYR B O   1 
ATOM   7496  C CB  . TYR E 5 80  ? 16.120  11.123  -9.481  1.00 59.08  ? 79  TYR B CB  1 
ATOM   7497  C CG  . TYR E 5 80  ? 17.084  9.992   -9.806  1.00 58.00  ? 79  TYR B CG  1 
ATOM   7498  C CD1 . TYR E 5 80  ? 18.121  10.177  -10.708 1.00 59.13  ? 79  TYR B CD1 1 
ATOM   7499  C CD2 . TYR E 5 80  ? 16.926  8.726   -9.248  1.00 63.76  ? 79  TYR B CD2 1 
ATOM   7500  C CE1 . TYR E 5 80  ? 18.995  9.151   -11.025 1.00 59.03  ? 79  TYR B CE1 1 
ATOM   7501  C CE2 . TYR E 5 80  ? 17.797  7.684   -9.566  1.00 67.16  ? 79  TYR B CE2 1 
ATOM   7502  C CZ  . TYR E 5 80  ? 18.835  7.914   -10.454 1.00 63.18  ? 79  TYR B CZ  1 
ATOM   7503  O OH  . TYR E 5 80  ? 19.721  6.915   -10.785 1.00 64.09  ? 79  TYR B OH  1 
ATOM   7504  N N   . MET E 5 81  ? 15.289  14.149  -8.622  1.00 57.21  ? 80  MET B N   1 
ATOM   7505  C CA  . MET E 5 81  ? 14.075  14.957  -8.551  1.00 60.26  ? 80  MET B CA  1 
ATOM   7506  C C   . MET E 5 81  ? 13.521  15.147  -9.941  1.00 60.82  ? 80  MET B C   1 
ATOM   7507  O O   . MET E 5 81  ? 14.240  15.525  -10.849 1.00 63.86  ? 80  MET B O   1 
ATOM   7508  C CB  . MET E 5 81  ? 14.338  16.341  -7.955  1.00 60.42  ? 80  MET B CB  1 
ATOM   7509  C CG  . MET E 5 81  ? 13.082  17.015  -7.397  1.00 61.23  ? 80  MET B CG  1 
ATOM   7510  S SD  . MET E 5 81  ? 13.181  18.811  -7.360  1.00 69.35  ? 80  MET B SD  1 
ATOM   7511  C CE  . MET E 5 81  ? 14.948  19.048  -7.317  1.00 58.18  ? 80  MET B CE  1 
ATOM   7512  N N   . GLN E 5 82  ? 12.238  14.900  -10.117 1.00 59.06  ? 81  GLN B N   1 
ATOM   7513  C CA  . GLN E 5 82  ? 11.647  15.215  -11.395 1.00 67.86  ? 81  GLN B CA  1 
ATOM   7514  C C   . GLN E 5 82  ? 10.768  16.451  -11.269 1.00 70.15  ? 81  GLN B C   1 
ATOM   7515  O O   . GLN E 5 82  ? 10.199  16.727  -10.212 1.00 69.20  ? 81  GLN B O   1 
ATOM   7516  C CB  . GLN E 5 82  ? 10.864  14.030  -11.967 1.00 71.88  ? 81  GLN B CB  1 
ATOM   7517  C CG  . GLN E 5 82  ? 10.426  14.233  -13.407 1.00 72.92  ? 81  GLN B CG  1 
ATOM   7518  C CD  . GLN E 5 82  ? 9.219   13.397  -13.776 1.00 77.02  ? 81  GLN B CD  1 
ATOM   7519  O OE1 . GLN E 5 82  ? 9.226   12.694  -14.788 1.00 84.01  ? 81  GLN B OE1 1 
ATOM   7520  N NE2 . GLN E 5 82  ? 8.173   13.466  -12.955 1.00 69.54  ? 81  GLN B NE2 1 
ATOM   7521  N N   . LEU E 5 83  ? 10.700  17.206  -12.358 1.00 75.61  ? 82  LEU B N   1 
ATOM   7522  C CA  . LEU E 5 83  ? 9.796   18.334  -12.492 1.00 77.22  ? 82  LEU B CA  1 
ATOM   7523  C C   . LEU E 5 83  ? 8.863   17.999  -13.650 1.00 79.69  ? 82  LEU B C   1 
ATOM   7524  O O   . LEU E 5 83  ? 9.150   17.105  -14.445 1.00 81.50  ? 82  LEU B O   1 
ATOM   7525  C CB  . LEU E 5 83  ? 10.588  19.628  -12.736 1.00 75.65  ? 82  LEU B CB  1 
ATOM   7526  C CG  . LEU E 5 83  ? 11.191  20.276  -11.473 1.00 70.95  ? 82  LEU B CG  1 
ATOM   7527  C CD1 . LEU E 5 83  ? 12.504  20.983  -11.725 1.00 59.49  ? 82  LEU B CD1 1 
ATOM   7528  C CD2 . LEU E 5 83  ? 10.191  21.231  -10.818 1.00 73.09  ? 82  LEU B CD2 1 
ATOM   7529  N N   . ASN E 5 84  A 7.729   18.673  -13.731 1.00 79.76  ? 82  ASN B N   1 
ATOM   7530  C CA  . ASN E 5 84  A 6.757   18.340  -14.761 1.00 86.34  ? 82  ASN B CA  1 
ATOM   7531  C C   . ASN E 5 84  A 5.849   19.526  -15.047 1.00 95.86  ? 82  ASN B C   1 
ATOM   7532  O O   . ASN E 5 84  A 5.527   20.296  -14.134 1.00 96.04  ? 82  ASN B O   1 
ATOM   7533  C CB  . ASN E 5 84  A 5.952   17.079  -14.390 1.00 87.69  ? 82  ASN B CB  1 
ATOM   7534  C CG  . ASN E 5 84  A 5.671   16.967  -12.888 1.00 90.69  ? 82  ASN B CG  1 
ATOM   7535  O OD1 . ASN E 5 84  A 5.810   17.936  -12.147 1.00 92.11  ? 82  ASN B OD1 1 
ATOM   7536  N ND2 . ASN E 5 84  A 5.277   15.777  -12.439 1.00 88.15  ? 82  ASN B ND2 1 
ATOM   7537  N N   . SER E 5 85  B 5.458   19.682  -16.313 1.00 95.00  ? 82  SER B N   1 
ATOM   7538  C CA  . SER E 5 85  B 4.657   20.835  -16.743 1.00 93.32  ? 82  SER B CA  1 
ATOM   7539  C C   . SER E 5 85  B 5.350   22.176  -16.419 1.00 94.45  ? 82  SER B C   1 
ATOM   7540  O O   . SER E 5 85  B 4.791   23.015  -15.691 1.00 92.75  ? 82  SER B O   1 
ATOM   7541  C CB  . SER E 5 85  B 3.254   20.778  -16.116 1.00 93.73  ? 82  SER B CB  1 
ATOM   7542  O OG  . SER E 5 85  B 2.479   21.922  -16.447 1.00 97.88  ? 82  SER B OG  1 
ATOM   7543  N N   . LEU E 5 86  C 6.554   22.371  -16.966 1.00 86.72  ? 82  LEU B N   1 
ATOM   7544  C CA  . LEU E 5 86  C 7.402   23.517  -16.617 1.00 83.08  ? 82  LEU B CA  1 
ATOM   7545  C C   . LEU E 5 86  C 6.824   24.888  -16.972 1.00 81.22  ? 82  LEU B C   1 
ATOM   7546  O O   . LEU E 5 86  C 6.216   25.049  -18.021 1.00 87.92  ? 82  LEU B O   1 
ATOM   7547  C CB  . LEU E 5 86  C 8.790   23.363  -17.237 1.00 82.62  ? 82  LEU B CB  1 
ATOM   7548  C CG  . LEU E 5 86  C 9.828   22.610  -16.401 1.00 86.93  ? 82  LEU B CG  1 
ATOM   7549  C CD1 . LEU E 5 86  C 10.080  23.342  -15.074 1.00 79.14  ? 82  LEU B CD1 1 
ATOM   7550  C CD2 . LEU E 5 86  C 9.404   21.167  -16.166 1.00 82.79  ? 82  LEU B CD2 1 
ATOM   7551  N N   . THR E 5 87  ? 7.034   25.870  -16.094 1.00 82.27  ? 83  THR B N   1 
ATOM   7552  C CA  . THR E 5 87  ? 6.569   27.248  -16.304 1.00 87.00  ? 83  THR B CA  1 
ATOM   7553  C C   . THR E 5 87  ? 7.727   28.258  -16.292 1.00 86.01  ? 83  THR B C   1 
ATOM   7554  O O   . THR E 5 87  ? 8.804   27.959  -15.776 1.00 84.18  ? 83  THR B O   1 
ATOM   7555  C CB  . THR E 5 87  ? 5.553   27.660  -15.216 1.00 85.45  ? 83  THR B CB  1 
ATOM   7556  O OG1 . THR E 5 87  ? 4.478   26.715  -15.178 1.00 86.97  ? 83  THR B OG1 1 
ATOM   7557  C CG2 . THR E 5 87  ? 4.994   29.053  -15.487 1.00 83.52  ? 83  THR B CG2 1 
ATOM   7558  N N   . SER E 5 88  ? 7.510   29.444  -16.863 1.00 84.10  ? 84  SER B N   1 
ATOM   7559  C CA  . SER E 5 88  ? 8.486   30.532  -16.770 1.00 87.32  ? 84  SER B CA  1 
ATOM   7560  C C   . SER E 5 88  ? 9.052   30.590  -15.359 1.00 88.06  ? 84  SER B C   1 
ATOM   7561  O O   . SER E 5 88  ? 10.266  30.565  -15.161 1.00 90.51  ? 84  SER B O   1 
ATOM   7562  C CB  . SER E 5 88  ? 7.833   31.880  -17.100 1.00 92.45  ? 84  SER B CB  1 
ATOM   7563  O OG  . SER E 5 88  ? 7.267   32.486  -15.942 1.00 87.71  ? 84  SER B OG  1 
ATOM   7564  N N   . GLU E 5 89  ? 8.140   30.666  -14.392 1.00 89.32  ? 85  GLU B N   1 
ATOM   7565  C CA  . GLU E 5 89  ? 8.430   30.648  -12.956 1.00 88.64  ? 85  GLU B CA  1 
ATOM   7566  C C   . GLU E 5 89  ? 9.436   29.599  -12.520 1.00 84.28  ? 85  GLU B C   1 
ATOM   7567  O O   . GLU E 5 89  ? 10.403  29.887  -11.823 1.00 80.51  ? 85  GLU B O   1 
ATOM   7568  C CB  . GLU E 5 89  ? 7.133   30.347  -12.215 1.00 86.60  ? 85  GLU B CB  1 
ATOM   7569  C CG  . GLU E 5 89  ? 6.065   31.350  -12.470 1.00 83.46  ? 85  GLU B CG  1 
ATOM   7570  C CD  . GLU E 5 89  ? 6.268   32.568  -11.623 1.00 88.70  ? 85  GLU B CD  1 
ATOM   7571  O OE1 . GLU E 5 89  ? 5.725   33.632  -11.977 1.00 100.61 ? 85  GLU B OE1 1 
ATOM   7572  O OE2 . GLU E 5 89  ? 6.980   32.458  -10.600 1.00 88.15  ? 85  GLU B OE2 1 
ATOM   7573  N N   . ASP E 5 90  ? 9.173   28.366  -12.925 1.00 84.02  ? 86  ASP B N   1 
ATOM   7574  C CA  . ASP E 5 90  ? 9.881   27.213  -12.399 1.00 85.01  ? 86  ASP B CA  1 
ATOM   7575  C C   . ASP E 5 90  ? 11.377  27.208  -12.769 1.00 79.80  ? 86  ASP B C   1 
ATOM   7576  O O   . ASP E 5 90  ? 12.121  26.310  -12.370 1.00 72.26  ? 86  ASP B O   1 
ATOM   7577  C CB  . ASP E 5 90  ? 9.157   25.911  -12.824 1.00 89.41  ? 86  ASP B CB  1 
ATOM   7578  C CG  . ASP E 5 90  ? 7.748   25.753  -12.172 1.00 90.70  ? 86  ASP B CG  1 
ATOM   7579  O OD1 . ASP E 5 90  ? 7.133   26.766  -11.755 1.00 93.06  ? 86  ASP B OD1 1 
ATOM   7580  O OD2 . ASP E 5 90  ? 7.248   24.605  -12.080 1.00 85.89  ? 86  ASP B OD2 1 
ATOM   7581  N N   . SER E 5 91  ? 11.810  28.223  -13.517 1.00 83.98  ? 87  SER B N   1 
ATOM   7582  C CA  . SER E 5 91  ? 13.214  28.351  -13.932 1.00 84.11  ? 87  SER B CA  1 
ATOM   7583  C C   . SER E 5 91  ? 14.016  29.049  -12.836 1.00 83.14  ? 87  SER B C   1 
ATOM   7584  O O   . SER E 5 91  ? 13.710  30.186  -12.449 1.00 82.41  ? 87  SER B O   1 
ATOM   7585  C CB  . SER E 5 91  ? 13.348  29.112  -15.268 1.00 88.87  ? 87  SER B CB  1 
ATOM   7586  O OG  . SER E 5 91  ? 13.155  28.276  -16.413 1.00 87.32  ? 87  SER B OG  1 
ATOM   7587  N N   . ALA E 5 92  ? 15.045  28.359  -12.344 1.00 85.44  ? 88  ALA B N   1 
ATOM   7588  C CA  . ALA E 5 92  ? 15.778  28.802  -11.157 1.00 79.49  ? 88  ALA B CA  1 
ATOM   7589  C C   . ALA E 5 92  ? 16.878  27.836  -10.683 1.00 71.00  ? 88  ALA B C   1 
ATOM   7590  O O   . ALA E 5 92  ? 17.382  26.991  -11.440 1.00 63.59  ? 88  ALA B O   1 
ATOM   7591  C CB  . ALA E 5 92  ? 14.798  29.081  -10.017 1.00 75.78  ? 88  ALA B CB  1 
ATOM   7592  N N   . VAL E 5 93  ? 17.233  27.978  -9.410  1.00 70.39  ? 89  VAL B N   1 
ATOM   7593  C CA  . VAL E 5 93  ? 18.316  27.207  -8.817  1.00 70.19  ? 89  VAL B CA  1 
ATOM   7594  C C   . VAL E 5 93  ? 17.802  26.155  -7.820  1.00 70.25  ? 89  VAL B C   1 
ATOM   7595  O O   . VAL E 5 93  ? 17.066  26.491  -6.882  1.00 70.66  ? 89  VAL B O   1 
ATOM   7596  C CB  . VAL E 5 93  ? 19.280  28.129  -8.093  1.00 65.90  ? 89  VAL B CB  1 
ATOM   7597  C CG1 . VAL E 5 93  ? 20.568  27.386  -7.802  1.00 61.27  ? 89  VAL B CG1 1 
ATOM   7598  C CG2 . VAL E 5 93  ? 19.529  29.374  -8.928  1.00 63.26  ? 89  VAL B CG2 1 
ATOM   7599  N N   . TYR E 5 94  ? 18.196  24.896  -8.018  1.00 60.18  ? 90  TYR B N   1 
ATOM   7600  C CA  . TYR E 5 94  ? 17.670  23.801  -7.223  1.00 55.56  ? 90  TYR B CA  1 
ATOM   7601  C C   . TYR E 5 94  ? 18.768  23.017  -6.522  1.00 62.64  ? 90  TYR B C   1 
ATOM   7602  O O   . TYR E 5 94  ? 19.548  22.313  -7.166  1.00 63.40  ? 90  TYR B O   1 
ATOM   7603  C CB  . TYR E 5 94  ? 16.829  22.870  -8.089  1.00 58.42  ? 90  TYR B CB  1 
ATOM   7604  C CG  . TYR E 5 94  ? 15.574  23.519  -8.596  1.00 62.40  ? 90  TYR B CG  1 
ATOM   7605  C CD1 . TYR E 5 94  ? 14.448  23.614  -7.791  1.00 63.18  ? 90  TYR B CD1 1 
ATOM   7606  C CD2 . TYR E 5 94  ? 15.515  24.049  -9.876  1.00 65.24  ? 90  TYR B CD2 1 
ATOM   7607  C CE1 . TYR E 5 94  ? 13.296  24.221  -8.247  1.00 65.87  ? 90  TYR B CE1 1 
ATOM   7608  C CE2 . TYR E 5 94  ? 14.370  24.659  -10.343 1.00 65.34  ? 90  TYR B CE2 1 
ATOM   7609  C CZ  . TYR E 5 94  ? 13.265  24.743  -9.527  1.00 68.79  ? 90  TYR B CZ  1 
ATOM   7610  O OH  . TYR E 5 94  ? 12.128  25.347  -10.006 1.00 69.64  ? 90  TYR B OH  1 
ATOM   7611  N N   . TYR E 5 95  ? 18.807  23.136  -5.193  1.00 63.71  ? 91  TYR B N   1 
ATOM   7612  C CA  . TYR E 5 95  ? 19.796  22.455  -4.353  1.00 61.28  ? 91  TYR B CA  1 
ATOM   7613  C C   . TYR E 5 95  ? 19.254  21.151  -3.759  1.00 60.61  ? 91  TYR B C   1 
ATOM   7614  O O   . TYR E 5 95  ? 18.049  21.049  -3.514  1.00 61.09  ? 91  TYR B O   1 
ATOM   7615  C CB  . TYR E 5 95  ? 20.190  23.354  -3.180  1.00 57.76  ? 91  TYR B CB  1 
ATOM   7616  C CG  . TYR E 5 95  ? 20.827  24.665  -3.552  1.00 54.09  ? 91  TYR B CG  1 
ATOM   7617  C CD1 . TYR E 5 95  ? 22.125  24.715  -4.037  1.00 55.37  ? 91  TYR B CD1 1 
ATOM   7618  C CD2 . TYR E 5 95  ? 20.141  25.854  -3.383  1.00 54.77  ? 91  TYR B CD2 1 
ATOM   7619  C CE1 . TYR E 5 95  ? 22.714  25.910  -4.366  1.00 56.83  ? 91  TYR B CE1 1 
ATOM   7620  C CE2 . TYR E 5 95  ? 20.714  27.055  -3.713  1.00 60.16  ? 91  TYR B CE2 1 
ATOM   7621  C CZ  . TYR E 5 95  ? 22.004  27.079  -4.207  1.00 61.70  ? 91  TYR B CZ  1 
ATOM   7622  O OH  . TYR E 5 95  ? 22.580  28.283  -4.535  1.00 65.24  ? 91  TYR B OH  1 
ATOM   7623  N N   . CYS E 5 96  ? 20.139  20.177  -3.510  1.00 57.32  ? 92  CYS B N   1 
ATOM   7624  C CA  . CYS E 5 96  ? 19.804  19.011  -2.680  1.00 59.72  ? 92  CYS B CA  1 
ATOM   7625  C C   . CYS E 5 96  ? 20.743  18.909  -1.470  1.00 59.11  ? 92  CYS B C   1 
ATOM   7626  O O   . CYS E 5 96  ? 21.949  19.143  -1.599  1.00 58.92  ? 92  CYS B O   1 
ATOM   7627  C CB  . CYS E 5 96  ? 19.781  17.709  -3.491  1.00 60.99  ? 92  CYS B CB  1 
ATOM   7628  S SG  . CYS E 5 96  ? 21.317  16.748  -3.534  1.00 79.97  ? 92  CYS B SG  1 
ATOM   7629  N N   . ALA E 5 97  ? 20.181  18.554  -0.311  1.00 51.52  ? 93  ALA B N   1 
ATOM   7630  C CA  . ALA E 5 97  ? 20.860  18.705  0.969   1.00 47.28  ? 93  ALA B CA  1 
ATOM   7631  C C   . ALA E 5 97  ? 20.579  17.572  1.933   1.00 47.77  ? 93  ALA B C   1 
ATOM   7632  O O   . ALA E 5 97  ? 19.454  17.152  2.072   1.00 54.11  ? 93  ALA B O   1 
ATOM   7633  C CB  . ALA E 5 97  ? 20.442  19.982  1.589   1.00 49.01  ? 93  ALA B CB  1 
ATOM   7634  N N   . ARG E 5 98  ? 21.602  17.099  2.629   1.00 49.51  ? 94  ARG B N   1 
ATOM   7635  C CA  . ARG E 5 98  ? 21.467  15.952  3.526   1.00 47.62  ? 94  ARG B CA  1 
ATOM   7636  C C   . ARG E 5 98  ? 21.452  16.371  4.982   1.00 47.45  ? 94  ARG B C   1 
ATOM   7637  O O   . ARG E 5 98  ? 22.110  17.327  5.361   1.00 49.26  ? 94  ARG B O   1 
ATOM   7638  C CB  . ARG E 5 98  ? 22.610  14.969  3.287   1.00 53.47  ? 94  ARG B CB  1 
ATOM   7639  C CG  . ARG E 5 98  ? 22.786  13.911  4.352   1.00 53.36  ? 94  ARG B CG  1 
ATOM   7640  C CD  . ARG E 5 98  ? 23.910  14.270  5.293   1.00 55.36  ? 94  ARG B CD  1 
ATOM   7641  N NE  . ARG E 5 98  ? 25.009  13.320  5.215   1.00 57.35  ? 94  ARG B NE  1 
ATOM   7642  C CZ  . ARG E 5 98  ? 26.189  13.498  5.796   1.00 59.54  ? 94  ARG B CZ  1 
ATOM   7643  N NH1 . ARG E 5 98  ? 27.138  12.574  5.675   1.00 63.92  ? 94  ARG B NH1 1 
ATOM   7644  N NH2 . ARG E 5 98  ? 26.424  14.601  6.496   1.00 53.70  ? 94  ARG B NH2 1 
ATOM   7645  N N   . SER E 5 99  ? 20.703  15.642  5.801   1.00 50.25  ? 95  SER B N   1 
ATOM   7646  C CA  . SER E 5 99  ? 20.470  16.035  7.189   1.00 50.18  ? 95  SER B CA  1 
ATOM   7647  C C   . SER E 5 99  ? 20.434  14.827  8.093   1.00 51.12  ? 95  SER B C   1 
ATOM   7648  O O   . SER E 5 99  ? 19.782  13.821  7.793   1.00 47.91  ? 95  SER B O   1 
ATOM   7649  C CB  . SER E 5 99  ? 19.146  16.764  7.324   1.00 47.14  ? 95  SER B CB  1 
ATOM   7650  O OG  . SER E 5 99  ? 18.088  15.853  7.140   1.00 46.19  ? 95  SER B OG  1 
ATOM   7651  N N   . GLY E 5 100 ? 21.122  14.944  9.220   1.00 52.92  ? 96  GLY B N   1 
ATOM   7652  C CA  . GLY E 5 100 ? 21.294  13.814  10.109  1.00 52.64  ? 96  GLY B CA  1 
ATOM   7653  C C   . GLY E 5 100 ? 20.572  14.005  11.417  1.00 48.03  ? 96  GLY B C   1 
ATOM   7654  O O   . GLY E 5 100 ? 20.210  13.046  12.086  1.00 50.13  ? 96  GLY B O   1 
ATOM   7655  N N   . ARG E 5 101 ? 20.264  15.252  11.697  1.00 48.30  ? 97  ARG B N   1 
ATOM   7656  C CA  . ARG E 5 101 ? 19.516  15.606  12.856  1.00 47.49  ? 97  ARG B CA  1 
ATOM   7657  C C   . ARG E 5 101 ? 18.842  16.916  12.629  1.00 48.98  ? 97  ARG B C   1 
ATOM   7658  O O   . ARG E 5 101 ? 18.905  17.781  13.448  1.00 52.18  ? 97  ARG B O   1 
ATOM   7659  C CB  . ARG E 5 101 ? 20.478  15.743  13.984  1.00 49.18  ? 97  ARG B CB  1 
ATOM   7660  C CG  . ARG E 5 101 ? 21.679  14.899  13.776  1.00 50.93  ? 97  ARG B CG  1 
ATOM   7661  C CD  . ARG E 5 101 ? 22.600  14.995  14.952  1.00 56.73  ? 97  ARG B CD  1 
ATOM   7662  N NE  . ARG E 5 101 ? 23.975  15.272  14.577  1.00 69.22  ? 97  ARG B NE  1 
ATOM   7663  C CZ  . ARG E 5 101 ? 24.753  16.140  15.207  1.00 71.01  ? 97  ARG B CZ  1 
ATOM   7664  N NH1 . ARG E 5 101 ? 25.996  16.332  14.812  1.00 71.28  ? 97  ARG B NH1 1 
ATOM   7665  N NH2 . ARG E 5 101 ? 24.284  16.818  16.233  1.00 66.35  ? 97  ARG B NH2 1 
ATOM   7666  N N   . LEU E 5 102 ? 18.218  17.073  11.484  1.00 44.15  ? 98  LEU B N   1 
ATOM   7667  C CA  . LEU E 5 102 ? 17.470  18.274  11.185  1.00 45.92  ? 98  LEU B CA  1 
ATOM   7668  C C   . LEU E 5 102 ? 18.192  19.393  10.452  1.00 51.10  ? 98  LEU B C   1 
ATOM   7669  O O   . LEU E 5 102 ? 17.833  19.718  9.355   1.00 57.43  ? 98  LEU B O   1 
ATOM   7670  C CB  . LEU E 5 102 ? 16.811  18.747  12.438  1.00 51.42  ? 98  LEU B CB  1 
ATOM   7671  C CG  . LEU E 5 102 ? 15.981  17.549  12.838  1.00 49.83  ? 98  LEU B CG  1 
ATOM   7672  C CD1 . LEU E 5 102 ? 14.599  17.967  13.136  1.00 52.67  ? 98  LEU B CD1 1 
ATOM   7673  C CD2 . LEU E 5 102 ? 15.979  16.605  11.694  1.00 46.70  ? 98  LEU B CD2 1 
ATOM   7674  N N   . TYR E 5 103 ? 19.208  19.999  11.011  1.00 49.34  ? 99  TYR B N   1 
ATOM   7675  C CA  . TYR E 5 103 ? 19.848  20.996  10.205  1.00 48.80  ? 99  TYR B CA  1 
ATOM   7676  C C   . TYR E 5 103 ? 20.384  20.250  9.015   1.00 49.37  ? 99  TYR B C   1 
ATOM   7677  O O   . TYR E 5 103 ? 20.508  19.052  9.073   1.00 49.72  ? 99  TYR B O   1 
ATOM   7678  C CB  . TYR E 5 103 ? 20.923  21.736  10.969  1.00 49.54  ? 99  TYR B CB  1 
ATOM   7679  C CG  . TYR E 5 103 ? 22.020  20.899  11.529  1.00 51.84  ? 99  TYR B CG  1 
ATOM   7680  C CD1 . TYR E 5 103 ? 23.249  20.886  10.962  1.00 50.60  ? 99  TYR B CD1 1 
ATOM   7681  C CD2 . TYR E 5 103 ? 21.838  20.166  12.643  1.00 56.39  ? 99  TYR B CD2 1 
ATOM   7682  C CE1 . TYR E 5 103 ? 24.237  20.148  11.469  1.00 54.40  ? 99  TYR B CE1 1 
ATOM   7683  C CE2 . TYR E 5 103 ? 22.822  19.434  13.140  1.00 62.41  ? 99  TYR B CE2 1 
ATOM   7684  C CZ  . TYR E 5 103 ? 24.017  19.432  12.560  1.00 60.41  ? 99  TYR B CZ  1 
ATOM   7685  O OH  . TYR E 5 103 ? 25.012  18.681  13.085  1.00 64.94  ? 99  TYR B OH  1 
ATOM   7686  N N   . PHE E 5 104 ? 20.658  20.955  7.925   1.00 48.16  ? 101 PHE B N   1 
ATOM   7687  C CA  . PHE E 5 104 ? 21.165  20.354  6.707   1.00 47.05  ? 101 PHE B CA  1 
ATOM   7688  C C   . PHE E 5 104 ? 22.660  20.394  6.673   1.00 49.70  ? 101 PHE B C   1 
ATOM   7689  O O   . PHE E 5 104 ? 23.233  21.376  6.313   1.00 52.73  ? 101 PHE B O   1 
ATOM   7690  C CB  . PHE E 5 104 ? 20.679  21.134  5.517   1.00 43.24  ? 101 PHE B CB  1 
ATOM   7691  C CG  . PHE E 5 104 ? 19.218  21.189  5.398   1.00 47.04  ? 101 PHE B CG  1 
ATOM   7692  C CD1 . PHE E 5 104 ? 18.437  21.041  6.480   1.00 51.18  ? 101 PHE B CD1 1 
ATOM   7693  C CD2 . PHE E 5 104 ? 18.628  21.397  4.198   1.00 46.20  ? 101 PHE B CD2 1 
ATOM   7694  C CE1 . PHE E 5 104 ? 17.108  21.096  6.361   1.00 48.09  ? 101 PHE B CE1 1 
ATOM   7695  C CE2 . PHE E 5 104 ? 17.307  21.452  4.095   1.00 45.90  ? 101 PHE B CE2 1 
ATOM   7696  C CZ  . PHE E 5 104 ? 16.552  21.301  5.172   1.00 45.32  ? 101 PHE B CZ  1 
ATOM   7697  N N   . ASP E 5 105 ? 23.306  19.312  7.031   1.00 46.54  ? 102 ASP B N   1 
ATOM   7698  C CA  . ASP E 5 105 ? 24.758  19.360  7.213   1.00 48.41  ? 102 ASP B CA  1 
ATOM   7699  C C   . ASP E 5 105 ? 25.600  19.389  5.954   1.00 47.40  ? 102 ASP B C   1 
ATOM   7700  O O   . ASP E 5 105 ? 26.789  19.638  6.034   1.00 52.21  ? 102 ASP B O   1 
ATOM   7701  C CB  . ASP E 5 105 ? 25.261  18.260  8.152   1.00 51.76  ? 102 ASP B CB  1 
ATOM   7702  C CG  . ASP E 5 105 ? 24.495  16.968  7.999   1.00 54.35  ? 102 ASP B CG  1 
ATOM   7703  O OD1 . ASP E 5 105 ? 24.197  16.581  6.856   1.00 53.07  ? 102 ASP B OD1 1 
ATOM   7704  O OD2 . ASP E 5 105 ? 24.182  16.336  9.030   1.00 60.46  ? 102 ASP B OD2 1 
ATOM   7705  N N   . VAL E 5 106 ? 25.008  19.137  4.796   1.00 47.41  ? 103 VAL B N   1 
ATOM   7706  C CA  . VAL E 5 106 ? 25.789  19.162  3.561   1.00 49.59  ? 103 VAL B CA  1 
ATOM   7707  C C   . VAL E 5 106 ? 24.960  19.373  2.306   1.00 51.74  ? 103 VAL B C   1 
ATOM   7708  O O   . VAL E 5 106 ? 24.178  18.513  1.929   1.00 50.40  ? 103 VAL B O   1 
ATOM   7709  C CB  . VAL E 5 106 ? 26.581  17.890  3.392   1.00 43.65  ? 103 VAL B CB  1 
ATOM   7710  C CG1 . VAL E 5 106 ? 27.963  18.068  3.944   1.00 48.51  ? 103 VAL B CG1 1 
ATOM   7711  C CG2 . VAL E 5 106 ? 25.876  16.776  4.103   1.00 49.41  ? 103 VAL B CG2 1 
ATOM   7712  N N   . TRP E 5 107 ? 25.154  20.509  1.645   1.00 51.71  ? 104 TRP B N   1 
ATOM   7713  C CA  . TRP E 5 107 ? 24.407  20.808  0.436   1.00 51.18  ? 104 TRP B CA  1 
ATOM   7714  C C   . TRP E 5 107 ? 25.181  20.384  -0.793  1.00 54.81  ? 104 TRP B C   1 
ATOM   7715  O O   . TRP E 5 107 ? 26.412  20.251  -0.755  1.00 54.97  ? 104 TRP B O   1 
ATOM   7716  C CB  . TRP E 5 107 ? 24.130  22.302  0.333   1.00 52.21  ? 104 TRP B CB  1 
ATOM   7717  C CG  . TRP E 5 107 ? 23.359  22.866  1.464   1.00 50.62  ? 104 TRP B CG  1 
ATOM   7718  C CD1 . TRP E 5 107 ? 23.744  22.928  2.756   1.00 50.67  ? 104 TRP B CD1 1 
ATOM   7719  C CD2 . TRP E 5 107 ? 22.068  23.479  1.399   1.00 50.41  ? 104 TRP B CD2 1 
ATOM   7720  N NE1 . TRP E 5 107 ? 22.767  23.532  3.514   1.00 50.63  ? 104 TRP B NE1 1 
ATOM   7721  C CE2 . TRP E 5 107 ? 21.727  23.874  2.699   1.00 48.87  ? 104 TRP B CE2 1 
ATOM   7722  C CE3 . TRP E 5 107 ? 21.167  23.718  0.372   1.00 50.25  ? 104 TRP B CE3 1 
ATOM   7723  C CZ2 . TRP E 5 107 ? 20.527  24.481  2.997   1.00 47.13  ? 104 TRP B CZ2 1 
ATOM   7724  C CZ3 . TRP E 5 107 ? 19.981  24.332  0.672   1.00 51.96  ? 104 TRP B CZ3 1 
ATOM   7725  C CH2 . TRP E 5 107 ? 19.667  24.703  1.972   1.00 47.78  ? 104 TRP B CH2 1 
ATOM   7726  N N   . GLY E 5 108 ? 24.458  20.189  -1.890  1.00 54.00  ? 105 GLY B N   1 
ATOM   7727  C CA  . GLY E 5 108 ? 25.105  19.944  -3.159  1.00 60.49  ? 105 GLY B CA  1 
ATOM   7728  C C   . GLY E 5 108 ? 25.198  21.278  -3.860  1.00 60.99  ? 105 GLY B C   1 
ATOM   7729  O O   . GLY E 5 108 ? 24.441  22.182  -3.528  1.00 58.91  ? 105 GLY B O   1 
ATOM   7730  N N   . ALA E 5 109 ? 26.105  21.401  -4.827  1.00 61.70  ? 106 ALA B N   1 
ATOM   7731  C CA  . ALA E 5 109 ? 26.368  22.682  -5.492  1.00 58.49  ? 106 ALA B CA  1 
ATOM   7732  C C   . ALA E 5 109 ? 25.130  23.384  -6.059  1.00 57.84  ? 106 ALA B C   1 
ATOM   7733  O O   . ALA E 5 109 ? 25.066  24.617  -6.082  1.00 52.47  ? 106 ALA B O   1 
ATOM   7734  C CB  . ALA E 5 109 ? 27.395  22.493  -6.573  1.00 52.97  ? 106 ALA B CB  1 
ATOM   7735  N N   . GLY E 5 110 ? 24.163  22.594  -6.524  1.00 61.71  ? 107 GLY B N   1 
ATOM   7736  C CA  . GLY E 5 110 ? 22.947  23.126  -7.115  1.00 63.79  ? 107 GLY B CA  1 
ATOM   7737  C C   . GLY E 5 110 ? 22.818  22.929  -8.623  1.00 69.57  ? 107 GLY B C   1 
ATOM   7738  O O   . GLY E 5 110 ? 23.780  22.590  -9.319  1.00 69.38  ? 107 GLY B O   1 
ATOM   7739  N N   . THR E 5 111 ? 21.613  23.150  -9.136  1.00 70.25  ? 108 THR B N   1 
ATOM   7740  C CA  . THR E 5 111 ? 21.345  22.952  -10.550 1.00 66.42  ? 108 THR B CA  1 
ATOM   7741  C C   . THR E 5 111 ? 20.412  24.044  -11.034 1.00 71.49  ? 108 THR B C   1 
ATOM   7742  O O   . THR E 5 111 ? 19.547  24.501  -10.287 1.00 71.13  ? 108 THR B O   1 
ATOM   7743  C CB  . THR E 5 111 ? 20.705  21.597  -10.801 1.00 66.46  ? 108 THR B CB  1 
ATOM   7744  O OG1 . THR E 5 111 ? 21.696  20.695  -11.304 1.00 72.63  ? 108 THR B OG1 1 
ATOM   7745  C CG2 . THR E 5 111 ? 19.605  21.730  -11.814 1.00 72.69  ? 108 THR B CG2 1 
ATOM   7746  N N   . THR E 5 112 ? 20.592  24.460  -12.286 1.00 77.63  ? 109 THR B N   1 
ATOM   7747  C CA  . THR E 5 112 ? 19.841  25.582  -12.848 1.00 77.27  ? 109 THR B CA  1 
ATOM   7748  C C   . THR E 5 112 ? 18.936  25.186  -14.022 1.00 76.58  ? 109 THR B C   1 
ATOM   7749  O O   . THR E 5 112 ? 19.273  24.308  -14.822 1.00 74.50  ? 109 THR B O   1 
ATOM   7750  C CB  . THR E 5 112 ? 20.787  26.686  -13.317 1.00 73.34  ? 109 THR B CB  1 
ATOM   7751  O OG1 . THR E 5 112 ? 20.668  26.826  -14.738 1.00 76.22  ? 109 THR B OG1 1 
ATOM   7752  C CG2 . THR E 5 112 ? 22.230  26.334  -12.946 1.00 68.11  ? 109 THR B CG2 1 
ATOM   7753  N N   . VAL E 5 113 ? 17.822  25.892  -14.155 1.00 76.54  ? 110 VAL B N   1 
ATOM   7754  C CA  . VAL E 5 113 ? 16.798  25.554  -15.127 1.00 80.95  ? 110 VAL B CA  1 
ATOM   7755  C C   . VAL E 5 113 ? 16.281  26.711  -15.906 1.00 88.85  ? 110 VAL B C   1 
ATOM   7756  O O   . VAL E 5 113 ? 15.985  27.758  -15.354 1.00 86.03  ? 110 VAL B O   1 
ATOM   7757  C CB  . VAL E 5 113 ? 15.603  24.975  -14.372 1.00 76.34  ? 110 VAL B CB  1 
ATOM   7758  C CG1 . VAL E 5 113 ? 14.556  24.538  -15.302 1.00 78.37  ? 110 VAL B CG1 1 
ATOM   7759  C CG2 . VAL E 5 113 ? 16.014  23.834  -13.512 1.00 76.27  ? 110 VAL B CG2 1 
ATOM   7760  N N   . THR E 5 114 ? 16.131  26.500  -17.200 1.00 92.52  ? 111 THR B N   1 
ATOM   7761  C CA  . THR E 5 114 ? 15.718  27.558  -18.074 1.00 92.88  ? 111 THR B CA  1 
ATOM   7762  C C   . THR E 5 114 ? 14.847  26.992  -19.201 1.00 93.35  ? 111 THR B C   1 
ATOM   7763  O O   . THR E 5 114 ? 14.434  25.855  -19.133 1.00 90.45  ? 111 THR B O   1 
ATOM   7764  C CB  . THR E 5 114 ? 16.945  28.232  -18.580 1.00 91.34  ? 111 THR B CB  1 
ATOM   7765  O OG1 . THR E 5 114 ? 18.063  27.503  -18.080 1.00 81.32  ? 111 THR B OG1 1 
ATOM   7766  C CG2 . THR E 5 114 ? 17.016  29.611  -18.021 1.00 85.07  ? 111 THR B CG2 1 
ATOM   7767  N N   . VAL E 5 115 ? 14.560  27.760  -20.240 1.00 100.61 ? 112 VAL B N   1 
ATOM   7768  C CA  . VAL E 5 115 ? 13.547  27.304  -21.178 1.00 98.66  ? 112 VAL B CA  1 
ATOM   7769  C C   . VAL E 5 115 ? 13.420  28.115  -22.505 1.00 94.44  ? 112 VAL B C   1 
ATOM   7770  O O   . VAL E 5 115 ? 14.235  28.919  -22.828 1.00 89.20  ? 112 VAL B O   1 
ATOM   7771  C CB  . VAL E 5 115 ? 12.239  27.199  -20.357 1.00 93.69  ? 112 VAL B CB  1 
ATOM   7772  C CG1 . VAL E 5 115 ? 12.574  27.178  -18.874 1.00 89.24  ? 112 VAL B CG1 1 
ATOM   7773  C CG2 . VAL E 5 115 ? 11.343  28.389  -20.600 1.00 86.81  ? 112 VAL B CG2 1 
ATOM   7774  N N   . SER E 5 116 ? 12.427  27.801  -23.318 1.00 90.80  ? 113 SER B N   1 
ATOM   7775  C CA  . SER E 5 116 ? 11.788  28.720  -24.277 1.00 94.90  ? 113 SER B CA  1 
ATOM   7776  C C   . SER E 5 116 ? 12.263  29.081  -25.738 1.00 91.82  ? 113 SER B C   1 
ATOM   7777  O O   . SER E 5 116 ? 11.410  29.418  -26.539 1.00 76.47  ? 113 SER B O   1 
ATOM   7778  C CB  . SER E 5 116 ? 11.352  29.987  -23.523 1.00 94.75  ? 113 SER B CB  1 
ATOM   7779  O OG  . SER E 5 116 ? 12.333  31.002  -23.550 1.00 89.21  ? 113 SER B OG  1 
ATOM   7780  N N   . SER E 5 117 ? 13.547  29.043  -26.085 1.00 99.06  ? 114 SER B N   1 
ATOM   7781  C CA  . SER E 5 117 ? 13.955  29.427  -27.422 1.00 88.88  ? 114 SER B CA  1 
ATOM   7782  C C   . SER E 5 117 ? 15.054  28.611  -28.067 1.00 84.80  ? 114 SER B C   1 
ATOM   7783  O O   . SER E 5 117 ? 15.013  27.392  -28.132 1.00 77.00  ? 114 SER B O   1 
ATOM   7784  C CB  . SER E 5 117 ? 14.381  30.876  -27.421 1.00 84.89  ? 114 SER B CB  1 
ATOM   7785  O OG  . SER E 5 117 ? 13.814  31.536  -26.322 1.00 97.28  ? 114 SER B OG  1 
ATOM   7786  N N   . ALA E 5 118 ? 16.033  29.323  -28.585 1.00 82.17  ? 115 ALA B N   1 
ATOM   7787  C CA  . ALA E 5 118 ? 16.963  28.730  -29.512 1.00 78.95  ? 115 ALA B CA  1 
ATOM   7788  C C   . ALA E 5 118 ? 18.354  28.899  -29.001 1.00 75.61  ? 115 ALA B C   1 
ATOM   7789  O O   . ALA E 5 118 ? 18.921  29.981  -29.119 1.00 74.20  ? 115 ALA B O   1 
ATOM   7790  C CB  . ALA E 5 118 ? 16.834  29.389  -30.865 1.00 84.75  ? 115 ALA B CB  1 
ATOM   7791  N N   . LYS E 5 119 ? 18.898  27.825  -28.437 1.00 77.90  ? 116 LYS B N   1 
ATOM   7792  C CA  . LYS E 5 119 ? 20.290  27.804  -28.012 1.00 84.05  ? 116 LYS B CA  1 
ATOM   7793  C C   . LYS E 5 119 ? 21.176  28.153  -29.199 1.00 87.07  ? 116 LYS B C   1 
ATOM   7794  O O   . LYS E 5 119 ? 21.129  27.490  -30.235 1.00 89.73  ? 116 LYS B O   1 
ATOM   7795  C CB  . LYS E 5 119 ? 20.671  26.426  -27.475 1.00 83.16  ? 116 LYS B CB  1 
ATOM   7796  C CG  . LYS E 5 119 ? 21.011  25.416  -28.560 1.00 90.11  ? 116 LYS B CG  1 
ATOM   7797  C CD  . LYS E 5 119 ? 21.571  24.125  -27.992 1.00 88.05  ? 116 LYS B CD  1 
ATOM   7798  C CE  . LYS E 5 119 ? 22.716  24.398  -27.030 1.00 87.17  ? 116 LYS B CE  1 
ATOM   7799  N NZ  . LYS E 5 119 ? 23.710  25.379  -27.561 1.00 85.90  ? 116 LYS B NZ  1 
ATOM   7800  N N   . THR E 5 120 ? 21.964  29.212  -29.064 1.00 90.44  ? 117 THR B N   1 
ATOM   7801  C CA  . THR E 5 120 ? 22.889  29.591  -30.125 1.00 92.71  ? 117 THR B CA  1 
ATOM   7802  C C   . THR E 5 120 ? 24.317  29.245  -29.689 1.00 95.14  ? 117 THR B C   1 
ATOM   7803  O O   . THR E 5 120 ? 24.546  28.825  -28.553 1.00 97.86  ? 117 THR B O   1 
ATOM   7804  C CB  . THR E 5 120 ? 22.771  31.089  -30.488 1.00 88.02  ? 117 THR B CB  1 
ATOM   7805  O OG1 . THR E 5 120 ? 23.464  31.873  -29.513 1.00 87.43  ? 117 THR B OG1 1 
ATOM   7806  C CG2 . THR E 5 120 ? 21.304  31.530  -30.554 1.00 80.75  ? 117 THR B CG2 1 
ATOM   7807  N N   . THR E 5 121 ? 25.279  29.395  -30.585 1.00 91.48  ? 118 THR B N   1 
ATOM   7808  C CA  . THR E 5 121 ? 26.645  29.088  -30.217 1.00 93.17  ? 118 THR B CA  1 
ATOM   7809  C C   . THR E 5 121 ? 27.133  30.218  -29.349 1.00 95.36  ? 118 THR B C   1 
ATOM   7810  O O   . THR E 5 121 ? 26.590  31.310  -29.440 1.00 97.26  ? 118 THR B O   1 
ATOM   7811  C CB  . THR E 5 121 ? 27.538  29.034  -31.438 1.00 96.86  ? 118 THR B CB  1 
ATOM   7812  O OG1 . THR E 5 121 ? 28.280  27.808  -31.430 1.00 99.26  ? 118 THR B OG1 1 
ATOM   7813  C CG2 . THR E 5 121 ? 28.495  30.226  -31.441 1.00 94.55  ? 118 THR B CG2 1 
ATOM   7814  N N   . ALA E 5 122 ? 28.139  29.960  -28.507 1.00 99.75  ? 119 ALA B N   1 
ATOM   7815  C CA  . ALA E 5 122 ? 28.827  31.032  -27.783 1.00 94.61  ? 119 ALA B CA  1 
ATOM   7816  C C   . ALA E 5 122 ? 29.276  31.982  -28.850 1.00 98.99  ? 119 ALA B C   1 
ATOM   7817  O O   . ALA E 5 122 ? 30.356  31.804  -29.420 1.00 98.34  ? 119 ALA B O   1 
ATOM   7818  C CB  . ALA E 5 122 ? 30.028  30.511  -27.032 1.00 88.33  ? 119 ALA B CB  1 
ATOM   7819  N N   . PRO E 5 123 ? 28.441  32.989  -29.135 1.00 101.58 ? 120 PRO B N   1 
ATOM   7820  C CA  . PRO E 5 123 ? 28.600  33.846  -30.305 1.00 104.23 ? 120 PRO B CA  1 
ATOM   7821  C C   . PRO E 5 123 ? 29.914  34.574  -30.179 1.00 106.69 ? 120 PRO B C   1 
ATOM   7822  O O   . PRO E 5 123 ? 30.445  34.683  -29.071 1.00 103.88 ? 120 PRO B O   1 
ATOM   7823  C CB  . PRO E 5 123 ? 27.431  34.830  -30.182 1.00 98.23  ? 120 PRO B CB  1 
ATOM   7824  C CG  . PRO E 5 123 ? 26.515  34.205  -29.209 1.00 93.61  ? 120 PRO B CG  1 
ATOM   7825  C CD  . PRO E 5 123 ? 27.400  33.511  -28.246 1.00 96.03  ? 120 PRO B CD  1 
ATOM   7826  N N   . PRO E 5 124 ? 30.424  35.089  -31.297 1.00 106.07 ? 121 PRO B N   1 
ATOM   7827  C CA  . PRO E 5 124 ? 31.825  35.514  -31.338 1.00 105.16 ? 121 PRO B CA  1 
ATOM   7828  C C   . PRO E 5 124 ? 32.431  35.967  -29.981 1.00 99.22  ? 121 PRO B C   1 
ATOM   7829  O O   . PRO E 5 124 ? 31.775  36.594  -29.138 1.00 92.55  ? 121 PRO B O   1 
ATOM   7830  C CB  . PRO E 5 124 ? 31.796  36.642  -32.365 1.00 108.48 ? 121 PRO B CB  1 
ATOM   7831  C CG  . PRO E 5 124 ? 30.686  36.243  -33.317 1.00 105.82 ? 121 PRO B CG  1 
ATOM   7832  C CD  . PRO E 5 124 ? 29.666  35.516  -32.491 1.00 102.51 ? 121 PRO B CD  1 
ATOM   7833  N N   . VAL E 5 125 ? 33.694  35.597  -29.782 1.00 95.85  ? 122 VAL B N   1 
ATOM   7834  C CA  . VAL E 5 125 ? 34.488  36.087  -28.667 1.00 90.90  ? 122 VAL B CA  1 
ATOM   7835  C C   . VAL E 5 125 ? 35.430  37.188  -29.171 1.00 99.12  ? 122 VAL B C   1 
ATOM   7836  O O   . VAL E 5 125 ? 36.151  37.009  -30.158 1.00 102.75 ? 122 VAL B O   1 
ATOM   7837  C CB  . VAL E 5 125 ? 35.294  34.954  -28.019 1.00 92.53  ? 122 VAL B CB  1 
ATOM   7838  C CG1 . VAL E 5 125 ? 34.535  33.646  -28.131 1.00 95.57  ? 122 VAL B CG1 1 
ATOM   7839  C CG2 . VAL E 5 125 ? 36.664  34.815  -28.664 1.00 91.31  ? 122 VAL B CG2 1 
ATOM   7840  N N   . TYR E 5 126 ? 35.423  38.331  -28.491 1.00 99.87  ? 123 TYR B N   1 
ATOM   7841  C CA  . TYR E 5 126 ? 36.136  39.514  -28.973 1.00 95.82  ? 123 TYR B CA  1 
ATOM   7842  C C   . TYR E 5 126 ? 37.230  40.031  -28.024 1.00 91.66  ? 123 TYR B C   1 
ATOM   7843  O O   . TYR E 5 126 ? 36.963  40.322  -26.859 1.00 92.88  ? 123 TYR B O   1 
ATOM   7844  C CB  . TYR E 5 126 ? 35.116  40.604  -29.299 1.00 90.72  ? 123 TYR B CB  1 
ATOM   7845  C CG  . TYR E 5 126 ? 34.220  40.214  -30.451 1.00 93.05  ? 123 TYR B CG  1 
ATOM   7846  C CD1 . TYR E 5 126 ? 34.733  39.488  -31.518 1.00 94.32  ? 123 TYR B CD1 1 
ATOM   7847  C CD2 . TYR E 5 126 ? 32.876  40.575  -30.484 1.00 90.99  ? 123 TYR B CD2 1 
ATOM   7848  C CE1 . TYR E 5 126 ? 33.948  39.130  -32.579 1.00 93.77  ? 123 TYR B CE1 1 
ATOM   7849  C CE2 . TYR E 5 126 ? 32.072  40.220  -31.551 1.00 92.01  ? 123 TYR B CE2 1 
ATOM   7850  C CZ  . TYR E 5 126 ? 32.621  39.497  -32.598 1.00 97.52  ? 123 TYR B CZ  1 
ATOM   7851  O OH  . TYR E 5 126 ? 31.857  39.122  -33.681 1.00 103.94 ? 123 TYR B OH  1 
ATOM   7852  N N   . PRO E 5 127 ? 38.472  40.132  -28.525 1.00 89.93  ? 124 PRO B N   1 
ATOM   7853  C CA  . PRO E 5 127 ? 39.635  40.564  -27.732 1.00 90.74  ? 124 PRO B CA  1 
ATOM   7854  C C   . PRO E 5 127 ? 39.713  42.081  -27.537 1.00 92.90  ? 124 PRO B C   1 
ATOM   7855  O O   . PRO E 5 127 ? 39.305  42.833  -28.429 1.00 91.39  ? 124 PRO B O   1 
ATOM   7856  C CB  . PRO E 5 127 ? 40.835  40.104  -28.577 1.00 96.95  ? 124 PRO B CB  1 
ATOM   7857  C CG  . PRO E 5 127 ? 40.271  39.219  -29.659 1.00 100.34 ? 124 PRO B CG  1 
ATOM   7858  C CD  . PRO E 5 127 ? 38.858  39.663  -29.864 1.00 96.20  ? 124 PRO B CD  1 
ATOM   7859  N N   . LEU E 5 128 ? 40.255  42.520  -26.400 1.00 93.55  ? 125 LEU B N   1 
ATOM   7860  C CA  . LEU E 5 128 ? 40.380  43.951  -26.115 1.00 91.24  ? 125 LEU B CA  1 
ATOM   7861  C C   . LEU E 5 128 ? 41.797  44.394  -25.713 1.00 92.84  ? 125 LEU B C   1 
ATOM   7862  O O   . LEU E 5 128 ? 42.214  44.197  -24.571 1.00 91.88  ? 125 LEU B O   1 
ATOM   7863  C CB  . LEU E 5 128 ? 39.377  44.355  -25.036 1.00 83.39  ? 125 LEU B CB  1 
ATOM   7864  C CG  . LEU E 5 128 ? 37.931  44.061  -25.416 1.00 78.43  ? 125 LEU B CG  1 
ATOM   7865  C CD1 . LEU E 5 128 ? 37.004  44.486  -24.309 1.00 79.96  ? 125 LEU B CD1 1 
ATOM   7866  C CD2 . LEU E 5 128 ? 37.589  44.770  -26.707 1.00 74.98  ? 125 LEU B CD2 1 
ATOM   7867  N N   . ALA E 5 129 ? 42.523  44.989  -26.666 1.00 97.22  ? 126 ALA B N   1 
ATOM   7868  C CA  . ALA E 5 129 ? 43.833  45.615  -26.421 1.00 102.68 ? 126 ALA B CA  1 
ATOM   7869  C C   . ALA E 5 129 ? 43.686  47.138  -26.397 1.00 105.32 ? 126 ALA B C   1 
ATOM   7870  O O   . ALA E 5 129 ? 42.781  47.690  -27.026 1.00 108.05 ? 126 ALA B O   1 
ATOM   7871  C CB  . ALA E 5 129 ? 44.858  45.188  -27.474 1.00 107.50 ? 126 ALA B CB  1 
ATOM   7872  N N   . PRO E 5 130 ? 44.571  47.821  -25.663 1.00 101.51 ? 127 PRO B N   1 
ATOM   7873  C CA  . PRO E 5 130 ? 44.370  49.223  -25.266 1.00 103.66 ? 127 PRO B CA  1 
ATOM   7874  C C   . PRO E 5 130 ? 44.440  50.241  -26.414 1.00 114.76 ? 127 PRO B C   1 
ATOM   7875  O O   . PRO E 5 130 ? 43.524  50.292  -27.238 1.00 111.51 ? 127 PRO B O   1 
ATOM   7876  C CB  . PRO E 5 130 ? 45.494  49.455  -24.254 1.00 103.73 ? 127 PRO B CB  1 
ATOM   7877  C CG  . PRO E 5 130 ? 45.882  48.080  -23.798 1.00 102.80 ? 127 PRO B CG  1 
ATOM   7878  C CD  . PRO E 5 130 ? 45.743  47.228  -25.007 1.00 99.88  ? 127 PRO B CD  1 
ATOM   7879  N N   . VAL E 5 131 ? 45.487  51.066  -26.428 1.00 127.62 ? 128 VAL B N   1 
ATOM   7880  C CA  . VAL E 5 131 ? 45.770  51.966  -27.548 1.00 128.14 ? 128 VAL B CA  1 
ATOM   7881  C C   . VAL E 5 131 ? 46.984  51.419  -28.296 1.00 132.20 ? 128 VAL B C   1 
ATOM   7882  O O   . VAL E 5 131 ? 47.452  50.313  -27.994 1.00 130.69 ? 128 VAL B O   1 
ATOM   7883  C CB  . VAL E 5 131 ? 46.036  53.424  -27.077 1.00 120.62 ? 128 VAL B CB  1 
ATOM   7884  C CG1 . VAL E 5 131 ? 47.347  53.520  -26.308 1.00 115.55 ? 128 VAL B CG1 1 
ATOM   7885  C CG2 . VAL E 5 131 ? 46.024  54.390  -28.261 1.00 124.20 ? 128 VAL B CG2 1 
ATOM   7886  N N   . CYS E 5 132 ? 47.491  52.179  -29.266 1.00 135.94 ? 129 CYS B N   1 
ATOM   7887  C CA  . CYS E 5 132 ? 48.657  51.741  -30.026 1.00 135.53 ? 129 CYS B CA  1 
ATOM   7888  C C   . CYS E 5 132 ? 49.751  51.233  -29.078 1.00 135.21 ? 129 CYS B C   1 
ATOM   7889  O O   . CYS E 5 132 ? 50.591  50.422  -29.474 1.00 135.49 ? 129 CYS B O   1 
ATOM   7890  C CB  . CYS E 5 132 ? 49.168  52.849  -30.959 1.00 133.01 ? 129 CYS B CB  1 
ATOM   7891  S SG  . CYS E 5 132 ? 48.148  53.107  -32.445 1.00 128.37 ? 129 CYS B SG  1 
ATOM   7892  N N   . GLY E 5 133 ? 49.713  51.688  -27.823 1.00 134.26 ? 130 GLY B N   1 
ATOM   7893  C CA  . GLY E 5 133 ? 50.635  51.209  -26.804 1.00 129.05 ? 130 GLY B CA  1 
ATOM   7894  C C   . GLY E 5 133 ? 50.716  52.044  -25.536 1.00 124.55 ? 130 GLY B C   1 
ATOM   7895  O O   . GLY E 5 133 ? 49.948  52.989  -25.344 1.00 121.25 ? 130 GLY B O   1 
ATOM   7896  N N   . ASP E 5 134 ? 51.663  51.692  -24.669 1.00 123.80 ? 131 ASP B N   1 
ATOM   7897  C CA  . ASP E 5 134 ? 51.810  52.360  -23.379 1.00 126.24 ? 131 ASP B CA  1 
ATOM   7898  C C   . ASP E 5 134 ? 53.225  52.241  -22.801 1.00 131.18 ? 131 ASP B C   1 
ATOM   7899  O O   . ASP E 5 134 ? 53.611  51.179  -22.301 1.00 130.42 ? 131 ASP B O   1 
ATOM   7900  C CB  . ASP E 5 134 ? 50.800  51.791  -22.379 1.00 127.14 ? 131 ASP B CB  1 
ATOM   7901  C CG  . ASP E 5 134 ? 50.339  52.822  -21.365 1.00 126.09 ? 131 ASP B CG  1 
ATOM   7902  O OD1 . ASP E 5 134 ? 49.225  53.356  -21.534 1.00 126.70 ? 131 ASP B OD1 1 
ATOM   7903  O OD2 . ASP E 5 134 ? 51.086  53.104  -20.405 1.00 124.59 ? 131 ASP B OD2 1 
ATOM   7904  N N   . THR E 5 135 ? 53.981  53.338  -22.864 1.00 135.62 ? 132 THR B N   1 
ATOM   7905  C CA  . THR E 5 135 ? 55.325  53.421  -22.275 1.00 137.42 ? 132 THR B CA  1 
ATOM   7906  C C   . THR E 5 135 ? 55.254  53.454  -20.739 1.00 129.84 ? 132 THR B C   1 
ATOM   7907  O O   . THR E 5 135 ? 56.066  52.832  -20.038 1.00 123.45 ? 132 THR B O   1 
ATOM   7908  C CB  . THR E 5 135 ? 56.111  54.651  -22.827 1.00 133.99 ? 132 THR B CB  1 
ATOM   7909  O OG1 . THR E 5 135 ? 57.248  54.916  -21.994 1.00 135.49 ? 132 THR B OG1 1 
ATOM   7910  C CG2 . THR E 5 135 ? 55.222  55.899  -22.892 1.00 117.24 ? 132 THR B CG2 1 
ATOM   7911  N N   . THR E 5 136 ? 54.269  54.191  -20.233 1.00 129.68 ? 133 THR B N   1 
ATOM   7912  C CA  . THR E 5 136 ? 53.907  54.166  -18.825 1.00 125.29 ? 133 THR B CA  1 
ATOM   7913  C C   . THR E 5 136 ? 53.407  52.762  -18.544 1.00 120.44 ? 133 THR B C   1 
ATOM   7914  O O   . THR E 5 136 ? 53.673  51.834  -19.310 1.00 116.33 ? 133 THR B O   1 
ATOM   7915  C CB  . THR E 5 136 ? 52.769  55.195  -18.524 1.00 122.74 ? 133 THR B CB  1 
ATOM   7916  O OG1 . THR E 5 136 ? 53.164  56.501  -18.970 1.00 121.03 ? 133 THR B OG1 1 
ATOM   7917  C CG2 . THR E 5 136 ? 52.424  55.258  -17.028 1.00 112.64 ? 133 THR B CG2 1 
ATOM   7918  N N   . GLY E 5 137 ? 52.681  52.606  -17.445 1.00 120.53 ? 134 GLY B N   1 
ATOM   7919  C CA  . GLY E 5 137 ? 51.962  51.382  -17.188 1.00 116.29 ? 134 GLY B CA  1 
ATOM   7920  C C   . GLY E 5 137 ? 52.743  50.362  -16.401 1.00 110.11 ? 134 GLY B C   1 
ATOM   7921  O O   . GLY E 5 137 ? 52.929  49.233  -16.853 1.00 115.04 ? 134 GLY B O   1 
ATOM   7922  N N   . SER E 5 138 ? 53.206  50.741  -15.219 1.00 100.76 ? 135 SER B N   1 
ATOM   7923  C CA  . SER E 5 138 ? 53.630  49.717  -14.292 1.00 104.44 ? 135 SER B CA  1 
ATOM   7924  C C   . SER E 5 138 ? 52.603  48.573  -14.384 1.00 108.77 ? 135 SER B C   1 
ATOM   7925  O O   . SER E 5 138 ? 52.971  47.397  -14.338 1.00 109.20 ? 135 SER B O   1 
ATOM   7926  C CB  . SER E 5 138 ? 53.730  50.268  -12.870 1.00 102.11 ? 135 SER B CB  1 
ATOM   7927  O OG  . SER E 5 138 ? 55.079  50.556  -12.530 1.00 96.18  ? 135 SER B OG  1 
ATOM   7928  N N   . SER E 5 139 ? 51.325  48.928  -14.554 1.00 109.65 ? 136 SER B N   1 
ATOM   7929  C CA  . SER E 5 139 ? 50.233  47.945  -14.706 1.00 105.92 ? 136 SER B CA  1 
ATOM   7930  C C   . SER E 5 139 ? 49.355  48.157  -15.974 1.00 102.42 ? 136 SER B C   1 
ATOM   7931  O O   . SER E 5 139 ? 49.032  49.297  -16.338 1.00 103.35 ? 136 SER B O   1 
ATOM   7932  C CB  . SER E 5 139 ? 49.348  47.916  -13.443 1.00 101.93 ? 136 SER B CB  1 
ATOM   7933  O OG  . SER E 5 139 ? 50.057  47.478  -12.290 1.00 96.42  ? 136 SER B OG  1 
ATOM   7934  N N   . VAL E 5 140 ? 48.961  47.056  -16.623 1.00 94.84  ? 137 VAL B N   1 
ATOM   7935  C CA  . VAL E 5 140 ? 48.171  47.103  -17.858 1.00 84.94  ? 137 VAL B CA  1 
ATOM   7936  C C   . VAL E 5 140 ? 46.819  46.421  -17.713 1.00 82.64  ? 137 VAL B C   1 
ATOM   7937  O O   . VAL E 5 140 ? 46.628  45.608  -16.820 1.00 82.37  ? 137 VAL B O   1 
ATOM   7938  C CB  . VAL E 5 140 ? 48.879  46.359  -18.981 1.00 88.55  ? 137 VAL B CB  1 
ATOM   7939  C CG1 . VAL E 5 140 ? 48.211  46.668  -20.315 1.00 85.19  ? 137 VAL B CG1 1 
ATOM   7940  C CG2 . VAL E 5 140 ? 50.356  46.705  -18.996 1.00 94.03  ? 137 VAL B CG2 1 
ATOM   7941  N N   . THR E 5 141 ? 45.893  46.726  -18.619 1.00 85.97  ? 138 THR B N   1 
ATOM   7942  C CA  . THR E 5 141 ? 44.570  46.093  -18.617 1.00 81.57  ? 138 THR B CA  1 
ATOM   7943  C C   . THR E 5 141 ? 44.161  45.467  -19.966 1.00 85.08  ? 138 THR B C   1 
ATOM   7944  O O   . THR E 5 141 ? 44.027  46.164  -20.976 1.00 82.52  ? 138 THR B O   1 
ATOM   7945  C CB  . THR E 5 141 ? 43.487  47.082  -18.174 1.00 72.16  ? 138 THR B CB  1 
ATOM   7946  O OG1 . THR E 5 141 ? 43.667  47.377  -16.792 1.00 66.50  ? 138 THR B OG1 1 
ATOM   7947  C CG2 . THR E 5 141 ? 42.111  46.487  -18.366 1.00 76.16  ? 138 THR B CG2 1 
ATOM   7948  N N   . LEU E 5 142 ? 43.965  44.148  -19.969 1.00 84.94  ? 139 LEU B N   1 
ATOM   7949  C CA  . LEU E 5 142 ? 43.503  43.429  -21.158 1.00 85.55  ? 139 LEU B CA  1 
ATOM   7950  C C   . LEU E 5 142 ? 42.139  42.817  -20.915 1.00 88.79  ? 139 LEU B C   1 
ATOM   7951  O O   . LEU E 5 142 ? 41.774  42.522  -19.774 1.00 87.76  ? 139 LEU B O   1 
ATOM   7952  C CB  . LEU E 5 142 ? 44.472  42.322  -21.547 1.00 84.00  ? 139 LEU B CB  1 
ATOM   7953  C CG  . LEU E 5 142 ? 45.678  42.735  -22.380 1.00 91.82  ? 139 LEU B CG  1 
ATOM   7954  C CD1 . LEU E 5 142 ? 46.322  44.006  -21.846 1.00 96.06  ? 139 LEU B CD1 1 
ATOM   7955  C CD2 . LEU E 5 142 ? 46.682  41.609  -22.415 1.00 93.63  ? 139 LEU B CD2 1 
ATOM   7956  N N   . GLY E 5 143 ? 41.391  42.603  -21.990 1.00 90.89  ? 140 GLY B N   1 
ATOM   7957  C CA  . GLY E 5 143 ? 40.017  42.162  -21.849 1.00 89.98  ? 140 GLY B CA  1 
ATOM   7958  C C   . GLY E 5 143 ? 39.564  41.089  -22.817 1.00 91.41  ? 140 GLY B C   1 
ATOM   7959  O O   . GLY E 5 143 ? 40.333  40.622  -23.669 1.00 88.79  ? 140 GLY B O   1 
ATOM   7960  N N   . CYS E 5 144 ? 38.291  40.723  -22.677 1.00 89.25  ? 141 CYS B N   1 
ATOM   7961  C CA  . CYS E 5 144 ? 37.664  39.653  -23.446 1.00 90.94  ? 141 CYS B CA  1 
ATOM   7962  C C   . CYS E 5 144 ? 36.129  39.740  -23.371 1.00 85.86  ? 141 CYS B C   1 
ATOM   7963  O O   . CYS E 5 144 ? 35.503  39.215  -22.446 1.00 82.30  ? 141 CYS B O   1 
ATOM   7964  C CB  . CYS E 5 144 ? 38.148  38.294  -22.923 1.00 94.86  ? 141 CYS B CB  1 
ATOM   7965  S SG  . CYS E 5 144 ? 37.726  36.820  -23.918 1.00 100.75 ? 141 CYS B SG  1 
ATOM   7966  N N   . LEU E 5 145 ? 35.530  40.422  -24.340 1.00 82.41  ? 142 LEU B N   1 
ATOM   7967  C CA  . LEU E 5 145 ? 34.076  40.478  -24.463 1.00 84.08  ? 142 LEU B CA  1 
ATOM   7968  C C   . LEU E 5 145 ? 33.535  39.171  -25.069 1.00 90.56  ? 142 LEU B C   1 
ATOM   7969  O O   . LEU E 5 145 ? 33.953  38.780  -26.154 1.00 94.49  ? 142 LEU B O   1 
ATOM   7970  C CB  . LEU E 5 145 ? 33.682  41.685  -25.323 1.00 80.02  ? 142 LEU B CB  1 
ATOM   7971  C CG  . LEU E 5 145 ? 32.342  41.759  -26.057 1.00 78.05  ? 142 LEU B CG  1 
ATOM   7972  C CD1 . LEU E 5 145 ? 32.060  43.188  -26.495 1.00 70.92  ? 142 LEU B CD1 1 
ATOM   7973  C CD2 . LEU E 5 145 ? 32.330  40.843  -27.258 1.00 81.65  ? 142 LEU B CD2 1 
ATOM   7974  N N   . VAL E 5 146 ? 32.622  38.493  -24.370 1.00 89.65  ? 143 VAL B N   1 
ATOM   7975  C CA  . VAL E 5 146 ? 31.986  37.278  -24.895 1.00 84.90  ? 143 VAL B CA  1 
ATOM   7976  C C   . VAL E 5 146 ? 30.466  37.414  -24.927 1.00 84.04  ? 143 VAL B C   1 
ATOM   7977  O O   . VAL E 5 146 ? 29.802  37.326  -23.895 1.00 82.68  ? 143 VAL B O   1 
ATOM   7978  C CB  . VAL E 5 146 ? 32.396  36.038  -24.103 1.00 83.24  ? 143 VAL B CB  1 
ATOM   7979  C CG1 . VAL E 5 146 ? 31.500  34.855  -24.449 1.00 85.10  ? 143 VAL B CG1 1 
ATOM   7980  C CG2 . VAL E 5 146 ? 33.853  35.715  -24.384 1.00 84.25  ? 143 VAL B CG2 1 
ATOM   7981  N N   . LYS E 5 147 ? 29.928  37.607  -26.129 1.00 83.54  ? 144 LYS B N   1 
ATOM   7982  C CA  . LYS E 5 147 ? 28.575  38.113  -26.282 1.00 82.88  ? 144 LYS B CA  1 
ATOM   7983  C C   . LYS E 5 147 ? 27.706  37.338  -27.264 1.00 85.86  ? 144 LYS B C   1 
ATOM   7984  O O   . LYS E 5 147 ? 28.191  36.803  -28.262 1.00 82.00  ? 144 LYS B O   1 
ATOM   7985  C CB  . LYS E 5 147 ? 28.637  39.578  -26.705 1.00 86.82  ? 144 LYS B CB  1 
ATOM   7986  C CG  . LYS E 5 147 ? 27.478  40.037  -27.567 1.00 92.88  ? 144 LYS B CG  1 
ATOM   7987  C CD  . LYS E 5 147 ? 27.816  41.326  -28.307 1.00 88.63  ? 144 LYS B CD  1 
ATOM   7988  C CE  . LYS E 5 147 ? 26.558  42.053  -28.763 1.00 99.66  ? 144 LYS B CE  1 
ATOM   7989  N NZ  . LYS E 5 147 ? 25.844  42.715  -27.627 1.00 103.07 ? 144 LYS B NZ  1 
ATOM   7990  N N   . GLY E 5 148 ? 26.415  37.280  -26.932 1.00 93.95  ? 145 GLY B N   1 
ATOM   7991  C CA  . GLY E 5 148 ? 25.364  36.804  -27.820 1.00 94.78  ? 145 GLY B CA  1 
ATOM   7992  C C   . GLY E 5 148 ? 24.670  35.472  -27.540 1.00 96.58  ? 145 GLY B C   1 
ATOM   7993  O O   . GLY E 5 148 ? 23.721  35.123  -28.241 1.00 91.70  ? 145 GLY B O   1 
ATOM   7994  N N   . TYR E 5 149 ? 25.125  34.716  -26.543 1.00 96.34  ? 146 TYR B N   1 
ATOM   7995  C CA  . TYR E 5 149 ? 24.720  33.312  -26.434 1.00 94.48  ? 146 TYR B CA  1 
ATOM   7996  C C   . TYR E 5 149 ? 23.392  33.117  -25.700 1.00 89.83  ? 146 TYR B C   1 
ATOM   7997  O O   . TYR E 5 149 ? 22.834  34.096  -25.213 1.00 90.37  ? 146 TYR B O   1 
ATOM   7998  C CB  . TYR E 5 149 ? 25.837  32.509  -25.789 1.00 90.72  ? 146 TYR B CB  1 
ATOM   7999  C CG  . TYR E 5 149 ? 26.296  33.060  -24.465 1.00 93.79  ? 146 TYR B CG  1 
ATOM   8000  C CD1 . TYR E 5 149 ? 25.394  33.647  -23.582 1.00 95.15  ? 146 TYR B CD1 1 
ATOM   8001  C CD2 . TYR E 5 149 ? 27.624  32.956  -24.073 1.00 93.88  ? 146 TYR B CD2 1 
ATOM   8002  C CE1 . TYR E 5 149 ? 25.804  34.125  -22.352 1.00 93.02  ? 146 TYR B CE1 1 
ATOM   8003  C CE2 . TYR E 5 149 ? 28.044  33.435  -22.837 1.00 94.24  ? 146 TYR B CE2 1 
ATOM   8004  C CZ  . TYR E 5 149 ? 27.127  34.020  -21.982 1.00 93.20  ? 146 TYR B CZ  1 
ATOM   8005  O OH  . TYR E 5 149 ? 27.531  34.498  -20.753 1.00 88.38  ? 146 TYR B OH  1 
ATOM   8006  N N   . PHE E 5 150 ? 22.874  31.881  -25.647 1.00 86.72  ? 147 PHE B N   1 
ATOM   8007  C CA  . PHE E 5 150 ? 21.661  31.598  -24.846 1.00 93.52  ? 147 PHE B CA  1 
ATOM   8008  C C   . PHE E 5 150 ? 21.612  30.312  -23.992 1.00 97.63  ? 147 PHE B C   1 
ATOM   8009  O O   . PHE E 5 150 ? 20.691  30.131  -23.182 1.00 90.33  ? 147 PHE B O   1 
ATOM   8010  C CB  . PHE E 5 150 ? 20.378  31.700  -25.665 1.00 86.04  ? 147 PHE B CB  1 
ATOM   8011  C CG  . PHE E 5 150 ? 19.129  31.729  -24.818 1.00 84.51  ? 147 PHE B CG  1 
ATOM   8012  C CD1 . PHE E 5 150 ? 18.558  32.933  -24.440 1.00 92.11  ? 147 PHE B CD1 1 
ATOM   8013  C CD2 . PHE E 5 150 ? 18.532  30.561  -24.393 1.00 85.51  ? 147 PHE B CD2 1 
ATOM   8014  C CE1 . PHE E 5 150 ? 17.405  32.972  -23.659 1.00 87.94  ? 147 PHE B CE1 1 
ATOM   8015  C CE2 . PHE E 5 150 ? 17.387  30.598  -23.610 1.00 92.10  ? 147 PHE B CE2 1 
ATOM   8016  C CZ  . PHE E 5 150 ? 16.823  31.807  -23.246 1.00 82.59  ? 147 PHE B CZ  1 
ATOM   8017  N N   . PRO E 5 151 ? 22.567  29.398  -24.190 1.00 95.94  ? 148 PRO B N   1 
ATOM   8018  C CA  . PRO E 5 151 ? 22.716  28.413  -23.115 1.00 91.69  ? 148 PRO B CA  1 
ATOM   8019  C C   . PRO E 5 151 ? 23.690  28.965  -22.050 1.00 94.20  ? 148 PRO B C   1 
ATOM   8020  O O   . PRO E 5 151 ? 24.913  28.851  -22.178 1.00 90.89  ? 148 PRO B O   1 
ATOM   8021  C CB  . PRO E 5 151 ? 23.291  27.188  -23.835 1.00 87.81  ? 148 PRO B CB  1 
ATOM   8022  C CG  . PRO E 5 151 ? 23.120  27.472  -25.312 1.00 86.95  ? 148 PRO B CG  1 
ATOM   8023  C CD  . PRO E 5 151 ? 23.189  28.949  -25.444 1.00 88.46  ? 148 PRO B CD  1 
ATOM   8024  N N   . GLU E 5 152 ? 23.122  29.555  -20.999 1.00 94.21  ? 149 GLU B N   1 
ATOM   8025  C CA  . GLU E 5 152 ? 23.859  30.380  -20.037 1.00 90.90  ? 149 GLU B CA  1 
ATOM   8026  C C   . GLU E 5 152 ? 25.167  29.858  -19.429 1.00 90.17  ? 149 GLU B C   1 
ATOM   8027  O O   . GLU E 5 152 ? 26.105  30.633  -19.263 1.00 96.67  ? 149 GLU B O   1 
ATOM   8028  C CB  . GLU E 5 152 ? 22.938  30.871  -18.917 1.00 88.81  ? 149 GLU B CB  1 
ATOM   8029  C CG  . GLU E 5 152 ? 23.689  31.364  -17.673 1.00 97.29  ? 149 GLU B CG  1 
ATOM   8030  C CD  . GLU E 5 152 ? 24.410  32.708  -17.860 1.00 99.82  ? 149 GLU B CD  1 
ATOM   8031  O OE1 . GLU E 5 152 ? 25.671  32.724  -17.865 1.00 97.55  ? 149 GLU B OE1 1 
ATOM   8032  O OE2 . GLU E 5 152 ? 23.714  33.747  -17.977 1.00 96.40  ? 149 GLU B OE2 1 
ATOM   8033  N N   . SER E 5 153 ? 25.263  28.592  -19.059 1.00 81.70  ? 150 SER B N   1 
ATOM   8034  C CA  . SER E 5 153 ? 26.530  28.177  -18.464 1.00 87.05  ? 150 SER B CA  1 
ATOM   8035  C C   . SER E 5 153 ? 27.721  28.496  -19.393 1.00 88.51  ? 150 SER B C   1 
ATOM   8036  O O   . SER E 5 153 ? 27.930  27.816  -20.400 1.00 88.32  ? 150 SER B O   1 
ATOM   8037  C CB  . SER E 5 153 ? 26.507  26.698  -18.083 1.00 89.13  ? 150 SER B CB  1 
ATOM   8038  O OG  . SER E 5 153 ? 27.772  26.266  -17.609 1.00 79.72  ? 150 SER B OG  1 
ATOM   8039  N N   . VAL E 5 154 ? 28.477  29.548  -19.066 1.00 85.78  ? 151 VAL B N   1 
ATOM   8040  C CA  . VAL E 5 154 ? 29.698  29.893  -19.808 1.00 88.10  ? 151 VAL B CA  1 
ATOM   8041  C C   . VAL E 5 154 ? 30.876  30.035  -18.862 1.00 85.78  ? 151 VAL B C   1 
ATOM   8042  O O   . VAL E 5 154 ? 30.703  30.370  -17.692 1.00 86.82  ? 151 VAL B O   1 
ATOM   8043  C CB  . VAL E 5 154 ? 29.558  31.186  -20.662 1.00 93.94  ? 151 VAL B CB  1 
ATOM   8044  C CG1 . VAL E 5 154 ? 30.477  32.279  -20.148 1.00 89.23  ? 151 VAL B CG1 1 
ATOM   8045  C CG2 . VAL E 5 154 ? 29.882  30.896  -22.124 1.00 91.93  ? 151 VAL B CG2 1 
ATOM   8046  N N   . THR E 5 155 ? 32.078  29.789  -19.372 1.00 87.34  ? 152 THR B N   1 
ATOM   8047  C CA  . THR E 5 155 ? 33.249  29.694  -18.503 1.00 92.42  ? 152 THR B CA  1 
ATOM   8048  C C   . THR E 5 155 ? 34.517  30.392  -19.026 1.00 94.82  ? 152 THR B C   1 
ATOM   8049  O O   . THR E 5 155 ? 34.904  30.208  -20.182 1.00 93.28  ? 152 THR B O   1 
ATOM   8050  C CB  . THR E 5 155 ? 33.562  28.224  -18.162 1.00 92.42  ? 152 THR B CB  1 
ATOM   8051  O OG1 . THR E 5 155 ? 33.528  28.056  -16.740 1.00 94.11  ? 152 THR B OG1 1 
ATOM   8052  C CG2 . THR E 5 155 ? 34.934  27.802  -18.716 1.00 92.99  ? 152 THR B CG2 1 
ATOM   8053  N N   . LEU E 5 156 ? 35.160  31.173  -18.149 1.00 97.51  ? 153 LEU B N   1 
ATOM   8054  C CA  . LEU E 5 156 ? 36.319  31.997  -18.508 1.00 88.46  ? 153 LEU B CA  1 
ATOM   8055  C C   . LEU E 5 156 ? 37.528  31.861  -17.608 1.00 91.94  ? 153 LEU B C   1 
ATOM   8056  O O   . LEU E 5 156 ? 37.641  32.563  -16.605 1.00 87.36  ? 153 LEU B O   1 
ATOM   8057  C CB  . LEU E 5 156 ? 35.932  33.455  -18.501 1.00 78.09  ? 153 LEU B CB  1 
ATOM   8058  C CG  . LEU E 5 156 ? 35.869  34.043  -19.891 1.00 89.63  ? 153 LEU B CG  1 
ATOM   8059  C CD1 . LEU E 5 156 ? 35.683  32.950  -20.913 1.00 93.04  ? 153 LEU B CD1 1 
ATOM   8060  C CD2 . LEU E 5 156 ? 34.720  35.022  -19.924 1.00 91.73  ? 153 LEU B CD2 1 
ATOM   8061  N N   . LEU E 5 157 ? 38.437  30.970  -17.980 1.00 97.44  ? 154 LEU B N   1 
ATOM   8062  C CA  . LEU E 5 157 ? 39.756  30.960  -17.381 1.00 97.49  ? 154 LEU B CA  1 
ATOM   8063  C C   . LEU E 5 157 ? 40.670  31.778  -18.291 1.00 101.36 ? 154 LEU B C   1 
ATOM   8064  O O   . LEU E 5 157 ? 40.330  32.044  -19.448 1.00 99.95  ? 154 LEU B O   1 
ATOM   8065  C CB  . LEU E 5 157 ? 40.274  29.526  -17.175 1.00 101.01 ? 154 LEU B CB  1 
ATOM   8066  C CG  . LEU E 5 157 ? 40.816  28.640  -18.303 1.00 104.24 ? 154 LEU B CG  1 
ATOM   8067  C CD1 . LEU E 5 157 ? 42.123  29.177  -18.848 1.00 107.65 ? 154 LEU B CD1 1 
ATOM   8068  C CD2 . LEU E 5 157 ? 41.028  27.225  -17.793 1.00 103.88 ? 154 LEU B CD2 1 
ATOM   8069  N N   . TRP E 5 158 ? 41.810  32.202  -17.759 1.00 103.22 ? 155 TRP B N   1 
ATOM   8070  C CA  . TRP E 5 158 ? 42.782  32.943  -18.546 1.00 100.43 ? 155 TRP B CA  1 
ATOM   8071  C C   . TRP E 5 158 ? 44.082  32.163  -18.633 1.00 102.89 ? 155 TRP B C   1 
ATOM   8072  O O   . TRP E 5 158 ? 44.493  31.503  -17.672 1.00 97.27  ? 155 TRP B O   1 
ATOM   8073  C CB  . TRP E 5 158 ? 43.030  34.320  -17.944 1.00 99.34  ? 155 TRP B CB  1 
ATOM   8074  C CG  . TRP E 5 158 ? 41.909  35.303  -18.159 1.00 96.20  ? 155 TRP B CG  1 
ATOM   8075  C CD1 . TRP E 5 158 ? 40.824  35.513  -17.348 1.00 91.86  ? 155 TRP B CD1 1 
ATOM   8076  C CD2 . TRP E 5 158 ? 41.778  36.223  -19.243 1.00 94.83  ? 155 TRP B CD2 1 
ATOM   8077  N NE1 . TRP E 5 158 ? 40.026  36.503  -17.867 1.00 84.58  ? 155 TRP B NE1 1 
ATOM   8078  C CE2 . TRP E 5 158 ? 40.590  36.957  -19.030 1.00 92.28  ? 155 TRP B CE2 1 
ATOM   8079  C CE3 . TRP E 5 158 ? 42.546  36.497  -20.379 1.00 93.03  ? 155 TRP B CE3 1 
ATOM   8080  C CZ2 . TRP E 5 158 ? 40.157  37.947  -19.911 1.00 92.93  ? 155 TRP B CZ2 1 
ATOM   8081  C CZ3 . TRP E 5 158 ? 42.115  37.475  -21.251 1.00 94.30  ? 155 TRP B CZ3 1 
ATOM   8082  C CH2 . TRP E 5 158 ? 40.932  38.190  -21.014 1.00 96.43  ? 155 TRP B CH2 1 
ATOM   8083  N N   . ASN E 5 159 ? 44.730  32.259  -19.790 1.00 104.98 ? 156 ASN B N   1 
ATOM   8084  C CA  . ASN E 5 159 ? 45.858  31.395  -20.108 1.00 107.22 ? 156 ASN B CA  1 
ATOM   8085  C C   . ASN E 5 159 ? 45.431  29.938  -19.987 1.00 110.27 ? 156 ASN B C   1 
ATOM   8086  O O   . ASN E 5 159 ? 44.791  29.400  -20.893 1.00 111.64 ? 156 ASN B O   1 
ATOM   8087  C CB  . ASN E 5 159 ? 47.071  31.694  -19.222 1.00 105.79 ? 156 ASN B CB  1 
ATOM   8088  C CG  . ASN E 5 159 ? 48.123  32.538  -19.937 1.00 104.23 ? 156 ASN B CG  1 
ATOM   8089  O OD1 . ASN E 5 159 ? 49.139  32.920  -19.352 1.00 105.87 ? 156 ASN B OD1 1 
ATOM   8090  N ND2 . ASN E 5 159 ? 47.884  32.821  -21.212 1.00 101.62 ? 156 ASN B ND2 1 
ATOM   8091  N N   . SER E 5 160 ? 45.780  29.299  -18.874 1.00 107.94 ? 157 SER B N   1 
ATOM   8092  C CA  . SER E 5 160 ? 45.316  27.939  -18.602 1.00 110.08 ? 157 SER B CA  1 
ATOM   8093  C C   . SER E 5 160 ? 44.513  27.949  -17.317 1.00 108.73 ? 157 SER B C   1 
ATOM   8094  O O   . SER E 5 160 ? 44.039  26.911  -16.852 1.00 107.90 ? 157 SER B O   1 
ATOM   8095  C CB  . SER E 5 160 ? 46.494  26.966  -18.472 1.00 114.30 ? 157 SER B CB  1 
ATOM   8096  O OG  . SER E 5 160 ? 47.035  26.632  -19.742 1.00 117.80 ? 157 SER B OG  1 
ATOM   8097  N N   . GLY E 5 161 ? 44.344  29.148  -16.769 1.00 109.41 ? 158 GLY B N   1 
ATOM   8098  C CA  . GLY E 5 161 ? 43.890  29.321  -15.404 1.00 109.76 ? 158 GLY B CA  1 
ATOM   8099  C C   . GLY E 5 161 ? 45.143  29.484  -14.570 1.00 108.91 ? 158 GLY B C   1 
ATOM   8100  O O   . GLY E 5 161 ? 45.081  29.719  -13.366 1.00 105.85 ? 158 GLY B O   1 
ATOM   8101  N N   . SER E 5 162 ? 46.286  29.349  -15.242 1.00 110.75 ? 159 SER B N   1 
ATOM   8102  C CA  . SER E 5 162 ? 47.606  29.475  -14.635 1.00 109.46 ? 159 SER B CA  1 
ATOM   8103  C C   . SER E 5 162 ? 47.717  30.784  -13.872 1.00 113.15 ? 159 SER B C   1 
ATOM   8104  O O   . SER E 5 162 ? 48.091  30.809  -12.696 1.00 115.20 ? 159 SER B O   1 
ATOM   8105  C CB  . SER E 5 162 ? 48.680  29.428  -15.719 1.00 106.20 ? 159 SER B CB  1 
ATOM   8106  O OG  . SER E 5 162 ? 48.429  30.407  -16.713 1.00 103.80 ? 159 SER B OG  1 
ATOM   8107  N N   . LEU E 5 163 ? 47.404  31.875  -14.560 1.00 110.97 ? 160 LEU B N   1 
ATOM   8108  C CA  . LEU E 5 163 ? 47.275  33.171  -13.913 1.00 114.49 ? 160 LEU B CA  1 
ATOM   8109  C C   . LEU E 5 163 ? 45.799  33.383  -13.562 1.00 111.80 ? 160 LEU B C   1 
ATOM   8110  O O   . LEU E 5 163 ? 44.917  33.201  -14.403 1.00 110.59 ? 160 LEU B O   1 
ATOM   8111  C CB  . LEU E 5 163 ? 47.815  34.288  -14.823 1.00 114.81 ? 160 LEU B CB  1 
ATOM   8112  C CG  . LEU E 5 163 ? 46.853  35.338  -15.408 1.00 111.19 ? 160 LEU B CG  1 
ATOM   8113  C CD1 . LEU E 5 163 ? 46.519  36.432  -14.376 1.00 107.96 ? 160 LEU B CD1 1 
ATOM   8114  C CD2 . LEU E 5 163 ? 47.406  35.949  -16.704 1.00 93.87  ? 160 LEU B CD2 1 
ATOM   8115  N N   . SER E 5 164 ? 45.531  33.738  -12.311 1.00 106.59 ? 161 SER B N   1 
ATOM   8116  C CA  . SER E 5 164 ? 44.162  33.885  -11.844 1.00 101.51 ? 161 SER B CA  1 
ATOM   8117  C C   . SER E 5 164 ? 44.163  34.804  -10.647 1.00 102.38 ? 161 SER B C   1 
ATOM   8118  O O   . SER E 5 164 ? 43.237  34.793  -9.835  1.00 102.03 ? 161 SER B O   1 
ATOM   8119  C CB  . SER E 5 164 ? 43.589  32.531  -11.431 1.00 114.18 ? 161 SER B CB  1 
ATOM   8120  O OG  . SER E 5 164 ? 43.572  31.616  -12.515 1.00 123.53 ? 161 SER B OG  1 
ATOM   8121  N N   . SER E 5 165 ? 45.223  35.597  -10.549 1.00 106.16 ? 162 SER B N   1 
ATOM   8122  C CA  . SER E 5 165 ? 45.434  36.509  -9.428  1.00 103.78 ? 162 SER B CA  1 
ATOM   8123  C C   . SER E 5 165 ? 44.730  37.856  -9.624  1.00 91.95  ? 162 SER B C   1 
ATOM   8124  O O   . SER E 5 165 ? 43.940  38.293  -8.784  1.00 83.27  ? 162 SER B O   1 
ATOM   8125  C CB  . SER E 5 165 ? 46.940  36.740  -9.235  1.00 103.53 ? 162 SER B CB  1 
ATOM   8126  O OG  . SER E 5 165 ? 47.705  35.810  -9.994  1.00 103.10 ? 162 SER B OG  1 
ATOM   8127  N N   . GLY E 5 166 ? 45.023  38.505  -10.744 1.00 87.65  ? 163 GLY B N   1 
ATOM   8128  C CA  . GLY E 5 166 ? 44.518  39.837  -10.989 1.00 85.78  ? 163 GLY B CA  1 
ATOM   8129  C C   . GLY E 5 166 ? 43.286  39.936  -11.869 1.00 85.90  ? 163 GLY B C   1 
ATOM   8130  O O   . GLY E 5 166 ? 43.013  40.992  -12.443 1.00 86.49  ? 163 GLY B O   1 
ATOM   8131  N N   . VAL E 5 167 ? 42.519  38.858  -11.967 1.00 85.75  ? 164 VAL B N   1 
ATOM   8132  C CA  . VAL E 5 167 ? 41.422  38.818  -12.936 1.00 81.27  ? 164 VAL B CA  1 
ATOM   8133  C C   . VAL E 5 167 ? 40.079  39.327  -12.401 1.00 76.97  ? 164 VAL B C   1 
ATOM   8134  O O   . VAL E 5 167 ? 39.839  39.337  -11.198 1.00 83.72  ? 164 VAL B O   1 
ATOM   8135  C CB  . VAL E 5 167 ? 41.273  37.403  -13.545 1.00 83.40  ? 164 VAL B CB  1 
ATOM   8136  C CG1 . VAL E 5 167 ? 41.706  36.328  -12.543 1.00 92.20  ? 164 VAL B CG1 1 
ATOM   8137  C CG2 . VAL E 5 167 ? 39.860  37.170  -14.028 1.00 84.29  ? 164 VAL B CG2 1 
ATOM   8138  N N   . HIS E 5 168 ? 39.217  39.779  -13.301 1.00 71.14  ? 165 HIS B N   1 
ATOM   8139  C CA  . HIS E 5 168 ? 37.844  40.085  -12.936 1.00 74.03  ? 165 HIS B CA  1 
ATOM   8140  C C   . HIS E 5 168 ? 36.889  39.355  -13.853 1.00 79.49  ? 165 HIS B C   1 
ATOM   8141  O O   . HIS E 5 168 ? 37.315  38.601  -14.725 1.00 83.34  ? 165 HIS B O   1 
ATOM   8142  C CB  . HIS E 5 168 ? 37.579  41.581  -13.005 1.00 78.15  ? 165 HIS B CB  1 
ATOM   8143  C CG  . HIS E 5 168 ? 37.683  42.264  -11.678 1.00 83.31  ? 165 HIS B CG  1 
ATOM   8144  N ND1 . HIS E 5 168 ? 36.603  42.854  -11.060 1.00 80.95  ? 165 HIS B ND1 1 
ATOM   8145  C CD2 . HIS E 5 168 ? 38.733  42.424  -10.842 1.00 84.69  ? 165 HIS B CD2 1 
ATOM   8146  C CE1 . HIS E 5 168 ? 36.990  43.363  -9.903  1.00 78.81  ? 165 HIS B CE1 1 
ATOM   8147  N NE2 . HIS E 5 168 ? 38.281  43.120  -9.750  1.00 79.46  ? 165 HIS B NE2 1 
ATOM   8148  N N   . THR E 5 169 ? 35.594  39.573  -13.663 1.00 79.00  ? 166 THR B N   1 
ATOM   8149  C CA  . THR E 5 169 ? 34.603  38.955  -14.538 1.00 78.10  ? 166 THR B CA  1 
ATOM   8150  C C   . THR E 5 169 ? 33.175  39.251  -14.078 1.00 77.13  ? 166 THR B C   1 
ATOM   8151  O O   . THR E 5 169 ? 32.896  39.339  -12.882 1.00 79.19  ? 166 THR B O   1 
ATOM   8152  C CB  . THR E 5 169 ? 34.835  37.445  -14.679 1.00 69.52  ? 166 THR B CB  1 
ATOM   8153  O OG1 . THR E 5 169 ? 33.901  36.911  -15.618 1.00 69.52  ? 166 THR B OG1 1 
ATOM   8154  C CG2 . THR E 5 169 ? 34.666  36.761  -13.344 1.00 74.92  ? 166 THR B CG2 1 
ATOM   8155  N N   . PHE E 5 170 ? 32.272  39.394  -15.038 1.00 71.10  ? 167 PHE B N   1 
ATOM   8156  C CA  . PHE E 5 170 ? 31.026  40.085  -14.789 1.00 74.28  ? 167 PHE B CA  1 
ATOM   8157  C C   . PHE E 5 170 ? 29.789  39.233  -15.005 1.00 78.41  ? 167 PHE B C   1 
ATOM   8158  O O   . PHE E 5 170 ? 29.795  38.301  -15.816 1.00 73.30  ? 167 PHE B O   1 
ATOM   8159  C CB  . PHE E 5 170 ? 30.950  41.333  -15.677 1.00 79.60  ? 167 PHE B CB  1 
ATOM   8160  C CG  . PHE E 5 170 ? 32.003  42.363  -15.366 1.00 84.94  ? 167 PHE B CG  1 
ATOM   8161  C CD1 . PHE E 5 170 ? 31.689  43.498  -14.622 1.00 84.52  ? 167 PHE B CD1 1 
ATOM   8162  C CD2 . PHE E 5 170 ? 33.310  42.196  -15.805 1.00 85.39  ? 167 PHE B CD2 1 
ATOM   8163  C CE1 . PHE E 5 170 ? 32.654  44.446  -14.322 1.00 79.62  ? 167 PHE B CE1 1 
ATOM   8164  C CE2 . PHE E 5 170 ? 34.282  43.141  -15.509 1.00 85.46  ? 167 PHE B CE2 1 
ATOM   8165  C CZ  . PHE E 5 170 ? 33.950  44.267  -14.767 1.00 85.19  ? 167 PHE B CZ  1 
ATOM   8166  N N   . PRO E 5 171 ? 28.709  39.573  -14.277 1.00 81.21  ? 168 PRO B N   1 
ATOM   8167  C CA  . PRO E 5 171 ? 27.376  39.010  -14.496 1.00 83.06  ? 168 PRO B CA  1 
ATOM   8168  C C   . PRO E 5 171 ? 26.981  39.087  -15.977 1.00 88.07  ? 168 PRO B C   1 
ATOM   8169  O O   . PRO E 5 171 ? 27.080  40.161  -16.593 1.00 89.11  ? 168 PRO B O   1 
ATOM   8170  C CB  . PRO E 5 171 ? 26.466  39.940  -13.674 1.00 74.01  ? 168 PRO B CB  1 
ATOM   8171  C CG  . PRO E 5 171 ? 27.323  40.482  -12.630 1.00 68.72  ? 168 PRO B CG  1 
ATOM   8172  C CD  . PRO E 5 171 ? 28.700  40.598  -13.218 1.00 75.01  ? 168 PRO B CD  1 
ATOM   8173  N N   . ALA E 5 172 ? 26.538  37.967  -16.545 1.00 81.99  ? 169 ALA B N   1 
ATOM   8174  C CA  . ALA E 5 172 ? 25.956  37.999  -17.874 1.00 79.87  ? 169 ALA B CA  1 
ATOM   8175  C C   . ALA E 5 172 ? 24.878  39.059  -17.901 1.00 79.67  ? 169 ALA B C   1 
ATOM   8176  O O   . ALA E 5 172 ? 24.467  39.591  -16.872 1.00 75.52  ? 169 ALA B O   1 
ATOM   8177  C CB  . ALA E 5 172 ? 25.368  36.658  -18.240 1.00 83.56  ? 169 ALA B CB  1 
ATOM   8178  N N   . VAL E 5 173 ? 24.425  39.382  -19.095 1.00 85.19  ? 170 VAL B N   1 
ATOM   8179  C CA  . VAL E 5 173 ? 23.266  40.232  -19.210 1.00 87.73  ? 170 VAL B CA  1 
ATOM   8180  C C   . VAL E 5 173 ? 22.519  39.872  -20.466 1.00 87.88  ? 170 VAL B C   1 
ATOM   8181  O O   . VAL E 5 173 ? 23.106  39.639  -21.517 1.00 83.53  ? 170 VAL B O   1 
ATOM   8182  C CB  . VAL E 5 173 ? 23.610  41.725  -19.179 1.00 87.79  ? 170 VAL B CB  1 
ATOM   8183  C CG1 . VAL E 5 173 ? 24.950  41.991  -19.864 1.00 89.60  ? 170 VAL B CG1 1 
ATOM   8184  C CG2 . VAL E 5 173 ? 22.487  42.529  -19.813 1.00 87.16  ? 170 VAL B CG2 1 
ATOM   8185  N N   . LEU E 5 174 ? 21.209  39.806  -20.321 1.00 89.14  ? 171 LEU B N   1 
ATOM   8186  C CA  . LEU E 5 174 ? 20.338  39.356  -21.373 1.00 92.57  ? 171 LEU B CA  1 
ATOM   8187  C C   . LEU E 5 174 ? 19.536  40.556  -21.829 1.00 98.47  ? 171 LEU B C   1 
ATOM   8188  O O   . LEU E 5 174 ? 18.689  41.072  -21.094 1.00 94.79  ? 171 LEU B O   1 
ATOM   8189  C CB  . LEU E 5 174 ? 19.436  38.249  -20.834 1.00 90.88  ? 171 LEU B CB  1 
ATOM   8190  C CG  . LEU E 5 174 ? 18.239  37.725  -21.618 1.00 96.81  ? 171 LEU B CG  1 
ATOM   8191  C CD1 . LEU E 5 174 ? 17.958  36.298  -21.177 1.00 91.05  ? 171 LEU B CD1 1 
ATOM   8192  C CD2 . LEU E 5 174 ? 16.995  38.619  -21.453 1.00 98.03  ? 171 LEU B CD2 1 
ATOM   8193  N N   . GLN E 5 175 ? 19.837  41.018  -23.038 1.00 104.78 ? 172 GLN B N   1 
ATOM   8194  C CA  . GLN E 5 175 ? 19.134  42.155  -23.618 1.00 110.85 ? 172 GLN B CA  1 
ATOM   8195  C C   . GLN E 5 175 ? 17.966  41.651  -24.462 1.00 107.30 ? 172 GLN B C   1 
ATOM   8196  O O   . GLN E 5 175 ? 16.846  42.161  -24.381 1.00 107.30 ? 172 GLN B O   1 
ATOM   8197  C CB  . GLN E 5 175 ? 20.089  43.016  -24.460 1.00 106.77 ? 172 GLN B CB  1 
ATOM   8198  C CG  . GLN E 5 175 ? 19.671  44.481  -24.567 1.00 104.94 ? 172 GLN B CG  1 
ATOM   8199  C CD  . GLN E 5 175 ? 19.654  44.989  -25.998 1.00 112.54 ? 172 GLN B CD  1 
ATOM   8200  O OE1 . GLN E 5 175 ? 20.490  44.604  -26.824 1.00 115.23 ? 172 GLN B OE1 1 
ATOM   8201  N NE2 . GLN E 5 175 ? 18.696  45.859  -26.300 1.00 108.47 ? 172 GLN B NE2 1 
ATOM   8202  N N   . SER E 5 176 ? 18.239  40.629  -25.260 1.00 105.05 ? 173 SER B N   1 
ATOM   8203  C CA  . SER E 5 176 ? 17.252  40.092  -26.175 1.00 107.91 ? 173 SER B CA  1 
ATOM   8204  C C   . SER E 5 176 ? 17.567  38.632  -26.401 1.00 106.11 ? 173 SER B C   1 
ATOM   8205  O O   . SER E 5 176 ? 18.387  38.292  -27.256 1.00 102.11 ? 173 SER B O   1 
ATOM   8206  C CB  . SER E 5 176 ? 17.303  40.841  -27.506 1.00 108.90 ? 173 SER B CB  1 
ATOM   8207  O OG  . SER E 5 176 ? 18.615  40.808  -28.052 1.00 103.37 ? 173 SER B OG  1 
ATOM   8208  N N   . ASP E 5 177 ? 16.928  37.775  -25.614 1.00 104.21 ? 174 ASP B N   1 
ATOM   8209  C CA  . ASP E 5 177 ? 17.097  36.336  -25.752 1.00 100.84 ? 174 ASP B CA  1 
ATOM   8210  C C   . ASP E 5 177 ? 18.565  36.004  -25.975 1.00 99.99  ? 174 ASP B C   1 
ATOM   8211  O O   . ASP E 5 177 ? 18.896  34.965  -26.544 1.00 99.29  ? 174 ASP B O   1 
ATOM   8212  C CB  . ASP E 5 177 ? 16.257  35.814  -26.916 1.00 102.42 ? 174 ASP B CB  1 
ATOM   8213  C CG  . ASP E 5 177 ? 14.844  36.374  -26.912 1.00 111.65 ? 174 ASP B CG  1 
ATOM   8214  O OD1 . ASP E 5 177 ? 14.069  36.030  -27.830 1.00 107.32 ? 174 ASP B OD1 1 
ATOM   8215  O OD2 . ASP E 5 177 ? 14.509  37.163  -25.994 1.00 114.50 ? 174 ASP B OD2 1 
ATOM   8216  N N   . LEU E 5 178 ? 19.443  36.899  -25.530 1.00 99.36  ? 175 LEU B N   1 
ATOM   8217  C CA  . LEU E 5 178 ? 20.876  36.704  -25.682 1.00 99.14  ? 175 LEU B CA  1 
ATOM   8218  C C   . LEU E 5 178 ? 21.649  37.404  -24.567 1.00 95.35  ? 175 LEU B C   1 
ATOM   8219  O O   . LEU E 5 178 ? 21.429  38.585  -24.299 1.00 95.96  ? 175 LEU B O   1 
ATOM   8220  C CB  . LEU E 5 178 ? 21.340  37.193  -27.056 1.00 97.45  ? 175 LEU B CB  1 
ATOM   8221  C CG  . LEU E 5 178 ? 21.219  36.231  -28.240 1.00 90.41  ? 175 LEU B CG  1 
ATOM   8222  C CD1 . LEU E 5 178 ? 19.804  36.134  -28.770 1.00 96.45  ? 175 LEU B CD1 1 
ATOM   8223  C CD2 . LEU E 5 178 ? 22.118  36.715  -29.330 1.00 87.40  ? 175 LEU B CD2 1 
ATOM   8224  N N   . TYR E 5 179 ? 22.543  36.666  -23.913 1.00 93.71  ? 176 TYR B N   1 
ATOM   8225  C CA  . TYR E 5 179 ? 23.346  37.228  -22.837 1.00 93.96  ? 176 TYR B CA  1 
ATOM   8226  C C   . TYR E 5 179 ? 24.582  37.807  -23.446 1.00 92.57  ? 176 TYR B C   1 
ATOM   8227  O O   . TYR E 5 179 ? 24.919  37.473  -24.578 1.00 91.70  ? 176 TYR B O   1 
ATOM   8228  C CB  . TYR E 5 179 ? 23.788  36.165  -21.834 1.00 95.71  ? 176 TYR B CB  1 
ATOM   8229  C CG  . TYR E 5 179 ? 22.671  35.467  -21.112 1.00 99.03  ? 176 TYR B CG  1 
ATOM   8230  C CD1 . TYR E 5 179 ? 21.887  36.144  -20.182 1.00 98.74  ? 176 TYR B CD1 1 
ATOM   8231  C CD2 . TYR E 5 179 ? 22.410  34.123  -21.344 1.00 97.79  ? 176 TYR B CD2 1 
ATOM   8232  C CE1 . TYR E 5 179 ? 20.863  35.507  -19.515 1.00 100.59 ? 176 TYR B CE1 1 
ATOM   8233  C CE2 . TYR E 5 179 ? 21.387  33.476  -20.684 1.00 102.81 ? 176 TYR B CE2 1 
ATOM   8234  C CZ  . TYR E 5 179 ? 20.614  34.173  -19.770 1.00 106.54 ? 176 TYR B CZ  1 
ATOM   8235  O OH  . TYR E 5 179 ? 19.591  33.530  -19.111 1.00 108.41 ? 176 TYR B OH  1 
ATOM   8236  N N   . THR E 5 180 ? 25.263  38.657  -22.679 1.00 93.76  ? 177 THR B N   1 
ATOM   8237  C CA  . THR E 5 180 ? 26.572  39.192  -23.064 1.00 92.39  ? 177 THR B CA  1 
ATOM   8238  C C   . THR E 5 180 ? 27.509  39.388  -21.847 1.00 85.55  ? 177 THR B C   1 
ATOM   8239  O O   . THR E 5 180 ? 27.359  40.322  -21.052 1.00 80.85  ? 177 THR B O   1 
ATOM   8240  C CB  . THR E 5 180 ? 26.433  40.495  -23.885 1.00 89.96  ? 177 THR B CB  1 
ATOM   8241  O OG1 . THR E 5 180 ? 25.904  41.530  -23.051 1.00 97.91  ? 177 THR B OG1 1 
ATOM   8242  C CG2 . THR E 5 180 ? 25.495  40.292  -25.067 1.00 84.70  ? 177 THR B CG2 1 
ATOM   8243  N N   . LEU E 5 181 ? 28.468  38.486  -21.701 1.00 80.25  ? 178 LEU B N   1 
ATOM   8244  C CA  . LEU E 5 181 ? 29.413  38.569  -20.604 1.00 81.15  ? 178 LEU B CA  1 
ATOM   8245  C C   . LEU E 5 181 ? 30.727  39.121  -21.120 1.00 83.31  ? 178 LEU B C   1 
ATOM   8246  O O   . LEU E 5 181 ? 31.096  38.867  -22.262 1.00 86.50  ? 178 LEU B O   1 
ATOM   8247  C CB  . LEU E 5 181 ? 29.625  37.183  -19.979 1.00 88.80  ? 178 LEU B CB  1 
ATOM   8248  C CG  . LEU E 5 181 ? 30.934  36.823  -19.250 1.00 80.86  ? 178 LEU B CG  1 
ATOM   8249  C CD1 . LEU E 5 181 ? 30.762  35.610  -18.343 1.00 73.34  ? 178 LEU B CD1 1 
ATOM   8250  C CD2 . LEU E 5 181 ? 32.060  36.585  -20.238 1.00 79.43  ? 178 LEU B CD2 1 
ATOM   8251  N N   . SER E 5 182 ? 31.425  39.855  -20.256 1.00 85.00  ? 179 SER B N   1 
ATOM   8252  C CA  . SER E 5 182 ? 32.712  40.488  -20.545 1.00 80.76  ? 179 SER B CA  1 
ATOM   8253  C C   . SER E 5 182 ? 33.642  40.279  -19.353 1.00 79.16  ? 179 SER B C   1 
ATOM   8254  O O   . SER E 5 182 ? 33.174  40.203  -18.223 1.00 81.99  ? 179 SER B O   1 
ATOM   8255  C CB  . SER E 5 182 ? 32.490  41.987  -20.738 1.00 83.36  ? 179 SER B CB  1 
ATOM   8256  O OG  . SER E 5 182 ? 31.470  42.481  -19.867 1.00 76.22  ? 179 SER B OG  1 
ATOM   8257  N N   . SER E 5 183 ? 34.949  40.194  -19.564 1.00 75.99  ? 180 SER B N   1 
ATOM   8258  C CA  . SER E 5 183 ? 35.838  40.088  -18.402 1.00 78.23  ? 180 SER B CA  1 
ATOM   8259  C C   . SER E 5 183 ? 37.052  41.006  -18.511 1.00 82.56  ? 180 SER B C   1 
ATOM   8260  O O   . SER E 5 183 ? 37.251  41.633  -19.551 1.00 85.64  ? 180 SER B O   1 
ATOM   8261  C CB  . SER E 5 183 ? 36.263  38.637  -18.158 1.00 75.45  ? 180 SER B CB  1 
ATOM   8262  O OG  . SER E 5 183 ? 37.618  38.418  -18.510 1.00 73.97  ? 180 SER B OG  1 
ATOM   8263  N N   . SER E 5 184 ? 37.846  41.093  -17.437 1.00 81.45  ? 181 SER B N   1 
ATOM   8264  C CA  . SER E 5 184 ? 39.100  41.864  -17.436 1.00 76.56  ? 181 SER B CA  1 
ATOM   8265  C C   . SER E 5 184 ? 40.221  41.221  -16.612 1.00 73.14  ? 181 SER B C   1 
ATOM   8266  O O   . SER E 5 184 ? 39.974  40.575  -15.603 1.00 74.05  ? 181 SER B O   1 
ATOM   8267  C CB  . SER E 5 184 ? 38.857  43.269  -16.902 1.00 72.28  ? 181 SER B CB  1 
ATOM   8268  O OG  . SER E 5 184 ? 39.103  43.294  -15.508 1.00 75.74  ? 181 SER B OG  1 
ATOM   8269  N N   . VAL E 5 185 ? 41.459  41.428  -17.035 1.00 71.88  ? 182 VAL B N   1 
ATOM   8270  C CA  . VAL E 5 185 ? 42.607  40.955  -16.271 1.00 77.38  ? 182 VAL B CA  1 
ATOM   8271  C C   . VAL E 5 185 ? 43.496  42.133  -15.841 1.00 79.18  ? 182 VAL B C   1 
ATOM   8272  O O   . VAL E 5 185 ? 43.176  43.279  -16.129 1.00 81.96  ? 182 VAL B O   1 
ATOM   8273  C CB  . VAL E 5 185 ? 43.457  40.028  -17.127 1.00 80.66  ? 182 VAL B CB  1 
ATOM   8274  C CG1 . VAL E 5 185 ? 44.424  40.855  -17.966 1.00 77.93  ? 182 VAL B CG1 1 
ATOM   8275  C CG2 . VAL E 5 185 ? 44.203  39.023  -16.259 1.00 80.37  ? 182 VAL B CG2 1 
ATOM   8276  N N   . THR E 5 186 ? 44.604  41.862  -15.153 1.00 75.96  ? 183 THR B N   1 
ATOM   8277  C CA  . THR E 5 186 ? 45.633  42.884  -14.951 1.00 74.70  ? 183 THR B CA  1 
ATOM   8278  C C   . THR E 5 186 ? 47.025  42.306  -14.741 1.00 78.31  ? 183 THR B C   1 
ATOM   8279  O O   . THR E 5 186 ? 47.248  41.497  -13.838 1.00 74.48  ? 183 THR B O   1 
ATOM   8280  C CB  . THR E 5 186 ? 45.304  43.871  -13.822 1.00 74.88  ? 183 THR B CB  1 
ATOM   8281  O OG1 . THR E 5 186 ? 44.187  44.676  -14.205 1.00 77.72  ? 183 THR B OG1 1 
ATOM   8282  C CG2 . THR E 5 186 ? 46.484  44.794  -13.564 1.00 73.89  ? 183 THR B CG2 1 
ATOM   8283  N N   . VAL E 5 187 ? 47.947  42.764  -15.589 1.00 84.65  ? 184 VAL B N   1 
ATOM   8284  C CA  . VAL E 5 187 ? 49.325  42.289  -15.658 1.00 86.15  ? 184 VAL B CA  1 
ATOM   8285  C C   . VAL E 5 187 ? 50.302  43.441  -15.477 1.00 91.25  ? 184 VAL B C   1 
ATOM   8286  O O   . VAL E 5 187 ? 49.895  44.570  -15.218 1.00 92.05  ? 184 VAL B O   1 
ATOM   8287  C CB  . VAL E 5 187 ? 49.620  41.713  -17.046 1.00 83.33  ? 184 VAL B CB  1 
ATOM   8288  C CG1 . VAL E 5 187 ? 49.826  40.216  -16.984 1.00 85.10  ? 184 VAL B CG1 1 
ATOM   8289  C CG2 . VAL E 5 187 ? 48.508  42.072  -18.005 1.00 82.36  ? 184 VAL B CG2 1 
ATOM   8290  N N   . THR E 5 188 ? 51.592  43.149  -15.638 1.00 97.49  ? 185 THR B N   1 
ATOM   8291  C CA  . THR E 5 188 ? 52.637  44.177  -15.696 1.00 105.18 ? 185 THR B CA  1 
ATOM   8292  C C   . THR E 5 188 ? 53.062  44.401  -17.146 1.00 109.11 ? 185 THR B C   1 
ATOM   8293  O O   . THR E 5 188 ? 53.144  43.445  -17.920 1.00 110.03 ? 185 THR B O   1 
ATOM   8294  C CB  . THR E 5 188 ? 53.892  43.746  -14.925 1.00 103.28 ? 185 THR B CB  1 
ATOM   8295  O OG1 . THR E 5 188 ? 53.515  42.883  -13.848 1.00 101.82 ? 185 THR B OG1 1 
ATOM   8296  C CG2 . THR E 5 188 ? 54.645  44.960  -14.393 1.00 99.57  ? 185 THR B CG2 1 
ATOM   8297  N N   . SER E 5 189 ? 53.343  45.650  -17.514 1.00 106.56 ? 186 SER B N   1 
ATOM   8298  C CA  . SER E 5 189 ? 53.784  45.953  -18.874 1.00 109.31 ? 186 SER B CA  1 
ATOM   8299  C C   . SER E 5 189 ? 55.024  45.148  -19.234 1.00 111.72 ? 186 SER B C   1 
ATOM   8300  O O   . SER E 5 189 ? 55.148  44.621  -20.344 1.00 111.22 ? 186 SER B O   1 
ATOM   8301  C CB  . SER E 5 189 ? 54.128  47.426  -18.998 1.00 112.19 ? 186 SER B CB  1 
ATOM   8302  O OG  . SER E 5 189 ? 55.385  47.675  -18.392 1.00 110.96 ? 186 SER B OG  1 
ATOM   8303  N N   . SER E 5 190 ? 55.950  45.083  -18.283 1.00 110.84 ? 187 SER B N   1 
ATOM   8304  C CA  . SER E 5 190 ? 57.184  44.328  -18.439 1.00 113.32 ? 187 SER B CA  1 
ATOM   8305  C C   . SER E 5 190 ? 56.893  42.942  -18.997 1.00 116.37 ? 187 SER B C   1 
ATOM   8306  O O   . SER E 5 190 ? 57.736  42.324  -19.655 1.00 119.00 ? 187 SER B O   1 
ATOM   8307  C CB  . SER E 5 190 ? 57.883  44.201  -17.083 1.00 111.72 ? 187 SER B CB  1 
ATOM   8308  O OG  . SER E 5 190 ? 57.005  43.674  -16.099 1.00 105.52 ? 187 SER B OG  1 
ATOM   8309  N N   . THR E 5 191 ? 55.681  42.466  -18.740 1.00 112.92 ? 188 THR B N   1 
ATOM   8310  C CA  . THR E 5 191 ? 55.338  41.081  -19.001 1.00 111.99 ? 188 THR B CA  1 
ATOM   8311  C C   . THR E 5 191 ? 54.522  40.897  -20.271 1.00 111.32 ? 188 THR B C   1 
ATOM   8312  O O   . THR E 5 191 ? 54.959  40.222  -21.199 1.00 113.59 ? 188 THR B O   1 
ATOM   8313  C CB  . THR E 5 191 ? 54.560  40.488  -17.819 1.00 110.16 ? 188 THR B CB  1 
ATOM   8314  O OG1 . THR E 5 191 ? 53.210  40.969  -17.840 1.00 105.98 ? 188 THR B OG1 1 
ATOM   8315  C CG2 . THR E 5 191 ? 55.218  40.887  -16.505 1.00 110.67 ? 188 THR B CG2 1 
ATOM   8316  N N   . TRP E 5 192 ? 53.337  41.495  -20.313 1.00 111.66 ? 189 TRP B N   1 
ATOM   8317  C CA  . TRP E 5 192 ? 52.395  41.210  -21.394 1.00 115.82 ? 189 TRP B CA  1 
ATOM   8318  C C   . TRP E 5 192 ? 52.916  41.469  -22.805 1.00 118.25 ? 189 TRP B C   1 
ATOM   8319  O O   . TRP E 5 192 ? 53.101  40.529  -23.582 1.00 119.77 ? 189 TRP B O   1 
ATOM   8320  C CB  . TRP E 5 192 ? 51.072  41.960  -21.236 1.00 111.23 ? 189 TRP B CB  1 
ATOM   8321  C CG  . TRP E 5 192 ? 50.369  42.016  -22.557 1.00 108.01 ? 189 TRP B CG  1 
ATOM   8322  C CD1 . TRP E 5 192 ? 50.002  40.952  -23.328 1.00 107.35 ? 189 TRP B CD1 1 
ATOM   8323  C CD2 . TRP E 5 192 ? 49.994  43.186  -23.287 1.00 107.40 ? 189 TRP B CD2 1 
ATOM   8324  N NE1 . TRP E 5 192 ? 49.401  41.387  -24.483 1.00 105.53 ? 189 TRP B NE1 1 
ATOM   8325  C CE2 . TRP E 5 192 ? 49.384  42.755  -24.482 1.00 107.12 ? 189 TRP B CE2 1 
ATOM   8326  C CE3 . TRP E 5 192 ? 50.098  44.555  -23.040 1.00 106.83 ? 189 TRP B CE3 1 
ATOM   8327  C CZ2 . TRP E 5 192 ? 48.886  43.644  -25.426 1.00 110.21 ? 189 TRP B CZ2 1 
ATOM   8328  C CZ3 . TRP E 5 192 ? 49.601  45.434  -23.979 1.00 106.87 ? 189 TRP B CZ3 1 
ATOM   8329  C CH2 . TRP E 5 192 ? 48.998  44.976  -25.155 1.00 107.70 ? 189 TRP B CH2 1 
ATOM   8330  N N   . PRO E 5 193 ? 53.119  42.750  -23.155 1.00 114.73 ? 190 PRO B N   1 
ATOM   8331  C CA  . PRO E 5 193 ? 53.456  43.013  -24.552 1.00 110.32 ? 190 PRO B CA  1 
ATOM   8332  C C   . PRO E 5 193 ? 54.569  42.073  -25.012 1.00 114.88 ? 190 PRO B C   1 
ATOM   8333  O O   . PRO E 5 193 ? 54.427  41.458  -26.069 1.00 116.86 ? 190 PRO B O   1 
ATOM   8334  C CB  . PRO E 5 193 ? 53.934  44.464  -24.522 1.00 119.20 ? 190 PRO B CB  1 
ATOM   8335  C CG  . PRO E 5 193 ? 53.274  45.063  -23.308 1.00 112.40 ? 190 PRO B CG  1 
ATOM   8336  C CD  . PRO E 5 193 ? 53.236  43.956  -22.313 1.00 110.87 ? 190 PRO B CD  1 
ATOM   8337  N N   . SER E 5 194 ? 55.629  41.938  -24.209 1.00 115.21 ? 191 SER B N   1 
ATOM   8338  C CA  . SER E 5 194 ? 56.781  41.092  -24.550 1.00 113.58 ? 191 SER B CA  1 
ATOM   8339  C C   . SER E 5 194 ? 56.443  39.604  -24.674 1.00 116.57 ? 191 SER B C   1 
ATOM   8340  O O   . SER E 5 194 ? 56.785  38.968  -25.672 1.00 118.15 ? 191 SER B O   1 
ATOM   8341  C CB  . SER E 5 194 ? 57.939  41.299  -23.561 1.00 108.63 ? 191 SER B CB  1 
ATOM   8342  O OG  . SER E 5 194 ? 57.562  41.019  -22.226 1.00 108.99 ? 191 SER B OG  1 
ATOM   8343  N N   . GLN E 5 195 ? 55.788  39.050  -23.657 1.00 117.04 ? 192 GLN B N   1 
ATOM   8344  C CA  . GLN E 5 195 ? 55.335  37.664  -23.701 1.00 114.99 ? 192 GLN B CA  1 
ATOM   8345  C C   . GLN E 5 195 ? 53.916  37.596  -24.239 1.00 119.03 ? 192 GLN B C   1 
ATOM   8346  O O   . GLN E 5 195 ? 53.505  38.447  -25.034 1.00 117.05 ? 192 GLN B O   1 
ATOM   8347  C CB  . GLN E 5 195 ? 55.402  37.020  -22.320 1.00 111.74 ? 192 GLN B CB  1 
ATOM   8348  C CG  . GLN E 5 195 ? 56.807  36.942  -21.760 1.00 123.10 ? 192 GLN B CG  1 
ATOM   8349  C CD  . GLN E 5 195 ? 56.828  36.645  -20.271 1.00 127.91 ? 192 GLN B CD  1 
ATOM   8350  O OE1 . GLN E 5 195 ? 55.879  36.077  -19.727 1.00 127.69 ? 192 GLN B OE1 1 
ATOM   8351  N NE2 . GLN E 5 195 ? 57.915  37.033  -19.602 1.00 126.73 ? 192 GLN B NE2 1 
ATOM   8352  N N   . SER E 5 196 ? 53.164  36.590  -23.806 1.00 116.73 ? 193 SER B N   1 
ATOM   8353  C CA  . SER E 5 196 ? 51.834  36.380  -24.355 1.00 110.04 ? 193 SER B CA  1 
ATOM   8354  C C   . SER E 5 196 ? 50.910  35.647  -23.419 1.00 105.88 ? 193 SER B C   1 
ATOM   8355  O O   . SER E 5 196 ? 51.340  34.826  -22.618 1.00 105.24 ? 193 SER B O   1 
ATOM   8356  C CB  . SER E 5 196 ? 51.911  35.599  -25.661 1.00 112.65 ? 193 SER B CB  1 
ATOM   8357  O OG  . SER E 5 196 ? 50.614  35.187  -26.054 1.00 113.09 ? 193 SER B OG  1 
ATOM   8358  N N   . ILE E 5 197 ? 49.624  35.936  -23.556 1.00 105.64 ? 194 ILE B N   1 
ATOM   8359  C CA  . ILE E 5 197 ? 48.602  35.298  -22.750 1.00 108.24 ? 194 ILE B CA  1 
ATOM   8360  C C   . ILE E 5 197 ? 47.346  35.152  -23.585 1.00 107.42 ? 194 ILE B C   1 
ATOM   8361  O O   . ILE E 5 197 ? 47.256  35.731  -24.663 1.00 110.41 ? 194 ILE B O   1 
ATOM   8362  C CB  . ILE E 5 197 ? 48.298  36.127  -21.507 1.00 109.02 ? 194 ILE B CB  1 
ATOM   8363  C CG1 . ILE E 5 197 ? 48.079  37.587  -21.896 1.00 99.81  ? 194 ILE B CG1 1 
ATOM   8364  C CG2 . ILE E 5 197 ? 49.447  36.017  -20.505 1.00 110.69 ? 194 ILE B CG2 1 
ATOM   8365  C CD1 . ILE E 5 197 ? 46.803  37.849  -22.636 1.00 99.58  ? 194 ILE B CD1 1 
ATOM   8366  N N   . THR E 5 198 ? 46.368  34.401  -23.089 1.00 106.21 ? 195 THR B N   1 
ATOM   8367  C CA  . THR E 5 198 ? 45.197  34.104  -23.908 1.00 106.31 ? 195 THR B CA  1 
ATOM   8368  C C   . THR E 5 198 ? 43.878  33.851  -23.160 1.00 108.81 ? 195 THR B C   1 
ATOM   8369  O O   . THR E 5 198 ? 43.852  33.291  -22.052 1.00 104.55 ? 195 THR B O   1 
ATOM   8370  C CB  . THR E 5 198 ? 45.477  32.901  -24.820 1.00 108.06 ? 195 THR B CB  1 
ATOM   8371  O OG1 . THR E 5 198 ? 46.762  33.057  -25.435 1.00 109.68 ? 195 THR B OG1 1 
ATOM   8372  C CG2 . THR E 5 198 ? 44.400  32.773  -25.888 1.00 108.21 ? 195 THR B CG2 1 
ATOM   8373  N N   . CYS E 5 199 ? 42.788  34.273  -23.798 1.00 105.10 ? 196 CYS B N   1 
ATOM   8374  C CA  . CYS E 5 199 ? 41.436  33.989  -23.341 1.00 99.55  ? 196 CYS B CA  1 
ATOM   8375  C C   . CYS E 5 199 ? 41.176  32.493  -23.397 1.00 105.74 ? 196 CYS B C   1 
ATOM   8376  O O   . CYS E 5 199 ? 41.900  31.764  -24.070 1.00 108.05 ? 196 CYS B O   1 
ATOM   8377  C CB  . CYS E 5 199 ? 40.439  34.694  -24.245 1.00 96.18  ? 196 CYS B CB  1 
ATOM   8378  S SG  . CYS E 5 199 ? 39.529  35.992  -23.439 1.00 92.90  ? 196 CYS B SG  1 
ATOM   8379  N N   . ASN E 5 200 ? 40.138  32.034  -22.701 1.00 104.93 ? 197 ASN B N   1 
ATOM   8380  C CA  . ASN E 5 200 ? 39.818  30.611  -22.669 1.00 99.18  ? 197 ASN B CA  1 
ATOM   8381  C C   . ASN E 5 200 ? 38.349  30.369  -22.477 1.00 92.55  ? 197 ASN B C   1 
ATOM   8382  O O   . ASN E 5 200 ? 37.953  29.819  -21.456 1.00 96.02  ? 197 ASN B O   1 
ATOM   8383  C CB  . ASN E 5 200 ? 40.549  29.918  -21.522 1.00 101.71 ? 197 ASN B CB  1 
ATOM   8384  C CG  . ASN E 5 200 ? 41.963  29.539  -21.876 1.00 104.48 ? 197 ASN B CG  1 
ATOM   8385  O OD1 . ASN E 5 200 ? 42.269  28.361  -22.049 1.00 108.98 ? 197 ASN B OD1 1 
ATOM   8386  N ND2 . ASN E 5 200 ? 42.841  30.533  -21.971 1.00 103.21 ? 197 ASN B ND2 1 
ATOM   8387  N N   . VAL E 5 201 ? 37.533  30.763  -23.441 1.00 88.00  ? 198 VAL B N   1 
ATOM   8388  C CA  . VAL E 5 201 ? 36.103  30.603  -23.269 1.00 84.50  ? 198 VAL B CA  1 
ATOM   8389  C C   . VAL E 5 201 ? 35.734  29.134  -23.387 1.00 88.54  ? 198 VAL B C   1 
ATOM   8390  O O   . VAL E 5 201 ? 36.548  28.321  -23.807 1.00 90.82  ? 198 VAL B O   1 
ATOM   8391  C CB  . VAL E 5 201 ? 35.324  31.465  -24.250 1.00 81.22  ? 198 VAL B CB  1 
ATOM   8392  C CG1 . VAL E 5 201 ? 33.835  31.356  -23.993 1.00 84.33  ? 198 VAL B CG1 1 
ATOM   8393  C CG2 . VAL E 5 201 ? 35.774  32.901  -24.108 1.00 84.80  ? 198 VAL B CG2 1 
ATOM   8394  N N   . ALA E 5 202 ? 34.523  28.804  -22.952 1.00 91.64  ? 199 ALA B N   1 
ATOM   8395  C CA  . ALA E 5 202 ? 33.956  27.465  -23.055 1.00 87.71  ? 199 ALA B CA  1 
ATOM   8396  C C   . ALA E 5 202 ? 32.453  27.599  -22.830 1.00 91.26  ? 199 ALA B C   1 
ATOM   8397  O O   . ALA E 5 202 ? 31.994  28.469  -22.083 1.00 88.73  ? 199 ALA B O   1 
ATOM   8398  C CB  . ALA E 5 202 ? 34.569  26.538  -22.038 1.00 83.94  ? 199 ALA B CB  1 
ATOM   8399  N N   . HIS E 5 203 ? 31.687  26.747  -23.495 1.00 91.65  ? 200 HIS B N   1 
ATOM   8400  C CA  . HIS E 5 203 ? 30.238  26.877  -23.522 1.00 88.03  ? 200 HIS B CA  1 
ATOM   8401  C C   . HIS E 5 203 ? 29.692  25.486  -23.768 1.00 92.19  ? 200 HIS B C   1 
ATOM   8402  O O   . HIS E 5 203 ? 29.489  25.086  -24.911 1.00 94.88  ? 200 HIS B O   1 
ATOM   8403  C CB  . HIS E 5 203 ? 29.833  27.831  -24.648 1.00 84.71  ? 200 HIS B CB  1 
ATOM   8404  C CG  . HIS E 5 203 ? 28.362  28.094  -24.750 1.00 81.44  ? 200 HIS B CG  1 
ATOM   8405  N ND1 . HIS E 5 203 ? 27.611  27.692  -25.834 1.00 83.70  ? 200 HIS B ND1 1 
ATOM   8406  C CD2 . HIS E 5 203 ? 27.513  28.763  -23.935 1.00 82.80  ? 200 HIS B CD2 1 
ATOM   8407  C CE1 . HIS E 5 203 ? 26.362  28.090  -25.676 1.00 83.95  ? 200 HIS B CE1 1 
ATOM   8408  N NE2 . HIS E 5 203 ? 26.276  28.742  -24.531 1.00 81.13  ? 200 HIS B NE2 1 
ATOM   8409  N N   . PRO E 5 204 ? 29.470  24.737  -22.682 1.00 90.93  ? 201 PRO B N   1 
ATOM   8410  C CA  . PRO E 5 204 ? 29.064  23.329  -22.661 1.00 92.05  ? 201 PRO B CA  1 
ATOM   8411  C C   . PRO E 5 204 ? 27.960  22.963  -23.658 1.00 88.81  ? 201 PRO B C   1 
ATOM   8412  O O   . PRO E 5 204 ? 28.097  21.943  -24.326 1.00 89.88  ? 201 PRO B O   1 
ATOM   8413  C CB  . PRO E 5 204 ? 28.583  23.136  -21.221 1.00 96.74  ? 201 PRO B CB  1 
ATOM   8414  C CG  . PRO E 5 204 ? 29.426  24.086  -20.438 1.00 100.15 ? 201 PRO B CG  1 
ATOM   8415  C CD  . PRO E 5 204 ? 29.608  25.290  -21.323 1.00 94.31  ? 201 PRO B CD  1 
ATOM   8416  N N   . ALA E 5 205 ? 26.899  23.761  -23.749 1.00 86.01  ? 202 ALA B N   1 
ATOM   8417  C CA  . ALA E 5 205 ? 25.802  23.469  -24.663 1.00 84.68  ? 202 ALA B CA  1 
ATOM   8418  C C   . ALA E 5 205 ? 26.342  22.978  -26.001 1.00 89.45  ? 202 ALA B C   1 
ATOM   8419  O O   . ALA E 5 205 ? 26.812  21.844  -26.113 1.00 94.71  ? 202 ALA B O   1 
ATOM   8420  C CB  . ALA E 5 205 ? 24.936  24.676  -24.846 1.00 81.74  ? 202 ALA B CB  1 
ATOM   8421  N N   . SER E 5 206 ? 26.274  23.806  -27.031 1.00 88.07  ? 203 SER B N   1 
ATOM   8422  C CA  . SER E 5 206 ? 26.992  23.455  -28.241 1.00 91.39  ? 203 SER B CA  1 
ATOM   8423  C C   . SER E 5 206 ? 28.398  23.087  -27.772 1.00 91.93  ? 203 SER B C   1 
ATOM   8424  O O   . SER E 5 206 ? 28.869  23.621  -26.777 1.00 94.79  ? 203 SER B O   1 
ATOM   8425  C CB  . SER E 5 206 ? 27.030  24.641  -29.201 1.00 90.54  ? 203 SER B CB  1 
ATOM   8426  O OG  . SER E 5 206 ? 27.278  25.848  -28.499 1.00 87.86  ? 203 SER B OG  1 
ATOM   8427  N N   . SER E 5 207 ? 29.060  22.161  -28.451 1.00 87.15  ? 204 SER B N   1 
ATOM   8428  C CA  . SER E 5 207 ? 30.438  21.831  -28.110 1.00 88.60  ? 204 SER B CA  1 
ATOM   8429  C C   . SER E 5 207 ? 31.390  23.020  -28.344 1.00 94.26  ? 204 SER B C   1 
ATOM   8430  O O   . SER E 5 207 ? 32.438  22.865  -28.969 1.00 100.23 ? 204 SER B O   1 
ATOM   8431  C CB  . SER E 5 207 ? 30.891  20.616  -28.929 1.00 90.49  ? 204 SER B CB  1 
ATOM   8432  O OG  . SER E 5 207 ? 32.230  20.247  -28.645 1.00 94.01  ? 204 SER B OG  1 
ATOM   8433  N N   . THR E 5 208 ? 31.033  24.199  -27.832 1.00 90.78  ? 205 THR B N   1 
ATOM   8434  C CA  . THR E 5 208 ? 31.805  25.430  -28.059 1.00 89.90  ? 205 THR B CA  1 
ATOM   8435  C C   . THR E 5 208 ? 32.955  25.622  -27.076 1.00 92.35  ? 205 THR B C   1 
ATOM   8436  O O   . THR E 5 208 ? 32.767  26.159  -25.989 1.00 93.06  ? 205 THR B O   1 
ATOM   8437  C CB  . THR E 5 208 ? 30.920  26.680  -27.918 1.00 88.00  ? 205 THR B CB  1 
ATOM   8438  O OG1 . THR E 5 208 ? 29.704  26.499  -28.646 1.00 89.29  ? 205 THR B OG1 1 
ATOM   8439  C CG2 . THR E 5 208 ? 31.645  27.914  -28.416 1.00 81.78  ? 205 THR B CG2 1 
ATOM   8440  N N   . LYS E 5 209 ? 34.156  25.215  -27.455 1.00 93.57  ? 206 LYS B N   1 
ATOM   8441  C CA  . LYS E 5 209 ? 35.298  25.400  -26.566 1.00 94.67  ? 206 LYS B CA  1 
ATOM   8442  C C   . LYS E 5 209 ? 36.398  26.221  -27.243 1.00 100.01 ? 206 LYS B C   1 
ATOM   8443  O O   . LYS E 5 209 ? 37.503  25.723  -27.474 1.00 105.84 ? 206 LYS B O   1 
ATOM   8444  C CB  . LYS E 5 209 ? 35.867  24.055  -26.071 1.00 100.31 ? 206 LYS B CB  1 
ATOM   8445  C CG  . LYS E 5 209 ? 34.952  22.822  -26.204 1.00 102.55 ? 206 LYS B CG  1 
ATOM   8446  C CD  . LYS E 5 209 ? 33.793  22.841  -25.211 1.00 104.35 ? 206 LYS B CD  1 
ATOM   8447  C CE  . LYS E 5 209 ? 32.762  21.764  -25.535 1.00 96.03  ? 206 LYS B CE  1 
ATOM   8448  N NZ  . LYS E 5 209 ? 31.471  22.008  -24.831 1.00 90.19  ? 206 LYS B NZ  1 
ATOM   8449  N N   . VAL E 5 210 ? 36.091  27.480  -27.551 1.00 98.63  ? 207 VAL B N   1 
ATOM   8450  C CA  . VAL E 5 210 ? 37.050  28.398  -28.178 1.00 99.11  ? 207 VAL B CA  1 
ATOM   8451  C C   . VAL E 5 210 ? 38.014  29.111  -27.197 1.00 98.52  ? 207 VAL B C   1 
ATOM   8452  O O   . VAL E 5 210 ? 37.699  29.327  -26.023 1.00 97.16  ? 207 VAL B O   1 
ATOM   8453  C CB  . VAL E 5 210 ? 36.319  29.462  -29.047 1.00 91.76  ? 207 VAL B CB  1 
ATOM   8454  C CG1 . VAL E 5 210 ? 34.814  29.391  -28.841 1.00 94.97  ? 207 VAL B CG1 1 
ATOM   8455  C CG2 . VAL E 5 210 ? 36.822  30.856  -28.727 1.00 92.81  ? 207 VAL B CG2 1 
ATOM   8456  N N   . ASP E 5 211 ? 39.196  29.470  -27.683 1.00 98.81  ? 208 ASP B N   1 
ATOM   8457  C CA  . ASP E 5 211 ? 40.064  30.358  -26.921 1.00 102.99 ? 208 ASP B CA  1 
ATOM   8458  C C   . ASP E 5 211 ? 41.007  31.186  -27.808 1.00 106.04 ? 208 ASP B C   1 
ATOM   8459  O O   . ASP E 5 211 ? 41.759  30.647  -28.617 1.00 107.35 ? 208 ASP B O   1 
ATOM   8460  C CB  . ASP E 5 211 ? 40.788  29.613  -25.784 1.00 104.52 ? 208 ASP B CB  1 
ATOM   8461  C CG  . ASP E 5 211 ? 41.948  28.766  -26.262 1.00 104.78 ? 208 ASP B CG  1 
ATOM   8462  O OD1 . ASP E 5 211 ? 42.037  27.597  -25.827 1.00 106.69 ? 208 ASP B OD1 1 
ATOM   8463  O OD2 . ASP E 5 211 ? 42.784  29.269  -27.042 1.00 102.57 ? 208 ASP B OD2 1 
ATOM   8464  N N   . LYS E 5 212 ? 40.942  32.506  -27.644 1.00 108.81 ? 209 LYS B N   1 
ATOM   8465  C CA  . LYS E 5 212 ? 41.627  33.444  -28.526 1.00 108.96 ? 209 LYS B CA  1 
ATOM   8466  C C   . LYS E 5 212 ? 42.396  34.533  -27.763 1.00 109.20 ? 209 LYS B C   1 
ATOM   8467  O O   . LYS E 5 212 ? 41.898  35.084  -26.782 1.00 106.20 ? 209 LYS B O   1 
ATOM   8468  C CB  . LYS E 5 212 ? 40.609  34.077  -29.473 1.00 107.24 ? 209 LYS B CB  1 
ATOM   8469  C CG  . LYS E 5 212 ? 41.214  34.820  -30.641 1.00 107.71 ? 209 LYS B CG  1 
ATOM   8470  C CD  . LYS E 5 212 ? 40.135  35.543  -31.410 1.00 107.15 ? 209 LYS B CD  1 
ATOM   8471  C CE  . LYS E 5 212 ? 40.715  36.427  -32.488 1.00 107.52 ? 209 LYS B CE  1 
ATOM   8472  N NZ  . LYS E 5 212 ? 39.637  37.273  -33.056 1.00 108.11 ? 209 LYS B NZ  1 
ATOM   8473  N N   . LYS E 5 213 ? 43.601  34.845  -28.243 1.00 114.61 ? 210 LYS B N   1 
ATOM   8474  C CA  . LYS E 5 213 ? 44.544  35.719  -27.537 1.00 114.74 ? 210 LYS B CA  1 
ATOM   8475  C C   . LYS E 5 213 ? 44.645  37.121  -28.109 1.00 114.80 ? 210 LYS B C   1 
ATOM   8476  O O   . LYS E 5 213 ? 44.627  37.306  -29.323 1.00 113.56 ? 210 LYS B O   1 
ATOM   8477  C CB  . LYS E 5 213 ? 45.949  35.108  -27.522 1.00 117.64 ? 210 LYS B CB  1 
ATOM   8478  C CG  . LYS E 5 213 ? 46.628  35.008  -28.879 1.00 113.70 ? 210 LYS B CG  1 
ATOM   8479  C CD  . LYS E 5 213 ? 48.074  34.578  -28.704 1.00 113.92 ? 210 LYS B CD  1 
ATOM   8480  C CE  . LYS E 5 213 ? 48.612  33.913  -29.954 1.00 125.15 ? 210 LYS B CE  1 
ATOM   8481  N NZ  . LYS E 5 213 ? 47.970  32.589  -30.191 1.00 130.71 ? 210 LYS B NZ  1 
ATOM   8482  N N   . ILE E 5 214 ? 44.789  38.100  -27.217 1.00 121.60 ? 211 ILE B N   1 
ATOM   8483  C CA  . ILE E 5 214 ? 44.862  39.504  -27.608 1.00 119.15 ? 211 ILE B CA  1 
ATOM   8484  C C   . ILE E 5 214 ? 46.262  39.855  -28.091 1.00 119.20 ? 211 ILE B C   1 
ATOM   8485  O O   . ILE E 5 214 ? 47.215  39.103  -27.880 1.00 115.96 ? 211 ILE B O   1 
ATOM   8486  C CB  . ILE E 5 214 ? 44.462  40.462  -26.451 1.00 108.80 ? 211 ILE B CB  1 
ATOM   8487  C CG1 . ILE E 5 214 ? 45.638  40.682  -25.501 1.00 108.95 ? 211 ILE B CG1 1 
ATOM   8488  C CG2 . ILE E 5 214 ? 43.230  39.957  -25.707 1.00 104.86 ? 211 ILE B CG2 1 
ATOM   8489  C CD1 . ILE E 5 214 ? 46.418  41.939  -25.793 1.00 110.51 ? 211 ILE B CD1 1 
ATOM   8490  N N   . VAL E 5 215 ? 46.368  41.015  -28.729 1.00 122.37 ? 212 VAL B N   1 
ATOM   8491  C CA  . VAL E 5 215 ? 47.605  41.475  -29.342 1.00 120.78 ? 212 VAL B CA  1 
ATOM   8492  C C   . VAL E 5 215 ? 47.513  42.992  -29.565 1.00 121.98 ? 212 VAL B C   1 
ATOM   8493  O O   . VAL E 5 215 ? 46.418  43.533  -29.744 1.00 120.46 ? 212 VAL B O   1 
ATOM   8494  C CB  . VAL E 5 215 ? 47.859  40.729  -30.678 1.00 114.03 ? 212 VAL B CB  1 
ATOM   8495  C CG1 . VAL E 5 215 ? 48.637  41.595  -31.649 1.00 119.31 ? 212 VAL B CG1 1 
ATOM   8496  C CG2 . VAL E 5 215 ? 48.559  39.394  -30.436 1.00 104.12 ? 212 VAL B CG2 1 
ATOM   8497  N N   . PRO E 5 216 ? 48.661  43.686  -29.529 1.00 120.08 ? 213 PRO B N   1 
ATOM   8498  C CA  . PRO E 5 216 ? 48.746  45.141  -29.733 1.00 123.38 ? 213 PRO B CA  1 
ATOM   8499  C C   . PRO E 5 216 ? 48.056  45.664  -31.011 1.00 123.72 ? 213 PRO B C   1 
ATOM   8500  O O   . PRO E 5 216 ? 47.278  44.940  -31.630 1.00 122.61 ? 213 PRO B O   1 
ATOM   8501  C CB  . PRO E 5 216 ? 50.255  45.379  -29.800 1.00 124.05 ? 213 PRO B CB  1 
ATOM   8502  C CG  . PRO E 5 216 ? 50.830  44.297  -28.934 1.00 112.70 ? 213 PRO B CG  1 
ATOM   8503  C CD  . PRO E 5 216 ? 49.963  43.102  -29.154 1.00 112.15 ? 213 PRO B CD  1 
ATOM   8504  N N   . ARG E 5 217 ? 48.338  46.913  -31.386 1.00 128.38 ? 214 ARG B N   1 
ATOM   8505  C CA  . ARG E 5 217 ? 47.768  47.520  -32.597 1.00 133.39 ? 214 ARG B CA  1 
ATOM   8506  C C   . ARG E 5 217 ? 48.844  47.992  -33.596 1.00 139.93 ? 214 ARG B C   1 
ATOM   8507  O O   . ARG E 5 217 ? 48.832  47.593  -34.764 1.00 140.70 ? 214 ARG B O   1 
ATOM   8508  C CB  . ARG E 5 217 ? 46.828  48.684  -32.237 1.00 130.44 ? 214 ARG B CB  1 
ATOM   8509  C CG  . ARG E 5 217 ? 45.586  48.286  -31.430 1.00 125.89 ? 214 ARG B CG  1 
ATOM   8510  C CD  . ARG E 5 217 ? 44.857  49.506  -30.842 1.00 121.33 ? 214 ARG B CD  1 
ATOM   8511  N NE  . ARG E 5 217 ? 43.851  50.069  -31.744 1.00 120.86 ? 214 ARG B NE  1 
ATOM   8512  C CZ  . ARG E 5 217 ? 42.570  49.705  -31.762 1.00 110.83 ? 214 ARG B CZ  1 
ATOM   8513  N NH1 . ARG E 5 217 ? 42.131  48.773  -30.928 1.00 102.06 ? 214 ARG B NH1 1 
ATOM   8514  N NH2 . ARG E 5 217 ? 41.726  50.267  -32.619 1.00 107.01 ? 214 ARG B NH2 1 
ATOM   8515  N N   . ASP E 5 218 ? 49.758  48.844  -33.127 1.00 137.95 ? 215 ASP B N   1 
ATOM   8516  C CA  . ASP E 5 218 ? 50.860  49.400  -33.938 1.00 142.58 ? 215 ASP B CA  1 
ATOM   8517  C C   . ASP E 5 218 ? 50.441  50.027  -35.281 1.00 148.76 ? 215 ASP B C   1 
ATOM   8518  O O   . ASP E 5 218 ? 51.294  50.337  -36.118 1.00 149.16 ? 215 ASP B O   1 
ATOM   8519  C CB  . ASP E 5 218 ? 51.980  48.363  -34.154 1.00 143.95 ? 215 ASP B CB  1 
ATOM   8520  C CG  . ASP E 5 218 ? 53.254  48.978  -34.741 1.00 133.72 ? 215 ASP B CG  1 
ATOM   8521  O OD1 . ASP E 5 218 ? 53.498  50.175  -34.502 1.00 126.20 ? 215 ASP B OD1 1 
ATOM   8522  O OD2 . ASP E 5 218 ? 54.014  48.266  -35.437 1.00 128.14 ? 215 ASP B OD2 1 
ATOM   8523  N N   . CYS E 5 219 ? 49.136  50.210  -35.482 1.00 153.40 ? 216 CYS B N   1 
ATOM   8524  C CA  . CYS E 5 219 ? 48.606  50.877  -36.680 1.00 158.86 ? 216 CYS B CA  1 
ATOM   8525  C C   . CYS E 5 219 ? 48.814  50.071  -37.971 1.00 156.80 ? 216 CYS B C   1 
ATOM   8526  O O   . CYS E 5 219 ? 48.293  48.959  -38.118 1.00 146.88 ? 216 CYS B O   1 
ATOM   8527  C CB  . CYS E 5 219 ? 49.198  52.291  -36.822 1.00 162.29 ? 216 CYS B CB  1 
ATOM   8528  S SG  . CYS E 5 219 ? 47.983  53.646  -36.922 1.00 160.56 ? 216 CYS B SG  1 
ATOM   8529  O OXT . CYS E 5 219 ? 49.499  50.517  -38.900 1.00 160.32 ? 216 CYS B OXT 1 
ATOM   8530  N N   . ILE F 1 1   ? 32.287  69.825  -9.423  1.00 111.79 ? 16  ILE Q N   1 
ATOM   8531  C CA  . ILE F 1 1   ? 31.794  70.373  -8.164  1.00 119.26 ? 16  ILE Q CA  1 
ATOM   8532  C C   . ILE F 1 1   ? 32.784  71.356  -7.531  1.00 122.30 ? 16  ILE Q C   1 
ATOM   8533  O O   . ILE F 1 1   ? 33.009  71.315  -6.321  1.00 122.57 ? 16  ILE Q O   1 
ATOM   8534  C CB  . ILE F 1 1   ? 31.438  69.253  -7.136  1.00 114.81 ? 16  ILE Q CB  1 
ATOM   8535  C CG1 . ILE F 1 1   ? 30.684  69.832  -5.930  1.00 113.78 ? 16  ILE Q CG1 1 
ATOM   8536  C CG2 . ILE F 1 1   ? 32.687  68.494  -6.700  1.00 105.46 ? 16  ILE Q CG2 1 
ATOM   8537  C CD1 . ILE F 1 1   ? 30.592  68.905  -4.734  1.00 107.23 ? 16  ILE Q CD1 1 
ATOM   8538  N N   . VAL F 1 2   ? 33.384  72.234  -8.337  1.00 121.39 ? 17  VAL Q N   1 
ATOM   8539  C CA  . VAL F 1 2   ? 34.136  73.358  -7.768  1.00 120.60 ? 17  VAL Q CA  1 
ATOM   8540  C C   . VAL F 1 2   ? 33.157  74.512  -7.580  1.00 125.15 ? 17  VAL Q C   1 
ATOM   8541  O O   . VAL F 1 2   ? 33.565  75.627  -7.260  1.00 124.42 ? 17  VAL Q O   1 
ATOM   8542  C CB  . VAL F 1 2   ? 35.384  73.797  -8.613  1.00 110.74 ? 17  VAL Q CB  1 
ATOM   8543  C CG1 . VAL F 1 2   ? 34.963  74.488  -9.902  1.00 108.84 ? 17  VAL Q CG1 1 
ATOM   8544  C CG2 . VAL F 1 2   ? 36.313  74.709  -7.797  1.00 98.56  ? 17  VAL Q CG2 1 
ATOM   8545  N N   . GLY F 1 3   ? 31.866  74.229  -7.784  1.00 123.99 ? 18  GLY Q N   1 
ATOM   8546  C CA  . GLY F 1 3   ? 30.802  75.189  -7.531  1.00 126.63 ? 18  GLY Q CA  1 
ATOM   8547  C C   . GLY F 1 3   ? 31.013  75.912  -6.212  1.00 132.13 ? 18  GLY Q C   1 
ATOM   8548  O O   . GLY F 1 3   ? 31.219  75.274  -5.175  1.00 132.40 ? 18  GLY Q O   1 
ATOM   8549  N N   . GLY F 1 4   ? 30.959  77.243  -6.247  1.00 131.71 ? 19  GLY Q N   1 
ATOM   8550  C CA  . GLY F 1 4   ? 31.369  78.046  -5.109  1.00 126.33 ? 19  GLY Q CA  1 
ATOM   8551  C C   . GLY F 1 4   ? 32.816  77.722  -4.808  1.00 120.39 ? 19  GLY Q C   1 
ATOM   8552  O O   . GLY F 1 4   ? 33.187  77.414  -3.675  1.00 119.10 ? 19  GLY Q O   1 
ATOM   8553  N N   . TRP F 1 5   ? 33.616  77.776  -5.865  1.00 115.54 ? 20  TRP Q N   1 
ATOM   8554  C CA  . TRP F 1 5   ? 35.040  77.473  -5.853  1.00 109.68 ? 20  TRP Q CA  1 
ATOM   8555  C C   . TRP F 1 5   ? 35.732  77.800  -4.553  1.00 102.38 ? 20  TRP Q C   1 
ATOM   8556  O O   . TRP F 1 5   ? 35.367  78.736  -3.851  1.00 98.04  ? 20  TRP Q O   1 
ATOM   8557  C CB  . TRP F 1 5   ? 35.688  78.265  -6.966  1.00 108.29 ? 20  TRP Q CB  1 
ATOM   8558  C CG  . TRP F 1 5   ? 34.707  79.211  -7.556  1.00 114.26 ? 20  TRP Q CG  1 
ATOM   8559  C CD1 . TRP F 1 5   ? 34.348  80.445  -7.076  1.00 112.94 ? 20  TRP Q CD1 1 
ATOM   8560  C CD2 . TRP F 1 5   ? 33.917  78.991  -8.725  1.00 120.03 ? 20  TRP Q CD2 1 
ATOM   8561  N NE1 . TRP F 1 5   ? 33.393  81.009  -7.890  1.00 115.56 ? 20  TRP Q NE1 1 
ATOM   8562  C CE2 . TRP F 1 5   ? 33.114  80.135  -8.910  1.00 123.44 ? 20  TRP Q CE2 1 
ATOM   8563  C CE3 . TRP F 1 5   ? 33.820  77.939  -9.644  1.00 119.00 ? 20  TRP Q CE3 1 
ATOM   8564  C CZ2 . TRP F 1 5   ? 32.228  80.252  -9.975  1.00 126.31 ? 20  TRP Q CZ2 1 
ATOM   8565  C CZ3 . TRP F 1 5   ? 32.941  78.058  -10.698 1.00 119.16 ? 20  TRP Q CZ3 1 
ATOM   8566  C CH2 . TRP F 1 5   ? 32.158  79.205  -10.857 1.00 126.27 ? 20  TRP Q CH2 1 
ATOM   8567  N N   . GLU F 1 6   ? 36.757  77.024  -4.251  1.00 100.83 ? 21  GLU Q N   1 
ATOM   8568  C CA  . GLU F 1 6   ? 37.500  77.218  -3.032  1.00 96.56  ? 21  GLU Q CA  1 
ATOM   8569  C C   . GLU F 1 6   ? 38.859  77.798  -3.367  1.00 90.40  ? 21  GLU Q C   1 
ATOM   8570  O O   . GLU F 1 6   ? 39.160  78.096  -4.525  1.00 89.71  ? 21  GLU Q O   1 
ATOM   8571  C CB  . GLU F 1 6   ? 37.654  75.885  -2.307  1.00 98.77  ? 21  GLU Q CB  1 
ATOM   8572  C CG  . GLU F 1 6   ? 38.339  74.811  -3.134  1.00 96.89  ? 21  GLU Q CG  1 
ATOM   8573  C CD  . GLU F 1 6   ? 37.367  73.828  -3.751  1.00 98.93  ? 21  GLU Q CD  1 
ATOM   8574  O OE1 . GLU F 1 6   ? 36.140  73.987  -3.564  1.00 104.78 ? 21  GLU Q OE1 1 
ATOM   8575  O OE2 . GLU F 1 6   ? 37.840  72.886  -4.420  1.00 100.51 ? 21  GLU Q OE2 1 
ATOM   8576  N N   . CYS F 1 7   ? 39.675  77.963  -2.339  1.00 83.03  ? 22  CYS Q N   1 
ATOM   8577  C CA  . CYS F 1 7   ? 41.019  78.456  -2.523  1.00 80.31  ? 22  CYS Q CA  1 
ATOM   8578  C C   . CYS F 1 7   ? 41.951  77.307  -2.858  1.00 80.30  ? 22  CYS Q C   1 
ATOM   8579  O O   . CYS F 1 7   ? 41.548  76.147  -2.852  1.00 85.27  ? 22  CYS Q O   1 
ATOM   8580  C CB  . CYS F 1 7   ? 41.491  79.149  -1.253  1.00 82.74  ? 22  CYS Q CB  1 
ATOM   8581  S SG  . CYS F 1 7   ? 40.268  80.251  -0.527  1.00 91.29  ? 22  CYS Q SG  1 
ATOM   8582  N N   . GLU F 1 8   ? 43.203  77.630  -3.154  1.00 76.99  ? 23  GLU Q N   1 
ATOM   8583  C CA  . GLU F 1 8   ? 44.209  76.603  -3.369  1.00 76.26  ? 23  GLU Q CA  1 
ATOM   8584  C C   . GLU F 1 8   ? 44.907  76.199  -2.068  1.00 83.58  ? 23  GLU Q C   1 
ATOM   8585  O O   . GLU F 1 8   ? 44.773  76.871  -1.037  1.00 83.64  ? 23  GLU Q O   1 
ATOM   8586  C CB  . GLU F 1 8   ? 45.233  77.058  -4.399  1.00 70.50  ? 23  GLU Q CB  1 
ATOM   8587  C CG  . GLU F 1 8   ? 44.872  76.672  -5.810  1.00 72.38  ? 23  GLU Q CG  1 
ATOM   8588  C CD  . GLU F 1 8   ? 44.913  75.179  -6.035  1.00 71.99  ? 23  GLU Q CD  1 
ATOM   8589  O OE1 . GLU F 1 8   ? 44.673  74.754  -7.183  1.00 69.62  ? 23  GLU Q OE1 1 
ATOM   8590  O OE2 . GLU F 1 8   ? 45.184  74.430  -5.070  1.00 74.15  ? 23  GLU Q OE2 1 
ATOM   8591  N N   . LYS F 1 9   ? 45.644  75.089  -2.124  1.00 84.38  ? 24  LYS Q N   1 
ATOM   8592  C CA  . LYS F 1 9   ? 46.370  74.587  -0.961  1.00 81.23  ? 24  LYS Q CA  1 
ATOM   8593  C C   . LYS F 1 9   ? 47.130  75.709  -0.243  1.00 81.89  ? 24  LYS Q C   1 
ATOM   8594  O O   . LYS F 1 9   ? 47.863  76.489  -0.864  1.00 79.06  ? 24  LYS Q O   1 
ATOM   8595  C CB  . LYS F 1 9   ? 47.311  73.440  -1.350  1.00 74.06  ? 24  LYS Q CB  1 
ATOM   8596  C CG  . LYS F 1 9   ? 46.642  72.073  -1.438  1.00 69.85  ? 24  LYS Q CG  1 
ATOM   8597  C CD  . LYS F 1 9   ? 47.356  71.041  -0.554  1.00 77.56  ? 24  LYS Q CD  1 
ATOM   8598  C CE  . LYS F 1 9   ? 48.809  70.768  -1.003  1.00 80.99  ? 24  LYS Q CE  1 
ATOM   8599  N NZ  . LYS F 1 9   ? 49.642  69.980  -0.023  1.00 65.16  ? 24  LYS Q NZ  1 
ATOM   8600  N N   . HIS F 1 10  ? 46.915  75.790  1.070   1.00 87.89  ? 25  HIS Q N   1 
ATOM   8601  C CA  . HIS F 1 10  ? 47.594  76.755  1.941   1.00 89.41  ? 25  HIS Q CA  1 
ATOM   8602  C C   . HIS F 1 10  ? 47.698  78.134  1.269   1.00 81.78  ? 25  HIS Q C   1 
ATOM   8603  O O   . HIS F 1 10  ? 48.681  78.885  1.415   1.00 73.25  ? 25  HIS Q O   1 
ATOM   8604  C CB  . HIS F 1 10  ? 48.942  76.196  2.422   1.00 92.67  ? 25  HIS Q CB  1 
ATOM   8605  C CG  . HIS F 1 10  ? 48.894  74.733  2.761   1.00 97.56  ? 25  HIS Q CG  1 
ATOM   8606  N ND1 . HIS F 1 10  ? 50.007  73.915  2.707   1.00 101.85 ? 25  HIS Q ND1 1 
ATOM   8607  C CD2 . HIS F 1 10  ? 47.859  73.936  3.129   1.00 91.84  ? 25  HIS Q CD2 1 
ATOM   8608  C CE1 . HIS F 1 10  ? 49.662  72.683  3.040   1.00 97.88  ? 25  HIS Q CE1 1 
ATOM   8609  N NE2 . HIS F 1 10  ? 48.364  72.667  3.294   1.00 95.33  ? 25  HIS Q NE2 1 
ATOM   8610  N N   . SER F 1 11  ? 46.639  78.431  0.527   1.00 78.58  ? 26  SER Q N   1 
ATOM   8611  C CA  . SER F 1 11  ? 46.420  79.730  -0.061  1.00 73.55  ? 26  SER Q CA  1 
ATOM   8612  C C   . SER F 1 11  ? 46.223  80.765  1.039   1.00 71.21  ? 26  SER Q C   1 
ATOM   8613  O O   . SER F 1 11  ? 46.674  81.905  0.908   1.00 69.65  ? 26  SER Q O   1 
ATOM   8614  C CB  . SER F 1 11  ? 45.180  79.663  -0.955  1.00 73.95  ? 26  SER Q CB  1 
ATOM   8615  O OG  . SER F 1 11  ? 44.579  80.931  -1.147  1.00 70.84  ? 26  SER Q OG  1 
ATOM   8616  N N   . GLN F 1 12  ? 45.558  80.364  2.123   1.00 67.81  ? 27  GLN Q N   1 
ATOM   8617  C CA  . GLN F 1 12  ? 45.205  81.295  3.200   1.00 66.75  ? 27  GLN Q CA  1 
ATOM   8618  C C   . GLN F 1 12  ? 45.798  80.922  4.564   1.00 63.22  ? 27  GLN Q C   1 
ATOM   8619  O O   . GLN F 1 12  ? 45.061  80.500  5.456   1.00 58.70  ? 27  GLN Q O   1 
ATOM   8620  C CB  . GLN F 1 12  ? 43.684  81.371  3.344   1.00 68.38  ? 27  GLN Q CB  1 
ATOM   8621  C CG  . GLN F 1 12  ? 42.910  81.200  2.062   1.00 66.71  ? 27  GLN Q CG  1 
ATOM   8622  C CD  . GLN F 1 12  ? 42.942  82.429  1.208   1.00 70.79  ? 27  GLN Q CD  1 
ATOM   8623  O OE1 . GLN F 1 12  ? 42.819  82.356  -0.017  1.00 72.33  ? 27  GLN Q OE1 1 
ATOM   8624  N NE2 . GLN F 1 12  ? 43.115  83.580  1.846   1.00 72.03  ? 27  GLN Q NE2 1 
ATOM   8625  N N   . PRO F 1 13  ? 47.120  81.100  4.737   1.00 61.77  ? 28  PRO Q N   1 
ATOM   8626  C CA  . PRO F 1 13  ? 47.864  80.727  5.945   1.00 59.63  ? 28  PRO Q CA  1 
ATOM   8627  C C   . PRO F 1 13  ? 47.279  81.330  7.209   1.00 61.50  ? 28  PRO Q C   1 
ATOM   8628  O O   . PRO F 1 13  ? 47.305  80.702  8.260   1.00 58.90  ? 28  PRO Q O   1 
ATOM   8629  C CB  . PRO F 1 13  ? 49.241  81.330  5.695   1.00 58.83  ? 28  PRO Q CB  1 
ATOM   8630  C CG  . PRO F 1 13  ? 49.361  81.365  4.245   1.00 60.40  ? 28  PRO Q CG  1 
ATOM   8631  C CD  . PRO F 1 13  ? 48.006  81.716  3.739   1.00 64.70  ? 28  PRO Q CD  1 
ATOM   8632  N N   . TRP F 1 14  ? 46.746  82.538  7.087   1.00 62.34  ? 29  TRP Q N   1 
ATOM   8633  C CA  . TRP F 1 14  ? 46.233  83.289  8.222   1.00 57.89  ? 29  TRP Q CA  1 
ATOM   8634  C C   . TRP F 1 14  ? 44.854  82.858  8.700   1.00 57.52  ? 29  TRP Q C   1 
ATOM   8635  O O   . TRP F 1 14  ? 44.375  83.348  9.707   1.00 60.87  ? 29  TRP Q O   1 
ATOM   8636  C CB  . TRP F 1 14  ? 46.189  84.773  7.865   1.00 66.47  ? 29  TRP Q CB  1 
ATOM   8637  C CG  . TRP F 1 14  ? 45.582  85.098  6.494   1.00 68.01  ? 29  TRP Q CG  1 
ATOM   8638  C CD1 . TRP F 1 14  ? 44.250  85.270  6.191   1.00 66.79  ? 29  TRP Q CD1 1 
ATOM   8639  C CD2 . TRP F 1 14  ? 46.295  85.321  5.270   1.00 64.14  ? 29  TRP Q CD2 1 
ATOM   8640  N NE1 . TRP F 1 14  ? 44.100  85.568  4.855   1.00 63.96  ? 29  TRP Q NE1 1 
ATOM   8641  C CE2 . TRP F 1 14  ? 45.340  85.607  4.270   1.00 65.53  ? 29  TRP Q CE2 1 
ATOM   8642  C CE3 . TRP F 1 14  ? 47.645  85.294  4.919   1.00 64.96  ? 29  TRP Q CE3 1 
ATOM   8643  C CZ2 . TRP F 1 14  ? 45.702  85.864  2.949   1.00 62.56  ? 29  TRP Q CZ2 1 
ATOM   8644  C CZ3 . TRP F 1 14  ? 47.998  85.549  3.599   1.00 63.56  ? 29  TRP Q CZ3 1 
ATOM   8645  C CH2 . TRP F 1 14  ? 47.034  85.831  2.637   1.00 58.35  ? 29  TRP Q CH2 1 
ATOM   8646  N N   . GLN F 1 15  ? 44.216  81.948  7.979   1.00 57.77  ? 30  GLN Q N   1 
ATOM   8647  C CA  . GLN F 1 15  ? 42.830  81.584  8.246   1.00 58.36  ? 30  GLN Q CA  1 
ATOM   8648  C C   . GLN F 1 15  ? 42.686  80.543  9.343   1.00 56.92  ? 30  GLN Q C   1 
ATOM   8649  O O   . GLN F 1 15  ? 43.313  79.500  9.291   1.00 60.94  ? 30  GLN Q O   1 
ATOM   8650  C CB  . GLN F 1 15  ? 42.210  81.033  6.964   1.00 68.99  ? 30  GLN Q CB  1 
ATOM   8651  C CG  . GLN F 1 15  ? 40.703  80.743  7.028   1.00 78.20  ? 30  GLN Q CG  1 
ATOM   8652  C CD  . GLN F 1 15  ? 39.851  81.771  6.266   1.00 79.24  ? 30  GLN Q CD  1 
ATOM   8653  O OE1 . GLN F 1 15  ? 38.872  82.296  6.803   1.00 82.12  ? 30  GLN Q OE1 1 
ATOM   8654  N NE2 . GLN F 1 15  ? 40.225  82.060  5.018   1.00 74.25  ? 30  GLN Q NE2 1 
ATOM   8655  N N   . VAL F 1 16  ? 41.835  80.797  10.328  1.00 60.88  ? 31  VAL Q N   1 
ATOM   8656  C CA  . VAL F 1 16  ? 41.630  79.803  11.389  1.00 64.19  ? 31  VAL Q CA  1 
ATOM   8657  C C   . VAL F 1 16  ? 40.181  79.329  11.525  1.00 68.24  ? 31  VAL Q C   1 
ATOM   8658  O O   . VAL F 1 16  ? 39.271  79.865  10.887  1.00 71.51  ? 31  VAL Q O   1 
ATOM   8659  C CB  . VAL F 1 16  ? 42.103  80.311  12.760  1.00 61.02  ? 31  VAL Q CB  1 
ATOM   8660  C CG1 . VAL F 1 16  ? 43.228  81.313  12.589  1.00 60.67  ? 31  VAL Q CG1 1 
ATOM   8661  C CG2 . VAL F 1 16  ? 40.956  80.938  13.507  1.00 62.20  ? 31  VAL Q CG2 1 
ATOM   8662  N N   . LEU F 1 17  ? 39.980  78.309  12.352  1.00 63.00  ? 32  LEU Q N   1 
ATOM   8663  C CA  . LEU F 1 17  ? 38.654  77.815  12.656  1.00 60.85  ? 32  LEU Q CA  1 
ATOM   8664  C C   . LEU F 1 17  ? 38.498  77.977  14.152  1.00 60.93  ? 32  LEU Q C   1 
ATOM   8665  O O   . LEU F 1 17  ? 39.469  77.853  14.873  1.00 65.14  ? 32  LEU Q O   1 
ATOM   8666  C CB  . LEU F 1 17  ? 38.542  76.348  12.254  1.00 57.18  ? 32  LEU Q CB  1 
ATOM   8667  C CG  . LEU F 1 17  ? 37.148  75.886  11.826  1.00 62.98  ? 32  LEU Q CG  1 
ATOM   8668  C CD1 . LEU F 1 17  ? 36.234  75.609  13.008  1.00 69.07  ? 32  LEU Q CD1 1 
ATOM   8669  C CD2 . LEU F 1 17  ? 36.516  76.917  10.928  1.00 69.11  ? 32  LEU Q CD2 1 
ATOM   8670  N N   . VAL F 1 18  ? 37.296  78.261  14.636  1.00 58.82  ? 33  VAL Q N   1 
ATOM   8671  C CA  . VAL F 1 18  ? 37.116  78.475  16.067  1.00 60.39  ? 33  VAL Q CA  1 
ATOM   8672  C C   . VAL F 1 18  ? 35.962  77.683  16.641  1.00 66.33  ? 33  VAL Q C   1 
ATOM   8673  O O   . VAL F 1 18  ? 34.813  78.120  16.583  1.00 70.74  ? 33  VAL Q O   1 
ATOM   8674  C CB  . VAL F 1 18  ? 36.861  79.939  16.359  1.00 61.64  ? 33  VAL Q CB  1 
ATOM   8675  C CG1 . VAL F 1 18  ? 36.654  80.156  17.844  1.00 62.36  ? 33  VAL Q CG1 1 
ATOM   8676  C CG2 . VAL F 1 18  ? 38.020  80.753  15.863  1.00 64.00  ? 33  VAL Q CG2 1 
ATOM   8677  N N   . ALA F 1 19  ? 36.269  76.534  17.228  1.00 66.42  ? 34  ALA Q N   1 
ATOM   8678  C CA  . ALA F 1 19  ? 35.226  75.606  17.643  1.00 69.89  ? 34  ALA Q CA  1 
ATOM   8679  C C   . ALA F 1 19  ? 34.969  75.648  19.131  1.00 70.14  ? 34  ALA Q C   1 
ATOM   8680  O O   . ALA F 1 19  ? 35.672  76.334  19.877  1.00 65.89  ? 34  ALA Q O   1 
ATOM   8681  C CB  . ALA F 1 19  ? 35.578  74.200  17.224  1.00 64.55  ? 34  ALA Q CB  1 
ATOM   8682  N N   . SER F 1 20  ? 33.954  74.895  19.544  1.00 74.24  ? 35  SER Q N   1 
ATOM   8683  C CA  . SER F 1 20  ? 33.638  74.722  20.953  1.00 77.52  ? 35  SER Q CA  1 
ATOM   8684  C C   . SER F 1 20  ? 32.615  73.615  21.142  1.00 78.28  ? 35  SER Q C   1 
ATOM   8685  O O   . SER F 1 20  ? 31.782  73.374  20.268  1.00 73.25  ? 35  SER Q O   1 
ATOM   8686  C CB  . SER F 1 20  ? 33.113  76.025  21.559  1.00 80.69  ? 35  SER Q CB  1 
ATOM   8687  O OG  . SER F 1 20  ? 31.761  76.246  21.207  1.00 84.57  ? 35  SER Q OG  1 
ATOM   8688  N N   . ARG F 1 21  ? 32.704  72.946  22.293  1.00 86.75  ? 36  ARG Q N   1 
ATOM   8689  C CA  . ARG F 1 21  ? 31.748  71.914  22.729  1.00 88.96  ? 36  ARG Q CA  1 
ATOM   8690  C C   . ARG F 1 21  ? 31.524  70.736  21.759  1.00 89.79  ? 36  ARG Q C   1 
ATOM   8691  O O   . ARG F 1 21  ? 30.690  69.868  22.017  1.00 88.94  ? 36  ARG Q O   1 
ATOM   8692  C CB  . ARG F 1 21  ? 30.416  72.557  23.121  1.00 86.99  ? 36  ARG Q CB  1 
ATOM   8693  C CG  . ARG F 1 21  ? 29.403  71.626  23.755  1.00 91.85  ? 36  ARG Q CG  1 
ATOM   8694  C CD  . ARG F 1 21  ? 28.083  72.372  23.902  1.00 102.39 ? 36  ARG Q CD  1 
ATOM   8695  N NE  . ARG F 1 21  ? 26.978  71.554  24.401  1.00 106.63 ? 36  ARG Q NE  1 
ATOM   8696  C CZ  . ARG F 1 21  ? 25.839  71.350  23.741  1.00 111.45 ? 36  ARG Q CZ  1 
ATOM   8697  N NH1 . ARG F 1 21  ? 25.655  71.896  22.545  1.00 109.03 ? 36  ARG Q NH1 1 
ATOM   8698  N NH2 . ARG F 1 21  ? 24.882  70.600  24.277  1.00 119.48 ? 36  ARG Q NH2 1 
ATOM   8699  N N   . GLY F 1 22  ? 32.271  70.700  20.657  1.00 89.27  ? 37  GLY Q N   1 
ATOM   8700  C CA  . GLY F 1 22  ? 32.155  69.609  19.707  1.00 85.58  ? 37  GLY Q CA  1 
ATOM   8701  C C   . GLY F 1 22  ? 31.900  70.023  18.265  1.00 84.39  ? 37  GLY Q C   1 
ATOM   8702  O O   . GLY F 1 22  ? 32.177  69.245  17.356  1.00 84.99  ? 37  GLY Q O   1 
ATOM   8703  N N   . ARG F 1 23  ? 31.357  71.223  18.048  1.00 84.59  ? 38  ARG Q N   1 
ATOM   8704  C CA  . ARG F 1 23  ? 31.133  71.741  16.688  1.00 83.89  ? 38  ARG Q CA  1 
ATOM   8705  C C   . ARG F 1 23  ? 31.916  73.038  16.477  1.00 78.43  ? 38  ARG Q C   1 
ATOM   8706  O O   . ARG F 1 23  ? 32.410  73.633  17.444  1.00 76.80  ? 38  ARG Q O   1 
ATOM   8707  C CB  . ARG F 1 23  ? 29.638  71.992  16.405  1.00 87.21  ? 38  ARG Q CB  1 
ATOM   8708  C CG  . ARG F 1 23  ? 28.649  71.033  17.086  1.00 86.58  ? 38  ARG Q CG  1 
ATOM   8709  C CD  . ARG F 1 23  ? 28.102  69.944  16.152  1.00 82.58  ? 38  ARG Q CD  1 
ATOM   8710  N NE  . ARG F 1 23  ? 26.954  69.243  16.744  1.00 92.24  ? 38  ARG Q NE  1 
ATOM   8711  C CZ  . ARG F 1 23  ? 27.029  68.160  17.524  1.00 91.61  ? 38  ARG Q CZ  1 
ATOM   8712  N NH1 . ARG F 1 23  ? 25.916  67.610  18.009  1.00 75.96  ? 38  ARG Q NH1 1 
ATOM   8713  N NH2 . ARG F 1 23  ? 28.210  67.621  17.826  1.00 90.44  ? 38  ARG Q NH2 1 
ATOM   8714  N N   . ALA F 1 24  ? 32.033  73.474  15.220  1.00 81.64  ? 39  ALA Q N   1 
ATOM   8715  C CA  . ALA F 1 24  ? 32.710  74.744  14.913  1.00 79.49  ? 39  ALA Q CA  1 
ATOM   8716  C C   . ALA F 1 24  ? 31.843  75.894  15.366  1.00 77.00  ? 39  ALA Q C   1 
ATOM   8717  O O   . ALA F 1 24  ? 30.788  75.684  15.956  1.00 83.78  ? 39  ALA Q O   1 
ATOM   8718  C CB  . ALA F 1 24  ? 33.010  74.876  13.432  1.00 76.60  ? 39  ALA Q CB  1 
ATOM   8719  N N   . VAL F 1 25  ? 32.263  77.115  15.085  1.00 73.80  ? 41  VAL Q N   1 
ATOM   8720  C CA  . VAL F 1 25  ? 31.489  78.244  15.579  1.00 77.34  ? 41  VAL Q CA  1 
ATOM   8721  C C   . VAL F 1 25  ? 31.793  79.543  14.870  1.00 76.99  ? 41  VAL Q C   1 
ATOM   8722  O O   . VAL F 1 25  ? 30.941  80.422  14.797  1.00 78.95  ? 41  VAL Q O   1 
ATOM   8723  C CB  . VAL F 1 25  ? 31.689  78.439  17.091  1.00 74.24  ? 41  VAL Q CB  1 
ATOM   8724  C CG1 . VAL F 1 25  ? 32.056  79.872  17.404  1.00 72.33  ? 41  VAL Q CG1 1 
ATOM   8725  C CG2 . VAL F 1 25  ? 30.437  78.028  17.848  1.00 79.95  ? 41  VAL Q CG2 1 
ATOM   8726  N N   . CYS F 1 26  ? 33.009  79.660  14.354  1.00 74.49  ? 42  CYS Q N   1 
ATOM   8727  C CA  . CYS F 1 26  ? 33.460  80.896  13.733  1.00 74.81  ? 42  CYS Q CA  1 
ATOM   8728  C C   . CYS F 1 26  ? 34.607  80.675  12.744  1.00 71.25  ? 42  CYS Q C   1 
ATOM   8729  O O   . CYS F 1 26  ? 34.886  79.548  12.317  1.00 69.80  ? 42  CYS Q O   1 
ATOM   8730  C CB  . CYS F 1 26  ? 33.910  81.893  14.809  1.00 74.16  ? 42  CYS Q CB  1 
ATOM   8731  S SG  . CYS F 1 26  ? 32.641  83.014  15.505  1.00 96.85  ? 42  CYS Q SG  1 
ATOM   8732  N N   . GLY F 1 27  ? 35.249  81.781  12.384  1.00 62.72  ? 43  GLY Q N   1 
ATOM   8733  C CA  . GLY F 1 27  ? 36.481  81.781  11.628  1.00 56.75  ? 43  GLY Q CA  1 
ATOM   8734  C C   . GLY F 1 27  ? 37.160  83.076  12.002  1.00 63.67  ? 43  GLY Q C   1 
ATOM   8735  O O   . GLY F 1 27  ? 36.510  83.978  12.513  1.00 68.15  ? 43  GLY Q O   1 
ATOM   8736  N N   . GLY F 1 28  ? 38.462  83.182  11.767  1.00 65.96  ? 44  GLY Q N   1 
ATOM   8737  C CA  . GLY F 1 28  ? 39.182  84.395  12.129  1.00 67.44  ? 44  GLY Q CA  1 
ATOM   8738  C C   . GLY F 1 28  ? 40.472  84.639  11.357  1.00 63.96  ? 44  GLY Q C   1 
ATOM   8739  O O   . GLY F 1 28  ? 40.684  84.098  10.266  1.00 60.90  ? 44  GLY Q O   1 
ATOM   8740  N N   . VAL F 1 29  ? 41.343  85.465  11.922  1.00 58.56  ? 45  VAL Q N   1 
ATOM   8741  C CA  . VAL F 1 29  ? 42.602  85.748  11.264  1.00 58.25  ? 45  VAL Q CA  1 
ATOM   8742  C C   . VAL F 1 29  ? 43.779  85.882  12.248  1.00 59.52  ? 45  VAL Q C   1 
ATOM   8743  O O   . VAL F 1 29  ? 43.689  86.534  13.293  1.00 60.35  ? 45  VAL Q O   1 
ATOM   8744  C CB  . VAL F 1 29  ? 42.485  87.005  10.353  1.00 60.77  ? 45  VAL Q CB  1 
ATOM   8745  C CG1 . VAL F 1 29  ? 43.716  87.150  9.434   1.00 64.29  ? 45  VAL Q CG1 1 
ATOM   8746  C CG2 . VAL F 1 29  ? 41.223  86.952  9.527   1.00 53.57  ? 45  VAL Q CG2 1 
ATOM   8747  N N   . LEU F 1 30  ? 44.895  85.264  11.892  1.00 55.83  ? 46  LEU Q N   1 
ATOM   8748  C CA  . LEU F 1 30  ? 46.090  85.339  12.704  1.00 58.43  ? 46  LEU Q CA  1 
ATOM   8749  C C   . LEU F 1 30  ? 46.898  86.591  12.392  1.00 62.50  ? 46  LEU Q C   1 
ATOM   8750  O O   . LEU F 1 30  ? 47.415  86.761  11.280  1.00 59.44  ? 46  LEU Q O   1 
ATOM   8751  C CB  . LEU F 1 30  ? 46.947  84.118  12.441  1.00 64.71  ? 46  LEU Q CB  1 
ATOM   8752  C CG  . LEU F 1 30  ? 47.925  83.810  13.553  1.00 63.18  ? 46  LEU Q CG  1 
ATOM   8753  C CD1 . LEU F 1 30  ? 47.157  83.834  14.865  1.00 59.52  ? 46  LEU Q CD1 1 
ATOM   8754  C CD2 . LEU F 1 30  ? 48.569  82.459  13.270  1.00 57.87  ? 46  LEU Q CD2 1 
ATOM   8755  N N   . VAL F 1 31  ? 47.018  87.462  13.387  1.00 63.61  ? 47  VAL Q N   1 
ATOM   8756  C CA  . VAL F 1 31  ? 47.685  88.745  13.199  1.00 62.30  ? 47  VAL Q CA  1 
ATOM   8757  C C   . VAL F 1 31  ? 49.020  88.771  13.951  1.00 67.88  ? 47  VAL Q C   1 
ATOM   8758  O O   . VAL F 1 31  ? 50.084  88.817  13.339  1.00 72.35  ? 47  VAL Q O   1 
ATOM   8759  C CB  . VAL F 1 31  ? 46.762  89.891  13.607  1.00 55.00  ? 47  VAL Q CB  1 
ATOM   8760  C CG1 . VAL F 1 31  ? 45.413  89.709  12.939  1.00 58.25  ? 47  VAL Q CG1 1 
ATOM   8761  C CG2 . VAL F 1 31  ? 46.550  89.892  15.090  1.00 60.90  ? 47  VAL Q CG2 1 
ATOM   8762  N N   . HIS F 1 32  ? 48.958  88.730  15.274  1.00 65.67  ? 48  HIS Q N   1 
ATOM   8763  C CA  . HIS F 1 32  ? 50.120  88.448  16.099  1.00 66.57  ? 48  HIS Q CA  1 
ATOM   8764  C C   . HIS F 1 32  ? 50.054  86.959  16.509  1.00 69.11  ? 48  HIS Q C   1 
ATOM   8765  O O   . HIS F 1 32  ? 48.969  86.442  16.790  1.00 68.17  ? 48  HIS Q O   1 
ATOM   8766  C CB  . HIS F 1 32  ? 50.111  89.365  17.317  1.00 65.25  ? 48  HIS Q CB  1 
ATOM   8767  C CG  . HIS F 1 32  ? 51.280  89.175  18.229  1.00 66.31  ? 48  HIS Q CG  1 
ATOM   8768  N ND1 . HIS F 1 32  ? 51.294  88.227  19.229  1.00 64.30  ? 48  HIS Q ND1 1 
ATOM   8769  C CD2 . HIS F 1 32  ? 52.468  89.818  18.301  1.00 65.00  ? 48  HIS Q CD2 1 
ATOM   8770  C CE1 . HIS F 1 32  ? 52.441  88.294  19.878  1.00 66.85  ? 48  HIS Q CE1 1 
ATOM   8771  N NE2 . HIS F 1 32  ? 53.173  89.249  19.333  1.00 67.58  ? 48  HIS Q NE2 1 
ATOM   8772  N N   . PRO F 1 33  ? 51.207  86.259  16.533  1.00 66.87  ? 49  PRO Q N   1 
ATOM   8773  C CA  . PRO F 1 33  ? 51.146  84.797  16.643  1.00 59.87  ? 49  PRO Q CA  1 
ATOM   8774  C C   . PRO F 1 33  ? 50.396  84.311  17.867  1.00 62.79  ? 49  PRO Q C   1 
ATOM   8775  O O   . PRO F 1 33  ? 50.007  83.148  17.943  1.00 62.57  ? 49  PRO Q O   1 
ATOM   8776  C CB  . PRO F 1 33  ? 52.613  84.404  16.729  1.00 57.24  ? 49  PRO Q CB  1 
ATOM   8777  C CG  . PRO F 1 33  ? 53.328  85.501  16.017  1.00 56.92  ? 49  PRO Q CG  1 
ATOM   8778  C CD  . PRO F 1 33  ? 52.596  86.738  16.406  1.00 61.36  ? 49  PRO Q CD  1 
ATOM   8779  N N   . GLN F 1 34  ? 50.187  85.205  18.818  1.00 61.56  ? 50  GLN Q N   1 
ATOM   8780  C CA  . GLN F 1 34  ? 49.525  84.832  20.050  1.00 66.95  ? 50  GLN Q CA  1 
ATOM   8781  C C   . GLN F 1 34  ? 48.076  85.320  20.063  1.00 69.54  ? 50  GLN Q C   1 
ATOM   8782  O O   . GLN F 1 34  ? 47.398  85.310  21.104  1.00 70.55  ? 50  GLN Q O   1 
ATOM   8783  C CB  . GLN F 1 34  ? 50.298  85.432  21.223  1.00 74.63  ? 50  GLN Q CB  1 
ATOM   8784  C CG  . GLN F 1 34  ? 49.665  85.220  22.589  1.00 81.41  ? 50  GLN Q CG  1 
ATOM   8785  C CD  . GLN F 1 34  ? 50.476  84.280  23.443  1.00 80.67  ? 50  GLN Q CD  1 
ATOM   8786  O OE1 . GLN F 1 34  ? 50.013  83.823  24.490  1.00 81.77  ? 50  GLN Q OE1 1 
ATOM   8787  N NE2 . GLN F 1 34  ? 51.700  83.984  23.003  1.00 71.84  ? 50  GLN Q NE2 1 
ATOM   8788  N N   . TRP F 1 35  ? 47.601  85.731  18.893  1.00 66.91  ? 51  TRP Q N   1 
ATOM   8789  C CA  . TRP F 1 35  ? 46.357  86.467  18.801  1.00 61.32  ? 51  TRP Q CA  1 
ATOM   8790  C C   . TRP F 1 35  ? 45.569  86.208  17.543  1.00 62.01  ? 51  TRP Q C   1 
ATOM   8791  O O   . TRP F 1 35  ? 46.120  86.128  16.445  1.00 63.04  ? 51  TRP Q O   1 
ATOM   8792  C CB  . TRP F 1 35  ? 46.662  87.939  18.889  1.00 59.17  ? 51  TRP Q CB  1 
ATOM   8793  C CG  . TRP F 1 35  ? 47.117  88.318  20.223  1.00 65.99  ? 51  TRP Q CG  1 
ATOM   8794  C CD1 . TRP F 1 35  ? 48.406  88.371  20.664  1.00 69.39  ? 51  TRP Q CD1 1 
ATOM   8795  C CD2 . TRP F 1 35  ? 46.296  88.690  21.330  1.00 66.17  ? 51  TRP Q CD2 1 
ATOM   8796  N NE1 . TRP F 1 35  ? 48.439  88.764  21.977  1.00 71.14  ? 51  TRP Q NE1 1 
ATOM   8797  C CE2 . TRP F 1 35  ? 47.154  88.969  22.408  1.00 73.16  ? 51  TRP Q CE2 1 
ATOM   8798  C CE3 . TRP F 1 35  ? 44.921  88.823  21.512  1.00 60.57  ? 51  TRP Q CE3 1 
ATOM   8799  C CZ2 . TRP F 1 35  ? 46.678  89.377  23.651  1.00 75.02  ? 51  TRP Q CZ2 1 
ATOM   8800  C CZ3 . TRP F 1 35  ? 44.455  89.226  22.741  1.00 63.62  ? 51  TRP Q CZ3 1 
ATOM   8801  C CH2 . TRP F 1 35  ? 45.327  89.499  23.795  1.00 69.73  ? 51  TRP Q CH2 1 
ATOM   8802  N N   . VAL F 1 36  ? 44.262  86.084  17.713  1.00 60.34  ? 52  VAL Q N   1 
ATOM   8803  C CA  . VAL F 1 36  ? 43.382  85.976  16.573  1.00 59.50  ? 52  VAL Q CA  1 
ATOM   8804  C C   . VAL F 1 36  ? 42.190  86.899  16.762  1.00 62.31  ? 52  VAL Q C   1 
ATOM   8805  O O   . VAL F 1 36  ? 41.780  87.166  17.885  1.00 59.20  ? 52  VAL Q O   1 
ATOM   8806  C CB  . VAL F 1 36  ? 42.962  84.534  16.314  1.00 58.17  ? 52  VAL Q CB  1 
ATOM   8807  C CG1 . VAL F 1 36  ? 41.524  84.466  15.907  1.00 60.93  ? 52  VAL Q CG1 1 
ATOM   8808  C CG2 . VAL F 1 36  ? 43.845  83.930  15.246  1.00 57.42  ? 52  VAL Q CG2 1 
ATOM   8809  N N   . LEU F 1 37  ? 41.671  87.396  15.639  1.00 71.32  ? 53  LEU Q N   1 
ATOM   8810  C CA  . LEU F 1 37  ? 40.626  88.427  15.578  1.00 72.15  ? 53  LEU Q CA  1 
ATOM   8811  C C   . LEU F 1 37  ? 39.390  87.951  14.818  1.00 72.29  ? 53  LEU Q C   1 
ATOM   8812  O O   . LEU F 1 37  ? 39.484  87.586  13.636  1.00 65.92  ? 53  LEU Q O   1 
ATOM   8813  C CB  . LEU F 1 37  ? 41.175  89.673  14.867  1.00 73.35  ? 53  LEU Q CB  1 
ATOM   8814  C CG  . LEU F 1 37  ? 40.166  90.745  14.435  1.00 73.76  ? 53  LEU Q CG  1 
ATOM   8815  C CD1 . LEU F 1 37  ? 39.344  91.254  15.617  1.00 74.84  ? 53  LEU Q CD1 1 
ATOM   8816  C CD2 . LEU F 1 37  ? 40.869  91.895  13.727  1.00 67.25  ? 53  LEU Q CD2 1 
ATOM   8817  N N   . THR F 1 38  ? 38.238  87.974  15.487  1.00 73.03  ? 54  THR Q N   1 
ATOM   8818  C CA  . THR F 1 38  ? 36.986  87.528  14.878  1.00 74.84  ? 54  THR Q CA  1 
ATOM   8819  C C   . THR F 1 38  ? 35.854  88.404  15.366  1.00 77.33  ? 54  THR Q C   1 
ATOM   8820  O O   . THR F 1 38  ? 36.058  89.252  16.225  1.00 82.30  ? 54  THR Q O   1 
ATOM   8821  C CB  . THR F 1 38  ? 36.668  86.043  15.210  1.00 73.66  ? 54  THR Q CB  1 
ATOM   8822  O OG1 . THR F 1 38  ? 35.443  85.658  14.575  1.00 76.52  ? 54  THR Q OG1 1 
ATOM   8823  C CG2 . THR F 1 38  ? 36.529  85.840  16.704  1.00 72.41  ? 54  THR Q CG2 1 
ATOM   8824  N N   . ALA F 1 39  ? 34.659  88.206  14.831  1.00 77.46  ? 55  ALA Q N   1 
ATOM   8825  C CA  . ALA F 1 39  ? 33.523  88.988  15.287  1.00 85.03  ? 55  ALA Q CA  1 
ATOM   8826  C C   . ALA F 1 39  ? 33.226  88.701  16.747  1.00 85.29  ? 55  ALA Q C   1 
ATOM   8827  O O   . ALA F 1 39  ? 33.142  87.544  17.152  1.00 84.78  ? 55  ALA Q O   1 
ATOM   8828  C CB  . ALA F 1 39  ? 32.317  88.694  14.448  1.00 92.43  ? 55  ALA Q CB  1 
ATOM   8829  N N   . ALA F 1 40  ? 33.068  89.763  17.529  1.00 85.66  ? 56  ALA Q N   1 
ATOM   8830  C CA  . ALA F 1 40  ? 32.651  89.643  18.924  1.00 87.79  ? 56  ALA Q CA  1 
ATOM   8831  C C   . ALA F 1 40  ? 31.274  88.991  19.084  1.00 92.95  ? 56  ALA Q C   1 
ATOM   8832  O O   . ALA F 1 40  ? 30.918  88.528  20.168  1.00 87.44  ? 56  ALA Q O   1 
ATOM   8833  C CB  . ALA F 1 40  ? 32.657  91.007  19.588  1.00 84.18  ? 56  ALA Q CB  1 
ATOM   8834  N N   . HIS F 1 41  ? 30.510  88.958  17.997  1.00 101.04 ? 57  HIS Q N   1 
ATOM   8835  C CA  . HIS F 1 41  ? 29.133  88.466  18.023  1.00 103.63 ? 57  HIS Q CA  1 
ATOM   8836  C C   . HIS F 1 41  ? 29.048  86.990  18.407  1.00 99.81  ? 57  HIS Q C   1 
ATOM   8837  O O   . HIS F 1 41  ? 27.978  86.472  18.728  1.00 97.01  ? 57  HIS Q O   1 
ATOM   8838  C CB  . HIS F 1 41  ? 28.439  88.716  16.669  1.00 109.83 ? 57  HIS Q CB  1 
ATOM   8839  C CG  . HIS F 1 41  ? 28.779  87.714  15.602  1.00 109.00 ? 57  HIS Q CG  1 
ATOM   8840  N ND1 . HIS F 1 41  ? 29.421  88.060  14.432  1.00 104.55 ? 57  HIS Q ND1 1 
ATOM   8841  C CD2 . HIS F 1 41  ? 28.542  86.382  15.520  1.00 104.19 ? 57  HIS Q CD2 1 
ATOM   8842  C CE1 . HIS F 1 41  ? 29.577  86.983  13.681  1.00 101.70 ? 57  HIS Q CE1 1 
ATOM   8843  N NE2 . HIS F 1 41  ? 29.056  85.952  14.320  1.00 101.10 ? 57  HIS Q NE2 1 
ATOM   8844  N N   . CYS F 1 42  ? 30.185  86.312  18.353  1.00 102.11 ? 58  CYS Q N   1 
ATOM   8845  C CA  . CYS F 1 42  ? 30.245  84.898  18.688  1.00 102.95 ? 58  CYS Q CA  1 
ATOM   8846  C C   . CYS F 1 42  ? 31.208  84.720  19.839  1.00 98.16  ? 58  CYS Q C   1 
ATOM   8847  O O   . CYS F 1 42  ? 32.413  84.947  19.696  1.00 95.92  ? 58  CYS Q O   1 
ATOM   8848  C CB  . CYS F 1 42  ? 30.706  84.072  17.485  1.00 102.97 ? 58  CYS Q CB  1 
ATOM   8849  S SG  . CYS F 1 42  ? 32.270  84.615  16.737  1.00 102.47 ? 58  CYS Q SG  1 
ATOM   8850  N N   . ILE F 1 43  ? 30.673  84.440  21.014  1.00 92.85  ? 59  ILE Q N   1 
ATOM   8851  C CA  . ILE F 1 43  ? 31.528  84.264  22.163  1.00 89.49  ? 59  ILE Q CA  1 
ATOM   8852  C C   . ILE F 1 43  ? 31.083  83.094  23.000  1.00 92.39  ? 59  ILE Q C   1 
ATOM   8853  O O   . ILE F 1 43  ? 29.898  82.908  23.252  1.00 98.52  ? 59  ILE Q O   1 
ATOM   8854  C CB  . ILE F 1 43  ? 31.574  85.519  23.029  1.00 85.60  ? 59  ILE Q CB  1 
ATOM   8855  C CG1 . ILE F 1 43  ? 32.222  86.660  22.258  1.00 82.83  ? 59  ILE Q CG1 1 
ATOM   8856  C CG2 . ILE F 1 43  ? 32.362  85.257  24.286  1.00 86.45  ? 59  ILE Q CG2 1 
ATOM   8857  C CD1 . ILE F 1 43  ? 33.400  87.255  22.967  1.00 78.60  ? 59  ILE Q CD1 1 
ATOM   8858  N N   . ARG F 1 44  ? 32.051  82.298  23.415  1.00 92.02  ? 60  ARG Q N   1 
ATOM   8859  C CA  . ARG F 1 44  ? 31.794  81.211  24.320  1.00 92.56  ? 60  ARG Q CA  1 
ATOM   8860  C C   . ARG F 1 44  ? 32.879  81.232  25.367  1.00 88.82  ? 60  ARG Q C   1 
ATOM   8861  O O   . ARG F 1 44  ? 33.995  81.662  25.109  1.00 87.03  ? 60  ARG Q O   1 
ATOM   8862  C CB  . ARG F 1 44  ? 31.780  79.889  23.568  1.00 94.09  ? 60  ARG Q CB  1 
ATOM   8863  C CG  . ARG F 1 44  ? 31.029  79.951  22.256  1.00 89.91  ? 60  ARG Q CG  1 
ATOM   8864  C CD  . ARG F 1 44  ? 29.554  79.680  22.453  1.00 94.07  ? 60  ARG Q CD  1 
ATOM   8865  N NE  . ARG F 1 44  ? 28.737  80.439  21.518  1.00 97.88  ? 60  ARG Q NE  1 
ATOM   8866  C CZ  . ARG F 1 44  ? 28.198  79.929  20.419  1.00 97.95  ? 60  ARG Q CZ  1 
ATOM   8867  N NH1 . ARG F 1 44  ? 27.467  80.693  19.622  1.00 97.11  ? 60  ARG Q NH1 1 
ATOM   8868  N NH2 . ARG F 1 44  ? 28.388  78.654  20.122  1.00 90.75  ? 60  ARG Q NH2 1 
ATOM   8869  N N   . ASN F 1 45  ? 32.523  80.716  26.527  1.00 90.43  ? 61  ASN Q N   1 
ATOM   8870  C CA  . ASN F 1 45  ? 33.382  80.664  27.675  1.00 94.82  ? 61  ASN Q CA  1 
ATOM   8871  C C   . ASN F 1 45  ? 34.512  79.662  27.488  1.00 94.68  ? 61  ASN Q C   1 
ATOM   8872  O O   . ASN F 1 45  ? 35.587  79.828  28.041  1.00 98.11  ? 61  ASN Q O   1 
ATOM   8873  C CB  . ASN F 1 45  ? 32.536  80.331  28.900  1.00 93.68  ? 61  ASN Q CB  1 
ATOM   8874  C CG  . ASN F 1 45  ? 31.106  80.819  28.770  1.00 94.81  ? 61  ASN Q CG  1 
ATOM   8875  O OD1 . ASN F 1 45  ? 30.863  82.009  28.702  1.00 93.37  ? 61  ASN Q OD1 1 
ATOM   8876  N ND2 . ASN F 1 45  ? 30.158  79.900  28.742  1.00 92.59  ? 61  ASN Q ND2 1 
ATOM   8877  N N   . LYS F 1 46  ? 34.262  78.625  26.702  1.00 87.39  ? 62  LYS Q N   1 
ATOM   8878  C CA  . LYS F 1 46  ? 35.263  77.635  26.299  1.00 86.35  ? 62  LYS Q CA  1 
ATOM   8879  C C   . LYS F 1 46  ? 35.410  77.513  24.787  1.00 74.30  ? 62  LYS Q C   1 
ATOM   8880  O O   . LYS F 1 46  ? 34.470  77.134  24.109  1.00 77.72  ? 62  LYS Q O   1 
ATOM   8881  C CB  . LYS F 1 46  ? 34.879  76.267  26.856  1.00 88.98  ? 62  LYS Q CB  1 
ATOM   8882  C CG  . LYS F 1 46  ? 33.397  76.121  27.186  1.00 95.12  ? 62  LYS Q CG  1 
ATOM   8883  C CD  . LYS F 1 46  ? 32.503  76.716  26.107  1.00 95.25  ? 62  LYS Q CD  1 
ATOM   8884  C CE  . LYS F 1 46  ? 31.031  76.524  26.447  1.00 89.88  ? 62  LYS Q CE  1 
ATOM   8885  N NZ  . LYS F 1 46  ? 30.135  76.783  25.289  1.00 83.33  ? 62  LYS Q NZ  1 
ATOM   8886  N N   . SER F 1 47  ? 36.600  77.786  24.263  1.00 70.44  ? 63  SER Q N   1 
ATOM   8887  C CA  . SER F 1 47  ? 36.822  77.718  22.821  1.00 71.54  ? 63  SER Q CA  1 
ATOM   8888  C C   . SER F 1 47  ? 38.244  77.323  22.436  1.00 66.15  ? 63  SER Q C   1 
ATOM   8889  O O   . SER F 1 47  ? 39.176  77.572  23.185  1.00 68.38  ? 63  SER Q O   1 
ATOM   8890  C CB  . SER F 1 47  ? 36.476  79.060  22.187  1.00 78.09  ? 63  SER Q CB  1 
ATOM   8891  O OG  . SER F 1 47  ? 36.283  80.047  23.182  1.00 85.25  ? 63  SER Q OG  1 
ATOM   8892  N N   . VAL F 1 48  ? 38.412  76.735  21.255  1.00 63.21  ? 64  VAL Q N   1 
ATOM   8893  C CA  . VAL F 1 48  ? 39.736  76.360  20.783  1.00 64.78  ? 64  VAL Q CA  1 
ATOM   8894  C C   . VAL F 1 48  ? 40.023  76.926  19.392  1.00 64.42  ? 64  VAL Q C   1 
ATOM   8895  O O   . VAL F 1 48  ? 39.160  77.551  18.781  1.00 66.67  ? 64  VAL Q O   1 
ATOM   8896  C CB  . VAL F 1 48  ? 39.913  74.832  20.806  1.00 60.81  ? 64  VAL Q CB  1 
ATOM   8897  C CG1 . VAL F 1 48  ? 39.893  74.340  22.231  1.00 61.34  ? 64  VAL Q CG1 1 
ATOM   8898  C CG2 . VAL F 1 48  ? 38.818  74.161  20.015  1.00 57.14  ? 64  VAL Q CG2 1 
ATOM   8899  N N   . ILE F 1 49  ? 41.236  76.718  18.897  1.00 58.72  ? 65  ILE Q N   1 
ATOM   8900  C CA  . ILE F 1 49  ? 41.601  77.243  17.593  1.00 59.26  ? 65  ILE Q CA  1 
ATOM   8901  C C   . ILE F 1 49  ? 42.272  76.161  16.750  1.00 63.74  ? 65  ILE Q C   1 
ATOM   8902  O O   . ILE F 1 49  ? 42.911  75.257  17.284  1.00 63.41  ? 65  ILE Q O   1 
ATOM   8903  C CB  . ILE F 1 49  ? 42.469  78.503  17.734  1.00 59.57  ? 65  ILE Q CB  1 
ATOM   8904  C CG1 . ILE F 1 49  ? 41.692  79.559  18.507  1.00 63.22  ? 65  ILE Q CG1 1 
ATOM   8905  C CG2 . ILE F 1 49  ? 42.813  79.086  16.399  1.00 60.36  ? 65  ILE Q CG2 1 
ATOM   8906  C CD1 . ILE F 1 49  ? 42.121  80.960  18.208  1.00 62.86  ? 65  ILE Q CD1 1 
ATOM   8907  N N   . LEU F 1 50  ? 42.092  76.241  15.433  1.00 66.05  ? 66  LEU Q N   1 
ATOM   8908  C CA  . LEU F 1 50  ? 42.575  75.223  14.492  1.00 65.49  ? 66  LEU Q CA  1 
ATOM   8909  C C   . LEU F 1 50  ? 43.229  75.850  13.254  1.00 65.82  ? 66  LEU Q C   1 
ATOM   8910  O O   . LEU F 1 50  ? 42.548  76.269  12.318  1.00 67.73  ? 66  LEU Q O   1 
ATOM   8911  C CB  . LEU F 1 50  ? 41.417  74.326  14.045  1.00 70.27  ? 66  LEU Q CB  1 
ATOM   8912  C CG  . LEU F 1 50  ? 40.872  73.189  14.915  1.00 66.62  ? 66  LEU Q CG  1 
ATOM   8913  C CD1 . LEU F 1 50  ? 40.614  73.602  16.357  1.00 61.68  ? 66  LEU Q CD1 1 
ATOM   8914  C CD2 . LEU F 1 50  ? 39.608  72.655  14.258  1.00 62.15  ? 66  LEU Q CD2 1 
ATOM   8915  N N   . LEU F 1 51  ? 44.555  75.887  13.245  1.00 69.07  ? 67  LEU Q N   1 
ATOM   8916  C CA  . LEU F 1 51  ? 45.304  76.576  12.200  1.00 69.17  ? 67  LEU Q CA  1 
ATOM   8917  C C   . LEU F 1 51  ? 45.963  75.573  11.263  1.00 75.52  ? 67  LEU Q C   1 
ATOM   8918  O O   . LEU F 1 51  ? 46.220  74.436  11.656  1.00 79.64  ? 67  LEU Q O   1 
ATOM   8919  C CB  . LEU F 1 51  ? 46.357  77.477  12.834  1.00 62.77  ? 67  LEU Q CB  1 
ATOM   8920  C CG  . LEU F 1 51  ? 45.849  78.448  13.906  1.00 59.25  ? 67  LEU Q CG  1 
ATOM   8921  C CD1 . LEU F 1 51  ? 45.324  77.754  15.145  1.00 58.30  ? 67  LEU Q CD1 1 
ATOM   8922  C CD2 . LEU F 1 51  ? 46.961  79.378  14.300  1.00 63.89  ? 67  LEU Q CD2 1 
ATOM   8923  N N   . GLY F 1 52  ? 46.232  75.991  10.028  1.00 81.18  ? 68  GLY Q N   1 
ATOM   8924  C CA  . GLY F 1 52  ? 46.797  75.096  9.020   1.00 89.38  ? 68  GLY Q CA  1 
ATOM   8925  C C   . GLY F 1 52  ? 45.773  74.122  8.457   1.00 93.08  ? 68  GLY Q C   1 
ATOM   8926  O O   . GLY F 1 52  ? 45.955  72.899  8.500   1.00 91.90  ? 68  GLY Q O   1 
ATOM   8927  N N   . ARG F 1 53  ? 44.708  74.693  7.897   1.00 98.97  ? 69  ARG Q N   1 
ATOM   8928  C CA  . ARG F 1 53  ? 43.454  73.994  7.640   1.00 98.99  ? 69  ARG Q CA  1 
ATOM   8929  C C   . ARG F 1 53  ? 42.900  74.358  6.255   1.00 96.89  ? 69  ARG Q C   1 
ATOM   8930  O O   . ARG F 1 53  ? 42.776  75.539  5.938   1.00 99.02  ? 69  ARG Q O   1 
ATOM   8931  C CB  . ARG F 1 53  ? 42.447  74.389  8.733   1.00 91.61  ? 69  ARG Q CB  1 
ATOM   8932  C CG  . ARG F 1 53  ? 41.849  73.221  9.447   1.00 87.60  ? 69  ARG Q CG  1 
ATOM   8933  C CD  . ARG F 1 53  ? 41.269  72.302  8.412   1.00 98.92  ? 69  ARG Q CD  1 
ATOM   8934  N NE  . ARG F 1 53  ? 41.355  70.897  8.791   1.00 104.57 ? 69  ARG Q NE  1 
ATOM   8935  C CZ  . ARG F 1 53  ? 42.477  70.185  8.799   1.00 97.42  ? 69  ARG Q CZ  1 
ATOM   8936  N NH1 . ARG F 1 53  ? 42.439  68.909  9.151   1.00 97.34  ? 69  ARG Q NH1 1 
ATOM   8937  N NH2 . ARG F 1 53  ? 43.630  70.749  8.468   1.00 95.56  ? 69  ARG Q NH2 1 
ATOM   8938  N N   . HIS F 1 54  ? 42.580  73.360  5.429   1.00 92.65  ? 70  HIS Q N   1 
ATOM   8939  C CA  . HIS F 1 54  ? 42.001  73.619  4.097   1.00 97.03  ? 70  HIS Q CA  1 
ATOM   8940  C C   . HIS F 1 54  ? 40.765  72.768  3.804   1.00 98.04  ? 70  HIS Q C   1 
ATOM   8941  O O   . HIS F 1 54  ? 39.732  73.284  3.362   1.00 96.46  ? 70  HIS Q O   1 
ATOM   8942  C CB  . HIS F 1 54  ? 43.047  73.457  2.973   1.00 102.53 ? 70  HIS Q CB  1 
ATOM   8943  C CG  . HIS F 1 54  ? 42.496  73.649  1.584   1.00 100.45 ? 70  HIS Q CG  1 
ATOM   8944  N ND1 . HIS F 1 54  ? 42.624  74.830  0.883   1.00 94.54  ? 70  HIS Q ND1 1 
ATOM   8945  C CD2 . HIS F 1 54  ? 41.830  72.799  0.765   1.00 96.80  ? 70  HIS Q CD2 1 
ATOM   8946  C CE1 . HIS F 1 54  ? 42.053  74.701  -0.303  1.00 89.04  ? 70  HIS Q CE1 1 
ATOM   8947  N NE2 . HIS F 1 54  ? 41.563  73.480  -0.399  1.00 90.17  ? 70  HIS Q NE2 1 
ATOM   8948  N N   . SER F 1 55  ? 40.889  71.462  4.015   1.00 99.76  ? 71  SER Q N   1 
ATOM   8949  C CA  . SER F 1 55  ? 39.725  70.594  4.002   1.00 103.59 ? 71  SER Q CA  1 
ATOM   8950  C C   . SER F 1 55  ? 39.776  69.612  5.147   1.00 105.62 ? 71  SER Q C   1 
ATOM   8951  O O   . SER F 1 55  ? 40.828  69.049  5.474   1.00 103.32 ? 71  SER Q O   1 
ATOM   8952  C CB  . SER F 1 55  ? 39.559  69.844  2.686   1.00 103.75 ? 71  SER Q CB  1 
ATOM   8953  O OG  . SER F 1 55  ? 38.265  69.250  2.629   1.00 107.18 ? 71  SER Q OG  1 
ATOM   8954  N N   . LEU F 1 56  ? 38.605  69.400  5.730   1.00 109.50 ? 72  LEU Q N   1 
ATOM   8955  C CA  . LEU F 1 56  ? 38.476  68.671  6.982   1.00 110.43 ? 72  LEU Q CA  1 
ATOM   8956  C C   . LEU F 1 56  ? 38.537  67.145  6.758   1.00 113.94 ? 72  LEU Q C   1 
ATOM   8957  O O   . LEU F 1 56  ? 39.267  66.420  7.454   1.00 109.86 ? 72  LEU Q O   1 
ATOM   8958  C CB  . LEU F 1 56  ? 37.193  69.113  7.705   1.00 106.45 ? 72  LEU Q CB  1 
ATOM   8959  C CG  . LEU F 1 56  ? 36.999  70.628  7.880   1.00 101.42 ? 72  LEU Q CG  1 
ATOM   8960  C CD1 . LEU F 1 56  ? 38.004  71.234  8.841   1.00 93.96  ? 72  LEU Q CD1 1 
ATOM   8961  C CD2 . LEU F 1 56  ? 37.044  71.369  6.551   1.00 100.69 ? 72  LEU Q CD2 1 
ATOM   8962  N N   . PHE F 1 57  ? 37.787  66.686  5.762   1.00 116.81 ? 73  PHE Q N   1 
ATOM   8963  C CA  . PHE F 1 57  ? 37.788  65.303  5.338   1.00 114.07 ? 73  PHE Q CA  1 
ATOM   8964  C C   . PHE F 1 57  ? 38.776  65.202  4.209   1.00 115.73 ? 73  PHE Q C   1 
ATOM   8965  O O   . PHE F 1 57  ? 38.956  66.144  3.446   1.00 118.02 ? 73  PHE Q O   1 
ATOM   8966  C CB  . PHE F 1 57  ? 36.392  64.952  4.865   1.00 113.17 ? 73  PHE Q CB  1 
ATOM   8967  C CG  . PHE F 1 57  ? 35.390  65.975  5.255   1.00 121.30 ? 73  PHE Q CG  1 
ATOM   8968  C CD1 . PHE F 1 57  ? 34.801  65.938  6.512   1.00 121.85 ? 73  PHE Q CD1 1 
ATOM   8969  C CD2 . PHE F 1 57  ? 35.095  67.027  4.405   1.00 119.99 ? 73  PHE Q CD2 1 
ATOM   8970  C CE1 . PHE F 1 57  ? 33.887  66.919  6.902   1.00 121.16 ? 73  PHE Q CE1 1 
ATOM   8971  C CE2 . PHE F 1 57  ? 34.186  68.007  4.784   1.00 121.78 ? 73  PHE Q CE2 1 
ATOM   8972  C CZ  . PHE F 1 57  ? 33.577  67.956  6.034   1.00 121.94 ? 73  PHE Q CZ  1 
ATOM   8973  N N   . HIS F 1 58  ? 39.411  64.049  4.085   1.00 116.83 ? 75  HIS Q N   1 
ATOM   8974  C CA  . HIS F 1 58  ? 40.585  63.931  3.210   1.00 113.37 ? 75  HIS Q CA  1 
ATOM   8975  C C   . HIS F 1 58  ? 41.757  64.733  3.815   1.00 116.18 ? 75  HIS Q C   1 
ATOM   8976  O O   . HIS F 1 58  ? 42.430  65.489  3.100   1.00 109.10 ? 75  HIS Q O   1 
ATOM   8977  C CB  . HIS F 1 58  ? 40.314  64.405  1.753   1.00 102.88 ? 75  HIS Q CB  1 
ATOM   8978  C CG  . HIS F 1 58  ? 38.999  63.951  1.171   1.00 104.88 ? 75  HIS Q CG  1 
ATOM   8979  N ND1 . HIS F 1 58  ? 38.180  64.789  0.444   1.00 105.03 ? 75  HIS Q ND1 1 
ATOM   8980  C CD2 . HIS F 1 58  ? 38.367  62.753  1.208   1.00 109.03 ? 75  HIS Q CD2 1 
ATOM   8981  C CE1 . HIS F 1 58  ? 37.094  64.133  0.065   1.00 105.25 ? 75  HIS Q CE1 1 
ATOM   8982  N NE2 . HIS F 1 58  ? 37.184  62.892  0.519   1.00 107.96 ? 75  HIS Q NE2 1 
ATOM   8983  N N   . PRO F 1 59  ? 42.043  64.501  5.116   1.00 120.49 ? 76  PRO Q N   1 
ATOM   8984  C CA  . PRO F 1 59  ? 42.793  65.392  6.022   1.00 119.59 ? 76  PRO Q CA  1 
ATOM   8985  C C   . PRO F 1 59  ? 44.224  65.842  5.657   1.00 119.00 ? 76  PRO Q C   1 
ATOM   8986  O O   . PRO F 1 59  ? 44.698  65.670  4.527   1.00 114.64 ? 76  PRO Q O   1 
ATOM   8987  C CB  . PRO F 1 59  ? 42.802  64.617  7.350   1.00 117.50 ? 76  PRO Q CB  1 
ATOM   8988  C CG  . PRO F 1 59  ? 41.644  63.700  7.266   1.00 117.11 ? 76  PRO Q CG  1 
ATOM   8989  C CD  . PRO F 1 59  ? 41.585  63.289  5.820   1.00 115.50 ? 76  PRO Q CD  1 
ATOM   8990  N N   . GLU F 1 60  ? 44.889  66.414  6.668   1.00 117.41 ? 77  GLU Q N   1 
ATOM   8991  C CA  . GLU F 1 60  ? 46.099  67.232  6.515   1.00 114.26 ? 77  GLU Q CA  1 
ATOM   8992  C C   . GLU F 1 60  ? 47.387  66.544  6.965   1.00 116.04 ? 77  GLU Q C   1 
ATOM   8993  O O   . GLU F 1 60  ? 47.374  65.385  7.377   1.00 114.19 ? 77  GLU Q O   1 
ATOM   8994  C CB  . GLU F 1 60  ? 45.956  68.545  7.305   1.00 113.74 ? 77  GLU Q CB  1 
ATOM   8995  C CG  . GLU F 1 60  ? 46.648  68.551  8.696   1.00 110.17 ? 77  GLU Q CG  1 
ATOM   8996  C CD  . GLU F 1 60  ? 45.757  68.069  9.837   1.00 107.00 ? 77  GLU Q CD  1 
ATOM   8997  O OE1 . GLU F 1 60  ? 44.756  68.755  10.134  1.00 103.39 ? 77  GLU Q OE1 1 
ATOM   8998  O OE2 . GLU F 1 60  ? 46.068  67.022  10.451  1.00 102.82 ? 77  GLU Q OE2 1 
ATOM   8999  N N   . ASP F 1 61  ? 48.490  67.292  6.888   1.00 118.67 ? 78  ASP Q N   1 
ATOM   9000  C CA  . ASP F 1 61  ? 49.818  66.850  7.313   1.00 113.87 ? 78  ASP Q CA  1 
ATOM   9001  C C   . ASP F 1 61  ? 50.419  67.911  8.254   1.00 111.81 ? 78  ASP Q C   1 
ATOM   9002  O O   . ASP F 1 61  ? 51.575  67.812  8.672   1.00 108.47 ? 78  ASP Q O   1 
ATOM   9003  C CB  . ASP F 1 61  ? 50.707  66.655  6.076   1.00 112.58 ? 78  ASP Q CB  1 
ATOM   9004  C CG  . ASP F 1 61  ? 51.986  65.902  6.379   1.00 119.89 ? 78  ASP Q CG  1 
ATOM   9005  O OD1 . ASP F 1 61  ? 51.909  64.686  6.661   1.00 119.56 ? 78  ASP Q OD1 1 
ATOM   9006  O OD2 . ASP F 1 61  ? 53.071  66.523  6.310   1.00 123.22 ? 78  ASP Q OD2 1 
ATOM   9007  N N   . THR F 1 62  ? 49.616  68.921  8.587   1.00 111.94 ? 79  THR Q N   1 
ATOM   9008  C CA  . THR F 1 62  ? 50.098  70.092  9.317   1.00 106.35 ? 79  THR Q CA  1 
ATOM   9009  C C   . THR F 1 62  ? 49.000  70.784  10.121  1.00 103.12 ? 79  THR Q C   1 
ATOM   9010  O O   . THR F 1 62  ? 48.678  71.947  9.872   1.00 100.53 ? 79  THR Q O   1 
ATOM   9011  C CB  . THR F 1 62  ? 50.702  71.137  8.355   1.00 106.16 ? 79  THR Q CB  1 
ATOM   9012  O OG1 . THR F 1 62  ? 51.024  72.331  9.084   1.00 101.32 ? 79  THR Q OG1 1 
ATOM   9013  C CG2 . THR F 1 62  ? 49.723  71.459  7.199   1.00 90.70  ? 79  THR Q CG2 1 
ATOM   9014  N N   . GLY F 1 63  ? 48.429  70.081  11.091  1.00 99.23  ? 80  GLY Q N   1 
ATOM   9015  C CA  . GLY F 1 63  ? 47.380  70.673  11.899  1.00 91.12  ? 80  GLY Q CA  1 
ATOM   9016  C C   . GLY F 1 63  ? 47.851  71.039  13.289  1.00 81.27  ? 80  GLY Q C   1 
ATOM   9017  O O   . GLY F 1 63  ? 48.410  70.197  13.989  1.00 84.16  ? 80  GLY Q O   1 
ATOM   9018  N N   . GLN F 1 64  ? 47.632  72.293  13.681  1.00 73.61  ? 81  GLN Q N   1 
ATOM   9019  C CA  . GLN F 1 64  ? 47.929  72.748  15.039  1.00 69.82  ? 81  GLN Q CA  1 
ATOM   9020  C C   . GLN F 1 64  ? 46.629  72.981  15.832  1.00 66.19  ? 81  GLN Q C   1 
ATOM   9021  O O   . GLN F 1 64  ? 45.572  73.188  15.235  1.00 65.71  ? 81  GLN Q O   1 
ATOM   9022  C CB  . GLN F 1 64  ? 48.772  74.029  15.007  1.00 70.00  ? 81  GLN Q CB  1 
ATOM   9023  C CG  . GLN F 1 64  ? 49.933  74.017  14.008  1.00 73.26  ? 81  GLN Q CG  1 
ATOM   9024  C CD  . GLN F 1 64  ? 50.950  75.171  14.204  1.00 75.14  ? 81  GLN Q CD  1 
ATOM   9025  O OE1 . GLN F 1 64  ? 50.786  76.043  15.066  1.00 72.31  ? 81  GLN Q OE1 1 
ATOM   9026  N NE2 . GLN F 1 64  ? 52.006  75.164  13.391  1.00 73.55  ? 81  GLN Q NE2 1 
ATOM   9027  N N   . VAL F 1 65  ? 46.705  72.925  17.165  1.00 60.17  ? 82  VAL Q N   1 
ATOM   9028  C CA  . VAL F 1 65  ? 45.550  73.201  18.031  1.00 57.68  ? 82  VAL Q CA  1 
ATOM   9029  C C   . VAL F 1 65  ? 45.968  74.097  19.197  1.00 61.01  ? 82  VAL Q C   1 
ATOM   9030  O O   . VAL F 1 65  ? 47.111  74.035  19.627  1.00 65.52  ? 82  VAL Q O   1 
ATOM   9031  C CB  . VAL F 1 65  ? 44.945  71.921  18.614  1.00 51.59  ? 82  VAL Q CB  1 
ATOM   9032  C CG1 . VAL F 1 65  ? 43.738  72.247  19.446  1.00 53.14  ? 82  VAL Q CG1 1 
ATOM   9033  C CG2 . VAL F 1 65  ? 44.563  70.979  17.520  1.00 64.37  ? 82  VAL Q CG2 1 
ATOM   9034  N N   . PHE F 1 66  ? 45.051  74.931  19.693  1.00 61.60  ? 83  PHE Q N   1 
ATOM   9035  C CA  . PHE F 1 66  ? 45.301  75.798  20.849  1.00 57.54  ? 83  PHE Q CA  1 
ATOM   9036  C C   . PHE F 1 66  ? 44.017  76.172  21.537  1.00 58.17  ? 83  PHE Q C   1 
ATOM   9037  O O   . PHE F 1 66  ? 43.029  76.494  20.896  1.00 59.10  ? 83  PHE Q O   1 
ATOM   9038  C CB  . PHE F 1 66  ? 45.962  77.101  20.444  1.00 55.18  ? 83  PHE Q CB  1 
ATOM   9039  C CG  . PHE F 1 66  ? 47.338  76.942  19.957  1.00 58.44  ? 83  PHE Q CG  1 
ATOM   9040  C CD1 . PHE F 1 66  ? 48.324  76.466  20.793  1.00 63.62  ? 83  PHE Q CD1 1 
ATOM   9041  C CD2 . PHE F 1 66  ? 47.664  77.279  18.658  1.00 59.79  ? 83  PHE Q CD2 1 
ATOM   9042  C CE1 . PHE F 1 66  ? 49.618  76.315  20.327  1.00 69.00  ? 83  PHE Q CE1 1 
ATOM   9043  C CE2 . PHE F 1 66  ? 48.948  77.136  18.192  1.00 60.98  ? 83  PHE Q CE2 1 
ATOM   9044  C CZ  . PHE F 1 66  ? 49.928  76.658  19.018  1.00 63.77  ? 83  PHE Q CZ  1 
ATOM   9045  N N   . GLN F 1 67  ? 44.045  76.168  22.854  1.00 59.21  ? 84  GLN Q N   1 
ATOM   9046  C CA  . GLN F 1 67  ? 42.908  76.623  23.622  1.00 61.88  ? 84  GLN Q CA  1 
ATOM   9047  C C   . GLN F 1 67  ? 42.911  78.155  23.799  1.00 66.19  ? 84  GLN Q C   1 
ATOM   9048  O O   . GLN F 1 67  ? 43.941  78.813  23.620  1.00 66.12  ? 84  GLN Q O   1 
ATOM   9049  C CB  . GLN F 1 67  ? 42.867  75.883  24.959  1.00 66.13  ? 84  GLN Q CB  1 
ATOM   9050  C CG  . GLN F 1 67  ? 44.239  75.467  25.500  1.00 68.39  ? 84  GLN Q CG  1 
ATOM   9051  C CD  . GLN F 1 67  ? 44.126  74.466  26.641  1.00 69.97  ? 84  GLN Q CD  1 
ATOM   9052  O OE1 . GLN F 1 67  ? 45.044  73.692  26.909  1.00 63.12  ? 84  GLN Q OE1 1 
ATOM   9053  N NE2 . GLN F 1 67  ? 42.976  74.468  27.307  1.00 72.46  ? 84  GLN Q NE2 1 
ATOM   9054  N N   . VAL F 1 68  ? 41.750  78.718  24.134  1.00 66.71  ? 85  VAL Q N   1 
ATOM   9055  C CA  . VAL F 1 68  ? 41.591  80.167  24.251  1.00 67.15  ? 85  VAL Q CA  1 
ATOM   9056  C C   . VAL F 1 68  ? 41.750  80.651  25.663  1.00 66.97  ? 85  VAL Q C   1 
ATOM   9057  O O   . VAL F 1 68  ? 40.796  80.572  26.422  1.00 70.00  ? 85  VAL Q O   1 
ATOM   9058  C CB  . VAL F 1 68  ? 40.183  80.578  23.877  1.00 62.97  ? 85  VAL Q CB  1 
ATOM   9059  C CG1 . VAL F 1 68  ? 40.089  82.099  23.764  1.00 61.62  ? 85  VAL Q CG1 1 
ATOM   9060  C CG2 . VAL F 1 68  ? 39.808  79.931  22.588  1.00 66.48  ? 85  VAL Q CG2 1 
ATOM   9061  N N   . SER F 1 69  ? 42.911  81.186  26.022  1.00 65.30  ? 86  SER Q N   1 
ATOM   9062  C CA  . SER F 1 69  ? 43.115  81.594  27.406  1.00 69.51  ? 86  SER Q CA  1 
ATOM   9063  C C   . SER F 1 69  ? 42.148  82.702  27.812  1.00 70.44  ? 86  SER Q C   1 
ATOM   9064  O O   . SER F 1 69  ? 41.602  82.680  28.915  1.00 69.16  ? 86  SER Q O   1 
ATOM   9065  C CB  . SER F 1 69  ? 44.556  82.030  27.644  1.00 74.98  ? 86  SER Q CB  1 
ATOM   9066  O OG  . SER F 1 69  ? 44.680  83.434  27.594  1.00 76.10  ? 86  SER Q OG  1 
ATOM   9067  N N   . HIS F 1 70  ? 41.932  83.658  26.908  1.00 74.67  ? 87  HIS Q N   1 
ATOM   9068  C CA  . HIS F 1 70  ? 41.056  84.813  27.170  1.00 80.42  ? 87  HIS Q CA  1 
ATOM   9069  C C   . HIS F 1 70  ? 40.412  85.431  25.897  1.00 80.93  ? 87  HIS Q C   1 
ATOM   9070  O O   . HIS F 1 70  ? 40.745  85.045  24.765  1.00 79.21  ? 87  HIS Q O   1 
ATOM   9071  C CB  . HIS F 1 70  ? 41.819  85.889  27.955  1.00 79.75  ? 87  HIS Q CB  1 
ATOM   9072  C CG  . HIS F 1 70  ? 40.934  86.785  28.763  1.00 79.63  ? 87  HIS Q CG  1 
ATOM   9073  N ND1 . HIS F 1 70  ? 40.873  88.146  28.566  1.00 78.81  ? 87  HIS Q ND1 1 
ATOM   9074  C CD2 . HIS F 1 70  ? 40.062  86.509  29.760  1.00 77.12  ? 87  HIS Q CD2 1 
ATOM   9075  C CE1 . HIS F 1 70  ? 40.011  88.674  29.416  1.00 77.12  ? 87  HIS Q CE1 1 
ATOM   9076  N NE2 . HIS F 1 70  ? 39.505  87.701  30.152  1.00 75.97  ? 87  HIS Q NE2 1 
ATOM   9077  N N   . SER F 1 71  ? 39.496  86.384  26.086  1.00 77.48  ? 88  SER Q N   1 
ATOM   9078  C CA  . SER F 1 71  ? 38.795  87.011  24.960  1.00 74.39  ? 88  SER Q CA  1 
ATOM   9079  C C   . SER F 1 71  ? 38.216  88.370  25.321  1.00 76.49  ? 88  SER Q C   1 
ATOM   9080  O O   . SER F 1 71  ? 37.617  88.518  26.380  1.00 80.72  ? 88  SER Q O   1 
ATOM   9081  C CB  . SER F 1 71  ? 37.670  86.105  24.474  1.00 69.36  ? 88  SER Q CB  1 
ATOM   9082  O OG  . SER F 1 71  ? 37.079  85.436  25.572  1.00 78.14  ? 88  SER Q OG  1 
ATOM   9083  N N   . PHE F 1 72  ? 38.388  89.354  24.439  1.00 75.07  ? 89  PHE Q N   1 
ATOM   9084  C CA  . PHE F 1 72  ? 37.872  90.700  24.674  1.00 74.85  ? 89  PHE Q CA  1 
ATOM   9085  C C   . PHE F 1 72  ? 37.085  91.223  23.488  1.00 79.97  ? 89  PHE Q C   1 
ATOM   9086  O O   . PHE F 1 72  ? 37.622  91.318  22.379  1.00 79.00  ? 89  PHE Q O   1 
ATOM   9087  C CB  . PHE F 1 72  ? 39.006  91.681  24.926  1.00 77.71  ? 89  PHE Q CB  1 
ATOM   9088  C CG  . PHE F 1 72  ? 40.242  91.052  25.467  1.00 80.96  ? 89  PHE Q CG  1 
ATOM   9089  C CD1 . PHE F 1 72  ? 41.094  90.348  24.628  1.00 77.39  ? 89  PHE Q CD1 1 
ATOM   9090  C CD2 . PHE F 1 72  ? 40.570  91.179  26.811  1.00 79.62  ? 89  PHE Q CD2 1 
ATOM   9091  C CE1 . PHE F 1 72  ? 42.245  89.769  25.122  1.00 79.50  ? 89  PHE Q CE1 1 
ATOM   9092  C CE2 . PHE F 1 72  ? 41.721  90.610  27.313  1.00 82.00  ? 89  PHE Q CE2 1 
ATOM   9093  C CZ  . PHE F 1 72  ? 42.562  89.899  26.469  1.00 84.38  ? 89  PHE Q CZ  1 
ATOM   9094  N N   . PRO F 1 73  ? 35.811  91.573  23.721  1.00 79.02  ? 90  PRO Q N   1 
ATOM   9095  C CA  . PRO F 1 73  ? 34.978  92.230  22.720  1.00 76.67  ? 90  PRO Q CA  1 
ATOM   9096  C C   . PRO F 1 73  ? 35.117  93.728  22.877  1.00 82.86  ? 90  PRO Q C   1 
ATOM   9097  O O   . PRO F 1 73  ? 35.297  94.202  23.996  1.00 84.83  ? 90  PRO Q O   1 
ATOM   9098  C CB  . PRO F 1 73  ? 33.560  91.816  23.122  1.00 76.14  ? 90  PRO Q CB  1 
ATOM   9099  C CG  . PRO F 1 73  ? 33.719  90.832  24.251  1.00 76.61  ? 90  PRO Q CG  1 
ATOM   9100  C CD  . PRO F 1 73  ? 35.017  91.167  24.883  1.00 77.60  ? 90  PRO Q CD  1 
ATOM   9101  N N   . HIS F 1 74  ? 35.048  94.458  21.771  1.00 86.55  ? 91  HIS Q N   1 
ATOM   9102  C CA  . HIS F 1 74  ? 35.041  95.911  21.812  1.00 91.62  ? 91  HIS Q CA  1 
ATOM   9103  C C   . HIS F 1 74  ? 33.953  96.412  22.753  1.00 95.86  ? 91  HIS Q C   1 
ATOM   9104  O O   . HIS F 1 74  ? 32.792  96.030  22.625  1.00 97.11  ? 91  HIS Q O   1 
ATOM   9105  C CB  . HIS F 1 74  ? 34.804  96.487  20.419  1.00 93.81  ? 91  HIS Q CB  1 
ATOM   9106  C CG  . HIS F 1 74  ? 35.159  97.932  20.308  1.00 93.73  ? 91  HIS Q CG  1 
ATOM   9107  N ND1 . HIS F 1 74  ? 34.325  98.936  20.744  1.00 93.77  ? 91  HIS Q ND1 1 
ATOM   9108  C CD2 . HIS F 1 74  ? 36.271  98.540  19.836  1.00 89.92  ? 91  HIS Q CD2 1 
ATOM   9109  C CE1 . HIS F 1 74  ? 34.906  100.103 20.540  1.00 94.69  ? 91  HIS Q CE1 1 
ATOM   9110  N NE2 . HIS F 1 74  ? 36.085  99.891  19.984  1.00 92.17  ? 91  HIS Q NE2 1 
ATOM   9111  N N   . PRO F 1 75  ? 34.327  97.278  23.705  1.00 102.46 ? 92  PRO Q N   1 
ATOM   9112  C CA  . PRO F 1 75  ? 33.383  97.804  24.698  1.00 101.64 ? 92  PRO Q CA  1 
ATOM   9113  C C   . PRO F 1 75  ? 32.181  98.483  24.056  1.00 100.24 ? 92  PRO Q C   1 
ATOM   9114  O O   . PRO F 1 75  ? 31.047  98.234  24.468  1.00 98.81  ? 92  PRO Q O   1 
ATOM   9115  C CB  . PRO F 1 75  ? 34.223  98.832  25.461  1.00 103.73 ? 92  PRO Q CB  1 
ATOM   9116  C CG  . PRO F 1 75  ? 35.631  98.330  25.328  1.00 103.74 ? 92  PRO Q CG  1 
ATOM   9117  C CD  . PRO F 1 75  ? 35.703  97.753  23.940  1.00 100.38 ? 92  PRO Q CD  1 
ATOM   9118  N N   . LEU F 1 76  ? 32.434  99.320  23.054  1.00 104.18 ? 93  LEU Q N   1 
ATOM   9119  C CA  . LEU F 1 76  ? 31.379  100.110 22.423  1.00 105.57 ? 93  LEU Q CA  1 
ATOM   9120  C C   . LEU F 1 76  ? 30.285  99.266  21.751  1.00 110.17 ? 93  LEU Q C   1 
ATOM   9121  O O   . LEU F 1 76  ? 29.165  99.743  21.573  1.00 118.68 ? 93  LEU Q O   1 
ATOM   9122  C CB  . LEU F 1 76  ? 31.966  101.127 21.436  1.00 101.98 ? 93  LEU Q CB  1 
ATOM   9123  C CG  . LEU F 1 76  ? 32.987  102.135 21.966  1.00 96.54  ? 93  LEU Q CG  1 
ATOM   9124  C CD1 . LEU F 1 76  ? 33.253  103.233 20.936  1.00 96.06  ? 93  LEU Q CD1 1 
ATOM   9125  C CD2 . LEU F 1 76  ? 32.503  102.732 23.262  1.00 97.61  ? 93  LEU Q CD2 1 
ATOM   9126  N N   . TYR F 1 77  ? 30.605  98.028  21.374  1.00 108.06 ? 94  TYR Q N   1 
ATOM   9127  C CA  . TYR F 1 77  ? 29.586  97.084  20.904  1.00 108.12 ? 94  TYR Q CA  1 
ATOM   9128  C C   . TYR F 1 77  ? 28.744  96.634  22.079  1.00 112.74 ? 94  TYR Q C   1 
ATOM   9129  O O   . TYR F 1 77  ? 29.269  96.392  23.166  1.00 111.53 ? 94  TYR Q O   1 
ATOM   9130  C CB  . TYR F 1 77  ? 30.229  95.851  20.280  1.00 108.48 ? 94  TYR Q CB  1 
ATOM   9131  C CG  . TYR F 1 77  ? 29.257  94.732  19.946  1.00 108.55 ? 94  TYR Q CG  1 
ATOM   9132  C CD1 . TYR F 1 77  ? 29.037  94.349  18.631  1.00 109.42 ? 94  TYR Q CD1 1 
ATOM   9133  C CD2 . TYR F 1 77  ? 28.568  94.056  20.939  1.00 111.47 ? 94  TYR Q CD2 1 
ATOM   9134  C CE1 . TYR F 1 77  ? 28.161  93.325  18.310  1.00 110.45 ? 94  TYR Q CE1 1 
ATOM   9135  C CE2 . TYR F 1 77  ? 27.683  93.031  20.629  1.00 117.49 ? 94  TYR Q CE2 1 
ATOM   9136  C CZ  . TYR F 1 77  ? 27.485  92.668  19.309  1.00 115.78 ? 94  TYR Q CZ  1 
ATOM   9137  O OH  . TYR F 1 77  ? 26.611  91.653  18.981  1.00 114.93 ? 94  TYR Q OH  1 
ATOM   9138  N N   . ASP F 1 78  ? 27.441  96.500  21.863  1.00 116.57 ? 95  ASP Q N   1 
ATOM   9139  C CA  . ASP F 1 78  ? 26.557  96.091  22.948  1.00 123.85 ? 95  ASP Q CA  1 
ATOM   9140  C C   . ASP F 1 78  ? 26.084  94.655  22.774  1.00 120.42 ? 95  ASP Q C   1 
ATOM   9141  O O   . ASP F 1 78  ? 25.544  94.274  21.737  1.00 115.67 ? 95  ASP Q O   1 
ATOM   9142  C CB  . ASP F 1 78  ? 25.374  97.052  23.108  1.00 129.71 ? 95  ASP Q CB  1 
ATOM   9143  C CG  . ASP F 1 78  ? 24.522  97.139  21.862  1.00 128.24 ? 95  ASP Q CG  1 
ATOM   9144  O OD1 . ASP F 1 78  ? 24.909  96.518  20.845  1.00 123.49 ? 95  ASP Q OD1 1 
ATOM   9145  O OD2 . ASP F 1 78  ? 23.473  97.827  21.904  1.00 126.49 ? 95  ASP Q OD2 1 
ATOM   9146  N N   . MET F 1 79  A 26.306  93.863  23.812  1.00 121.32 ? 95  MET Q N   1 
ATOM   9147  C CA  . MET F 1 79  A 26.031  92.442  23.755  1.00 122.78 ? 95  MET Q CA  1 
ATOM   9148  C C   . MET F 1 79  A 24.549  92.195  23.985  1.00 126.09 ? 95  MET Q C   1 
ATOM   9149  O O   . MET F 1 79  A 24.096  91.050  24.009  1.00 126.80 ? 95  MET Q O   1 
ATOM   9150  C CB  . MET F 1 79  A 26.863  91.706  24.811  1.00 125.81 ? 95  MET Q CB  1 
ATOM   9151  C CG  . MET F 1 79  A 27.550  90.435  24.311  1.00 129.26 ? 95  MET Q CG  1 
ATOM   9152  S SD  . MET F 1 79  A 28.880  90.724  23.119  1.00 119.10 ? 95  MET Q SD  1 
ATOM   9153  C CE  . MET F 1 79  A 29.085  89.082  22.444  1.00 114.81 ? 95  MET Q CE  1 
ATOM   9154  N N   . SER F 1 80  B 23.796  93.277  24.153  1.00 127.93 ? 95  SER Q N   1 
ATOM   9155  C CA  . SER F 1 80  B 22.373  93.175  24.444  1.00 131.01 ? 95  SER Q CA  1 
ATOM   9156  C C   . SER F 1 80  B 21.675  92.280  23.425  1.00 127.87 ? 95  SER Q C   1 
ATOM   9157  O O   . SER F 1 80  B 20.554  91.816  23.647  1.00 127.63 ? 95  SER Q O   1 
ATOM   9158  C CB  . SER F 1 80  B 21.736  94.573  24.444  1.00 131.78 ? 95  SER Q CB  1 
ATOM   9159  O OG  . SER F 1 80  B 20.335  94.509  24.680  1.00 136.11 ? 95  SER Q OG  1 
ATOM   9160  N N   . LEU F 1 81  C 22.377  92.001  22.333  1.00 120.94 ? 95  LEU Q N   1 
ATOM   9161  C CA  . LEU F 1 81  C 21.736  91.611  21.087  1.00 120.81 ? 95  LEU Q CA  1 
ATOM   9162  C C   . LEU F 1 81  C 21.552  90.116  20.827  1.00 119.43 ? 95  LEU Q C   1 
ATOM   9163  O O   . LEU F 1 81  C 20.649  89.724  20.095  1.00 123.15 ? 95  LEU Q O   1 
ATOM   9164  C CB  . LEU F 1 81  C 22.481  92.257  19.919  1.00 122.76 ? 95  LEU Q CB  1 
ATOM   9165  C CG  . LEU F 1 81  C 22.390  93.783  19.819  1.00 120.06 ? 95  LEU Q CG  1 
ATOM   9166  C CD1 . LEU F 1 81  C 22.825  94.467  21.106  1.00 120.88 ? 95  LEU Q CD1 1 
ATOM   9167  C CD2 . LEU F 1 81  C 23.210  94.280  18.639  1.00 121.77 ? 95  LEU Q CD2 1 
ATOM   9168  N N   . LEU F 1 82  D 22.398  89.282  21.412  1.00 120.28 ? 95  LEU Q N   1 
ATOM   9169  C CA  . LEU F 1 82  D 22.387  87.863  21.080  1.00 120.61 ? 95  LEU Q CA  1 
ATOM   9170  C C   . LEU F 1 82  D 21.270  87.087  21.758  1.00 124.71 ? 95  LEU Q C   1 
ATOM   9171  O O   . LEU F 1 82  D 20.873  86.032  21.277  1.00 125.44 ? 95  LEU Q O   1 
ATOM   9172  C CB  . LEU F 1 82  D 23.719  87.225  21.443  1.00 119.12 ? 95  LEU Q CB  1 
ATOM   9173  C CG  . LEU F 1 82  D 24.929  88.063  21.057  1.00 116.15 ? 95  LEU Q CG  1 
ATOM   9174  C CD1 . LEU F 1 82  D 25.784  88.308  22.284  1.00 113.64 ? 95  LEU Q CD1 1 
ATOM   9175  C CD2 . LEU F 1 82  D 25.707  87.365  19.966  1.00 114.57 ? 95  LEU Q CD2 1 
ATOM   9176  N N   . LYS F 1 83  E 20.771  87.595  22.878  1.00 130.06 ? 95  LYS Q N   1 
ATOM   9177  C CA  . LYS F 1 83  E 19.791  86.845  23.657  1.00 135.97 ? 95  LYS Q CA  1 
ATOM   9178  C C   . LYS F 1 83  E 18.430  86.854  22.986  1.00 136.99 ? 95  LYS Q C   1 
ATOM   9179  O O   . LYS F 1 83  E 17.717  85.853  22.988  1.00 137.25 ? 95  LYS Q O   1 
ATOM   9180  C CB  . LYS F 1 83  E 19.683  87.383  25.084  1.00 136.44 ? 95  LYS Q CB  1 
ATOM   9181  C CG  . LYS F 1 83  E 19.224  86.340  26.090  1.00 137.48 ? 95  LYS Q CG  1 
ATOM   9182  C CD  . LYS F 1 83  E 18.806  86.994  27.396  1.00 142.59 ? 95  LYS Q CD  1 
ATOM   9183  C CE  . LYS F 1 83  E 17.747  86.166  28.084  1.00 148.31 ? 95  LYS Q CE  1 
ATOM   9184  N NZ  . LYS F 1 83  E 17.932  84.730  27.736  1.00 147.00 ? 95  LYS Q NZ  1 
ATOM   9185  N N   . ASN F 1 84  F 18.074  87.993  22.411  1.00 136.59 ? 95  ASN Q N   1 
ATOM   9186  C CA  . ASN F 1 84  F 16.820  88.103  21.691  1.00 144.98 ? 95  ASN Q CA  1 
ATOM   9187  C C   . ASN F 1 84  F 16.828  87.193  20.466  1.00 145.76 ? 95  ASN Q C   1 
ATOM   9188  O O   . ASN F 1 84  F 15.802  86.624  20.089  1.00 146.34 ? 95  ASN Q O   1 
ATOM   9189  C CB  . ASN F 1 84  F 16.581  89.553  21.274  1.00 147.73 ? 95  ASN Q CB  1 
ATOM   9190  C CG  . ASN F 1 84  F 15.110  89.914  21.246  1.00 151.96 ? 95  ASN Q CG  1 
ATOM   9191  O OD1 . ASN F 1 84  F 14.581  90.333  20.219  1.00 151.94 ? 95  ASN Q OD1 1 
ATOM   9192  N ND2 . ASN F 1 84  F 14.439  89.747  22.379  1.00 152.19 ? 95  ASN Q ND2 1 
ATOM   9193  N N   . ARG F 1 85  G 18.007  87.055  19.868  1.00 144.25 ? 95  ARG Q N   1 
ATOM   9194  C CA  . ARG F 1 85  G 18.199  86.297  18.630  1.00 148.96 ? 95  ARG Q CA  1 
ATOM   9195  C C   . ARG F 1 85  G 17.491  86.930  17.441  1.00 152.86 ? 95  ARG Q C   1 
ATOM   9196  O O   . ARG F 1 85  G 18.124  87.310  16.452  1.00 153.59 ? 95  ARG Q O   1 
ATOM   9197  C CB  . ARG F 1 85  G 17.745  84.846  18.779  1.00 148.93 ? 95  ARG Q CB  1 
ATOM   9198  C CG  . ARG F 1 85  G 17.748  84.085  17.458  1.00 150.61 ? 95  ARG Q CG  1 
ATOM   9199  C CD  . ARG F 1 85  G 19.121  84.123  16.795  1.00 145.58 ? 95  ARG Q CD  1 
ATOM   9200  N NE  . ARG F 1 85  G 19.033  84.343  15.354  1.00 149.10 ? 95  ARG Q NE  1 
ATOM   9201  C CZ  . ARG F 1 85  G 18.560  83.452  14.488  1.00 149.25 ? 95  ARG Q CZ  1 
ATOM   9202  N NH1 . ARG F 1 85  G 18.521  83.737  13.194  1.00 148.41 ? 95  ARG Q NH1 1 
ATOM   9203  N NH2 . ARG F 1 85  G 18.120  82.277  14.916  1.00 148.55 ? 95  ARG Q NH2 1 
ATOM   9204  N N   . PHE F 1 86  H 16.169  87.006  17.540  1.00 154.92 ? 95  PHE Q N   1 
ATOM   9205  C CA  . PHE F 1 86  H 15.340  87.651  16.535  1.00 155.42 ? 95  PHE Q CA  1 
ATOM   9206  C C   . PHE F 1 86  H 15.504  89.162  16.705  1.00 157.11 ? 95  PHE Q C   1 
ATOM   9207  O O   . PHE F 1 86  H 15.007  89.734  17.677  1.00 157.21 ? 95  PHE Q O   1 
ATOM   9208  C CB  . PHE F 1 86  H 13.881  87.221  16.732  1.00 152.68 ? 95  PHE Q CB  1 
ATOM   9209  C CG  . PHE F 1 86  H 13.726  85.761  17.090  1.00 153.94 ? 95  PHE Q CG  1 
ATOM   9210  C CD1 . PHE F 1 86  H 13.423  84.816  16.120  1.00 151.36 ? 95  PHE Q CD1 1 
ATOM   9211  C CD2 . PHE F 1 86  H 13.904  85.334  18.397  1.00 152.90 ? 95  PHE Q CD2 1 
ATOM   9212  C CE1 . PHE F 1 86  H 13.291  83.477  16.452  1.00 148.84 ? 95  PHE Q CE1 1 
ATOM   9213  C CE2 . PHE F 1 86  H 13.777  84.000  18.731  1.00 151.00 ? 95  PHE Q CE2 1 
ATOM   9214  C CZ  . PHE F 1 86  H 13.469  83.071  17.758  1.00 148.37 ? 95  PHE Q CZ  1 
ATOM   9215  N N   . LEU F 1 87  I 16.217  89.802  15.776  1.00 156.32 ? 95  LEU Q N   1 
ATOM   9216  C CA  . LEU F 1 87  I 16.609  91.208  15.932  1.00 151.44 ? 95  LEU Q CA  1 
ATOM   9217  C C   . LEU F 1 87  I 15.572  92.204  15.409  1.00 150.52 ? 95  LEU Q C   1 
ATOM   9218  O O   . LEU F 1 87  I 15.157  92.134  14.251  1.00 151.07 ? 95  LEU Q O   1 
ATOM   9219  C CB  . LEU F 1 87  I 17.970  91.467  15.266  1.00 146.49 ? 95  LEU Q CB  1 
ATOM   9220  C CG  . LEU F 1 87  I 18.062  91.559  13.741  1.00 139.87 ? 95  LEU Q CG  1 
ATOM   9221  C CD1 . LEU F 1 87  I 17.941  93.007  13.286  1.00 142.41 ? 95  LEU Q CD1 1 
ATOM   9222  C CD2 . LEU F 1 87  I 19.372  90.968  13.261  1.00 134.04 ? 95  LEU Q CD2 1 
ATOM   9223  N N   . ARG F 1 88  J 15.152  93.128  16.268  1.00 147.18 ? 95  ARG Q N   1 
ATOM   9224  C CA  . ARG F 1 88  J 14.258  94.194  15.835  1.00 146.05 ? 95  ARG Q CA  1 
ATOM   9225  C C   . ARG F 1 88  J 15.057  95.242  15.059  1.00 146.37 ? 95  ARG Q C   1 
ATOM   9226  O O   . ARG F 1 88  J 16.158  95.621  15.470  1.00 141.88 ? 95  ARG Q O   1 
ATOM   9227  C CB  . ARG F 1 88  J 13.512  94.821  17.016  1.00 139.75 ? 95  ARG Q CB  1 
ATOM   9228  C CG  . ARG F 1 88  J 12.445  93.926  17.626  1.00 136.43 ? 95  ARG Q CG  1 
ATOM   9229  C CD  . ARG F 1 88  J 13.060  92.914  18.578  1.00 146.25 ? 95  ARG Q CD  1 
ATOM   9230  N NE  . ARG F 1 88  J 12.052  92.072  19.218  1.00 150.56 ? 95  ARG Q NE  1 
ATOM   9231  C CZ  . ARG F 1 88  J 12.035  91.769  20.514  1.00 148.56 ? 95  ARG Q CZ  1 
ATOM   9232  N NH1 . ARG F 1 88  J 11.076  90.992  21.002  1.00 143.73 ? 95  ARG Q NH1 1 
ATOM   9233  N NH2 . ARG F 1 88  J 12.974  92.239  21.325  1.00 149.14 ? 95  ARG Q NH2 1 
ATOM   9234  N N   . PRO F 1 89  K 14.502  95.699  13.923  1.00 147.20 ? 95  PRO Q N   1 
ATOM   9235  C CA  . PRO F 1 89  K 15.124  96.583  12.924  1.00 139.86 ? 95  PRO Q CA  1 
ATOM   9236  C C   . PRO F 1 89  K 15.752  97.878  13.450  1.00 132.44 ? 95  PRO Q C   1 
ATOM   9237  O O   . PRO F 1 89  K 16.618  98.428  12.769  1.00 130.71 ? 95  PRO Q O   1 
ATOM   9238  C CB  . PRO F 1 89  K 13.963  96.905  11.980  1.00 136.59 ? 95  PRO Q CB  1 
ATOM   9239  C CG  . PRO F 1 89  K 13.079  95.714  12.076  1.00 138.24 ? 95  PRO Q CG  1 
ATOM   9240  C CD  . PRO F 1 89  K 13.158  95.260  13.501  1.00 142.99 ? 95  PRO Q CD  1 
ATOM   9241  N N   . GLY F 1 90  ? 15.329  98.354  14.617  1.00 130.23 ? 96  GLY Q N   1 
ATOM   9242  C CA  . GLY F 1 90  ? 15.848  99.594  15.166  1.00 130.29 ? 96  GLY Q CA  1 
ATOM   9243  C C   . GLY F 1 90  ? 17.208  99.441  15.824  1.00 135.20 ? 96  GLY Q C   1 
ATOM   9244  O O   . GLY F 1 90  ? 17.593  100.260 16.657  1.00 135.57 ? 96  GLY Q O   1 
ATOM   9245  N N   . ASP F 1 91  ? 17.941  98.401  15.427  1.00 137.11 ? 97  ASP Q N   1 
ATOM   9246  C CA  . ASP F 1 91  ? 19.195  98.007  16.079  1.00 133.48 ? 97  ASP Q CA  1 
ATOM   9247  C C   . ASP F 1 91  ? 20.473  98.445  15.356  1.00 130.50 ? 97  ASP Q C   1 
ATOM   9248  O O   . ASP F 1 91  ? 20.465  98.762  14.167  1.00 130.58 ? 97  ASP Q O   1 
ATOM   9249  C CB  . ASP F 1 91  ? 19.228  96.484  16.276  1.00 130.65 ? 97  ASP Q CB  1 
ATOM   9250  C CG  . ASP F 1 91  ? 18.886  96.072  17.692  1.00 133.06 ? 97  ASP Q CG  1 
ATOM   9251  O OD1 . ASP F 1 91  ? 19.449  96.677  18.629  1.00 131.84 ? 97  ASP Q OD1 1 
ATOM   9252  O OD2 . ASP F 1 91  ? 18.065  95.143  17.866  1.00 135.20 ? 97  ASP Q OD2 1 
ATOM   9253  N N   . ASP F 1 92  ? 21.574  98.440  16.096  1.00 127.23 ? 98  ASP Q N   1 
ATOM   9254  C CA  . ASP F 1 92  ? 22.892  98.711  15.540  1.00 125.14 ? 98  ASP Q CA  1 
ATOM   9255  C C   . ASP F 1 92  ? 23.840  97.647  16.096  1.00 119.89 ? 98  ASP Q C   1 
ATOM   9256  O O   . ASP F 1 92  ? 23.754  97.281  17.264  1.00 122.64 ? 98  ASP Q O   1 
ATOM   9257  C CB  . ASP F 1 92  ? 23.348  100.132 15.920  1.00 124.10 ? 98  ASP Q CB  1 
ATOM   9258  C CG  . ASP F 1 92  ? 24.568  100.602 15.129  1.00 123.07 ? 98  ASP Q CG  1 
ATOM   9259  O OD1 . ASP F 1 92  ? 25.003  99.882  14.205  1.00 122.34 ? 98  ASP Q OD1 1 
ATOM   9260  O OD2 . ASP F 1 92  ? 25.093  101.698 15.437  1.00 119.96 ? 98  ASP Q OD2 1 
ATOM   9261  N N   . SER F 1 93  ? 24.719  97.119  15.256  1.00 114.08 ? 99  SER Q N   1 
ATOM   9262  C CA  . SER F 1 93  ? 25.710  96.167  15.720  1.00 108.49 ? 99  SER Q CA  1 
ATOM   9263  C C   . SER F 1 93  ? 27.002  96.515  15.026  1.00 106.59 ? 99  SER Q C   1 
ATOM   9264  O O   . SER F 1 93  ? 27.607  95.683  14.359  1.00 105.55 ? 99  SER Q O   1 
ATOM   9265  C CB  . SER F 1 93  ? 25.290  94.756  15.352  1.00 106.25 ? 99  SER Q CB  1 
ATOM   9266  O OG  . SER F 1 93  ? 25.184  94.643  13.946  1.00 105.40 ? 99  SER Q OG  1 
ATOM   9267  N N   . SER F 1 94  ? 27.419  97.762  15.185  1.00 107.28 ? 100 SER Q N   1 
ATOM   9268  C CA  . SER F 1 94  ? 28.472  98.308  14.343  1.00 112.48 ? 100 SER Q CA  1 
ATOM   9269  C C   . SER F 1 94  ? 29.875  98.077  14.879  1.00 107.21 ? 100 SER Q C   1 
ATOM   9270  O O   . SER F 1 94  ? 30.855  98.212  14.145  1.00 105.92 ? 100 SER Q O   1 
ATOM   9271  C CB  . SER F 1 94  ? 28.239  99.803  14.086  1.00 115.48 ? 100 SER Q CB  1 
ATOM   9272  O OG  . SER F 1 94  ? 28.109  100.532 15.298  1.00 117.95 ? 100 SER Q OG  1 
ATOM   9273  N N   . HIS F 1 95  ? 29.990  97.717  16.147  1.00 99.39  ? 101 HIS Q N   1 
ATOM   9274  C CA  . HIS F 1 95  ? 31.322  97.618  16.714  1.00 101.94 ? 101 HIS Q CA  1 
ATOM   9275  C C   . HIS F 1 95  ? 31.872  96.206  16.917  1.00 102.40 ? 101 HIS Q C   1 
ATOM   9276  O O   . HIS F 1 95  ? 32.979  96.059  17.442  1.00 98.19  ? 101 HIS Q O   1 
ATOM   9277  C CB  . HIS F 1 95  ? 31.410  98.415  18.011  1.00 104.91 ? 101 HIS Q CB  1 
ATOM   9278  C CG  . HIS F 1 95  ? 31.466  99.897  17.795  1.00 105.72 ? 101 HIS Q CG  1 
ATOM   9279  N ND1 . HIS F 1 95  ? 32.283  100.473 16.857  1.00 100.12 ? 101 HIS Q ND1 1 
ATOM   9280  C CD2 . HIS F 1 95  ? 30.807  100.910 18.407  1.00 107.12 ? 101 HIS Q CD2 1 
ATOM   9281  C CE1 . HIS F 1 95  ? 32.134  101.791 16.894  1.00 101.02 ? 101 HIS Q CE1 1 
ATOM   9282  N NE2 . HIS F 1 95  ? 31.246  102.077 17.826  1.00 102.98 ? 101 HIS Q NE2 1 
ATOM   9283  N N   . ASP F 1 96  ? 31.134  95.174  16.499  1.00 101.32 ? 102 ASP Q N   1 
ATOM   9284  C CA  . ASP F 1 96  ? 31.587  93.802  16.782  1.00 99.08  ? 102 ASP Q CA  1 
ATOM   9285  C C   . ASP F 1 96  ? 32.905  93.395  16.106  1.00 93.63  ? 102 ASP Q C   1 
ATOM   9286  O O   . ASP F 1 96  ? 32.999  93.185  14.891  1.00 89.60  ? 102 ASP Q O   1 
ATOM   9287  C CB  . ASP F 1 96  ? 30.475  92.733  16.663  1.00 103.00 ? 102 ASP Q CB  1 
ATOM   9288  C CG  . ASP F 1 96  ? 30.059  92.449  15.239  1.00 108.98 ? 102 ASP Q CG  1 
ATOM   9289  O OD1 . ASP F 1 96  ? 30.515  93.173  14.323  1.00 112.28 ? 102 ASP Q OD1 1 
ATOM   9290  O OD2 . ASP F 1 96  ? 29.267  91.491  15.046  1.00 107.25 ? 102 ASP Q OD2 1 
ATOM   9291  N N   . LEU F 1 97  ? 33.918  93.300  16.952  1.00 86.09  ? 103 LEU Q N   1 
ATOM   9292  C CA  . LEU F 1 97  ? 35.271  93.041  16.548  1.00 78.62  ? 103 LEU Q CA  1 
ATOM   9293  C C   . LEU F 1 97  ? 35.934  92.634  17.835  1.00 82.07  ? 103 LEU Q C   1 
ATOM   9294  O O   . LEU F 1 97  ? 36.203  93.484  18.687  1.00 80.08  ? 103 LEU Q O   1 
ATOM   9295  C CB  . LEU F 1 97  ? 35.926  94.314  16.030  1.00 75.26  ? 103 LEU Q CB  1 
ATOM   9296  C CG  . LEU F 1 97  ? 37.249  94.075  15.309  1.00 75.82  ? 103 LEU Q CG  1 
ATOM   9297  C CD1 . LEU F 1 97  ? 37.044  93.138  14.129  1.00 73.52  ? 103 LEU Q CD1 1 
ATOM   9298  C CD2 . LEU F 1 97  ? 37.871  95.383  14.855  1.00 75.96  ? 103 LEU Q CD2 1 
ATOM   9299  N N   . MET F 1 98  ? 36.173  91.333  17.989  1.00 88.14  ? 104 MET Q N   1 
ATOM   9300  C CA  . MET F 1 98  ? 36.790  90.785  19.205  1.00 82.82  ? 104 MET Q CA  1 
ATOM   9301  C C   . MET F 1 98  ? 38.196  90.208  19.030  1.00 71.97  ? 104 MET Q C   1 
ATOM   9302  O O   . MET F 1 98  ? 38.528  89.630  17.990  1.00 66.50  ? 104 MET Q O   1 
ATOM   9303  C CB  . MET F 1 98  ? 35.895  89.713  19.812  1.00 78.22  ? 104 MET Q CB  1 
ATOM   9304  C CG  . MET F 1 98  ? 36.605  88.807  20.765  1.00 71.36  ? 104 MET Q CG  1 
ATOM   9305  S SD  . MET F 1 98  ? 35.458  87.566  21.334  1.00 77.96  ? 104 MET Q SD  1 
ATOM   9306  C CE  . MET F 1 98  ? 34.839  86.926  19.779  1.00 80.97  ? 104 MET Q CE  1 
ATOM   9307  N N   . LEU F 1 99  ? 39.004  90.360  20.077  1.00 71.79  ? 105 LEU Q N   1 
ATOM   9308  C CA  . LEU F 1 99  ? 40.320  89.745  20.115  1.00 69.83  ? 105 LEU Q CA  1 
ATOM   9309  C C   . LEU F 1 99  ? 40.399  88.505  21.020  1.00 66.10  ? 105 LEU Q C   1 
ATOM   9310  O O   . LEU F 1 99  ? 39.956  88.525  22.162  1.00 68.89  ? 105 LEU Q O   1 
ATOM   9311  C CB  . LEU F 1 99  ? 41.401  90.769  20.456  1.00 60.91  ? 105 LEU Q CB  1 
ATOM   9312  C CG  . LEU F 1 99  ? 42.065  91.324  19.195  1.00 57.91  ? 105 LEU Q CG  1 
ATOM   9313  C CD1 . LEU F 1 99  ? 43.494  91.727  19.460  1.00 64.39  ? 105 LEU Q CD1 1 
ATOM   9314  C CD2 . LEU F 1 99  ? 42.054  90.297  18.109  1.00 61.20  ? 105 LEU Q CD2 1 
ATOM   9315  N N   . LEU F 1 100 ? 40.968  87.438  20.462  1.00 64.49  ? 106 LEU Q N   1 
ATOM   9316  C CA  . LEU F 1 100 ? 41.160  86.149  21.110  1.00 62.71  ? 106 LEU Q CA  1 
ATOM   9317  C C   . LEU F 1 100 ? 42.642  85.925  21.389  1.00 66.83  ? 106 LEU Q C   1 
ATOM   9318  O O   . LEU F 1 100 ? 43.461  85.949  20.462  1.00 65.01  ? 106 LEU Q O   1 
ATOM   9319  C CB  . LEU F 1 100 ? 40.686  85.052  20.168  1.00 62.07  ? 106 LEU Q CB  1 
ATOM   9320  C CG  . LEU F 1 100 ? 39.282  84.500  20.364  1.00 56.73  ? 106 LEU Q CG  1 
ATOM   9321  C CD1 . LEU F 1 100 ? 38.367  85.586  20.868  1.00 59.41  ? 106 LEU Q CD1 1 
ATOM   9322  C CD2 . LEU F 1 100 ? 38.800  83.893  19.061  1.00 46.49  ? 106 LEU Q CD2 1 
ATOM   9323  N N   . ARG F 1 101 ? 42.975  85.698  22.661  1.00 71.48  ? 107 ARG Q N   1 
ATOM   9324  C CA  . ARG F 1 101 ? 44.353  85.497  23.114  1.00 70.12  ? 107 ARG Q CA  1 
ATOM   9325  C C   . ARG F 1 101 ? 44.570  84.026  23.418  1.00 73.61  ? 107 ARG Q C   1 
ATOM   9326  O O   . ARG F 1 101 ? 43.870  83.446  24.256  1.00 72.84  ? 107 ARG Q O   1 
ATOM   9327  C CB  . ARG F 1 101 ? 44.615  86.315  24.379  1.00 73.73  ? 107 ARG Q CB  1 
ATOM   9328  C CG  . ARG F 1 101 ? 46.087  86.452  24.782  1.00 82.62  ? 107 ARG Q CG  1 
ATOM   9329  C CD  . ARG F 1 101 ? 46.554  85.376  25.772  1.00 87.00  ? 107 ARG Q CD  1 
ATOM   9330  N NE  . ARG F 1 101 ? 45.929  85.455  27.099  1.00 84.15  ? 107 ARG Q NE  1 
ATOM   9331  C CZ  . ARG F 1 101 ? 46.461  86.080  28.146  1.00 83.98  ? 107 ARG Q CZ  1 
ATOM   9332  N NH1 . ARG F 1 101 ? 45.825  86.088  29.318  1.00 75.25  ? 107 ARG Q NH1 1 
ATOM   9333  N NH2 . ARG F 1 101 ? 47.629  86.703  28.013  1.00 87.34  ? 107 ARG Q NH2 1 
ATOM   9334  N N   . LEU F 1 102 ? 45.533  83.415  22.739  1.00 73.36  ? 108 LEU Q N   1 
ATOM   9335  C CA  . LEU F 1 102 ? 45.726  81.975  22.883  1.00 73.97  ? 108 LEU Q CA  1 
ATOM   9336  C C   . LEU F 1 102 ? 46.900  81.626  23.809  1.00 76.73  ? 108 LEU Q C   1 
ATOM   9337  O O   . LEU F 1 102 ? 47.809  82.439  24.011  1.00 74.45  ? 108 LEU Q O   1 
ATOM   9338  C CB  . LEU F 1 102 ? 45.791  81.262  21.514  1.00 71.35  ? 108 LEU Q CB  1 
ATOM   9339  C CG  . LEU F 1 102 ? 46.445  81.855  20.249  1.00 69.95  ? 108 LEU Q CG  1 
ATOM   9340  C CD1 . LEU F 1 102 ? 46.279  80.908  19.073  1.00 63.76  ? 108 LEU Q CD1 1 
ATOM   9341  C CD2 . LEU F 1 102 ? 45.894  83.214  19.875  1.00 64.76  ? 108 LEU Q CD2 1 
ATOM   9342  N N   . SER F 1 103 ? 46.845  80.416  24.369  1.00 77.48  ? 109 SER Q N   1 
ATOM   9343  C CA  . SER F 1 103 ? 47.697  79.980  25.481  1.00 73.22  ? 109 SER Q CA  1 
ATOM   9344  C C   . SER F 1 103 ? 49.174  79.933  25.147  1.00 71.10  ? 109 SER Q C   1 
ATOM   9345  O O   . SER F 1 103 ? 50.021  80.113  26.018  1.00 71.98  ? 109 SER Q O   1 
ATOM   9346  C CB  . SER F 1 103 ? 47.270  78.586  25.937  1.00 73.88  ? 109 SER Q CB  1 
ATOM   9347  O OG  . SER F 1 103 ? 47.516  77.621  24.922  1.00 74.04  ? 109 SER Q OG  1 
ATOM   9348  N N   . GLU F 1 104 ? 49.475  79.655  23.888  1.00 67.41  ? 110 GLU Q N   1 
ATOM   9349  C CA  . GLU F 1 104 ? 50.846  79.574  23.429  1.00 68.86  ? 110 GLU Q CA  1 
ATOM   9350  C C   . GLU F 1 104 ? 50.863  80.150  22.028  1.00 67.23  ? 110 GLU Q C   1 
ATOM   9351  O O   . GLU F 1 104 ? 49.836  80.198  21.373  1.00 72.14  ? 110 GLU Q O   1 
ATOM   9352  C CB  . GLU F 1 104 ? 51.334  78.111  23.423  1.00 74.22  ? 110 GLU Q CB  1 
ATOM   9353  C CG  . GLU F 1 104 ? 51.415  77.409  24.812  1.00 73.87  ? 110 GLU Q CG  1 
ATOM   9354  C CD  . GLU F 1 104 ? 51.610  75.877  24.726  1.00 77.98  ? 110 GLU Q CD  1 
ATOM   9355  O OE1 . GLU F 1 104 ? 51.254  75.187  25.708  1.00 73.77  ? 110 GLU Q OE1 1 
ATOM   9356  O OE2 . GLU F 1 104 ? 52.103  75.359  23.689  1.00 75.60  ? 110 GLU Q OE2 1 
ATOM   9357  N N   . PRO F 1 105 ? 52.023  80.622  21.572  1.00 69.38  ? 111 PRO Q N   1 
ATOM   9358  C CA  . PRO F 1 105 ? 52.196  81.160  20.212  1.00 71.01  ? 111 PRO Q CA  1 
ATOM   9359  C C   . PRO F 1 105 ? 52.380  80.096  19.145  1.00 68.30  ? 111 PRO Q C   1 
ATOM   9360  O O   . PRO F 1 105 ? 53.411  79.432  19.157  1.00 68.63  ? 111 PRO Q O   1 
ATOM   9361  C CB  . PRO F 1 105 ? 53.498  81.958  20.314  1.00 68.71  ? 111 PRO Q CB  1 
ATOM   9362  C CG  . PRO F 1 105 ? 53.666  82.226  21.764  1.00 77.27  ? 111 PRO Q CG  1 
ATOM   9363  C CD  . PRO F 1 105 ? 53.101  81.045  22.472  1.00 70.95  ? 111 PRO Q CD  1 
ATOM   9364  N N   . ALA F 1 106 ? 51.429  79.976  18.220  1.00 70.60  ? 112 ALA Q N   1 
ATOM   9365  C CA  . ALA F 1 106 ? 51.477  78.959  17.156  1.00 70.78  ? 112 ALA Q CA  1 
ATOM   9366  C C   . ALA F 1 106 ? 52.798  78.911  16.431  1.00 59.54  ? 112 ALA Q C   1 
ATOM   9367  O O   . ALA F 1 106 ? 53.436  79.933  16.230  1.00 56.03  ? 112 ALA Q O   1 
ATOM   9368  C CB  . ALA F 1 106 ? 50.370  79.180  16.152  1.00 73.62  ? 112 ALA Q CB  1 
ATOM   9369  N N   . GLU F 1 107 ? 53.193  77.716  16.019  1.00 59.26  ? 113 GLU Q N   1 
ATOM   9370  C CA  . GLU F 1 107 ? 54.492  77.565  15.400  1.00 71.22  ? 113 GLU Q CA  1 
ATOM   9371  C C   . GLU F 1 107 ? 54.386  78.167  14.041  1.00 71.77  ? 113 GLU Q C   1 
ATOM   9372  O O   . GLU F 1 107 ? 53.619  77.683  13.210  1.00 68.41  ? 113 GLU Q O   1 
ATOM   9373  C CB  . GLU F 1 107 ? 54.914  76.103  15.259  1.00 78.52  ? 113 GLU Q CB  1 
ATOM   9374  C CG  . GLU F 1 107 ? 56.205  75.957  14.438  1.00 82.85  ? 113 GLU Q CG  1 
ATOM   9375  C CD  . GLU F 1 107 ? 56.629  74.508  14.200  1.00 92.99  ? 113 GLU Q CD  1 
ATOM   9376  O OE1 . GLU F 1 107 ? 55.899  73.589  14.632  1.00 93.49  ? 113 GLU Q OE1 1 
ATOM   9377  O OE2 . GLU F 1 107 ? 57.697  74.293  13.574  1.00 100.95 ? 113 GLU Q OE2 1 
ATOM   9378  N N   . LEU F 1 108 ? 55.138  79.234  13.809  1.00 69.62  ? 114 LEU Q N   1 
ATOM   9379  C CA  . LEU F 1 108 ? 55.061  79.871  12.515  1.00 66.87  ? 114 LEU Q CA  1 
ATOM   9380  C C   . LEU F 1 108 ? 55.651  78.899  11.496  1.00 70.69  ? 114 LEU Q C   1 
ATOM   9381  O O   . LEU F 1 108 ? 56.856  78.673  11.462  1.00 77.21  ? 114 LEU Q O   1 
ATOM   9382  C CB  . LEU F 1 108 ? 55.720  81.260  12.528  1.00 65.01  ? 114 LEU Q CB  1 
ATOM   9383  C CG  . LEU F 1 108 ? 54.722  82.444  12.501  1.00 63.28  ? 114 LEU Q CG  1 
ATOM   9384  C CD1 . LEU F 1 108 ? 53.299  81.937  12.612  1.00 58.19  ? 114 LEU Q CD1 1 
ATOM   9385  C CD2 . LEU F 1 108 ? 54.980  83.545  13.551  1.00 55.34  ? 114 LEU Q CD2 1 
ATOM   9386  N N   . THR F 1 109 ? 54.769  78.277  10.718  1.00 68.96  ? 115 THR Q N   1 
ATOM   9387  C CA  . THR F 1 109 ? 55.162  77.315  9.694   1.00 73.37  ? 115 THR Q CA  1 
ATOM   9388  C C   . THR F 1 109 ? 54.695  77.791  8.324   1.00 73.49  ? 115 THR Q C   1 
ATOM   9389  O O   . THR F 1 109 ? 53.845  78.673  8.220   1.00 71.41  ? 115 THR Q O   1 
ATOM   9390  C CB  . THR F 1 109 ? 54.568  75.879  9.946   1.00 79.73  ? 115 THR Q CB  1 
ATOM   9391  O OG1 . THR F 1 109 ? 53.307  75.732  9.275   1.00 76.02  ? 115 THR Q OG1 1 
ATOM   9392  C CG2 . THR F 1 109 ? 54.384  75.590  11.428  1.00 76.88  ? 115 THR Q CG2 1 
ATOM   9393  N N   . ASP F 1 110 ? 55.239  77.185  7.274   1.00 74.63  ? 116 ASP Q N   1 
ATOM   9394  C CA  . ASP F 1 110 ? 54.865  77.538  5.912   1.00 71.95  ? 116 ASP Q CA  1 
ATOM   9395  C C   . ASP F 1 110 ? 53.352  77.583  5.727   1.00 70.24  ? 116 ASP Q C   1 
ATOM   9396  O O   . ASP F 1 110 ? 52.842  78.461  5.064   1.00 73.49  ? 116 ASP Q O   1 
ATOM   9397  C CB  . ASP F 1 110 ? 55.482  76.561  4.909   1.00 76.36  ? 116 ASP Q CB  1 
ATOM   9398  C CG  . ASP F 1 110 ? 54.675  75.274  4.766   1.00 80.89  ? 116 ASP Q CG  1 
ATOM   9399  O OD1 . ASP F 1 110 ? 53.522  75.339  4.271   1.00 78.21  ? 116 ASP Q OD1 1 
ATOM   9400  O OD2 . ASP F 1 110 ? 55.200  74.197  5.143   1.00 86.37  ? 116 ASP Q OD2 1 
ATOM   9401  N N   . ALA F 1 111 ? 52.628  76.637  6.302   1.00 68.96  ? 117 ALA Q N   1 
ATOM   9402  C CA  . ALA F 1 111 ? 51.187  76.617  6.117   1.00 68.12  ? 117 ALA Q CA  1 
ATOM   9403  C C   . ALA F 1 111 ? 50.469  77.226  7.311   1.00 63.86  ? 117 ALA Q C   1 
ATOM   9404  O O   . ALA F 1 111 ? 49.346  76.852  7.636   1.00 63.80  ? 117 ALA Q O   1 
ATOM   9405  C CB  . ALA F 1 111 ? 50.707  75.220  5.859   1.00 83.46  ? 117 ALA Q CB  1 
ATOM   9406  N N   . VAL F 1 112 ? 51.132  78.161  7.973   1.00 60.57  ? 118 VAL Q N   1 
ATOM   9407  C CA  . VAL F 1 112 ? 50.438  79.033  8.901   1.00 60.01  ? 118 VAL Q CA  1 
ATOM   9408  C C   . VAL F 1 112 ? 51.258  80.311  9.115   1.00 61.16  ? 118 VAL Q C   1 
ATOM   9409  O O   . VAL F 1 112 ? 52.420  80.253  9.506   1.00 64.49  ? 118 VAL Q O   1 
ATOM   9410  C CB  . VAL F 1 112 ? 50.082  78.290  10.196  1.00 52.57  ? 118 VAL Q CB  1 
ATOM   9411  C CG1 . VAL F 1 112 ? 51.163  77.318  10.529  1.00 61.01  ? 118 VAL Q CG1 1 
ATOM   9412  C CG2 . VAL F 1 112 ? 49.819  79.251  11.332  1.00 47.41  ? 118 VAL Q CG2 1 
ATOM   9413  N N   . LYS F 1 113 ? 50.671  81.465  8.802   1.00 57.59  ? 119 LYS Q N   1 
ATOM   9414  C CA  . LYS F 1 113 ? 51.384  82.727  8.948   1.00 58.26  ? 119 LYS Q CA  1 
ATOM   9415  C C   . LYS F 1 113 ? 50.515  83.867  9.475   1.00 59.74  ? 119 LYS Q C   1 
ATOM   9416  O O   . LYS F 1 113 ? 49.297  83.738  9.566   1.00 60.14  ? 119 LYS Q O   1 
ATOM   9417  C CB  . LYS F 1 113 ? 52.013  83.118  7.623   1.00 61.54  ? 119 LYS Q CB  1 
ATOM   9418  C CG  . LYS F 1 113 ? 52.839  82.022  7.027   1.00 62.76  ? 119 LYS Q CG  1 
ATOM   9419  C CD  . LYS F 1 113 ? 53.696  82.555  5.930   1.00 59.29  ? 119 LYS Q CD  1 
ATOM   9420  C CE  . LYS F 1 113 ? 54.721  81.539  5.469   1.00 66.37  ? 119 LYS Q CE  1 
ATOM   9421  N NZ  . LYS F 1 113 ? 55.804  81.349  6.475   1.00 71.60  ? 119 LYS Q NZ  1 
ATOM   9422  N N   . VAL F 1 114 ? 51.160  84.977  9.825   1.00 59.45  ? 120 VAL Q N   1 
ATOM   9423  C CA  . VAL F 1 114 ? 50.476  86.162  10.347  1.00 67.33  ? 120 VAL Q CA  1 
ATOM   9424  C C   . VAL F 1 114 ? 50.163  87.195  9.247   1.00 73.23  ? 120 VAL Q C   1 
ATOM   9425  O O   . VAL F 1 114 ? 50.991  87.447  8.362   1.00 73.30  ? 120 VAL Q O   1 
ATOM   9426  C CB  . VAL F 1 114 ? 51.309  86.847  11.452  1.00 69.36  ? 120 VAL Q CB  1 
ATOM   9427  C CG1 . VAL F 1 114 ? 51.469  85.928  12.646  1.00 64.32  ? 120 VAL Q CG1 1 
ATOM   9428  C CG2 . VAL F 1 114 ? 52.673  87.266  10.914  1.00 70.32  ? 120 VAL Q CG2 1 
ATOM   9429  N N   . MET F 1 115 ? 48.973  87.795  9.313   1.00 70.23  ? 121 MET Q N   1 
ATOM   9430  C CA  . MET F 1 115 ? 48.494  88.700  8.267   1.00 70.80  ? 121 MET Q CA  1 
ATOM   9431  C C   . MET F 1 115 ? 48.150  90.044  8.901   1.00 77.25  ? 121 MET Q C   1 
ATOM   9432  O O   . MET F 1 115 ? 47.248  90.105  9.734   1.00 80.06  ? 121 MET Q O   1 
ATOM   9433  C CB  . MET F 1 115 ? 47.266  88.078  7.583   1.00 71.10  ? 121 MET Q CB  1 
ATOM   9434  C CG  . MET F 1 115 ? 46.026  88.970  7.463   1.00 73.23  ? 121 MET Q CG  1 
ATOM   9435  S SD  . MET F 1 115 ? 46.002  90.037  5.990   1.00 82.48  ? 121 MET Q SD  1 
ATOM   9436  C CE  . MET F 1 115 ? 46.016  88.825  4.668   1.00 65.53  ? 121 MET Q CE  1 
ATOM   9437  N N   . ASP F 1 116 ? 48.865  91.111  8.521   1.00 78.21  ? 122 ASP Q N   1 
ATOM   9438  C CA  . ASP F 1 116 ? 48.796  92.411  9.237   1.00 80.20  ? 122 ASP Q CA  1 
ATOM   9439  C C   . ASP F 1 116 ? 47.607  93.321  8.870   1.00 82.81  ? 122 ASP Q C   1 
ATOM   9440  O O   . ASP F 1 116 ? 46.919  93.090  7.877   1.00 82.81  ? 122 ASP Q O   1 
ATOM   9441  C CB  . ASP F 1 116 ? 50.119  93.186  9.129   1.00 80.49  ? 122 ASP Q CB  1 
ATOM   9442  C CG  . ASP F 1 116 ? 50.574  93.379  7.686   1.00 84.46  ? 122 ASP Q CG  1 
ATOM   9443  O OD1 . ASP F 1 116 ? 50.412  92.438  6.873   1.00 86.20  ? 122 ASP Q OD1 1 
ATOM   9444  O OD2 . ASP F 1 116 ? 51.110  94.467  7.370   1.00 81.66  ? 122 ASP Q OD2 1 
ATOM   9445  N N   . LEU F 1 117 ? 47.375  94.354  9.679   1.00 78.96  ? 123 LEU Q N   1 
ATOM   9446  C CA  . LEU F 1 117 ? 46.172  95.170  9.546   1.00 72.41  ? 123 LEU Q CA  1 
ATOM   9447  C C   . LEU F 1 117 ? 46.377  96.215  8.480   1.00 78.02  ? 123 LEU Q C   1 
ATOM   9448  O O   . LEU F 1 117 ? 47.510  96.527  8.123   1.00 80.96  ? 123 LEU Q O   1 
ATOM   9449  C CB  . LEU F 1 117 ? 45.825  95.828  10.871  1.00 73.08  ? 123 LEU Q CB  1 
ATOM   9450  C CG  . LEU F 1 117 ? 46.317  94.998  12.049  1.00 74.65  ? 123 LEU Q CG  1 
ATOM   9451  C CD1 . LEU F 1 117 ? 47.809  95.271  12.236  1.00 80.52  ? 123 LEU Q CD1 1 
ATOM   9452  C CD2 . LEU F 1 117 ? 45.527  95.250  13.336  1.00 63.74  ? 123 LEU Q CD2 1 
ATOM   9453  N N   . PRO F 1 118 ? 45.278  96.778  7.974   1.00 77.92  ? 124 PRO Q N   1 
ATOM   9454  C CA  . PRO F 1 118 ? 45.349  97.624  6.783   1.00 79.77  ? 124 PRO Q CA  1 
ATOM   9455  C C   . PRO F 1 118 ? 45.942  98.998  7.092   1.00 85.44  ? 124 PRO Q C   1 
ATOM   9456  O O   . PRO F 1 118 ? 45.958  99.415  8.256   1.00 91.35  ? 124 PRO Q O   1 
ATOM   9457  C CB  . PRO F 1 118 ? 43.880  97.765  6.374   1.00 78.98  ? 124 PRO Q CB  1 
ATOM   9458  C CG  . PRO F 1 118 ? 43.081  96.979  7.386   1.00 75.96  ? 124 PRO Q CG  1 
ATOM   9459  C CD  . PRO F 1 118 ? 43.937  96.777  8.566   1.00 72.24  ? 124 PRO Q CD  1 
ATOM   9460  N N   . THR F 1 119 ? 46.432  99.691  6.071   1.00 83.18  ? 125 THR Q N   1 
ATOM   9461  C CA  . THR F 1 119 ? 46.747  101.102 6.221   1.00 82.96  ? 125 THR Q CA  1 
ATOM   9462  C C   . THR F 1 119 ? 45.460  101.926 6.279   1.00 92.64  ? 125 THR Q C   1 
ATOM   9463  O O   . THR F 1 119 ? 45.037  102.411 7.344   1.00 91.73  ? 125 THR Q O   1 
ATOM   9464  C CB  . THR F 1 119 ? 47.560  101.606 5.020   1.00 81.99  ? 125 THR Q CB  1 
ATOM   9465  O OG1 . THR F 1 119 ? 48.909  101.149 5.147   1.00 79.09  ? 125 THR Q OG1 1 
ATOM   9466  C CG2 . THR F 1 119 ? 47.531  103.128 4.952   1.00 84.13  ? 125 THR Q CG2 1 
ATOM   9467  N N   . GLN F 1 120 ? 44.828  102.045 5.114   1.00 94.12  ? 128 GLN Q N   1 
ATOM   9468  C CA  . GLN F 1 120 ? 43.664  102.892 4.920   1.00 89.56  ? 128 GLN Q CA  1 
ATOM   9469  C C   . GLN F 1 120 ? 42.553  102.111 4.241   1.00 88.73  ? 128 GLN Q C   1 
ATOM   9470  O O   . GLN F 1 120 ? 42.786  101.011 3.752   1.00 91.63  ? 128 GLN Q O   1 
ATOM   9471  C CB  . GLN F 1 120 ? 44.078  104.081 4.068   1.00 95.53  ? 128 GLN Q CB  1 
ATOM   9472  C CG  . GLN F 1 120 ? 42.952  104.738 3.311   1.00 100.21 ? 128 GLN Q CG  1 
ATOM   9473  C CD  . GLN F 1 120 ? 43.422  105.920 2.472   1.00 109.28 ? 128 GLN Q CD  1 
ATOM   9474  O OE1 . GLN F 1 120 ? 42.638  106.820 2.145   1.00 114.02 ? 128 GLN Q OE1 1 
ATOM   9475  N NE2 . GLN F 1 120 ? 44.708  105.925 2.122   1.00 104.71 ? 128 GLN Q NE2 1 
ATOM   9476  N N   . GLU F 1 121 ? 41.351  102.677 4.203   1.00 93.25  ? 129 GLU Q N   1 
ATOM   9477  C CA  . GLU F 1 121 ? 40.173  101.944 3.727   1.00 92.75  ? 129 GLU Q CA  1 
ATOM   9478  C C   . GLU F 1 121 ? 40.206  101.605 2.230   1.00 92.50  ? 129 GLU Q C   1 
ATOM   9479  O O   . GLU F 1 121 ? 41.170  101.943 1.533   1.00 90.38  ? 129 GLU Q O   1 
ATOM   9480  C CB  . GLU F 1 121 ? 38.866  102.648 4.137   1.00 91.49  ? 129 GLU Q CB  1 
ATOM   9481  C CG  . GLU F 1 121 ? 38.774  104.126 3.814   1.00 99.56  ? 129 GLU Q CG  1 
ATOM   9482  C CD  . GLU F 1 121 ? 37.441  104.726 4.245   1.00 103.91 ? 129 GLU Q CD  1 
ATOM   9483  O OE1 . GLU F 1 121 ? 36.893  105.570 3.502   1.00 107.11 ? 129 GLU Q OE1 1 
ATOM   9484  O OE2 . GLU F 1 121 ? 36.938  104.348 5.326   1.00 103.12 ? 129 GLU Q OE2 1 
ATOM   9485  N N   . PRO F 1 122 ? 39.164  100.907 1.739   1.00 96.08  ? 130 PRO Q N   1 
ATOM   9486  C CA  . PRO F 1 122 ? 39.142  100.430 0.354   1.00 99.09  ? 130 PRO Q CA  1 
ATOM   9487  C C   . PRO F 1 122 ? 38.474  101.421 -0.579  1.00 100.97 ? 130 PRO Q C   1 
ATOM   9488  O O   . PRO F 1 122 ? 37.397  101.946 -0.264  1.00 97.83  ? 130 PRO Q O   1 
ATOM   9489  C CB  . PRO F 1 122 ? 38.266  99.172  0.429   1.00 94.70  ? 130 PRO Q CB  1 
ATOM   9490  C CG  . PRO F 1 122 ? 37.718  99.115  1.851   1.00 90.19  ? 130 PRO Q CG  1 
ATOM   9491  C CD  . PRO F 1 122 ? 37.977  100.443 2.472   1.00 92.86  ? 130 PRO Q CD  1 
ATOM   9492  N N   . ALA F 1 123 ? 39.104  101.660 -1.724  1.00 104.95 ? 131 ALA Q N   1 
ATOM   9493  C CA  . ALA F 1 123 ? 38.491  102.466 -2.770  1.00 109.97 ? 131 ALA Q CA  1 
ATOM   9494  C C   . ALA F 1 123 ? 37.069  101.960 -3.051  1.00 105.56 ? 131 ALA Q C   1 
ATOM   9495  O O   . ALA F 1 123 ? 36.740  100.821 -2.717  1.00 103.33 ? 131 ALA Q O   1 
ATOM   9496  C CB  . ALA F 1 123 ? 39.347  102.423 -4.031  1.00 109.02 ? 131 ALA Q CB  1 
ATOM   9497  N N   . LEU F 1 124 ? 36.227  102.809 -3.640  1.00 108.01 ? 132 LEU Q N   1 
ATOM   9498  C CA  . LEU F 1 124 ? 34.869  102.407 -4.025  1.00 108.55 ? 132 LEU Q CA  1 
ATOM   9499  C C   . LEU F 1 124 ? 34.833  101.707 -5.385  1.00 107.58 ? 132 LEU Q C   1 
ATOM   9500  O O   . LEU F 1 124 ? 35.321  102.242 -6.390  1.00 106.52 ? 132 LEU Q O   1 
ATOM   9501  C CB  . LEU F 1 124 ? 33.911  103.598 -4.009  1.00 108.16 ? 132 LEU Q CB  1 
ATOM   9502  C CG  . LEU F 1 124 ? 33.113  103.695 -2.712  1.00 103.22 ? 132 LEU Q CG  1 
ATOM   9503  C CD1 . LEU F 1 124 ? 32.045  102.610 -2.681  1.00 98.53  ? 132 LEU Q CD1 1 
ATOM   9504  C CD2 . LEU F 1 124 ? 34.058  103.586 -1.524  1.00 94.25  ? 132 LEU Q CD2 1 
ATOM   9505  N N   . GLY F 1 125 ? 34.248  100.510 -5.402  1.00 103.36 ? 133 GLY Q N   1 
ATOM   9506  C CA  . GLY F 1 125 ? 34.270  99.653  -6.571  1.00 94.18  ? 133 GLY Q CA  1 
ATOM   9507  C C   . GLY F 1 125 ? 35.584  98.905  -6.651  1.00 96.02  ? 133 GLY Q C   1 
ATOM   9508  O O   . GLY F 1 125 ? 36.156  98.764  -7.725  1.00 93.71  ? 133 GLY Q O   1 
ATOM   9509  N N   . THR F 1 126 ? 36.076  98.442  -5.503  1.00 102.97 ? 134 THR Q N   1 
ATOM   9510  C CA  . THR F 1 126 ? 37.334  97.690  -5.451  1.00 102.59 ? 134 THR Q CA  1 
ATOM   9511  C C   . THR F 1 126 ? 37.066  96.188  -5.384  1.00 96.61  ? 134 THR Q C   1 
ATOM   9512  O O   . THR F 1 126 ? 36.033  95.753  -4.875  1.00 92.73  ? 134 THR Q O   1 
ATOM   9513  C CB  . THR F 1 126 ? 38.259  98.129  -4.269  1.00 102.70 ? 134 THR Q CB  1 
ATOM   9514  O OG1 . THR F 1 126 ? 38.813  99.430  -4.526  1.00 101.41 ? 134 THR Q OG1 1 
ATOM   9515  C CG2 . THR F 1 126 ? 39.408  97.138  -4.083  1.00 96.24  ? 134 THR Q CG2 1 
ATOM   9516  N N   . THR F 1 127 ? 38.003  95.410  -5.916  1.00 94.55  ? 135 THR Q N   1 
ATOM   9517  C CA  . THR F 1 127 ? 37.873  93.959  -5.982  1.00 97.05  ? 135 THR Q CA  1 
ATOM   9518  C C   . THR F 1 127 ? 38.252  93.290  -4.666  1.00 98.05  ? 135 THR Q C   1 
ATOM   9519  O O   . THR F 1 127 ? 39.205  93.703  -3.997  1.00 97.77  ? 135 THR Q O   1 
ATOM   9520  C CB  . THR F 1 127 ? 38.744  93.370  -7.110  1.00 102.88 ? 135 THR Q CB  1 
ATOM   9521  O OG1 . THR F 1 127 ? 39.835  94.260  -7.398  1.00 96.51  ? 135 THR Q OG1 1 
ATOM   9522  C CG2 . THR F 1 127 ? 37.907  93.164  -8.368  1.00 111.93 ? 135 THR Q CG2 1 
ATOM   9523  N N   . CYS F 1 128 ? 37.508  92.247  -4.309  1.00 92.04  ? 136 CYS Q N   1 
ATOM   9524  C CA  . CYS F 1 128 ? 37.658  91.599  -3.011  1.00 86.86  ? 136 CYS Q CA  1 
ATOM   9525  C C   . CYS F 1 128 ? 37.326  90.099  -3.084  1.00 91.39  ? 136 CYS Q C   1 
ATOM   9526  O O   . CYS F 1 128 ? 36.942  89.592  -4.150  1.00 90.50  ? 136 CYS Q O   1 
ATOM   9527  C CB  . CYS F 1 128 ? 36.755  92.285  -1.974  1.00 84.91  ? 136 CYS Q CB  1 
ATOM   9528  S SG  . CYS F 1 128 ? 37.485  93.658  -1.035  1.00 96.52  ? 136 CYS Q SG  1 
ATOM   9529  N N   . TYR F 1 129 ? 37.520  89.402  -1.956  1.00 86.63  ? 137 TYR Q N   1 
ATOM   9530  C CA  . TYR F 1 129 ? 37.013  88.036  -1.752  1.00 78.66  ? 137 TYR Q CA  1 
ATOM   9531  C C   . TYR F 1 129 ? 36.677  87.730  -0.303  1.00 75.24  ? 137 TYR Q C   1 
ATOM   9532  O O   . TYR F 1 129 ? 36.993  88.506  0.595   1.00 75.60  ? 137 TYR Q O   1 
ATOM   9533  C CB  . TYR F 1 129 ? 37.944  86.952  -2.330  1.00 84.72  ? 137 TYR Q CB  1 
ATOM   9534  C CG  . TYR F 1 129 ? 39.330  86.732  -1.709  1.00 84.76  ? 137 TYR Q CG  1 
ATOM   9535  C CD1 . TYR F 1 129 ? 39.575  85.672  -0.832  1.00 80.47  ? 137 TYR Q CD1 1 
ATOM   9536  C CD2 . TYR F 1 129 ? 40.412  87.532  -2.071  1.00 84.96  ? 137 TYR Q CD2 1 
ATOM   9537  C CE1 . TYR F 1 129 ? 40.854  85.452  -0.303  1.00 79.21  ? 137 TYR Q CE1 1 
ATOM   9538  C CE2 . TYR F 1 129 ? 41.687  87.317  -1.546  1.00 82.30  ? 137 TYR Q CE2 1 
ATOM   9539  C CZ  . TYR F 1 129 ? 41.907  86.280  -0.670  1.00 77.96  ? 137 TYR Q CZ  1 
ATOM   9540  O OH  . TYR F 1 129 ? 43.189  86.092  -0.183  1.00 70.39  ? 137 TYR Q OH  1 
ATOM   9541  N N   . ALA F 1 130 ? 36.013  86.603  -0.088  1.00 69.70  ? 138 ALA Q N   1 
ATOM   9542  C CA  . ALA F 1 130 ? 35.753  86.138  1.257   1.00 70.76  ? 138 ALA Q CA  1 
ATOM   9543  C C   . ALA F 1 130 ? 36.046  84.651  1.295   1.00 82.26  ? 138 ALA Q C   1 
ATOM   9544  O O   . ALA F 1 130 ? 36.015  83.998  0.256   1.00 80.91  ? 138 ALA Q O   1 
ATOM   9545  C CB  . ALA F 1 130 ? 34.327  86.420  1.652   1.00 68.33  ? 138 ALA Q CB  1 
ATOM   9546  N N   . SER F 1 131 ? 36.347  84.125  2.486   1.00 89.07  ? 139 SER Q N   1 
ATOM   9547  C CA  . SER F 1 131 ? 36.704  82.711  2.656   1.00 81.86  ? 139 SER Q CA  1 
ATOM   9548  C C   . SER F 1 131 ? 36.025  82.045  3.853   1.00 82.31  ? 139 SER Q C   1 
ATOM   9549  O O   . SER F 1 131 ? 36.011  82.587  4.955   1.00 81.68  ? 139 SER Q O   1 
ATOM   9550  C CB  . SER F 1 131 ? 38.225  82.541  2.747   1.00 83.35  ? 139 SER Q CB  1 
ATOM   9551  O OG  . SER F 1 131 ? 38.854  83.671  3.333   1.00 81.71  ? 139 SER Q OG  1 
ATOM   9552  N N   . GLY F 1 132 ? 35.463  80.863  3.625   1.00 90.29  ? 140 GLY Q N   1 
ATOM   9553  C CA  . GLY F 1 132 ? 34.812  80.106  4.678   1.00 96.73  ? 140 GLY Q CA  1 
ATOM   9554  C C   . GLY F 1 132 ? 34.487  78.689  4.242   1.00 102.14 ? 140 GLY Q C   1 
ATOM   9555  O O   . GLY F 1 132 ? 34.754  78.304  3.104   1.00 97.56  ? 140 GLY Q O   1 
ATOM   9556  N N   . TRP F 1 133 ? 33.897  77.916  5.151   1.00 112.28 ? 141 TRP Q N   1 
ATOM   9557  C CA  . TRP F 1 133 ? 33.590  76.503  4.911   1.00 115.53 ? 141 TRP Q CA  1 
ATOM   9558  C C   . TRP F 1 133 ? 32.097  76.190  4.673   1.00 122.91 ? 141 TRP Q C   1 
ATOM   9559  O O   . TRP F 1 133 ? 31.688  75.879  3.552   1.00 125.04 ? 141 TRP Q O   1 
ATOM   9560  C CB  . TRP F 1 133 ? 34.100  75.655  6.082   1.00 112.14 ? 141 TRP Q CB  1 
ATOM   9561  C CG  . TRP F 1 133 ? 35.569  75.287  6.042   1.00 107.37 ? 141 TRP Q CG  1 
ATOM   9562  C CD1 . TRP F 1 133 ? 36.141  74.246  5.355   1.00 108.55 ? 141 TRP Q CD1 1 
ATOM   9563  C CD2 . TRP F 1 133 ? 36.635  75.925  6.753   1.00 96.22  ? 141 TRP Q CD2 1 
ATOM   9564  N NE1 . TRP F 1 133 ? 37.495  74.212  5.586   1.00 104.02 ? 141 TRP Q NE1 1 
ATOM   9565  C CE2 . TRP F 1 133 ? 37.823  75.231  6.439   1.00 99.38  ? 141 TRP Q CE2 1 
ATOM   9566  C CE3 . TRP F 1 133 ? 36.703  77.022  7.612   1.00 92.94  ? 141 TRP Q CE3 1 
ATOM   9567  C CZ2 . TRP F 1 133 ? 39.061  75.601  6.956   1.00 97.31  ? 141 TRP Q CZ2 1 
ATOM   9568  C CZ3 . TRP F 1 133 ? 37.936  77.389  8.123   1.00 91.42  ? 141 TRP Q CZ3 1 
ATOM   9569  C CH2 . TRP F 1 133 ? 39.097  76.682  7.793   1.00 94.70  ? 141 TRP Q CH2 1 
ATOM   9570  N N   . GLY F 1 134 ? 31.301  76.259  5.739   1.00 130.38 ? 142 GLY Q N   1 
ATOM   9571  C CA  . GLY F 1 134 ? 29.895  75.889  5.699   1.00 139.18 ? 142 GLY Q CA  1 
ATOM   9572  C C   . GLY F 1 134 ? 28.936  77.058  5.829   1.00 148.17 ? 142 GLY Q C   1 
ATOM   9573  O O   . GLY F 1 134 ? 29.355  78.209  5.822   1.00 147.14 ? 142 GLY Q O   1 
ATOM   9574  N N   . SER F 1 135 ? 27.650  76.759  5.985   1.00 157.89 ? 143 SER Q N   1 
ATOM   9575  C CA  . SER F 1 135 ? 26.571  77.741  5.774   1.00 165.77 ? 143 SER Q CA  1 
ATOM   9576  C C   . SER F 1 135 ? 26.407  78.906  6.776   1.00 162.31 ? 143 SER Q C   1 
ATOM   9577  O O   . SER F 1 135 ? 26.197  80.050  6.365   1.00 156.90 ? 143 SER Q O   1 
ATOM   9578  C CB  . SER F 1 135 ? 25.236  77.004  5.607   1.00 171.22 ? 143 SER Q CB  1 
ATOM   9579  O OG  . SER F 1 135 ? 25.192  75.849  6.429   1.00 174.59 ? 143 SER Q OG  1 
ATOM   9580  N N   . ILE F 1 136 ? 26.489  78.598  8.071   1.00 164.91 ? 144 ILE Q N   1 
ATOM   9581  C CA  . ILE F 1 136 ? 26.230  79.537  9.180   1.00 163.74 ? 144 ILE Q CA  1 
ATOM   9582  C C   . ILE F 1 136 ? 24.748  79.743  9.523   1.00 170.09 ? 144 ILE Q C   1 
ATOM   9583  O O   . ILE F 1 136 ? 24.426  80.449  10.474  1.00 174.49 ? 144 ILE Q O   1 
ATOM   9584  C CB  . ILE F 1 136 ? 26.919  80.919  9.028   1.00 149.22 ? 144 ILE Q CB  1 
ATOM   9585  C CG1 . ILE F 1 136 ? 25.984  81.927  8.362   1.00 152.90 ? 144 ILE Q CG1 1 
ATOM   9586  C CG2 . ILE F 1 136 ? 28.227  80.795  8.294   1.00 139.33 ? 144 ILE Q CG2 1 
ATOM   9587  C CD1 . ILE F 1 136 ? 26.381  83.346  8.609   1.00 145.74 ? 144 ILE Q CD1 1 
ATOM   9588  N N   . GLU F 1 137 ? 23.854  79.134  8.751   1.00 170.98 ? 145 GLU Q N   1 
ATOM   9589  C CA  . GLU F 1 137 ? 22.455  79.006  9.152   1.00 175.81 ? 145 GLU Q CA  1 
ATOM   9590  C C   . GLU F 1 137 ? 22.237  77.535  9.507   1.00 185.52 ? 145 GLU Q C   1 
ATOM   9591  O O   . GLU F 1 137 ? 21.466  76.834  8.845   1.00 187.06 ? 145 GLU Q O   1 
ATOM   9592  C CB  . GLU F 1 137 ? 21.524  79.445  8.022   1.00 172.77 ? 145 GLU Q CB  1 
ATOM   9593  C CG  . GLU F 1 137 ? 21.748  80.875  7.560   1.00 166.33 ? 145 GLU Q CG  1 
ATOM   9594  C CD  . GLU F 1 137 ? 21.915  80.971  6.061   1.00 166.82 ? 145 GLU Q CD  1 
ATOM   9595  O OE1 . GLU F 1 137 ? 21.695  79.949  5.377   1.00 167.84 ? 145 GLU Q OE1 1 
ATOM   9596  O OE2 . GLU F 1 137 ? 22.268  82.063  5.568   1.00 163.46 ? 145 GLU Q OE2 1 
ATOM   9597  N N   . PRO F 1 138 ? 22.916  77.073  10.577  1.00 187.29 ? 146 PRO Q N   1 
ATOM   9598  C CA  . PRO F 1 138 ? 23.243  75.664  10.840  1.00 187.99 ? 146 PRO Q CA  1 
ATOM   9599  C C   . PRO F 1 138 ? 22.083  74.709  11.111  1.00 190.35 ? 146 PRO Q C   1 
ATOM   9600  O O   . PRO F 1 138 ? 22.257  73.517  10.871  1.00 190.08 ? 146 PRO Q O   1 
ATOM   9601  C CB  . PRO F 1 138 ? 24.146  75.739  12.079  1.00 186.31 ? 146 PRO Q CB  1 
ATOM   9602  C CG  . PRO F 1 138 ? 23.729  76.974  12.767  1.00 184.95 ? 146 PRO Q CG  1 
ATOM   9603  C CD  . PRO F 1 138 ? 23.339  77.944  11.689  1.00 184.36 ? 146 PRO Q CD  1 
ATOM   9604  N N   . GLU F 1 139 ? 20.942  75.181  11.600  1.00 192.34 ? 147 GLU Q N   1 
ATOM   9605  C CA  . GLU F 1 139 ? 19.917  74.231  12.030  1.00 193.89 ? 147 GLU Q CA  1 
ATOM   9606  C C   . GLU F 1 139 ? 19.017  73.710  10.901  1.00 196.17 ? 147 GLU Q C   1 
ATOM   9607  O O   . GLU F 1 139 ? 18.439  72.627  11.023  1.00 199.12 ? 147 GLU Q O   1 
ATOM   9608  C CB  . GLU F 1 139 ? 19.111  74.759  13.227  1.00 195.66 ? 147 GLU Q CB  1 
ATOM   9609  C CG  . GLU F 1 139 ? 18.420  73.669  14.066  1.00 195.26 ? 147 GLU Q CG  1 
ATOM   9610  C CD  . GLU F 1 139 ? 19.387  72.681  14.717  1.00 190.00 ? 147 GLU Q CD  1 
ATOM   9611  O OE1 . GLU F 1 139 ? 20.478  72.438  14.159  1.00 188.60 ? 147 GLU Q OE1 1 
ATOM   9612  O OE2 . GLU F 1 139 ? 19.045  72.138  15.790  1.00 182.29 ? 147 GLU Q OE2 1 
ATOM   9613  N N   . GLU F 1 140 ? 18.909  74.454  9.802   1.00 192.82 ? 148 GLU Q N   1 
ATOM   9614  C CA  . GLU F 1 140 ? 18.232  73.921  8.619   1.00 194.86 ? 148 GLU Q CA  1 
ATOM   9615  C C   . GLU F 1 140 ? 19.180  72.975  7.855   1.00 195.30 ? 148 GLU Q C   1 
ATOM   9616  O O   . GLU F 1 140 ? 18.744  71.959  7.305   1.00 193.26 ? 148 GLU Q O   1 
ATOM   9617  C CB  . GLU F 1 140 ? 17.696  75.043  7.721   1.00 193.74 ? 148 GLU Q CB  1 
ATOM   9618  C CG  . GLU F 1 140 ? 16.600  74.608  6.738   1.00 192.72 ? 148 GLU Q CG  1 
ATOM   9619  C CD  . GLU F 1 140 ? 15.297  74.214  7.421   1.00 185.57 ? 148 GLU Q CD  1 
ATOM   9620  O OE1 . GLU F 1 140 ? 14.985  74.782  8.488   1.00 187.55 ? 148 GLU Q OE1 1 
ATOM   9621  O OE2 . GLU F 1 140 ? 14.580  73.342  6.881   1.00 177.68 ? 148 GLU Q OE2 1 
ATOM   9622  N N   . PHE F 1 141 ? 20.471  73.323  7.834   1.00 194.68 ? 149 PHE Q N   1 
ATOM   9623  C CA  . PHE F 1 141 ? 21.563  72.434  7.386   1.00 191.22 ? 149 PHE Q CA  1 
ATOM   9624  C C   . PHE F 1 141 ? 22.930  73.118  7.611   1.00 187.55 ? 149 PHE Q C   1 
ATOM   9625  O O   . PHE F 1 141 ? 22.992  74.347  7.684   1.00 187.32 ? 149 PHE Q O   1 
ATOM   9626  C CB  . PHE F 1 141 ? 21.385  71.994  5.923   1.00 189.57 ? 149 PHE Q CB  1 
ATOM   9627  C CG  . PHE F 1 141 ? 21.677  70.528  5.685   1.00 183.25 ? 149 PHE Q CG  1 
ATOM   9628  C CD1 . PHE F 1 141 ? 21.400  69.586  6.665   1.00 181.42 ? 149 PHE Q CD1 1 
ATOM   9629  C CD2 . PHE F 1 141 ? 22.206  70.091  4.478   1.00 178.46 ? 149 PHE Q CD2 1 
ATOM   9630  C CE1 . PHE F 1 141 ? 21.659  68.243  6.457   1.00 174.07 ? 149 PHE Q CE1 1 
ATOM   9631  C CE2 . PHE F 1 141 ? 22.466  68.744  4.262   1.00 174.58 ? 149 PHE Q CE2 1 
ATOM   9632  C CZ  . PHE F 1 141 ? 22.190  67.822  5.254   1.00 172.84 ? 149 PHE Q CZ  1 
ATOM   9633  N N   . LEU F 1 142 ? 24.010  72.332  7.716   1.00 184.49 ? 150 LEU Q N   1 
ATOM   9634  C CA  . LEU F 1 142 ? 25.322  72.851  8.166   1.00 176.87 ? 150 LEU Q CA  1 
ATOM   9635  C C   . LEU F 1 142 ? 26.461  72.989  7.129   1.00 168.79 ? 150 LEU Q C   1 
ATOM   9636  O O   . LEU F 1 142 ? 26.235  73.302  5.959   1.00 169.02 ? 150 LEU Q O   1 
ATOM   9637  C CB  . LEU F 1 142 ? 25.839  72.078  9.401   1.00 171.88 ? 150 LEU Q CB  1 
ATOM   9638  C CG  . LEU F 1 142 ? 26.120  70.564  9.424   1.00 169.04 ? 150 LEU Q CG  1 
ATOM   9639  C CD1 . LEU F 1 142 ? 26.182  69.938  8.032   1.00 168.89 ? 150 LEU Q CD1 1 
ATOM   9640  C CD2 . LEU F 1 142 ? 27.396  70.243  10.227  1.00 161.08 ? 150 LEU Q CD2 1 
ATOM   9641  N N   . THR F 1 143 ? 27.685  72.756  7.606   1.00 166.58 ? 151 THR Q N   1 
ATOM   9642  C CA  . THR F 1 143 ? 28.925  72.965  6.853   1.00 158.55 ? 151 THR Q CA  1 
ATOM   9643  C C   . THR F 1 143 ? 29.313  71.796  5.936   1.00 156.33 ? 151 THR Q C   1 
ATOM   9644  O O   . THR F 1 143 ? 29.348  70.647  6.376   1.00 156.66 ? 151 THR Q O   1 
ATOM   9645  C CB  . THR F 1 143 ? 30.109  73.220  7.827   1.00 149.96 ? 151 THR Q CB  1 
ATOM   9646  O OG1 . THR F 1 143 ? 31.184  72.324  7.523   1.00 144.48 ? 151 THR Q OG1 1 
ATOM   9647  C CG2 . THR F 1 143 ? 29.686  72.986  9.267   1.00 149.20 ? 151 THR Q CG2 1 
ATOM   9648  N N   . PRO F 1 144 ? 29.590  72.088  4.651   1.00 152.63 ? 152 PRO Q N   1 
ATOM   9649  C CA  . PRO F 1 144 ? 30.109  71.093  3.700   1.00 147.61 ? 152 PRO Q CA  1 
ATOM   9650  C C   . PRO F 1 144 ? 31.561  71.302  3.206   1.00 135.98 ? 152 PRO Q C   1 
ATOM   9651  O O   . PRO F 1 144 ? 31.856  72.283  2.519   1.00 134.05 ? 152 PRO Q O   1 
ATOM   9652  C CB  . PRO F 1 144 ? 29.148  71.232  2.502   1.00 151.21 ? 152 PRO Q CB  1 
ATOM   9653  C CG  . PRO F 1 144 ? 28.194  72.405  2.852   1.00 151.42 ? 152 PRO Q CG  1 
ATOM   9654  C CD  . PRO F 1 144 ? 28.879  73.162  3.945   1.00 153.08 ? 152 PRO Q CD  1 
ATOM   9655  N N   . LYS F 1 145 ? 32.448  70.378  3.568   1.00 127.94 ? 153 LYS Q N   1 
ATOM   9656  C CA  . LYS F 1 145 ? 33.728  70.155  2.863   1.00 127.19 ? 153 LYS Q CA  1 
ATOM   9657  C C   . LYS F 1 145 ? 34.863  71.192  2.966   1.00 124.99 ? 153 LYS Q C   1 
ATOM   9658  O O   . LYS F 1 145 ? 35.310  71.538  4.064   1.00 118.37 ? 153 LYS Q O   1 
ATOM   9659  C CB  . LYS F 1 145 ? 33.490  69.805  1.385   1.00 126.52 ? 153 LYS Q CB  1 
ATOM   9660  C CG  . LYS F 1 145 ? 34.427  68.728  0.846   1.00 113.05 ? 153 LYS Q CG  1 
ATOM   9661  C CD  . LYS F 1 145 ? 33.922  67.345  1.217   1.00 112.39 ? 153 LYS Q CD  1 
ATOM   9662  C CE  . LYS F 1 145 ? 32.642  67.033  0.457   1.00 111.62 ? 153 LYS Q CE  1 
ATOM   9663  N NZ  . LYS F 1 145 ? 31.976  65.796  0.946   1.00 105.46 ? 153 LYS Q NZ  1 
ATOM   9664  N N   . LYS F 1 146 ? 35.335  71.646  1.799   1.00 118.92 ? 154 LYS Q N   1 
ATOM   9665  C CA  . LYS F 1 146 ? 36.594  72.389  1.677   1.00 109.77 ? 154 LYS Q CA  1 
ATOM   9666  C C   . LYS F 1 146 ? 36.435  73.909  1.806   1.00 106.62 ? 154 LYS Q C   1 
ATOM   9667  O O   . LYS F 1 146 ? 35.318  74.425  1.769   1.00 108.65 ? 154 LYS Q O   1 
ATOM   9668  C CB  . LYS F 1 146 ? 37.284  72.033  0.356   1.00 99.52  ? 154 LYS Q CB  1 
ATOM   9669  C CG  . LYS F 1 146 ? 37.371  70.540  0.081   1.00 94.16  ? 154 LYS Q CG  1 
ATOM   9670  C CD  . LYS F 1 146 ? 38.364  70.249  -1.038  1.00 91.56  ? 154 LYS Q CD  1 
ATOM   9671  C CE  . LYS F 1 146 ? 37.690  69.943  -2.378  1.00 90.48  ? 154 LYS Q CE  1 
ATOM   9672  N NZ  . LYS F 1 146 ? 37.195  68.534  -2.492  1.00 87.22  ? 154 LYS Q NZ  1 
ATOM   9673  N N   . LEU F 1 147 ? 37.560  74.612  1.943   1.00 101.55 ? 155 LEU Q N   1 
ATOM   9674  C CA  . LEU F 1 147 ? 37.570  76.054  2.209   1.00 99.61  ? 155 LEU Q CA  1 
ATOM   9675  C C   . LEU F 1 147 ? 37.311  76.910  0.968   1.00 95.67  ? 155 LEU Q C   1 
ATOM   9676  O O   . LEU F 1 147 ? 38.139  76.954  0.067   1.00 91.32  ? 155 LEU Q O   1 
ATOM   9677  C CB  . LEU F 1 147 ? 38.913  76.451  2.813   1.00 96.74  ? 155 LEU Q CB  1 
ATOM   9678  C CG  . LEU F 1 147 ? 38.879  77.653  3.763   1.00 94.99  ? 155 LEU Q CG  1 
ATOM   9679  C CD1 . LEU F 1 147 ? 39.321  78.956  3.095   1.00 85.98  ? 155 LEU Q CD1 1 
ATOM   9680  C CD2 . LEU F 1 147 ? 37.496  77.791  4.384   1.00 97.56  ? 155 LEU Q CD2 1 
ATOM   9681  N N   . GLN F 1 148 ? 36.190  77.628  0.949   1.00 94.92  ? 156 GLN Q N   1 
ATOM   9682  C CA  . GLN F 1 148 ? 35.744  78.309  -0.265  1.00 96.26  ? 156 GLN Q CA  1 
ATOM   9683  C C   . GLN F 1 148 ? 35.957  79.831  -0.296  1.00 90.00  ? 156 GLN Q C   1 
ATOM   9684  O O   . GLN F 1 148 ? 36.052  80.481  0.741   1.00 84.70  ? 156 GLN Q O   1 
ATOM   9685  C CB  . GLN F 1 148 ? 34.275  77.977  -0.520  1.00 104.36 ? 156 GLN Q CB  1 
ATOM   9686  C CG  . GLN F 1 148 ? 33.922  76.528  -0.235  1.00 107.23 ? 156 GLN Q CG  1 
ATOM   9687  C CD  . GLN F 1 148 ? 32.765  76.041  -1.078  1.00 120.49 ? 156 GLN Q CD  1 
ATOM   9688  O OE1 . GLN F 1 148 ? 32.949  75.235  -1.993  1.00 119.35 ? 156 GLN Q OE1 1 
ATOM   9689  N NE2 . GLN F 1 148 ? 31.566  76.536  -0.786  1.00 127.90 ? 156 GLN Q NE2 1 
ATOM   9690  N N   . CYS F 1 149 ? 36.022  80.390  -1.503  1.00 90.22  ? 157 CYS Q N   1 
ATOM   9691  C CA  . CYS F 1 149 ? 36.241  81.827  -1.687  1.00 86.37  ? 157 CYS Q CA  1 
ATOM   9692  C C   . CYS F 1 149 ? 35.409  82.455  -2.817  1.00 91.82  ? 157 CYS Q C   1 
ATOM   9693  O O   . CYS F 1 149 ? 35.682  82.241  -4.003  1.00 91.43  ? 157 CYS Q O   1 
ATOM   9694  C CB  . CYS F 1 149 ? 37.715  82.116  -1.938  1.00 86.46  ? 157 CYS Q CB  1 
ATOM   9695  S SG  . CYS F 1 149 ? 38.759  81.615  -0.592  1.00 94.35  ? 157 CYS Q SG  1 
ATOM   9696  N N   . VAL F 1 150 ? 34.417  83.258  -2.433  1.00 91.54  ? 158 VAL Q N   1 
ATOM   9697  C CA  . VAL F 1 150 ? 33.489  83.883  -3.371  1.00 80.36  ? 158 VAL Q CA  1 
ATOM   9698  C C   . VAL F 1 150 ? 33.907  85.320  -3.701  1.00 76.92  ? 158 VAL Q C   1 
ATOM   9699  O O   . VAL F 1 150 ? 34.367  86.051  -2.819  1.00 74.49  ? 158 VAL Q O   1 
ATOM   9700  C CB  . VAL F 1 150 ? 32.054  83.826  -2.825  1.00 81.34  ? 158 VAL Q CB  1 
ATOM   9701  C CG1 . VAL F 1 150 ? 31.384  82.520  -3.233  1.00 90.33  ? 158 VAL Q CG1 1 
ATOM   9702  C CG2 . VAL F 1 150 ? 32.064  83.957  -1.312  1.00 79.88  ? 158 VAL Q CG2 1 
ATOM   9703  N N   . ASP F 1 151 ? 33.742  85.705  -4.973  1.00 77.70  ? 159 ASP Q N   1 
ATOM   9704  C CA  . ASP F 1 151 ? 34.275  86.964  -5.524  1.00 76.94  ? 159 ASP Q CA  1 
ATOM   9705  C C   . ASP F 1 151 ? 33.357  88.170  -5.333  1.00 81.52  ? 159 ASP Q C   1 
ATOM   9706  O O   . ASP F 1 151 ? 32.169  88.088  -5.623  1.00 86.32  ? 159 ASP Q O   1 
ATOM   9707  C CB  . ASP F 1 151 ? 34.580  86.809  -7.011  1.00 72.25  ? 159 ASP Q CB  1 
ATOM   9708  C CG  . ASP F 1 151 ? 35.804  85.957  -7.270  1.00 81.86  ? 159 ASP Q CG  1 
ATOM   9709  O OD1 . ASP F 1 151 ? 36.575  86.272  -8.208  1.00 82.82  ? 159 ASP Q OD1 1 
ATOM   9710  O OD2 . ASP F 1 151 ? 36.000  84.970  -6.531  1.00 87.58  ? 159 ASP Q OD2 1 
ATOM   9711  N N   . LEU F 1 152 ? 33.923  89.292  -4.877  1.00 82.50  ? 160 LEU Q N   1 
ATOM   9712  C CA  . LEU F 1 152 ? 33.149  90.467  -4.474  1.00 82.19  ? 160 LEU Q CA  1 
ATOM   9713  C C   . LEU F 1 152 ? 33.763  91.789  -4.917  1.00 91.34  ? 160 LEU Q C   1 
ATOM   9714  O O   . LEU F 1 152 ? 34.864  91.824  -5.465  1.00 93.37  ? 160 LEU Q O   1 
ATOM   9715  C CB  . LEU F 1 152 ? 33.024  90.502  -2.960  1.00 76.82  ? 160 LEU Q CB  1 
ATOM   9716  C CG  . LEU F 1 152 ? 31.818  89.860  -2.286  1.00 78.04  ? 160 LEU Q CG  1 
ATOM   9717  C CD1 . LEU F 1 152 ? 31.212  88.733  -3.090  1.00 79.73  ? 160 LEU Q CD1 1 
ATOM   9718  C CD2 . LEU F 1 152 ? 32.224  89.372  -0.914  1.00 79.38  ? 160 LEU Q CD2 1 
ATOM   9719  N N   . HIS F 1 153 ? 33.028  92.875  -4.679  1.00 96.46  ? 161 HIS Q N   1 
ATOM   9720  C CA  . HIS F 1 153 ? 33.571  94.234  -4.769  1.00 96.20  ? 161 HIS Q CA  1 
ATOM   9721  C C   . HIS F 1 153 ? 32.795  95.208  -3.863  1.00 95.54  ? 161 HIS Q C   1 
ATOM   9722  O O   . HIS F 1 153 ? 31.660  94.928  -3.479  1.00 93.96  ? 161 HIS Q O   1 
ATOM   9723  C CB  . HIS F 1 153 ? 33.740  94.717  -6.233  1.00 100.21 ? 161 HIS Q CB  1 
ATOM   9724  C CG  . HIS F 1 153 ? 32.466  95.098  -6.938  1.00 106.07 ? 161 HIS Q CG  1 
ATOM   9725  N ND1 . HIS F 1 153 ? 32.105  96.406  -7.188  1.00 106.54 ? 161 HIS Q ND1 1 
ATOM   9726  C CD2 . HIS F 1 153 ? 31.431  94.339  -7.378  1.00 107.05 ? 161 HIS Q CD2 1 
ATOM   9727  C CE1 . HIS F 1 153 ? 30.926  96.435  -7.786  1.00 106.89 ? 161 HIS Q CE1 1 
ATOM   9728  N NE2 . HIS F 1 153 ? 30.493  95.191  -7.912  1.00 107.87 ? 161 HIS Q NE2 1 
ATOM   9729  N N   . VAL F 1 154 ? 33.423  96.323  -3.496  1.00 97.41  ? 162 VAL Q N   1 
ATOM   9730  C CA  . VAL F 1 154 ? 32.861  97.252  -2.503  1.00 99.15  ? 162 VAL Q CA  1 
ATOM   9731  C C   . VAL F 1 154 ? 31.871  98.307  -3.034  1.00 105.86 ? 162 VAL Q C   1 
ATOM   9732  O O   . VAL F 1 154 ? 32.169  99.043  -3.984  1.00 107.46 ? 162 VAL Q O   1 
ATOM   9733  C CB  . VAL F 1 154 ? 33.975  98.013  -1.769  1.00 94.59  ? 162 VAL Q CB  1 
ATOM   9734  C CG1 . VAL F 1 154 ? 33.847  97.822  -0.268  1.00 91.92  ? 162 VAL Q CG1 1 
ATOM   9735  C CG2 . VAL F 1 154 ? 35.345  97.584  -2.284  1.00 91.85  ? 162 VAL Q CG2 1 
ATOM   9736  N N   . ILE F 1 155 ? 30.713  98.412  -2.388  1.00 103.14 ? 163 ILE Q N   1 
ATOM   9737  C CA  . ILE F 1 155 ? 29.716  99.408  -2.773  1.00 104.60 ? 163 ILE Q CA  1 
ATOM   9738  C C   . ILE F 1 155 ? 29.318  100.313 -1.590  1.00 114.58 ? 163 ILE Q C   1 
ATOM   9739  O O   . ILE F 1 155 ? 29.705  100.050 -0.445  1.00 115.41 ? 163 ILE Q O   1 
ATOM   9740  C CB  . ILE F 1 155 ? 28.492  98.723  -3.362  1.00 102.44 ? 163 ILE Q CB  1 
ATOM   9741  C CG1 . ILE F 1 155 ? 27.894  97.768  -2.331  1.00 104.61 ? 163 ILE Q CG1 1 
ATOM   9742  C CG2 . ILE F 1 155 ? 28.886  97.957  -4.606  1.00 98.94  ? 163 ILE Q CG2 1 
ATOM   9743  C CD1 . ILE F 1 155 ? 26.550  97.205  -2.717  1.00 109.09 ? 163 ILE Q CD1 1 
ATOM   9744  N N   . SER F 1 156 ? 28.553  101.373 -1.870  1.00 115.84 ? 164 SER Q N   1 
ATOM   9745  C CA  . SER F 1 156 ? 28.150  102.366 -0.857  1.00 118.42 ? 164 SER Q CA  1 
ATOM   9746  C C   . SER F 1 156 ? 27.310  101.818 0.311   1.00 117.72 ? 164 SER Q C   1 
ATOM   9747  O O   . SER F 1 156 ? 26.470  100.939 0.132   1.00 118.46 ? 164 SER Q O   1 
ATOM   9748  C CB  . SER F 1 156 ? 27.396  103.522 -1.522  1.00 123.84 ? 164 SER Q CB  1 
ATOM   9749  O OG  . SER F 1 156 ? 26.084  103.644 -0.987  1.00 126.43 ? 164 SER Q OG  1 
ATOM   9750  N N   . ASN F 1 157 ? 27.523  102.366 1.504   1.00 112.79 ? 165 ASN Q N   1 
ATOM   9751  C CA  . ASN F 1 157 ? 26.858  101.857 2.703   1.00 118.83 ? 165 ASN Q CA  1 
ATOM   9752  C C   . ASN F 1 157 ? 25.345  102.066 2.755   1.00 129.47 ? 165 ASN Q C   1 
ATOM   9753  O O   . ASN F 1 157 ? 24.645  101.377 3.504   1.00 128.81 ? 165 ASN Q O   1 
ATOM   9754  C CB  . ASN F 1 157 ? 27.481  102.454 3.958   1.00 113.32 ? 165 ASN Q CB  1 
ATOM   9755  C CG  . ASN F 1 157 ? 28.902  102.012 4.163   1.00 107.73 ? 165 ASN Q CG  1 
ATOM   9756  O OD1 . ASN F 1 157 ? 29.536  101.492 3.247   1.00 108.75 ? 165 ASN Q OD1 1 
ATOM   9757  N ND2 . ASN F 1 157 ? 29.419  102.217 5.368   1.00 104.78 ? 165 ASN Q ND2 1 
ATOM   9758  N N   . ASP F 1 158 ? 24.843  103.025 1.981   1.00 135.12 ? 166 ASP Q N   1 
ATOM   9759  C CA  . ASP F 1 158 ? 23.414  103.347 2.004   1.00 137.56 ? 166 ASP Q CA  1 
ATOM   9760  C C   . ASP F 1 158 ? 22.598  102.331 1.200   1.00 131.58 ? 166 ASP Q C   1 
ATOM   9761  O O   . ASP F 1 158 ? 21.418  102.110 1.479   1.00 132.02 ? 166 ASP Q O   1 
ATOM   9762  C CB  . ASP F 1 158 ? 23.164  104.779 1.494   1.00 141.58 ? 166 ASP Q CB  1 
ATOM   9763  C CG  . ASP F 1 158 ? 21.921  105.423 2.115   1.00 139.45 ? 166 ASP Q CG  1 
ATOM   9764  O OD1 . ASP F 1 158 ? 22.037  106.555 2.638   1.00 132.32 ? 166 ASP Q OD1 1 
ATOM   9765  O OD2 . ASP F 1 158 ? 20.834  104.802 2.081   1.00 132.54 ? 166 ASP Q OD2 1 
ATOM   9766  N N   . VAL F 1 159 ? 23.232  101.712 0.208   1.00 128.57 ? 167 VAL Q N   1 
ATOM   9767  C CA  . VAL F 1 159 ? 22.546  100.738 -0.634  1.00 128.75 ? 167 VAL Q CA  1 
ATOM   9768  C C   . VAL F 1 159 ? 22.195  99.489  0.167   1.00 127.81 ? 167 VAL Q C   1 
ATOM   9769  O O   . VAL F 1 159 ? 21.443  98.622  -0.293  1.00 127.18 ? 167 VAL Q O   1 
ATOM   9770  C CB  . VAL F 1 159 ? 23.372  100.373 -1.895  1.00 127.90 ? 167 VAL Q CB  1 
ATOM   9771  C CG1 . VAL F 1 159 ? 24.642  101.209 -1.969  1.00 120.40 ? 167 VAL Q CG1 1 
ATOM   9772  C CG2 . VAL F 1 159 ? 23.688  98.883  -1.930  1.00 125.03 ? 167 VAL Q CG2 1 
ATOM   9773  N N   . CYS F 1 160 ? 22.733  99.415  1.379   1.00 124.78 ? 168 CYS Q N   1 
ATOM   9774  C CA  . CYS F 1 160 ? 22.451  98.299  2.263   1.00 127.60 ? 168 CYS Q CA  1 
ATOM   9775  C C   . CYS F 1 160 ? 21.610  98.778  3.436   1.00 128.34 ? 168 CYS Q C   1 
ATOM   9776  O O   . CYS F 1 160 ? 20.875  98.005  4.045   1.00 130.18 ? 168 CYS Q O   1 
ATOM   9777  C CB  . CYS F 1 160 ? 23.749  97.665  2.755   1.00 130.57 ? 168 CYS Q CB  1 
ATOM   9778  S SG  . CYS F 1 160 ? 25.158  97.936  1.650   1.00 142.52 ? 168 CYS Q SG  1 
ATOM   9779  N N   . ALA F 1 161 ? 21.720  100.062 3.750   1.00 128.31 ? 169 ALA Q N   1 
ATOM   9780  C CA  . ALA F 1 161 ? 20.926  100.640 4.823   1.00 128.89 ? 169 ALA Q CA  1 
ATOM   9781  C C   . ALA F 1 161 ? 19.456  100.553 4.457   1.00 132.51 ? 169 ALA Q C   1 
ATOM   9782  O O   . ALA F 1 161 ? 18.619  100.179 5.283   1.00 134.19 ? 169 ALA Q O   1 
ATOM   9783  C CB  . ALA F 1 161 ? 21.331  102.086 5.070   1.00 130.22 ? 169 ALA Q CB  1 
ATOM   9784  N N   . GLN F 1 162 ? 19.160  100.898 3.205   1.00 131.67 ? 170 GLN Q N   1 
ATOM   9785  C CA  . GLN F 1 162 ? 17.807  100.829 2.668   1.00 131.48 ? 170 GLN Q CA  1 
ATOM   9786  C C   . GLN F 1 162 ? 17.283  99.400  2.647   1.00 139.47 ? 170 GLN Q C   1 
ATOM   9787  O O   . GLN F 1 162 ? 16.147  99.136  3.064   1.00 144.70 ? 170 GLN Q O   1 
ATOM   9788  C CB  . GLN F 1 162 ? 17.771  101.385 1.249   1.00 122.82 ? 170 GLN Q CB  1 
ATOM   9789  C CG  . GLN F 1 162 ? 17.609  102.878 1.165   1.00 118.66 ? 170 GLN Q CG  1 
ATOM   9790  C CD  . GLN F 1 162 ? 16.900  103.285 -0.106  1.00 117.88 ? 170 GLN Q CD  1 
ATOM   9791  O OE1 . GLN F 1 162 ? 16.589  102.438 -0.945  1.00 119.89 ? 170 GLN Q OE1 1 
ATOM   9792  N NE2 . GLN F 1 162 ? 16.629  104.580 -0.255  1.00 110.09 ? 170 GLN Q NE2 1 
ATOM   9793  N N   . VAL F 1 163 ? 18.108  98.483  2.148   1.00 135.92 ? 171 VAL Q N   1 
ATOM   9794  C CA  . VAL F 1 163 ? 17.710  97.085  2.039   1.00 136.61 ? 171 VAL Q CA  1 
ATOM   9795  C C   . VAL F 1 163 ? 17.658  96.380  3.411   1.00 135.60 ? 171 VAL Q C   1 
ATOM   9796  O O   . VAL F 1 163 ? 16.620  95.838  3.787   1.00 134.84 ? 171 VAL Q O   1 
ATOM   9797  C CB  . VAL F 1 163 ? 18.578  96.313  0.999   1.00 133.13 ? 171 VAL Q CB  1 
ATOM   9798  C CG1 . VAL F 1 163 ? 18.453  96.949  -0.378  1.00 124.76 ? 171 VAL Q CG1 1 
ATOM   9799  C CG2 . VAL F 1 163 ? 20.022  96.285  1.419   1.00 136.70 ? 171 VAL Q CG2 1 
ATOM   9800  N N   . HIS F 1 164 ? 18.757  96.421  4.164   1.00 135.40 ? 172 HIS Q N   1 
ATOM   9801  C CA  . HIS F 1 164 ? 18.848  95.757  5.471   1.00 135.20 ? 172 HIS Q CA  1 
ATOM   9802  C C   . HIS F 1 164 ? 17.980  96.385  6.567   1.00 137.25 ? 172 HIS Q C   1 
ATOM   9803  O O   . HIS F 1 164 ? 18.017  97.601  6.779   1.00 133.62 ? 172 HIS Q O   1 
ATOM   9804  C CB  . HIS F 1 164 ? 20.300  95.721  5.955   1.00 133.45 ? 172 HIS Q CB  1 
ATOM   9805  C CG  . HIS F 1 164 ? 21.079  94.529  5.470   1.00 136.10 ? 172 HIS Q CG  1 
ATOM   9806  N ND1 . HIS F 1 164 ? 22.159  94.652  4.633   1.00 135.99 ? 172 HIS Q ND1 1 
ATOM   9807  C CD2 . HIS F 1 164 ? 20.930  93.211  5.722   1.00 136.91 ? 172 HIS Q CD2 1 
ATOM   9808  C CE1 . HIS F 1 164 ? 22.652  93.437  4.378   1.00 134.30 ? 172 HIS Q CE1 1 
ATOM   9809  N NE2 . HIS F 1 164 ? 21.921  92.558  5.032   1.00 135.56 ? 172 HIS Q NE2 1 
ATOM   9810  N N   . PRO F 1 165 ? 17.217  95.539  7.287   1.00 138.80 ? 173 PRO Q N   1 
ATOM   9811  C CA  . PRO F 1 165 ? 16.320  95.916  8.391   1.00 133.55 ? 173 PRO Q CA  1 
ATOM   9812  C C   . PRO F 1 165 ? 17.098  96.487  9.571   1.00 132.76 ? 173 PRO Q C   1 
ATOM   9813  O O   . PRO F 1 165 ? 16.564  97.244  10.383  1.00 132.93 ? 173 PRO Q O   1 
ATOM   9814  C CB  . PRO F 1 165 ? 15.677  94.580  8.784   1.00 129.73 ? 173 PRO Q CB  1 
ATOM   9815  C CG  . PRO F 1 165 ? 16.645  93.542  8.321   1.00 130.41 ? 173 PRO Q CG  1 
ATOM   9816  C CD  . PRO F 1 165 ? 17.212  94.084  7.050   1.00 135.82 ? 173 PRO Q CD  1 
ATOM   9817  N N   . GLN F 1 166 ? 18.367  96.110  9.643   1.00 131.91 ? 174 GLN Q N   1 
ATOM   9818  C CA  . GLN F 1 166 ? 19.278  96.552  10.682  1.00 129.37 ? 174 GLN Q CA  1 
ATOM   9819  C C   . GLN F 1 166 ? 19.895  97.898  10.309  1.00 124.67 ? 174 GLN Q C   1 
ATOM   9820  O O   . GLN F 1 166 ? 20.074  98.199  9.128   1.00 125.80 ? 174 GLN Q O   1 
ATOM   9821  C CB  . GLN F 1 166 ? 20.380  95.509  10.816  1.00 134.17 ? 174 GLN Q CB  1 
ATOM   9822  C CG  . GLN F 1 166 ? 20.899  95.044  9.458   1.00 133.05 ? 174 GLN Q CG  1 
ATOM   9823  C CD  . GLN F 1 166 ? 21.880  93.894  9.554   1.00 132.79 ? 174 GLN Q CD  1 
ATOM   9824  O OE1 . GLN F 1 166 ? 21.486  92.726  9.521   1.00 137.57 ? 174 GLN Q OE1 1 
ATOM   9825  N NE2 . GLN F 1 166 ? 23.167  94.218  9.666   1.00 125.44 ? 174 GLN Q NE2 1 
ATOM   9826  N N   . LYS F 1 167 ? 20.225  98.706  11.311  1.00 117.65 ? 175 LYS Q N   1 
ATOM   9827  C CA  . LYS F 1 167 ? 20.875  99.986  11.063  1.00 116.33 ? 175 LYS Q CA  1 
ATOM   9828  C C   . LYS F 1 167 ? 22.231  99.803  10.388  1.00 109.13 ? 175 LYS Q C   1 
ATOM   9829  O O   . LYS F 1 167 ? 22.860  98.760  10.522  1.00 110.22 ? 175 LYS Q O   1 
ATOM   9830  C CB  . LYS F 1 167 ? 21.039  100.767 12.367  1.00 120.34 ? 175 LYS Q CB  1 
ATOM   9831  C CG  . LYS F 1 167 ? 20.000  101.861 12.581  1.00 126.23 ? 175 LYS Q CG  1 
ATOM   9832  C CD  . LYS F 1 167 ? 18.751  101.360 13.296  1.00 128.46 ? 175 LYS Q CD  1 
ATOM   9833  C CE  . LYS F 1 167 ? 17.778  102.509 13.552  1.00 127.62 ? 175 LYS Q CE  1 
ATOM   9834  N NZ  . LYS F 1 167 ? 16.853  102.252 14.694  1.00 127.00 ? 175 LYS Q NZ  1 
ATOM   9835  N N   . VAL F 1 168 ? 22.685  100.825 9.673   1.00 103.28 ? 176 VAL Q N   1 
ATOM   9836  C CA  . VAL F 1 168 ? 23.926  100.726 8.911   1.00 109.22 ? 176 VAL Q CA  1 
ATOM   9837  C C   . VAL F 1 168 ? 24.907  101.875 9.179   1.00 107.38 ? 176 VAL Q C   1 
ATOM   9838  O O   . VAL F 1 168 ? 25.266  102.635 8.276   1.00 105.12 ? 176 VAL Q O   1 
ATOM   9839  C CB  . VAL F 1 168 ? 23.638  100.595 7.395   1.00 114.81 ? 176 VAL Q CB  1 
ATOM   9840  C CG1 . VAL F 1 168 ? 24.932  100.631 6.570   1.00 109.06 ? 176 VAL Q CG1 1 
ATOM   9841  C CG2 . VAL F 1 168 ? 22.864  99.318  7.129   1.00 116.95 ? 176 VAL Q CG2 1 
ATOM   9842  N N   . THR F 1 169 ? 25.346  101.982 10.427  1.00 105.54 ? 177 THR Q N   1 
ATOM   9843  C CA  . THR F 1 169 ? 26.356  102.963 10.811  1.00 109.62 ? 177 THR Q CA  1 
ATOM   9844  C C   . THR F 1 169 ? 27.618  102.885 9.946   1.00 109.05 ? 177 THR Q C   1 
ATOM   9845  O O   . THR F 1 169 ? 28.091  101.798 9.621   1.00 108.07 ? 177 THR Q O   1 
ATOM   9846  C CB  . THR F 1 169 ? 26.751  102.797 12.290  1.00 119.36 ? 177 THR Q CB  1 
ATOM   9847  O OG1 . THR F 1 169 ? 26.516  101.443 12.695  1.00 120.33 ? 177 THR Q OG1 1 
ATOM   9848  C CG2 . THR F 1 169 ? 25.924  103.720 13.171  1.00 126.93 ? 177 THR Q CG2 1 
ATOM   9849  N N   . LYS F 1 170 ? 28.165  104.042 9.585   1.00 110.77 ? 178 LYS Q N   1 
ATOM   9850  C CA  . LYS F 1 170 ? 29.349  104.082 8.737   1.00 107.47 ? 178 LYS Q CA  1 
ATOM   9851  C C   . LYS F 1 170 ? 30.614  103.939 9.576   1.00 108.65 ? 178 LYS Q C   1 
ATOM   9852  O O   . LYS F 1 170 ? 31.620  104.631 9.361   1.00 108.95 ? 178 LYS Q O   1 
ATOM   9853  C CB  . LYS F 1 170 ? 29.386  105.342 7.865   1.00 114.80 ? 178 LYS Q CB  1 
ATOM   9854  C CG  . LYS F 1 170 ? 28.092  105.620 7.091   1.00 112.69 ? 178 LYS Q CG  1 
ATOM   9855  C CD  . LYS F 1 170 ? 27.483  104.349 6.519   1.00 114.04 ? 178 LYS Q CD  1 
ATOM   9856  C CE  . LYS F 1 170 ? 26.109  104.611 5.912   1.00 113.93 ? 178 LYS Q CE  1 
ATOM   9857  N NZ  . LYS F 1 170 ? 26.173  105.568 4.774   1.00 116.51 ? 178 LYS Q NZ  1 
ATOM   9858  N N   . PHE F 1 171 ? 30.516  103.057 10.568  1.00 106.87 ? 179 PHE Q N   1 
ATOM   9859  C CA  . PHE F 1 171 ? 31.666  102.318 11.065  1.00 106.42 ? 179 PHE Q CA  1 
ATOM   9860  C C   . PHE F 1 171 ? 31.752  101.063 10.189  1.00 101.57 ? 179 PHE Q C   1 
ATOM   9861  O O   . PHE F 1 171 ? 32.761  100.357 10.184  1.00 95.75  ? 179 PHE Q O   1 
ATOM   9862  C CB  . PHE F 1 171 ? 31.473  101.876 12.519  1.00 107.05 ? 179 PHE Q CB  1 
ATOM   9863  C CG  . PHE F 1 171 ? 31.342  103.004 13.508  1.00 107.44 ? 179 PHE Q CG  1 
ATOM   9864  C CD1 . PHE F 1 171 ? 30.100  103.334 14.041  1.00 111.18 ? 179 PHE Q CD1 1 
ATOM   9865  C CD2 . PHE F 1 171 ? 32.458  103.704 13.940  1.00 104.45 ? 179 PHE Q CD2 1 
ATOM   9866  C CE1 . PHE F 1 171 ? 29.971  104.359 14.968  1.00 108.80 ? 179 PHE Q CE1 1 
ATOM   9867  C CE2 . PHE F 1 171 ? 32.338  104.732 14.866  1.00 105.80 ? 179 PHE Q CE2 1 
ATOM   9868  C CZ  . PHE F 1 171 ? 31.092  105.061 15.381  1.00 104.13 ? 179 PHE Q CZ  1 
ATOM   9869  N N   . MET F 1 172 ? 30.676  100.787 9.455   1.00 97.61  ? 180 MET Q N   1 
ATOM   9870  C CA  . MET F 1 172 ? 30.586  99.575  8.656   1.00 88.81  ? 180 MET Q CA  1 
ATOM   9871  C C   . MET F 1 172 ? 31.227  99.717  7.292   1.00 88.84  ? 180 MET Q C   1 
ATOM   9872  O O   . MET F 1 172 ? 31.754  100.773 6.937   1.00 92.12  ? 180 MET Q O   1 
ATOM   9873  C CB  . MET F 1 172 ? 29.132  99.145  8.488   1.00 88.84  ? 180 MET Q CB  1 
ATOM   9874  C CG  . MET F 1 172 ? 28.400  98.964  9.801   1.00 94.12  ? 180 MET Q CG  1 
ATOM   9875  S SD  . MET F 1 172 ? 27.002  97.839  9.661   1.00 93.62  ? 180 MET Q SD  1 
ATOM   9876  C CE  . MET F 1 172 ? 26.239  98.054  11.269  1.00 110.39 ? 180 MET Q CE  1 
ATOM   9877  N N   . LEU F 1 173 ? 31.179  98.620  6.547   1.00 85.80  ? 181 LEU Q N   1 
ATOM   9878  C CA  . LEU F 1 173 ? 31.650  98.555  5.175   1.00 89.91  ? 181 LEU Q CA  1 
ATOM   9879  C C   . LEU F 1 173 ? 30.680  97.665  4.418   1.00 96.03  ? 181 LEU Q C   1 
ATOM   9880  O O   . LEU F 1 173 ? 30.242  96.642  4.943   1.00 98.12  ? 181 LEU Q O   1 
ATOM   9881  C CB  . LEU F 1 173 ? 33.044  97.937  5.114   1.00 86.17  ? 181 LEU Q CB  1 
ATOM   9882  C CG  . LEU F 1 173 ? 33.826  98.225  3.830   1.00 90.33  ? 181 LEU Q CG  1 
ATOM   9883  C CD1 . LEU F 1 173 ? 34.287  99.672  3.817   1.00 96.53  ? 181 LEU Q CD1 1 
ATOM   9884  C CD2 . LEU F 1 173 ? 35.016  97.306  3.686   1.00 81.21  ? 181 LEU Q CD2 1 
ATOM   9885  N N   . CYS F 1 174 ? 30.328  98.036  3.192   1.00 97.89  ? 182 CYS Q N   1 
ATOM   9886  C CA  . CYS F 1 174 ? 29.391  97.202  2.450   1.00 102.23 ? 182 CYS Q CA  1 
ATOM   9887  C C   . CYS F 1 174 ? 29.885  96.779  1.079   1.00 102.64 ? 182 CYS Q C   1 
ATOM   9888  O O   . CYS F 1 174 ? 30.502  97.569  0.362   1.00 101.07 ? 182 CYS Q O   1 
ATOM   9889  C CB  . CYS F 1 174 ? 28.026  97.865  2.320   1.00 106.88 ? 182 CYS Q CB  1 
ATOM   9890  S SG  . CYS F 1 174 ? 26.789  96.713  1.668   1.00 116.67 ? 182 CYS Q SG  1 
ATOM   9891  N N   . ALA F 1 175 ? 29.598  95.526  0.722   1.00 99.82  ? 183 ALA Q N   1 
ATOM   9892  C CA  . ALA F 1 175 ? 29.987  95.008  -0.586  1.00 99.14  ? 183 ALA Q CA  1 
ATOM   9893  C C   . ALA F 1 175 ? 29.326  93.695  -1.040  1.00 99.83  ? 183 ALA Q C   1 
ATOM   9894  O O   . ALA F 1 175 ? 28.414  93.159  -0.400  1.00 96.24  ? 183 ALA Q O   1 
ATOM   9895  C CB  . ALA F 1 175 ? 31.497  94.907  -0.689  1.00 88.78  ? 183 ALA Q CB  1 
ATOM   9896  N N   . GLY F 1 176 ? 29.826  93.207  -2.172  1.00 99.44  ? 184 GLY Q N   1 
ATOM   9897  C CA  . GLY F 1 176 ? 29.232  92.121  -2.930  1.00 98.62  ? 184 GLY Q CA  1 
ATOM   9898  C C   . GLY F 1 176 ? 29.471  92.352  -4.421  1.00 99.74  ? 184 GLY Q C   1 
ATOM   9899  O O   . GLY F 1 176 ? 29.771  93.476  -4.842  1.00 99.30  ? 184 GLY Q O   1 
ATOM   9900  N N   . ARG F 1 177 ? 29.366  91.278  -5.205  1.00 103.20 ? 185 ARG Q N   1 
ATOM   9901  C CA  . ARG F 1 177 ? 29.379  91.298  -6.681  1.00 110.04 ? 185 ARG Q CA  1 
ATOM   9902  C C   . ARG F 1 177 ? 28.734  89.985  -7.079  1.00 113.99 ? 185 ARG Q C   1 
ATOM   9903  O O   . ARG F 1 177 ? 28.529  89.683  -8.262  1.00 112.32 ? 185 ARG Q O   1 
ATOM   9904  C CB  . ARG F 1 177 ? 30.809  91.363  -7.244  1.00 105.71 ? 185 ARG Q CB  1 
ATOM   9905  C CG  . ARG F 1 177 ? 31.058  90.516  -8.513  1.00 100.91 ? 185 ARG Q CG  1 
ATOM   9906  C CD  . ARG F 1 177 ? 31.328  91.375  -9.741  1.00 104.93 ? 185 ARG Q CD  1 
ATOM   9907  N NE  . ARG F 1 177 ? 32.613  92.063  -9.657  1.00 101.31 ? 185 ARG Q NE  1 
ATOM   9908  C CZ  . ARG F 1 177 ? 33.015  93.006  -10.504 1.00 107.05 ? 185 ARG Q CZ  1 
ATOM   9909  N NH1 . ARG F 1 177 ? 32.229  93.382  -11.507 1.00 107.32 ? 185 ARG Q NH1 1 
ATOM   9910  N NH2 . ARG F 1 177 ? 34.203  93.578  -10.342 1.00 111.16 ? 185 ARG Q NH2 1 
ATOM   9911  N N   . TRP F 1 178 ? 28.416  89.221  -6.036  1.00 116.74 ? 186 TRP Q N   1 
ATOM   9912  C CA  . TRP F 1 178 ? 27.933  87.851  -6.125  1.00 119.11 ? 186 TRP Q CA  1 
ATOM   9913  C C   . TRP F 1 178 ? 27.333  87.470  -7.487  1.00 121.38 ? 186 TRP Q C   1 
ATOM   9914  O O   . TRP F 1 178 ? 26.281  87.976  -7.897  1.00 119.52 ? 186 TRP Q O   1 
ATOM   9915  C CB  . TRP F 1 178 ? 26.952  87.576  -4.978  1.00 122.67 ? 186 TRP Q CB  1 
ATOM   9916  C CG  . TRP F 1 178 ? 27.161  86.245  -4.299  1.00 131.52 ? 186 TRP Q CG  1 
ATOM   9917  C CD1 . TRP F 1 178 ? 27.890  85.188  -4.768  1.00 129.85 ? 186 TRP Q CD1 1 
ATOM   9918  C CD2 . TRP F 1 178 ? 26.617  85.825  -3.038  1.00 137.93 ? 186 TRP Q CD2 1 
ATOM   9919  N NE1 . TRP F 1 178 ? 27.837  84.140  -3.877  1.00 129.01 ? 186 TRP Q NE1 1 
ATOM   9920  C CE2 . TRP F 1 178 ? 27.062  84.506  -2.808  1.00 133.34 ? 186 TRP Q CE2 1 
ATOM   9921  C CE3 . TRP F 1 178 ? 25.800  86.437  -2.081  1.00 141.76 ? 186 TRP Q CE3 1 
ATOM   9922  C CZ2 . TRP F 1 178 ? 26.717  83.790  -1.666  1.00 143.67 ? 186 TRP Q CZ2 1 
ATOM   9923  C CZ3 . TRP F 1 178 ? 25.456  85.725  -0.946  1.00 145.26 ? 186 TRP Q CZ3 1 
ATOM   9924  C CH2 . TRP F 1 178 ? 25.915  84.416  -0.748  1.00 152.02 ? 186 TRP Q CH2 1 
ATOM   9925  N N   . THR F 1 179 A 28.032  86.581  -8.189  1.00 121.48 ? 186 THR Q N   1 
ATOM   9926  C CA  . THR F 1 179 A 27.526  85.996  -9.426  1.00 114.22 ? 186 THR Q CA  1 
ATOM   9927  C C   . THR F 1 179 A 27.072  84.560  -9.154  1.00 107.67 ? 186 THR Q C   1 
ATOM   9928  O O   . THR F 1 179 A 27.697  83.824  -8.379  1.00 104.92 ? 186 THR Q O   1 
ATOM   9929  C CB  . THR F 1 179 A 28.588  86.009  -10.555 1.00 116.39 ? 186 THR Q CB  1 
ATOM   9930  O OG1 . THR F 1 179 A 29.741  86.753  -10.135 1.00 125.34 ? 186 THR Q OG1 1 
ATOM   9931  C CG2 . THR F 1 179 A 28.017  86.637  -11.833 1.00 108.11 ? 186 THR Q CG2 1 
ATOM   9932  N N   . GLY F 1 180 B 25.978  84.168  -9.794  1.00 101.28 ? 186 GLY Q N   1 
ATOM   9933  C CA  . GLY F 1 180 B 25.388  82.868  -9.552  1.00 97.73  ? 186 GLY Q CA  1 
ATOM   9934  C C   . GLY F 1 180 B 24.237  83.024  -8.578  1.00 103.80 ? 186 GLY Q C   1 
ATOM   9935  O O   . GLY F 1 180 B 23.220  83.659  -8.901  1.00 95.53  ? 186 GLY Q O   1 
ATOM   9936  N N   . GLY F 1 181 ? 24.401  82.460  -7.380  1.00 109.35 ? 187 GLY Q N   1 
ATOM   9937  C CA  . GLY F 1 181 ? 23.354  82.506  -6.375  1.00 117.65 ? 187 GLY Q CA  1 
ATOM   9938  C C   . GLY F 1 181 ? 23.655  81.791  -5.072  1.00 129.93 ? 187 GLY Q C   1 
ATOM   9939  O O   . GLY F 1 181 ? 24.815  81.553  -4.727  1.00 137.36 ? 187 GLY Q O   1 
ATOM   9940  N N   . LYS F 1 182 ? 22.591  81.446  -4.350  1.00 134.40 ? 188 LYS Q N   1 
ATOM   9941  C CA  . LYS F 1 182 ? 22.711  80.884  -3.010  1.00 143.46 ? 188 LYS Q CA  1 
ATOM   9942  C C   . LYS F 1 182 ? 22.594  79.357  -2.973  1.00 149.62 ? 188 LYS Q C   1 
ATOM   9943  O O   . LYS F 1 182 ? 21.534  78.815  -2.643  1.00 146.51 ? 188 LYS Q O   1 
ATOM   9944  C CB  . LYS F 1 182 ? 21.679  81.524  -2.073  1.00 142.29 ? 188 LYS Q CB  1 
ATOM   9945  C CG  . LYS F 1 182 ? 20.604  82.349  -2.777  1.00 135.89 ? 188 LYS Q CG  1 
ATOM   9946  C CD  . LYS F 1 182 ? 19.713  83.053  -1.762  1.00 138.04 ? 188 LYS Q CD  1 
ATOM   9947  C CE  . LYS F 1 182 ? 19.175  84.384  -2.274  1.00 132.30 ? 188 LYS Q CE  1 
ATOM   9948  N NZ  . LYS F 1 182 ? 18.614  85.211  -1.163  1.00 134.09 ? 188 LYS Q NZ  1 
ATOM   9949  N N   . SER F 1 183 ? 23.691  78.680  -3.317  1.00 151.75 ? 189 SER Q N   1 
ATOM   9950  C CA  . SER F 1 183 ? 23.808  77.228  -3.159  1.00 151.09 ? 189 SER Q CA  1 
ATOM   9951  C C   . SER F 1 183 ? 25.219  76.684  -3.437  1.00 152.25 ? 189 SER Q C   1 
ATOM   9952  O O   . SER F 1 183 ? 25.412  75.770  -4.241  1.00 155.05 ? 189 SER Q O   1 
ATOM   9953  C CB  . SER F 1 183 ? 22.744  76.481  -3.972  1.00 147.09 ? 189 SER Q CB  1 
ATOM   9954  O OG  . SER F 1 183 ? 21.625  76.155  -3.154  1.00 135.55 ? 189 SER Q OG  1 
ATOM   9955  N N   . THR F 1 184 ? 26.201  77.289  -2.780  1.00 153.89 ? 190 THR Q N   1 
ATOM   9956  C CA  . THR F 1 184 ? 27.505  76.670  -2.548  1.00 156.76 ? 190 THR Q CA  1 
ATOM   9957  C C   . THR F 1 184 ? 28.131  77.403  -1.357  1.00 157.00 ? 190 THR Q C   1 
ATOM   9958  O O   . THR F 1 184 ? 29.068  78.197  -1.500  1.00 149.68 ? 190 THR Q O   1 
ATOM   9959  C CB  . THR F 1 184 ? 28.438  76.660  -3.788  1.00 145.06 ? 190 THR Q CB  1 
ATOM   9960  O OG1 . THR F 1 184 ? 29.718  77.185  -3.419  1.00 142.44 ? 190 THR Q OG1 1 
ATOM   9961  C CG2 . THR F 1 184 ? 27.854  77.465  -4.952  1.00 138.46 ? 190 THR Q CG2 1 
ATOM   9962  N N   . CYS F 1 185 ? 27.585  77.111  -0.179  1.00 157.30 ? 191 CYS Q N   1 
ATOM   9963  C CA  . CYS F 1 185 ? 27.727  77.961  1.002   1.00 159.47 ? 191 CYS Q CA  1 
ATOM   9964  C C   . CYS F 1 185 ? 29.099  78.621  1.233   1.00 155.95 ? 191 CYS Q C   1 
ATOM   9965  O O   . CYS F 1 185 ? 30.155  78.057  0.917   1.00 148.42 ? 191 CYS Q O   1 
ATOM   9966  C CB  . CYS F 1 185 ? 27.193  77.251  2.252   1.00 158.58 ? 191 CYS Q CB  1 
ATOM   9967  S SG  . CYS F 1 185 ? 25.376  77.281  2.365   1.00 150.95 ? 191 CYS Q SG  1 
ATOM   9968  N N   . SER F 1 186 ? 29.042  79.826  1.800   1.00 153.90 ? 192 SER Q N   1 
ATOM   9969  C CA  . SER F 1 186 ? 30.154  80.775  1.807   1.00 146.87 ? 192 SER Q CA  1 
ATOM   9970  C C   . SER F 1 186 ? 30.870  80.922  3.158   1.00 141.57 ? 192 SER Q C   1 
ATOM   9971  O O   . SER F 1 186 ? 31.375  82.002  3.483   1.00 138.56 ? 192 SER Q O   1 
ATOM   9972  C CB  . SER F 1 186 ? 29.650  82.147  1.335   1.00 143.81 ? 192 SER Q CB  1 
ATOM   9973  O OG  . SER F 1 186 ? 30.666  83.135  1.364   1.00 134.32 ? 192 SER Q OG  1 
ATOM   9974  N N   . GLY F 1 187 ? 30.900  79.846  3.943   1.00 139.07 ? 193 GLY Q N   1 
ATOM   9975  C CA  . GLY F 1 187 ? 31.723  79.783  5.145   1.00 131.56 ? 193 GLY Q CA  1 
ATOM   9976  C C   . GLY F 1 187 ? 31.205  80.442  6.411   1.00 129.35 ? 193 GLY Q C   1 
ATOM   9977  O O   . GLY F 1 187 ? 30.372  81.348  6.356   1.00 137.24 ? 193 GLY Q O   1 
ATOM   9978  N N   . ASP F 1 188 ? 31.713  80.003  7.559   1.00 119.39 ? 194 ASP Q N   1 
ATOM   9979  C CA  . ASP F 1 188 ? 31.211  80.501  8.835   1.00 117.42 ? 194 ASP Q CA  1 
ATOM   9980  C C   . ASP F 1 188 ? 31.405  82.014  9.041   1.00 111.35 ? 194 ASP Q C   1 
ATOM   9981  O O   . ASP F 1 188 ? 32.243  82.646  8.396   1.00 105.67 ? 194 ASP Q O   1 
ATOM   9982  C CB  . ASP F 1 188 ? 31.772  79.684  10.010  1.00 113.64 ? 194 ASP Q CB  1 
ATOM   9983  C CG  . ASP F 1 188 ? 31.055  78.344  10.193  1.00 118.86 ? 194 ASP Q CG  1 
ATOM   9984  O OD1 . ASP F 1 188 ? 30.288  78.187  11.175  1.00 111.66 ? 194 ASP Q OD1 1 
ATOM   9985  O OD2 . ASP F 1 188 ? 31.259  77.448  9.349   1.00 122.91 ? 194 ASP Q OD2 1 
ATOM   9986  N N   . SER F 1 189 ? 30.604  82.584  9.935   1.00 109.63 ? 195 SER Q N   1 
ATOM   9987  C CA  . SER F 1 189 ? 30.672  84.006  10.234  1.00 100.98 ? 195 SER Q CA  1 
ATOM   9988  C C   . SER F 1 189 ? 32.023  84.380  10.817  1.00 94.88  ? 195 SER Q C   1 
ATOM   9989  O O   . SER F 1 189 ? 32.732  83.539  11.364  1.00 88.56  ? 195 SER Q O   1 
ATOM   9990  C CB  . SER F 1 189 ? 29.577  84.392  11.219  1.00 99.56  ? 195 SER Q CB  1 
ATOM   9991  O OG  . SER F 1 189 ? 28.349  83.819  10.832  1.00 108.49 ? 195 SER Q OG  1 
ATOM   9992  N N   . GLY F 1 190 ? 32.363  85.659  10.712  1.00 95.73  ? 196 GLY Q N   1 
ATOM   9993  C CA  . GLY F 1 190 ? 33.652  86.154  11.158  1.00 88.57  ? 196 GLY Q CA  1 
ATOM   9994  C C   . GLY F 1 190 ? 34.610  86.269  9.987   1.00 83.59  ? 196 GLY Q C   1 
ATOM   9995  O O   . GLY F 1 190 ? 35.471  87.154  9.960   1.00 78.42  ? 196 GLY Q O   1 
ATOM   9996  N N   . GLY F 1 191 ? 34.444  85.368  9.019   1.00 79.58  ? 197 GLY Q N   1 
ATOM   9997  C CA  . GLY F 1 191 ? 35.281  85.327  7.838   1.00 76.61  ? 197 GLY Q CA  1 
ATOM   9998  C C   . GLY F 1 191 ? 35.855  86.679  7.456   1.00 76.30  ? 197 GLY Q C   1 
ATOM   9999  O O   . GLY F 1 191 ? 35.146  87.686  7.489   1.00 73.71  ? 197 GLY Q O   1 
ATOM   10000 N N   . PRO F 1 192 ? 37.148  86.704  7.086   1.00 73.64  ? 198 PRO Q N   1 
ATOM   10001 C CA  . PRO F 1 192 ? 37.864  87.915  6.690   1.00 69.49  ? 198 PRO Q CA  1 
ATOM   10002 C C   . PRO F 1 192 ? 37.527  88.332  5.243   1.00 74.79  ? 198 PRO Q C   1 
ATOM   10003 O O   . PRO F 1 192 ? 37.055  87.502  4.461   1.00 73.66  ? 198 PRO Q O   1 
ATOM   10004 C CB  . PRO F 1 192 ? 39.315  87.469  6.780   1.00 62.74  ? 198 PRO Q CB  1 
ATOM   10005 C CG  . PRO F 1 192 ? 39.265  86.045  6.370   1.00 61.78  ? 198 PRO Q CG  1 
ATOM   10006 C CD  . PRO F 1 192 ? 38.012  85.512  6.991   1.00 68.79  ? 198 PRO Q CD  1 
ATOM   10007 N N   . LEU F 1 193 ? 37.760  89.603  4.908   1.00 75.39  ? 199 LEU Q N   1 
ATOM   10008 C CA  . LEU F 1 193 ? 37.560  90.136  3.565   1.00 67.06  ? 199 LEU Q CA  1 
ATOM   10009 C C   . LEU F 1 193 ? 38.840  90.832  3.135   1.00 65.14  ? 199 LEU Q C   1 
ATOM   10010 O O   . LEU F 1 193 ? 39.259  91.833  3.715   1.00 63.01  ? 199 LEU Q O   1 
ATOM   10011 C CB  . LEU F 1 193 ? 36.392  91.129  3.543   1.00 72.46  ? 199 LEU Q CB  1 
ATOM   10012 C CG  . LEU F 1 193 ? 36.029  91.788  2.205   1.00 75.74  ? 199 LEU Q CG  1 
ATOM   10013 C CD1 . LEU F 1 193 ? 35.088  90.912  1.403   1.00 72.77  ? 199 LEU Q CD1 1 
ATOM   10014 C CD2 . LEU F 1 193 ? 35.413  93.161  2.404   1.00 69.25  ? 199 LEU Q CD2 1 
ATOM   10015 N N   . VAL F 1 194 ? 39.467  90.282  2.112   1.00 68.72  ? 200 VAL Q N   1 
ATOM   10016 C CA  . VAL F 1 194 ? 40.698  90.845  1.591   1.00 76.32  ? 200 VAL Q CA  1 
ATOM   10017 C C   . VAL F 1 194 ? 40.440  91.593  0.292   1.00 78.57  ? 200 VAL Q C   1 
ATOM   10018 O O   . VAL F 1 194 ? 39.560  91.226  -0.490  1.00 80.85  ? 200 VAL Q O   1 
ATOM   10019 C CB  . VAL F 1 194 ? 41.746  89.749  1.310   1.00 78.37  ? 200 VAL Q CB  1 
ATOM   10020 C CG1 . VAL F 1 194 ? 43.144  90.364  1.159   1.00 72.05  ? 200 VAL Q CG1 1 
ATOM   10021 C CG2 . VAL F 1 194 ? 41.718  88.704  2.406   1.00 74.41  ? 200 VAL Q CG2 1 
ATOM   10022 N N   . CYS F 1 195 ? 41.223  92.640  0.064   1.00 77.11  ? 201 CYS Q N   1 
ATOM   10023 C CA  . CYS F 1 195 ? 41.111  93.422  -1.145  1.00 76.08  ? 201 CYS Q CA  1 
ATOM   10024 C C   . CYS F 1 195 ? 42.516  93.795  -1.548  1.00 73.24  ? 201 CYS Q C   1 
ATOM   10025 O O   . CYS F 1 195 ? 43.242  94.426  -0.787  1.00 72.77  ? 201 CYS Q O   1 
ATOM   10026 C CB  . CYS F 1 195 ? 40.273  94.676  -0.894  1.00 84.53  ? 201 CYS Q CB  1 
ATOM   10027 S SG  . CYS F 1 195 ? 38.882  94.416  0.251   1.00 96.88  ? 201 CYS Q SG  1 
ATOM   10028 N N   . ASN F 1 196 ? 42.913  93.372  -2.737  1.00 77.96  ? 202 ASN Q N   1 
ATOM   10029 C CA  . ASN F 1 196 ? 44.218  93.751  -3.264  1.00 81.77  ? 202 ASN Q CA  1 
ATOM   10030 C C   . ASN F 1 196 ? 45.330  93.371  -2.301  1.00 74.87  ? 202 ASN Q C   1 
ATOM   10031 O O   . ASN F 1 196 ? 46.383  94.010  -2.240  1.00 74.51  ? 202 ASN Q O   1 
ATOM   10032 C CB  . ASN F 1 196 ? 44.275  95.246  -3.587  1.00 86.36  ? 202 ASN Q CB  1 
ATOM   10033 C CG  . ASN F 1 196 ? 43.665  95.579  -4.950  1.00 89.31  ? 202 ASN Q CG  1 
ATOM   10034 O OD1 . ASN F 1 196 ? 43.713  96.726  -5.394  1.00 98.94  ? 202 ASN Q OD1 1 
ATOM   10035 N ND2 . ASN F 1 196 ? 43.091  94.575  -5.617  1.00 82.05  ? 202 ASN Q ND2 1 
ATOM   10036 N N   . GLY F 1 197 ? 45.073  92.323  -1.535  1.00 74.46  ? 203 GLY Q N   1 
ATOM   10037 C CA  . GLY F 1 197 ? 46.125  91.697  -0.772  1.00 71.92  ? 203 GLY Q CA  1 
ATOM   10038 C C   . GLY F 1 197 ? 46.098  92.020  0.694   1.00 68.41  ? 203 GLY Q C   1 
ATOM   10039 O O   . GLY F 1 197 ? 46.928  91.509  1.448   1.00 68.28  ? 203 GLY Q O   1 
ATOM   10040 N N   . VAL F 1 198 ? 45.147  92.839  1.122   1.00 60.54  ? 208 VAL Q N   1 
ATOM   10041 C CA  . VAL F 1 198 ? 45.128  93.181  2.527   1.00 66.65  ? 208 VAL Q CA  1 
ATOM   10042 C C   . VAL F 1 198 ? 43.789  93.056  3.206   1.00 65.57  ? 208 VAL Q C   1 
ATOM   10043 O O   . VAL F 1 198 ? 42.754  93.148  2.576   1.00 67.58  ? 208 VAL Q O   1 
ATOM   10044 C CB  . VAL F 1 198 ? 45.699  94.556  2.748   1.00 69.33  ? 208 VAL Q CB  1 
ATOM   10045 C CG1 . VAL F 1 198 ? 45.813  95.266  1.406   1.00 68.31  ? 208 VAL Q CG1 1 
ATOM   10046 C CG2 . VAL F 1 198 ? 44.868  95.330  3.770   1.00 68.29  ? 208 VAL Q CG2 1 
ATOM   10047 N N   . LEU F 1 199 ? 43.835  92.818  4.509   1.00 66.02  ? 209 LEU Q N   1 
ATOM   10048 C CA  . LEU F 1 199 ? 42.636  92.624  5.304   1.00 69.56  ? 209 LEU Q CA  1 
ATOM   10049 C C   . LEU F 1 199 ? 41.951  93.958  5.402   1.00 70.43  ? 209 LEU Q C   1 
ATOM   10050 O O   . LEU F 1 199 ? 42.624  94.983  5.438   1.00 71.57  ? 209 LEU Q O   1 
ATOM   10051 C CB  . LEU F 1 199 ? 43.007  92.142  6.699   1.00 69.25  ? 209 LEU Q CB  1 
ATOM   10052 C CG  . LEU F 1 199 ? 41.888  92.204  7.728   1.00 65.32  ? 209 LEU Q CG  1 
ATOM   10053 C CD1 . LEU F 1 199 ? 41.016  90.980  7.653   1.00 63.82  ? 209 LEU Q CD1 1 
ATOM   10054 C CD2 . LEU F 1 199 ? 42.500  92.327  9.100   1.00 71.39  ? 209 LEU Q CD2 1 
ATOM   10055 N N   . GLN F 1 200 ? 40.624  93.955  5.463   1.00 70.28  ? 210 GLN Q N   1 
ATOM   10056 C CA  . GLN F 1 200 ? 39.880  95.195  5.288   1.00 73.36  ? 210 GLN Q CA  1 
ATOM   10057 C C   . GLN F 1 200 ? 38.617  95.238  6.140   1.00 69.75  ? 210 GLN Q C   1 
ATOM   10058 O O   . GLN F 1 200 ? 38.096  96.314  6.454   1.00 64.18  ? 210 GLN Q O   1 
ATOM   10059 C CB  . GLN F 1 200 ? 39.544  95.373  3.803   1.00 75.06  ? 210 GLN Q CB  1 
ATOM   10060 C CG  . GLN F 1 200 ? 39.517  96.818  3.327   1.00 81.66  ? 210 GLN Q CG  1 
ATOM   10061 C CD  . GLN F 1 200 ? 40.804  97.574  3.617   1.00 82.38  ? 210 GLN Q CD  1 
ATOM   10062 O OE1 . GLN F 1 200 ? 40.998  98.100  4.724   1.00 76.57  ? 210 GLN Q OE1 1 
ATOM   10063 N NE2 . GLN F 1 200 ? 41.690  97.641  2.617   1.00 80.80  ? 210 GLN Q NE2 1 
ATOM   10064 N N   . GLY F 1 201 ? 38.136  94.056  6.512   1.00 68.67  ? 211 GLY Q N   1 
ATOM   10065 C CA  . GLY F 1 201 ? 36.953  93.947  7.341   1.00 70.97  ? 211 GLY Q CA  1 
ATOM   10066 C C   . GLY F 1 201 ? 36.492  92.519  7.523   1.00 67.93  ? 211 GLY Q C   1 
ATOM   10067 O O   . GLY F 1 201 ? 36.692  91.696  6.650   1.00 64.69  ? 211 GLY Q O   1 
ATOM   10068 N N   . ILE F 1 202 ? 35.868  92.231  8.661   1.00 74.91  ? 212 ILE Q N   1 
ATOM   10069 C CA  . ILE F 1 202 ? 35.451  90.870  8.982   1.00 78.51  ? 212 ILE Q CA  1 
ATOM   10070 C C   . ILE F 1 202 ? 33.987  90.817  9.360   1.00 78.02  ? 212 ILE Q C   1 
ATOM   10071 O O   . ILE F 1 202 ? 33.451  91.746  9.956   1.00 78.82  ? 212 ILE Q O   1 
ATOM   10072 C CB  . ILE F 1 202 ? 36.262  90.258  10.136  1.00 78.26  ? 212 ILE Q CB  1 
ATOM   10073 C CG1 . ILE F 1 202 ? 35.891  90.950  11.449  1.00 75.32  ? 212 ILE Q CG1 1 
ATOM   10074 C CG2 . ILE F 1 202 ? 37.776  90.304  9.828   1.00 70.71  ? 212 ILE Q CG2 1 
ATOM   10075 C CD1 . ILE F 1 202 ? 36.312  90.190  12.676  1.00 78.63  ? 212 ILE Q CD1 1 
ATOM   10076 N N   . THR F 1 203 ? 33.376  89.682  9.045   1.00 82.36  ? 213 THR Q N   1 
ATOM   10077 C CA  . THR F 1 203 ? 31.927  89.515  9.011   1.00 87.55  ? 213 THR Q CA  1 
ATOM   10078 C C   . THR F 1 203 ? 31.157  89.872  10.283  1.00 93.56  ? 213 THR Q C   1 
ATOM   10079 O O   . THR F 1 203 ? 31.637  89.669  11.395  1.00 94.80  ? 213 THR Q O   1 
ATOM   10080 C CB  . THR F 1 203 ? 31.572  88.096  8.566   1.00 87.93  ? 213 THR Q CB  1 
ATOM   10081 O OG1 . THR F 1 203 ? 31.926  87.940  7.187   1.00 83.32  ? 213 THR Q OG1 1 
ATOM   10082 C CG2 . THR F 1 203 ? 30.088  87.833  8.745   1.00 99.53  ? 213 THR Q CG2 1 
ATOM   10083 N N   . SER F 1 204 ? 29.944  90.385  10.087  1.00 98.86  ? 214 SER Q N   1 
ATOM   10084 C CA  . SER F 1 204 ? 29.129  90.921  11.168  1.00 104.62 ? 214 SER Q CA  1 
ATOM   10085 C C   . SER F 1 204 ? 27.871  90.090  11.485  1.00 118.93 ? 214 SER Q C   1 
ATOM   10086 O O   . SER F 1 204 ? 27.551  89.112  10.793  1.00 120.25 ? 214 SER Q O   1 
ATOM   10087 C CB  . SER F 1 204 ? 28.742  92.364  10.847  1.00 97.57  ? 214 SER Q CB  1 
ATOM   10088 O OG  . SER F 1 204 ? 28.054  92.948  11.934  1.00 101.23 ? 214 SER Q OG  1 
ATOM   10089 N N   . TRP F 1 205 ? 27.178  90.498  12.550  1.00 121.56 ? 215 TRP Q N   1 
ATOM   10090 C CA  . TRP F 1 205 ? 25.945  89.870  13.036  1.00 124.48 ? 215 TRP Q CA  1 
ATOM   10091 C C   . TRP F 1 205 ? 24.833  89.936  11.974  1.00 130.58 ? 215 TRP Q C   1 
ATOM   10092 O O   . TRP F 1 205 ? 24.678  90.955  11.292  1.00 129.09 ? 215 TRP Q O   1 
ATOM   10093 C CB  . TRP F 1 205 ? 25.480  90.630  14.292  1.00 121.33 ? 215 TRP Q CB  1 
ATOM   10094 C CG  . TRP F 1 205 ? 24.874  89.842  15.463  1.00 124.00 ? 215 TRP Q CG  1 
ATOM   10095 C CD1 . TRP F 1 205 ? 24.936  90.196  16.783  1.00 122.02 ? 215 TRP Q CD1 1 
ATOM   10096 C CD2 . TRP F 1 205 ? 24.106  88.619  15.419  1.00 127.91 ? 215 TRP Q CD2 1 
ATOM   10097 N NE1 . TRP F 1 205 ? 24.271  89.276  17.558  1.00 124.29 ? 215 TRP Q NE1 1 
ATOM   10098 C CE2 . TRP F 1 205 ? 23.753  88.300  16.749  1.00 125.55 ? 215 TRP Q CE2 1 
ATOM   10099 C CE3 . TRP F 1 205 ? 23.687  87.765  14.391  1.00 134.51 ? 215 TRP Q CE3 1 
ATOM   10100 C CZ2 . TRP F 1 205 ? 23.007  87.164  17.077  1.00 127.95 ? 215 TRP Q CZ2 1 
ATOM   10101 C CZ3 . TRP F 1 205 ? 22.938  86.634  14.722  1.00 133.90 ? 215 TRP Q CZ3 1 
ATOM   10102 C CH2 . TRP F 1 205 ? 22.610  86.347  16.052  1.00 131.60 ? 215 TRP Q CH2 1 
ATOM   10103 N N   . GLY F 1 206 ? 24.070  88.851  11.836  1.00 133.01 ? 216 GLY Q N   1 
ATOM   10104 C CA  . GLY F 1 206 ? 22.826  88.852  11.076  1.00 132.32 ? 216 GLY Q CA  1 
ATOM   10105 C C   . GLY F 1 206 ? 22.977  89.037  9.581   1.00 132.68 ? 216 GLY Q C   1 
ATOM   10106 O O   . GLY F 1 206 ? 21.987  89.158  8.857   1.00 130.91 ? 216 GLY Q O   1 
ATOM   10107 N N   . SER F 1 207 ? 24.224  89.053  9.124   1.00 132.59 ? 217 SER Q N   1 
ATOM   10108 C CA  . SER F 1 207 ? 24.532  89.256  7.713   1.00 137.90 ? 217 SER Q CA  1 
ATOM   10109 C C   . SER F 1 207 ? 25.099  87.986  7.070   1.00 139.62 ? 217 SER Q C   1 
ATOM   10110 O O   . SER F 1 207 ? 26.197  87.981  6.504   1.00 130.95 ? 217 SER Q O   1 
ATOM   10111 C CB  . SER F 1 207 ? 25.483  90.448  7.533   1.00 132.55 ? 217 SER Q CB  1 
ATOM   10112 O OG  . SER F 1 207 ? 26.436  90.525  8.586   1.00 127.00 ? 217 SER Q OG  1 
ATOM   10113 N N   . GLU F 1 208 ? 24.320  86.914  7.160   1.00 145.82 ? 218 GLU Q N   1 
ATOM   10114 C CA  . GLU F 1 208 ? 24.703  85.605  6.639   1.00 151.39 ? 218 GLU Q CA  1 
ATOM   10115 C C   . GLU F 1 208 ? 25.320  85.672  5.230   1.00 151.76 ? 218 GLU Q C   1 
ATOM   10116 O O   . GLU F 1 208 ? 24.747  86.275  4.326   1.00 154.36 ? 218 GLU Q O   1 
ATOM   10117 C CB  . GLU F 1 208 ? 23.474  84.683  6.637   1.00 152.75 ? 218 GLU Q CB  1 
ATOM   10118 C CG  . GLU F 1 208 ? 22.348  85.112  7.591   1.00 148.74 ? 218 GLU Q CG  1 
ATOM   10119 C CD  . GLU F 1 208 ? 22.724  84.980  9.060   1.00 148.69 ? 218 GLU Q CD  1 
ATOM   10120 O OE1 . GLU F 1 208 ? 23.879  84.607  9.352   1.00 148.75 ? 218 GLU Q OE1 1 
ATOM   10121 O OE2 . GLU F 1 208 ? 21.860  85.250  9.926   1.00 145.58 ? 218 GLU Q OE2 1 
ATOM   10122 N N   . PRO F 1 209 ? 26.510  85.077  5.051   1.00 147.58 ? 219 PRO Q N   1 
ATOM   10123 C CA  . PRO F 1 209 ? 27.137  84.946  3.731   1.00 146.17 ? 219 PRO Q CA  1 
ATOM   10124 C C   . PRO F 1 209 ? 26.572  83.826  2.853   1.00 149.36 ? 219 PRO Q C   1 
ATOM   10125 O O   . PRO F 1 209 ? 27.166  83.556  1.817   1.00 149.77 ? 219 PRO Q O   1 
ATOM   10126 C CB  . PRO F 1 209 ? 28.598  84.634  4.070   1.00 141.63 ? 219 PRO Q CB  1 
ATOM   10127 C CG  . PRO F 1 209 ? 28.787  85.157  5.441   1.00 139.81 ? 219 PRO Q CG  1 
ATOM   10128 C CD  . PRO F 1 209 ? 27.490  84.901  6.131   1.00 144.02 ? 219 PRO Q CD  1 
ATOM   10129 N N   . CYS F 1 210 ? 25.480  83.177  3.248   1.00 154.61 ? 220 CYS Q N   1 
ATOM   10130 C CA  . CYS F 1 210 ? 24.843  82.176  2.382   1.00 159.52 ? 220 CYS Q CA  1 
ATOM   10131 C C   . CYS F 1 210 ? 23.626  82.803  1.676   1.00 159.97 ? 220 CYS Q C   1 
ATOM   10132 O O   . CYS F 1 210 ? 23.561  82.846  0.445   1.00 154.37 ? 220 CYS Q O   1 
ATOM   10133 C CB  . CYS F 1 210 ? 24.443  80.919  3.184   1.00 166.04 ? 220 CYS Q CB  1 
ATOM   10134 S SG  . CYS F 1 210 ? 25.027  79.283  2.537   1.00 170.01 ? 220 CYS Q SG  1 
ATOM   10135 N N   . ALA F 1 211 ? 22.673  83.284  2.468   1.00 162.73 ? 221 ALA Q N   1 
ATOM   10136 C CA  . ALA F 1 211 ? 21.469  83.903  1.928   1.00 156.87 ? 221 ALA Q CA  1 
ATOM   10137 C C   . ALA F 1 211 ? 20.667  84.597  3.025   1.00 158.22 ? 221 ALA Q C   1 
ATOM   10138 O O   . ALA F 1 211 ? 20.265  83.969  4.004   1.00 159.13 ? 221 ALA Q O   1 
ATOM   10139 C CB  . ALA F 1 211 ? 20.612  82.867  1.217   1.00 154.60 ? 221 ALA Q CB  1 
ATOM   10140 N N   . LEU F 1 212 ? 20.439  85.895  2.854   1.00 157.66 ? 222 LEU Q N   1 
ATOM   10141 C CA  . LEU F 1 212 ? 19.686  86.675  3.828   1.00 157.46 ? 222 LEU Q CA  1 
ATOM   10142 C C   . LEU F 1 212 ? 18.678  87.591  3.142   1.00 158.70 ? 222 LEU Q C   1 
ATOM   10143 O O   . LEU F 1 212 ? 18.452  87.488  1.936   1.00 158.50 ? 222 LEU Q O   1 
ATOM   10144 C CB  . LEU F 1 212 ? 20.633  87.498  4.703   1.00 155.00 ? 222 LEU Q CB  1 
ATOM   10145 C CG  . LEU F 1 212 ? 21.668  88.351  3.966   1.00 151.39 ? 222 LEU Q CG  1 
ATOM   10146 C CD1 . LEU F 1 212 ? 21.450  89.828  4.255   1.00 153.17 ? 222 LEU Q CD1 1 
ATOM   10147 C CD2 . LEU F 1 212 ? 23.080  87.929  4.344   1.00 149.99 ? 222 LEU Q CD2 1 
ATOM   10148 N N   . PRO F 1 213 ? 18.075  88.486  3.918   1.00 160.35 ? 223 PRO Q N   1 
ATOM   10149 C CA  . PRO F 1 213 ? 17.084  89.426  3.385   1.00 158.67 ? 223 PRO Q CA  1 
ATOM   10150 C C   . PRO F 1 213 ? 17.627  90.206  2.192   1.00 157.60 ? 223 PRO Q C   1 
ATOM   10151 O O   . PRO F 1 213 ? 17.023  90.192  1.120   1.00 155.01 ? 223 PRO Q O   1 
ATOM   10152 C CB  . PRO F 1 213 ? 16.835  90.370  4.562   1.00 154.12 ? 223 PRO Q CB  1 
ATOM   10153 C CG  . PRO F 1 213 ? 17.120  89.544  5.765   1.00 151.46 ? 223 PRO Q CG  1 
ATOM   10154 C CD  . PRO F 1 213 ? 18.240  88.622  5.376   1.00 159.47 ? 223 PRO Q CD  1 
ATOM   10155 N N   . GLU F 1 214 A 18.757  90.879  2.384   1.00 156.74 ? 223 GLU Q N   1 
ATOM   10156 C CA  . GLU F 1 214 A 19.374  91.667  1.315   1.00 150.85 ? 223 GLU Q CA  1 
ATOM   10157 C C   . GLU F 1 214 A 20.761  91.119  0.981   1.00 150.25 ? 223 GLU Q C   1 
ATOM   10158 O O   . GLU F 1 214 A 21.665  91.156  1.819   1.00 150.76 ? 223 GLU Q O   1 
ATOM   10159 C CB  . GLU F 1 214 A 19.493  93.129  1.733   1.00 143.29 ? 223 GLU Q CB  1 
ATOM   10160 C CG  . GLU F 1 214 A 18.571  93.513  2.871   1.00 144.78 ? 223 GLU Q CG  1 
ATOM   10161 C CD  . GLU F 1 214 A 17.109  93.461  2.480   1.00 148.74 ? 223 GLU Q CD  1 
ATOM   10162 O OE1 . GLU F 1 214 A 16.811  93.478  1.263   1.00 145.64 ? 223 GLU Q OE1 1 
ATOM   10163 O OE2 . GLU F 1 214 A 16.260  93.405  3.396   1.00 151.94 ? 223 GLU Q OE2 1 
ATOM   10164 N N   . ARG F 1 215 ? 20.926  90.635  -0.249  1.00 149.31 ? 224 ARG Q N   1 
ATOM   10165 C CA  . ARG F 1 215 ? 22.104  89.857  -0.653  1.00 142.08 ? 224 ARG Q CA  1 
ATOM   10166 C C   . ARG F 1 215 ? 23.469  90.310  -0.122  1.00 139.41 ? 224 ARG Q C   1 
ATOM   10167 O O   . ARG F 1 215 ? 24.078  89.598  0.680   1.00 138.66 ? 224 ARG Q O   1 
ATOM   10168 C CB  . ARG F 1 215 ? 22.188  89.727  -2.169  1.00 135.09 ? 224 ARG Q CB  1 
ATOM   10169 C CG  . ARG F 1 215 ? 23.346  88.872  -2.567  1.00 132.18 ? 224 ARG Q CG  1 
ATOM   10170 C CD  . ARG F 1 215 ? 23.041  87.454  -2.205  1.00 130.33 ? 224 ARG Q CD  1 
ATOM   10171 N NE  . ARG F 1 215 ? 22.279  86.840  -3.277  1.00 133.81 ? 224 ARG Q NE  1 
ATOM   10172 C CZ  . ARG F 1 215 ? 22.174  85.533  -3.464  1.00 136.96 ? 224 ARG Q CZ  1 
ATOM   10173 N NH1 . ARG F 1 215 ? 21.460  85.069  -4.481  1.00 131.84 ? 224 ARG Q NH1 1 
ATOM   10174 N NH2 . ARG F 1 215 ? 22.781  84.694  -2.635  1.00 138.39 ? 224 ARG Q NH2 1 
ATOM   10175 N N   . PRO F 1 216 ? 23.961  91.482  -0.578  1.00 136.96 ? 225 PRO Q N   1 
ATOM   10176 C CA  . PRO F 1 216 ? 25.313  91.921  -0.213  1.00 131.32 ? 225 PRO Q CA  1 
ATOM   10177 C C   . PRO F 1 216 ? 25.415  92.110  1.294   1.00 130.57 ? 225 PRO Q C   1 
ATOM   10178 O O   . PRO F 1 216 ? 24.496  92.652  1.912   1.00 134.17 ? 225 PRO Q O   1 
ATOM   10179 C CB  . PRO F 1 216 ? 25.439  93.271  -0.919  1.00 126.81 ? 225 PRO Q CB  1 
ATOM   10180 C CG  . PRO F 1 216 ? 24.047  93.776  -0.961  1.00 133.35 ? 225 PRO Q CG  1 
ATOM   10181 C CD  . PRO F 1 216 ? 23.213  92.562  -1.248  1.00 140.43 ? 225 PRO Q CD  1 
ATOM   10182 N N   . SER F 1 217 ? 26.514  91.662  1.886   1.00 121.77 ? 226 SER Q N   1 
ATOM   10183 C CA  . SER F 1 217 ? 26.612  91.689  3.333   1.00 117.07 ? 226 SER Q CA  1 
ATOM   10184 C C   . SER F 1 217 ? 27.492  92.822  3.831   1.00 111.34 ? 226 SER Q C   1 
ATOM   10185 O O   . SER F 1 217 ? 28.431  93.246  3.152   1.00 102.40 ? 226 SER Q O   1 
ATOM   10186 C CB  . SER F 1 217 ? 27.094  90.343  3.871   1.00 121.40 ? 226 SER Q CB  1 
ATOM   10187 O OG  . SER F 1 217 ? 26.091  89.347  3.731   1.00 132.82 ? 226 SER Q OG  1 
ATOM   10188 N N   . LEU F 1 218 ? 27.154  93.311  5.022   1.00 110.87 ? 227 LEU Q N   1 
ATOM   10189 C CA  . LEU F 1 218 ? 27.882  94.384  5.684   1.00 102.67 ? 227 LEU Q CA  1 
ATOM   10190 C C   . LEU F 1 218 ? 28.885  93.809  6.691   1.00 98.61  ? 227 LEU Q C   1 
ATOM   10191 O O   . LEU F 1 218 ? 28.629  92.777  7.317   1.00 96.46  ? 227 LEU Q O   1 
ATOM   10192 C CB  . LEU F 1 218 ? 26.902  95.358  6.356   1.00 108.57 ? 227 LEU Q CB  1 
ATOM   10193 C CG  . LEU F 1 218 ? 25.590  94.830  6.969   1.00 116.31 ? 227 LEU Q CG  1 
ATOM   10194 C CD1 . LEU F 1 218 ? 25.846  93.794  8.054   1.00 116.17 ? 227 LEU Q CD1 1 
ATOM   10195 C CD2 . LEU F 1 218 ? 24.733  95.966  7.522   1.00 112.23 ? 227 LEU Q CD2 1 
ATOM   10196 N N   . TYR F 1 219 ? 30.018  94.493  6.846   1.00 92.80  ? 228 TYR Q N   1 
ATOM   10197 C CA  . TYR F 1 219 ? 31.173  93.940  7.548   1.00 84.79  ? 228 TYR Q CA  1 
ATOM   10198 C C   . TYR F 1 219 ? 31.558  94.628  8.859   1.00 85.09  ? 228 TYR Q C   1 
ATOM   10199 O O   . TYR F 1 219 ? 30.751  94.677  9.787   1.00 88.03  ? 228 TYR Q O   1 
ATOM   10200 C CB  . TYR F 1 219 ? 32.350  93.863  6.583   1.00 77.94  ? 228 TYR Q CB  1 
ATOM   10201 C CG  . TYR F 1 219 ? 32.241  92.625  5.740   1.00 77.56  ? 228 TYR Q CG  1 
ATOM   10202 C CD1 . TYR F 1 219 ? 32.811  92.544  4.480   1.00 70.24  ? 228 TYR Q CD1 1 
ATOM   10203 C CD2 . TYR F 1 219 ? 31.540  91.525  6.219   1.00 81.44  ? 228 TYR Q CD2 1 
ATOM   10204 C CE1 . TYR F 1 219 ? 32.693  91.386  3.724   1.00 70.30  ? 228 TYR Q CE1 1 
ATOM   10205 C CE2 . TYR F 1 219 ? 31.414  90.372  5.479   1.00 80.75  ? 228 TYR Q CE2 1 
ATOM   10206 C CZ  . TYR F 1 219 ? 31.983  90.301  4.232   1.00 76.35  ? 228 TYR Q CZ  1 
ATOM   10207 O OH  . TYR F 1 219 ? 31.829  89.133  3.512   1.00 71.65  ? 228 TYR Q OH  1 
ATOM   10208 N N   . THR F 1 220 ? 32.803  95.094  8.952   1.00 78.03  ? 229 THR Q N   1 
ATOM   10209 C CA  . THR F 1 220 ? 33.224  96.014  10.008  1.00 76.43  ? 229 THR Q CA  1 
ATOM   10210 C C   . THR F 1 220 ? 34.553  96.610  9.609   1.00 73.27  ? 229 THR Q C   1 
ATOM   10211 O O   . THR F 1 220 ? 35.568  95.940  9.649   1.00 73.16  ? 229 THR Q O   1 
ATOM   10212 C CB  . THR F 1 220 ? 33.382  95.360  11.395  1.00 80.59  ? 229 THR Q CB  1 
ATOM   10213 O OG1 . THR F 1 220 ? 32.399  94.341  11.581  1.00 83.83  ? 229 THR Q OG1 1 
ATOM   10214 C CG2 . THR F 1 220 ? 33.219  96.410  12.485  1.00 82.36  ? 229 THR Q CG2 1 
ATOM   10215 N N   . LYS F 1 221 ? 34.534  97.878  9.227   1.00 77.25  ? 230 LYS Q N   1 
ATOM   10216 C CA  . LYS F 1 221 ? 35.710  98.542  8.681   1.00 80.37  ? 230 LYS Q CA  1 
ATOM   10217 C C   . LYS F 1 221 ? 36.874  98.397  9.649   1.00 80.52  ? 230 LYS Q C   1 
ATOM   10218 O O   . LYS F 1 221 ? 36.832  98.914  10.762  1.00 81.21  ? 230 LYS Q O   1 
ATOM   10219 C CB  . LYS F 1 221 ? 35.390  100.023 8.406   1.00 90.90  ? 230 LYS Q CB  1 
ATOM   10220 C CG  . LYS F 1 221 ? 36.144  100.672 7.221   1.00 95.57  ? 230 LYS Q CG  1 
ATOM   10221 C CD  . LYS F 1 221 ? 35.298  101.731 6.471   1.00 94.33  ? 230 LYS Q CD  1 
ATOM   10222 C CE  . LYS F 1 221 ? 34.834  102.863 7.388   1.00 106.77 ? 230 LYS Q CE  1 
ATOM   10223 N NZ  . LYS F 1 221 ? 35.944  103.650 8.049   1.00 110.13 ? 230 LYS Q NZ  1 
ATOM   10224 N N   . VAL F 1 222 ? 37.913  97.681  9.227   1.00 83.39  ? 231 VAL Q N   1 
ATOM   10225 C CA  . VAL F 1 222 ? 39.018  97.357  10.131  1.00 81.37  ? 231 VAL Q CA  1 
ATOM   10226 C C   . VAL F 1 222 ? 39.911  98.553  10.385  1.00 82.77  ? 231 VAL Q C   1 
ATOM   10227 O O   . VAL F 1 222 ? 40.154  98.916  11.535  1.00 88.80  ? 231 VAL Q O   1 
ATOM   10228 C CB  . VAL F 1 222 ? 39.888  96.186  9.629   1.00 71.63  ? 231 VAL Q CB  1 
ATOM   10229 C CG1 . VAL F 1 222 ? 41.192  96.130  10.409  1.00 68.80  ? 231 VAL Q CG1 1 
ATOM   10230 C CG2 . VAL F 1 222 ? 39.136  94.883  9.758   1.00 69.44  ? 231 VAL Q CG2 1 
ATOM   10231 N N   . VAL F 1 223 ? 40.408  99.160  9.316   1.00 79.94  ? 232 VAL Q N   1 
ATOM   10232 C CA  . VAL F 1 223 ? 41.283  100.309 9.450   1.00 81.32  ? 232 VAL Q CA  1 
ATOM   10233 C C   . VAL F 1 223 ? 40.767  101.224 10.549  1.00 84.96  ? 232 VAL Q C   1 
ATOM   10234 O O   . VAL F 1 223 ? 41.540  101.965 11.158  1.00 88.02  ? 232 VAL Q O   1 
ATOM   10235 C CB  . VAL F 1 223 ? 41.323  101.080 8.160   1.00 86.37  ? 232 VAL Q CB  1 
ATOM   10236 C CG1 . VAL F 1 223 ? 42.142  100.326 7.138   1.00 83.59  ? 232 VAL Q CG1 1 
ATOM   10237 C CG2 . VAL F 1 223 ? 39.894  101.284 7.664   1.00 90.78  ? 232 VAL Q CG2 1 
ATOM   10238 N N   . HIS F 1 224 ? 39.457  101.152 10.803  1.00 85.76  ? 233 HIS Q N   1 
ATOM   10239 C CA  . HIS F 1 224 ? 38.796  101.947 11.844  1.00 89.77  ? 233 HIS Q CA  1 
ATOM   10240 C C   . HIS F 1 224 ? 39.376  101.685 13.230  1.00 86.19  ? 233 HIS Q C   1 
ATOM   10241 O O   . HIS F 1 224 ? 39.677  102.604 13.984  1.00 85.30  ? 233 HIS Q O   1 
ATOM   10242 C CB  . HIS F 1 224 ? 37.286  101.666 11.865  1.00 91.35  ? 233 HIS Q CB  1 
ATOM   10243 C CG  . HIS F 1 224 ? 36.454  102.818 12.353  1.00 104.97 ? 233 HIS Q CG  1 
ATOM   10244 N ND1 . HIS F 1 224 ? 36.101  102.977 13.681  1.00 104.11 ? 233 HIS Q ND1 1 
ATOM   10245 C CD2 . HIS F 1 224 ? 35.892  103.860 11.692  1.00 107.43 ? 233 HIS Q CD2 1 
ATOM   10246 C CE1 . HIS F 1 224 ? 35.370  104.068 13.814  1.00 104.59 ? 233 HIS Q CE1 1 
ATOM   10247 N NE2 . HIS F 1 224 ? 35.224  104.623 12.621  1.00 110.66 ? 233 HIS Q NE2 1 
ATOM   10248 N N   . TYR F 1 225 ? 39.541  100.423 13.568  1.00 81.92  ? 234 TYR Q N   1 
ATOM   10249 C CA  . TYR F 1 225 ? 39.964  100.104 14.906  1.00 81.59  ? 234 TYR Q CA  1 
ATOM   10250 C C   . TYR F 1 225 ? 41.451  99.819  14.985  1.00 79.15  ? 234 TYR Q C   1 
ATOM   10251 O O   . TYR F 1 225 ? 41.952  99.465  16.050  1.00 75.42  ? 234 TYR Q O   1 
ATOM   10252 C CB  . TYR F 1 225 ? 39.190  98.905  15.408  1.00 82.91  ? 234 TYR Q CB  1 
ATOM   10253 C CG  . TYR F 1 225 ? 37.693  99.004  15.239  1.00 85.51  ? 234 TYR Q CG  1 
ATOM   10254 C CD1 . TYR F 1 225 ? 36.855  99.064  16.344  1.00 87.24  ? 234 TYR Q CD1 1 
ATOM   10255 C CD2 . TYR F 1 225 ? 37.113  99.010  13.980  1.00 85.66  ? 234 TYR Q CD2 1 
ATOM   10256 C CE1 . TYR F 1 225 ? 35.486  99.122  16.198  1.00 90.96  ? 234 TYR Q CE1 1 
ATOM   10257 C CE2 . TYR F 1 225 ? 35.741  99.072  13.827  1.00 85.31  ? 234 TYR Q CE2 1 
ATOM   10258 C CZ  . TYR F 1 225 ? 34.934  99.126  14.940  1.00 88.24  ? 234 TYR Q CZ  1 
ATOM   10259 O OH  . TYR F 1 225 ? 33.567  99.186  14.806  1.00 95.39  ? 234 TYR Q OH  1 
ATOM   10260 N N   . ARG F 1 226 ? 42.154  99.974  13.866  1.00 76.81  ? 235 ARG Q N   1 
ATOM   10261 C CA  . ARG F 1 226 ? 43.587  99.707  13.838  1.00 77.02  ? 235 ARG Q CA  1 
ATOM   10262 C C   . ARG F 1 226 ? 44.265  100.160 15.116  1.00 78.18  ? 235 ARG Q C   1 
ATOM   10263 O O   . ARG F 1 226 ? 45.284  99.612  15.509  1.00 80.77  ? 235 ARG Q O   1 
ATOM   10264 C CB  . ARG F 1 226 ? 44.265  100.394 12.660  1.00 81.06  ? 235 ARG Q CB  1 
ATOM   10265 C CG  . ARG F 1 226 ? 45.768  100.224 12.679  1.00 77.62  ? 235 ARG Q CG  1 
ATOM   10266 C CD  . ARG F 1 226 ? 46.438  101.210 11.772  1.00 87.17  ? 235 ARG Q CD  1 
ATOM   10267 N NE  . ARG F 1 226 ? 47.883  101.171 11.944  1.00 93.99  ? 235 ARG Q NE  1 
ATOM   10268 C CZ  . ARG F 1 226 ? 48.702  100.437 11.201  1.00 96.24  ? 235 ARG Q CZ  1 
ATOM   10269 N NH1 . ARG F 1 226 ? 48.211  99.680  10.224  1.00 83.09  ? 235 ARG Q NH1 1 
ATOM   10270 N NH2 . ARG F 1 226 ? 50.014  100.463 11.433  1.00 97.37  ? 235 ARG Q NH2 1 
ATOM   10271 N N   . LYS F 1 227 ? 43.708  101.178 15.755  1.00 80.90  ? 236 LYS Q N   1 
ATOM   10272 C CA  . LYS F 1 227 ? 44.259  101.653 17.007  1.00 78.53  ? 236 LYS Q CA  1 
ATOM   10273 C C   . LYS F 1 227 ? 43.875  100.691 18.107  1.00 77.27  ? 236 LYS Q C   1 
ATOM   10274 O O   . LYS F 1 227 ? 44.720  100.269 18.881  1.00 79.54  ? 236 LYS Q O   1 
ATOM   10275 C CB  . LYS F 1 227 ? 43.767  103.067 17.325  1.00 82.68  ? 236 LYS Q CB  1 
ATOM   10276 C CG  . LYS F 1 227 ? 44.456  104.160 16.513  1.00 90.57  ? 236 LYS Q CG  1 
ATOM   10277 C CD  . LYS F 1 227 ? 43.474  104.963 15.660  1.00 89.25  ? 236 LYS Q CD  1 
ATOM   10278 C CE  . LYS F 1 227 ? 44.211  105.923 14.728  1.00 94.57  ? 236 LYS Q CE  1 
ATOM   10279 N NZ  . LYS F 1 227 ? 45.035  105.186 13.720  1.00 106.14 ? 236 LYS Q NZ  1 
ATOM   10280 N N   . TRP F 1 228 ? 42.601  100.323 18.158  1.00 75.78  ? 237 TRP Q N   1 
ATOM   10281 C CA  . TRP F 1 228 ? 42.084  99.531  19.271  1.00 78.58  ? 237 TRP Q CA  1 
ATOM   10282 C C   . TRP F 1 228 ? 42.581  98.111  19.290  1.00 80.49  ? 237 TRP Q C   1 
ATOM   10283 O O   . TRP F 1 228 ? 42.680  97.490  20.346  1.00 79.97  ? 237 TRP Q O   1 
ATOM   10284 C CB  . TRP F 1 228 ? 40.581  99.465  19.216  1.00 79.24  ? 237 TRP Q CB  1 
ATOM   10285 C CG  . TRP F 1 228 ? 40.005  98.634  20.300  1.00 80.72  ? 237 TRP Q CG  1 
ATOM   10286 C CD1 . TRP F 1 228 ? 39.635  99.057  21.538  1.00 84.85  ? 237 TRP Q CD1 1 
ATOM   10287 C CD2 . TRP F 1 228 ? 39.710  97.236  20.250  1.00 84.16  ? 237 TRP Q CD2 1 
ATOM   10288 N NE1 . TRP F 1 228 ? 39.118  98.015  22.265  1.00 85.92  ? 237 TRP Q NE1 1 
ATOM   10289 C CE2 . TRP F 1 228 ? 39.152  96.884  21.497  1.00 85.45  ? 237 TRP Q CE2 1 
ATOM   10290 C CE3 . TRP F 1 228 ? 39.864  96.248  19.277  1.00 79.84  ? 237 TRP Q CE3 1 
ATOM   10291 C CZ2 . TRP F 1 228 ? 38.743  95.589  21.796  1.00 82.11  ? 237 TRP Q CZ2 1 
ATOM   10292 C CZ3 . TRP F 1 228 ? 39.463  94.962  19.577  1.00 81.65  ? 237 TRP Q CZ3 1 
ATOM   10293 C CH2 . TRP F 1 228 ? 38.906  94.644  20.827  1.00 81.15  ? 237 TRP Q CH2 1 
ATOM   10294 N N   . ILE F 1 229 ? 42.820  97.576  18.104  1.00 82.21  ? 238 ILE Q N   1 
ATOM   10295 C CA  . ILE F 1 229 ? 43.475  96.296  17.979  1.00 76.20  ? 238 ILE Q CA  1 
ATOM   10296 C C   . ILE F 1 229 ? 44.889  96.494  18.463  1.00 72.56  ? 238 ILE Q C   1 
ATOM   10297 O O   . ILE F 1 229 ? 45.264  96.022  19.525  1.00 76.12  ? 238 ILE Q O   1 
ATOM   10298 C CB  . ILE F 1 229 ? 43.566  95.863  16.513  1.00 73.46  ? 238 ILE Q CB  1 
ATOM   10299 C CG1 . ILE F 1 229 ? 42.185  95.609  15.923  1.00 66.37  ? 238 ILE Q CG1 1 
ATOM   10300 C CG2 . ILE F 1 229 ? 44.421  94.631  16.383  1.00 75.18  ? 238 ILE Q CG2 1 
ATOM   10301 C CD1 . ILE F 1 229 ? 42.239  95.321  14.457  1.00 63.50  ? 238 ILE Q CD1 1 
ATOM   10302 N N   . LYS F 1 230 ? 45.655  97.233  17.674  1.00 70.85  ? 239 LYS Q N   1 
ATOM   10303 C CA  . LYS F 1 230 ? 47.097  97.315  17.830  1.00 75.81  ? 239 LYS Q CA  1 
ATOM   10304 C C   . LYS F 1 230 ? 47.583  97.587  19.254  1.00 82.05  ? 239 LYS Q C   1 
ATOM   10305 O O   . LYS F 1 230 ? 48.769  97.404  19.548  1.00 84.81  ? 239 LYS Q O   1 
ATOM   10306 C CB  . LYS F 1 230 ? 47.662  98.368  16.879  1.00 74.22  ? 239 LYS Q CB  1 
ATOM   10307 C CG  . LYS F 1 230 ? 49.166  98.443  16.865  1.00 71.78  ? 239 LYS Q CG  1 
ATOM   10308 C CD  . LYS F 1 230 ? 49.742  97.742  15.649  1.00 77.07  ? 239 LYS Q CD  1 
ATOM   10309 C CE  . LYS F 1 230 ? 49.167  98.314  14.353  1.00 79.36  ? 239 LYS Q CE  1 
ATOM   10310 N NZ  . LYS F 1 230 ? 50.033  98.051  13.154  1.00 79.92  ? 239 LYS Q NZ  1 
ATOM   10311 N N   . ASP F 1 231 ? 46.685  98.018  20.138  1.00 81.65  ? 240 ASP Q N   1 
ATOM   10312 C CA  . ASP F 1 231 ? 47.099  98.392  21.493  1.00 83.61  ? 240 ASP Q CA  1 
ATOM   10313 C C   . ASP F 1 231 ? 46.593  97.470  22.601  1.00 83.63  ? 240 ASP Q C   1 
ATOM   10314 O O   . ASP F 1 231 ? 47.331  97.199  23.547  1.00 85.34  ? 240 ASP Q O   1 
ATOM   10315 C CB  . ASP F 1 231 ? 46.786  99.871  21.807  1.00 90.67  ? 240 ASP Q CB  1 
ATOM   10316 C CG  . ASP F 1 231 ? 45.293  100.177 21.819  1.00 90.50  ? 240 ASP Q CG  1 
ATOM   10317 O OD1 . ASP F 1 231 ? 44.496  99.306  21.401  1.00 89.43  ? 240 ASP Q OD1 1 
ATOM   10318 O OD2 . ASP F 1 231 ? 44.921  101.298 22.242  1.00 88.70  ? 240 ASP Q OD2 1 
ATOM   10319 N N   . THR F 1 232 ? 45.351  96.993  22.496  1.00 83.39  ? 241 THR Q N   1 
ATOM   10320 C CA  . THR F 1 232 ? 44.822  96.059  23.489  1.00 81.16  ? 241 THR Q CA  1 
ATOM   10321 C C   . THR F 1 232 ? 45.615  94.769  23.430  1.00 76.64  ? 241 THR Q C   1 
ATOM   10322 O O   . THR F 1 232 ? 45.747  94.069  24.427  1.00 79.46  ? 241 THR Q O   1 
ATOM   10323 C CB  . THR F 1 232 ? 43.337  95.746  23.286  1.00 77.91  ? 241 THR Q CB  1 
ATOM   10324 O OG1 . THR F 1 232 ? 43.138  95.271  21.952  1.00 77.61  ? 241 THR Q OG1 1 
ATOM   10325 C CG2 . THR F 1 232 ? 42.481  96.985  23.539  1.00 78.76  ? 241 THR Q CG2 1 
ATOM   10326 N N   . ILE F 1 233 ? 46.141  94.458  22.254  1.00 75.36  ? 242 ILE Q N   1 
ATOM   10327 C CA  . ILE F 1 233 ? 47.137  93.403  22.138  1.00 79.16  ? 242 ILE Q CA  1 
ATOM   10328 C C   . ILE F 1 233 ? 48.295  93.644  23.116  1.00 81.15  ? 242 ILE Q C   1 
ATOM   10329 O O   . ILE F 1 233 ? 48.641  92.753  23.889  1.00 82.78  ? 242 ILE Q O   1 
ATOM   10330 C CB  . ILE F 1 233 ? 47.667  93.261  20.684  1.00 79.01  ? 242 ILE Q CB  1 
ATOM   10331 C CG1 . ILE F 1 233 ? 47.125  91.991  20.048  1.00 70.28  ? 242 ILE Q CG1 1 
ATOM   10332 C CG2 . ILE F 1 233 ? 49.196  93.245  20.635  1.00 78.10  ? 242 ILE Q CG2 1 
ATOM   10333 C CD1 . ILE F 1 233 ? 48.120  91.323  19.174  1.00 68.03  ? 242 ILE Q CD1 1 
ATOM   10334 N N   . VAL F 1 234 ? 48.872  94.848  23.095  1.00 79.17  ? 243 VAL Q N   1 
ATOM   10335 C CA  . VAL F 1 234 ? 50.027  95.182  23.938  1.00 83.56  ? 243 VAL Q CA  1 
ATOM   10336 C C   . VAL F 1 234 ? 49.637  95.440  25.401  1.00 85.52  ? 243 VAL Q C   1 
ATOM   10337 O O   . VAL F 1 234 ? 50.493  95.455  26.294  1.00 82.30  ? 243 VAL Q O   1 
ATOM   10338 C CB  . VAL F 1 234 ? 50.828  96.388  23.359  1.00 85.85  ? 243 VAL Q CB  1 
ATOM   10339 C CG1 . VAL F 1 234 ? 51.736  97.019  24.419  1.00 82.80  ? 243 VAL Q CG1 1 
ATOM   10340 C CG2 . VAL F 1 234 ? 51.632  95.964  22.109  1.00 80.83  ? 243 VAL Q CG2 1 
ATOM   10341 N N   . ALA F 1 235 ? 48.336  95.619  25.630  1.00 86.80  ? 244 ALA Q N   1 
ATOM   10342 C CA  . ALA F 1 235 ? 47.764  95.814  26.967  1.00 81.94  ? 244 ALA Q CA  1 
ATOM   10343 C C   . ALA F 1 235 ? 48.079  94.654  27.882  1.00 80.15  ? 244 ALA Q C   1 
ATOM   10344 O O   . ALA F 1 235 ? 48.586  94.854  28.981  1.00 82.13  ? 244 ALA Q O   1 
ATOM   10345 C CB  . ALA F 1 235 ? 46.256  95.991  26.873  1.00 85.07  ? 244 ALA Q CB  1 
ATOM   10346 N N   . ASN F 1 236 ? 47.739  93.450  27.421  1.00 82.72  ? 245 ASN Q N   1 
ATOM   10347 C CA  . ASN F 1 236 ? 48.079  92.191  28.085  1.00 88.94  ? 245 ASN Q CA  1 
ATOM   10348 C C   . ASN F 1 236 ? 48.856  91.290  27.122  1.00 89.63  ? 245 ASN Q C   1 
ATOM   10349 O O   . ASN F 1 236 ? 48.306  90.288  26.651  1.00 89.96  ? 245 ASN Q O   1 
ATOM   10350 C CB  . ASN F 1 236 ? 46.801  91.476  28.515  1.00 90.52  ? 245 ASN Q CB  1 
ATOM   10351 C CG  . ASN F 1 236 ? 45.652  92.433  28.740  1.00 89.31  ? 245 ASN Q CG  1 
ATOM   10352 O OD1 . ASN F 1 236 ? 45.347  92.791  29.881  1.00 90.94  ? 245 ASN Q OD1 1 
ATOM   10353 N ND2 . ASN F 1 236 ? 45.007  92.860  27.651  1.00 78.62  ? 245 ASN Q ND2 1 
ATOM   10354 N N   . PRO F 1 237 ? 50.143  91.632  26.860  1.00 95.15  ? 246 PRO Q N   1 
ATOM   10355 C CA  . PRO F 1 237 ? 50.928  91.298  25.645  1.00 99.88  ? 246 PRO Q CA  1 
ATOM   10356 C C   . PRO F 1 237 ? 51.217  89.805  25.344  1.00 102.48 ? 246 PRO Q C   1 
ATOM   10357 O O   . PRO F 1 237 ? 51.116  88.930  26.216  1.00 108.03 ? 246 PRO Q O   1 
ATOM   10358 C CB  . PRO F 1 237 ? 52.251  92.072  25.847  1.00 97.06  ? 246 PRO Q CB  1 
ATOM   10359 C CG  . PRO F 1 237 ? 52.004  93.022  26.996  1.00 88.03  ? 246 PRO Q CG  1 
ATOM   10360 C CD  . PRO F 1 237 ? 50.973  92.342  27.850  1.00 90.09  ? 246 PRO Q CD  1 
ATOM   10361 O OXT . PRO F 1 237 ? 51.567  89.437  24.205  1.00 86.17  ? 246 PRO Q OXT 1 
ATOM   10362 N N   . ASP G 2 1   ? 60.821  63.742  -7.627  1.00 75.64  ? 1   ASP M N   1 
ATOM   10363 C CA  . ASP G 2 1   ? 60.359  64.267  -8.922  1.00 78.54  ? 1   ASP M CA  1 
ATOM   10364 C C   . ASP G 2 1   ? 59.305  63.364  -9.568  1.00 71.05  ? 1   ASP M C   1 
ATOM   10365 O O   . ASP G 2 1   ? 59.472  62.146  -9.587  1.00 77.61  ? 1   ASP M O   1 
ATOM   10366 C CB  . ASP G 2 1   ? 61.537  64.435  -9.903  1.00 79.84  ? 1   ASP M CB  1 
ATOM   10367 C CG  . ASP G 2 1   ? 62.545  65.495  -9.453  1.00 73.26  ? 1   ASP M CG  1 
ATOM   10368 O OD1 . ASP G 2 1   ? 63.608  65.622  -10.107 1.00 71.94  ? 1   ASP M OD1 1 
ATOM   10369 O OD2 . ASP G 2 1   ? 62.273  66.198  -8.451  1.00 68.06  ? 1   ASP M OD2 1 
ATOM   10370 N N   . ILE G 2 2   ? 58.231  63.960  -10.087 1.00 63.62  ? 2   ILE M N   1 
ATOM   10371 C CA  . ILE G 2 2   ? 57.245  63.236  -10.885 1.00 59.87  ? 2   ILE M CA  1 
ATOM   10372 C C   . ILE G 2 2   ? 57.502  63.607  -12.329 1.00 60.65  ? 2   ILE M C   1 
ATOM   10373 O O   . ILE G 2 2   ? 57.504  64.796  -12.639 1.00 64.53  ? 2   ILE M O   1 
ATOM   10374 C CB  . ILE G 2 2   ? 55.796  63.706  -10.596 1.00 57.44  ? 2   ILE M CB  1 
ATOM   10375 C CG1 . ILE G 2 2   ? 55.385  63.490  -9.136  1.00 59.06  ? 2   ILE M CG1 1 
ATOM   10376 C CG2 . ILE G 2 2   ? 54.835  62.992  -11.518 1.00 60.70  ? 2   ILE M CG2 1 
ATOM   10377 C CD1 . ILE G 2 2   ? 53.872  63.614  -8.879  1.00 48.41  ? 2   ILE M CD1 1 
ATOM   10378 N N   . VAL G 2 3   ? 57.706  62.644  -13.228 1.00 56.47  ? 3   VAL M N   1 
ATOM   10379 C CA  . VAL G 2 3   ? 57.954  63.033  -14.631 1.00 64.93  ? 3   VAL M CA  1 
ATOM   10380 C C   . VAL G 2 3   ? 56.715  63.044  -15.538 1.00 64.51  ? 3   VAL M C   1 
ATOM   10381 O O   . VAL G 2 3   ? 55.959  62.072  -15.586 1.00 63.69  ? 3   VAL M O   1 
ATOM   10382 C CB  . VAL G 2 3   ? 59.104  62.249  -15.325 1.00 61.21  ? 3   VAL M CB  1 
ATOM   10383 C CG1 . VAL G 2 3   ? 60.269  62.013  -14.369 1.00 65.09  ? 3   VAL M CG1 1 
ATOM   10384 C CG2 . VAL G 2 3   ? 58.594  60.950  -15.911 1.00 67.06  ? 3   VAL M CG2 1 
ATOM   10385 N N   . MET G 2 4   ? 56.536  64.153  -16.261 1.00 67.08  ? 4   MET M N   1 
ATOM   10386 C CA  . MET G 2 4   ? 55.408  64.339  -17.186 1.00 69.13  ? 4   MET M CA  1 
ATOM   10387 C C   . MET G 2 4   ? 55.854  64.219  -18.629 1.00 69.32  ? 4   MET M C   1 
ATOM   10388 O O   . MET G 2 4   ? 56.942  64.687  -18.987 1.00 72.88  ? 4   MET M O   1 
ATOM   10389 C CB  . MET G 2 4   ? 54.797  65.720  -17.007 1.00 63.65  ? 4   MET M CB  1 
ATOM   10390 C CG  . MET G 2 4   ? 54.523  66.072  -15.581 1.00 60.50  ? 4   MET M CG  1 
ATOM   10391 S SD  . MET G 2 4   ? 52.980  65.374  -15.028 1.00 54.70  ? 4   MET M SD  1 
ATOM   10392 C CE  . MET G 2 4   ? 51.814  66.505  -15.763 1.00 51.40  ? 4   MET M CE  1 
ATOM   10393 N N   . THR G 2 5   ? 55.005  63.634  -19.466 1.00 63.16  ? 5   THR M N   1 
ATOM   10394 C CA  . THR G 2 5   ? 55.431  63.293  -20.811 1.00 65.56  ? 5   THR M CA  1 
ATOM   10395 C C   . THR G 2 5   ? 54.425  63.703  -21.884 1.00 72.64  ? 5   THR M C   1 
ATOM   10396 O O   . THR G 2 5   ? 53.226  63.449  -21.753 1.00 74.55  ? 5   THR M O   1 
ATOM   10397 C CB  . THR G 2 5   ? 55.728  61.798  -20.905 1.00 68.09  ? 5   THR M CB  1 
ATOM   10398 O OG1 . THR G 2 5   ? 55.793  61.248  -19.582 1.00 68.41  ? 5   THR M OG1 1 
ATOM   10399 C CG2 . THR G 2 5   ? 57.058  61.558  -21.614 1.00 70.62  ? 5   THR M CG2 1 
ATOM   10400 N N   . GLN G 2 6   ? 54.925  64.352  -22.937 1.00 76.29  ? 6   GLN M N   1 
ATOM   10401 C CA  . GLN G 2 6   ? 54.104  64.759  -24.080 1.00 71.54  ? 6   GLN M CA  1 
ATOM   10402 C C   . GLN G 2 6   ? 54.664  64.236  -25.394 1.00 75.90  ? 6   GLN M C   1 
ATOM   10403 O O   . GLN G 2 6   ? 55.549  64.838  -26.000 1.00 75.48  ? 6   GLN M O   1 
ATOM   10404 C CB  . GLN G 2 6   ? 53.951  66.270  -24.133 1.00 65.03  ? 6   GLN M CB  1 
ATOM   10405 C CG  . GLN G 2 6   ? 52.867  66.767  -23.229 1.00 66.55  ? 6   GLN M CG  1 
ATOM   10406 C CD  . GLN G 2 6   ? 52.920  68.256  -23.031 1.00 70.26  ? 6   GLN M CD  1 
ATOM   10407 O OE1 . GLN G 2 6   ? 51.949  68.974  -23.306 1.00 70.39  ? 6   GLN M OE1 1 
ATOM   10408 N NE2 . GLN G 2 6   ? 54.060  68.740  -22.549 1.00 67.82  ? 6   GLN M NE2 1 
ATOM   10409 N N   . THR G 2 7   ? 54.114  63.103  -25.809 1.00 80.56  ? 7   THR M N   1 
ATOM   10410 C CA  . THR G 2 7   ? 54.538  62.354  -26.977 1.00 82.42  ? 7   THR M CA  1 
ATOM   10411 C C   . THR G 2 7   ? 54.400  63.169  -28.260 1.00 81.74  ? 7   THR M C   1 
ATOM   10412 O O   . THR G 2 7   ? 55.084  62.902  -29.255 1.00 79.05  ? 7   THR M O   1 
ATOM   10413 C CB  . THR G 2 7   ? 53.656  61.096  -27.113 1.00 91.05  ? 7   THR M CB  1 
ATOM   10414 O OG1 . THR G 2 7   ? 52.413  61.450  -27.741 1.00 87.83  ? 7   THR M OG1 1 
ATOM   10415 C CG2 . THR G 2 7   ? 53.367  60.489  -25.731 1.00 87.27  ? 7   THR M CG2 1 
ATOM   10416 N N   . ALA G 2 8   ? 53.505  64.153  -28.234 1.00 77.63  ? 8   ALA M N   1 
ATOM   10417 C CA  . ALA G 2 8   ? 53.201  64.945  -29.419 1.00 80.27  ? 8   ALA M CA  1 
ATOM   10418 C C   . ALA G 2 8   ? 54.071  66.204  -29.510 1.00 83.92  ? 8   ALA M C   1 
ATOM   10419 O O   . ALA G 2 8   ? 53.725  67.252  -28.959 1.00 81.49  ? 8   ALA M O   1 
ATOM   10420 C CB  . ALA G 2 8   ? 51.721  65.312  -29.445 1.00 74.88  ? 8   ALA M CB  1 
ATOM   10421 N N   . PRO G 2 9   ? 55.216  66.116  -30.205 1.00 84.92  ? 9   PRO M N   1 
ATOM   10422 C CA  . PRO G 2 9   ? 55.950  67.375  -30.319 1.00 75.73  ? 9   PRO M CA  1 
ATOM   10423 C C   . PRO G 2 9   ? 55.204  68.335  -31.231 1.00 72.61  ? 9   PRO M C   1 
ATOM   10424 O O   . PRO G 2 9   ? 55.362  69.537  -31.066 1.00 73.74  ? 9   PRO M O   1 
ATOM   10425 C CB  . PRO G 2 9   ? 57.294  66.952  -30.944 1.00 82.38  ? 9   PRO M CB  1 
ATOM   10426 C CG  . PRO G 2 9   ? 57.402  65.460  -30.721 1.00 82.98  ? 9   PRO M CG  1 
ATOM   10427 C CD  . PRO G 2 9   ? 55.965  64.980  -30.776 1.00 86.89  ? 9   PRO M CD  1 
ATOM   10428 N N   . SER G 2 10  ? 54.391  67.825  -32.158 1.00 75.93  ? 10  SER M N   1 
ATOM   10429 C CA  . SER G 2 10  ? 53.712  68.714  -33.111 1.00 78.33  ? 10  SER M CA  1 
ATOM   10430 C C   . SER G 2 10  ? 52.375  68.230  -33.710 1.00 75.44  ? 10  SER M C   1 
ATOM   10431 O O   . SER G 2 10  ? 52.116  67.027  -33.845 1.00 70.69  ? 10  SER M O   1 
ATOM   10432 C CB  . SER G 2 10  ? 54.675  69.167  -34.218 1.00 74.66  ? 10  SER M CB  1 
ATOM   10433 O OG  . SER G 2 10  ? 54.385  70.492  -34.620 1.00 70.94  ? 10  SER M OG  1 
ATOM   10434 N N   . VAL G 2 11  ? 51.550  69.220  -34.064 1.00 71.93  ? 11  VAL M N   1 
ATOM   10435 C CA  . VAL G 2 11  ? 50.170  69.046  -34.511 1.00 71.35  ? 11  VAL M CA  1 
ATOM   10436 C C   . VAL G 2 11  ? 49.794  70.148  -35.520 1.00 78.34  ? 11  VAL M C   1 
ATOM   10437 O O   . VAL G 2 11  ? 50.376  71.234  -35.500 1.00 78.60  ? 11  VAL M O   1 
ATOM   10438 C CB  . VAL G 2 11  ? 49.209  69.221  -33.335 1.00 59.43  ? 11  VAL M CB  1 
ATOM   10439 C CG1 . VAL G 2 11  ? 47.944  68.474  -33.593 1.00 60.48  ? 11  VAL M CG1 1 
ATOM   10440 C CG2 . VAL G 2 11  ? 49.851  68.762  -32.067 1.00 61.82  ? 11  VAL M CG2 1 
ATOM   10441 N N   . PHE G 2 12  ? 48.813  69.891  -36.383 1.00 73.41  ? 12  PHE M N   1 
ATOM   10442 C CA  . PHE G 2 12  ? 48.304  70.930  -37.270 1.00 66.91  ? 12  PHE M CA  1 
ATOM   10443 C C   . PHE G 2 12  ? 46.811  70.961  -37.165 1.00 66.25  ? 12  PHE M C   1 
ATOM   10444 O O   . PHE G 2 12  ? 46.228  70.041  -36.628 1.00 71.22  ? 12  PHE M O   1 
ATOM   10445 C CB  . PHE G 2 12  ? 48.727  70.667  -38.704 1.00 74.20  ? 12  PHE M CB  1 
ATOM   10446 C CG  . PHE G 2 12  ? 50.172  70.941  -38.949 1.00 76.00  ? 12  PHE M CG  1 
ATOM   10447 C CD1 . PHE G 2 12  ? 51.071  69.902  -39.100 1.00 78.61  ? 12  PHE M CD1 1 
ATOM   10448 C CD2 . PHE G 2 12  ? 50.639  72.242  -38.995 1.00 70.15  ? 12  PHE M CD2 1 
ATOM   10449 C CE1 . PHE G 2 12  ? 52.407  70.161  -39.312 1.00 78.60  ? 12  PHE M CE1 1 
ATOM   10450 C CE2 . PHE G 2 12  ? 51.955  72.497  -39.194 1.00 69.89  ? 12  PHE M CE2 1 
ATOM   10451 C CZ  . PHE G 2 12  ? 52.844  71.460  -39.356 1.00 74.74  ? 12  PHE M CZ  1 
ATOM   10452 N N   . VAL G 2 13  ? 46.186  72.004  -37.690 1.00 66.92  ? 13  VAL M N   1 
ATOM   10453 C CA  . VAL G 2 13  ? 44.766  72.242  -37.432 1.00 71.01  ? 13  VAL M CA  1 
ATOM   10454 C C   . VAL G 2 13  ? 44.095  73.148  -38.460 1.00 74.57  ? 13  VAL M C   1 
ATOM   10455 O O   . VAL G 2 13  ? 44.549  74.266  -38.703 1.00 74.48  ? 13  VAL M O   1 
ATOM   10456 C CB  . VAL G 2 13  ? 44.549  72.885  -36.036 1.00 67.57  ? 13  VAL M CB  1 
ATOM   10457 C CG1 . VAL G 2 13  ? 43.212  73.587  -35.974 1.00 71.16  ? 13  VAL M CG1 1 
ATOM   10458 C CG2 . VAL G 2 13  ? 44.641  71.849  -34.942 1.00 68.76  ? 13  VAL M CG2 1 
ATOM   10459 N N   . THR G 2 14  ? 43.000  72.686  -39.053 1.00 75.49  ? 14  THR M N   1 
ATOM   10460 C CA  . THR G 2 14  ? 42.238  73.580  -39.903 1.00 75.28  ? 14  THR M CA  1 
ATOM   10461 C C   . THR G 2 14  ? 41.448  74.509  -39.013 1.00 72.78  ? 14  THR M C   1 
ATOM   10462 O O   . THR G 2 14  ? 40.726  74.059  -38.131 1.00 71.84  ? 14  THR M O   1 
ATOM   10463 C CB  . THR G 2 14  ? 41.265  72.861  -40.809 1.00 79.06  ? 14  THR M CB  1 
ATOM   10464 O OG1 . THR G 2 14  ? 41.804  71.591  -41.186 1.00 81.27  ? 14  THR M OG1 1 
ATOM   10465 C CG2 . THR G 2 14  ? 41.020  73.709  -42.042 1.00 80.29  ? 14  THR M CG2 1 
ATOM   10466 N N   . PRO G 2 15  ? 41.575  75.814  -39.255 1.00 73.46  ? 15  PRO M N   1 
ATOM   10467 C CA  . PRO G 2 15  ? 40.926  76.826  -38.423 1.00 68.39  ? 15  PRO M CA  1 
ATOM   10468 C C   . PRO G 2 15  ? 39.452  76.510  -38.321 1.00 66.56  ? 15  PRO M C   1 
ATOM   10469 O O   . PRO G 2 15  ? 39.004  75.582  -38.987 1.00 68.39  ? 15  PRO M O   1 
ATOM   10470 C CB  . PRO G 2 15  ? 41.132  78.112  -39.222 1.00 67.99  ? 15  PRO M CB  1 
ATOM   10471 C CG  . PRO G 2 15  ? 42.308  77.838  -40.098 1.00 69.54  ? 15  PRO M CG  1 
ATOM   10472 C CD  . PRO G 2 15  ? 42.219  76.394  -40.445 1.00 74.73  ? 15  PRO M CD  1 
ATOM   10473 N N   . GLY G 2 16  ? 38.719  77.261  -37.505 1.00 69.00  ? 16  GLY M N   1 
ATOM   10474 C CA  . GLY G 2 16  ? 37.298  77.034  -37.307 1.00 71.00  ? 16  GLY M CA  1 
ATOM   10475 C C   . GLY G 2 16  ? 36.929  75.633  -36.828 1.00 70.44  ? 16  GLY M C   1 
ATOM   10476 O O   . GLY G 2 16  ? 35.773  75.378  -36.503 1.00 72.13  ? 16  GLY M O   1 
ATOM   10477 N N   . GLU G 2 17  ? 37.898  74.723  -36.792 1.00 68.86  ? 17  GLU M N   1 
ATOM   10478 C CA  . GLU G 2 17  ? 37.636  73.338  -36.401 1.00 72.72  ? 17  GLU M CA  1 
ATOM   10479 C C   . GLU G 2 17  ? 37.966  73.082  -34.929 1.00 76.18  ? 17  GLU M C   1 
ATOM   10480 O O   . GLU G 2 17  ? 37.956  74.013  -34.120 1.00 72.84  ? 17  GLU M O   1 
ATOM   10481 C CB  . GLU G 2 17  ? 38.423  72.370  -37.280 1.00 72.47  ? 17  GLU M CB  1 
ATOM   10482 C CG  . GLU G 2 17  ? 37.676  71.877  -38.487 1.00 79.05  ? 17  GLU M CG  1 
ATOM   10483 C CD  . GLU G 2 17  ? 38.115  70.480  -38.879 1.00 98.86  ? 17  GLU M CD  1 
ATOM   10484 O OE1 . GLU G 2 17  ? 37.664  69.986  -39.940 1.00 103.27 ? 17  GLU M OE1 1 
ATOM   10485 O OE2 . GLU G 2 17  ? 38.913  69.876  -38.120 1.00 99.50  ? 17  GLU M OE2 1 
ATOM   10486 N N   . SER G 2 18  ? 38.251  71.819  -34.593 1.00 72.85  ? 18  SER M N   1 
ATOM   10487 C CA  . SER G 2 18  ? 38.672  71.441  -33.242 1.00 68.84  ? 18  SER M CA  1 
ATOM   10488 C C   . SER G 2 18  ? 39.824  70.410  -33.199 1.00 71.38  ? 18  SER M C   1 
ATOM   10489 O O   . SER G 2 18  ? 40.160  69.778  -34.204 1.00 66.58  ? 18  SER M O   1 
ATOM   10490 C CB  . SER G 2 18  ? 37.477  70.951  -32.428 1.00 59.75  ? 18  SER M CB  1 
ATOM   10491 O OG  . SER G 2 18  ? 36.849  69.851  -33.043 1.00 49.50  ? 18  SER M OG  1 
ATOM   10492 N N   . VAL G 2 19  ? 40.446  70.270  -32.030 1.00 77.22  ? 19  VAL M N   1 
ATOM   10493 C CA  . VAL G 2 19  ? 41.448  69.216  -31.813 1.00 81.80  ? 19  VAL M CA  1 
ATOM   10494 C C   . VAL G 2 19  ? 41.774  68.989  -30.321 1.00 81.73  ? 19  VAL M C   1 
ATOM   10495 O O   . VAL G 2 19  ? 41.158  69.595  -29.435 1.00 75.48  ? 19  VAL M O   1 
ATOM   10496 C CB  . VAL G 2 19  ? 42.745  69.455  -32.620 1.00 78.84  ? 19  VAL M CB  1 
ATOM   10497 C CG1 . VAL G 2 19  ? 43.622  70.463  -31.902 1.00 71.05  ? 19  VAL M CG1 1 
ATOM   10498 C CG2 . VAL G 2 19  ? 43.491  68.127  -32.850 1.00 76.89  ? 19  VAL M CG2 1 
ATOM   10499 N N   . SER G 2 20  ? 42.743  68.112  -30.058 1.00 84.57  ? 20  SER M N   1 
ATOM   10500 C CA  . SER G 2 20  ? 43.043  67.666  -28.695 1.00 86.00  ? 20  SER M CA  1 
ATOM   10501 C C   . SER G 2 20  ? 44.529  67.392  -28.442 1.00 84.09  ? 20  SER M C   1 
ATOM   10502 O O   . SER G 2 20  ? 45.291  67.048  -29.364 1.00 82.07  ? 20  SER M O   1 
ATOM   10503 C CB  . SER G 2 20  ? 42.270  66.386  -28.395 1.00 88.81  ? 20  SER M CB  1 
ATOM   10504 O OG  . SER G 2 20  ? 42.897  65.288  -29.040 1.00 93.62  ? 20  SER M OG  1 
ATOM   10505 N N   . ILE G 2 21  ? 44.921  67.492  -27.176 1.00 75.83  ? 21  ILE M N   1 
ATOM   10506 C CA  . ILE G 2 21  ? 46.314  67.301  -26.811 1.00 75.87  ? 21  ILE M CA  1 
ATOM   10507 C C   . ILE G 2 21  ? 46.512  66.514  -25.493 1.00 75.35  ? 21  ILE M C   1 
ATOM   10508 O O   . ILE G 2 21  ? 45.832  66.786  -24.495 1.00 74.48  ? 21  ILE M O   1 
ATOM   10509 C CB  . ILE G 2 21  ? 46.997  68.653  -26.742 1.00 73.59  ? 21  ILE M CB  1 
ATOM   10510 C CG1 . ILE G 2 21  ? 48.506  68.451  -26.698 1.00 77.32  ? 21  ILE M CG1 1 
ATOM   10511 C CG2 . ILE G 2 21  ? 46.452  69.445  -25.572 1.00 70.64  ? 21  ILE M CG2 1 
ATOM   10512 C CD1 . ILE G 2 21  ? 49.002  67.544  -27.817 1.00 77.34  ? 21  ILE M CD1 1 
ATOM   10513 N N   . SER G 2 22  ? 47.455  65.560  -25.492 1.00 69.22  ? 22  SER M N   1 
ATOM   10514 C CA  . SER G 2 22  ? 47.535  64.519  -24.445 1.00 70.70  ? 22  SER M CA  1 
ATOM   10515 C C   . SER G 2 22  ? 48.726  64.543  -23.457 1.00 68.48  ? 22  SER M C   1 
ATOM   10516 O O   . SER G 2 22  ? 49.875  64.503  -23.869 1.00 66.44  ? 22  SER M O   1 
ATOM   10517 C CB  . SER G 2 22  ? 47.454  63.130  -25.096 1.00 73.62  ? 22  SER M CB  1 
ATOM   10518 O OG  . SER G 2 22  ? 46.143  62.846  -25.571 1.00 80.70  ? 22  SER M OG  1 
ATOM   10519 N N   . CYS G 2 23  ? 48.424  64.542  -22.154 1.00 71.86  ? 23  CYS M N   1 
ATOM   10520 C CA  . CYS G 2 23  ? 49.421  64.625  -21.073 1.00 71.65  ? 23  CYS M CA  1 
ATOM   10521 C C   . CYS G 2 23  ? 49.315  63.458  -20.076 1.00 78.34  ? 23  CYS M C   1 
ATOM   10522 O O   . CYS G 2 23  ? 48.272  63.267  -19.439 1.00 75.42  ? 23  CYS M O   1 
ATOM   10523 C CB  . CYS G 2 23  ? 49.226  65.933  -20.308 1.00 69.43  ? 23  CYS M CB  1 
ATOM   10524 S SG  . CYS G 2 23  ? 50.592  66.445  -19.235 1.00 84.37  ? 23  CYS M SG  1 
ATOM   10525 N N   . ARG G 2 24  ? 50.396  62.691  -19.922 1.00 82.28  ? 24  ARG M N   1 
ATOM   10526 C CA  . ARG G 2 24  ? 50.388  61.520  -19.028 1.00 79.56  ? 24  ARG M CA  1 
ATOM   10527 C C   . ARG G 2 24  ? 51.566  61.458  -18.045 1.00 70.51  ? 24  ARG M C   1 
ATOM   10528 O O   . ARG G 2 24  ? 52.727  61.514  -18.441 1.00 69.11  ? 24  ARG M O   1 
ATOM   10529 C CB  . ARG G 2 24  ? 50.294  60.218  -19.834 1.00 80.33  ? 24  ARG M CB  1 
ATOM   10530 C CG  . ARG G 2 24  ? 51.532  59.882  -20.640 1.00 87.53  ? 24  ARG M CG  1 
ATOM   10531 C CD  . ARG G 2 24  ? 51.165  59.225  -21.965 1.00 99.07  ? 24  ARG M CD  1 
ATOM   10532 N NE  . ARG G 2 24  ? 51.111  57.771  -21.852 1.00 109.47 ? 24  ARG M NE  1 
ATOM   10533 C CZ  . ARG G 2 24  ? 50.574  56.975  -22.769 1.00 112.50 ? 24  ARG M CZ  1 
ATOM   10534 N NH1 . ARG G 2 24  ? 50.040  57.501  -23.863 1.00 112.84 ? 24  ARG M NH1 1 
ATOM   10535 N NH2 . ARG G 2 24  ? 50.568  55.658  -22.592 1.00 115.87 ? 24  ARG M NH2 1 
ATOM   10536 N N   . SER G 2 25  ? 51.252  61.325  -16.761 1.00 67.24  ? 25  SER M N   1 
ATOM   10537 C CA  . SER G 2 25  ? 52.266  61.379  -15.712 1.00 65.70  ? 25  SER M CA  1 
ATOM   10538 C C   . SER G 2 25  ? 53.004  60.073  -15.480 1.00 68.31  ? 25  SER M C   1 
ATOM   10539 O O   . SER G 2 25  ? 53.498  59.425  -16.404 1.00 73.30  ? 25  SER M O   1 
ATOM   10540 C CB  . SER G 2 25  ? 51.640  61.816  -14.392 1.00 58.87  ? 25  SER M CB  1 
ATOM   10541 O OG  . SER G 2 25  ? 50.239  61.897  -14.521 1.00 61.20  ? 25  SER M OG  1 
ATOM   10542 N N   . SER G 2 26  ? 53.087  59.709  -14.213 1.00 63.04  ? 26  SER M N   1 
ATOM   10543 C CA  . SER G 2 26  ? 53.767  58.499  -13.814 1.00 63.49  ? 26  SER M CA  1 
ATOM   10544 C C   . SER G 2 26  ? 53.208  58.119  -12.448 1.00 62.86  ? 26  SER M C   1 
ATOM   10545 O O   . SER G 2 26  ? 53.471  57.043  -11.926 1.00 64.54  ? 26  SER M O   1 
ATOM   10546 C CB  . SER G 2 26  ? 55.276  58.737  -13.750 1.00 59.00  ? 26  SER M CB  1 
ATOM   10547 O OG  . SER G 2 26  ? 55.659  59.203  -12.466 1.00 61.21  ? 26  SER M OG  1 
ATOM   10548 N N   . LYS G 2 27  ? 52.423  59.026  -11.882 1.00 61.94  ? 27  LYS M N   1 
ATOM   10549 C CA  . LYS G 2 27  ? 51.753  58.812  -10.610 1.00 58.13  ? 27  LYS M CA  1 
ATOM   10550 C C   . LYS G 2 27  ? 50.367  59.331  -10.793 1.00 55.97  ? 27  LYS M C   1 
ATOM   10551 O O   . LYS G 2 27  ? 50.143  60.182  -11.632 1.00 61.00  ? 27  LYS M O   1 
ATOM   10552 C CB  . LYS G 2 27  ? 52.391  59.636  -9.499  1.00 58.91  ? 27  LYS M CB  1 
ATOM   10553 C CG  . LYS G 2 27  ? 53.738  59.156  -8.999  1.00 61.32  ? 27  LYS M CG  1 
ATOM   10554 C CD  . LYS G 2 27  ? 54.155  59.985  -7.776  1.00 70.55  ? 27  LYS M CD  1 
ATOM   10555 C CE  . LYS G 2 27  ? 52.987  60.173  -6.782  1.00 68.19  ? 27  LYS M CE  1 
ATOM   10556 N NZ  . LYS G 2 27  ? 52.827  59.045  -5.817  1.00 65.91  ? 27  LYS M NZ  1 
ATOM   10557 N N   . SER G 2 28  A 49.421  58.838  -10.019 1.00 59.64  ? 27  SER M N   1 
ATOM   10558 C CA  . SER G 2 28  A 48.121  59.464  -10.071 1.00 65.38  ? 27  SER M CA  1 
ATOM   10559 C C   . SER G 2 28  A 48.474  60.849  -9.593  1.00 62.90  ? 27  SER M C   1 
ATOM   10560 O O   . SER G 2 28  A 49.415  61.005  -8.807  1.00 60.80  ? 27  SER M O   1 
ATOM   10561 C CB  . SER G 2 28  A 47.117  58.794  -9.126  1.00 64.71  ? 27  SER M CB  1 
ATOM   10562 O OG  . SER G 2 28  A 47.316  59.213  -7.782  1.00 68.99  ? 27  SER M OG  1 
ATOM   10563 N N   . LEU G 2 29  B 47.767  61.846  -10.109 1.00 60.23  ? 27  LEU M N   1 
ATOM   10564 C CA  . LEU G 2 29  B 47.878  63.200  -9.610  1.00 57.77  ? 27  LEU M CA  1 
ATOM   10565 C C   . LEU G 2 29  B 46.584  63.526  -8.900  1.00 62.47  ? 27  LEU M C   1 
ATOM   10566 O O   . LEU G 2 29  B 45.972  64.562  -9.138  1.00 65.01  ? 27  LEU M O   1 
ATOM   10567 C CB  . LEU G 2 29  B 48.119  64.153  -10.763 1.00 61.43  ? 27  LEU M CB  1 
ATOM   10568 C CG  . LEU G 2 29  B 49.562  64.136  -11.267 1.00 59.37  ? 27  LEU M CG  1 
ATOM   10569 C CD1 . LEU G 2 29  B 49.648  64.650  -12.691 1.00 58.03  ? 27  LEU M CD1 1 
ATOM   10570 C CD2 . LEU G 2 29  B 50.449  64.947  -10.323 1.00 57.58  ? 27  LEU M CD2 1 
ATOM   10571 N N   . LEU G 2 30  C 46.189  62.612  -8.017  1.00 66.27  ? 27  LEU M N   1 
ATOM   10572 C CA  . LEU G 2 30  C 44.873  62.597  -7.400  1.00 62.62  ? 27  LEU M CA  1 
ATOM   10573 C C   . LEU G 2 30  C 44.996  62.587  -5.876  1.00 64.60  ? 27  LEU M C   1 
ATOM   10574 O O   . LEU G 2 30  C 45.035  61.540  -5.250  1.00 65.79  ? 27  LEU M O   1 
ATOM   10575 C CB  . LEU G 2 30  C 44.144  61.354  -7.871  1.00 57.33  ? 27  LEU M CB  1 
ATOM   10576 C CG  . LEU G 2 30  C 42.636  61.473  -7.868  1.00 65.30  ? 27  LEU M CG  1 
ATOM   10577 C CD1 . LEU G 2 30  C 42.027  60.123  -8.267  1.00 65.67  ? 27  LEU M CD1 1 
ATOM   10578 C CD2 . LEU G 2 30  C 42.159  61.958  -6.502  1.00 62.56  ? 27  LEU M CD2 1 
ATOM   10579 N N   . HIS G 2 31  D 45.061  63.770  -5.288  1.00 69.36  ? 27  HIS M N   1 
ATOM   10580 C CA  . HIS G 2 31  D 45.299  63.931  -3.863  1.00 68.79  ? 27  HIS M CA  1 
ATOM   10581 C C   . HIS G 2 31  D 44.181  63.320  -3.057  1.00 67.61  ? 27  HIS M C   1 
ATOM   10582 O O   . HIS G 2 31  D 43.077  63.173  -3.552  1.00 68.60  ? 27  HIS M O   1 
ATOM   10583 C CB  . HIS G 2 31  D 45.380  65.419  -3.537  1.00 72.19  ? 27  HIS M CB  1 
ATOM   10584 C CG  . HIS G 2 31  D 45.930  65.710  -2.180  1.00 77.61  ? 27  HIS M CG  1 
ATOM   10585 N ND1 . HIS G 2 31  D 45.130  65.851  -1.068  1.00 79.47  ? 27  HIS M ND1 1 
ATOM   10586 C CD2 . HIS G 2 31  D 47.205  65.879  -1.754  1.00 82.24  ? 27  HIS M CD2 1 
ATOM   10587 C CE1 . HIS G 2 31  D 45.887  66.095  -0.013  1.00 85.18  ? 27  HIS M CE1 1 
ATOM   10588 N NE2 . HIS G 2 31  D 47.151  66.118  -0.403  1.00 86.23  ? 27  HIS M NE2 1 
ATOM   10589 N N   . SER G 2 32  E 44.467  62.974  -1.809  1.00 71.93  ? 27  SER M N   1 
ATOM   10590 C CA  . SER G 2 32  E 43.435  62.495  -0.911  1.00 71.00  ? 27  SER M CA  1 
ATOM   10591 C C   . SER G 2 32  E 42.320  63.503  -0.962  1.00 75.99  ? 27  SER M C   1 
ATOM   10592 O O   . SER G 2 32  E 41.147  63.164  -0.889  1.00 77.64  ? 27  SER M O   1 
ATOM   10593 C CB  . SER G 2 32  E 43.960  62.428  0.517   1.00 69.66  ? 27  SER M CB  1 
ATOM   10594 O OG  . SER G 2 32  E 45.332  62.094  0.529   1.00 72.72  ? 27  SER M OG  1 
ATOM   10595 N N   . ASN G 2 33  ? 42.704  64.759  -1.116  1.00 76.24  ? 28  ASN M N   1 
ATOM   10596 C CA  . ASN G 2 33  ? 41.798  65.861  -0.847  1.00 80.42  ? 28  ASN M CA  1 
ATOM   10597 C C   . ASN G 2 33  ? 40.597  65.959  -1.788  1.00 80.05  ? 28  ASN M C   1 
ATOM   10598 O O   . ASN G 2 33  ? 39.601  66.600  -1.466  1.00 83.54  ? 28  ASN M O   1 
ATOM   10599 C CB  . ASN G 2 33  ? 42.582  67.172  -0.760  1.00 76.61  ? 28  ASN M CB  1 
ATOM   10600 C CG  . ASN G 2 33  ? 41.876  68.318  -1.425  1.00 80.04  ? 28  ASN M CG  1 
ATOM   10601 O OD1 . ASN G 2 33  ? 41.728  68.347  -2.649  1.00 81.79  ? 28  ASN M OD1 1 
ATOM   10602 N ND2 . ASN G 2 33  ? 41.449  69.288  -0.627  1.00 80.04  ? 28  ASN M ND2 1 
ATOM   10603 N N   . GLY G 2 34  ? 40.679  65.310  -2.939  1.00 77.67  ? 29  GLY M N   1 
ATOM   10604 C CA  . GLY G 2 34  ? 39.581  65.345  -3.887  1.00 77.37  ? 29  GLY M CA  1 
ATOM   10605 C C   . GLY G 2 34  ? 39.940  66.072  -5.165  1.00 74.19  ? 29  GLY M C   1 
ATOM   10606 O O   . GLY G 2 34  ? 39.527  65.703  -6.267  1.00 69.56  ? 29  GLY M O   1 
ATOM   10607 N N   . ASN G 2 35  ? 40.719  67.127  -5.022  1.00 74.14  ? 30  ASN M N   1 
ATOM   10608 C CA  . ASN G 2 35  ? 41.198  67.815  -6.195  1.00 75.78  ? 30  ASN M CA  1 
ATOM   10609 C C   . ASN G 2 35  ? 42.292  67.009  -6.879  1.00 70.64  ? 30  ASN M C   1 
ATOM   10610 O O   . ASN G 2 35  ? 42.864  66.108  -6.292  1.00 71.65  ? 30  ASN M O   1 
ATOM   10611 C CB  . ASN G 2 35  ? 41.654  69.217  -5.818  1.00 73.85  ? 30  ASN M CB  1 
ATOM   10612 C CG  . ASN G 2 35  ? 40.512  70.064  -5.303  1.00 76.41  ? 30  ASN M CG  1 
ATOM   10613 O OD1 . ASN G 2 35  ? 40.689  70.878  -4.399  1.00 81.89  ? 30  ASN M OD1 1 
ATOM   10614 N ND2 . ASN G 2 35  ? 39.324  69.863  -5.865  1.00 73.97  ? 30  ASN M ND2 1 
ATOM   10615 N N   . THR G 2 36  ? 42.555  67.309  -8.137  1.00 67.15  ? 31  THR M N   1 
ATOM   10616 C CA  . THR G 2 36  ? 43.607  66.617  -8.852  1.00 68.61  ? 31  THR M CA  1 
ATOM   10617 C C   . THR G 2 36  ? 44.516  67.655  -9.539  1.00 70.03  ? 31  THR M C   1 
ATOM   10618 O O   . THR G 2 36  ? 44.163  68.262  -10.558 1.00 68.17  ? 31  THR M O   1 
ATOM   10619 C CB  . THR G 2 36  ? 43.009  65.559  -9.808  1.00 68.40  ? 31  THR M CB  1 
ATOM   10620 O OG1 . THR G 2 36  ? 43.957  65.198  -10.828 1.00 61.00  ? 31  THR M OG1 1 
ATOM   10621 C CG2 . THR G 2 36  ? 41.717  66.091  -10.425 1.00 69.11  ? 31  THR M CG2 1 
ATOM   10622 N N   . TYR G 2 37  ? 45.691  67.851  -8.950  1.00 66.99  ? 32  TYR M N   1 
ATOM   10623 C CA  . TYR G 2 37  ? 46.553  68.992  -9.252  1.00 62.98  ? 32  TYR M CA  1 
ATOM   10624 C C   . TYR G 2 37  ? 47.328  68.905  -10.573 1.00 62.30  ? 32  TYR M C   1 
ATOM   10625 O O   . TYR G 2 37  ? 48.544  68.746  -10.596 1.00 60.47  ? 32  TYR M O   1 
ATOM   10626 C CB  . TYR G 2 37  ? 47.457  69.261  -8.045  1.00 58.91  ? 32  TYR M CB  1 
ATOM   10627 C CG  . TYR G 2 37  ? 46.617  69.519  -6.825  1.00 61.03  ? 32  TYR M CG  1 
ATOM   10628 C CD1 . TYR G 2 37  ? 46.383  70.817  -6.381  1.00 65.07  ? 32  TYR M CD1 1 
ATOM   10629 C CD2 . TYR G 2 37  ? 45.991  68.477  -6.161  1.00 64.80  ? 32  TYR M CD2 1 
ATOM   10630 C CE1 . TYR G 2 37  ? 45.578  71.069  -5.281  1.00 65.41  ? 32  TYR M CE1 1 
ATOM   10631 C CE2 . TYR G 2 37  ? 45.183  68.716  -5.064  1.00 71.08  ? 32  TYR M CE2 1 
ATOM   10632 C CZ  . TYR G 2 37  ? 44.980  70.013  -4.628  1.00 69.91  ? 32  TYR M CZ  1 
ATOM   10633 O OH  . TYR G 2 37  ? 44.181  70.249  -3.536  1.00 67.60  ? 32  TYR M OH  1 
ATOM   10634 N N   . LEU G 2 38  ? 46.593  69.024  -11.672 1.00 61.98  ? 33  LEU M N   1 
ATOM   10635 C CA  . LEU G 2 38  ? 47.175  69.084  -13.009 1.00 58.70  ? 33  LEU M CA  1 
ATOM   10636 C C   . LEU G 2 38  ? 46.642  70.346  -13.679 1.00 62.94  ? 33  LEU M C   1 
ATOM   10637 O O   . LEU G 2 38  ? 45.431  70.584  -13.669 1.00 61.31  ? 33  LEU M O   1 
ATOM   10638 C CB  . LEU G 2 38  ? 46.793  67.839  -13.799 1.00 58.32  ? 33  LEU M CB  1 
ATOM   10639 C CG  . LEU G 2 38  ? 46.772  67.726  -15.327 1.00 56.89  ? 33  LEU M CG  1 
ATOM   10640 C CD1 . LEU G 2 38  ? 45.808  68.703  -15.962 1.00 54.66  ? 33  LEU M CD1 1 
ATOM   10641 C CD2 . LEU G 2 38  ? 48.152  67.865  -15.918 1.00 62.73  ? 33  LEU M CD2 1 
ATOM   10642 N N   . TYR G 2 39  ? 47.557  71.147  -14.241 1.00 63.59  ? 34  TYR M N   1 
ATOM   10643 C CA  . TYR G 2 39  ? 47.268  72.474  -14.800 1.00 56.53  ? 34  TYR M CA  1 
ATOM   10644 C C   . TYR G 2 39  ? 47.673  72.559  -16.281 1.00 57.86  ? 34  TYR M C   1 
ATOM   10645 O O   . TYR G 2 39  ? 48.545  71.825  -16.724 1.00 58.51  ? 34  TYR M O   1 
ATOM   10646 C CB  . TYR G 2 39  ? 48.021  73.543  -14.001 1.00 53.56  ? 34  TYR M CB  1 
ATOM   10647 C CG  . TYR G 2 39  ? 47.546  73.747  -12.562 1.00 58.95  ? 34  TYR M CG  1 
ATOM   10648 C CD1 . TYR G 2 39  ? 46.885  74.907  -12.188 1.00 58.86  ? 34  TYR M CD1 1 
ATOM   10649 C CD2 . TYR G 2 39  ? 47.772  72.791  -11.578 1.00 58.85  ? 34  TYR M CD2 1 
ATOM   10650 C CE1 . TYR G 2 39  ? 46.455  75.101  -10.887 1.00 55.24  ? 34  TYR M CE1 1 
ATOM   10651 C CE2 . TYR G 2 39  ? 47.339  72.987  -10.273 1.00 56.31  ? 34  TYR M CE2 1 
ATOM   10652 C CZ  . TYR G 2 39  ? 46.683  74.144  -9.945  1.00 53.68  ? 34  TYR M CZ  1 
ATOM   10653 O OH  . TYR G 2 39  ? 46.254  74.363  -8.668  1.00 55.39  ? 34  TYR M OH  1 
ATOM   10654 N N   . TRP G 2 40  ? 47.037  73.452  -17.040 1.00 60.22  ? 35  TRP M N   1 
ATOM   10655 C CA  . TRP G 2 40  ? 47.377  73.676  -18.454 1.00 57.20  ? 35  TRP M CA  1 
ATOM   10656 C C   . TRP G 2 40  ? 47.780  75.139  -18.733 1.00 54.33  ? 35  TRP M C   1 
ATOM   10657 O O   . TRP G 2 40  ? 47.305  76.049  -18.061 1.00 57.79  ? 35  TRP M O   1 
ATOM   10658 C CB  . TRP G 2 40  ? 46.206  73.279  -19.360 1.00 62.00  ? 35  TRP M CB  1 
ATOM   10659 C CG  . TRP G 2 40  ? 46.019  71.795  -19.563 1.00 61.75  ? 35  TRP M CG  1 
ATOM   10660 C CD1 . TRP G 2 40  ? 45.054  71.009  -19.010 1.00 62.36  ? 35  TRP M CD1 1 
ATOM   10661 C CD2 . TRP G 2 40  ? 46.806  70.935  -20.396 1.00 59.26  ? 35  TRP M CD2 1 
ATOM   10662 N NE1 . TRP G 2 40  ? 45.195  69.711  -19.439 1.00 62.14  ? 35  TRP M NE1 1 
ATOM   10663 C CE2 . TRP G 2 40  ? 46.266  69.639  -20.290 1.00 60.04  ? 35  TRP M CE2 1 
ATOM   10664 C CE3 . TRP G 2 40  ? 47.916  71.136  -21.219 1.00 59.89  ? 35  TRP M CE3 1 
ATOM   10665 C CZ2 . TRP G 2 40  ? 46.797  68.547  -20.978 1.00 63.27  ? 35  TRP M CZ2 1 
ATOM   10666 C CZ3 . TRP G 2 40  ? 48.447  70.045  -21.900 1.00 63.17  ? 35  TRP M CZ3 1 
ATOM   10667 C CH2 . TRP G 2 40  ? 47.883  68.771  -21.777 1.00 65.02  ? 35  TRP M CH2 1 
ATOM   10668 N N   . PHE G 2 41  ? 48.649  75.361  -19.719 1.00 50.46  ? 36  PHE M N   1 
ATOM   10669 C CA  . PHE G 2 41  ? 49.175  76.696  -20.005 1.00 51.13  ? 36  PHE M CA  1 
ATOM   10670 C C   . PHE G 2 41  ? 49.296  76.933  -21.484 1.00 55.20  ? 36  PHE M C   1 
ATOM   10671 O O   . PHE G 2 41  ? 49.553  75.990  -22.245 1.00 55.18  ? 36  PHE M O   1 
ATOM   10672 C CB  . PHE G 2 41  ? 50.587  76.853  -19.451 1.00 52.82  ? 36  PHE M CB  1 
ATOM   10673 C CG  . PHE G 2 41  ? 50.654  76.982  -17.970 1.00 46.10  ? 36  PHE M CG  1 
ATOM   10674 C CD1 . PHE G 2 41  ? 51.418  76.118  -17.238 1.00 44.74  ? 36  PHE M CD1 1 
ATOM   10675 C CD2 . PHE G 2 41  ? 49.962  77.965  -17.316 1.00 44.05  ? 36  PHE M CD2 1 
ATOM   10676 C CE1 . PHE G 2 41  ? 51.481  76.228  -15.893 1.00 44.98  ? 36  PHE M CE1 1 
ATOM   10677 C CE2 . PHE G 2 41  ? 50.035  78.074  -15.969 1.00 44.85  ? 36  PHE M CE2 1 
ATOM   10678 C CZ  . PHE G 2 41  ? 50.790  77.204  -15.256 1.00 42.82  ? 36  PHE M CZ  1 
ATOM   10679 N N   . LEU G 2 42  ? 49.190  78.201  -21.884 1.00 56.04  ? 37  LEU M N   1 
ATOM   10680 C CA  . LEU G 2 42  ? 49.352  78.579  -23.292 1.00 59.03  ? 37  LEU M CA  1 
ATOM   10681 C C   . LEU G 2 42  ? 50.411  79.635  -23.479 1.00 53.79  ? 37  LEU M C   1 
ATOM   10682 O O   . LEU G 2 42  ? 50.424  80.610  -22.750 1.00 58.79  ? 37  LEU M O   1 
ATOM   10683 C CB  . LEU G 2 42  ? 48.046  79.109  -23.876 1.00 61.92  ? 37  LEU M CB  1 
ATOM   10684 C CG  . LEU G 2 42  ? 48.242  79.954  -25.140 1.00 65.42  ? 37  LEU M CG  1 
ATOM   10685 C CD1 . LEU G 2 42  ? 48.734  79.139  -26.368 1.00 61.92  ? 37  LEU M CD1 1 
ATOM   10686 C CD2 . LEU G 2 42  ? 46.954  80.684  -25.451 1.00 69.70  ? 37  LEU M CD2 1 
ATOM   10687 N N   . GLN G 2 43  ? 51.278  79.451  -24.472 1.00 54.30  ? 38  GLN M N   1 
ATOM   10688 C CA  . GLN G 2 43  ? 52.355  80.403  -24.747 1.00 58.19  ? 38  GLN M CA  1 
ATOM   10689 C C   . GLN G 2 43  ? 52.378  80.855  -26.203 1.00 62.79  ? 38  GLN M C   1 
ATOM   10690 O O   . GLN G 2 43  ? 53.067  80.242  -27.032 1.00 62.27  ? 38  GLN M O   1 
ATOM   10691 C CB  . GLN G 2 43  ? 53.718  79.793  -24.399 1.00 54.72  ? 38  GLN M CB  1 
ATOM   10692 C CG  . GLN G 2 43  ? 54.722  80.791  -23.818 1.00 55.62  ? 38  GLN M CG  1 
ATOM   10693 C CD  . GLN G 2 43  ? 56.139  80.228  -23.677 1.00 54.62  ? 38  GLN M CD  1 
ATOM   10694 O OE1 . GLN G 2 43  ? 56.503  79.247  -24.324 1.00 54.32  ? 38  GLN M OE1 1 
ATOM   10695 N NE2 . GLN G 2 43  ? 56.944  80.862  -22.831 1.00 51.53  ? 38  GLN M NE2 1 
ATOM   10696 N N   . ARG G 2 44  ? 51.642  81.927  -26.512 1.00 62.93  ? 39  ARG M N   1 
ATOM   10697 C CA  . ARG G 2 44  ? 51.599  82.449  -27.882 1.00 64.42  ? 39  ARG M CA  1 
ATOM   10698 C C   . ARG G 2 44  ? 52.993  82.920  -28.232 1.00 62.69  ? 39  ARG M C   1 
ATOM   10699 O O   . ARG G 2 44  ? 53.677  83.450  -27.373 1.00 67.87  ? 39  ARG M O   1 
ATOM   10700 C CB  . ARG G 2 44  ? 50.582  83.589  -28.015 1.00 67.60  ? 39  ARG M CB  1 
ATOM   10701 C CG  . ARG G 2 44  ? 49.143  83.116  -28.245 1.00 66.06  ? 39  ARG M CG  1 
ATOM   10702 C CD  . ARG G 2 44  ? 48.172  84.284  -28.323 1.00 68.73  ? 39  ARG M CD  1 
ATOM   10703 N NE  . ARG G 2 44  ? 47.631  84.630  -27.013 1.00 69.53  ? 39  ARG M NE  1 
ATOM   10704 C CZ  . ARG G 2 44  ? 46.394  84.341  -26.609 1.00 77.34  ? 39  ARG M CZ  1 
ATOM   10705 N NH1 . ARG G 2 44  ? 45.550  83.706  -27.416 1.00 78.05  ? 39  ARG M NH1 1 
ATOM   10706 N NH2 . ARG G 2 44  ? 45.993  84.695  -25.392 1.00 77.71  ? 39  ARG M NH2 1 
ATOM   10707 N N   . PRO G 2 45  ? 53.421  82.736  -29.487 1.00 60.21  ? 40  PRO M N   1 
ATOM   10708 C CA  . PRO G 2 45  ? 54.835  82.927  -29.864 1.00 62.60  ? 40  PRO M CA  1 
ATOM   10709 C C   . PRO G 2 45  ? 55.460  84.186  -29.237 1.00 63.85  ? 40  PRO M C   1 
ATOM   10710 O O   . PRO G 2 45  ? 54.827  85.249  -29.253 1.00 61.46  ? 40  PRO M O   1 
ATOM   10711 C CB  . PRO G 2 45  ? 54.777  83.091  -31.388 1.00 64.03  ? 40  PRO M CB  1 
ATOM   10712 C CG  . PRO G 2 45  ? 53.478  82.505  -31.800 1.00 61.72  ? 40  PRO M CG  1 
ATOM   10713 C CD  . PRO G 2 45  ? 52.529  82.691  -30.653 1.00 59.00  ? 40  PRO M CD  1 
ATOM   10714 N N   . GLY G 2 46  ? 56.675  84.080  -28.702 1.00 61.37  ? 41  GLY M N   1 
ATOM   10715 C CA  . GLY G 2 46  ? 57.309  85.228  -28.071 1.00 60.51  ? 41  GLY M CA  1 
ATOM   10716 C C   . GLY G 2 46  ? 56.338  86.007  -27.196 1.00 53.89  ? 41  GLY M C   1 
ATOM   10717 O O   . GLY G 2 46  ? 55.901  87.095  -27.548 1.00 49.43  ? 41  GLY M O   1 
ATOM   10718 N N   . GLN G 2 47  ? 56.003  85.418  -26.054 1.00 54.59  ? 42  GLN M N   1 
ATOM   10719 C CA  . GLN G 2 47  ? 55.049  85.964  -25.100 1.00 54.30  ? 42  GLN M CA  1 
ATOM   10720 C C   . GLN G 2 47  ? 55.321  85.324  -23.750 1.00 54.77  ? 42  GLN M C   1 
ATOM   10721 O O   . GLN G 2 47  ? 55.967  84.284  -23.667 1.00 55.73  ? 42  GLN M O   1 
ATOM   10722 C CB  . GLN G 2 47  ? 53.632  85.576  -25.508 1.00 55.95  ? 42  GLN M CB  1 
ATOM   10723 C CG  . GLN G 2 47  ? 53.019  86.412  -26.577 1.00 54.69  ? 42  GLN M CG  1 
ATOM   10724 C CD  . GLN G 2 47  ? 52.227  87.538  -25.992 1.00 54.45  ? 42  GLN M CD  1 
ATOM   10725 O OE1 . GLN G 2 47  ? 52.789  88.475  -25.413 1.00 49.35  ? 42  GLN M OE1 1 
ATOM   10726 N NE2 . GLN G 2 47  ? 50.902  87.456  -26.124 1.00 59.25  ? 42  GLN M NE2 1 
ATOM   10727 N N   . SER G 2 48  ? 54.814  85.915  -22.684 1.00 51.85  ? 43  SER M N   1 
ATOM   10728 C CA  . SER G 2 48  ? 54.844  85.215  -21.418 1.00 51.25  ? 43  SER M CA  1 
ATOM   10729 C C   . SER G 2 48  ? 53.680  84.235  -21.433 1.00 56.77  ? 43  SER M C   1 
ATOM   10730 O O   . SER G 2 48  ? 52.631  84.534  -22.003 1.00 62.01  ? 43  SER M O   1 
ATOM   10731 C CB  . SER G 2 48  ? 54.691  86.205  -20.270 1.00 55.09  ? 43  SER M CB  1 
ATOM   10732 O OG  . SER G 2 48  ? 55.283  87.450  -20.613 1.00 59.85  ? 43  SER M OG  1 
ATOM   10733 N N   . PRO G 2 49  ? 53.857  83.048  -20.833 1.00 58.81  ? 44  PRO M N   1 
ATOM   10734 C CA  . PRO G 2 49  ? 52.743  82.102  -20.708 1.00 54.04  ? 44  PRO M CA  1 
ATOM   10735 C C   . PRO G 2 49  ? 51.644  82.624  -19.786 1.00 54.92  ? 44  PRO M C   1 
ATOM   10736 O O   . PRO G 2 49  ? 51.920  83.471  -18.936 1.00 53.81  ? 44  PRO M O   1 
ATOM   10737 C CB  . PRO G 2 49  ? 53.398  80.881  -20.060 1.00 53.06  ? 44  PRO M CB  1 
ATOM   10738 C CG  . PRO G 2 49  ? 54.844  81.008  -20.358 1.00 53.92  ? 44  PRO M CG  1 
ATOM   10739 C CD  . PRO G 2 49  ? 55.119  82.474  -20.338 1.00 58.19  ? 44  PRO M CD  1 
ATOM   10740 N N   . GLN G 2 50  ? 50.417  82.128  -19.973 1.00 60.21  ? 45  GLN M N   1 
ATOM   10741 C CA  . GLN G 2 50  ? 49.301  82.322  -19.028 1.00 60.30  ? 45  GLN M CA  1 
ATOM   10742 C C   . GLN G 2 50  ? 48.397  81.066  -18.969 1.00 55.95  ? 45  GLN M C   1 
ATOM   10743 O O   . GLN G 2 50  ? 48.315  80.2