data_3RK3
# 
_entry.id   3RK3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3RK3         
RCSB  RCSB065029   
WWPDB D_1000065029 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3RK2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3RK3 
_pdbx_database_status.recvd_initial_deposition_date   2011-04-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kuemmel, D.'    1 
'Reinisch, K.M.' 2 
# 
_citation.id                        primary 
_citation.title                     'Complexin cross-links prefusion SNAREs into a zigzag array.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            18 
_citation.page_first                927 
_citation.page_last                 933 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21785414 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2101 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kummel, D.'         1 
primary 'Krishnakumar, S.S.' 2 
primary 'Radoff, D.T.'       3 
primary 'Li, F.'             4 
primary 'Giraudo, C.G.'      5 
primary 'Pincet, F.'         6 
primary 'Rothman, J.E.'      7 
primary 'Reinisch, K.M.'     8 
# 
_cell.entry_id           3RK3 
_cell.length_a           75.861 
_cell.length_b           52.729 
_cell.length_c           128.712 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.21 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3RK3 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Vamp2         4254.826 1 ? ? 'UNP residues 28-60'   ? 
2 polymer man 'Syntaxin 1a' 7551.502 1 ? ? 'UNP residues 191-253' ? 
3 polymer man SNAP25        9500.615 1 ? ? 'UNP residues 7-82'    ? 
4 polymer man SNAP25        7427.250 1 ? ? 'UNP residues 141-203' ? 
5 polymer man Complexin-1   7235.150 1 ? ? 'UNP residues 26-83'   ? 
# 
_entity_name_com.entity_id   5 
_entity_name_com.name        'Complexin I, CPX I, Synaphin-2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GPLGSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL                                                
GPLGSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL                                                A ? 
2 'polypeptide(L)' no no GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKK                    
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKK                    B ? 
3 'polypeptide(L)' no no 
;GSHMMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLG
W
;
;GSHMMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLG
W
;
C ? 
4 'polypeptide(L)' no no GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML                    
GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML                    D ? 
5 'polypeptide(L)' no no GPLGSKLPDAAKKFEEAQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEEREAEAQ                      
GPLGSKLPDAAKKFEEAQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEEREAEAQ                      E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  SER n 
1 6  ASN n 
1 7  ARG n 
1 8  ARG n 
1 9  LEU n 
1 10 GLN n 
1 11 GLN n 
1 12 THR n 
1 13 GLN n 
1 14 ALA n 
1 15 GLN n 
1 16 VAL n 
1 17 ASP n 
1 18 GLU n 
1 19 VAL n 
1 20 VAL n 
1 21 ASP n 
1 22 ILE n 
1 23 MET n 
1 24 ARG n 
1 25 VAL n 
1 26 ASN n 
1 27 VAL n 
1 28 ASP n 
1 29 LYS n 
1 30 VAL n 
1 31 LEU n 
1 32 GLU n 
1 33 ARG n 
1 34 ASP n 
1 35 GLN n 
1 36 LYS n 
1 37 LEU n 
2 1  GLY n 
2 2  SER n 
2 3  ALA n 
2 4  LEU n 
2 5  SER n 
2 6  GLU n 
2 7  ILE n 
2 8  GLU n 
2 9  THR n 
2 10 ARG n 
2 11 HIS n 
2 12 SER n 
2 13 GLU n 
2 14 ILE n 
2 15 ILE n 
2 16 LYS n 
2 17 LEU n 
2 18 GLU n 
2 19 ASN n 
2 20 SER n 
2 21 ILE n 
2 22 ARG n 
2 23 GLU n 
2 24 LEU n 
2 25 HIS n 
2 26 ASP n 
2 27 MET n 
2 28 PHE n 
2 29 MET n 
2 30 ASP n 
2 31 MET n 
2 32 ALA n 
2 33 MET n 
2 34 LEU n 
2 35 VAL n 
2 36 GLU n 
2 37 SER n 
2 38 GLN n 
2 39 GLY n 
2 40 GLU n 
2 41 MET n 
2 42 ILE n 
2 43 ASP n 
2 44 ARG n 
2 45 ILE n 
2 46 GLU n 
2 47 TYR n 
2 48 ASN n 
2 49 VAL n 
2 50 GLU n 
2 51 HIS n 
2 52 ALA n 
2 53 VAL n 
2 54 ASP n 
2 55 TYR n 
2 56 VAL n 
2 57 GLU n 
2 58 ARG n 
2 59 ALA n 
2 60 VAL n 
2 61 SER n 
2 62 ASP n 
2 63 THR n 
2 64 LYS n 
2 65 LYS n 
3 1  GLY n 
3 2  SER n 
3 3  HIS n 
3 4  MET n 
3 5  MET n 
3 6  ARG n 
3 7  ASN n 
3 8  GLU n 
3 9  LEU n 
3 10 GLU n 
3 11 GLU n 
3 12 MET n 
3 13 GLN n 
3 14 ARG n 
3 15 ARG n 
3 16 ALA n 
3 17 ASP n 
3 18 GLN n 
3 19 LEU n 
3 20 ALA n 
3 21 ASP n 
3 22 GLU n 
3 23 SER n 
3 24 LEU n 
3 25 GLU n 
3 26 SER n 
3 27 THR n 
3 28 ARG n 
3 29 ARG n 
3 30 MET n 
3 31 LEU n 
3 32 GLN n 
3 33 LEU n 
3 34 VAL n 
3 35 GLU n 
3 36 GLU n 
3 37 SER n 
3 38 LYS n 
3 39 ASP n 
3 40 ALA n 
3 41 GLY n 
3 42 ILE n 
3 43 ARG n 
3 44 THR n 
3 45 LEU n 
3 46 VAL n 
3 47 MET n 
3 48 LEU n 
3 49 ASP n 
3 50 GLU n 
3 51 GLN n 
3 52 GLY n 
3 53 GLU n 
3 54 GLN n 
3 55 LEU n 
3 56 ASP n 
3 57 ARG n 
3 58 VAL n 
3 59 GLU n 
3 60 GLU n 
3 61 GLY n 
3 62 MET n 
3 63 ASN n 
3 64 HIS n 
3 65 ILE n 
3 66 ASN n 
3 67 GLN n 
3 68 ASP n 
3 69 MET n 
3 70 LYS n 
3 71 GLU n 
3 72 ALA n 
3 73 GLU n 
3 74 LYS n 
3 75 ASN n 
3 76 LEU n 
3 77 LYS n 
3 78 ASP n 
3 79 LEU n 
3 80 GLY n 
3 81 TRP n 
4 1  GLY n 
4 2  SER n 
4 3  ALA n 
4 4  ARG n 
4 5  GLU n 
4 6  ASN n 
4 7  GLU n 
4 8  MET n 
4 9  ASP n 
4 10 GLU n 
4 11 ASN n 
4 12 LEU n 
4 13 GLU n 
4 14 GLN n 
4 15 VAL n 
4 16 SER n 
4 17 GLY n 
4 18 ILE n 
4 19 ILE n 
4 20 GLY n 
4 21 ASN n 
4 22 LEU n 
4 23 ARG n 
4 24 HIS n 
4 25 MET n 
4 26 ALA n 
4 27 LEU n 
4 28 ASP n 
4 29 MET n 
4 30 GLY n 
4 31 ASN n 
4 32 GLU n 
4 33 ILE n 
4 34 ASP n 
4 35 THR n 
4 36 GLN n 
4 37 ASN n 
4 38 ARG n 
4 39 GLN n 
4 40 ILE n 
4 41 ASP n 
4 42 ARG n 
4 43 ILE n 
4 44 MET n 
4 45 GLU n 
4 46 LYS n 
4 47 ALA n 
4 48 ASP n 
4 49 SER n 
4 50 ASN n 
4 51 LYS n 
4 52 THR n 
4 53 ARG n 
4 54 ILE n 
4 55 ASP n 
4 56 GLU n 
4 57 ALA n 
4 58 ASN n 
4 59 GLN n 
4 60 ARG n 
4 61 ALA n 
4 62 THR n 
4 63 LYS n 
4 64 MET n 
4 65 LEU n 
5 1  GLY n 
5 2  PRO n 
5 3  LEU n 
5 4  GLY n 
5 5  SER n 
5 6  LYS n 
5 7  LEU n 
5 8  PRO n 
5 9  ASP n 
5 10 ALA n 
5 11 ALA n 
5 12 LYS n 
5 13 LYS n 
5 14 PHE n 
5 15 GLU n 
5 16 GLU n 
5 17 ALA n 
5 18 GLN n 
5 19 GLU n 
5 20 ALA n 
5 21 LEU n 
5 22 ARG n 
5 23 GLN n 
5 24 ALA n 
5 25 GLU n 
5 26 GLU n 
5 27 GLU n 
5 28 ARG n 
5 29 LYS n 
5 30 ALA n 
5 31 LYS n 
5 32 TYR n 
5 33 ALA n 
5 34 LYS n 
5 35 MET n 
5 36 GLU n 
5 37 ALA n 
5 38 GLU n 
5 39 ARG n 
5 40 GLU n 
5 41 ALA n 
5 42 VAL n 
5 43 ARG n 
5 44 GLN n 
5 45 GLY n 
5 46 ILE n 
5 47 ARG n 
5 48 ASP n 
5 49 LYS n 
5 50 TYR n 
5 51 GLY n 
5 52 ILE n 
5 53 LYS n 
5 54 LYS n 
5 55 LYS n 
5 56 GLU n 
5 57 GLU n 
5 58 ARG n 
5 59 GLU n 
5 60 ALA n 
5 61 GLU n 
5 62 ALA n 
5 63 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ?     ? 'VAMP2, SYB2'  ? ? ? ? ? ? 'Homo sapiens'      9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? ?     ? 'Stx1a, Sap'   ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? ?     ? 'SNAP25, SNAP' ? ? ? ? ? ? 'Homo sapiens'      9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? ?     ? 'SNAP25, SNAP' ? ? ? ? ? ? 'Homo sapiens'      9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample ? ? ? human ? CPLX1          ? ? ? ? ? ? 'Homo sapiens'      9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP VAMP2_HUMAN P63027 1 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL                                            28  ? 
2 UNP STX1A_RAT   P32851 2 ALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKK              191 ? 
3 UNP SNP25_HUMAN P60880 3 MRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLG 7   ? 
4 UNP SNP25_HUMAN P60880 4 ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML              141 ? 
5 UNP CPLX1_HUMAN O14810 5 KDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEEREAEAQ                   26  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3RK3 A 5 ? 37 ? P63027 28  ? 60  ? 28  60  
2 2 3RK3 B 3 ? 65 ? P32851 191 ? 253 ? 191 253 
3 3 3RK3 C 5 ? 80 ? P60880 7   ? 82  ? 7   82  
4 4 3RK3 D 3 ? 65 ? P60880 141 ? 203 ? 141 203 
5 5 3RK3 E 6 ? 63 ? O14810 26  ? 83  ? 26  83  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3RK3 GLY A 1  ? UNP P63027 ?   ?  'EXPRESSION TAG'      24  1  
1 3RK3 PRO A 2  ? UNP P63027 ?   ?  'EXPRESSION TAG'      25  2  
1 3RK3 LEU A 3  ? UNP P63027 ?   ?  'EXPRESSION TAG'      26  3  
1 3RK3 GLY A 4  ? UNP P63027 ?   ?  'EXPRESSION TAG'      27  4  
2 3RK3 GLY B 1  ? UNP P32851 ?   ?  'EXPRESSION TAG'      189 5  
2 3RK3 SER B 2  ? UNP P32851 ?   ?  'EXPRESSION TAG'      190 6  
3 3RK3 GLY C 1  ? UNP P60880 ?   ?  'EXPRESSION TAG'      3   7  
3 3RK3 SER C 2  ? UNP P60880 ?   ?  'EXPRESSION TAG'      4   8  
3 3RK3 HIS C 3  ? UNP P60880 ?   ?  'EXPRESSION TAG'      5   9  
3 3RK3 MET C 4  ? UNP P60880 ?   ?  'EXPRESSION TAG'      6   10 
3 3RK3 TRP C 81 ? UNP P60880 ?   ?  'EXPRESSION TAG'      83  11 
4 3RK3 GLY D 1  ? UNP P60880 ?   ?  'EXPRESSION TAG'      139 12 
4 3RK3 SER D 2  ? UNP P60880 ?   ?  'EXPRESSION TAG'      140 13 
5 3RK3 GLY E 1  ? UNP O14810 ?   ?  'EXPRESSION TAG'      21  14 
5 3RK3 PRO E 2  ? UNP O14810 ?   ?  'EXPRESSION TAG'      22  15 
5 3RK3 LEU E 3  ? UNP O14810 ?   ?  'EXPRESSION TAG'      23  16 
5 3RK3 GLY E 4  ? UNP O14810 ?   ?  'EXPRESSION TAG'      24  17 
5 3RK3 SER E 5  ? UNP O14810 ?   ?  'EXPRESSION TAG'      25  18 
5 3RK3 LEU E 7  ? UNP O14810 ASP 27 'ENGINEERED MUTATION' 27  19 
5 3RK3 PHE E 14 ? UNP O14810 GLU 34 'ENGINEERED MUTATION' 34  20 
5 3RK3 ALA E 17 ? UNP O14810 ARG 37 'ENGINEERED MUTATION' 37  21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3RK3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.55 
_exptl_crystal.density_percent_sol   65.37 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'13-15% polyethyleneglycol (PEG) 5000MME, 0.2 M ammonium sulfate, 0.01 M EDTA, 0.1 M Tris pH 7.5, VAPOR DIFFUSION, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-10-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Kohzu HLD8-24' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9797 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9797 
# 
_reflns.entry_id                     3RK3 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.5 
_reflns.number_obs                   ? 
_reflns.number_all                   6465 
_reflns.percent_possible_obs         94.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.5 
_reflns_shell.d_res_low              3.63 
_reflns_shell.percent_possible_all   91.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3RK3 
_refine.ls_number_reflns_obs                     6172 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.05 
_refine.ls_d_res_high                            3.50 
_refine.ls_percent_reflns_obs                    99.13 
_refine.ls_R_factor_obs                          0.27176 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.26973 
_refine.ls_R_factor_R_free                       0.31631 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  314 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.929 
_refine.correlation_coeff_Fo_to_Fc_free          0.875 
_refine.B_iso_mean                               99.795 
_refine.aniso_B[1][1]                            13.58 
_refine.aniso_B[2][2]                            -0.24 
_refine.aniso_B[3][3]                            -11.37 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            10.83 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3RK2' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.674 
_refine.overall_SU_ML                            0.475 
_refine.overall_SU_B                             65.568 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2215 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2215 
_refine_hist.d_res_high                       3.50 
_refine_hist.d_res_low                        32.05 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.054  0.030  ? 2475 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               0.001  0.020  ? 1540 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.280  1.968  ? 2942 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            0.773  3.000  ? 3743 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.563  5.000  ? 271  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       33.762 25.426 ? 129  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       16.636 15.000 ? 453  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       13.633 15.000 ? 24   ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.038  0.200  ? 323  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.001  0.020  ? 2478 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           0.000  0.020  ? 402  ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  4.741  2.000  ? 1634 ? 'X-RAY DIFFRACTION' 
r_mcbond_other               0.859  2.000  ? 559  ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 7.096  3.000  ? 2172 ? 'X-RAY DIFFRACTION' 
r_scbond_it                  10.921 4.500  ? 840  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 17.249 6.000  ? 770  ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.500 
_refine_ls_shell.d_res_low                        3.589 
_refine_ls_shell.number_reflns_R_work             433 
_refine_ls_shell.R_factor_R_work                  0.280 
_refine_ls_shell.percent_reflns_obs               98.91 
_refine_ls_shell.R_factor_R_free                  0.378 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             22 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3RK3 
_struct.title                     'Truncated SNARE complex with complexin' 
_struct.pdbx_descriptor           'Vamp2, Syntaxin 1a, SNAP25, Complexin-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3RK3 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN/EXOCYTOSIS' 
_struct_keywords.text            
'SNARE proteins, membrane fusion, MEMBRANE PROTEIN-EXOCYTOSIS-TRANSPORT PROTEIN complex, MEMBRANE PROTEIN-EXOCYTOSIS complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 4 ? LEU A 37 ? GLY A 27  LEU A 60  1 ? 34 
HELX_P HELX_P2 2 GLY B 1 ? ALA B 59 ? GLY B 189 ALA B 247 1 ? 59 
HELX_P HELX_P3 3 GLU C 8 ? ALA C 72 ? GLU C 10  ALA C 74  1 ? 65 
HELX_P HELX_P4 4 GLY D 1 ? LEU D 65 ? GLY D 139 LEU D 203 1 ? 65 
HELX_P HELX_P5 5 PRO E 8 ? GLY E 51 ? PRO E 28  GLY E 71  1 ? 44 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          3RK3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3RK3 
_atom_sites.fract_transf_matrix[1][1]   0.013182 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001203 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018965 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007802 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . GLY A 1 4  ? 1.033   -7.453  75.759  1.00 78.81  ? 27  GLY A N   1 
ATOM 2    C CA  . GLY A 1 4  ? 2.495   -7.290  76.020  1.00 89.28  ? 27  GLY A CA  1 
ATOM 3    C C   . GLY A 1 4  ? 3.309   -7.551  74.762  1.00 91.39  ? 27  GLY A C   1 
ATOM 4    O O   . GLY A 1 4  ? 3.195   -6.827  73.771  1.00 90.60  ? 27  GLY A O   1 
ATOM 5    N N   . SER A 1 5  ? 4.138   -8.589  74.772  1.00 94.79  ? 28  SER A N   1 
ATOM 6    C CA  . SER A 1 5  ? 4.823   -8.988  73.539  1.00 92.56  ? 28  SER A CA  1 
ATOM 7    C C   . SER A 1 5  ? 3.787   -9.304  72.468  1.00 83.27  ? 28  SER A C   1 
ATOM 8    O O   . SER A 1 5  ? 4.058   -9.190  71.276  1.00 74.60  ? 28  SER A O   1 
ATOM 9    C CB  . SER A 1 5  ? 5.726   -10.201 73.761  1.00 98.94  ? 28  SER A CB  1 
ATOM 10   O OG  . SER A 1 5  ? 6.612   -10.357 72.663  1.00 106.62 ? 28  SER A OG  1 
ATOM 11   N N   . ASN A 1 6  ? 2.599   -9.703  72.904  1.00 81.12  ? 29  ASN A N   1 
ATOM 12   C CA  . ASN A 1 6  ? 1.453   -9.769  72.022  1.00 80.57  ? 29  ASN A CA  1 
ATOM 13   C C   . ASN A 1 6  ? 1.272   -8.485  71.204  1.00 76.42  ? 29  ASN A C   1 
ATOM 14   O O   . ASN A 1 6  ? 1.123   -8.531  69.981  1.00 67.47  ? 29  ASN A O   1 
ATOM 15   C CB  . ASN A 1 6  ? 0.185   -10.027 72.823  1.00 83.32  ? 29  ASN A CB  1 
ATOM 16   C CG  . ASN A 1 6  ? -1.040  -10.053 71.946  1.00 89.41  ? 29  ASN A CG  1 
ATOM 17   O OD1 . ASN A 1 6  ? -1.742  -9.047  71.791  1.00 92.93  ? 29  ASN A OD1 1 
ATOM 18   N ND2 . ASN A 1 6  ? -1.300  -11.210 71.351  1.00 97.69  ? 29  ASN A ND2 1 
ATOM 19   N N   . ARG A 1 7  ? 1.284   -7.343  71.884  1.00 77.62  ? 30  ARG A N   1 
ATOM 20   C CA  . ARG A 1 7  ? 1.208   -6.050  71.199  1.00 78.22  ? 30  ARG A CA  1 
ATOM 21   C C   . ARG A 1 7  ? 2.295   -5.951  70.139  1.00 70.11  ? 30  ARG A C   1 
ATOM 22   O O   . ARG A 1 7  ? 2.086   -5.399  69.065  1.00 62.20  ? 30  ARG A O   1 
ATOM 23   C CB  . ARG A 1 7  ? 1.353   -4.876  72.176  1.00 85.24  ? 30  ARG A CB  1 
ATOM 24   C CG  . ARG A 1 7  ? 0.346   -4.863  73.320  1.00 106.39 ? 30  ARG A CG  1 
ATOM 25   C CD  . ARG A 1 7  ? 0.587   -3.687  74.268  1.00 125.99 ? 30  ARG A CD  1 
ATOM 26   N NE  . ARG A 1 7  ? -0.511  -3.540  75.226  1.00 143.35 ? 30  ARG A NE  1 
ATOM 27   C CZ  . ARG A 1 7  ? -0.666  -2.518  76.069  1.00 151.97 ? 30  ARG A CZ  1 
ATOM 28   N NH1 . ARG A 1 7  ? 0.211   -1.516  76.098  1.00 158.38 ? 30  ARG A NH1 1 
ATOM 29   N NH2 . ARG A 1 7  ? -1.711  -2.498  76.894  1.00 152.33 ? 30  ARG A NH2 1 
ATOM 30   N N   . ARG A 1 8  ? 3.463   -6.493  70.450  1.00 72.55  ? 31  ARG A N   1 
ATOM 31   C CA  . ARG A 1 8  ? 4.560   -6.488  69.494  1.00 68.77  ? 31  ARG A CA  1 
ATOM 32   C C   . ARG A 1 8  ? 4.295   -7.415  68.302  1.00 57.32  ? 31  ARG A C   1 
ATOM 33   O O   . ARG A 1 8  ? 4.816   -7.184  67.232  1.00 49.46  ? 31  ARG A O   1 
ATOM 34   C CB  . ARG A 1 8  ? 5.881   -6.841  70.195  1.00 76.30  ? 31  ARG A CB  1 
ATOM 35   C CG  . ARG A 1 8  ? 7.072   -6.698  69.289  1.00 94.81  ? 31  ARG A CG  1 
ATOM 36   C CD  . ARG A 1 8  ? 8.300   -6.092  69.959  1.00 111.62 ? 31  ARG A CD  1 
ATOM 37   N NE  . ARG A 1 8  ? 9.507   -6.378  69.170  1.00 123.68 ? 31  ARG A NE  1 
ATOM 38   C CZ  . ARG A 1 8  ? 9.778   -5.875  67.962  1.00 118.39 ? 31  ARG A CZ  1 
ATOM 39   N NH1 . ARG A 1 8  ? 8.934   -5.036  67.358  1.00 121.48 ? 31  ARG A NH1 1 
ATOM 40   N NH2 . ARG A 1 8  ? 10.907  -6.215  67.349  1.00 111.92 ? 31  ARG A NH2 1 
ATOM 41   N N   . LEU A 1 9  ? 3.492   -8.456  68.486  1.00 54.44  ? 32  LEU A N   1 
ATOM 42   C CA  . LEU A 1 9  ? 3.030   -9.270  67.357  1.00 47.69  ? 32  LEU A CA  1 
ATOM 43   C C   . LEU A 1 9  ? 1.968   -8.562  66.513  1.00 45.34  ? 32  LEU A C   1 
ATOM 44   O O   . LEU A 1 9  ? 2.001   -8.610  65.304  1.00 33.52  ? 32  LEU A O   1 
ATOM 45   C CB  . LEU A 1 9  ? 2.456   -10.604 67.838  1.00 48.15  ? 32  LEU A CB  1 
ATOM 46   C CG  . LEU A 1 9  ? 1.882   -11.523 66.747  1.00 33.95  ? 32  LEU A CG  1 
ATOM 47   C CD1 . LEU A 1 9  ? 2.983   -11.930 65.842  1.00 44.72  ? 32  LEU A CD1 1 
ATOM 48   C CD2 . LEU A 1 9  ? 1.216   -12.778 67.282  1.00 41.98  ? 32  LEU A CD2 1 
ATOM 49   N N   . GLN A 1 10 ? 1.012   -7.904  67.144  1.00 56.13  ? 33  GLN A N   1 
ATOM 50   C CA  . GLN A 1 10 ? 0.048   -7.127  66.369  1.00 58.95  ? 33  GLN A CA  1 
ATOM 51   C C   . GLN A 1 10 ? 0.828   -6.238  65.425  1.00 55.31  ? 33  GLN A C   1 
ATOM 52   O O   . GLN A 1 10 ? 0.704   -6.335  64.213  1.00 48.72  ? 33  GLN A O   1 
ATOM 53   C CB  . GLN A 1 10 ? -0.856  -6.264  67.259  1.00 65.44  ? 33  GLN A CB  1 
ATOM 54   C CG  . GLN A 1 10 ? -1.645  -7.028  68.335  1.00 79.98  ? 33  GLN A CG  1 
ATOM 55   C CD  . GLN A 1 10 ? -2.762  -7.871  67.771  1.00 89.66  ? 33  GLN A CD  1 
ATOM 56   O OE1 . GLN A 1 10 ? -2.700  -8.343  66.629  1.00 103.85 ? 33  GLN A OE1 1 
ATOM 57   N NE2 . GLN A 1 10 ? -3.802  -8.067  68.574  1.00 97.19  ? 33  GLN A NE2 1 
ATOM 58   N N   . GLN A 1 11 ? 1.643   -5.377  66.009  1.00 52.61  ? 34  GLN A N   1 
ATOM 59   C CA  . GLN A 1 11 ? 2.484   -4.450  65.275  1.00 54.60  ? 34  GLN A CA  1 
ATOM 60   C C   . GLN A 1 11 ? 3.188   -5.073  64.063  1.00 42.24  ? 34  GLN A C   1 
ATOM 61   O O   . GLN A 1 11 ? 3.221   -4.511  62.958  1.00 35.45  ? 34  GLN A O   1 
ATOM 62   C CB  . GLN A 1 11 ? 3.513   -3.898  66.267  1.00 65.72  ? 34  GLN A CB  1 
ATOM 63   C CG  . GLN A 1 11 ? 4.575   -2.964  65.700  1.00 84.86  ? 34  GLN A CG  1 
ATOM 64   C CD  . GLN A 1 11 ? 5.407   -2.330  66.797  1.00 100.35 ? 34  GLN A CD  1 
ATOM 65   O OE1 . GLN A 1 11 ? 5.100   -2.476  67.988  1.00 97.42  ? 34  GLN A OE1 1 
ATOM 66   N NE2 . GLN A 1 11 ? 6.468   -1.620  66.405  1.00 117.60 ? 34  GLN A NE2 1 
ATOM 67   N N   . THR A 1 12 ? 3.754   -6.241  64.293  1.00 35.40  ? 35  THR A N   1 
ATOM 68   C CA  . THR A 1 12 ? 4.556   -6.876  63.305  1.00 33.92  ? 35  THR A CA  1 
ATOM 69   C C   . THR A 1 12 ? 3.676   -7.156  62.149  1.00 34.97  ? 35  THR A C   1 
ATOM 70   O O   . THR A 1 12 ? 4.074   -6.902  61.017  1.00 41.69  ? 35  THR A O   1 
ATOM 71   C CB  . THR A 1 12 ? 5.065   -8.225  63.782  1.00 39.01  ? 35  THR A CB  1 
ATOM 72   O OG1 . THR A 1 12 ? 6.060   -8.022  64.796  1.00 56.82  ? 35  THR A OG1 1 
ATOM 73   C CG2 . THR A 1 12 ? 5.621   -9.053  62.585  1.00 14.99  ? 35  THR A CG2 1 
ATOM 74   N N   . GLN A 1 13 ? 2.477   -7.683  62.442  1.00 27.97  ? 36  GLN A N   1 
ATOM 75   C CA  . GLN A 1 13 ? 1.557   -8.113  61.409  1.00 17.12  ? 36  GLN A CA  1 
ATOM 76   C C   . GLN A 1 13 ? 1.257   -6.887  60.608  1.00 17.81  ? 36  GLN A C   1 
ATOM 77   O O   . GLN A 1 13 ? 1.479   -6.871  59.414  1.00 23.81  ? 36  GLN A O   1 
ATOM 78   C CB  . GLN A 1 13 ? 0.287   -8.727  61.972  1.00 16.52  ? 36  GLN A CB  1 
ATOM 79   C CG  . GLN A 1 13 ? -0.793  -9.137  60.907  1.00 20.70  ? 36  GLN A CG  1 
ATOM 80   C CD  . GLN A 1 13 ? -0.795  -10.641 60.498  1.00 25.25  ? 36  GLN A CD  1 
ATOM 81   O OE1 . GLN A 1 13 ? -1.077  -11.565 61.290  1.00 20.77  ? 36  GLN A OE1 1 
ATOM 82   N NE2 . GLN A 1 13 ? -0.489  -10.870 59.245  1.00 14.57  ? 36  GLN A NE2 1 
ATOM 83   N N   . ALA A 1 14 ? 0.771   -5.841  61.244  1.00 23.77  ? 37  ALA A N   1 
ATOM 84   C CA  . ALA A 1 14 ? 0.530   -4.611  60.507  1.00 30.23  ? 37  ALA A CA  1 
ATOM 85   C C   . ALA A 1 14 ? 1.678   -4.320  59.537  1.00 32.62  ? 37  ALA A C   1 
ATOM 86   O O   . ALA A 1 14 ? 1.457   -4.086  58.348  1.00 27.09  ? 37  ALA A O   1 
ATOM 87   C CB  . ALA A 1 14 ? 0.375   -3.480  61.450  1.00 36.95  ? 37  ALA A CB  1 
ATOM 88   N N   . GLN A 1 15 ? 2.895   -4.346  60.079  1.00 38.67  ? 38  GLN A N   1 
ATOM 89   C CA  . GLN A 1 15 ? 4.114   -4.003  59.344  1.00 42.68  ? 38  GLN A CA  1 
ATOM 90   C C   . GLN A 1 15 ? 4.226   -4.773  58.049  1.00 35.88  ? 38  GLN A C   1 
ATOM 91   O O   . GLN A 1 15 ? 4.683   -4.242  57.040  1.00 31.82  ? 38  GLN A O   1 
ATOM 92   C CB  . GLN A 1 15 ? 5.350   -4.285  60.212  1.00 53.35  ? 38  GLN A CB  1 
ATOM 93   C CG  . GLN A 1 15 ? 6.622   -3.485  59.819  1.00 69.55  ? 38  GLN A CG  1 
ATOM 94   C CD  . GLN A 1 15 ? 7.853   -3.855  60.662  1.00 70.58  ? 38  GLN A CD  1 
ATOM 95   O OE1 . GLN A 1 15 ? 8.991   -3.726  60.200  1.00 84.14  ? 38  GLN A OE1 1 
ATOM 96   N NE2 . GLN A 1 15 ? 7.624   -4.318  61.897  1.00 56.13  ? 38  GLN A NE2 1 
ATOM 97   N N   . VAL A 1 16 ? 3.803   -6.030  58.099  1.00 35.56  ? 39  VAL A N   1 
ATOM 98   C CA  . VAL A 1 16 ? 3.714   -6.868  56.911  1.00 33.51  ? 39  VAL A CA  1 
ATOM 99   C C   . VAL A 1 16 ? 2.594   -6.396  56.002  1.00 38.63  ? 39  VAL A C   1 
ATOM 100  O O   . VAL A 1 16 ? 2.836   -5.966  54.873  1.00 38.17  ? 39  VAL A O   1 
ATOM 101  C CB  . VAL A 1 16 ? 3.437   -8.331  57.272  1.00 27.18  ? 39  VAL A CB  1 
ATOM 102  C CG1 . VAL A 1 16 ? 3.053   -9.142  56.034  1.00 13.49  ? 39  VAL A CG1 1 
ATOM 103  C CG2 . VAL A 1 16 ? 4.646   -8.913  57.954  1.00 36.82  ? 39  VAL A CG2 1 
ATOM 104  N N   . ASP A 1 17 ? 1.364   -6.474  56.506  1.00 38.70  ? 40  ASP A N   1 
ATOM 105  C CA  . ASP A 1 17 ? 0.182   -6.232  55.693  1.00 41.70  ? 40  ASP A CA  1 
ATOM 106  C C   . ASP A 1 17 ? 0.418   -4.987  54.911  1.00 41.85  ? 40  ASP A C   1 
ATOM 107  O O   . ASP A 1 17 ? -0.012  -4.905  53.772  1.00 53.90  ? 40  ASP A O   1 
ATOM 108  C CB  . ASP A 1 17 ? -1.076  -6.107  56.550  1.00 43.73  ? 40  ASP A CB  1 
ATOM 109  C CG  . ASP A 1 17 ? -1.467  -7.438  57.197  1.00 57.91  ? 40  ASP A CG  1 
ATOM 110  O OD1 . ASP A 1 17 ? -1.308  -8.470  56.505  1.00 70.08  ? 40  ASP A OD1 1 
ATOM 111  O OD2 . ASP A 1 17 ? -1.925  -7.463  58.377  1.00 46.99  ? 40  ASP A OD2 1 
ATOM 112  N N   . GLU A 1 18 ? 1.108   -4.023  55.516  1.00 32.47  ? 41  GLU A N   1 
ATOM 113  C CA  . GLU A 1 18 ? 1.514   -2.845  54.802  1.00 35.80  ? 41  GLU A CA  1 
ATOM 114  C C   . GLU A 1 18 ? 2.305   -3.261  53.589  1.00 37.03  ? 41  GLU A C   1 
ATOM 115  O O   . GLU A 1 18 ? 1.877   -3.021  52.463  1.00 46.86  ? 41  GLU A O   1 
ATOM 116  C CB  . GLU A 1 18 ? 2.357   -1.939  55.675  1.00 38.29  ? 41  GLU A CB  1 
ATOM 117  C CG  . GLU A 1 18 ? 2.771   -0.644  54.972  1.00 57.54  ? 41  GLU A CG  1 
ATOM 118  C CD  . GLU A 1 18 ? 3.478   0.348   55.904  1.00 85.43  ? 41  GLU A CD  1 
ATOM 119  O OE1 . GLU A 1 18 ? 3.700   0.014   57.093  1.00 99.63  ? 41  GLU A OE1 1 
ATOM 120  O OE2 . GLU A 1 18 ? 3.814   1.467   55.444  1.00 102.01 ? 41  GLU A OE2 1 
ATOM 121  N N   . VAL A 1 19 ? 3.452   -3.892  53.810  1.00 37.55  ? 42  VAL A N   1 
ATOM 122  C CA  . VAL A 1 19 ? 4.367   -4.233  52.703  1.00 40.13  ? 42  VAL A CA  1 
ATOM 123  C C   . VAL A 1 19 ? 3.700   -5.047  51.596  1.00 41.96  ? 42  VAL A C   1 
ATOM 124  O O   . VAL A 1 19 ? 3.964   -4.824  50.417  1.00 36.82  ? 42  VAL A O   1 
ATOM 125  C CB  . VAL A 1 19 ? 5.564   -5.039  53.200  1.00 38.58  ? 42  VAL A CB  1 
ATOM 126  C CG1 . VAL A 1 19 ? 6.473   -5.404  52.049  1.00 36.91  ? 42  VAL A CG1 1 
ATOM 127  C CG2 . VAL A 1 19 ? 6.323   -4.247  54.212  1.00 46.68  ? 42  VAL A CG2 1 
ATOM 128  N N   . VAL A 1 20 ? 2.840   -5.985  51.992  1.00 38.72  ? 43  VAL A N   1 
ATOM 129  C CA  . VAL A 1 20 ? 2.096   -6.803  51.045  1.00 41.69  ? 43  VAL A CA  1 
ATOM 130  C C   . VAL A 1 20 ? 1.366   -5.902  50.078  1.00 45.73  ? 43  VAL A C   1 
ATOM 131  O O   . VAL A 1 20 ? 1.490   -6.055  48.859  1.00 50.15  ? 43  VAL A O   1 
ATOM 132  C CB  . VAL A 1 20 ? 1.032   -7.716  51.701  1.00 40.20  ? 43  VAL A CB  1 
ATOM 133  C CG1 . VAL A 1 20 ? 0.786   -8.908  50.821  1.00 41.04  ? 43  VAL A CG1 1 
ATOM 134  C CG2 . VAL A 1 20 ? 1.474   -8.211  53.043  1.00 65.41  ? 43  VAL A CG2 1 
ATOM 135  N N   . ASP A 1 21 ? 0.603   -4.958  50.616  1.00 45.38  ? 44  ASP A N   1 
ATOM 136  C CA  . ASP A 1 21 ? -0.153  -4.057  49.766  1.00 47.17  ? 44  ASP A CA  1 
ATOM 137  C C   . ASP A 1 21 ? 0.843   -3.350  48.851  1.00 42.93  ? 44  ASP A C   1 
ATOM 138  O O   . ASP A 1 21 ? 0.678   -3.357  47.618  1.00 42.09  ? 44  ASP A O   1 
ATOM 139  C CB  . ASP A 1 21 ? -0.990  -3.089  50.604  1.00 50.33  ? 44  ASP A CB  1 
ATOM 140  C CG  . ASP A 1 21 ? -1.872  -3.821  51.635  1.00 66.28  ? 44  ASP A CG  1 
ATOM 141  O OD1 . ASP A 1 21 ? -2.077  -5.047  51.481  1.00 76.70  ? 44  ASP A OD1 1 
ATOM 142  O OD2 . ASP A 1 21 ? -2.357  -3.187  52.600  1.00 73.84  ? 44  ASP A OD2 1 
ATOM 143  N N   . ILE A 1 22 ? 1.885   -2.766  49.444  1.00 35.41  ? 45  ILE A N   1 
ATOM 144  C CA  . ILE A 1 22 ? 2.876   -2.045  48.657  1.00 36.14  ? 45  ILE A CA  1 
ATOM 145  C C   . ILE A 1 22 ? 3.295   -2.897  47.473  1.00 36.17  ? 45  ILE A C   1 
ATOM 146  O O   . ILE A 1 22 ? 3.286   -2.470  46.324  1.00 36.34  ? 45  ILE A O   1 
ATOM 147  C CB  . ILE A 1 22 ? 4.167   -1.685  49.431  1.00 38.56  ? 45  ILE A CB  1 
ATOM 148  C CG1 . ILE A 1 22 ? 3.976   -0.546  50.436  1.00 45.94  ? 45  ILE A CG1 1 
ATOM 149  C CG2 . ILE A 1 22 ? 5.232   -1.212  48.463  1.00 36.88  ? 45  ILE A CG2 1 
ATOM 150  C CD1 . ILE A 1 22 ? 3.296   -0.915  51.728  1.00 57.13  ? 45  ILE A CD1 1 
ATOM 151  N N   . MET A 1 23 ? 3.668   -4.124  47.760  1.00 37.01  ? 46  MET A N   1 
ATOM 152  C CA  . MET A 1 23 ? 4.244   -4.961  46.730  1.00 38.36  ? 46  MET A CA  1 
ATOM 153  C C   . MET A 1 23 ? 3.225   -5.290  45.665  1.00 36.37  ? 46  MET A C   1 
ATOM 154  O O   . MET A 1 23 ? 3.575   -5.265  44.495  1.00 30.81  ? 46  MET A O   1 
ATOM 155  C CB  . MET A 1 23 ? 4.806   -6.241  47.344  1.00 45.23  ? 46  MET A CB  1 
ATOM 156  C CG  . MET A 1 23 ? 6.176   -6.071  47.969  1.00 36.46  ? 46  MET A CG  1 
ATOM 157  S SD  . MET A 1 23 ? 7.371   -5.968  46.639  1.00 40.08  ? 46  MET A SD  1 
ATOM 158  C CE  . MET A 1 23 ? 7.578   -7.741  46.297  1.00 13.91  ? 46  MET A CE  1 
ATOM 159  N N   . ARG A 1 24 ? 1.981   -5.592  46.057  1.00 40.54  ? 47  ARG A N   1 
ATOM 160  C CA  . ARG A 1 24 ? 0.937   -5.894  45.067  1.00 41.24  ? 47  ARG A CA  1 
ATOM 161  C C   . ARG A 1 24 ? 1.033   -4.862  43.993  1.00 42.90  ? 47  ARG A C   1 
ATOM 162  O O   . ARG A 1 24 ? 1.178   -5.190  42.805  1.00 38.91  ? 47  ARG A O   1 
ATOM 163  C CB  . ARG A 1 24 ? -0.476  -5.857  45.639  1.00 42.43  ? 47  ARG A CB  1 
ATOM 164  C CG  . ARG A 1 24 ? -1.104  -7.227  45.798  1.00 58.16  ? 47  ARG A CG  1 
ATOM 165  C CD  . ARG A 1 24 ? -2.599  -7.189  46.186  1.00 67.73  ? 47  ARG A CD  1 
ATOM 166  N NE  . ARG A 1 24 ? -2.856  -8.089  47.316  1.00 69.86  ? 47  ARG A NE  1 
ATOM 167  C CZ  . ARG A 1 24 ? -2.990  -7.704  48.589  1.00 90.74  ? 47  ARG A CZ  1 
ATOM 168  N NH1 . ARG A 1 24 ? -2.907  -6.419  48.946  1.00 97.61  ? 47  ARG A NH1 1 
ATOM 169  N NH2 . ARG A 1 24 ? -3.215  -8.620  49.526  1.00 101.08 ? 47  ARG A NH2 1 
ATOM 170  N N   . VAL A 1 25 ? 0.962   -3.606  44.427  1.00 38.73  ? 48  VAL A N   1 
ATOM 171  C CA  . VAL A 1 25 ? 0.981   -2.500  43.502  1.00 37.59  ? 48  VAL A CA  1 
ATOM 172  C C   . VAL A 1 25 ? 2.229   -2.543  42.627  1.00 38.87  ? 48  VAL A C   1 
ATOM 173  O O   . VAL A 1 25 ? 2.167   -2.286  41.419  1.00 43.65  ? 48  VAL A O   1 
ATOM 174  C CB  . VAL A 1 25 ? 0.969   -1.181  44.233  1.00 39.38  ? 48  VAL A CB  1 
ATOM 175  C CG1 . VAL A 1 25 ? 0.755   -0.032  43.221  1.00 46.16  ? 48  VAL A CG1 1 
ATOM 176  C CG2 . VAL A 1 25 ? -0.096  -1.197  45.336  1.00 39.42  ? 48  VAL A CG2 1 
ATOM 177  N N   . ASN A 1 26 ? 3.362   -2.865  43.235  1.00 33.05  ? 49  ASN A N   1 
ATOM 178  C CA  . ASN A 1 26 ? 4.578   -2.951  42.476  1.00 34.10  ? 49  ASN A CA  1 
ATOM 179  C C   . ASN A 1 26 ? 4.517   -4.070  41.451  1.00 33.94  ? 49  ASN A C   1 
ATOM 180  O O   . ASN A 1 26 ? 4.976   -3.909  40.331  1.00 35.92  ? 49  ASN A O   1 
ATOM 181  C CB  . ASN A 1 26 ? 5.754   -3.154  43.410  1.00 42.68  ? 49  ASN A CB  1 
ATOM 182  C CG  . ASN A 1 26 ? 6.172   -1.884  44.095  1.00 58.29  ? 49  ASN A CG  1 
ATOM 183  O OD1 . ASN A 1 26 ? 5.524   -0.848  43.955  1.00 80.54  ? 49  ASN A OD1 1 
ATOM 184  N ND2 . ASN A 1 26 ? 7.267   -1.954  44.849  1.00 75.65  ? 49  ASN A ND2 1 
ATOM 185  N N   . VAL A 1 27 ? 3.947   -5.207  41.825  1.00 35.58  ? 50  VAL A N   1 
ATOM 186  C CA  . VAL A 1 27 ? 3.791   -6.310  40.871  1.00 41.00  ? 50  VAL A CA  1 
ATOM 187  C C   . VAL A 1 27 ? 2.958   -5.828  39.696  1.00 44.45  ? 50  VAL A C   1 
ATOM 188  O O   . VAL A 1 27 ? 3.345   -6.015  38.536  1.00 44.24  ? 50  VAL A O   1 
ATOM 189  C CB  . VAL A 1 27 ? 3.160   -7.571  41.526  1.00 44.73  ? 50  VAL A CB  1 
ATOM 190  C CG1 . VAL A 1 27 ? 2.865   -8.678  40.506  1.00 9.18   ? 50  VAL A CG1 1 
ATOM 191  C CG2 . VAL A 1 27 ? 4.081   -8.108  42.612  1.00 55.54  ? 50  VAL A CG2 1 
ATOM 192  N N   . ASP A 1 28 ? 1.828   -5.202  40.008  1.00 44.38  ? 51  ASP A N   1 
ATOM 193  C CA  . ASP A 1 28 ? 1.039   -4.536  38.994  1.00 53.55  ? 51  ASP A CA  1 
ATOM 194  C C   . ASP A 1 28 ? 1.927   -3.690  38.094  1.00 50.89  ? 51  ASP A C   1 
ATOM 195  O O   . ASP A 1 28 ? 2.036   -3.957  36.902  1.00 58.86  ? 51  ASP A O   1 
ATOM 196  C CB  . ASP A 1 28 ? -0.042  -3.658  39.615  1.00 61.25  ? 51  ASP A CB  1 
ATOM 197  C CG  . ASP A 1 28 ? -0.961  -3.046  38.569  1.00 80.08  ? 51  ASP A CG  1 
ATOM 198  O OD1 . ASP A 1 28 ? -1.472  -3.798  37.703  1.00 91.06  ? 51  ASP A OD1 1 
ATOM 199  O OD2 . ASP A 1 28 ? -1.169  -1.815  38.613  1.00 104.49 ? 51  ASP A OD2 1 
ATOM 200  N N   . LYS A 1 29 ? 2.571   -2.675  38.641  1.00 46.51  ? 52  LYS A N   1 
ATOM 201  C CA  . LYS A 1 29 ? 3.457   -1.875  37.811  1.00 55.59  ? 52  LYS A CA  1 
ATOM 202  C C   . LYS A 1 29 ? 4.257   -2.756  36.863  1.00 53.94  ? 52  LYS A C   1 
ATOM 203  O O   . LYS A 1 29 ? 4.314   -2.487  35.664  1.00 58.97  ? 52  LYS A O   1 
ATOM 204  C CB  . LYS A 1 29 ? 4.410   -1.050  38.665  1.00 59.80  ? 52  LYS A CB  1 
ATOM 205  C CG  . LYS A 1 29 ? 3.724   0.131   39.311  1.00 78.25  ? 52  LYS A CG  1 
ATOM 206  C CD  . LYS A 1 29 ? 4.580   0.815   40.364  1.00 82.75  ? 52  LYS A CD  1 
ATOM 207  C CE  . LYS A 1 29 ? 3.790   1.927   41.071  1.00 77.95  ? 52  LYS A CE  1 
ATOM 208  N NZ  . LYS A 1 29 ? 4.660   2.820   41.892  1.00 85.95  ? 52  LYS A NZ  1 
ATOM 209  N N   . VAL A 1 30 ? 4.864   -3.806  37.408  1.00 49.78  ? 53  VAL A N   1 
ATOM 210  C CA  . VAL A 1 30 ? 5.741   -4.664  36.629  1.00 55.20  ? 53  VAL A CA  1 
ATOM 211  C C   . VAL A 1 30 ? 4.988   -5.330  35.503  1.00 60.01  ? 53  VAL A C   1 
ATOM 212  O O   . VAL A 1 30 ? 5.521   -5.480  34.409  1.00 69.25  ? 53  VAL A O   1 
ATOM 213  C CB  . VAL A 1 30 ? 6.424   -5.743  37.492  1.00 57.22  ? 53  VAL A CB  1 
ATOM 214  C CG1 . VAL A 1 30 ? 6.550   -7.069  36.745  1.00 54.14  ? 53  VAL A CG1 1 
ATOM 215  C CG2 . VAL A 1 30 ? 7.783   -5.255  37.940  1.00 56.44  ? 53  VAL A CG2 1 
ATOM 216  N N   . LEU A 1 31 ? 3.754   -5.736  35.749  1.00 60.25  ? 54  LEU A N   1 
ATOM 217  C CA  . LEU A 1 31 ? 2.968   -6.328  34.666  1.00 67.76  ? 54  LEU A CA  1 
ATOM 218  C C   . LEU A 1 31 ? 2.802   -5.341  33.536  1.00 71.17  ? 54  LEU A C   1 
ATOM 219  O O   . LEU A 1 31 ? 2.997   -5.695  32.378  1.00 74.87  ? 54  LEU A O   1 
ATOM 220  C CB  . LEU A 1 31 ? 1.594   -6.785  35.146  1.00 68.19  ? 54  LEU A CB  1 
ATOM 221  C CG  . LEU A 1 31 ? 1.687   -7.997  36.065  1.00 64.07  ? 54  LEU A CG  1 
ATOM 222  C CD1 . LEU A 1 31 ? 0.302   -8.387  36.469  1.00 61.43  ? 54  LEU A CD1 1 
ATOM 223  C CD2 . LEU A 1 31 ? 2.416   -9.155  35.388  1.00 27.04  ? 54  LEU A CD2 1 
ATOM 224  N N   . GLU A 1 32 ? 2.442   -4.105  33.867  1.00 72.03  ? 55  GLU A N   1 
ATOM 225  C CA  . GLU A 1 32 ? 2.360   -3.082  32.845  1.00 80.01  ? 55  GLU A CA  1 
ATOM 226  C C   . GLU A 1 32 ? 3.703   -3.040  32.108  1.00 80.48  ? 55  GLU A C   1 
ATOM 227  O O   . GLU A 1 32 ? 3.714   -3.006  30.888  1.00 89.94  ? 55  GLU A O   1 
ATOM 228  C CB  . GLU A 1 32 ? 1.968   -1.721  33.431  1.00 84.17  ? 55  GLU A CB  1 
ATOM 229  C CG  . GLU A 1 32 ? 0.502   -1.647  33.901  1.00 99.11  ? 55  GLU A CG  1 
ATOM 230  C CD  . GLU A 1 32 ? 0.207   -0.470  34.857  1.00 120.63 ? 55  GLU A CD  1 
ATOM 231  O OE1 . GLU A 1 32 ? 1.085   -0.084  35.670  1.00 124.05 ? 55  GLU A OE1 1 
ATOM 232  O OE2 . GLU A 1 32 ? -0.920  0.072   34.798  1.00 132.72 ? 55  GLU A OE2 1 
ATOM 233  N N   . ARG A 1 33 ? 4.821   -3.057  32.842  1.00 74.88  ? 56  ARG A N   1 
ATOM 234  C CA  . ARG A 1 33 ? 6.167   -3.086  32.234  1.00 73.37  ? 56  ARG A CA  1 
ATOM 235  C C   . ARG A 1 33 ? 6.344   -4.263  31.280  1.00 74.46  ? 56  ARG A C   1 
ATOM 236  O O   . ARG A 1 33 ? 6.559   -4.072  30.087  1.00 82.78  ? 56  ARG A O   1 
ATOM 237  C CB  . ARG A 1 33 ? 7.256   -3.141  33.317  1.00 72.76  ? 56  ARG A CB  1 
ATOM 238  C CG  . ARG A 1 33 ? 8.708   -2.957  32.836  1.00 67.18  ? 56  ARG A CG  1 
ATOM 239  C CD  . ARG A 1 33 ? 9.667   -3.332  33.953  1.00 56.53  ? 56  ARG A CD  1 
ATOM 240  N NE  . ARG A 1 33 ? 11.029  -2.777  33.855  1.00 55.97  ? 56  ARG A NE  1 
ATOM 241  C CZ  . ARG A 1 33 ? 12.166  -3.487  33.742  1.00 67.10  ? 56  ARG A CZ  1 
ATOM 242  N NH1 . ARG A 1 33 ? 12.168  -4.825  33.696  1.00 70.58  ? 56  ARG A NH1 1 
ATOM 243  N NH2 . ARG A 1 33 ? 13.336  -2.850  33.670  1.00 64.86  ? 56  ARG A NH2 1 
ATOM 244  N N   . ASP A 1 34 ? 6.250   -5.479  31.806  1.00 73.94  ? 57  ASP A N   1 
ATOM 245  C CA  . ASP A 1 34 ? 6.392   -6.693  30.999  1.00 78.92  ? 57  ASP A CA  1 
ATOM 246  C C   . ASP A 1 34 ? 5.564   -6.622  29.707  1.00 83.84  ? 57  ASP A C   1 
ATOM 247  O O   . ASP A 1 34 ? 6.008   -7.091  28.661  1.00 82.17  ? 57  ASP A O   1 
ATOM 248  C CB  . ASP A 1 34 ? 6.002   -7.914  31.843  1.00 79.29  ? 57  ASP A CB  1 
ATOM 249  C CG  . ASP A 1 34 ? 6.299   -9.237  31.153  1.00 88.32  ? 57  ASP A CG  1 
ATOM 250  O OD1 . ASP A 1 34 ? 5.470   -9.670  30.313  1.00 87.73  ? 57  ASP A OD1 1 
ATOM 251  O OD2 . ASP A 1 34 ? 7.357   -9.843  31.463  1.00 89.65  ? 57  ASP A OD2 1 
ATOM 252  N N   . GLN A 1 35 ? 4.370   -6.032  29.795  1.00 89.14  ? 58  GLN A N   1 
ATOM 253  C CA  . GLN A 1 35 ? 3.497   -5.805  28.635  1.00 97.66  ? 58  GLN A CA  1 
ATOM 254  C C   . GLN A 1 35 ? 4.159   -4.908  27.594  1.00 98.10  ? 58  GLN A C   1 
ATOM 255  O O   . GLN A 1 35 ? 4.181   -5.238  26.407  1.00 101.87 ? 58  GLN A O   1 
ATOM 256  C CB  . GLN A 1 35 ? 2.140   -5.215  29.069  1.00 101.26 ? 58  GLN A CB  1 
ATOM 257  C CG  . GLN A 1 35 ? 1.133   -6.292  29.514  1.00 115.13 ? 58  GLN A CG  1 
ATOM 258  C CD  . GLN A 1 35 ? -0.197  -5.752  30.037  1.00 126.28 ? 58  GLN A CD  1 
ATOM 259  O OE1 . GLN A 1 35 ? -0.326  -4.573  30.389  1.00 133.68 ? 58  GLN A OE1 1 
ATOM 260  N NE2 . GLN A 1 35 ? -1.199  -6.631  30.088  1.00 126.66 ? 58  GLN A NE2 1 
ATOM 261  N N   . LYS A 1 36 ? 4.703   -3.782  28.048  1.00 97.43  ? 59  LYS A N   1 
ATOM 262  C CA  . LYS A 1 36 ? 5.361   -2.806  27.171  1.00 100.59 ? 59  LYS A CA  1 
ATOM 263  C C   . LYS A 1 36 ? 6.523   -3.387  26.357  1.00 100.72 ? 59  LYS A C   1 
ATOM 264  O O   . LYS A 1 36 ? 6.915   -2.796  25.357  1.00 105.27 ? 59  LYS A O   1 
ATOM 265  C CB  . LYS A 1 36 ? 5.878   -1.608  27.981  1.00 100.11 ? 59  LYS A CB  1 
ATOM 266  C CG  . LYS A 1 36 ? 4.789   -0.659  28.522  1.00 106.46 ? 59  LYS A CG  1 
ATOM 267  C CD  . LYS A 1 36 ? 5.305   0.180   29.722  1.00 101.79 ? 59  LYS A CD  1 
ATOM 268  C CE  . LYS A 1 36 ? 4.672   1.575   29.804  1.00 95.72  ? 59  LYS A CE  1 
ATOM 269  N NZ  . LYS A 1 36 ? 3.223   1.564   30.156  1.00 88.87  ? 59  LYS A NZ  1 
ATOM 270  N N   . LEU A 1 37 ? 7.072   -4.528  26.770  1.00 97.89  ? 60  LEU A N   1 
ATOM 271  C CA  . LEU A 1 37 ? 8.210   -5.128  26.055  1.00 100.58 ? 60  LEU A CA  1 
ATOM 272  C C   . LEU A 1 37 ? 7.782   -6.126  24.959  1.00 101.85 ? 60  LEU A C   1 
ATOM 273  O O   . LEU A 1 37 ? 8.244   -6.028  23.819  1.00 104.53 ? 60  LEU A O   1 
ATOM 274  C CB  . LEU A 1 37 ? 9.165   -5.796  27.053  1.00 98.66  ? 60  LEU A CB  1 
ATOM 275  C CG  . LEU A 1 37 ? 9.555   -4.980  28.301  1.00 94.36  ? 60  LEU A CG  1 
ATOM 276  C CD1 . LEU A 1 37 ? 10.386  -5.852  29.224  1.00 98.65  ? 60  LEU A CD1 1 
ATOM 277  C CD2 . LEU A 1 37 ? 10.307  -3.686  27.984  1.00 64.86  ? 60  LEU A CD2 1 
ATOM 278  O OXT . LEU A 1 37 ? 6.982   -7.046  25.159  1.00 99.80  ? 60  LEU A OXT 1 
ATOM 279  N N   . GLY B 2 1  ? -9.041  -23.129 79.286  1.00 97.59  ? 189 GLY B N   1 
ATOM 280  C CA  . GLY B 2 1  ? -9.333  -21.665 79.417  1.00 88.77  ? 189 GLY B CA  1 
ATOM 281  C C   . GLY B 2 1  ? -8.049  -20.879 79.536  1.00 83.51  ? 189 GLY B C   1 
ATOM 282  O O   . GLY B 2 1  ? -7.010  -21.308 79.022  1.00 81.84  ? 189 GLY B O   1 
ATOM 283  N N   . SER B 2 2  ? -8.128  -19.739 80.226  1.00 78.63  ? 190 SER B N   1 
ATOM 284  C CA  . SER B 2 2  ? -7.105  -18.665 80.141  1.00 76.54  ? 190 SER B CA  1 
ATOM 285  C C   . SER B 2 2  ? -5.633  -19.140 80.043  1.00 74.40  ? 190 SER B C   1 
ATOM 286  O O   . SER B 2 2  ? -4.863  -18.551 79.306  1.00 73.58  ? 190 SER B O   1 
ATOM 287  C CB  . SER B 2 2  ? -7.284  -17.654 81.290  1.00 77.40  ? 190 SER B CB  1 
ATOM 288  O OG  . SER B 2 2  ? -8.298  -16.706 80.964  1.00 61.95  ? 190 SER B OG  1 
ATOM 289  N N   . ALA B 2 3  ? -5.240  -20.186 80.755  1.00 72.69  ? 191 ALA B N   1 
ATOM 290  C CA  . ALA B 2 3  ? -3.920  -20.781 80.532  1.00 71.69  ? 191 ALA B CA  1 
ATOM 291  C C   . ALA B 2 3  ? -3.712  -21.201 79.060  1.00 65.91  ? 191 ALA B C   1 
ATOM 292  O O   . ALA B 2 3  ? -2.926  -20.602 78.302  1.00 55.17  ? 191 ALA B O   1 
ATOM 293  C CB  . ALA B 2 3  ? -3.740  -21.979 81.459  1.00 77.37  ? 191 ALA B CB  1 
ATOM 294  N N   . LEU B 2 4  ? -4.445  -22.240 78.677  1.00 66.59  ? 192 LEU B N   1 
ATOM 295  C CA  . LEU B 2 4  ? -4.341  -22.847 77.353  1.00 70.22  ? 192 LEU B CA  1 
ATOM 296  C C   . LEU B 2 4  ? -4.877  -21.974 76.219  1.00 68.03  ? 192 LEU B C   1 
ATOM 297  O O   . LEU B 2 4  ? -4.304  -21.926 75.132  1.00 68.10  ? 192 LEU B O   1 
ATOM 298  C CB  . LEU B 2 4  ? -5.092  -24.183 77.355  1.00 75.69  ? 192 LEU B CB  1 
ATOM 299  C CG  . LEU B 2 4  ? -5.445  -24.846 76.022  1.00 76.26  ? 192 LEU B CG  1 
ATOM 300  C CD1 . LEU B 2 4  ? -5.467  -26.360 76.178  1.00 79.75  ? 192 LEU B CD1 1 
ATOM 301  C CD2 . LEU B 2 4  ? -6.774  -24.335 75.488  1.00 79.35  ? 192 LEU B CD2 1 
ATOM 302  N N   . SER B 2 5  ? -5.981  -21.291 76.459  1.00 65.84  ? 193 SER B N   1 
ATOM 303  C CA  . SER B 2 5  ? -6.523  -20.428 75.445  1.00 65.00  ? 193 SER B CA  1 
ATOM 304  C C   . SER B 2 5  ? -5.494  -19.363 75.094  1.00 61.07  ? 193 SER B C   1 
ATOM 305  O O   . SER B 2 5  ? -5.167  -19.226 73.924  1.00 60.03  ? 193 SER B O   1 
ATOM 306  C CB  . SER B 2 5  ? -7.791  -19.767 75.934  1.00 69.59  ? 193 SER B CB  1 
ATOM 307  O OG  . SER B 2 5  ? -7.463  -18.799 76.912  1.00 85.36  ? 193 SER B OG  1 
ATOM 308  N N   . GLU B 2 6  ? -4.980  -18.622 76.089  1.00 58.27  ? 194 GLU B N   1 
ATOM 309  C CA  . GLU B 2 6  ? -4.056  -17.513 75.796  1.00 59.22  ? 194 GLU B CA  1 
ATOM 310  C C   . GLU B 2 6  ? -3.050  -17.989 74.796  1.00 59.23  ? 194 GLU B C   1 
ATOM 311  O O   . GLU B 2 6  ? -2.636  -17.247 73.906  1.00 60.55  ? 194 GLU B O   1 
ATOM 312  C CB  . GLU B 2 6  ? -3.287  -17.036 77.014  1.00 66.46  ? 194 GLU B CB  1 
ATOM 313  C CG  . GLU B 2 6  ? -3.964  -15.976 77.887  1.00 82.62  ? 194 GLU B CG  1 
ATOM 314  C CD  . GLU B 2 6  ? -3.290  -15.855 79.272  1.00 105.05 ? 194 GLU B CD  1 
ATOM 315  O OE1 . GLU B 2 6  ? -2.034  -15.831 79.337  1.00 111.03 ? 194 GLU B OE1 1 
ATOM 316  O OE2 . GLU B 2 6  ? -4.015  -15.792 80.293  1.00 111.63 ? 194 GLU B OE2 1 
ATOM 317  N N   . ILE B 2 7  ? -2.656  -19.246 74.948  1.00 59.31  ? 195 ILE B N   1 
ATOM 318  C CA  . ILE B 2 7  ? -1.823  -19.878 73.940  1.00 60.73  ? 195 ILE B CA  1 
ATOM 319  C C   . ILE B 2 7  ? -2.577  -20.008 72.625  1.00 57.63  ? 195 ILE B C   1 
ATOM 320  O O   . ILE B 2 7  ? -2.320  -19.268 71.688  1.00 54.81  ? 195 ILE B O   1 
ATOM 321  C CB  . ILE B 2 7  ? -1.348  -21.252 74.385  1.00 61.29  ? 195 ILE B CB  1 
ATOM 322  C CG1 . ILE B 2 7  ? -0.487  -21.107 75.636  1.00 63.73  ? 195 ILE B CG1 1 
ATOM 323  C CG2 . ILE B 2 7  ? -0.590  -21.922 73.251  1.00 63.10  ? 195 ILE B CG2 1 
ATOM 324  C CD1 . ILE B 2 7  ? 0.272   -22.355 75.973  1.00 76.72  ? 195 ILE B CD1 1 
ATOM 325  N N   . GLU B 2 8  ? -3.510  -20.941 72.558  1.00 61.56  ? 196 GLU B N   1 
ATOM 326  C CA  . GLU B 2 8  ? -4.238  -21.192 71.322  1.00 71.47  ? 196 GLU B CA  1 
ATOM 327  C C   . GLU B 2 8  ? -4.472  -19.947 70.476  1.00 69.54  ? 196 GLU B C   1 
ATOM 328  O O   . GLU B 2 8  ? -4.308  -19.993 69.265  1.00 62.88  ? 196 GLU B O   1 
ATOM 329  C CB  . GLU B 2 8  ? -5.605  -21.793 71.635  1.00 82.25  ? 196 GLU B CB  1 
ATOM 330  C CG  . GLU B 2 8  ? -5.560  -23.270 71.991  1.00 95.80  ? 196 GLU B CG  1 
ATOM 331  C CD  . GLU B 2 8  ? -6.928  -23.834 72.329  1.00 100.41 ? 196 GLU B CD  1 
ATOM 332  O OE1 . GLU B 2 8  ? -7.848  -23.024 72.602  1.00 104.03 ? 196 GLU B OE1 1 
ATOM 333  O OE2 . GLU B 2 8  ? -7.070  -25.084 72.322  1.00 88.88  ? 196 GLU B OE2 1 
ATOM 334  N N   . THR B 2 9  ? -4.864  -18.846 71.116  1.00 67.56  ? 197 THR B N   1 
ATOM 335  C CA  . THR B 2 9  ? -5.078  -17.583 70.413  1.00 66.32  ? 197 THR B CA  1 
ATOM 336  C C   . THR B 2 9  ? -3.735  -17.012 69.938  1.00 59.98  ? 197 THR B C   1 
ATOM 337  O O   . THR B 2 9  ? -3.635  -16.566 68.808  1.00 52.74  ? 197 THR B O   1 
ATOM 338  C CB  . THR B 2 9  ? -5.822  -16.521 71.271  1.00 64.89  ? 197 THR B CB  1 
ATOM 339  O OG1 . THR B 2 9  ? -4.967  -16.088 72.335  1.00 82.57  ? 197 THR B OG1 1 
ATOM 340  C CG2 . THR B 2 9  ? -7.125  -17.071 71.849  1.00 55.93  ? 197 THR B CG2 1 
ATOM 341  N N   . ARG B 2 10 ? -2.704  -17.019 70.775  1.00 52.42  ? 198 ARG B N   1 
ATOM 342  C CA  . ARG B 2 10 ? -1.404  -16.600 70.279  1.00 53.29  ? 198 ARG B CA  1 
ATOM 343  C C   . ARG B 2 10 ? -1.019  -17.464 69.084  1.00 46.51  ? 198 ARG B C   1 
ATOM 344  O O   . ARG B 2 10 ? -0.530  -16.980 68.068  1.00 44.91  ? 198 ARG B O   1 
ATOM 345  C CB  . ARG B 2 10 ? -0.328  -16.690 71.363  1.00 63.57  ? 198 ARG B CB  1 
ATOM 346  C CG  . ARG B 2 10 ? 0.979   -15.902 71.048  1.00 75.43  ? 198 ARG B CG  1 
ATOM 347  C CD  . ARG B 2 10 ? 2.003   -15.983 72.188  1.00 99.60  ? 198 ARG B CD  1 
ATOM 348  N NE  . ARG B 2 10 ? 2.379   -17.368 72.514  1.00 127.17 ? 198 ARG B NE  1 
ATOM 349  C CZ  . ARG B 2 10 ? 3.361   -17.727 73.353  1.00 146.41 ? 198 ARG B CZ  1 
ATOM 350  N NH1 . ARG B 2 10 ? 4.105   -16.816 73.982  1.00 154.30 ? 198 ARG B NH1 1 
ATOM 351  N NH2 . ARG B 2 10 ? 3.608   -19.019 73.566  1.00 149.16 ? 198 ARG B NH2 1 
ATOM 352  N N   . HIS B 2 11 ? -1.246  -18.752 69.210  1.00 46.25  ? 199 HIS B N   1 
ATOM 353  C CA  . HIS B 2 11 ? -0.908  -19.670 68.152  1.00 52.76  ? 199 HIS B CA  1 
ATOM 354  C C   . HIS B 2 11 ? -1.634  -19.282 66.856  1.00 57.33  ? 199 HIS B C   1 
ATOM 355  O O   . HIS B 2 11 ? -0.995  -19.003 65.839  1.00 61.20  ? 199 HIS B O   1 
ATOM 356  C CB  . HIS B 2 11 ? -1.245  -21.086 68.605  1.00 58.66  ? 199 HIS B CB  1 
ATOM 357  C CG  . HIS B 2 11 ? -1.458  -22.059 67.492  1.00 64.49  ? 199 HIS B CG  1 
ATOM 358  N ND1 . HIS B 2 11 ? -0.463  -22.897 67.040  1.00 70.27  ? 199 HIS B ND1 1 
ATOM 359  C CD2 . HIS B 2 11 ? -2.554  -22.336 66.745  1.00 57.66  ? 199 HIS B CD2 1 
ATOM 360  C CE1 . HIS B 2 11 ? -0.934  -23.646 66.059  1.00 63.83  ? 199 HIS B CE1 1 
ATOM 361  N NE2 . HIS B 2 11 ? -2.200  -23.326 65.863  1.00 60.58  ? 199 HIS B NE2 1 
ATOM 362  N N   . SER B 2 12 ? -2.960  -19.260 66.894  1.00 54.94  ? 200 SER B N   1 
ATOM 363  C CA  . SER B 2 12 ? -3.762  -18.794 65.776  1.00 49.65  ? 200 SER B CA  1 
ATOM 364  C C   . SER B 2 12 ? -3.173  -17.546 65.127  1.00 44.39  ? 200 SER B C   1 
ATOM 365  O O   . SER B 2 12 ? -2.861  -17.544 63.943  1.00 43.67  ? 200 SER B O   1 
ATOM 366  C CB  . SER B 2 12 ? -5.167  -18.472 66.254  1.00 52.99  ? 200 SER B CB  1 
ATOM 367  O OG  . SER B 2 12 ? -5.809  -17.599 65.341  1.00 62.73  ? 200 SER B OG  1 
ATOM 368  N N   . GLU B 2 13 ? -3.022  -16.489 65.915  1.00 39.98  ? 201 GLU B N   1 
ATOM 369  C CA  . GLU B 2 13 ? -2.464  -15.229 65.435  1.00 40.86  ? 201 GLU B CA  1 
ATOM 370  C C   . GLU B 2 13 ? -1.167  -15.391 64.688  1.00 41.04  ? 201 GLU B C   1 
ATOM 371  O O   . GLU B 2 13 ? -0.897  -14.643 63.752  1.00 41.92  ? 201 GLU B O   1 
ATOM 372  C CB  . GLU B 2 13 ? -2.214  -14.285 66.589  1.00 40.83  ? 201 GLU B CB  1 
ATOM 373  C CG  . GLU B 2 13 ? -3.442  -13.501 66.962  1.00 66.20  ? 201 GLU B CG  1 
ATOM 374  C CD  . GLU B 2 13 ? -3.197  -12.519 68.101  1.00 86.46  ? 201 GLU B CD  1 
ATOM 375  O OE1 . GLU B 2 13 ? -3.416  -11.301 67.890  1.00 92.65  ? 201 GLU B OE1 1 
ATOM 376  O OE2 . GLU B 2 13 ? -2.786  -12.966 69.202  1.00 98.09  ? 201 GLU B OE2 1 
ATOM 377  N N   . ILE B 2 14 ? -0.362  -16.358 65.098  1.00 43.90  ? 202 ILE B N   1 
ATOM 378  C CA  . ILE B 2 14 ? 0.883   -16.633 64.394  1.00 46.80  ? 202 ILE B CA  1 
ATOM 379  C C   . ILE B 2 14 ? 0.665   -17.176 62.979  1.00 46.84  ? 202 ILE B C   1 
ATOM 380  O O   . ILE B 2 14 ? 1.334   -16.756 62.020  1.00 38.28  ? 202 ILE B O   1 
ATOM 381  C CB  . ILE B 2 14 ? 1.732   -17.593 65.190  1.00 46.06  ? 202 ILE B CB  1 
ATOM 382  C CG1 . ILE B 2 14 ? 2.337   -16.814 66.337  1.00 51.30  ? 202 ILE B CG1 1 
ATOM 383  C CG2 . ILE B 2 14 ? 2.828   -18.203 64.325  1.00 50.95  ? 202 ILE B CG2 1 
ATOM 384  C CD1 . ILE B 2 14 ? 3.241   -17.624 67.180  1.00 86.33  ? 202 ILE B CD1 1 
ATOM 385  N N   . ILE B 2 15 ? -0.265  -18.107 62.848  1.00 50.59  ? 203 ILE B N   1 
ATOM 386  C CA  . ILE B 2 15 ? -0.602  -18.611 61.525  1.00 51.86  ? 203 ILE B CA  1 
ATOM 387  C C   . ILE B 2 15 ? -1.020  -17.448 60.623  1.00 48.12  ? 203 ILE B C   1 
ATOM 388  O O   . ILE B 2 15 ? -0.625  -17.380 59.445  1.00 45.66  ? 203 ILE B O   1 
ATOM 389  C CB  . ILE B 2 15 ? -1.731  -19.650 61.559  1.00 51.93  ? 203 ILE B CB  1 
ATOM 390  C CG1 . ILE B 2 15 ? -1.319  -20.849 62.408  1.00 51.54  ? 203 ILE B CG1 1 
ATOM 391  C CG2 . ILE B 2 15 ? -2.084  -20.078 60.155  1.00 51.95  ? 203 ILE B CG2 1 
ATOM 392  C CD1 . ILE B 2 15 ? -1.787  -20.735 63.850  1.00 56.02  ? 203 ILE B CD1 1 
ATOM 393  N N   . LYS B 2 16 ? -1.812  -16.529 61.168  1.00 40.21  ? 204 LYS B N   1 
ATOM 394  C CA  . LYS B 2 16 ? -2.154  -15.379 60.379  1.00 41.53  ? 204 LYS B CA  1 
ATOM 395  C C   . LYS B 2 16 ? -0.845  -14.778 59.894  1.00 39.64  ? 204 LYS B C   1 
ATOM 396  O O   . LYS B 2 16 ? -0.661  -14.563 58.704  1.00 41.31  ? 204 LYS B O   1 
ATOM 397  C CB  . LYS B 2 16 ? -2.976  -14.357 61.150  1.00 41.82  ? 204 LYS B CB  1 
ATOM 398  C CG  . LYS B 2 16 ? -3.629  -13.354 60.223  1.00 47.19  ? 204 LYS B CG  1 
ATOM 399  C CD  . LYS B 2 16 ? -4.414  -12.266 60.954  1.00 64.56  ? 204 LYS B CD  1 
ATOM 400  C CE  . LYS B 2 16 ? -4.871  -11.168 59.962  1.00 71.71  ? 204 LYS B CE  1 
ATOM 401  N NZ  . LYS B 2 16 ? -5.443  -9.948  60.609  1.00 75.11  ? 204 LYS B NZ  1 
ATOM 402  N N   . LEU B 2 17 ? 0.072   -14.523 60.813  1.00 37.71  ? 205 LEU B N   1 
ATOM 403  C CA  . LEU B 2 17 ? 1.311   -13.858 60.446  1.00 33.10  ? 205 LEU B CA  1 
ATOM 404  C C   . LEU B 2 17 ? 2.104   -14.625 59.412  1.00 31.12  ? 205 LEU B C   1 
ATOM 405  O O   . LEU B 2 17 ? 2.685   -14.013 58.518  1.00 26.88  ? 205 LEU B O   1 
ATOM 406  C CB  . LEU B 2 17 ? 2.195   -13.643 61.660  1.00 29.15  ? 205 LEU B CB  1 
ATOM 407  C CG  . LEU B 2 17 ? 3.400   -12.779 61.303  1.00 36.31  ? 205 LEU B CG  1 
ATOM 408  C CD1 . LEU B 2 17 ? 2.952   -11.361 61.004  1.00 30.58  ? 205 LEU B CD1 1 
ATOM 409  C CD2 . LEU B 2 17 ? 4.433   -12.787 62.416  1.00 51.28  ? 205 LEU B CD2 1 
ATOM 410  N N   . GLU B 2 18 ? 2.136   -15.951 59.528  1.00 31.38  ? 206 GLU B N   1 
ATOM 411  C CA  . GLU B 2 18 ? 2.918   -16.749 58.586  1.00 33.60  ? 206 GLU B CA  1 
ATOM 412  C C   . GLU B 2 18 ? 2.327   -16.582 57.196  1.00 35.91  ? 206 GLU B C   1 
ATOM 413  O O   . GLU B 2 18 ? 3.014   -16.243 56.235  1.00 29.40  ? 206 GLU B O   1 
ATOM 414  C CB  . GLU B 2 18 ? 2.953   -18.220 58.985  1.00 31.62  ? 206 GLU B CB  1 
ATOM 415  C CG  . GLU B 2 18 ? 3.711   -19.132 57.999  1.00 41.26  ? 206 GLU B CG  1 
ATOM 416  C CD  . GLU B 2 18 ? 3.931   -20.576 58.523  1.00 57.52  ? 206 GLU B CD  1 
ATOM 417  O OE1 . GLU B 2 18 ? 4.358   -20.756 59.689  1.00 47.89  ? 206 GLU B OE1 1 
ATOM 418  O OE2 . GLU B 2 18 ? 3.682   -21.551 57.768  1.00 60.87  ? 206 GLU B OE2 1 
ATOM 419  N N   . ASN B 2 19 ? 1.031   -16.807 57.090  1.00 44.26  ? 207 ASN B N   1 
ATOM 420  C CA  . ASN B 2 19 ? 0.386   -16.713 55.783  1.00 46.91  ? 207 ASN B CA  1 
ATOM 421  C C   . ASN B 2 19 ? 0.595   -15.386 55.116  1.00 39.64  ? 207 ASN B C   1 
ATOM 422  O O   . ASN B 2 19 ? 0.598   -15.313 53.893  1.00 39.93  ? 207 ASN B O   1 
ATOM 423  C CB  . ASN B 2 19 ? -1.095  -17.025 55.899  1.00 47.46  ? 207 ASN B CB  1 
ATOM 424  C CG  . ASN B 2 19 ? -1.320  -18.487 55.984  1.00 56.85  ? 207 ASN B CG  1 
ATOM 425  O OD1 . ASN B 2 19 ? -1.537  -19.038 57.063  1.00 71.61  ? 207 ASN B OD1 1 
ATOM 426  N ND2 . ASN B 2 19 ? -1.243  -19.150 54.835  1.00 62.43  ? 207 ASN B ND2 1 
ATOM 427  N N   . SER B 2 20 ? 0.770   -14.350 55.917  1.00 28.98  ? 208 SER B N   1 
ATOM 428  C CA  . SER B 2 20 ? 1.044   -13.055 55.392  1.00 26.81  ? 208 SER B CA  1 
ATOM 429  C C   . SER B 2 20 ? 2.429   -13.070 54.849  1.00 25.31  ? 208 SER B C   1 
ATOM 430  O O   . SER B 2 20 ? 2.706   -12.520 53.781  1.00 33.55  ? 208 SER B O   1 
ATOM 431  C CB  . SER B 2 20 ? 0.946   -12.044 56.494  1.00 26.84  ? 208 SER B CB  1 
ATOM 432  O OG  . SER B 2 20 ? -0.102  -12.451 57.341  1.00 60.40  ? 208 SER B OG  1 
ATOM 433  N N   . ILE B 2 21 ? 3.326   -13.701 55.572  1.00 23.78  ? 209 ILE B N   1 
ATOM 434  C CA  . ILE B 2 21 ? 4.698   -13.690 55.122  1.00 28.24  ? 209 ILE B CA  1 
ATOM 435  C C   . ILE B 2 21 ? 4.757   -14.498 53.858  1.00 29.44  ? 209 ILE B C   1 
ATOM 436  O O   . ILE B 2 21 ? 5.406   -14.123 52.882  1.00 31.02  ? 209 ILE B O   1 
ATOM 437  C CB  . ILE B 2 21 ? 5.609   -14.266 56.174  1.00 28.47  ? 209 ILE B CB  1 
ATOM 438  C CG1 . ILE B 2 21 ? 5.872   -13.192 57.222  1.00 26.16  ? 209 ILE B CG1 1 
ATOM 439  C CG2 . ILE B 2 21 ? 6.889   -14.747 55.545  1.00 27.43  ? 209 ILE B CG2 1 
ATOM 440  C CD1 . ILE B 2 21 ? 6.038   -13.795 58.565  1.00 48.77  ? 209 ILE B CD1 1 
ATOM 441  N N   . ARG B 2 22 ? 4.055   -15.616 53.893  1.00 38.67  ? 210 ARG B N   1 
ATOM 442  C CA  . ARG B 2 22 ? 4.036   -16.511 52.779  1.00 41.83  ? 210 ARG B CA  1 
ATOM 443  C C   . ARG B 2 22 ? 3.724   -15.708 51.535  1.00 36.83  ? 210 ARG B C   1 
ATOM 444  O O   . ARG B 2 22 ? 4.527   -15.655 50.621  1.00 31.87  ? 210 ARG B O   1 
ATOM 445  C CB  . ARG B 2 22 ? 3.000   -17.594 53.011  1.00 48.86  ? 210 ARG B CB  1 
ATOM 446  C CG  . ARG B 2 22 ? 2.987   -18.652 51.930  1.00 66.41  ? 210 ARG B CG  1 
ATOM 447  C CD  . ARG B 2 22 ? 4.173   -19.580 52.045  1.00 71.08  ? 210 ARG B CD  1 
ATOM 448  N NE  . ARG B 2 22 ? 4.218   -20.284 53.329  1.00 80.11  ? 210 ARG B NE  1 
ATOM 449  C CZ  . ARG B 2 22 ? 5.148   -21.182 53.655  1.00 85.66  ? 210 ARG B CZ  1 
ATOM 450  N NH1 . ARG B 2 22 ? 6.114   -21.496 52.793  1.00 90.35  ? 210 ARG B NH1 1 
ATOM 451  N NH2 . ARG B 2 22 ? 5.119   -21.775 54.844  1.00 74.61  ? 210 ARG B NH2 1 
ATOM 452  N N   . GLU B 2 23 ? 2.558   -15.080 51.510  1.00 39.01  ? 211 GLU B N   1 
ATOM 453  C CA  . GLU B 2 23 ? 2.208   -14.221 50.407  1.00 37.88  ? 211 GLU B CA  1 
ATOM 454  C C   . GLU B 2 23 ? 3.335   -13.277 50.141  1.00 33.33  ? 211 GLU B C   1 
ATOM 455  O O   . GLU B 2 23 ? 3.851   -13.232 49.030  1.00 40.10  ? 211 GLU B O   1 
ATOM 456  C CB  . GLU B 2 23 ? 0.966   -13.416 50.712  1.00 41.04  ? 211 GLU B CB  1 
ATOM 457  C CG  . GLU B 2 23 ? -0.291  -14.097 50.270  1.00 58.25  ? 211 GLU B CG  1 
ATOM 458  C CD  . GLU B 2 23 ? -0.732  -13.641 48.904  1.00 66.89  ? 211 GLU B CD  1 
ATOM 459  O OE1 . GLU B 2 23 ? -1.155  -12.469 48.780  1.00 58.11  ? 211 GLU B OE1 1 
ATOM 460  O OE2 . GLU B 2 23 ? -0.657  -14.456 47.960  1.00 83.32  ? 211 GLU B OE2 1 
ATOM 461  N N   . LEU B 2 24 ? 3.740   -12.516 51.141  1.00 29.57  ? 212 LEU B N   1 
ATOM 462  C CA  . LEU B 2 24 ? 4.728   -11.489 50.847  1.00 33.92  ? 212 LEU B CA  1 
ATOM 463  C C   . LEU B 2 24 ? 5.895   -12.088 50.050  1.00 38.95  ? 212 LEU B C   1 
ATOM 464  O O   . LEU B 2 24 ? 6.229   -11.636 48.953  1.00 37.06  ? 212 LEU B O   1 
ATOM 465  C CB  . LEU B 2 24 ? 5.251   -10.828 52.110  1.00 31.85  ? 212 LEU B CB  1 
ATOM 466  C CG  . LEU B 2 24 ? 6.064   -9.580  51.754  1.00 30.77  ? 212 LEU B CG  1 
ATOM 467  C CD1 . LEU B 2 24 ? 5.133   -8.348  51.740  1.00 32.14  ? 212 LEU B CD1 1 
ATOM 468  C CD2 . LEU B 2 24 ? 7.292   -9.362  52.675  1.00 19.81  ? 212 LEU B CD2 1 
ATOM 469  N N   . HIS B 2 25 ? 6.497   -13.118 50.629  1.00 44.12  ? 213 HIS B N   1 
ATOM 470  C CA  . HIS B 2 25 ? 7.580   -13.844 50.002  1.00 42.37  ? 213 HIS B CA  1 
ATOM 471  C C   . HIS B 2 25 ? 7.232   -14.227 48.590  1.00 38.81  ? 213 HIS B C   1 
ATOM 472  O O   . HIS B 2 25 ? 7.979   -13.955 47.674  1.00 39.58  ? 213 HIS B O   1 
ATOM 473  C CB  . HIS B 2 25 ? 7.867   -15.099 50.801  1.00 44.77  ? 213 HIS B CB  1 
ATOM 474  C CG  . HIS B 2 25 ? 8.651   -16.121 50.051  1.00 43.38  ? 213 HIS B CG  1 
ATOM 475  N ND1 . HIS B 2 25 ? 8.055   -17.170 49.389  1.00 35.56  ? 213 HIS B ND1 1 
ATOM 476  C CD2 . HIS B 2 25 ? 9.984   -16.257 49.862  1.00 47.73  ? 213 HIS B CD2 1 
ATOM 477  C CE1 . HIS B 2 25 ? 8.993   -17.912 48.825  1.00 60.68  ? 213 HIS B CE1 1 
ATOM 478  N NE2 . HIS B 2 25 ? 10.171  -17.378 49.096  1.00 46.13  ? 213 HIS B NE2 1 
ATOM 479  N N   . ASP B 2 26 ? 6.089   -14.860 48.416  1.00 40.65  ? 214 ASP B N   1 
ATOM 480  C CA  . ASP B 2 26 ? 5.659   -15.254 47.083  1.00 53.88  ? 214 ASP B CA  1 
ATOM 481  C C   . ASP B 2 26 ? 5.728   -14.094 46.113  1.00 50.05  ? 214 ASP B C   1 
ATOM 482  O O   . ASP B 2 26 ? 6.246   -14.233 45.001  1.00 53.74  ? 214 ASP B O   1 
ATOM 483  C CB  . ASP B 2 26 ? 4.234   -15.823 47.106  1.00 61.68  ? 214 ASP B CB  1 
ATOM 484  C CG  . ASP B 2 26 ? 4.202   -17.300 47.459  1.00 79.01  ? 214 ASP B CG  1 
ATOM 485  O OD1 . ASP B 2 26 ? 3.228   -17.960 47.042  1.00 92.74  ? 214 ASP B OD1 1 
ATOM 486  O OD2 . ASP B 2 26 ? 5.141   -17.794 48.140  1.00 90.06  ? 214 ASP B OD2 1 
ATOM 487  N N   . MET B 2 27 ? 5.213   -12.950 46.533  1.00 44.87  ? 215 MET B N   1 
ATOM 488  C CA  . MET B 2 27 ? 5.273   -11.766 45.691  1.00 48.78  ? 215 MET B CA  1 
ATOM 489  C C   . MET B 2 27 ? 6.725   -11.380 45.360  1.00 51.41  ? 215 MET B C   1 
ATOM 490  O O   . MET B 2 27 ? 7.034   -10.997 44.228  1.00 56.17  ? 215 MET B O   1 
ATOM 491  C CB  . MET B 2 27 ? 4.559   -10.603 46.361  1.00 44.77  ? 215 MET B CB  1 
ATOM 492  C CG  . MET B 2 27 ? 3.084   -10.875 46.579  1.00 46.57  ? 215 MET B CG  1 
ATOM 493  S SD  . MET B 2 27 ? 2.182   -9.491  47.318  1.00 49.58  ? 215 MET B SD  1 
ATOM 494  C CE  . MET B 2 27 ? 2.834   -8.169  46.283  1.00 18.17  ? 215 MET B CE  1 
ATOM 495  N N   . PHE B 2 28 ? 7.609   -11.487 46.346  1.00 46.73  ? 216 PHE B N   1 
ATOM 496  C CA  . PHE B 2 28 ? 9.007   -11.151 46.138  1.00 43.82  ? 216 PHE B CA  1 
ATOM 497  C C   . PHE B 2 28 ? 9.667   -12.081 45.167  1.00 45.36  ? 216 PHE B C   1 
ATOM 498  O O   . PHE B 2 28 ? 10.557  -11.687 44.426  1.00 50.18  ? 216 PHE B O   1 
ATOM 499  C CB  . PHE B 2 28 ? 9.787   -11.171 47.459  1.00 45.00  ? 216 PHE B CB  1 
ATOM 500  C CG  . PHE B 2 28 ? 9.844   -9.845  48.098  1.00 38.82  ? 216 PHE B CG  1 
ATOM 501  C CD1 . PHE B 2 28 ? 10.634  -8.857  47.563  1.00 33.12  ? 216 PHE B CD1 1 
ATOM 502  C CD2 . PHE B 2 28 ? 9.099   -9.565  49.210  1.00 55.88  ? 216 PHE B CD2 1 
ATOM 503  C CE1 . PHE B 2 28 ? 10.688  -7.617  48.129  1.00 22.57  ? 216 PHE B CE1 1 
ATOM 504  C CE2 . PHE B 2 28 ? 9.154   -8.313  49.786  1.00 54.38  ? 216 PHE B CE2 1 
ATOM 505  C CZ  . PHE B 2 28 ? 9.949   -7.342  49.242  1.00 33.23  ? 216 PHE B CZ  1 
ATOM 506  N N   . MET B 2 29 ? 9.244   -13.324 45.167  1.00 48.23  ? 217 MET B N   1 
ATOM 507  C CA  . MET B 2 29 ? 9.863   -14.254 44.272  1.00 59.18  ? 217 MET B CA  1 
ATOM 508  C C   . MET B 2 29 ? 9.397   -13.871 42.882  1.00 57.71  ? 217 MET B C   1 
ATOM 509  O O   . MET B 2 29 ? 10.210  -13.512 42.036  1.00 59.60  ? 217 MET B O   1 
ATOM 510  C CB  . MET B 2 29 ? 9.514   -15.696 44.651  1.00 65.54  ? 217 MET B CB  1 
ATOM 511  C CG  . MET B 2 29 ? 10.091  -16.114 46.018  1.00 76.16  ? 217 MET B CG  1 
ATOM 512  S SD  . MET B 2 29 ? 11.880  -15.856 46.212  1.00 71.40  ? 217 MET B SD  1 
ATOM 513  C CE  . MET B 2 29 ? 12.515  -17.068 45.043  1.00 90.76  ? 217 MET B CE  1 
ATOM 514  N N   . ASP B 2 30 ? 8.091   -13.930 42.649  1.00 56.15  ? 218 ASP B N   1 
ATOM 515  C CA  . ASP B 2 30 ? 7.576   -13.706 41.307  1.00 55.02  ? 218 ASP B CA  1 
ATOM 516  C C   . ASP B 2 30 ? 8.203   -12.440 40.771  1.00 51.01  ? 218 ASP B C   1 
ATOM 517  O O   . ASP B 2 30 ? 8.738   -12.425 39.674  1.00 47.77  ? 218 ASP B O   1 
ATOM 518  C CB  . ASP B 2 30 ? 6.042   -13.644 41.303  1.00 55.38  ? 218 ASP B CB  1 
ATOM 519  C CG  . ASP B 2 30 ? 5.404   -15.007 41.590  1.00 66.04  ? 218 ASP B CG  1 
ATOM 520  O OD1 . ASP B 2 30 ? 5.833   -16.028 40.993  1.00 80.19  ? 218 ASP B OD1 1 
ATOM 521  O OD2 . ASP B 2 30 ? 4.474   -15.057 42.419  1.00 64.51  ? 218 ASP B OD2 1 
ATOM 522  N N   . MET B 2 31 ? 8.148   -11.381 41.564  1.00 55.02  ? 219 MET B N   1 
ATOM 523  C CA  . MET B 2 31 ? 8.793   -10.122 41.209  1.00 56.56  ? 219 MET B CA  1 
ATOM 524  C C   . MET B 2 31 ? 10.165  -10.302 40.549  1.00 53.60  ? 219 MET B C   1 
ATOM 525  O O   . MET B 2 31 ? 10.386  -9.865  39.422  1.00 55.38  ? 219 MET B O   1 
ATOM 526  C CB  . MET B 2 31 ? 8.953   -9.262  42.456  1.00 59.60  ? 219 MET B CB  1 
ATOM 527  C CG  . MET B 2 31 ? 9.607   -7.948  42.184  1.00 71.24  ? 219 MET B CG  1 
ATOM 528  S SD  . MET B 2 31 ? 8.875   -7.134  40.734  1.00 98.69  ? 219 MET B SD  1 
ATOM 529  C CE  . MET B 2 31 ? 7.295   -6.520  41.335  1.00 49.35  ? 219 MET B CE  1 
ATOM 530  N N   . ALA B 2 32 ? 11.080  -10.945 41.253  1.00 51.62  ? 220 ALA B N   1 
ATOM 531  C CA  . ALA B 2 32 ? 12.393  -11.238 40.698  1.00 54.79  ? 220 ALA B CA  1 
ATOM 532  C C   . ALA B 2 32 ? 12.311  -12.023 39.398  1.00 58.91  ? 220 ALA B C   1 
ATOM 533  O O   . ALA B 2 32 ? 12.967  -11.677 38.421  1.00 62.56  ? 220 ALA B O   1 
ATOM 534  C CB  . ALA B 2 32 ? 13.180  -12.022 41.675  1.00 61.03  ? 220 ALA B CB  1 
ATOM 535  N N   . MET B 2 33 ? 11.506  -13.083 39.409  1.00 60.85  ? 221 MET B N   1 
ATOM 536  C CA  . MET B 2 33 ? 11.281  -13.946 38.247  1.00 59.44  ? 221 MET B CA  1 
ATOM 537  C C   . MET B 2 33 ? 10.955  -13.149 37.007  1.00 52.24  ? 221 MET B C   1 
ATOM 538  O O   . MET B 2 33 ? 11.467  -13.438 35.924  1.00 58.09  ? 221 MET B O   1 
ATOM 539  C CB  . MET B 2 33 ? 10.127  -14.906 38.537  1.00 63.87  ? 221 MET B CB  1 
ATOM 540  C CG  . MET B 2 33 ? 9.756   -15.828 37.398  1.00 73.33  ? 221 MET B CG  1 
ATOM 541  S SD  . MET B 2 33 ? 8.598   -17.095 37.936  1.00 95.45  ? 221 MET B SD  1 
ATOM 542  C CE  . MET B 2 33 ? 9.632   -18.182 38.937  1.00 59.44  ? 221 MET B CE  1 
ATOM 543  N N   . LEU B 2 34 ? 10.102  -12.148 37.177  1.00 43.85  ? 222 LEU B N   1 
ATOM 544  C CA  . LEU B 2 34 ? 9.715   -11.295 36.080  1.00 46.05  ? 222 LEU B CA  1 
ATOM 545  C C   . LEU B 2 34 ? 10.814  -10.355 35.684  1.00 50.34  ? 222 LEU B C   1 
ATOM 546  O O   . LEU B 2 34 ? 11.116  -10.247 34.510  1.00 54.81  ? 222 LEU B O   1 
ATOM 547  C CB  . LEU B 2 34 ? 8.496   -10.473 36.446  1.00 48.87  ? 222 LEU B CB  1 
ATOM 548  C CG  . LEU B 2 34 ? 7.240   -11.311 36.660  1.00 61.24  ? 222 LEU B CG  1 
ATOM 549  C CD1 . LEU B 2 34 ? 5.995   -10.426 36.520  1.00 54.61  ? 222 LEU B CD1 1 
ATOM 550  C CD2 . LEU B 2 34 ? 7.199   -12.523 35.703  1.00 61.14  ? 222 LEU B CD2 1 
ATOM 551  N N   . VAL B 2 35 ? 11.419  -9.661  36.639  1.00 55.20  ? 223 VAL B N   1 
ATOM 552  C CA  . VAL B 2 35 ? 12.471  -8.708  36.265  1.00 60.85  ? 223 VAL B CA  1 
ATOM 553  C C   . VAL B 2 35 ? 13.692  -9.432  35.696  1.00 63.63  ? 223 VAL B C   1 
ATOM 554  O O   . VAL B 2 35 ? 14.380  -8.895  34.833  1.00 72.90  ? 223 VAL B O   1 
ATOM 555  C CB  . VAL B 2 35 ? 12.893  -7.798  37.430  1.00 63.19  ? 223 VAL B CB  1 
ATOM 556  C CG1 . VAL B 2 35 ? 14.291  -7.234  37.195  1.00 69.23  ? 223 VAL B CG1 1 
ATOM 557  C CG2 . VAL B 2 35 ? 11.898  -6.674  37.591  1.00 57.47  ? 223 VAL B CG2 1 
ATOM 558  N N   . GLU B 2 36 ? 13.961  -10.638 36.170  1.00 62.12  ? 224 GLU B N   1 
ATOM 559  C CA  . GLU B 2 36 ? 14.911  -11.495 35.492  1.00 69.70  ? 224 GLU B CA  1 
ATOM 560  C C   . GLU B 2 36 ? 14.535  -11.656 34.015  1.00 74.21  ? 224 GLU B C   1 
ATOM 561  O O   . GLU B 2 36 ? 15.364  -11.413 33.124  1.00 80.11  ? 224 GLU B O   1 
ATOM 562  C CB  . GLU B 2 36 ? 14.984  -12.860 36.171  1.00 71.95  ? 224 GLU B CB  1 
ATOM 563  C CG  . GLU B 2 36 ? 16.036  -13.812 35.583  1.00 79.59  ? 224 GLU B CG  1 
ATOM 564  C CD  . GLU B 2 36 ? 16.112  -15.131 36.345  1.00 96.10  ? 224 GLU B CD  1 
ATOM 565  O OE1 . GLU B 2 36 ? 15.137  -15.474 37.055  1.00 111.53 ? 224 GLU B OE1 1 
ATOM 566  O OE2 . GLU B 2 36 ? 17.145  -15.828 36.235  1.00 94.55  ? 224 GLU B OE2 1 
ATOM 567  N N   . SER B 2 37 ? 13.291  -12.060 33.753  1.00 72.68  ? 225 SER B N   1 
ATOM 568  C CA  . SER B 2 37 ? 12.883  -12.362 32.377  1.00 75.83  ? 225 SER B CA  1 
ATOM 569  C C   . SER B 2 37 ? 12.896  -11.104 31.528  1.00 72.90  ? 225 SER B C   1 
ATOM 570  O O   . SER B 2 37 ? 13.299  -11.123 30.373  1.00 81.17  ? 225 SER B O   1 
ATOM 571  C CB  . SER B 2 37 ? 11.494  -13.002 32.327  1.00 76.36  ? 225 SER B CB  1 
ATOM 572  O OG  . SER B 2 37 ? 10.478  -12.014 32.218  1.00 90.03  ? 225 SER B OG  1 
ATOM 573  N N   . GLN B 2 38 ? 12.449  -10.008 32.112  1.00 67.68  ? 226 GLN B N   1 
ATOM 574  C CA  . GLN B 2 38 ? 12.341  -8.761  31.391  1.00 71.85  ? 226 GLN B CA  1 
ATOM 575  C C   . GLN B 2 38 ? 13.719  -8.275  31.024  1.00 73.53  ? 226 GLN B C   1 
ATOM 576  O O   . GLN B 2 38 ? 13.916  -7.793  29.923  1.00 77.37  ? 226 GLN B O   1 
ATOM 577  C CB  . GLN B 2 38 ? 11.588  -7.724  32.222  1.00 71.18  ? 226 GLN B CB  1 
ATOM 578  C CG  . GLN B 2 38 ? 10.086  -7.972  32.189  1.00 79.99  ? 226 GLN B CG  1 
ATOM 579  C CD  . GLN B 2 38 ? 9.326   -7.194  33.230  1.00 81.92  ? 226 GLN B CD  1 
ATOM 580  O OE1 . GLN B 2 38 ? 8.526   -6.310  32.907  1.00 76.31  ? 226 GLN B OE1 1 
ATOM 581  N NE2 . GLN B 2 38 ? 9.570   -7.517  34.496  1.00 93.19  ? 226 GLN B NE2 1 
ATOM 582  N N   . GLY B 2 39 ? 14.671  -8.409  31.942  1.00 77.36  ? 227 GLY B N   1 
ATOM 583  C CA  . GLY B 2 39 ? 16.058  -8.066  31.652  1.00 80.34  ? 227 GLY B CA  1 
ATOM 584  C C   . GLY B 2 39 ? 16.482  -8.667  30.338  1.00 84.77  ? 227 GLY B C   1 
ATOM 585  O O   . GLY B 2 39 ? 17.114  -8.006  29.513  1.00 85.95  ? 227 GLY B O   1 
ATOM 586  N N   . GLU B 2 40 ? 16.119  -9.928  30.140  1.00 87.71  ? 228 GLU B N   1 
ATOM 587  C CA  . GLU B 2 40 ? 16.501  -10.635 28.926  1.00 95.56  ? 228 GLU B CA  1 
ATOM 588  C C   . GLU B 2 40 ? 15.906  -9.959  27.692  1.00 94.88  ? 228 GLU B C   1 
ATOM 589  O O   . GLU B 2 40 ? 16.646  -9.485  26.852  1.00 98.96  ? 228 GLU B O   1 
ATOM 590  C CB  . GLU B 2 40 ? 16.110  -12.104 29.018  1.00 99.10  ? 228 GLU B CB  1 
ATOM 591  C CG  . GLU B 2 40 ? 16.793  -12.784 30.198  1.00 110.25 ? 228 GLU B CG  1 
ATOM 592  C CD  . GLU B 2 40 ? 16.663  -14.282 30.170  1.00 123.65 ? 228 GLU B CD  1 
ATOM 593  O OE1 . GLU B 2 40 ? 15.651  -14.781 29.628  1.00 128.03 ? 228 GLU B OE1 1 
ATOM 594  O OE2 . GLU B 2 40 ? 17.579  -14.957 30.695  1.00 132.80 ? 228 GLU B OE2 1 
ATOM 595  N N   . MET B 2 41 ? 14.587  -9.898  27.578  1.00 91.04  ? 229 MET B N   1 
ATOM 596  C CA  . MET B 2 41 ? 13.982  -9.140  26.495  1.00 93.32  ? 229 MET B CA  1 
ATOM 597  C C   . MET B 2 41 ? 14.702  -7.818  26.240  1.00 93.49  ? 229 MET B C   1 
ATOM 598  O O   . MET B 2 41 ? 14.938  -7.446  25.094  1.00 96.58  ? 229 MET B O   1 
ATOM 599  C CB  . MET B 2 41 ? 12.546  -8.803  26.824  1.00 95.85  ? 229 MET B CB  1 
ATOM 600  C CG  . MET B 2 41 ? 11.568  -9.912  26.604  1.00 107.73 ? 229 MET B CG  1 
ATOM 601  S SD  . MET B 2 41 ? 9.917   -9.187  26.564  1.00 133.71 ? 229 MET B SD  1 
ATOM 602  C CE  . MET B 2 41 ? 9.982   -8.321  24.989  1.00 132.13 ? 229 MET B CE  1 
ATOM 603  N N   . ILE B 2 42 ? 15.045  -7.106  27.310  1.00 91.76  ? 230 ILE B N   1 
ATOM 604  C CA  . ILE B 2 42 ? 15.614  -5.769  27.171  1.00 91.58  ? 230 ILE B CA  1 
ATOM 605  C C   . ILE B 2 42 ? 16.916  -5.860  26.425  1.00 92.05  ? 230 ILE B C   1 
ATOM 606  O O   . ILE B 2 42 ? 17.070  -5.202  25.406  1.00 98.93  ? 230 ILE B O   1 
ATOM 607  C CB  . ILE B 2 42 ? 15.841  -5.065  28.515  1.00 91.20  ? 230 ILE B CB  1 
ATOM 608  C CG1 . ILE B 2 42 ? 14.669  -4.139  28.856  1.00 84.31  ? 230 ILE B CG1 1 
ATOM 609  C CG2 . ILE B 2 42 ? 17.104  -4.212  28.484  1.00 87.34  ? 230 ILE B CG2 1 
ATOM 610  C CD1 . ILE B 2 42 ? 13.309  -4.746  28.726  1.00 74.73  ? 230 ILE B CD1 1 
ATOM 611  N N   . ASP B 2 43 ? 17.847  -6.672  26.907  1.00 90.15  ? 231 ASP B N   1 
ATOM 612  C CA  . ASP B 2 43 ? 19.149  -6.749  26.241  1.00 97.49  ? 231 ASP B CA  1 
ATOM 613  C C   . ASP B 2 43 ? 19.036  -7.184  24.759  1.00 101.02 ? 231 ASP B C   1 
ATOM 614  O O   . ASP B 2 43 ? 19.998  -7.048  24.005  1.00 107.15 ? 231 ASP B O   1 
ATOM 615  C CB  . ASP B 2 43 ? 20.127  -7.637  27.022  1.00 98.64  ? 231 ASP B CB  1 
ATOM 616  C CG  . ASP B 2 43 ? 19.576  -9.007  27.302  1.00 106.14 ? 231 ASP B CG  1 
ATOM 617  O OD1 . ASP B 2 43 ? 19.530  -9.391  28.485  1.00 109.76 ? 231 ASP B OD1 1 
ATOM 618  O OD2 . ASP B 2 43 ? 19.188  -9.702  26.342  1.00 123.61 ? 231 ASP B OD2 1 
ATOM 619  N N   . ARG B 2 44 ? 17.875  -7.697  24.346  1.00 102.24 ? 232 ARG B N   1 
ATOM 620  C CA  . ARG B 2 44 ? 17.587  -7.908  22.923  1.00 105.60 ? 232 ARG B CA  1 
ATOM 621  C C   . ARG B 2 44 ? 17.248  -6.601  22.233  1.00 102.60 ? 232 ARG B C   1 
ATOM 622  O O   . ARG B 2 44 ? 17.650  -6.390  21.101  1.00 109.12 ? 232 ARG B O   1 
ATOM 623  C CB  . ARG B 2 44 ? 16.442  -8.895  22.706  1.00 108.05 ? 232 ARG B CB  1 
ATOM 624  C CG  . ARG B 2 44 ? 16.835  -10.336 22.940  1.00 127.34 ? 232 ARG B CG  1 
ATOM 625  C CD  . ARG B 2 44 ? 15.678  -11.291 22.648  1.00 146.29 ? 232 ARG B CD  1 
ATOM 626  N NE  . ARG B 2 44 ? 15.963  -12.650 23.115  1.00 161.91 ? 232 ARG B NE  1 
ATOM 627  C CZ  . ARG B 2 44 ? 15.104  -13.670 23.079  1.00 170.73 ? 232 ARG B CZ  1 
ATOM 628  N NH1 . ARG B 2 44 ? 13.875  -13.510 22.595  1.00 172.24 ? 232 ARG B NH1 1 
ATOM 629  N NH2 . ARG B 2 44 ? 15.479  -14.864 23.534  1.00 175.34 ? 232 ARG B NH2 1 
ATOM 630  N N   . ILE B 2 45 ? 16.511  -5.720  22.895  1.00 99.28  ? 233 ILE B N   1 
ATOM 631  C CA  . ILE B 2 45 ? 16.304  -4.386  22.331  1.00 100.62 ? 233 ILE B CA  1 
ATOM 632  C C   . ILE B 2 45 ? 17.624  -3.593  22.317  1.00 101.41 ? 233 ILE B C   1 
ATOM 633  O O   . ILE B 2 45 ? 17.789  -2.671  21.519  1.00 104.29 ? 233 ILE B O   1 
ATOM 634  C CB  . ILE B 2 45 ? 15.190  -3.611  23.059  1.00 99.11  ? 233 ILE B CB  1 
ATOM 635  C CG1 . ILE B 2 45 ? 13.846  -4.338  22.888  1.00 99.70  ? 233 ILE B CG1 1 
ATOM 636  C CG2 . ILE B 2 45 ? 15.114  -2.186  22.531  1.00 98.28  ? 233 ILE B CG2 1 
ATOM 637  C CD1 . ILE B 2 45 ? 12.639  -3.421  22.598  1.00 96.18  ? 233 ILE B CD1 1 
ATOM 638  N N   . GLU B 2 46 ? 18.552  -3.959  23.194  1.00 103.74 ? 234 GLU B N   1 
ATOM 639  C CA  . GLU B 2 46 ? 19.920  -3.459  23.128  1.00 113.03 ? 234 GLU B CA  1 
ATOM 640  C C   . GLU B 2 46 ? 20.595  -3.951  21.845  1.00 120.19 ? 234 GLU B C   1 
ATOM 641  O O   . GLU B 2 46 ? 21.255  -3.176  21.151  1.00 125.91 ? 234 GLU B O   1 
ATOM 642  C CB  . GLU B 2 46 ? 20.712  -3.914  24.357  1.00 115.32 ? 234 GLU B CB  1 
ATOM 643  C CG  . GLU B 2 46 ? 22.116  -3.320  24.520  1.00 123.35 ? 234 GLU B CG  1 
ATOM 644  C CD  . GLU B 2 46 ? 23.043  -4.207  25.364  1.00 138.42 ? 234 GLU B CD  1 
ATOM 645  O OE1 . GLU B 2 46 ? 22.563  -5.178  25.995  1.00 140.83 ? 234 GLU B OE1 1 
ATOM 646  O OE2 . GLU B 2 46 ? 24.264  -3.930  25.395  1.00 156.09 ? 234 GLU B OE2 1 
ATOM 647  N N   . TYR B 2 47 ? 20.428  -5.239  21.537  1.00 120.71 ? 235 TYR B N   1 
ATOM 648  C CA  . TYR B 2 47 ? 20.919  -5.826  20.276  1.00 125.11 ? 235 TYR B CA  1 
ATOM 649  C C   . TYR B 2 47 ? 20.290  -5.132  19.072  1.00 122.76 ? 235 TYR B C   1 
ATOM 650  O O   . TYR B 2 47 ? 21.003  -4.678  18.185  1.00 128.83 ? 235 TYR B O   1 
ATOM 651  C CB  . TYR B 2 47 ? 20.608  -7.327  20.240  1.00 128.24 ? 235 TYR B CB  1 
ATOM 652  C CG  . TYR B 2 47 ? 21.403  -8.214  19.280  1.00 140.03 ? 235 TYR B CG  1 
ATOM 653  C CD1 . TYR B 2 47 ? 22.638  -8.759  19.655  1.00 148.84 ? 235 TYR B CD1 1 
ATOM 654  C CD2 . TYR B 2 47 ? 20.910  -8.528  18.008  1.00 145.33 ? 235 TYR B CD2 1 
ATOM 655  C CE1 . TYR B 2 47 ? 23.366  -9.582  18.783  1.00 150.52 ? 235 TYR B CE1 1 
ATOM 656  C CE2 . TYR B 2 47 ? 21.633  -9.350  17.130  1.00 148.08 ? 235 TYR B CE2 1 
ATOM 657  C CZ  . TYR B 2 47 ? 22.856  -9.870  17.526  1.00 151.51 ? 235 TYR B CZ  1 
ATOM 658  O OH  . TYR B 2 47 ? 23.567  -10.676 16.668  1.00 155.24 ? 235 TYR B OH  1 
ATOM 659  N N   . ASN B 2 48 ? 18.960  -5.045  19.048  1.00 116.33 ? 236 ASN B N   1 
ATOM 660  C CA  . ASN B 2 48 ? 18.245  -4.390  17.946  1.00 115.65 ? 236 ASN B CA  1 
ATOM 661  C C   . ASN B 2 48 ? 18.646  -2.940  17.748  1.00 116.96 ? 236 ASN B C   1 
ATOM 662  O O   . ASN B 2 48 ? 18.795  -2.488  16.613  1.00 123.63 ? 236 ASN B O   1 
ATOM 663  C CB  . ASN B 2 48 ? 16.726  -4.459  18.142  1.00 114.82 ? 236 ASN B CB  1 
ATOM 664  C CG  . ASN B 2 48 ? 16.122  -5.751  17.609  1.00 117.47 ? 236 ASN B CG  1 
ATOM 665  O OD1 . ASN B 2 48 ? 16.807  -6.771  17.494  1.00 118.42 ? 236 ASN B OD1 1 
ATOM 666  N ND2 . ASN B 2 48 ? 14.830  -5.712  17.280  1.00 111.22 ? 236 ASN B ND2 1 
ATOM 667  N N   . VAL B 2 49 ? 18.820  -2.205  18.837  1.00 116.15 ? 237 VAL B N   1 
ATOM 668  C CA  . VAL B 2 49 ? 19.235  -0.807  18.718  1.00 122.28 ? 237 VAL B CA  1 
ATOM 669  C C   . VAL B 2 49 ? 20.688  -0.673  18.264  1.00 127.29 ? 237 VAL B C   1 
ATOM 670  O O   . VAL B 2 49 ? 20.960  -0.067  17.224  1.00 131.31 ? 237 VAL B O   1 
ATOM 671  C CB  . VAL B 2 49 ? 19.050  -0.050  20.032  1.00 122.73 ? 237 VAL B CB  1 
ATOM 672  C CG1 . VAL B 2 49 ? 19.878  1.244   20.038  1.00 120.46 ? 237 VAL B CG1 1 
ATOM 673  C CG2 . VAL B 2 49 ? 17.575  0.232   20.245  1.00 120.11 ? 237 VAL B CG2 1 
ATOM 674  N N   . GLU B 2 50 ? 21.614  -1.235  19.037  1.00 128.86 ? 238 GLU B N   1 
ATOM 675  C CA  . GLU B 2 50 ? 23.038  -1.171  18.705  1.00 135.32 ? 238 GLU B CA  1 
ATOM 676  C C   . GLU B 2 50 ? 23.297  -1.398  17.205  1.00 138.47 ? 238 GLU B C   1 
ATOM 677  O O   . GLU B 2 50 ? 24.154  -0.731  16.611  1.00 141.81 ? 238 GLU B O   1 
ATOM 678  C CB  . GLU B 2 50 ? 23.833  -2.175  19.550  1.00 137.18 ? 238 GLU B CB  1 
ATOM 679  C CG  . GLU B 2 50 ? 24.084  -1.706  20.987  1.00 141.27 ? 238 GLU B CG  1 
ATOM 680  C CD  . GLU B 2 50 ? 24.879  -2.707  21.831  1.00 145.20 ? 238 GLU B CD  1 
ATOM 681  O OE1 . GLU B 2 50 ? 24.887  -3.916  21.503  1.00 145.71 ? 238 GLU B OE1 1 
ATOM 682  O OE2 . GLU B 2 50 ? 25.497  -2.277  22.832  1.00 142.04 ? 238 GLU B OE2 1 
ATOM 683  N N   . HIS B 2 51 ? 22.556  -2.332  16.605  1.00 137.45 ? 239 HIS B N   1 
ATOM 684  C CA  . HIS B 2 51 ? 22.617  -2.574  15.159  1.00 140.52 ? 239 HIS B CA  1 
ATOM 685  C C   . HIS B 2 51 ? 22.090  -1.379  14.365  1.00 138.43 ? 239 HIS B C   1 
ATOM 686  O O   . HIS B 2 51 ? 22.852  -0.725  13.642  1.00 142.80 ? 239 HIS B O   1 
ATOM 687  C CB  . HIS B 2 51 ? 21.833  -3.837  14.765  1.00 140.60 ? 239 HIS B CB  1 
ATOM 688  C CG  . HIS B 2 51 ? 22.570  -5.117  15.020  1.00 149.05 ? 239 HIS B CG  1 
ATOM 689  N ND1 . HIS B 2 51 ? 23.860  -5.334  14.587  1.00 159.56 ? 239 HIS B ND1 1 
ATOM 690  C CD2 . HIS B 2 51 ? 22.193  -6.250  15.660  1.00 156.57 ? 239 HIS B CD2 1 
ATOM 691  C CE1 . HIS B 2 51 ? 24.248  -6.544  14.951  1.00 163.35 ? 239 HIS B CE1 1 
ATOM 692  N NE2 . HIS B 2 51 ? 23.255  -7.121  15.604  1.00 160.13 ? 239 HIS B NE2 1 
ATOM 693  N N   . ALA B 2 52 ? 20.793  -1.101  14.504  1.00 132.32 ? 240 ALA B N   1 
ATOM 694  C CA  . ALA B 2 52 ? 20.153  -0.012  13.774  1.00 131.53 ? 240 ALA B CA  1 
ATOM 695  C C   . ALA B 2 52 ? 21.023  1.256   13.792  1.00 137.06 ? 240 ALA B C   1 
ATOM 696  O O   . ALA B 2 52 ? 21.042  2.021   12.819  1.00 142.51 ? 240 ALA B O   1 
ATOM 697  C CB  . ALA B 2 52 ? 18.776  0.263   14.342  1.00 124.05 ? 240 ALA B CB  1 
ATOM 698  N N   . VAL B 2 53 ? 21.746  1.468   14.894  1.00 139.71 ? 241 VAL B N   1 
ATOM 699  C CA  . VAL B 2 53 ? 22.710  2.576   14.994  1.00 142.85 ? 241 VAL B CA  1 
ATOM 700  C C   . VAL B 2 53 ? 23.863  2.426   14.012  1.00 146.34 ? 241 VAL B C   1 
ATOM 701  O O   . VAL B 2 53 ? 24.079  3.300   13.176  1.00 147.51 ? 241 VAL B O   1 
ATOM 702  C CB  . VAL B 2 53 ? 23.309  2.697   16.408  1.00 143.10 ? 241 VAL B CB  1 
ATOM 703  C CG1 . VAL B 2 53 ? 24.612  3.486   16.371  1.00 144.81 ? 241 VAL B CG1 1 
ATOM 704  C CG2 . VAL B 2 53 ? 22.314  3.351   17.350  1.00 144.24 ? 241 VAL B CG2 1 
ATOM 705  N N   . ASP B 2 54 ? 24.600  1.321   14.121  1.00 149.43 ? 242 ASP B N   1 
ATOM 706  C CA  . ASP B 2 54 ? 25.721  1.047   13.217  1.00 155.32 ? 242 ASP B CA  1 
ATOM 707  C C   . ASP B 2 54 ? 25.294  1.221   11.773  1.00 155.44 ? 242 ASP B C   1 
ATOM 708  O O   . ASP B 2 54 ? 25.996  1.853   10.983  1.00 158.36 ? 242 ASP B O   1 
ATOM 709  C CB  . ASP B 2 54 ? 26.267  -0.373  13.410  1.00 157.43 ? 242 ASP B CB  1 
ATOM 710  C CG  . ASP B 2 54 ? 27.094  -0.519  14.673  1.00 162.24 ? 242 ASP B CG  1 
ATOM 711  O OD1 . ASP B 2 54 ? 26.843  0.225   15.649  1.00 167.63 ? 242 ASP B OD1 1 
ATOM 712  O OD2 . ASP B 2 54 ? 27.999  -1.385  14.684  1.00 165.30 ? 242 ASP B OD2 1 
ATOM 713  N N   . TYR B 2 55 ? 24.136  0.659   11.437  1.00 153.33 ? 243 TYR B N   1 
ATOM 714  C CA  . TYR B 2 55 ? 23.620  0.749   10.072  1.00 155.11 ? 243 TYR B CA  1 
ATOM 715  C C   . TYR B 2 55 ? 23.420  2.203   9.628   1.00 154.30 ? 243 TYR B C   1 
ATOM 716  O O   . TYR B 2 55 ? 24.122  2.662   8.728   1.00 160.85 ? 243 TYR B O   1 
ATOM 717  C CB  . TYR B 2 55 ? 22.333  -0.080  9.913   1.00 153.17 ? 243 TYR B CB  1 
ATOM 718  C CG  . TYR B 2 55 ? 22.631  -1.544  9.662   1.00 157.29 ? 243 TYR B CG  1 
ATOM 719  C CD1 . TYR B 2 55 ? 22.755  -2.031  8.363   1.00 165.02 ? 243 TYR B CD1 1 
ATOM 720  C CD2 . TYR B 2 55 ? 22.800  -2.437  10.717  1.00 154.72 ? 243 TYR B CD2 1 
ATOM 721  C CE1 . TYR B 2 55 ? 23.034  -3.369  8.120   1.00 168.69 ? 243 TYR B CE1 1 
ATOM 722  C CE2 . TYR B 2 55 ? 23.078  -3.777  10.486  1.00 159.31 ? 243 TYR B CE2 1 
ATOM 723  C CZ  . TYR B 2 55 ? 23.194  -4.236  9.183   1.00 168.66 ? 243 TYR B CZ  1 
ATOM 724  O OH  . TYR B 2 55 ? 23.470  -5.561  8.932   1.00 176.98 ? 243 TYR B OH  1 
ATOM 725  N N   . VAL B 2 56 ? 22.492  2.933   10.241  1.00 150.03 ? 244 VAL B N   1 
ATOM 726  C CA  . VAL B 2 56 ? 22.184  4.295   9.750   1.00 151.44 ? 244 VAL B CA  1 
ATOM 727  C C   . VAL B 2 56 ? 23.384  5.256   9.847   1.00 155.16 ? 244 VAL B C   1 
ATOM 728  O O   . VAL B 2 56 ? 23.666  6.017   8.906   1.00 158.34 ? 244 VAL B O   1 
ATOM 729  C CB  . VAL B 2 56 ? 20.974  4.910   10.477  1.00 149.28 ? 244 VAL B CB  1 
ATOM 730  C CG1 . VAL B 2 56 ? 20.699  6.330   9.970   1.00 140.88 ? 244 VAL B CG1 1 
ATOM 731  C CG2 . VAL B 2 56 ? 19.752  4.026   10.291  1.00 145.74 ? 244 VAL B CG2 1 
ATOM 732  N N   . GLU B 2 57 ? 24.079  5.214   10.981  1.00 155.71 ? 245 GLU B N   1 
ATOM 733  C CA  . GLU B 2 57 ? 25.306  5.987   11.183  1.00 160.08 ? 245 GLU B CA  1 
ATOM 734  C C   . GLU B 2 57 ? 26.282  5.818   10.015  1.00 165.14 ? 245 GLU B C   1 
ATOM 735  O O   . GLU B 2 57 ? 26.748  6.809   9.445   1.00 167.57 ? 245 GLU B O   1 
ATOM 736  C CB  . GLU B 2 57 ? 25.990  5.565   12.487  1.00 160.11 ? 245 GLU B CB  1 
ATOM 737  C CG  . GLU B 2 57 ? 27.261  6.346   12.836  1.00 159.65 ? 245 GLU B CG  1 
ATOM 738  C CD  . GLU B 2 57 ? 28.259  5.513   13.626  1.00 157.88 ? 245 GLU B CD  1 
ATOM 739  O OE1 . GLU B 2 57 ? 29.448  5.483   13.239  1.00 162.88 ? 245 GLU B OE1 1 
ATOM 740  O OE2 . GLU B 2 57 ? 27.854  4.887   14.630  1.00 141.29 ? 245 GLU B OE2 1 
ATOM 741  N N   . ARG B 2 58 ? 26.584  4.565   9.667   1.00 166.55 ? 246 ARG B N   1 
ATOM 742  C CA  . ARG B 2 58 ? 27.561  4.261   8.612   1.00 171.52 ? 246 ARG B CA  1 
ATOM 743  C C   . ARG B 2 58 ? 27.024  4.650   7.223   1.00 170.71 ? 246 ARG B C   1 
ATOM 744  O O   . ARG B 2 58 ? 27.802  4.951   6.314   1.00 172.02 ? 246 ARG B O   1 
ATOM 745  C CB  . ARG B 2 58 ? 27.957  2.773   8.659   1.00 173.59 ? 246 ARG B CB  1 
ATOM 746  C CG  . ARG B 2 58 ? 29.269  2.430   7.944   1.00 184.10 ? 246 ARG B CG  1 
ATOM 747  C CD  . ARG B 2 58 ? 29.808  1.053   8.349   1.00 189.59 ? 246 ARG B CD  1 
ATOM 748  N NE  . ARG B 2 58 ? 28.809  -0.006  8.188   1.00 199.22 ? 246 ARG B NE  1 
ATOM 749  C CZ  . ARG B 2 58 ? 28.496  -0.604  7.036   1.00 208.91 ? 246 ARG B CZ  1 
ATOM 750  N NH1 . ARG B 2 58 ? 29.099  -0.264  5.898   1.00 215.49 ? 246 ARG B NH1 1 
ATOM 751  N NH2 . ARG B 2 58 ? 27.565  -1.557  7.021   1.00 210.48 ? 246 ARG B NH2 1 
ATOM 752  N N   . ALA B 2 59 ? 25.697  4.650   7.075   1.00 167.58 ? 247 ALA B N   1 
ATOM 753  C CA  . ALA B 2 59 ? 25.035  5.020   5.815   1.00 167.14 ? 247 ALA B CA  1 
ATOM 754  C C   . ALA B 2 59 ? 24.753  6.526   5.685   1.00 167.88 ? 247 ALA B C   1 
ATOM 755  O O   . ALA B 2 59 ? 23.712  6.913   5.137   1.00 166.00 ? 247 ALA B O   1 
ATOM 756  C CB  . ALA B 2 59 ? 23.733  4.235   5.657   1.00 162.43 ? 247 ALA B CB  1 
ATOM 757  N N   . VAL B 2 60 ? 25.667  7.365   6.187   1.00 169.18 ? 248 VAL B N   1 
ATOM 758  C CA  . VAL B 2 60 ? 25.583  8.831   5.993   1.00 170.35 ? 248 VAL B CA  1 
ATOM 759  C C   . VAL B 2 60 ? 26.911  9.524   5.603   1.00 173.23 ? 248 VAL B C   1 
ATOM 760  O O   . VAL B 2 60 ? 26.910  10.422  4.756   1.00 173.73 ? 248 VAL B O   1 
ATOM 761  C CB  . VAL B 2 60 ? 25.026  9.534   7.258   1.00 168.89 ? 248 VAL B CB  1 
ATOM 762  C CG1 . VAL B 2 60 ? 24.754  11.008  6.981   1.00 166.10 ? 248 VAL B CG1 1 
ATOM 763  C CG2 . VAL B 2 60 ? 23.757  8.846   7.738   1.00 168.06 ? 248 VAL B CG2 1 
ATOM 764  N N   . SER B 2 61 ? 28.024  9.108   6.214   1.00 175.07 ? 249 SER B N   1 
ATOM 765  C CA  . SER B 2 61 ? 29.296  9.864   6.185   1.00 177.47 ? 249 SER B CA  1 
ATOM 766  C C   . SER B 2 61 ? 29.990  9.985   4.806   1.00 180.02 ? 249 SER B C   1 
ATOM 767  O O   . SER B 2 61 ? 30.662  9.050   4.363   1.00 182.50 ? 249 SER B O   1 
ATOM 768  C CB  . SER B 2 61 ? 30.269  9.233   7.196   1.00 176.53 ? 249 SER B CB  1 
ATOM 769  O OG  . SER B 2 61 ? 31.469  9.975   7.297   1.00 179.80 ? 249 SER B OG  1 
ATOM 770  N N   . ASP B 2 62 ? 29.823  11.140  4.149   1.00 178.74 ? 250 ASP B N   1 
ATOM 771  C CA  . ASP B 2 62 ? 30.550  11.478  2.910   1.00 179.13 ? 250 ASP B CA  1 
ATOM 772  C C   . ASP B 2 62 ? 30.970  12.943  2.911   1.00 177.14 ? 250 ASP B C   1 
ATOM 773  O O   . ASP B 2 62 ? 30.237  13.806  2.431   1.00 172.50 ? 250 ASP B O   1 
ATOM 774  C CB  . ASP B 2 62 ? 29.704  11.193  1.662   1.00 179.06 ? 250 ASP B CB  1 
ATOM 775  C CG  . ASP B 2 62 ? 29.864  9.773   1.148   1.00 182.67 ? 250 ASP B CG  1 
ATOM 776  O OD1 . ASP B 2 62 ? 31.018  9.292   1.029   1.00 183.69 ? 250 ASP B OD1 1 
ATOM 777  O OD2 . ASP B 2 62 ? 28.827  9.139   0.854   1.00 187.43 ? 250 ASP B OD2 1 
ATOM 778  N N   . GLU C 3 8  ? -7.175  -35.315 82.585  1.00 135.99 ? 10  GLU C N   1 
ATOM 779  C CA  . GLU C 3 8  ? -7.818  -33.994 82.322  1.00 137.81 ? 10  GLU C CA  1 
ATOM 780  C C   . GLU C 3 8  ? -6.779  -32.881 82.182  1.00 135.74 ? 10  GLU C C   1 
ATOM 781  O O   . GLU C 3 8  ? -6.370  -32.552 81.062  1.00 133.09 ? 10  GLU C O   1 
ATOM 782  C CB  . GLU C 3 8  ? -8.800  -33.650 83.437  1.00 139.25 ? 10  GLU C CB  1 
ATOM 783  C CG  . GLU C 3 8  ? -10.074 -34.451 83.394  1.00 150.26 ? 10  GLU C CG  1 
ATOM 784  C CD  . GLU C 3 8  ? -11.002 -34.119 84.546  1.00 160.13 ? 10  GLU C CD  1 
ATOM 785  O OE1 . GLU C 3 8  ? -10.525 -33.587 85.578  1.00 160.86 ? 10  GLU C OE1 1 
ATOM 786  O OE2 . GLU C 3 8  ? -12.212 -34.396 84.417  1.00 170.62 ? 10  GLU C OE2 1 
ATOM 787  N N   . LEU C 3 9  ? -6.355  -32.307 83.312  1.00 134.87 ? 11  LEU C N   1 
ATOM 788  C CA  . LEU C 3 9  ? -5.359  -31.223 83.311  1.00 132.55 ? 11  LEU C CA  1 
ATOM 789  C C   . LEU C 3 9  ? -3.971  -31.693 82.844  1.00 128.60 ? 11  LEU C C   1 
ATOM 790  O O   . LEU C 3 9  ? -3.201  -30.893 82.302  1.00 122.77 ? 11  LEU C O   1 
ATOM 791  C CB  . LEU C 3 9  ? -5.254  -30.563 84.698  1.00 133.43 ? 11  LEU C CB  1 
ATOM 792  C CG  . LEU C 3 9  ? -6.323  -29.519 85.046  1.00 139.21 ? 11  LEU C CG  1 
ATOM 793  C CD1 . LEU C 3 9  ? -6.207  -29.036 86.491  1.00 134.03 ? 11  LEU C CD1 1 
ATOM 794  C CD2 . LEU C 3 9  ? -6.231  -28.339 84.093  1.00 145.00 ? 11  LEU C CD2 1 
ATOM 795  N N   . GLU C 3 10 ? -3.664  -32.978 83.053  1.00 128.02 ? 12  GLU C N   1 
ATOM 796  C CA  . GLU C 3 10 ? -2.415  -33.580 82.563  1.00 126.68 ? 12  GLU C CA  1 
ATOM 797  C C   . GLU C 3 10 ? -2.295  -33.475 81.029  1.00 128.59 ? 12  GLU C C   1 
ATOM 798  O O   . GLU C 3 10 ? -1.236  -33.095 80.491  1.00 124.51 ? 12  GLU C O   1 
ATOM 799  C CB  . GLU C 3 10 ? -2.312  -35.050 82.997  1.00 125.70 ? 12  GLU C CB  1 
ATOM 800  C CG  . GLU C 3 10 ? -2.277  -35.287 84.514  1.00 114.42 ? 12  GLU C CG  1 
ATOM 801  C CD  . GLU C 3 10 ? -1.725  -36.668 84.895  1.00 111.53 ? 12  GLU C CD  1 
ATOM 802  O OE1 . GLU C 3 10 ? -1.451  -37.477 83.990  1.00 111.90 ? 12  GLU C OE1 1 
ATOM 803  O OE2 . GLU C 3 10 ? -1.559  -36.959 86.100  1.00 93.58  ? 12  GLU C OE2 1 
ATOM 804  N N   . GLU C 3 11 ? -3.393  -33.812 80.344  1.00 129.64 ? 13  GLU C N   1 
ATOM 805  C CA  . GLU C 3 11 ? -3.494  -33.738 78.878  1.00 130.09 ? 13  GLU C CA  1 
ATOM 806  C C   . GLU C 3 11 ? -3.607  -32.306 78.342  1.00 125.92 ? 13  GLU C C   1 
ATOM 807  O O   . GLU C 3 11 ? -3.240  -32.048 77.198  1.00 118.54 ? 13  GLU C O   1 
ATOM 808  C CB  . GLU C 3 11 ? -4.711  -34.522 78.379  1.00 135.44 ? 13  GLU C CB  1 
ATOM 809  C CG  . GLU C 3 11 ? -4.722  -36.015 78.707  1.00 141.09 ? 13  GLU C CG  1 
ATOM 810  C CD  . GLU C 3 11 ? -6.125  -36.623 78.608  1.00 144.42 ? 13  GLU C CD  1 
ATOM 811  O OE1 . GLU C 3 11 ? -7.046  -36.123 79.297  1.00 141.94 ? 13  GLU C OE1 1 
ATOM 812  O OE2 . GLU C 3 11 ? -6.309  -37.598 77.847  1.00 139.22 ? 13  GLU C OE2 1 
ATOM 813  N N   . MET C 3 12 ? -4.123  -31.386 79.156  1.00 124.41 ? 14  MET C N   1 
ATOM 814  C CA  . MET C 3 12 ? -4.135  -29.961 78.798  1.00 120.62 ? 14  MET C CA  1 
ATOM 815  C C   . MET C 3 12 ? -2.728  -29.386 78.645  1.00 115.53 ? 14  MET C C   1 
ATOM 816  O O   . MET C 3 12 ? -2.487  -28.611 77.729  1.00 109.43 ? 14  MET C O   1 
ATOM 817  C CB  . MET C 3 12 ? -4.892  -29.127 79.838  1.00 123.08 ? 14  MET C CB  1 
ATOM 818  C CG  . MET C 3 12 ? -6.245  -28.615 79.374  1.00 130.84 ? 14  MET C CG  1 
ATOM 819  S SD  . MET C 3 12 ? -6.995  -27.459 80.552  1.00 141.33 ? 14  MET C SD  1 
ATOM 820  C CE  . MET C 3 12 ? -5.757  -26.161 80.685  1.00 143.55 ? 14  MET C CE  1 
ATOM 821  N N   . GLN C 3 13 ? -1.812  -29.760 79.541  1.00 115.72 ? 15  GLN C N   1 
ATOM 822  C CA  . GLN C 3 13 ? -0.439  -29.216 79.529  1.00 114.11 ? 15  GLN C CA  1 
ATOM 823  C C   . GLN C 3 13 ? 0.451   -29.872 78.487  1.00 112.55 ? 15  GLN C C   1 
ATOM 824  O O   . GLN C 3 13 ? 1.338   -29.231 77.908  1.00 105.22 ? 15  GLN C O   1 
ATOM 825  C CB  . GLN C 3 13 ? 0.215   -29.375 80.894  1.00 116.90 ? 15  GLN C CB  1 
ATOM 826  C CG  . GLN C 3 13 ? -0.279  -28.376 81.925  1.00 129.45 ? 15  GLN C CG  1 
ATOM 827  C CD  . GLN C 3 13 ? 0.182   -28.704 83.345  1.00 143.45 ? 15  GLN C CD  1 
ATOM 828  O OE1 . GLN C 3 13 ? 0.182   -29.869 83.767  1.00 156.45 ? 15  GLN C OE1 1 
ATOM 829  N NE2 . GLN C 3 13 ? 0.573   -27.673 84.090  1.00 144.18 ? 15  GLN C NE2 1 
ATOM 830  N N   . ARG C 3 14 ? 0.221   -31.154 78.248  1.00 113.57 ? 16  ARG C N   1 
ATOM 831  C CA  . ARG C 3 14 ? 0.887   -31.815 77.143  1.00 112.91 ? 16  ARG C CA  1 
ATOM 832  C C   . ARG C 3 14 ? 0.438   -31.161 75.842  1.00 106.70 ? 16  ARG C C   1 
ATOM 833  O O   . ARG C 3 14 ? 1.262   -30.659 75.083  1.00 93.91  ? 16  ARG C O   1 
ATOM 834  C CB  . ARG C 3 14 ? 0.560   -33.293 77.153  1.00 119.78 ? 16  ARG C CB  1 
ATOM 835  C CG  . ARG C 3 14 ? 1.014   -33.984 78.427  1.00 137.09 ? 16  ARG C CG  1 
ATOM 836  C CD  . ARG C 3 14 ? 0.295   -35.299 78.621  1.00 157.37 ? 16  ARG C CD  1 
ATOM 837  N NE  . ARG C 3 14 ? 0.673   -35.947 79.873  1.00 166.48 ? 16  ARG C NE  1 
ATOM 838  C CZ  . ARG C 3 14 ? 0.510   -37.243 80.132  1.00 177.51 ? 16  ARG C CZ  1 
ATOM 839  N NH1 . ARG C 3 14 ? -0.030  -38.062 79.230  1.00 181.05 ? 16  ARG C NH1 1 
ATOM 840  N NH2 . ARG C 3 14 ? 0.892   -37.726 81.307  1.00 183.94 ? 16  ARG C NH2 1 
ATOM 841  N N   . ARG C 3 15 ? -0.875  -31.167 75.605  1.00 106.95 ? 17  ARG C N   1 
ATOM 842  C CA  . ARG C 3 15 ? -1.501  -30.434 74.500  1.00 103.33 ? 17  ARG C CA  1 
ATOM 843  C C   . ARG C 3 15 ? -0.809  -29.109 74.267  1.00 97.63  ? 17  ARG C C   1 
ATOM 844  O O   . ARG C 3 15 ? -0.253  -28.863 73.194  1.00 92.28  ? 17  ARG C O   1 
ATOM 845  C CB  . ARG C 3 15 ? -2.984  -30.177 74.807  1.00 106.34 ? 17  ARG C CB  1 
ATOM 846  C CG  . ARG C 3 15 ? -3.669  -29.015 74.034  1.00 112.87 ? 17  ARG C CG  1 
ATOM 847  C CD  . ARG C 3 15 ? -4.541  -29.488 72.859  1.00 131.61 ? 17  ARG C CD  1 
ATOM 848  N NE  . ARG C 3 15 ? -3.767  -29.697 71.634  1.00 149.89 ? 17  ARG C NE  1 
ATOM 849  C CZ  . ARG C 3 15 ? -4.279  -30.051 70.452  1.00 160.80 ? 17  ARG C CZ  1 
ATOM 850  N NH1 . ARG C 3 15 ? -5.587  -30.248 70.300  1.00 163.55 ? 17  ARG C NH1 1 
ATOM 851  N NH2 . ARG C 3 15 ? -3.470  -30.211 69.405  1.00 167.94 ? 17  ARG C NH2 1 
ATOM 852  N N   . ALA C 3 16 ? -0.853  -28.267 75.295  1.00 95.33  ? 18  ALA C N   1 
ATOM 853  C CA  . ALA C 3 16 ? -0.366  -26.899 75.214  1.00 88.56  ? 18  ALA C CA  1 
ATOM 854  C C   . ALA C 3 16 ? 1.093   -26.866 74.787  1.00 84.16  ? 18  ALA C C   1 
ATOM 855  O O   . ALA C 3 16 ? 1.513   -25.986 74.024  1.00 74.80  ? 18  ALA C O   1 
ATOM 856  C CB  . ALA C 3 16 ? -0.548  -26.208 76.546  1.00 85.95  ? 18  ALA C CB  1 
ATOM 857  N N   . ASP C 3 17 ? 1.858   -27.829 75.277  1.00 84.36  ? 19  ASP C N   1 
ATOM 858  C CA  . ASP C 3 17 ? 3.251   -27.933 74.897  1.00 83.41  ? 19  ASP C CA  1 
ATOM 859  C C   . ASP C 3 17 ? 3.418   -28.186 73.384  1.00 77.11  ? 19  ASP C C   1 
ATOM 860  O O   . ASP C 3 17 ? 4.332   -27.664 72.755  1.00 68.10  ? 19  ASP C O   1 
ATOM 861  C CB  . ASP C 3 17 ? 3.903   -29.037 75.722  1.00 91.92  ? 19  ASP C CB  1 
ATOM 862  C CG  . ASP C 3 17 ? 5.399   -29.086 75.558  1.00 103.95 ? 19  ASP C CG  1 
ATOM 863  O OD1 . ASP C 3 17 ? 5.881   -29.726 74.589  1.00 111.69 ? 19  ASP C OD1 1 
ATOM 864  O OD2 . ASP C 3 17 ? 6.090   -28.480 76.407  1.00 122.31 ? 19  ASP C OD2 1 
ATOM 865  N N   . GLN C 3 18 ? 2.538   -28.979 72.792  1.00 78.07  ? 20  GLN C N   1 
ATOM 866  C CA  . GLN C 3 18 ? 2.640   -29.251 71.358  1.00 80.66  ? 20  GLN C CA  1 
ATOM 867  C C   . GLN C 3 18 ? 2.205   -28.056 70.552  1.00 73.69  ? 20  GLN C C   1 
ATOM 868  O O   . GLN C 3 18 ? 2.835   -27.688 69.569  1.00 64.27  ? 20  GLN C O   1 
ATOM 869  C CB  . GLN C 3 18 ? 1.808   -30.469 70.978  1.00 87.54  ? 20  GLN C CB  1 
ATOM 870  C CG  . GLN C 3 18 ? 2.458   -31.750 71.500  1.00 115.58 ? 20  GLN C CG  1 
ATOM 871  C CD  . GLN C 3 18 ? 1.595   -32.982 71.335  1.00 143.56 ? 20  GLN C CD  1 
ATOM 872  O OE1 . GLN C 3 18 ? 0.522   -32.925 70.728  1.00 163.39 ? 20  GLN C OE1 1 
ATOM 873  N NE2 . GLN C 3 18 ? 2.059   -34.111 71.878  1.00 154.72 ? 20  GLN C NE2 1 
ATOM 874  N N   . LEU C 3 19 ? 1.119   -27.443 70.980  1.00 74.18  ? 21  LEU C N   1 
ATOM 875  C CA  . LEU C 3 19 ? 0.642   -26.257 70.301  1.00 68.67  ? 21  LEU C CA  1 
ATOM 876  C C   . LEU C 3 19 ? 1.699   -25.185 70.278  1.00 61.13  ? 21  LEU C C   1 
ATOM 877  O O   . LEU C 3 19 ? 1.845   -24.512 69.262  1.00 58.92  ? 21  LEU C O   1 
ATOM 878  C CB  . LEU C 3 19 ? -0.620  -25.715 70.959  1.00 69.07  ? 21  LEU C CB  1 
ATOM 879  C CG  . LEU C 3 19 ? -1.898  -26.301 70.361  1.00 77.75  ? 21  LEU C CG  1 
ATOM 880  C CD1 . LEU C 3 19 ? -3.090  -25.741 71.088  1.00 94.11  ? 21  LEU C CD1 1 
ATOM 881  C CD2 . LEU C 3 19 ? -2.029  -26.030 68.850  1.00 80.57  ? 21  LEU C CD2 1 
ATOM 882  N N   . ALA C 3 20 ? 2.425   -25.034 71.388  1.00 56.69  ? 22  ALA C N   1 
ATOM 883  C CA  . ALA C 3 20 ? 3.499   -24.031 71.490  1.00 48.07  ? 22  ALA C CA  1 
ATOM 884  C C   . ALA C 3 20 ? 4.658   -24.338 70.553  1.00 47.19  ? 22  ALA C C   1 
ATOM 885  O O   . ALA C 3 20 ? 5.159   -23.441 69.870  1.00 41.67  ? 22  ALA C O   1 
ATOM 886  C CB  . ALA C 3 20 ? 4.000   -23.925 72.906  1.00 42.15  ? 22  ALA C CB  1 
ATOM 887  N N   . ASP C 3 21 ? 5.081   -25.598 70.516  1.00 52.66  ? 23  ASP C N   1 
ATOM 888  C CA  . ASP C 3 21 ? 6.172   -25.980 69.623  1.00 56.72  ? 23  ASP C CA  1 
ATOM 889  C C   . ASP C 3 21 ? 5.827   -25.686 68.165  1.00 55.21  ? 23  ASP C C   1 
ATOM 890  O O   . ASP C 3 21 ? 6.657   -25.183 67.405  1.00 40.36  ? 23  ASP C O   1 
ATOM 891  C CB  . ASP C 3 21 ? 6.509   -27.466 69.771  1.00 63.29  ? 23  ASP C CB  1 
ATOM 892  C CG  . ASP C 3 21 ? 7.183   -27.804 71.105  1.00 81.12  ? 23  ASP C CG  1 
ATOM 893  O OD1 . ASP C 3 21 ? 7.972   -26.981 71.655  1.00 77.17  ? 23  ASP C OD1 1 
ATOM 894  O OD2 . ASP C 3 21 ? 6.914   -28.922 71.604  1.00 103.04 ? 23  ASP C OD2 1 
ATOM 895  N N   . GLU C 3 22 ? 4.589   -26.009 67.788  1.00 59.53  ? 24  GLU C N   1 
ATOM 896  C CA  . GLU C 3 22 ? 4.122   -25.836 66.415  1.00 60.65  ? 24  GLU C CA  1 
ATOM 897  C C   . GLU C 3 22 ? 4.329   -24.398 66.002  1.00 54.74  ? 24  GLU C C   1 
ATOM 898  O O   . GLU C 3 22 ? 4.775   -24.097 64.876  1.00 45.49  ? 24  GLU C O   1 
ATOM 899  C CB  . GLU C 3 22 ? 2.643   -26.214 66.299  1.00 61.68  ? 24  GLU C CB  1 
ATOM 900  C CG  . GLU C 3 22 ? 2.378   -27.688 66.584  1.00 78.75  ? 24  GLU C CG  1 
ATOM 901  C CD  . GLU C 3 22 ? 1.090   -28.199 65.976  1.00 89.36  ? 24  GLU C CD  1 
ATOM 902  O OE1 . GLU C 3 22 ? 0.083   -27.461 65.981  1.00 92.49  ? 24  GLU C OE1 1 
ATOM 903  O OE2 . GLU C 3 22 ? 1.090   -29.350 65.493  1.00 92.70  ? 24  GLU C OE2 1 
ATOM 904  N N   . SER C 3 23 ? 3.993   -23.530 66.954  1.00 51.63  ? 25  SER C N   1 
ATOM 905  C CA  . SER C 3 23 ? 4.062   -22.107 66.781  1.00 50.15  ? 25  SER C CA  1 
ATOM 906  C C   . SER C 3 23 ? 5.500   -21.731 66.622  1.00 48.94  ? 25  SER C C   1 
ATOM 907  O O   . SER C 3 23 ? 5.850   -20.921 65.760  1.00 48.91  ? 25  SER C O   1 
ATOM 908  C CB  . SER C 3 23 ? 3.467   -21.395 67.995  1.00 54.03  ? 25  SER C CB  1 
ATOM 909  O OG  . SER C 3 23 ? 2.098   -21.765 68.211  1.00 71.74  ? 25  SER C OG  1 
ATOM 910  N N   . LEU C 3 24 ? 6.351   -22.320 67.449  1.00 45.01  ? 26  LEU C N   1 
ATOM 911  C CA  . LEU C 3 24 ? 7.773   -21.988 67.394  1.00 40.80  ? 26  LEU C CA  1 
ATOM 912  C C   . LEU C 3 24 ? 8.340   -22.317 66.038  1.00 32.69  ? 26  LEU C C   1 
ATOM 913  O O   . LEU C 3 24 ? 9.023   -21.507 65.423  1.00 25.85  ? 26  LEU C O   1 
ATOM 914  C CB  . LEU C 3 24 ? 8.546   -22.757 68.456  1.00 40.42  ? 26  LEU C CB  1 
ATOM 915  C CG  . LEU C 3 24 ? 10.046  -22.629 68.280  1.00 39.69  ? 26  LEU C CG  1 
ATOM 916  C CD1 . LEU C 3 24 ? 10.417  -21.176 68.490  1.00 29.03  ? 26  LEU C CD1 1 
ATOM 917  C CD2 . LEU C 3 24 ? 10.769  -23.592 69.223  1.00 51.06  ? 26  LEU C CD2 1 
ATOM 918  N N   . GLU C 3 25 ? 8.042   -23.530 65.593  1.00 30.87  ? 27  GLU C N   1 
ATOM 919  C CA  . GLU C 3 25 ? 8.535   -24.039 64.341  1.00 28.94  ? 27  GLU C CA  1 
ATOM 920  C C   . GLU C 3 25 ? 8.102   -23.088 63.232  1.00 28.01  ? 27  GLU C C   1 
ATOM 921  O O   . GLU C 3 25 ? 8.820   -22.892 62.248  1.00 23.48  ? 27  GLU C O   1 
ATOM 922  C CB  . GLU C 3 25 ? 8.019   -25.466 64.150  1.00 32.62  ? 27  GLU C CB  1 
ATOM 923  C CG  . GLU C 3 25 ? 8.292   -26.104 62.794  1.00 48.80  ? 27  GLU C CG  1 
ATOM 924  C CD  . GLU C 3 25 ? 9.755   -26.083 62.380  1.00 70.74  ? 27  GLU C CD  1 
ATOM 925  O OE1 . GLU C 3 25 ? 10.007  -25.825 61.178  1.00 83.70  ? 27  GLU C OE1 1 
ATOM 926  O OE2 . GLU C 3 25 ? 10.643  -26.326 63.240  1.00 74.05  ? 27  GLU C OE2 1 
ATOM 927  N N   . SER C 3 26 ? 6.924   -22.492 63.398  1.00 32.34  ? 28  SER C N   1 
ATOM 928  C CA  . SER C 3 26 ? 6.454   -21.501 62.448  1.00 31.63  ? 28  SER C CA  1 
ATOM 929  C C   . SER C 3 26 ? 7.357   -20.265 62.410  1.00 32.70  ? 28  SER C C   1 
ATOM 930  O O   . SER C 3 26 ? 7.760   -19.816 61.346  1.00 31.84  ? 28  SER C O   1 
ATOM 931  C CB  . SER C 3 26 ? 5.044   -21.079 62.776  1.00 29.36  ? 28  SER C CB  1 
ATOM 932  O OG  . SER C 3 26 ? 4.617   -20.148 61.813  1.00 39.96  ? 28  SER C OG  1 
ATOM 933  N N   . THR C 3 27 ? 7.674   -19.709 63.567  1.00 34.83  ? 29  THR C N   1 
ATOM 934  C CA  . THR C 3 27 ? 8.624   -18.609 63.615  1.00 30.53  ? 29  THR C CA  1 
ATOM 935  C C   . THR C 3 27 ? 9.845   -18.976 62.791  1.00 30.25  ? 29  THR C C   1 
ATOM 936  O O   . THR C 3 27 ? 10.244  -18.199 61.939  1.00 35.11  ? 29  THR C O   1 
ATOM 937  C CB  . THR C 3 27 ? 9.096   -18.336 65.019  1.00 28.83  ? 29  THR C CB  1 
ATOM 938  O OG1 . THR C 3 27 ? 9.469   -19.577 65.627  1.00 58.26  ? 29  THR C OG1 1 
ATOM 939  C CG2 . THR C 3 27 ? 8.038   -17.749 65.837  1.00 15.70  ? 29  THR C CG2 1 
ATOM 940  N N   . ARG C 3 28 ? 10.432  -20.158 63.038  1.00 27.85  ? 30  ARG C N   1 
ATOM 941  C CA  . ARG C 3 28 ? 11.595  -20.625 62.244  1.00 33.21  ? 30  ARG C CA  1 
ATOM 942  C C   . ARG C 3 28 ? 11.337  -20.501 60.750  1.00 37.88  ? 30  ARG C C   1 
ATOM 943  O O   . ARG C 3 28 ? 12.181  -20.002 59.972  1.00 30.17  ? 30  ARG C O   1 
ATOM 944  C CB  . ARG C 3 28 ? 11.957  -22.086 62.528  1.00 32.00  ? 30  ARG C CB  1 
ATOM 945  C CG  . ARG C 3 28 ? 12.258  -22.397 63.982  1.00 56.88  ? 30  ARG C CG  1 
ATOM 946  C CD  . ARG C 3 28 ? 12.986  -23.739 64.148  1.00 78.35  ? 30  ARG C CD  1 
ATOM 947  N NE  . ARG C 3 28 ? 13.092  -24.128 65.563  1.00 97.30  ? 30  ARG C NE  1 
ATOM 948  C CZ  . ARG C 3 28 ? 12.318  -25.021 66.193  1.00 109.29 ? 30  ARG C CZ  1 
ATOM 949  N NH1 . ARG C 3 28 ? 11.338  -25.670 65.560  1.00 105.31 ? 30  ARG C NH1 1 
ATOM 950  N NH2 . ARG C 3 28 ? 12.531  -25.272 67.484  1.00 116.20 ? 30  ARG C NH2 1 
ATOM 951  N N   . ARG C 3 29 ? 10.138  -20.972 60.390  1.00 39.97  ? 31  ARG C N   1 
ATOM 952  C CA  . ARG C 3 29 ? 9.654   -21.080 59.020  1.00 38.92  ? 31  ARG C CA  1 
ATOM 953  C C   . ARG C 3 29 ? 9.409   -19.707 58.415  1.00 34.72  ? 31  ARG C C   1 
ATOM 954  O O   . ARG C 3 29 ? 9.746   -19.440 57.248  1.00 35.72  ? 31  ARG C O   1 
ATOM 955  C CB  . ARG C 3 29 ? 8.376   -21.902 59.035  1.00 35.88  ? 31  ARG C CB  1 
ATOM 956  C CG  . ARG C 3 29 ? 8.021   -22.553 57.735  1.00 46.31  ? 31  ARG C CG  1 
ATOM 957  C CD  . ARG C 3 29 ? 6.497   -22.823 57.641  1.00 64.78  ? 31  ARG C CD  1 
ATOM 958  N NE  . ARG C 3 29 ? 5.827   -23.072 58.929  1.00 46.05  ? 31  ARG C NE  1 
ATOM 959  C CZ  . ARG C 3 29 ? 6.001   -24.156 59.671  1.00 39.19  ? 31  ARG C CZ  1 
ATOM 960  N NH1 . ARG C 3 29 ? 6.836   -25.115 59.274  1.00 47.11  ? 31  ARG C NH1 1 
ATOM 961  N NH2 . ARG C 3 29 ? 5.342   -24.276 60.823  1.00 44.50  ? 31  ARG C NH2 1 
ATOM 962  N N   . MET C 3 30 ? 8.824   -18.833 59.225  1.00 38.39  ? 32  MET C N   1 
ATOM 963  C CA  . MET C 3 30 ? 8.666   -17.440 58.842  1.00 49.09  ? 32  MET C CA  1 
ATOM 964  C C   . MET C 3 30 ? 10.019  -16.899 58.459  1.00 50.09  ? 32  MET C C   1 
ATOM 965  O O   . MET C 3 30 ? 10.147  -16.121 57.494  1.00 51.66  ? 32  MET C O   1 
ATOM 966  C CB  . MET C 3 30 ? 8.093   -16.588 59.976  1.00 50.37  ? 32  MET C CB  1 
ATOM 967  C CG  . MET C 3 30 ? 6.610   -16.750 60.174  1.00 55.81  ? 32  MET C CG  1 
ATOM 968  S SD  . MET C 3 30 ? 6.017   -15.849 61.612  1.00 47.49  ? 32  MET C SD  1 
ATOM 969  C CE  . MET C 3 30 ? 4.348   -16.489 61.633  1.00 70.95  ? 32  MET C CE  1 
ATOM 970  N N   . LEU C 3 31 ? 11.036  -17.316 59.211  1.00 42.63  ? 33  LEU C N   1 
ATOM 971  C CA  . LEU C 3 31 ? 12.335  -16.695 59.083  1.00 42.78  ? 33  LEU C CA  1 
ATOM 972  C C   . LEU C 3 31 ? 13.008  -16.997 57.746  1.00 44.38  ? 33  LEU C C   1 
ATOM 973  O O   . LEU C 3 31 ? 13.556  -16.085 57.127  1.00 38.76  ? 33  LEU C O   1 
ATOM 974  C CB  . LEU C 3 31 ? 13.230  -17.110 60.229  1.00 41.59  ? 33  LEU C CB  1 
ATOM 975  C CG  . LEU C 3 31 ? 14.278  -16.025 60.430  1.00 47.33  ? 33  LEU C CG  1 
ATOM 976  C CD1 . LEU C 3 31 ? 14.505  -15.832 61.919  1.00 54.44  ? 33  LEU C CD1 1 
ATOM 977  C CD2 . LEU C 3 31 ? 15.586  -16.349 59.650  1.00 74.20  ? 33  LEU C CD2 1 
ATOM 978  N N   . GLN C 3 32 ? 12.962  -18.257 57.304  1.00 45.67  ? 34  GLN C N   1 
ATOM 979  C CA  . GLN C 3 32 ? 13.616  -18.625 56.045  1.00 53.39  ? 34  GLN C CA  1 
ATOM 980  C C   . GLN C 3 32 ? 12.933  -17.832 54.984  1.00 50.10  ? 34  GLN C C   1 
ATOM 981  O O   . GLN C 3 32 ? 13.580  -17.265 54.097  1.00 50.33  ? 34  GLN C O   1 
ATOM 982  C CB  . GLN C 3 32 ? 13.511  -20.121 55.708  1.00 58.00  ? 34  GLN C CB  1 
ATOM 983  C CG  . GLN C 3 32 ? 13.861  -21.090 56.855  1.00 88.62  ? 34  GLN C CG  1 
ATOM 984  C CD  . GLN C 3 32 ? 15.140  -20.720 57.632  1.00 114.35 ? 34  GLN C CD  1 
ATOM 985  O OE1 . GLN C 3 32 ? 15.154  -19.775 58.436  1.00 121.04 ? 34  GLN C OE1 1 
ATOM 986  N NE2 . GLN C 3 32 ? 16.215  -21.478 57.395  1.00 124.11 ? 34  GLN C NE2 1 
ATOM 987  N N   . LEU C 3 33 ? 11.606  -17.793 55.095  1.00 44.83  ? 35  LEU C N   1 
ATOM 988  C CA  . LEU C 3 33 ? 10.772  -17.092 54.126  1.00 42.54  ? 35  LEU C CA  1 
ATOM 989  C C   . LEU C 3 33 ? 11.255  -15.684 53.887  1.00 36.22  ? 35  LEU C C   1 
ATOM 990  O O   . LEU C 3 33 ? 11.465  -15.262 52.742  1.00 25.07  ? 35  LEU C O   1 
ATOM 991  C CB  . LEU C 3 33 ? 9.325   -17.035 54.610  1.00 42.61  ? 35  LEU C CB  1 
ATOM 992  C CG  . LEU C 3 33 ? 8.402   -18.073 54.020  1.00 32.86  ? 35  LEU C CG  1 
ATOM 993  C CD1 . LEU C 3 33 ? 7.035   -17.828 54.561  1.00 22.93  ? 35  LEU C CD1 1 
ATOM 994  C CD2 . LEU C 3 33 ? 8.429   -17.957 52.509  1.00 25.49  ? 35  LEU C CD2 1 
ATOM 995  N N   . VAL C 3 34 ? 11.422  -14.978 54.998  1.00 38.36  ? 36  VAL C N   1 
ATOM 996  C CA  . VAL C 3 34 ? 11.771  -13.571 54.970  1.00 40.21  ? 36  VAL C CA  1 
ATOM 997  C C   . VAL C 3 34 ? 13.195  -13.366 54.443  1.00 47.93  ? 36  VAL C C   1 
ATOM 998  O O   . VAL C 3 34 ? 13.474  -12.395 53.721  1.00 49.76  ? 36  VAL C O   1 
ATOM 999  C CB  . VAL C 3 34 ? 11.644  -12.972 56.367  1.00 35.32  ? 36  VAL C CB  1 
ATOM 1000 C CG1 . VAL C 3 34 ? 12.257  -11.624 56.403  1.00 45.41  ? 36  VAL C CG1 1 
ATOM 1001 C CG2 . VAL C 3 34 ? 10.207  -12.858 56.744  1.00 22.83  ? 36  VAL C CG2 1 
ATOM 1002 N N   . GLU C 3 35 ? 14.089  -14.281 54.806  1.00 47.36  ? 37  GLU C N   1 
ATOM 1003 C CA  . GLU C 3 35 ? 15.442  -14.241 54.310  1.00 49.60  ? 37  GLU C CA  1 
ATOM 1004 C C   . GLU C 3 35 ? 15.388  -14.283 52.814  1.00 45.22  ? 37  GLU C C   1 
ATOM 1005 O O   . GLU C 3 35 ? 15.892  -13.383 52.155  1.00 44.34  ? 37  GLU C O   1 
ATOM 1006 C CB  . GLU C 3 35 ? 16.264  -15.423 54.825  1.00 58.68  ? 37  GLU C CB  1 
ATOM 1007 C CG  . GLU C 3 35 ? 16.617  -15.365 56.310  1.00 72.01  ? 37  GLU C CG  1 
ATOM 1008 C CD  . GLU C 3 35 ? 17.593  -14.253 56.649  1.00 86.38  ? 37  GLU C CD  1 
ATOM 1009 O OE1 . GLU C 3 35 ? 18.075  -13.543 55.727  1.00 96.95  ? 37  GLU C OE1 1 
ATOM 1010 O OE2 . GLU C 3 35 ? 17.876  -14.095 57.857  1.00 95.26  ? 37  GLU C OE2 1 
ATOM 1011 N N   . GLU C 3 36 ? 14.767  -15.330 52.285  1.00 45.06  ? 38  GLU C N   1 
ATOM 1012 C CA  . GLU C 3 36 ? 14.707  -15.541 50.839  1.00 52.16  ? 38  GLU C CA  1 
ATOM 1013 C C   . GLU C 3 36 ? 14.086  -14.342 50.117  1.00 44.94  ? 38  GLU C C   1 
ATOM 1014 O O   . GLU C 3 36 ? 14.542  -13.933 49.047  1.00 41.30  ? 38  GLU C O   1 
ATOM 1015 C CB  . GLU C 3 36 ? 13.929  -16.829 50.533  1.00 62.55  ? 38  GLU C CB  1 
ATOM 1016 C CG  . GLU C 3 36 ? 13.868  -17.227 49.036  1.00 79.63  ? 38  GLU C CG  1 
ATOM 1017 C CD  . GLU C 3 36 ? 13.295  -18.638 48.797  1.00 92.54  ? 38  GLU C CD  1 
ATOM 1018 O OE1 . GLU C 3 36 ? 13.187  -19.024 47.605  1.00 95.47  ? 38  GLU C OE1 1 
ATOM 1019 O OE2 . GLU C 3 36 ? 12.959  -19.350 49.785  1.00 81.14  ? 38  GLU C OE2 1 
ATOM 1020 N N   . SER C 3 37 ? 13.046  -13.788 50.723  1.00 39.79  ? 39  SER C N   1 
ATOM 1021 C CA  . SER C 3 37 ? 12.372  -12.620 50.192  1.00 42.63  ? 39  SER C CA  1 
ATOM 1022 C C   . SER C 3 37 ? 13.320  -11.454 50.047  1.00 44.65  ? 39  SER C C   1 
ATOM 1023 O O   . SER C 3 37 ? 13.258  -10.740 49.058  1.00 48.01  ? 39  SER C O   1 
ATOM 1024 C CB  . SER C 3 37 ? 11.234  -12.233 51.112  1.00 43.61  ? 39  SER C CB  1 
ATOM 1025 O OG  . SER C 3 37 ? 10.519  -13.392 51.514  1.00 56.88  ? 39  SER C OG  1 
ATOM 1026 N N   . LYS C 3 38 ? 14.194  -11.263 51.033  1.00 49.35  ? 40  LYS C N   1 
ATOM 1027 C CA  . LYS C 3 38 ? 15.192  -10.203 50.968  1.00 49.42  ? 40  LYS C CA  1 
ATOM 1028 C C   . LYS C 3 38 ? 16.178  -10.476 49.855  1.00 50.29  ? 40  LYS C C   1 
ATOM 1029 O O   . LYS C 3 38 ? 16.399  -9.637  48.992  1.00 54.99  ? 40  LYS C O   1 
ATOM 1030 C CB  . LYS C 3 38 ? 15.956  -10.071 52.272  1.00 46.49  ? 40  LYS C CB  1 
ATOM 1031 C CG  . LYS C 3 38 ? 16.905  -8.880  52.294  1.00 50.13  ? 40  LYS C CG  1 
ATOM 1032 C CD  . LYS C 3 38 ? 17.650  -8.796  53.645  1.00 79.82  ? 40  LYS C CD  1 
ATOM 1033 C CE  . LYS C 3 38 ? 17.869  -7.338  54.129  1.00 88.25  ? 40  LYS C CE  1 
ATOM 1034 N NZ  . LYS C 3 38 ? 18.275  -7.251  55.573  1.00 78.80  ? 40  LYS C NZ  1 
ATOM 1035 N N   . ASP C 3 39 ? 16.776  -11.650 49.868  1.00 47.09  ? 41  ASP C N   1 
ATOM 1036 C CA  . ASP C 3 39 ? 17.748  -11.952 48.854  1.00 56.25  ? 41  ASP C CA  1 
ATOM 1037 C C   . ASP C 3 39 ? 17.088  -11.599 47.537  1.00 52.92  ? 41  ASP C C   1 
ATOM 1038 O O   . ASP C 3 39 ? 17.635  -10.841 46.720  1.00 45.75  ? 41  ASP C O   1 
ATOM 1039 C CB  . ASP C 3 39 ? 18.157  -13.422 48.915  1.00 64.62  ? 41  ASP C CB  1 
ATOM 1040 C CG  . ASP C 3 39 ? 18.668  -13.840 50.307  1.00 82.51  ? 41  ASP C CG  1 
ATOM 1041 O OD1 . ASP C 3 39 ? 19.058  -12.950 51.104  1.00 108.20 ? 41  ASP C OD1 1 
ATOM 1042 O OD2 . ASP C 3 39 ? 18.677  -15.061 50.602  1.00 87.98  ? 41  ASP C OD2 1 
ATOM 1043 N N   . ALA C 3 40 ? 15.892  -12.150 47.356  1.00 52.45  ? 42  ALA C N   1 
ATOM 1044 C CA  . ALA C 3 40 ? 15.087  -11.900 46.168  1.00 56.38  ? 42  ALA C CA  1 
ATOM 1045 C C   . ALA C 3 40 ? 14.954  -10.409 45.891  1.00 55.61  ? 42  ALA C C   1 
ATOM 1046 O O   . ALA C 3 40 ? 15.123  -9.963  44.760  1.00 53.90  ? 42  ALA C O   1 
ATOM 1047 C CB  . ALA C 3 40 ? 13.710  -12.524 46.322  1.00 55.42  ? 42  ALA C CB  1 
ATOM 1048 N N   . GLY C 3 41 ? 14.650  -9.642  46.932  1.00 57.25  ? 43  GLY C N   1 
ATOM 1049 C CA  . GLY C 3 41 ? 14.536  -8.187  46.807  1.00 59.15  ? 43  GLY C CA  1 
ATOM 1050 C C   . GLY C 3 41 ? 15.807  -7.557  46.267  1.00 61.22  ? 43  GLY C C   1 
ATOM 1051 O O   . GLY C 3 41 ? 15.781  -6.742  45.340  1.00 61.33  ? 43  GLY C O   1 
ATOM 1052 N N   . ILE C 3 42 ? 16.935  -7.944  46.842  1.00 59.04  ? 44  ILE C N   1 
ATOM 1053 C CA  . ILE C 3 42 ? 18.192  -7.354  46.447  1.00 55.46  ? 44  ILE C CA  1 
ATOM 1054 C C   . ILE C 3 42 ? 18.445  -7.675  44.988  1.00 50.76  ? 44  ILE C C   1 
ATOM 1055 O O   . ILE C 3 42 ? 18.604  -6.783  44.164  1.00 46.34  ? 44  ILE C O   1 
ATOM 1056 C CB  . ILE C 3 42 ? 19.335  -7.906  47.266  1.00 57.38  ? 44  ILE C CB  1 
ATOM 1057 C CG1 . ILE C 3 42 ? 19.171  -7.540  48.743  1.00 58.54  ? 44  ILE C CG1 1 
ATOM 1058 C CG2 . ILE C 3 42 ? 20.652  -7.370  46.721  1.00 71.98  ? 44  ILE C CG2 1 
ATOM 1059 C CD1 . ILE C 3 42 ? 19.952  -8.462  49.681  1.00 75.20  ? 44  ILE C CD1 1 
ATOM 1060 N N   . ARG C 3 43 ? 18.473  -8.964  44.673  1.00 49.03  ? 45  ARG C N   1 
ATOM 1061 C CA  . ARG C 3 43 ? 18.735  -9.386  43.309  1.00 52.67  ? 45  ARG C CA  1 
ATOM 1062 C C   . ARG C 3 43 ? 17.797  -8.640  42.357  1.00 55.34  ? 45  ARG C C   1 
ATOM 1063 O O   . ARG C 3 43 ? 18.225  -8.173  41.299  1.00 53.36  ? 45  ARG C O   1 
ATOM 1064 C CB  . ARG C 3 43 ? 18.587  -10.909 43.182  1.00 50.54  ? 45  ARG C CB  1 
ATOM 1065 C CG  . ARG C 3 43 ? 19.901  -11.563 43.672  0.00 94.92  ? 45  ARG C CG  1 
ATOM 1066 C CD  . ARG C 3 43 ? 19.874  -13.082 43.368  0.00 113.80 ? 45  ARG C CD  1 
ATOM 1067 N NE  . ARG C 3 43 ? 20.923  -13.852 44.072  0.00 119.92 ? 45  ARG C NE  1 
ATOM 1068 C CZ  . ARG C 3 43 ? 21.049  -15.187 44.073  0.00 118.61 ? 45  ARG C CZ  1 
ATOM 1069 N NH1 . ARG C 3 43 ? 20.195  -15.966 43.404  0.00 110.79 ? 45  ARG C NH1 1 
ATOM 1070 N NH2 . ARG C 3 43 ? 22.047  -15.754 44.754  0.00 122.07 ? 45  ARG C NH2 1 
ATOM 1071 N N   . THR C 3 44 ? 16.525  -8.531  42.757  1.00 58.23  ? 46  THR C N   1 
ATOM 1072 C CA  . THR C 3 44 ? 15.503  -7.884  41.962  1.00 59.59  ? 46  THR C CA  1 
ATOM 1073 C C   . THR C 3 44 ? 15.982  -6.504  41.619  1.00 60.84  ? 46  THR C C   1 
ATOM 1074 O O   . THR C 3 44 ? 15.853  -6.054  40.480  1.00 65.70  ? 46  THR C O   1 
ATOM 1075 C CB  . THR C 3 44 ? 14.165  -7.748  42.726  1.00 62.15  ? 46  THR C CB  1 
ATOM 1076 O OG1 . THR C 3 44 ? 13.622  -9.041  43.023  1.00 71.00  ? 46  THR C OG1 1 
ATOM 1077 C CG2 . THR C 3 44 ? 13.151  -6.973  41.906  1.00 62.82  ? 46  THR C CG2 1 
ATOM 1078 N N   . LEU C 3 45 ? 16.543  -5.839  42.620  1.00 60.04  ? 47  LEU C N   1 
ATOM 1079 C CA  . LEU C 3 45 ? 16.998  -4.463  42.464  1.00 64.61  ? 47  LEU C CA  1 
ATOM 1080 C C   . LEU C 3 45 ? 18.256  -4.347  41.630  1.00 65.07  ? 47  LEU C C   1 
ATOM 1081 O O   . LEU C 3 45 ? 18.337  -3.500  40.756  1.00 73.97  ? 47  LEU C O   1 
ATOM 1082 C CB  . LEU C 3 45 ? 17.270  -3.840  43.818  1.00 67.96  ? 47  LEU C CB  1 
ATOM 1083 C CG  . LEU C 3 45 ? 16.000  -3.587  44.615  1.00 73.38  ? 47  LEU C CG  1 
ATOM 1084 C CD1 . LEU C 3 45 ? 16.287  -3.736  46.123  1.00 77.49  ? 47  LEU C CD1 1 
ATOM 1085 C CD2 . LEU C 3 45 ? 15.390  -2.213  44.244  1.00 49.09  ? 47  LEU C CD2 1 
ATOM 1086 N N   . VAL C 3 46 ? 19.243  -5.185  41.893  1.00 59.97  ? 48  VAL C N   1 
ATOM 1087 C CA  . VAL C 3 46 ? 20.432  -5.171  41.074  1.00 61.82  ? 48  VAL C CA  1 
ATOM 1088 C C   . VAL C 3 46 ? 19.957  -5.144  39.648  1.00 57.93  ? 48  VAL C C   1 
ATOM 1089 O O   . VAL C 3 46 ? 20.309  -4.272  38.868  1.00 59.22  ? 48  VAL C O   1 
ATOM 1090 C CB  . VAL C 3 46 ? 21.298  -6.411  41.299  1.00 65.15  ? 48  VAL C CB  1 
ATOM 1091 C CG1 . VAL C 3 46 ? 22.358  -6.509  40.227  1.00 57.57  ? 48  VAL C CG1 1 
ATOM 1092 C CG2 . VAL C 3 46 ? 21.932  -6.380  42.697  1.00 65.79  ? 48  VAL C CG2 1 
ATOM 1093 N N   . MET C 3 47 ? 19.130  -6.111  39.319  1.00 59.86  ? 49  MET C N   1 
ATOM 1094 C CA  . MET C 3 47 ? 18.626  -6.221  37.976  1.00 70.85  ? 49  MET C CA  1 
ATOM 1095 C C   . MET C 3 47 ? 18.014  -4.911  37.496  1.00 71.20  ? 49  MET C C   1 
ATOM 1096 O O   . MET C 3 47 ? 18.402  -4.385  36.458  1.00 76.60  ? 49  MET C O   1 
ATOM 1097 C CB  . MET C 3 47 ? 17.605  -7.360  37.890  1.00 73.55  ? 49  MET C CB  1 
ATOM 1098 C CG  . MET C 3 47 ? 18.256  -8.718  37.959  1.00 76.76  ? 49  MET C CG  1 
ATOM 1099 S SD  . MET C 3 47 ? 17.141  -10.011 37.457  1.00 81.72  ? 49  MET C SD  1 
ATOM 1100 C CE  . MET C 3 47 ? 18.276  -11.410 37.550  1.00 74.73  ? 49  MET C CE  1 
ATOM 1101 N N   . LEU C 3 48 ? 17.062  -4.378  38.244  1.00 72.32  ? 50  LEU C N   1 
ATOM 1102 C CA  . LEU C 3 48 ? 16.352  -3.182  37.777  1.00 77.83  ? 50  LEU C CA  1 
ATOM 1103 C C   . LEU C 3 48 ? 17.287  -2.008  37.538  1.00 82.06  ? 50  LEU C C   1 
ATOM 1104 O O   . LEU C 3 48 ? 17.023  -1.185  36.655  1.00 86.17  ? 50  LEU C O   1 
ATOM 1105 C CB  . LEU C 3 48 ? 15.254  -2.781  38.763  1.00 77.95  ? 50  LEU C CB  1 
ATOM 1106 C CG  . LEU C 3 48 ? 13.899  -3.351  38.335  1.00 84.38  ? 50  LEU C CG  1 
ATOM 1107 C CD1 . LEU C 3 48 ? 13.000  -3.601  39.519  1.00 91.84  ? 50  LEU C CD1 1 
ATOM 1108 C CD2 . LEU C 3 48 ? 13.232  -2.408  37.331  1.00 86.83  ? 50  LEU C CD2 1 
ATOM 1109 N N   . ASP C 3 49 ? 18.365  -1.958  38.327  1.00 82.26  ? 51  ASP C N   1 
ATOM 1110 C CA  . ASP C 3 49 ? 19.351  -0.881  38.303  1.00 80.84  ? 51  ASP C CA  1 
ATOM 1111 C C   . ASP C 3 49 ? 20.202  -0.941  37.028  1.00 79.36  ? 51  ASP C C   1 
ATOM 1112 O O   . ASP C 3 49 ? 20.284  0.034   36.280  1.00 82.08  ? 51  ASP C O   1 
ATOM 1113 C CB  . ASP C 3 49 ? 20.231  -0.962  39.553  1.00 83.59  ? 51  ASP C CB  1 
ATOM 1114 C CG  . ASP C 3 49 ? 20.513  0.392   40.158  1.00 94.61  ? 51  ASP C CG  1 
ATOM 1115 O OD1 . ASP C 3 49 ? 20.335  0.532   41.388  1.00 109.59 ? 51  ASP C OD1 1 
ATOM 1116 O OD2 . ASP C 3 49 ? 20.912  1.314   39.414  1.00 110.51 ? 51  ASP C OD2 1 
ATOM 1117 N N   . GLU C 3 50 ? 20.832  -2.080  36.767  1.00 74.97  ? 52  GLU C N   1 
ATOM 1118 C CA  . GLU C 3 50 ? 21.579  -2.227  35.517  1.00 81.08  ? 52  GLU C CA  1 
ATOM 1119 C C   . GLU C 3 50 ? 20.652  -2.141  34.299  1.00 80.42  ? 52  GLU C C   1 
ATOM 1120 O O   . GLU C 3 50 ? 21.027  -1.618  33.260  1.00 85.40  ? 52  GLU C O   1 
ATOM 1121 C CB  . GLU C 3 50 ? 22.388  -3.522  35.503  1.00 83.62  ? 52  GLU C CB  1 
ATOM 1122 C CG  . GLU C 3 50 ? 21.583  -4.792  35.409  1.00 89.99  ? 52  GLU C CG  1 
ATOM 1123 C CD  . GLU C 3 50 ? 22.375  -6.004  35.879  1.00 104.83 ? 52  GLU C CD  1 
ATOM 1124 O OE1 . GLU C 3 50 ? 21.737  -7.005  36.272  1.00 112.65 ? 52  GLU C OE1 1 
ATOM 1125 O OE2 . GLU C 3 50 ? 23.629  -5.957  35.859  1.00 107.11 ? 52  GLU C OE2 1 
ATOM 1126 N N   . GLN C 3 51 ? 19.439  -2.658  34.430  1.00 84.13  ? 53  GLN C N   1 
ATOM 1127 C CA  . GLN C 3 51 ? 18.425  -2.472  33.391  1.00 88.39  ? 53  GLN C CA  1 
ATOM 1128 C C   . GLN C 3 51 ? 18.170  -0.983  33.134  1.00 91.03  ? 53  GLN C C   1 
ATOM 1129 O O   . GLN C 3 51 ? 17.894  -0.587  32.001  1.00 93.31  ? 53  GLN C O   1 
ATOM 1130 C CB  . GLN C 3 51 ? 17.120  -3.201  33.748  1.00 85.85  ? 53  GLN C CB  1 
ATOM 1131 C CG  . GLN C 3 51 ? 17.200  -4.703  33.472  1.00 84.98  ? 53  GLN C CG  1 
ATOM 1132 C CD  . GLN C 3 51 ? 15.861  -5.404  33.554  1.00 81.45  ? 53  GLN C CD  1 
ATOM 1133 O OE1 . GLN C 3 51 ? 14.850  -4.903  33.061  1.00 71.22  ? 53  GLN C OE1 1 
ATOM 1134 N NE2 . GLN C 3 51 ? 15.849  -6.576  34.176  1.00 69.32  ? 53  GLN C NE2 1 
ATOM 1135 N N   . GLY C 3 52 ? 18.265  -0.167  34.182  1.00 92.12  ? 54  GLY C N   1 
ATOM 1136 C CA  . GLY C 3 52 ? 18.163  1.282   34.041  1.00 93.97  ? 54  GLY C CA  1 
ATOM 1137 C C   . GLY C 3 52 ? 19.236  1.831   33.127  1.00 95.92  ? 54  GLY C C   1 
ATOM 1138 O O   . GLY C 3 52 ? 18.948  2.627   32.226  1.00 98.01  ? 54  GLY C O   1 
ATOM 1139 N N   . GLU C 3 53 ? 20.472  1.404   33.354  1.00 91.96  ? 55  GLU C N   1 
ATOM 1140 C CA  . GLU C 3 53 ? 21.573  1.810   32.500  1.00 100.10 ? 55  GLU C CA  1 
ATOM 1141 C C   . GLU C 3 53 ? 21.211  1.485   31.064  1.00 96.25  ? 55  GLU C C   1 
ATOM 1142 O O   . GLU C 3 53 ? 21.056  2.374   30.235  1.00 97.78  ? 55  GLU C O   1 
ATOM 1143 C CB  . GLU C 3 53 ? 22.890  1.111   32.888  1.00 105.81 ? 55  GLU C CB  1 
ATOM 1144 C CG  . GLU C 3 53 ? 23.293  1.251   34.352  1.00 115.66 ? 55  GLU C CG  1 
ATOM 1145 C CD  . GLU C 3 53 ? 23.152  2.669   34.863  1.00 132.26 ? 55  GLU C CD  1 
ATOM 1146 O OE1 . GLU C 3 53 ? 23.568  3.608   34.146  1.00 139.06 ? 55  GLU C OE1 1 
ATOM 1147 O OE2 . GLU C 3 53 ? 22.623  2.843   35.983  1.00 145.82 ? 55  GLU C OE2 1 
ATOM 1148 N N   . GLN C 3 54 ? 21.065  0.200   30.784  1.00 92.91  ? 56  GLN C N   1 
ATOM 1149 C CA  . GLN C 3 54 ? 20.789  -0.257  29.439  1.00 96.18  ? 56  GLN C CA  1 
ATOM 1150 C C   . GLN C 3 54 ? 19.752  0.638   28.771  1.00 94.12  ? 56  GLN C C   1 
ATOM 1151 O O   . GLN C 3 54 ? 19.974  1.143   27.683  1.00 95.20  ? 56  GLN C O   1 
ATOM 1152 C CB  . GLN C 3 54 ? 20.320  -1.716  29.464  1.00 98.77  ? 56  GLN C CB  1 
ATOM 1153 C CG  . GLN C 3 54 ? 21.411  -2.701  29.926  1.00 106.89 ? 56  GLN C CG  1 
ATOM 1154 C CD  . GLN C 3 54 ? 21.034  -4.176  29.762  1.00 113.84 ? 56  GLN C CD  1 
ATOM 1155 O OE1 . GLN C 3 54 ? 20.170  -4.542  28.955  1.00 112.16 ? 56  GLN C OE1 1 
ATOM 1156 N NE2 . GLN C 3 54 ? 21.696  -5.033  30.536  1.00 111.01 ? 56  GLN C NE2 1 
ATOM 1157 N N   . LEU C 3 55 ? 18.622  0.838   29.432  1.00 96.57  ? 57  LEU C N   1 
ATOM 1158 C CA  . LEU C 3 55 ? 17.544  1.643   28.863  1.00 100.02 ? 57  LEU C CA  1 
ATOM 1159 C C   . LEU C 3 55 ? 17.976  3.048   28.528  1.00 99.54  ? 57  LEU C C   1 
ATOM 1160 O O   . LEU C 3 55 ? 17.528  3.608   27.539  1.00 103.50 ? 57  LEU C O   1 
ATOM 1161 C CB  . LEU C 3 55 ? 16.371  1.753   29.832  1.00 103.42 ? 57  LEU C CB  1 
ATOM 1162 C CG  . LEU C 3 55 ? 15.494  0.522   30.014  1.00 107.83 ? 57  LEU C CG  1 
ATOM 1163 C CD1 . LEU C 3 55 ? 14.553  0.747   31.192  1.00 115.01 ? 57  LEU C CD1 1 
ATOM 1164 C CD2 . LEU C 3 55 ? 14.726  0.222   28.745  1.00 95.92  ? 57  LEU C CD2 1 
ATOM 1165 N N   . ASP C 3 56 ? 18.835  3.626   29.354  1.00 99.38  ? 58  ASP C N   1 
ATOM 1166 C CA  . ASP C 3 56 ? 19.309  4.971   29.084  1.00 103.44 ? 58  ASP C CA  1 
ATOM 1167 C C   . ASP C 3 56 ? 20.126  4.937   27.797  1.00 103.90 ? 58  ASP C C   1 
ATOM 1168 O O   . ASP C 3 56 ? 20.069  5.850   26.987  1.00 107.53 ? 58  ASP C O   1 
ATOM 1169 C CB  . ASP C 3 56 ? 20.115  5.517   30.265  1.00 106.10 ? 58  ASP C CB  1 
ATOM 1170 C CG  . ASP C 3 56 ? 19.312  5.540   31.562  1.00 112.34 ? 58  ASP C CG  1 
ATOM 1171 O OD1 . ASP C 3 56 ? 18.127  5.925   31.532  1.00 112.55 ? 58  ASP C OD1 1 
ATOM 1172 O OD2 . ASP C 3 56 ? 19.866  5.170   32.620  1.00 129.56 ? 58  ASP C OD2 1 
ATOM 1173 N N   . ARG C 3 57 ? 20.880  3.866   27.610  1.00 104.29 ? 59  ARG C N   1 
ATOM 1174 C CA  . ARG C 3 57 ? 21.676  3.711   26.409  1.00 106.86 ? 59  ARG C CA  1 
ATOM 1175 C C   . ARG C 3 57 ? 20.740  3.542   25.224  1.00 101.65 ? 59  ARG C C   1 
ATOM 1176 O O   . ARG C 3 57 ? 20.977  4.092   24.160  1.00 108.82 ? 59  ARG C O   1 
ATOM 1177 C CB  . ARG C 3 57 ? 22.643  2.523   26.541  1.00 110.73 ? 59  ARG C CB  1 
ATOM 1178 C CG  . ARG C 3 57 ? 23.392  2.487   27.887  1.00 114.30 ? 59  ARG C CG  1 
ATOM 1179 C CD  . ARG C 3 57 ? 24.768  1.842   27.796  1.00 124.31 ? 59  ARG C CD  1 
ATOM 1180 N NE  . ARG C 3 57 ? 24.719  0.392   27.589  1.00 129.88 ? 59  ARG C NE  1 
ATOM 1181 C CZ  . ARG C 3 57 ? 24.482  -0.521  28.535  1.00 126.21 ? 59  ARG C CZ  1 
ATOM 1182 N NH1 . ARG C 3 57 ? 24.253  -0.169  29.800  1.00 123.73 ? 59  ARG C NH1 1 
ATOM 1183 N NH2 . ARG C 3 57 ? 24.471  -1.809  28.208  1.00 122.62 ? 59  ARG C NH2 1 
ATOM 1184 N N   . VAL C 3 58 ? 19.673  2.785   25.415  1.00 98.89  ? 60  VAL C N   1 
ATOM 1185 C CA  . VAL C 3 58 ? 18.669  2.612   24.368  1.00 101.97 ? 60  VAL C CA  1 
ATOM 1186 C C   . VAL C 3 58 ? 18.006  3.942   23.999  1.00 108.86 ? 60  VAL C C   1 
ATOM 1187 O O   . VAL C 3 58 ? 17.757  4.214   22.816  1.00 114.04 ? 60  VAL C O   1 
ATOM 1188 C CB  . VAL C 3 58 ? 17.577  1.574   24.768  1.00 100.49 ? 60  VAL C CB  1 
ATOM 1189 C CG1 . VAL C 3 58 ? 16.265  1.840   24.033  1.00 76.50  ? 60  VAL C CG1 1 
ATOM 1190 C CG2 . VAL C 3 58 ? 18.069  0.145   24.511  1.00 90.00  ? 60  VAL C CG2 1 
ATOM 1191 N N   . GLU C 3 59 ? 17.719  4.771   24.999  1.00 111.88 ? 61  GLU C N   1 
ATOM 1192 C CA  . GLU C 3 59 ? 17.137  6.077   24.728  1.00 117.49 ? 61  GLU C CA  1 
ATOM 1193 C C   . GLU C 3 59 ? 18.115  6.878   23.860  1.00 122.85 ? 61  GLU C C   1 
ATOM 1194 O O   . GLU C 3 59 ? 17.713  7.456   22.842  1.00 126.77 ? 61  GLU C O   1 
ATOM 1195 C CB  . GLU C 3 59 ? 16.788  6.827   26.022  1.00 118.51 ? 61  GLU C CB  1 
ATOM 1196 C CG  . GLU C 3 59 ? 15.804  7.994   25.812  1.00 128.14 ? 61  GLU C CG  1 
ATOM 1197 C CD  . GLU C 3 59 ? 15.527  8.810   27.080  1.00 144.12 ? 61  GLU C CD  1 
ATOM 1198 O OE1 . GLU C 3 59 ? 16.494  9.230   27.755  1.00 156.54 ? 61  GLU C OE1 1 
ATOM 1199 O OE2 . GLU C 3 59 ? 14.338  9.039   27.400  1.00 150.31 ? 61  GLU C OE2 1 
ATOM 1200 N N   . GLU C 3 60 ? 19.392  6.899   24.257  1.00 123.78 ? 62  GLU C N   1 
ATOM 1201 C CA  . GLU C 3 60 ? 20.436  7.628   23.514  1.00 128.82 ? 62  GLU C CA  1 
ATOM 1202 C C   . GLU C 3 60 ? 20.474  7.176   22.063  1.00 125.80 ? 62  GLU C C   1 
ATOM 1203 O O   . GLU C 3 60 ? 20.485  8.007   21.156  1.00 129.56 ? 62  GLU C O   1 
ATOM 1204 C CB  . GLU C 3 60 ? 21.813  7.454   24.166  1.00 133.39 ? 62  GLU C CB  1 
ATOM 1205 C CG  . GLU C 3 60 ? 21.980  8.280   25.447  1.00 147.24 ? 62  GLU C CG  1 
ATOM 1206 C CD  . GLU C 3 60 ? 23.239  7.940   26.240  1.00 161.78 ? 62  GLU C CD  1 
ATOM 1207 O OE1 . GLU C 3 60 ? 23.758  6.805   26.098  1.00 169.08 ? 62  GLU C OE1 1 
ATOM 1208 O OE2 . GLU C 3 60 ? 23.705  8.814   27.013  1.00 163.20 ? 62  GLU C OE2 1 
ATOM 1209 N N   . GLY C 3 61 ? 20.488  5.861   21.854  1.00 120.61 ? 63  GLY C N   1 
ATOM 1210 C CA  . GLY C 3 61 ? 20.340  5.283   20.521  1.00 122.95 ? 63  GLY C CA  1 
ATOM 1211 C C   . GLY C 3 61 ? 19.206  5.915   19.724  1.00 123.37 ? 63  GLY C C   1 
ATOM 1212 O O   . GLY C 3 61 ? 19.417  6.401   18.606  1.00 128.42 ? 63  GLY C O   1 
ATOM 1213 N N   . MET C 3 62 ? 18.003  5.915   20.293  1.00 120.54 ? 64  MET C N   1 
ATOM 1214 C CA  . MET C 3 62 ? 16.834  6.483   19.607  1.00 123.44 ? 64  MET C CA  1 
ATOM 1215 C C   . MET C 3 62 ? 16.984  7.970   19.300  1.00 124.66 ? 64  MET C C   1 
ATOM 1216 O O   . MET C 3 62 ? 16.442  8.474   18.312  1.00 126.56 ? 64  MET C O   1 
ATOM 1217 C CB  . MET C 3 62 ? 15.575  6.271   20.441  1.00 123.93 ? 64  MET C CB  1 
ATOM 1218 C CG  . MET C 3 62 ? 15.107  4.823   20.482  1.00 132.41 ? 64  MET C CG  1 
ATOM 1219 S SD  . MET C 3 62 ? 14.397  4.208   18.931  1.00 131.05 ? 64  MET C SD  1 
ATOM 1220 C CE  . MET C 3 62 ? 13.156  5.445   18.606  1.00 117.20 ? 64  MET C CE  1 
ATOM 1221 N N   . ASN C 3 63 ? 17.720  8.670   20.152  1.00 127.78 ? 65  ASN C N   1 
ATOM 1222 C CA  . ASN C 3 63 ? 18.032  10.068  19.902  1.00 131.19 ? 65  ASN C CA  1 
ATOM 1223 C C   . ASN C 3 63 ? 18.975  10.221  18.705  1.00 133.35 ? 65  ASN C C   1 
ATOM 1224 O O   . ASN C 3 63 ? 18.691  11.000  17.800  1.00 135.77 ? 65  ASN C O   1 
ATOM 1225 C CB  . ASN C 3 63 ? 18.625  10.727  21.153  1.00 131.64 ? 65  ASN C CB  1 
ATOM 1226 C CG  . ASN C 3 63 ? 17.639  10.780  22.314  1.00 132.57 ? 65  ASN C CG  1 
ATOM 1227 O OD1 . ASN C 3 63 ? 16.417  10.740  22.120  1.00 132.67 ? 65  ASN C OD1 1 
ATOM 1228 N ND2 . ASN C 3 63 ? 18.171  10.874  23.531  1.00 123.30 ? 65  ASN C ND2 1 
ATOM 1229 N N   . HIS C 3 64 ? 20.086  9.481   18.691  1.00 133.72 ? 66  HIS C N   1 
ATOM 1230 C CA  . HIS C 3 64 ? 21.042  9.565   17.570  1.00 137.15 ? 66  HIS C CA  1 
ATOM 1231 C C   . HIS C 3 64 ? 20.307  9.437   16.253  1.00 135.33 ? 66  HIS C C   1 
ATOM 1232 O O   . HIS C 3 64 ? 20.614  10.127  15.285  1.00 139.75 ? 66  HIS C O   1 
ATOM 1233 C CB  . HIS C 3 64 ? 22.127  8.490   17.649  1.00 138.36 ? 66  HIS C CB  1 
ATOM 1234 C CG  . HIS C 3 64 ? 23.023  8.626   18.840  1.00 151.65 ? 66  HIS C CG  1 
ATOM 1235 N ND1 . HIS C 3 64 ? 23.892  9.684   19.003  1.00 162.23 ? 66  HIS C ND1 1 
ATOM 1236 C CD2 . HIS C 3 64 ? 23.183  7.837   19.929  1.00 163.40 ? 66  HIS C CD2 1 
ATOM 1237 C CE1 . HIS C 3 64 ? 24.548  9.540   20.142  1.00 164.90 ? 66  HIS C CE1 1 
ATOM 1238 N NE2 . HIS C 3 64 ? 24.136  8.428   20.723  1.00 166.52 ? 66  HIS C NE2 1 
ATOM 1239 N N   . ILE C 3 65 ? 19.326  8.551   16.225  1.00 132.49 ? 67  ILE C N   1 
ATOM 1240 C CA  . ILE C 3 65 ? 18.480  8.419   15.055  1.00 134.30 ? 67  ILE C CA  1 
ATOM 1241 C C   . ILE C 3 65 ? 17.731  9.727   14.785  1.00 137.04 ? 67  ILE C C   1 
ATOM 1242 O O   . ILE C 3 65 ? 17.768  10.237  13.662  1.00 141.37 ? 67  ILE C O   1 
ATOM 1243 C CB  . ILE C 3 65 ? 17.501  7.250   15.212  1.00 133.45 ? 67  ILE C CB  1 
ATOM 1244 C CG1 . ILE C 3 65 ? 18.204  5.932   14.855  1.00 132.32 ? 67  ILE C CG1 1 
ATOM 1245 C CG2 . ILE C 3 65 ? 16.278  7.457   14.336  1.00 127.81 ? 67  ILE C CG2 1 
ATOM 1246 C CD1 . ILE C 3 65 ? 19.607  5.745   15.466  1.00 118.16 ? 67  ILE C CD1 1 
ATOM 1247 N N   . ASN C 3 66 ? 17.061  10.274  15.798  1.00 136.58 ? 68  ASN C N   1 
ATOM 1248 C CA  . ASN C 3 66 ? 16.410  11.579  15.642  1.00 140.80 ? 68  ASN C CA  1 
ATOM 1249 C C   . ASN C 3 66 ? 17.341  12.600  14.981  1.00 141.94 ? 68  ASN C C   1 
ATOM 1250 O O   . ASN C 3 66 ? 16.899  13.376  14.138  1.00 144.04 ? 68  ASN C O   1 
ATOM 1251 C CB  . ASN C 3 66 ? 15.899  12.119  16.989  1.00 142.81 ? 68  ASN C CB  1 
ATOM 1252 C CG  . ASN C 3 66 ? 15.061  13.405  16.848  1.00 149.51 ? 68  ASN C CG  1 
ATOM 1253 O OD1 . ASN C 3 66 ? 14.898  13.956  15.755  1.00 148.66 ? 68  ASN C OD1 1 
ATOM 1254 N ND2 . ASN C 3 66 ? 14.526  13.881  17.974  1.00 158.66 ? 68  ASN C ND2 1 
ATOM 1255 N N   . GLN C 3 67 ? 18.621  12.595  15.355  1.00 140.98 ? 69  GLN C N   1 
ATOM 1256 C CA  . GLN C 3 67 ? 19.575  13.580  14.838  1.00 144.05 ? 69  GLN C CA  1 
ATOM 1257 C C   . GLN C 3 67 ? 19.886  13.341  13.348  1.00 145.76 ? 69  GLN C C   1 
ATOM 1258 O O   . GLN C 3 67 ? 19.756  14.255  12.522  1.00 147.32 ? 69  GLN C O   1 
ATOM 1259 C CB  . GLN C 3 67 ? 20.861  13.575  15.686  1.00 144.91 ? 69  GLN C CB  1 
ATOM 1260 C CG  . GLN C 3 67 ? 21.739  14.832  15.547  1.00 145.26 ? 69  GLN C CG  1 
ATOM 1261 C CD  . GLN C 3 67 ? 22.882  14.668  14.544  1.00 146.96 ? 69  GLN C CD  1 
ATOM 1262 O OE1 . GLN C 3 67 ? 23.707  13.760  14.668  1.00 151.40 ? 69  GLN C OE1 1 
ATOM 1263 N NE2 . GLN C 3 67 ? 22.934  15.552  13.548  1.00 132.53 ? 69  GLN C NE2 1 
ATOM 1264 N N   . ASP C 3 68 ? 20.287  12.116  13.011  1.00 144.56 ? 70  ASP C N   1 
ATOM 1265 C CA  . ASP C 3 68 ? 20.661  11.776  11.633  1.00 146.30 ? 70  ASP C CA  1 
ATOM 1266 C C   . ASP C 3 68 ? 19.517  12.029  10.656  1.00 145.25 ? 70  ASP C C   1 
ATOM 1267 O O   . ASP C 3 68 ? 19.670  12.766  9.673   1.00 145.80 ? 70  ASP C O   1 
ATOM 1268 C CB  . ASP C 3 68 ? 21.108  10.312  11.536  1.00 147.62 ? 70  ASP C CB  1 
ATOM 1269 C CG  . ASP C 3 68 ? 22.478  10.076  12.146  1.00 152.50 ? 70  ASP C CG  1 
ATOM 1270 O OD1 . ASP C 3 68 ? 22.920  10.909  12.968  1.00 153.52 ? 70  ASP C OD1 1 
ATOM 1271 O OD2 . ASP C 3 68 ? 23.113  9.054   11.800  1.00 161.15 ? 70  ASP C OD2 1 
ATOM 1272 N N   . MET C 3 69 ? 18.366  11.424  10.933  1.00 143.85 ? 71  MET C N   1 
ATOM 1273 C CA  . MET C 3 69 ? 17.203  11.558  10.052  1.00 144.28 ? 71  MET C CA  1 
ATOM 1274 C C   . MET C 3 69 ? 16.731  13.016  9.953   1.00 144.07 ? 71  MET C C   1 
ATOM 1275 O O   . MET C 3 69 ? 16.015  13.384  9.019   1.00 141.74 ? 71  MET C O   1 
ATOM 1276 C CB  . MET C 3 69 ? 16.058  10.664  10.528  1.00 144.67 ? 71  MET C CB  1 
ATOM 1277 C CG  . MET C 3 69 ? 16.402  9.173   10.605  1.00 147.18 ? 71  MET C CG  1 
ATOM 1278 S SD  . MET C 3 69 ? 16.282  8.290   9.040   1.00 151.04 ? 71  MET C SD  1 
ATOM 1279 C CE  . MET C 3 69 ? 14.507  8.163   8.858   1.00 149.52 ? 71  MET C CE  1 
ATOM 1280 N N   . LYS C 3 70 ? 17.137  13.836  10.920  1.00 145.97 ? 72  LYS C N   1 
ATOM 1281 C CA  . LYS C 3 70 ? 16.941  15.277  10.842  1.00 148.94 ? 72  LYS C CA  1 
ATOM 1282 C C   . LYS C 3 70 ? 17.852  15.866  9.763   1.00 150.95 ? 72  LYS C C   1 
ATOM 1283 O O   . LYS C 3 70 ? 17.475  16.828  9.093   1.00 153.04 ? 72  LYS C O   1 
ATOM 1284 C CB  . LYS C 3 70 ? 17.204  15.934  12.203  1.00 149.87 ? 72  LYS C CB  1 
ATOM 1285 C CG  . LYS C 3 70 ? 16.613  17.326  12.373  1.00 152.63 ? 72  LYS C CG  1 
ATOM 1286 C CD  . LYS C 3 70 ? 16.583  17.743  13.850  1.00 151.35 ? 72  LYS C CD  1 
ATOM 1287 C CE  . LYS C 3 70 ? 16.140  19.196  14.017  1.00 151.10 ? 72  LYS C CE  1 
ATOM 1288 N NZ  . LYS C 3 70 ? 15.953  19.588  15.444  1.00 146.47 ? 72  LYS C NZ  1 
ATOM 1289 N N   . GLU C 3 71 ? 19.045  15.291  9.594   1.00 150.64 ? 73  GLU C N   1 
ATOM 1290 C CA  . GLU C 3 71 ? 19.955  15.702  8.502   1.00 152.01 ? 73  GLU C CA  1 
ATOM 1291 C C   . GLU C 3 71 ? 19.429  15.321  7.103   1.00 149.82 ? 73  GLU C C   1 
ATOM 1292 O O   . GLU C 3 71 ? 19.808  15.947  6.108   1.00 151.86 ? 73  GLU C O   1 
ATOM 1293 C CB  . GLU C 3 71 ? 21.369  15.123  8.686   1.00 154.01 ? 73  GLU C CB  1 
ATOM 1294 C CG  . GLU C 3 71 ? 22.066  15.528  9.987   1.00 155.77 ? 73  GLU C CG  1 
ATOM 1295 C CD  . GLU C 3 71 ? 23.567  15.238  9.981   1.00 157.11 ? 73  GLU C CD  1 
ATOM 1296 O OE1 . GLU C 3 71 ? 24.261  15.701  10.915  1.00 153.32 ? 73  GLU C OE1 1 
ATOM 1297 O OE2 . GLU C 3 71 ? 24.054  14.551  9.051   1.00 147.26 ? 73  GLU C OE2 1 
ATOM 1298 N N   . ALA C 3 72 ? 18.571  14.301  7.029   1.00 144.69 ? 74  ALA C N   1 
ATOM 1299 C CA  . ALA C 3 72 ? 17.918  13.938  5.760   1.00 139.47 ? 74  ALA C CA  1 
ATOM 1300 C C   . ALA C 3 72 ? 16.651  14.757  5.538   1.00 134.36 ? 74  ALA C C   1 
ATOM 1301 O O   . ALA C 3 72 ? 16.679  15.791  4.873   1.00 129.53 ? 74  ALA C O   1 
ATOM 1302 C CB  . ALA C 3 72 ? 17.593  12.459  5.731   1.00 136.60 ? 74  ALA C CB  1 
ATOM 1303 N N   . GLY D 4 1  ? 6.905   -22.434 79.038  1.00 69.90  ? 139 GLY D N   1 
ATOM 1304 C CA  . GLY D 4 1  ? 8.383   -22.523 79.384  1.00 72.69  ? 139 GLY D CA  1 
ATOM 1305 C C   . GLY D 4 1  ? 9.264   -21.394 78.820  1.00 64.16  ? 139 GLY D C   1 
ATOM 1306 O O   . GLY D 4 1  ? 9.667   -21.434 77.639  1.00 59.19  ? 139 GLY D O   1 
ATOM 1307 N N   . SER D 4 2  ? 9.577   -20.398 79.659  1.00 51.39  ? 140 SER D N   1 
ATOM 1308 C CA  . SER D 4 2  ? 10.110  -19.132 79.164  1.00 46.00  ? 140 SER D CA  1 
ATOM 1309 C C   . SER D 4 2  ? 11.192  -19.303 78.082  1.00 48.82  ? 140 SER D C   1 
ATOM 1310 O O   . SER D 4 2  ? 11.246  -18.497 77.182  1.00 46.82  ? 140 SER D O   1 
ATOM 1311 C CB  . SER D 4 2  ? 10.627  -18.240 80.296  1.00 46.39  ? 140 SER D CB  1 
ATOM 1312 O OG  . SER D 4 2  ? 10.752  -16.900 79.830  1.00 38.16  ? 140 SER D OG  1 
ATOM 1313 N N   . ALA D 4 3  ? 12.038  -20.337 78.161  1.00 59.51  ? 141 ALA D N   1 
ATOM 1314 C CA  . ALA D 4 3  ? 13.123  -20.577 77.158  1.00 59.91  ? 141 ALA D CA  1 
ATOM 1315 C C   . ALA D 4 3  ? 12.576  -20.722 75.770  1.00 56.78  ? 141 ALA D C   1 
ATOM 1316 O O   . ALA D 4 3  ? 13.087  -20.132 74.821  1.00 52.73  ? 141 ALA D O   1 
ATOM 1317 C CB  . ALA D 4 3  ? 13.936  -21.830 77.492  1.00 59.16  ? 141 ALA D CB  1 
ATOM 1318 N N   . ARG D 4 4  ? 11.528  -21.527 75.674  1.00 59.42  ? 142 ARG D N   1 
ATOM 1319 C CA  . ARG D 4 4  ? 10.794  -21.684 74.444  1.00 59.26  ? 142 ARG D CA  1 
ATOM 1320 C C   . ARG D 4 4  ? 10.351  -20.311 73.956  1.00 56.71  ? 142 ARG D C   1 
ATOM 1321 O O   . ARG D 4 4  ? 10.813  -19.839 72.904  1.00 54.03  ? 142 ARG D O   1 
ATOM 1322 C CB  . ARG D 4 4  ? 9.600   -22.608 74.676  1.00 60.82  ? 142 ARG D CB  1 
ATOM 1323 C CG  . ARG D 4 4  ? 8.760   -22.850 73.447  1.00 71.14  ? 142 ARG D CG  1 
ATOM 1324 C CD  . ARG D 4 4  ? 8.110   -24.237 73.465  1.00 81.34  ? 142 ARG D CD  1 
ATOM 1325 N NE  . ARG D 4 4  ? 7.267   -24.455 74.640  1.00 93.05  ? 142 ARG D NE  1 
ATOM 1326 C CZ  . ARG D 4 4  ? 6.550   -25.557 74.850  1.00 102.56 ? 142 ARG D CZ  1 
ATOM 1327 N NH1 . ARG D 4 4  ? 6.577   -26.540 73.961  1.00 104.73 ? 142 ARG D NH1 1 
ATOM 1328 N NH2 . ARG D 4 4  ? 5.805   -25.675 75.948  1.00 109.02 ? 142 ARG D NH2 1 
ATOM 1329 N N   . GLU D 4 5  ? 9.471   -19.657 74.714  1.00 53.33  ? 143 GLU D N   1 
ATOM 1330 C CA  . GLU D 4 5  ? 8.966   -18.377 74.236  1.00 52.99  ? 143 GLU D CA  1 
ATOM 1331 C C   . GLU D 4 5  ? 10.139  -17.429 73.971  1.00 50.83  ? 143 GLU D C   1 
ATOM 1332 O O   . GLU D 4 5  ? 10.166  -16.753 72.964  1.00 56.45  ? 143 GLU D O   1 
ATOM 1333 C CB  . GLU D 4 5  ? 7.871   -17.735 75.136  1.00 54.94  ? 143 GLU D CB  1 
ATOM 1334 C CG  . GLU D 4 5  ? 8.014   -17.824 76.628  1.00 61.97  ? 143 GLU D CG  1 
ATOM 1335 C CD  . GLU D 4 5  ? 7.153   -18.925 77.278  1.00 71.47  ? 143 GLU D CD  1 
ATOM 1336 O OE1 . GLU D 4 5  ? 6.524   -18.658 78.336  1.00 57.42  ? 143 GLU D OE1 1 
ATOM 1337 O OE2 . GLU D 4 5  ? 7.109   -20.055 76.738  1.00 86.48  ? 143 GLU D OE2 1 
ATOM 1338 N N   . ASN D 4 6  ? 11.124  -17.373 74.835  1.00 47.16  ? 144 ASN D N   1 
ATOM 1339 C CA  . ASN D 4 6  ? 12.206  -16.426 74.608  1.00 52.19  ? 144 ASN D CA  1 
ATOM 1340 C C   . ASN D 4 6  ? 12.826  -16.573 73.206  1.00 51.71  ? 144 ASN D C   1 
ATOM 1341 O O   . ASN D 4 6  ? 13.195  -15.580 72.572  1.00 53.92  ? 144 ASN D O   1 
ATOM 1342 C CB  . ASN D 4 6  ? 13.253  -16.553 75.709  1.00 56.81  ? 144 ASN D CB  1 
ATOM 1343 C CG  . ASN D 4 6  ? 12.654  -16.352 77.100  1.00 67.63  ? 144 ASN D CG  1 
ATOM 1344 O OD1 . ASN D 4 6  ? 11.509  -15.890 77.242  1.00 66.00  ? 144 ASN D OD1 1 
ATOM 1345 N ND2 . ASN D 4 6  ? 13.421  -16.704 78.132  1.00 74.28  ? 144 ASN D ND2 1 
ATOM 1346 N N   . GLU D 4 7  ? 12.931  -17.806 72.721  1.00 53.86  ? 145 GLU D N   1 
ATOM 1347 C CA  . GLU D 4 7  ? 13.399  -18.048 71.354  1.00 53.33  ? 145 GLU D CA  1 
ATOM 1348 C C   . GLU D 4 7  ? 12.328  -17.525 70.394  1.00 50.82  ? 145 GLU D C   1 
ATOM 1349 O O   . GLU D 4 7  ? 12.614  -16.874 69.388  1.00 47.27  ? 145 GLU D O   1 
ATOM 1350 C CB  . GLU D 4 7  ? 13.710  -19.545 71.123  1.00 50.75  ? 145 GLU D CB  1 
ATOM 1351 C CG  . GLU D 4 7  ? 14.760  -19.844 70.007  1.00 53.02  ? 145 GLU D CG  1 
ATOM 1352 C CD  . GLU D 4 7  ? 14.747  -21.330 69.496  1.00 64.34  ? 145 GLU D CD  1 
ATOM 1353 O OE1 . GLU D 4 7  ? 14.232  -22.199 70.232  1.00 44.12  ? 145 GLU D OE1 1 
ATOM 1354 O OE2 . GLU D 4 7  ? 15.245  -21.637 68.364  1.00 45.00  ? 145 GLU D OE2 1 
ATOM 1355 N N   . MET D 4 8  ? 11.077  -17.799 70.713  1.00 50.25  ? 146 MET D N   1 
ATOM 1356 C CA  . MET D 4 8  ? 9.997   -17.286 69.885  1.00 53.07  ? 146 MET D CA  1 
ATOM 1357 C C   . MET D 4 8  ? 10.062  -15.774 69.758  1.00 48.08  ? 146 MET D C   1 
ATOM 1358 O O   . MET D 4 8  ? 9.972   -15.214 68.676  1.00 45.06  ? 146 MET D O   1 
ATOM 1359 C CB  . MET D 4 8  ? 8.654   -17.687 70.474  1.00 54.95  ? 146 MET D CB  1 
ATOM 1360 C CG  . MET D 4 8  ? 7.511   -17.524 69.539  1.00 55.03  ? 146 MET D CG  1 
ATOM 1361 S SD  . MET D 4 8  ? 6.118   -18.442 70.183  1.00 94.36  ? 146 MET D SD  1 
ATOM 1362 C CE  . MET D 4 8  ? 6.429   -20.085 69.563  1.00 90.54  ? 146 MET D CE  1 
ATOM 1363 N N   . ASP D 4 9  ? 10.228  -15.116 70.881  1.00 47.99  ? 147 ASP D N   1 
ATOM 1364 C CA  . ASP D 4 9  ? 10.121  -13.690 70.906  1.00 52.94  ? 147 ASP D CA  1 
ATOM 1365 C C   . ASP D 4 9  ? 11.301  -13.112 70.151  1.00 51.31  ? 147 ASP D C   1 
ATOM 1366 O O   . ASP D 4 9  ? 11.184  -12.057 69.514  1.00 48.63  ? 147 ASP D O   1 
ATOM 1367 C CB  . ASP D 4 9  ? 10.052  -13.187 72.357  1.00 59.15  ? 147 ASP D CB  1 
ATOM 1368 C CG  . ASP D 4 9  ? 8.830   -13.750 73.132  1.00 72.62  ? 147 ASP D CG  1 
ATOM 1369 O OD1 . ASP D 4 9  ? 7.892   -14.302 72.504  1.00 89.17  ? 147 ASP D OD1 1 
ATOM 1370 O OD2 . ASP D 4 9  ? 8.808   -13.641 74.377  1.00 83.52  ? 147 ASP D OD2 1 
ATOM 1371 N N   . GLU D 4 10 ? 12.441  -13.793 70.202  1.00 53.19  ? 148 GLU D N   1 
ATOM 1372 C CA  . GLU D 4 10 ? 13.611  -13.246 69.507  1.00 59.41  ? 148 GLU D CA  1 
ATOM 1373 C C   . GLU D 4 10 ? 13.535  -13.548 67.998  1.00 55.67  ? 148 GLU D C   1 
ATOM 1374 O O   . GLU D 4 10 ? 14.145  -12.855 67.174  1.00 53.95  ? 148 GLU D O   1 
ATOM 1375 C CB  . GLU D 4 10 ? 14.931  -13.705 70.155  1.00 59.89  ? 148 GLU D CB  1 
ATOM 1376 C CG  . GLU D 4 10 ? 15.416  -15.082 69.767  1.00 78.75  ? 148 GLU D CG  1 
ATOM 1377 C CD  . GLU D 4 10 ? 16.448  -15.627 70.748  1.00 98.53  ? 148 GLU D CD  1 
ATOM 1378 O OE1 . GLU D 4 10 ? 17.510  -16.126 70.296  1.00 111.48 ? 148 GLU D OE1 1 
ATOM 1379 O OE2 . GLU D 4 10 ? 16.190  -15.552 71.973  1.00 97.51  ? 148 GLU D OE2 1 
ATOM 1380 N N   . ASN D 4 11 ? 12.782  -14.575 67.632  1.00 50.54  ? 149 ASN D N   1 
ATOM 1381 C CA  . ASN D 4 11 ? 12.585  -14.847 66.222  1.00 48.88  ? 149 ASN D CA  1 
ATOM 1382 C C   . ASN D 4 11 ? 11.723  -13.753 65.625  1.00 45.60  ? 149 ASN D C   1 
ATOM 1383 O O   . ASN D 4 11 ? 12.003  -13.217 64.552  1.00 44.90  ? 149 ASN D O   1 
ATOM 1384 C CB  . ASN D 4 11 ? 11.973  -16.232 66.016  1.00 49.93  ? 149 ASN D CB  1 
ATOM 1385 C CG  . ASN D 4 11 ? 12.950  -17.363 66.353  1.00 57.63  ? 149 ASN D CG  1 
ATOM 1386 O OD1 . ASN D 4 11 ? 12.615  -18.543 66.269  1.00 42.48  ? 149 ASN D OD1 1 
ATOM 1387 N ND2 . ASN D 4 11 ? 14.167  -16.998 66.736  1.00 89.65  ? 149 ASN D ND2 1 
ATOM 1388 N N   . LEU D 4 12 ? 10.670  -13.407 66.338  1.00 44.39  ? 150 LEU D N   1 
ATOM 1389 C CA  . LEU D 4 12 ? 9.755   -12.398 65.847  1.00 42.89  ? 150 LEU D CA  1 
ATOM 1390 C C   . LEU D 4 12 ? 10.447  -11.050 65.767  1.00 51.05  ? 150 LEU D C   1 
ATOM 1391 O O   . LEU D 4 12 ? 10.299  -10.316 64.781  1.00 47.78  ? 150 LEU D O   1 
ATOM 1392 C CB  . LEU D 4 12 ? 8.580   -12.276 66.773  1.00 36.97  ? 150 LEU D CB  1 
ATOM 1393 C CG  . LEU D 4 12 ? 7.909   -13.605 66.959  1.00 28.21  ? 150 LEU D CG  1 
ATOM 1394 C CD1 . LEU D 4 12 ? 7.308   -13.592 68.338  1.00 59.76  ? 150 LEU D CD1 1 
ATOM 1395 C CD2 . LEU D 4 12 ? 6.889   -13.841 65.849  1.00 42.96  ? 150 LEU D CD2 1 
ATOM 1396 N N   . GLU D 4 13 ? 11.203  -10.712 66.807  1.00 49.82  ? 151 GLU D N   1 
ATOM 1397 C CA  . GLU D 4 13 ? 11.965  -9.507  66.722  1.00 49.16  ? 151 GLU D CA  1 
ATOM 1398 C C   . GLU D 4 13 ? 12.700  -9.622  65.403  1.00 40.53  ? 151 GLU D C   1 
ATOM 1399 O O   . GLU D 4 13 ? 12.570  -8.794  64.523  1.00 37.38  ? 151 GLU D O   1 
ATOM 1400 C CB  . GLU D 4 13 ? 12.927  -9.354  67.895  1.00 52.94  ? 151 GLU D CB  1 
ATOM 1401 C CG  . GLU D 4 13 ? 12.192  -9.224  69.340  0.00 86.28  ? 151 GLU D CG  1 
ATOM 1402 C CD  . GLU D 4 13 ? 13.125  -9.173  70.562  0.00 101.53 ? 151 GLU D CD  1 
ATOM 1403 O OE1 . GLU D 4 13 ? 14.334  -9.474  70.434  0.00 124.05 ? 151 GLU D OE1 1 
ATOM 1404 O OE2 . GLU D 4 13 ? 12.636  -8.819  71.662  0.00 112.97 ? 151 GLU D OE2 1 
ATOM 1405 N N   . GLN D 4 14 ? 13.466  -10.672 65.249  1.00 39.60  ? 152 GLN D N   1 
ATOM 1406 C CA  . GLN D 4 14 ? 14.348  -10.700 64.115  1.00 45.55  ? 152 GLN D CA  1 
ATOM 1407 C C   . GLN D 4 14 ? 13.580  -10.446 62.825  1.00 41.71  ? 152 GLN D C   1 
ATOM 1408 O O   . GLN D 4 14 ? 13.957  -9.589  62.021  1.00 42.30  ? 152 GLN D O   1 
ATOM 1409 C CB  . GLN D 4 14 ? 15.081  -12.022 64.063  1.00 50.98  ? 152 GLN D CB  1 
ATOM 1410 C CG  . GLN D 4 14 ? 16.306  -11.982 63.195  1.00 56.29  ? 152 GLN D CG  1 
ATOM 1411 C CD  . GLN D 4 14 ? 17.105  -13.231 63.334  1.00 53.82  ? 152 GLN D CD  1 
ATOM 1412 O OE1 . GLN D 4 14 ? 17.660  -13.735 62.352  1.00 57.77  ? 152 GLN D OE1 1 
ATOM 1413 N NE2 . GLN D 4 14 ? 17.170  -13.759 64.566  1.00 32.08  ? 152 GLN D NE2 1 
ATOM 1414 N N   . VAL D 4 15 ? 12.508  -11.201 62.650  1.00 41.58  ? 153 VAL D N   1 
ATOM 1415 C CA  . VAL D 4 15 ? 11.591  -11.004 61.542  1.00 42.95  ? 153 VAL D CA  1 
ATOM 1416 C C   . VAL D 4 15 ? 11.224  -9.533  61.332  1.00 42.36  ? 153 VAL D C   1 
ATOM 1417 O O   . VAL D 4 15 ? 11.512  -8.899  60.296  1.00 33.98  ? 153 VAL D O   1 
ATOM 1418 C CB  . VAL D 4 15 ? 10.263  -11.726 61.816  1.00 42.28  ? 153 VAL D CB  1 
ATOM 1419 C CG1 . VAL D 4 15 ? 9.229   -11.336 60.750  1.00 46.80  ? 153 VAL D CG1 1 
ATOM 1420 C CG2 . VAL D 4 15 ? 10.456  -13.204 61.867  1.00 26.68  ? 153 VAL D CG2 1 
ATOM 1421 N N   . SER D 4 16 ? 10.575  -9.004  62.356  1.00 39.29  ? 154 SER D N   1 
ATOM 1422 C CA  . SER D 4 16 ? 10.062  -7.677  62.324  1.00 41.09  ? 154 SER D CA  1 
ATOM 1423 C C   . SER D 4 16 ? 11.113  -6.766  61.746  1.00 39.68  ? 154 SER D C   1 
ATOM 1424 O O   . SER D 4 16 ? 10.823  -5.884  60.957  1.00 39.36  ? 154 SER D O   1 
ATOM 1425 C CB  . SER D 4 16 ? 9.707   -7.241  63.731  1.00 41.75  ? 154 SER D CB  1 
ATOM 1426 O OG  . SER D 4 16 ? 8.927   -6.071  63.666  1.00 63.29  ? 154 SER D OG  1 
ATOM 1427 N N   . GLY D 4 17 ? 12.348  -7.000  62.150  1.00 43.36  ? 155 GLY D N   1 
ATOM 1428 C CA  . GLY D 4 17 ? 13.466  -6.304  61.573  1.00 48.47  ? 155 GLY D CA  1 
ATOM 1429 C C   . GLY D 4 17 ? 13.400  -6.388  60.069  1.00 44.41  ? 155 GLY D C   1 
ATOM 1430 O O   . GLY D 4 17 ? 13.234  -5.384  59.370  1.00 44.46  ? 155 GLY D O   1 
ATOM 1431 N N   . ILE D 4 18 ? 13.519  -7.601  59.573  1.00 37.87  ? 156 ILE D N   1 
ATOM 1432 C CA  . ILE D 4 18 ? 13.728  -7.785  58.158  1.00 37.97  ? 156 ILE D CA  1 
ATOM 1433 C C   . ILE D 4 18 ? 12.569  -7.239  57.350  1.00 36.42  ? 156 ILE D C   1 
ATOM 1434 O O   . ILE D 4 18 ? 12.717  -6.852  56.171  1.00 28.97  ? 156 ILE D O   1 
ATOM 1435 C CB  . ILE D 4 18 ? 13.859  -9.246  57.806  1.00 38.05  ? 156 ILE D CB  1 
ATOM 1436 C CG1 . ILE D 4 18 ? 14.937  -9.907  58.650  1.00 51.92  ? 156 ILE D CG1 1 
ATOM 1437 C CG2 . ILE D 4 18 ? 14.216  -9.380  56.340  1.00 19.95  ? 156 ILE D CG2 1 
ATOM 1438 C CD1 . ILE D 4 18 ? 15.435  -11.189 58.027  1.00 63.66  ? 156 ILE D CD1 1 
ATOM 1439 N N   . ILE D 4 19 ? 11.409  -7.222  57.994  1.00 35.04  ? 157 ILE D N   1 
ATOM 1440 C CA  . ILE D 4 19 ? 10.215  -6.762  57.321  1.00 35.25  ? 157 ILE D CA  1 
ATOM 1441 C C   . ILE D 4 19 ? 10.405  -5.264  57.151  1.00 36.48  ? 157 ILE D C   1 
ATOM 1442 O O   . ILE D 4 19 ? 10.045  -4.683  56.125  1.00 32.33  ? 157 ILE D O   1 
ATOM 1443 C CB  . ILE D 4 19 ? 8.942   -7.207  58.074  1.00 32.22  ? 157 ILE D CB  1 
ATOM 1444 C CG1 . ILE D 4 19 ? 8.628   -8.641  57.705  1.00 30.48  ? 157 ILE D CG1 1 
ATOM 1445 C CG2 . ILE D 4 19 ? 7.719   -6.452  57.675  1.00 30.90  ? 157 ILE D CG2 1 
ATOM 1446 C CD1 . ILE D 4 19 ? 9.748   -9.595  57.961  1.00 45.87  ? 157 ILE D CD1 1 
ATOM 1447 N N   . GLY D 4 20 ? 10.998  -4.632  58.148  1.00 42.09  ? 158 GLY D N   1 
ATOM 1448 C CA  . GLY D 4 20 ? 11.513  -3.295  57.915  1.00 48.85  ? 158 GLY D CA  1 
ATOM 1449 C C   . GLY D 4 20 ? 12.132  -3.225  56.520  1.00 47.56  ? 158 GLY D C   1 
ATOM 1450 O O   . GLY D 4 20 ? 11.641  -2.523  55.626  1.00 43.96  ? 158 GLY D O   1 
ATOM 1451 N N   . ASN D 4 21 ? 13.210  -3.974  56.337  1.00 43.11  ? 159 ASN D N   1 
ATOM 1452 C CA  . ASN D 4 21 ? 14.062  -3.812  55.173  1.00 45.45  ? 159 ASN D CA  1 
ATOM 1453 C C   . ASN D 4 21 ? 13.246  -3.935  53.934  1.00 41.49  ? 159 ASN D C   1 
ATOM 1454 O O   . ASN D 4 21 ? 13.352  -3.141  52.995  1.00 39.27  ? 159 ASN D O   1 
ATOM 1455 C CB  . ASN D 4 21 ? 15.178  -4.850  55.192  1.00 46.86  ? 159 ASN D CB  1 
ATOM 1456 C CG  . ASN D 4 21 ? 16.053  -4.713  56.424  1.00 60.87  ? 159 ASN D CG  1 
ATOM 1457 O OD1 . ASN D 4 21 ? 16.160  -5.630  57.245  1.00 57.30  ? 159 ASN D OD1 1 
ATOM 1458 N ND2 . ASN D 4 21 ? 16.678  -3.547  56.564  1.00 73.77  ? 159 ASN D ND2 1 
ATOM 1459 N N   . LEU D 4 22 ? 12.403  -4.947  53.948  1.00 41.34  ? 160 LEU D N   1 
ATOM 1460 C CA  . LEU D 4 22 ? 11.622  -5.264  52.771  1.00 44.20  ? 160 LEU D CA  1 
ATOM 1461 C C   . LEU D 4 22 ? 10.701  -4.101  52.438  1.00 47.61  ? 160 LEU D C   1 
ATOM 1462 O O   . LEU D 4 22 ? 10.450  -3.831  51.255  1.00 44.79  ? 160 LEU D O   1 
ATOM 1463 C CB  . LEU D 4 22 ? 10.838  -6.538  53.002  1.00 40.33  ? 160 LEU D CB  1 
ATOM 1464 C CG  . LEU D 4 22 ? 11.802  -7.695  53.262  1.00 38.57  ? 160 LEU D CG  1 
ATOM 1465 C CD1 . LEU D 4 22 ? 11.229  -8.644  54.300  1.00 54.57  ? 160 LEU D CD1 1 
ATOM 1466 C CD2 . LEU D 4 22 ? 12.146  -8.417  51.951  1.00 29.90  ? 160 LEU D CD2 1 
ATOM 1467 N N   . ARG D 4 23 ? 10.207  -3.412  53.476  1.00 43.35  ? 161 ARG D N   1 
ATOM 1468 C CA  . ARG D 4 23 ? 9.408   -2.223  53.251  1.00 41.15  ? 161 ARG D CA  1 
ATOM 1469 C C   . ARG D 4 23 ? 10.207  -1.389  52.309  1.00 36.93  ? 161 ARG D C   1 
ATOM 1470 O O   . ARG D 4 23 ? 9.863   -1.248  51.148  1.00 41.16  ? 161 ARG D O   1 
ATOM 1471 C CB  . ARG D 4 23 ? 9.096   -1.437  54.531  1.00 42.85  ? 161 ARG D CB  1 
ATOM 1472 C CG  . ARG D 4 23 ? 8.275   -0.163  54.270  1.00 40.74  ? 161 ARG D CG  1 
ATOM 1473 C CD  . ARG D 4 23 ? 7.851   0.535   55.535  1.00 59.34  ? 161 ARG D CD  1 
ATOM 1474 N NE  . ARG D 4 23 ? 8.976   1.203   56.214  1.00 85.03  ? 161 ARG D NE  1 
ATOM 1475 C CZ  . ARG D 4 23 ? 9.716   0.690   57.210  1.00 89.71  ? 161 ARG D CZ  1 
ATOM 1476 N NH1 . ARG D 4 23 ? 9.500   -0.529  57.707  1.00 84.31  ? 161 ARG D NH1 1 
ATOM 1477 N NH2 . ARG D 4 23 ? 10.698  1.413   57.728  1.00 98.32  ? 161 ARG D NH2 1 
ATOM 1478 N N   . HIS D 4 24 ? 11.294  -0.846  52.801  1.00 36.03  ? 162 HIS D N   1 
ATOM 1479 C CA  . HIS D 4 24 ? 12.037  0.082   51.995  1.00 42.32  ? 162 HIS D CA  1 
ATOM 1480 C C   . HIS D 4 24 ? 12.221  -0.475  50.591  1.00 40.96  ? 162 HIS D C   1 
ATOM 1481 O O   . HIS D 4 24 ? 11.971  0.197   49.590  1.00 34.29  ? 162 HIS D O   1 
ATOM 1482 C CB  . HIS D 4 24 ? 13.374  0.340   52.654  1.00 48.39  ? 162 HIS D CB  1 
ATOM 1483 C CG  . HIS D 4 24 ? 13.246  0.932   54.016  1.00 54.51  ? 162 HIS D CG  1 
ATOM 1484 N ND1 . HIS D 4 24 ? 12.780  2.210   54.217  1.00 64.84  ? 162 HIS D ND1 1 
ATOM 1485 C CD2 . HIS D 4 24 ? 13.513  0.428   55.243  1.00 60.55  ? 162 HIS D CD2 1 
ATOM 1486 C CE1 . HIS D 4 24 ? 12.769  2.472   55.509  1.00 57.31  ? 162 HIS D CE1 1 
ATOM 1487 N NE2 . HIS D 4 24 ? 13.208  1.407   56.153  1.00 60.95  ? 162 HIS D NE2 1 
ATOM 1488 N N   . MET D 4 25 ? 12.658  -1.724  50.532  1.00 42.08  ? 163 MET D N   1 
ATOM 1489 C CA  . MET D 4 25 ? 12.962  -2.319  49.258  1.00 43.39  ? 163 MET D CA  1 
ATOM 1490 C C   . MET D 4 25 ? 11.767  -2.127  48.371  1.00 40.47  ? 163 MET D C   1 
ATOM 1491 O O   . MET D 4 25 ? 11.903  -1.606  47.269  1.00 47.25  ? 163 MET D O   1 
ATOM 1492 C CB  . MET D 4 25 ? 13.305  -3.793  49.419  1.00 48.32  ? 163 MET D CB  1 
ATOM 1493 C CG  . MET D 4 25 ? 14.792  -4.076  49.297  1.00 56.88  ? 163 MET D CG  1 
ATOM 1494 S SD  . MET D 4 25 ? 15.283  -5.709  49.878  1.00 73.31  ? 163 MET D SD  1 
ATOM 1495 C CE  . MET D 4 25 ? 15.578  -5.335  51.615  1.00 70.82  ? 163 MET D CE  1 
ATOM 1496 N N   . ALA D 4 26 ? 10.601  -2.541  48.860  1.00 36.49  ? 164 ALA D N   1 
ATOM 1497 C CA  . ALA D 4 26 ? 9.360   -2.347  48.127  1.00 33.69  ? 164 ALA D CA  1 
ATOM 1498 C C   . ALA D 4 26 ? 9.278   -0.921  47.618  1.00 38.68  ? 164 ALA D C   1 
ATOM 1499 O O   . ALA D 4 26 ? 9.312   -0.682  46.409  1.00 48.48  ? 164 ALA D O   1 
ATOM 1500 C CB  . ALA D 4 26 ? 8.197   -2.633  48.986  1.00 22.93  ? 164 ALA D CB  1 
ATOM 1501 N N   . LEU D 4 27 ? 9.183   0.031   48.535  1.00 41.20  ? 165 LEU D N   1 
ATOM 1502 C CA  . LEU D 4 27 ? 8.893   1.406   48.153  1.00 46.73  ? 165 LEU D CA  1 
ATOM 1503 C C   . LEU D 4 27 ? 9.794   1.847   47.018  1.00 53.60  ? 165 LEU D C   1 
ATOM 1504 O O   . LEU D 4 27 ? 9.364   2.519   46.075  1.00 60.57  ? 165 LEU D O   1 
ATOM 1505 C CB  . LEU D 4 27 ? 9.068   2.357   49.337  1.00 48.58  ? 165 LEU D CB  1 
ATOM 1506 C CG  . LEU D 4 27 ? 8.074   2.227   50.497  1.00 45.55  ? 165 LEU D CG  1 
ATOM 1507 C CD1 . LEU D 4 27 ? 8.665   1.379   51.574  1.00 50.74  ? 165 LEU D CD1 1 
ATOM 1508 C CD2 . LEU D 4 27 ? 7.688   3.585   51.077  1.00 48.97  ? 165 LEU D CD2 1 
ATOM 1509 N N   . ASP D 4 28 ? 11.053  1.452   47.124  1.00 56.49  ? 166 ASP D N   1 
ATOM 1510 C CA  . ASP D 4 28 ? 12.076  1.897   46.204  1.00 64.54  ? 166 ASP D CA  1 
ATOM 1511 C C   . ASP D 4 28 ? 11.772  1.380   44.827  1.00 61.37  ? 166 ASP D C   1 
ATOM 1512 O O   . ASP D 4 28 ? 11.672  2.165   43.872  1.00 66.91  ? 166 ASP D O   1 
ATOM 1513 C CB  . ASP D 4 28 ? 13.436  1.419   46.696  1.00 68.40  ? 166 ASP D CB  1 
ATOM 1514 C CG  . ASP D 4 28 ? 13.814  2.069   47.995  1.00 71.34  ? 166 ASP D CG  1 
ATOM 1515 O OD1 . ASP D 4 28 ? 13.635  3.299   48.074  1.00 69.54  ? 166 ASP D OD1 1 
ATOM 1516 O OD2 . ASP D 4 28 ? 14.274  1.373   48.922  1.00 86.75  ? 166 ASP D OD2 1 
ATOM 1517 N N   . MET D 4 29 ? 11.617  0.063   44.737  1.00 53.66  ? 167 MET D N   1 
ATOM 1518 C CA  . MET D 4 29 ? 11.241  -0.546  43.489  1.00 58.40  ? 167 MET D CA  1 
ATOM 1519 C C   . MET D 4 29 ? 10.144  0.273   42.850  1.00 64.68  ? 167 MET D C   1 
ATOM 1520 O O   . MET D 4 29 ? 10.312  0.782   41.741  1.00 70.85  ? 167 MET D O   1 
ATOM 1521 C CB  . MET D 4 29 ? 10.722  -1.944  43.705  1.00 56.51  ? 167 MET D CB  1 
ATOM 1522 C CG  . MET D 4 29 ? 11.767  -2.932  44.094  1.00 62.95  ? 167 MET D CG  1 
ATOM 1523 S SD  . MET D 4 29 ? 11.035  -4.473  44.720  1.00 84.24  ? 167 MET D SD  1 
ATOM 1524 C CE  . MET D 4 29 ? 9.748   -4.792  43.501  1.00 46.34  ? 167 MET D CE  1 
ATOM 1525 N N   . GLY D 4 30 ? 9.027   0.395   43.565  1.00 62.98  ? 168 GLY D N   1 
ATOM 1526 C CA  . GLY D 4 30 ? 7.855   1.114   43.076  1.00 64.98  ? 168 GLY D CA  1 
ATOM 1527 C C   . GLY D 4 30 ? 8.230   2.404   42.387  1.00 65.54  ? 168 GLY D C   1 
ATOM 1528 O O   . GLY D 4 30 ? 8.182   2.491   41.170  1.00 67.24  ? 168 GLY D O   1 
ATOM 1529 N N   . ASN D 4 31 ? 8.614   3.401   43.171  1.00 68.45  ? 169 ASN D N   1 
ATOM 1530 C CA  . ASN D 4 31 ? 8.964   4.710   42.630  1.00 75.42  ? 169 ASN D CA  1 
ATOM 1531 C C   . ASN D 4 31 ? 9.893   4.605   41.417  1.00 79.92  ? 169 ASN D C   1 
ATOM 1532 O O   . ASN D 4 31 ? 9.693   5.287   40.394  1.00 80.42  ? 169 ASN D O   1 
ATOM 1533 C CB  . ASN D 4 31 ? 9.589   5.567   43.728  1.00 74.43  ? 169 ASN D CB  1 
ATOM 1534 C CG  . ASN D 4 31 ? 8.669   5.716   44.924  1.00 87.34  ? 169 ASN D CG  1 
ATOM 1535 O OD1 . ASN D 4 31 ? 7.536   5.233   44.899  1.00 109.94 ? 169 ASN D OD1 1 
ATOM 1536 N ND2 . ASN D 4 31 ? 9.141   6.376   45.974  1.00 94.18  ? 169 ASN D ND2 1 
ATOM 1537 N N   . GLU D 4 32 ? 10.899  3.740   41.534  1.00 78.22  ? 170 GLU D N   1 
ATOM 1538 C CA  . GLU D 4 32 ? 11.886  3.550   40.469  1.00 83.59  ? 170 GLU D CA  1 
ATOM 1539 C C   . GLU D 4 32 ? 11.349  2.917   39.218  1.00 76.65  ? 170 GLU D C   1 
ATOM 1540 O O   . GLU D 4 32 ? 11.690  3.298   38.108  1.00 80.25  ? 170 GLU D O   1 
ATOM 1541 C CB  . GLU D 4 32 ? 13.028  2.657   40.923  1.00 88.33  ? 170 GLU D CB  1 
ATOM 1542 C CG  . GLU D 4 32 ? 13.926  2.244   39.750  1.00 94.83  ? 170 GLU D CG  1 
ATOM 1543 C CD  . GLU D 4 32 ? 15.308  1.873   40.180  1.00 115.04 ? 170 GLU D CD  1 
ATOM 1544 O OE1 . GLU D 4 32 ? 15.487  1.485   41.353  1.00 133.15 ? 170 GLU D OE1 1 
ATOM 1545 O OE2 . GLU D 4 32 ? 16.221  1.970   39.337  1.00 132.19 ? 170 GLU D OE2 1 
ATOM 1546 N N   . ILE D 4 33 ? 10.517  1.926   39.393  1.00 69.75  ? 171 ILE D N   1 
ATOM 1547 C CA  . ILE D 4 33 ? 9.937   1.278   38.249  1.00 65.97  ? 171 ILE D CA  1 
ATOM 1548 C C   . ILE D 4 33 ? 9.117   2.290   37.477  1.00 66.33  ? 171 ILE D C   1 
ATOM 1549 O O   . ILE D 4 33 ? 9.326   2.480   36.295  1.00 66.25  ? 171 ILE D O   1 
ATOM 1550 C CB  . ILE D 4 33 ? 9.104   0.083   38.691  1.00 63.59  ? 171 ILE D CB  1 
ATOM 1551 C CG1 . ILE D 4 33 ? 10.066  -1.083  38.917  1.00 60.29  ? 171 ILE D CG1 1 
ATOM 1552 C CG2 . ILE D 4 33 ? 8.038   -0.242  37.673  1.00 45.09  ? 171 ILE D CG2 1 
ATOM 1553 C CD1 . ILE D 4 33 ? 9.410   -2.368  39.189  1.00 54.95  ? 171 ILE D CD1 1 
ATOM 1554 N N   . ASP D 4 34 ? 8.191   2.945   38.155  1.00 70.66  ? 172 ASP D N   1 
ATOM 1555 C CA  . ASP D 4 34 ? 7.424   4.002   37.537  1.00 77.25  ? 172 ASP D CA  1 
ATOM 1556 C C   . ASP D 4 34 ? 8.319   4.810   36.662  1.00 79.66  ? 172 ASP D C   1 
ATOM 1557 O O   . ASP D 4 34 ? 8.002   5.048   35.511  1.00 88.39  ? 172 ASP D O   1 
ATOM 1558 C CB  . ASP D 4 34 ? 6.831   4.936   38.580  1.00 82.73  ? 172 ASP D CB  1 
ATOM 1559 C CG  . ASP D 4 34 ? 5.799   4.259   39.427  1.00 94.34  ? 172 ASP D CG  1 
ATOM 1560 O OD1 . ASP D 4 34 ? 5.186   3.296   38.919  1.00 92.52  ? 172 ASP D OD1 1 
ATOM 1561 O OD2 . ASP D 4 34 ? 5.608   4.687   40.588  1.00 104.04 ? 172 ASP D OD2 1 
ATOM 1562 N N   . THR D 4 35 ? 9.444   5.239   37.210  1.00 78.62  ? 173 THR D N   1 
ATOM 1563 C CA  . THR D 4 35 ? 10.392  5.996   36.425  1.00 79.54  ? 173 THR D CA  1 
ATOM 1564 C C   . THR D 4 35 ? 10.643  5.264   35.111  1.00 76.59  ? 173 THR D C   1 
ATOM 1565 O O   . THR D 4 35 ? 10.436  5.816   34.040  1.00 82.00  ? 173 THR D O   1 
ATOM 1566 C CB  . THR D 4 35 ? 11.697  6.213   37.203  1.00 82.80  ? 173 THR D CB  1 
ATOM 1567 O OG1 . THR D 4 35 ? 11.372  6.606   38.546  1.00 81.46  ? 173 THR D OG1 1 
ATOM 1568 C CG2 . THR D 4 35 ? 12.571  7.281   36.532  1.00 83.37  ? 173 THR D CG2 1 
ATOM 1569 N N   . GLN D 4 36 ? 11.075  4.016   35.188  1.00 73.02  ? 174 GLN D N   1 
ATOM 1570 C CA  . GLN D 4 36 ? 11.400  3.269   33.975  1.00 70.25  ? 174 GLN D CA  1 
ATOM 1571 C C   . GLN D 4 36 ? 10.216  3.140   33.043  1.00 64.99  ? 174 GLN D C   1 
ATOM 1572 O O   . GLN D 4 36 ? 10.361  3.258   31.850  1.00 64.93  ? 174 GLN D O   1 
ATOM 1573 C CB  . GLN D 4 36 ? 11.927  1.885   34.324  1.00 71.19  ? 174 GLN D CB  1 
ATOM 1574 C CG  . GLN D 4 36 ? 13.218  1.936   35.116  1.00 69.47  ? 174 GLN D CG  1 
ATOM 1575 C CD  . GLN D 4 36 ? 14.075  0.718   34.898  1.00 68.79  ? 174 GLN D CD  1 
ATOM 1576 O OE1 . GLN D 4 36 ? 13.565  -0.362  34.610  1.00 57.21  ? 174 GLN D OE1 1 
ATOM 1577 N NE2 . GLN D 4 36 ? 15.388  0.881   35.035  1.00 74.90  ? 174 GLN D NE2 1 
ATOM 1578 N N   . ASN D 4 37 ? 9.049   2.894   33.602  1.00 70.11  ? 175 ASN D N   1 
ATOM 1579 C CA  . ASN D 4 37 ? 7.840   2.784   32.809  1.00 79.85  ? 175 ASN D CA  1 
ATOM 1580 C C   . ASN D 4 37 ? 7.578   4.040   32.027  1.00 82.69  ? 175 ASN D C   1 
ATOM 1581 O O   . ASN D 4 37 ? 7.057   3.992   30.921  1.00 88.45  ? 175 ASN D O   1 
ATOM 1582 C CB  . ASN D 4 37 ? 6.644   2.456   33.704  1.00 82.71  ? 175 ASN D CB  1 
ATOM 1583 C CG  . ASN D 4 37 ? 6.615   0.986   34.093  1.00 97.79  ? 175 ASN D CG  1 
ATOM 1584 O OD1 . ASN D 4 37 ? 7.623   0.276   33.946  1.00 101.84 ? 175 ASN D OD1 1 
ATOM 1585 N ND2 . ASN D 4 37 ? 5.465   0.517   34.586  1.00 102.19 ? 175 ASN D ND2 1 
ATOM 1586 N N   . ARG D 4 38 ? 7.952   5.158   32.620  1.00 87.28  ? 176 ARG D N   1 
ATOM 1587 C CA  . ARG D 4 38 ? 7.918   6.440   31.966  1.00 94.83  ? 176 ARG D CA  1 
ATOM 1588 C C   . ARG D 4 38 ? 8.906   6.442   30.793  1.00 93.27  ? 176 ARG D C   1 
ATOM 1589 O O   . ARG D 4 38 ? 8.581   6.887   29.691  1.00 96.79  ? 176 ARG D O   1 
ATOM 1590 C CB  . ARG D 4 38 ? 8.262   7.531   32.987  1.00 100.65 ? 176 ARG D CB  1 
ATOM 1591 C CG  . ARG D 4 38 ? 7.542   8.849   32.789  1.00 118.66 ? 176 ARG D CG  1 
ATOM 1592 C CD  . ARG D 4 38 ? 7.668   9.779   34.014  1.00 129.09 ? 176 ARG D CD  1 
ATOM 1593 N NE  . ARG D 4 38 ? 9.046   10.227  34.274  1.00 137.51 ? 176 ARG D NE  1 
ATOM 1594 C CZ  . ARG D 4 38 ? 9.759   9.969   35.376  1.00 141.45 ? 176 ARG D CZ  1 
ATOM 1595 N NH1 . ARG D 4 38 ? 9.257   9.248   36.379  1.00 142.24 ? 176 ARG D NH1 1 
ATOM 1596 N NH2 . ARG D 4 38 ? 10.999  10.441  35.478  1.00 140.02 ? 176 ARG D NH2 1 
ATOM 1597 N N   . GLN D 4 39 ? 10.109  5.932   31.047  1.00 89.49  ? 177 GLN D N   1 
ATOM 1598 C CA  . GLN D 4 39 ? 11.166  5.844   30.040  1.00 90.41  ? 177 GLN D CA  1 
ATOM 1599 C C   . GLN D 4 39 ? 10.763  4.990   28.850  1.00 86.50  ? 177 GLN D C   1 
ATOM 1600 O O   . GLN D 4 39 ? 11.033  5.325   27.699  1.00 92.02  ? 177 GLN D O   1 
ATOM 1601 C CB  . GLN D 4 39 ? 12.453  5.289   30.670  1.00 93.54  ? 177 GLN D CB  1 
ATOM 1602 C CG  . GLN D 4 39 ? 13.708  5.553   29.837  1.00 105.96 ? 177 GLN D CG  1 
ATOM 1603 C CD  . GLN D 4 39 ? 15.014  5.074   30.479  1.00 112.33 ? 177 GLN D CD  1 
ATOM 1604 O OE1 . GLN D 4 39 ? 15.071  4.732   31.667  1.00 108.18 ? 177 GLN D OE1 1 
ATOM 1605 N NE2 . GLN D 4 39 ? 16.078  5.053   29.679  1.00 115.09 ? 177 GLN D NE2 1 
ATOM 1606 N N   . ILE D 4 40 ? 10.111  3.880   29.135  1.00 85.21  ? 178 ILE D N   1 
ATOM 1607 C CA  . ILE D 4 40 ? 9.646   2.983   28.090  1.00 88.35  ? 178 ILE D CA  1 
ATOM 1608 C C   . ILE D 4 40 ? 8.551   3.657   27.265  1.00 93.46  ? 178 ILE D C   1 
ATOM 1609 O O   . ILE D 4 40 ? 8.538   3.539   26.040  1.00 101.20 ? 178 ILE D O   1 
ATOM 1610 C CB  . ILE D 4 40 ? 9.153   1.659   28.686  1.00 85.68  ? 178 ILE D CB  1 
ATOM 1611 C CG1 . ILE D 4 40 ? 10.348  0.745   28.991  1.00 85.37  ? 178 ILE D CG1 1 
ATOM 1612 C CG2 . ILE D 4 40 ? 8.243   0.959   27.732  1.00 75.15  ? 178 ILE D CG2 1 
ATOM 1613 C CD1 . ILE D 4 40 ? 11.506  1.420   29.745  1.00 81.77  ? 178 ILE D CD1 1 
ATOM 1614 N N   . ASP D 4 41 ? 7.642   4.364   27.925  1.00 95.72  ? 179 ASP D N   1 
ATOM 1615 C CA  . ASP D 4 41 ? 6.635   5.142   27.207  1.00 103.86 ? 179 ASP D CA  1 
ATOM 1616 C C   . ASP D 4 41 ? 7.271   6.061   26.175  1.00 106.07 ? 179 ASP D C   1 
ATOM 1617 O O   . ASP D 4 41 ? 6.800   6.138   25.039  1.00 113.72 ? 179 ASP D O   1 
ATOM 1618 C CB  . ASP D 4 41 ? 5.800   5.966   28.177  1.00 107.90 ? 179 ASP D CB  1 
ATOM 1619 C CG  . ASP D 4 41 ? 4.900   5.107   29.029  1.00 122.58 ? 179 ASP D CG  1 
ATOM 1620 O OD1 . ASP D 4 41 ? 4.109   4.331   28.449  1.00 132.42 ? 179 ASP D OD1 1 
ATOM 1621 O OD2 . ASP D 4 41 ? 4.982   5.206   30.274  1.00 142.13 ? 179 ASP D OD2 1 
ATOM 1622 N N   . ARG D 4 42 ? 8.338   6.752   26.574  1.00 106.83 ? 180 ARG D N   1 
ATOM 1623 C CA  . ARG D 4 42 ? 9.112   7.582   25.646  1.00 110.50 ? 180 ARG D CA  1 
ATOM 1624 C C   . ARG D 4 42 ? 9.578   6.771   24.451  1.00 108.76 ? 180 ARG D C   1 
ATOM 1625 O O   . ARG D 4 42 ? 9.242   7.084   23.300  1.00 115.88 ? 180 ARG D O   1 
ATOM 1626 C CB  . ARG D 4 42 ? 10.337  8.205   26.330  1.00 113.77 ? 180 ARG D CB  1 
ATOM 1627 C CG  . ARG D 4 42 ? 10.041  9.484   27.099  1.00 122.33 ? 180 ARG D CG  1 
ATOM 1628 C CD  . ARG D 4 42 ? 11.315  10.127  27.660  1.00 125.76 ? 180 ARG D CD  1 
ATOM 1629 N NE  . ARG D 4 42 ? 11.861  9.398   28.805  1.00 126.75 ? 180 ARG D NE  1 
ATOM 1630 C CZ  . ARG D 4 42 ? 11.327  9.391   30.028  1.00 137.11 ? 180 ARG D CZ  1 
ATOM 1631 N NH1 . ARG D 4 42 ? 10.214  10.074  30.291  1.00 140.32 ? 180 ARG D NH1 1 
ATOM 1632 N NH2 . ARG D 4 42 ? 11.905  8.693   31.002  1.00 138.64 ? 180 ARG D NH2 1 
ATOM 1633 N N   . ILE D 4 43 ? 10.351  5.726   24.731  1.00 103.74 ? 181 ILE D N   1 
ATOM 1634 C CA  . ILE D 4 43 ? 10.948  4.919   23.664  1.00 105.33 ? 181 ILE D CA  1 
ATOM 1635 C C   . ILE D 4 43 ? 9.881   4.426   22.659  1.00 110.62 ? 181 ILE D C   1 
ATOM 1636 O O   . ILE D 4 43 ? 10.115  4.444   21.453  1.00 116.12 ? 181 ILE D O   1 
ATOM 1637 C CB  . ILE D 4 43 ? 11.786  3.758   24.249  1.00 102.37 ? 181 ILE D CB  1 
ATOM 1638 C CG1 . ILE D 4 43 ? 13.004  4.324   24.973  1.00 93.10  ? 181 ILE D CG1 1 
ATOM 1639 C CG2 . ILE D 4 43 ? 12.235  2.795   23.164  1.00 92.31  ? 181 ILE D CG2 1 
ATOM 1640 C CD1 . ILE D 4 43 ? 14.021  3.291   25.355  1.00 84.49  ? 181 ILE D CD1 1 
ATOM 1641 N N   . MET D 4 44 ? 8.721   3.998   23.145  1.00 114.01 ? 182 MET D N   1 
ATOM 1642 C CA  . MET D 4 44 ? 7.625   3.610   22.247  1.00 123.57 ? 182 MET D CA  1 
ATOM 1643 C C   . MET D 4 44 ? 7.181   4.735   21.301  1.00 127.49 ? 182 MET D C   1 
ATOM 1644 O O   . MET D 4 44 ? 6.904   4.477   20.122  1.00 133.06 ? 182 MET D O   1 
ATOM 1645 C CB  . MET D 4 44 ? 6.413   3.140   23.045  1.00 127.02 ? 182 MET D CB  1 
ATOM 1646 C CG  . MET D 4 44 ? 6.559   1.751   23.627  1.00 136.32 ? 182 MET D CG  1 
ATOM 1647 S SD  . MET D 4 44 ? 5.011   1.154   24.357  1.00 153.65 ? 182 MET D SD  1 
ATOM 1648 C CE  . MET D 4 44 ? 4.601   2.485   25.495  1.00 144.33 ? 182 MET D CE  1 
ATOM 1649 N N   . GLU D 4 45 ? 7.108   5.967   21.809  1.00 128.14 ? 183 GLU D N   1 
ATOM 1650 C CA  . GLU D 4 45 ? 6.770   7.128   20.968  1.00 132.91 ? 183 GLU D CA  1 
ATOM 1651 C C   . GLU D 4 45 ? 7.835   7.423   19.913  1.00 134.37 ? 183 GLU D C   1 
ATOM 1652 O O   . GLU D 4 45 ? 7.514   7.761   18.760  1.00 136.68 ? 183 GLU D O   1 
ATOM 1653 C CB  . GLU D 4 45 ? 6.589   8.388   21.805  1.00 133.57 ? 183 GLU D CB  1 
ATOM 1654 C CG  . GLU D 4 45 ? 5.348   8.419   22.656  1.00 140.81 ? 183 GLU D CG  1 
ATOM 1655 C CD  . GLU D 4 45 ? 5.244   9.718   23.431  1.00 147.51 ? 183 GLU D CD  1 
ATOM 1656 O OE1 . GLU D 4 45 ? 5.656   10.767  22.886  1.00 144.11 ? 183 GLU D OE1 1 
ATOM 1657 O OE2 . GLU D 4 45 ? 4.755   9.694   24.582  1.00 155.10 ? 183 GLU D OE2 1 
ATOM 1658 N N   . LYS D 4 46 ? 9.101   7.298   20.316  1.00 132.26 ? 184 LYS D N   1 
ATOM 1659 C CA  . LYS D 4 46 ? 10.235  7.587   19.423  1.00 136.22 ? 184 LYS D CA  1 
ATOM 1660 C C   . LYS D 4 46 ? 10.347  6.566   18.281  1.00 134.34 ? 184 LYS D C   1 
ATOM 1661 O O   . LYS D 4 46 ? 10.518  6.943   17.114  1.00 134.77 ? 184 LYS D O   1 
ATOM 1662 C CB  . LYS D 4 46 ? 11.549  7.654   20.221  1.00 137.10 ? 184 LYS D CB  1 
ATOM 1663 C CG  . LYS D 4 46 ? 11.582  8.780   21.258  1.00 145.69 ? 184 LYS D CG  1 
ATOM 1664 C CD  . LYS D 4 46 ? 12.812  8.725   22.169  1.00 152.77 ? 184 LYS D CD  1 
ATOM 1665 C CE  . LYS D 4 46 ? 12.757  9.813   23.251  1.00 153.53 ? 184 LYS D CE  1 
ATOM 1666 N NZ  . LYS D 4 46 ? 13.996  9.882   24.087  1.00 151.84 ? 184 LYS D NZ  1 
ATOM 1667 N N   . ALA D 4 47 ? 10.249  5.281   18.625  1.00 130.75 ? 185 ALA D N   1 
ATOM 1668 C CA  . ALA D 4 47 ? 10.302  4.202   17.635  1.00 133.07 ? 185 ALA D CA  1 
ATOM 1669 C C   . ALA D 4 47 ? 9.175   4.329   16.617  1.00 136.58 ? 185 ALA D C   1 
ATOM 1670 O O   . ALA D 4 47 ? 9.401   4.115   15.430  1.00 140.78 ? 185 ALA D O   1 
ATOM 1671 C CB  . ALA D 4 47 ? 10.253  2.839   18.312  1.00 130.62 ? 185 ALA D CB  1 
ATOM 1672 N N   . ASP D 4 48 ? 7.971   4.675   17.077  1.00 139.13 ? 186 ASP D N   1 
ATOM 1673 C CA  . ASP D 4 48 ? 6.843   4.926   16.170  1.00 143.31 ? 186 ASP D CA  1 
ATOM 1674 C C   . ASP D 4 48 ? 7.167   6.084   15.202  1.00 144.15 ? 186 ASP D C   1 
ATOM 1675 O O   . ASP D 4 48 ? 6.823   6.037   14.003  1.00 145.87 ? 186 ASP D O   1 
ATOM 1676 C CB  . ASP D 4 48 ? 5.561   5.215   16.970  1.00 144.75 ? 186 ASP D CB  1 
ATOM 1677 C CG  . ASP D 4 48 ? 4.282   4.891   16.193  1.00 152.54 ? 186 ASP D CG  1 
ATOM 1678 O OD1 . ASP D 4 48 ? 4.315   4.813   14.941  1.00 158.79 ? 186 ASP D OD1 1 
ATOM 1679 O OD2 . ASP D 4 48 ? 3.231   4.714   16.851  1.00 155.57 ? 186 ASP D OD2 1 
ATOM 1680 N N   . SER D 4 49 ? 7.834   7.116   15.725  1.00 142.87 ? 187 SER D N   1 
ATOM 1681 C CA  . SER D 4 49 ? 8.250   8.259   14.902  1.00 143.29 ? 187 SER D CA  1 
ATOM 1682 C C   . SER D 4 49 ? 9.357   7.912   13.893  1.00 141.09 ? 187 SER D C   1 
ATOM 1683 O O   . SER D 4 49 ? 9.378   8.474   12.805  1.00 143.58 ? 187 SER D O   1 
ATOM 1684 C CB  . SER D 4 49 ? 8.705   9.427   15.779  1.00 143.93 ? 187 SER D CB  1 
ATOM 1685 O OG  . SER D 4 49 ? 8.799   10.610  15.005  1.00 146.49 ? 187 SER D OG  1 
ATOM 1686 N N   . ASN D 4 50 ? 10.265  7.001   14.246  1.00 138.14 ? 188 ASN D N   1 
ATOM 1687 C CA  . ASN D 4 50 ? 11.291  6.525   13.298  1.00 136.37 ? 188 ASN D CA  1 
ATOM 1688 C C   . ASN D 4 50 ? 10.796  5.471   12.317  1.00 140.22 ? 188 ASN D C   1 
ATOM 1689 O O   . ASN D 4 50 ? 11.411  5.269   11.270  1.00 142.26 ? 188 ASN D O   1 
ATOM 1690 C CB  . ASN D 4 50 ? 12.495  5.986   14.051  1.00 132.87 ? 188 ASN D CB  1 
ATOM 1691 C CG  . ASN D 4 50 ? 13.225  7.067   14.781  1.00 128.38 ? 188 ASN D CG  1 
ATOM 1692 O OD1 . ASN D 4 50 ? 13.164  8.231   14.396  1.00 111.88 ? 188 ASN D OD1 1 
ATOM 1693 N ND2 . ASN D 4 50 ? 13.923  6.700   15.842  1.00 134.68 ? 188 ASN D ND2 1 
ATOM 1694 N N   . LYS D 4 51 ? 9.698   4.798   12.656  1.00 144.43 ? 189 LYS D N   1 
ATOM 1695 C CA  . LYS D 4 51 ? 8.965   3.992   11.687  1.00 149.61 ? 189 LYS D CA  1 
ATOM 1696 C C   . LYS D 4 51 ? 8.555   4.919   10.564  1.00 148.69 ? 189 LYS D C   1 
ATOM 1697 O O   . LYS D 4 51 ? 8.967   4.744   9.414   1.00 149.97 ? 189 LYS D O   1 
ATOM 1698 C CB  . LYS D 4 51 ? 7.711   3.332   12.289  1.00 152.87 ? 189 LYS D CB  1 
ATOM 1699 C CG  . LYS D 4 51 ? 7.954   2.069   13.120  1.00 162.79 ? 189 LYS D CG  1 
ATOM 1700 C CD  . LYS D 4 51 ? 6.657   1.542   13.771  1.00 168.73 ? 189 LYS D CD  1 
ATOM 1701 C CE  . LYS D 4 51 ? 6.936   0.409   14.774  1.00 170.40 ? 189 LYS D CE  1 
ATOM 1702 N NZ  . LYS D 4 51 ? 5.707   -0.068  15.478  1.00 168.71 ? 189 LYS D NZ  1 
ATOM 1703 N N   . THR D 4 52 ? 7.742   5.915   10.910  1.00 147.88 ? 190 THR D N   1 
ATOM 1704 C CA  . THR D 4 52 ? 7.224   6.842   9.907   1.00 149.20 ? 190 THR D CA  1 
ATOM 1705 C C   . THR D 4 52 ? 8.357   7.556   9.143   1.00 148.03 ? 190 THR D C   1 
ATOM 1706 O O   . THR D 4 52 ? 8.207   7.863   7.954   1.00 150.55 ? 190 THR D O   1 
ATOM 1707 C CB  . THR D 4 52 ? 6.236   7.870   10.532  1.00 150.44 ? 190 THR D CB  1 
ATOM 1708 O OG1 . THR D 4 52 ? 6.827   8.481   11.684  1.00 154.82 ? 190 THR D OG1 1 
ATOM 1709 C CG2 . THR D 4 52 ? 4.927   7.190   10.942  1.00 149.60 ? 190 THR D CG2 1 
ATOM 1710 N N   . ARG D 4 53 ? 9.482   7.805   9.817   1.00 147.28 ? 191 ARG D N   1 
ATOM 1711 C CA  . ARG D 4 53 ? 10.602  8.552   9.219   1.00 149.79 ? 191 ARG D CA  1 
ATOM 1712 C C   . ARG D 4 53 ? 11.420  7.718   8.226   1.00 150.17 ? 191 ARG D C   1 
ATOM 1713 O O   . ARG D 4 53 ? 11.754  8.198   7.140   1.00 152.41 ? 191 ARG D O   1 
ATOM 1714 C CB  . ARG D 4 53 ? 11.532  9.111   10.306  1.00 151.77 ? 191 ARG D CB  1 
ATOM 1715 C CG  . ARG D 4 53 ? 12.320  10.363  9.889   1.00 157.49 ? 191 ARG D CG  1 
ATOM 1716 C CD  . ARG D 4 53 ? 11.484  11.646  10.009  1.00 168.95 ? 191 ARG D CD  1 
ATOM 1717 N NE  . ARG D 4 53 ? 11.320  12.097  11.397  1.00 179.66 ? 191 ARG D NE  1 
ATOM 1718 C CZ  . ARG D 4 53 ? 10.484  13.059  11.801  1.00 188.93 ? 191 ARG D CZ  1 
ATOM 1719 N NH1 . ARG D 4 53 ? 9.706   13.704  10.931  1.00 192.53 ? 191 ARG D NH1 1 
ATOM 1720 N NH2 . ARG D 4 53 ? 10.422  13.384  13.091  1.00 189.90 ? 191 ARG D NH2 1 
ATOM 1721 N N   . ILE D 4 54 ? 11.747  6.480   8.590   1.00 149.33 ? 192 ILE D N   1 
ATOM 1722 C CA  . ILE D 4 54 ? 12.530  5.611   7.696   1.00 152.43 ? 192 ILE D CA  1 
ATOM 1723 C C   . ILE D 4 54 ? 11.716  5.118   6.497   1.00 153.70 ? 192 ILE D C   1 
ATOM 1724 O O   . ILE D 4 54 ? 12.279  4.799   5.447   1.00 157.74 ? 192 ILE D O   1 
ATOM 1725 C CB  . ILE D 4 54 ? 13.110  4.400   8.440   1.00 154.24 ? 192 ILE D CB  1 
ATOM 1726 C CG1 . ILE D 4 54 ? 14.161  4.871   9.443   1.00 157.04 ? 192 ILE D CG1 1 
ATOM 1727 C CG2 . ILE D 4 54 ? 13.724  3.406   7.459   1.00 154.49 ? 192 ILE D CG2 1 
ATOM 1728 C CD1 . ILE D 4 54 ? 14.760  3.762   10.266  1.00 162.14 ? 192 ILE D CD1 1 
ATOM 1729 N N   . ASP D 4 55 ? 10.397  5.056   6.653   1.00 153.35 ? 193 ASP D N   1 
ATOM 1730 C CA  . ASP D 4 55 ? 9.526   4.663   5.547   1.00 154.92 ? 193 ASP D CA  1 
ATOM 1731 C C   . ASP D 4 55 ? 9.415   5.780   4.487   1.00 155.72 ? 193 ASP D C   1 
ATOM 1732 O O   . ASP D 4 55 ? 9.691   5.538   3.297   1.00 159.85 ? 193 ASP D O   1 
ATOM 1733 C CB  . ASP D 4 55 ? 8.156   4.233   6.087   1.00 154.96 ? 193 ASP D CB  1 
ATOM 1734 C CG  . ASP D 4 55 ? 8.243   2.987   6.970   1.00 152.90 ? 193 ASP D CG  1 
ATOM 1735 O OD1 . ASP D 4 55 ? 9.314   2.338   6.983   1.00 146.12 ? 193 ASP D OD1 1 
ATOM 1736 O OD2 . ASP D 4 55 ? 7.246   2.654   7.649   1.00 151.71 ? 193 ASP D OD2 1 
ATOM 1737 N N   . GLU D 4 56 ? 9.030   6.994   4.898   1.00 153.86 ? 194 GLU D N   1 
ATOM 1738 C CA  . GLU D 4 56 ? 8.990   8.131   3.949   1.00 153.39 ? 194 GLU D CA  1 
ATOM 1739 C C   . GLU D 4 56 ? 10.390  8.438   3.347   1.00 155.27 ? 194 GLU D C   1 
ATOM 1740 O O   . GLU D 4 56 ? 10.505  8.939   2.211   1.00 157.02 ? 194 GLU D O   1 
ATOM 1741 C CB  . GLU D 4 56 ? 8.342   9.378   4.593   1.00 151.20 ? 194 GLU D CB  1 
ATOM 1742 C CG  . GLU D 4 56 ? 9.127   10.047  5.730   1.00 145.39 ? 194 GLU D CG  1 
ATOM 1743 C CD  . GLU D 4 56 ? 8.281   11.017  6.574   1.00 136.62 ? 194 GLU D CD  1 
ATOM 1744 O OE1 . GLU D 4 56 ? 7.032   10.931  6.547   1.00 120.34 ? 194 GLU D OE1 1 
ATOM 1745 O OE2 . GLU D 4 56 ? 8.875   11.871  7.271   1.00 123.58 ? 194 GLU D OE2 1 
ATOM 1746 N N   . ALA D 4 57 ? 11.439  8.123   4.111   1.00 156.61 ? 195 ALA D N   1 
ATOM 1747 C CA  . ALA D 4 57 ? 12.832  8.320   3.679   1.00 158.76 ? 195 ALA D CA  1 
ATOM 1748 C C   . ALA D 4 57 ? 13.240  7.471   2.467   1.00 160.72 ? 195 ALA D C   1 
ATOM 1749 O O   . ALA D 4 57 ? 13.631  8.019   1.426   1.00 162.16 ? 195 ALA D O   1 
ATOM 1750 C CB  . ALA D 4 57 ? 13.777  8.043   4.842   1.00 159.51 ? 195 ALA D CB  1 
ATOM 1751 N N   . ASN D 4 58 ? 13.158  6.143   2.599   1.00 161.52 ? 196 ASN D N   1 
ATOM 1752 C CA  . ASN D 4 58 ? 13.526  5.245   1.488   1.00 163.56 ? 196 ASN D CA  1 
ATOM 1753 C C   . ASN D 4 58 ? 12.607  5.438   0.268   1.00 164.23 ? 196 ASN D C   1 
ATOM 1754 O O   . ASN D 4 58 ? 13.010  5.140   -0.860  1.00 165.68 ? 196 ASN D O   1 
ATOM 1755 C CB  . ASN D 4 58 ? 13.601  3.765   1.931   1.00 164.38 ? 196 ASN D CB  1 
ATOM 1756 C CG  . ASN D 4 58 ? 12.283  3.229   2.472   1.00 163.93 ? 196 ASN D CG  1 
ATOM 1757 O OD1 . ASN D 4 58 ? 11.249  3.304   1.811   1.00 165.99 ? 196 ASN D OD1 1 
ATOM 1758 N ND2 . ASN D 4 58 ? 12.322  2.675   3.683   1.00 156.25 ? 196 ASN D ND2 1 
ATOM 1759 N N   . GLN D 4 59 ? 11.387  5.936   0.500   1.00 164.43 ? 197 GLN D N   1 
ATOM 1760 C CA  . GLN D 4 59 ? 10.491  6.333   -0.603  1.00 166.62 ? 197 GLN D CA  1 
ATOM 1761 C C   . GLN D 4 59 ? 11.028  7.492   -1.451  1.00 165.86 ? 197 GLN D C   1 
ATOM 1762 O O   . GLN D 4 59 ? 10.755  7.546   -2.648  1.00 167.10 ? 197 GLN D O   1 
ATOM 1763 C CB  . GLN D 4 59 ? 9.106   6.712   -0.077  1.00 166.69 ? 197 GLN D CB  1 
ATOM 1764 C CG  . GLN D 4 59 ? 8.260   5.528   0.326   1.00 169.42 ? 197 GLN D CG  1 
ATOM 1765 C CD  . GLN D 4 59 ? 6.993   5.952   1.033   1.00 172.22 ? 197 GLN D CD  1 
ATOM 1766 O OE1 . GLN D 4 59 ? 6.358   6.937   0.653   1.00 173.56 ? 197 GLN D OE1 1 
ATOM 1767 N NE2 . GLN D 4 59 ? 6.616   5.209   2.068   1.00 173.23 ? 197 GLN D NE2 1 
ATOM 1768 N N   . ARG D 4 60 ? 11.775  8.415   -0.841  1.00 163.92 ? 198 ARG D N   1 
ATOM 1769 C CA  . ARG D 4 60 ? 12.454  9.470   -1.618  1.00 164.83 ? 198 ARG D CA  1 
ATOM 1770 C C   . ARG D 4 60 ? 13.775  8.989   -2.242  1.00 164.32 ? 198 ARG D C   1 
ATOM 1771 O O   . ARG D 4 60 ? 14.102  9.372   -3.372  1.00 166.82 ? 198 ARG D O   1 
ATOM 1772 C CB  . ARG D 4 60 ? 12.713  10.709  -0.759  1.00 165.57 ? 198 ARG D CB  1 
ATOM 1773 C CG  . ARG D 4 60 ? 11.458  11.464  -0.338  1.00 172.39 ? 198 ARG D CG  1 
ATOM 1774 C CD  . ARG D 4 60 ? 11.814  12.655  0.550   1.00 181.84 ? 198 ARG D CD  1 
ATOM 1775 N NE  . ARG D 4 60 ? 10.657  13.218  1.250   1.00 189.10 ? 198 ARG D NE  1 
ATOM 1776 C CZ  . ARG D 4 60 ? 10.716  14.204  2.148   1.00 194.23 ? 198 ARG D CZ  1 
ATOM 1777 N NH1 . ARG D 4 60 ? 11.880  14.760  2.476   1.00 196.38 ? 198 ARG D NH1 1 
ATOM 1778 N NH2 . ARG D 4 60 ? 9.601   14.643  2.728   1.00 195.55 ? 198 ARG D NH2 1 
ATOM 1779 N N   . ALA D 4 61 ? 14.526  8.159   -1.515  1.00 163.75 ? 199 ALA D N   1 
ATOM 1780 C CA  . ALA D 4 61 ? 15.823  7.655   -2.003  1.00 165.03 ? 199 ALA D CA  1 
ATOM 1781 C C   . ALA D 4 61 ? 15.674  6.747   -3.226  1.00 168.21 ? 199 ALA D C   1 
ATOM 1782 O O   . ALA D 4 61 ? 16.396  6.902   -4.219  1.00 170.75 ? 199 ALA D O   1 
ATOM 1783 C CB  . ALA D 4 61 ? 16.563  6.924   -0.896  1.00 163.85 ? 199 ALA D CB  1 
ATOM 1784 N N   . THR D 4 62 ? 14.740  5.800   -3.156  1.00 170.57 ? 200 THR D N   1 
ATOM 1785 C CA  . THR D 4 62 ? 14.441  4.931   -4.305  1.00 173.46 ? 200 THR D CA  1 
ATOM 1786 C C   . THR D 4 62 ? 13.538  5.639   -5.332  1.00 173.71 ? 200 THR D C   1 
ATOM 1787 O O   . THR D 4 62 ? 13.482  5.234   -6.496  1.00 174.64 ? 200 THR D O   1 
ATOM 1788 C CB  . THR D 4 62 ? 13.794  3.601   -3.866  1.00 174.07 ? 200 THR D CB  1 
ATOM 1789 O OG1 . THR D 4 62 ? 14.467  3.105   -2.703  1.00 179.05 ? 200 THR D OG1 1 
ATOM 1790 C CG2 . THR D 4 62 ? 13.889  2.564   -4.975  1.00 172.63 ? 200 THR D CG2 1 
ATOM 1791 N N   . LYS D 4 63 ? 12.837  6.689   -4.899  1.00 172.24 ? 201 LYS D N   1 
ATOM 1792 C CA  . LYS D 4 63 ? 12.116  7.573   -5.817  1.00 172.28 ? 201 LYS D CA  1 
ATOM 1793 C C   . LYS D 4 63 ? 13.093  8.394   -6.663  1.00 173.88 ? 201 LYS D C   1 
ATOM 1794 O O   . LYS D 4 63 ? 12.754  8.794   -7.777  1.00 175.41 ? 201 LYS D O   1 
ATOM 1795 C CB  . LYS D 4 63 ? 11.170  8.493   -5.058  1.00 169.78 ? 201 LYS D CB  1 
ATOM 1796 N N   . MET D 4 64 ? 14.296  8.644   -6.138  1.00 174.25 ? 202 MET D N   1 
ATOM 1797 C CA  . MET D 4 64 ? 15.370  9.255   -6.937  1.00 175.45 ? 202 MET D CA  1 
ATOM 1798 C C   . MET D 4 64 ? 15.925  8.291   -8.004  1.00 176.68 ? 202 MET D C   1 
ATOM 1799 O O   . MET D 4 64 ? 16.266  8.727   -9.108  1.00 177.47 ? 202 MET D O   1 
ATOM 1800 C CB  . MET D 4 64 ? 16.510  9.759   -6.041  1.00 175.71 ? 202 MET D CB  1 
ATOM 1801 C CG  . MET D 4 64 ? 17.643  10.444  -6.804  1.00 177.58 ? 202 MET D CG  1 
ATOM 1802 S SD  . MET D 4 64 ? 18.928  11.101  -5.730  1.00 187.53 ? 202 MET D SD  1 
ATOM 1803 C CE  . MET D 4 64 ? 20.245  11.369  -6.914  1.00 185.96 ? 202 MET D CE  1 
ATOM 1804 N N   . LEU D 4 65 ? 16.019  6.996   -7.682  1.00 176.11 ? 203 LEU D N   1 
ATOM 1805 C CA  . LEU D 4 65 ? 16.563  6.000   -8.633  1.00 177.65 ? 203 LEU D CA  1 
ATOM 1806 C C   . LEU D 4 65 ? 15.797  4.678   -8.653  1.00 178.41 ? 203 LEU D C   1 
ATOM 1807 O O   . LEU D 4 65 ? 15.923  3.848   -7.750  1.00 177.96 ? 203 LEU D O   1 
ATOM 1808 C CB  . LEU D 4 65 ? 18.026  5.713   -8.305  1.00 178.74 ? 203 LEU D CB  1 
ATOM 1809 C CG  . LEU D 4 65 ? 18.979  6.872   -8.590  1.00 176.26 ? 203 LEU D CG  1 
ATOM 1810 C CD1 . LEU D 4 65 ? 20.207  6.730   -7.731  1.00 179.35 ? 203 LEU D CD1 1 
ATOM 1811 C CD2 . LEU D 4 65 ? 19.335  6.928   -10.074 1.00 169.57 ? 203 LEU D CD2 1 
ATOM 1812 O OXT . LEU D 4 65 ? 15.038  4.409   -9.584  1.00 178.04 ? 203 LEU D OXT 1 
ATOM 1813 N N   . GLY E 5 4  ? 28.096  -33.967 -19.949 1.00 129.76 ? 24  GLY E N   1 
ATOM 1814 C CA  . GLY E 5 4  ? 27.877  -32.826 -20.891 1.00 133.21 ? 24  GLY E CA  1 
ATOM 1815 C C   . GLY E 5 4  ? 28.113  -31.477 -20.233 1.00 136.95 ? 24  GLY E C   1 
ATOM 1816 O O   . GLY E 5 4  ? 28.967  -30.705 -20.679 1.00 137.19 ? 24  GLY E O   1 
ATOM 1817 N N   . SER E 5 5  ? 27.341  -31.204 -19.175 1.00 139.85 ? 25  SER E N   1 
ATOM 1818 C CA  . SER E 5 5  ? 27.537  -30.027 -18.306 1.00 141.75 ? 25  SER E CA  1 
ATOM 1819 C C   . SER E 5 5  ? 27.303  -30.323 -16.811 1.00 142.68 ? 25  SER E C   1 
ATOM 1820 O O   . SER E 5 5  ? 28.012  -29.787 -15.961 1.00 144.66 ? 25  SER E O   1 
ATOM 1821 C CB  . SER E 5 5  ? 26.649  -28.865 -18.745 1.00 140.96 ? 25  SER E CB  1 
ATOM 1822 O OG  . SER E 5 5  ? 27.110  -27.656 -18.168 1.00 135.91 ? 25  SER E OG  1 
ATOM 1823 N N   . LYS E 5 6  ? 26.310  -31.160 -16.503 1.00 143.12 ? 26  LYS E N   1 
ATOM 1824 C CA  . LYS E 5 6  ? 26.112  -31.744 -15.156 1.00 145.80 ? 26  LYS E CA  1 
ATOM 1825 C C   . LYS E 5 6  ? 25.926  -30.749 -13.996 1.00 146.66 ? 26  LYS E C   1 
ATOM 1826 O O   . LYS E 5 6  ? 26.558  -30.891 -12.942 1.00 142.45 ? 26  LYS E O   1 
ATOM 1827 C CB  . LYS E 5 6  ? 27.281  -32.677 -14.802 1.00 148.36 ? 26  LYS E CB  1 
ATOM 1828 C CG  . LYS E 5 6  ? 27.528  -33.821 -15.765 1.00 150.55 ? 26  LYS E CG  1 
ATOM 1829 C CD  . LYS E 5 6  ? 28.661  -34.680 -15.229 1.00 153.93 ? 26  LYS E CD  1 
ATOM 1830 C CE  . LYS E 5 6  ? 28.860  -35.939 -16.032 1.00 157.20 ? 26  LYS E CE  1 
ATOM 1831 N NZ  . LYS E 5 6  ? 29.843  -36.835 -15.363 1.00 156.87 ? 26  LYS E NZ  1 
ATOM 1832 N N   . LEU E 5 7  ? 25.061  -29.753 -14.187 1.00 149.89 ? 27  LEU E N   1 
ATOM 1833 C CA  . LEU E 5 7  ? 24.787  -28.751 -13.141 1.00 150.47 ? 27  LEU E CA  1 
ATOM 1834 C C   . LEU E 5 7  ? 23.299  -28.374 -12.964 1.00 148.91 ? 27  LEU E C   1 
ATOM 1835 O O   . LEU E 5 7  ? 22.951  -27.191 -12.895 1.00 143.11 ? 27  LEU E O   1 
ATOM 1836 C CB  . LEU E 5 7  ? 25.610  -27.491 -13.421 1.00 153.87 ? 27  LEU E CB  1 
ATOM 1837 C CG  . LEU E 5 7  ? 25.953  -26.669 -12.184 1.00 154.25 ? 27  LEU E CG  1 
ATOM 1838 C CD1 . LEU E 5 7  ? 27.110  -27.330 -11.454 1.00 153.86 ? 27  LEU E CD1 1 
ATOM 1839 C CD2 . LEU E 5 7  ? 26.280  -25.219 -12.553 1.00 154.86 ? 27  LEU E CD2 1 
ATOM 1840 N N   . PRO E 5 8  ? 22.414  -29.382 -12.889 1.00 151.77 ? 28  PRO E N   1 
ATOM 1841 C CA  . PRO E 5 8  ? 21.074  -29.132 -12.368 1.00 154.47 ? 28  PRO E CA  1 
ATOM 1842 C C   . PRO E 5 8  ? 21.069  -29.249 -10.843 1.00 156.34 ? 28  PRO E C   1 
ATOM 1843 O O   . PRO E 5 8  ? 20.047  -28.982 -10.198 1.00 156.06 ? 28  PRO E O   1 
ATOM 1844 C CB  . PRO E 5 8  ? 20.251  -30.255 -12.988 1.00 154.31 ? 28  PRO E CB  1 
ATOM 1845 C CG  . PRO E 5 8  ? 21.214  -31.401 -13.063 1.00 153.88 ? 28  PRO E CG  1 
ATOM 1846 C CD  . PRO E 5 8  ? 22.587  -30.795 -13.281 1.00 151.91 ? 28  PRO E CD  1 
ATOM 1847 N N   . ASP E 5 9  ? 22.214  -29.650 -10.285 1.00 157.77 ? 29  ASP E N   1 
ATOM 1848 C CA  . ASP E 5 9  ? 22.373  -29.842 -8.852  1.00 157.20 ? 29  ASP E CA  1 
ATOM 1849 C C   . ASP E 5 9  ? 22.441  -28.501 -8.155  1.00 156.71 ? 29  ASP E C   1 
ATOM 1850 O O   . ASP E 5 9  ? 21.739  -28.280 -7.180  1.00 153.15 ? 29  ASP E O   1 
ATOM 1851 C CB  . ASP E 5 9  ? 23.640  -30.644 -8.550  1.00 159.41 ? 29  ASP E CB  1 
ATOM 1852 C CG  . ASP E 5 9  ? 23.653  -32.004 -9.230  1.00 162.38 ? 29  ASP E CG  1 
ATOM 1853 O OD1 . ASP E 5 9  ? 22.767  -32.264 -10.073 1.00 164.18 ? 29  ASP E OD1 1 
ATOM 1854 O OD2 . ASP E 5 9  ? 24.554  -32.812 -8.920  1.00 167.94 ? 29  ASP E OD2 1 
ATOM 1855 N N   . ALA E 5 10 ? 23.283  -27.605 -8.660  1.00 159.49 ? 30  ALA E N   1 
ATOM 1856 C CA  . ALA E 5 10 ? 23.379  -26.250 -8.116  1.00 162.89 ? 30  ALA E CA  1 
ATOM 1857 C C   . ALA E 5 10 ? 21.999  -25.609 -7.933  1.00 165.30 ? 30  ALA E C   1 
ATOM 1858 O O   . ALA E 5 10 ? 21.811  -24.788 -7.034  1.00 169.36 ? 30  ALA E O   1 
ATOM 1859 C CB  . ALA E 5 10 ? 24.243  -25.398 -9.006  1.00 165.50 ? 30  ALA E CB  1 
ATOM 1860 N N   . ALA E 5 11 ? 21.047  -25.991 -8.787  1.00 168.46 ? 31  ALA E N   1 
ATOM 1861 C CA  . ALA E 5 11 ? 19.637  -25.637 -8.612  1.00 171.37 ? 31  ALA E CA  1 
ATOM 1862 C C   . ALA E 5 11 ? 19.059  -26.294 -7.369  1.00 174.15 ? 31  ALA E C   1 
ATOM 1863 O O   . ALA E 5 11 ? 18.303  -25.673 -6.628  1.00 177.93 ? 31  ALA E O   1 
ATOM 1864 C CB  . ALA E 5 11 ? 18.834  -26.048 -9.824  1.00 170.92 ? 31  ALA E CB  1 
ATOM 1865 N N   . LYS E 5 12 ? 19.418  -27.553 -7.146  1.00 176.37 ? 32  LYS E N   1 
ATOM 1866 C CA  . LYS E 5 12 ? 18.988  -28.280 -5.953  1.00 179.10 ? 32  LYS E CA  1 
ATOM 1867 C C   . LYS E 5 12 ? 19.751  -27.857 -4.686  1.00 180.68 ? 32  LYS E C   1 
ATOM 1868 O O   . LYS E 5 12 ? 19.182  -27.870 -3.601  1.00 180.44 ? 32  LYS E O   1 
ATOM 1869 C CB  . LYS E 5 12 ? 19.123  -29.787 -6.184  1.00 180.42 ? 32  LYS E CB  1 
ATOM 1870 C CG  . LYS E 5 12 ? 18.269  -30.290 -7.346  1.00 185.91 ? 32  LYS E CG  1 
ATOM 1871 C CD  . LYS E 5 12 ? 18.875  -31.513 -8.036  1.00 192.81 ? 32  LYS E CD  1 
ATOM 1872 C CE  . LYS E 5 12 ? 18.283  -31.722 -9.436  1.00 195.75 ? 32  LYS E CE  1 
ATOM 1873 N NZ  . LYS E 5 12 ? 19.251  -32.320 -10.406 1.00 193.50 ? 32  LYS E NZ  1 
ATOM 1874 N N   . LYS E 5 13 ? 21.025  -27.485 -4.821  1.00 183.32 ? 33  LYS E N   1 
ATOM 1875 C CA  . LYS E 5 13 ? 21.812  -26.974 -3.687  1.00 184.56 ? 33  LYS E CA  1 
ATOM 1876 C C   . LYS E 5 13 ? 21.206  -25.684 -3.153  1.00 181.35 ? 33  LYS E C   1 
ATOM 1877 O O   . LYS E 5 13 ? 20.948  -25.536 -1.950  1.00 179.48 ? 33  LYS E O   1 
ATOM 1878 C CB  . LYS E 5 13 ? 23.265  -26.688 -4.094  1.00 189.33 ? 33  LYS E CB  1 
ATOM 1879 C CG  . LYS E 5 13 ? 24.086  -27.901 -4.539  1.00 194.63 ? 33  LYS E CG  1 
ATOM 1880 C CD  . LYS E 5 13 ? 25.406  -27.474 -5.208  1.00 198.50 ? 33  LYS E CD  1 
ATOM 1881 C CE  . LYS E 5 13 ? 25.931  -28.533 -6.180  1.00 196.40 ? 33  LYS E CE  1 
ATOM 1882 N NZ  . LYS E 5 13 ? 26.787  -27.939 -7.243  1.00 190.13 ? 33  LYS E NZ  1 
ATOM 1883 N N   . PHE E 5 14 ? 20.981  -24.750 -4.070  1.00 178.37 ? 34  PHE E N   1 
ATOM 1884 C CA  . PHE E 5 14 ? 20.508  -23.431 -3.703  1.00 180.09 ? 34  PHE E CA  1 
ATOM 1885 C C   . PHE E 5 14 ? 19.010  -23.388 -3.401  1.00 180.72 ? 34  PHE E C   1 
ATOM 1886 O O   . PHE E 5 14 ? 18.573  -22.520 -2.653  1.00 183.76 ? 34  PHE E O   1 
ATOM 1887 C CB  . PHE E 5 14 ? 20.821  -22.424 -4.801  1.00 180.86 ? 34  PHE E CB  1 
ATOM 1888 C CG  . PHE E 5 14 ? 20.577  -21.020 -4.381  1.00 180.93 ? 34  PHE E CG  1 
ATOM 1889 C CD1 . PHE E 5 14 ? 21.510  -20.357 -3.603  1.00 181.18 ? 34  PHE E CD1 1 
ATOM 1890 C CD2 . PHE E 5 14 ? 19.411  -20.359 -4.749  1.00 179.98 ? 34  PHE E CD2 1 
ATOM 1891 C CE1 . PHE E 5 14 ? 21.295  -19.053 -3.200  1.00 186.31 ? 34  PHE E CE1 1 
ATOM 1892 C CE2 . PHE E 5 14 ? 19.185  -19.055 -4.352  1.00 184.87 ? 34  PHE E CE2 1 
ATOM 1893 C CZ  . PHE E 5 14 ? 20.130  -18.398 -3.574  1.00 188.12 ? 34  PHE E CZ  1 
ATOM 1894 N N   . GLU E 5 15 ? 18.229  -24.303 -3.973  1.00 180.30 ? 35  GLU E N   1 
ATOM 1895 C CA  . GLU E 5 15 ? 16.802  -24.404 -3.634  1.00 181.97 ? 35  GLU E CA  1 
ATOM 1896 C C   . GLU E 5 15 ? 16.624  -24.982 -2.227  1.00 181.35 ? 35  GLU E C   1 
ATOM 1897 O O   . GLU E 5 15 ? 15.661  -24.653 -1.523  1.00 180.06 ? 35  GLU E O   1 
ATOM 1898 C CB  . GLU E 5 15 ? 16.048  -25.252 -4.660  1.00 183.01 ? 35  GLU E CB  1 
ATOM 1899 C CG  . GLU E 5 15 ? 14.553  -25.407 -4.375  1.00 187.41 ? 35  GLU E CG  1 
ATOM 1900 C CD  . GLU E 5 15 ? 13.791  -26.026 -5.538  1.00 193.28 ? 35  GLU E CD  1 
ATOM 1901 O OE1 . GLU E 5 15 ? 13.776  -25.427 -6.633  1.00 199.14 ? 35  GLU E OE1 1 
ATOM 1902 O OE2 . GLU E 5 15 ? 13.202  -27.113 -5.361  1.00 197.80 ? 35  GLU E OE2 1 
ATOM 1903 N N   . GLU E 5 16 ? 17.558  -25.844 -1.832  1.00 180.87 ? 36  GLU E N   1 
ATOM 1904 C CA  . GLU E 5 16 ? 17.594  -26.394 -0.481  1.00 179.76 ? 36  GLU E CA  1 
ATOM 1905 C C   . GLU E 5 16 ? 18.012  -25.326 0.531   1.00 179.59 ? 36  GLU E C   1 
ATOM 1906 O O   . GLU E 5 16 ? 17.498  -25.303 1.647   1.00 178.69 ? 36  GLU E O   1 
ATOM 1907 C CB  . GLU E 5 16 ? 18.525  -27.612 -0.418  1.00 180.29 ? 36  GLU E CB  1 
ATOM 1908 C CG  . GLU E 5 16 ? 17.895  -28.888 -0.984  1.00 179.86 ? 36  GLU E CG  1 
ATOM 1909 C CD  . GLU E 5 16 ? 18.896  -30.015 -1.200  1.00 181.97 ? 36  GLU E CD  1 
ATOM 1910 O OE1 . GLU E 5 16 ? 19.959  -29.768 -1.810  1.00 182.76 ? 36  GLU E OE1 1 
ATOM 1911 O OE2 . GLU E 5 16 ? 18.617  -31.155 -0.761  1.00 181.04 ? 36  GLU E OE2 1 
ATOM 1912 N N   . ALA E 5 17 ? 18.937  -24.445 0.143   1.00 180.03 ? 37  ALA E N   1 
ATOM 1913 C CA  . ALA E 5 17 ? 19.275  -23.283 0.973   1.00 181.40 ? 37  ALA E CA  1 
ATOM 1914 C C   . ALA E 5 17 ? 18.045  -22.396 1.213   1.00 181.01 ? 37  ALA E C   1 
ATOM 1915 O O   . ALA E 5 17 ? 17.740  -22.015 2.355   1.00 181.89 ? 37  ALA E O   1 
ATOM 1916 C CB  . ALA E 5 17 ? 20.395  -22.477 0.332   1.00 182.91 ? 37  ALA E CB  1 
ATOM 1917 N N   . GLN E 5 18 ? 17.344  -22.083 0.125   1.00 180.95 ? 38  GLN E N   1 
ATOM 1918 C CA  . GLN E 5 18 ? 16.199  -21.164 0.132   1.00 181.73 ? 38  GLN E CA  1 
ATOM 1919 C C   . GLN E 5 18 ? 15.038  -21.633 1.017   1.00 179.81 ? 38  GLN E C   1 
ATOM 1920 O O   . GLN E 5 18 ? 14.341  -20.815 1.634   1.00 179.97 ? 38  GLN E O   1 
ATOM 1921 C CB  . GLN E 5 18 ? 15.696  -20.945 -1.302  1.00 183.30 ? 38  GLN E CB  1 
ATOM 1922 C CG  . GLN E 5 18 ? 14.730  -19.773 -1.465  1.00 187.47 ? 38  GLN E CG  1 
ATOM 1923 C CD  . GLN E 5 18 ? 15.359  -18.431 -1.114  1.00 191.45 ? 38  GLN E CD  1 
ATOM 1924 O OE1 . GLN E 5 18 ? 16.583  -18.269 -1.172  1.00 189.18 ? 38  GLN E OE1 1 
ATOM 1925 N NE2 . GLN E 5 18 ? 14.522  -17.462 -0.746  1.00 193.30 ? 38  GLN E NE2 1 
ATOM 1926 N N   . GLU E 5 19 ? 14.825  -22.942 1.080   1.00 177.72 ? 39  GLU E N   1 
ATOM 1927 C CA  . GLU E 5 19 ? 13.858  -23.489 2.024   1.00 176.35 ? 39  GLU E CA  1 
ATOM 1928 C C   . GLU E 5 19 ? 14.410  -23.472 3.450   1.00 176.20 ? 39  GLU E C   1 
ATOM 1929 O O   . GLU E 5 19 ? 13.639  -23.501 4.409   1.00 174.85 ? 39  GLU E O   1 
ATOM 1930 C CB  . GLU E 5 19 ? 13.452  -24.894 1.619   1.00 175.34 ? 39  GLU E CB  1 
ATOM 1931 C CG  . GLU E 5 19 ? 12.663  -24.900 0.338   1.00 178.13 ? 39  GLU E CG  1 
ATOM 1932 C CD  . GLU E 5 19 ? 12.051  -26.239 0.035   1.00 184.10 ? 39  GLU E CD  1 
ATOM 1933 O OE1 . GLU E 5 19 ? 12.176  -27.157 0.872   1.00 186.35 ? 39  GLU E OE1 1 
ATOM 1934 O OE2 . GLU E 5 19 ? 11.442  -26.373 -1.045  1.00 193.08 ? 39  GLU E OE2 1 
ATOM 1935 N N   . ALA E 5 20 ? 15.737  -23.421 3.583   1.00 178.13 ? 40  ALA E N   1 
ATOM 1936 C CA  . ALA E 5 20 ? 16.372  -23.212 4.883   1.00 178.65 ? 40  ALA E CA  1 
ATOM 1937 C C   . ALA E 5 20 ? 16.022  -21.820 5.399   1.00 179.16 ? 40  ALA E C   1 
ATOM 1938 O O   . ALA E 5 20 ? 15.801  -21.631 6.599   1.00 177.86 ? 40  ALA E O   1 
ATOM 1939 C CB  . ALA E 5 20 ? 17.883  -23.388 4.793   1.00 180.06 ? 40  ALA E CB  1 
ATOM 1940 N N   . LEU E 5 21 ? 15.970  -20.852 4.483   1.00 180.24 ? 41  LEU E N   1 
ATOM 1941 C CA  . LEU E 5 21 ? 15.543  -19.488 4.827   1.00 180.98 ? 41  LEU E CA  1 
ATOM 1942 C C   . LEU E 5 21 ? 14.050  -19.442 5.184   1.00 179.10 ? 41  LEU E C   1 
ATOM 1943 O O   . LEU E 5 21 ? 13.669  -18.812 6.184   1.00 178.20 ? 41  LEU E O   1 
ATOM 1944 C CB  . LEU E 5 21 ? 15.855  -18.500 3.692   1.00 184.00 ? 41  LEU E CB  1 
ATOM 1945 C CG  . LEU E 5 21 ? 17.310  -18.410 3.208   1.00 187.62 ? 41  LEU E CG  1 
ATOM 1946 C CD1 . LEU E 5 21 ? 17.487  -17.235 2.251   1.00 188.96 ? 41  LEU E CD1 1 
ATOM 1947 C CD2 . LEU E 5 21 ? 18.289  -18.305 4.369   1.00 189.87 ? 41  LEU E CD2 1 
ATOM 1948 N N   . ARG E 5 22 ? 13.215  -20.102 4.376   1.00 177.66 ? 42  ARG E N   1 
ATOM 1949 C CA  . ARG E 5 22 ? 11.781  -20.232 4.690   1.00 178.03 ? 42  ARG E CA  1 
ATOM 1950 C C   . ARG E 5 22 ? 11.552  -20.824 6.084   1.00 176.12 ? 42  ARG E C   1 
ATOM 1951 O O   . ARG E 5 22 ? 10.690  -20.351 6.836   1.00 174.82 ? 42  ARG E O   1 
ATOM 1952 C CB  . ARG E 5 22 ? 11.056  -21.099 3.658   1.00 179.30 ? 42  ARG E CB  1 
ATOM 1953 C CG  . ARG E 5 22 ? 10.692  -20.389 2.361   1.00 187.54 ? 42  ARG E CG  1 
ATOM 1954 C CD  . ARG E 5 22 ? 9.652   -21.193 1.578   1.00 196.18 ? 42  ARG E CD  1 
ATOM 1955 N NE  . ARG E 5 22 ? 9.226   -20.534 0.341   1.00 201.24 ? 42  ARG E NE  1 
ATOM 1956 C CZ  . ARG E 5 22 ? 8.226   -20.951 -0.439  1.00 203.51 ? 42  ARG E CZ  1 
ATOM 1957 N NH1 . ARG E 5 22 ? 7.524   -22.038 -0.129  1.00 204.37 ? 42  ARG E NH1 1 
ATOM 1958 N NH2 . ARG E 5 22 ? 7.922   -20.275 -1.541  1.00 205.39 ? 42  ARG E NH2 1 
ATOM 1959 N N   . GLN E 5 23 ? 12.325  -21.857 6.417   1.00 174.15 ? 43  GLN E N   1 
ATOM 1960 C CA  . GLN E 5 23 ? 12.260  -22.484 7.739   1.00 171.63 ? 43  GLN E CA  1 
ATOM 1961 C C   . GLN E 5 23 ? 12.639  -21.510 8.854   1.00 170.86 ? 43  GLN E C   1 
ATOM 1962 O O   . GLN E 5 23 ? 11.887  -21.348 9.811   1.00 167.63 ? 43  GLN E O   1 
ATOM 1963 C CB  . GLN E 5 23 ? 13.155  -23.726 7.791   1.00 171.23 ? 43  GLN E CB  1 
ATOM 1964 C CG  . GLN E 5 23 ? 12.578  -24.916 7.027   1.00 170.34 ? 43  GLN E CG  1 
ATOM 1965 C CD  . GLN E 5 23 ? 13.620  -25.944 6.619   1.00 170.04 ? 43  GLN E CD  1 
ATOM 1966 O OE1 . GLN E 5 23 ? 14.818  -25.764 6.840   1.00 176.68 ? 43  GLN E OE1 1 
ATOM 1967 N NE2 . GLN E 5 23 ? 13.161  -27.032 6.016   1.00 163.80 ? 43  GLN E NE2 1 
ATOM 1968 N N   . ALA E 5 24 ? 13.797  -20.862 8.728   1.00 172.62 ? 44  ALA E N   1 
ATOM 1969 C CA  . ALA E 5 24 ? 14.268  -19.915 9.749   1.00 172.35 ? 44  ALA E CA  1 
ATOM 1970 C C   . ALA E 5 24 ? 13.184  -18.933 10.166  1.00 171.72 ? 44  ALA E C   1 
ATOM 1971 O O   . ALA E 5 24 ? 12.753  -18.933 11.321  1.00 169.34 ? 44  ALA E O   1 
ATOM 1972 C CB  . ALA E 5 24 ? 15.480  -19.148 9.257   1.00 173.62 ? 44  ALA E CB  1 
ATOM 1973 N N   . GLU E 5 25 ? 12.741  -18.103 9.224   1.00 172.73 ? 45  GLU E N   1 
ATOM 1974 C CA  . GLU E 5 25 ? 11.913  -16.941 9.575   1.00 172.92 ? 45  GLU E CA  1 
ATOM 1975 C C   . GLU E 5 25 ? 10.411  -17.239 9.744   1.00 170.64 ? 45  GLU E C   1 
ATOM 1976 O O   . GLU E 5 25 ? 9.782   -16.637 10.616  1.00 168.45 ? 45  GLU E O   1 
ATOM 1977 C CB  . GLU E 5 25 ? 12.138  -15.817 8.560   1.00 175.97 ? 45  GLU E CB  1 
ATOM 1978 C CG  . GLU E 5 25 ? 13.544  -15.240 8.659   1.00 183.86 ? 45  GLU E CG  1 
ATOM 1979 C CD  . GLU E 5 25 ? 13.898  -14.297 7.525   1.00 196.83 ? 45  GLU E CD  1 
ATOM 1980 O OE1 . GLU E 5 25 ? 13.602  -14.609 6.348   1.00 202.17 ? 45  GLU E OE1 1 
ATOM 1981 O OE2 . GLU E 5 25 ? 14.486  -13.234 7.817   1.00 207.49 ? 45  GLU E OE2 1 
ATOM 1982 N N   . GLU E 5 26 ? 9.835   -18.144 8.946   1.00 169.19 ? 46  GLU E N   1 
ATOM 1983 C CA  . GLU E 5 26 ? 8.399   -18.473 9.098   1.00 167.70 ? 46  GLU E CA  1 
ATOM 1984 C C   . GLU E 5 26 ? 8.104   -19.299 10.360  1.00 165.48 ? 46  GLU E C   1 
ATOM 1985 O O   . GLU E 5 26 ? 7.023   -19.178 10.952  1.00 162.37 ? 46  GLU E O   1 
ATOM 1986 C CB  . GLU E 5 26 ? 7.846   -19.210 7.879   1.00 168.88 ? 46  GLU E CB  1 
ATOM 1987 C CG  . GLU E 5 26 ? 6.320   -19.290 7.895   1.00 171.25 ? 46  GLU E CG  1 
ATOM 1988 C CD  . GLU E 5 26 ? 5.742   -19.998 6.696   1.00 179.05 ? 46  GLU E CD  1 
ATOM 1989 O OE1 . GLU E 5 26 ? 6.330   -19.907 5.597   1.00 187.69 ? 46  GLU E OE1 1 
ATOM 1990 O OE2 . GLU E 5 26 ? 4.689   -20.648 6.858   1.00 183.34 ? 46  GLU E OE2 1 
ATOM 1991 N N   . GLU E 5 27 ? 9.059   -20.135 10.763  1.00 164.05 ? 47  GLU E N   1 
ATOM 1992 C CA  . GLU E 5 27 ? 8.967   -20.843 12.038  1.00 162.61 ? 47  GLU E CA  1 
ATOM 1993 C C   . GLU E 5 27 ? 9.264   -19.897 13.187  1.00 160.74 ? 47  GLU E C   1 
ATOM 1994 O O   . GLU E 5 27 ? 8.506   -19.844 14.146  1.00 157.42 ? 47  GLU E O   1 
ATOM 1995 C CB  . GLU E 5 27 ? 9.943   -22.005 12.096  1.00 163.88 ? 47  GLU E CB  1 
ATOM 1996 C CG  . GLU E 5 27 ? 9.689   -23.082 11.062  1.00 168.84 ? 47  GLU E CG  1 
ATOM 1997 C CD  . GLU E 5 27 ? 10.831  -24.076 10.964  1.00 174.62 ? 47  GLU E CD  1 
ATOM 1998 O OE1 . GLU E 5 27 ? 11.900  -23.832 11.563  1.00 182.10 ? 47  GLU E OE1 1 
ATOM 1999 O OE2 . GLU E 5 27 ? 10.659  -25.107 10.282  1.00 179.05 ? 47  GLU E OE2 1 
ATOM 2000 N N   . ARG E 5 28 ? 10.368  -19.154 13.090  1.00 161.14 ? 48  ARG E N   1 
ATOM 2001 C CA  . ARG E 5 28 ? 10.719  -18.159 14.110  1.00 158.98 ? 48  ARG E CA  1 
ATOM 2002 C C   . ARG E 5 28 ? 9.573   -17.167 14.351  1.00 156.36 ? 48  ARG E C   1 
ATOM 2003 O O   . ARG E 5 28 ? 9.408   -16.675 15.463  1.00 154.62 ? 48  ARG E O   1 
ATOM 2004 C CB  . ARG E 5 28 ? 12.010  -17.414 13.740  1.00 160.67 ? 48  ARG E CB  1 
ATOM 2005 C CG  . ARG E 5 28 ? 12.408  -16.331 14.739  1.00 164.07 ? 48  ARG E CG  1 
ATOM 2006 C CD  . ARG E 5 28 ? 13.911  -16.070 14.769  1.00 167.02 ? 48  ARG E CD  1 
ATOM 2007 N NE  . ARG E 5 28 ? 14.395  -15.402 13.563  1.00 167.50 ? 48  ARG E NE  1 
ATOM 2008 C CZ  . ARG E 5 28 ? 15.634  -14.938 13.399  1.00 170.44 ? 48  ARG E CZ  1 
ATOM 2009 N NH1 . ARG E 5 28 ? 16.546  -15.060 14.364  1.00 165.38 ? 48  ARG E NH1 1 
ATOM 2010 N NH2 . ARG E 5 28 ? 15.967  -14.345 12.258  1.00 174.88 ? 48  ARG E NH2 1 
ATOM 2011 N N   . LYS E 5 29 ? 8.789   -16.877 13.316  1.00 156.01 ? 49  LYS E N   1 
ATOM 2012 C CA  . LYS E 5 29 ? 7.564   -16.091 13.489  1.00 154.65 ? 49  LYS E CA  1 
ATOM 2013 C C   . LYS E 5 29 ? 6.480   -16.856 14.262  1.00 152.29 ? 49  LYS E C   1 
ATOM 2014 O O   . LYS E 5 29 ? 5.833   -16.290 15.141  1.00 150.00 ? 49  LYS E O   1 
ATOM 2015 C CB  . LYS E 5 29 ? 7.028   -15.628 12.132  1.00 157.65 ? 49  LYS E CB  1 
ATOM 2016 C CG  . LYS E 5 29 ? 7.847   -14.492 11.536  1.00 162.87 ? 49  LYS E CG  1 
ATOM 2017 C CD  . LYS E 5 29 ? 7.733   -14.412 10.018  1.00 167.02 ? 49  LYS E CD  1 
ATOM 2018 C CE  . LYS E 5 29 ? 8.859   -13.558 9.446   1.00 168.03 ? 49  LYS E CE  1 
ATOM 2019 N NZ  . LYS E 5 29 ? 8.822   -13.476 7.967   1.00 168.97 ? 49  LYS E NZ  1 
ATOM 2020 N N   . ALA E 5 30 ? 6.281   -18.134 13.944  1.00 152.79 ? 50  ALA E N   1 
ATOM 2021 C CA  . ALA E 5 30 ? 5.279   -18.949 14.655  1.00 151.44 ? 50  ALA E CA  1 
ATOM 2022 C C   . ALA E 5 30 ? 5.629   -19.183 16.139  1.00 150.07 ? 50  ALA E C   1 
ATOM 2023 O O   . ALA E 5 30 ? 4.754   -19.116 17.012  1.00 144.83 ? 50  ALA E O   1 
ATOM 2024 C CB  . ALA E 5 30 ? 5.084   -20.279 13.944  1.00 153.00 ? 50  ALA E CB  1 
ATOM 2025 N N   . LYS E 5 31 ? 6.906   -19.455 16.411  1.00 151.73 ? 51  LYS E N   1 
ATOM 2026 C CA  . LYS E 5 31 ? 7.412   -19.667 17.777  1.00 151.07 ? 51  LYS E CA  1 
ATOM 2027 C C   . LYS E 5 31 ? 7.248   -18.431 18.659  1.00 148.03 ? 51  LYS E C   1 
ATOM 2028 O O   . LYS E 5 31 ? 6.937   -18.560 19.834  1.00 143.52 ? 51  LYS E O   1 
ATOM 2029 C CB  . LYS E 5 31 ? 8.897   -20.042 17.765  1.00 152.76 ? 51  LYS E CB  1 
ATOM 2030 C CG  . LYS E 5 31 ? 9.236   -21.362 17.092  1.00 160.85 ? 51  LYS E CG  1 
ATOM 2031 C CD  . LYS E 5 31 ? 10.724  -21.417 16.740  1.00 171.13 ? 51  LYS E CD  1 
ATOM 2032 C CE  . LYS E 5 31 ? 11.089  -22.663 15.942  1.00 173.34 ? 51  LYS E CE  1 
ATOM 2033 N NZ  . LYS E 5 31 ? 12.454  -22.569 15.342  1.00 171.33 ? 51  LYS E NZ  1 
ATOM 2034 N N   . TYR E 5 32 ? 7.467   -17.245 18.091  1.00 146.83 ? 52  TYR E N   1 
ATOM 2035 C CA  . TYR E 5 32 ? 7.276   -15.983 18.814  1.00 143.34 ? 52  TYR E CA  1 
ATOM 2036 C C   . TYR E 5 32 ? 5.796   -15.744 19.114  1.00 141.15 ? 52  TYR E C   1 
ATOM 2037 O O   . TYR E 5 32 ? 5.459   -15.162 20.146  1.00 140.26 ? 52  TYR E O   1 
ATOM 2038 C CB  . TYR E 5 32 ? 7.871   -14.802 18.024  1.00 144.19 ? 52  TYR E CB  1 
ATOM 2039 C CG  . TYR E 5 32 ? 7.661   -13.418 18.637  1.00 149.65 ? 52  TYR E CG  1 
ATOM 2040 C CD1 . TYR E 5 32 ? 8.534   -12.914 19.606  1.00 151.98 ? 52  TYR E CD1 1 
ATOM 2041 C CD2 . TYR E 5 32 ? 6.591   -12.609 18.242  1.00 153.41 ? 52  TYR E CD2 1 
ATOM 2042 C CE1 . TYR E 5 32 ? 8.343   -11.645 20.167  1.00 153.95 ? 52  TYR E CE1 1 
ATOM 2043 C CE2 . TYR E 5 32 ? 6.393   -11.340 18.798  1.00 154.96 ? 52  TYR E CE2 1 
ATOM 2044 C CZ  . TYR E 5 32 ? 7.274   -10.866 19.758  1.00 157.83 ? 52  TYR E CZ  1 
ATOM 2045 O OH  . TYR E 5 32 ? 7.090   -9.619  20.310  1.00 164.95 ? 52  TYR E OH  1 
ATOM 2046 N N   . ALA E 5 33 ? 4.913   -16.188 18.223  1.00 140.42 ? 53  ALA E N   1 
ATOM 2047 C CA  . ALA E 5 33 ? 3.479   -16.001 18.433  1.00 138.64 ? 53  ALA E CA  1 
ATOM 2048 C C   . ALA E 5 33 ? 2.992   -16.749 19.679  1.00 138.04 ? 53  ALA E C   1 
ATOM 2049 O O   . ALA E 5 33 ? 2.242   -16.195 20.495  1.00 133.38 ? 53  ALA E O   1 
ATOM 2050 C CB  . ALA E 5 33 ? 2.700   -16.444 17.204  1.00 139.74 ? 53  ALA E CB  1 
ATOM 2051 N N   . LYS E 5 34 ? 3.424   -18.002 19.824  1.00 139.68 ? 54  LYS E N   1 
ATOM 2052 C CA  . LYS E 5 34 ? 2.969   -18.859 20.940  1.00 141.15 ? 54  LYS E CA  1 
ATOM 2053 C C   . LYS E 5 34 ? 3.565   -18.483 22.299  1.00 136.49 ? 54  LYS E C   1 
ATOM 2054 O O   . LYS E 5 34 ? 2.897   -18.604 23.318  1.00 126.95 ? 54  LYS E O   1 
ATOM 2055 C CB  . LYS E 5 34 ? 3.273   -20.339 20.655  1.00 145.34 ? 54  LYS E CB  1 
ATOM 2056 C CG  . LYS E 5 34 ? 2.382   -20.955 19.576  1.00 154.98 ? 54  LYS E CG  1 
ATOM 2057 C CD  . LYS E 5 34 ? 2.423   -22.482 19.589  1.00 161.35 ? 54  LYS E CD  1 
ATOM 2058 C CE  . LYS E 5 34 ? 1.429   -23.075 18.594  1.00 163.49 ? 54  LYS E CE  1 
ATOM 2059 N NZ  . LYS E 5 34 ? 1.195   -24.528 18.827  1.00 167.26 ? 54  LYS E NZ  1 
ATOM 2060 N N   . MET E 5 35 ? 4.817   -18.036 22.300  1.00 137.03 ? 55  MET E N   1 
ATOM 2061 C CA  . MET E 5 35 ? 5.493   -17.583 23.514  1.00 136.29 ? 55  MET E CA  1 
ATOM 2062 C C   . MET E 5 35 ? 4.849   -16.327 24.060  1.00 130.67 ? 55  MET E C   1 
ATOM 2063 O O   . MET E 5 35 ? 4.684   -16.181 25.266  1.00 128.03 ? 55  MET E O   1 
ATOM 2064 C CB  . MET E 5 35 ? 6.977   -17.315 23.251  1.00 138.52 ? 55  MET E CB  1 
ATOM 2065 C CG  . MET E 5 35 ? 7.796   -18.567 22.995  1.00 151.04 ? 55  MET E CG  1 
ATOM 2066 S SD  . MET E 5 35 ? 7.778   -19.717 24.381  1.00 180.82 ? 55  MET E SD  1 
ATOM 2067 C CE  . MET E 5 35 ? 8.244   -18.642 25.746  1.00 180.44 ? 55  MET E CE  1 
ATOM 2068 N N   . GLU E 5 36 ? 4.487   -15.417 23.168  1.00 128.30 ? 56  GLU E N   1 
ATOM 2069 C CA  . GLU E 5 36 ? 3.730   -14.247 23.564  1.00 126.04 ? 56  GLU E CA  1 
ATOM 2070 C C   . GLU E 5 36 ? 2.463   -14.688 24.301  1.00 122.39 ? 56  GLU E C   1 
ATOM 2071 O O   . GLU E 5 36 ? 2.253   -14.360 25.474  1.00 114.75 ? 56  GLU E O   1 
ATOM 2072 C CB  . GLU E 5 36 ? 3.381   -13.397 22.337  1.00 129.24 ? 56  GLU E CB  1 
ATOM 2073 C CG  . GLU E 5 36 ? 2.887   -11.996 22.662  1.00 131.77 ? 56  GLU E CG  1 
ATOM 2074 C CD  . GLU E 5 36 ? 3.952   -11.145 23.333  1.00 136.45 ? 56  GLU E CD  1 
ATOM 2075 O OE1 . GLU E 5 36 ? 5.122   -11.157 22.869  1.00 130.76 ? 56  GLU E OE1 1 
ATOM 2076 O OE2 . GLU E 5 36 ? 3.612   -10.466 24.329  1.00 134.00 ? 56  GLU E OE2 1 
ATOM 2077 N N   . ALA E 5 37 ? 1.624   -15.444 23.608  1.00 121.91 ? 57  ALA E N   1 
ATOM 2078 C CA  . ALA E 5 37 ? 0.359   -15.878 24.176  1.00 120.00 ? 57  ALA E CA  1 
ATOM 2079 C C   . ALA E 5 37 ? 0.552   -16.591 25.519  1.00 118.89 ? 57  ALA E C   1 
ATOM 2080 O O   . ALA E 5 37 ? -0.220  -16.385 26.457  1.00 112.28 ? 57  ALA E O   1 
ATOM 2081 C CB  . ALA E 5 37 ? -0.362  -16.784 23.195  1.00 121.01 ? 57  ALA E CB  1 
ATOM 2082 N N   . GLU E 5 38 ? 1.585   -17.423 25.608  1.00 119.36 ? 58  GLU E N   1 
ATOM 2083 C CA  . GLU E 5 38 ? 1.774   -18.284 26.772  1.00 120.87 ? 58  GLU E CA  1 
ATOM 2084 C C   . GLU E 5 38 ? 2.444   -17.574 27.935  1.00 117.70 ? 58  GLU E C   1 
ATOM 2085 O O   . GLU E 5 38 ? 2.440   -18.098 29.050  1.00 113.39 ? 58  GLU E O   1 
ATOM 2086 C CB  . GLU E 5 38 ? 2.612   -19.515 26.419  1.00 124.41 ? 58  GLU E CB  1 
ATOM 2087 C CG  . GLU E 5 38 ? 4.112   -19.359 26.700  1.00 128.07 ? 58  GLU E CG  1 
ATOM 2088 C CD  . GLU E 5 38 ? 4.904   -20.590 26.334  1.00 132.28 ? 58  GLU E CD  1 
ATOM 2089 O OE1 . GLU E 5 38 ? 4.576   -21.233 25.315  1.00 143.66 ? 58  GLU E OE1 1 
ATOM 2090 O OE2 . GLU E 5 38 ? 5.858   -20.914 27.069  1.00 136.77 ? 58  GLU E OE2 1 
ATOM 2091 N N   . ARG E 5 39 ? 3.029   -16.404 27.689  1.00 114.47 ? 59  ARG E N   1 
ATOM 2092 C CA  . ARG E 5 39 ? 3.561   -15.621 28.789  1.00 107.99 ? 59  ARG E CA  1 
ATOM 2093 C C   . ARG E 5 39 ? 2.470   -14.625 29.219  1.00 102.84 ? 59  ARG E C   1 
ATOM 2094 O O   . ARG E 5 39 ? 2.464   -14.184 30.360  1.00 98.62  ? 59  ARG E O   1 
ATOM 2095 C CB  . ARG E 5 39 ? 4.898   -14.962 28.421  1.00 105.43 ? 59  ARG E CB  1 
ATOM 2096 C CG  . ARG E 5 39 ? 4.786   -13.546 27.940  1.00 115.88 ? 59  ARG E CG  1 
ATOM 2097 C CD  . ARG E 5 39 ? 6.085   -13.023 27.344  1.00 128.06 ? 59  ARG E CD  1 
ATOM 2098 N NE  . ARG E 5 39 ? 5.981   -11.584 27.076  1.00 143.06 ? 59  ARG E NE  1 
ATOM 2099 C CZ  . ARG E 5 39 ? 6.804   -10.879 26.299  1.00 153.13 ? 59  ARG E CZ  1 
ATOM 2100 N NH1 . ARG E 5 39 ? 7.828   -11.463 25.682  1.00 157.13 ? 59  ARG E NH1 1 
ATOM 2101 N NH2 . ARG E 5 39 ? 6.599   -9.571  26.136  1.00 158.72 ? 59  ARG E NH2 1 
ATOM 2102 N N   . GLU E 5 40 ? 1.552   -14.282 28.313  1.00 99.33  ? 60  GLU E N   1 
ATOM 2103 C CA  . GLU E 5 40 ? 0.324   -13.560 28.688  1.00 94.26  ? 60  GLU E CA  1 
ATOM 2104 C C   . GLU E 5 40 ? -0.527  -14.436 29.605  1.00 94.92  ? 60  GLU E C   1 
ATOM 2105 O O   . GLU E 5 40 ? -1.297  -13.950 30.443  1.00 89.33  ? 60  GLU E O   1 
ATOM 2106 C CB  . GLU E 5 40 ? -0.462  -13.130 27.442  1.00 94.84  ? 60  GLU E CB  1 
ATOM 2107 C CG  . GLU E 5 40 ? -1.900  -12.619 27.682  1.00 98.05  ? 60  GLU E CG  1 
ATOM 2108 C CD  . GLU E 5 40 ? -1.988  -11.319 28.480  1.00 103.68 ? 60  GLU E CD  1 
ATOM 2109 O OE1 . GLU E 5 40 ? -1.109  -10.445 28.321  1.00 109.75 ? 60  GLU E OE1 1 
ATOM 2110 O OE2 . GLU E 5 40 ? -2.949  -11.167 29.270  1.00 94.73  ? 60  GLU E OE2 1 
ATOM 2111 N N   . ALA E 5 41 ? -0.379  -15.742 29.434  1.00 102.36 ? 61  ALA E N   1 
ATOM 2112 C CA  . ALA E 5 41 ? -0.993  -16.712 30.326  1.00 106.35 ? 61  ALA E CA  1 
ATOM 2113 C C   . ALA E 5 41 ? -0.362  -16.613 31.687  1.00 102.06 ? 61  ALA E C   1 
ATOM 2114 O O   . ALA E 5 41 ? -1.050  -16.599 32.698  1.00 100.66 ? 61  ALA E O   1 
ATOM 2115 C CB  . ALA E 5 41 ? -0.816  -18.117 29.782  1.00 111.55 ? 61  ALA E CB  1 
ATOM 2116 N N   . VAL E 5 42 ? 0.961   -16.549 31.692  1.00 99.02  ? 62  VAL E N   1 
ATOM 2117 C CA  . VAL E 5 42 ? 1.712   -16.470 32.918  1.00 97.26  ? 62  VAL E CA  1 
ATOM 2118 C C   . VAL E 5 42 ? 1.327   -15.177 33.601  1.00 90.66  ? 62  VAL E C   1 
ATOM 2119 O O   . VAL E 5 42 ? 1.102   -15.152 34.812  1.00 88.75  ? 62  VAL E O   1 
ATOM 2120 C CB  . VAL E 5 42 ? 3.239   -16.528 32.663  1.00 99.30  ? 62  VAL E CB  1 
ATOM 2121 C CG1 . VAL E 5 42 ? 3.999   -15.874 33.790  1.00 99.09  ? 62  VAL E CG1 1 
ATOM 2122 C CG2 . VAL E 5 42 ? 3.711   -17.984 32.465  1.00 108.84 ? 62  VAL E CG2 1 
ATOM 2123 N N   . ARG E 5 43 ? 1.244   -14.111 32.810  1.00 84.50  ? 63  ARG E N   1 
ATOM 2124 C CA  . ARG E 5 43 ? 0.917   -12.793 33.333  1.00 79.56  ? 63  ARG E CA  1 
ATOM 2125 C C   . ARG E 5 43 ? -0.421  -12.840 34.013  1.00 81.51  ? 63  ARG E C   1 
ATOM 2126 O O   . ARG E 5 43 ? -0.613  -12.259 35.081  1.00 80.65  ? 63  ARG E O   1 
ATOM 2127 C CB  . ARG E 5 43 ? 0.892   -11.738 32.232  1.00 78.37  ? 63  ARG E CB  1 
ATOM 2128 C CG  . ARG E 5 43 ? 2.280   -11.239 31.829  1.00 92.24  ? 63  ARG E CG  1 
ATOM 2129 C CD  . ARG E 5 43 ? 2.246   -10.299 30.617  1.00 102.56 ? 63  ARG E CD  1 
ATOM 2130 N NE  . ARG E 5 43 ? 2.309   -11.014 29.342  1.00 107.40 ? 63  ARG E NE  1 
ATOM 2131 C CZ  . ARG E 5 43 ? 2.189   -10.434 28.149  1.00 117.32 ? 63  ARG E CZ  1 
ATOM 2132 N NH1 . ARG E 5 43 ? 2.005   -9.126  28.059  1.00 122.25 ? 63  ARG E NH1 1 
ATOM 2133 N NH2 . ARG E 5 43 ? 2.255   -11.163 27.040  1.00 120.62 ? 63  ARG E NH2 1 
ATOM 2134 N N   . GLN E 5 44 ? -1.364  -13.537 33.404  1.00 88.94  ? 64  GLN E N   1 
ATOM 2135 C CA  . GLN E 5 44 ? -2.675  -13.603 34.018  1.00 92.67  ? 64  GLN E CA  1 
ATOM 2136 C C   . GLN E 5 44 ? -2.636  -14.517 35.225  1.00 91.00  ? 64  GLN E C   1 
ATOM 2137 O O   . GLN E 5 44 ? -3.108  -14.149 36.297  1.00 89.87  ? 64  GLN E O   1 
ATOM 2138 C CB  . GLN E 5 44 ? -3.749  -14.054 33.024  1.00 95.63  ? 64  GLN E CB  1 
ATOM 2139 C CG  . GLN E 5 44 ? -5.142  -13.605 33.449  1.00 97.02  ? 64  GLN E CG  1 
ATOM 2140 C CD  . GLN E 5 44 ? -5.219  -12.104 33.748  1.00 95.62  ? 64  GLN E CD  1 
ATOM 2141 O OE1 . GLN E 5 44 ? -4.398  -11.316 33.265  1.00 98.82  ? 64  GLN E OE1 1 
ATOM 2142 N NE2 . GLN E 5 44 ? -6.206  -11.706 34.546  1.00 88.62  ? 64  GLN E NE2 1 
ATOM 2143 N N   . GLY E 5 45 ? -2.063  -15.700 35.047  1.00 92.27  ? 65  GLY E N   1 
ATOM 2144 C CA  . GLY E 5 45 ? -2.002  -16.687 36.113  1.00 93.13  ? 65  GLY E CA  1 
ATOM 2145 C C   . GLY E 5 45 ? -1.686  -16.023 37.433  1.00 88.85  ? 65  GLY E C   1 
ATOM 2146 O O   . GLY E 5 45 ? -2.374  -16.215 38.442  1.00 83.38  ? 65  GLY E O   1 
ATOM 2147 N N   . ILE E 5 46 ? -0.633  -15.223 37.419  1.00 86.44  ? 66  ILE E N   1 
ATOM 2148 C CA  . ILE E 5 46 ? -0.204  -14.577 38.635  1.00 82.14  ? 66  ILE E CA  1 
ATOM 2149 C C   . ILE E 5 46 ? -1.182  -13.444 38.934  1.00 77.45  ? 66  ILE E C   1 
ATOM 2150 O O   . ILE E 5 46 ? -1.571  -13.251 40.073  1.00 76.34  ? 66  ILE E O   1 
ATOM 2151 C CB  . ILE E 5 46 ? 1.286   -14.111 38.563  1.00 78.20  ? 66  ILE E CB  1 
ATOM 2152 C CG1 . ILE E 5 46 ? 1.389   -12.725 37.957  1.00 59.92  ? 66  ILE E CG1 1 
ATOM 2153 C CG2 . ILE E 5 46 ? 2.149   -15.135 37.793  1.00 82.96  ? 66  ILE E CG2 1 
ATOM 2154 C CD1 . ILE E 5 46 ? 0.774   -11.707 38.826  1.00 35.38  ? 66  ILE E CD1 1 
ATOM 2155 N N   . ARG E 5 47 ? -1.601  -12.694 37.927  1.00 77.03  ? 67  ARG E N   1 
ATOM 2156 C CA  . ARG E 5 47 ? -2.522  -11.604 38.217  1.00 80.68  ? 67  ARG E CA  1 
ATOM 2157 C C   . ARG E 5 47 ? -3.669  -12.087 39.107  1.00 84.15  ? 67  ARG E C   1 
ATOM 2158 O O   . ARG E 5 47 ? -4.091  -11.395 40.025  1.00 80.75  ? 67  ARG E O   1 
ATOM 2159 C CB  . ARG E 5 47 ? -3.079  -11.011 36.942  1.00 80.85  ? 67  ARG E CB  1 
ATOM 2160 C CG  . ARG E 5 47 ? -3.795  -9.712  37.170  1.00 89.22  ? 67  ARG E CG  1 
ATOM 2161 C CD  . ARG E 5 47 ? -4.355  -9.201  35.860  1.00 117.49 ? 67  ARG E CD  1 
ATOM 2162 N NE  . ARG E 5 47 ? -4.258  -7.745  35.724  1.00 128.52 ? 67  ARG E NE  1 
ATOM 2163 C CZ  . ARG E 5 47 ? -3.332  -7.094  35.015  1.00 129.38 ? 67  ARG E CZ  1 
ATOM 2164 N NH1 . ARG E 5 47 ? -2.380  -7.745  34.345  1.00 113.76 ? 67  ARG E NH1 1 
ATOM 2165 N NH2 . ARG E 5 47 ? -3.363  -5.767  34.978  1.00 142.26 ? 67  ARG E NH2 1 
ATOM 2166 N N   . ASP E 5 48 ? -4.159  -13.285 38.824  1.00 90.21  ? 68  ASP E N   1 
ATOM 2167 C CA  . ASP E 5 48 ? -5.240  -13.882 39.597  1.00 94.67  ? 68  ASP E CA  1 
ATOM 2168 C C   . ASP E 5 48 ? -4.726  -14.258 40.971  1.00 91.89  ? 68  ASP E C   1 
ATOM 2169 O O   . ASP E 5 48 ? -5.401  -14.035 41.972  1.00 92.10  ? 68  ASP E O   1 
ATOM 2170 C CB  . ASP E 5 48 ? -5.797  -15.134 38.902  1.00 100.62 ? 68  ASP E CB  1 
ATOM 2171 C CG  . ASP E 5 48 ? -5.955  -14.957 37.391  1.00 108.52 ? 68  ASP E CG  1 
ATOM 2172 O OD1 . ASP E 5 48 ? -6.170  -13.808 36.939  1.00 121.74 ? 68  ASP E OD1 1 
ATOM 2173 O OD2 . ASP E 5 48 ? -5.860  -15.970 36.658  1.00 105.33 ? 68  ASP E OD2 1 
ATOM 2174 N N   . LYS E 5 49 ? -3.523  -14.834 41.002  1.00 87.36  ? 69  LYS E N   1 
ATOM 2175 C CA  . LYS E 5 49 ? -2.864  -15.257 42.246  1.00 85.73  ? 69  LYS E CA  1 
ATOM 2176 C C   . LYS E 5 49 ? -2.961  -14.197 43.308  1.00 82.33  ? 69  LYS E C   1 
ATOM 2177 O O   . LYS E 5 49 ? -3.023  -14.516 44.492  1.00 87.08  ? 69  LYS E O   1 
ATOM 2178 C CB  . LYS E 5 49 ? -1.390  -15.546 41.978  1.00 83.90  ? 69  LYS E CB  1 
ATOM 2179 C CG  . LYS E 5 49 ? -0.574  -16.150 43.102  1.00 80.59  ? 69  LYS E CG  1 
ATOM 2180 C CD  . LYS E 5 49 ? 0.824   -16.458 42.525  1.00 89.85  ? 69  LYS E CD  1 
ATOM 2181 C CE  . LYS E 5 49 ? 1.715   -17.325 43.409  1.00 99.92  ? 69  LYS E CE  1 
ATOM 2182 N NZ  . LYS E 5 49 ? 2.966   -17.731 42.680  1.00 87.91  ? 69  LYS E NZ  1 
ATOM 2183 N N   . TYR E 5 50 ? -2.972  -12.939 42.879  1.00 69.15  ? 70  TYR E N   1 
ATOM 2184 C CA  . TYR E 5 50 ? -2.966  -11.833 43.804  1.00 69.35  ? 70  TYR E CA  1 
ATOM 2185 C C   . TYR E 5 50 ? -4.152  -10.912 43.608  1.00 77.55  ? 70  TYR E C   1 
ATOM 2186 O O   . TYR E 5 50 ? -4.386  -10.022 44.414  1.00 83.47  ? 70  TYR E O   1 
ATOM 2187 C CB  . TYR E 5 50 ? -1.672  -11.060 43.612  1.00 67.04  ? 70  TYR E CB  1 
ATOM 2188 C CG  . TYR E 5 50 ? -0.410  -11.885 43.819  1.00 47.73  ? 70  TYR E CG  1 
ATOM 2189 C CD1 . TYR E 5 50 ? -0.243  -12.665 44.945  1.00 43.53  ? 70  TYR E CD1 1 
ATOM 2190 C CD2 . TYR E 5 50 ? 0.608   -11.873 42.889  1.00 35.44  ? 70  TYR E CD2 1 
ATOM 2191 C CE1 . TYR E 5 50 ? 0.902   -13.415 45.140  1.00 53.73  ? 70  TYR E CE1 1 
ATOM 2192 C CE2 . TYR E 5 50 ? 1.757   -12.621 43.074  1.00 49.83  ? 70  TYR E CE2 1 
ATOM 2193 C CZ  . TYR E 5 50 ? 1.905   -13.394 44.206  1.00 47.43  ? 70  TYR E CZ  1 
ATOM 2194 O OH  . TYR E 5 50 ? 3.058   -14.144 44.404  1.00 57.43  ? 70  TYR E OH  1 
ATOM 2195 N N   . GLY E 5 51 ? -4.897  -11.130 42.532  1.00 85.53  ? 71  GLY E N   1 
ATOM 2196 C CA  . GLY E 5 51 ? -6.139  -10.409 42.282  1.00 96.26  ? 71  GLY E CA  1 
ATOM 2197 C C   . GLY E 5 51 ? -6.016  -8.921  42.000  1.00 96.89  ? 71  GLY E C   1 
ATOM 2198 O O   . GLY E 5 51 ? -6.677  -8.118  42.650  1.00 108.78 ? 71  GLY E O   1 
ATOM 2199 N N   . ILE E 5 52 ? -5.174  -8.551  41.038  1.00 91.76  ? 72  ILE E N   1 
ATOM 2200 C CA  . ILE E 5 52 ? -5.184  -7.199  40.471  1.00 94.45  ? 72  ILE E CA  1 
ATOM 2201 C C   . ILE E 5 52 ? -6.113  -7.220  39.238  1.00 99.11  ? 72  ILE E C   1 
ATOM 2202 O O   . ILE E 5 52 ? -6.487  -8.300  38.794  1.00 105.63 ? 72  ILE E O   1 
ATOM 2203 C CB  . ILE E 5 52 ? -3.757  -6.738  40.120  1.00 86.59  ? 72  ILE E CB  1 
ATOM 2204 C CG1 . ILE E 5 52 ? -3.391  -6.891  41.468  0.00 119.37 ? 72  ILE E CG1 1 
ATOM 2205 C CG2 . ILE E 5 52 ? -4.059  -5.568  39.389  0.00 123.86 ? 72  ILE E CG2 1 
ATOM 2206 C CD1 . ILE E 5 52 ? -1.900  -6.756  41.326  0.00 124.86 ? 72  ILE E CD1 1 
ATOM 2207 N N   . LYS E 5 53 ? -6.492  -6.064  38.683  1.00 102.24 ? 73  LYS E N   1 
ATOM 2208 C CA  . LYS E 5 53 ? -7.430  -6.044  37.538  1.00 108.41 ? 73  LYS E CA  1 
ATOM 2209 C C   . LYS E 5 53 ? -7.112  -5.017  36.440  1.00 109.86 ? 73  LYS E C   1 
ATOM 2210 O O   . LYS E 5 53 ? -6.087  -4.334  36.464  1.00 106.57 ? 73  LYS E O   1 
ATOM 2211 C CB  . LYS E 5 53 ? -8.858  -5.821  38.039  1.00 119.72 ? 73  LYS E CB  1 
ATOM 2212 C CG  . LYS E 5 53 ? -9.482  -6.857  38.125  0.00 176.90 ? 73  LYS E CG  1 
ATOM 2213 C CD  . LYS E 5 53 ? -10.989 -6.614  38.370  0.00 205.62 ? 73  LYS E CD  1 
ATOM 2214 C CE  . LYS E 5 53 ? -11.735 -7.853  38.915  0.00 222.31 ? 73  LYS E CE  1 
ATOM 2215 N NZ  . LYS E 5 53 ? -13.161 -7.513  39.314  0.00 140.96 ? 73  LYS E NZ  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 4  ? 1.1425 0.9529 0.8992 0.0689  -0.0211 -0.0509 27  GLY A N   
2    C CA  . GLY A 4  ? 1.2704 1.1130 1.0087 0.0661  -0.0623 -0.0502 27  GLY A CA  
3    C C   . GLY A 4  ? 1.2465 1.1730 1.0530 0.0618  -0.0806 -0.0455 27  GLY A C   
4    O O   . GLY A 4  ? 1.2104 1.1674 1.0645 0.0425  -0.0821 -0.0487 27  GLY A O   
5    N N   . SER A 5  ? 1.2795 1.2380 1.0840 0.0853  -0.0908 -0.0360 28  SER A N   
6    C CA  . SER A 5  ? 1.2083 1.2371 1.0716 0.0895  -0.0979 -0.0285 28  SER A CA  
7    C C   . SER A 5  ? 1.0847 1.0964 0.9826 0.0829  -0.0686 -0.0313 28  SER A C   
8    O O   . SER A 5  ? 0.9440 0.9999 0.8905 0.0750  -0.0722 -0.0295 28  SER A O   
9    C CB  . SER A 5  ? 1.2889 1.3399 1.1304 0.1296  -0.1027 -0.0138 28  SER A CB  
10   O OG  . SER A 5  ? 1.3423 1.4702 1.2384 0.1354  -0.1121 -0.0044 28  SER A OG  
11   N N   . ASN A 6  ? 1.0867 1.0374 0.9579 0.0840  -0.0397 -0.0355 29  ASN A N   
12   C CA  . ASN A 6  ? 1.0681 1.0165 0.9765 0.0681  -0.0171 -0.0401 29  ASN A CA  
13   C C   . ASN A 6  ? 0.9862 0.9738 0.9437 0.0488  -0.0294 -0.0445 29  ASN A C   
14   O O   . ASN A 6  ? 0.8482 0.8681 0.8474 0.0410  -0.0296 -0.0444 29  ASN A O   
15   C CB  . ASN A 6  ? 1.1297 1.0249 1.0110 0.0654  0.0142  -0.0440 29  ASN A CB  
16   C CG  . ASN A 6  ? 1.1831 1.1007 1.1134 0.0456  0.0334  -0.0479 29  ASN A CG  
17   O OD1 . ASN A 6  ? 1.2094 1.1497 1.1719 0.0390  0.0350  -0.0497 29  ASN A OD1 
18   N ND2 . ASN A 6  ? 1.2907 1.2008 1.2202 0.0370  0.0482  -0.0484 29  ASN A ND2 
19   N N   . ARG A 7  ? 1.0135 0.9843 0.9513 0.0423  -0.0374 -0.0482 30  ARG A N   
20   C CA  . ARG A 7  ? 1.0083 0.9943 0.9694 0.0275  -0.0450 -0.0514 30  ARG A CA  
21   C C   . ARG A 7  ? 0.8763 0.9149 0.8727 0.0177  -0.0662 -0.0493 30  ARG A C   
22   O O   . ARG A 7  ? 0.7602 0.8160 0.7869 0.0102  -0.0650 -0.0498 30  ARG A O   
23   C CB  . ARG A 7  ? 1.1308 1.0693 1.0384 0.0191  -0.0504 -0.0563 30  ARG A CB  
24   C CG  . ARG A 7  ? 1.4351 1.3110 1.2961 0.0329  -0.0249 -0.0567 30  ARG A CG  
25   C CD  . ARG A 7  ? 1.7300 1.5396 1.5174 0.0237  -0.0296 -0.0620 30  ARG A CD  
26   N NE  . ARG A 7  ? 1.9879 1.7302 1.7284 0.0427  0.0033  -0.0601 30  ARG A NE  
27   C CZ  . ARG A 7  ? 2.1511 1.8111 1.8120 0.0422  0.0128  -0.0632 30  ARG A CZ  
28   N NH1 . ARG A 7  ? 2.2584 1.8877 1.8717 0.0154  -0.0106 -0.0710 30  ARG A NH1 
29   N NH2 . ARG A 7  ? 2.1879 1.7902 1.8100 0.0661  0.0495  -0.0584 30  ARG A NH2 
30   N N   . ARG A 8  ? 0.8996 0.9666 0.8902 0.0220  -0.0838 -0.0450 31  ARG A N   
31   C CA  . ARG A 8  ? 0.8186 0.9466 0.8479 0.0164  -0.0989 -0.0397 31  ARG A CA  
32   C C   . ARG A 8  ? 0.6594 0.8001 0.7185 0.0304  -0.0839 -0.0342 31  ARG A C   
33   O O   . ARG A 8  ? 0.5380 0.7129 0.6283 0.0244  -0.0876 -0.0311 31  ARG A O   
34   C CB  . ARG A 8  ? 0.9013 1.0754 0.9223 0.0235  -0.1216 -0.0329 31  ARG A CB  
35   C CG  . ARG A 8  ? 1.0936 1.3465 1.1623 0.0161  -0.1347 -0.0254 31  ARG A CG  
36   C CD  . ARG A 8  ? 1.2841 1.6006 1.3564 -0.0054 -0.1655 -0.0246 31  ARG A CD  
37   N NE  . ARG A 8  ? 1.3858 1.7999 1.5137 0.0003  -0.1725 -0.0112 31  ARG A NE  
38   C CZ  . ARG A 8  ? 1.2964 1.7367 1.4653 -0.0190 -0.1631 -0.0106 31  ARG A CZ  
39   N NH1 . ARG A 8  ? 1.3613 1.7359 1.5184 -0.0434 -0.1491 -0.0227 31  ARG A NH1 
40   N NH2 . ARG A 8  ? 1.1669 1.7000 1.3857 -0.0088 -0.1650 0.0043  31  ARG A NH2 
41   N N   . LEU A 9  ? 0.6410 0.7460 0.6816 0.0448  -0.0651 -0.0338 32  LEU A N   
42   C CA  . LEU A 9  ? 0.5531 0.6525 0.6063 0.0472  -0.0501 -0.0324 32  LEU A CA  
43   C C   . LEU A 9  ? 0.5129 0.6152 0.5947 0.0288  -0.0467 -0.0395 32  LEU A C   
44   O O   . LEU A 9  ? 0.3522 0.4689 0.4524 0.0247  -0.0480 -0.0386 32  LEU A O   
45   C CB  . LEU A 9  ? 0.5891 0.6389 0.6013 0.0579  -0.0282 -0.0320 32  LEU A CB  
46   C CG  . LEU A 9  ? 0.4187 0.4459 0.4254 0.0494  -0.0115 -0.0339 32  LEU A CG  
47   C CD1 . LEU A 9  ? 0.5519 0.5918 0.5553 0.0668  -0.0146 -0.0243 32  LEU A CD1 
48   C CD2 . LEU A 9  ? 0.5596 0.5225 0.5131 0.0478  0.0153  -0.0363 32  LEU A CD2 
49   N N   . GLN A 10 ? 0.6546 0.7430 0.7352 0.0229  -0.0413 -0.0446 33  GLN A N   
50   C CA  . GLN A 10 ? 0.6763 0.7794 0.7842 0.0162  -0.0392 -0.0472 33  GLN A CA  
51   C C   . GLN A 10 ? 0.6210 0.7402 0.7404 0.0131  -0.0533 -0.0455 33  GLN A C   
52   O O   . GLN A 10 ? 0.5266 0.6613 0.6632 0.0115  -0.0557 -0.0445 33  GLN A O   
53   C CB  . GLN A 10 ? 0.7670 0.8534 0.8659 0.0211  -0.0287 -0.0484 33  GLN A CB  
54   C CG  . GLN A 10 ? 0.9627 1.0291 1.0472 0.0234  -0.0086 -0.0493 33  GLN A CG  
55   C CD  . GLN A 10 ? 1.0653 1.1604 1.1809 0.0124  0.0048  -0.0506 33  GLN A CD  
56   O OE1 . GLN A 10 ? 1.2307 1.3497 1.3654 0.0015  -0.0045 -0.0520 33  GLN A OE1 
57   N NE2 . GLN A 10 ? 1.1610 1.2536 1.2783 0.0115  0.0279  -0.0503 33  GLN A NE2 
58   N N   . GLN A 11 ? 0.5956 0.7055 0.6978 0.0081  -0.0616 -0.0459 34  GLN A N   
59   C CA  . GLN A 11 ? 0.6169 0.7353 0.7224 -0.0036 -0.0705 -0.0453 34  GLN A CA  
60   C C   . GLN A 11 ? 0.4413 0.5915 0.5721 -0.0024 -0.0731 -0.0401 34  GLN A C   
61   O O   . GLN A 11 ? 0.3538 0.5029 0.4904 -0.0058 -0.0717 -0.0392 34  GLN A O   
62   C CB  . GLN A 11 ? 0.7664 0.8819 0.8487 -0.0199 -0.0822 -0.0476 34  GLN A CB  
63   C CG  . GLN A 11 ? 1.0037 1.1330 1.0874 -0.0452 -0.0901 -0.0484 34  GLN A CG  
64   C CD  . GLN A 11 ? 1.2108 1.3372 1.2647 -0.0726 -0.1045 -0.0538 34  GLN A CD  
65   O OE1 . GLN A 11 ? 1.1927 1.2936 1.2152 -0.0679 -0.1085 -0.0570 34  GLN A OE1 
66   N NE2 . GLN A 11 ? 1.4192 1.5707 1.4783 -0.1058 -0.1122 -0.0554 34  GLN A NE2 
67   N N   . THR A 12 ? 0.3472 0.5157 0.4820 0.0076  -0.0734 -0.0353 35  THR A N   
68   C CA  . THR A 12 ? 0.3169 0.5078 0.4643 0.0154  -0.0706 -0.0275 35  THR A CA  
69   C C   . THR A 12 ? 0.3382 0.5069 0.4835 0.0166  -0.0630 -0.0299 35  THR A C   
70   O O   . THR A 12 ? 0.4204 0.5930 0.5707 0.0158  -0.0613 -0.0266 35  THR A O   
71   C CB  . THR A 12 ? 0.3842 0.5798 0.5182 0.0374  -0.0651 -0.0196 35  THR A CB  
72   O OG1 . THR A 12 ? 0.5957 0.8293 0.7338 0.0407  -0.0777 -0.0147 35  THR A OG1 
73   C CG2 . THR A 12 ? 0.0807 0.2771 0.2116 0.0537  -0.0526 -0.0101 35  THR A CG2 
74   N N   . GLN A 13 ? 0.2594 0.4076 0.3957 0.0159  -0.0584 -0.0356 36  GLN A N   
75   C CA  . GLN A 13 ? 0.1262 0.2643 0.2599 0.0104  -0.0561 -0.0391 36  GLN A CA  
76   C C   . GLN A 13 ? 0.1273 0.2758 0.2738 0.0090  -0.0643 -0.0397 36  GLN A C   
77   O O   . GLN A 13 ? 0.2075 0.3501 0.3469 0.0099  -0.0661 -0.0377 36  GLN A O   
78   C CB  . GLN A 13 ? 0.1212 0.2536 0.2529 0.0006  -0.0502 -0.0456 36  GLN A CB  
79   C CG  . GLN A 13 ? 0.1708 0.3107 0.3050 -0.0157 -0.0538 -0.0511 36  GLN A CG  
80   C CD  . GLN A 13 ? 0.2560 0.3547 0.3485 -0.0308 -0.0432 -0.0548 36  GLN A CD  
81   O OE1 . GLN A 13 ? 0.2164 0.2872 0.2854 -0.0405 -0.0278 -0.0581 36  GLN A OE1 
82   N NE2 . GLN A 13 ? 0.1344 0.2147 0.2043 -0.0329 -0.0478 -0.0544 36  GLN A NE2 
83   N N   . ALA A 14 ? 0.1996 0.3512 0.3524 0.0108  -0.0660 -0.0412 37  ALA A N   
84   C CA  . ALA A 14 ? 0.2854 0.4302 0.4329 0.0168  -0.0687 -0.0396 37  ALA A CA  
85   C C   . ALA A 14 ? 0.3230 0.4562 0.4601 0.0128  -0.0683 -0.0362 37  ALA A C   
86   O O   . ALA A 14 ? 0.2598 0.3834 0.3862 0.0188  -0.0699 -0.0343 37  ALA A O   
87   C CB  . ALA A 14 ? 0.3820 0.5069 0.5149 0.0206  -0.0636 -0.0399 37  ALA A CB  
88   N N   . GLN A 15 ? 0.3963 0.5364 0.5368 0.0030  -0.0660 -0.0344 38  GLN A N   
89   C CA  . GLN A 15 ? 0.4456 0.5900 0.5861 -0.0051 -0.0611 -0.0296 38  GLN A CA  
90   C C   . GLN A 15 ? 0.3623 0.5021 0.4986 0.0057  -0.0557 -0.0248 38  GLN A C   
91   O O   . GLN A 15 ? 0.3201 0.4446 0.4444 0.0042  -0.0481 -0.0213 38  GLN A O   
92   C CB  . GLN A 15 ? 0.5615 0.7447 0.7209 -0.0150 -0.0631 -0.0261 38  GLN A CB  
93   C CG  . GLN A 15 ? 0.7563 0.9613 0.9248 -0.0362 -0.0579 -0.0223 38  GLN A CG  
94   C CD  . GLN A 15 ? 0.7365 1.0093 0.9358 -0.0448 -0.0652 -0.0165 38  GLN A CD  
95   O OE1 . GLN A 15 ? 0.8837 1.2046 1.1087 -0.0556 -0.0589 -0.0086 38  GLN A OE1 
96   N NE2 . GLN A 15 ? 0.5510 0.8337 0.7479 -0.0381 -0.0780 -0.0190 38  GLN A NE2 
97   N N   . VAL A 16 ? 0.3589 0.4992 0.4931 0.0143  -0.0566 -0.0251 39  VAL A N   
98   C CA  . VAL A 16 ? 0.3490 0.4651 0.4593 0.0215  -0.0513 -0.0228 39  VAL A CA  
99   C C   . VAL A 16 ? 0.4251 0.5233 0.5193 0.0197  -0.0618 -0.0283 39  VAL A C   
100  O O   . VAL A 16 ? 0.4341 0.5096 0.5064 0.0246  -0.0590 -0.0251 39  VAL A O   
101  C CB  . VAL A 16 ? 0.2794 0.3811 0.3722 0.0245  -0.0467 -0.0241 39  VAL A CB  
102  C CG1 . VAL A 16 ? 0.1355 0.1929 0.1842 0.0229  -0.0430 -0.0259 39  VAL A CG1 
103  C CG2 . VAL A 16 ? 0.3948 0.5119 0.4921 0.0398  -0.0346 -0.0140 39  VAL A CG2 
104  N N   . ASP A 17 ? 0.4172 0.5311 0.5223 0.0151  -0.0732 -0.0349 40  ASP A N   
105  C CA  . ASP A 17 ? 0.4555 0.5760 0.5529 0.0162  -0.0877 -0.0382 40  ASP A CA  
106  C C   . ASP A 17 ? 0.4691 0.5714 0.5495 0.0313  -0.0877 -0.0330 40  ASP A C   
107  O O   . ASP A 17 ? 0.6344 0.7248 0.6888 0.0381  -0.0973 -0.0324 40  ASP A O   
108  C CB  . ASP A 17 ? 0.4570 0.6194 0.5850 0.0140  -0.0957 -0.0419 40  ASP A CB  
109  C CG  . ASP A 17 ? 0.6319 0.8023 0.7662 -0.0071 -0.0922 -0.0484 40  ASP A CG  
110  O OD1 . ASP A 17 ? 0.8057 0.9481 0.9088 -0.0216 -0.0917 -0.0521 40  ASP A OD1 
111  O OD2 . ASP A 17 ? 0.4787 0.6698 0.6368 -0.0096 -0.0860 -0.0498 40  ASP A OD2 
112  N N   . GLU A 18 ? 0.3523 0.4447 0.4369 0.0338  -0.0765 -0.0299 41  GLU A N   
113  C CA  . GLU A 18 ? 0.4171 0.4725 0.4707 0.0423  -0.0683 -0.0255 41  GLU A CA  
114  C C   . GLU A 18 ? 0.4495 0.4786 0.4790 0.0410  -0.0606 -0.0220 41  GLU A C   
115  O O   . GLU A 18 ? 0.5952 0.5966 0.5887 0.0542  -0.0654 -0.0201 41  GLU A O   
116  C CB  . GLU A 18 ? 0.4532 0.4947 0.5068 0.0297  -0.0546 -0.0254 41  GLU A CB  
117  C CG  . GLU A 18 ? 0.7312 0.7168 0.7381 0.0309  -0.0396 -0.0222 41  GLU A CG  
118  C CD  . GLU A 18 ? 1.0970 1.0585 1.0902 0.0070  -0.0265 -0.0253 41  GLU A CD  
119  O OE1 . GLU A 18 ? 1.2557 1.2508 1.2789 -0.0082 -0.0330 -0.0294 41  GLU A OE1 
120  O OE2 . GLU A 18 ? 1.3445 1.2450 1.2866 0.0007  -0.0091 -0.0243 41  GLU A OE2 
121  N N   . VAL A 19 ? 0.4474 0.4863 0.4930 0.0299  -0.0478 -0.0192 42  VAL A N   
122  C CA  . VAL A 19 ? 0.4967 0.5096 0.5186 0.0334  -0.0314 -0.0123 42  VAL A CA  
123  C C   . VAL A 19 ? 0.5447 0.5244 0.5253 0.0434  -0.0397 -0.0139 42  VAL A C   
124  O O   . VAL A 19 ? 0.5087 0.4441 0.4463 0.0518  -0.0306 -0.0097 42  VAL A O   
125  C CB  . VAL A 19 ? 0.4565 0.5020 0.5075 0.0303  -0.0165 -0.0055 42  VAL A CB  
126  C CG1 . VAL A 19 ? 0.4521 0.4724 0.4780 0.0409  0.0068  0.0049  42  VAL A CG1 
127  C CG2 . VAL A 19 ? 0.5326 0.6193 0.6218 0.0134  -0.0132 -0.0046 42  VAL A CG2 
128  N N   . VAL A 20 ? 0.4631 0.5480 0.4599 0.0489  -0.0491 -0.0434 43  VAL A N   
129  C CA  . VAL A 20 ? 0.4964 0.5848 0.5027 0.0462  -0.0439 -0.0354 43  VAL A CA  
130  C C   . VAL A 20 ? 0.5403 0.6338 0.5634 0.0452  -0.0438 -0.0341 43  VAL A C   
131  O O   . VAL A 20 ? 0.5911 0.6903 0.6241 0.0400  -0.0465 -0.0297 43  VAL A O   
132  C CB  . VAL A 20 ? 0.4808 0.5692 0.4775 0.0466  -0.0331 -0.0326 43  VAL A CB  
133  C CG1 . VAL A 20 ? 0.4918 0.5787 0.4889 0.0371  -0.0272 -0.0274 43  VAL A CG1 
134  C CG2 . VAL A 20 ? 0.8106 0.8904 0.7843 0.0535  -0.0308 -0.0327 43  VAL A CG2 
135  N N   . ASP A 21 ? 0.5366 0.6278 0.5600 0.0527  -0.0393 -0.0369 44  ASP A N   
136  C CA  . ASP A 21 ? 0.5528 0.6496 0.5898 0.0593  -0.0371 -0.0317 44  ASP A CA  
137  C C   . ASP A 21 ? 0.5033 0.5856 0.5422 0.0555  -0.0428 -0.0311 44  ASP A C   
138  O O   . ASP A 21 ? 0.4857 0.5786 0.5348 0.0547  -0.0453 -0.0229 44  ASP A O   
139  C CB  . ASP A 21 ? 0.5968 0.6859 0.6295 0.0733  -0.0276 -0.0343 44  ASP A CB  
140  C CG  . ASP A 21 ? 0.7950 0.8993 0.8242 0.0751  -0.0202 -0.0359 44  ASP A CG  
141  O OD1 . ASP A 21 ? 0.9200 1.0418 0.9525 0.0647  -0.0210 -0.0329 44  ASP A OD1 
142  O OD2 . ASP A 21 ? 0.8971 0.9916 0.9169 0.0856  -0.0109 -0.0406 44  ASP A OD2 
143  N N   . ILE A 22 ? 0.4188 0.4802 0.4463 0.0507  -0.0444 -0.0403 45  ILE A N   
144  C CA  . ILE A 22 ? 0.4323 0.4798 0.4610 0.0427  -0.0469 -0.0413 45  ILE A CA  
145  C C   . ILE A 22 ? 0.4230 0.4882 0.4631 0.0370  -0.0529 -0.0334 45  ILE A C   
146  O O   . ILE A 22 ? 0.4244 0.4866 0.4698 0.0368  -0.0523 -0.0262 45  ILE A O   
147  C CB  . ILE A 22 ? 0.4693 0.5085 0.4874 0.0296  -0.0504 -0.0548 45  ILE A CB  
148  C CG1 . ILE A 22 ? 0.5785 0.5891 0.5780 0.0288  -0.0422 -0.0671 45  ILE A CG1 
149  C CG2 . ILE A 22 ? 0.4474 0.4823 0.4714 0.0169  -0.0524 -0.0548 45  ILE A CG2 
150  C CD1 . ILE A 22 ? 0.7225 0.7378 0.7104 0.0369  -0.0398 -0.0721 45  ILE A CD1 
151  N N   . MET A 23 ? 0.4288 0.5089 0.4685 0.0337  -0.0567 -0.0340 46  MET A N   
152  C CA  . MET A 23 ? 0.4410 0.5304 0.4861 0.0284  -0.0590 -0.0289 46  MET A CA  
153  C C   . MET A 23 ? 0.4114 0.5091 0.4613 0.0280  -0.0570 -0.0216 46  MET A C   
154  O O   . MET A 23 ? 0.3393 0.4391 0.3922 0.0233  -0.0582 -0.0175 46  MET A O   
155  C CB  . MET A 23 ? 0.5284 0.6238 0.5662 0.0300  -0.0590 -0.0294 46  MET A CB  
156  C CG  . MET A 23 ? 0.4147 0.5190 0.4516 0.0301  -0.0643 -0.0339 46  MET A CG  
157  S SD  . MET A 23 ? 0.4533 0.5668 0.5028 0.0232  -0.0657 -0.0313 46  MET A SD  
158  C CE  . MET A 23 ? 0.1243 0.2380 0.1661 0.0331  -0.0590 -0.0231 46  MET A CE  
159  N N   . ARG A 24 ? 0.4607 0.5686 0.5111 0.0312  -0.0537 -0.0204 47  ARG A N   
160  C CA  . ARG A 24 ? 0.4600 0.5900 0.5168 0.0275  -0.0534 -0.0148 47  ARG A CA  
161  C C   . ARG A 24 ? 0.4788 0.6105 0.5407 0.0324  -0.0569 -0.0075 47  ARG A C   
162  O O   . ARG A 24 ? 0.4255 0.5665 0.4865 0.0250  -0.0595 -0.0038 47  ARG A O   
163  C CB  . ARG A 24 ? 0.4658 0.6176 0.5289 0.0323  -0.0496 -0.0136 47  ARG A CB  
164  C CG  . ARG A 24 ? 0.6618 0.8270 0.7209 0.0177  -0.0443 -0.0175 47  ARG A CG  
165  C CD  . ARG A 24 ? 0.7675 0.9680 0.8381 0.0185  -0.0398 -0.0162 47  ARG A CD  
166  N NE  . ARG A 24 ? 0.8014 0.9914 0.8615 0.0111  -0.0298 -0.0219 47  ARG A NE  
167  C CZ  . ARG A 24 ? 1.0707 1.2502 1.1270 0.0232  -0.0248 -0.0231 47  ARG A CZ  
168  N NH1 . ARG A 24 ? 1.1577 1.3322 1.2189 0.0421  -0.0275 -0.0213 47  ARG A NH1 
169  N NH2 . ARG A 24 ? 1.2097 1.3785 1.2523 0.0157  -0.0145 -0.0264 47  ARG A NH2 
170  N N   . VAL A 25 ? 0.4308 0.5477 0.4930 0.0451  -0.0545 -0.0054 48  VAL A N   
171  C CA  . VAL A 25 ? 0.4195 0.5278 0.4810 0.0536  -0.0535 0.0043  48  VAL A CA  
172  C C   . VAL A 25 ? 0.4417 0.5363 0.4987 0.0417  -0.0556 0.0039  48  VAL A C   
173  O O   . VAL A 25 ? 0.5010 0.6014 0.5561 0.0430  -0.0566 0.0137  48  VAL A O   
174  C CB  . VAL A 25 ? 0.4553 0.5313 0.5094 0.0663  -0.0451 0.0036  48  VAL A CB  
175  C CG1 . VAL A 25 ? 0.5482 0.6092 0.5964 0.0804  -0.0396 0.0182  48  VAL A CG1 
176  C CG2 . VAL A 25 ? 0.4514 0.5379 0.5084 0.0782  -0.0405 0.0011  48  VAL A CG2 
177  N N   . ASN A 26 ? 0.3729 0.4547 0.4281 0.0314  -0.0561 -0.0063 49  ASN A N   
178  C CA  . ASN A 26 ? 0.3880 0.4649 0.4427 0.0208  -0.0566 -0.0069 49  ASN A CA  
179  C C   . ASN A 26 ? 0.3800 0.4751 0.4345 0.0154  -0.0587 -0.0035 49  ASN A C   
180  O O   . ASN A 26 ? 0.4064 0.5005 0.4580 0.0110  -0.0575 0.0015  49  ASN A O   
181  C CB  . ASN A 26 ? 0.4969 0.5715 0.5532 0.0132  -0.0578 -0.0177 49  ASN A CB  
182  C CG  . ASN A 26 ? 0.7030 0.7567 0.7549 0.0091  -0.0544 -0.0246 49  ASN A CG  
183  O OD1 . ASN A 26 ? 0.9951 1.0252 1.0397 0.0151  -0.0480 -0.0207 49  ASN A OD1 
184  N ND2 . ASN A 26 ? 0.9194 0.9819 0.9732 -0.0012 -0.0573 -0.0352 49  ASN A ND2 
185  N N   . VAL A 27 ? 0.3970 0.5044 0.4503 0.0138  -0.0593 -0.0070 50  VAL A N   
186  C CA  . VAL A 27 ? 0.4648 0.5820 0.5112 0.0045  -0.0577 -0.0071 50  VAL A CA  
187  C C   . VAL A 27 ? 0.5028 0.6382 0.5480 0.0038  -0.0612 0.0009  50  VAL A C   
188  O O   . VAL A 27 ? 0.5021 0.6393 0.5393 -0.0031 -0.0606 0.0031  50  VAL A O   
189  C CB  . VAL A 27 ? 0.5133 0.6328 0.5535 -0.0008 -0.0536 -0.0132 50  VAL A CB  
190  C CG1 . VAL A 27 ? 0.0665 0.1891 0.0931 -0.0159 -0.0487 -0.0167 50  VAL A CG1 
191  C CG2 . VAL A 27 ? 0.6572 0.7593 0.6937 0.0048  -0.0497 -0.0171 50  VAL A CG2 
192  N N   . ASP A 28 ? 0.4940 0.6461 0.5461 0.0133  -0.0642 0.0064  51  ASP A N   
193  C CA  . ASP A 28 ? 0.6021 0.7784 0.6541 0.0204  -0.0683 0.0185  51  ASP A CA  
194  C C   . ASP A 28 ? 0.5783 0.7333 0.6221 0.0242  -0.0666 0.0268  51  ASP A C   
195  O O   . ASP A 28 ? 0.6784 0.8453 0.7126 0.0172  -0.0685 0.0307  51  ASP A O   
196  C CB  . ASP A 28 ? 0.6915 0.8823 0.7534 0.0397  -0.0685 0.0266  51  ASP A CB  
197  C CG  . ASP A 28 ? 0.9179 1.1446 0.9803 0.0531  -0.0730 0.0430  51  ASP A CG  
198  O OD1 . ASP A 28 ? 1.0438 1.3116 1.1046 0.0403  -0.0799 0.0426  51  ASP A OD1 
199  O OD2 . ASP A 28 ? 1.2321 1.4450 1.2931 0.0768  -0.0686 0.0565  51  ASP A OD2 
200  N N   . LYS A 29 ? 0.5337 0.6557 0.5779 0.0323  -0.0612 0.0284  52  LYS A N   
201  C CA  . LYS A 29 ? 0.6599 0.7577 0.6946 0.0314  -0.0561 0.0354  52  LYS A CA  
202  C C   . LYS A 29 ? 0.6382 0.7438 0.6676 0.0158  -0.0567 0.0315  52  LYS A C   
203  O O   . LYS A 29 ? 0.7047 0.8133 0.7225 0.0158  -0.0556 0.0414  52  LYS A O   
204  C CB  . LYS A 29 ? 0.7255 0.7860 0.7607 0.0284  -0.0485 0.0287  52  LYS A CB  
205  C CG  . LYS A 29 ? 0.9687 1.0053 0.9989 0.0448  -0.0419 0.0342  52  LYS A CG  
206  C CD  . LYS A 29 ? 1.0388 1.0393 1.0659 0.0353  -0.0343 0.0212  52  LYS A CD  
207  C CE  . LYS A 29 ? 0.9922 0.9610 1.0084 0.0525  -0.0240 0.0245  52  LYS A CE  
208  N NZ  . LYS A 29 ? 1.1126 1.0365 1.1167 0.0381  -0.0129 0.0104  52  LYS A NZ  
209  N N   . VAL A 30 ? 0.5832 0.6901 0.6180 0.0052  -0.0565 0.0184  53  VAL A N   
210  C CA  . VAL A 30 ? 0.6537 0.7614 0.6821 -0.0059 -0.0527 0.0140  53  VAL A CA  
211  C C   . VAL A 30 ? 0.7130 0.8399 0.7272 -0.0121 -0.0550 0.0161  53  VAL A C   
212  O O   . VAL A 30 ? 0.8348 0.9600 0.8365 -0.0185 -0.0510 0.0179  53  VAL A O   
213  C CB  . VAL A 30 ? 0.6786 0.7831 0.7124 -0.0092 -0.0497 0.0025  53  VAL A CB  
214  C CG1 . VAL A 30 ? 0.6440 0.7494 0.6638 -0.0171 -0.0438 -0.0026 53  VAL A CG1 
215  C CG2 . VAL A 30 ? 0.6674 0.7651 0.7120 -0.0094 -0.0463 0.0002  53  VAL A CG2 
216  N N   . LEU A 31 ? 0.7086 0.8574 0.7233 -0.0127 -0.0609 0.0145  54  LEU A N   
217  C CA  . LEU A 31 ? 0.7992 0.9758 0.7994 -0.0238 -0.0645 0.0142  54  LEU A CA  
218  C C   . LEU A 31 ? 0.8408 1.0309 0.8324 -0.0155 -0.0687 0.0298  54  LEU A C   
219  O O   . LEU A 31 ? 0.8914 1.0890 0.8644 -0.0258 -0.0678 0.0296  54  LEU A O   
220  C CB  . LEU A 31 ? 0.7916 1.0012 0.7980 -0.0284 -0.0704 0.0102  54  LEU A CB  
221  C CG  . LEU A 31 ? 0.7458 0.9375 0.7511 -0.0407 -0.0628 -0.0051 54  LEU A CG  
222  C CD1 . LEU A 31 ? 0.6986 0.9256 0.7100 -0.0494 -0.0665 -0.0091 54  LEU A CD1 
223  C CD2 . LEU A 31 ? 0.2923 0.4602 0.2750 -0.0578 -0.0523 -0.0164 54  LEU A CD2 
224  N N   . GLU A 32 ? 0.8492 1.0380 0.8496 0.0044  -0.0710 0.0440  55  GLU A N   
225  C CA  . GLU A 32 ? 0.9537 1.1450 0.9411 0.0174  -0.0713 0.0629  55  GLU A CA  
226  C C   . GLU A 32 ? 0.9745 1.1345 0.9486 0.0074  -0.0621 0.0618  55  GLU A C   
227  O O   . GLU A 32 ? 1.0971 1.2685 1.0516 0.0051  -0.0625 0.0698  55  GLU A O   
228  C CB  . GLU A 32 ? 1.0098 1.1847 1.0036 0.0428  -0.0682 0.0782  55  GLU A CB  
229  C CG  . GLU A 32 ? 1.1807 1.3982 1.1869 0.0585  -0.0761 0.0844  55  GLU A CG  
230  C CD  . GLU A 32 ? 1.4605 1.6494 1.4734 0.0839  -0.0680 0.0937  55  GLU A CD  
231  O OE1 . GLU A 32 ? 1.5204 1.6588 1.5342 0.0795  -0.0585 0.0847  55  GLU A OE1 
232  O OE2 . GLU A 32 ? 1.6022 1.8221 1.6185 0.1087  -0.0704 0.1098  55  GLU A OE2 
233  N N   . ARG A 33 ? 0.9110 1.0385 0.8957 0.0014  -0.0539 0.0519  56  ARG A N   
234  C CA  . ARG A 33 ? 0.9010 1.0080 0.8789 -0.0090 -0.0436 0.0495  56  ARG A CA  
235  C C   . ARG A 33 ? 0.9150 1.0367 0.8776 -0.0222 -0.0423 0.0417  56  ARG A C   
236  O O   . ARG A 33 ? 1.0264 1.1495 0.9694 -0.0251 -0.0386 0.0492  56  ARG A O   
237  C CB  . ARG A 33 ? 0.8930 0.9817 0.8900 -0.0142 -0.0378 0.0378  56  ARG A CB  
238  C CG  . ARG A 33 ? 0.8261 0.9028 0.8236 -0.0241 -0.0262 0.0364  56  ARG A CG  
239  C CD  . ARG A 33 ? 0.6829 0.7628 0.7023 -0.0286 -0.0243 0.0236  56  ARG A CD  
240  N NE  . ARG A 33 ? 0.6734 0.7508 0.7023 -0.0390 -0.0142 0.0220  56  ARG A NE  
241  C CZ  . ARG A 33 ? 0.8045 0.9007 0.8444 -0.0434 -0.0076 0.0157  56  ARG A CZ  
242  N NH1 . ARG A 33 ? 0.8453 0.9532 0.8833 -0.0362 -0.0074 0.0107  56  ARG A NH1 
243  N NH2 . ARG A 33 ? 0.7697 0.8730 0.8218 -0.0554 0.0014  0.0144  56  ARG A NH2 
244  N N   . ASP A 34 ? 0.9051 1.0324 0.8719 -0.0302 -0.0429 0.0264  57  ASP A N   
245  C CA  . ASP A 34 ? 0.9741 1.1039 0.9206 -0.0443 -0.0371 0.0156  57  ASP A CA  
246  C C   . ASP A 34 ? 1.0365 1.1912 0.9581 -0.0511 -0.0432 0.0213  57  ASP A C   
247  O O   . ASP A 34 ? 1.0245 1.1751 0.9225 -0.0614 -0.0357 0.0171  57  ASP A O   
248  C CB  . ASP A 34 ? 0.9791 1.1058 0.9278 -0.0510 -0.0357 0.0007  57  ASP A CB  
249  C CG  . ASP A 34 ? 1.1070 1.2193 1.0295 -0.0657 -0.0231 -0.0131 57  ASP A CG  
250  O OD1 . ASP A 34 ? 1.1020 1.2298 1.0014 -0.0819 -0.0258 -0.0188 57  ASP A OD1 
251  O OD2 . ASP A 34 ? 1.1319 1.2188 1.0555 -0.0607 -0.0094 -0.0184 57  ASP A OD2 
252  N N   . GLN A 35 ? 1.0921 1.2765 1.0181 -0.0436 -0.0564 0.0312  58  GLN A N   
253  C CA  . GLN A 35 ? 1.1944 1.4170 1.0994 -0.0452 -0.0658 0.0408  58  GLN A CA  
254  C C   . GLN A 35 ? 1.2102 1.4198 1.0974 -0.0362 -0.0606 0.0576  58  GLN A C   
255  O O   . GLN A 35 ? 1.2628 1.4861 1.1216 -0.0468 -0.0600 0.0571  58  GLN A O   
256  C CB  . GLN A 35 ? 1.2213 1.4852 1.1410 -0.0310 -0.0800 0.0524  58  GLN A CB  
257  C CG  . GLN A 35 ? 1.3830 1.6826 1.3087 -0.0494 -0.0868 0.0355  58  GLN A CG  
258  C CD  . GLN A 35 ? 1.5009 1.8502 1.4471 -0.0345 -0.0993 0.0465  58  GLN A CD  
259  O OE1 . GLN A 35 ? 1.5920 1.9363 1.5508 -0.0056 -0.1004 0.0659  58  GLN A OE1 
260  N NE2 . GLN A 35 ? 1.4894 1.8859 1.4373 -0.0554 -0.1061 0.0332  58  GLN A NE2 
261  N N   . LYS A 36 ? 1.2073 1.3874 1.1074 -0.0194 -0.0547 0.0711  59  LYS A N   
262  C CA  . LYS A 36 ? 1.2604 1.4188 1.1427 -0.0116 -0.0455 0.0887  59  LYS A CA  
263  C C   . LYS A 36 ? 1.2728 1.4148 1.1391 -0.0284 -0.0326 0.0794  59  LYS A C   
264  O O   . LYS A 36 ? 1.3412 1.4740 1.1848 -0.0261 -0.0251 0.0932  59  LYS A O   
265  C CB  . LYS A 36 ? 1.2625 1.3810 1.1605 0.0013  -0.0365 0.0984  59  LYS A CB  
266  C CG  . LYS A 36 ? 1.3396 1.4623 1.2430 0.0253  -0.0429 0.1146  59  LYS A CG  
267  C CD  . LYS A 36 ? 1.2897 1.3674 1.2107 0.0300  -0.0327 0.1123  59  LYS A CD  
268  C CE  . LYS A 36 ? 1.2252 1.2775 1.1344 0.0566  -0.0263 0.1353  59  LYS A CE  
269  N NZ  . LYS A 36 ? 1.1229 1.2138 1.0397 0.0792  -0.0390 0.1437  59  LYS A NZ  
270  N N   . LEU A 37 ? 1.2358 1.3723 1.1114 -0.0426 -0.0275 0.0580  60  LEU A N   
271  C CA  . LEU A 37 ? 1.2795 1.4007 1.1415 -0.0541 -0.0118 0.0493  60  LEU A CA  
272  C C   . LEU A 37 ? 1.3020 1.4391 1.1288 -0.0686 -0.0119 0.0392  60  LEU A C   
273  O O   . LEU A 37 ? 1.3461 1.4799 1.1458 -0.0731 -0.0030 0.0437  60  LEU A O   
274  C CB  . LEU A 37 ? 1.2520 1.3567 1.1398 -0.0561 -0.0024 0.0343  60  LEU A CB  
275  C CG  . LEU A 37 ? 1.1893 1.2849 1.1109 -0.0473 -0.0043 0.0384  60  LEU A CG  
276  C CD1 . LEU A 37 ? 1.2376 1.3301 1.1805 -0.0475 0.0021  0.0242  60  LEU A CD1 
277  C CD2 . LEU A 37 ? 0.8199 0.9007 0.7438 -0.0463 0.0045  0.0520  60  LEU A CD2 
278  O OXT . LEU A 37 ? 1.2729 1.4250 1.0939 -0.0790 -0.0190 0.0251  60  LEU A OXT 
279  N N   . GLY B 1  ? 1.2638 1.2395 1.2048 -0.0110 -0.0584 0.0090  189 GLY B N   
280  C CA  . GLY B 1  ? 1.1348 1.1416 1.0965 -0.0048 -0.0696 0.0118  189 GLY B CA  
281  C C   . GLY B 1  ? 1.0636 1.0691 1.0402 0.0100  -0.0785 0.0183  189 GLY B C   
282  O O   . GLY B 1  ? 1.0448 1.0410 1.0237 0.0152  -0.0774 0.0201  189 GLY B O   
283  N N   . SER B 2  ? 0.9963 1.0113 0.9802 0.0155  -0.0858 0.0213  190 SER B N   
284  C CA  . SER B 2  ? 0.9637 0.9840 0.9603 0.0234  -0.0922 0.0247  190 SER B CA  
285  C C   . SER B 2  ? 0.9372 0.9514 0.9384 0.0292  -0.0942 0.0266  190 SER B C   
286  O O   . SER B 2  ? 0.9199 0.9437 0.9320 0.0309  -0.0962 0.0267  190 SER B O   
287  C CB  . SER B 2  ? 0.9758 0.9952 0.9700 0.0259  -0.0969 0.0267  190 SER B CB  
288  O OG  . SER B 2  ? 0.7771 0.8072 0.7696 0.0265  -0.0947 0.0270  190 SER B OG  
289  N N   . ALA B 3  ? 0.9240 0.9234 0.9145 0.0339  -0.0926 0.0284  191 ALA B N   
290  C CA  . ALA B 3  ? 0.9113 0.9095 0.9031 0.0438  -0.0926 0.0315  191 ALA B CA  
291  C C   . ALA B 3  ? 0.8368 0.8348 0.8326 0.0419  -0.0871 0.0300  191 ALA B C   
292  O O   . ALA B 3  ? 0.6905 0.7047 0.7011 0.0435  -0.0907 0.0299  191 ALA B O   
293  C CB  . ALA B 3  ? 0.9972 0.9737 0.9688 0.0531  -0.0878 0.0352  191 ALA B CB  
294  N N   . LEU B 4  ? 0.8572 0.8356 0.8371 0.0361  -0.0772 0.0276  192 LEU B N   
295  C CA  . LEU B 4  ? 0.9055 0.8787 0.8836 0.0323  -0.0696 0.0253  192 LEU B CA  
296  C C   . LEU B 4  ? 0.8642 0.8613 0.8592 0.0228  -0.0721 0.0212  192 LEU B C   
297  O O   . LEU B 4  ? 0.8599 0.8636 0.8640 0.0240  -0.0713 0.0211  192 LEU B O   
298  C CB  . LEU B 4  ? 0.9946 0.9369 0.9444 0.0236  -0.0554 0.0218  192 LEU B CB  
299  C CG  . LEU B 4  ? 1.0068 0.9421 0.9486 0.0110  -0.0444 0.0161  192 LEU B CG  
300  C CD1 . LEU B 4  ? 1.0788 0.9681 0.9834 0.0085  -0.0268 0.0150  192 LEU B CD1 
301  C CD2 . LEU B 4  ? 1.0344 0.9965 0.9840 -0.0076 -0.0448 0.0084  192 LEU B CD2 
302  N N   . SER B 5  ? 0.8311 0.8421 0.8286 0.0155  -0.0743 0.0187  193 SER B N   
303  C CA  . SER B 5  ? 0.8083 0.8437 0.8179 0.0117  -0.0755 0.0166  193 SER B CA  
304  C C   . SER B 5  ? 0.7509 0.7938 0.7757 0.0204  -0.0819 0.0200  193 SER B C   
305  O O   . SER B 5  ? 0.7325 0.7832 0.7653 0.0202  -0.0803 0.0192  193 SER B O   
306  C CB  . SER B 5  ? 0.8619 0.9134 0.8689 0.0086  -0.0767 0.0156  193 SER B CB  
307  O OG  . SER B 5  ? 1.0618 1.1096 1.0719 0.0169  -0.0834 0.0198  193 SER B OG  
308  N N   . GLU B 6  ? 0.7156 0.7559 0.7424 0.0257  -0.0879 0.0228  194 GLU B N   
309  C CA  . GLU B 6  ? 0.7223 0.7690 0.7587 0.0285  -0.0914 0.0237  194 GLU B CA  
310  C C   . GLU B 6  ? 0.7185 0.7686 0.7635 0.0299  -0.0905 0.0232  194 GLU B C   
311  O O   . GLU B 6  ? 0.7304 0.7873 0.7827 0.0292  -0.0900 0.0223  194 GLU B O   
312  C CB  . GLU B 6  ? 0.8150 0.8598 0.8504 0.0300  -0.0966 0.0247  194 GLU B CB  
313  C CG  . GLU B 6  ? 1.0239 1.0641 1.0512 0.0280  -0.0971 0.0249  194 GLU B CG  
314  C CD  . GLU B 6  ? 1.3092 1.3487 1.3335 0.0272  -0.1021 0.0249  194 GLU B CD  
315  O OE1 . GLU B 6  ? 1.3792 1.4300 1.4096 0.0263  -0.1051 0.0237  194 GLU B OE1 
316  O OE2 . GLU B 6  ? 1.3978 1.4300 1.4135 0.0273  -0.1030 0.0260  194 GLU B OE2 
317  N N   . ILE B 7  ? 0.7238 0.7656 0.7641 0.0333  -0.0886 0.0244  195 ILE B N   
318  C CA  . ILE B 7  ? 0.7402 0.7823 0.7849 0.0365  -0.0857 0.0247  195 ILE B CA  
319  C C   . ILE B 7  ? 0.7001 0.7436 0.7461 0.0294  -0.0801 0.0216  195 ILE B C   
320  O O   . ILE B 7  ? 0.6569 0.7119 0.7137 0.0284  -0.0811 0.0206  195 ILE B O   
321  C CB  . ILE B 7  ? 0.7572 0.7829 0.7884 0.0449  -0.0813 0.0279  195 ILE B CB  
322  C CG1 . ILE B 7  ? 0.7855 0.8194 0.8166 0.0550  -0.0875 0.0317  195 ILE B CG1 
323  C CG2 . ILE B 7  ? 0.7808 0.8037 0.8131 0.0495  -0.0761 0.0287  195 ILE B CG2 
324  C CD1 . ILE B 7  ? 0.9588 0.9809 0.9752 0.0708  -0.0824 0.0373  195 ILE B CD1 
325  N N   . GLU B 8  ? 0.7577 0.7907 0.7906 0.0229  -0.0732 0.0192  196 GLU B N   
326  C CA  . GLU B 8  ? 0.8809 0.9215 0.9133 0.0135  -0.0670 0.0148  196 GLU B CA  
327  C C   . GLU B 8  ? 0.8437 0.9081 0.8905 0.0144  -0.0707 0.0147  196 GLU B C   
328  O O   . GLU B 8  ? 0.7549 0.8269 0.8075 0.0125  -0.0679 0.0132  196 GLU B O   
329  C CB  . GLU B 8  ? 1.0226 1.0628 1.0398 0.0012  -0.0607 0.0100  196 GLU B CB  
330  C CG  . GLU B 8  ? 1.2126 1.2209 1.2064 -0.0045 -0.0502 0.0079  196 GLU B CG  
331  C CD  . GLU B 8  ? 1.2770 1.2854 1.2528 -0.0216 -0.0422 0.0008  196 GLU B CD  
332  O OE1 . GLU B 8  ? 1.3105 1.3475 1.2948 -0.0245 -0.0478 -0.0005 196 GLU B OE1 
333  O OE2 . GLU B 8  ? 1.1494 1.1281 1.0994 -0.0322 -0.0289 -0.0035 196 GLU B OE2 
334  N N   . THR B 9  ? 0.8152 0.8877 0.8641 0.0184  -0.0753 0.0167  197 THR B N   
335  C CA  . THR B 9  ? 0.7931 0.8795 0.8474 0.0232  -0.0757 0.0181  197 THR B CA  
336  C C   . THR B 9  ? 0.7120 0.7918 0.7751 0.0268  -0.0777 0.0192  197 THR B C   
337  O O   . THR B 9  ? 0.6167 0.7033 0.6840 0.0283  -0.0750 0.0191  197 THR B O   
338  C CB  . THR B 9  ? 0.7766 0.8654 0.8235 0.0287  -0.0770 0.0208  197 THR B CB  
339  O OG1 . THR B 9  ? 1.0065 1.0784 1.0524 0.0300  -0.0811 0.0223  197 THR B OG1 
340  C CG2 . THR B 9  ? 0.6620 0.7623 0.7008 0.0246  -0.0756 0.0193  197 THR B CG2 
341  N N   . ARG B 10 ? 0.6187 0.6892 0.6838 0.0276  -0.0819 0.0199  198 ARG B N   
342  C CA  . ARG B 10 ? 0.6265 0.6986 0.6998 0.0278  -0.0831 0.0192  198 ARG B CA  
343  C C   . ARG B 10 ? 0.5369 0.6127 0.6174 0.0280  -0.0806 0.0185  198 ARG B C   
344  O O   . ARG B 10 ? 0.5131 0.5934 0.6000 0.0275  -0.0790 0.0175  198 ARG B O   
345  C CB  . ARG B 10 ? 0.7556 0.8293 0.8306 0.0282  -0.0881 0.0193  198 ARG B CB  
346  C CG  . ARG B 10 ? 0.9002 0.9839 0.9819 0.0243  -0.0892 0.0165  198 ARG B CG  
347  C CD  . ARG B 10 ? 1.2011 1.2990 1.2843 0.0237  -0.0944 0.0157  198 ARG B CD  
348  N NE  . ARG B 10 ? 1.5476 1.6517 1.6327 0.0348  -0.0968 0.0198  198 ARG B NE  
349  C CZ  . ARG B 10 ? 1.7843 1.9081 1.8707 0.0407  -0.1011 0.0211  198 ARG B CZ  
350  N NH1 . ARG B 10 ? 1.8760 2.0217 1.9650 0.0322  -0.1046 0.0167  198 ARG B NH1 
351  N NH2 . ARG B 10 ? 1.8211 1.9434 1.9027 0.0556  -0.1001 0.0268  198 ARG B NH2 
352  N N   . HIS B 11 ? 0.5374 0.6068 0.6130 0.0281  -0.0784 0.0188  199 HIS B N   
353  C CA  . HIS B 11 ? 0.6205 0.6870 0.6973 0.0277  -0.0736 0.0180  199 HIS B CA  
354  C C   . HIS B 11 ? 0.6736 0.7507 0.7542 0.0224  -0.0701 0.0154  199 HIS B C   
355  O O   . HIS B 11 ? 0.7179 0.8000 0.8073 0.0236  -0.0695 0.0151  199 HIS B O   
356  C CB  . HIS B 11 ? 0.7065 0.7547 0.7675 0.0269  -0.0677 0.0181  199 HIS B CB  
357  C CG  . HIS B 11 ? 0.7860 0.8249 0.8395 0.0209  -0.0585 0.0154  199 HIS B CG  
358  N ND1 . HIS B 11 ? 0.8655 0.8903 0.9142 0.0277  -0.0536 0.0176  199 HIS B ND1 
359  C CD2 . HIS B 11 ? 0.6998 0.7437 0.7474 0.0081  -0.0522 0.0101  199 HIS B CD2 
360  C CE1 . HIS B 11 ? 0.7907 0.8053 0.8294 0.0180  -0.0439 0.0136  199 HIS B CE1 
361  N NE2 . HIS B 11 ? 0.7447 0.7735 0.7834 0.0045  -0.0432 0.0083  199 HIS B NE2 
362  N N   . SER B 12 ? 0.6429 0.7278 0.7168 0.0174  -0.0676 0.0136  200 SER B N   
363  C CA  . SER B 12 ? 0.5684 0.6733 0.6447 0.0154  -0.0645 0.0119  200 SER B CA  
364  C C   . SER B 12 ? 0.4981 0.6064 0.5822 0.0233  -0.0662 0.0145  200 SER B C   
365  O O   . SER B 12 ? 0.4852 0.5991 0.5750 0.0231  -0.0637 0.0137  200 SER B O   
366  C CB  . SER B 12 ? 0.6076 0.7296 0.6762 0.0143  -0.0638 0.0114  200 SER B CB  
367  O OG  . SER B 12 ? 0.7224 0.8684 0.7926 0.0203  -0.0619 0.0127  200 SER B OG  
368  N N   . GLU B 13 ? 0.4457 0.5469 0.5265 0.0288  -0.0687 0.0172  201 GLU B N   
369  C CA  . GLU B 13 ? 0.4592 0.5543 0.5390 0.0338  -0.0667 0.0187  201 GLU B CA  
370  C C   . GLU B 13 ? 0.4593 0.5507 0.5494 0.0305  -0.0672 0.0167  201 GLU B C   
371  O O   . GLU B 13 ? 0.4712 0.5610 0.5605 0.0327  -0.0631 0.0167  201 GLU B O   
372  C CB  . GLU B 13 ? 0.4670 0.5470 0.5375 0.0348  -0.0676 0.0198  201 GLU B CB  
373  C CG  . GLU B 13 ? 0.7934 0.8733 0.8488 0.0431  -0.0636 0.0234  201 GLU B CG  
374  C CD  . GLU B 13 ? 1.0616 1.1203 1.1031 0.0429  -0.0621 0.0241  201 GLU B CD  
375  O OE1 . GLU B 13 ? 1.1517 1.1941 1.1746 0.0500  -0.0535 0.0267  201 GLU B OE1 
376  O OE2 . GLU B 13 ? 1.2083 1.2645 1.2541 0.0361  -0.0680 0.0222  201 GLU B OE2 
377  N N   . ILE B 14 ? 0.4935 0.5836 0.5908 0.0272  -0.0710 0.0155  202 ILE B N   
378  C CA  . ILE B 14 ? 0.5263 0.6185 0.6334 0.0262  -0.0714 0.0142  202 ILE B CA  
379  C C   . ILE B 14 ? 0.5238 0.6205 0.6353 0.0258  -0.0673 0.0135  202 ILE B C   
380  O O   . ILE B 14 ? 0.4127 0.5116 0.5303 0.0256  -0.0657 0.0125  202 ILE B O   
381  C CB  . ILE B 14 ? 0.5159 0.6085 0.6257 0.0282  -0.0751 0.0151  202 ILE B CB  
382  C CG1 . ILE B 14 ? 0.5813 0.6779 0.6901 0.0267  -0.0794 0.0143  202 ILE B CG1 
383  C CG2 . ILE B 14 ? 0.5731 0.6712 0.6914 0.0307  -0.0741 0.0150  202 ILE B CG2 
384  C CD1 . ILE B 14 ? 1.0212 1.1267 1.1321 0.0320  -0.0834 0.0160  202 ILE B CD1 
385  N N   . ILE B 15 ? 0.5723 0.6707 0.6791 0.0234  -0.0647 0.0130  203 ILE B N   
386  C CA  . ILE B 15 ? 0.5854 0.6909 0.6940 0.0198  -0.0598 0.0109  203 ILE B CA  
387  C C   . ILE B 15 ? 0.5333 0.6514 0.6437 0.0236  -0.0582 0.0116  203 ILE B C   
388  O O   . ILE B 15 ? 0.4989 0.6209 0.6150 0.0237  -0.0557 0.0108  203 ILE B O   
389  C CB  . ILE B 15 ? 0.5886 0.6976 0.6869 0.0114  -0.0551 0.0079  203 ILE B CB  
390  C CG1 . ILE B 15 ? 0.5943 0.6809 0.6830 0.0094  -0.0529 0.0079  203 ILE B CG1 
391  C CG2 . ILE B 15 ? 0.5846 0.7057 0.6837 0.0045  -0.0493 0.0043  203 ILE B CG2 
392  C CD1 . ILE B 15 ? 0.6549 0.7370 0.7366 0.0108  -0.0563 0.0093  203 ILE B CD1 
393  N N   . LYS B 16 ? 0.4342 0.5566 0.5369 0.0288  -0.0584 0.0138  204 LYS B N   
394  C CA  . LYS B 16 ? 0.4506 0.5790 0.5483 0.0375  -0.0542 0.0164  204 LYS B CA  
395  C C   . LYS B 16 ? 0.4309 0.5427 0.5324 0.0373  -0.0532 0.0158  204 LYS B C   
396  O O   . LYS B 16 ? 0.4501 0.5657 0.5539 0.0395  -0.0495 0.0158  204 LYS B O   
397  C CB  . LYS B 16 ? 0.4597 0.5864 0.5429 0.0469  -0.0523 0.0204  204 LYS B CB  
398  C CG  . LYS B 16 ? 0.5287 0.6643 0.6001 0.0611  -0.0450 0.0248  204 LYS B CG  
399  C CD  . LYS B 16 ? 0.7578 0.8864 0.8087 0.0752  -0.0402 0.0305  204 LYS B CD  
400  C CE  . LYS B 16 ? 0.8542 0.9839 0.8866 0.0949  -0.0298 0.0369  204 LYS B CE  
401  N NZ  . LYS B 16 ? 0.9132 1.0233 0.9171 0.1125  -0.0210 0.0440  204 LYS B NZ  
402  N N   . LEU B 17 ? 0.4112 0.5083 0.5132 0.0333  -0.0561 0.0147  205 LEU B N   
403  C CA  . LEU B 17 ? 0.3559 0.4424 0.4593 0.0294  -0.0541 0.0123  205 LEU B CA  
404  C C   . LEU B 17 ? 0.3232 0.4183 0.4411 0.0264  -0.0552 0.0104  205 LEU B C   
405  O O   . LEU B 17 ? 0.2710 0.3617 0.3887 0.0254  -0.0510 0.0089  205 LEU B O   
406  C CB  . LEU B 17 ? 0.3078 0.3888 0.4108 0.0224  -0.0578 0.0098  205 LEU B CB  
407  C CG  . LEU B 17 ? 0.4016 0.4761 0.5021 0.0141  -0.0537 0.0051  205 LEU B CG  
408  C CD1 . LEU B 17 ? 0.3452 0.3946 0.4221 0.0156  -0.0426 0.0055  205 LEU B CD1 
409  C CD2 . LEU B 17 ? 0.5871 0.6705 0.6910 0.0044  -0.0583 0.0009  205 LEU B CD2 
410  N N   . GLU B 18 ? 0.3208 0.4239 0.4475 0.0253  -0.0590 0.0104  206 GLU B N   
411  C CA  . GLU B 18 ? 0.3442 0.4514 0.4810 0.0240  -0.0585 0.0093  206 GLU B CA  
412  C C   . GLU B 18 ? 0.3719 0.4838 0.5088 0.0248  -0.0536 0.0090  206 GLU B C   
413  O O   . GLU B 18 ? 0.2878 0.3995 0.4298 0.0245  -0.0514 0.0079  206 GLU B O   
414  C CB  . GLU B 18 ? 0.3197 0.4250 0.4567 0.0246  -0.0594 0.0101  206 GLU B CB  
415  C CG  . GLU B 18 ? 0.4404 0.5445 0.5826 0.0254  -0.0563 0.0099  206 GLU B CG  
416  C CD  . GLU B 18 ? 0.6533 0.7452 0.7868 0.0293  -0.0535 0.0120  206 GLU B CD  
417  O OE1 . GLU B 18 ? 0.5329 0.6236 0.6632 0.0353  -0.0567 0.0146  206 GLU B OE1 
418  O OE2 . GLU B 18 ? 0.7020 0.7829 0.8280 0.0266  -0.0463 0.0112  206 GLU B OE2 
419  N N   . ASN B 19 ? 0.4769 0.5973 0.6076 0.0255  -0.0517 0.0097  207 ASN B N   
420  C CA  . ASN B 19 ? 0.5059 0.6401 0.6363 0.0268  -0.0472 0.0093  207 ASN B CA  
421  C C   . ASN B 19 ? 0.4166 0.5468 0.5427 0.0346  -0.0436 0.0115  207 ASN B C   
422  O O   . ASN B 19 ? 0.4170 0.5547 0.5454 0.0365  -0.0400 0.0113  207 ASN B O   
423  C CB  . ASN B 19 ? 0.5084 0.6632 0.6315 0.0259  -0.0457 0.0090  207 ASN B CB  
424  C CG  . ASN B 19 ? 0.6270 0.7833 0.7497 0.0136  -0.0444 0.0046  207 ASN B CG  
425  O OD1 . ASN B 19 ? 0.8187 0.9664 0.9358 0.0096  -0.0457 0.0039  207 ASN B OD1 
426  N ND2 . ASN B 19 ? 0.6949 0.8574 0.8199 0.0067  -0.0400 0.0013  207 ASN B ND2 
427  N N   . SER B 20 ? 0.2900 0.4049 0.4063 0.0386  -0.0428 0.0132  208 SER B N   
428  C CA  . SER B 20 ? 0.2718 0.3713 0.3756 0.0447  -0.0356 0.0148  208 SER B CA  
429  C C   . SER B 20 ? 0.2527 0.3433 0.3657 0.0363  -0.0355 0.0107  208 SER B C   
430  O O   . SER B 20 ? 0.3606 0.4449 0.4692 0.0388  -0.0294 0.0107  208 SER B O   
431  C CB  . SER B 20 ? 0.2849 0.3639 0.3709 0.0472  -0.0324 0.0162  208 SER B CB  
432  O OG  . SER B 20 ? 0.7060 0.7979 0.7908 0.0511  -0.0364 0.0187  208 SER B OG  
433  N N   . ILE B 21 ? 0.2287 0.3213 0.3533 0.0274  -0.0418 0.0075  209 ILE B N   
434  C CA  . ILE B 21 ? 0.2824 0.3746 0.4159 0.0200  -0.0419 0.0035  209 ILE B CA  
435  C C   . ILE B 21 ? 0.2904 0.3927 0.4356 0.0219  -0.0418 0.0039  209 ILE B C   
436  O O   . ILE B 21 ? 0.3107 0.4102 0.4578 0.0200  -0.0379 0.0020  209 ILE B O   
437  C CB  . ILE B 21 ? 0.2790 0.3807 0.4219 0.0142  -0.0486 0.0012  209 ILE B CB  
438  C CG1 . ILE B 21 ? 0.2572 0.3494 0.3872 0.0073  -0.0468 -0.0017 209 ILE B CG1 
439  C CG2 . ILE B 21 ? 0.2571 0.3716 0.4137 0.0107  -0.0501 -0.0015 209 ILE B CG2 
440  C CD1 . ILE B 21 ? 0.5381 0.6419 0.6731 0.0066  -0.0542 -0.0014 209 ILE B CD1 
441  N N   . ARG B 22 ? 0.4083 0.5413 0.5197 -0.0460 0.0422  -0.0488 210 ARG B N   
442  C CA  . ARG B 22 ? 0.4347 0.5830 0.5715 -0.0554 0.0478  -0.0494 210 ARG B CA  
443  C C   . ARG B 22 ? 0.3702 0.5215 0.5078 -0.0524 0.0460  -0.0554 210 ARG B C   
444  O O   . ARG B 22 ? 0.3065 0.4515 0.4528 -0.0577 0.0428  -0.0557 210 ARG B O   
445  C CB  . ARG B 22 ? 0.5124 0.6825 0.6615 -0.0576 0.0581  -0.0477 210 ARG B CB  
446  C CG  . ARG B 22 ? 0.7230 0.9047 0.8958 -0.0675 0.0620  -0.0479 210 ARG B CG  
447  C CD  . ARG B 22 ? 0.7819 0.9541 0.9648 -0.0770 0.0605  -0.0435 210 ARG B CD  
448  N NE  . ARG B 22 ? 0.8971 1.0689 1.0777 -0.0791 0.0627  -0.0380 210 ARG B NE  
449  C CZ  . ARG B 22 ? 0.9674 1.1314 1.1560 -0.0870 0.0615  -0.0336 210 ARG B CZ  
450  N NH1 . ARG B 22 ? 1.0251 1.1825 1.2252 -0.0927 0.0591  -0.0335 210 ARG B NH1 
451  N NH2 . ARG B 22 ? 0.8291 0.9920 1.0138 -0.0885 0.0632  -0.0289 210 ARG B NH2 
452  N N   . GLU B 23 ? 0.3977 0.5585 0.5259 -0.0433 0.0484  -0.0597 211 GLU B N   
453  C CA  . GLU B 23 ? 0.3838 0.5457 0.5099 -0.0395 0.0456  -0.0659 211 GLU B CA  
454  C C   . GLU B 23 ? 0.3370 0.4769 0.4526 -0.0397 0.0352  -0.0662 211 GLU B C   
455  O O   . GLU B 23 ? 0.4201 0.5579 0.5457 -0.0448 0.0337  -0.0673 211 GLU B O   
456  C CB  . GLU B 23 ? 0.4259 0.5959 0.5375 -0.0271 0.0473  -0.0697 211 GLU B CB  
457  C CG  . GLU B 23 ? 0.6296 0.8255 0.7582 -0.0278 0.0562  -0.0703 211 GLU B CG  
458  C CD  . GLU B 23 ? 0.7356 0.9361 0.8700 -0.0276 0.0541  -0.0766 211 GLU B CD  
459  O OE1 . GLU B 23 ? 0.6311 0.8273 0.7496 -0.0176 0.0501  -0.0814 211 GLU B OE1 
460  O OE2 . GLU B 23 ? 0.9356 1.1419 1.0884 -0.0368 0.0558  -0.0768 211 GLU B OE2 
461  N N   . LEU B 24 ? 0.3022 0.4243 0.3970 -0.0339 0.0274  -0.0644 212 LEU B N   
462  C CA  . LEU B 24 ? 0.3676 0.4686 0.4528 -0.0343 0.0152  -0.0638 212 LEU B CA  
463  C C   . LEU B 24 ? 0.4242 0.5241 0.5315 -0.0461 0.0151  -0.0589 212 LEU B C   
464  O O   . LEU B 24 ? 0.3989 0.4973 0.5118 -0.0482 0.0130  -0.0602 212 LEU B O   
465  C CB  . LEU B 24 ? 0.3571 0.4346 0.4186 -0.0292 0.0044  -0.0605 212 LEU B CB  
466  C CG  . LEU B 24 ? 0.3547 0.4101 0.4044 -0.0287 -0.0105 -0.0598 212 LEU B CG  
467  C CD1 . LEU B 24 ? 0.3828 0.4319 0.4064 -0.0155 -0.0154 -0.0672 212 LEU B CD1 
468  C CD2 . LEU B 24 ? 0.2270 0.2572 0.2684 -0.0325 -0.0239 -0.0520 212 LEU B CD2 
469  N N   . HIS B 25 ? 0.4855 0.5863 0.6045 -0.0530 0.0181  -0.0531 213 HIS B N   
470  C CA  . HIS B 25 ? 0.4561 0.5574 0.5965 -0.0628 0.0198  -0.0476 213 HIS B CA  
471  C C   . HIS B 25 ? 0.4018 0.5166 0.5562 -0.0649 0.0277  -0.0514 213 HIS B C   
472  O O   . HIS B 25 ? 0.4105 0.5210 0.5723 -0.0675 0.0261  -0.0493 213 HIS B O   
473  C CB  . HIS B 25 ? 0.4818 0.5869 0.6325 -0.0685 0.0246  -0.0428 213 HIS B CB  
474  C CG  . HIS B 25 ? 0.4547 0.5655 0.6282 -0.0769 0.0300  -0.0387 213 HIS B CG  
475  N ND1 . HIS B 25 ? 0.3465 0.4724 0.5323 -0.0795 0.0400  -0.0417 213 HIS B ND1 
476  C CD2 . HIS B 25 ? 0.5084 0.6111 0.6940 -0.0824 0.0265  -0.0312 213 HIS B CD2 
477  C CE1 . HIS B 25 ? 0.6596 0.7846 0.8612 -0.0852 0.0427  -0.0371 213 HIS B CE1 
478  N NE2 . HIS B 25 ? 0.4791 0.5918 0.6821 -0.0868 0.0356  -0.0304 213 HIS B NE2 
479  N N   . ASP B 26 ? 0.4188 0.5493 0.5765 -0.0634 0.0359  -0.0564 214 ASP B N   
480  C CA  . ASP B 26 ? 0.5795 0.7197 0.7478 -0.0650 0.0417  -0.0605 214 ASP B CA  
481  C C   . ASP B 26 ? 0.5359 0.6693 0.6964 -0.0609 0.0370  -0.0643 214 ASP B C   
482  O O   . ASP B 26 ? 0.5807 0.7119 0.7491 -0.0635 0.0390  -0.0637 214 ASP B O   
483  C CB  . ASP B 26 ? 0.6718 0.8290 0.8427 -0.0632 0.0478  -0.0650 214 ASP B CB  
484  C CG  . ASP B 26 ? 0.8838 1.0494 1.0689 -0.0702 0.0537  -0.0611 214 ASP B CG  
485  O OD1 . ASP B 26 ? 1.0506 1.2293 1.2437 -0.0716 0.0579  -0.0634 214 ASP B OD1 
486  O OD2 . ASP B 26 ? 1.0249 1.1835 1.2136 -0.0746 0.0530  -0.0554 214 ASP B OD2 
487  N N   . MET B 27 ? 0.4776 0.6064 0.6208 -0.0537 0.0309  -0.0678 215 MET B N   
488  C CA  . MET B 27 ? 0.5331 0.6536 0.6668 -0.0498 0.0249  -0.0713 215 MET B CA  
489  C C   . MET B 27 ? 0.5695 0.6762 0.7075 -0.0546 0.0193  -0.0641 215 MET B C   
490  O O   . MET B 27 ? 0.6297 0.7338 0.7707 -0.0552 0.0192  -0.0645 215 MET B O   
491  C CB  . MET B 27 ? 0.4915 0.6064 0.6032 -0.0404 0.0179  -0.0758 215 MET B CB  
492  C CG  . MET B 27 ? 0.5094 0.6410 0.6190 -0.0344 0.0245  -0.0815 215 MET B CG  
493  S SD  . MET B 27 ? 0.5588 0.6843 0.6406 -0.0201 0.0179  -0.0867 215 MET B SD  
494  C CE  . MET B 27 ? 0.1706 0.2779 0.2418 -0.0196 0.0066  -0.0895 215 MET B CE  
495  N N   . PHE B 28 ? 0.5127 0.6107 0.6519 -0.0580 0.0144  -0.0567 216 PHE B N   
496  C CA  . PHE B 28 ? 0.4770 0.5639 0.6241 -0.0632 0.0082  -0.0475 216 PHE B CA  
497  C C   . PHE B 28 ? 0.4868 0.5817 0.6550 -0.0686 0.0177  -0.0431 216 PHE B C   
498  O O   . PHE B 28 ? 0.5468 0.6374 0.7226 -0.0707 0.0162  -0.0369 216 PHE B O   
499  C CB  . PHE B 28 ? 0.4965 0.5717 0.6415 -0.0661 -0.0001 -0.0399 216 PHE B CB  
500  C CG  . PHE B 28 ? 0.4316 0.4884 0.5550 -0.0617 -0.0150 -0.0397 216 PHE B CG  
501  C CD1 . PHE B 28 ? 0.3632 0.4085 0.4866 -0.0638 -0.0252 -0.0343 216 PHE B CD1 
502  C CD2 . PHE B 28 ? 0.6571 0.7070 0.7589 -0.0547 -0.0192 -0.0444 216 PHE B CD2 
503  C CE1 . PHE B 28 ? 0.2437 0.2688 0.3453 -0.0600 -0.0412 -0.0340 216 PHE B CE1 
504  C CE2 . PHE B 28 ? 0.6534 0.6820 0.7309 -0.0491 -0.0342 -0.0447 216 PHE B CE2 
505  C CZ  . PHE B 28 ? 0.3900 0.4054 0.4671 -0.0522 -0.0462 -0.0397 216 PHE B CZ  
506  N N   . MET B 29 ? 0.5164 0.6225 0.6935 -0.0702 0.0275  -0.0455 217 MET B N   
507  C CA  . MET B 29 ? 0.6481 0.7588 0.8414 -0.0737 0.0362  -0.0417 217 MET B CA  
508  C C   . MET B 29 ? 0.6306 0.7425 0.8196 -0.0698 0.0398  -0.0474 217 MET B C   
509  O O   . MET B 29 ? 0.6544 0.7619 0.8482 -0.0698 0.0407  -0.0422 217 MET B O   
510  C CB  . MET B 29 ? 0.7231 0.8424 0.9246 -0.0766 0.0437  -0.0429 217 MET B CB  
511  C CG  . MET B 29 ? 0.8574 0.9736 1.0629 -0.0807 0.0402  -0.0365 217 MET B CG  
512  S SD  . MET B 29 ? 0.7960 0.9023 1.0144 -0.0851 0.0346  -0.0231 217 MET B SD  
513  C CE  . MET B 29 ? 1.0329 1.1460 1.2694 -0.0864 0.0470  -0.0194 217 MET B CE  
514  N N   . ASP B 30 ? 0.6117 0.7297 0.7922 -0.0664 0.0417  -0.0572 218 ASP B N   
515  C CA  . ASP B 30 ? 0.5989 0.7166 0.7748 -0.0629 0.0447  -0.0632 218 ASP B CA  
516  C C   . ASP B 30 ? 0.5533 0.6617 0.7231 -0.0609 0.0391  -0.0605 218 ASP B C   
517  O O   . ASP B 30 ? 0.5126 0.6171 0.6853 -0.0601 0.0433  -0.0579 218 ASP B O   
518  C CB  . ASP B 30 ? 0.6037 0.7291 0.7713 -0.0594 0.0441  -0.0732 218 ASP B CB  
519  C CG  . ASP B 30 ? 0.7323 0.8678 0.9089 -0.0626 0.0497  -0.0745 218 ASP B CG  
520  O OD1 . ASP B 30 ? 0.9095 1.0430 1.0942 -0.0655 0.0550  -0.0722 218 ASP B OD1 
521  O OD2 . ASP B 30 ? 0.7105 0.8553 0.8852 -0.0617 0.0486  -0.0770 218 ASP B OD2 
522  N N   . MET B 31 ? 0.6091 0.7124 0.7690 -0.0595 0.0295  -0.0603 219 MET B N   
523  C CA  . MET B 31 ? 0.6342 0.7268 0.7879 -0.0587 0.0214  -0.0563 219 MET B CA  
524  C C   . MET B 31 ? 0.5926 0.6826 0.7613 -0.0627 0.0250  -0.0449 219 MET B C   
525  O O   . MET B 31 ? 0.6165 0.7036 0.7842 -0.0610 0.0273  -0.0439 219 MET B O   
526  C CB  . MET B 31 ? 0.6791 0.7628 0.8225 -0.0585 0.0090  -0.0539 219 MET B CB  
527  C CG  . MET B 31 ? 0.8332 0.9038 0.9696 -0.0587 -0.0022 -0.0489 219 MET B CG  
528  S SD  . MET B 31 ? 1.1851 1.2546 1.3102 -0.0535 -0.0012 -0.0576 219 MET B SD  
529  C CE  . MET B 31 ? 0.5680 0.6371 0.6700 -0.0449 -0.0067 -0.0713 219 MET B CE  
530  N N   . ALA B 32 ? 0.5623 0.6538 0.7451 -0.0675 0.0259  -0.0355 220 ALA B N   
531  C CA  . ALA B 32 ? 0.5965 0.6886 0.7968 -0.0705 0.0309  -0.0230 220 ALA B CA  
532  C C   . ALA B 32 ? 0.6458 0.7426 0.8497 -0.0670 0.0444  -0.0253 220 ALA B C   
533  O O   . ALA B 32 ? 0.6915 0.7863 0.8994 -0.0652 0.0484  -0.0188 220 ALA B O   
534  C CB  . ALA B 32 ? 0.6699 0.7643 0.8848 -0.0755 0.0308  -0.0146 220 ALA B CB  
535  N N   . MET B 33 ? 0.6698 0.7712 0.8711 -0.0656 0.0510  -0.0337 221 MET B N   
536  C CA  . MET B 33 ? 0.6521 0.7537 0.8524 -0.0616 0.0619  -0.0374 221 MET B CA  
537  C C   . MET B 33 ? 0.5671 0.6626 0.7553 -0.0566 0.0625  -0.0416 221 MET B C   
538  O O   . MET B 33 ? 0.6424 0.7339 0.8311 -0.0526 0.0710  -0.0379 221 MET B O   
539  C CB  . MET B 33 ? 0.7085 0.8142 0.9040 -0.0619 0.0636  -0.0476 221 MET B CB  
540  C CG  . MET B 33 ? 0.8312 0.9330 1.0221 -0.0580 0.0715  -0.0524 221 MET B CG  
541  S SD  . MET B 33 ? 1.1095 1.2167 1.3004 -0.0610 0.0713  -0.0603 221 MET B SD  
542  C CE  . MET B 33 ? 0.6470 0.7579 0.8536 -0.0659 0.0748  -0.0508 221 MET B CE  
543  N N   . LEU B 34 ? 0.4655 0.5592 0.6413 -0.0559 0.0539  -0.0493 222 LEU B N   
544  C CA  . LEU B 34 ? 0.4999 0.5869 0.6628 -0.0515 0.0527  -0.0542 222 LEU B CA  
545  C C   . LEU B 34 ? 0.5546 0.6369 0.7213 -0.0520 0.0508  -0.0433 222 LEU B C   
546  O O   . LEU B 34 ? 0.6138 0.6913 0.7773 -0.0481 0.0572  -0.0411 222 LEU B O   
547  C CB  . LEU B 34 ? 0.5403 0.6271 0.6893 -0.0500 0.0434  -0.0652 222 LEU B CB  
548  C CG  . LEU B 34 ? 0.6957 0.7892 0.8420 -0.0491 0.0453  -0.0753 222 LEU B CG  
549  C CD1 . LEU B 34 ? 0.6166 0.7098 0.7487 -0.0451 0.0382  -0.0859 222 LEU B CD1 
550  C CD2 . LEU B 34 ? 0.6942 0.7856 0.8431 -0.0479 0.0546  -0.0766 222 LEU B CD2 
551  N N   . VAL B 35 ? 0.6140 0.6965 0.7869 -0.0566 0.0416  -0.0357 223 VAL B N   
552  C CA  . VAL B 35 ? 0.6850 0.7632 0.8637 -0.0584 0.0378  -0.0234 223 VAL B CA  
553  C C   . VAL B 35 ? 0.7124 0.7957 0.9096 -0.0584 0.0497  -0.0097 223 VAL B C   
554  O O   . VAL B 35 ? 0.8290 0.9107 1.0299 -0.0570 0.0529  -0.0005 223 VAL B O   
555  C CB  . VAL B 35 ? 0.7155 0.7896 0.8960 -0.0638 0.0225  -0.0172 223 VAL B CB  
556  C CG1 . VAL B 35 ? 0.7870 0.8600 0.9835 -0.0682 0.0196  0.0008  223 VAL B CG1 
557  C CG2 . VAL B 35 ? 0.6533 0.7186 0.8119 -0.0613 0.0105  -0.0281 223 VAL B CG2 
558  N N   . GLU B 36 ? 0.6874 0.7770 0.8959 -0.0593 0.0567  -0.0076 224 GLU B N   
559  C CA  . GLU B 36 ? 0.7774 0.8713 0.9996 -0.0563 0.0704  0.0028  224 GLU B CA  
560  C C   . GLU B 36 ? 0.8411 0.9291 1.0493 -0.0479 0.0810  -0.0027 224 GLU B C   
561  O O   . GLU B 36 ? 0.9143 1.0021 1.1275 -0.0440 0.0888  0.0081  224 GLU B O   
562  C CB  . GLU B 36 ? 0.8013 0.9002 1.0323 -0.0575 0.0757  0.0020  224 GLU B CB  
563  C CG  . GLU B 36 ? 0.8921 0.9950 1.1371 -0.0532 0.0897  0.0133  224 GLU B CG  
564  C CD  . GLU B 36 ? 1.0974 1.2038 1.3502 -0.0549 0.0930  0.0123  224 GLU B CD  
565  O OE1 . GLU B 36 ? 1.2961 1.4014 1.5402 -0.0581 0.0871  0.0006  224 GLU B OE1 
566  O OE2 . GLU B 36 ? 1.0712 1.1821 1.3393 -0.0527 0.1016  0.0238  224 GLU B OE2 
567  N N   . SER B 37 ? 0.8294 0.9122 1.0201 -0.0448 0.0810  -0.0186 225 SER B N   
568  C CA  . SER B 37 ? 0.8776 0.9510 1.0525 -0.0366 0.0897  -0.0247 225 SER B CA  
569  C C   . SER B 37 ? 0.8460 0.9131 1.0108 -0.0342 0.0871  -0.0236 225 SER B C   
570  O O   . SER B 37 ? 0.9550 1.0156 1.1135 -0.0273 0.0965  -0.0193 225 SER B O   
571  C CB  . SER B 37 ? 0.8910 0.9596 1.0509 -0.0353 0.0871  -0.0411 225 SER B CB  
572  O OG  . SER B 37 ? 1.0696 1.1349 1.2162 -0.0358 0.0776  -0.0514 225 SER B OG  
573  N N   . GLN B 38 ? 0.7807 0.8485 0.9423 -0.0392 0.0741  -0.0274 226 GLN B N   
574  C CA  . GLN B 38 ? 0.8397 0.9002 0.9900 -0.0377 0.0691  -0.0278 226 GLN B CA  
575  C C   . GLN B 38 ? 0.8554 0.9188 1.0198 -0.0385 0.0735  -0.0093 226 GLN B C   
576  O O   . GLN B 38 ? 0.9088 0.9660 1.0651 -0.0338 0.0784  -0.0062 226 GLN B O   
577  C CB  . GLN B 38 ? 0.8340 0.8935 0.9768 -0.0421 0.0531  -0.0355 226 GLN B CB  
578  C CG  . GLN B 38 ? 0.9519 1.0087 1.0785 -0.0391 0.0501  -0.0534 226 GLN B CG  
579  C CD  . GLN B 38 ? 0.9779 1.0363 1.0984 -0.0418 0.0365  -0.0606 226 GLN B CD  
580  O OE1 . GLN B 38 ? 0.9140 0.9662 1.0190 -0.0391 0.0291  -0.0694 226 GLN B OE1 
581  N NE2 . GLN B 38 ? 1.1148 1.1802 1.2459 -0.0461 0.0332  -0.0568 226 GLN B NE2 
582  N N   . GLY B 39 ? 0.8934 0.9663 1.0796 -0.0444 0.0715  0.0036  227 GLY B N   
583  C CA  . GLY B 39 ? 0.9228 1.0016 1.1282 -0.0458 0.0760  0.0241  227 GLY B CA  
584  C C   . GLY B 39 ? 0.9801 1.0579 1.1830 -0.0361 0.0942  0.0293  227 GLY B C   
585  O O   . GLY B 39 ? 0.9943 1.0719 1.1997 -0.0337 0.0987  0.0408  227 GLY B O   
586  N N   . GLU B 40 ? 1.0202 1.0959 1.2165 -0.0300 0.1044  0.0212  228 GLU B N   
587  C CA  . GLU B 40 ? 1.1236 1.1945 1.3129 -0.0186 0.1218  0.0252  228 GLU B CA  
588  C C   . GLU B 40 ? 1.1277 1.1847 1.2925 -0.0121 0.1233  0.0180  228 GLU B C   
589  O O   . GLU B 40 ? 1.1789 1.2358 1.3454 -0.0074 0.1316  0.0304  228 GLU B O   
590  C CB  . GLU B 40 ? 1.1717 1.2389 1.3547 -0.0137 0.1288  0.0162  228 GLU B CB  
591  C CG  . GLU B 40 ? 1.3005 1.3808 1.5078 -0.0197 0.1281  0.0245  228 GLU B CG  
592  C CD  . GLU B 40 ? 1.4731 1.5494 1.6757 -0.0139 0.1367  0.0192  228 GLU B CD  
593  O OE1 . GLU B 40 ? 1.5406 1.6035 1.7202 -0.0091 0.1369  0.0043  228 GLU B OE1 
594  O OE2 . GLU B 40 ? 1.5793 1.6651 1.8015 -0.0144 0.1422  0.0305  228 GLU B OE2 
595  N N   . MET B 41 ? 1.0902 1.1360 1.2332 -0.0120 0.1153  -0.0011 229 MET B N   
596  C CA  . MET B 41 ? 1.1313 1.1631 1.2513 -0.0071 0.1139  -0.0085 229 MET B CA  
597  C C   . MET B 41 ? 1.1299 1.1653 1.2571 -0.0102 0.1110  0.0046  229 MET B C   
598  O O   . MET B 41 ? 1.1758 1.2027 1.2912 -0.0032 0.1187  0.0090  229 MET B O   
599  C CB  . MET B 41 ? 1.1706 1.1960 1.2752 -0.0109 0.0998  -0.0277 229 MET B CB  
600  C CG  . MET B 41 ? 1.3288 1.3453 1.4191 -0.0065 0.1016  -0.0421 229 MET B CG  
601  S SD  . MET B 41 ? 1.6668 1.6753 1.7382 -0.0089 0.0862  -0.0616 229 MET B SD  
602  C CE  . MET B 41 ? 1.6603 1.6508 1.7092 -0.0010 0.0897  -0.0615 229 MET B CE  
603  N N   . ILE B 42 ? 1.0983 1.1446 1.2437 -0.0207 0.0988  0.0113  230 ILE B N   
604  C CA  . ILE B 42 ? 1.0935 1.1411 1.2450 -0.0256 0.0915  0.0231  230 ILE B CA  
605  C C   . ILE B 42 ? 1.0922 1.1468 1.2587 -0.0212 0.1064  0.0443  230 ILE B C   
606  O O   . ILE B 42 ? 1.1847 1.2329 1.3412 -0.0169 0.1108  0.0492  230 ILE B O   
607  C CB  . ILE B 42 ? 1.0809 1.1359 1.2483 -0.0373 0.0742  0.0279  230 ILE B CB  
608  C CG1 . ILE B 42 ? 1.0040 1.0485 1.1510 -0.0404 0.0570  0.0113  230 ILE B CG1 
609  C CG2 . ILE B 42 ? 1.0227 1.0848 1.2109 -0.0430 0.0714  0.0506  230 ILE B CG2 
610  C CD1 . ILE B 42 ? 0.8917 0.9295 1.0182 -0.0351 0.0581  -0.0101 230 ILE B CD1 
611  N N   . ASP B 43 ? 1.0556 1.1237 1.2459 -0.0215 0.1149  0.0575  231 ASP B N   
612  C CA  . ASP B 43 ? 1.1394 1.2174 1.3476 -0.0165 0.1302  0.0803  231 ASP B CA  
613  C C   . ASP B 43 ? 1.1955 1.2620 1.3810 -0.0013 0.1487  0.0780  231 ASP B C   
614  O O   . ASP B 43 ? 1.2678 1.3406 1.4627 0.0050  0.1625  0.0966  231 ASP B O   
615  C CB  . ASP B 43 ? 1.1385 1.2329 1.3762 -0.0183 0.1364  0.0942  231 ASP B CB  
616  C CG  . ASP B 43 ? 1.2383 1.3284 1.4662 -0.0128 0.1426  0.0797  231 ASP B CG  
617  O OD1 . ASP B 43 ? 1.2778 1.3742 1.5186 -0.0207 0.1336  0.0770  231 ASP B OD1 
618  O OD2 . ASP B 43 ? 1.4707 1.5494 1.6766 -0.0007 0.1554  0.0714  231 ASP B OD2 
619  N N   . ARG B 44 ? 1.2265 1.2758 1.3821 0.0050  0.1487  0.0563  232 ARG B N   
620  C CA  . ARG B 44 ? 1.2845 1.3163 1.4116 0.0189  0.1616  0.0513  232 ARG B CA  
621  C C   . ARG B 44 ? 1.2545 1.2770 1.3669 0.0172  0.1545  0.0498  232 ARG B C   
622  O O   . ARG B 44 ? 1.3432 1.3586 1.4443 0.0268  0.1670  0.0581  232 ARG B O   
623  C CB  . ARG B 44 ? 1.3305 1.3445 1.4306 0.0253  0.1611  0.0293  232 ARG B CB  
624  C CG  . ARG B 44 ? 1.5719 1.5885 1.6780 0.0317  0.1724  0.0316  232 ARG B CG  
625  C CD  . ARG B 44 ? 1.8280 1.8244 1.9062 0.0374  0.1699  0.0107  232 ARG B CD  
626  N NE  . ARG B 44 ? 2.0224 2.0216 2.1078 0.0407  0.1764  0.0115  232 ARG B NE  
627  C CZ  . ARG B 44 ? 2.1452 2.1294 2.2123 0.0439  0.1731  -0.0037 232 ARG B CZ  
628  N NH1 . ARG B 44 ? 2.1789 2.1448 2.2207 0.0441  0.1634  -0.0209 232 ARG B NH1 
629  N NH2 . ARG B 44 ? 2.2000 2.1872 2.2750 0.0464  0.1787  -0.0011 232 ARG B NH2 
630  N N   . ILE B 45 ? 1.2133 1.2347 1.3241 0.0061  0.1350  0.0394  233 ILE B N   
631  C CA  . ILE B 45 ? 1.2368 1.2503 1.3362 0.0034  0.1266  0.0398  233 ILE B CA  
632  C C   . ILE B 45 ? 1.2333 1.2615 1.3584 -0.0016 0.1292  0.0658  233 ILE B C   
633  O O   . ILE B 45 ? 1.2744 1.2967 1.3913 -0.0006 0.1292  0.0724  233 ILE B O   
634  C CB  . ILE B 45 ? 1.2226 1.2305 1.3125 -0.0059 0.1047  0.0224  233 ILE B CB  
635  C CG1 . ILE B 45 ? 1.2429 1.2371 1.3083 -0.0004 0.1030  -0.0013 233 ILE B CG1 
636  C CG2 . ILE B 45 ? 1.2182 1.2181 1.2979 -0.0091 0.0950  0.0249  233 ILE B CG2 
637  C CD1 . ILE B 45 ? 1.2111 1.1908 1.2527 -0.0018 0.0884  -0.0184 233 ILE B CD1 
638  N N   . GLU B 46 ? 1.2459 1.2930 1.4027 -0.0072 0.1306  0.0811  234 GLU B N   
639  C CA  . GLU B 46 ? 1.3482 1.4119 1.5344 -0.0108 0.1357  0.1090  234 GLU B CA  
640  C C   . GLU B 46 ? 1.4402 1.5044 1.6221 0.0040  0.1606  0.1221  234 GLU B C   
641  O O   . GLU B 46 ? 1.5092 1.5775 1.6975 0.0047  0.1657  0.1396  234 GLU B O   
642  C CB  . GLU B 46 ? 1.3596 1.4420 1.5801 -0.0192 0.1318  0.1214  234 GLU B CB  
643  C CG  . GLU B 46 ? 1.4428 1.5442 1.6998 -0.0263 0.1319  0.1517  234 GLU B CG  
644  C CD  . GLU B 46 ? 1.6163 1.7366 1.9064 -0.0285 0.1373  0.1659  234 GLU B CD  
645  O OE1 . GLU B 46 ? 1.6495 1.7673 1.9340 -0.0267 0.1376  0.1510  234 GLU B OE1 
646  O OE2 . GLU B 46 ? 1.8232 1.9613 2.1463 -0.0323 0.1408  0.1928  234 GLU B OE2 
647  N N   . TYR B 47 ? 1.4525 1.5116 1.6225 0.0163  0.1759  0.1141  235 TYR B N   
648  C CA  . TYR B 47 ? 1.5143 1.5681 1.6713 0.0340  0.2002  0.1229  235 TYR B CA  
649  C C   . TYR B 47 ? 1.5030 1.5354 1.6259 0.0408  0.2014  0.1145  235 TYR B C   
650  O O   . TYR B 47 ? 1.5787 1.6136 1.7027 0.0475  0.2143  0.1320  235 TYR B O   
651  C CB  . TYR B 47 ? 1.5616 1.6067 1.7042 0.0456  0.2112  0.1107  235 TYR B CB  
652  C CG  . TYR B 47 ? 1.7136 1.7570 1.8498 0.0649  0.2373  0.1237  235 TYR B CG  
653  C CD1 . TYR B 47 ? 1.8067 1.8729 1.9757 0.0677  0.2503  0.1457  235 TYR B CD1 
654  C CD2 . TYR B 47 ? 1.8030 1.8203 1.8987 0.0815  0.2487  0.1138  235 TYR B CD2 
655  C CE1 . TYR B 47 ? 1.8309 1.8955 1.9926 0.0875  0.2753  0.1579  235 TYR B CE1 
656  C CE2 . TYR B 47 ? 1.8428 1.8553 1.9281 0.1015  0.2730  0.1255  235 TYR B CE2 
657  C CZ  . TYR B 47 ? 1.8671 1.9041 1.9855 0.1049  0.2867  0.1476  235 TYR B CZ  
658  O OH  . TYR B 47 ? 1.9196 1.9521 2.0267 0.1265  0.3115  0.1594  235 TYR B OH  
659  N N   . ASN B 48 ? 1.4380 1.4501 1.5319 0.0391  0.1881  0.0887  236 ASN B N   
660  C CA  . ASN B 48 ? 1.4483 1.4377 1.5081 0.0449  0.1867  0.0782  236 ASN B CA  
661  C C   . ASN B 48 ? 1.4598 1.4550 1.5290 0.0364  0.1791  0.0915  236 ASN B C   
662  O O   . ASN B 48 ? 1.5540 1.5381 1.6053 0.0447  0.1885  0.0974  236 ASN B O   
663  C CB  . ASN B 48 ? 1.4529 1.4232 1.4863 0.0419  0.1702  0.0492  236 ASN B CB  
664  C CG  . ASN B 48 ? 1.5017 1.4529 1.5086 0.0551  0.1794  0.0344  236 ASN B CG  
665  O OD1 . ASN B 48 ? 1.5107 1.4658 1.5230 0.0645  0.1954  0.0434  236 ASN B OD1 
666  N ND2 . ASN B 48 ? 1.4394 1.3690 1.4173 0.0560  0.1681  0.0120  236 ASN B ND2 
667  N N   . VAL B 49 ? 1.4358 1.4462 1.5310 0.0202  0.1615  0.0966  237 VAL B N   
668  C CA  . VAL B 49 ? 1.5088 1.5235 1.6137 0.0108  0.1515  0.1104  237 VAL B CA  
669  C C   . VAL B 49 ? 1.5573 1.5904 1.6889 0.0135  0.1679  0.1422  237 VAL B C   
670  O O   . VAL B 49 ? 1.6135 1.6409 1.7346 0.0189  0.1762  0.1524  237 VAL B O   
671  C CB  . VAL B 49 ? 1.5061 1.5283 1.6287 -0.0066 0.1262  0.1078  237 VAL B CB  
672  C CG1 . VAL B 49 ? 1.4679 1.4987 1.6102 -0.0172 0.1167  0.1299  237 VAL B CG1 
673  C CG2 . VAL B 49 ? 1.4892 1.4922 1.5823 -0.0085 0.1094  0.0790  237 VAL B CG2 
674  N N   . GLU B 50 ? 1.5579 1.6136 1.7247 0.0100  0.1729  0.1587  238 GLU B N   
675  C CA  . GLU B 50 ? 1.6218 1.6994 1.8202 0.0123  0.1887  0.1912  238 GLU B CA  
676  C C   . GLU B 50 ? 1.6716 1.7411 1.8487 0.0308  0.2140  0.1988  238 GLU B C   
677  O O   . GLU B 50 ? 1.7051 1.7858 1.8972 0.0312  0.2224  0.2235  238 GLU B O   
678  C CB  . GLU B 50 ? 1.6273 1.7262 1.8585 0.0120  0.1962  0.2028  238 GLU B CB  
679  C CG  . GLU B 50 ? 1.6642 1.7764 1.9269 -0.0074 0.1727  0.2079  238 GLU B CG  
680  C CD  . GLU B 50 ? 1.6966 1.8288 1.9916 -0.0079 0.1793  0.2193  238 GLU B CD  
681  O OE1 . GLU B 50 ? 1.7061 1.8376 1.9924 0.0064  0.1985  0.2142  238 GLU B OE1 
682  O OE2 . GLU B 50 ? 1.6407 1.7873 1.9688 -0.0226 0.1639  0.2335  238 GLU B OE2 
683  N N   . HIS B 51 ? 1.6773 1.7262 1.8189 0.0460  0.2252  0.1785  239 HIS B N   
684  C CA  . HIS B 51 ? 1.7316 1.7647 1.8429 0.0655  0.2472  0.1812  239 HIS B CA  
685  C C   . HIS B 51 ? 1.7192 1.7348 1.8059 0.0629  0.2387  0.1764  239 HIS B C   
686  O O   . HIS B 51 ? 1.7696 1.7925 1.8637 0.0658  0.2495  0.1986  239 HIS B O   
687  C CB  . HIS B 51 ? 1.7526 1.7620 1.8276 0.0812  0.2561  0.1582  239 HIS B CB  
688  C CG  . HIS B 51 ? 1.8503 1.8723 1.9407 0.0917  0.2738  0.1679  239 HIS B CG  
689  N ND1 . HIS B 51 ? 1.9701 2.0110 2.0816 0.1024  0.2967  0.1964  239 HIS B ND1 
690  C CD2 . HIS B 51 ? 1.9475 1.9661 2.0354 0.0935  0.2717  0.1533  239 HIS B CD2 
691  C CE1 . HIS B 51 ? 2.0128 2.0606 2.1331 0.1109  0.3079  0.1982  239 HIS B CE1 
692  N NE2 . HIS B 51 ? 1.9816 2.0154 2.0874 0.1053  0.2926  0.1721  239 HIS B NE2 
693  N N   . ALA B 52 ? 1.6585 1.6519 1.7171 0.0575  0.2197  0.1483  240 ALA B N   
694  C CA  . ALA B 52 ? 1.6640 1.6378 1.6958 0.0554  0.2098  0.1401  240 ALA B CA  
695  C C   . ALA B 52 ? 1.7193 1.7104 1.7781 0.0438  0.2045  0.1654  240 ALA B C   
696  O O   . ALA B 52 ? 1.7980 1.7777 1.8391 0.0474  0.2081  0.1711  240 ALA B O   
697  C CB  . ALA B 52 ? 1.5810 1.5384 1.5939 0.0461  0.1853  0.1105  240 ALA B CB  
698  N N   . VAL B 53 ? 1.7300 1.7471 1.8310 0.0295  0.1952  0.1812  241 VAL B N   
699  C CA  . VAL B 53 ? 1.7532 1.7887 1.8856 0.0174  0.1891  0.2091  241 VAL B CA  
700  C C   . VAL B 53 ? 1.7886 1.8381 1.9337 0.0293  0.2165  0.2387  241 VAL B C   
701  O O   . VAL B 53 ? 1.8072 1.8524 1.9449 0.0298  0.2192  0.2508  241 VAL B O   
702  C CB  . VAL B 53 ? 1.7342 1.7931 1.9098 0.0005  0.1732  0.2211  241 VAL B CB  
703  C CG1 . VAL B 53 ? 1.7349 1.8173 1.9498 -0.0086 0.1740  0.2573  241 VAL B CG1 
704  C CG2 . VAL B 53 ? 1.7567 1.8021 1.9215 -0.0138 0.1425  0.1984  241 VAL B CG2 
705  N N   . ASP B 54 ? 1.8157 1.8822 1.9798 0.0395  0.2369  0.2508  242 ASP B N   
706  C CA  . ASP B 54 ? 1.8809 1.9628 2.0577 0.0540  0.2660  0.2799  242 ASP B CA  
707  C C   . ASP B 54 ? 1.9058 1.9621 2.0380 0.0704  0.2808  0.2735  242 ASP B C   
708  O O   . ASP B 54 ? 1.9378 2.0022 2.0768 0.0740  0.2930  0.2976  242 ASP B O   
709  C CB  . ASP B 54 ? 1.8993 1.9939 2.0883 0.0679  0.2872  0.2850  242 ASP B CB  
710  C CG  . ASP B 54 ? 1.9323 2.0582 2.1737 0.0536  0.2785  0.3022  242 ASP B CG  
711  O OD1 . ASP B 54 ? 1.9940 2.1231 2.2519 0.0328  0.2509  0.2976  242 ASP B OD1 
712  O OD2 . ASP B 54 ? 1.9569 2.1027 2.2213 0.0642  0.2991  0.3203  242 ASP B OD2 
713  N N   . TYR B 55 ? 1.9048 1.9298 1.9913 0.0802  0.2789  0.2417  243 TYR B N   
714  C CA  . TYR B 55 ? 1.9532 1.9482 1.9919 0.0965  0.2907  0.2323  243 TYR B CA  
715  C C   . TYR B 55 ? 1.9479 1.9354 1.9794 0.0857  0.2771  0.2363  243 TYR B C   
716  O O   . TYR B 55 ? 2.0293 2.0211 2.0610 0.0930  0.2934  0.2589  243 TYR B O   
717  C CB  . TYR B 55 ? 1.9549 1.9163 1.9484 0.1058  0.2856  0.1966  243 TYR B CB  
718  C CG  . TYR B 55 ? 2.0116 1.9696 1.9951 0.1258  0.3083  0.1964  243 TYR B CG  
719  C CD1 . TYR B 55 ? 2.1294 2.0652 2.0753 0.1499  0.3319  0.1991  243 TYR B CD1 
720  C CD2 . TYR B 55 ? 1.9650 1.9398 1.9740 0.1215  0.3057  0.1938  243 TYR B CD2 
721  C CE1 . TYR B 55 ? 2.1823 2.1116 2.1153 0.1697  0.3518  0.1988  243 TYR B CE1 
722  C CE2 . TYR B 55 ? 2.0283 1.9982 2.0266 0.1401  0.3254  0.1936  243 TYR B CE2 
723  C CZ  . TYR B 55 ? 2.1673 2.1140 2.1271 0.1644  0.3482  0.1960  243 TYR B CZ  
724  O OH  . TYR B 55 ? 2.2803 2.2188 2.2254 0.1844  0.3669  0.1956  243 TYR B OH  
725  N N   . VAL B 56 ? 1.8997 1.8762 1.9245 0.0691  0.2481  0.2156  244 VAL B N   
726  C CA  . VAL B 56 ? 1.9263 1.8903 1.9375 0.0603  0.2339  0.2161  244 VAL B CA  
727  C C   . VAL B 56 ? 1.9505 1.9423 2.0027 0.0484  0.2338  0.2517  244 VAL B C   
728  O O   . VAL B 56 ? 1.9961 1.9823 2.0379 0.0513  0.2405  0.2657  244 VAL B O   
729  C CB  . VAL B 56 ? 1.9088 1.8569 1.9064 0.0453  0.2019  0.1878  244 VAL B CB  
730  C CG1 . VAL B 56 ? 1.8116 1.7462 1.7948 0.0366  0.1868  0.1889  244 VAL B CG1 
731  C CG2 . VAL B 56 ? 1.8860 1.8072 1.8444 0.0564  0.2014  0.1546  244 VAL B CG2 
732  N N   . GLU B 57 ? 1.9325 1.9530 2.0308 0.0349  0.2254  0.2668  245 GLU B N   
733  C CA  . GLU B 57 ? 1.9630 2.0125 2.1068 0.0227  0.2244  0.3033  245 GLU B CA  
734  C C   . GLU B 57 ? 2.0214 2.0829 2.1702 0.0387  0.2565  0.3324  245 GLU B C   
735  O O   . GLU B 57 ? 2.0482 2.1144 2.2043 0.0334  0.2562  0.3535  245 GLU B O   
736  C CB  . GLU B 57 ? 1.9381 2.0160 2.1293 0.0112  0.2169  0.3156  245 GLU B CB  
737  C CG  . GLU B 57 ? 1.9048 2.0133 2.1478 -0.0038 0.2116  0.3542  245 GLU B CG  
738  C CD  . GLU B 57 ? 1.8564 1.9966 2.1459 -0.0047 0.2209  0.3744  245 GLU B CD  
739  O OE1 . GLU B 57 ? 1.8991 2.0665 2.2230 -0.0011 0.2397  0.4094  245 GLU B OE1 
740  O OE2 . GLU B 57 ? 1.6461 1.7843 1.9380 -0.0088 0.2097  0.3559  245 GLU B OE2 
741  N N   . ARG B 58 ? 2.0397 2.1054 2.1832 0.0587  0.2839  0.3340  246 ARG B N   
742  C CA  . ARG B 58 ? 2.0968 2.1752 2.2449 0.0773  0.3177  0.3625  246 ARG B CA  
743  C C   . ARG B 58 ? 2.1138 2.1612 2.2111 0.0916  0.3284  0.3541  246 ARG B C   
744  O O   . ARG B 58 ? 2.1259 2.1827 2.2273 0.1014  0.3498  0.3813  246 ARG B O   
745  C CB  . ARG B 58 ? 2.1191 2.2063 2.2703 0.0966  0.3427  0.3636  246 ARG B CB  
746  C CG  . ARG B 58 ? 2.2359 2.3490 2.4100 0.1134  0.3768  0.4010  246 ARG B CG  
747  C CD  . ARG B 58 ? 2.2947 2.4237 2.4853 0.1272  0.3956  0.4054  246 ARG B CD  
748  N NE  . ARG B 58 ? 2.4444 2.5394 2.5857 0.1424  0.3982  0.3700  246 ARG B NE  
749  C CZ  . ARG B 58 ? 2.5933 2.6597 2.6847 0.1682  0.4200  0.3604  246 ARG B CZ  
750  N NH1 . ARG B 58 ? 2.6798 2.7471 2.7609 0.1837  0.4439  0.3832  246 ARG B NH1 
751  N NH2 . ARG B 58 ? 2.6373 2.6725 2.6874 0.1787  0.4173  0.3283  246 ARG B NH2 
752  N N   . ALA B 59 ? 2.1020 2.1129 2.1524 0.0927  0.3133  0.3174  247 ALA B N   
753  C CA  . ALA B 59 ? 2.1253 2.1015 2.1235 0.1051  0.3191  0.3049  247 ALA B CA  
754  C C   . ALA B 59 ? 2.1377 2.1069 2.1340 0.0874  0.2966  0.3068  247 ALA B C   
755  O O   . ALA B 59 ? 2.1401 2.0752 2.0919 0.0895  0.2855  0.2819  247 ALA B O   
756  C CB  . ALA B 59 ? 2.0947 2.0337 2.0432 0.1157  0.3135  0.2653  247 ALA B CB  
757  N N   . VAL B 60 ? 2.1279 2.1282 2.1720 0.0699  0.2885  0.3363  248 VAL B N   
758  C CA  . VAL B 60 ? 2.1443 2.1392 2.1889 0.0535  0.2684  0.3438  248 VAL B CA  
759  C C   . VAL B 60 ? 2.1579 2.1827 2.2414 0.0488  0.2809  0.3885  248 VAL B C   
760  O O   . VAL B 60 ? 2.1736 2.1870 2.2404 0.0481  0.2810  0.3974  248 VAL B O   
761  C CB  . VAL B 60 ? 2.1206 2.1154 2.1812 0.0286  0.2298  0.3284  248 VAL B CB  
762  C CG1 . VAL B 60 ? 2.0932 2.0743 2.1436 0.0139  0.2073  0.3304  248 VAL B CG1 
763  C CG2 . VAL B 60 ? 2.1287 2.0995 2.1575 0.0323  0.2180  0.2874  248 VAL B CG2 
764  N N   . SER B 61 ? 2.1510 2.2139 2.2867 0.0454  0.2909  0.4169  249 SER B N   
765  C CA  . SER B 61 ? 2.1533 2.2506 2.3392 0.0342  0.2945  0.4614  249 SER B CA  
766  C C   . SER B 61 ? 2.1862 2.2893 2.3643 0.0518  0.3272  0.4895  249 SER B C   
767  O O   . SER B 61 ? 2.2100 2.3290 2.3953 0.0723  0.3604  0.5055  249 SER B O   
768  C CB  . SER B 61 ? 2.1093 2.2454 2.3526 0.0282  0.2980  0.4832  249 SER B CB  
769  O OG  . SER B 61 ? 2.1214 2.2919 2.4182 0.0146  0.2971  0.5265  249 SER B OG  
770  N N   . ASP B 62 ? 2.1798 2.2692 2.3421 0.0442  0.3176  0.4955  250 ASP B N   
771  C CA  . ASP B 62 ? 2.1829 2.2802 2.3429 0.0569  0.3454  0.5267  250 ASP B CA  
772  C C   . ASP B 62 ? 2.1452 2.2534 2.3320 0.0336  0.3245  0.5521  250 ASP B C   
773  O O   . ASP B 62 ? 2.1086 2.1866 2.2589 0.0280  0.3084  0.5365  250 ASP B O   
774  C CB  . ASP B 62 ? 2.2191 2.2748 2.3094 0.0807  0.3627  0.5020  250 ASP B CB  
775  C CG  . ASP B 62 ? 2.2727 2.3257 2.3421 0.1111  0.3985  0.4982  250 ASP B CG  
776  O OD1 . ASP B 62 ? 2.2620 2.3496 2.3677 0.1216  0.4261  0.5325  250 ASP B OD1 
777  O OD2 . ASP B 62 ? 2.3633 2.3786 2.3795 0.1250  0.3984  0.4614  250 ASP B OD2 
778  N N   . GLU C 8  ? 1.8043 1.6960 1.6666 -0.2815 -0.0531 0.0171  10  GLU C N   
779  C CA  . GLU C 8  ? 1.7694 1.7616 1.7050 -0.2691 -0.0521 0.0258  10  GLU C CA  
780  C C   . GLU C 8  ? 1.7246 1.7213 1.7117 -0.2198 -0.0444 0.0211  10  GLU C C   
781  O O   . GLU C 8  ? 1.6889 1.6832 1.6846 -0.2071 -0.0439 0.0208  10  GLU C O   
782  C CB  . GLU C 8  ? 1.7566 1.8141 1.7201 -0.2796 -0.0511 0.0336  10  GLU C CB  
783  C CG  . GLU C 8  ? 1.8975 1.9883 1.8234 -0.3334 -0.0594 0.0435  10  GLU C CG  
784  C CD  . GLU C 8  ? 1.9894 2.1504 1.9442 -0.3401 -0.0574 0.0526  10  GLU C CD  
785  O OE1 . GLU C 8  ? 1.9920 2.1438 1.9762 -0.3089 -0.0496 0.0461  10  GLU C OE1 
786  O OE2 . GLU C 8  ? 2.1024 2.3327 2.0477 -0.3793 -0.0631 0.0671  10  GLU C OE2 
787  N N   . LEU C 9  ? 1.7020 1.7049 1.7176 -0.1975 -0.0382 0.0169  11  LEU C N   
788  C CA  . LEU C 9  ? 1.6588 1.6645 1.7129 -0.1608 -0.0298 0.0114  11  LEU C CA  
789  C C   . LEU C 9  ? 1.6355 1.5847 1.6661 -0.1437 -0.0322 0.0048  11  LEU C C   
790  O O   . LEU C 9  ? 1.5507 1.5073 1.6066 -0.1207 -0.0279 0.0022  11  LEU C O   
791  C CB  . LEU C 9  ? 1.6569 1.6789 1.7338 -0.1515 -0.0212 0.0075  11  LEU C CB  
792  C CG  . LEU C 9  ? 1.6989 1.7787 1.8115 -0.1476 -0.0088 0.0142  11  LEU C CG  
793  C CD1 . LEU C 9  ? 1.6309 1.7112 1.7504 -0.1443 0.0017  0.0076  11  LEU C CD1 
794  C CD2 . LEU C 9  ? 1.7554 1.8550 1.8989 -0.1227 0.0023  0.0180  11  LEU C CD2 
795  N N   . GLU C 10 ? 1.6646 1.5570 1.6426 -0.1532 -0.0366 0.0042  12  GLU C N   
796  C CA  . GLU C 10 ? 1.6762 1.5138 1.6234 -0.1308 -0.0349 0.0031  12  GLU C CA  
797  C C   . GLU C 10 ? 1.7047 1.5334 1.6478 -0.1272 -0.0350 0.0020  12  GLU C C   
798  O O   . GLU C 10 ? 1.6491 1.4756 1.6061 -0.0990 -0.0319 0.0010  12  GLU C O   
799  C CB  . GLU C 10 ? 1.7111 1.4760 1.5890 -0.1396 -0.0340 0.0059  12  GLU C CB  
800  C CG  . GLU C 10 ? 1.5671 1.3364 1.4439 -0.1407 -0.0342 0.0090  12  GLU C CG  
801  C CD  . GLU C 10 ? 1.5807 1.2695 1.3875 -0.1319 -0.0287 0.0159  12  GLU C CD  
802  O OE1 . GLU C 10 ? 1.6271 1.2463 1.3783 -0.1264 -0.0220 0.0170  12  GLU C OE1 
803  O OE2 . GLU C 10 ? 1.3548 1.0444 1.1564 -0.1289 -0.0284 0.0214  12  GLU C OE2 
804  N N   . GLU C 11 ? 1.7239 1.5553 1.6465 -0.1597 -0.0389 0.0036  13  GLU C N   
805  C CA  . GLU C 11 ? 1.7321 1.5631 1.6477 -0.1659 -0.0400 0.0036  13  GLU C CA  
806  C C   . GLU C 11 ? 1.6320 1.5363 1.6163 -0.1494 -0.0398 0.0072  13  GLU C C   
807  O O   . GLU C 11 ? 1.5372 1.4409 1.5259 -0.1410 -0.0396 0.0069  13  GLU C O   
808  C CB  . GLU C 11 ? 1.8174 1.6425 1.6861 -0.2155 -0.0450 0.0066  13  GLU C CB  
809  C CG  . GLU C 11 ? 1.9497 1.6820 1.7290 -0.2412 -0.0418 0.0023  13  GLU C CG  
810  C CD  . GLU C 11 ? 2.0012 1.7480 1.7380 -0.3030 -0.0481 0.0060  13  GLU C CD  
811  O OE1 . GLU C 11 ? 1.9289 1.7558 1.7084 -0.3174 -0.0546 0.0140  13  GLU C OE1 
812  O OE2 . GLU C 11 ? 1.9849 1.6641 1.6408 -0.3394 -0.0450 0.0017  13  GLU C OE2 
813  N N   . MET C 12 ? 1.5786 1.5386 1.6098 -0.1439 -0.0371 0.0112  14  MET C N   
814  C CA  . MET C 12 ? 1.4953 1.5065 1.5815 -0.1215 -0.0303 0.0154  14  MET C CA  
815  C C   . MET C 12 ? 1.4341 1.4223 1.5333 -0.0925 -0.0258 0.0072  14  MET C C   
816  O O   . MET C 12 ? 1.3440 1.3486 1.4653 -0.0795 -0.0227 0.0091  14  MET C O   
817  C CB  . MET C 12 ? 1.5000 1.5567 1.6198 -0.1172 -0.0216 0.0206  14  MET C CB  
818  C CG  . MET C 12 ? 1.5670 1.6927 1.7116 -0.1232 -0.0182 0.0380  14  MET C CG  
819  S SD  . MET C 12 ? 1.6729 1.8431 1.8538 -0.1031 0.0010  0.0461  14  MET C SD  
820  C CE  . MET C 12 ? 1.7100 1.8382 1.9062 -0.0693 0.0178  0.0336  14  MET C CE  
821  N N   . GLN C 13 ? 1.4514 1.4095 1.5360 -0.0841 -0.0255 0.0007  15  GLN C N   
822  C CA  . GLN C 13 ? 1.4284 1.3827 1.5246 -0.0616 -0.0220 -0.0038 15  GLN C CA  
823  C C   . GLN C 13 ? 1.4264 1.3511 1.4988 -0.0488 -0.0255 -0.0035 15  GLN C C   
824  O O   . GLN C 13 ? 1.3238 1.2615 1.4127 -0.0330 -0.0234 -0.0047 15  GLN C O   
825  C CB  . GLN C 13 ? 1.4667 1.4182 1.5569 -0.0589 -0.0206 -0.0060 15  GLN C CB  
826  C CG  . GLN C 13 ? 1.6085 1.5872 1.7229 -0.0674 -0.0122 -0.0094 15  GLN C CG  
827  C CD  . GLN C 13 ? 1.7895 1.7683 1.8925 -0.0731 -0.0125 -0.0109 15  GLN C CD  
828  O OE1 . GLN C 13 ? 1.9698 1.9282 2.0465 -0.0755 -0.0194 -0.0064 15  GLN C OE1 
829  N NE2 . GLN C 13 ? 1.7882 1.7858 1.9041 -0.0778 -0.0033 -0.0167 15  GLN C NE2 
830  N N   . ARG C 14 ? 1.4696 1.3494 1.4961 -0.0570 -0.0285 -0.0020 16  ARG C N   
831  C CA  . ARG C 14 ? 1.4855 1.3257 1.4789 -0.0451 -0.0271 -0.0019 16  ARG C CA  
832  C C   . ARG C 14 ? 1.3919 1.2565 1.4059 -0.0534 -0.0294 -0.0028 16  ARG C C   
833  O O   . ARG C 14 ? 1.2212 1.0961 1.2509 -0.0348 -0.0278 -0.0035 16  ARG C O   
834  C CB  . ARG C 14 ? 1.6190 1.3887 1.5435 -0.0580 -0.0248 -0.0014 16  ARG C CB  
835  C CG  . ARG C 14 ? 1.8551 1.5979 1.7558 -0.0455 -0.0210 0.0030  16  ARG C CG  
836  C CD  . ARG C 14 ? 2.1599 1.8300 1.9894 -0.0697 -0.0177 0.0029  16  ARG C CD  
837  N NE  . ARG C 14 ? 2.2916 1.9359 2.0978 -0.0565 -0.0134 0.0096  16  ARG C NE  
838  C CZ  . ARG C 14 ? 2.4853 2.0448 2.2143 -0.0633 -0.0048 0.0127  16  ARG C CZ  
839  N NH1 . ARG C 14 ? 2.5782 2.0631 2.2377 -0.0891 0.0014  0.0071  16  ARG C NH1 
840  N NH2 . ARG C 14 ? 2.5764 2.1216 2.2908 -0.0470 -0.0008 0.0219  16  ARG C NH2 
841  N N   . ARG C 15 ? 1.3888 1.2715 1.4032 -0.0823 -0.0333 -0.0002 17  ARG C N   
842  C CA  . ARG C 15 ? 1.3196 1.2456 1.3610 -0.0909 -0.0356 0.0048  17  ARG C CA  
843  C C   . ARG C 15 ? 1.2199 1.1795 1.3103 -0.0638 -0.0311 0.0050  17  ARG C C   
844  O O   . ARG C 15 ? 1.1514 1.1099 1.2449 -0.0545 -0.0313 0.0043  17  ARG C O   
845  C CB  . ARG C 15 ? 1.3345 1.3124 1.3935 -0.1155 -0.0381 0.0146  17  ARG C CB  
846  C CG  . ARG C 15 ? 1.3783 1.4258 1.4843 -0.1104 -0.0361 0.0275  17  ARG C CG  
847  C CD  . ARG C 15 ? 1.6127 1.6885 1.6992 -0.1419 -0.0436 0.0374  17  ARG C CD  
848  N NE  . ARG C 15 ? 1.8616 1.9050 1.9284 -0.1397 -0.0455 0.0310  17  ARG C NE  
849  C CZ  . ARG C 15 ? 2.0013 2.0622 2.0461 -0.1681 -0.0511 0.0370  17  ARG C CZ  
850  N NH1 . ARG C 15 ? 2.0175 2.1385 2.0579 -0.2042 -0.0567 0.0520  17  ARG C NH1 
851  N NH2 . ARG C 15 ? 2.1103 2.1350 2.1356 -0.1627 -0.0507 0.0291  17  ARG C NH2 
852  N N   . ALA C 16 ? 1.1724 1.1561 1.2937 -0.0549 -0.0255 0.0053  18  ALA C N   
853  C CA  . ALA C 16 ? 1.0676 1.0736 1.2238 -0.0372 -0.0172 0.0049  18  ALA C CA  
854  C C   . ALA C 16 ? 1.0194 1.0091 1.1693 -0.0227 -0.0183 -0.0014 18  ALA C C   
855  O O   . ALA C 16 ? 0.8907 0.8936 1.0580 -0.0143 -0.0148 -0.0009 18  ALA C O   
856  C CB  . ALA C 16 ? 1.0269 1.0416 1.1971 -0.0357 -0.0077 0.0029  18  ALA C CB  
857  N N   . ASP C 17 ? 1.0392 1.0039 1.1624 -0.0182 -0.0219 -0.0045 19  ASP C N   
858  C CA  . ASP C 17 ? 1.0302 0.9925 1.1463 -0.0002 -0.0220 -0.0053 19  ASP C CA  
859  C C   . ASP C 17 ? 0.9579 0.9083 1.0637 0.0055  -0.0241 -0.0046 19  ASP C C   
860  O O   . ASP C 17 ? 0.8342 0.8017 0.9514 0.0178  -0.0230 -0.0045 19  ASP C O   
861  C CB  . ASP C 17 ? 1.1553 1.0961 1.2412 0.0106  -0.0223 -0.0023 19  ASP C CB  
862  C CG  . ASP C 17 ? 1.3024 1.2616 1.3855 0.0345  -0.0205 0.0030  19  ASP C CG  
863  O OD1 . ASP C 17 ? 1.4155 1.3525 1.4759 0.0521  -0.0184 0.0062  19  ASP C OD1 
864  O OD2 . ASP C 17 ? 1.5157 1.5156 1.6161 0.0339  -0.0199 0.0052  19  ASP C OD2 
865  N N   . GLN C 18 ? 0.9876 0.9109 1.0678 -0.0084 -0.0267 -0.0041 20  GLN C N   
866  C CA  . GLN C 18 ? 1.0307 0.9399 1.0941 -0.0091 -0.0276 -0.0045 20  GLN C CA  
867  C C   . GLN C 18 ? 0.9140 0.8679 1.0179 -0.0144 -0.0294 -0.0010 20  GLN C C   
868  O O   . GLN C 18 ? 0.7899 0.7514 0.9005 -0.0050 -0.0292 -0.0013 20  GLN C O   
869  C CB  . GLN C 18 ? 1.1506 1.0138 1.1619 -0.0326 -0.0285 -0.0057 20  GLN C CB  
870  C CG  . GLN C 18 ? 1.5468 1.3433 1.5013 -0.0195 -0.0211 -0.0079 20  GLN C CG  
871  C CD  . GLN C 18 ? 1.9452 1.6779 1.8317 -0.0501 -0.0184 -0.0110 20  GLN C CD  
872  O OE1 . GLN C 18 ? 2.1923 1.9413 2.0744 -0.0864 -0.0244 -0.0112 20  GLN C OE1 
873  N NE2 . GLN C 18 ? 2.1301 1.7909 1.9575 -0.0373 -0.0078 -0.0113 20  GLN C NE2 
874  N N   . LEU C 19 ? 0.9015 0.8860 1.0308 -0.0263 -0.0292 0.0047  21  LEU C N   
875  C CA  . LEU C 19 ? 0.8062 0.8316 0.9714 -0.0239 -0.0263 0.0131  21  LEU C CA  
876  C C   . LEU C 19 ? 0.7025 0.7321 0.8881 -0.0056 -0.0200 0.0095  21  LEU C C   
877  O O   . LEU C 19 ? 0.6650 0.7095 0.8642 -0.0007 -0.0188 0.0137  21  LEU C O   
878  C CB  . LEU C 19 ? 0.7927 0.8516 0.9802 -0.0293 -0.0214 0.0238  21  LEU C CB  
879  C CG  . LEU C 19 ? 0.8947 0.9851 1.0742 -0.0526 -0.0281 0.0360  21  LEU C CG  
880  C CD1 . LEU C 19 ? 1.0781 1.2149 1.2830 -0.0515 -0.0213 0.0508  21  LEU C CD1 
881  C CD2 . LEU C 19 ? 0.9189 1.0370 1.1053 -0.0562 -0.0316 0.0452  21  LEU C CD2 
882  N N   . ALA C 20 ? 0.6503 0.6696 0.8340 -0.0001 -0.0162 0.0025  22  ALA C N   
883  C CA  . ALA C 20 ? 0.5358 0.5618 0.7289 0.0066  -0.0101 -0.0017 22  ALA C CA  
884  C C   . ALA C 20 ? 0.5261 0.5559 0.7110 0.0149  -0.0158 -0.0035 22  ALA C C   
885  O O   . ALA C 20 ? 0.4486 0.4909 0.6438 0.0161  -0.0129 -0.0032 22  ALA C O   
886  C CB  . ALA C 20 ? 0.4636 0.4873 0.6505 0.0023  -0.0061 -0.0073 22  ALA C CB  
887  N N   . ASP C 21 ? 0.6082 0.6232 0.7696 0.0223  -0.0214 -0.0043 23  ASP C N   
888  C CA  . ASP C 21 ? 0.6627 0.6806 0.8120 0.0369  -0.0232 -0.0038 23  ASP C CA  
889  C C   . ASP C 21 ? 0.6413 0.6602 0.7962 0.0331  -0.0251 -0.0029 23  ASP C C   
890  O O   . ASP C 21 ? 0.4443 0.4823 0.6068 0.0397  -0.0250 -0.0025 23  ASP C O   
891  C CB  . ASP C 21 ? 0.7696 0.7544 0.8807 0.0517  -0.0223 -0.0023 23  ASP C CB  
892  C CG  . ASP C 21 ? 0.9936 0.9893 1.0993 0.0628  -0.0202 0.0019  23  ASP C CG  
893  O OD1 . ASP C 21 ? 0.9211 0.9629 1.0483 0.0617  -0.0203 0.0040  23  ASP C OD1 
894  O OD2 . ASP C 21 ? 1.2947 1.2518 1.3687 0.0693  -0.0177 0.0039  23  ASP C OD2 
895  N N   . GLU C 22 ? 0.7020 0.7079 0.8520 0.0193  -0.0274 -0.0009 24  GLU C N   
896  C CA  . GLU C 22 ? 0.7123 0.7271 0.8651 0.0111  -0.0302 0.0028  24  GLU C CA  
897  C C   . GLU C 22 ? 0.6153 0.6622 0.8025 0.0155  -0.0272 0.0073  24  GLU C C   
898  O O   . GLU C 22 ? 0.4935 0.5510 0.6840 0.0179  -0.0288 0.0085  24  GLU C O   
899  C CB  . GLU C 22 ? 0.7260 0.7443 0.8731 -0.0108 -0.0334 0.0089  24  GLU C CB  
900  C CG  . GLU C 22 ? 0.9737 0.9469 1.0715 -0.0240 -0.0348 0.0032  24  GLU C CG  
901  C CD  . GLU C 22 ? 1.1124 1.0931 1.1899 -0.0573 -0.0396 0.0088  24  GLU C CD  
902  O OE1 . GLU C 22 ? 1.1222 1.1574 1.2345 -0.0668 -0.0423 0.0217  24  GLU C OE1 
903  O OE2 . GLU C 22 ? 1.1896 1.1219 1.2106 -0.0748 -0.0387 0.0020  24  GLU C OE2 
904  N N   . SER C 23 ? 0.5671 0.6217 0.7730 0.0157  -0.0206 0.0096  25  SER C N   
905  C CA  . SER C 23 ? 0.5383 0.6039 0.7634 0.0190  -0.0115 0.0141  25  SER C CA  
906  C C   . SER C 23 ? 0.5243 0.5919 0.7433 0.0205  -0.0115 0.0067  25  SER C C   
907  O O   . SER C 23 ? 0.5194 0.5949 0.7442 0.0205  -0.0088 0.0095  25  SER C O   
908  C CB  . SER C 23 ? 0.5886 0.6451 0.8193 0.0190  0.0008  0.0158  25  SER C CB  
909  O OG  . SER C 23 ? 0.8064 0.8744 1.0450 0.0185  0.0010  0.0257  25  SER C OG  
910  N N   . LEU C 24 ? 0.4787 0.5465 0.6851 0.0214  -0.0143 -0.0002 26  LEU C N   
911  C CA  . LEU C 24 ? 0.4198 0.5095 0.6209 0.0207  -0.0148 -0.0032 26  LEU C CA  
912  C C   . LEU C 24 ? 0.3130 0.4161 0.5129 0.0300  -0.0206 -0.0011 26  LEU C C   
913  O O   . LEU C 24 ? 0.2188 0.3408 0.4227 0.0245  -0.0194 -0.0005 26  LEU C O   
914  C CB  . LEU C 24 ? 0.4143 0.5179 0.6037 0.0252  -0.0174 -0.0043 26  LEU C CB  
915  C CG  . LEU C 24 ? 0.3915 0.5398 0.5766 0.0272  -0.0195 -0.0013 26  LEU C CG  
916  C CD1 . LEU C 24 ? 0.2525 0.4131 0.4373 -0.0001 -0.0136 -0.0050 26  LEU C CD1 
917  C CD2 . LEU C 24 ? 0.5306 0.7041 0.7052 0.0408  -0.0215 0.0048  26  LEU C CD2 
918  N N   . GLU C 25 ? 0.2995 0.3866 0.4867 0.0411  -0.0250 -0.0006 27  GLU C N   
919  C CA  . GLU C 25 ? 0.2781 0.3673 0.4543 0.0508  -0.0275 0.0000  27  GLU C CA  
920  C C   . GLU C 25 ? 0.2570 0.3566 0.4507 0.0399  -0.0287 0.0027  27  GLU C C   
921  O O   . GLU C 25 ? 0.1941 0.3106 0.3876 0.0433  -0.0301 0.0032  27  GLU C O   
922  C CB  . GLU C 25 ? 0.3489 0.3973 0.4933 0.0568  -0.0272 -0.0018 27  GLU C CB  
923  C CG  . GLU C 25 ? 0.5675 0.5996 0.6869 0.0628  -0.0258 -0.0033 27  GLU C CG  
924  C CD  . GLU C 25 ? 0.8374 0.8962 0.9541 0.0857  -0.0221 -0.0009 27  GLU C CD  
925  O OE1 . GLU C 25 ? 0.9978 1.0672 1.1154 0.0841  -0.0230 -0.0014 27  GLU C OE1 
926  O OE2 . GLU C 25 ? 0.8741 0.9515 0.9881 0.1048  -0.0184 0.0038  27  GLU C OE2 
927  N N   . SER C 26 ? 0.3089 0.4025 0.5174 0.0296  -0.0267 0.0072  28  SER C N   
928  C CA  . SER C 26 ? 0.2900 0.3964 0.5153 0.0247  -0.0248 0.0153  28  SER C CA  
929  C C   . SER C 26 ? 0.2993 0.4137 0.5293 0.0223  -0.0187 0.0145  28  SER C C   
930  O O   . SER C 26 ? 0.2832 0.4106 0.5162 0.0209  -0.0202 0.0174  28  SER C O   
931  C CB  . SER C 26 ? 0.2566 0.3630 0.4959 0.0222  -0.0198 0.0260  28  SER C CB  
932  O OG  . SER C 26 ? 0.3805 0.5034 0.6346 0.0241  -0.0157 0.0390  28  SER C OG  
933  N N   . THR C 27 ? 0.3313 0.4359 0.5561 0.0167  -0.0112 0.0102  29  THR C N   
934  C CA  . THR C 27 ? 0.2792 0.3866 0.4940 0.0037  -0.0045 0.0073  29  THR C CA  
935  C C   . THR C 27 ? 0.2645 0.4080 0.4770 0.0041  -0.0141 0.0054  29  THR C C   
936  O O   . THR C 27 ? 0.3241 0.4748 0.5351 -0.0038 -0.0125 0.0077  29  THR C O   
937  C CB  . THR C 27 ? 0.2651 0.3662 0.4642 -0.0101 0.0018  0.0001  29  THR C CB  
938  O OG1 . THR C 27 ? 0.6298 0.7532 0.8306 -0.0012 -0.0081 -0.0024 29  THR C OG1 
939  C CG2 . THR C 27 ? 0.1136 0.1746 0.3083 -0.0112 0.0159  0.0013  29  THR C CG2 
940  N N   . ARG C 28 ? 0.2728 0.3697 0.4156 0.0114  0.0010  0.0447  30  ARG C N   
941  C CA  . ARG C 28 ? 0.3344 0.4337 0.4937 0.0151  0.0050  0.0467  30  ARG C CA  
942  C C   . ARG C 28 ? 0.3979 0.4871 0.5543 0.0144  0.0123  0.0371  30  ARG C C   
943  O O   . ARG C 28 ? 0.2961 0.3906 0.4596 0.0164  0.0147  0.0361  30  ARG C O   
944  C CB  . ARG C 28 ? 0.3182 0.4111 0.4864 0.0227  0.0109  0.0553  30  ARG C CB  
945  C CG  . ARG C 28 ? 0.6279 0.7321 0.8013 0.0237  0.0038  0.0669  30  ARG C CG  
946  C CD  . ARG C 28 ? 0.8968 0.9979 1.0823 0.0355  0.0118  0.0791  30  ARG C CD  
947  N NE  . ARG C 28 ? 1.1320 1.2434 1.3214 0.0352  0.0045  0.0904  30  ARG C NE  
948  C CZ  . ARG C 28 ? 1.2921 1.3884 1.4720 0.0353  0.0058  0.0908  30  ARG C CZ  
949  N NH1 . ARG C 28 ? 1.2557 1.3256 1.4200 0.0323  0.0123  0.0821  30  ARG C NH1 
950  N NH2 . ARG C 28 ? 1.3745 1.4822 1.5583 0.0352  -0.0013 0.1018  30  ARG C NH2 
951  N N   . ARG C 29 ? 0.4323 0.5090 0.5772 0.0093  0.0146  0.0327  31  ARG C N   
952  C CA  . ARG C 29 ? 0.4272 0.4893 0.5621 0.0035  0.0191  0.0253  31  ARG C CA  
953  C C   . ARG C 29 ? 0.3702 0.4446 0.5044 0.0010  0.0170  0.0191  31  ARG C C   
954  O O   . ARG C 29 ? 0.3862 0.4532 0.5180 0.0001  0.0210  0.0127  31  ARG C O   
955  C CB  . ARG C 29 ? 0.3962 0.4487 0.5185 -0.0081 0.0166  0.0284  31  ARG C CB  
956  C CG  . ARG C 29 ? 0.5450 0.5684 0.6461 -0.0198 0.0191  0.0240  31  ARG C CG  
957  C CD  . ARG C 29 ? 0.7798 0.8104 0.8713 -0.0401 0.0101  0.0319  31  ARG C CD  
958  N NE  . ARG C 29 ? 0.5313 0.5845 0.6339 -0.0404 0.0054  0.0438  31  ARG C NE  
959  C CZ  . ARG C 29 ? 0.4522 0.4881 0.5487 -0.0408 0.0054  0.0481  31  ARG C CZ  
960  N NH1 . ARG C 29 ? 0.5734 0.5660 0.6504 -0.0381 0.0117  0.0422  31  ARG C NH1 
961  N NH2 . ARG C 29 ? 0.5079 0.5677 0.6151 -0.0409 0.0014  0.0598  31  ARG C NH2 
962  N N   . MET C 30 ? 0.4129 0.5014 0.5444 0.0020  0.0127  0.0218  32  MET C N   
963  C CA  . MET C 30 ? 0.5496 0.6425 0.6732 0.0032  0.0126  0.0173  32  MET C CA  
964  C C   . MET C 30 ? 0.5616 0.6520 0.6894 0.0034  0.0112  0.0130  32  MET C C   
965  O O   . MET C 30 ? 0.5830 0.6721 0.7077 0.0017  0.0127  0.0070  32  MET C O   
966  C CB  . MET C 30 ? 0.5707 0.6650 0.6783 0.0094  0.0120  0.0223  32  MET C CB  
967  C CG  . MET C 30 ? 0.6356 0.7431 0.7417 0.0128  0.0165  0.0319  32  MET C CG  
968  S SD  . MET C 30 ? 0.5416 0.6421 0.6207 0.0280  0.0224  0.0405  32  MET C SD  
969  C CE  . MET C 30 ? 0.8224 0.9566 0.9169 0.0312  0.0285  0.0598  32  MET C CE  
970  N N   . LEU C 31 ? 0.4627 0.5571 0.5997 0.0047  0.0076  0.0193  33  LEU C N   
971  C CA  . LEU C 31 ? 0.4595 0.5626 0.6035 0.0019  0.0032  0.0230  33  LEU C CA  
972  C C   . LEU C 31 ? 0.4734 0.5804 0.6324 0.0059  0.0116  0.0219  33  LEU C C   
973  O O   . LEU C 31 ? 0.3999 0.5131 0.5596 0.0019  0.0097  0.0208  33  LEU C O   
974  C CB  . LEU C 31 ? 0.4371 0.5525 0.5909 0.0007  -0.0040 0.0363  33  LEU C CB  
975  C CG  . LEU C 31 ? 0.5075 0.6332 0.6576 -0.0113 -0.0158 0.0438  33  LEU C CG  
976  C CD1 . LEU C 31 ? 0.6039 0.7267 0.7379 -0.0212 -0.0293 0.0530  33  LEU C CD1 
977  C CD2 . LEU C 31 ? 0.8275 0.9818 1.0098 -0.0082 -0.0123 0.0570  33  LEU C CD2 
978  N N   . GLN C 32 ? 0.4913 0.5885 0.6555 0.0139  0.0217  0.0227  34  GLN C N   
979  C CA  . GLN C 32 ? 0.5902 0.6802 0.7582 0.0217  0.0340  0.0225  34  GLN C CA  
980  C C   . GLN C 32 ? 0.5562 0.6367 0.7106 0.0142  0.0338  0.0096  34  GLN C C   
981  O O   . GLN C 32 ? 0.5560 0.6416 0.7147 0.0159  0.0378  0.0088  34  GLN C O   
982  C CB  . GLN C 32 ? 0.6623 0.7229 0.8187 0.0313  0.0470  0.0235  34  GLN C CB  
983  C CG  . GLN C 32 ? 1.0461 1.1099 1.2111 0.0395  0.0480  0.0358  34  GLN C CG  
984  C CD  . GLN C 32 ? 1.3485 1.4525 1.5438 0.0459  0.0440  0.0543  34  GLN C CD  
985  O OE1 . GLN C 32 ? 1.4231 1.5504 1.6256 0.0334  0.0282  0.0562  34  GLN C OE1 
986  N NE2 . GLN C 32 ? 1.4658 1.5757 1.6743 0.0651  0.0588  0.0710  34  GLN C NE2 
987  N N   . LEU C 33 ? 0.4973 0.5686 0.6373 0.0061  0.0292  0.0027  35  LEU C N   
988  C CA  . LEU C 33 ? 0.4735 0.5409 0.6020 -0.0012 0.0284  -0.0056 35  LEU C CA  
989  C C   . LEU C 33 ? 0.3884 0.4680 0.5198 -0.0014 0.0255  -0.0081 35  LEU C C   
990  O O   . LEU C 33 ? 0.2494 0.3252 0.3781 -0.0026 0.0294  -0.0133 35  LEU C O   
991  C CB  . LEU C 33 ? 0.4750 0.5479 0.5961 -0.0077 0.0229  -0.0035 35  LEU C CB  
992  C CG  . LEU C 33 ? 0.3601 0.4192 0.4692 -0.0187 0.0227  -0.0022 35  LEU C CG  
993  C CD1 . LEU C 33 ? 0.2266 0.3074 0.3374 -0.0243 0.0169  0.0072  35  LEU C CD1 
994  C CD2 . LEU C 33 ? 0.2766 0.3196 0.3722 -0.0256 0.0258  -0.0092 35  LEU C CD2 
995  N N   . VAL C 34 ? 0.4130 0.5012 0.5434 -0.0018 0.0182  -0.0040 36  VAL C N   
996  C CA  . VAL C 34 ? 0.4399 0.5282 0.5597 -0.0059 0.0131  -0.0058 36  VAL C CA  
997  C C   . VAL C 34 ? 0.5290 0.6288 0.6634 -0.0088 0.0122  -0.0010 36  VAL C C   
998  O O   . VAL C 34 ? 0.5545 0.6533 0.6828 -0.0137 0.0110  -0.0042 36  VAL C O   
999  C CB  . VAL C 34 ? 0.3869 0.4674 0.4877 -0.0079 0.0055  -0.0018 36  VAL C CB  
1000 C CG1 . VAL C 34 ? 0.5260 0.5944 0.6049 -0.0166 -0.0016 -0.0023 36  VAL C CG1 
1001 C CG2 . VAL C 34 ? 0.2367 0.3092 0.3214 -0.0007 0.0103  -0.0029 36  VAL C CG2 
1002 N N   . GLU C 35 ? 0.5101 0.6241 0.6651 -0.0047 0.0136  0.0099  37  GLU C N   
1003 C CA  . GLU C 35 ? 0.5243 0.6601 0.7002 -0.0035 0.0158  0.0221  37  GLU C CA  
1004 C C   . GLU C 35 ? 0.4718 0.5992 0.6472 0.0031  0.0284  0.0143  37  GLU C C   
1005 O O   . GLU C 35 ? 0.4570 0.5934 0.6342 -0.0023 0.0266  0.0155  37  GLU C O   
1006 C CB  . GLU C 35 ? 0.6253 0.7792 0.8249 0.0075  0.0213  0.0389  37  GLU C CB  
1007 C CG  . GLU C 35 ? 0.7875 0.9571 0.9914 -0.0014 0.0068  0.0517  37  GLU C CG  
1008 C CD  . GLU C 35 ? 0.9605 1.1538 1.1676 -0.0201 -0.0097 0.0662  37  GLU C CD  
1009 O OE1 . GLU C 35 ? 1.0897 1.2926 1.3012 -0.0247 -0.0089 0.0680  37  GLU C OE1 
1010 O OE2 . GLU C 35 ? 1.0726 1.2728 1.2741 -0.0330 -0.0249 0.0770  37  GLU C OE2 
1011 N N   . GLU C 36 ? 0.4798 0.5854 0.6470 0.0121  0.0399  0.0070  38  GLU C N   
1012 C CA  . GLU C 36 ? 0.5795 0.6665 0.7359 0.0172  0.0525  -0.0003 38  GLU C CA  
1013 C C   . GLU C 36 ? 0.4927 0.5772 0.6375 0.0062  0.0464  -0.0117 38  GLU C C   
1014 O O   . GLU C 36 ? 0.4470 0.5311 0.5912 0.0078  0.0527  -0.0132 38  GLU C O   
1015 C CB  . GLU C 36 ? 0.7306 0.7815 0.8644 0.0205  0.0610  -0.0070 38  GLU C CB  
1016 C CG  . GLU C 36 ? 0.9672 0.9836 1.0749 0.0234  0.0743  -0.0145 38  GLU C CG  
1017 C CD  . GLU C 36 ? 1.1589 1.1261 1.2309 0.0233  0.0821  -0.0184 38  GLU C CD  
1018 O OE1 . GLU C 36 ? 1.2215 1.1474 1.2585 0.0224  0.0920  -0.0251 38  GLU C OE1 
1019 O OE2 . GLU C 36 ? 1.0153 0.9797 1.0881 0.0221  0.0777  -0.0146 38  GLU C OE2 
1020 N N   . SER C 37 ? 0.4314 0.5143 0.5662 -0.0022 0.0362  -0.0174 39  SER C N   
1021 C CA  . SER C 37 ? 0.4723 0.5529 0.5944 -0.0086 0.0323  -0.0248 39  SER C CA  
1022 C C   . SER C 37 ? 0.4939 0.5840 0.6188 -0.0125 0.0282  -0.0221 39  SER C C   
1023 O O   . SER C 37 ? 0.5398 0.6263 0.6580 -0.0150 0.0303  -0.0273 39  SER C O   
1024 C CB  . SER C 37 ? 0.4889 0.5684 0.5996 -0.0100 0.0261  -0.0249 39  SER C CB  
1025 O OG  . SER C 37 ? 0.6570 0.7346 0.7697 -0.0092 0.0272  -0.0224 39  SER C OG  
1026 N N   . LYS C 38 ? 0.5467 0.6490 0.6793 -0.0162 0.0205  -0.0120 40  LYS C N   
1027 C CA  . LYS C 38 ? 0.5442 0.6567 0.6769 -0.0269 0.0125  -0.0047 40  LYS C CA  
1028 C C   . LYS C 38 ? 0.5409 0.6732 0.6966 -0.0221 0.0217  0.0027  40  LYS C C   
1029 O O   . LYS C 38 ? 0.6021 0.7343 0.7530 -0.0273 0.0219  0.0004  40  LYS C O   
1030 C CB  . LYS C 38 ? 0.5029 0.6264 0.6371 -0.0375 -0.0009 0.0092  40  LYS C CB  
1031 C CG  . LYS C 38 ? 0.5501 0.6797 0.6750 -0.0574 -0.0145 0.0193  40  LYS C CG  
1032 C CD  . LYS C 38 ? 0.9245 1.0634 1.0449 -0.0746 -0.0321 0.0363  40  LYS C CD  
1033 C CE  . LYS C 38 ? 1.0574 1.1655 1.1304 -0.1016 -0.0509 0.0376  40  LYS C CE  
1034 N NZ  . LYS C 38 ? 0.9482 1.0475 0.9984 -0.1214 -0.0696 0.0502  40  LYS C NZ  
1035 N N   . ASP C 39 ? 0.4881 0.6351 0.6660 -0.0096 0.0316  0.0133  41  ASP C N   
1036 C CA  . ASP C 39 ? 0.5923 0.7563 0.7886 0.0012  0.0454  0.0244  41  ASP C CA  
1037 C C   . ASP C 39 ? 0.5652 0.7039 0.7416 0.0022  0.0532  0.0072  41  ASP C C   
1038 O O   . ASP C 39 ? 0.4694 0.6192 0.6498 -0.0012 0.0547  0.0106  41  ASP C O   
1039 C CB  . ASP C 39 ? 0.6938 0.8589 0.9026 0.0224  0.0623  0.0348  41  ASP C CB  
1040 C CG  . ASP C 39 ? 0.9050 1.0961 1.1339 0.0214  0.0536  0.0525  41  ASP C CG  
1041 O OD1 . ASP C 39 ? 1.2200 1.4350 1.4562 0.0025  0.0343  0.0620  41  ASP C OD1 
1042 O OD2 . ASP C 39 ? 0.9764 1.1586 1.2078 0.0380  0.0655  0.0573  41  ASP C OD2 
1043 N N   . ALA C 40 ? 0.5768 0.6843 0.7317 0.0043  0.0564  -0.0089 42  ALA C N   
1044 C CA  . ALA C 40 ? 0.6417 0.7257 0.7749 0.0014  0.0606  -0.0234 42  ALA C CA  
1045 C C   . ALA C 40 ? 0.6306 0.7224 0.7598 -0.0098 0.0510  -0.0274 42  ALA C C   
1046 O O   . ALA C 40 ? 0.6119 0.7002 0.7360 -0.0102 0.0565  -0.0308 42  ALA C O   
1047 C CB  . ALA C 40 ? 0.6438 0.7045 0.7575 -0.0029 0.0578  -0.0337 42  ALA C CB  
1048 N N   . GLY C 41 ? 0.6515 0.7473 0.7764 -0.0181 0.0380  -0.0269 43  GLY C N   
1049 C CA  . GLY C 41 ? 0.6825 0.7732 0.7917 -0.0278 0.0299  -0.0299 43  GLY C CA  
1050 C C   . GLY C 41 ? 0.6996 0.8068 0.8197 -0.0345 0.0285  -0.0206 43  GLY C C   
1051 O O   . GLY C 41 ? 0.7060 0.8075 0.8167 -0.0383 0.0298  -0.0252 43  GLY C O   
1052 N N   . ILE C 42 ? 0.6559 0.7888 0.7985 -0.0365 0.0256  -0.0039 44  ILE C N   
1053 C CA  . ILE C 42 ? 0.5961 0.7564 0.7547 -0.0456 0.0222  0.0126  44  ILE C CA  
1054 C C   . ILE C 42 ? 0.5312 0.6969 0.7006 -0.0320 0.0400  0.0115  44  ILE C C   
1055 O O   . ILE C 42 ? 0.4778 0.6425 0.6402 -0.0392 0.0391  0.0097  44  ILE C O   
1056 C CB  . ILE C 42 ? 0.5977 0.7963 0.7862 -0.0476 0.0178  0.0377  44  ILE C CB  
1057 C CG1 . ILE C 42 ? 0.6215 0.8105 0.7924 -0.0650 -0.0020 0.0399  44  ILE C CG1 
1058 C CG2 . ILE C 42 ? 0.7611 1.0005 0.9734 -0.0567 0.0155  0.0620  44  ILE C CG2 
1059 C CD1 . ILE C 42 ? 0.8110 1.0349 1.0116 -0.0624 -0.0047 0.0621  44  ILE C CD1 
1060 N N   . ARG C 43 ? 0.5064 0.6707 0.6859 -0.0121 0.0571  0.0126  45  ARG C N   
1061 C CA  . ARG C 43 ? 0.5555 0.7126 0.7334 0.0030  0.0771  0.0119  45  ARG C CA  
1062 C C   . ARG C 43 ? 0.6078 0.7364 0.7584 -0.0052 0.0748  -0.0086 45  ARG C C   
1063 O O   . ARG C 43 ? 0.5817 0.7139 0.7317 -0.0040 0.0820  -0.0067 45  ARG C O   
1064 C CB  . ARG C 43 ? 0.5384 0.6729 0.7088 0.0242  0.0958  0.0105  45  ARG C CB  
1065 C CG  . ARG C 43 ? 1.0773 1.2490 1.2802 0.0406  0.1067  0.0393  45  ARG C CG  
1066 C CD  . ARG C 43 ? 1.3340 1.4711 1.5189 0.0673  0.1316  0.0395  45  ARG C CD  
1067 N NE  . ARG C 43 ? 1.3905 1.5609 1.6051 0.0872  0.1431  0.0683  45  ARG C NE  
1068 C CZ  . ARG C 43 ? 1.3891 1.5298 1.5877 0.1135  0.1658  0.0737  45  ARG C CZ  
1069 N NH1 . ARG C 43 ? 1.3311 1.4008 1.4775 0.1193  0.1780  0.0511  45  ARG C NH1 
1070 N NH2 . ARG C 43 ? 1.4088 1.5892 1.6402 0.1329  0.1760  0.1046  45  ARG C NH2 
1071 N N   . THR C 44 ? 0.6590 0.7640 0.7895 -0.0124 0.0654  -0.0247 46  THR C N   
1072 C CA  . THR C 44 ? 0.6907 0.7751 0.7984 -0.0189 0.0628  -0.0393 46  THR C CA  
1073 C C   . THR C 44 ? 0.7031 0.7978 0.8108 -0.0284 0.0564  -0.0364 46  THR C C   
1074 O O   . THR C 44 ? 0.7706 0.8576 0.8684 -0.0292 0.0613  -0.0418 46  THR C O   
1075 C CB  . THR C 44 ? 0.7316 0.8043 0.8255 -0.0239 0.0527  -0.0475 46  THR C CB  
1076 O OG1 . THR C 44 ? 0.8478 0.9104 0.9395 -0.0192 0.0565  -0.0493 46  THR C OG1 
1077 C CG2 . THR C 44 ? 0.7499 0.8116 0.8254 -0.0285 0.0509  -0.0557 46  THR C CG2 
1078 N N   . LEU C 45 ? 0.6866 0.7946 0.8001 -0.0384 0.0441  -0.0270 47  LEU C N   
1079 C CA  . LEU C 45 ? 0.7476 0.8564 0.8509 -0.0532 0.0343  -0.0230 47  LEU C CA  
1080 C C   . LEU C 45 ? 0.7366 0.8739 0.8619 -0.0549 0.0398  -0.0082 47  LEU C C   
1081 O O   . LEU C 45 ? 0.8541 0.9867 0.9698 -0.0609 0.0400  -0.0106 47  LEU C O   
1082 C CB  . LEU C 45 ? 0.7956 0.9001 0.8866 -0.0686 0.0174  -0.0156 47  LEU C CB  
1083 C CG  . LEU C 45 ? 0.8861 0.9563 0.9456 -0.0652 0.0140  -0.0285 47  LEU C CG  
1084 C CD1 . LEU C 45 ? 0.9413 1.0087 0.9942 -0.0735 0.0024  -0.0206 47  LEU C CD1 
1085 C CD2 . LEU C 45 ? 0.6027 0.6391 0.6233 -0.0697 0.0119  -0.0367 47  LEU C CD2 
1086 N N   . VAL C 46 ? 0.6509 0.8209 0.8069 -0.0479 0.0456  0.0102  48  VAL C N   
1087 C CA  . VAL C 46 ? 0.6543 0.8590 0.8356 -0.0438 0.0554  0.0302  48  VAL C CA  
1088 C C   . VAL C 46 ? 0.6183 0.7995 0.7834 -0.0329 0.0706  0.0150  48  VAL C C   
1089 O O   . VAL C 46 ? 0.6330 0.8208 0.7961 -0.0409 0.0696  0.0183  48  VAL C O   
1090 C CB  . VAL C 46 ? 0.6748 0.9121 0.8886 -0.0240 0.0705  0.0517  48  VAL C CB  
1091 C CG1 . VAL C 46 ? 0.5606 0.8298 0.7968 -0.0101 0.0892  0.0730  48  VAL C CG1 
1092 C CG2 . VAL C 46 ? 0.6647 0.9356 0.8994 -0.0383 0.0530  0.0729  48  VAL C CG2 
1093 N N   . MET C 47 ? 0.6580 0.8090 0.8075 -0.0175 0.0831  -0.0009 49  MET C N   
1094 C CA  . MET C 47 ? 0.8140 0.9371 0.9409 -0.0102 0.0959  -0.0145 49  MET C CA  
1095 C C   . MET C 47 ? 0.8277 0.9400 0.9375 -0.0261 0.0838  -0.0260 49  MET C C   
1096 O O   . MET C 47 ? 0.8961 1.0112 1.0033 -0.0266 0.0900  -0.0240 49  MET C O   
1097 C CB  . MET C 47 ? 0.8691 0.9540 0.9713 -0.0019 0.1029  -0.0301 49  MET C CB  
1098 C CG  . MET C 47 ? 0.9105 0.9901 1.0159 0.0188  0.1220  -0.0198 49  MET C CG  
1099 S SD  . MET C 47 ? 1.0098 1.0275 1.0676 0.0229  0.1310  -0.0381 49  MET C SD  
1100 C CE  . MET C 47 ? 0.9250 0.9322 0.9822 0.0535  0.1591  -0.0207 49  MET C CE  
1101 N N   . LEU C 48 ? 0.8510 0.9497 0.9471 -0.0364 0.0689  -0.0363 50  LEU C N   
1102 C CA  . LEU C 48 ? 0.9333 1.0160 1.0078 -0.0459 0.0615  -0.0457 50  LEU C CA  
1103 C C   . LEU C 48 ? 0.9820 1.0770 1.0589 -0.0580 0.0555  -0.0358 50  LEU C C   
1104 O O   . LEU C 48 ? 1.0431 1.1265 1.1046 -0.0619 0.0560  -0.0414 50  LEU C O   
1105 C CB  . LEU C 48 ? 0.9460 1.0123 1.0034 -0.0491 0.0507  -0.0526 50  LEU C CB  
1106 C CG  . LEU C 48 ? 1.0353 1.0891 1.0818 -0.0425 0.0548  -0.0622 50  LEU C CG  
1107 C CD1 . LEU C 48 ? 1.1322 1.1825 1.1750 -0.0396 0.0490  -0.0624 50  LEU C CD1 
1108 C CD2 . LEU C 48 ? 1.0753 1.1197 1.1044 -0.0449 0.0550  -0.0666 50  LEU C CD2 
1109 N N   . ASP C 49 ? 0.9700 1.0900 1.0657 -0.0663 0.0484  -0.0188 51  ASP C N   
1110 C CA  . ASP C 49 ? 0.9462 1.0818 1.0435 -0.0856 0.0375  -0.0036 51  ASP C CA  
1111 C C   . ASP C 49 ? 0.9116 1.0741 1.0297 -0.0798 0.0509  0.0078  51  ASP C C   
1112 O O   . ASP C 49 ? 0.9529 1.1083 1.0577 -0.0898 0.0481  0.0067  51  ASP C O   
1113 C CB  . ASP C 49 ? 0.9677 1.1282 1.0802 -0.1000 0.0235  0.0164  51  ASP C CB  
1114 C CG  . ASP C 49 ? 1.1237 1.2657 1.2052 -0.1304 0.0012  0.0225  51  ASP C CG  
1115 O OD1 . ASP C 49 ? 1.3270 1.4495 1.3874 -0.1420 -0.0127 0.0224  51  ASP C OD1 
1116 O OD2 . ASP C 49 ? 1.3287 1.4697 1.4005 -0.1437 -0.0024 0.0274  51  ASP C OD2 
1117 N N   . GLU C 50 ? 0.8373 1.0270 0.9841 -0.0612 0.0678  0.0200  52  GLU C N   
1118 C CA  . GLU C 50 ? 0.9035 1.1130 1.0641 -0.0489 0.0863  0.0317  52  GLU C CA  
1119 C C   . GLU C 50 ? 0.9189 1.0879 1.0486 -0.0410 0.0966  0.0079  52  GLU C C   
1120 O O   . GLU C 50 ? 0.9810 1.1551 1.1086 -0.0414 0.1036  0.0120  52  GLU C O   
1121 C CB  . GLU C 50 ? 0.9172 1.1544 1.1055 -0.0235 0.1080  0.0512  52  GLU C CB  
1122 C CG  . GLU C 50 ? 1.0183 1.2151 1.1857 -0.0016 0.1237  0.0325  52  GLU C CG  
1123 C CD  . GLU C 50 ? 1.1909 1.4105 1.3818 0.0217  0.1411  0.0540  52  GLU C CD  
1124 O OE1 . GLU C 50 ? 1.3064 1.4936 1.4803 0.0328  0.1467  0.0408  52  GLU C OE1 
1125 O OE2 . GLU C 50 ? 1.1903 1.4625 1.4170 0.0290  0.1494  0.0869  52  GLU C OE2 
1126 N N   . GLN C 51 ? 0.9861 1.1184 1.0922 -0.0360 0.0963  -0.0141 53  GLN C N   
1127 C CA  . GLN C 51 ? 1.0616 1.1595 1.1372 -0.0355 0.0997  -0.0334 53  GLN C CA  
1128 C C   . GLN C 51 ? 1.0999 1.1946 1.1642 -0.0518 0.0864  -0.0369 53  GLN C C   
1129 O O   . GLN C 51 ? 1.1383 1.2202 1.1870 -0.0519 0.0917  -0.0434 53  GLN C O   
1130 C CB  . GLN C 51 ? 1.0455 1.1147 1.1018 -0.0334 0.0964  -0.0497 53  GLN C CB  
1131 C CG  . GLN C 51 ? 1.0434 1.0947 1.0910 -0.0182 0.1130  -0.0507 53  GLN C CG  
1132 C CD  . GLN C 51 ? 1.0177 1.0378 1.0394 -0.0227 0.1076  -0.0650 53  GLN C CD  
1133 O OE1 . GLN C 51 ? 0.8976 0.9065 0.9018 -0.0336 0.0987  -0.0737 53  GLN C OE1 
1134 N NE2 . GLN C 51 ? 0.8683 0.8774 0.8882 -0.0151 0.1126  -0.0640 53  GLN C NE2 
1135 N N   . GLY C 52 ? 1.1118 1.2115 1.1770 -0.0659 0.0698  -0.0323 54  GLY C N   
1136 C CA  . GLY C 52 ? 1.1465 1.2327 1.1911 -0.0814 0.0583  -0.0334 54  GLY C CA  
1137 C C   . GLY C 52 ? 1.1605 1.2679 1.2160 -0.0886 0.0619  -0.0200 54  GLY C C   
1138 O O   . GLY C 52 ? 1.1982 1.2903 1.2356 -0.0922 0.0629  -0.0261 54  GLY C O   
1139 N N   . GLU C 53 ? 1.0866 1.2337 1.1739 -0.0899 0.0646  0.0017  55  GLU C N   
1140 C CA  . GLU C 53 ? 1.1731 1.3520 1.2783 -0.0946 0.0703  0.0212  55  GLU C CA  
1141 C C   . GLU C 53 ? 1.1325 1.2965 1.2279 -0.0762 0.0905  0.0095  55  GLU C C   
1142 O O   . GLU C 53 ? 1.1617 1.3132 1.2403 -0.0841 0.0887  0.0046  55  GLU C O   
1143 C CB  . GLU C 53 ? 1.2124 1.4470 1.3609 -0.0901 0.0764  0.0524  55  GLU C CB  
1144 C CG  . GLU C 53 ? 1.3276 1.5805 1.4866 -0.1103 0.0550  0.0670  55  GLU C CG  
1145 C CD  . GLU C 53 ? 1.5579 1.7843 1.6832 -0.1448 0.0283  0.0642  55  GLU C CD  
1146 O OE1 . GLU C 53 ? 1.6455 1.8752 1.7630 -0.1603 0.0238  0.0722  55  GLU C OE1 
1147 O OE2 . GLU C 53 ? 1.7479 1.9440 1.8485 -0.1558 0.0131  0.0544  55  GLU C OE2 
1148 N N   . GLN C 54 ? 1.0908 1.2496 1.1897 -0.0530 0.1093  0.0052  56  GLN C N   
1149 C CA  . GLN C 54 ? 1.1468 1.2820 1.2257 -0.0371 0.1291  -0.0046 56  GLN C CA  
1150 C C   . GLN C 54 ? 1.1415 1.2451 1.1897 -0.0491 0.1192  -0.0243 56  GLN C C   
1151 O O   . GLN C 54 ? 1.1588 1.2601 1.1981 -0.0497 0.1261  -0.0230 56  GLN C O   
1152 C CB  . GLN C 54 ? 1.1935 1.3013 1.2579 -0.0176 0.1440  -0.0145 56  GLN C CB  
1153 C CG  . GLN C 54 ? 1.2780 1.4139 1.3694 0.0023  0.1611  0.0079  56  GLN C CG  
1154 C CD  . GLN C 54 ? 1.3891 1.4834 1.4528 0.0242  0.1806  -0.0014 56  GLN C CD  
1155 O OE1 . GLN C 54 ? 1.3996 1.4427 1.4193 0.0244  0.1854  -0.0216 56  GLN C OE1 
1156 N NE2 . GLN C 54 ? 1.3395 1.4535 1.4250 0.0405  0.1908  0.0154  56  GLN C NE2 
1157 N N   . LEU C 55 ? 1.1847 1.2668 1.2179 -0.0568 0.1046  -0.0393 57  LEU C N   
1158 C CA  . LEU C 55 ? 1.2455 1.3027 1.2520 -0.0640 0.0970  -0.0530 57  LEU C CA  
1159 C C   . LEU C 55 ? 1.2392 1.3011 1.2418 -0.0768 0.0898  -0.0469 57  LEU C C   
1160 O O   . LEU C 55 ? 1.3001 1.3479 1.2845 -0.0782 0.0917  -0.0530 57  LEU C O   
1161 C CB  . LEU C 55 ? 1.2966 1.3396 1.2930 -0.0667 0.0842  -0.0620 57  LEU C CB  
1162 C CG  . LEU C 55 ? 1.3577 1.3902 1.3493 -0.0592 0.0871  -0.0700 57  LEU C CG  
1163 C CD1 . LEU C 55 ? 1.4501 1.4798 1.4398 -0.0606 0.0753  -0.0722 57  LEU C CD1 
1164 C CD2 . LEU C 55 ? 1.2207 1.2350 1.1890 -0.0598 0.0920  -0.0776 57  LEU C CD2 
1165 N N   . ASP C 56 ? 1.2270 1.3062 1.2427 -0.0889 0.0799  -0.0334 58  ASP C N   
1166 C CA  . ASP C 56 ? 1.2827 1.3600 1.2874 -0.1063 0.0707  -0.0257 58  ASP C CA  
1167 C C   . ASP C 56 ? 1.2767 1.3763 1.2949 -0.1027 0.0842  -0.0157 58  ASP C C   
1168 O O   . ASP C 56 ? 1.3318 1.4203 1.3336 -0.1101 0.0830  -0.0172 58  ASP C O   
1169 C CB  . ASP C 56 ? 1.3117 1.3994 1.3204 -0.1269 0.0538  -0.0102 58  ASP C CB  
1170 C CG  . ASP C 56 ? 1.4074 1.4657 1.3951 -0.1283 0.0428  -0.0203 58  ASP C CG  
1171 O OD1 . ASP C 56 ? 1.4321 1.4542 1.3901 -0.1202 0.0435  -0.0360 58  ASP C OD1 
1172 O OD2 . ASP C 56 ? 1.6158 1.6897 1.6170 -0.1362 0.0345  -0.0098 58  ASP C OD2 
1173 N N   . ARG C 57 ? 1.2630 1.3914 1.3082 -0.0884 0.0997  -0.0042 59  ARG C N   
1174 C CA  . ARG C 57 ? 1.2858 1.4334 1.3410 -0.0786 0.1182  0.0080  59  ARG C CA  
1175 C C   . ARG C 57 ? 1.2434 1.3526 1.2660 -0.0683 0.1288  -0.0130 59  ARG C C   
1176 O O   . ARG C 57 ? 1.3376 1.4458 1.3514 -0.0698 0.1352  -0.0104 59  ARG C O   
1177 C CB  . ARG C 57 ? 1.3134 1.4949 1.3989 -0.0583 0.1377  0.0278  59  ARG C CB  
1178 C CG  . ARG C 57 ? 1.3338 1.5560 1.4530 -0.0691 0.1244  0.0495  59  ARG C CG  
1179 C CD  . ARG C 57 ? 1.4278 1.7072 1.5883 -0.0535 0.1428  0.0852  59  ARG C CD  
1180 N NE  . ARG C 57 ? 1.5034 1.7700 1.6616 -0.0185 0.1706  0.0827  59  ARG C NE  
1181 C CZ  . ARG C 57 ? 1.4570 1.7180 1.6203 -0.0092 0.1705  0.0791  59  ARG C CZ  
1182 N NH1 . ARG C 57 ? 1.4192 1.6892 1.5927 -0.0314 0.1442  0.0774  59  ARG C NH1 
1183 N NH2 . ARG C 57 ? 1.4231 1.6619 1.5740 0.0228  0.1980  0.0772  59  ARG C NH2 
1184 N N   . VAL C 58 ? 1.2247 1.3040 1.2287 -0.0609 0.1288  -0.0314 60  VAL C N   
1185 C CA  . VAL C 58 ? 1.2869 1.3307 1.2567 -0.0581 0.1333  -0.0484 60  VAL C CA  
1186 C C   . VAL C 58 ? 1.3820 1.4168 1.3372 -0.0722 0.1194  -0.0543 60  VAL C C   
1187 O O   . VAL C 58 ? 1.4590 1.4799 1.3941 -0.0727 0.1249  -0.0586 60  VAL C O   
1188 C CB  . VAL C 58 ? 1.2824 1.3005 1.2352 -0.0543 0.1307  -0.0624 60  VAL C CB  
1189 C CG1 . VAL C 58 ? 0.9972 0.9898 0.9195 -0.0631 0.1225  -0.0751 60  VAL C CG1 
1190 C CG2 . VAL C 58 ? 1.1576 1.1608 1.1011 -0.0376 0.1511  -0.0606 60  VAL C CG2 
1191 N N   . GLU C 59 ? 1.4181 1.4553 1.3775 -0.0823 0.1031  -0.0537 61  GLU C N   
1192 C CA  . GLU C 59 ? 1.5011 1.5226 1.4403 -0.0913 0.0933  -0.0568 61  GLU C CA  
1193 C C   . GLU C 59 ? 1.5653 1.5966 1.5059 -0.0992 0.0971  -0.0469 61  GLU C C   
1194 O O   . GLU C 59 ? 1.6255 1.6438 1.5476 -0.1003 0.0992  -0.0510 61  GLU C O   
1195 C CB  . GLU C 59 ? 1.5206 1.5303 1.4519 -0.0979 0.0790  -0.0562 61  GLU C CB  
1196 C CG  . GLU C 59 ? 1.6623 1.6439 1.5625 -0.0981 0.0739  -0.0603 61  GLU C CG  
1197 C CD  . GLU C 59 ? 1.8813 1.8360 1.7587 -0.1011 0.0643  -0.0588 61  GLU C CD  
1198 O OE1 . GLU C 59 ? 2.0414 1.9914 1.9151 -0.1163 0.0562  -0.0518 61  GLU C OE1 
1199 O OE2 . GLU C 59 ? 1.9715 1.9085 1.8310 -0.0886 0.0653  -0.0618 61  GLU C OE2 
1200 N N   . GLU C 60 ? 1.5600 1.6190 1.5242 -0.1058 0.0973  -0.0305 62  GLU C N   
1201 C CA  . GLU C 60 ? 1.6150 1.6933 1.5864 -0.1157 0.1001  -0.0148 62  GLU C CA  
1202 C C   . GLU C 60 ? 1.5785 1.6563 1.5449 -0.1015 0.1194  -0.0176 62  GLU C C   
1203 O O   . GLU C 60 ? 1.6333 1.7037 1.5855 -0.1079 0.1198  -0.0172 62  GLU C O   
1204 C CB  . GLU C 60 ? 1.6466 1.7691 1.6526 -0.1240 0.0983  0.0106  62  GLU C CB  
1205 C CG  . GLU C 60 ? 1.8264 1.9429 1.8251 -0.1491 0.0743  0.0174  62  GLU C CG  
1206 C CD  . GLU C 60 ? 1.9819 2.1479 2.0172 -0.1604 0.0687  0.0456  62  GLU C CD  
1207 O OE1 . GLU C 60 ? 2.0504 2.2536 2.1203 -0.1400 0.0862  0.0567  62  GLU C OE1 
1208 O OE2 . GLU C 60 ? 2.0038 2.1685 2.0287 -0.1905 0.0468  0.0588  62  GLU C OE2 
1209 N N   . GLY C 61 ? 1.5111 1.5894 1.4820 -0.0827 0.1360  -0.0206 63  GLY C N   
1210 C CA  . GLY C 61 ? 1.5549 1.6134 1.5033 -0.0689 0.1551  -0.0270 63  GLY C CA  
1211 C C   . GLY C 61 ? 1.5817 1.6086 1.4970 -0.0773 0.1466  -0.0432 63  GLY C C   
1212 O O   . GLY C 61 ? 1.6518 1.6739 1.5536 -0.0785 0.1537  -0.0411 63  GLY C O   
1213 N N   . MET C 62 ? 1.5554 1.5651 1.4595 -0.0821 0.1323  -0.0561 64  MET C N   
1214 C CA  . MET C 62 ? 1.6079 1.5967 1.4855 -0.0885 0.1239  -0.0655 64  MET C CA  
1215 C C   . MET C 62 ? 1.6233 1.6150 1.4981 -0.0976 0.1169  -0.0601 64  MET C C   
1216 O O   . MET C 62 ? 1.6583 1.6378 1.5126 -0.1004 0.1166  -0.0630 64  MET C O   
1217 C CB  . MET C 62 ? 1.6174 1.5996 1.4918 -0.0896 0.1108  -0.0723 64  MET C CB  
1218 C CG  . MET C 62 ? 1.7318 1.7022 1.5968 -0.0859 0.1146  -0.0788 64  MET C CG  
1219 S SD  . MET C 62 ? 1.7391 1.6792 1.5608 -0.0928 0.1184  -0.0851 64  MET C SD  
1220 C CE  . MET C 62 ? 1.5614 1.5125 1.3793 -0.1024 0.1018  -0.0807 64  MET C CE  
1221 N N   . ASN C 63 ? 1.6534 1.6578 1.5441 -0.1046 0.1102  -0.0510 65  ASN C N   
1222 C CA  . ASN C 63 ? 1.7018 1.7007 1.5820 -0.1168 0.1034  -0.0443 65  ASN C CA  
1223 C C   . ASN C 63 ? 1.7229 1.7364 1.6075 -0.1188 0.1149  -0.0353 65  ASN C C   
1224 O O   . ASN C 63 ? 1.7645 1.7646 1.6297 -0.1226 0.1148  -0.0369 65  ASN C O   
1225 C CB  . ASN C 63 ? 1.7056 1.7056 1.5906 -0.1302 0.0905  -0.0354 65  ASN C CB  
1226 C CG  . ASN C 63 ? 1.7299 1.7065 1.6008 -0.1261 0.0811  -0.0439 65  ASN C CG  
1227 O OD1 . ASN C 63 ? 1.7411 1.7023 1.5975 -0.1146 0.0824  -0.0529 65  ASN C OD1 
1228 N ND2 . ASN C 63 ? 1.6112 1.5878 1.4860 -0.1361 0.0715  -0.0377 65  ASN C ND2 
1229 N N   . HIS C 64 ? 1.7094 1.7520 1.6195 -0.1138 0.1267  -0.0231 66  HIS C N   
1230 C CA  . HIS C 64 ? 1.7447 1.8058 1.6608 -0.1111 0.1420  -0.0098 66  HIS C CA  
1231 C C   . HIS C 64 ? 1.7417 1.7741 1.6262 -0.1032 0.1516  -0.0234 66  HIS C C   
1232 O O   . HIS C 64 ? 1.8006 1.8333 1.6758 -0.1076 0.1559  -0.0180 66  HIS C O   
1233 C CB  . HIS C 64 ? 1.7395 1.8336 1.6839 -0.0958 0.1611  0.0067  66  HIS C CB  
1234 C CG  . HIS C 64 ? 1.8824 2.0165 1.8631 -0.1065 0.1510  0.0274  66  HIS C CG  
1235 N ND1 . HIS C 64 ? 2.0015 2.1648 1.9978 -0.1292 0.1387  0.0493  66  HIS C ND1 
1236 C CD2 . HIS C 64 ? 2.0192 2.1683 2.0208 -0.1010 0.1493  0.0313  66  HIS C CD2 
1237 C CE1 . HIS C 64 ? 2.0152 2.2108 2.0396 -0.1396 0.1282  0.0671  66  HIS C CE1 
1238 N NE2 . HIS C 64 ? 2.0362 2.2250 2.0660 -0.1211 0.1353  0.0562  66  HIS C NE2 
1239 N N   . ILE C 65 ? 1.7204 1.7277 1.5861 -0.0948 0.1530  -0.0394 67  ILE C N   
1240 C CA  . ILE C 65 ? 1.7652 1.7427 1.5950 -0.0940 0.1563  -0.0508 67  ILE C CA  
1241 C C   . ILE C 65 ? 1.8058 1.7767 1.6243 -0.1061 0.1409  -0.0530 67  ILE C C   
1242 O O   . ILE C 65 ? 1.8691 1.8322 1.6700 -0.1091 0.1454  -0.0517 67  ILE C O   
1243 C CB  . ILE C 65 ? 1.7695 1.7222 1.5788 -0.0903 0.1548  -0.0639 67  ILE C CB  
1244 C CG1 . ILE C 65 ? 1.7649 1.7021 1.5604 -0.0753 0.1774  -0.0631 67  ILE C CG1 
1245 C CG2 . ILE C 65 ? 1.7170 1.6465 1.4926 -0.1000 0.1453  -0.0720 67  ILE C CG2 
1246 C CD1 . ILE C 65 ? 1.5618 1.5330 1.3948 -0.0619 0.1918  -0.0464 67  ILE C CD1 
1247 N N   . ASN C 66 ? 1.7980 1.7687 1.6228 -0.1106 0.1253  -0.0549 68  ASN C N   
1248 C CA  . ASN C 66 ? 1.8601 1.8195 1.6700 -0.1166 0.1148  -0.0535 68  ASN C CA  
1249 C C   . ASN C 66 ? 1.8748 1.8364 1.6816 -0.1250 0.1178  -0.0446 68  ASN C C   
1250 O O   . ASN C 66 ? 1.9122 1.8614 1.6991 -0.1275 0.1165  -0.0443 68  ASN C O   
1251 C CB  . ASN C 66 ? 1.8874 1.8396 1.6991 -0.1162 0.1029  -0.0530 68  ASN C CB  
1252 C CG  . ASN C 66 ? 1.9876 1.9186 1.7744 -0.1150 0.0969  -0.0500 68  ASN C CG  
1253 O OD1 . ASN C 66 ? 1.9832 1.9095 1.7558 -0.1167 0.0994  -0.0478 68  ASN C OD1 
1254 N ND2 . ASN C 66 ? 2.1121 2.0267 1.8895 -0.1096 0.0911  -0.0486 68  ASN C ND2 
1255 N N   . GLN C 67 ? 1.8489 1.8306 1.6769 -0.1306 0.1212  -0.0340 69  GLN C N   
1256 C CA  . GLN C 67 ? 1.8850 1.8751 1.7133 -0.1432 0.1214  -0.0205 69  GLN C CA  
1257 C C   . GLN C 67 ? 1.9067 1.9025 1.7289 -0.1369 0.1375  -0.0185 69  GLN C C   
1258 O O   . GLN C 67 ? 1.9365 1.9206 1.7403 -0.1434 0.1359  -0.0171 69  GLN C O   
1259 C CB  . GLN C 67 ? 1.8761 1.8966 1.7331 -0.1544 0.1182  -0.0029 69  GLN C CB  
1260 C CG  . GLN C 67 ? 1.8799 1.9062 1.7331 -0.1777 0.1090  0.0148  69  GLN C CG  
1261 C CD  . GLN C 67 ? 1.8804 1.9469 1.7566 -0.1771 0.1241  0.0342  69  GLN C CD  
1262 O OE1 . GLN C 67 ? 1.9119 2.0189 1.8216 -0.1674 0.1367  0.0486  69  GLN C OE1 
1263 N NE2 . GLN C 67 ? 1.7073 1.7632 1.5650 -0.1847 0.1251  0.0372  69  GLN C NE2 
1264 N N   . ASP C 68 ? 1.8846 1.8920 1.7160 -0.1227 0.1546  -0.0182 70  ASP C N   
1265 C CA  . ASP C 68 ? 1.9129 1.9167 1.7291 -0.1136 0.1741  -0.0156 70  ASP C CA  
1266 C C   . ASP C 68 ? 1.9236 1.8936 1.7017 -0.1161 0.1698  -0.0301 70  ASP C C   
1267 O O   . ASP C 68 ? 1.9365 1.9025 1.7006 -0.1209 0.1727  -0.0259 70  ASP C O   
1268 C CB  . ASP C 68 ? 1.9292 1.9333 1.7462 -0.0936 0.1959  -0.0147 70  ASP C CB  
1269 C CG  . ASP C 68 ? 1.9622 2.0115 1.8206 -0.0869 0.2068  0.0089  70  ASP C CG  
1270 O OD1 . ASP C 68 ? 1.9555 2.0346 1.8429 -0.1037 0.1902  0.0216  70  ASP C OD1 
1271 O OD2 . ASP C 68 ? 2.0707 2.1236 1.9285 -0.0649 0.2324  0.0174  70  ASP C OD2 
1272 N N   . MET C 69 ? 1.9178 1.8675 1.6804 -0.1146 0.1615  -0.0440 71  MET C N   
1273 C CA  . MET C 69 ? 1.9423 1.8681 1.6714 -0.1200 0.1545  -0.0524 71  MET C CA  
1274 C C   . MET C 69 ? 1.9390 1.8675 1.6675 -0.1283 0.1412  -0.0478 71  MET C C   
1275 O O   . MET C 69 ? 1.9214 1.8381 1.6260 -0.1326 0.1375  -0.0485 71  MET C O   
1276 C CB  . MET C 69 ? 1.9546 1.8685 1.6735 -0.1209 0.1446  -0.0616 71  MET C CB  
1277 C CG  . MET C 69 ? 1.9958 1.8934 1.7028 -0.1134 0.1576  -0.0675 71  MET C CG  
1278 S SD  . MET C 69 ? 2.0811 1.9313 1.7263 -0.1156 0.1712  -0.0738 71  MET C SD  
1279 C CE  . MET C 69 ? 2.0747 1.9128 1.6935 -0.1371 0.1448  -0.0780 71  MET C CE  
1280 N N   . LYS C 70 ? 1.9528 1.8919 1.7016 -0.1312 0.1342  -0.0417 72  LYS C N   
1281 C CA  . LYS C 70 ? 1.9971 1.9267 1.7353 -0.1379 0.1256  -0.0359 72  LYS C CA  
1282 C C   . LYS C 70 ? 2.0233 1.9564 1.7557 -0.1447 0.1339  -0.0280 72  LYS C C   
1283 O O   . LYS C 70 ? 2.0609 1.9804 1.7735 -0.1486 0.1304  -0.0255 72  LYS C O   
1284 C CB  . LYS C 70 ? 2.0074 1.9327 1.7541 -0.1427 0.1158  -0.0319 72  LYS C CB  
1285 C CG  . LYS C 70 ? 2.0612 1.9572 1.7807 -0.1448 0.1074  -0.0284 72  LYS C CG  
1286 C CD  . LYS C 70 ? 2.0540 1.9299 1.7667 -0.1466 0.0987  -0.0275 72  LYS C CD  
1287 C CE  . LYS C 70 ? 2.0798 1.9107 1.7507 -0.1468 0.0945  -0.0228 72  LYS C CE  
1288 N NZ  . LYS C 70 ? 2.0402 1.8361 1.6888 -0.1457 0.0884  -0.0229 72  LYS C NZ  
1289 N N   . GLU C 71 ? 2.0065 1.9603 1.7569 -0.1438 0.1466  -0.0212 73  GLU C N   
1290 C CA  . GLU C 71 ? 2.0215 1.9851 1.7692 -0.1473 0.1583  -0.0101 73  GLU C CA  
1291 C C   . GLU C 71 ? 2.0103 1.9548 1.7272 -0.1405 0.1687  -0.0178 73  GLU C C   
1292 O O   . GLU C 71 ? 2.0404 1.9840 1.7456 -0.1443 0.1747  -0.0110 73  GLU C O   
1293 C CB  . GLU C 71 ? 2.0249 2.0236 1.8032 -0.1433 0.1729  0.0060  73  GLU C CB  
1294 C CG  . GLU C 71 ? 2.0290 2.0523 1.8373 -0.1566 0.1601  0.0194  73  GLU C CG  
1295 C CD  . GLU C 71 ? 2.0177 2.0901 1.8615 -0.1565 0.1731  0.0460  73  GLU C CD  
1296 O OE1 . GLU C 71 ? 1.9534 2.0513 1.8206 -0.1747 0.1595  0.0631  73  GLU C OE1 
1297 O OE2 . GLU C 71 ? 1.8883 1.9731 1.7338 -0.1384 0.1973  0.0528  73  GLU C OE2 
1298 N N   . ALA C 72 ? 1.9569 1.8838 1.6567 -0.1336 0.1693  -0.0307 74  ALA C N   
1299 C CA  . ALA C 72 ? 1.9128 1.8135 1.5727 -0.1341 0.1736  -0.0377 74  ALA C CA  
1300 C C   . ALA C 72 ? 1.8553 1.7486 1.5014 -0.1433 0.1548  -0.0393 74  ALA C C   
1301 O O   . ALA C 72 ? 1.7970 1.6895 1.4351 -0.1482 0.1530  -0.0332 74  ALA C O   
1302 C CB  . ALA C 72 ? 1.8913 1.7697 1.5290 -0.1281 0.1806  -0.0477 74  ALA C CB  
1303 N N   . GLY D 1  ? 0.7693 0.9641 0.9227 -0.0242 -0.1357 0.0286  139 GLY D N   
1304 C CA  . GLY D 1  ? 0.8036 0.9922 0.9660 -0.0227 -0.1382 0.0281  139 GLY D CA  
1305 C C   . GLY D 1  ? 0.6984 0.8784 0.8612 -0.0147 -0.1301 0.0156  139 GLY D C   
1306 O O   . GLY D 1  ? 0.6399 0.8029 0.8062 -0.0099 -0.1273 0.0100  139 GLY D O   
1307 N N   . SER D 2  ? 0.5333 0.7264 0.6931 -0.0139 -0.1268 0.0114  140 SER D N   
1308 C CA  . SER D 2  ? 0.4674 0.6547 0.6255 -0.0071 -0.1193 -0.0002 140 SER D CA  
1309 C C   . SER D 2  ? 0.5081 0.6749 0.6719 -0.0030 -0.1177 -0.0049 140 SER D C   
1310 O O   . SER D 2  ? 0.4865 0.6450 0.6475 0.0012  -0.1121 -0.0126 140 SER D O   
1311 C CB  . SER D 2  ? 0.4672 0.6701 0.6253 -0.0065 -0.1178 -0.0036 140 SER D CB  
1312 O OG  . SER D 2  ? 0.3651 0.5645 0.5204 -0.0007 -0.1117 -0.0144 140 SER D OG  
1313 N N   . ALA D 3  ? 0.6429 0.8029 0.8151 -0.0045 -0.1234 -0.0007 141 ALA D N   
1314 C CA  . ALA D 3  ? 0.6510 0.7954 0.8300 -0.0008 -0.1230 -0.0071 141 ALA D CA  
1315 C C   . ALA D 3  ? 0.6147 0.7492 0.7937 0.0013  -0.1204 -0.0105 141 ALA D C   
1316 O O   . ALA D 3  ? 0.5657 0.6933 0.7446 0.0046  -0.1154 -0.0188 141 ALA D O   
1317 C CB  . ALA D 3  ? 0.6394 0.7792 0.8291 -0.0027 -0.1321 -0.0025 141 ALA D CB  
1318 N N   . ARG D 4  ? 0.6478 0.7829 0.8268 -0.0013 -0.1241 -0.0036 142 ARG D N   
1319 C CA  . ARG D 4  ? 0.6483 0.7763 0.8268 0.0005  -0.1213 -0.0060 142 ARG D CA  
1320 C C   . ARG D 4  ? 0.6191 0.7479 0.7876 0.0032  -0.1124 -0.0128 142 ARG D C   
1321 O O   . ARG D 4  ? 0.5873 0.7087 0.7569 0.0060  -0.1081 -0.0200 142 ARG D O   
1322 C CB  . ARG D 4  ? 0.6673 0.7985 0.8450 -0.0033 -0.1262 0.0033  142 ARG D CB  
1323 C CG  . ARG D 4  ? 0.8004 0.9249 0.9778 -0.0012 -0.1231 0.0012  142 ARG D CG  
1324 C CD  . ARG D 4  ? 0.9280 1.0510 1.1116 -0.0044 -0.1312 0.0100  142 ARG D CD  
1325 N NE  . ARG D 4  ? 1.0748 1.2093 1.2511 -0.0107 -0.1352 0.0200  142 ARG D NE  
1326 C CZ  . ARG D 4  ? 1.1941 1.3296 1.3729 -0.0155 -0.1428 0.0297  142 ARG D CZ  
1327 N NH1 . ARG D 4  ? 1.2217 1.3459 1.4115 -0.0136 -0.1473 0.0301  142 ARG D NH1 
1328 N NH2 . ARG D 4  ? 1.2739 1.4234 1.4448 -0.0226 -0.1464 0.0388  142 ARG D NH2 
1329 N N   . GLU D 5  ? 0.5758 0.7149 0.7355 0.0019  -0.1108 -0.0109 143 GLU D N   
1330 C CA  . GLU D 5  ? 0.5744 0.7130 0.7260 0.0048  -0.1045 -0.0178 143 GLU D CA  
1331 C C   . GLU D 5  ? 0.5484 0.6818 0.7013 0.0073  -0.1014 -0.0250 143 GLU D C   
1332 O O   . GLU D 5  ? 0.6229 0.7485 0.7735 0.0091  -0.0975 -0.0303 143 GLU D O   
1333 C CB  . GLU D 5  ? 0.5971 0.7501 0.7404 0.0038  -0.1044 -0.0175 143 GLU D CB  
1334 C CG  . GLU D 5  ? 0.6802 0.8501 0.8243 0.0006  -0.1083 -0.0135 143 GLU D CG  
1335 C CD  . GLU D 5  ? 0.7973 0.9782 0.9403 -0.0053 -0.1136 -0.0038 143 GLU D CD  
1336 O OE1 . GLU D 5  ? 0.6139 0.8149 0.7527 -0.0085 -0.1154 -0.0024 143 GLU D OE1 
1337 O OE2 . GLU D 5  ? 0.9892 1.1603 1.1363 -0.0071 -0.1166 0.0023  143 GLU D OE2 
1338 N N   . ASN D 6  ? 0.4992 0.6371 0.6557 0.0070  -0.1032 -0.0249 144 ASN D N   
1339 C CA  . ASN D 6  ? 0.5642 0.6977 0.7209 0.0091  -0.1001 -0.0318 144 ASN D CA  
1340 C C   . ASN D 6  ? 0.5610 0.6830 0.7208 0.0095  -0.0981 -0.0361 144 ASN D C   
1341 O O   . ASN D 6  ? 0.5914 0.7092 0.7479 0.0101  -0.0947 -0.0415 144 ASN D O   
1342 C CB  . ASN D 6  ? 0.6193 0.7590 0.7803 0.0087  -0.1023 -0.0309 144 ASN D CB  
1343 C CG  . ASN D 6  ? 0.7517 0.9073 0.9105 0.0074  -0.1042 -0.0271 144 ASN D CG  
1344 O OD1 . ASN D 6  ? 0.7304 0.8934 0.8839 0.0074  -0.1035 -0.0273 144 ASN D OD1 
1345 N ND2 . ASN D 6  ? 0.8321 0.9951 0.9953 0.0061  -0.1068 -0.0243 144 ASN D ND2 
1346 N N   . GLU D 7  ? 0.5870 0.7057 0.7538 0.0088  -0.1010 -0.0339 145 GLU D N   
1347 C CA  . GLU D 7  ? 0.5808 0.6933 0.7523 0.0091  -0.0996 -0.0390 145 GLU D CA  
1348 C C   . GLU D 7  ? 0.5521 0.6615 0.7175 0.0092  -0.0954 -0.0396 145 GLU D C   
1349 O O   . GLU D 7  ? 0.5086 0.6151 0.6723 0.0086  -0.0920 -0.0445 145 GLU D O   
1350 C CB  . GLU D 7  ? 0.5446 0.6559 0.7279 0.0092  -0.1054 -0.0378 145 GLU D CB  
1351 C CG  . GLU D 7  ? 0.5707 0.6811 0.7627 0.0097  -0.1057 -0.0465 145 GLU D CG  
1352 C CD  . GLU D 7  ? 0.7096 0.8195 0.9156 0.0108  -0.1124 -0.0470 145 GLU D CD  
1353 O OE1 . GLU D 7  ? 0.4529 0.5611 0.6624 0.0105  -0.1184 -0.0396 145 GLU D OE1 
1354 O OE2 . GLU D 7  ? 0.4609 0.5735 0.6753 0.0115  -0.1125 -0.0552 145 GLU D OE2 
1355 N N   . MET D 8  ? 0.5456 0.6566 0.7072 0.0093  -0.0960 -0.0345 146 MET D N   
1356 C CA  . MET D 8  ? 0.5844 0.6924 0.7396 0.0099  -0.0923 -0.0355 146 MET D CA  
1357 C C   . MET D 8  ? 0.5244 0.6304 0.6721 0.0101  -0.0894 -0.0399 146 MET D C   
1358 O O   . MET D 8  ? 0.4886 0.5894 0.6341 0.0095  -0.0867 -0.0429 146 MET D O   
1359 C CB  . MET D 8  ? 0.6082 0.7205 0.7590 0.0098  -0.0936 -0.0302 146 MET D CB  
1360 C CG  . MET D 8  ? 0.6122 0.7208 0.7580 0.0107  -0.0903 -0.0311 146 MET D CG  
1361 S SD  . MET D 8  ? 1.1093 1.2242 1.2517 0.0098  -0.0928 -0.0245 146 MET D SD  
1362 C CE  . MET D 8  ? 1.0581 1.1689 1.2131 0.0092  -0.0960 -0.0203 146 MET D CE  
1363 N N   . ASP D 9  ? 0.5226 0.6335 0.6674 0.0107  -0.0908 -0.0402 147 ASP D N   
1364 C CA  . ASP D 9  ? 0.5878 0.6969 0.7268 0.0116  -0.0900 -0.0444 147 ASP D CA  
1365 C C   . ASP D 9  ? 0.5687 0.6718 0.7092 0.0098  -0.0887 -0.0480 147 ASP D C   
1366 O O   . ASP D 9  ? 0.5380 0.6354 0.6744 0.0089  -0.0884 -0.0506 147 ASP D O   
1367 C CB  . ASP D 9  ? 0.6634 0.7827 0.8014 0.0131  -0.0924 -0.0450 147 ASP D CB  
1368 C CG  . ASP D 9  ? 0.8313 0.9611 0.9669 0.0133  -0.0942 -0.0416 147 ASP D CG  
1369 O OD1 . ASP D 9  ? 1.0427 1.1696 1.1758 0.0128  -0.0933 -0.0394 147 ASP D OD1 
1370 O OD2 . ASP D 9  ? 0.9647 1.1075 1.1011 0.0133  -0.0964 -0.0412 147 ASP D OD2 
1371 N N   . GLU D 10 ? 0.5899 0.6945 0.7365 0.0088  -0.0888 -0.0482 148 GLU D N   
1372 C CA  . GLU D 10 ? 0.6695 0.7713 0.8167 0.0063  -0.0876 -0.0524 148 GLU D CA  
1373 C C   . GLU D 10 ? 0.6223 0.7217 0.7710 0.0034  -0.0858 -0.0537 148 GLU D C   
1374 O O   . GLU D 10 ? 0.6015 0.6999 0.7484 -0.0003 -0.0849 -0.0565 148 GLU D O   
1375 C CB  . GLU D 10 ? 0.6724 0.7783 0.8250 0.0064  -0.0886 -0.0543 148 GLU D CB  
1376 C CG  . GLU D 10 ? 0.9076 1.0157 1.0688 0.0062  -0.0901 -0.0550 148 GLU D CG  
1377 C CD  . GLU D 10 ? 1.1552 1.2667 1.3216 0.0074  -0.0927 -0.0560 148 GLU D CD  
1378 O OE1 . GLU D 10 ? 1.3167 1.4299 1.4891 0.0067  -0.0939 -0.0612 148 GLU D OE1 
1379 O OE2 . GLU D 10 ? 1.1420 1.2561 1.3069 0.0090  -0.0940 -0.0520 148 GLU D OE2 
1380 N N   . ASN D 11 ? 0.5559 0.6561 0.7082 0.0047  -0.0856 -0.0515 149 ASN D N   
1381 C CA  . ASN D 11 ? 0.5340 0.6344 0.6888 0.0025  -0.0836 -0.0532 149 ASN D CA  
1382 C C   . ASN D 11 ? 0.4971 0.5921 0.6434 0.0010  -0.0819 -0.0521 149 ASN D C   
1383 O O   . ASN D 11 ? 0.4886 0.5836 0.6337 -0.0033 -0.0807 -0.0538 149 ASN D O   
1384 C CB  . ASN D 11 ? 0.5440 0.6467 0.7063 0.0048  -0.0843 -0.0514 149 ASN D CB  
1385 C CG  . ASN D 11 ? 0.6363 0.7437 0.8097 0.0058  -0.0880 -0.0535 149 ASN D CG  
1386 O OD1 . ASN D 11 ? 0.4413 0.5499 0.6230 0.0076  -0.0907 -0.0522 149 ASN D OD1 
1387 N ND2 . ASN D 11 ? 1.0409 1.1504 1.2149 0.0046  -0.0890 -0.0571 149 ASN D ND2 
1388 N N   . LEU D 12 ? 0.4848 0.5763 0.6255 0.0040  -0.0827 -0.0496 150 LEU D N   
1389 C CA  . LEU D 12 ? 0.4703 0.5556 0.6037 0.0035  -0.0827 -0.0496 150 LEU D CA  
1390 C C   . LEU D 12 ? 0.5763 0.6574 0.7060 0.0004  -0.0850 -0.0514 150 LEU D C   
1391 O O   . LEU D 12 ? 0.5376 0.6138 0.6641 -0.0034 -0.0856 -0.0513 150 LEU D O   
1392 C CB  . LEU D 12 ? 0.3968 0.4822 0.5256 0.0076  -0.0842 -0.0488 150 LEU D CB  
1393 C CG  . LEU D 12 ? 0.2835 0.3733 0.4150 0.0096  -0.0828 -0.0458 150 LEU D CG  
1394 C CD1 . LEU D 12 ? 0.6821 0.7779 0.8107 0.0121  -0.0853 -0.0448 150 LEU D CD1 
1395 C CD2 . LEU D 12 ? 0.4722 0.5584 0.6017 0.0097  -0.0800 -0.0454 150 LEU D CD2 
1396 N N   . GLU D 13 ? 0.5596 0.6429 0.6903 0.0015  -0.0869 -0.0526 151 GLU D N   
1397 C CA  . GLU D 13 ? 0.5534 0.6328 0.6816 -0.0016 -0.0895 -0.0542 151 GLU D CA  
1398 C C   . GLU D 13 ? 0.4434 0.5239 0.5725 -0.0082 -0.0878 -0.0540 151 GLU D C   
1399 O O   . GLU D 13 ? 0.4063 0.4821 0.5317 -0.0130 -0.0896 -0.0529 151 GLU D O   
1400 C CB  . GLU D 13 ? 0.5990 0.6827 0.7297 0.0002  -0.0905 -0.0560 151 GLU D CB  
1401 C CG  . GLU D 13 ? 1.0197 1.1077 1.1507 0.0063  -0.0926 -0.0568 151 GLU D CG  
1402 C CD  . GLU D 13 ? 1.2095 1.3043 1.3440 0.0083  -0.0930 -0.0584 151 GLU D CD  
1403 O OE1 . GLU D 13 ? 1.4937 1.5893 1.6304 0.0060  -0.0912 -0.0589 151 GLU D OE1 
1404 O OE2 . GLU D 13 ? 1.3520 1.4530 1.4873 0.0122  -0.0952 -0.0599 151 GLU D OE2 
1405 N N   . GLN D 14 ? 0.4271 0.5154 0.5620 -0.0088 -0.0851 -0.0555 152 GLN D N   
1406 C CA  . GLN D 14 ? 0.5000 0.5942 0.6366 -0.0154 -0.0840 -0.0574 152 GLN D CA  
1407 C C   . GLN D 14 ? 0.4525 0.5455 0.5868 -0.0196 -0.0833 -0.0553 152 GLN D C   
1408 O O   . GLN D 14 ? 0.4612 0.5544 0.5917 -0.0270 -0.0850 -0.0543 152 GLN D O   
1409 C CB  . GLN D 14 ? 0.5624 0.6668 0.7079 -0.0142 -0.0823 -0.0613 152 GLN D CB  
1410 C CG  . GLN D 14 ? 0.6253 0.7402 0.7733 -0.0209 -0.0820 -0.0660 152 GLN D CG  
1411 C CD  . GLN D 14 ? 0.5874 0.7122 0.7455 -0.0183 -0.0822 -0.0719 152 GLN D CD  
1412 O OE1 . GLN D 14 ? 0.6309 0.7686 0.7954 -0.0221 -0.0819 -0.0775 152 GLN D OE1 
1413 N NE2 . GLN D 14 ? 0.3126 0.4330 0.4733 -0.0122 -0.0835 -0.0713 152 GLN D NE2 
1414 N N   . VAL D 15 ? 0.4504 0.5426 0.5867 -0.0155 -0.0812 -0.0542 153 VAL D N   
1415 C CA  . VAL D 15 ? 0.4692 0.5595 0.6032 -0.0180 -0.0801 -0.0521 153 VAL D CA  
1416 C C   . VAL D 15 ? 0.4680 0.5480 0.5936 -0.0218 -0.0842 -0.0492 153 VAL D C   
1417 O O   . VAL D 15 ? 0.3621 0.4434 0.4855 -0.0298 -0.0856 -0.0475 153 VAL D O   
1418 C CB  . VAL D 15 ? 0.4618 0.5485 0.5961 -0.0113 -0.0781 -0.0509 153 VAL D CB  
1419 C CG1 . VAL D 15 ? 0.5216 0.6044 0.6520 -0.0133 -0.0770 -0.0490 153 VAL D CG1 
1420 C CG2 . VAL D 15 ? 0.2582 0.3535 0.4020 -0.0081 -0.0757 -0.0527 153 VAL D CG2 
1421 N N   . SER D 16 ? 0.4334 0.5043 0.5552 -0.0163 -0.0871 -0.0490 154 SER D N   
1422 C CA  . SER D 16 ? 0.4617 0.5217 0.5777 -0.0177 -0.0929 -0.0478 154 SER D CA  
1423 C C   . SER D 16 ? 0.4447 0.5040 0.5591 -0.0266 -0.0967 -0.0459 154 SER D C   
1424 O O   . SER D 16 ? 0.4441 0.4967 0.5548 -0.0323 -0.1012 -0.0428 154 SER D O   
1425 C CB  . SER D 16 ? 0.4718 0.5276 0.5869 -0.0108 -0.0965 -0.0504 154 SER D CB  
1426 O OG  . SER D 16 ? 0.7493 0.7947 0.8607 -0.0104 -0.1032 -0.0510 154 SER D OG  
1427 N N   . GLY D 17 ? 0.4880 0.5545 0.6051 -0.0282 -0.0953 -0.0476 155 GLY D N   
1428 C CA  . GLY D 17 ? 0.5523 0.6217 0.6676 -0.0376 -0.0980 -0.0462 155 GLY D CA  
1429 C C   . GLY D 17 ? 0.4990 0.5749 0.6135 -0.0465 -0.0970 -0.0433 155 GLY D C   
1430 O O   . GLY D 17 ? 0.5031 0.5730 0.6131 -0.0541 -0.1025 -0.0387 155 GLY D O   
1431 N N   . ILE D 18 ? 0.4100 0.4990 0.5300 -0.0457 -0.0908 -0.0462 156 ILE D N   
1432 C CA  . ILE D 18 ? 0.4064 0.5084 0.5280 -0.0548 -0.0892 -0.0452 156 ILE D CA  
1433 C C   . ILE D 18 ? 0.3907 0.4847 0.5083 -0.0575 -0.0911 -0.0400 156 ILE D C   
1434 O O   . ILE D 18 ? 0.2943 0.3960 0.4104 -0.0680 -0.0926 -0.0366 156 ILE D O   
1435 C CB  . ILE D 18 ? 0.3990 0.5168 0.5299 -0.0514 -0.0830 -0.0507 156 ILE D CB  
1436 C CG1 . ILE D 18 ? 0.5707 0.6953 0.7068 -0.0476 -0.0819 -0.0566 156 ILE D CG1 
1437 C CG2 . ILE D 18 ? 0.1625 0.2989 0.2966 -0.0615 -0.0816 -0.0514 156 ILE D CG2 
1438 C CD1 . ILE D 18 ? 0.7092 0.8533 0.8564 -0.0475 -0.0786 -0.0636 156 ILE D CD1 
1439 N N   . ILE D 19 ? 0.3785 0.4585 0.4942 -0.0484 -0.0915 -0.0397 157 ILE D N   
1440 C CA  . ILE D 19 ? 0.3854 0.4565 0.4972 -0.0493 -0.0935 -0.0362 157 ILE D CA  
1441 C C   . ILE D 19 ? 0.4068 0.4666 0.5126 -0.0570 -0.1030 -0.0313 157 ILE D C   
1442 O O   . ILE D 19 ? 0.3559 0.4135 0.4588 -0.0650 -0.1066 -0.0263 157 ILE D O   
1443 C CB  . ILE D 19 ? 0.3504 0.4122 0.4617 -0.0375 -0.0914 -0.0387 157 ILE D CB  
1444 C CG1 . ILE D 19 ? 0.3224 0.3958 0.4398 -0.0334 -0.0831 -0.0412 157 ILE D CG1 
1445 C CG2 . ILE D 19 ? 0.3397 0.3885 0.4456 -0.0371 -0.0956 -0.0365 157 ILE D CG2 
1446 C CD1 . ILE D 19 ? 0.5103 0.5975 0.6353 -0.0332 -0.0796 -0.0446 157 ILE D CD1 
1447 N N   . GLY D 20 ? 0.4805 0.5334 0.5852 -0.0553 -0.1078 -0.0323 158 GLY D N   
1448 C CA  . GLY D 20 ? 0.5701 0.6152 0.6709 -0.0645 -0.1174 -0.0275 158 GLY D CA  
1449 C C   . GLY D 20 ? 0.5500 0.6078 0.6494 -0.0789 -0.1174 -0.0222 158 GLY D C   
1450 O O   . GLY D 20 ? 0.5073 0.5596 0.6034 -0.0868 -0.1233 -0.0161 158 GLY D O   
1451 N N   . ASN D 21 ? 0.4863 0.5630 0.5887 -0.0825 -0.1112 -0.0252 159 ASN D N   
1452 C CA  . ASN D 21 ? 0.5106 0.6045 0.6119 -0.0975 -0.1121 -0.0217 159 ASN D CA  
1453 C C   . ASN D 21 ? 0.4585 0.5579 0.5599 -0.1030 -0.1112 -0.0177 159 ASN D C   
1454 O O   . ASN D 21 ? 0.4308 0.5328 0.5282 -0.1165 -0.1174 -0.0102 159 ASN D O   
1455 C CB  . ASN D 21 ? 0.5192 0.6355 0.6258 -0.0977 -0.1047 -0.0290 159 ASN D CB  
1456 C CG  . ASN D 21 ? 0.6985 0.8097 0.8046 -0.0925 -0.1055 -0.0329 159 ASN D CG  
1457 O OD1 . ASN D 21 ? 0.6510 0.7639 0.7621 -0.0818 -0.1000 -0.0395 159 ASN D OD1 
1458 N ND2 . ASN D 21 ? 0.8661 0.9705 0.9664 -0.1005 -0.1130 -0.0283 159 ASN D ND2 
1459 N N   . LEU D 22 ? 0.4544 0.5557 0.5606 -0.0929 -0.1037 -0.0222 160 LEU D N   
1460 C CA  . LEU D 22 ? 0.4874 0.5967 0.5952 -0.0966 -0.1007 -0.0199 160 LEU D CA  
1461 C C   . LEU D 22 ? 0.5394 0.6292 0.6404 -0.1006 -0.1093 -0.0120 160 LEU D C   
1462 O O   . LEU D 22 ? 0.5015 0.5988 0.6013 -0.1109 -0.1110 -0.0064 160 LEU D O   
1463 C CB  . LEU D 22 ? 0.4353 0.5473 0.5496 -0.0837 -0.0918 -0.0263 160 LEU D CB  
1464 C CG  . LEU D 22 ? 0.4038 0.5350 0.5267 -0.0805 -0.0855 -0.0342 160 LEU D CG  
1465 C CD1 . LEU D 22 ? 0.6079 0.7306 0.7349 -0.0655 -0.0810 -0.0393 160 LEU D CD1 
1466 C CD2 . LEU D 22 ? 0.2820 0.4413 0.4129 -0.0879 -0.0809 -0.0371 160 LEU D CD2 
1467 N N   . ARG D 23 ? 0.5664 0.6536 0.4273 -0.0173 -0.0268 0.0443  161 ARG D N   
1468 C CA  . ARG D 23 ? 0.5569 0.6084 0.3982 -0.0264 -0.0364 0.0318  161 ARG D CA  
1469 C C   . ARG D 23 ? 0.5042 0.5617 0.3374 -0.0393 -0.0422 0.0410  161 ARG D C   
1470 O O   . ARG D 23 ? 0.5617 0.6082 0.3941 -0.0324 -0.0399 0.0359  161 ARG D O   
1471 C CB  . ARG D 23 ? 0.5934 0.6214 0.4134 -0.0380 -0.0450 0.0273  161 ARG D CB  
1472 C CG  . ARG D 23 ? 0.5944 0.5741 0.3793 -0.0390 -0.0506 0.0170  161 ARG D CG  
1473 C CD  . ARG D 23 ? 0.8540 0.7962 0.6047 -0.0432 -0.0550 0.0124  161 ARG D CD  
1474 N NE  . ARG D 23 ? 1.1916 1.1247 0.9142 -0.0743 -0.0652 0.0232  161 ARG D NE  
1475 C CZ  . ARG D 23 ? 1.2362 1.2003 0.9721 -0.0886 -0.0681 0.0329  161 ARG D CZ  
1476 N NH1 . ARG D 23 ? 1.1429 1.1424 0.9182 -0.0713 -0.0601 0.0319  161 ARG D NH1 
1477 N NH2 . ARG D 23 ? 1.3575 1.3166 1.0615 -0.1238 -0.0797 0.0453  161 ARG D NH2 
1478 N N   . HIS D 24 ? 0.4880 0.5670 0.3138 -0.0616 -0.0506 0.0564  162 HIS D N   
1479 C CA  . HIS D 24 ? 0.5711 0.6549 0.3820 -0.0815 -0.0589 0.0664  162 HIS D CA  
1480 C C   . HIS D 24 ? 0.5396 0.6446 0.3720 -0.0634 -0.0494 0.0699  162 HIS D C   
1481 O O   . HIS D 24 ? 0.4669 0.5488 0.2870 -0.0661 -0.0525 0.0639  162 HIS D O   
1482 C CB  . HIS D 24 ? 0.6334 0.7638 0.4415 -0.1105 -0.0678 0.0903  162 HIS D CB  
1483 C CG  . HIS D 24 ? 0.7308 0.8325 0.5079 -0.1340 -0.0781 0.0873  162 HIS D CG  
1484 N ND1 . HIS D 24 ? 0.9039 0.9346 0.6252 -0.1549 -0.0884 0.0759  162 HIS D ND1 
1485 C CD2 . HIS D 24 ? 0.7959 0.9225 0.5822 -0.1382 -0.0783 0.0945  162 HIS D CD2 
1486 C CE1 . HIS D 24 ? 0.8249 0.8339 0.5188 -0.1722 -0.0945 0.0758  162 HIS D CE1 
1487 N NE2 . HIS D 24 ? 0.8361 0.9068 0.5731 -0.1640 -0.0896 0.0867  162 HIS D NE2 
1488 N N   . MET D 25 ? 0.5326 0.6756 0.3906 -0.0425 -0.0363 0.0802  163 MET D N   
1489 C CA  . MET D 25 ? 0.5414 0.6981 0.4092 -0.0233 -0.0249 0.0863  163 MET D CA  
1490 C C   . MET D 25 ? 0.5244 0.6313 0.3820 -0.0171 -0.0244 0.0642  163 MET D C   
1491 O O   . MET D 25 ? 0.6130 0.7160 0.4664 -0.0202 -0.0266 0.0650  163 MET D O   
1492 C CB  . MET D 25 ? 0.5935 0.7709 0.4716 0.0058  -0.0064 0.0964  163 MET D CB  
1493 C CG  . MET D 25 ? 0.6750 0.9209 0.5651 0.0142  0.0006  0.1289  163 MET D CG  
1494 S SD  . MET D 25 ? 0.8757 1.1435 0.7662 0.0540  0.0246  0.1456  163 MET D SD  
1495 C CE  . MET D 25 ? 0.8264 1.1331 0.7314 0.0299  0.0111  0.1535  163 MET D CE  
1496 N N   . ALA D 26 ? 0.4855 0.5615 0.3394 -0.0095 -0.0221 0.0470  164 ALA D N   
1497 C CA  . ALA D 26 ? 0.4640 0.5069 0.3092 -0.0056 -0.0227 0.0301  164 ALA D CA  
1498 C C   . ALA D 26 ? 0.5369 0.5645 0.3685 -0.0176 -0.0335 0.0275  164 ALA D C   
1499 O O   . ALA D 26 ? 0.6627 0.6867 0.4926 -0.0161 -0.0327 0.0274  164 ALA D O   
1500 C CB  . ALA D 26 ? 0.3338 0.3610 0.1763 -0.0024 -0.0230 0.0177  164 ALA D CB  
1501 N N   . LEU D 27 ? 0.5805 0.5909 0.3940 -0.0292 -0.0427 0.0256  165 LEU D N   
1502 C CA  . LEU D 27 ? 0.6729 0.6475 0.4551 -0.0371 -0.0506 0.0212  165 LEU D CA  
1503 C C   . LEU D 27 ? 0.7569 0.7418 0.5377 -0.0486 -0.0538 0.0302  165 LEU D C   
1504 O O   . LEU D 27 ? 0.8580 0.8194 0.6241 -0.0454 -0.0550 0.0246  165 LEU D O   
1505 C CB  . LEU D 27 ? 0.7191 0.6620 0.4646 -0.0533 -0.0591 0.0221  165 LEU D CB  
1506 C CG  . LEU D 27 ? 0.6904 0.6134 0.4270 -0.0398 -0.0561 0.0130  165 LEU D CG  
1507 C CD1 . LEU D 27 ? 0.7385 0.6925 0.4968 -0.0474 -0.0560 0.0192  165 LEU D CD1 
1508 C CD2 . LEU D 27 ? 0.7756 0.6341 0.4511 -0.0433 -0.0605 0.0090  165 LEU D CD2 
1509 N N   . ASP D 28 ? 0.7745 0.8010 0.5710 -0.0603 -0.0546 0.0468  166 ASP D N   
1510 C CA  . ASP D 28 ? 0.8691 0.9185 0.6646 -0.0746 -0.0588 0.0609  166 ASP D CA  
1511 C C   . ASP D 28 ? 0.8222 0.8749 0.6346 -0.0541 -0.0494 0.0565  166 ASP D C   
1512 O O   . ASP D 28 ? 0.9034 0.9370 0.7018 -0.0597 -0.0536 0.0533  166 ASP D O   
1513 C CB  . ASP D 28 ? 0.8909 1.0032 0.7046 -0.0857 -0.0591 0.0853  166 ASP D CB  
1514 C CG  . ASP D 28 ? 0.9370 1.0465 0.7273 -0.1155 -0.0716 0.0918  166 ASP D CG  
1515 O OD1 . ASP D 28 ? 0.9453 1.0056 0.6913 -0.1405 -0.0835 0.0855  166 ASP D OD1 
1516 O OD2 . ASP D 28 ? 1.1129 1.2621 0.9212 -0.1142 -0.0688 0.1031  166 ASP D OD2 
1517 N N   . MET D 29 ? 0.7119 0.7810 0.5460 -0.0319 -0.0362 0.0564  167 MET D N   
1518 C CA  . MET D 29 ? 0.7734 0.8335 0.6119 -0.0152 -0.0264 0.0512  167 MET D CA  
1519 C C   . MET D 29 ? 0.8693 0.8938 0.6944 -0.0181 -0.0326 0.0352  167 MET D C   
1520 O O   . MET D 29 ? 0.9501 0.9708 0.7709 -0.0205 -0.0343 0.0364  167 MET D O   
1521 C CB  . MET D 29 ? 0.7515 0.8031 0.5927 0.0031  -0.0133 0.0459  167 MET D CB  
1522 C CG  . MET D 29 ? 0.8214 0.9020 0.6684 0.0171  -0.0013 0.0634  167 MET D CG  
1523 S SD  . MET D 29 ? 1.1055 1.1563 0.9389 0.0338  0.0129  0.0546  167 MET D SD  
1524 C CE  . MET D 29 ? 0.6490 0.6518 0.4600 0.0310  0.0151  0.0362  167 MET D CE  
1525 N N   . GLY D 30 ? 0.8571 0.8608 0.6753 -0.0153 -0.0348 0.0228  168 GLY D N   
1526 C CA  . GLY D 30 ? 0.8948 0.8746 0.6995 -0.0106 -0.0378 0.0119  168 GLY D CA  
1527 C C   . GLY D 30 ? 0.9148 0.8761 0.6994 -0.0187 -0.0448 0.0141  168 GLY D C   
1528 O O   . GLY D 30 ? 0.9351 0.8973 0.7223 -0.0161 -0.0433 0.0136  168 GLY D O   
1529 N N   . ASN D 31 ? 0.9685 0.9067 0.7257 -0.0313 -0.0525 0.0165  169 ASN D N   
1530 C CA  . ASN D 31 ? 1.0798 0.9850 0.8010 -0.0439 -0.0597 0.0185  169 ASN D CA  
1531 C C   . ASN D 31 ? 1.1224 1.0541 0.8601 -0.0536 -0.0608 0.0272  169 ASN D C   
1532 O O   . ASN D 31 ? 1.1403 1.0521 0.8630 -0.0523 -0.0621 0.0244  169 ASN D O   
1533 C CB  . ASN D 31 ? 1.0911 0.9656 0.7711 -0.0675 -0.0688 0.0234  169 ASN D CB  
1534 C CG  . ASN D 31 ? 1.2733 1.1148 0.9304 -0.0543 -0.0660 0.0152  169 ASN D CG  
1535 O OD1 . ASN D 31 ? 1.5506 1.4007 1.2260 -0.0271 -0.0578 0.0076  169 ASN D OD1 
1536 N ND2 . ASN D 31 ? 1.3861 1.1923 0.9999 -0.0755 -0.0730 0.0186  169 ASN D ND2 
1537 N N   . GLU D 32 ? 1.0756 1.0541 0.8424 -0.0594 -0.0586 0.0397  170 GLU D N   
1538 C CA  . GLU D 32 ? 1.1270 1.1398 0.9094 -0.0638 -0.0572 0.0528  170 GLU D CA  
1539 C C   . GLU D 32 ? 1.0339 1.0461 0.8322 -0.0430 -0.0474 0.0459  170 GLU D C   
1540 O O   . GLU D 32 ? 1.0796 1.0939 0.8758 -0.0459 -0.0484 0.0496  170 GLU D O   
1541 C CB  . GLU D 32 ? 1.1597 1.2293 0.9671 -0.0643 -0.0525 0.0723  170 GLU D CB  
1542 C CG  . GLU D 32 ? 1.2231 1.3327 1.0473 -0.0563 -0.0455 0.0882  170 GLU D CG  
1543 C CD  . GLU D 32 ? 1.4511 1.6291 1.2906 -0.0613 -0.0438 0.1167  170 GLU D CD  
1544 O OE1 . GLU D 32 ? 1.6724 1.8691 1.5175 -0.0629 -0.0435 0.1226  170 GLU D OE1 
1545 O OE2 . GLU D 32 ? 1.6521 1.8718 1.4987 -0.0627 -0.0423 0.1358  170 GLU D OE2 
1546 N N   . ILE D 33 ? 0.9442 0.9521 0.7539 -0.0256 -0.0385 0.0368  171 ILE D N   
1547 C CA  . ILE D 33 ? 0.8973 0.8980 0.7113 -0.0129 -0.0304 0.0306  171 ILE D CA  
1548 C C   . ILE D 33 ? 0.9138 0.8917 0.7148 -0.0150 -0.0366 0.0213  171 ILE D C   
1549 O O   . ILE D 33 ? 0.9132 0.8905 0.7135 -0.0150 -0.0358 0.0229  171 ILE D O   
1550 C CB  . ILE D 33 ? 0.8684 0.8629 0.6848 -0.0031 -0.0222 0.0231  171 ILE D CB  
1551 C CG1 . ILE D 33 ? 0.8206 0.8293 0.6407 0.0066  -0.0103 0.0347  171 ILE D CG1 
1552 C CG2 . ILE D 33 ? 0.6418 0.6210 0.4505 -0.0010 -0.0194 0.0138  171 ILE D CG2 
1553 C CD1 . ILE D 33 ? 0.7635 0.7526 0.5719 0.0142  -0.0003 0.0284  171 ILE D CD1 
1554 N N   . ASP D 34 ? 0.9790 0.9387 0.7669 -0.0131 -0.0413 0.0134  172 ASP D N   
1555 C CA  . ASP D 34 ? 1.0765 1.0140 0.8448 -0.0080 -0.0447 0.0083  172 ASP D CA  
1556 C C   . ASP D 34 ? 1.1143 1.0416 0.8708 -0.0190 -0.0494 0.0134  172 ASP D C   
1557 O O   . ASP D 34 ? 1.2263 1.1504 0.9819 -0.0143 -0.0483 0.0114  172 ASP D O   
1558 C CB  . ASP D 34 ? 1.1651 1.0738 0.9043 -0.0024 -0.0478 0.0051  172 ASP D CB  
1559 C CG  . ASP D 34 ? 1.3031 1.2275 1.0537 0.0104  -0.0434 0.0016  172 ASP D CG  
1560 O OD1 . ASP D 34 ? 1.2629 1.2160 1.0364 0.0137  -0.0392 0.0003  172 ASP D OD1 
1561 O OD2 . ASP D 34 ? 1.4388 1.3443 1.1699 0.0144  -0.0444 0.0009  172 ASP D OD2 
1562 N N   . THR D 35 ? 1.1051 1.0312 0.8510 -0.0369 -0.0556 0.0218  173 THR D N   
1563 C CA  . THR D 35 ? 1.1220 1.0457 0.8545 -0.0539 -0.0618 0.0300  173 THR D CA  
1564 C C   . THR D 35 ? 1.0654 1.0181 0.8264 -0.0451 -0.0551 0.0332  173 THR D C   
1565 O O   . THR D 35 ? 1.1417 1.0803 0.8938 -0.0439 -0.0562 0.0302  173 THR D O   
1566 C CB  . THR D 35 ? 1.1592 1.1021 0.8846 -0.0805 -0.0697 0.0449  173 THR D CB  
1567 O OG1 . THR D 35 ? 1.1613 1.0743 0.8596 -0.0874 -0.0740 0.0407  173 THR D OG1 
1568 C CG2 . THR D 35 ? 1.1787 1.1131 0.8760 -0.1072 -0.0798 0.0546  173 THR D CG2 
1569 N N   . GLN D 36 ? 0.9999 0.9864 0.7880 -0.0368 -0.0465 0.0397  174 GLN D N   
1570 C CA  . GLN D 36 ? 0.9552 0.9573 0.7569 -0.0260 -0.0374 0.0443  174 GLN D CA  
1571 C C   . GLN D 36 ? 0.8981 0.8759 0.6954 -0.0168 -0.0342 0.0305  174 GLN D C   
1572 O O   . GLN D 36 ? 0.8984 0.8744 0.6944 -0.0156 -0.0325 0.0317  174 GLN D O   
1573 C CB  . GLN D 36 ? 0.9548 0.9803 0.7698 -0.0120 -0.0246 0.0535  174 GLN D CB  
1574 C CG  . GLN D 36 ? 0.9158 0.9841 0.7398 -0.0188 -0.0264 0.0736  174 GLN D CG  
1575 C CD  . GLN D 36 ? 0.8941 0.9934 0.7264 0.0040  -0.0096 0.0911  174 GLN D CD  
1576 O OE1 . GLN D 36 ? 0.7600 0.8314 0.5823 0.0241  0.0043  0.0838  174 GLN D OE1 
1577 N NE2 . GLN D 36 ? 0.9489 1.1052 0.7918 0.0010  -0.0098 0.1168  174 GLN D NE2 
1578 N N   . ASN D 37 ? 0.9676 0.9336 0.7625 -0.0119 -0.0338 0.0199  175 ASN D N   
1579 C CA  . ASN D 37 ? 1.0950 1.0528 0.8860 -0.0074 -0.0325 0.0113  175 ASN D CA  
1580 C C   . ASN D 37 ? 1.1384 1.0851 0.9185 -0.0074 -0.0386 0.0096  175 ASN D C   
1581 O O   . ASN D 37 ? 1.2113 1.1588 0.9907 -0.0055 -0.0371 0.0074  175 ASN D O   
1582 C CB  . ASN D 37 ? 1.1301 1.0917 0.9209 -0.0039 -0.0326 0.0053  175 ASN D CB  
1583 C CG  . ASN D 37 ? 1.3192 1.2838 1.1125 -0.0060 -0.0251 0.0051  175 ASN D CG  
1584 O OD1 . ASN D 37 ? 1.3726 1.3323 1.1646 -0.0042 -0.0178 0.0106  175 ASN D OD1 
1585 N ND2 . ASN D 37 ? 1.3730 1.3456 1.1642 -0.0085 -0.0255 0.0011  175 ASN D ND2 
1586 N N   . ARG D 38 ? 1.2072 1.1377 0.9712 -0.0112 -0.0452 0.0112  176 ARG D N   
1587 C CA  . ARG D 38 ? 1.3192 1.2249 1.0590 -0.0121 -0.0502 0.0108  176 ARG D CA  
1588 C C   . ARG D 38 ? 1.2939 1.2087 1.0414 -0.0220 -0.0510 0.0166  176 ARG D C   
1589 O O   . ARG D 38 ? 1.3431 1.2497 1.0847 -0.0183 -0.0512 0.0143  176 ARG D O   
1590 C CB  . ARG D 38 ? 1.4166 1.2872 1.1204 -0.0202 -0.0566 0.0120  176 ARG D CB  
1591 C CG  . ARG D 38 ? 1.6758 1.4991 1.3336 -0.0090 -0.0572 0.0084  176 ARG D CG  
1592 C CD  . ARG D 38 ? 1.8432 1.6137 1.4480 -0.0145 -0.0605 0.0084  176 ARG D CD  
1593 N NE  . ARG D 38 ? 1.9628 1.7170 1.5449 -0.0497 -0.0707 0.0150  176 ARG D NE  
1594 C CZ  . ARG D 38 ? 2.0101 1.7727 1.5916 -0.0702 -0.0760 0.0202  176 ARG D CZ  
1595 N NH1 . ARG D 38 ? 2.0076 1.7870 1.6099 -0.0571 -0.0714 0.0171  176 ARG D NH1 
1596 N NH2 . ARG D 38 ? 2.0004 1.7600 1.5596 -0.1070 -0.0868 0.0307  176 ARG D NH2 
1597 N N   . GLN D 39 ? 1.2339 1.1715 0.9949 -0.0322 -0.0507 0.0265  177 GLN D N   
1598 C CA  . GLN D 39 ? 1.2359 1.1937 1.0057 -0.0382 -0.0497 0.0371  177 GLN D CA  
1599 C C   . GLN D 39 ? 1.1814 1.1424 0.9630 -0.0243 -0.0401 0.0334  177 GLN D C   
1600 O O   . GLN D 39 ? 1.2523 1.2122 1.0317 -0.0257 -0.0404 0.0356  177 GLN D O   
1601 C CB  . GLN D 39 ? 1.2578 1.2548 1.0416 -0.0445 -0.0479 0.0540  177 GLN D CB  
1602 C CG  . GLN D 39 ? 1.4027 1.4324 1.1909 -0.0538 -0.0493 0.0717  177 GLN D CG  
1603 C CD  . GLN D 39 ? 1.4593 1.5464 1.2624 -0.0581 -0.0472 0.0957  177 GLN D CD  
1604 O OE1 . GLN D 39 ? 1.4018 1.4998 1.2087 -0.0596 -0.0473 0.0984  177 GLN D OE1 
1605 N NE2 . GLN D 39 ? 1.4765 1.6076 1.2885 -0.0586 -0.0446 0.1159  177 GLN D NE2 
1606 N N   . ILE D 40 ? 1.1633 1.1234 0.9508 -0.0144 -0.0321 0.0280  178 ILE D N   
1607 C CA  . ILE D 40 ? 1.2074 1.1583 0.9911 -0.0079 -0.0234 0.0243  178 ILE D CA  
1608 C C   . ILE D 40 ? 1.2776 1.2184 1.0553 -0.0109 -0.0291 0.0155  178 ILE D C   
1609 O O   . ILE D 40 ? 1.3792 1.3142 1.1519 -0.0114 -0.0264 0.0154  178 ILE D O   
1610 C CB  . ILE D 40 ? 1.1783 1.1211 0.9558 -0.0038 -0.0148 0.0210  178 ILE D CB  
1611 C CG1 . ILE D 40 ? 1.1735 1.1216 0.9486 0.0077  -0.0028 0.0332  178 ILE D CG1 
1612 C CG2 . ILE D 40 ? 1.0578 0.9805 0.8170 -0.0083 -0.0105 0.0143  178 ILE D CG2 
1613 C CD1 . ILE D 40 ? 1.1103 1.0931 0.9035 0.0069  -0.0078 0.0465  178 ILE D CD1 
1614 N N   . ASP D 41 ? 1.3070 1.2475 1.0823 -0.0098 -0.0355 0.0102  179 ASP D N   
1615 C CA  . ASP D 41 ? 1.4129 1.3524 1.1809 -0.0058 -0.0391 0.0069  179 ASP D CA  
1616 C C   . ASP D 41 ? 1.4474 1.3746 1.2082 -0.0075 -0.0422 0.0090  179 ASP D C   
1617 O O   . ASP D 41 ? 1.5439 1.4737 1.3033 -0.0066 -0.0416 0.0079  179 ASP D O   
1618 C CB  . ASP D 41 ? 1.4682 1.4056 1.2261 0.0046  -0.0424 0.0056  179 ASP D CB  
1619 C CG  . ASP D 41 ? 1.6439 1.6028 1.4106 0.0065  -0.0399 0.0048  179 ASP D CG  
1620 O OD1 . ASP D 41 ? 1.7596 1.7403 1.5316 0.0005  -0.0383 0.0055  179 ASP D OD1 
1621 O OD2 . ASP D 41 ? 1.8941 1.8477 1.6585 0.0103  -0.0405 0.0043  179 ASP D OD2 
1622 N N   . ARG D 42 ? 1.4632 1.3792 1.2166 -0.0139 -0.0465 0.0133  180 ARG D N   
1623 C CA  . ARG D 42 ? 1.5163 1.4225 1.2598 -0.0214 -0.0505 0.0173  180 ARG D CA  
1624 C C   . ARG D 42 ? 1.4836 1.4059 1.2429 -0.0213 -0.0446 0.0208  180 ARG D C   
1625 O O   . ARG D 42 ? 1.5771 1.4933 1.3326 -0.0196 -0.0447 0.0184  180 ARG D O   
1626 C CB  . ARG D 42 ? 1.5629 1.4655 1.2943 -0.0382 -0.0574 0.0259  180 ARG D CB  
1627 C CG  . ARG D 42 ? 1.6990 1.5594 1.3895 -0.0437 -0.0646 0.0225  180 ARG D CG  
1628 C CD  . ARG D 42 ? 1.7522 1.6063 1.4198 -0.0723 -0.0741 0.0330  180 ARG D CD  
1629 N NE  . ARG D 42 ? 1.7486 1.6329 1.4344 -0.0796 -0.0743 0.0399  180 ARG D NE  
1630 C CZ  . ARG D 42 ? 1.8903 1.7557 1.5635 -0.0756 -0.0742 0.0345  180 ARG D CZ  
1631 N NH1 . ARG D 42 ? 1.9579 1.7753 1.5981 -0.0609 -0.0725 0.0235  180 ARG D NH1 
1632 N NH2 . ARG D 42 ? 1.8928 1.7900 1.5849 -0.0828 -0.0743 0.0420  180 ARG D NH2 
1633 N N   . ILE D 43 ? 1.4102 1.3497 1.1819 -0.0201 -0.0377 0.0279  181 ILE D N   
1634 C CA  . ILE D 43 ? 1.4272 1.3728 1.2019 -0.0142 -0.0282 0.0341  181 ILE D CA  
1635 C C   . ILE D 43 ? 1.5038 1.4304 1.2689 -0.0121 -0.0242 0.0245  181 ILE D C   
1636 O O   . ILE D 43 ? 1.5772 1.4978 1.3369 -0.0114 -0.0214 0.0262  181 ILE D O   
1637 C CB  . ILE D 43 ? 1.3837 1.3439 1.1622 -0.0042 -0.0168 0.0450  181 ILE D CB  
1638 C CG1 . ILE D 43 ? 1.2507 1.2463 1.0404 -0.0107 -0.0222 0.0607  181 ILE D CG1 
1639 C CG2 . ILE D 43 ? 1.2637 1.2144 1.0295 0.0099  -0.0021 0.0515  181 ILE D CG2 
1640 C CD1 . ILE D 43 ? 1.1300 1.1552 0.9252 0.0050  -0.0090 0.0786  181 ILE D CD1 
1641 N N   . MET D 44 ? 1.5497 1.4712 1.3110 -0.0140 -0.0247 0.0163  182 MET D N   
1642 C CA  . MET D 44 ? 1.6771 1.5915 1.4267 -0.0204 -0.0241 0.0107  182 MET D CA  
1643 C C   . MET D 44 ? 1.7237 1.6445 1.4758 -0.0209 -0.0312 0.0093  182 MET D C   
1644 O O   . MET D 44 ? 1.7993 1.7144 1.5421 -0.0267 -0.0294 0.0087  182 MET D O   
1645 C CB  . MET D 44 ? 1.7182 1.6426 1.4654 -0.0265 -0.0262 0.0067  182 MET D CB  
1646 C CG  . MET D 44 ? 1.8471 1.7540 1.5786 -0.0307 -0.0178 0.0065  182 MET D CG  
1647 S SD  . MET D 44 ? 2.0633 1.9871 1.7875 -0.0465 -0.0224 0.0036  182 MET D SD  
1648 C CE  . MET D 44 ? 1.9233 1.8828 1.6776 -0.0311 -0.0309 0.0044  182 MET D CE  
1649 N N   . GLU D 45 ? 1.7289 1.6543 1.4855 -0.0148 -0.0381 0.0093  183 GLU D N   
1650 C CA  . GLU D 45 ? 1.7927 1.7148 1.5425 -0.0106 -0.0428 0.0091  183 GLU D CA  
1651 C C   . GLU D 45 ? 1.8153 1.7263 1.5637 -0.0153 -0.0428 0.0118  183 GLU D C   
1652 O O   . GLU D 45 ? 1.8463 1.7562 1.5909 -0.0152 -0.0435 0.0111  183 GLU D O   
1653 C CB  . GLU D 45 ? 1.8104 1.7190 1.5458 -0.0009 -0.0474 0.0091  183 GLU D CB  
1654 C CG  . GLU D 45 ? 1.8983 1.8211 1.6307 0.0118  -0.0461 0.0092  183 GLU D CG  
1655 C CD  . GLU D 45 ? 2.0036 1.8956 1.7056 0.0265  -0.0472 0.0099  183 GLU D CD  
1656 O OE1 . GLU D 45 ? 1.9800 1.8393 1.6563 0.0280  -0.0492 0.0101  183 GLU D OE1 
1657 O OE2 . GLU D 45 ? 2.1013 1.9945 1.7974 0.0360  -0.0455 0.0105  183 GLU D OE2 
1658 N N   . LYS D 46 ? 1.7874 1.6980 1.5399 -0.0193 -0.0419 0.0174  184 LYS D N   
1659 C CA  . LYS D 46 ? 1.8368 1.7494 1.5898 -0.0237 -0.0419 0.0247  184 LYS D CA  
1660 C C   . LYS D 46 ? 1.8128 1.7249 1.5666 -0.0193 -0.0322 0.0262  184 LYS D C   
1661 O O   . LYS D 46 ? 1.8207 1.7287 1.5712 -0.0205 -0.0328 0.0271  184 LYS D O   
1662 C CB  . LYS D 46 ? 1.8405 1.7702 1.5984 -0.0302 -0.0435 0.0365  184 LYS D CB  
1663 C CG  . LYS D 46 ? 1.9588 1.8759 1.7009 -0.0420 -0.0543 0.0359  184 LYS D CG  
1664 C CD  . LYS D 46 ? 2.0385 1.9816 1.7845 -0.0553 -0.0575 0.0501  184 LYS D CD  
1665 C CE  . LYS D 46 ? 2.0671 1.9831 1.7831 -0.0725 -0.0686 0.0481  184 LYS D CE  
1666 N NZ  . LYS D 46 ? 2.0358 1.9825 1.7508 -0.0947 -0.0749 0.0649  184 LYS D NZ  
1667 N N   . ALA D 47 ? 1.7700 1.6778 1.5199 -0.0145 -0.0226 0.0263  185 ALA D N   
1668 C CA  . ALA D 47 ? 1.8127 1.6999 1.5435 -0.0106 -0.0109 0.0272  185 ALA D CA  
1669 C C   . ALA D 47 ? 1.8649 1.7398 1.5846 -0.0213 -0.0151 0.0187  185 ALA D C   
1670 O O   . ALA D 47 ? 1.9283 1.7874 1.6335 -0.0215 -0.0101 0.0201  185 ALA D O   
1671 C CB  . ALA D 47 ? 1.7941 1.6628 1.5062 -0.0055 0.0005  0.0279  185 ALA D CB  
1672 N N   . ASP D 48 ? 1.8911 1.7788 1.6165 -0.0290 -0.0235 0.0125  186 ASP D N   
1673 C CA  . ASP D 48 ? 1.9436 1.8386 1.6630 -0.0389 -0.0286 0.0095  186 ASP D CA  
1674 C C   . ASP D 48 ? 1.9506 1.8490 1.6776 -0.0336 -0.0331 0.0106  186 ASP D C   
1675 O O   . ASP D 48 ? 1.9766 1.8715 1.6942 -0.0405 -0.0331 0.0104  186 ASP D O   
1676 C CB  . ASP D 48 ? 1.9492 1.8738 1.6768 -0.0411 -0.0355 0.0089  186 ASP D CB  
1677 C CG  . ASP D 48 ? 2.0444 1.9903 1.7611 -0.0576 -0.0389 0.0114  186 ASP D CG  
1678 O OD1 . ASP D 48 ? 2.1309 2.0668 1.8355 -0.0667 -0.0385 0.0118  186 ASP D OD1 
1679 O OD2 . ASP D 48 ? 2.0709 2.0495 1.7906 -0.0632 -0.0426 0.0151  186 ASP D OD2 
1680 N N   . SER D 49 ? 1.9299 1.8310 1.6677 -0.0249 -0.0374 0.0123  187 SER D N   
1681 C CA  . SER D 49 ? 1.9373 1.8334 1.6739 -0.0229 -0.0419 0.0138  187 SER D CA  
1682 C C   . SER D 49 ? 1.9120 1.8012 1.6477 -0.0252 -0.0369 0.0185  187 SER D C   
1683 O O   . SER D 49 ? 1.9459 1.8311 1.6783 -0.0265 -0.0391 0.0185  187 SER D O   
1684 C CB  . SER D 49 ? 1.9496 1.8379 1.6813 -0.0205 -0.0484 0.0152  187 SER D CB  
1685 O OG  . SER D 49 ? 1.9915 1.8650 1.7093 -0.0203 -0.0532 0.0154  187 SER D OG  
1686 N N   . ASN D 50 ? 1.8742 1.7639 1.6108 -0.0218 -0.0287 0.0247  188 ASN D N   
1687 C CA  . ASN D 50 ? 1.8547 1.7411 1.5855 -0.0159 -0.0196 0.0333  188 ASN D CA  
1688 C C   . ASN D 50 ? 1.9217 1.7787 1.6274 -0.0155 -0.0096 0.0295  188 ASN D C   
1689 O O   . ASN D 50 ? 1.9551 1.8011 1.6489 -0.0094 -0.0022 0.0350  188 ASN D O   
1690 C CB  . ASN D 50 ? 1.8028 1.7067 1.5388 -0.0056 -0.0116 0.0468  188 ASN D CB  
1691 C CG  . ASN D 50 ? 1.7303 1.6645 1.4831 -0.0144 -0.0227 0.0547  188 ASN D CG  
1692 O OD1 . ASN D 50 ? 1.5220 1.4546 1.2743 -0.0262 -0.0338 0.0521  188 ASN D OD1 
1693 N ND2 . ASN D 50 ? 1.7995 1.7574 1.5601 -0.0110 -0.0200 0.0653  188 ASN D ND2 
1694 N N   . LYS D 51 ? 1.9844 1.8272 1.6760 -0.0246 -0.0097 0.0215  189 LYS D N   
1695 C CA  . LYS D 51 ? 2.0716 1.8836 1.7294 -0.0369 -0.0052 0.0172  189 LYS D CA  
1696 C C   . LYS D 51 ? 2.0525 1.8772 1.7198 -0.0439 -0.0137 0.0151  189 LYS D C   
1697 O O   . LYS D 51 ? 2.0817 1.8851 1.7314 -0.0431 -0.0080 0.0170  189 LYS D O   
1698 C CB  . LYS D 51 ? 2.1188 1.9281 1.7616 -0.0552 -0.0089 0.0117  189 LYS D CB  
1699 C CG  . LYS D 51 ? 2.2650 2.0418 1.8785 -0.0533 0.0023  0.0123  189 LYS D CG  
1700 C CD  . LYS D 51 ? 2.3426 2.1252 1.9433 -0.0770 -0.0045 0.0080  189 LYS D CD  
1701 C CE  . LYS D 51 ? 2.3842 2.1335 1.9569 -0.0738 0.0059  0.0081  189 LYS D CE  
1702 N NZ  . LYS D 51 ? 2.3626 2.1233 1.9243 -0.0997 -0.0020 0.0054  189 LYS D NZ  
1703 N N   . THR D 52 ? 2.0237 1.8808 1.7145 -0.0470 -0.0257 0.0125  190 THR D N   
1704 C CA  . THR D 52 ? 2.0337 1.9047 1.7306 -0.0499 -0.0328 0.0120  190 THR D CA  
1705 C C   . THR D 52 ? 2.0197 1.8820 1.7227 -0.0408 -0.0318 0.0146  190 THR D C   
1706 O O   . THR D 52 ? 2.0546 1.9134 1.7521 -0.0446 -0.0331 0.0144  190 THR D O   
1707 C CB  . THR D 52 ? 2.0329 1.9369 1.7461 -0.0441 -0.0418 0.0123  190 THR D CB  
1708 O OG1 . THR D 52 ? 2.0857 1.9875 1.8092 -0.0318 -0.0432 0.0121  190 THR D OG1 
1709 C CG2 . THR D 52 ? 2.0154 1.9450 1.7236 -0.0561 -0.0438 0.0143  190 THR D CG2 
1710 N N   . ARG D 53 ? 2.0060 1.8703 1.7195 -0.0318 -0.0302 0.0191  191 ARG D N   
1711 C CA  . ARG D 53 ? 2.0347 1.9025 1.7542 -0.0283 -0.0314 0.0255  191 ARG D CA  
1712 C C   . ARG D 53 ? 2.0474 1.9034 1.7548 -0.0223 -0.0196 0.0322  191 ARG D C   
1713 O O   . ARG D 53 ? 2.0766 1.9315 1.7829 -0.0228 -0.0206 0.0345  191 ARG D O   
1714 C CB  . ARG D 53 ? 2.0508 1.9345 1.7813 -0.0278 -0.0357 0.0326  191 ARG D CB  
1715 C CG  . ARG D 53 ? 2.1213 2.0109 1.8516 -0.0354 -0.0441 0.0385  191 ARG D CG  
1716 C CD  . ARG D 53 ? 2.2777 2.1476 1.9942 -0.0398 -0.0544 0.0300  191 ARG D CD  
1717 N NE  . ARG D 53 ? 2.4189 2.2810 2.1263 -0.0423 -0.0594 0.0286  191 ARG D NE  
1718 C CZ  . ARG D 53 ? 2.5526 2.3888 2.2372 -0.0378 -0.0639 0.0224  191 ARG D CZ  
1719 N NH1 . ARG D 53 ? 2.6072 2.4293 2.2788 -0.0289 -0.0640 0.0184  191 ARG D NH1 
1720 N NH2 . ARG D 53 ? 2.5744 2.3970 2.2440 -0.0391 -0.0667 0.0219  191 ARG D NH2 
1721 N N   . ILE D 54 ? 2.0466 1.8886 1.7385 -0.0137 -0.0069 0.0363  192 ILE D N   
1722 C CA  . ILE D 54 ? 2.1019 1.9215 1.7682 0.0002  0.0092  0.0451  192 ILE D CA  
1723 C C   . ILE D 54 ? 2.1432 1.9211 1.7756 -0.0099 0.0125  0.0365  192 ILE D C   
1724 O O   . ILE D 54 ? 2.2095 1.9651 1.8190 -0.0004 0.0230  0.0422  192 ILE D O   
1725 C CB  . ILE D 54 ? 2.1368 1.9418 1.7819 0.0183  0.0258  0.0538  192 ILE D CB  
1726 C CG1 . ILE D 54 ? 2.1438 2.0010 1.8222 0.0283  0.0235  0.0682  192 ILE D CG1 
1727 C CG2 . ILE D 54 ? 2.1688 1.9325 1.7684 0.0388  0.0468  0.0629  192 ILE D CG2 
1728 C CD1 . ILE D 54 ? 2.2149 2.0686 1.8769 0.0503  0.0402  0.0799  192 ILE D CD1 
1729 N N   . ASP D 55 ? 2.1427 1.9144 1.7696 -0.0302 0.0036  0.0254  193 ASP D N   
1730 C CA  . ASP D 55 ? 2.1831 1.9258 1.7773 -0.0489 0.0031  0.0197  193 ASP D CA  
1731 C C   . ASP D 55 ? 2.1788 1.9436 1.7944 -0.0523 -0.0063 0.0189  193 ASP D C   
1732 O O   . ASP D 55 ? 2.2483 1.9859 1.8393 -0.0530 -0.0001 0.0202  193 ASP D O   
1733 C CB  . ASP D 55 ? 2.1863 1.9323 1.7691 -0.0731 -0.0047 0.0136  193 ASP D CB  
1734 C CG  . ASP D 55 ? 2.1839 1.8938 1.7320 -0.0735 0.0058  0.0136  193 ASP D CG  
1735 O OD1 . ASP D 55 ? 2.1183 1.7917 1.6417 -0.0521 0.0220  0.0190  193 ASP D OD1 
1736 O OD2 . ASP D 55 ? 2.1669 1.8872 1.7101 -0.0931 -0.0011 0.0105  193 ASP D OD2 
1737 N N   . GLU D 56 ? 2.1287 1.9351 1.7821 -0.0522 -0.0195 0.0171  194 GLU D N   
1738 C CA  . GLU D 56 ? 2.1130 1.9342 1.7808 -0.0519 -0.0270 0.0170  194 GLU D CA  
1739 C C   . GLU D 56 ? 2.1376 1.9525 1.8093 -0.0397 -0.0217 0.0235  194 GLU D C   
1740 O O   . GLU D 56 ? 2.1611 1.9734 1.8313 -0.0413 -0.0235 0.0238  194 GLU D O   
1741 C CB  . GLU D 56 ? 2.0672 1.9191 1.7585 -0.0484 -0.0386 0.0154  194 GLU D CB  
1742 C CG  . GLU D 56 ? 1.9871 1.8445 1.6926 -0.0385 -0.0412 0.0174  194 GLU D CG  
1743 C CD  . GLU D 56 ? 1.8706 1.7401 1.5801 -0.0328 -0.0487 0.0153  194 GLU D CD  
1744 O OE1 . GLU D 56 ? 1.6590 1.5461 1.3674 -0.0326 -0.0502 0.0148  194 GLU D OE1 
1745 O OE2 . GLU D 56 ? 1.7087 1.5702 1.4166 -0.0288 -0.0525 0.0165  194 GLU D OE2 
1746 N N   . ALA D 57 ? 2.1512 1.9711 1.8283 -0.0278 -0.0151 0.0311  195 ALA D N   
1747 C CA  . ALA D 57 ? 2.1726 2.0046 1.8552 -0.0159 -0.0093 0.0438  195 ALA D CA  
1748 C C   . ALA D 57 ? 2.2169 2.0196 1.8700 -0.0055 0.0056  0.0488  195 ALA D C   
1749 O O   . ALA D 57 ? 2.2325 2.0402 1.8886 -0.0050 0.0042  0.0522  195 ALA D O   
1750 C CB  . ALA D 57 ? 2.1701 2.0265 1.8640 -0.0053 -0.0046 0.0556  195 ALA D CB  
1751 N N   . ASN D 58 ? 2.2521 2.0164 1.8685 0.0031  0.0208  0.0494  196 ASN D N   
1752 C CA  . ASN D 58 ? 2.3096 2.0263 1.8785 0.0158  0.0385  0.0544  196 ASN D CA  
1753 C C   . ASN D 58 ? 2.3334 2.0225 1.8839 -0.0060 0.0315  0.0430  196 ASN D C   
1754 O O   . ASN D 58 ? 2.3726 2.0305 1.8922 0.0022  0.0421  0.0472  196 ASN D O   
1755 C CB  . ASN D 58 ? 2.3565 2.0187 1.8706 0.0299  0.0584  0.0575  196 ASN D CB  
1756 C CG  . ASN D 58 ? 2.3688 1.9996 1.8602 0.0023  0.0511  0.0424  196 ASN D CG  
1757 O OD1 . ASN D 58 ? 2.4057 2.0192 1.8819 -0.0258 0.0413  0.0319  196 ASN D OD1 
1758 N ND2 . ASN D 58 ? 2.2725 1.9028 1.7615 0.0089  0.0555  0.0439  196 ASN D ND2 
1759 N N   . GLN D 59 ? 2.3249 2.0299 1.8928 -0.0314 0.0147  0.0312  197 GLN D N   
1760 C CA  . GLN D 59 ? 2.3564 2.0571 1.9175 -0.0523 0.0054  0.0242  197 GLN D CA  
1761 C C   . GLN D 59 ? 2.3278 2.0555 1.9188 -0.0451 -0.0005 0.0272  197 GLN D C   
1762 O O   . GLN D 59 ? 2.3548 2.0657 1.9286 -0.0539 -0.0009 0.0251  197 GLN D O   
1763 C CB  . GLN D 59 ? 2.3412 2.0725 1.9199 -0.0741 -0.0099 0.0174  197 GLN D CB  
1764 C CG  . GLN D 59 ? 2.3988 2.1017 1.9369 -0.0951 -0.0072 0.0145  197 GLN D CG  
1765 C CD  . GLN D 59 ? 2.4090 2.1618 1.9729 -0.1115 -0.0217 0.0131  197 GLN D CD  
1766 O OE1 . GLN D 59 ? 2.4021 2.1984 1.9941 -0.1140 -0.0325 0.0145  197 GLN D OE1 
1767 N NE2 . GLN D 59 ? 2.4275 2.1754 1.9790 -0.1194 -0.0205 0.0124  197 GLN D NE2 
1768 N N   . ARG D 60 ? 2.2775 2.0437 1.9070 -0.0334 -0.0060 0.0324  198 ARG D N   
1769 C CA  . ARG D 60 ? 2.2759 2.0622 1.9246 -0.0297 -0.0112 0.0372  198 ARG D CA  
1770 C C   . ARG D 60 ? 2.2752 2.0565 1.9116 -0.0114 0.0034  0.0510  198 ARG D C   
1771 O O   . ARG D 60 ? 2.3082 2.0879 1.9421 -0.0104 0.0039  0.0538  198 ARG D O   
1772 C CB  . ARG D 60 ? 2.2634 2.0843 1.9432 -0.0322 -0.0241 0.0387  198 ARG D CB  
1773 C CG  . ARG D 60 ? 2.3462 2.1711 2.0326 -0.0415 -0.0362 0.0283  198 ARG D CG  
1774 C CD  . ARG D 60 ? 2.4581 2.2958 2.1553 -0.0425 -0.0461 0.0301  198 ARG D CD  
1775 N NE  . ARG D 60 ? 2.5512 2.3875 2.2460 -0.0417 -0.0525 0.0230  198 ARG D NE  
1776 C CZ  . ARG D 60 ? 2.6204 2.4508 2.3087 -0.0410 -0.0592 0.0229  198 ARG D CZ  
1777 N NH1 . ARG D 60 ? 2.6500 2.4778 2.3336 -0.0497 -0.0634 0.0293  198 ARG D NH1 
1778 N NH2 . ARG D 60 ? 2.6409 2.4681 2.3210 -0.0326 -0.0613 0.0187  198 ARG D NH2 
1779 N N   . ALA D 61 ? 2.2705 2.0530 1.8982 0.0064  0.0165  0.0618  199 ALA D N   
1780 C CA  . ALA D 61 ? 2.2893 2.0777 1.9033 0.0330  0.0342  0.0812  199 ALA D CA  
1781 C C   . ALA D 61 ? 2.3677 2.0946 1.9288 0.0432  0.0507  0.0796  199 ALA D C   
1782 O O   . ALA D 61 ? 2.4002 2.1320 1.9554 0.0568  0.0582  0.0903  199 ALA D O   
1783 C CB  . ALA D 61 ? 2.2693 2.0750 1.8813 0.0546  0.0468  0.0958  199 ALA D CB  
1784 N N   . THR D 62 ? 2.4328 2.0991 1.9490 0.0336  0.0562  0.0672  200 THR D N   
1785 C CA  . THR D 62 ? 2.5167 2.1080 1.9660 0.0333  0.0700  0.0635  200 THR D CA  
1786 C C   . THR D 62 ? 2.5173 2.1078 1.9753 0.0028  0.0534  0.0505  200 THR D C   
1787 O O   . THR D 62 ? 2.5609 2.1019 1.9726 0.0008  0.0619  0.0497  200 THR D O   
1788 C CB  . THR D 62 ? 2.5717 2.0888 1.9534 0.0265  0.0814  0.0568  200 THR D CB  
1789 O OG1 . THR D 62 ? 2.6297 2.1588 2.0145 0.0529  0.0932  0.0675  200 THR D OG1 
1790 C CG2 . THR D 62 ? 2.6155 2.0379 1.9057 0.0342  0.1025  0.0587  200 THR D CG2 
1791 N N   . LYS D 63 ? 2.4634 2.1061 1.9750 -0.0182 0.0314  0.0420  201 LYS D N   
1792 C CA  . LYS D 63 ? 2.4531 2.1113 1.9817 -0.0388 0.0165  0.0343  201 LYS D CA  
1793 C C   . LYS D 63 ? 2.4582 2.1393 2.0090 -0.0242 0.0170  0.0423  201 LYS D C   
1794 O O   . LYS D 63 ? 2.4817 2.1554 2.0276 -0.0348 0.0122  0.0383  201 LYS D O   
1795 C CB  . LYS D 63 ? 2.3916 2.0964 1.9628 -0.0547 -0.0027 0.0270  201 LYS D CB  
1796 N N   . MET D 64 ? 2.4438 2.1584 2.0184 -0.0029 0.0221  0.0556  202 MET D N   
1797 C CA  . MET D 64 ? 2.4453 2.1865 2.0346 0.0099  0.0245  0.0683  202 MET D CA  
1798 C C   . MET D 64 ? 2.4917 2.1886 2.0328 0.0314  0.0463  0.0773  202 MET D C   
1799 O O   . MET D 64 ? 2.5005 2.2005 2.0419 0.0334  0.0465  0.0810  202 MET D O   
1800 C CB  . MET D 64 ? 2.4168 2.2178 2.0415 0.0207  0.0225  0.0852  202 MET D CB  
1801 C CG  . MET D 64 ? 2.4213 2.2637 2.0623 0.0276  0.0224  0.1024  202 MET D CG  
1802 S SD  . MET D 64 ? 2.5075 2.4322 2.1855 0.0266  0.0154  0.1263  202 MET D SD  
1803 C CE  . MET D 64 ? 2.4710 2.4417 2.1528 0.0405  0.0232  0.1525  202 MET D CE  
1804 N N   . LEU D 65 ? 2.5169 2.1656 2.0090 0.0490  0.0659  0.0812  203 LEU D N   
1805 C CA  . LEU D 65 ? 2.5784 2.1665 2.0050 0.0758  0.0914  0.0912  203 LEU D CA  
1806 C C   . LEU D 65 ? 2.6478 2.1386 1.9925 0.0697  0.1050  0.0809  203 LEU D C   
1807 O O   . LEU D 65 ? 2.6596 2.1260 1.9761 0.0844  0.1175  0.0851  203 LEU D O   
1808 C CB  . LEU D 65 ? 2.5780 2.2045 2.0086 0.1208  0.1115  0.1191  203 LEU D CB  
1809 C CG  . LEU D 65 ? 2.4961 2.2128 1.9883 0.1247  0.1014  0.1355  203 LEU D CG  
1810 C CD1 . LEU D 65 ? 2.5046 2.2908 2.0192 0.1556  0.1125  0.1646  203 LEU D CD1 
1811 C CD2 . LEU D 65 ? 2.4268 2.1222 1.8940 0.1365  0.1109  0.1414  203 LEU D CD2 
1812 O OXT . LEU D 65 ? 2.6780 2.1098 1.9768 0.0466  0.1034  0.0691  203 LEU D OXT 
1813 N N   . GLY E 4  ? 1.7933 1.7605 1.3764 -0.2019 0.2792  -0.0901 24  GLY E N   
1814 C CA  . GLY E 4  ? 1.8930 1.7739 1.3946 -0.2276 0.2801  -0.0980 24  GLY E CA  
1815 C C   . GLY E 4  ? 1.9757 1.8163 1.4115 -0.2570 0.2890  -0.1039 24  GLY E C   
1816 O O   . GLY E 4  ? 2.0073 1.8208 1.3845 -0.3026 0.3107  -0.1222 24  GLY E O   
1817 N N   . SER E 5  ? 2.0129 1.8452 1.4555 -0.2351 0.2776  -0.0917 25  SER E N   
1818 C CA  . SER E 5  ? 2.0629 1.8680 1.4547 -0.2606 0.2869  -0.0971 25  SER E CA  
1819 C C   . SER E 5  ? 2.0338 1.9039 1.4836 -0.2379 0.2764  -0.0874 25  SER E C   
1820 O O   . SER E 5  ? 2.0466 1.9579 1.4920 -0.2631 0.2868  -0.1005 25  SER E O   
1821 C CB  . SER E 5  ? 2.1306 1.8060 1.4192 -0.2556 0.2865  -0.0917 25  SER E CB  
1822 O OG  . SER E 5  ? 2.1053 1.7344 1.3241 -0.2952 0.3090  -0.1026 25  SER E OG  
1823 N N   . LYS E 6  ? 2.0195 1.8986 1.5197 -0.1934 0.2601  -0.0696 26  LYS E N   
1824 C CA  . LYS E 6  ? 2.0164 1.9517 1.5716 -0.1659 0.2562  -0.0578 26  LYS E CA  
1825 C C   . LYS E 6  ? 2.0397 1.9647 1.5681 -0.1728 0.2532  -0.0564 26  LYS E C   
1826 O O   . LYS E 6  ? 1.9543 1.9489 1.5094 -0.1690 0.2567  -0.0582 26  LYS E O   
1827 C CB  . LYS E 6  ? 2.0016 2.0317 1.6038 -0.1581 0.2657  -0.0618 26  LYS E CB  
1828 C CG  . LYS E 6  ? 2.0138 2.0595 1.6469 -0.1455 0.2714  -0.0612 26  LYS E CG  
1829 C CD  . LYS E 6  ? 2.0152 2.1536 1.6801 -0.1227 0.2792  -0.0647 26  LYS E CD  
1830 C CE  . LYS E 6  ? 2.0452 2.1910 1.7365 -0.1013 0.2882  -0.0604 26  LYS E CE  
1831 N NZ  . LYS E 6  ? 2.0091 2.2354 1.7158 -0.0589 0.2954  -0.0603 26  LYS E NZ  
1832 N N   . LEU E 7  ? 2.1280 1.9688 1.5982 -0.1763 0.2462  -0.0547 27  LEU E N   
1833 C CA  . LEU E 7  ? 2.1543 1.9717 1.5912 -0.1825 0.2444  -0.0530 27  LEU E CA  
1834 C C   . LEU E 7  ? 2.1629 1.9173 1.5776 -0.1499 0.2267  -0.0430 27  LEU E C   
1835 O O   . LEU E 7  ? 2.1396 1.8200 1.4780 -0.1558 0.2261  -0.0446 27  LEU E O   
1836 C CB  . LEU E 7  ? 2.2400 2.0105 1.5961 -0.2328 0.2652  -0.0715 27  LEU E CB  
1837 C CG  . LEU E 7  ? 2.2421 2.0337 1.5851 -0.2558 0.2743  -0.0808 27  LEU E CG  
1838 C CD1 . LEU E 7  ? 2.1671 2.0962 1.5826 -0.2650 0.2797  -0.0972 27  LEU E CD1 
1839 C CD2 . LEU E 7  ? 2.3200 2.0109 1.5530 -0.3058 0.3031  -0.0992 27  LEU E CD2 
1840 N N   . PRO E 8  ? 2.1688 1.9523 1.6453 -0.1157 0.2163  -0.0379 28  PRO E N   
1841 C CA  . PRO E 8  ? 2.2103 1.9718 1.6872 -0.0873 0.2015  -0.0378 28  PRO E CA  
1842 C C   . PRO E 8  ? 2.2088 2.0087 1.7228 -0.0840 0.2051  -0.0269 28  PRO E C   
1843 O O   . PRO E 8  ? 2.2084 1.9960 1.7250 -0.0656 0.1953  -0.0276 28  PRO E O   
1844 C CB  . PRO E 8  ? 2.1805 1.9690 1.7134 -0.0650 0.1995  -0.0491 28  PRO E CB  
1845 C CG  . PRO E 8  ? 2.1424 1.9776 1.7266 -0.0766 0.2188  -0.0420 28  PRO E CG  
1846 C CD  . PRO E 8  ? 2.1310 1.9658 1.6751 -0.1051 0.2237  -0.0375 28  PRO E CD  
1847 N N   . ASP E 9  ? 2.2007 2.0535 1.7402 -0.0969 0.2181  -0.0204 29  ASP E N   
1848 C CA  . ASP E 9  ? 2.1697 2.0661 1.7372 -0.0851 0.2222  -0.0103 29  ASP E CA  
1849 C C   . ASP E 9  ? 2.1850 2.0622 1.7069 -0.1035 0.2161  -0.0137 29  ASP E C   
1850 O O   . ASP E 9  ? 2.1397 2.0116 1.6679 -0.0882 0.2100  -0.0065 29  ASP E O   
1851 C CB  . ASP E 9  ? 2.1634 2.1337 1.7598 -0.0800 0.2349  -0.0084 29  ASP E CB  
1852 C CG  . ASP E 9  ? 2.1876 2.1641 1.8180 -0.0602 0.2467  -0.0034 29  ASP E CG  
1853 O OD1 . ASP E 9  ? 2.2229 2.1552 1.8599 -0.0613 0.2457  -0.0075 29  ASP E OD1 
1854 O OD2 . ASP E 9  ? 2.2350 2.2645 1.8814 -0.0400 0.2577  0.0008  29  ASP E OD2 
1855 N N   . ALA E 10 ? 2.2425 2.1033 1.7141 -0.1406 0.2232  -0.0276 30  ALA E N   
1856 C CA  . ALA E 10 ? 2.3176 2.1408 1.7306 -0.1674 0.2277  -0.0362 30  ALA E CA  
1857 C C   . ALA E 10 ? 2.3873 2.1313 1.7622 -0.1433 0.2125  -0.0260 30  ALA E C   
1858 O O   . ALA E 10 ? 2.4530 2.1803 1.8016 -0.1493 0.2124  -0.0261 30  ALA E O   
1859 C CB  . ALA E 10 ? 2.3887 2.1668 1.7326 -0.2158 0.2489  -0.0568 30  ALA E CB  
1860 N N   . ALA E 11 ? 2.4403 2.1469 1.8136 -0.1140 0.1993  -0.0228 31  ALA E N   
1861 C CA  . ALA E 11 ? 2.4967 2.1626 1.8520 -0.0786 0.1803  -0.0220 31  ALA E CA  
1862 C C   . ALA E 11 ? 2.4869 2.2135 1.9166 -0.0609 0.1753  -0.0157 31  ALA E C   
1863 O O   . ALA E 11 ? 2.5467 2.2543 1.9595 -0.0475 0.1652  -0.0154 31  ALA E O   
1864 C CB  . ALA E 11 ? 2.4988 2.1459 1.8494 -0.0497 0.1678  -0.0324 31  ALA E CB  
1865 N N   . LYS E 12 ? 2.4700 2.2594 1.9717 -0.0585 0.1864  -0.0105 32  LYS E N   
1866 C CA  . LYS E 12 ? 2.4735 2.3018 2.0295 -0.0413 0.1928  -0.0024 32  LYS E CA  
1867 C C   . LYS E 12 ? 2.4851 2.3442 2.0359 -0.0480 0.1967  0.0088  32  LYS E C   
1868 O O   . LYS E 12 ? 2.4744 2.3407 2.0406 -0.0332 0.1963  0.0152  32  LYS E O   
1869 C CB  . LYS E 12 ? 2.4623 2.3210 2.0719 -0.0309 0.2125  0.0002  32  LYS E CB  
1870 C CG  . LYS E 12 ? 2.5311 2.3752 2.1575 -0.0273 0.2119  -0.0196 32  LYS E CG  
1871 C CD  . LYS E 12 ? 2.6027 2.4636 2.2596 -0.0295 0.2326  -0.0182 32  LYS E CD  
1872 C CE  . LYS E 12 ? 2.6399 2.4939 2.3036 -0.0320 0.2267  -0.0426 32  LYS E CE  
1873 N NZ  . LYS E 12 ? 2.6077 2.4696 2.2749 -0.0412 0.2355  -0.0386 32  LYS E NZ  
1874 N N   . LYS E 13 ? 2.5160 2.4022 2.0471 -0.0714 0.2021  0.0049  33  LYS E N   
1875 C CA  . LYS E 13 ? 2.5161 2.4529 2.0435 -0.0809 0.2054  0.0024  33  LYS E CA  
1876 C C   . LYS E 13 ? 2.5065 2.3941 1.9901 -0.0943 0.1975  -0.0008 33  LYS E C   
1877 O O   . LYS E 13 ? 2.4701 2.3818 1.9676 -0.0815 0.1941  0.0052  33  LYS E O   
1878 C CB  . LYS E 13 ? 2.5640 2.5516 2.0783 -0.1141 0.2162  -0.0180 33  LYS E CB  
1879 C CG  . LYS E 13 ? 2.5967 2.6485 2.1498 -0.0970 0.2230  -0.0183 33  LYS E CG  
1880 C CD  . LYS E 13 ? 2.6351 2.7346 2.1724 -0.1390 0.2340  -0.0486 33  LYS E CD  
1881 C CE  . LYS E 13 ? 2.5914 2.7174 2.1534 -0.1271 0.2381  -0.0482 33  LYS E CE  
1882 N NZ  . LYS E 13 ? 2.5220 2.6474 2.0548 -0.1792 0.2507  -0.0768 33  LYS E NZ  
1883 N N   . PHE E 14 ? 2.5161 2.3251 1.9360 -0.1155 0.1967  -0.0095 34  PHE E N   
1884 C CA  . PHE E 14 ? 2.5826 2.3234 1.9366 -0.1263 0.1948  -0.0131 34  PHE E CA  
1885 C C   . PHE E 14 ? 2.6020 2.3065 1.9580 -0.0865 0.1742  -0.0036 34  PHE E C   
1886 O O   . PHE E 14 ? 2.6619 2.3358 1.9843 -0.0849 0.1698  -0.0032 34  PHE E O   
1887 C CB  . PHE E 14 ? 2.6566 2.3013 1.9141 -0.1557 0.2095  -0.0250 34  PHE E CB  
1888 C CG  . PHE E 14 ? 2.7157 2.2742 1.8847 -0.1712 0.2195  -0.0302 34  PHE E CG  
1889 C CD1 . PHE E 14 ? 2.7137 2.2994 1.8709 -0.2191 0.2437  -0.0482 34  PHE E CD1 
1890 C CD2 . PHE E 14 ? 2.7631 2.2185 1.8569 -0.1347 0.2062  -0.0221 34  PHE E CD2 
1891 C CE1 . PHE E 14 ? 2.8383 2.3334 1.9072 -0.2385 0.2602  -0.0552 34  PHE E CE1 
1892 C CE2 . PHE E 14 ? 2.8891 2.2491 1.8860 -0.1430 0.2190  -0.0249 34  PHE E CE2 
1893 C CZ  . PHE E 14 ? 2.9312 2.3026 1.9141 -0.1990 0.2489  -0.0399 34  PHE E CZ  
1894 N N   . GLU E 15 ? 2.5799 2.2949 1.9760 -0.0573 0.1640  -0.0025 35  GLU E N   
1895 C CA  . GLU E 15 ? 2.5962 2.3070 2.0110 -0.0234 0.1477  -0.0068 35  GLU E CA  
1896 C C   . GLU E 15 ? 2.5490 2.3152 2.0261 -0.0179 0.1533  0.0022  35  GLU E C   
1897 O O   . GLU E 15 ? 2.5336 2.2946 2.0133 -0.0019 0.1436  -0.0018 35  GLU E O   
1898 C CB  . GLU E 15 ? 2.5950 2.3178 2.0408 -0.0020 0.1418  -0.0215 35  GLU E CB  
1899 C CG  . GLU E 15 ? 2.6344 2.3774 2.1087 0.0279  0.1284  -0.0419 35  GLU E CG  
1900 C CD  . GLU E 15 ? 2.6940 2.4598 2.1899 0.0470  0.1220  -0.0711 35  GLU E CD  
1901 O OE1 . GLU E 15 ? 2.8028 2.5289 2.2346 0.0643  0.1072  -0.0788 35  GLU E OE1 
1902 O OE2 . GLU E 15 ? 2.7081 2.5283 2.2790 0.0445  0.1360  -0.0898 35  GLU E OE2 
1903 N N   . GLU E 16 ? 2.5123 2.3291 2.0308 -0.0255 0.1700  0.0132  36  GLU E N   
1904 C CA  . GLU E 16 ? 2.4720 2.3301 2.0279 -0.0121 0.1800  0.0254  36  GLU E CA  
1905 C C   . GLU E 16 ? 2.4756 2.3444 2.0036 -0.0230 0.1736  0.0279  36  GLU E C   
1906 O O   . GLU E 16 ? 2.4561 2.3353 1.9979 -0.0085 0.1728  0.0343  36  GLU E O   
1907 C CB  . GLU E 16 ? 2.4538 2.3558 2.0405 -0.0016 0.1997  0.0360  36  GLU E CB  
1908 C CG  . GLU E 16 ? 2.4435 2.3278 2.0625 0.0116  0.2175  0.0346  36  GLU E CG  
1909 C CD  . GLU E 16 ? 2.4588 2.3671 2.0881 0.0252  0.2381  0.0454  36  GLU E CD  
1910 O OE1 . GLU E 16 ? 2.4625 2.4008 2.0807 0.0137  0.2302  0.0425  36  GLU E OE1 
1911 O OE2 . GLU E 16 ? 2.4490 2.3399 2.0898 0.0479  0.2665  0.0546  36  GLU E OE2 
1912 N N   . ALA E 17 ? 2.4964 2.3609 1.9831 -0.0530 0.1741  0.0185  37  ALA E N   
1913 C CA  . ALA E 17 ? 2.5249 2.3905 1.9772 -0.0742 0.1742  0.0112  37  ALA E CA  
1914 C C   . ALA E 17 ? 2.5564 2.3509 1.9703 -0.0645 0.1609  0.0128  37  ALA E C   
1915 O O   . ALA E 17 ? 2.5606 2.3700 1.9806 -0.0588 0.1570  0.0160  37  ALA E O   
1916 C CB  . ALA E 17 ? 2.5628 2.4193 1.9674 -0.1198 0.1890  -0.0092 37  ALA E CB  
1917 N N   . GLN E 18 ? 2.5940 2.3164 1.9649 -0.0561 0.1527  0.0085  38  GLN E N   
1918 C CA  . GLN E 18 ? 2.6456 2.2981 1.9613 -0.0351 0.1374  0.0048  38  GLN E CA  
1919 C C   . GLN E 18 ? 2.5896 2.2811 1.9613 -0.0041 0.1233  0.0057  38  GLN E C   
1920 O O   . GLN E 18 ? 2.6116 2.2748 1.9518 0.0083  0.1125  0.0031  38  GLN E O   
1921 C CB  . GLN E 18 ? 2.7077 2.2918 1.9649 -0.0154 0.1291  -0.0036 38  GLN E CB  
1922 C CG  . GLN E 18 ? 2.8212 2.3174 1.9845 0.0166  0.1149  -0.0099 38  GLN E CG  
1923 C CD  . GLN E 18 ? 2.9335 2.3423 1.9985 -0.0123 0.1351  -0.0061 38  GLN E CD  
1924 O OE1 . GLN E 18 ? 2.9104 2.3150 1.9627 -0.0625 0.1627  -0.0073 38  GLN E OE1 
1925 N NE2 . GLN E 18 ? 3.0032 2.3450 1.9964 0.0174  0.1252  -0.0073 38  GLN E NE2 
1926 N N   . GLU E 19 ? 2.5188 2.2673 1.9664 0.0059  0.1287  0.0067  39  GLU E N   
1927 C CA  . GLU E 19 ? 2.4730 2.2551 1.9724 0.0236  0.1289  0.0038  39  GLU E CA  
1928 C C   . GLU E 19 ? 2.4554 2.2682 1.9711 0.0173  0.1387  0.0210  39  GLU E C   
1929 O O   . GLU E 19 ? 2.4282 2.2513 1.9640 0.0291  0.1382  0.0203  39  GLU E O   
1930 C CB  . GLU E 19 ? 2.4300 2.2428 1.9894 0.0299  0.1447  -0.0052 39  GLU E CB  
1931 C CG  . GLU E 19 ? 2.4706 2.2744 2.0233 0.0415  0.1317  -0.0326 39  GLU E CG  
1932 C CD  . GLU E 19 ? 2.5125 2.3529 2.1297 0.0403  0.1530  -0.0539 39  GLU E CD  
1933 O OE1 . GLU E 19 ? 2.5247 2.3761 2.1795 0.0317  0.1828  -0.0435 39  GLU E OE1 
1934 O OE2 . GLU E 19 ? 2.6202 2.4737 2.2423 0.0494  0.1438  -0.0838 39  GLU E OE2 
1935 N N   . ALA E 20 ? 2.4747 2.3117 1.9818 0.0004  0.1478  0.0311  40  ALA E N   
1936 C CA  . ALA E 20 ? 2.4642 2.3457 1.9780 -0.0011 0.1528  0.0394  40  ALA E CA  
1937 C C   . ALA E 20 ? 2.4960 2.3449 1.9666 -0.0138 0.1410  0.0325  40  ALA E C   
1938 O O   . ALA E 20 ? 2.4674 2.3404 1.9502 -0.0054 0.1394  0.0373  40  ALA E O   
1939 C CB  . ALA E 20 ? 2.4630 2.4006 1.9779 -0.0150 0.1631  0.0371  40  ALA E CB  
1940 N N   . LEU E 21 ? 2.5519 2.3351 1.9612 -0.0309 0.1360  0.0220  41  LEU E N   
1941 C CA  . LEU E 21 ? 2.6029 2.3254 1.9479 -0.0379 0.1301  0.0160  41  LEU E CA  
1942 C C   . LEU E 21 ? 2.5826 2.2866 1.9357 -0.0015 0.1104  0.0159  41  LEU E C   
1943 O O   . LEU E 21 ? 2.5752 2.2767 1.9188 0.0017  0.1053  0.0167  41  LEU E O   
1944 C CB  . LEU E 21 ? 2.7040 2.3326 1.9546 -0.0579 0.1387  0.0063  41  LEU E CB  
1945 C CG  . LEU E 21 ? 2.7509 2.3925 1.9852 -0.1047 0.1645  -0.0045 41  LEU E CG  
1946 C CD1 . LEU E 21 ? 2.8495 2.3652 1.9648 -0.1285 0.1841  -0.0150 41  LEU E CD1 
1947 C CD2 . LEU E 21 ? 2.7374 2.4674 2.0095 -0.1350 0.1780  -0.0155 41  LEU E CD2 
1948 N N   . ARG E 22 ? 2.5581 2.2602 1.9319 0.0239  0.1006  0.0085  42  ARG E N   
1949 C CA  . ARG E 22 ? 2.5503 2.2654 1.9484 0.0557  0.0848  -0.0054 42  ARG E CA  
1950 C C   . ARG E 22 ? 2.4862 2.2566 1.9488 0.0536  0.0941  0.0016  42  ARG E C   
1951 O O   . ARG E 22 ? 2.4698 2.2414 1.9311 0.0671  0.0836  -0.0062 42  ARG E O   
1952 C CB  . ARG E 22 ? 2.5479 2.2851 1.9795 0.0744  0.0804  -0.0260 42  ARG E CB  
1953 C CG  . ARG E 22 ? 2.6948 2.3786 2.0521 0.1004  0.0618  -0.0415 42  ARG E CG  
1954 C CD  . ARG E 22 ? 2.7713 2.5080 2.1746 0.1265  0.0522  -0.0760 42  ARG E CD  
1955 N NE  . ARG E 22 ? 2.8751 2.5709 2.2003 0.1671  0.0301  -0.0944 42  ARG E NE  
1956 C CZ  . ARG E 22 ? 2.8778 2.6289 2.2258 0.2021  0.0142  -0.1356 42  ARG E CZ  
1957 N NH1 . ARG E 22 ? 2.8220 2.6692 2.2740 0.1893  0.0243  -0.1675 42  ARG E NH1 
1958 N NH2 . ARG E 22 ? 2.9453 2.6541 2.2044 0.2511  -0.0077 -0.1497 42  ARG E NH2 
1959 N N   . GLN E 23 ? 2.4327 2.2427 1.9415 0.0424  0.1153  0.0162  43  GLN E N   
1960 C CA  . GLN E 23 ? 2.3754 2.2212 1.9244 0.0480  0.1308  0.0277  43  GLN E CA  
1961 C C   . GLN E 23 ? 2.3715 2.2245 1.8961 0.0432  0.1230  0.0371  43  GLN E C   
1962 O O   . GLN E 23 ? 2.3250 2.1832 1.8610 0.0531  0.1207  0.0358  43  GLN E O   
1963 C CB  . GLN E 23 ? 2.3526 2.2247 1.9286 0.0507  0.1564  0.0439  43  GLN E CB  
1964 C CG  . GLN E 23 ? 2.3343 2.1960 1.9418 0.0539  0.1758  0.0331  43  GLN E CG  
1965 C CD  . GLN E 23 ? 2.3263 2.1957 1.9388 0.0579  0.1972  0.0484  43  GLN E CD  
1966 O OE1 . GLN E 23 ? 2.4069 2.3037 2.0026 0.0614  0.1936  0.0634  43  GLN E OE1 
1967 N NE2 . GLN E 23 ? 2.2453 2.0977 1.8809 0.0573  0.2216  0.0385  43  GLN E NE2 
1968 N N   . ALA E 24 ? 2.4027 2.2607 1.8954 0.0236  0.1224  0.0406  44  ALA E N   
1969 C CA  . ALA E 24 ? 2.4008 2.2759 1.8720 0.0109  0.1202  0.0404  44  ALA E CA  
1970 C C   . ALA E 24 ? 2.4179 2.2471 1.8597 0.0166  0.1053  0.0342  44  ALA E C   
1971 O O   . ALA E 24 ? 2.3718 2.2265 1.8356 0.0280  0.1035  0.0388  44  ALA E O   
1972 C CB  . ALA E 24 ? 2.4304 2.3051 1.8613 -0.0245 0.1277  0.0287  44  ALA E CB  
1973 N N   . GLU E 25 ? 2.4740 2.2316 1.8573 0.0151  0.0953  0.0238  45  GLU E N   
1974 C CA  . GLU E 25 ? 2.5124 2.2156 1.8421 0.0257  0.0819  0.0168  45  GLU E CA  
1975 C C   . GLU E 25 ? 2.4707 2.1842 1.8286 0.0631  0.0632  0.0068  45  GLU E C   
1976 O O   . GLU E 25 ? 2.4470 2.1574 1.7959 0.0735  0.0539  0.0036  45  GLU E O   
1977 C CB  . GLU E 25 ? 2.6191 2.2221 1.8450 0.0174  0.0852  0.0097  45  GLU E CB  
1978 C CG  . GLU E 25 ? 2.7342 2.3263 1.9253 -0.0333 0.1125  0.0068  45  GLU E CG  
1979 C CD  . GLU E 25 ? 2.9754 2.4498 2.0534 -0.0505 0.1306  -0.0012 45  GLU E CD  
1980 O OE1 . GLU E 25 ? 3.0654 2.4987 2.1176 -0.0276 0.1237  0.0005  45  GLU E OE1 
1981 O OE2 . GLU E 25 ? 3.1528 2.5700 2.1606 -0.0886 0.1570  -0.0119 45  GLU E OE2 
1982 N N   . GLU E 26 ? 2.4330 2.1677 1.8277 0.0797  0.0599  -0.0046 46  GLU E N   
1983 C CA  . GLU E 26 ? 2.3911 2.1585 1.8223 0.1075  0.0475  -0.0296 46  GLU E CA  
1984 C C   . GLU E 26 ? 2.3206 2.1431 1.8239 0.0981  0.0647  -0.0264 46  GLU E C   
1985 O O   . GLU E 26 ? 2.2671 2.1125 1.7898 0.1115  0.0576  -0.0468 46  GLU E O   
1986 C CB  . GLU E 26 ? 2.3919 2.1795 1.8454 0.1224  0.0441  -0.0548 46  GLU E CB  
1987 C CG  . GLU E 26 ? 2.3964 2.2322 1.8779 0.1515  0.0289  -0.0979 46  GLU E CG  
1988 C CD  . GLU E 26 ? 2.4725 2.3492 1.9815 0.1653  0.0261  -0.1349 46  GLU E CD  
1989 O OE1 . GLU E 26 ? 2.6077 2.4480 2.0757 0.1713  0.0210  -0.1261 46  GLU E OE1 
1990 O OE2 . GLU E 26 ? 2.4811 2.4310 2.0537 0.1669  0.0323  -0.1784 46  GLU E OE2 
1991 N N   . GLU E 27 ? 2.2861 2.1268 1.8201 0.0800  0.0891  -0.0030 47  GLU E N   
1992 C CA  . GLU E 27 ? 2.2451 2.1143 1.8189 0.0790  0.1110  0.0076  47  GLU E CA  
1993 C C   . GLU E 27 ? 2.2285 2.1000 1.7787 0.0787  0.1008  0.0215  47  GLU E C   
1994 O O   . GLU E 27 ? 2.1773 2.0602 1.7437 0.0855  0.1024  0.0164  47  GLU E O   
1995 C CB  . GLU E 27 ? 2.2517 2.1315 1.8436 0.0761  0.1399  0.0294  47  GLU E CB  
1996 C CG  . GLU E 27 ? 2.3083 2.1816 1.9251 0.0726  0.1583  0.0163  47  GLU E CG  
1997 C CD  . GLU E 27 ? 2.3819 2.2549 1.9980 0.0765  0.1834  0.0408  47  GLU E CD  
1998 O OE1 . GLU E 27 ? 2.4766 2.3692 2.0731 0.0848  0.1800  0.0632  47  GLU E OE1 
1999 O OE2 . GLU E 27 ? 2.4365 2.2961 2.0704 0.0733  0.2073  0.0329  47  GLU E OE2 
2000 N N   . ARG E 28 ? 2.2484 2.1129 1.7613 0.0660  0.0941  0.0336  48  ARG E N   
2001 C CA  . ARG E 28 ? 2.2269 2.0981 1.7155 0.0585  0.0876  0.0386  48  ARG E CA  
2002 C C   . ARG E 28 ? 2.2148 2.0504 1.6759 0.0682  0.0683  0.0247  48  ARG E C   
2003 O O   . ARG E 28 ? 2.1884 2.0372 1.6494 0.0688  0.0656  0.0275  48  ARG E O   
2004 C CB  . ARG E 28 ? 2.2632 2.1302 1.7112 0.0313  0.0907  0.0379  48  ARG E CB  
2005 C CG  . ARG E 28 ? 2.3115 2.1891 1.7334 0.0140  0.0904  0.0330  48  ARG E CG  
2006 C CD  . ARG E 28 ? 2.3359 2.2609 1.7490 -0.0178 0.1057  0.0227  48  ARG E CD  
2007 N NE  . ARG E 28 ? 2.3819 2.2442 1.7380 -0.0502 0.1154  0.0090  48  ARG E NE  
2008 C CZ  . ARG E 28 ? 2.4169 2.3063 1.7529 -0.0924 0.1358  -0.0126 48  ARG E CZ  
2009 N NH1 . ARG E 28 ? 2.3029 2.3022 1.6784 -0.1026 0.1430  -0.0275 48  ARG E NH1 
2010 N NH2 . ARG E 28 ? 2.5207 2.3311 1.7927 -0.1236 0.1516  -0.0248 48  ARG E NH2 
2011 N N   . LYS E 29 ? 2.2328 2.0285 1.6665 0.0824  0.0537  0.0077  49  LYS E N   
2012 C CA  . LYS E 29 ? 2.2316 2.0059 1.6384 0.1073  0.0325  -0.0113 49  LYS E CA  
2013 C C   . LYS E 29 ? 2.1597 1.9917 1.6351 0.1183  0.0352  -0.0267 49  LYS E C   
2014 O O   . LYS E 29 ? 2.1293 1.9681 1.6017 0.1276  0.0255  -0.0336 49  LYS E O   
2015 C CB  . LYS E 29 ? 2.3049 2.0310 1.6541 0.1342  0.0146  -0.0302 49  LYS E CB  
2016 C CG  . LYS E 29 ? 2.4360 2.0694 1.6829 0.1261  0.0174  -0.0184 49  LYS E CG  
2017 C CD  . LYS E 29 ? 2.5256 2.1066 1.7140 0.1498  0.0103  -0.0282 49  LYS E CD  
2018 C CE  . LYS E 29 ? 2.6036 2.0859 1.6950 0.1235  0.0308  -0.0138 49  LYS E CE  
2019 N NZ  . LYS E 29 ? 2.6603 2.0779 1.6818 0.1481  0.0280  -0.0197 49  LYS E NZ  
2020 N N   . ALA E 30 ? 2.1351 2.0026 1.6676 0.1131  0.0538  -0.0353 50  ALA E N   
2021 C CA  . ALA E 30 ? 2.0842 1.9946 1.6754 0.1118  0.0714  -0.0567 50  ALA E CA  
2022 C C   . ALA E 30 ? 2.0602 1.9761 1.6658 0.1026  0.0920  -0.0310 50  ALA E C   
2023 O O   . ALA E 30 ? 1.9813 1.9155 1.6062 0.1047  0.0956  -0.0465 50  ALA E O   
2024 C CB  . ALA E 30 ? 2.0826 2.0120 1.7186 0.1004  0.0991  -0.0743 50  ALA E CB  
2025 N N   . LYS E 31 ? 2.0881 1.9954 1.6816 0.0967  0.1048  0.0040  51  LYS E N   
2026 C CA  . LYS E 31 ? 2.0751 1.9946 1.6702 0.1007  0.1214  0.0289  51  LYS E CA  
2027 C C   . LYS E 31 ? 2.0409 1.9675 1.6161 0.1024  0.0982  0.0292  51  LYS E C   
2028 O O   . LYS E 31 ? 1.9757 1.9153 1.5620 0.1087  0.1088  0.0347  51  LYS E O   
2029 C CB  . LYS E 31 ? 2.0974 2.0289 1.6778 0.1042  0.1312  0.0565  51  LYS E CB  
2030 C CG  . LYS E 31 ? 2.2001 2.1196 1.7917 0.1089  0.1590  0.0632  51  LYS E CG  
2031 C CD  . LYS E 31 ? 2.3277 2.2725 1.9018 0.1135  0.1557  0.0803  51  LYS E CD  
2032 C CE  . LYS E 31 ? 2.3595 2.2878 1.9387 0.1210  0.1805  0.0870  51  LYS E CE  
2033 N NZ  . LYS E 31 ? 2.3267 2.2895 1.8936 0.1211  0.1710  0.0936  51  LYS E NZ  
2034 N N   . TYR E 32 ? 2.0453 1.9520 1.5817 0.0967  0.0717  0.0233  52  TYR E N   
2035 C CA  . TYR E 32 ? 2.0149 1.9117 1.5197 0.0963  0.0538  0.0206  52  TYR E CA  
2036 C C   . TYR E 32 ? 1.9833 1.8803 1.4995 0.1127  0.0410  -0.0027 52  TYR E C   
2037 O O   . TYR E 32 ? 1.9704 1.8755 1.4832 0.1157  0.0349  -0.0026 52  TYR E O   
2038 C CB  . TYR E 32 ? 2.0644 1.9114 1.5028 0.0843  0.0412  0.0178  52  TYR E CB  
2039 C CG  . TYR E 32 ? 2.1625 1.9745 1.5490 0.0818  0.0298  0.0124  52  TYR E CG  
2040 C CD1 . TYR E 32 ? 2.1856 2.0221 1.5670 0.0588  0.0399  0.0191  52  TYR E CD1 
2041 C CD2 . TYR E 32 ? 2.2444 2.0025 1.5818 0.1068  0.0100  -0.0037 52  TYR E CD2 
2042 C CE1 . TYR E 32 ? 2.2404 2.0381 1.5710 0.0515  0.0352  0.0114  52  TYR E CE1 
2043 C CE2 . TYR E 32 ? 2.3002 2.0109 1.5768 0.1088  0.0035  -0.0071 52  TYR E CE2 
2044 C CZ  . TYR E 32 ? 2.3324 2.0577 1.6068 0.0764  0.0185  0.0013  52  TYR E CZ  
2045 O OH  . TYR E 32 ? 2.4609 2.1337 1.6729 0.0731  0.0177  -0.0046 52  TYR E OH  
2046 N N   . ALA E 33 ? 1.9674 1.8678 1.5002 0.1236  0.0370  -0.0288 53  ALA E N   
2047 C CA  . ALA E 33 ? 1.9304 1.8565 1.4809 0.1409  0.0243  -0.0648 53  ALA E CA  
2048 C C   . ALA E 33 ? 1.8931 1.8554 1.4964 0.1288  0.0505  -0.0679 53  ALA E C   
2049 O O   . ALA E 33 ? 1.8277 1.8065 1.4338 0.1363  0.0401  -0.0819 53  ALA E O   
2050 C CB  . ALA E 33 ? 1.9319 1.8799 1.4978 0.1544  0.0176  -0.1032 53  ALA E CB  
2051 N N   . LYS E 34 ? 1.9031 1.8668 1.5372 0.1127  0.0881  -0.0542 54  LYS E N   
2052 C CA  . LYS E 34 ? 1.9091 1.8805 1.5734 0.1023  0.1263  -0.0562 54  LYS E CA  
2053 C C   . LYS E 34 ? 1.8594 1.8236 1.5029 0.1097  0.1279  -0.0210 54  LYS E C   
2054 O O   . LYS E 34 ? 1.7326 1.7029 1.3883 0.1077  0.1439  -0.0291 54  LYS E O   
2055 C CB  . LYS E 34 ? 1.9652 1.9136 1.6435 0.0895  0.1749  -0.0502 54  LYS E CB  
2056 C CG  . LYS E 34 ? 2.0686 2.0374 1.7826 0.0730  0.1880  -0.0996 54  LYS E CG  
2057 C CD  . LYS E 34 ? 2.1586 2.0901 1.8819 0.0517  0.2527  -0.1016 54  LYS E CD  
2058 C CE  . LYS E 34 ? 2.1589 2.1262 1.9266 0.0259  0.2714  -0.1647 54  LYS E CE  
2059 N NZ  . LYS E 34 ? 2.2218 2.1404 1.9929 -0.0067 0.3500  -0.1792 54  LYS E NZ  
2060 N N   . MET E 35 ? 1.8779 1.8371 1.4915 0.1164  0.1136  0.0116  55  MET E N   
2061 C CA  . MET E 35 ? 1.8696 1.8432 1.4655 0.1251  0.1108  0.0367  55  MET E CA  
2062 C C   . MET E 35 ? 1.7983 1.7800 1.3863 0.1238  0.0824  0.0225  55  MET E C   
2063 O O   . MET E 35 ? 1.7593 1.7554 1.3499 0.1294  0.0875  0.0294  55  MET E O   
2064 C CB  . MET E 35 ? 1.9005 1.8897 1.4728 0.1262  0.1022  0.0578  55  MET E CB  
2065 C CG  . MET E 35 ? 2.0589 2.0490 1.6311 0.1394  0.1298  0.0766  55  MET E CG  
2066 S SD  . MET E 35 ? 2.4430 2.4243 2.0031 0.1723  0.1705  0.0992  55  MET E SD  
2067 C CE  . MET E 35 ? 2.4231 2.4608 1.9719 0.1847  0.1472  0.1056  55  MET E CE  
2068 N N   . GLU E 36 ? 1.7804 1.7455 1.3487 0.1218  0.0539  0.0035  56  GLU E N   
2069 C CA  . GLU E 36 ? 1.7607 1.7200 1.3082 0.1292  0.0284  -0.0128 56  GLU E CA  
2070 C C   . GLU E 36 ? 1.6911 1.6798 1.2794 0.1343  0.0373  -0.0359 56  GLU E C   
2071 O O   . GLU E 36 ? 1.5887 1.5904 1.1808 0.1352  0.0382  -0.0309 56  GLU E O   
2072 C CB  . GLU E 36 ? 1.8293 1.7503 1.3309 0.1416  0.0018  -0.0320 56  GLU E CB  
2073 C CG  . GLU E 36 ? 1.8898 1.7793 1.3376 0.1574  -0.0229 -0.0419 56  GLU E CG  
2074 C CD  . GLU E 36 ? 1.9710 1.8340 1.3795 0.1363  -0.0173 -0.0188 56  GLU E CD  
2075 O OE1 . GLU E 36 ? 1.9109 1.7574 1.2998 0.1144  -0.0045 -0.0046 56  GLU E OE1 
2076 O OE2 . GLU E 36 ? 1.9414 1.8084 1.3417 0.1388  -0.0238 -0.0208 56  GLU E OE2 
2077 N N   . ALA E 37 ? 1.6690 1.6736 1.2893 0.1335  0.0474  -0.0670 57  ALA E N   
2078 C CA  . ALA E 37 ? 1.6186 1.6600 1.2808 0.1286  0.0626  -0.1042 57  ALA E CA  
2079 C C   . ALA E 37 ? 1.6028 1.6359 1.2785 0.1153  0.1019  -0.0816 57  ALA E C   
2080 O O   . ALA E 37 ? 1.5082 1.5602 1.1977 0.1131  0.1063  -0.0980 57  ALA E O   
2081 C CB  . ALA E 37 ? 1.6096 1.6786 1.3095 0.1189  0.0801  -0.1475 57  ALA E CB  
2082 N N   . GLU E 38 ? 1.6233 1.6256 1.2862 0.1128  0.1308  -0.0446 58  GLU E N   
2083 C CA  . GLU E 38 ? 1.6532 1.6313 1.3081 0.1134  0.1754  -0.0222 58  GLU E CA  
2084 C C   . GLU E 38 ? 1.6183 1.6061 1.2476 0.1320  0.1587  0.0104  58  GLU E C   
2085 O O   . GLU E 38 ? 1.5745 1.5449 1.1887 0.1415  0.1903  0.0262  58  GLU E O   
2086 C CB  . GLU E 38 ? 1.7184 1.6549 1.3535 0.1179  0.2148  0.0037  58  GLU E CB  
2087 C CG  . GLU E 38 ? 1.7756 1.7158 1.3747 0.1458  0.2015  0.0496  58  GLU E CG  
2088 C CD  . GLU E 38 ? 1.8504 1.7525 1.4229 0.1609  0.2384  0.0726  58  GLU E CD  
2089 O OE1 . GLU E 38 ? 1.9973 1.8762 1.5851 0.1424  0.2560  0.0549  58  GLU E OE1 
2090 O OE2 . GLU E 38 ? 1.9214 1.8212 1.4540 0.1962  0.2495  0.1058  58  GLU E OE2 
2091 N N   . ARG E 39 ? 1.5743 1.5843 1.1909 0.1367  0.1152  0.0178  59  ARG E N   
2092 C CA  . ARG E 39 ? 1.4906 1.5228 1.0896 0.1468  0.1003  0.0362  59  ARG E CA  
2093 C C   . ARG E 39 ? 1.4192 1.4612 1.0271 0.1414  0.0768  0.0108  59  ARG E C   
2094 O O   . ARG E 39 ? 1.3619 1.4202 0.9649 0.1471  0.0739  0.0188  59  ARG E O   
2095 C CB  . ARG E 39 ? 1.4597 1.5108 1.0355 0.1464  0.0794  0.0514  59  ARG E CB  
2096 C CG  . ARG E 39 ? 1.6018 1.6432 1.1578 0.1315  0.0462  0.0349  59  ARG E CG  
2097 C CD  . ARG E 39 ? 1.7636 1.8100 1.2923 0.1175  0.0398  0.0404  59  ARG E CD  
2098 N NE  . ARG E 39 ? 1.9792 1.9903 1.4662 0.1013  0.0205  0.0252  59  ARG E NE  
2099 C CZ  . ARG E 39 ? 2.1302 2.1128 1.5754 0.0791  0.0205  0.0193  59  ARG E CZ  
2100 N NH1 . ARG E 39 ? 2.1711 2.1755 1.6235 0.0690  0.0328  0.0246  59  ARG E NH1 
2101 N NH2 . ARG E 39 ? 2.2402 2.1634 1.6271 0.0670  0.0128  0.0063  59  ARG E NH2 
2102 N N   . GLU E 40 ? 1.3729 1.4109 0.9904 0.1369  0.0588  -0.0220 60  GLU E N   
2103 C CA  . GLU E 40 ? 1.2994 1.3556 0.9263 0.1414  0.0396  -0.0545 60  GLU E CA  
2104 C C   . GLU E 40 ? 1.2899 1.3635 0.9531 0.1314  0.0750  -0.0704 60  GLU E C   
2105 O O   . GLU E 40 ? 1.2088 1.3039 0.8815 0.1329  0.0681  -0.0876 60  GLU E O   
2106 C CB  . GLU E 40 ? 1.3070 1.3673 0.9290 0.1528  0.0127  -0.0924 60  GLU E CB  
2107 C CG  . GLU E 40 ? 1.3292 1.4297 0.9666 0.1674  -0.0062 -0.1399 60  GLU E CG  
2108 C CD  . GLU E 40 ? 1.4172 1.5054 1.0170 0.1835  -0.0340 -0.1316 60  GLU E CD  
2109 O OE1 . GLU E 40 ? 1.5292 1.5676 1.0732 0.1884  -0.0491 -0.1026 60  GLU E OE1 
2110 O OE2 . GLU E 40 ? 1.2826 1.4097 0.9070 0.1873  -0.0363 -0.1584 60  GLU E OE2 
2111 N N   . ALA E 41 ? 1.3863 1.4409 1.0619 0.1195  0.1188  -0.0660 61  ALA E N   
2112 C CA  . ALA E 41 ? 1.4376 1.4779 1.1255 0.1050  0.1704  -0.0759 61  ALA E CA  
2113 C C   . ALA E 41 ? 1.3997 1.4220 1.0562 0.1218  0.1802  -0.0346 61  ALA E C   
2114 O O   . ALA E 41 ? 1.3800 1.4040 1.0406 0.1167  0.1971  -0.0457 61  ALA E O   
2115 C CB  . ALA E 41 ? 1.5184 1.5162 1.2038 0.0906  0.2231  -0.0756 61  ALA E CB  
2116 N N   . VAL E 42 ? 1.3740 1.3887 0.9995 0.1432  0.1695  0.0079  62  VAL E N   
2117 C CA  . VAL E 42 ? 1.3614 1.3789 0.9552 0.1686  0.1747  0.0427  62  VAL E CA  
2118 C C   . VAL E 42 ? 1.2602 1.3182 0.8662 0.1658  0.1370  0.0315  62  VAL E C   
2119 O O   . VAL E 42 ? 1.2382 1.2990 0.8348 0.1755  0.1494  0.0389  62  VAL E O   
2120 C CB  . VAL E 42 ? 1.3908 1.4244 0.9576 0.1927  0.1636  0.0754  62  VAL E CB  
2121 C CG1 . VAL E 42 ? 1.3786 1.4595 0.9270 0.2166  0.1459  0.0933  62  VAL E CG1 
2122 C CG2 . VAL E 42 ? 1.5393 1.5227 1.0734 0.2129  0.2109  0.0967  62  VAL E CG2 
2123 N N   . ARG E 43 ? 1.1720 1.2501 0.7885 0.1553  0.0944  0.0142  63  ARG E N   
2124 C CA  . ARG E 43 ? 1.1029 1.2034 0.7166 0.1546  0.0601  0.0033  63  ARG E CA  
2125 C C   . ARG E 43 ? 1.1171 1.2256 0.7543 0.1501  0.0687  -0.0236 63  ARG E C   
2126 O O   . ARG E 43 ? 1.1015 1.2268 0.7359 0.1547  0.0610  -0.0209 63  ARG E O   
2127 C CB  . ARG E 43 ? 1.0969 1.1865 0.6942 0.1500  0.0234  -0.0130 63  ARG E CB  
2128 C CG  . ARG E 43 ? 1.2849 1.3691 0.8507 0.1448  0.0143  0.0076  63  ARG E CG  
2129 C CD  . ARG E 43 ? 1.4420 1.4845 0.9702 0.1400  -0.0097 -0.0071 63  ARG E CD  
2130 N NE  . ARG E 43 ? 1.5079 1.5323 1.0407 0.1405  -0.0043 -0.0102 63  ARG E NE  
2131 C CZ  . ARG E 43 ? 1.6605 1.6420 1.1549 0.1448  -0.0212 -0.0228 63  ARG E CZ  
2132 N NH1 . ARG E 43 ? 1.7571 1.6943 1.1934 0.1513  -0.0405 -0.0316 63  ARG E NH1 
2133 N NH2 . ARG E 43 ? 1.7021 1.6755 1.2056 0.1460  -0.0157 -0.0263 63  ARG E NH2 
2134 N N   . GLN E 44 ? 1.2034 1.3087 0.8672 0.1379  0.0871  -0.0560 64  GLN E N   
2135 C CA  . GLN E 44 ? 1.2335 1.3616 0.9258 0.1269  0.0997  -0.0945 64  GLN E CA  
2136 C C   . GLN E 44 ? 1.2252 1.3246 0.9079 0.1211  0.1516  -0.0759 64  GLN E C   
2137 O O   . GLN E 44 ? 1.2059 1.3183 0.8903 0.1217  0.1528  -0.0804 64  GLN E O   
2138 C CB  . GLN E 44 ? 1.2499 1.4046 0.9789 0.1113  0.1074  -0.1508 64  GLN E CB  
2139 C CG  . GLN E 44 ? 1.2376 1.4494 0.9993 0.1063  0.0980  -0.2069 64  GLN E CG  
2140 C CD  . GLN E 44 ? 1.2213 1.4514 0.9605 0.1359  0.0414  -0.2019 64  GLN E CD  
2141 O OE1 . GLN E 44 ? 1.2853 1.4856 0.9838 0.1561  0.0079  -0.1707 64  GLN E OE1 
2142 N NE2 . GLN E 44 ? 1.1118 1.3842 0.8711 0.1357  0.0365  -0.2358 64  GLN E NE2 
2143 N N   . GLY E 45 ? 1.2646 1.3154 0.9260 0.1201  0.1964  -0.0535 65  GLY E N   
2144 C CA  . GLY E 45 ? 1.3064 1.3009 0.9311 0.1241  0.2560  -0.0327 65  GLY E CA  
2145 C C   . GLY E 45 ? 1.2545 1.2644 0.8570 0.1488  0.2395  -0.0057 65  GLY E C   
2146 O O   . GLY E 45 ? 1.1940 1.1860 0.7882 0.1421  0.2701  -0.0151 65  GLY E O   
2147 N N   . ILE E 46 ? 1.2147 1.2615 0.8080 0.1736  0.1938  0.0229  66  ILE E N   
2148 C CA  . ILE E 46 ? 1.1568 1.2324 0.7317 0.1970  0.1772  0.0441  66  ILE E CA  
2149 C C   . ILE E 46 ? 1.0724 1.1869 0.6835 0.1772  0.1436  0.0121  66  ILE E C   
2150 O O   . ILE E 46 ? 1.0579 1.1789 0.6639 0.1822  0.1514  0.0127  66  ILE E O   
2151 C CB  . ILE E 46 ? 1.0990 1.2171 0.6551 0.2235  0.1464  0.0725  66  ILE E CB  
2152 C CG1 . ILE E 46 ? 0.8443 1.0057 0.4269 0.2021  0.0946  0.0538  66  ILE E CG1 
2153 C CG2 . ILE E 46 ? 1.1769 1.2673 0.7078 0.2404  0.1690  0.0927  66  ILE E CG2 
2154 C CD1 . ILE E 46 ? 0.5214 0.7081 0.1148 0.1957  0.0732  0.0398  66  ILE E CD1 
2155 N N   . ARG E 47 ? 1.0507 1.1867 0.6895 0.1611  0.1070  -0.0161 67  ARG E N   
2156 C CA  . ARG E 47 ? 1.0799 1.2476 0.7381 0.1549  0.0745  -0.0463 67  ARG E CA  
2157 C C   . ARG E 47 ? 1.1163 1.2870 0.7940 0.1426  0.1068  -0.0717 67  ARG E C   
2158 O O   . ARG E 47 ? 1.0640 1.2583 0.7457 0.1458  0.0926  -0.0782 67  ARG E O   
2159 C CB  . ARG E 47 ? 1.0746 1.2522 0.7450 0.1512  0.0414  -0.0801 67  ARG E CB  
2160 C CG  . ARG E 47 ? 1.1742 1.3749 0.8409 0.1610  0.0015  -0.1048 67  ARG E CG  
2161 C CD  . ARG E 47 ? 1.5343 1.7369 1.1930 0.1739  -0.0295 -0.1382 67  ARG E CD  
2162 N NE  . ARG E 47 ? 1.6983 1.8780 1.3068 0.1956  -0.0698 -0.1365 67  ARG E NE  
2163 C CZ  . ARG E 47 ? 1.7441 1.8723 1.2995 0.2001  -0.0833 -0.1139 67  ARG E CZ  
2164 N NH1 . ARG E 47 ? 1.5524 1.6625 1.1075 0.1865  -0.0672 -0.0912 67  ARG E NH1 
2165 N NH2 . ARG E 47 ? 1.9413 2.0283 1.4358 0.2172  -0.1084 -0.1164 67  ARG E NH2 
2166 N N   . ASP E 48 ? 1.1993 1.3422 0.8862 0.1238  0.1557  -0.0895 68  ASP E N   
2167 C CA  . ASP E 48 ? 1.2539 1.3893 0.9538 0.1001  0.2023  -0.1219 68  ASP E CA  
2168 C C   . ASP E 48 ? 1.2499 1.3391 0.9023 0.1172  0.2363  -0.0789 68  ASP E C   
2169 O O   . ASP E 48 ? 1.2482 1.3465 0.9045 0.1101  0.2474  -0.0932 68  ASP E O   
2170 C CB  . ASP E 48 ? 1.3353 1.4404 1.0472 0.0669  0.2598  -0.1568 68  ASP E CB  
2171 C CG  . ASP E 48 ? 1.4094 1.5568 1.1569 0.0616  0.2272  -0.1888 68  ASP E CG  
2172 O OD1 . ASP E 48 ? 1.5511 1.7565 1.3179 0.0794  0.1644  -0.2049 68  ASP E OD1 
2173 O OD2 . ASP E 48 ? 1.3805 1.4947 1.1267 0.0433  0.2671  -0.1973 68  ASP E OD2 
2174 N N   . LYS E 49 ? 1.2240 1.2681 0.8273 0.1458  0.2519  -0.0287 69  LYS E N   
2175 C CA  . LYS E 49 ? 1.2381 1.2404 0.7788 0.1813  0.2819  0.0153  69  LYS E CA  
2176 C C   . LYS E 49 ? 1.1737 1.2294 0.7250 0.1933  0.2458  0.0182  69  LYS E C   
2177 O O   . LYS E 49 ? 1.2580 1.2825 0.7680 0.2116  0.2778  0.0348  69  LYS E O   
2178 C CB  . LYS E 49 ? 1.2311 1.2272 0.7296 0.2244  0.2723  0.0613  69  LYS E CB  
2179 C CG  . LYS E 49 ? 1.2282 1.1866 0.6473 0.2801  0.3033  0.1052  69  LYS E CG  
2180 C CD  . LYS E 49 ? 1.3495 1.3249 0.7395 0.3213  0.2888  0.1355  69  LYS E CD  
2181 C CE  . LYS E 49 ? 1.5233 1.4567 0.8165 0.3947  0.3243  0.1770  69  LYS E CE  
2182 N NZ  . LYS E 49 ? 1.3713 1.3280 0.6411 0.4331  0.3125  0.1965  69  LYS E NZ  
2183 N N   . TYR E 50 ? 0.5773 1.3245 0.7255 -0.0690 -0.0692 -0.0549 70  TYR E N   
2184 C CA  . TYR E 50 ? 0.5497 1.4200 0.6654 0.0379  -0.0077 -0.1604 70  TYR E CA  
2185 C C   . TYR E 50 ? 0.5903 1.5283 0.8278 0.0807  0.0552  -0.1244 70  TYR E C   
2186 O O   . TYR E 50 ? 0.6930 1.6637 0.8146 0.2249  0.1310  -0.1960 70  TYR E O   
2187 C CB  . TYR E 50 ? 0.5606 1.2969 0.6899 0.0358  -0.0721 -0.3173 70  TYR E CB  
2188 C CG  . TYR E 50 ? 0.3176 1.0220 0.4738 0.0077  -0.1242 -0.3000 70  TYR E CG  
2189 C CD1 . TYR E 50 ? 0.2874 1.0726 0.2938 0.0479  -0.1665 -0.2793 70  TYR E CD1 
2190 C CD2 . TYR E 50 ? 0.1356 0.7252 0.4858 -0.0224 -0.0929 -0.2583 70  TYR E CD2 
2191 C CE1 . TYR E 50 ? 0.3941 1.1627 0.4848 0.0197  -0.2305 -0.2430 70  TYR E CE1 
2192 C CE2 . TYR E 50 ? 0.2729 0.8643 0.7560 -0.0227 -0.1014 -0.1840 70  TYR E CE2 
2193 C CZ  . TYR E 50 ? 0.2459 0.9357 0.6206 -0.0213 -0.1982 -0.1893 70  TYR E CZ  
2194 O OH  . TYR E 50 ? 0.3042 1.0081 0.8696 -0.0252 -0.2255 -0.0963 70  TYR E OH  
2195 N N   . GLY E 51 ? 0.6479 1.5306 1.0711 -0.0209 -0.0082 -0.0117 71  GLY E N   
2196 C CA  . GLY E 51 ? 0.6662 1.6475 1.3437 -0.0017 0.0210  0.0925  71  GLY E CA  
2197 C C   . GLY E 51 ? 0.7134 1.6211 1.3468 0.0586  0.0630  -0.0677 71  GLY E C   
2198 O O   . GLY E 51 ? 0.8013 1.8347 1.4970 0.1921  0.1924  -0.0499 71  GLY E O   
2199 N N   . ILE E 52 ? 0.7614 1.4391 1.2860 -0.0026 -0.0130 -0.1906 72  ILE E N   
2200 C CA  . ILE E 52 ? 0.8020 1.3927 1.3938 0.0236  0.0018  -0.2780 72  ILE E CA  
2201 C C   . ILE E 52 ? 0.8829 1.3346 1.5481 -0.0434 -0.1000 -0.1560 72  ILE E C   
2202 O O   . ILE E 52 ? 1.0241 1.3546 1.6348 -0.1154 -0.2392 -0.0414 72  ILE E O   
2203 C CB  . ILE E 52 ? 0.7658 1.2018 1.3224 0.0224  0.0060  -0.3882 72  ILE E CB  
2204 C CG1 . ILE E 52 ? 1.1597 1.7133 1.6625 0.0738  -0.0088 -0.4688 72  ILE E CG1 
2205 C CG2 . ILE E 52 ? 1.2258 1.5790 1.9013 0.0364  0.0194  -0.4030 72  ILE E CG2 
2206 C CD1 . ILE E 52 ? 1.2172 1.6739 1.8530 0.0438  -0.0601 -0.5097 72  ILE E CD1 
2207 N N   . LYS E 53 ? 0.9045 1.3059 1.6745 -0.0199 -0.0920 -0.1783 73  LYS E N   
2208 C CA  . LYS E 53 ? 1.0316 1.2440 1.8435 -0.0755 -0.2583 -0.0557 73  LYS E CA  
2209 C C   . LYS E 53 ? 1.1874 1.1343 1.8526 -0.0361 -0.2524 -0.1100 73  LYS E C   
2210 O O   . LYS E 53 ? 1.1620 1.0932 1.7940 0.0207  -0.1020 -0.2070 73  LYS E O   
2211 C CB  . LYS E 53 ? 0.9210 1.4268 2.2008 -0.0786 -0.2711 0.1158  73  LYS E CB  
2212 C CG  . LYS E 53 ? 1.5646 2.1219 3.0350 -0.1531 -0.4083 0.2931  73  LYS E CG  
2213 C CD  . LYS E 53 ? 1.6043 2.4607 3.7478 -0.1542 -0.4261 0.5830  73  LYS E CD  
2214 C CE  . LYS E 53 ? 1.5760 2.6590 4.2118 -0.2203 -0.5056 0.8928  73  LYS E CE  
2215 N NZ  . LYS E 53 ? 0.1254 1.6097 3.6207 -0.1681 -0.4074 1.2797  73  LYS E NZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  24  ?   ?   ?   A . n 
A 1 2  PRO 2  25  ?   ?   ?   A . n 
A 1 3  LEU 3  26  ?   ?   ?   A . n 
A 1 4  GLY 4  27  27  GLY GLY A . n 
A 1 5  SER 5  28  28  SER SER A . n 
A 1 6  ASN 6  29  29  ASN ASN A . n 
A 1 7  ARG 7  30  30  ARG ARG A . n 
A 1 8  ARG 8  31  31  ARG ARG A . n 
A 1 9  LEU 9  32  32  LEU LEU A . n 
A 1 10 GLN 10 33  33  GLN GLN A . n 
A 1 11 GLN 11 34  34  GLN GLN A . n 
A 1 12 THR 12 35  35  THR THR A . n 
A 1 13 GLN 13 36  36  GLN GLN A . n 
A 1 14 ALA 14 37  37  ALA ALA A . n 
A 1 15 GLN 15 38  38  GLN GLN A . n 
A 1 16 VAL 16 39  39  VAL VAL A . n 
A 1 17 ASP 17 40  40  ASP ASP A . n 
A 1 18 GLU 18 41  41  GLU GLU A . n 
A 1 19 VAL 19 42  42  VAL VAL A . n 
A 1 20 VAL 20 43  43  VAL VAL A . n 
A 1 21 ASP 21 44  44  ASP ASP A . n 
A 1 22 ILE 22 45  45  ILE ILE A . n 
A 1 23 MET 23 46  46  MET MET A . n 
A 1 24 ARG 24 47  47  ARG ARG A . n 
A 1 25 VAL 25 48  48  VAL VAL A . n 
A 1 26 ASN 26 49  49  ASN ASN A . n 
A 1 27 VAL 27 50  50  VAL VAL A . n 
A 1 28 ASP 28 51  51  ASP ASP A . n 
A 1 29 LYS 29 52  52  LYS LYS A . n 
A 1 30 VAL 30 53  53  VAL VAL A . n 
A 1 31 LEU 31 54  54  LEU LEU A . n 
A 1 32 GLU 32 55  55  GLU GLU A . n 
A 1 33 ARG 33 56  56  ARG ARG A . n 
A 1 34 ASP 34 57  57  ASP ASP A . n 
A 1 35 GLN 35 58  58  GLN GLN A . n 
A 1 36 LYS 36 59  59  LYS LYS A . n 
A 1 37 LEU 37 60  60  LEU LEU A . n 
B 2 1  GLY 1  189 189 GLY GLY B . n 
B 2 2  SER 2  190 190 SER SER B . n 
B 2 3  ALA 3  191 191 ALA ALA B . n 
B 2 4  LEU 4  192 192 LEU LEU B . n 
B 2 5  SER 5  193 193 SER SER B . n 
B 2 6  GLU 6  194 194 GLU GLU B . n 
B 2 7  ILE 7  195 195 ILE ILE B . n 
B 2 8  GLU 8  196 196 GLU GLU B . n 
B 2 9  THR 9  197 197 THR THR B . n 
B 2 10 ARG 10 198 198 ARG ARG B . n 
B 2 11 HIS 11 199 199 HIS HIS B . n 
B 2 12 SER 12 200 200 SER SER B . n 
B 2 13 GLU 13 201 201 GLU GLU B . n 
B 2 14 ILE 14 202 202 ILE ILE B . n 
B 2 15 ILE 15 203 203 ILE ILE B . n 
B 2 16 LYS 16 204 204 LYS LYS B . n 
B 2 17 LEU 17 205 205 LEU LEU B . n 
B 2 18 GLU 18 206 206 GLU GLU B . n 
B 2 19 ASN 19 207 207 ASN ASN B . n 
B 2 20 SER 20 208 208 SER SER B . n 
B 2 21 ILE 21 209 209 ILE ILE B . n 
B 2 22 ARG 22 210 210 ARG ARG B . n 
B 2 23 GLU 23 211 211 GLU GLU B . n 
B 2 24 LEU 24 212 212 LEU LEU B . n 
B 2 25 HIS 25 213 213 HIS HIS B . n 
B 2 26 ASP 26 214 214 ASP ASP B . n 
B 2 27 MET 27 215 215 MET MET B . n 
B 2 28 PHE 28 216 216 PHE PHE B . n 
B 2 29 MET 29 217 217 MET MET B . n 
B 2 30 ASP 30 218 218 ASP ASP B . n 
B 2 31 MET 31 219 219 MET MET B . n 
B 2 32 ALA 32 220 220 ALA ALA B . n 
B 2 33 MET 33 221 221 MET MET B . n 
B 2 34 LEU 34 222 222 LEU LEU B . n 
B 2 35 VAL 35 223 223 VAL VAL B . n 
B 2 36 GLU 36 224 224 GLU GLU B . n 
B 2 37 SER 37 225 225 SER SER B . n 
B 2 38 GLN 38 226 226 GLN GLN B . n 
B 2 39 GLY 39 227 227 GLY GLY B . n 
B 2 40 GLU 40 228 228 GLU GLU B . n 
B 2 41 MET 41 229 229 MET MET B . n 
B 2 42 ILE 42 230 230 ILE ILE B . n 
B 2 43 ASP 43 231 231 ASP ASP B . n 
B 2 44 ARG 44 232 232 ARG ARG B . n 
B 2 45 ILE 45 233 233 ILE ILE B . n 
B 2 46 GLU 46 234 234 GLU GLU B . n 
B 2 47 TYR 47 235 235 TYR TYR B . n 
B 2 48 ASN 48 236 236 ASN ASN B . n 
B 2 49 VAL 49 237 237 VAL VAL B . n 
B 2 50 GLU 50 238 238 GLU GLU B . n 
B 2 51 HIS 51 239 239 HIS HIS B . n 
B 2 52 ALA 52 240 240 ALA ALA B . n 
B 2 53 VAL 53 241 241 VAL VAL B . n 
B 2 54 ASP 54 242 242 ASP ASP B . n 
B 2 55 TYR 55 243 243 TYR TYR B . n 
B 2 56 VAL 56 244 244 VAL VAL B . n 
B 2 57 GLU 57 245 245 GLU GLU B . n 
B 2 58 ARG 58 246 246 ARG ARG B . n 
B 2 59 ALA 59 247 247 ALA ALA B . n 
B 2 60 VAL 60 248 248 VAL VAL B . n 
B 2 61 SER 61 249 249 SER SER B . n 
B 2 62 ASP 62 250 250 ASP ASP B . n 
B 2 63 THR 63 251 ?   ?   ?   B . n 
B 2 64 LYS 64 252 ?   ?   ?   B . n 
B 2 65 LYS 65 253 ?   ?   ?   B . n 
C 3 1  GLY 1  3   ?   ?   ?   C . n 
C 3 2  SER 2  4   ?   ?   ?   C . n 
C 3 3  HIS 3  5   ?   ?   ?   C . n 
C 3 4  MET 4  6   ?   ?   ?   C . n 
C 3 5  MET 5  7   ?   ?   ?   C . n 
C 3 6  ARG 6  8   ?   ?   ?   C . n 
C 3 7  ASN 7  9   ?   ?   ?   C . n 
C 3 8  GLU 8  10  10  GLU GLU C . n 
C 3 9  LEU 9  11  11  LEU LEU C . n 
C 3 10 GLU 10 12  12  GLU GLU C . n 
C 3 11 GLU 11 13  13  GLU GLU C . n 
C 3 12 MET 12 14  14  MET MET C . n 
C 3 13 GLN 13 15  15  GLN GLN C . n 
C 3 14 ARG 14 16  16  ARG ARG C . n 
C 3 15 ARG 15 17  17  ARG ARG C . n 
C 3 16 ALA 16 18  18  ALA ALA C . n 
C 3 17 ASP 17 19  19  ASP ASP C . n 
C 3 18 GLN 18 20  20  GLN GLN C . n 
C 3 19 LEU 19 21  21  LEU LEU C . n 
C 3 20 ALA 20 22  22  ALA ALA C . n 
C 3 21 ASP 21 23  23  ASP ASP C . n 
C 3 22 GLU 22 24  24  GLU GLU C . n 
C 3 23 SER 23 25  25  SER SER C . n 
C 3 24 LEU 24 26  26  LEU LEU C . n 
C 3 25 GLU 25 27  27  GLU GLU C . n 
C 3 26 SER 26 28  28  SER SER C . n 
C 3 27 THR 27 29  29  THR THR C . n 
C 3 28 ARG 28 30  30  ARG ARG C . n 
C 3 29 ARG 29 31  31  ARG ARG C . n 
C 3 30 MET 30 32  32  MET MET C . n 
C 3 31 LEU 31 33  33  LEU LEU C . n 
C 3 32 GLN 32 34  34  GLN GLN C . n 
C 3 33 LEU 33 35  35  LEU LEU C . n 
C 3 34 VAL 34 36  36  VAL VAL C . n 
C 3 35 GLU 35 37  37  GLU GLU C . n 
C 3 36 GLU 36 38  38  GLU GLU C . n 
C 3 37 SER 37 39  39  SER SER C . n 
C 3 38 LYS 38 40  40  LYS LYS C . n 
C 3 39 ASP 39 41  41  ASP ASP C . n 
C 3 40 ALA 40 42  42  ALA ALA C . n 
C 3 41 GLY 41 43  43  GLY GLY C . n 
C 3 42 ILE 42 44  44  ILE ILE C . n 
C 3 43 ARG 43 45  45  ARG ARG C . n 
C 3 44 THR 44 46  46  THR THR C . n 
C 3 45 LEU 45 47  47  LEU LEU C . n 
C 3 46 VAL 46 48  48  VAL VAL C . n 
C 3 47 MET 47 49  49  MET MET C . n 
C 3 48 LEU 48 50  50  LEU LEU C . n 
C 3 49 ASP 49 51  51  ASP ASP C . n 
C 3 50 GLU 50 52  52  GLU GLU C . n 
C 3 51 GLN 51 53  53  GLN GLN C . n 
C 3 52 GLY 52 54  54  GLY GLY C . n 
C 3 53 GLU 53 55  55  GLU GLU C . n 
C 3 54 GLN 54 56  56  GLN GLN C . n 
C 3 55 LEU 55 57  57  LEU LEU C . n 
C 3 56 ASP 56 58  58  ASP ASP C . n 
C 3 57 ARG 57 59  59  ARG ARG C . n 
C 3 58 VAL 58 60  60  VAL VAL C . n 
C 3 59 GLU 59 61  61  GLU GLU C . n 
C 3 60 GLU 60 62  62  GLU GLU C . n 
C 3 61 GLY 61 63  63  GLY GLY C . n 
C 3 62 MET 62 64  64  MET MET C . n 
C 3 63 ASN 63 65  65  ASN ASN C . n 
C 3 64 HIS 64 66  66  HIS HIS C . n 
C 3 65 ILE 65 67  67  ILE ILE C . n 
C 3 66 ASN 66 68  68  ASN ASN C . n 
C 3 67 GLN 67 69  69  GLN GLN C . n 
C 3 68 ASP 68 70  70  ASP ASP C . n 
C 3 69 MET 69 71  71  MET MET C . n 
C 3 70 LYS 70 72  72  LYS LYS C . n 
C 3 71 GLU 71 73  73  GLU GLU C . n 
C 3 72 ALA 72 74  74  ALA ALA C . n 
C 3 73 GLU 73 75  ?   ?   ?   C . n 
C 3 74 LYS 74 76  ?   ?   ?   C . n 
C 3 75 ASN 75 77  ?   ?   ?   C . n 
C 3 76 LEU 76 78  ?   ?   ?   C . n 
C 3 77 LYS 77 79  ?   ?   ?   C . n 
C 3 78 ASP 78 80  ?   ?   ?   C . n 
C 3 79 LEU 79 81  ?   ?   ?   C . n 
C 3 80 GLY 80 82  ?   ?   ?   C . n 
C 3 81 TRP 81 83  ?   ?   ?   C . n 
D 4 1  GLY 1  139 139 GLY GLY D . n 
D 4 2  SER 2  140 140 SER SER D . n 
D 4 3  ALA 3  141 141 ALA ALA D . n 
D 4 4  ARG 4  142 142 ARG ARG D . n 
D 4 5  GLU 5  143 143 GLU GLU D . n 
D 4 6  ASN 6  144 144 ASN ASN D . n 
D 4 7  GLU 7  145 145 GLU GLU D . n 
D 4 8  MET 8  146 146 MET MET D . n 
D 4 9  ASP 9  147 147 ASP ASP D . n 
D 4 10 GLU 10 148 148 GLU GLU D . n 
D 4 11 ASN 11 149 149 ASN ASN D . n 
D 4 12 LEU 12 150 150 LEU LEU D . n 
D 4 13 GLU 13 151 151 GLU GLU D . n 
D 4 14 GLN 14 152 152 GLN GLN D . n 
D 4 15 VAL 15 153 153 VAL VAL D . n 
D 4 16 SER 16 154 154 SER SER D . n 
D 4 17 GLY 17 155 155 GLY GLY D . n 
D 4 18 ILE 18 156 156 ILE ILE D . n 
D 4 19 ILE 19 157 157 ILE ILE D . n 
D 4 20 GLY 20 158 158 GLY GLY D . n 
D 4 21 ASN 21 159 159 ASN ASN D . n 
D 4 22 LEU 22 160 160 LEU LEU D . n 
D 4 23 ARG 23 161 161 ARG ARG D . n 
D 4 24 HIS 24 162 162 HIS HIS D . n 
D 4 25 MET 25 163 163 MET MET D . n 
D 4 26 ALA 26 164 164 ALA ALA D . n 
D 4 27 LEU 27 165 165 LEU LEU D . n 
D 4 28 ASP 28 166 166 ASP ASP D . n 
D 4 29 MET 29 167 167 MET MET D . n 
D 4 30 GLY 30 168 168 GLY GLY D . n 
D 4 31 ASN 31 169 169 ASN ASN D . n 
D 4 32 GLU 32 170 170 GLU GLU D . n 
D 4 33 ILE 33 171 171 ILE ILE D . n 
D 4 34 ASP 34 172 172 ASP ASP D . n 
D 4 35 THR 35 173 173 THR THR D . n 
D 4 36 GLN 36 174 174 GLN GLN D . n 
D 4 37 ASN 37 175 175 ASN ASN D . n 
D 4 38 ARG 38 176 176 ARG ARG D . n 
D 4 39 GLN 39 177 177 GLN GLN D . n 
D 4 40 ILE 40 178 178 ILE ILE D . n 
D 4 41 ASP 41 179 179 ASP ASP D . n 
D 4 42 ARG 42 180 180 ARG ARG D . n 
D 4 43 ILE 43 181 181 ILE ILE D . n 
D 4 44 MET 44 182 182 MET MET D . n 
D 4 45 GLU 45 183 183 GLU GLU D . n 
D 4 46 LYS 46 184 184 LYS LYS D . n 
D 4 47 ALA 47 185 185 ALA ALA D . n 
D 4 48 ASP 48 186 186 ASP ASP D . n 
D 4 49 SER 49 187 187 SER SER D . n 
D 4 50 ASN 50 188 188 ASN ASN D . n 
D 4 51 LYS 51 189 189 LYS LYS D . n 
D 4 52 THR 52 190 190 THR THR D . n 
D 4 53 ARG 53 191 191 ARG ARG D . n 
D 4 54 ILE 54 192 192 ILE ILE D . n 
D 4 55 ASP 55 193 193 ASP ASP D . n 
D 4 56 GLU 56 194 194 GLU GLU D . n 
D 4 57 ALA 57 195 195 ALA ALA D . n 
D 4 58 ASN 58 196 196 ASN ASN D . n 
D 4 59 GLN 59 197 197 GLN GLN D . n 
D 4 60 ARG 60 198 198 ARG ARG D . n 
D 4 61 ALA 61 199 199 ALA ALA D . n 
D 4 62 THR 62 200 200 THR THR D . n 
D 4 63 LYS 63 201 201 LYS ALA D . n 
D 4 64 MET 64 202 202 MET MET D . n 
D 4 65 LEU 65 203 203 LEU LEU D . n 
E 5 1  GLY 1  21  ?   ?   ?   E . n 
E 5 2  PRO 2  22  ?   ?   ?   E . n 
E 5 3  LEU 3  23  ?   ?   ?   E . n 
E 5 4  GLY 4  24  24  GLY GLY E . n 
E 5 5  SER 5  25  25  SER SER E . n 
E 5 6  LYS 6  26  26  LYS LYS E . n 
E 5 7  LEU 7  27  27  LEU LEU E . n 
E 5 8  PRO 8  28  28  PRO PRO E . n 
E 5 9  ASP 9  29  29  ASP ASP E . n 
E 5 10 ALA 10 30  30  ALA ALA E . n 
E 5 11 ALA 11 31  31  ALA ALA E . n 
E 5 12 LYS 12 32  32  LYS LYS E . n 
E 5 13 LYS 13 33  33  LYS LYS E . n 
E 5 14 PHE 14 34  34  PHE PHE E . n 
E 5 15 GLU 15 35  35  GLU GLU E . n 
E 5 16 GLU 16 36  36  GLU GLU E . n 
E 5 17 ALA 17 37  37  ALA ALA E . n 
E 5 18 GLN 18 38  38  GLN GLN E . n 
E 5 19 GLU 19 39  39  GLU GLU E . n 
E 5 20 ALA 20 40  40  ALA ALA E . n 
E 5 21 LEU 21 41  41  LEU LEU E . n 
E 5 22 ARG 22 42  42  ARG ARG E . n 
E 5 23 GLN 23 43  43  GLN GLN E . n 
E 5 24 ALA 24 44  44  ALA ALA E . n 
E 5 25 GLU 25 45  45  GLU GLU E . n 
E 5 26 GLU 26 46  46  GLU GLU E . n 
E 5 27 GLU 27 47  47  GLU GLU E . n 
E 5 28 ARG 28 48  48  ARG ARG E . n 
E 5 29 LYS 29 49  49  LYS LYS E . n 
E 5 30 ALA 30 50  50  ALA ALA E . n 
E 5 31 LYS 31 51  51  LYS LYS E . n 
E 5 32 TYR 32 52  52  TYR TYR E . n 
E 5 33 ALA 33 53  53  ALA ALA E . n 
E 5 34 LYS 34 54  54  LYS LYS E . n 
E 5 35 MET 35 55  55  MET MET E . n 
E 5 36 GLU 36 56  56  GLU GLU E . n 
E 5 37 ALA 37 57  57  ALA ALA E . n 
E 5 38 GLU 38 58  58  GLU GLU E . n 
E 5 39 ARG 39 59  59  ARG ARG E . n 
E 5 40 GLU 40 60  60  GLU GLU E . n 
E 5 41 ALA 41 61  61  ALA ALA E . n 
E 5 42 VAL 42 62  62  VAL VAL E . n 
E 5 43 ARG 43 63  63  ARG ARG E . n 
E 5 44 GLN 44 64  64  GLN GLN E . n 
E 5 45 GLY 45 65  65  GLY GLY E . n 
E 5 46 ILE 46 66  66  ILE ILE E . n 
E 5 47 ARG 47 67  67  ARG ARG E . n 
E 5 48 ASP 48 68  68  ASP ASP E . n 
E 5 49 LYS 49 69  69  LYS LYS E . n 
E 5 50 TYR 50 70  70  TYR TYR E . n 
E 5 51 GLY 51 71  71  GLY GLY E . n 
E 5 52 ILE 52 72  72  ILE ILE E . n 
E 5 53 LYS 53 73  73  LYS LYS E . n 
E 5 54 LYS 54 74  ?   ?   ?   E . n 
E 5 55 LYS 55 75  ?   ?   ?   E . n 
E 5 56 GLU 56 76  ?   ?   ?   E . n 
E 5 57 GLU 57 77  ?   ?   ?   E . n 
E 5 58 ARG 58 78  ?   ?   ?   E . n 
E 5 59 GLU 59 79  ?   ?   ?   E . n 
E 5 60 ALA 60 80  ?   ?   ?   E . n 
E 5 61 GLU 61 81  ?   ?   ?   E . n 
E 5 62 ALA 62 82  ?   ?   ?   E . n 
E 5 63 GLN 63 83  ?   ?   ?   E . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   pentameric 
_pdbx_struct_assembly.oligomeric_count     5 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10570 ? 
1 MORE         -94   ? 
1 'SSA (A^2)'  17010 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-07-27 
2 'Structure model' 1 1 2011-08-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 2.7544  -6.1956  64.9213 0.0413 0.1854 0.1644 0.0089  -0.0683 -0.0401 0.9981  6.2706   12.2220 
-0.7378  -3.1767 -1.2576  -0.0906 -0.1354 0.0820  0.4004  -0.0483 -0.0491 -0.0985 0.4747  0.1390  
'X-RAY DIFFRACTION' 2  ? refined 3.6148  -4.1746  38.6770 0.0513 0.1727 0.0948 0.0121  -0.0611 0.0137  3.0847  2.3226   6.7770  
0.1130   -2.7020 -0.2121  -0.0376 0.3611  0.2992  -0.1723 0.1184  0.0287  -0.2693 -0.4616 -0.0809 
'X-RAY DIFFRACTION' 3  ? refined 15.8955 -6.6730  28.3271 0.1745 0.2334 0.3446 -0.0299 0.0912  0.0252  0.2519  1.7528   1.2087  
-0.5732  0.8089  -0.9291  -0.0459 0.1288  0.0124  -0.2932 -0.4236 -0.4947 -0.0610 0.2265  0.4695  
'X-RAY DIFFRACTION' 4  ? refined 16.9926 -2.9326  36.0808 0.0612 0.1476 0.1356 -0.0431 0.0744  -0.0438 0.5689  3.1388   6.2144  
0.4535   -0.5985 -3.9224  -0.0957 0.0173  -0.1749 -0.1819 -0.2818 -0.4651 0.0265  0.5439  0.3775  
'X-RAY DIFFRACTION' 5  ? refined 10.5149 5.1030   23.6730 0.2764 0.2162 0.0491 -0.0154 -0.0305 0.0297  0.0748  1.0600   9.1895  
0.3577   -0.9636 -3.0997  -0.1370 -0.0491 -0.0117 -0.0847 -0.1994 -0.1159 -0.0247 0.3461  0.3364  
'X-RAY DIFFRACTION' 6  ? refined 10.3183 -19.9343 12.2730 0.5438 0.4066 0.0743 0.0680  0.1018  0.0300  2.6261  3.0754   12.2471 
-2.4799  -5.0069 6.3344   -0.3595 -0.2116 -0.4472 -0.3162 -0.2036 0.2859  -0.5150 0.2350  0.5632  
'X-RAY DIFFRACTION' 7  ? refined -1.7517 -17.7552 67.6458 0.0786 0.1603 0.1605 0.0258  -0.0751 0.0171  0.7811  0.1446   5.2825  
-0.0682  -2.1421 0.2676   -0.0361 0.0313  -0.0517 0.1099  0.0084  -0.1492 0.0865  -0.0912 0.0277  
'X-RAY DIFFRACTION' 8  ? refined 0.7672  -28.6537 73.9012 0.1322 0.0811 0.2318 -0.0354 -0.0279 -0.0005 2.0662  0.9310   9.7758  
1.4731   -2.7567 -2.4999  0.0370  0.0802  0.0630  -0.0840 0.0803  0.0912  0.8875  -0.3387 -0.1172 
'X-RAY DIFFRACTION' 9  ? refined 11.4384 -13.7505 67.2066 0.0575 0.1526 0.2017 0.0049  -0.0842 -0.0498 1.4603  -0.3526  0.5730  
0.4023   1.0482  0.5927   -0.0390 -0.0599 -0.0616 0.0172  0.0739  -0.0879 -0.0829 0.0499  -0.0350 
'X-RAY DIFFRACTION' 10 ? refined -3.8063 -9.6757  41.6218 0.0506 0.6992 0.3839 -0.0150 -0.0226 -0.2383 33.4778 108.1712 26.3304 
-39.0212 17.4690 -45.7458 -0.5080 -4.4342 1.3199  0.2244  2.4777  2.0256  0.0843  -2.1924 -1.9697 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 27  ? ? A 42  ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 43  ? ? A 60  ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  B 210 ? ? B 250 ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  C 30  ? ? C 74  ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  D 161 ? ? D 203 ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  E 24  ? ? E 69  ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  B 189 ? ? B 209 ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  C 10  ? ? C 29  ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  D 139 ? ? D 160 ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 E 70  ? ? E 73  ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .        ? 1 
PHASER    phasing           .        ? 2 
REFMAC    refinement        5.5.0109 ? 3 
HKL-2000  'data reduction'  .        ? 4 
SCALEPACK 'data scaling'    .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   C 
_pdbx_validate_close_contact.auth_comp_id_1   LEU 
_pdbx_validate_close_contact.auth_seq_id_1    26 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OG1 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   THR 
_pdbx_validate_close_contact.auth_seq_id_2    29 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.99 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            E 
_pdbx_validate_rmsd_bond.auth_comp_id_1            LYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             73 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            E 
_pdbx_validate_rmsd_bond.auth_comp_id_2            LYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             73 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.212 
_pdbx_validate_rmsd_bond.bond_target_value         1.521 
_pdbx_validate_rmsd_bond.bond_deviation            -0.309 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.027 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CG1 E ILE 72 ? ? CB E ILE 72 ? ? CG2 E ILE 72 ? ? 129.98 111.40 18.58  2.20 N 
2 1 CA  E ILE 72 ? ? CB E ILE 72 ? ? CG1 E ILE 72 ? ? 89.43  111.00 -21.57 1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER B 190 ? ? -38.55  -38.89 
2 1 ILE B 195 ? ? -64.90  -74.50 
3 1 ALA B 247 ? ? -88.06  36.55  
4 1 VAL B 248 ? ? -135.35 -40.32 
5 1 ARG D 161 ? ? -50.39  -70.44 
6 1 SER E 25  ? ? -141.13 -37.82 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 C ARG 45  ? CG  ? C ARG 43 CG  
2  1 Y 0 C ARG 45  ? CD  ? C ARG 43 CD  
3  1 Y 0 C ARG 45  ? NE  ? C ARG 43 NE  
4  1 Y 0 C ARG 45  ? CZ  ? C ARG 43 CZ  
5  1 Y 0 C ARG 45  ? NH1 ? C ARG 43 NH1 
6  1 Y 0 C ARG 45  ? NH2 ? C ARG 43 NH2 
7  1 Y 0 D GLU 151 ? CG  ? D GLU 13 CG  
8  1 Y 0 D GLU 151 ? CD  ? D GLU 13 CD  
9  1 Y 0 D GLU 151 ? OE1 ? D GLU 13 OE1 
10 1 Y 0 D GLU 151 ? OE2 ? D GLU 13 OE2 
11 1 Y 1 D LYS 201 ? CG  ? D LYS 63 CG  
12 1 Y 1 D LYS 201 ? CD  ? D LYS 63 CD  
13 1 Y 1 D LYS 201 ? CE  ? D LYS 63 CE  
14 1 Y 1 D LYS 201 ? NZ  ? D LYS 63 NZ  
15 1 Y 0 E ILE 72  ? CG1 ? E ILE 52 CG1 
16 1 Y 0 E ILE 72  ? CG2 ? E ILE 52 CG2 
17 1 Y 0 E ILE 72  ? CD1 ? E ILE 52 CD1 
18 1 Y 0 E LYS 73  ? CG  ? E LYS 53 CG  
19 1 Y 0 E LYS 73  ? CD  ? E LYS 53 CD  
20 1 Y 0 E LYS 73  ? CE  ? E LYS 53 CE  
21 1 Y 0 E LYS 73  ? NZ  ? E LYS 53 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 24  ? A GLY 1  
2  1 Y 1 A PRO 25  ? A PRO 2  
3  1 Y 1 A LEU 26  ? A LEU 3  
4  1 Y 1 B THR 251 ? B THR 63 
5  1 Y 1 B LYS 252 ? B LYS 64 
6  1 Y 1 B LYS 253 ? B LYS 65 
7  1 Y 1 C GLY 3   ? C GLY 1  
8  1 Y 1 C SER 4   ? C SER 2  
9  1 Y 1 C HIS 5   ? C HIS 3  
10 1 Y 1 C MET 6   ? C MET 4  
11 1 Y 1 C MET 7   ? C MET 5  
12 1 Y 1 C ARG 8   ? C ARG 6  
13 1 Y 1 C ASN 9   ? C ASN 7  
14 1 Y 1 C GLU 75  ? C GLU 73 
15 1 Y 1 C LYS 76  ? C LYS 74 
16 1 Y 1 C ASN 77  ? C ASN 75 
17 1 Y 1 C LEU 78  ? C LEU 76 
18 1 Y 1 C LYS 79  ? C LYS 77 
19 1 Y 1 C ASP 80  ? C ASP 78 
20 1 Y 1 C LEU 81  ? C LEU 79 
21 1 Y 1 C GLY 82  ? C GLY 80 
22 1 Y 1 C TRP 83  ? C TRP 81 
23 1 Y 1 E GLY 21  ? E GLY 1  
24 1 Y 1 E PRO 22  ? E PRO 2  
25 1 Y 1 E LEU 23  ? E LEU 3  
26 1 Y 1 E LYS 74  ? E LYS 54 
27 1 Y 1 E LYS 75  ? E LYS 55 
28 1 Y 1 E GLU 76  ? E GLU 56 
29 1 Y 1 E GLU 77  ? E GLU 57 
30 1 Y 1 E ARG 78  ? E ARG 58 
31 1 Y 1 E GLU 79  ? E GLU 59 
32 1 Y 1 E ALA 80  ? E ALA 60 
33 1 Y 1 E GLU 81  ? E GLU 61 
34 1 Y 1 E ALA 82  ? E ALA 62 
35 1 Y 1 E GLN 83  ? E GLN 63 
#